data_3DLS
# 
_entry.id   3DLS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DLS         
RCSB  RCSB048197   
WWPDB D_1000048197 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          NYSGXRC-9501a 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3DLS 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Antonysamy, S.'                                                 1  ?                   
'Bonanno, J.B.'                                                  2  ?                   
'Romero, R.'                                                     3  ?                   
'Russell, M.'                                                    4  ?                   
'Iizuka, M.'                                                     5  ?                   
'Gheyi, T.'                                                      6  ?                   
'Wasserman, S.R.'                                                7  ?                   
'Rutter, J.'                                                     8  ?                   
'Sauder, J.M.'                                                   9  0000-0002-0254-4955 
'Burley, S.K.'                                                   10 0000-0002-2487-9713 
'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ?                   
# 
_citation.id                        primary 
_citation.title                     
'Structural bases of PAS domain-regulated kinase (PASK) activation in the absence of activation loop phosphorylation.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                41034 
_citation.page_last                 41043 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20943661 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.157594 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kikani, C.K.'     1  ?                   
primary 'Antonysamy, S.A.' 2  ?                   
primary 'Bonanno, J.B.'    3  ?                   
primary 'Romero, R.'       4  ?                   
primary 'Zhang, F.F.'      5  ?                   
primary 'Russell, M.'      6  ?                   
primary 'Gheyi, T.'        7  ?                   
primary 'Iizuka, M.'       8  ?                   
primary 'Emtage, S.'       9  ?                   
primary 'Sauder, J.M.'     10 ?                   
primary 'Turk, B.E.'       11 ?                   
primary 'Burley, S.K.'     12 0000-0002-2487-9713 
primary 'Rutter, J.'       13 ?                   
# 
_cell.entry_id           3DLS 
_cell.length_a           85.778 
_cell.length_b           85.840 
_cell.length_c           94.154 
_cell.angle_alpha        77.280 
_cell.angle_beta         77.500 
_cell.angle_gamma        60.090 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DLS 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PAS domain-containing serine/threonine-protein kinase' 37875.270 6   2.7.11.1 ? 'PROTEIN KINASE DOMAIN' ? 
2 non-polymer syn 'MAGNESIUM ION'                                         24.305    19  ?        ? ?                       ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                              427.201   6   ?        ? ?                       ? 
4 water       nat water                                                   18.015    280 ?        ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PAS-kinase, PASKIN, hPASK' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MALEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEI
AILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDEN
IVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAA
IHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQ
AQELCGGEGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MALEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEI
AILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDEN
IVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAA
IHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQ
AQELCGGEGHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         NYSGXRC-9501a 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LEU n 
1 4   GLU n 
1 5   GLU n 
1 6   PRO n 
1 7   PRO n 
1 8   LYS n 
1 9   ALA n 
1 10  VAL n 
1 11  GLU n 
1 12  LEU n 
1 13  GLU n 
1 14  GLY n 
1 15  LEU n 
1 16  ALA n 
1 17  ALA n 
1 18  CYS n 
1 19  GLU n 
1 20  GLY n 
1 21  GLU n 
1 22  TYR n 
1 23  SER n 
1 24  GLN n 
1 25  LYS n 
1 26  TYR n 
1 27  SER n 
1 28  THR n 
1 29  MET n 
1 30  SER n 
1 31  PRO n 
1 32  LEU n 
1 33  GLY n 
1 34  SER n 
1 35  GLY n 
1 36  ALA n 
1 37  PHE n 
1 38  GLY n 
1 39  PHE n 
1 40  VAL n 
1 41  TRP n 
1 42  THR n 
1 43  ALA n 
1 44  VAL n 
1 45  ASP n 
1 46  LYS n 
1 47  GLU n 
1 48  LYS n 
1 49  ASN n 
1 50  LYS n 
1 51  GLU n 
1 52  VAL n 
1 53  VAL n 
1 54  VAL n 
1 55  LYS n 
1 56  PHE n 
1 57  ILE n 
1 58  LYS n 
1 59  LYS n 
1 60  GLU n 
1 61  LYS n 
1 62  VAL n 
1 63  LEU n 
1 64  GLU n 
1 65  ASP n 
1 66  CYS n 
1 67  TRP n 
1 68  ILE n 
1 69  GLU n 
1 70  ASP n 
1 71  PRO n 
1 72  LYS n 
1 73  LEU n 
1 74  GLY n 
1 75  LYS n 
1 76  VAL n 
1 77  THR n 
1 78  LEU n 
1 79  GLU n 
1 80  ILE n 
1 81  ALA n 
1 82  ILE n 
1 83  LEU n 
1 84  SER n 
1 85  ARG n 
1 86  VAL n 
1 87  GLU n 
1 88  HIS n 
1 89  ALA n 
1 90  ASN n 
1 91  ILE n 
1 92  ILE n 
1 93  LYS n 
1 94  VAL n 
1 95  LEU n 
1 96  ASP n 
1 97  ILE n 
1 98  PHE n 
1 99  GLU n 
1 100 ASN n 
1 101 GLN n 
1 102 GLY n 
1 103 PHE n 
1 104 PHE n 
1 105 GLN n 
1 106 LEU n 
1 107 VAL n 
1 108 MET n 
1 109 GLU n 
1 110 LYS n 
1 111 HIS n 
1 112 GLY n 
1 113 SER n 
1 114 GLY n 
1 115 LEU n 
1 116 ASP n 
1 117 LEU n 
1 118 PHE n 
1 119 ALA n 
1 120 PHE n 
1 121 ILE n 
1 122 ASP n 
1 123 ARG n 
1 124 HIS n 
1 125 PRO n 
1 126 ARG n 
1 127 LEU n 
1 128 ASP n 
1 129 GLU n 
1 130 PRO n 
1 131 LEU n 
1 132 ALA n 
1 133 SER n 
1 134 TYR n 
1 135 ILE n 
1 136 PHE n 
1 137 ARG n 
1 138 GLN n 
1 139 LEU n 
1 140 VAL n 
1 141 SER n 
1 142 ALA n 
1 143 VAL n 
1 144 GLY n 
1 145 TYR n 
1 146 LEU n 
1 147 ARG n 
1 148 LEU n 
1 149 LYS n 
1 150 ASP n 
1 151 ILE n 
1 152 ILE n 
1 153 HIS n 
1 154 ARG n 
1 155 ASP n 
1 156 ILE n 
1 157 LYS n 
1 158 ASP n 
1 159 GLU n 
1 160 ASN n 
1 161 ILE n 
1 162 VAL n 
1 163 ILE n 
1 164 ALA n 
1 165 GLU n 
1 166 ASP n 
1 167 PHE n 
1 168 THR n 
1 169 ILE n 
1 170 LYS n 
1 171 LEU n 
1 172 ILE n 
1 173 ASP n 
1 174 PHE n 
1 175 GLY n 
1 176 SER n 
1 177 ALA n 
1 178 ALA n 
1 179 TYR n 
1 180 LEU n 
1 181 GLU n 
1 182 ARG n 
1 183 GLY n 
1 184 LYS n 
1 185 LEU n 
1 186 PHE n 
1 187 TYR n 
1 188 THR n 
1 189 PHE n 
1 190 CYS n 
1 191 GLY n 
1 192 THR n 
1 193 ILE n 
1 194 GLU n 
1 195 TYR n 
1 196 CYS n 
1 197 ALA n 
1 198 PRO n 
1 199 GLU n 
1 200 VAL n 
1 201 LEU n 
1 202 MET n 
1 203 GLY n 
1 204 ASN n 
1 205 PRO n 
1 206 TYR n 
1 207 ARG n 
1 208 GLY n 
1 209 PRO n 
1 210 GLU n 
1 211 LEU n 
1 212 GLU n 
1 213 MET n 
1 214 TRP n 
1 215 SER n 
1 216 LEU n 
1 217 GLY n 
1 218 VAL n 
1 219 THR n 
1 220 LEU n 
1 221 TYR n 
1 222 THR n 
1 223 LEU n 
1 224 VAL n 
1 225 PHE n 
1 226 GLU n 
1 227 GLU n 
1 228 ASN n 
1 229 PRO n 
1 230 PHE n 
1 231 CYS n 
1 232 GLU n 
1 233 LEU n 
1 234 GLU n 
1 235 GLU n 
1 236 THR n 
1 237 VAL n 
1 238 GLU n 
1 239 ALA n 
1 240 ALA n 
1 241 ILE n 
1 242 HIS n 
1 243 PRO n 
1 244 PRO n 
1 245 TYR n 
1 246 LEU n 
1 247 VAL n 
1 248 SER n 
1 249 LYS n 
1 250 GLU n 
1 251 LEU n 
1 252 MET n 
1 253 SER n 
1 254 LEU n 
1 255 VAL n 
1 256 SER n 
1 257 GLY n 
1 258 LEU n 
1 259 LEU n 
1 260 GLN n 
1 261 PRO n 
1 262 VAL n 
1 263 PRO n 
1 264 GLU n 
1 265 ARG n 
1 266 ARG n 
1 267 THR n 
1 268 THR n 
1 269 LEU n 
1 270 GLU n 
1 271 LYS n 
1 272 LEU n 
1 273 VAL n 
1 274 THR n 
1 275 ASP n 
1 276 PRO n 
1 277 TRP n 
1 278 VAL n 
1 279 THR n 
1 280 GLN n 
1 281 PRO n 
1 282 VAL n 
1 283 ASN n 
1 284 LEU n 
1 285 ALA n 
1 286 ASP n 
1 287 TYR n 
1 288 THR n 
1 289 TRP n 
1 290 GLU n 
1 291 GLU n 
1 292 VAL n 
1 293 PHE n 
1 294 ARG n 
1 295 VAL n 
1 296 ASN n 
1 297 LYS n 
1 298 PRO n 
1 299 GLU n 
1 300 SER n 
1 301 GLY n 
1 302 VAL n 
1 303 LEU n 
1 304 SER n 
1 305 ALA n 
1 306 ALA n 
1 307 SER n 
1 308 LEU n 
1 309 GLU n 
1 310 MET n 
1 311 GLY n 
1 312 ASN n 
1 313 ARG n 
1 314 SER n 
1 315 LEU n 
1 316 SER n 
1 317 ASP n 
1 318 VAL n 
1 319 ALA n 
1 320 GLN n 
1 321 ALA n 
1 322 GLN n 
1 323 GLU n 
1 324 LEU n 
1 325 CYS n 
1 326 GLY n 
1 327 GLY n 
1 328 GLU n 
1 329 GLY n 
1 330 HIS n 
1 331 HIS n 
1 332 HIS n 
1 333 HIS n 
1 334 HIS n 
1 335 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PASK, KIAA0135' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      BACULOVIRUS 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SF9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PASK_HUMAN 
_struct_ref.pdbx_db_accession          Q96RG2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAIL
SRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVI
AEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHP
PYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQE
LCGG
;
_struct_ref.pdbx_align_begin           977 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DLS A 4 ? 327 ? Q96RG2 977 ? 1300 ? 977 1300 
2 1 3DLS B 4 ? 327 ? Q96RG2 977 ? 1300 ? 977 1300 
3 1 3DLS C 4 ? 327 ? Q96RG2 977 ? 1300 ? 977 1300 
4 1 3DLS D 4 ? 327 ? Q96RG2 977 ? 1300 ? 977 1300 
5 1 3DLS E 4 ? 327 ? Q96RG2 977 ? 1300 ? 977 1300 
6 1 3DLS F 4 ? 327 ? Q96RG2 977 ? 1300 ? 977 1300 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3DLS MET A 1   ? UNP Q96RG2 ? ? 'expression tag' 974  1  
1 3DLS ALA A 2   ? UNP Q96RG2 ? ? 'expression tag' 975  2  
1 3DLS LEU A 3   ? UNP Q96RG2 ? ? 'expression tag' 976  3  
1 3DLS GLU A 328 ? UNP Q96RG2 ? ? 'expression tag' 1301 4  
1 3DLS GLY A 329 ? UNP Q96RG2 ? ? 'expression tag' 1302 5  
1 3DLS HIS A 330 ? UNP Q96RG2 ? ? 'expression tag' 1303 6  
1 3DLS HIS A 331 ? UNP Q96RG2 ? ? 'expression tag' 1304 7  
1 3DLS HIS A 332 ? UNP Q96RG2 ? ? 'expression tag' 1305 8  
1 3DLS HIS A 333 ? UNP Q96RG2 ? ? 'expression tag' 1306 9  
1 3DLS HIS A 334 ? UNP Q96RG2 ? ? 'expression tag' 1307 10 
1 3DLS HIS A 335 ? UNP Q96RG2 ? ? 'expression tag' 1308 11 
2 3DLS MET B 1   ? UNP Q96RG2 ? ? 'expression tag' 974  12 
2 3DLS ALA B 2   ? UNP Q96RG2 ? ? 'expression tag' 975  13 
2 3DLS LEU B 3   ? UNP Q96RG2 ? ? 'expression tag' 976  14 
2 3DLS GLU B 328 ? UNP Q96RG2 ? ? 'expression tag' 1301 15 
2 3DLS GLY B 329 ? UNP Q96RG2 ? ? 'expression tag' 1302 16 
2 3DLS HIS B 330 ? UNP Q96RG2 ? ? 'expression tag' 1303 17 
2 3DLS HIS B 331 ? UNP Q96RG2 ? ? 'expression tag' 1304 18 
2 3DLS HIS B 332 ? UNP Q96RG2 ? ? 'expression tag' 1305 19 
2 3DLS HIS B 333 ? UNP Q96RG2 ? ? 'expression tag' 1306 20 
2 3DLS HIS B 334 ? UNP Q96RG2 ? ? 'expression tag' 1307 21 
2 3DLS HIS B 335 ? UNP Q96RG2 ? ? 'expression tag' 1308 22 
3 3DLS MET C 1   ? UNP Q96RG2 ? ? 'expression tag' 974  23 
3 3DLS ALA C 2   ? UNP Q96RG2 ? ? 'expression tag' 975  24 
3 3DLS LEU C 3   ? UNP Q96RG2 ? ? 'expression tag' 976  25 
3 3DLS GLU C 328 ? UNP Q96RG2 ? ? 'expression tag' 1301 26 
3 3DLS GLY C 329 ? UNP Q96RG2 ? ? 'expression tag' 1302 27 
3 3DLS HIS C 330 ? UNP Q96RG2 ? ? 'expression tag' 1303 28 
3 3DLS HIS C 331 ? UNP Q96RG2 ? ? 'expression tag' 1304 29 
3 3DLS HIS C 332 ? UNP Q96RG2 ? ? 'expression tag' 1305 30 
3 3DLS HIS C 333 ? UNP Q96RG2 ? ? 'expression tag' 1306 31 
3 3DLS HIS C 334 ? UNP Q96RG2 ? ? 'expression tag' 1307 32 
3 3DLS HIS C 335 ? UNP Q96RG2 ? ? 'expression tag' 1308 33 
4 3DLS MET D 1   ? UNP Q96RG2 ? ? 'expression tag' 974  34 
4 3DLS ALA D 2   ? UNP Q96RG2 ? ? 'expression tag' 975  35 
4 3DLS LEU D 3   ? UNP Q96RG2 ? ? 'expression tag' 976  36 
4 3DLS GLU D 328 ? UNP Q96RG2 ? ? 'expression tag' 1301 37 
4 3DLS GLY D 329 ? UNP Q96RG2 ? ? 'expression tag' 1302 38 
4 3DLS HIS D 330 ? UNP Q96RG2 ? ? 'expression tag' 1303 39 
4 3DLS HIS D 331 ? UNP Q96RG2 ? ? 'expression tag' 1304 40 
4 3DLS HIS D 332 ? UNP Q96RG2 ? ? 'expression tag' 1305 41 
4 3DLS HIS D 333 ? UNP Q96RG2 ? ? 'expression tag' 1306 42 
4 3DLS HIS D 334 ? UNP Q96RG2 ? ? 'expression tag' 1307 43 
4 3DLS HIS D 335 ? UNP Q96RG2 ? ? 'expression tag' 1308 44 
5 3DLS MET E 1   ? UNP Q96RG2 ? ? 'expression tag' 974  45 
5 3DLS ALA E 2   ? UNP Q96RG2 ? ? 'expression tag' 975  46 
5 3DLS LEU E 3   ? UNP Q96RG2 ? ? 'expression tag' 976  47 
5 3DLS GLU E 328 ? UNP Q96RG2 ? ? 'expression tag' 1301 48 
5 3DLS GLY E 329 ? UNP Q96RG2 ? ? 'expression tag' 1302 49 
5 3DLS HIS E 330 ? UNP Q96RG2 ? ? 'expression tag' 1303 50 
5 3DLS HIS E 331 ? UNP Q96RG2 ? ? 'expression tag' 1304 51 
5 3DLS HIS E 332 ? UNP Q96RG2 ? ? 'expression tag' 1305 52 
5 3DLS HIS E 333 ? UNP Q96RG2 ? ? 'expression tag' 1306 53 
5 3DLS HIS E 334 ? UNP Q96RG2 ? ? 'expression tag' 1307 54 
5 3DLS HIS E 335 ? UNP Q96RG2 ? ? 'expression tag' 1308 55 
6 3DLS MET F 1   ? UNP Q96RG2 ? ? 'expression tag' 974  56 
6 3DLS ALA F 2   ? UNP Q96RG2 ? ? 'expression tag' 975  57 
6 3DLS LEU F 3   ? UNP Q96RG2 ? ? 'expression tag' 976  58 
6 3DLS GLU F 328 ? UNP Q96RG2 ? ? 'expression tag' 1301 59 
6 3DLS GLY F 329 ? UNP Q96RG2 ? ? 'expression tag' 1302 60 
6 3DLS HIS F 330 ? UNP Q96RG2 ? ? 'expression tag' 1303 61 
6 3DLS HIS F 331 ? UNP Q96RG2 ? ? 'expression tag' 1304 62 
6 3DLS HIS F 332 ? UNP Q96RG2 ? ? 'expression tag' 1305 63 
6 3DLS HIS F 333 ? UNP Q96RG2 ? ? 'expression tag' 1306 64 
6 3DLS HIS F 334 ? UNP Q96RG2 ? ? 'expression tag' 1307 65 
6 3DLS HIS F 335 ? UNP Q96RG2 ? ? 'expression tag' 1308 66 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3DLS 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    '10% GLYCEROL, 18% PEG 3350, 150 mM CALCIUM ACETATE, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2008-04-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    DIAMOND 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97929 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_wavelength_list        0.97929 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
# 
_reflns.entry_id                     3DLS 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             ? 
_reflns.number_all                   ? 
_reflns.number_obs                   96809 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3DLS 
_refine.B_iso_mean                               37.365 
_refine.pdbx_method_to_determine_struct          ? 
_refine.B_iso_max                                81.99 
_refine.B_iso_min                                2.72 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.ls_d_res_high                            2.3 
_refine.ls_d_res_low                             ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     96809 
_refine.ls_number_reflns_obs                     96809 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.244 
_refine.ls_R_factor_obs                          0.244 
_refine.ls_R_factor_R_work                       0.241 
_refine.ls_R_factor_R_free                       0.297 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13263 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         181 
_refine_hist.number_atoms_solvent             280 
_refine_hist.number_atoms_total               13724 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  3DLS 
_struct.title                     'Crystal structure of human PAS kinase bound to ADP' 
_struct.pdbx_descriptor           'PAS domain-containing serine/threonine-protein kinase (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DLS 
_struct_keywords.text            
;PAS KINASE, PASK, PROTEIN KINASE, DRUG DISCOVERY, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
;
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 3 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 13  ? GLU A 19  ? GLU A 986  GLU A 992  1 ? 7  
HELX_P HELX_P2  2  GLY A 20  ? LYS A 25  ? GLY A 993  LYS A 998  1 ? 6  
HELX_P HELX_P3  3  LEU A 78  ? SER A 84  ? LEU A 1051 SER A 1057 1 ? 7  
HELX_P HELX_P4  4  ASP A 116 ? ARG A 123 ? ASP A 1089 ARG A 1096 1 ? 8  
HELX_P HELX_P5  5  ASP A 128 ? LYS A 149 ? ASP A 1101 LYS A 1122 1 ? 22 
HELX_P HELX_P6  6  LYS A 157 ? GLU A 159 ? LYS A 1130 GLU A 1132 5 ? 3  
HELX_P HELX_P7  7  THR A 192 ? CYS A 196 ? THR A 1165 CYS A 1169 5 ? 5  
HELX_P HELX_P8  8  ALA A 197 ? MET A 202 ? ALA A 1170 MET A 1175 1 ? 6  
HELX_P HELX_P9  9  GLY A 208 ? GLU A 226 ? GLY A 1181 GLU A 1199 1 ? 19 
HELX_P HELX_P10 10 GLU A 232 ? VAL A 237 ? GLU A 1205 VAL A 1210 5 ? 6  
HELX_P HELX_P11 11 SER A 248 ? LEU A 259 ? SER A 1221 LEU A 1232 1 ? 12 
HELX_P HELX_P12 12 VAL A 262 ? ARG A 266 ? VAL A 1235 ARG A 1239 5 ? 5  
HELX_P HELX_P13 13 THR A 268 ? ASP A 275 ? THR A 1241 ASP A 1248 1 ? 8  
HELX_P HELX_P14 14 ASN A 283 ? TYR A 287 ? ASN A 1256 TYR A 1260 5 ? 5  
HELX_P HELX_P15 15 THR A 288 ? PHE A 293 ? THR A 1261 PHE A 1266 1 ? 6  
HELX_P HELX_P16 16 GLU B 13  ? GLU B 19  ? GLU B 986  GLU B 992  1 ? 7  
HELX_P HELX_P17 17 GLY B 20  ? LYS B 25  ? GLY B 993  LYS B 998  1 ? 6  
HELX_P HELX_P18 18 THR B 77  ? VAL B 86  ? THR B 1050 VAL B 1059 1 ? 10 
HELX_P HELX_P19 19 ASP B 116 ? ARG B 123 ? ASP B 1089 ARG B 1096 1 ? 8  
HELX_P HELX_P20 20 ASP B 128 ? LYS B 149 ? ASP B 1101 LYS B 1122 1 ? 22 
HELX_P HELX_P21 21 THR B 192 ? CYS B 196 ? THR B 1165 CYS B 1169 5 ? 5  
HELX_P HELX_P22 22 ALA B 197 ? MET B 202 ? ALA B 1170 MET B 1175 1 ? 6  
HELX_P HELX_P23 23 GLY B 208 ? GLU B 226 ? GLY B 1181 GLU B 1199 1 ? 19 
HELX_P HELX_P24 24 LEU B 233 ? VAL B 237 ? LEU B 1206 VAL B 1210 5 ? 5  
HELX_P HELX_P25 25 SER B 248 ? LEU B 259 ? SER B 1221 LEU B 1232 1 ? 12 
HELX_P HELX_P26 26 VAL B 262 ? ARG B 266 ? VAL B 1235 ARG B 1239 5 ? 5  
HELX_P HELX_P27 27 THR B 268 ? ASP B 275 ? THR B 1241 ASP B 1248 1 ? 8  
HELX_P HELX_P28 28 ASN B 283 ? TYR B 287 ? ASN B 1256 TYR B 1260 5 ? 5  
HELX_P HELX_P29 29 THR B 288 ? PHE B 293 ? THR B 1261 PHE B 1266 1 ? 6  
HELX_P HELX_P30 30 GLU C 13  ? GLU C 19  ? GLU C 986  GLU C 992  1 ? 7  
HELX_P HELX_P31 31 GLY C 20  ? LYS C 25  ? GLY C 993  LYS C 998  1 ? 6  
HELX_P HELX_P32 32 THR C 77  ? VAL C 86  ? THR C 1050 VAL C 1059 1 ? 10 
HELX_P HELX_P33 33 ASP C 116 ? ARG C 123 ? ASP C 1089 ARG C 1096 1 ? 8  
HELX_P HELX_P34 34 ASP C 128 ? LYS C 149 ? ASP C 1101 LYS C 1122 1 ? 22 
HELX_P HELX_P35 35 LYS C 157 ? GLU C 159 ? LYS C 1130 GLU C 1132 5 ? 3  
HELX_P HELX_P36 36 THR C 192 ? CYS C 196 ? THR C 1165 CYS C 1169 5 ? 5  
HELX_P HELX_P37 37 ALA C 197 ? MET C 202 ? ALA C 1170 MET C 1175 1 ? 6  
HELX_P HELX_P38 38 GLY C 208 ? GLU C 226 ? GLY C 1181 GLU C 1199 1 ? 19 
HELX_P HELX_P39 39 SER C 248 ? LEU C 259 ? SER C 1221 LEU C 1232 1 ? 12 
HELX_P HELX_P40 40 THR C 268 ? THR C 274 ? THR C 1241 THR C 1247 1 ? 7  
HELX_P HELX_P41 41 ASP C 275 ? GLN C 280 ? ASP C 1248 GLN C 1253 1 ? 6  
HELX_P HELX_P42 42 ASN C 283 ? TYR C 287 ? ASN C 1256 TYR C 1260 5 ? 5  
HELX_P HELX_P43 43 THR C 288 ? PHE C 293 ? THR C 1261 PHE C 1266 1 ? 6  
HELX_P HELX_P44 44 GLU D 13  ? GLU D 19  ? GLU D 986  GLU D 992  1 ? 7  
HELX_P HELX_P45 45 GLY D 20  ? LYS D 25  ? GLY D 993  LYS D 998  1 ? 6  
HELX_P HELX_P46 46 GLU D 60  ? VAL D 62  ? GLU D 1033 VAL D 1035 5 ? 3  
HELX_P HELX_P47 47 LEU D 78  ? ARG D 85  ? LEU D 1051 ARG D 1058 1 ? 8  
HELX_P HELX_P48 48 ASP D 116 ? ARG D 123 ? ASP D 1089 ARG D 1096 1 ? 8  
HELX_P HELX_P49 49 ASP D 128 ? LYS D 149 ? ASP D 1101 LYS D 1122 1 ? 22 
HELX_P HELX_P50 50 LYS D 157 ? GLU D 159 ? LYS D 1130 GLU D 1132 5 ? 3  
HELX_P HELX_P51 51 THR D 192 ? CYS D 196 ? THR D 1165 CYS D 1169 5 ? 5  
HELX_P HELX_P52 52 ALA D 197 ? MET D 202 ? ALA D 1170 MET D 1175 1 ? 6  
HELX_P HELX_P53 53 GLY D 208 ? GLU D 226 ? GLY D 1181 GLU D 1199 1 ? 19 
HELX_P HELX_P54 54 GLU D 232 ? VAL D 237 ? GLU D 1205 VAL D 1210 5 ? 6  
HELX_P HELX_P55 55 SER D 248 ? LEU D 259 ? SER D 1221 LEU D 1232 1 ? 12 
HELX_P HELX_P56 56 THR D 268 ? THR D 274 ? THR D 1241 THR D 1247 1 ? 7  
HELX_P HELX_P57 57 ASP D 275 ? GLN D 280 ? ASP D 1248 GLN D 1253 1 ? 6  
HELX_P HELX_P58 58 ASN D 283 ? TYR D 287 ? ASN D 1256 TYR D 1260 5 ? 5  
HELX_P HELX_P59 59 THR D 288 ? PHE D 293 ? THR D 1261 PHE D 1266 1 ? 6  
HELX_P HELX_P60 60 GLU E 13  ? CYS E 18  ? GLU E 986  CYS E 991  1 ? 6  
HELX_P HELX_P61 61 GLY E 20  ? LYS E 25  ? GLY E 993  LYS E 998  1 ? 6  
HELX_P HELX_P62 62 GLU E 60  ? VAL E 62  ? GLU E 1033 VAL E 1035 5 ? 3  
HELX_P HELX_P63 63 THR E 77  ? VAL E 86  ? THR E 1050 VAL E 1059 1 ? 10 
HELX_P HELX_P64 64 ASP E 116 ? ARG E 123 ? ASP E 1089 ARG E 1096 1 ? 8  
HELX_P HELX_P65 65 ASP E 128 ? LYS E 149 ? ASP E 1101 LYS E 1122 1 ? 22 
HELX_P HELX_P66 66 LYS E 157 ? GLU E 159 ? LYS E 1130 GLU E 1132 5 ? 3  
HELX_P HELX_P67 67 THR E 192 ? CYS E 196 ? THR E 1165 CYS E 1169 5 ? 5  
HELX_P HELX_P68 68 ALA E 197 ? MET E 202 ? ALA E 1170 MET E 1175 1 ? 6  
HELX_P HELX_P69 69 GLY E 208 ? GLU E 226 ? GLY E 1181 GLU E 1199 1 ? 19 
HELX_P HELX_P70 70 GLU E 232 ? GLU E 238 ? GLU E 1205 GLU E 1211 5 ? 7  
HELX_P HELX_P71 71 SER E 248 ? LEU E 259 ? SER E 1221 LEU E 1232 1 ? 12 
HELX_P HELX_P72 72 THR E 268 ? ASP E 275 ? THR E 1241 ASP E 1248 1 ? 8  
HELX_P HELX_P73 73 ASP E 275 ? GLN E 280 ? ASP E 1248 GLN E 1253 1 ? 6  
HELX_P HELX_P74 74 ASN E 283 ? TYR E 287 ? ASN E 1256 TYR E 1260 5 ? 5  
HELX_P HELX_P75 75 THR E 288 ? PHE E 293 ? THR E 1261 PHE E 1266 1 ? 6  
HELX_P HELX_P76 76 GLU F 13  ? GLU F 19  ? GLU F 986  GLU F 992  1 ? 7  
HELX_P HELX_P77 77 GLU F 21  ? LYS F 25  ? GLU F 994  LYS F 998  1 ? 5  
HELX_P HELX_P78 78 THR F 77  ? VAL F 86  ? THR F 1050 VAL F 1059 1 ? 10 
HELX_P HELX_P79 79 ASP F 116 ? ARG F 123 ? ASP F 1089 ARG F 1096 1 ? 8  
HELX_P HELX_P80 80 ASP F 128 ? LYS F 149 ? ASP F 1101 LYS F 1122 1 ? 22 
HELX_P HELX_P81 81 LYS F 157 ? GLU F 159 ? LYS F 1130 GLU F 1132 5 ? 3  
HELX_P HELX_P82 82 THR F 192 ? CYS F 196 ? THR F 1165 CYS F 1169 5 ? 5  
HELX_P HELX_P83 83 ALA F 197 ? MET F 202 ? ALA F 1170 MET F 1175 1 ? 6  
HELX_P HELX_P84 84 GLY F 208 ? GLU F 226 ? GLY F 1181 GLU F 1199 1 ? 19 
HELX_P HELX_P85 85 GLU F 232 ? VAL F 237 ? GLU F 1205 VAL F 1210 5 ? 6  
HELX_P HELX_P86 86 SER F 248 ? LEU F 259 ? SER F 1221 LEU F 1232 1 ? 12 
HELX_P HELX_P87 87 VAL F 262 ? ARG F 266 ? VAL F 1235 ARG F 1239 5 ? 5  
HELX_P HELX_P88 88 THR F 268 ? THR F 274 ? THR F 1241 THR F 1247 1 ? 7  
HELX_P HELX_P89 89 ASN F 283 ? TYR F 287 ? ASN F 1256 TYR F 1260 5 ? 5  
HELX_P HELX_P90 90 THR F 288 ? PHE F 293 ? THR F 1261 PHE F 1266 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? K  ADP .  O1A ? ? ? 1_555 G  MG  .   MG  ? ? A ADP 1    A MG  7    1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc2  metalc ? ? K  ADP .  O2B ? ? ? 1_555 G  MG  .   MG  ? ? A ADP 1    A MG  7    1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc3  metalc ? ? K  ADP .  O1B ? ? ? 1_555 H  MG  .   MG  ? ? A ADP 1    A MG  8    1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc4  metalc ? ? G  MG  .  MG  ? ? ? 1_555 FA HOH .   O   ? ? A MG  7    A HOH 271  1_555 ? ? ? ? ? ? ? 2.782 ? ? 
metalc5  metalc ? ? G  MG  .  MG  ? ? ? 1_555 A  ASN 160 OD1 ? ? A MG  7    A ASN 1133 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc6  metalc ? ? G  MG  .  MG  ? ? ? 1_555 A  ASP 173 OD2 ? ? A MG  7    A ASP 1146 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc7  metalc ? ? H  MG  .  MG  ? ? ? 1_555 A  ASP 173 OD1 ? ? A MG  8    A ASP 1146 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc8  metalc ? ? H  MG  .  MG  ? ? ? 1_555 A  ASP 173 OD2 ? ? A MG  8    A ASP 1146 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc9  metalc ? ? I  MG  .  MG  ? ? ? 1_555 A  PRO 125 O   ? ? A MG  20   A PRO 1098 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc10 metalc ? ? I  MG  .  MG  ? ? ? 1_555 A  GLU 226 OE2 ? ? A MG  20   A GLU 1199 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc11 metalc ? ? I  MG  .  MG  ? ? ? 1_555 A  GLU 226 OE1 ? ? A MG  20   A GLU 1199 1_555 ? ? ? ? ? ? ? 2.819 ? ? 
metalc12 metalc ? ? J  MG  .  MG  ? ? ? 1_555 A  GLU 234 OE2 ? ? A MG  25   A GLU 1207 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc13 metalc ? ? J  MG  .  MG  ? ? ? 1_555 A  GLU 234 OE1 ? ? A MG  25   A GLU 1207 1_555 ? ? ? ? ? ? ? 2.830 ? ? 
metalc14 metalc ? ? J  MG  .  MG  ? ? ? 1_555 C  GLY 33  O   ? ? A MG  25   C GLY 1006 1_555 ? ? ? ? ? ? ? 2.650 ? ? 
metalc15 metalc ? ? J  MG  .  MG  ? ? ? 1_555 C  GLY 35  O   ? ? A MG  25   C GLY 1008 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc16 metalc ? ? A  GLY 33 O   ? ? ? 1_555 O  MG  .   MG  ? ? A GLY 1006 B MG  24   1_555 ? ? ? ? ? ? ? 2.493 ? ? 
metalc17 metalc ? ? P  ADP .  O1A ? ? ? 1_555 L  MG  .   MG  ? ? B ADP 2    B MG  9    1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc18 metalc ? ? P  ADP .  O1B ? ? ? 1_555 M  MG  .   MG  ? ? B ADP 2    B MG  10   1_555 ? ? ? ? ? ? ? 2.356 ? ? 
metalc19 metalc ? ? L  MG  .  MG  ? ? ? 1_555 GA HOH .   O   ? ? B MG  9    B HOH 171  1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc20 metalc ? ? L  MG  .  MG  ? ? ? 1_555 B  ASN 160 OD1 ? ? B MG  9    B ASN 1133 1_555 ? ? ? ? ? ? ? 2.501 ? ? 
metalc21 metalc ? ? L  MG  .  MG  ? ? ? 1_555 B  ASP 173 OD2 ? ? B MG  9    B ASP 1146 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc22 metalc ? ? M  MG  .  MG  ? ? ? 1_555 B  ASP 173 OD1 ? ? B MG  10   B ASP 1146 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc23 metalc ? ? M  MG  .  MG  ? ? ? 1_555 B  ASP 173 OD2 ? ? B MG  10   B ASP 1146 1_555 ? ? ? ? ? ? ? 2.708 ? ? 
metalc24 metalc ? ? N  MG  .  MG  ? ? ? 1_555 B  PRO 125 O   ? ? B MG  19   B PRO 1098 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc25 metalc ? ? N  MG  .  MG  ? ? ? 1_555 B  GLU 226 OE2 ? ? B MG  19   B GLU 1199 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc26 metalc ? ? O  MG  .  MG  ? ? ? 1_555 B  GLU 234 OE2 ? ? B MG  24   B GLU 1207 1_555 ? ? ? ? ? ? ? 2.656 ? ? 
metalc27 metalc ? ? O  MG  .  MG  ? ? ? 1_555 B  GLU 234 OE1 ? ? B MG  24   B GLU 1207 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc28 metalc ? ? B  GLY 33 O   ? ? ? 1_555 T  MG  .   MG  ? ? B GLY 1006 C MG  22   1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc29 metalc ? ? U  ADP .  O1A ? ? ? 1_555 Q  MG  .   MG  ? ? C ADP 3    C MG  11   1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc30 metalc ? ? U  ADP .  O2B ? ? ? 1_555 Q  MG  .   MG  ? ? C ADP 3    C MG  11   1_555 ? ? ? ? ? ? ? 1.898 ? ? 
metalc31 metalc ? ? U  ADP .  O1B ? ? ? 1_555 R  MG  .   MG  ? ? C ADP 3    C MG  12   1_555 ? ? ? ? ? ? ? 2.831 ? ? 
metalc32 metalc ? ? Q  MG  .  MG  ? ? ? 1_555 C  ASN 160 OD1 ? ? C MG  11   C ASN 1133 1_555 ? ? ? ? ? ? ? 2.598 ? ? 
metalc33 metalc ? ? Q  MG  .  MG  ? ? ? 1_555 C  ASP 173 OD2 ? ? C MG  11   C ASP 1146 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc34 metalc ? ? R  MG  .  MG  ? ? ? 1_555 C  ASP 173 OD1 ? ? C MG  12   C ASP 1146 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc35 metalc ? ? R  MG  .  MG  ? ? ? 1_555 C  ASP 173 OD2 ? ? C MG  12   C ASP 1146 1_555 ? ? ? ? ? ? ? 2.863 ? ? 
metalc36 metalc ? ? S  MG  .  MG  ? ? ? 1_555 HA HOH .   O   ? ? C MG  21   C HOH 249  1_555 ? ? ? ? ? ? ? 2.558 ? ? 
metalc37 metalc ? ? S  MG  .  MG  ? ? ? 1_555 C  PRO 125 O   ? ? C MG  21   C PRO 1098 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc38 metalc ? ? S  MG  .  MG  ? ? ? 1_555 C  GLU 226 OE2 ? ? C MG  21   C GLU 1199 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc39 metalc ? ? S  MG  .  MG  ? ? ? 1_555 C  GLU 226 OE1 ? ? C MG  21   C GLU 1199 1_555 ? ? ? ? ? ? ? 2.562 ? ? 
metalc40 metalc ? ? T  MG  .  MG  ? ? ? 1_555 C  GLU 234 OE2 ? ? C MG  22   C GLU 1207 1_555 ? ? ? ? ? ? ? 2.742 ? ? 
metalc41 metalc ? ? T  MG  .  MG  ? ? ? 1_555 C  GLU 234 OE1 ? ? C MG  22   C GLU 1207 1_555 ? ? ? ? ? ? ? 2.771 ? ? 
metalc42 metalc ? ? Y  ADP .  O1A ? ? ? 1_555 V  MG  .   MG  ? ? D ADP 4    D MG  13   1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc43 metalc ? ? Y  ADP .  O2B ? ? ? 1_555 V  MG  .   MG  ? ? D ADP 4    D MG  13   1_555 ? ? ? ? ? ? ? 2.221 ? ? 
metalc44 metalc ? ? Y  ADP .  O1B ? ? ? 1_555 W  MG  .   MG  ? ? D ADP 4    D MG  14   1_555 ? ? ? ? ? ? ? 2.551 ? ? 
metalc45 metalc ? ? V  MG  .  MG  ? ? ? 1_555 D  ASN 160 OD1 ? ? D MG  13   D ASN 1133 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc46 metalc ? ? V  MG  .  MG  ? ? ? 1_555 D  ASP 173 OD2 ? ? D MG  13   D ASP 1146 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc47 metalc ? ? W  MG  .  MG  ? ? ? 1_555 IA HOH .   O   ? ? D MG  14   D HOH 167  1_555 ? ? ? ? ? ? ? 2.226 ? ? 
metalc48 metalc ? ? W  MG  .  MG  ? ? ? 1_555 D  ASP 173 OD1 ? ? D MG  14   D ASP 1146 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc49 metalc ? ? W  MG  .  MG  ? ? ? 1_555 D  ASP 173 OD2 ? ? D MG  14   D ASP 1146 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc50 metalc ? ? X  MG  .  MG  ? ? ? 1_555 D  GLY 33  O   ? ? D MG  23   D GLY 1006 1_555 ? ? ? ? ? ? ? 2.242 ? ? 
metalc51 metalc ? ? X  MG  .  MG  ? ? ? 1_555 D  GLY 35  O   ? ? D MG  23   D GLY 1008 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc52 metalc ? ? BA ADP .  O1A ? ? ? 1_555 Z  MG  .   MG  ? ? E ADP 5    E MG  15   1_555 ? ? ? ? ? ? ? 1.956 ? ? 
metalc53 metalc ? ? BA ADP .  O2B ? ? ? 1_555 Z  MG  .   MG  ? ? E ADP 5    E MG  15   1_555 ? ? ? ? ? ? ? 2.661 ? ? 
metalc54 metalc ? ? BA ADP .  O1B ? ? ? 1_555 AA MG  .   MG  ? ? E ADP 5    E MG  16   1_555 ? ? ? ? ? ? ? 2.281 ? ? 
metalc55 metalc ? ? Z  MG  .  MG  ? ? ? 1_555 E  ASN 160 OD1 ? ? E MG  15   E ASN 1133 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc56 metalc ? ? Z  MG  .  MG  ? ? ? 1_555 E  ASP 173 OD2 ? ? E MG  15   E ASP 1146 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc57 metalc ? ? AA MG  .  MG  ? ? ? 1_555 E  ASP 173 OD1 ? ? E MG  16   E ASP 1146 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc58 metalc ? ? AA MG  .  MG  ? ? ? 1_555 E  ASP 173 OD2 ? ? E MG  16   E ASP 1146 1_555 ? ? ? ? ? ? ? 2.597 ? ? 
metalc59 metalc ? ? EA ADP .  O2B ? ? ? 1_555 CA MG  .   MG  ? ? F ADP 6    F MG  17   1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc60 metalc ? ? EA ADP .  O1A ? ? ? 1_555 CA MG  .   MG  ? ? F ADP 6    F MG  17   1_555 ? ? ? ? ? ? ? 2.100 ? ? 
metalc61 metalc ? ? EA ADP .  O1B ? ? ? 1_555 DA MG  .   MG  ? ? F ADP 6    F MG  18   1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc62 metalc ? ? CA MG  .  MG  ? ? ? 1_555 KA HOH .   O   ? ? F MG  17   F HOH 122  1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc63 metalc ? ? CA MG  .  MG  ? ? ? 1_555 F  ASN 160 OD1 ? ? F MG  17   F ASN 1133 1_555 ? ? ? ? ? ? ? 2.550 ? ? 
metalc64 metalc ? ? CA MG  .  MG  ? ? ? 1_555 F  ASP 173 OD2 ? ? F MG  17   F ASP 1146 1_555 ? ? ? ? ? ? ? 2.613 ? ? 
metalc65 metalc ? ? DA MG  .  MG  ? ? ? 1_555 F  ASP 173 OD1 ? ? F MG  18   F ASP 1146 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc66 metalc ? ? DA MG  .  MG  ? ? ? 1_555 F  ASP 173 OD2 ? ? F MG  18   F ASP 1146 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 5 ? 
M ? 2 ? 
N ? 2 ? 
O ? 5 ? 
P ? 2 ? 
Q ? 2 ? 
R ? 2 ? 
S ? 5 ? 
T ? 2 ? 
U ? 2 ? 
V ? 2 ? 
W ? 5 ? 
X ? 2 ? 
Y ? 2 ? 
Z ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
S 4 5 ? anti-parallel 
T 1 2 ? anti-parallel 
U 1 2 ? anti-parallel 
V 1 2 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
W 4 5 ? anti-parallel 
X 1 2 ? anti-parallel 
Y 1 2 ? anti-parallel 
Z 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 10  ? GLU A 11  ? VAL A 983  GLU A 984  
A 2 THR B 188 ? PHE B 189 ? THR B 1161 PHE B 1162 
B 1 TYR A 26  ? PRO A 31  ? TYR A 999  PRO A 1004 
B 2 VAL A 40  ? ASP A 45  ? VAL A 1013 ASP A 1018 
B 3 LYS A 50  ? LYS A 58  ? LYS A 1023 LYS A 1031 
B 4 PHE A 103 ? GLU A 109 ? PHE A 1076 GLU A 1082 
B 5 VAL A 94  ? GLU A 99  ? VAL A 1067 GLU A 1072 
C 1 TRP A 67  ? ASP A 70  ? TRP A 1040 ASP A 1043 
C 2 GLY A 74  ? THR A 77  ? GLY A 1047 THR A 1050 
D 1 ILE A 151 ? ILE A 152 ? ILE A 1124 ILE A 1125 
D 2 ALA A 178 ? TYR A 179 ? ALA A 1151 TYR A 1152 
E 1 ILE A 161 ? ILE A 163 ? ILE A 1134 ILE A 1136 
E 2 ILE A 169 ? LEU A 171 ? ILE A 1142 LEU A 1144 
F 1 THR A 188 ? PHE A 189 ? THR A 1161 PHE A 1162 
F 2 VAL C 10  ? GLU C 11  ? VAL C 983  GLU C 984  
G 1 VAL B 10  ? GLU B 11  ? VAL B 983  GLU B 984  
G 2 THR C 188 ? PHE C 189 ? THR C 1161 PHE C 1162 
H 1 TYR B 26  ? PRO B 31  ? TYR B 999  PRO B 1004 
H 2 VAL B 40  ? ASP B 45  ? VAL B 1013 ASP B 1018 
H 3 LYS B 50  ? LYS B 58  ? LYS B 1023 LYS B 1031 
H 4 PHE B 103 ? GLU B 109 ? PHE B 1076 GLU B 1082 
H 5 VAL B 94  ? GLU B 99  ? VAL B 1067 GLU B 1072 
I 1 ILE B 68  ? ASP B 70  ? ILE B 1041 ASP B 1043 
I 2 GLY B 74  ? VAL B 76  ? GLY B 1047 VAL B 1049 
J 1 ILE B 151 ? ILE B 152 ? ILE B 1124 ILE B 1125 
J 2 ALA B 178 ? TYR B 179 ? ALA B 1151 TYR B 1152 
K 1 ILE B 161 ? ILE B 163 ? ILE B 1134 ILE B 1136 
K 2 ILE B 169 ? LEU B 171 ? ILE B 1142 LEU B 1144 
L 1 TYR C 26  ? PRO C 31  ? TYR C 999  PRO C 1004 
L 2 VAL C 40  ? ASP C 45  ? VAL C 1013 ASP C 1018 
L 3 LYS C 50  ? LYS C 58  ? LYS C 1023 LYS C 1031 
L 4 PHE C 103 ? GLU C 109 ? PHE C 1076 GLU C 1082 
L 5 VAL C 94  ? GLU C 99  ? VAL C 1067 GLU C 1072 
M 1 ILE C 151 ? ILE C 152 ? ILE C 1124 ILE C 1125 
M 2 ALA C 178 ? TYR C 179 ? ALA C 1151 TYR C 1152 
N 1 ILE C 161 ? ILE C 163 ? ILE C 1134 ILE C 1136 
N 2 ILE C 169 ? LEU C 171 ? ILE C 1142 LEU C 1144 
O 1 TYR D 26  ? PRO D 31  ? TYR D 999  PRO D 1004 
O 2 VAL D 40  ? ASP D 45  ? VAL D 1013 ASP D 1018 
O 3 LYS D 50  ? LYS D 58  ? LYS D 1023 LYS D 1031 
O 4 PHE D 103 ? GLU D 109 ? PHE D 1076 GLU D 1082 
O 5 VAL D 94  ? GLU D 99  ? VAL D 1067 GLU D 1072 
P 1 TRP D 67  ? ASP D 70  ? TRP D 1040 ASP D 1043 
P 2 GLY D 74  ? THR D 77  ? GLY D 1047 THR D 1050 
Q 1 ILE D 151 ? ILE D 152 ? ILE D 1124 ILE D 1125 
Q 2 ALA D 178 ? TYR D 179 ? ALA D 1151 TYR D 1152 
R 1 ILE D 161 ? ILE D 163 ? ILE D 1134 ILE D 1136 
R 2 ILE D 169 ? LEU D 171 ? ILE D 1142 LEU D 1144 
S 1 TYR E 26  ? PRO E 31  ? TYR E 999  PRO E 1004 
S 2 VAL E 40  ? ASP E 45  ? VAL E 1013 ASP E 1018 
S 3 GLU E 51  ? LYS E 58  ? GLU E 1024 LYS E 1031 
S 4 PHE E 103 ? GLU E 109 ? PHE E 1076 GLU E 1082 
S 5 VAL E 94  ? GLU E 99  ? VAL E 1067 GLU E 1072 
T 1 ILE E 68  ? ASP E 70  ? ILE E 1041 ASP E 1043 
T 2 GLY E 74  ? VAL E 76  ? GLY E 1047 VAL E 1049 
U 1 ILE E 151 ? ILE E 152 ? ILE E 1124 ILE E 1125 
U 2 ALA E 178 ? TYR E 179 ? ALA E 1151 TYR E 1152 
V 1 ILE E 161 ? ILE E 163 ? ILE E 1134 ILE E 1136 
V 2 ILE E 169 ? LEU E 171 ? ILE E 1142 LEU E 1144 
W 1 TYR F 26  ? PRO F 31  ? TYR F 999  PRO F 1004 
W 2 VAL F 40  ? ASP F 45  ? VAL F 1013 ASP F 1018 
W 3 GLU F 51  ? LYS F 58  ? GLU F 1024 LYS F 1031 
W 4 PHE F 103 ? GLU F 109 ? PHE F 1076 GLU F 1082 
W 5 VAL F 94  ? GLU F 99  ? VAL F 1067 GLU F 1072 
X 1 ILE F 68  ? ASP F 70  ? ILE F 1041 ASP F 1043 
X 2 GLY F 74  ? VAL F 76  ? GLY F 1047 VAL F 1049 
Y 1 ILE F 151 ? ILE F 152 ? ILE F 1124 ILE F 1125 
Y 2 ALA F 178 ? TYR F 179 ? ALA F 1151 TYR F 1152 
Z 1 ILE F 161 ? ILE F 163 ? ILE F 1134 ILE F 1136 
Z 2 ILE F 169 ? LEU F 171 ? ILE F 1142 LEU F 1144 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 10  ? N VAL A 983  O PHE B 189 ? O PHE B 1162 
B 1 2 N SER A 30  ? N SER A 1003 O THR A 42  ? O THR A 1015 
B 2 3 N ASP A 45  ? N ASP A 1018 O LYS A 50  ? O LYS A 1023 
B 3 4 N VAL A 53  ? N VAL A 1026 O MET A 108 ? O MET A 1081 
B 4 5 O VAL A 107 ? O VAL A 1080 N LEU A 95  ? N LEU A 1068 
C 1 2 N ILE A 68  ? N ILE A 1041 O VAL A 76  ? O VAL A 1049 
D 1 2 N ILE A 152 ? N ILE A 1125 O ALA A 178 ? O ALA A 1151 
E 1 2 N VAL A 162 ? N VAL A 1135 O LYS A 170 ? O LYS A 1143 
F 1 2 N PHE A 189 ? N PHE A 1162 O VAL C 10  ? O VAL C 983  
G 1 2 N VAL B 10  ? N VAL B 983  O PHE C 189 ? O PHE C 1162 
H 1 2 N SER B 30  ? N SER B 1003 O THR B 42  ? O THR B 1015 
H 2 3 N ALA B 43  ? N ALA B 1016 O VAL B 52  ? O VAL B 1025 
H 3 4 N VAL B 53  ? N VAL B 1026 O MET B 108 ? O MET B 1081 
H 4 5 O VAL B 107 ? O VAL B 1080 N ASP B 96  ? N ASP B 1069 
I 1 2 N ASP B 70  ? N ASP B 1043 O GLY B 74  ? O GLY B 1047 
J 1 2 N ILE B 152 ? N ILE B 1125 O ALA B 178 ? O ALA B 1151 
K 1 2 N VAL B 162 ? N VAL B 1135 O LYS B 170 ? O LYS B 1143 
L 1 2 N SER C 30  ? N SER C 1003 O THR C 42  ? O THR C 1015 
L 2 3 N TRP C 41  ? N TRP C 1014 O VAL C 54  ? O VAL C 1027 
L 3 4 N VAL C 53  ? N VAL C 1026 O MET C 108 ? O MET C 1081 
L 4 5 O VAL C 107 ? O VAL C 1080 N LEU C 95  ? N LEU C 1068 
M 1 2 N ILE C 152 ? N ILE C 1125 O ALA C 178 ? O ALA C 1151 
N 1 2 N VAL C 162 ? N VAL C 1135 O LYS C 170 ? O LYS C 1143 
O 1 2 N SER D 30  ? N SER D 1003 O THR D 42  ? O THR D 1015 
O 2 3 N ALA D 43  ? N ALA D 1016 O VAL D 52  ? O VAL D 1025 
O 3 4 N VAL D 53  ? N VAL D 1026 O MET D 108 ? O MET D 1081 
O 4 5 O VAL D 107 ? O VAL D 1080 N LEU D 95  ? N LEU D 1068 
P 1 2 N ASP D 70  ? N ASP D 1043 O GLY D 74  ? O GLY D 1047 
Q 1 2 N ILE D 152 ? N ILE D 1125 O ALA D 178 ? O ALA D 1151 
R 1 2 N VAL D 162 ? N VAL D 1135 O LYS D 170 ? O LYS D 1143 
S 1 2 N SER E 30  ? N SER E 1003 O THR E 42  ? O THR E 1015 
S 2 3 N TRP E 41  ? N TRP E 1014 O VAL E 54  ? O VAL E 1027 
S 3 4 N VAL E 53  ? N VAL E 1026 O MET E 108 ? O MET E 1081 
S 4 5 O VAL E 107 ? O VAL E 1080 N LEU E 95  ? N LEU E 1068 
T 1 2 N ASP E 70  ? N ASP E 1043 O GLY E 74  ? O GLY E 1047 
U 1 2 N ILE E 152 ? N ILE E 1125 O ALA E 178 ? O ALA E 1151 
V 1 2 N VAL E 162 ? N VAL E 1135 O LYS E 170 ? O LYS E 1143 
W 1 2 N SER F 30  ? N SER F 1003 O THR F 42  ? O THR F 1015 
W 2 3 N TRP F 41  ? N TRP F 1014 O VAL F 54  ? O VAL F 1027 
W 3 4 N VAL F 53  ? N VAL F 1026 O MET F 108 ? O MET F 1081 
W 4 5 O GLN F 105 ? O GLN F 1078 N PHE F 98  ? N PHE F 1071 
X 1 2 N ASP F 70  ? N ASP F 1043 O GLY F 74  ? O GLY F 1047 
Y 1 2 N ILE F 152 ? N ILE F 1125 O ALA F 178 ? O ALA F 1151 
Z 1 2 N VAL F 162 ? N VAL F 1135 O LYS F 170 ? O LYS F 1143 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  7  ? 2  'BINDING SITE FOR RESIDUE MG A 7'  
AC2 Software A MG  8  ? 1  'BINDING SITE FOR RESIDUE MG A 8'  
AC3 Software B MG  9  ? 2  'BINDING SITE FOR RESIDUE MG B 9'  
AC4 Software B MG  10 ? 1  'BINDING SITE FOR RESIDUE MG B 10' 
AC5 Software C MG  11 ? 2  'BINDING SITE FOR RESIDUE MG C 11' 
AC6 Software C MG  12 ? 1  'BINDING SITE FOR RESIDUE MG C 12' 
AC7 Software D MG  13 ? 2  'BINDING SITE FOR RESIDUE MG D 13' 
AC8 Software D MG  14 ? 1  'BINDING SITE FOR RESIDUE MG D 14' 
AC9 Software E MG  15 ? 2  'BINDING SITE FOR RESIDUE MG E 15' 
BC1 Software E MG  16 ? 1  'BINDING SITE FOR RESIDUE MG E 16' 
BC2 Software F MG  17 ? 2  'BINDING SITE FOR RESIDUE MG F 17' 
BC3 Software F MG  18 ? 1  'BINDING SITE FOR RESIDUE MG F 18' 
BC4 Software B MG  19 ? 2  'BINDING SITE FOR RESIDUE MG B 19' 
BC5 Software A MG  20 ? 2  'BINDING SITE FOR RESIDUE MG A 20' 
BC6 Software C MG  21 ? 2  'BINDING SITE FOR RESIDUE MG C 21' 
BC7 Software C MG  22 ? 4  'BINDING SITE FOR RESIDUE MG C 22' 
BC8 Software D MG  23 ? 3  'BINDING SITE FOR RESIDUE MG D 23' 
BC9 Software B MG  24 ? 2  'BINDING SITE FOR RESIDUE MG B 24' 
CC1 Software A MG  25 ? 3  'BINDING SITE FOR RESIDUE MG A 25' 
CC2 Software A ADP 1  ? 12 'BINDING SITE FOR RESIDUE ADP A 1' 
CC3 Software B ADP 2  ? 10 'BINDING SITE FOR RESIDUE ADP B 2' 
CC4 Software C ADP 3  ? 13 'BINDING SITE FOR RESIDUE ADP C 3' 
CC5 Software D ADP 4  ? 10 'BINDING SITE FOR RESIDUE ADP D 4' 
CC6 Software E ADP 5  ? 12 'BINDING SITE FOR RESIDUE ADP E 5' 
CC7 Software F ADP 6  ? 11 'BINDING SITE FOR RESIDUE ADP F 6' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 2  ASN A 160 ? ASN A 1133 . ? 1_555 ? 
2   AC1 2  ASP A 173 ? ASP A 1146 . ? 1_555 ? 
3   AC2 1  ASP A 173 ? ASP A 1146 . ? 1_555 ? 
4   AC3 2  ASN B 160 ? ASN B 1133 . ? 1_555 ? 
5   AC3 2  ASP B 173 ? ASP B 1146 . ? 1_555 ? 
6   AC4 1  ASP B 173 ? ASP B 1146 . ? 1_555 ? 
7   AC5 2  ASN C 160 ? ASN C 1133 . ? 1_555 ? 
8   AC5 2  ASP C 173 ? ASP C 1146 . ? 1_555 ? 
9   AC6 1  ASP C 173 ? ASP C 1146 . ? 1_555 ? 
10  AC7 2  ASN D 160 ? ASN D 1133 . ? 1_555 ? 
11  AC7 2  ASP D 173 ? ASP D 1146 . ? 1_555 ? 
12  AC8 1  ASP D 173 ? ASP D 1146 . ? 1_555 ? 
13  AC9 2  ASN E 160 ? ASN E 1133 . ? 1_555 ? 
14  AC9 2  ASP E 173 ? ASP E 1146 . ? 1_555 ? 
15  BC1 1  ASP E 173 ? ASP E 1146 . ? 1_555 ? 
16  BC2 2  ASN F 160 ? ASN F 1133 . ? 1_555 ? 
17  BC2 2  ASP F 173 ? ASP F 1146 . ? 1_555 ? 
18  BC3 1  ASP F 173 ? ASP F 1146 . ? 1_555 ? 
19  BC4 2  PRO B 125 ? PRO B 1098 . ? 1_555 ? 
20  BC4 2  GLU B 226 ? GLU B 1199 . ? 1_555 ? 
21  BC5 2  PRO A 125 ? PRO A 1098 . ? 1_555 ? 
22  BC5 2  GLU A 226 ? GLU A 1199 . ? 1_555 ? 
23  BC6 2  PRO C 125 ? PRO C 1098 . ? 1_555 ? 
24  BC6 2  GLU C 226 ? GLU C 1199 . ? 1_555 ? 
25  BC7 4  GLY B 33  ? GLY B 1006 . ? 1_555 ? 
26  BC7 4  GLY B 35  ? GLY B 1008 . ? 1_555 ? 
27  BC7 4  ALA B 36  ? ALA B 1009 . ? 1_555 ? 
28  BC7 4  GLU C 234 ? GLU C 1207 . ? 1_555 ? 
29  BC8 3  GLY D 33  ? GLY D 1006 . ? 1_555 ? 
30  BC8 3  GLY D 35  ? GLY D 1008 . ? 1_555 ? 
31  BC8 3  GLU F 234 ? GLU F 1207 . ? 1_465 ? 
32  BC9 2  GLY A 33  ? GLY A 1006 . ? 1_555 ? 
33  BC9 2  GLU B 234 ? GLU B 1207 . ? 1_555 ? 
34  CC1 3  GLU A 234 ? GLU A 1207 . ? 1_555 ? 
35  CC1 3  GLY C 33  ? GLY C 1006 . ? 1_555 ? 
36  CC1 3  GLY C 35  ? GLY C 1008 . ? 1_555 ? 
37  CC2 12 LEU A 32  ? LEU A 1005 . ? 1_555 ? 
38  CC2 12 GLY A 33  ? GLY A 1006 . ? 1_555 ? 
39  CC2 12 LYS A 55  ? LYS A 1028 . ? 1_555 ? 
40  CC2 12 ILE A 92  ? ILE A 1065 . ? 1_555 ? 
41  CC2 12 GLU A 109 ? GLU A 1082 . ? 1_555 ? 
42  CC2 12 HIS A 111 ? HIS A 1084 . ? 1_555 ? 
43  CC2 12 GLY A 114 ? GLY A 1087 . ? 1_555 ? 
44  CC2 12 ASP A 116 ? ASP A 1089 . ? 1_555 ? 
45  CC2 12 GLU A 159 ? GLU A 1132 . ? 1_555 ? 
46  CC2 12 ASN A 160 ? ASN A 1133 . ? 1_555 ? 
47  CC2 12 ILE A 172 ? ILE A 1145 . ? 1_555 ? 
48  CC2 12 ASP A 173 ? ASP A 1146 . ? 1_555 ? 
49  CC3 10 GLY B 33  ? GLY B 1006 . ? 1_555 ? 
50  CC3 10 LYS B 55  ? LYS B 1028 . ? 1_555 ? 
51  CC3 10 ILE B 92  ? ILE B 1065 . ? 1_555 ? 
52  CC3 10 GLU B 109 ? GLU B 1082 . ? 1_555 ? 
53  CC3 10 HIS B 111 ? HIS B 1084 . ? 1_555 ? 
54  CC3 10 GLY B 114 ? GLY B 1087 . ? 1_555 ? 
55  CC3 10 ASP B 116 ? ASP B 1089 . ? 1_555 ? 
56  CC3 10 GLU B 159 ? GLU B 1132 . ? 1_555 ? 
57  CC3 10 ASN B 160 ? ASN B 1133 . ? 1_555 ? 
58  CC3 10 ASP B 173 ? ASP B 1146 . ? 1_555 ? 
59  CC4 13 LEU C 32  ? LEU C 1005 . ? 1_555 ? 
60  CC4 13 GLY C 33  ? GLY C 1006 . ? 1_555 ? 
61  CC4 13 LYS C 55  ? LYS C 1028 . ? 1_555 ? 
62  CC4 13 ILE C 92  ? ILE C 1065 . ? 1_555 ? 
63  CC4 13 MET C 108 ? MET C 1081 . ? 1_555 ? 
64  CC4 13 GLU C 109 ? GLU C 1082 . ? 1_555 ? 
65  CC4 13 HIS C 111 ? HIS C 1084 . ? 1_555 ? 
66  CC4 13 GLY C 114 ? GLY C 1087 . ? 1_555 ? 
67  CC4 13 ASP C 116 ? ASP C 1089 . ? 1_555 ? 
68  CC4 13 GLU C 159 ? GLU C 1132 . ? 1_555 ? 
69  CC4 13 ASN C 160 ? ASN C 1133 . ? 1_555 ? 
70  CC4 13 ILE C 172 ? ILE C 1145 . ? 1_555 ? 
71  CC4 13 ASP C 173 ? ASP C 1146 . ? 1_555 ? 
72  CC5 10 LYS D 55  ? LYS D 1028 . ? 1_555 ? 
73  CC5 10 ILE D 92  ? ILE D 1065 . ? 1_555 ? 
74  CC5 10 GLU D 109 ? GLU D 1082 . ? 1_555 ? 
75  CC5 10 HIS D 111 ? HIS D 1084 . ? 1_555 ? 
76  CC5 10 GLY D 114 ? GLY D 1087 . ? 1_555 ? 
77  CC5 10 ASP D 116 ? ASP D 1089 . ? 1_555 ? 
78  CC5 10 GLU D 159 ? GLU D 1132 . ? 1_555 ? 
79  CC5 10 ASN D 160 ? ASN D 1133 . ? 1_555 ? 
80  CC5 10 ILE D 172 ? ILE D 1145 . ? 1_555 ? 
81  CC5 10 ASP D 173 ? ASP D 1146 . ? 1_555 ? 
82  CC6 12 LEU E 32  ? LEU E 1005 . ? 1_555 ? 
83  CC6 12 GLY E 33  ? GLY E 1006 . ? 1_555 ? 
84  CC6 12 LYS E 55  ? LYS E 1028 . ? 1_555 ? 
85  CC6 12 ILE E 92  ? ILE E 1065 . ? 1_555 ? 
86  CC6 12 GLU E 109 ? GLU E 1082 . ? 1_555 ? 
87  CC6 12 HIS E 111 ? HIS E 1084 . ? 1_555 ? 
88  CC6 12 GLY E 114 ? GLY E 1087 . ? 1_555 ? 
89  CC6 12 ASP E 116 ? ASP E 1089 . ? 1_555 ? 
90  CC6 12 GLU E 159 ? GLU E 1132 . ? 1_555 ? 
91  CC6 12 ASN E 160 ? ASN E 1133 . ? 1_555 ? 
92  CC6 12 ILE E 172 ? ILE E 1145 . ? 1_555 ? 
93  CC6 12 ASP E 173 ? ASP E 1146 . ? 1_555 ? 
94  CC7 11 GLY F 33  ? GLY F 1006 . ? 1_555 ? 
95  CC7 11 LYS F 55  ? LYS F 1028 . ? 1_555 ? 
96  CC7 11 ILE F 92  ? ILE F 1065 . ? 1_555 ? 
97  CC7 11 GLU F 109 ? GLU F 1082 . ? 1_555 ? 
98  CC7 11 HIS F 111 ? HIS F 1084 . ? 1_555 ? 
99  CC7 11 GLY F 114 ? GLY F 1087 . ? 1_555 ? 
100 CC7 11 ASP F 116 ? ASP F 1089 . ? 1_555 ? 
101 CC7 11 GLU F 159 ? GLU F 1132 . ? 1_555 ? 
102 CC7 11 ASN F 160 ? ASN F 1133 . ? 1_555 ? 
103 CC7 11 ILE F 172 ? ILE F 1145 . ? 1_555 ? 
104 CC7 11 ASP F 173 ? ASP F 1146 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3DLS 
_atom_sites.fract_transf_matrix[1][1]   0.011658 
_atom_sites.fract_transf_matrix[1][2]   -0.006707 
_atom_sites.fract_transf_matrix[1][3]   -0.001710 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013440 
_atom_sites.fract_transf_matrix[2][3]   -0.001800 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010976 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A  1 9   ? 13.954  7.215   10.220  1.00 47.36 ? 982  ALA A N     1 
ATOM   2     C  CA    . ALA A  1 9   ? 12.677  7.987   10.186  1.00 47.53 ? 982  ALA A CA    1 
ATOM   3     C  C     . ALA A  1 9   ? 12.887  9.488   10.440  1.00 43.63 ? 982  ALA A C     1 
ATOM   4     O  O     . ALA A  1 9   ? 13.345  9.894   11.514  1.00 44.14 ? 982  ALA A O     1 
ATOM   5     C  CB    . ALA A  1 9   ? 11.673  7.401   11.175  1.00 47.69 ? 982  ALA A CB    1 
ATOM   6     N  N     . VAL A  1 10  ? 12.539  10.295  9.440   1.00 39.35 ? 983  VAL A N     1 
ATOM   7     C  CA    . VAL A  1 10  ? 12.730  11.749  9.481   1.00 38.19 ? 983  VAL A CA    1 
ATOM   8     C  C     . VAL A  1 10  ? 11.861  12.433  10.539  1.00 36.89 ? 983  VAL A C     1 
ATOM   9     O  O     . VAL A  1 10  ? 10.636  12.298  10.549  1.00 30.64 ? 983  VAL A O     1 
ATOM   10    C  CB    . VAL A  1 10  ? 12.467  12.414  8.101   1.00 34.76 ? 983  VAL A CB    1 
ATOM   11    C  CG1   . VAL A  1 10  ? 12.975  13.852  8.096   1.00 39.49 ? 983  VAL A CG1   1 
ATOM   12    C  CG2   . VAL A  1 10  ? 13.140  11.626  6.975   1.00 44.77 ? 983  VAL A CG2   1 
ATOM   13    N  N     . GLU A  1 11  ? 12.515  13.165  11.434  1.00 38.11 ? 984  GLU A N     1 
ATOM   14    C  CA    . GLU A  1 11  ? 11.812  14.024  12.366  1.00 39.08 ? 984  GLU A CA    1 
ATOM   15    C  C     . GLU A  1 11  ? 11.371  15.304  11.660  1.00 38.14 ? 984  GLU A C     1 
ATOM   16    O  O     . GLU A  1 11  ? 12.026  15.794  10.733  1.00 39.05 ? 984  GLU A O     1 
ATOM   17    C  CB    . GLU A  1 11  ? 12.663  14.303  13.604  1.00 45.38 ? 984  GLU A CB    1 
ATOM   18    C  CG    . GLU A  1 11  ? 12.741  13.101  14.548  1.00 50.53 ? 984  GLU A CG    1 
ATOM   19    C  CD    . GLU A  1 11  ? 13.915  13.168  15.510  1.00 57.01 ? 984  GLU A CD    1 
ATOM   20    O  OE1   . GLU A  1 11  ? 15.080  13.177  15.046  1.00 55.29 ? 984  GLU A OE1   1 
ATOM   21    O  OE2   . GLU A  1 11  ? 13.670  13.191  16.735  1.00 58.18 ? 984  GLU A OE2   1 
ATOM   22    N  N     . LEU A  1 12  ? 10.227  15.811  12.088  1.00 37.64 ? 985  LEU A N     1 
ATOM   23    C  CA    . LEU A  1 12  ? 9.583   16.932  11.441  1.00 36.82 ? 985  LEU A CA    1 
ATOM   24    C  C     . LEU A  1 12  ? 9.640   18.120  12.386  1.00 36.31 ? 985  LEU A C     1 
ATOM   25    O  O     . LEU A  1 12  ? 8.774   18.297  13.249  1.00 35.31 ? 985  LEU A O     1 
ATOM   26    C  CB    . LEU A  1 12  ? 8.140   16.556  11.084  1.00 29.57 ? 985  LEU A CB    1 
ATOM   27    C  CG    . LEU A  1 12  ? 7.758   15.996  9.709   1.00 27.52 ? 985  LEU A CG    1 
ATOM   28    C  CD1   . LEU A  1 12  ? 8.901   15.379  8.922   1.00 20.88 ? 985  LEU A CD1   1 
ATOM   29    C  CD2   . LEU A  1 12  ? 6.587   15.021  9.852   1.00 23.27 ? 985  LEU A CD2   1 
ATOM   30    N  N     . GLU A  1 13  ? 10.681  18.927  12.216  1.00 42.90 ? 986  GLU A N     1 
ATOM   31    C  CA    . GLU A  1 13  ? 11.005  19.994  13.166  1.00 44.86 ? 986  GLU A CA    1 
ATOM   32    C  C     . GLU A  1 13  ? 10.786  21.391  12.597  1.00 43.10 ? 986  GLU A C     1 
ATOM   33    O  O     . GLU A  1 13  ? 11.401  22.347  13.056  1.00 46.55 ? 986  GLU A O     1 
ATOM   34    C  CB    . GLU A  1 13  ? 12.445  19.835  13.668  1.00 46.05 ? 986  GLU A CB    1 
ATOM   35    C  CG    . GLU A  1 13  ? 12.629  18.735  14.708  1.00 55.64 ? 986  GLU A CG    1 
ATOM   36    C  CD    . GLU A  1 13  ? 12.174  19.151  16.102  1.00 62.82 ? 986  GLU A CD    1 
ATOM   37    O  OE1   . GLU A  1 13  ? 12.701  20.151  16.632  1.00 66.15 ? 986  GLU A OE1   1 
ATOM   38    O  OE2   . GLU A  1 13  ? 11.295  18.470  16.673  1.00 69.61 ? 986  GLU A OE2   1 
ATOM   39    N  N     . GLY A  1 14  ? 9.898   21.507  11.611  1.00 43.39 ? 987  GLY A N     1 
ATOM   40    C  CA    . GLY A  1 14  ? 9.564   22.798  10.998  1.00 43.78 ? 987  GLY A CA    1 
ATOM   41    C  C     . GLY A  1 14  ? 9.104   23.875  11.967  1.00 44.06 ? 987  GLY A C     1 
ATOM   42    O  O     . GLY A  1 14  ? 9.486   25.042  11.834  1.00 46.24 ? 987  GLY A O     1 
ATOM   43    N  N     . LEU A  1 15  ? 8.295   23.483  12.948  1.00 41.06 ? 988  LEU A N     1 
ATOM   44    C  CA    . LEU A  1 15  ? 7.760   24.418  13.941  1.00 41.00 ? 988  LEU A CA    1 
ATOM   45    C  C     . LEU A  1 15  ? 8.816   24.848  14.967  1.00 38.52 ? 988  LEU A C     1 
ATOM   46    O  O     . LEU A  1 15  ? 9.099   26.036  15.109  1.00 39.32 ? 988  LEU A O     1 
ATOM   47    C  CB    . LEU A  1 15  ? 6.530   23.820  14.647  1.00 40.56 ? 988  LEU A CB    1 
ATOM   48    C  CG    . LEU A  1 15  ? 5.301   23.419  13.818  1.00 40.68 ? 988  LEU A CG    1 
ATOM   49    C  CD1   . LEU A  1 15  ? 4.326   22.596  14.666  1.00 42.28 ? 988  LEU A CD1   1 
ATOM   50    C  CD2   . LEU A  1 15  ? 4.594   24.634  13.212  1.00 43.39 ? 988  LEU A CD2   1 
ATOM   51    N  N     . ALA A  1 16  ? 9.391   23.875  15.669  1.00 36.96 ? 989  ALA A N     1 
ATOM   52    C  CA    . ALA A  1 16  ? 10.434  24.118  16.675  1.00 36.35 ? 989  ALA A CA    1 
ATOM   53    C  C     . ALA A  1 16  ? 11.691  24.834  16.139  1.00 34.82 ? 989  ALA A C     1 
ATOM   54    O  O     . ALA A  1 16  ? 12.392  25.505  16.900  1.00 35.72 ? 989  ALA A O     1 
ATOM   55    C  CB    . ALA A  1 16  ? 10.818  22.808  17.360  1.00 33.76 ? 989  ALA A CB    1 
ATOM   56    N  N     . ALA A  1 17  ? 11.965  24.691  14.842  1.00 31.45 ? 990  ALA A N     1 
ATOM   57    C  CA    . ALA A  1 17  ? 13.079  25.390  14.195  1.00 27.30 ? 990  ALA A CA    1 
ATOM   58    C  C     . ALA A  1 17  ? 12.822  26.883  14.013  1.00 25.71 ? 990  ALA A C     1 
ATOM   59    O  O     . ALA A  1 17  ? 13.757  27.676  14.002  1.00 22.32 ? 990  ALA A O     1 
ATOM   60    C  CB    . ALA A  1 17  ? 13.409  24.746  12.848  1.00 24.41 ? 990  ALA A CB    1 
ATOM   61    N  N     . CYS A  1 18  ? 11.551  27.247  13.876  1.00 28.52 ? 991  CYS A N     1 
ATOM   62    C  CA    . CYS A  1 18  ? 11.137  28.592  13.476  1.00 30.07 ? 991  CYS A CA    1 
ATOM   63    C  C     . CYS A  1 18  ? 10.559  29.444  14.614  1.00 32.33 ? 991  CYS A C     1 
ATOM   64    O  O     . CYS A  1 18  ? 10.529  30.668  14.507  1.00 34.07 ? 991  CYS A O     1 
ATOM   65    C  CB    . CYS A  1 18  ? 10.098  28.507  12.343  1.00 27.86 ? 991  CYS A CB    1 
ATOM   66    S  SG    . CYS A  1 18  ? 10.725  27.966  10.713  1.00 40.68 ? 991  CYS A SG    1 
ATOM   67    N  N     . GLU A  1 19  ? 10.099  28.808  15.691  1.00 30.81 ? 992  GLU A N     1 
ATOM   68    C  CA    . GLU A  1 19  ? 9.343   29.524  16.723  1.00 36.39 ? 992  GLU A CA    1 
ATOM   69    C  C     . GLU A  1 19  ? 10.146  30.611  17.475  1.00 34.26 ? 992  GLU A C     1 
ATOM   70    O  O     . GLU A  1 19  ? 11.371  30.510  17.641  1.00 36.23 ? 992  GLU A O     1 
ATOM   71    C  CB    . GLU A  1 19  ? 8.642   28.541  17.687  1.00 33.98 ? 992  GLU A CB    1 
ATOM   72    C  CG    . GLU A  1 19  ? 9.414   28.159  18.937  1.00 44.61 ? 992  GLU A CG    1 
ATOM   73    C  CD    . GLU A  1 19  ? 9.201   29.137  20.086  1.00 52.50 ? 992  GLU A CD    1 
ATOM   74    O  OE1   . GLU A  1 19  ? 10.193  29.502  20.754  1.00 56.61 ? 992  GLU A OE1   1 
ATOM   75    O  OE2   . GLU A  1 19  ? 8.043   29.543  20.323  1.00 57.52 ? 992  GLU A OE2   1 
ATOM   76    N  N     . GLY A  1 20  ? 9.429   31.649  17.906  1.00 32.96 ? 993  GLY A N     1 
ATOM   77    C  CA    . GLY A  1 20  ? 10.000  32.736  18.692  1.00 29.36 ? 993  GLY A CA    1 
ATOM   78    C  C     . GLY A  1 20  ? 10.377  33.930  17.847  1.00 33.82 ? 993  GLY A C     1 
ATOM   79    O  O     . GLY A  1 20  ? 9.688   34.259  16.876  1.00 37.43 ? 993  GLY A O     1 
ATOM   80    N  N     . GLU A  1 21  ? 11.488  34.564  18.210  1.00 34.00 ? 994  GLU A N     1 
ATOM   81    C  CA    . GLU A  1 21  ? 11.901  35.835  17.624  1.00 37.50 ? 994  GLU A CA    1 
ATOM   82    C  C     . GLU A  1 21  ? 12.170  35.758  16.122  1.00 35.59 ? 994  GLU A C     1 
ATOM   83    O  O     . GLU A  1 21  ? 11.985  36.742  15.404  1.00 36.65 ? 994  GLU A O     1 
ATOM   84    C  CB    . GLU A  1 21  ? 13.125  36.381  18.361  1.00 40.69 ? 994  GLU A CB    1 
ATOM   85    C  CG    . GLU A  1 21  ? 13.330  37.888  18.210  1.00 48.35 ? 994  GLU A CG    1 
ATOM   86    C  CD    . GLU A  1 21  ? 14.563  38.398  18.945  1.00 47.69 ? 994  GLU A CD    1 
ATOM   87    O  OE1   . GLU A  1 21  ? 15.164  37.631  19.735  1.00 54.65 ? 994  GLU A OE1   1 
ATOM   88    O  OE2   . GLU A  1 21  ? 14.929  39.574  18.727  1.00 58.31 ? 994  GLU A OE2   1 
ATOM   89    N  N     . TYR A  1 22  ? 12.604  34.593  15.651  1.00 33.71 ? 995  TYR A N     1 
ATOM   90    C  CA    . TYR A  1 22  ? 12.820  34.394  14.220  1.00 31.64 ? 995  TYR A CA    1 
ATOM   91    C  C     . TYR A  1 22  ? 11.522  34.586  13.414  1.00 31.21 ? 995  TYR A C     1 
ATOM   92    O  O     . TYR A  1 22  ? 11.504  35.318  12.419  1.00 29.79 ? 995  TYR A O     1 
ATOM   93    C  CB    . TYR A  1 22  ? 13.477  33.032  13.922  1.00 25.66 ? 995  TYR A CB    1 
ATOM   94    C  CG    . TYR A  1 22  ? 13.437  32.702  12.447  1.00 20.64 ? 995  TYR A CG    1 
ATOM   95    C  CD1   . TYR A  1 22  ? 14.374  33.242  11.572  1.00 10.91 ? 995  TYR A CD1   1 
ATOM   96    C  CD2   . TYR A  1 22  ? 12.432  31.886  11.923  1.00 17.34 ? 995  TYR A CD2   1 
ATOM   97    C  CE1   . TYR A  1 22  ? 14.319  32.973  10.217  1.00 17.48 ? 995  TYR A CE1   1 
ATOM   98    C  CE2   . TYR A  1 22  ? 12.372  31.607  10.570  1.00 18.00 ? 995  TYR A CE2   1 
ATOM   99    C  CZ    . TYR A  1 22  ? 13.317  32.152  9.725   1.00 17.23 ? 995  TYR A CZ    1 
ATOM   100   O  OH    . TYR A  1 22  ? 13.252  31.884  8.381   1.00 23.90 ? 995  TYR A OH    1 
ATOM   101   N  N     . SER A  1 23  ? 10.446  33.936  13.860  1.00 34.32 ? 996  SER A N     1 
ATOM   102   C  CA    . SER A  1 23  ? 9.141   33.988  13.178  1.00 34.84 ? 996  SER A CA    1 
ATOM   103   C  C     . SER A  1 23  ? 8.447   35.344  13.207  1.00 34.63 ? 996  SER A C     1 
ATOM   104   O  O     . SER A  1 23  ? 7.603   35.620  12.355  1.00 36.14 ? 996  SER A O     1 
ATOM   105   C  CB    . SER A  1 23  ? 8.198   32.923  13.732  1.00 35.13 ? 996  SER A CB    1 
ATOM   106   O  OG    . SER A  1 23  ? 8.542   31.650  13.220  1.00 47.71 ? 996  SER A OG    1 
ATOM   107   N  N     . GLN A  1 24  ? 8.797   36.185  14.178  1.00 36.24 ? 997  GLN A N     1 
ATOM   108   C  CA    . GLN A  1 24  ? 8.275   37.555  14.240  1.00 39.03 ? 997  GLN A CA    1 
ATOM   109   C  C     . GLN A  1 24  ? 8.848   38.436  13.125  1.00 36.14 ? 997  GLN A C     1 
ATOM   110   O  O     . GLN A  1 24  ? 8.198   39.384  12.678  1.00 40.28 ? 997  GLN A O     1 
ATOM   111   C  CB    . GLN A  1 24  ? 8.563   38.198  15.606  1.00 41.12 ? 997  GLN A CB    1 
ATOM   112   C  CG    . GLN A  1 24  ? 8.373   37.283  16.825  1.00 47.08 ? 997  GLN A CG    1 
ATOM   113   C  CD    . GLN A  1 24  ? 6.925   37.144  17.280  1.00 48.75 ? 997  GLN A CD    1 
ATOM   114   O  OE1   . GLN A  1 24  ? 6.630   37.262  18.469  1.00 51.70 ? 997  GLN A OE1   1 
ATOM   115   N  NE2   . GLN A  1 24  ? 6.022   36.879  16.344  1.00 49.09 ? 997  GLN A NE2   1 
ATOM   116   N  N     . LYS A  1 25  ? 10.058  38.104  12.677  1.00 34.29 ? 998  LYS A N     1 
ATOM   117   C  CA    . LYS A  1 25  ? 10.821  38.920  11.722  1.00 28.23 ? 998  LYS A CA    1 
ATOM   118   C  C     . LYS A  1 25  ? 10.856  38.327  10.301  1.00 23.09 ? 998  LYS A C     1 
ATOM   119   O  O     . LYS A  1 25  ? 10.772  39.048  9.303   1.00 20.75 ? 998  LYS A O     1 
ATOM   120   C  CB    . LYS A  1 25  ? 12.243  39.077  12.256  1.00 26.46 ? 998  LYS A CB    1 
ATOM   121   C  CG    . LYS A  1 25  ? 12.986  40.285  11.768  1.00 27.45 ? 998  LYS A CG    1 
ATOM   122   C  CD    . LYS A  1 25  ? 14.209  40.537  12.638  1.00 24.22 ? 998  LYS A CD    1 
ATOM   123   C  CE    . LYS A  1 25  ? 14.959  41.794  12.199  1.00 27.98 ? 998  LYS A CE    1 
ATOM   124   N  NZ    . LYS A  1 25  ? 15.034  41.880  10.717  1.00 24.96 ? 998  LYS A NZ    1 
ATOM   125   N  N     . TYR A  1 26  ? 10.974  37.008  10.218  1.00 26.70 ? 999  TYR A N     1 
ATOM   126   C  CA    . TYR A  1 26  ? 11.168  36.338  8.935   1.00 26.44 ? 999  TYR A CA    1 
ATOM   127   C  C     . TYR A  1 26  ? 10.153  35.228  8.688   1.00 25.20 ? 999  TYR A C     1 
ATOM   128   O  O     . TYR A  1 26  ? 9.760   34.524  9.609   1.00 27.53 ? 999  TYR A O     1 
ATOM   129   C  CB    . TYR A  1 26  ? 12.572  35.731  8.857   1.00 20.97 ? 999  TYR A CB    1 
ATOM   130   C  CG    . TYR A  1 26  ? 13.711  36.698  9.063   1.00 20.56 ? 999  TYR A CG    1 
ATOM   131   C  CD1   . TYR A  1 26  ? 14.207  37.444  7.999   1.00 22.38 ? 999  TYR A CD1   1 
ATOM   132   C  CD2   . TYR A  1 26  ? 14.325  36.839  10.314  1.00 21.80 ? 999  TYR A CD2   1 
ATOM   133   C  CE1   . TYR A  1 26  ? 15.264  38.339  8.175   1.00 22.96 ? 999  TYR A CE1   1 
ATOM   134   C  CE2   . TYR A  1 26  ? 15.394  37.726  10.496  1.00 20.95 ? 999  TYR A CE2   1 
ATOM   135   C  CZ    . TYR A  1 26  ? 15.850  38.476  9.416   1.00 19.48 ? 999  TYR A CZ    1 
ATOM   136   O  OH    . TYR A  1 26  ? 16.896  39.361  9.560   1.00 16.54 ? 999  TYR A OH    1 
ATOM   137   N  N     . SER A  1 27  ? 9.760   35.069  7.428   1.00 29.03 ? 1000 SER A N     1 
ATOM   138   C  CA    . SER A  1 27  ? 9.000   33.899  6.989   1.00 30.60 ? 1000 SER A CA    1 
ATOM   139   C  C     . SER A  1 27  ? 9.826   33.042  6.027   1.00 28.84 ? 1000 SER A C     1 
ATOM   140   O  O     . SER A  1 27  ? 10.367  33.541  5.037   1.00 29.80 ? 1000 SER A O     1 
ATOM   141   C  CB    . SER A  1 27  ? 7.681   34.310  6.334   1.00 35.50 ? 1000 SER A CB    1 
ATOM   142   O  OG    . SER A  1 27  ? 6.891   33.163  6.073   1.00 53.43 ? 1000 SER A OG    1 
ATOM   143   N  N     . THR A  1 28  ? 9.917   31.753  6.344   1.00 26.69 ? 1001 THR A N     1 
ATOM   144   C  CA    . THR A  1 28  ? 10.703  30.772  5.586   1.00 29.36 ? 1001 THR A CA    1 
ATOM   145   C  C     . THR A  1 28  ? 9.975   30.339  4.306   1.00 28.26 ? 1001 THR A C     1 
ATOM   146   O  O     . THR A  1 28  ? 8.806   29.975  4.349   1.00 25.69 ? 1001 THR A O     1 
ATOM   147   C  CB    . THR A  1 28  ? 11.013  29.535  6.465   1.00 24.89 ? 1001 THR A CB    1 
ATOM   148   O  OG1   . THR A  1 28  ? 11.413  29.968  7.772   1.00 30.59 ? 1001 THR A OG1   1 
ATOM   149   C  CG2   . THR A  1 28  ? 12.117  28.701  5.866   1.00 27.01 ? 1001 THR A CG2   1 
ATOM   150   N  N     . MET A  1 29  ? 10.671  30.367  3.170   1.00 27.04 ? 1002 MET A N     1 
ATOM   151   C  CA    . MET A  1 29  ? 9.999   30.163  1.885   1.00 26.78 ? 1002 MET A CA    1 
ATOM   152   C  C     . MET A  1 29  ? 10.325  28.829  1.215   1.00 25.94 ? 1002 MET A C     1 
ATOM   153   O  O     . MET A  1 29  ? 9.493   27.923  1.186   1.00 28.15 ? 1002 MET A O     1 
ATOM   154   C  CB    . MET A  1 29  ? 10.272  31.330  0.928   1.00 24.53 ? 1002 MET A CB    1 
ATOM   155   C  CG    . MET A  1 29  ? 9.883   32.692  1.476   1.00 33.79 ? 1002 MET A CG    1 
ATOM   156   S  SD    . MET A  1 29  ? 8.124   32.968  1.773   1.00 38.17 ? 1002 MET A SD    1 
ATOM   157   C  CE    . MET A  1 29  ? 7.537   33.198  0.092   1.00 28.18 ? 1002 MET A CE    1 
ATOM   158   N  N     . SER A  1 30  ? 11.540  28.719  0.686   1.00 29.23 ? 1003 SER A N     1 
ATOM   159   C  CA    . SER A  1 30  ? 11.940  27.583  -0.136  1.00 28.47 ? 1003 SER A CA    1 
ATOM   160   C  C     . SER A  1 30  ? 13.347  27.120  0.246   1.00 30.58 ? 1003 SER A C     1 
ATOM   161   O  O     . SER A  1 30  ? 14.142  27.922  0.743   1.00 31.34 ? 1003 SER A O     1 
ATOM   162   C  CB    . SER A  1 30  ? 11.884  27.974  -1.608  1.00 22.36 ? 1003 SER A CB    1 
ATOM   163   O  OG    . SER A  1 30  ? 12.625  29.162  -1.831  1.00 34.20 ? 1003 SER A OG    1 
ATOM   164   N  N     . PRO A  1 31  ? 13.647  25.818  0.047   1.00 30.15 ? 1004 PRO A N     1 
ATOM   165   C  CA    . PRO A  1 31  ? 14.963  25.291  0.421   1.00 30.06 ? 1004 PRO A CA    1 
ATOM   166   C  C     . PRO A  1 31  ? 16.061  25.764  -0.519  1.00 29.97 ? 1004 PRO A C     1 
ATOM   167   O  O     . PRO A  1 31  ? 15.786  26.101  -1.672  1.00 32.20 ? 1004 PRO A O     1 
ATOM   168   C  CB    . PRO A  1 31  ? 14.779  23.769  0.327   1.00 30.24 ? 1004 PRO A CB    1 
ATOM   169   C  CG    . PRO A  1 31  ? 13.634  23.580  -0.615  1.00 31.20 ? 1004 PRO A CG    1 
ATOM   170   C  CD    . PRO A  1 31  ? 12.759  24.775  -0.506  1.00 25.51 ? 1004 PRO A CD    1 
ATOM   171   N  N     . LEU A  1 32  ? 17.297  25.784  -0.027  1.00 26.22 ? 1005 LEU A N     1 
ATOM   172   C  CA    . LEU A  1 32  ? 18.417  26.302  -0.808  1.00 27.61 ? 1005 LEU A CA    1 
ATOM   173   C  C     . LEU A  1 32  ? 19.548  25.314  -1.087  1.00 30.22 ? 1005 LEU A C     1 
ATOM   174   O  O     . LEU A  1 32  ? 19.799  24.389  -0.309  1.00 28.23 ? 1005 LEU A O     1 
ATOM   175   C  CB    . LEU A  1 32  ? 18.989  27.559  -0.156  1.00 21.46 ? 1005 LEU A CB    1 
ATOM   176   C  CG    . LEU A  1 32  ? 18.753  28.910  -0.807  1.00 26.31 ? 1005 LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1 32  ? 19.788  29.850  -0.245  1.00 19.66 ? 1005 LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1 32  ? 18.870  28.844  -2.324  1.00 23.99 ? 1005 LEU A CD2   1 
ATOM   179   N  N     . GLY A  1 33  ? 20.215  25.540  -2.220  1.00 37.62 ? 1006 GLY A N     1 
ATOM   180   C  CA    . GLY A  1 33  ? 21.468  24.881  -2.575  1.00 44.27 ? 1006 GLY A CA    1 
ATOM   181   C  C     . GLY A  1 33  ? 21.427  23.368  -2.622  1.00 51.60 ? 1006 GLY A C     1 
ATOM   182   O  O     . GLY A  1 33  ? 20.382  22.772  -2.905  1.00 47.28 ? 1006 GLY A O     1 
ATOM   183   N  N     . SER A  1 34  ? 22.599  22.773  -2.381  1.00 58.40 ? 1007 SER A N     1 
ATOM   184   C  CA    . SER A  1 34  ? 22.799  21.333  -2.128  1.00 59.92 ? 1007 SER A CA    1 
ATOM   185   C  C     . SER A  1 34  ? 21.863  20.356  -2.858  1.00 57.83 ? 1007 SER A C     1 
ATOM   186   O  O     . SER A  1 34  ? 21.825  20.324  -4.093  1.00 56.46 ? 1007 SER A O     1 
ATOM   187   C  CB    . SER A  1 34  ? 22.805  21.064  -0.613  1.00 61.36 ? 1007 SER A CB    1 
ATOM   188   N  N     . GLY A  1 35  ? 21.133  19.555  -2.081  1.00 58.26 ? 1008 GLY A N     1 
ATOM   189   C  CA    . GLY A  1 35  ? 20.210  18.554  -2.621  1.00 57.55 ? 1008 GLY A CA    1 
ATOM   190   C  C     . GLY A  1 35  ? 19.213  18.050  -1.592  1.00 53.81 ? 1008 GLY A C     1 
ATOM   191   O  O     . GLY A  1 35  ? 19.598  17.668  -0.487  1.00 56.41 ? 1008 GLY A O     1 
ATOM   192   N  N     . ALA A  1 36  ? 17.933  18.062  -1.973  1.00 50.90 ? 1009 ALA A N     1 
ATOM   193   C  CA    . ALA A  1 36  ? 16.803  17.563  -1.167  1.00 43.66 ? 1009 ALA A CA    1 
ATOM   194   C  C     . ALA A  1 36  ? 16.598  18.291  0.163   1.00 41.34 ? 1009 ALA A C     1 
ATOM   195   O  O     . ALA A  1 36  ? 16.965  17.781  1.223   1.00 38.86 ? 1009 ALA A O     1 
ATOM   196   C  CB    . ALA A  1 36  ? 16.901  16.042  -0.960  1.00 47.11 ? 1009 ALA A CB    1 
ATOM   197   N  N     . PHE A  1 37  ? 16.003  19.483  0.089   1.00 39.57 ? 1010 PHE A N     1 
ATOM   198   C  CA    . PHE A  1 37  ? 15.677  20.301  1.271   1.00 39.71 ? 1010 PHE A CA    1 
ATOM   199   C  C     . PHE A  1 37  ? 16.870  20.443  2.230   1.00 38.81 ? 1010 PHE A C     1 
ATOM   200   O  O     . PHE A  1 37  ? 18.001  20.657  1.782   1.00 39.31 ? 1010 PHE A O     1 
ATOM   201   C  CB    . PHE A  1 37  ? 14.417  19.771  1.988   1.00 40.79 ? 1010 PHE A CB    1 
ATOM   202   C  CG    . PHE A  1 37  ? 13.206  19.676  1.100   1.00 34.72 ? 1010 PHE A CG    1 
ATOM   203   C  CD1   . PHE A  1 37  ? 12.320  20.746  0.994   1.00 33.76 ? 1010 PHE A CD1   1 
ATOM   204   C  CD2   . PHE A  1 37  ? 12.959  18.521  0.356   1.00 40.00 ? 1010 PHE A CD2   1 
ATOM   205   C  CE1   . PHE A  1 37  ? 11.204  20.672  0.160   1.00 40.71 ? 1010 PHE A CE1   1 
ATOM   206   C  CE2   . PHE A  1 37  ? 11.849  18.434  -0.485  1.00 41.79 ? 1010 PHE A CE2   1 
ATOM   207   C  CZ    . PHE A  1 37  ? 10.964  19.512  -0.580  1.00 44.61 ? 1010 PHE A CZ    1 
ATOM   208   N  N     . GLY A  1 38  ? 16.624  20.311  3.533   1.00 36.26 ? 1011 GLY A N     1 
ATOM   209   C  CA    . GLY A  1 38  ? 17.686  20.436  4.532   1.00 31.48 ? 1011 GLY A CA    1 
ATOM   210   C  C     . GLY A  1 38  ? 17.491  21.620  5.468   1.00 29.71 ? 1011 GLY A C     1 
ATOM   211   O  O     . GLY A  1 38  ? 16.370  22.075  5.678   1.00 23.22 ? 1011 GLY A O     1 
ATOM   212   N  N     . PHE A  1 39  ? 18.594  22.128  6.017   1.00 30.50 ? 1012 PHE A N     1 
ATOM   213   C  CA    . PHE A  1 39  ? 18.531  23.137  7.086   1.00 30.40 ? 1012 PHE A CA    1 
ATOM   214   C  C     . PHE A  1 39  ? 18.823  24.559  6.626   1.00 23.95 ? 1012 PHE A C     1 
ATOM   215   O  O     . PHE A  1 39  ? 18.795  25.484  7.427   1.00 25.88 ? 1012 PHE A O     1 
ATOM   216   C  CB    . PHE A  1 39  ? 19.444  22.735  8.253   1.00 30.11 ? 1012 PHE A CB    1 
ATOM   217   C  CG    . PHE A  1 39  ? 19.001  21.483  8.959   1.00 35.07 ? 1012 PHE A CG    1 
ATOM   218   C  CD1   . PHE A  1 39  ? 18.199  21.556  10.088  1.00 38.51 ? 1012 PHE A CD1   1 
ATOM   219   C  CD2   . PHE A  1 39  ? 19.373  20.229  8.481   1.00 41.78 ? 1012 PHE A CD2   1 
ATOM   220   C  CE1   . PHE A  1 39  ? 17.779  20.404  10.737  1.00 42.49 ? 1012 PHE A CE1   1 
ATOM   221   C  CE2   . PHE A  1 39  ? 18.957  19.069  9.127   1.00 43.60 ? 1012 PHE A CE2   1 
ATOM   222   C  CZ    . PHE A  1 39  ? 18.161  19.158  10.256  1.00 43.17 ? 1012 PHE A CZ    1 
ATOM   223   N  N     . VAL A  1 40  ? 19.079  24.723  5.332   1.00 24.75 ? 1013 VAL A N     1 
ATOM   224   C  CA    . VAL A  1 40  ? 19.403  26.019  4.743   1.00 23.74 ? 1013 VAL A CA    1 
ATOM   225   C  C     . VAL A  1 40  ? 18.257  26.438  3.811   1.00 20.86 ? 1013 VAL A C     1 
ATOM   226   O  O     . VAL A  1 40  ? 17.896  25.706  2.906   1.00 19.19 ? 1013 VAL A O     1 
ATOM   227   C  CB    . VAL A  1 40  ? 20.785  25.986  3.999   1.00 23.37 ? 1013 VAL A CB    1 
ATOM   228   C  CG1   . VAL A  1 40  ? 21.242  27.394  3.613   1.00 13.82 ? 1013 VAL A CG1   1 
ATOM   229   C  CG2   . VAL A  1 40  ? 21.854  25.308  4.861   1.00 22.31 ? 1013 VAL A CG2   1 
ATOM   230   N  N     . TRP A  1 41  ? 17.668  27.606  4.053   1.00 21.42 ? 1014 TRP A N     1 
ATOM   231   C  CA    . TRP A  1 41  ? 16.488  28.028  3.292   1.00 19.94 ? 1014 TRP A CA    1 
ATOM   232   C  C     . TRP A  1 41  ? 16.564  29.487  2.863   1.00 17.48 ? 1014 TRP A C     1 
ATOM   233   O  O     . TRP A  1 41  ? 17.239  30.289  3.489   1.00 13.84 ? 1014 TRP A O     1 
ATOM   234   C  CB    . TRP A  1 41  ? 15.210  27.825  4.133   1.00 19.18 ? 1014 TRP A CB    1 
ATOM   235   C  CG    . TRP A  1 41  ? 14.862  26.384  4.402   1.00 22.86 ? 1014 TRP A CG    1 
ATOM   236   C  CD1   . TRP A  1 41  ? 15.562  25.501  5.162   1.00 21.71 ? 1014 TRP A CD1   1 
ATOM   237   C  CD2   . TRP A  1 41  ? 13.707  25.678  3.932   1.00 22.66 ? 1014 TRP A CD2   1 
ATOM   238   N  NE1   . TRP A  1 41  ? 14.936  24.282  5.182   1.00 27.53 ? 1014 TRP A NE1   1 
ATOM   239   C  CE2   . TRP A  1 41  ? 13.787  24.364  4.439   1.00 30.61 ? 1014 TRP A CE2   1 
ATOM   240   C  CE3   . TRP A  1 41  ? 12.608  26.031  3.139   1.00 26.85 ? 1014 TRP A CE3   1 
ATOM   241   C  CZ2   . TRP A  1 41  ? 12.825  23.392  4.157   1.00 23.55 ? 1014 TRP A CZ2   1 
ATOM   242   C  CZ3   . TRP A  1 41  ? 11.645  25.066  2.867   1.00 28.31 ? 1014 TRP A CZ3   1 
ATOM   243   C  CH2   . TRP A  1 41  ? 11.761  23.764  3.377   1.00 23.17 ? 1014 TRP A CH2   1 
ATOM   244   N  N     . THR A  1 42  ? 15.857  29.824  1.795   1.00 22.13 ? 1015 THR A N     1 
ATOM   245   C  CA    . THR A  1 42  ? 15.497  31.215  1.540   1.00 22.35 ? 1015 THR A CA    1 
ATOM   246   C  C     . THR A  1 42  ? 14.375  31.643  2.502   1.00 26.92 ? 1015 THR A C     1 
ATOM   247   O  O     . THR A  1 42  ? 13.385  30.905  2.722   1.00 21.39 ? 1015 THR A O     1 
ATOM   248   C  CB    . THR A  1 42  ? 15.036  31.413  0.094   1.00 20.49 ? 1015 THR A CB    1 
ATOM   249   O  OG1   . THR A  1 42  ? 16.132  31.145  -0.786  1.00 28.42 ? 1015 THR A OG1   1 
ATOM   250   C  CG2   . THR A  1 42  ? 14.535  32.843  -0.137  1.00 16.47 ? 1015 THR A CG2   1 
ATOM   251   N  N     . ALA A  1 43  ? 14.552  32.825  3.088   1.00 24.52 ? 1016 ALA A N     1 
ATOM   252   C  CA    . ALA A  1 43  ? 13.536  33.435  3.930   1.00 24.64 ? 1016 ALA A CA    1 
ATOM   253   C  C     . ALA A  1 43  ? 13.256  34.860  3.445   1.00 24.63 ? 1016 ALA A C     1 
ATOM   254   O  O     . ALA A  1 43  ? 14.006  35.413  2.641   1.00 21.79 ? 1016 ALA A O     1 
ATOM   255   C  CB    . ALA A  1 43  ? 13.963  33.422  5.389   1.00 18.27 ? 1016 ALA A CB    1 
ATOM   256   N  N     . VAL A  1 44  ? 12.148  35.430  3.904   1.00 27.77 ? 1017 VAL A N     1 
ATOM   257   C  CA    . VAL A  1 44  ? 11.813  36.807  3.585   1.00 27.97 ? 1017 VAL A CA    1 
ATOM   258   C  C     . VAL A  1 44  ? 11.787  37.614  4.875   1.00 23.72 ? 1017 VAL A C     1 
ATOM   259   O  O     . VAL A  1 44  ? 11.139  37.221  5.839   1.00 18.96 ? 1017 VAL A O     1 
ATOM   260   C  CB    . VAL A  1 44  ? 10.463  36.922  2.835   1.00 29.52 ? 1017 VAL A CB    1 
ATOM   261   C  CG1   . VAL A  1 44  ? 10.216  38.366  2.386   1.00 28.32 ? 1017 VAL A CG1   1 
ATOM   262   C  CG2   . VAL A  1 44  ? 10.451  36.007  1.617   1.00 33.78 ? 1017 VAL A CG2   1 
ATOM   263   N  N     . ASP A  1 45  ? 12.533  38.717  4.899   1.00 25.83 ? 1018 ASP A N     1 
ATOM   264   C  CA    . ASP A  1 45  ? 12.427  39.688  5.988   1.00 26.76 ? 1018 ASP A CA    1 
ATOM   265   C  C     . ASP A  1 45  ? 11.077  40.378  5.827   1.00 26.52 ? 1018 ASP A C     1 
ATOM   266   O  O     . ASP A  1 45  ? 10.830  41.030  4.811   1.00 29.85 ? 1018 ASP A O     1 
ATOM   267   C  CB    . ASP A  1 45  ? 13.586  40.694  5.942   1.00 21.41 ? 1018 ASP A CB    1 
ATOM   268   C  CG    . ASP A  1 45  ? 13.420  41.833  6.928   1.00 22.00 ? 1018 ASP A CG    1 
ATOM   269   O  OD1   . ASP A  1 45  ? 14.320  42.043  7.759   1.00 32.67 ? 1018 ASP A OD1   1 
ATOM   270   O  OD2   . ASP A  1 45  ? 12.391  42.528  6.881   1.00 27.65 ? 1018 ASP A OD2   1 
ATOM   271   N  N     . LYS A  1 46  ? 10.206  40.217  6.819   1.00 24.48 ? 1019 LYS A N     1 
ATOM   272   C  CA    . LYS A  1 46  ? 8.810   40.676  6.708   1.00 32.28 ? 1019 LYS A CA    1 
ATOM   273   C  C     . LYS A  1 46  ? 8.653   42.158  6.385   1.00 29.44 ? 1019 LYS A C     1 
ATOM   274   O  O     . LYS A  1 46  ? 7.916   42.522  5.459   1.00 29.36 ? 1019 LYS A O     1 
ATOM   275   C  CB    . LYS A  1 46  ? 8.014   40.325  7.969   1.00 33.12 ? 1019 LYS A CB    1 
ATOM   276   C  CG    . LYS A  1 46  ? 7.168   39.090  7.824   1.00 39.05 ? 1019 LYS A CG    1 
ATOM   277   C  CD    . LYS A  1 46  ? 6.582   38.643  9.147   1.00 39.77 ? 1019 LYS A CD    1 
ATOM   278   C  CE    . LYS A  1 46  ? 7.218   37.350  9.588   1.00 45.07 ? 1019 LYS A CE    1 
ATOM   279   N  NZ    . LYS A  1 46  ? 6.239   36.498  10.315  1.00 40.36 ? 1019 LYS A NZ    1 
ATOM   280   N  N     . GLU A  1 47  ? 9.347   42.999  7.150   1.00 32.58 ? 1020 GLU A N     1 
ATOM   281   C  CA    . GLU A  1 47  ? 9.270   44.453  6.991   1.00 30.55 ? 1020 GLU A CA    1 
ATOM   282   C  C     . GLU A  1 47  ? 9.879   44.938  5.681   1.00 33.24 ? 1020 GLU A C     1 
ATOM   283   O  O     . GLU A  1 47  ? 9.258   45.718  4.957   1.00 35.04 ? 1020 GLU A O     1 
ATOM   284   C  CB    . GLU A  1 47  ? 9.960   45.153  8.152   1.00 27.83 ? 1020 GLU A CB    1 
ATOM   285   C  CG    . GLU A  1 47  ? 9.223   45.080  9.477   1.00 29.11 ? 1020 GLU A CG    1 
ATOM   286   C  CD    . GLU A  1 47  ? 9.969   45.801  10.580  1.00 30.26 ? 1020 GLU A CD    1 
ATOM   287   O  OE1   . GLU A  1 47  ? 11.096  46.282  10.327  1.00 31.59 ? 1020 GLU A OE1   1 
ATOM   288   O  OE2   . GLU A  1 47  ? 9.429   45.888  11.701  1.00 41.07 ? 1020 GLU A OE2   1 
ATOM   289   N  N     . LYS A  1 48  ? 11.093  44.473  5.381   1.00 33.65 ? 1021 LYS A N     1 
ATOM   290   C  CA    . LYS A  1 48  ? 11.833  44.943  4.209   1.00 32.63 ? 1021 LYS A CA    1 
ATOM   291   C  C     . LYS A  1 48  ? 11.408  44.248  2.913   1.00 31.97 ? 1021 LYS A C     1 
ATOM   292   O  O     . LYS A  1 48  ? 11.738  44.708  1.817   1.00 35.14 ? 1021 LYS A O     1 
ATOM   293   C  CB    . LYS A  1 48  ? 13.349  44.801  4.433   1.00 33.96 ? 1021 LYS A CB    1 
ATOM   294   C  CG    . LYS A  1 48  ? 13.863  45.479  5.700   1.00 40.70 ? 1021 LYS A CG    1 
ATOM   295   C  CD    . LYS A  1 48  ? 15.376  45.587  5.726   1.00 34.09 ? 1021 LYS A CD    1 
ATOM   296   C  CE    . LYS A  1 48  ? 15.849  46.291  6.995   1.00 48.20 ? 1021 LYS A CE    1 
ATOM   297   N  NZ    . LYS A  1 48  ? 17.258  46.793  6.899   1.00 52.17 ? 1021 LYS A NZ    1 
ATOM   298   N  N     . ASN A  1 49  ? 10.672  43.145  3.042   1.00 34.91 ? 1022 ASN A N     1 
ATOM   299   C  CA    . ASN A  1 49  ? 10.340  42.270  1.908   1.00 34.06 ? 1022 ASN A CA    1 
ATOM   300   C  C     . ASN A  1 49  ? 11.579  41.843  1.112   1.00 34.04 ? 1022 ASN A C     1 
ATOM   301   O  O     . ASN A  1 49  ? 11.522  41.652  -0.111  1.00 35.67 ? 1022 ASN A O     1 
ATOM   302   C  CB    . ASN A  1 49  ? 9.282   42.915  0.998   1.00 35.86 ? 1022 ASN A CB    1 
ATOM   303   N  N     . LYS A  1 50  ? 12.705  41.711  1.813   1.00 34.42 ? 1023 LYS A N     1 
ATOM   304   C  CA    . LYS A  1 50  ? 13.948  41.278  1.182   1.00 35.50 ? 1023 LYS A CA    1 
ATOM   305   C  C     . LYS A  1 50  ? 14.227  39.812  1.481   1.00 26.84 ? 1023 LYS A C     1 
ATOM   306   O  O     . LYS A  1 50  ? 13.986  39.342  2.596   1.00 25.65 ? 1023 LYS A O     1 
ATOM   307   C  CB    . LYS A  1 50  ? 15.138  42.171  1.585   1.00 37.25 ? 1023 LYS A CB    1 
ATOM   308   C  CG    . LYS A  1 50  ? 15.624  42.027  3.031   1.00 44.03 ? 1023 LYS A CG    1 
ATOM   309   C  CD    . LYS A  1 50  ? 16.891  42.851  3.271   1.00 41.65 ? 1023 LYS A CD    1 
ATOM   310   C  CE    . LYS A  1 50  ? 17.759  42.260  4.375   1.00 37.38 ? 1023 LYS A CE    1 
ATOM   311   N  NZ    . LYS A  1 50  ? 17.074  42.264  5.688   1.00 46.93 ? 1023 LYS A NZ    1 
ATOM   312   N  N     . GLU A  1 51  ? 14.714  39.108  0.462   1.00 27.13 ? 1024 GLU A N     1 
ATOM   313   C  CA    . GLU A  1 51  ? 15.172  37.724  0.581   1.00 26.77 ? 1024 GLU A CA    1 
ATOM   314   C  C     . GLU A  1 51  ? 16.470  37.619  1.364   1.00 24.83 ? 1024 GLU A C     1 
ATOM   315   O  O     . GLU A  1 51  ? 17.443  38.342  1.108   1.00 23.72 ? 1024 GLU A O     1 
ATOM   316   C  CB    . GLU A  1 51  ? 15.363  37.088  -0.798  1.00 25.78 ? 1024 GLU A CB    1 
ATOM   317   C  CG    . GLU A  1 51  ? 14.081  36.537  -1.422  1.00 28.37 ? 1024 GLU A CG    1 
ATOM   318   C  CD    . GLU A  1 51  ? 14.363  35.598  -2.582  1.00 40.30 ? 1024 GLU A CD    1 
ATOM   319   O  OE1   . GLU A  1 51  ? 15.423  35.756  -3.229  1.00 43.32 ? 1024 GLU A OE1   1 
ATOM   320   O  OE2   . GLU A  1 51  ? 13.530  34.700  -2.845  1.00 41.96 ? 1024 GLU A OE2   1 
ATOM   321   N  N     . VAL A  1 52  ? 16.458  36.722  2.341   1.00 26.12 ? 1025 VAL A N     1 
ATOM   322   C  CA    . VAL A  1 52  ? 17.634  36.410  3.144   1.00 18.81 ? 1025 VAL A CA    1 
ATOM   323   C  C     . VAL A  1 52  ? 17.813  34.898  3.127   1.00 21.15 ? 1025 VAL A C     1 
ATOM   324   O  O     . VAL A  1 52  ? 17.006  34.175  2.531   1.00 20.48 ? 1025 VAL A O     1 
ATOM   325   C  CB    . VAL A  1 52  ? 17.515  36.939  4.606   1.00 21.03 ? 1025 VAL A CB    1 
ATOM   326   C  CG1   . VAL A  1 52  ? 17.299  38.454  4.628   1.00 15.33 ? 1025 VAL A CG1   1 
ATOM   327   C  CG2   . VAL A  1 52  ? 16.394  36.205  5.381   1.00 20.25 ? 1025 VAL A CG2   1 
ATOM   328   N  N     . VAL A  1 53  ? 18.886  34.432  3.762   1.00 21.95 ? 1026 VAL A N     1 
ATOM   329   C  CA    . VAL A  1 53  ? 19.153  33.015  3.901   1.00 18.26 ? 1026 VAL A CA    1 
ATOM   330   C  C     . VAL A  1 53  ? 19.186  32.763  5.388   1.00 19.43 ? 1026 VAL A C     1 
ATOM   331   O  O     . VAL A  1 53  ? 19.856  33.480  6.127   1.00 18.82 ? 1026 VAL A O     1 
ATOM   332   C  CB    . VAL A  1 53  ? 20.502  32.595  3.227   1.00 12.28 ? 1026 VAL A CB    1 
ATOM   333   C  CG1   . VAL A  1 53  ? 20.879  31.148  3.561   1.00 10.14 ? 1026 VAL A CG1   1 
ATOM   334   C  CG2   . VAL A  1 53  ? 20.412  32.764  1.744   1.00 12.87 ? 1026 VAL A CG2   1 
ATOM   335   N  N     . VAL A  1 54  ? 18.416  31.767  5.811   1.00 19.98 ? 1027 VAL A N     1 
ATOM   336   C  CA    . VAL A  1 54  ? 18.481  31.227  7.161   1.00 19.79 ? 1027 VAL A CA    1 
ATOM   337   C  C     . VAL A  1 54  ? 19.096  29.810  7.150   1.00 18.07 ? 1027 VAL A C     1 
ATOM   338   O  O     . VAL A  1 54  ? 18.822  28.994  6.273   1.00 17.15 ? 1027 VAL A O     1 
ATOM   339   C  CB    . VAL A  1 54  ? 17.078  31.254  7.862   1.00 24.04 ? 1027 VAL A CB    1 
ATOM   340   C  CG1   . VAL A  1 54  ? 16.025  30.447  7.060   1.00 23.99 ? 1027 VAL A CG1   1 
ATOM   341   C  CG2   . VAL A  1 54  ? 17.168  30.783  9.333   1.00 14.97 ? 1027 VAL A CG2   1 
ATOM   342   N  N     . LYS A  1 55  ? 19.951  29.557  8.126   1.00 17.26 ? 1028 LYS A N     1 
ATOM   343   C  CA    . LYS A  1 55  ? 20.531  28.256  8.358   1.00 21.05 ? 1028 LYS A CA    1 
ATOM   344   C  C     . LYS A  1 55  ? 20.083  27.841  9.760   1.00 22.29 ? 1028 LYS A C     1 
ATOM   345   O  O     . LYS A  1 55  ? 20.475  28.461  10.754  1.00 21.67 ? 1028 LYS A O     1 
ATOM   346   C  CB    . LYS A  1 55  ? 22.060  28.348  8.247   1.00 21.96 ? 1028 LYS A CB    1 
ATOM   347   C  CG    . LYS A  1 55  ? 22.824  27.050  8.440   1.00 26.72 ? 1028 LYS A CG    1 
ATOM   348   C  CD    . LYS A  1 55  ? 24.208  27.192  7.835   1.00 17.58 ? 1028 LYS A CD    1 
ATOM   349   C  CE    . LYS A  1 55  ? 25.055  25.944  8.021   1.00 21.48 ? 1028 LYS A CE    1 
ATOM   350   N  NZ    . LYS A  1 55  ? 26.446  26.178  7.513   1.00 24.74 ? 1028 LYS A NZ    1 
ATOM   351   N  N     . PHE A  1 56  ? 19.228  26.821  9.821   1.00 20.55 ? 1029 PHE A N     1 
ATOM   352   C  CA    . PHE A  1 56  ? 18.779  26.252  11.090  1.00 25.42 ? 1029 PHE A CA    1 
ATOM   353   C  C     . PHE A  1 56  ? 19.844  25.324  11.649  1.00 25.68 ? 1029 PHE A C     1 
ATOM   354   O  O     . PHE A  1 56  ? 20.348  24.438  10.957  1.00 28.44 ? 1029 PHE A O     1 
ATOM   355   C  CB    . PHE A  1 56  ? 17.413  25.548  10.952  1.00 24.12 ? 1029 PHE A CB    1 
ATOM   356   C  CG    . PHE A  1 56  ? 16.312  26.461  10.483  1.00 20.67 ? 1029 PHE A CG    1 
ATOM   357   C  CD1   . PHE A  1 56  ? 15.600  27.236  11.389  1.00 15.82 ? 1029 PHE A CD1   1 
ATOM   358   C  CD2   . PHE A  1 56  ? 15.998  26.557  9.129   1.00 24.37 ? 1029 PHE A CD2   1 
ATOM   359   C  CE1   . PHE A  1 56  ? 14.576  28.100  10.954  1.00 17.78 ? 1029 PHE A CE1   1 
ATOM   360   C  CE2   . PHE A  1 56  ? 14.984  27.408  8.685   1.00 23.64 ? 1029 PHE A CE2   1 
ATOM   361   C  CZ    . PHE A  1 56  ? 14.275  28.184  9.599   1.00 21.72 ? 1029 PHE A CZ    1 
ATOM   362   N  N     . ILE A  1 57  ? 20.211  25.572  12.899  1.00 25.43 ? 1030 ILE A N     1 
ATOM   363   C  CA    . ILE A  1 57  ? 21.249  24.816  13.567  1.00 24.88 ? 1030 ILE A CA    1 
ATOM   364   C  C     . ILE A  1 57  ? 20.626  24.151  14.795  1.00 27.05 ? 1030 ILE A C     1 
ATOM   365   O  O     . ILE A  1 57  ? 20.317  24.815  15.786  1.00 26.11 ? 1030 ILE A O     1 
ATOM   366   C  CB    . ILE A  1 57  ? 22.484  25.714  13.908  1.00 26.12 ? 1030 ILE A CB    1 
ATOM   367   C  CG1   . ILE A  1 57  ? 23.114  26.269  12.619  1.00 27.29 ? 1030 ILE A CG1   1 
ATOM   368   C  CG2   . ILE A  1 57  ? 23.531  24.934  14.688  1.00 17.82 ? 1030 ILE A CG2   1 
ATOM   369   C  CD1   . ILE A  1 57  ? 23.924  27.569  12.790  1.00 24.32 ? 1030 ILE A CD1   1 
ATOM   370   N  N     . LYS A  1 58  ? 20.411  22.839  14.692  1.00 29.45 ? 1031 LYS A N     1 
ATOM   371   C  CA    . LYS A  1 58  ? 19.822  22.054  15.769  1.00 32.09 ? 1031 LYS A CA    1 
ATOM   372   C  C     . LYS A  1 58  ? 20.805  21.918  16.923  1.00 33.50 ? 1031 LYS A C     1 
ATOM   373   O  O     . LYS A  1 58  ? 21.960  21.555  16.716  1.00 34.67 ? 1031 LYS A O     1 
ATOM   374   C  CB    . LYS A  1 58  ? 19.398  20.671  15.267  1.00 28.98 ? 1031 LYS A CB    1 
ATOM   375   N  N     . LYS A  1 59  ? 20.327  22.209  18.131  1.00 35.95 ? 1032 LYS A N     1 
ATOM   376   C  CA    . LYS A  1 59  ? 21.159  22.215  19.342  1.00 37.26 ? 1032 LYS A CA    1 
ATOM   377   C  C     . LYS A  1 59  ? 21.730  20.868  19.765  1.00 37.09 ? 1032 LYS A C     1 
ATOM   378   O  O     . LYS A  1 59  ? 22.917  20.774  20.097  1.00 30.62 ? 1032 LYS A O     1 
ATOM   379   C  CB    . LYS A  1 59  ? 20.377  22.801  20.512  1.00 35.47 ? 1032 LYS A CB    1 
ATOM   380   C  CG    . LYS A  1 59  ? 20.859  24.148  20.955  1.00 38.72 ? 1032 LYS A CG    1 
ATOM   381   C  CD    . LYS A  1 59  ? 20.169  25.256  20.237  1.00 24.73 ? 1032 LYS A CD    1 
ATOM   382   C  CE    . LYS A  1 59  ? 20.071  26.442  21.144  1.00 31.23 ? 1032 LYS A CE    1 
ATOM   383   N  NZ    . LYS A  1 59  ? 19.308  26.122  22.379  1.00 39.27 ? 1032 LYS A NZ    1 
ATOM   384   N  N     . GLU A  1 60  ? 20.878  19.842  19.780  1.00 40.38 ? 1033 GLU A N     1 
ATOM   385   C  CA    . GLU A  1 60  ? 21.280  18.502  20.219  1.00 44.31 ? 1033 GLU A CA    1 
ATOM   386   C  C     . GLU A  1 60  ? 22.385  17.918  19.344  1.00 45.46 ? 1033 GLU A C     1 
ATOM   387   O  O     . GLU A  1 60  ? 23.286  17.246  19.844  1.00 48.13 ? 1033 GLU A O     1 
ATOM   388   C  CB    . GLU A  1 60  ? 20.079  17.555  20.250  1.00 46.97 ? 1033 GLU A CB    1 
ATOM   389   N  N     . LYS A  1 61  ? 22.317  18.196  18.044  1.00 46.32 ? 1034 LYS A N     1 
ATOM   390   C  CA    . LYS A  1 61  ? 23.282  17.668  17.079  1.00 47.15 ? 1034 LYS A CA    1 
ATOM   391   C  C     . LYS A  1 61  ? 24.673  18.314  17.165  1.00 48.57 ? 1034 LYS A C     1 
ATOM   392   O  O     . LYS A  1 61  ? 25.636  17.777  16.616  1.00 47.50 ? 1034 LYS A O     1 
ATOM   393   C  CB    . LYS A  1 61  ? 22.722  17.764  15.658  1.00 46.07 ? 1034 LYS A CB    1 
ATOM   394   N  N     . VAL A  1 62  ? 24.773  19.454  17.855  1.00 51.04 ? 1035 VAL A N     1 
ATOM   395   C  CA    . VAL A  1 62  ? 26.051  20.157  18.042  1.00 50.61 ? 1035 VAL A CA    1 
ATOM   396   C  C     . VAL A  1 62  ? 26.935  19.399  19.041  1.00 50.96 ? 1035 VAL A C     1 
ATOM   397   O  O     . VAL A  1 62  ? 26.483  19.026  20.123  1.00 49.24 ? 1035 VAL A O     1 
ATOM   398   C  CB    . VAL A  1 62  ? 25.857  21.642  18.512  1.00 49.12 ? 1035 VAL A CB    1 
ATOM   399   C  CG1   . VAL A  1 62  ? 27.204  22.341  18.714  1.00 49.73 ? 1035 VAL A CG1   1 
ATOM   400   C  CG2   . VAL A  1 62  ? 25.021  22.427  17.522  1.00 46.98 ? 1035 VAL A CG2   1 
ATOM   401   N  N     . LEU A  1 63  ? 28.190  19.174  18.659  1.00 52.71 ? 1036 LEU A N     1 
ATOM   402   C  CA    . LEU A  1 63  ? 29.163  18.500  19.519  1.00 55.75 ? 1036 LEU A CA    1 
ATOM   403   C  C     . LEU A  1 63  ? 29.618  19.412  20.659  1.00 57.10 ? 1036 LEU A C     1 
ATOM   404   O  O     . LEU A  1 63  ? 29.545  20.638  20.546  1.00 59.58 ? 1036 LEU A O     1 
ATOM   405   C  CB    . LEU A  1 63  ? 30.376  18.028  18.703  1.00 53.37 ? 1036 LEU A CB    1 
ATOM   406   C  CG    . LEU A  1 63  ? 30.220  16.779  17.830  1.00 53.68 ? 1036 LEU A CG    1 
ATOM   407   C  CD1   . LEU A  1 63  ? 29.780  17.128  16.412  1.00 50.81 ? 1036 LEU A CD1   1 
ATOM   408   C  CD2   . LEU A  1 63  ? 31.528  15.997  17.800  1.00 52.97 ? 1036 LEU A CD2   1 
ATOM   409   N  N     . GLU A  1 64  ? 30.091  18.806  21.747  1.00 56.49 ? 1037 GLU A N     1 
ATOM   410   C  CA    . GLU A  1 64  ? 30.596  19.552  22.904  1.00 58.89 ? 1037 GLU A CA    1 
ATOM   411   C  C     . GLU A  1 64  ? 31.876  20.327  22.589  1.00 57.05 ? 1037 GLU A C     1 
ATOM   412   O  O     . GLU A  1 64  ? 32.212  21.283  23.285  1.00 59.45 ? 1037 GLU A O     1 
ATOM   413   C  CB    . GLU A  1 64  ? 30.829  18.615  24.096  1.00 61.25 ? 1037 GLU A CB    1 
ATOM   414   N  N     . ASP A  1 65  ? 32.576  19.912  21.537  1.00 55.07 ? 1038 ASP A N     1 
ATOM   415   C  CA    . ASP A  1 65  ? 33.802  20.571  21.098  1.00 55.05 ? 1038 ASP A CA    1 
ATOM   416   C  C     . ASP A  1 65  ? 33.523  21.791  20.215  1.00 53.01 ? 1038 ASP A C     1 
ATOM   417   O  O     . ASP A  1 65  ? 34.456  22.495  19.803  1.00 51.45 ? 1038 ASP A O     1 
ATOM   418   C  CB    . ASP A  1 65  ? 34.699  19.575  20.350  1.00 57.31 ? 1038 ASP A CB    1 
ATOM   419   N  N     . CYS A  1 66  ? 32.245  22.033  19.926  1.00 47.91 ? 1039 CYS A N     1 
ATOM   420   C  CA    . CYS A  1 66  ? 31.839  23.123  19.039  1.00 46.24 ? 1039 CYS A CA    1 
ATOM   421   C  C     . CYS A  1 66  ? 31.117  24.255  19.765  1.00 44.44 ? 1039 CYS A C     1 
ATOM   422   O  O     . CYS A  1 66  ? 30.845  25.297  19.173  1.00 46.03 ? 1039 CYS A O     1 
ATOM   423   C  CB    . CYS A  1 66  ? 30.981  22.592  17.888  1.00 45.12 ? 1039 CYS A CB    1 
ATOM   424   S  SG    . CYS A  1 66  ? 31.916  21.642  16.683  1.00 49.36 ? 1039 CYS A SG    1 
ATOM   425   N  N     . TRP A  1 67  ? 30.818  24.055  21.045  1.00 42.25 ? 1040 TRP A N     1 
ATOM   426   C  CA    . TRP A  1 67  ? 30.198  25.099  21.849  1.00 45.05 ? 1040 TRP A CA    1 
ATOM   427   C  C     . TRP A  1 67  ? 31.199  26.203  22.230  1.00 45.70 ? 1040 TRP A C     1 
ATOM   428   O  O     . TRP A  1 67  ? 32.372  25.930  22.492  1.00 44.80 ? 1040 TRP A O     1 
ATOM   429   C  CB    . TRP A  1 67  ? 29.540  24.499  23.091  1.00 46.47 ? 1040 TRP A CB    1 
ATOM   430   C  CG    . TRP A  1 67  ? 28.283  23.713  22.797  1.00 47.69 ? 1040 TRP A CG    1 
ATOM   431   C  CD1   . TRP A  1 67  ? 28.140  22.353  22.821  1.00 42.64 ? 1040 TRP A CD1   1 
ATOM   432   C  CD2   . TRP A  1 67  ? 26.995  24.245  22.439  1.00 47.97 ? 1040 TRP A CD2   1 
ATOM   433   N  NE1   . TRP A  1 67  ? 26.846  22.005  22.507  1.00 38.99 ? 1040 TRP A NE1   1 
ATOM   434   C  CE2   . TRP A  1 67  ? 26.122  23.144  22.267  1.00 44.17 ? 1040 TRP A CE2   1 
ATOM   435   C  CE3   . TRP A  1 67  ? 26.493  25.543  22.254  1.00 42.24 ? 1040 TRP A CE3   1 
ATOM   436   C  CZ2   . TRP A  1 67  ? 24.773  23.301  21.914  1.00 45.51 ? 1040 TRP A CZ2   1 
ATOM   437   C  CZ3   . TRP A  1 67  ? 25.149  25.699  21.902  1.00 43.57 ? 1040 TRP A CZ3   1 
ATOM   438   C  CH2   . TRP A  1 67  ? 24.308  24.582  21.732  1.00 44.10 ? 1040 TRP A CH2   1 
ATOM   439   N  N     . ILE A  1 68  ? 30.721  27.447  22.233  1.00 44.87 ? 1041 ILE A N     1 
ATOM   440   C  CA    . ILE A  1 68  ? 31.534  28.617  22.580  1.00 41.36 ? 1041 ILE A CA    1 
ATOM   441   C  C     . ILE A  1 68  ? 30.771  29.576  23.507  1.00 38.24 ? 1041 ILE A C     1 
ATOM   442   O  O     . ILE A  1 68  ? 29.599  29.879  23.274  1.00 33.82 ? 1041 ILE A O     1 
ATOM   443   C  CB    . ILE A  1 68  ? 32.044  29.386  21.303  1.00 39.98 ? 1041 ILE A CB    1 
ATOM   444   C  CG1   . ILE A  1 68  ? 33.018  28.531  20.474  1.00 44.55 ? 1041 ILE A CG1   1 
ATOM   445   C  CG2   . ILE A  1 68  ? 32.715  30.714  21.671  1.00 33.46 ? 1041 ILE A CG2   1 
ATOM   446   C  CD1   . ILE A  1 68  ? 34.360  28.210  21.148  1.00 47.05 ? 1041 ILE A CD1   1 
ATOM   447   N  N     . GLU A  1 69  ? 31.444  30.026  24.566  1.00 36.77 ? 1042 GLU A N     1 
ATOM   448   C  CA    . GLU A  1 69  ? 30.969  31.144  25.373  1.00 38.11 ? 1042 GLU A CA    1 
ATOM   449   C  C     . GLU A  1 69  ? 31.521  32.451  24.798  1.00 35.33 ? 1042 GLU A C     1 
ATOM   450   O  O     . GLU A  1 69  ? 32.611  32.897  25.166  1.00 33.36 ? 1042 GLU A O     1 
ATOM   451   C  CB    . GLU A  1 69  ? 31.401  30.991  26.836  1.00 40.65 ? 1042 GLU A CB    1 
ATOM   452   C  CG    . GLU A  1 69  ? 30.814  29.795  27.553  1.00 44.23 ? 1042 GLU A CG    1 
ATOM   453   C  CD    . GLU A  1 69  ? 29.539  30.116  28.295  1.00 47.27 ? 1042 GLU A CD    1 
ATOM   454   O  OE1   . GLU A  1 69  ? 29.157  29.317  29.177  1.00 51.11 ? 1042 GLU A OE1   1 
ATOM   455   O  OE2   . GLU A  1 69  ? 28.915  31.160  28.004  1.00 54.28 ? 1042 GLU A OE2   1 
ATOM   456   N  N     . ASP A  1 70  ? 30.762  33.046  23.884  1.00 32.50 ? 1043 ASP A N     1 
ATOM   457   C  CA    . ASP A  1 70  ? 31.100  34.326  23.282  1.00 29.97 ? 1043 ASP A CA    1 
ATOM   458   C  C     . ASP A  1 70  ? 30.532  35.443  24.162  1.00 33.96 ? 1043 ASP A C     1 
ATOM   459   O  O     . ASP A  1 70  ? 29.333  35.438  24.478  1.00 35.47 ? 1043 ASP A O     1 
ATOM   460   C  CB    . ASP A  1 70  ? 30.521  34.407  21.866  1.00 28.79 ? 1043 ASP A CB    1 
ATOM   461   C  CG    . ASP A  1 70  ? 30.973  35.646  21.108  1.00 31.19 ? 1043 ASP A CG    1 
ATOM   462   O  OD1   . ASP A  1 70  ? 32.179  35.761  20.815  1.00 37.22 ? 1043 ASP A OD1   1 
ATOM   463   O  OD2   . ASP A  1 70  ? 30.113  36.495  20.775  1.00 40.53 ? 1043 ASP A OD2   1 
ATOM   464   N  N     . PRO A  1 71  ? 31.388  36.405  24.566  1.00 32.32 ? 1044 PRO A N     1 
ATOM   465   C  CA    . PRO A  1 71  ? 30.957  37.473  25.465  1.00 31.34 ? 1044 PRO A CA    1 
ATOM   466   C  C     . PRO A  1 71  ? 29.740  38.261  24.947  1.00 35.22 ? 1044 PRO A C     1 
ATOM   467   O  O     . PRO A  1 71  ? 28.833  38.579  25.727  1.00 37.54 ? 1044 PRO A O     1 
ATOM   468   C  CB    . PRO A  1 71  ? 32.201  38.368  25.563  1.00 25.67 ? 1044 PRO A CB    1 
ATOM   469   C  CG    . PRO A  1 71  ? 33.329  37.513  25.200  1.00 17.07 ? 1044 PRO A CG    1 
ATOM   470   C  CD    . PRO A  1 71  ? 32.814  36.534  24.209  1.00 29.14 ? 1044 PRO A CD    1 
ATOM   471   N  N     . LYS A  1 72  ? 29.718  38.548  23.646  1.00 36.99 ? 1045 LYS A N     1 
ATOM   472   C  CA    . LYS A  1 72  ? 28.643  39.324  23.023  1.00 37.86 ? 1045 LYS A CA    1 
ATOM   473   C  C     . LYS A  1 72  ? 27.349  38.532  22.842  1.00 36.46 ? 1045 LYS A C     1 
ATOM   474   O  O     . LYS A  1 72  ? 26.261  39.059  23.080  1.00 41.21 ? 1045 LYS A O     1 
ATOM   475   C  CB    . LYS A  1 72  ? 29.099  39.888  21.668  1.00 38.77 ? 1045 LYS A CB    1 
ATOM   476   C  CG    . LYS A  1 72  ? 30.072  41.046  21.778  1.00 42.20 ? 1045 LYS A CG    1 
ATOM   477   C  CD    . LYS A  1 72  ? 30.510  41.574  20.414  1.00 43.97 ? 1045 LYS A CD    1 
ATOM   478   C  CE    . LYS A  1 72  ? 31.432  42.786  20.580  1.00 44.81 ? 1045 LYS A CE    1 
ATOM   479   N  NZ    . LYS A  1 72  ? 32.294  43.043  19.396  1.00 34.33 ? 1045 LYS A NZ    1 
ATOM   480   N  N     . LEU A  1 73  ? 27.471  37.270  22.434  1.00 35.02 ? 1046 LEU A N     1 
ATOM   481   C  CA    . LEU A  1 73  ? 26.315  36.497  21.973  1.00 32.92 ? 1046 LEU A CA    1 
ATOM   482   C  C     . LEU A  1 73  ? 25.781  35.478  22.973  1.00 33.72 ? 1046 LEU A C     1 
ATOM   483   O  O     . LEU A  1 73  ? 24.603  35.134  22.922  1.00 38.95 ? 1046 LEU A O     1 
ATOM   484   C  CB    . LEU A  1 73  ? 26.593  35.829  20.612  1.00 32.48 ? 1046 LEU A CB    1 
ATOM   485   C  CG    . LEU A  1 73  ? 26.861  36.718  19.382  1.00 32.32 ? 1046 LEU A CG    1 
ATOM   486   C  CD1   . LEU A  1 73  ? 26.892  35.886  18.111  1.00 27.79 ? 1046 LEU A CD1   1 
ATOM   487   C  CD2   . LEU A  1 73  ? 25.839  37.850  19.242  1.00 29.03 ? 1046 LEU A CD2   1 
ATOM   488   N  N     . GLY A  1 74  ? 26.637  35.012  23.880  1.00 33.48 ? 1047 GLY A N     1 
ATOM   489   C  CA    . GLY A  1 74  ? 26.250  34.014  24.875  1.00 29.63 ? 1047 GLY A CA    1 
ATOM   490   C  C     . GLY A  1 74  ? 26.726  32.629  24.491  1.00 33.03 ? 1047 GLY A C     1 
ATOM   491   O  O     . GLY A  1 74  ? 27.782  32.480  23.869  1.00 35.27 ? 1047 GLY A O     1 
ATOM   492   N  N     . LYS A  1 75  ? 25.952  31.616  24.870  1.00 33.80 ? 1048 LYS A N     1 
ATOM   493   C  CA    . LYS A  1 75  ? 26.219  30.230  24.470  1.00 36.65 ? 1048 LYS A CA    1 
ATOM   494   C  C     . LYS A  1 75  ? 25.867  29.995  23.000  1.00 31.25 ? 1048 LYS A C     1 
ATOM   495   O  O     . LYS A  1 75  ? 24.697  29.843  22.655  1.00 29.55 ? 1048 LYS A O     1 
ATOM   496   C  CB    . LYS A  1 75  ? 25.419  29.249  25.340  1.00 39.19 ? 1048 LYS A CB    1 
ATOM   497   C  CG    . LYS A  1 75  ? 25.930  29.046  26.761  1.00 43.72 ? 1048 LYS A CG    1 
ATOM   498   C  CD    . LYS A  1 75  ? 27.183  28.158  26.839  1.00 56.44 ? 1048 LYS A CD    1 
ATOM   499   C  CE    . LYS A  1 75  ? 27.090  26.875  26.023  1.00 57.36 ? 1048 LYS A CE    1 
ATOM   500   N  NZ    . LYS A  1 75  ? 27.852  26.999  24.748  1.00 56.47 ? 1048 LYS A NZ    1 
ATOM   501   N  N     . VAL A  1 76  ? 26.882  29.978  22.140  1.00 31.59 ? 1049 VAL A N     1 
ATOM   502   C  CA    . VAL A  1 76  ? 26.689  29.700  20.707  1.00 27.68 ? 1049 VAL A CA    1 
ATOM   503   C  C     . VAL A  1 76  ? 27.649  28.613  20.211  1.00 24.41 ? 1049 VAL A C     1 
ATOM   504   O  O     . VAL A  1 76  ? 28.396  28.046  21.003  1.00 26.08 ? 1049 VAL A O     1 
ATOM   505   C  CB    . VAL A  1 76  ? 26.771  30.985  19.824  1.00 26.17 ? 1049 VAL A CB    1 
ATOM   506   C  CG1   . VAL A  1 76  ? 25.689  31.987  20.223  1.00 19.11 ? 1049 VAL A CG1   1 
ATOM   507   C  CG2   . VAL A  1 76  ? 28.185  31.613  19.833  1.00 12.32 ? 1049 VAL A CG2   1 
ATOM   508   N  N     . THR A  1 77  ? 27.600  28.313  18.916  1.00 22.02 ? 1050 THR A N     1 
ATOM   509   C  CA    . THR A  1 77  ? 28.549  27.391  18.280  1.00 22.45 ? 1050 THR A CA    1 
ATOM   510   C  C     . THR A  1 77  ? 29.743  28.139  17.675  1.00 23.36 ? 1050 THR A C     1 
ATOM   511   O  O     . THR A  1 77  ? 29.664  29.343  17.434  1.00 21.98 ? 1050 THR A O     1 
ATOM   512   C  CB    . THR A  1 77  ? 27.881  26.581  17.148  1.00 26.18 ? 1050 THR A CB    1 
ATOM   513   O  OG1   . THR A  1 77  ? 27.612  27.445  16.036  1.00 25.12 ? 1050 THR A OG1   1 
ATOM   514   C  CG2   . THR A  1 77  ? 26.571  25.935  17.626  1.00 21.79 ? 1050 THR A CG2   1 
ATOM   515   N  N     . LEU A  1 78  ? 30.831  27.413  17.407  1.00 23.08 ? 1051 LEU A N     1 
ATOM   516   C  CA    . LEU A  1 78  ? 32.034  27.975  16.782  1.00 24.28 ? 1051 LEU A CA    1 
ATOM   517   C  C     . LEU A  1 78  ? 31.792  28.605  15.405  1.00 26.85 ? 1051 LEU A C     1 
ATOM   518   O  O     . LEU A  1 78  ? 32.440  29.593  15.052  1.00 27.33 ? 1051 LEU A O     1 
ATOM   519   C  CB    . LEU A  1 78  ? 33.138  26.918  16.699  1.00 24.76 ? 1051 LEU A CB    1 
ATOM   520   C  CG    . LEU A  1 78  ? 34.568  27.351  16.393  1.00 25.53 ? 1051 LEU A CG    1 
ATOM   521   C  CD1   . LEU A  1 78  ? 35.059  28.425  17.369  1.00 30.93 ? 1051 LEU A CD1   1 
ATOM   522   C  CD2   . LEU A  1 78  ? 35.505  26.149  16.380  1.00 20.66 ? 1051 LEU A CD2   1 
ATOM   523   N  N     . GLU A  1 79  ? 30.872  28.027  14.636  1.00 27.25 ? 1052 GLU A N     1 
ATOM   524   C  CA    . GLU A  1 79  ? 30.451  28.581  13.346  1.00 27.64 ? 1052 GLU A CA    1 
ATOM   525   C  C     . GLU A  1 79  ? 29.805  29.964  13.507  1.00 23.01 ? 1052 GLU A C     1 
ATOM   526   O  O     . GLU A  1 79  ? 30.114  30.891  12.772  1.00 23.63 ? 1052 GLU A O     1 
ATOM   527   C  CB    . GLU A  1 79  ? 29.472  27.616  12.655  1.00 25.25 ? 1052 GLU A CB    1 
ATOM   528   C  CG    . GLU A  1 79  ? 28.727  28.199  11.450  1.00 23.34 ? 1052 GLU A CG    1 
ATOM   529   C  CD    . GLU A  1 79  ? 27.868  27.169  10.694  1.00 30.36 ? 1052 GLU A CD    1 
ATOM   530   O  OE1   . GLU A  1 79  ? 27.463  26.135  11.270  1.00 26.82 ? 1052 GLU A OE1   1 
ATOM   531   O  OE2   . GLU A  1 79  ? 27.583  27.409  9.507   1.00 26.27 ? 1052 GLU A OE2   1 
ATOM   532   N  N     . ILE A  1 80  ? 28.896  30.076  14.467  1.00 21.23 ? 1053 ILE A N     1 
ATOM   533   C  CA    . ILE A  1 80  ? 28.173  31.308  14.721  1.00 22.98 ? 1053 ILE A CA    1 
ATOM   534   C  C     . ILE A  1 80  ? 29.114  32.386  15.276  1.00 25.27 ? 1053 ILE A C     1 
ATOM   535   O  O     . ILE A  1 80  ? 29.097  33.518  14.807  1.00 26.56 ? 1053 ILE A O     1 
ATOM   536   C  CB    . ILE A  1 80  ? 26.962  31.064  15.653  1.00 22.43 ? 1053 ILE A CB    1 
ATOM   537   C  CG1   . ILE A  1 80  ? 25.890  30.243  14.920  1.00 22.25 ? 1053 ILE A CG1   1 
ATOM   538   C  CG2   . ILE A  1 80  ? 26.388  32.388  16.170  1.00 15.43 ? 1053 ILE A CG2   1 
ATOM   539   C  CD1   . ILE A  1 80  ? 24.743  29.767  15.817  1.00 15.78 ? 1053 ILE A CD1   1 
ATOM   540   N  N     . ALA A  1 81  ? 29.943  31.996  16.243  1.00 23.14 ? 1054 ALA A N     1 
ATOM   541   C  CA    . ALA A  1 81  ? 30.959  32.847  16.850  1.00 25.55 ? 1054 ALA A CA    1 
ATOM   542   C  C     . ALA A  1 81  ? 31.939  33.441  15.837  1.00 22.06 ? 1054 ALA A C     1 
ATOM   543   O  O     . ALA A  1 81  ? 32.139  34.650  15.826  1.00 25.05 ? 1054 ALA A O     1 
ATOM   544   C  CB    . ALA A  1 81  ? 31.718  32.070  17.967  1.00 26.39 ? 1054 ALA A CB    1 
ATOM   545   N  N     . ILE A  1 82  ? 32.531  32.593  14.995  1.00 26.87 ? 1055 ILE A N     1 
ATOM   546   C  CA    . ILE A  1 82  ? 33.524  33.014  13.986  1.00 29.14 ? 1055 ILE A CA    1 
ATOM   547   C  C     . ILE A  1 82  ? 32.943  33.953  12.923  1.00 31.36 ? 1055 ILE A C     1 
ATOM   548   O  O     . ILE A  1 82  ? 33.555  34.979  12.599  1.00 29.22 ? 1055 ILE A O     1 
ATOM   549   C  CB    . ILE A  1 82  ? 34.252  31.795  13.336  1.00 31.64 ? 1055 ILE A CB    1 
ATOM   550   C  CG1   . ILE A  1 82  ? 35.308  31.246  14.300  1.00 22.60 ? 1055 ILE A CG1   1 
ATOM   551   C  CG2   . ILE A  1 82  ? 34.903  32.159  11.969  1.00 25.46 ? 1055 ILE A CG2   1 
ATOM   552   C  CD1   . ILE A  1 82  ? 35.807  29.836  13.956  1.00 27.80 ? 1055 ILE A CD1   1 
ATOM   553   N  N     . LEU A  1 83  ? 31.760  33.597  12.413  1.00 31.55 ? 1056 LEU A N     1 
ATOM   554   C  CA    . LEU A  1 83  ? 31.052  34.356  11.382  1.00 29.75 ? 1056 LEU A CA    1 
ATOM   555   C  C     . LEU A  1 83  ? 30.616  35.715  11.921  1.00 30.92 ? 1056 LEU A C     1 
ATOM   556   O  O     . LEU A  1 83  ? 30.556  36.705  11.177  1.00 27.11 ? 1056 LEU A O     1 
ATOM   557   C  CB    . LEU A  1 83  ? 29.804  33.586  10.926  1.00 27.19 ? 1056 LEU A CB    1 
ATOM   558   C  CG    . LEU A  1 83  ? 29.515  33.304  9.444   1.00 33.39 ? 1056 LEU A CG    1 
ATOM   559   C  CD1   . LEU A  1 83  ? 28.084  32.793  9.294   1.00 33.37 ? 1056 LEU A CD1   1 
ATOM   560   C  CD2   . LEU A  1 83  ? 29.761  34.497  8.524   1.00 34.55 ? 1056 LEU A CD2   1 
ATOM   561   N  N     . SER A  1 84  ? 30.278  35.730  13.211  1.00 28.81 ? 1057 SER A N     1 
ATOM   562   C  CA    . SER A  1 84  ? 29.922  36.941  13.941  1.00 31.68 ? 1057 SER A CA    1 
ATOM   563   C  C     . SER A  1 84  ? 31.147  37.806  14.236  1.00 25.22 ? 1057 SER A C     1 
ATOM   564   O  O     . SER A  1 84  ? 31.017  38.954  14.636  1.00 23.53 ? 1057 SER A O     1 
ATOM   565   C  CB    . SER A  1 84  ? 29.235  36.575  15.263  1.00 31.53 ? 1057 SER A CB    1 
ATOM   566   O  OG    . SER A  1 84  ? 27.971  35.976  15.024  1.00 43.32 ? 1057 SER A OG    1 
ATOM   567   N  N     . ARG A  1 85  ? 32.332  37.240  14.052  1.00 26.27 ? 1058 ARG A N     1 
ATOM   568   C  CA    . ARG A  1 85  ? 33.576  37.919  14.430  1.00 28.64 ? 1058 ARG A CA    1 
ATOM   569   C  C     . ARG A  1 85  ? 34.348  38.474  13.232  1.00 30.34 ? 1058 ARG A C     1 
ATOM   570   O  O     . ARG A  1 85  ? 35.295  39.247  13.400  1.00 35.76 ? 1058 ARG A O     1 
ATOM   571   C  CB    . ARG A  1 85  ? 34.444  36.981  15.285  1.00 25.58 ? 1058 ARG A CB    1 
ATOM   572   C  CG    . ARG A  1 85  ? 34.418  37.350  16.757  1.00 20.08 ? 1058 ARG A CG    1 
ATOM   573   C  CD    . ARG A  1 85  ? 34.047  36.219  17.699  1.00 31.31 ? 1058 ARG A CD    1 
ATOM   574   N  NE    . ARG A  1 85  ? 35.036  35.148  17.783  1.00 31.14 ? 1058 ARG A NE    1 
ATOM   575   C  CZ    . ARG A  1 85  ? 35.197  34.351  18.842  1.00 31.44 ? 1058 ARG A CZ    1 
ATOM   576   N  NH1   . ARG A  1 85  ? 34.458  34.507  19.937  1.00 25.12 ? 1058 ARG A NH1   1 
ATOM   577   N  NH2   . ARG A  1 85  ? 36.112  33.397  18.813  1.00 28.76 ? 1058 ARG A NH2   1 
ATOM   578   N  N     . VAL A  1 86  ? 33.927  38.084  12.029  1.00 28.21 ? 1059 VAL A N     1 
ATOM   579   C  CA    . VAL A  1 86  ? 34.616  38.457  10.798  1.00 27.97 ? 1059 VAL A CA    1 
ATOM   580   C  C     . VAL A  1 86  ? 33.781  39.399  9.931   1.00 29.02 ? 1059 VAL A C     1 
ATOM   581   O  O     . VAL A  1 86  ? 32.556  39.312  9.901   1.00 33.18 ? 1059 VAL A O     1 
ATOM   582   C  CB    . VAL A  1 86  ? 35.081  37.217  9.972   1.00 28.62 ? 1059 VAL A CB    1 
ATOM   583   C  CG1   . VAL A  1 86  ? 36.047  36.360  10.784  1.00 27.37 ? 1059 VAL A CG1   1 
ATOM   584   C  CG2   . VAL A  1 86  ? 33.909  36.391  9.485   1.00 25.05 ? 1059 VAL A CG2   1 
ATOM   585   N  N     . GLU A  1 87  ? 34.465  40.299  9.233   1.00 27.83 ? 1060 GLU A N     1 
ATOM   586   C  CA    . GLU A  1 87  ? 33.824  41.298  8.399   1.00 23.31 ? 1060 GLU A CA    1 
ATOM   587   C  C     . GLU A  1 87  ? 34.710  41.540  7.196   1.00 20.96 ? 1060 GLU A C     1 
ATOM   588   O  O     . GLU A  1 87  ? 35.828  42.042  7.324   1.00 25.70 ? 1060 GLU A O     1 
ATOM   589   C  CB    . GLU A  1 87  ? 33.614  42.599  9.186   1.00 26.16 ? 1060 GLU A CB    1 
ATOM   590   N  N     . HIS A  1 88  ? 34.212  41.167  6.023   1.00 19.87 ? 1061 HIS A N     1 
ATOM   591   C  CA    . HIS A  1 88  ? 34.990  41.272  4.799   1.00 16.04 ? 1061 HIS A CA    1 
ATOM   592   C  C     . HIS A  1 88  ? 34.080  41.334  3.597   1.00 17.97 ? 1061 HIS A C     1 
ATOM   593   O  O     . HIS A  1 88  ? 32.965  40.820  3.639   1.00 21.15 ? 1061 HIS A O     1 
ATOM   594   C  CB    . HIS A  1 88  ? 35.958  40.094  4.668   1.00 17.26 ? 1061 HIS A CB    1 
ATOM   595   C  CG    . HIS A  1 88  ? 36.993  40.284  3.608   1.00 12.49 ? 1061 HIS A CG    1 
ATOM   596   N  ND1   . HIS A  1 88  ? 36.826  39.833  2.320   1.00 19.65 ? 1061 HIS A ND1   1 
ATOM   597   C  CD2   . HIS A  1 88  ? 38.211  40.875  3.645   1.00 8.83  ? 1061 HIS A CD2   1 
ATOM   598   C  CE1   . HIS A  1 88  ? 37.888  40.145  1.602   1.00 6.67  ? 1061 HIS A CE1   1 
ATOM   599   N  NE2   . HIS A  1 88  ? 38.744  40.777  2.384   1.00 9.46  ? 1061 HIS A NE2   1 
ATOM   600   N  N     . ALA A  1 89  ? 34.577  41.949  2.523   1.00 19.31 ? 1062 ALA A N     1 
ATOM   601   C  CA    . ALA A  1 89  ? 33.813  42.185  1.304   1.00 21.30 ? 1062 ALA A CA    1 
ATOM   602   C  C     . ALA A  1 89  ? 33.411  40.886  0.608   1.00 26.28 ? 1062 ALA A C     1 
ATOM   603   O  O     . ALA A  1 89  ? 32.444  40.855  -0.158  1.00 23.53 ? 1062 ALA A O     1 
ATOM   604   C  CB    . ALA A  1 89  ? 34.613  43.072  0.350   1.00 21.18 ? 1062 ALA A CB    1 
ATOM   605   N  N     . ASN A  1 90  ? 34.159  39.820  0.889   1.00 27.12 ? 1063 ASN A N     1 
ATOM   606   C  CA    . ASN A  1 90  ? 33.985  38.545  0.217   1.00 23.31 ? 1063 ASN A CA    1 
ATOM   607   C  C     . ASN A  1 90  ? 33.635  37.396  1.175   1.00 18.93 ? 1063 ASN A C     1 
ATOM   608   O  O     . ASN A  1 90  ? 33.837  36.224  0.866   1.00 18.06 ? 1063 ASN A O     1 
ATOM   609   C  CB    . ASN A  1 90  ? 35.228  38.227  -0.630  1.00 20.34 ? 1063 ASN A CB    1 
ATOM   610   C  CG    . ASN A  1 90  ? 35.491  39.273  -1.713  1.00 9.06  ? 1063 ASN A CG    1 
ATOM   611   O  OD1   . ASN A  1 90  ? 36.506  39.963  -1.687  1.00 22.12 ? 1063 ASN A OD1   1 
ATOM   612   N  ND2   . ASN A  1 90  ? 34.600  39.359  -2.687  1.00 13.76 ? 1063 ASN A ND2   1 
ATOM   613   N  N     . ILE A  1 91  ? 33.104  37.753  2.335   1.00 20.80 ? 1064 ILE A N     1 
ATOM   614   C  CA    . ILE A  1 91  ? 32.601  36.788  3.308   1.00 18.30 ? 1064 ILE A CA    1 
ATOM   615   C  C     . ILE A  1 91  ? 31.161  37.186  3.600   1.00 22.78 ? 1064 ILE A C     1 
ATOM   616   O  O     . ILE A  1 91  ? 30.853  38.375  3.735   1.00 21.34 ? 1064 ILE A O     1 
ATOM   617   C  CB    . ILE A  1 91  ? 33.460  36.743  4.622   1.00 19.59 ? 1064 ILE A CB    1 
ATOM   618   C  CG1   . ILE A  1 91  ? 34.885  36.251  4.317   1.00 17.62 ? 1064 ILE A CG1   1 
ATOM   619   C  CG2   . ILE A  1 91  ? 32.798  35.843  5.673   1.00 21.82 ? 1064 ILE A CG2   1 
ATOM   620   C  CD1   . ILE A  1 91  ? 35.870  36.311  5.463   1.00 14.59 ? 1064 ILE A CD1   1 
ATOM   621   N  N     . ILE A  1 92  ? 30.281  36.187  3.635   1.00 20.01 ? 1065 ILE A N     1 
ATOM   622   C  CA    . ILE A  1 92  ? 28.861  36.403  3.862   1.00 21.09 ? 1065 ILE A CA    1 
ATOM   623   C  C     . ILE A  1 92  ? 28.596  37.181  5.162   1.00 23.46 ? 1065 ILE A C     1 
ATOM   624   O  O     . ILE A  1 92  ? 29.234  36.943  6.187   1.00 25.22 ? 1065 ILE A O     1 
ATOM   625   C  CB    . ILE A  1 92  ? 28.074  35.051  3.816   1.00 18.39 ? 1065 ILE A CB    1 
ATOM   626   C  CG1   . ILE A  1 92  ? 26.632  35.265  3.348   1.00 17.02 ? 1065 ILE A CG1   1 
ATOM   627   C  CG2   . ILE A  1 92  ? 28.172  34.300  5.159   1.00 14.37 ? 1065 ILE A CG2   1 
ATOM   628   C  CD1   . ILE A  1 92  ? 26.462  35.500  1.825   1.00 14.24 ? 1065 ILE A CD1   1 
ATOM   629   N  N     . LYS A  1 93  ? 27.651  38.116  5.089   1.00 27.79 ? 1066 LYS A N     1 
ATOM   630   C  CA    . LYS A  1 93  ? 27.278  38.976  6.212   1.00 26.25 ? 1066 LYS A CA    1 
ATOM   631   C  C     . LYS A  1 93  ? 26.142  38.361  7.033   1.00 22.69 ? 1066 LYS A C     1 
ATOM   632   O  O     . LYS A  1 93  ? 25.173  37.849  6.478   1.00 22.49 ? 1066 LYS A O     1 
ATOM   633   C  CB    . LYS A  1 93  ? 26.868  40.358  5.671   1.00 28.51 ? 1066 LYS A CB    1 
ATOM   634   C  CG    . LYS A  1 93  ? 26.512  41.380  6.722   1.00 37.49 ? 1066 LYS A CG    1 
ATOM   635   C  CD    . LYS A  1 93  ? 26.146  42.728  6.102   1.00 36.51 ? 1066 LYS A CD    1 
ATOM   636   C  CE    . LYS A  1 93  ? 25.161  43.500  6.994   1.00 42.64 ? 1066 LYS A CE    1 
ATOM   637   N  NZ    . LYS A  1 93  ? 25.363  43.235  8.459   1.00 35.57 ? 1066 LYS A NZ    1 
ATOM   638   N  N     . VAL A  1 94  ? 26.273  38.422  8.355   1.00 25.41 ? 1067 VAL A N     1 
ATOM   639   C  CA    . VAL A  1 94  ? 25.242  37.961  9.284   1.00 26.15 ? 1067 VAL A CA    1 
ATOM   640   C  C     . VAL A  1 94  ? 24.258  39.094  9.583   1.00 31.95 ? 1067 VAL A C     1 
ATOM   641   O  O     . VAL A  1 94  ? 24.655  40.186  9.992   1.00 33.03 ? 1067 VAL A O     1 
ATOM   642   C  CB    . VAL A  1 94  ? 25.860  37.482  10.608  1.00 27.33 ? 1067 VAL A CB    1 
ATOM   643   C  CG1   . VAL A  1 94  ? 24.771  37.196  11.671  1.00 20.97 ? 1067 VAL A CG1   1 
ATOM   644   C  CG2   . VAL A  1 94  ? 26.749  36.269  10.373  1.00 23.29 ? 1067 VAL A CG2   1 
ATOM   645   N  N     . LEU A  1 95  ? 22.972  38.814  9.392   1.00 32.78 ? 1068 LEU A N     1 
ATOM   646   C  CA    . LEU A  1 95  ? 21.926  39.803  9.601   1.00 30.40 ? 1068 LEU A CA    1 
ATOM   647   C  C     . LEU A  1 95  ? 21.300  39.685  10.981  1.00 29.75 ? 1068 LEU A C     1 
ATOM   648   O  O     . LEU A  1 95  ? 20.935  40.683  11.600  1.00 30.26 ? 1068 LEU A O     1 
ATOM   649   C  CB    . LEU A  1 95  ? 20.854  39.669  8.521   1.00 26.08 ? 1068 LEU A CB    1 
ATOM   650   C  CG    . LEU A  1 95  ? 21.295  40.038  7.110   1.00 23.15 ? 1068 LEU A CG    1 
ATOM   651   C  CD1   . LEU A  1 95  ? 20.136  39.787  6.160   1.00 20.03 ? 1068 LEU A CD1   1 
ATOM   652   C  CD2   . LEU A  1 95  ? 21.752  41.509  7.053   1.00 23.89 ? 1068 LEU A CD2   1 
ATOM   653   N  N     . ASP A  1 96  ? 21.183  38.455  11.461  1.00 27.38 ? 1069 ASP A N     1 
ATOM   654   C  CA    . ASP A  1 96  ? 20.555  38.186  12.745  1.00 27.57 ? 1069 ASP A CA    1 
ATOM   655   C  C     . ASP A  1 96  ? 20.979  36.828  13.240  1.00 23.09 ? 1069 ASP A C     1 
ATOM   656   O  O     . ASP A  1 96  ? 21.277  35.942  12.456  1.00 29.18 ? 1069 ASP A O     1 
ATOM   657   C  CB    . ASP A  1 96  ? 19.024  38.212  12.624  1.00 25.32 ? 1069 ASP A CB    1 
ATOM   658   C  CG    . ASP A  1 96  ? 18.437  39.606  12.810  1.00 16.11 ? 1069 ASP A CG    1 
ATOM   659   O  OD1   . ASP A  1 96  ? 18.673  40.218  13.862  1.00 25.28 ? 1069 ASP A OD1   1 
ATOM   660   O  OD2   . ASP A  1 96  ? 17.719  40.077  11.914  1.00 26.76 ? 1069 ASP A OD2   1 
ATOM   661   N  N     . ILE A  1 97  ? 21.016  36.677  14.550  1.00 28.79 ? 1070 ILE A N     1 
ATOM   662   C  CA    . ILE A  1 97  ? 21.120  35.362  15.151  1.00 30.30 ? 1070 ILE A CA    1 
ATOM   663   C  C     . ILE A  1 97  ? 20.114  35.263  16.292  1.00 29.92 ? 1070 ILE A C     1 
ATOM   664   O  O     . ILE A  1 97  ? 20.186  36.012  17.265  1.00 28.98 ? 1070 ILE A O     1 
ATOM   665   C  CB    . ILE A  1 97  ? 22.575  35.002  15.585  1.00 32.42 ? 1070 ILE A CB    1 
ATOM   666   C  CG1   . ILE A  1 97  ? 22.574  33.689  16.388  1.00 26.25 ? 1070 ILE A CG1   1 
ATOM   667   C  CG2   . ILE A  1 97  ? 23.269  36.198  16.284  1.00 35.04 ? 1070 ILE A CG2   1 
ATOM   668   C  CD1   . ILE A  1 97  ? 23.649  33.568  17.420  1.00 35.55 ? 1070 ILE A CD1   1 
ATOM   669   N  N     . PHE A  1 98  ? 19.146  34.363  16.126  1.00 28.83 ? 1071 PHE A N     1 
ATOM   670   C  CA    . PHE A  1 98  ? 18.164  34.071  17.165  1.00 25.51 ? 1071 PHE A CA    1 
ATOM   671   C  C     . PHE A  1 98  ? 18.360  32.651  17.699  1.00 27.31 ? 1071 PHE A C     1 
ATOM   672   O  O     . PHE A  1 98  ? 19.079  31.848  17.117  1.00 23.71 ? 1071 PHE A O     1 
ATOM   673   C  CB    . PHE A  1 98  ? 16.733  34.241  16.647  1.00 25.14 ? 1071 PHE A CB    1 
ATOM   674   C  CG    . PHE A  1 98  ? 16.477  35.544  15.933  1.00 26.87 ? 1071 PHE A CG    1 
ATOM   675   C  CD1   . PHE A  1 98  ? 16.508  36.757  16.619  1.00 27.40 ? 1071 PHE A CD1   1 
ATOM   676   C  CD2   . PHE A  1 98  ? 16.179  35.551  14.573  1.00 27.76 ? 1071 PHE A CD2   1 
ATOM   677   C  CE1   . PHE A  1 98  ? 16.257  37.964  15.958  1.00 23.89 ? 1071 PHE A CE1   1 
ATOM   678   C  CE2   . PHE A  1 98  ? 15.926  36.745  13.907  1.00 27.84 ? 1071 PHE A CE2   1 
ATOM   679   C  CZ    . PHE A  1 98  ? 15.957  37.953  14.606  1.00 31.91 ? 1071 PHE A CZ    1 
ATOM   680   N  N     . GLU A  1 99  ? 17.718  32.367  18.823  1.00 34.41 ? 1072 GLU A N     1 
ATOM   681   C  CA    . GLU A  1 99  ? 17.801  31.082  19.496  1.00 39.64 ? 1072 GLU A CA    1 
ATOM   682   C  C     . GLU A  1 99  ? 16.439  30.787  20.121  1.00 37.27 ? 1072 GLU A C     1 
ATOM   683   O  O     . GLU A  1 99  ? 15.762  31.709  20.578  1.00 34.63 ? 1072 GLU A O     1 
ATOM   684   C  CB    . GLU A  1 99  ? 18.880  31.145  20.575  1.00 39.98 ? 1072 GLU A CB    1 
ATOM   685   C  CG    . GLU A  1 99  ? 19.133  29.838  21.303  1.00 45.84 ? 1072 GLU A CG    1 
ATOM   686   C  CD    . GLU A  1 99  ? 19.979  30.008  22.554  1.00 47.13 ? 1072 GLU A CD    1 
ATOM   687   O  OE1   . GLU A  1 99  ? 20.230  31.166  22.961  1.00 49.14 ? 1072 GLU A OE1   1 
ATOM   688   O  OE2   . GLU A  1 99  ? 20.389  28.974  23.133  1.00 54.99 ? 1072 GLU A OE2   1 
ATOM   689   N  N     . ASN A  1 100 ? 16.037  29.513  20.124  1.00 38.49 ? 1073 ASN A N     1 
ATOM   690   C  CA    . ASN A  1 100 ? 14.778  29.102  20.767  1.00 36.81 ? 1073 ASN A CA    1 
ATOM   691   C  C     . ASN A  1 100 ? 14.834  27.835  21.635  1.00 40.57 ? 1073 ASN A C     1 
ATOM   692   O  O     . ASN A  1 100 ? 13.809  27.187  21.866  1.00 43.72 ? 1073 ASN A O     1 
ATOM   693   C  CB    . ASN A  1 100 ? 13.608  29.045  19.761  1.00 31.08 ? 1073 ASN A CB    1 
ATOM   694   C  CG    . ASN A  1 100 ? 13.722  27.901  18.747  1.00 20.77 ? 1073 ASN A CG    1 
ATOM   695   O  OD1   . ASN A  1 100 ? 14.395  26.892  18.966  1.00 26.23 ? 1073 ASN A OD1   1 
ATOM   696   N  ND2   . ASN A  1 100 ? 13.032  28.062  17.626  1.00 25.27 ? 1073 ASN A ND2   1 
ATOM   697   N  N     . GLN A  1 101 ? 16.022  27.489  22.123  1.00 42.26 ? 1074 GLN A N     1 
ATOM   698   C  CA    . GLN A  1 101 ? 16.183  26.342  23.046  1.00 43.50 ? 1074 GLN A CA    1 
ATOM   699   C  C     . GLN A  1 101 ? 16.114  24.969  22.368  1.00 35.81 ? 1074 GLN A C     1 
ATOM   700   O  O     . GLN A  1 101 ? 16.477  23.962  22.969  1.00 38.14 ? 1074 GLN A O     1 
ATOM   701   C  CB    . GLN A  1 101 ? 15.213  26.424  24.237  1.00 45.32 ? 1074 GLN A CB    1 
ATOM   702   N  N     . GLY A  1 102 ? 15.652  24.935  21.121  1.00 36.22 ? 1075 GLY A N     1 
ATOM   703   C  CA    . GLY A  1 102 ? 15.864  23.782  20.245  1.00 32.37 ? 1075 GLY A CA    1 
ATOM   704   C  C     . GLY A  1 102 ? 16.831  24.144  19.121  1.00 30.40 ? 1075 GLY A C     1 
ATOM   705   O  O     . GLY A  1 102 ? 17.706  23.362  18.742  1.00 23.52 ? 1075 GLY A O     1 
ATOM   706   N  N     . PHE A  1 103 ? 16.671  25.350  18.588  1.00 31.07 ? 1076 PHE A N     1 
ATOM   707   C  CA    . PHE A  1 103 ? 17.424  25.772  17.411  1.00 27.44 ? 1076 PHE A CA    1 
ATOM   708   C  C     . PHE A  1 103 ? 18.094  27.139  17.548  1.00 28.70 ? 1076 PHE A C     1 
ATOM   709   O  O     . PHE A  1 103 ? 17.699  27.967  18.371  1.00 25.94 ? 1076 PHE A O     1 
ATOM   710   C  CB    . PHE A  1 103 ? 16.514  25.752  16.182  1.00 26.62 ? 1076 PHE A CB    1 
ATOM   711   C  CG    . PHE A  1 103 ? 16.159  24.364  15.716  1.00 26.29 ? 1076 PHE A CG    1 
ATOM   712   C  CD1   . PHE A  1 103 ? 16.805  23.806  14.635  1.00 16.64 ? 1076 PHE A CD1   1 
ATOM   713   C  CD2   . PHE A  1 103 ? 15.178  23.619  16.367  1.00 29.36 ? 1076 PHE A CD2   1 
ATOM   714   C  CE1   . PHE A  1 103 ? 16.489  22.527  14.202  1.00 31.81 ? 1076 PHE A CE1   1 
ATOM   715   C  CE2   . PHE A  1 103 ? 14.856  22.335  15.941  1.00 35.56 ? 1076 PHE A CE2   1 
ATOM   716   C  CZ    . PHE A  1 103 ? 15.518  21.788  14.864  1.00 24.05 ? 1076 PHE A CZ    1 
ATOM   717   N  N     . PHE A  1 104 ? 19.142  27.332  16.753  1.00 28.92 ? 1077 PHE A N     1 
ATOM   718   C  CA    . PHE A  1 104 ? 19.664  28.644  16.440  1.00 22.60 ? 1077 PHE A CA    1 
ATOM   719   C  C     . PHE A  1 104 ? 19.147  28.910  15.049  1.00 23.81 ? 1077 PHE A C     1 
ATOM   720   O  O     . PHE A  1 104 ? 19.069  27.984  14.233  1.00 16.81 ? 1077 PHE A O     1 
ATOM   721   C  CB    . PHE A  1 104 ? 21.197  28.631  16.384  1.00 26.73 ? 1077 PHE A CB    1 
ATOM   722   C  CG    . PHE A  1 104 ? 21.874  28.702  17.726  1.00 20.32 ? 1077 PHE A CG    1 
ATOM   723   C  CD1   . PHE A  1 104 ? 22.675  27.649  18.170  1.00 31.12 ? 1077 PHE A CD1   1 
ATOM   724   C  CD2   . PHE A  1 104 ? 21.756  29.843  18.527  1.00 22.61 ? 1077 PHE A CD2   1 
ATOM   725   C  CE1   . PHE A  1 104 ? 23.337  27.715  19.407  1.00 19.04 ? 1077 PHE A CE1   1 
ATOM   726   C  CE2   . PHE A  1 104 ? 22.390  29.916  19.765  1.00 25.36 ? 1077 PHE A CE2   1 
ATOM   727   C  CZ    . PHE A  1 104 ? 23.185  28.845  20.207  1.00 26.49 ? 1077 PHE A CZ    1 
ATOM   728   N  N     . GLN A  1 105 ? 18.772  30.162  14.787  1.00 24.68 ? 1078 GLN A N     1 
ATOM   729   C  CA    . GLN A  1 105 ? 18.434  30.620  13.439  1.00 25.84 ? 1078 GLN A CA    1 
ATOM   730   C  C     . GLN A  1 105 ? 19.484  31.632  12.983  1.00 28.88 ? 1078 GLN A C     1 
ATOM   731   O  O     . GLN A  1 105 ? 19.463  32.807  13.397  1.00 30.41 ? 1078 GLN A O     1 
ATOM   732   C  CB    . GLN A  1 105 ? 17.027  31.226  13.381  1.00 21.31 ? 1078 GLN A CB    1 
ATOM   733   C  CG    . GLN A  1 105 ? 15.900  30.241  13.698  1.00 19.11 ? 1078 GLN A CG    1 
ATOM   734   C  CD    . GLN A  1 105 ? 15.701  30.023  15.200  1.00 20.05 ? 1078 GLN A CD    1 
ATOM   735   O  OE1   . GLN A  1 105 ? 15.306  28.950  15.628  1.00 24.79 ? 1078 GLN A OE1   1 
ATOM   736   N  NE2   . GLN A  1 105 ? 15.967  31.049  15.995  1.00 18.46 ? 1078 GLN A NE2   1 
ATOM   737   N  N     . LEU A  1 106 ? 20.413  31.158  12.150  1.00 23.51 ? 1079 LEU A N     1 
ATOM   738   C  CA    . LEU A  1 106 ? 21.517  31.981  11.661  1.00 19.54 ? 1079 LEU A CA    1 
ATOM   739   C  C     . LEU A  1 106 ? 21.082  32.617  10.352  1.00 19.45 ? 1079 LEU A C     1 
ATOM   740   O  O     . LEU A  1 106 ? 20.927  31.924  9.339   1.00 16.71 ? 1079 LEU A O     1 
ATOM   741   C  CB    . LEU A  1 106 ? 22.775  31.116  11.453  1.00 20.96 ? 1079 LEU A CB    1 
ATOM   742   C  CG    . LEU A  1 106 ? 24.215  31.654  11.336  1.00 22.54 ? 1079 LEU A CG    1 
ATOM   743   C  CD1   . LEU A  1 106 ? 24.960  30.825  10.311  1.00 24.21 ? 1079 LEU A CD1   1 
ATOM   744   C  CD2   . LEU A  1 106 ? 24.347  33.144  10.998  1.00 32.40 ? 1079 LEU A CD2   1 
ATOM   745   N  N     . VAL A  1 107 ? 20.872  33.934  10.389  1.00 20.84 ? 1080 VAL A N     1 
ATOM   746   C  CA    . VAL A  1 107 ? 20.338  34.680  9.246   1.00 20.55 ? 1080 VAL A CA    1 
ATOM   747   C  C     . VAL A  1 107 ? 21.414  35.545  8.587   1.00 22.42 ? 1080 VAL A C     1 
ATOM   748   O  O     . VAL A  1 107 ? 22.066  36.367  9.235   1.00 24.27 ? 1080 VAL A O     1 
ATOM   749   C  CB    . VAL A  1 107 ? 19.063  35.510  9.607   1.00 24.21 ? 1080 VAL A CB    1 
ATOM   750   C  CG1   . VAL A  1 107 ? 18.453  36.123  8.358   1.00 15.46 ? 1080 VAL A CG1   1 
ATOM   751   C  CG2   . VAL A  1 107 ? 18.014  34.633  10.297  1.00 19.91 ? 1080 VAL A CG2   1 
ATOM   752   N  N     . MET A  1 108 ? 21.603  35.317  7.293   1.00 21.36 ? 1081 MET A N     1 
ATOM   753   C  CA    . MET A  1 108 ? 22.588  36.022  6.498   1.00 23.06 ? 1081 MET A CA    1 
ATOM   754   C  C     . MET A  1 108 ? 21.922  36.690  5.301   1.00 22.75 ? 1081 MET A C     1 
ATOM   755   O  O     . MET A  1 108 ? 20.855  36.262  4.853   1.00 19.54 ? 1081 MET A O     1 
ATOM   756   C  CB    . MET A  1 108 ? 23.608  35.037  5.940   1.00 21.45 ? 1081 MET A CB    1 
ATOM   757   C  CG    . MET A  1 108 ? 24.383  34.230  6.950   1.00 26.26 ? 1081 MET A CG    1 
ATOM   758   S  SD    . MET A  1 108 ? 24.852  32.682  6.169   1.00 29.89 ? 1081 MET A SD    1 
ATOM   759   C  CE    . MET A  1 108 ? 23.333  31.752  6.424   1.00 23.57 ? 1081 MET A CE    1 
ATOM   760   N  N     . GLU A  1 109 ? 22.574  37.714  4.761   1.00 16.93 ? 1082 GLU A N     1 
ATOM   761   C  CA    . GLU A  1 109 ? 22.199  38.238  3.460   1.00 24.43 ? 1082 GLU A CA    1 
ATOM   762   C  C     . GLU A  1 109 ? 22.118  37.073  2.465   1.00 27.15 ? 1082 GLU A C     1 
ATOM   763   O  O     . GLU A  1 109 ? 22.859  36.094  2.592   1.00 28.10 ? 1082 GLU A O     1 
ATOM   764   C  CB    . GLU A  1 109 ? 23.233  39.260  2.982   1.00 19.72 ? 1082 GLU A CB    1 
ATOM   765   C  CG    . GLU A  1 109 ? 24.530  38.641  2.435   1.00 20.60 ? 1082 GLU A CG    1 
ATOM   766   C  CD    . GLU A  1 109 ? 25.666  39.640  2.304   1.00 25.90 ? 1082 GLU A CD    1 
ATOM   767   O  OE1   . GLU A  1 109 ? 25.395  40.832  2.037   1.00 32.53 ? 1082 GLU A OE1   1 
ATOM   768   O  OE2   . GLU A  1 109 ? 26.836  39.230  2.472   1.00 27.59 ? 1082 GLU A OE2   1 
ATOM   769   N  N     . LYS A  1 110 ? 21.206  37.165  1.500   1.00 25.49 ? 1083 LYS A N     1 
ATOM   770   C  CA    . LYS A  1 110 ? 21.248  36.257  0.358   1.00 22.92 ? 1083 LYS A CA    1 
ATOM   771   C  C     . LYS A  1 110 ? 22.119  36.916  -0.697  1.00 22.65 ? 1083 LYS A C     1 
ATOM   772   O  O     . LYS A  1 110 ? 21.861  38.033  -1.125  1.00 20.03 ? 1083 LYS A O     1 
ATOM   773   C  CB    . LYS A  1 110 ? 19.851  35.947  -0.179  1.00 18.26 ? 1083 LYS A CB    1 
ATOM   774   C  CG    . LYS A  1 110 ? 19.820  34.827  -1.228  1.00 24.64 ? 1083 LYS A CG    1 
ATOM   775   C  CD    . LYS A  1 110 ? 18.405  34.333  -1.443  1.00 21.73 ? 1083 LYS A CD    1 
ATOM   776   C  CE    . LYS A  1 110 ? 18.333  33.311  -2.561  1.00 35.90 ? 1083 LYS A CE    1 
ATOM   777   N  NZ    . LYS A  1 110 ? 16.966  32.713  -2.683  1.00 18.77 ? 1083 LYS A NZ    1 
ATOM   778   N  N     . HIS A  1 111 ? 23.191  36.242  -1.077  1.00 27.43 ? 1084 HIS A N     1 
ATOM   779   C  CA    . HIS A  1 111 ? 24.073  36.796  -2.072  1.00 24.87 ? 1084 HIS A CA    1 
ATOM   780   C  C     . HIS A  1 111 ? 23.792  36.119  -3.402  1.00 24.90 ? 1084 HIS A C     1 
ATOM   781   O  O     . HIS A  1 111 ? 24.115  34.944  -3.593  1.00 28.41 ? 1084 HIS A O     1 
ATOM   782   C  CB    . HIS A  1 111 ? 25.535  36.656  -1.653  1.00 17.08 ? 1084 HIS A CB    1 
ATOM   783   C  CG    . HIS A  1 111 ? 26.494  37.244  -2.640  1.00 27.04 ? 1084 HIS A CG    1 
ATOM   784   N  ND1   . HIS A  1 111 ? 26.758  38.595  -2.700  1.00 26.65 ? 1084 HIS A ND1   1 
ATOM   785   C  CD2   . HIS A  1 111 ? 27.226  36.672  -3.626  1.00 17.15 ? 1084 HIS A CD2   1 
ATOM   786   C  CE1   . HIS A  1 111 ? 27.623  38.827  -3.671  1.00 15.96 ? 1084 HIS A CE1   1 
ATOM   787   N  NE2   . HIS A  1 111 ? 27.926  37.677  -4.244  1.00 14.82 ? 1084 HIS A NE2   1 
ATOM   788   N  N     . GLY A  1 112 ? 23.190  36.873  -4.316  1.00 23.44 ? 1085 GLY A N     1 
ATOM   789   C  CA    . GLY A  1 112 ? 22.659  36.312  -5.546  1.00 29.33 ? 1085 GLY A CA    1 
ATOM   790   C  C     . GLY A  1 112 ? 21.371  35.522  -5.338  1.00 35.60 ? 1085 GLY A C     1 
ATOM   791   O  O     . GLY A  1 112 ? 20.486  35.931  -4.569  1.00 34.56 ? 1085 GLY A O     1 
ATOM   792   N  N     . SER A  1 113 ? 21.273  34.387  -6.032  1.00 39.50 ? 1086 SER A N     1 
ATOM   793   C  CA    . SER A  1 113 ? 20.074  33.547  -6.023  1.00 40.27 ? 1086 SER A CA    1 
ATOM   794   C  C     . SER A  1 113 ? 20.277  32.236  -5.256  1.00 39.16 ? 1086 SER A C     1 
ATOM   795   O  O     . SER A  1 113 ? 19.477  31.308  -5.388  1.00 37.59 ? 1086 SER A O     1 
ATOM   796   C  CB    . SER A  1 113 ? 19.638  33.239  -7.459  1.00 41.54 ? 1086 SER A CB    1 
ATOM   797   O  OG    . SER A  1 113 ? 20.430  32.203  -8.020  1.00 40.35 ? 1086 SER A OG    1 
ATOM   798   N  N     . GLY A  1 114 ? 21.343  32.167  -4.461  1.00 39.98 ? 1087 GLY A N     1 
ATOM   799   C  CA    . GLY A  1 114 ? 21.684  30.948  -3.728  1.00 37.92 ? 1087 GLY A CA    1 
ATOM   800   C  C     . GLY A  1 114 ? 22.515  29.986  -4.552  1.00 38.78 ? 1087 GLY A C     1 
ATOM   801   O  O     . GLY A  1 114 ? 22.589  28.793  -4.243  1.00 42.10 ? 1087 GLY A O     1 
ATOM   802   N  N     . LEU A  1 115 ? 23.137  30.514  -5.604  1.00 36.80 ? 1088 LEU A N     1 
ATOM   803   C  CA    . LEU A  1 115 ? 23.940  29.719  -6.524  1.00 36.79 ? 1088 LEU A CA    1 
ATOM   804   C  C     . LEU A  1 115 ? 25.394  29.613  -6.048  1.00 34.74 ? 1088 LEU A C     1 
ATOM   805   O  O     . LEU A  1 115 ? 26.158  30.589  -6.095  1.00 30.02 ? 1088 LEU A O     1 
ATOM   806   C  CB    . LEU A  1 115 ? 23.868  30.311  -7.940  1.00 37.33 ? 1088 LEU A CB    1 
ATOM   807   C  CG    . LEU A  1 115 ? 24.467  29.528  -9.111  1.00 39.43 ? 1088 LEU A CG    1 
ATOM   808   C  CD1   . LEU A  1 115 ? 23.535  28.399  -9.540  1.00 39.08 ? 1088 LEU A CD1   1 
ATOM   809   C  CD2   . LEU A  1 115 ? 24.745  30.461  -10.281 1.00 39.73 ? 1088 LEU A CD2   1 
ATOM   810   N  N     . ASP A  1 116 ? 25.759  28.425  -5.573  1.00 32.93 ? 1089 ASP A N     1 
ATOM   811   C  CA    . ASP A  1 116 ? 27.147  28.142  -5.239  1.00 35.47 ? 1089 ASP A CA    1 
ATOM   812   C  C     . ASP A  1 116 ? 27.953  27.898  -6.519  1.00 36.36 ? 1089 ASP A C     1 
ATOM   813   O  O     . ASP A  1 116 ? 27.384  27.723  -7.602  1.00 33.75 ? 1089 ASP A O     1 
ATOM   814   C  CB    . ASP A  1 116 ? 27.285  26.995  -4.217  1.00 36.65 ? 1089 ASP A CB    1 
ATOM   815   C  CG    . ASP A  1 116 ? 26.715  25.679  -4.710  1.00 37.60 ? 1089 ASP A CG    1 
ATOM   816   O  OD1   . ASP A  1 116 ? 27.286  25.091  -5.648  1.00 42.90 ? 1089 ASP A OD1   1 
ATOM   817   O  OD2   . ASP A  1 116 ? 25.705  25.212  -4.138  1.00 49.13 ? 1089 ASP A OD2   1 
ATOM   818   N  N     . LEU A  1 117 ? 29.275  27.910  -6.390  1.00 34.30 ? 1090 LEU A N     1 
ATOM   819   C  CA    . LEU A  1 117 ? 30.154  27.819  -7.541  1.00 30.73 ? 1090 LEU A CA    1 
ATOM   820   C  C     . LEU A  1 117 ? 30.101  26.436  -8.203  1.00 28.18 ? 1090 LEU A C     1 
ATOM   821   O  O     . LEU A  1 117 ? 30.350  26.321  -9.396  1.00 30.53 ? 1090 LEU A O     1 
ATOM   822   C  CB    . LEU A  1 117 ? 31.581  28.212  -7.143  1.00 32.26 ? 1090 LEU A CB    1 
ATOM   823   C  CG    . LEU A  1 117 ? 32.418  29.149  -8.015  1.00 32.35 ? 1090 LEU A CG    1 
ATOM   824   C  CD1   . LEU A  1 117 ? 31.650  30.388  -8.483  1.00 22.85 ? 1090 LEU A CD1   1 
ATOM   825   C  CD2   . LEU A  1 117 ? 33.664  29.544  -7.244  1.00 28.77 ? 1090 LEU A CD2   1 
ATOM   826   N  N     . PHE A  1 118 ? 29.767  25.399  -7.430  1.00 27.93 ? 1091 PHE A N     1 
ATOM   827   C  CA    . PHE A  1 118 ? 29.549  24.047  -7.969  1.00 27.80 ? 1091 PHE A CA    1 
ATOM   828   C  C     . PHE A  1 118 ? 28.400  24.039  -8.979  1.00 27.38 ? 1091 PHE A C     1 
ATOM   829   O  O     . PHE A  1 118 ? 28.579  23.605  -10.116 1.00 31.13 ? 1091 PHE A O     1 
ATOM   830   C  CB    . PHE A  1 118 ? 29.276  23.042  -6.834  1.00 29.72 ? 1091 PHE A CB    1 
ATOM   831   C  CG    . PHE A  1 118 ? 29.042  21.612  -7.303  1.00 24.81 ? 1091 PHE A CG    1 
ATOM   832   C  CD1   . PHE A  1 118 ? 27.783  21.205  -7.767  1.00 29.01 ? 1091 PHE A CD1   1 
ATOM   833   C  CD2   . PHE A  1 118 ? 30.068  20.673  -7.243  1.00 22.12 ? 1091 PHE A CD2   1 
ATOM   834   C  CE1   . PHE A  1 118 ? 27.555  19.895  -8.190  1.00 27.23 ? 1091 PHE A CE1   1 
ATOM   835   C  CE2   . PHE A  1 118 ? 29.857  19.355  -7.665  1.00 36.85 ? 1091 PHE A CE2   1 
ATOM   836   C  CZ    . PHE A  1 118 ? 28.593  18.965  -8.140  1.00 36.21 ? 1091 PHE A CZ    1 
ATOM   837   N  N     . ALA A  1 119 ? 27.231  24.522  -8.555  1.00 25.27 ? 1092 ALA A N     1 
ATOM   838   C  CA    . ALA A  1 119 ? 26.053  24.616  -9.417  1.00 29.28 ? 1092 ALA A CA    1 
ATOM   839   C  C     . ALA A  1 119 ? 26.265  25.568  -10.613 1.00 31.47 ? 1092 ALA A C     1 
ATOM   840   O  O     . ALA A  1 119 ? 25.653  25.398  -11.665 1.00 36.88 ? 1092 ALA A O     1 
ATOM   841   C  CB    . ALA A  1 119 ? 24.822  25.018  -8.598  1.00 21.56 ? 1092 ALA A CB    1 
ATOM   842   N  N     . PHE A  1 120 ? 27.143  26.552  -10.437 1.00 30.48 ? 1093 PHE A N     1 
ATOM   843   C  CA    . PHE A  1 120 ? 27.634  27.410  -11.520 1.00 29.98 ? 1093 PHE A CA    1 
ATOM   844   C  C     . PHE A  1 120 ? 28.503  26.600  -12.515 1.00 35.94 ? 1093 PHE A C     1 
ATOM   845   O  O     . PHE A  1 120 ? 28.308  26.678  -13.737 1.00 32.69 ? 1093 PHE A O     1 
ATOM   846   C  CB    . PHE A  1 120 ? 28.413  28.581  -10.896 1.00 27.60 ? 1093 PHE A CB    1 
ATOM   847   C  CG    . PHE A  1 120 ? 29.090  29.505  -11.893 1.00 31.41 ? 1093 PHE A CG    1 
ATOM   848   C  CD1   . PHE A  1 120 ? 28.356  30.455  -12.612 1.00 25.33 ? 1093 PHE A CD1   1 
ATOM   849   C  CD2   . PHE A  1 120 ? 30.473  29.466  -12.063 1.00 27.09 ? 1093 PHE A CD2   1 
ATOM   850   C  CE1   . PHE A  1 120 ? 28.987  31.325  -13.526 1.00 25.35 ? 1093 PHE A CE1   1 
ATOM   851   C  CE2   . PHE A  1 120 ? 31.112  30.335  -12.968 1.00 27.06 ? 1093 PHE A CE2   1 
ATOM   852   C  CZ    . PHE A  1 120 ? 30.361  31.265  -13.693 1.00 29.06 ? 1093 PHE A CZ    1 
ATOM   853   N  N     . ILE A  1 121 ? 29.439  25.810  -11.978 1.00 35.87 ? 1094 ILE A N     1 
ATOM   854   C  CA    . ILE A  1 121 ? 30.371  25.010  -12.785 1.00 34.79 ? 1094 ILE A CA    1 
ATOM   855   C  C     . ILE A  1 121 ? 29.658  23.844  -13.478 1.00 32.27 ? 1094 ILE A C     1 
ATOM   856   O  O     . ILE A  1 121 ? 29.998  23.486  -14.602 1.00 27.83 ? 1094 ILE A O     1 
ATOM   857   C  CB    . ILE A  1 121 ? 31.624  24.575  -11.949 1.00 36.12 ? 1094 ILE A CB    1 
ATOM   858   C  CG1   . ILE A  1 121 ? 32.633  25.728  -11.885 1.00 31.67 ? 1094 ILE A CG1   1 
ATOM   859   C  CG2   . ILE A  1 121 ? 32.295  23.321  -12.522 1.00 31.75 ? 1094 ILE A CG2   1 
ATOM   860   C  CD1   . ILE A  1 121 ? 33.443  25.815  -10.588 1.00 24.96 ? 1094 ILE A CD1   1 
ATOM   861   N  N     . ASP A  1 122 ? 28.644  23.296  -12.814 1.00 36.07 ? 1095 ASP A N     1 
ATOM   862   C  CA    . ASP A  1 122 ? 27.835  22.200  -13.353 1.00 42.86 ? 1095 ASP A CA    1 
ATOM   863   C  C     . ASP A  1 122 ? 26.940  22.620  -14.538 1.00 44.12 ? 1095 ASP A C     1 
ATOM   864   O  O     . ASP A  1 122 ? 26.603  21.797  -15.389 1.00 46.05 ? 1095 ASP A O     1 
ATOM   865   C  CB    . ASP A  1 122 ? 26.972  21.587  -12.243 1.00 41.58 ? 1095 ASP A CB    1 
ATOM   866   C  CG    . ASP A  1 122 ? 26.891  20.078  -12.334 1.00 43.05 ? 1095 ASP A CG    1 
ATOM   867   O  OD1   . ASP A  1 122 ? 27.926  19.446  -12.642 1.00 46.05 ? 1095 ASP A OD1   1 
ATOM   868   O  OD2   . ASP A  1 122 ? 25.800  19.523  -12.085 1.00 43.11 ? 1095 ASP A OD2   1 
ATOM   869   N  N     . ARG A  1 123 ? 26.552  23.893  -14.570 1.00 44.50 ? 1096 ARG A N     1 
ATOM   870   C  CA    . ARG A  1 123 ? 25.764  24.458  -15.665 1.00 41.95 ? 1096 ARG A CA    1 
ATOM   871   C  C     . ARG A  1 123 ? 26.645  24.949  -16.830 1.00 41.92 ? 1096 ARG A C     1 
ATOM   872   O  O     . ARG A  1 123 ? 26.182  25.690  -17.701 1.00 41.57 ? 1096 ARG A O     1 
ATOM   873   C  CB    . ARG A  1 123 ? 24.881  25.597  -15.144 1.00 42.85 ? 1096 ARG A CB    1 
ATOM   874   C  CG    . ARG A  1 123 ? 23.676  25.171  -14.313 1.00 38.20 ? 1096 ARG A CG    1 
ATOM   875   C  CD    . ARG A  1 123 ? 22.471  24.871  -15.188 1.00 44.58 ? 1096 ARG A CD    1 
ATOM   876   N  N     . HIS A  1 124 ? 27.910  24.520  -16.824 1.00 43.73 ? 1097 HIS A N     1 
ATOM   877   C  CA    . HIS A  1 124 ? 28.914  24.784  -17.884 1.00 42.83 ? 1097 HIS A CA    1 
ATOM   878   C  C     . HIS A  1 124 ? 29.111  26.255  -18.313 1.00 40.19 ? 1097 HIS A C     1 
ATOM   879   O  O     . HIS A  1 124 ? 28.751  26.639  -19.434 1.00 34.74 ? 1097 HIS A O     1 
ATOM   880   C  CB    . HIS A  1 124 ? 28.712  23.858  -19.095 1.00 42.46 ? 1097 HIS A CB    1 
ATOM   881   C  CG    . HIS A  1 124 ? 28.825  22.403  -18.760 1.00 50.24 ? 1097 HIS A CG    1 
ATOM   882   N  ND1   . HIS A  1 124 ? 30.038  21.768  -18.595 1.00 52.11 ? 1097 HIS A ND1   1 
ATOM   883   C  CD2   . HIS A  1 124 ? 27.875  21.462  -18.538 1.00 50.78 ? 1097 HIS A CD2   1 
ATOM   884   C  CE1   . HIS A  1 124 ? 29.831  20.498  -18.296 1.00 55.82 ? 1097 HIS A CE1   1 
ATOM   885   N  NE2   . HIS A  1 124 ? 28.527  20.287  -18.254 1.00 49.48 ? 1097 HIS A NE2   1 
ATOM   886   N  N     . PRO A  1 125 ? 29.742  27.062  -17.436 1.00 35.70 ? 1098 PRO A N     1 
ATOM   887   C  CA    . PRO A  1 125 ? 29.941  28.491  -17.690 1.00 32.38 ? 1098 PRO A CA    1 
ATOM   888   C  C     . PRO A  1 125 ? 30.967  28.749  -18.786 1.00 29.73 ? 1098 PRO A C     1 
ATOM   889   O  O     . PRO A  1 125 ? 31.702  27.849  -19.174 1.00 36.68 ? 1098 PRO A O     1 
ATOM   890   C  CB    . PRO A  1 125 ? 30.444  29.030  -16.347 1.00 33.56 ? 1098 PRO A CB    1 
ATOM   891   C  CG    . PRO A  1 125 ? 31.001  27.857  -15.624 1.00 30.50 ? 1098 PRO A CG    1 
ATOM   892   C  CD    . PRO A  1 125 ? 30.336  26.627  -16.155 1.00 32.04 ? 1098 PRO A CD    1 
ATOM   893   N  N     . ARG A  1 126 ? 31.006  29.977  -19.285 1.00 29.02 ? 1099 ARG A N     1 
ATOM   894   C  CA    . ARG A  1 126 ? 31.889  30.323  -20.383 1.00 28.91 ? 1099 ARG A CA    1 
ATOM   895   C  C     . ARG A  1 126 ? 32.878  31.355  -19.903 1.00 24.84 ? 1099 ARG A C     1 
ATOM   896   O  O     . ARG A  1 126 ? 32.668  32.562  -20.072 1.00 27.20 ? 1099 ARG A O     1 
ATOM   897   C  CB    . ARG A  1 126 ? 31.096  30.826  -21.600 1.00 29.39 ? 1099 ARG A CB    1 
ATOM   898   C  CG    . ARG A  1 126 ? 30.364  29.718  -22.339 1.00 31.79 ? 1099 ARG A CG    1 
ATOM   899   C  CD    . ARG A  1 126 ? 29.804  30.199  -23.663 1.00 30.98 ? 1099 ARG A CD    1 
ATOM   900   N  NE    . ARG A  1 126 ? 29.067  29.134  -24.340 1.00 36.16 ? 1099 ARG A NE    1 
ATOM   901   C  CZ    . ARG A  1 126 ? 28.813  29.096  -25.646 1.00 26.26 ? 1099 ARG A CZ    1 
ATOM   902   N  NH1   . ARG A  1 126 ? 29.237  30.065  -26.444 1.00 22.95 ? 1099 ARG A NH1   1 
ATOM   903   N  NH2   . ARG A  1 126 ? 28.128  28.084  -26.151 1.00 23.42 ? 1099 ARG A NH2   1 
ATOM   904   N  N     . LEU A  1 127 ? 33.956  30.861  -19.299 1.00 23.56 ? 1100 LEU A N     1 
ATOM   905   C  CA    . LEU A  1 127 ? 34.960  31.713  -18.680 1.00 27.40 ? 1100 LEU A CA    1 
ATOM   906   C  C     . LEU A  1 127 ? 36.233  31.771  -19.495 1.00 24.22 ? 1100 LEU A C     1 
ATOM   907   O  O     . LEU A  1 127 ? 36.676  30.769  -20.047 1.00 19.08 ? 1100 LEU A O     1 
ATOM   908   C  CB    . LEU A  1 127 ? 35.299  31.226  -17.255 1.00 28.38 ? 1100 LEU A CB    1 
ATOM   909   C  CG    . LEU A  1 127 ? 34.214  31.192  -16.167 1.00 30.91 ? 1100 LEU A CG    1 
ATOM   910   C  CD1   . LEU A  1 127 ? 34.742  30.578  -14.858 1.00 25.36 ? 1100 LEU A CD1   1 
ATOM   911   C  CD2   . LEU A  1 127 ? 33.656  32.586  -15.924 1.00 27.86 ? 1100 LEU A CD2   1 
ATOM   912   N  N     . ASP A  1 128 ? 36.812  32.964  -19.556 1.00 26.47 ? 1101 ASP A N     1 
ATOM   913   C  CA    . ASP A  1 128 ? 38.192  33.141  -19.979 1.00 26.98 ? 1101 ASP A CA    1 
ATOM   914   C  C     . ASP A  1 128 ? 39.062  33.268  -18.724 1.00 26.84 ? 1101 ASP A C     1 
ATOM   915   O  O     . ASP A  1 128 ? 38.555  33.214  -17.595 1.00 32.31 ? 1101 ASP A O     1 
ATOM   916   C  CB    . ASP A  1 128 ? 38.327  34.378  -20.878 1.00 27.83 ? 1101 ASP A CB    1 
ATOM   917   C  CG    . ASP A  1 128 ? 37.824  35.650  -20.213 1.00 31.15 ? 1101 ASP A CG    1 
ATOM   918   O  OD1   . ASP A  1 128 ? 36.954  35.574  -19.324 1.00 40.91 ? 1101 ASP A OD1   1 
ATOM   919   O  OD2   . ASP A  1 128 ? 38.295  36.739  -20.591 1.00 39.75 ? 1101 ASP A OD2   1 
ATOM   920   N  N     . GLU A  1 129 ? 40.364  33.445  -18.914 1.00 23.37 ? 1102 GLU A N     1 
ATOM   921   C  CA    . GLU A  1 129 ? 41.278  33.528  -17.786 1.00 20.17 ? 1102 GLU A CA    1 
ATOM   922   C  C     . GLU A  1 129 ? 41.111  34.795  -16.967 1.00 19.95 ? 1102 GLU A C     1 
ATOM   923   O  O     . GLU A  1 129 ? 41.133  34.712  -15.742 1.00 22.86 ? 1102 GLU A O     1 
ATOM   924   C  CB    . GLU A  1 129 ? 42.741  33.311  -18.213 1.00 21.91 ? 1102 GLU A CB    1 
ATOM   925   C  CG    . GLU A  1 129 ? 43.054  31.864  -18.623 1.00 15.56 ? 1102 GLU A CG    1 
ATOM   926   C  CD    . GLU A  1 129 ? 44.535  31.596  -18.780 1.00 17.96 ? 1102 GLU A CD    1 
ATOM   927   O  OE1   . GLU A  1 129 ? 45.332  32.082  -17.956 1.00 29.28 ? 1102 GLU A OE1   1 
ATOM   928   O  OE2   . GLU A  1 129 ? 44.904  30.886  -19.728 1.00 26.48 ? 1102 GLU A OE2   1 
ATOM   929   N  N     . PRO A  1 130 ? 40.992  35.977  -17.625 1.00 23.46 ? 1103 PRO A N     1 
ATOM   930   C  CA    . PRO A  1 130 ? 40.728  37.198  -16.848 1.00 21.96 ? 1103 PRO A CA    1 
ATOM   931   C  C     . PRO A  1 130 ? 39.519  37.137  -15.894 1.00 18.37 ? 1103 PRO A C     1 
ATOM   932   O  O     . PRO A  1 130 ? 39.646  37.565  -14.753 1.00 24.07 ? 1103 PRO A O     1 
ATOM   933   C  CB    . PRO A  1 130 ? 40.542  38.281  -17.932 1.00 22.44 ? 1103 PRO A CB    1 
ATOM   934   C  CG    . PRO A  1 130 ? 41.340  37.804  -19.079 1.00 22.89 ? 1103 PRO A CG    1 
ATOM   935   C  CD    . PRO A  1 130 ? 41.158  36.288  -19.064 1.00 24.58 ? 1103 PRO A CD    1 
ATOM   936   N  N     . LEU A  1 131 ? 38.378  36.618  -16.345 1.00 20.41 ? 1104 LEU A N     1 
ATOM   937   C  CA    . LEU A  1 131 ? 37.180  36.487  -15.484 1.00 18.62 ? 1104 LEU A CA    1 
ATOM   938   C  C     . LEU A  1 131 ? 37.342  35.436  -14.380 1.00 21.48 ? 1104 LEU A C     1 
ATOM   939   O  O     . LEU A  1 131 ? 37.014  35.705  -13.227 1.00 18.88 ? 1104 LEU A O     1 
ATOM   940   C  CB    . LEU A  1 131 ? 35.905  36.216  -16.307 1.00 18.24 ? 1104 LEU A CB    1 
ATOM   941   C  CG    . LEU A  1 131 ? 34.525  36.259  -15.607 1.00 21.77 ? 1104 LEU A CG    1 
ATOM   942   C  CD1   . LEU A  1 131 ? 34.307  37.559  -14.839 1.00 23.47 ? 1104 LEU A CD1   1 
ATOM   943   C  CD2   . LEU A  1 131 ? 33.380  36.047  -16.583 1.00 17.48 ? 1104 LEU A CD2   1 
ATOM   944   N  N     . ALA A  1 132 ? 37.845  34.246  -14.729 1.00 23.67 ? 1105 ALA A N     1 
ATOM   945   C  CA    . ALA A  1 132 ? 38.239  33.248  -13.721 1.00 22.52 ? 1105 ALA A CA    1 
ATOM   946   C  C     . ALA A  1 132 ? 39.140  33.895  -12.659 1.00 26.13 ? 1105 ALA A C     1 
ATOM   947   O  O     . ALA A  1 132 ? 38.964  33.683  -11.456 1.00 28.58 ? 1105 ALA A O     1 
ATOM   948   C  CB    . ALA A  1 132 ? 38.949  32.082  -14.384 1.00 23.18 ? 1105 ALA A CB    1 
ATOM   949   N  N     . SER A  1 133 ? 40.085  34.705  -13.134 1.00 24.82 ? 1106 SER A N     1 
ATOM   950   C  CA    . SER A  1 133 ? 41.021  35.463  -12.307 1.00 24.76 ? 1106 SER A CA    1 
ATOM   951   C  C     . SER A  1 133 ? 40.320  36.437  -11.358 1.00 25.27 ? 1106 SER A C     1 
ATOM   952   O  O     . SER A  1 133 ? 40.700  36.566  -10.191 1.00 25.34 ? 1106 SER A O     1 
ATOM   953   C  CB    . SER A  1 133 ? 41.994  36.217  -13.220 1.00 24.84 ? 1106 SER A CB    1 
ATOM   954   O  OG    . SER A  1 133 ? 42.995  36.868  -12.491 1.00 30.60 ? 1106 SER A OG    1 
ATOM   955   N  N     . TYR A  1 134 ? 39.302  37.125  -11.868 1.00 25.83 ? 1107 TYR A N     1 
ATOM   956   C  CA    . TYR A  1 134 ? 38.504  38.036  -11.056 1.00 25.09 ? 1107 TYR A CA    1 
ATOM   957   C  C     . TYR A  1 134 ? 37.772  37.286  -9.934  1.00 22.57 ? 1107 TYR A C     1 
ATOM   958   O  O     . TYR A  1 134 ? 37.714  37.745  -8.791  1.00 20.21 ? 1107 TYR A O     1 
ATOM   959   C  CB    . TYR A  1 134 ? 37.514  38.822  -11.933 1.00 23.09 ? 1107 TYR A CB    1 
ATOM   960   C  CG    . TYR A  1 134 ? 36.654  39.789  -11.143 1.00 23.92 ? 1107 TYR A CG    1 
ATOM   961   C  CD1   . TYR A  1 134 ? 37.217  40.909  -10.535 1.00 28.18 ? 1107 TYR A CD1   1 
ATOM   962   C  CD2   . TYR A  1 134 ? 35.282  39.571  -10.986 1.00 20.93 ? 1107 TYR A CD2   1 
ATOM   963   C  CE1   . TYR A  1 134 ? 36.438  41.797  -9.796  1.00 30.55 ? 1107 TYR A CE1   1 
ATOM   964   C  CE2   . TYR A  1 134 ? 34.493  40.454  -10.248 1.00 15.76 ? 1107 TYR A CE2   1 
ATOM   965   C  CZ    . TYR A  1 134 ? 35.078  41.563  -9.658  1.00 26.77 ? 1107 TYR A CZ    1 
ATOM   966   O  OH    . TYR A  1 134 ? 34.308  42.451  -8.934  1.00 30.38 ? 1107 TYR A OH    1 
ATOM   967   N  N     . ILE A  1 135 ? 37.216  36.133  -10.285 1.00 21.56 ? 1108 ILE A N     1 
ATOM   968   C  CA    . ILE A  1 135 ? 36.518  35.280  -9.341  1.00 23.48 ? 1108 ILE A CA    1 
ATOM   969   C  C     . ILE A  1 135 ? 37.483  34.714  -8.270  1.00 23.18 ? 1108 ILE A C     1 
ATOM   970   O  O     . ILE A  1 135 ? 37.212  34.812  -7.079  1.00 24.53 ? 1108 ILE A O     1 
ATOM   971   C  CB    . ILE A  1 135 ? 35.687  34.181  -10.106 1.00 24.57 ? 1108 ILE A CB    1 
ATOM   972   C  CG1   . ILE A  1 135 ? 34.621  34.849  -11.005 1.00 18.32 ? 1108 ILE A CG1   1 
ATOM   973   C  CG2   . ILE A  1 135 ? 35.062  33.167  -9.138  1.00 17.37 ? 1108 ILE A CG2   1 
ATOM   974   C  CD1   . ILE A  1 135 ? 33.832  33.900  -11.916 1.00 19.30 ? 1108 ILE A CD1   1 
ATOM   975   N  N     . PHE A  1 136 ? 38.614  34.158  -8.699  1.00 25.34 ? 1109 PHE A N     1 
ATOM   976   C  CA    . PHE A  1 136 ? 39.586  33.551  -7.784  1.00 21.98 ? 1109 PHE A CA    1 
ATOM   977   C  C     . PHE A  1 136 ? 40.273  34.525  -6.814  1.00 22.10 ? 1109 PHE A C     1 
ATOM   978   O  O     . PHE A  1 136 ? 40.451  34.196  -5.641  1.00 21.15 ? 1109 PHE A O     1 
ATOM   979   C  CB    . PHE A  1 136 ? 40.622  32.720  -8.564  1.00 27.00 ? 1109 PHE A CB    1 
ATOM   980   C  CG    . PHE A  1 136 ? 41.616  31.984  -7.688  1.00 25.24 ? 1109 PHE A CG    1 
ATOM   981   C  CD1   . PHE A  1 136 ? 41.197  30.961  -6.832  1.00 26.73 ? 1109 PHE A CD1   1 
ATOM   982   C  CD2   . PHE A  1 136 ? 42.971  32.305  -7.736  1.00 15.31 ? 1109 PHE A CD2   1 
ATOM   983   C  CE1   . PHE A  1 136 ? 42.116  30.279  -6.023  1.00 23.33 ? 1109 PHE A CE1   1 
ATOM   984   C  CE2   . PHE A  1 136 ? 43.898  31.625  -6.949  1.00 17.28 ? 1109 PHE A CE2   1 
ATOM   985   C  CZ    . PHE A  1 136 ? 43.467  30.606  -6.086  1.00 15.71 ? 1109 PHE A CZ    1 
ATOM   986   N  N     . ARG A  1 137 ? 40.632  35.722  -7.286  1.00 20.25 ? 1110 ARG A N     1 
ATOM   987   C  CA    . ARG A  1 137 ? 41.321  36.709  -6.442  1.00 18.35 ? 1110 ARG A CA    1 
ATOM   988   C  C     . ARG A  1 137 ? 40.463  37.197  -5.268  1.00 17.15 ? 1110 ARG A C     1 
ATOM   989   O  O     . ARG A  1 137 ? 40.984  37.633  -4.233  1.00 16.54 ? 1110 ARG A O     1 
ATOM   990   C  CB    . ARG A  1 137 ? 41.826  37.901  -7.279  1.00 22.54 ? 1110 ARG A CB    1 
ATOM   991   C  CG    . ARG A  1 137 ? 40.794  39.036  -7.497  1.00 23.07 ? 1110 ARG A CG    1 
ATOM   992   C  CD    . ARG A  1 137 ? 41.358  40.151  -8.341  1.00 19.15 ? 1110 ARG A CD    1 
ATOM   993   N  NE    . ARG A  1 137 ? 41.647  39.698  -9.698  1.00 29.97 ? 1110 ARG A NE    1 
ATOM   994   C  CZ    . ARG A  1 137 ? 42.229  40.439  -10.633 1.00 29.78 ? 1110 ARG A CZ    1 
ATOM   995   N  NH1   . ARG A  1 137 ? 42.589  41.682  -10.360 1.00 34.16 ? 1110 ARG A NH1   1 
ATOM   996   N  NH2   . ARG A  1 137 ? 42.460  39.931  -11.841 1.00 33.03 ? 1110 ARG A NH2   1 
ATOM   997   N  N     . GLN A  1 138 ? 39.149  37.146  -5.448  1.00 17.10 ? 1111 GLN A N     1 
ATOM   998   C  CA    . GLN A  1 138 ? 38.196  37.507  -4.404  1.00 11.82 ? 1111 GLN A CA    1 
ATOM   999   C  C     . GLN A  1 138 ? 38.224  36.491  -3.258  1.00 11.99 ? 1111 GLN A C     1 
ATOM   1000  O  O     . GLN A  1 138 ? 38.128  36.852  -2.089  1.00 12.08 ? 1111 GLN A O     1 
ATOM   1001  C  CB    . GLN A  1 138 ? 36.798  37.554  -4.999  1.00 12.13 ? 1111 GLN A CB    1 
ATOM   1002  C  CG    . GLN A  1 138 ? 36.507  38.768  -5.847  1.00 24.26 ? 1111 GLN A CG    1 
ATOM   1003  C  CD    . GLN A  1 138 ? 35.104  38.724  -6.410  1.00 15.14 ? 1111 GLN A CD    1 
ATOM   1004  O  OE1   . GLN A  1 138 ? 34.146  39.087  -5.734  1.00 26.84 ? 1111 GLN A OE1   1 
ATOM   1005  N  NE2   . GLN A  1 138 ? 34.978  38.277  -7.651  1.00 14.43 ? 1111 GLN A NE2   1 
ATOM   1006  N  N     . LEU A  1 139 ? 38.343  35.218  -3.618  1.00 13.49 ? 1112 LEU A N     1 
ATOM   1007  C  CA    . LEU A  1 139 ? 38.534  34.153  -2.658  1.00 19.21 ? 1112 LEU A CA    1 
ATOM   1008  C  C     . LEU A  1 139 ? 39.848  34.337  -1.895  1.00 15.30 ? 1112 LEU A C     1 
ATOM   1009  O  O     . LEU A  1 139 ? 39.902  34.136  -0.690  1.00 19.90 ? 1112 LEU A O     1 
ATOM   1010  C  CB    . LEU A  1 139 ? 38.471  32.782  -3.361  1.00 15.44 ? 1112 LEU A CB    1 
ATOM   1011  C  CG    . LEU A  1 139 ? 38.571  31.519  -2.498  1.00 22.69 ? 1112 LEU A CG    1 
ATOM   1012  C  CD1   . LEU A  1 139 ? 37.453  31.446  -1.402  1.00 13.94 ? 1112 LEU A CD1   1 
ATOM   1013  C  CD2   . LEU A  1 139 ? 38.548  30.299  -3.408  1.00 15.69 ? 1112 LEU A CD2   1 
ATOM   1014  N  N     . VAL A  1 140 ? 40.893  34.739  -2.612  1.00 18.81 ? 1113 VAL A N     1 
ATOM   1015  C  CA    . VAL A  1 140 ? 42.220  34.943  -2.044  1.00 17.51 ? 1113 VAL A CA    1 
ATOM   1016  C  C     . VAL A  1 140 ? 42.222  36.040  -0.988  1.00 16.90 ? 1113 VAL A C     1 
ATOM   1017  O  O     . VAL A  1 140 ? 42.837  35.884  0.076   1.00 24.48 ? 1113 VAL A O     1 
ATOM   1018  C  CB    . VAL A  1 140 ? 43.258  35.221  -3.158  1.00 22.47 ? 1113 VAL A CB    1 
ATOM   1019  C  CG1   . VAL A  1 140 ? 44.658  35.515  -2.573  1.00 20.03 ? 1113 VAL A CG1   1 
ATOM   1020  C  CG2   . VAL A  1 140 ? 43.300  34.048  -4.144  1.00 6.12  ? 1113 VAL A CG2   1 
ATOM   1021  N  N     . SER A  1 141 ? 41.518  37.140  -1.269  1.00 20.20 ? 1114 SER A N     1 
ATOM   1022  C  CA    . SER A  1 141 ? 41.386  38.247  -0.321  1.00 16.39 ? 1114 SER A CA    1 
ATOM   1023  C  C     . SER A  1 141 ? 40.668  37.797  0.932   1.00 13.38 ? 1114 SER A C     1 
ATOM   1024  O  O     . SER A  1 141 ? 41.059  38.191  2.024   1.00 16.89 ? 1114 SER A O     1 
ATOM   1025  C  CB    . SER A  1 141 ? 40.644  39.438  -0.935  1.00 12.64 ? 1114 SER A CB    1 
ATOM   1026  O  OG    . SER A  1 141 ? 40.827  39.425  -2.321  1.00 25.75 ? 1114 SER A OG    1 
ATOM   1027  N  N     . ALA A  1 142 ? 39.615  36.987  0.768   1.00 16.51 ? 1115 ALA A N     1 
ATOM   1028  C  CA    . ALA A  1 142 ? 38.872  36.425  1.908   1.00 21.34 ? 1115 ALA A CA    1 
ATOM   1029  C  C     . ALA A  1 142 ? 39.765  35.525  2.758   1.00 16.51 ? 1115 ALA A C     1 
ATOM   1030  O  O     . ALA A  1 142 ? 39.714  35.565  3.981   1.00 19.13 ? 1115 ALA A O     1 
ATOM   1031  C  CB    . ALA A  1 142 ? 37.628  35.652  1.438   1.00 19.06 ? 1115 ALA A CB    1 
ATOM   1032  N  N     . VAL A  1 143 ? 40.591  34.725  2.095   1.00 17.73 ? 1116 VAL A N     1 
ATOM   1033  C  CA    . VAL A  1 143 ? 41.492  33.794  2.783   1.00 18.36 ? 1116 VAL A CA    1 
ATOM   1034  C  C     . VAL A  1 143 ? 42.674  34.551  3.415   1.00 24.67 ? 1116 VAL A C     1 
ATOM   1035  O  O     . VAL A  1 143 ? 43.039  34.280  4.563   1.00 32.27 ? 1116 VAL A O     1 
ATOM   1036  C  CB    . VAL A  1 143 ? 41.937  32.649  1.836   1.00 17.10 ? 1116 VAL A CB    1 
ATOM   1037  C  CG1   . VAL A  1 143 ? 42.963  31.742  2.480   1.00 16.08 ? 1116 VAL A CG1   1 
ATOM   1038  C  CG2   . VAL A  1 143 ? 40.736  31.845  1.411   1.00 13.29 ? 1116 VAL A CG2   1 
ATOM   1039  N  N     . GLY A  1 144 ? 43.250  35.503  2.681   1.00 17.83 ? 1117 GLY A N     1 
ATOM   1040  C  CA    . GLY A  1 144 ? 44.227  36.430  3.260   1.00 22.37 ? 1117 GLY A CA    1 
ATOM   1041  C  C     . GLY A  1 144 ? 43.746  37.124  4.529   1.00 23.89 ? 1117 GLY A C     1 
ATOM   1042  O  O     . GLY A  1 144 ? 44.494  37.236  5.502   1.00 23.05 ? 1117 GLY A O     1 
ATOM   1043  N  N     . TYR A  1 145 ? 42.492  37.583  4.517   1.00 24.27 ? 1118 TYR A N     1 
ATOM   1044  C  CA    . TYR A  1 145 ? 41.868  38.231  5.682   1.00 21.01 ? 1118 TYR A CA    1 
ATOM   1045  C  C     . TYR A  1 145 ? 41.708  37.291  6.887   1.00 18.34 ? 1118 TYR A C     1 
ATOM   1046  O  O     . TYR A  1 145 ? 41.971  37.679  8.035   1.00 16.45 ? 1118 TYR A O     1 
ATOM   1047  C  CB    . TYR A  1 145 ? 40.515  38.860  5.288   1.00 21.72 ? 1118 TYR A CB    1 
ATOM   1048  C  CG    . TYR A  1 145 ? 39.652  39.292  6.461   1.00 22.30 ? 1118 TYR A CG    1 
ATOM   1049  C  CD1   . TYR A  1 145 ? 39.849  40.528  7.082   1.00 22.68 ? 1118 TYR A CD1   1 
ATOM   1050  C  CD2   . TYR A  1 145 ? 38.654  38.454  6.963   1.00 13.21 ? 1118 TYR A CD2   1 
ATOM   1051  C  CE1   . TYR A  1 145 ? 39.065  40.917  8.164   1.00 12.73 ? 1118 TYR A CE1   1 
ATOM   1052  C  CE2   . TYR A  1 145 ? 37.876  38.826  8.054   1.00 14.00 ? 1118 TYR A CE2   1 
ATOM   1053  C  CZ    . TYR A  1 145 ? 38.077  40.065  8.644   1.00 16.29 ? 1118 TYR A CZ    1 
ATOM   1054  O  OH    . TYR A  1 145 ? 37.306  40.448  9.726   1.00 18.94 ? 1118 TYR A OH    1 
ATOM   1055  N  N     . LEU A  1 146 ? 41.258  36.065  6.632   1.00 16.66 ? 1119 LEU A N     1 
ATOM   1056  C  CA    . LEU A  1 146 ? 41.034  35.105  7.709   1.00 16.39 ? 1119 LEU A CA    1 
ATOM   1057  C  C     . LEU A  1 146 ? 42.358  34.702  8.361   1.00 14.38 ? 1119 LEU A C     1 
ATOM   1058  O  O     . LEU A  1 146 ? 42.428  34.523  9.576   1.00 19.23 ? 1119 LEU A O     1 
ATOM   1059  C  CB    . LEU A  1 146 ? 40.246  33.876  7.215   1.00 11.06 ? 1119 LEU A CB    1 
ATOM   1060  C  CG    . LEU A  1 146 ? 38.764  34.028  6.860   1.00 18.85 ? 1119 LEU A CG    1 
ATOM   1061  C  CD1   . LEU A  1 146 ? 38.270  32.860  6.010   1.00 16.03 ? 1119 LEU A CD1   1 
ATOM   1062  C  CD2   . LEU A  1 146 ? 37.864  34.209  8.081   1.00 10.44 ? 1119 LEU A CD2   1 
ATOM   1063  N  N     . ARG A  1 147 ? 43.395  34.576  7.541   1.00 14.86 ? 1120 ARG A N     1 
ATOM   1064  C  CA    . ARG A  1 147 ? 44.747  34.276  7.998   1.00 19.69 ? 1120 ARG A CA    1 
ATOM   1065  C  C     . ARG A  1 147 ? 45.247  35.333  8.977   1.00 21.35 ? 1120 ARG A C     1 
ATOM   1066  O  O     . ARG A  1 147 ? 45.720  35.003  10.060  1.00 21.66 ? 1120 ARG A O     1 
ATOM   1067  C  CB    . ARG A  1 147 ? 45.689  34.137  6.797   1.00 19.55 ? 1120 ARG A CB    1 
ATOM   1068  C  CG    . ARG A  1 147 ? 47.077  33.569  7.123   1.00 21.70 ? 1120 ARG A CG    1 
ATOM   1069  C  CD    . ARG A  1 147 ? 47.070  32.073  7.524   1.00 12.62 ? 1120 ARG A CD    1 
ATOM   1070  N  NE    . ARG A  1 147 ? 46.577  31.144  6.499   1.00 15.17 ? 1120 ARG A NE    1 
ATOM   1071  C  CZ    . ARG A  1 147 ? 47.282  30.685  5.466   1.00 19.48 ? 1120 ARG A CZ    1 
ATOM   1072  N  NH1   . ARG A  1 147 ? 48.531  31.072  5.267   1.00 19.22 ? 1120 ARG A NH1   1 
ATOM   1073  N  NH2   . ARG A  1 147 ? 46.727  29.834  4.608   1.00 24.26 ? 1120 ARG A NH2   1 
ATOM   1074  N  N     . LEU A  1 148 ? 45.107  36.601  8.592   1.00 23.24 ? 1121 LEU A N     1 
ATOM   1075  C  CA    . LEU A  1 148 ? 45.365  37.727  9.471   1.00 26.69 ? 1121 LEU A CA    1 
ATOM   1076  C  C     . LEU A  1 148 ? 44.604  37.629  10.802  1.00 24.80 ? 1121 LEU A C     1 
ATOM   1077  O  O     . LEU A  1 148 ? 45.100  38.063  11.846  1.00 23.00 ? 1121 LEU A O     1 
ATOM   1078  C  CB    . LEU A  1 148 ? 45.020  39.031  8.743   1.00 28.70 ? 1121 LEU A CB    1 
ATOM   1079  C  CG    . LEU A  1 148 ? 45.565  40.329  9.347   1.00 42.21 ? 1121 LEU A CG    1 
ATOM   1080  C  CD1   . LEU A  1 148 ? 47.102  40.351  9.325   1.00 43.20 ? 1121 LEU A CD1   1 
ATOM   1081  C  CD2   . LEU A  1 148 ? 45.005  41.518  8.600   1.00 36.28 ? 1121 LEU A CD2   1 
ATOM   1082  N  N     . LYS A  1 149 ? 43.402  37.055  10.756  1.00 25.10 ? 1122 LYS A N     1 
ATOM   1083  C  CA    . LYS A  1 149 ? 42.572  36.867  11.946  1.00 23.83 ? 1122 LYS A CA    1 
ATOM   1084  C  C     . LYS A  1 149 ? 42.898  35.556  12.688  1.00 24.52 ? 1122 LYS A C     1 
ATOM   1085  O  O     . LYS A  1 149 ? 42.331  35.285  13.749  1.00 31.43 ? 1122 LYS A O     1 
ATOM   1086  C  CB    . LYS A  1 149 ? 41.071  36.933  11.580  1.00 25.97 ? 1122 LYS A CB    1 
ATOM   1087  C  CG    . LYS A  1 149 ? 40.525  38.320  11.163  1.00 20.48 ? 1122 LYS A CG    1 
ATOM   1088  C  CD    . LYS A  1 149 ? 39.991  39.137  12.355  1.00 23.90 ? 1122 LYS A CD    1 
ATOM   1089  C  CE    . LYS A  1 149 ? 41.005  40.144  12.904  1.00 37.73 ? 1122 LYS A CE    1 
ATOM   1090  N  NZ    . LYS A  1 149 ? 41.940  39.625  13.965  1.00 39.13 ? 1122 LYS A NZ    1 
ATOM   1091  N  N     . ASP A  1 150 ? 43.830  34.777  12.137  1.00 26.71 ? 1123 ASP A N     1 
ATOM   1092  C  CA    . ASP A  1 150 ? 44.189  33.426  12.625  1.00 28.46 ? 1123 ASP A CA    1 
ATOM   1093  C  C     . ASP A  1 150 ? 43.049  32.417  12.433  1.00 25.42 ? 1123 ASP A C     1 
ATOM   1094  O  O     . ASP A  1 150 ? 42.853  31.516  13.247  1.00 20.20 ? 1123 ASP A O     1 
ATOM   1095  C  CB    . ASP A  1 150 ? 44.680  33.444  14.087  1.00 29.65 ? 1123 ASP A CB    1 
ATOM   1096  C  CG    . ASP A  1 150 ? 45.968  34.226  14.265  1.00 34.66 ? 1123 ASP A CG    1 
ATOM   1097  O  OD1   . ASP A  1 150 ? 46.883  34.082  13.429  1.00 45.60 ? 1123 ASP A OD1   1 
ATOM   1098  O  OD2   . ASP A  1 150 ? 46.068  34.986  15.249  1.00 43.54 ? 1123 ASP A OD2   1 
ATOM   1099  N  N     . ILE A  1 151 ? 42.300  32.593  11.347  1.00 25.04 ? 1124 ILE A N     1 
ATOM   1100  C  CA    . ILE A  1 151 ? 41.195  31.705  11.013  1.00 24.74 ? 1124 ILE A CA    1 
ATOM   1101  C  C     . ILE A  1 151 ? 41.514  30.896  9.772   1.00 21.74 ? 1124 ILE A C     1 
ATOM   1102  O  O     . ILE A  1 151 ? 41.872  31.431  8.715   1.00 21.53 ? 1124 ILE A O     1 
ATOM   1103  C  CB    . ILE A  1 151 ? 39.831  32.440  10.868  1.00 23.88 ? 1124 ILE A CB    1 
ATOM   1104  C  CG1   . ILE A  1 151 ? 39.391  32.989  12.222  1.00 21.47 ? 1124 ILE A CG1   1 
ATOM   1105  C  CG2   . ILE A  1 151 ? 38.741  31.474  10.355  1.00 20.04 ? 1124 ILE A CG2   1 
ATOM   1106  C  CD1   . ILE A  1 151 ? 38.507  34.195  12.149  1.00 25.27 ? 1124 ILE A CD1   1 
ATOM   1107  N  N     . ILE A  1 152 ? 41.416  29.588  9.935   1.00 18.37 ? 1125 ILE A N     1 
ATOM   1108  C  CA    . ILE A  1 152 ? 41.457  28.683  8.805   1.00 16.00 ? 1125 ILE A CA    1 
ATOM   1109  C  C     . ILE A  1 152 ? 40.006  28.196  8.622   1.00 13.75 ? 1125 ILE A C     1 
ATOM   1110  O  O     . ILE A  1 152 ? 39.356  27.790  9.580   1.00 22.73 ? 1125 ILE A O     1 
ATOM   1111  C  CB    . ILE A  1 152 ? 42.614  27.619  8.995   1.00 13.51 ? 1125 ILE A CB    1 
ATOM   1112  C  CG1   . ILE A  1 152 ? 43.376  27.373  7.709   1.00 18.35 ? 1125 ILE A CG1   1 
ATOM   1113  C  CG2   . ILE A  1 152 ? 42.188  26.356  9.701   1.00 20.17 ? 1125 ILE A CG2   1 
ATOM   1114  C  CD1   . ILE A  1 152 ? 44.671  28.129  7.633   1.00 35.67 ? 1125 ILE A CD1   1 
ATOM   1115  N  N     . HIS A  1 153 ? 39.486  28.334  7.405   1.00 20.15 ? 1126 HIS A N     1 
ATOM   1116  C  CA    . HIS A  1 153 ? 38.105  27.974  7.058   1.00 16.90 ? 1126 HIS A CA    1 
ATOM   1117  C  C     . HIS A  1 153 ? 37.871  26.459  7.026   1.00 16.16 ? 1126 HIS A C     1 
ATOM   1118  O  O     . HIS A  1 153 ? 36.804  25.963  7.439   1.00 20.57 ? 1126 HIS A O     1 
ATOM   1119  C  CB    . HIS A  1 153 ? 37.741  28.587  5.698   1.00 19.10 ? 1126 HIS A CB    1 
ATOM   1120  C  CG    . HIS A  1 153 ? 36.363  28.226  5.217   1.00 22.29 ? 1126 HIS A CG    1 
ATOM   1121  N  ND1   . HIS A  1 153 ? 36.074  27.023  4.607   1.00 12.68 ? 1126 HIS A ND1   1 
ATOM   1122  C  CD2   . HIS A  1 153 ? 35.200  28.914  5.255   1.00 10.68 ? 1126 HIS A CD2   1 
ATOM   1123  C  CE1   . HIS A  1 153 ? 34.787  26.982  4.309   1.00 19.30 ? 1126 HIS A CE1   1 
ATOM   1124  N  NE2   . HIS A  1 153 ? 34.236  28.117  4.689   1.00 15.39 ? 1126 HIS A NE2   1 
ATOM   1125  N  N     . ARG A  1 154 ? 38.861  25.750  6.488   1.00 16.65 ? 1127 ARG A N     1 
ATOM   1126  C  CA    . ARG A  1 154 ? 38.931  24.268  6.456   1.00 20.43 ? 1127 ARG A CA    1 
ATOM   1127  C  C     . ARG A  1 154 ? 38.000  23.516  5.506   1.00 13.55 ? 1127 ARG A C     1 
ATOM   1128  O  O     . ARG A  1 154 ? 38.043  22.299  5.457   1.00 19.32 ? 1127 ARG A O     1 
ATOM   1129  C  CB    . ARG A  1 154 ? 38.854  23.671  7.858   1.00 21.61 ? 1127 ARG A CB    1 
ATOM   1130  C  CG    . ARG A  1 154 ? 39.937  24.177  8.790   1.00 22.03 ? 1127 ARG A CG    1 
ATOM   1131  C  CD    . ARG A  1 154 ? 39.574  23.861  10.212  1.00 24.64 ? 1127 ARG A CD    1 
ATOM   1132  N  NE    . ARG A  1 154 ? 40.050  22.543  10.584  1.00 28.96 ? 1127 ARG A NE    1 
ATOM   1133  C  CZ    . ARG A  1 154 ? 39.525  21.776  11.536  1.00 20.43 ? 1127 ARG A CZ    1 
ATOM   1134  N  NH1   . ARG A  1 154 ? 38.460  22.164  12.218  1.00 20.03 ? 1127 ARG A NH1   1 
ATOM   1135  N  NH2   . ARG A  1 154 ? 40.072  20.599  11.784  1.00 26.82 ? 1127 ARG A NH2   1 
ATOM   1136  N  N     . ASP A  1 155 ? 37.191  24.237  4.738   1.00 18.33 ? 1128 ASP A N     1 
ATOM   1137  C  CA    . ASP A  1 155 ? 36.294  23.612  3.785   1.00 18.52 ? 1128 ASP A CA    1 
ATOM   1138  C  C     . ASP A  1 155 ? 36.141  24.474  2.541   1.00 18.75 ? 1128 ASP A C     1 
ATOM   1139  O  O     . ASP A  1 155 ? 35.037  24.661  2.038   1.00 20.99 ? 1128 ASP A O     1 
ATOM   1140  C  CB    . ASP A  1 155 ? 34.931  23.308  4.432   1.00 19.49 ? 1128 ASP A CB    1 
ATOM   1141  C  CG    . ASP A  1 155 ? 34.180  22.160  3.739   1.00 23.88 ? 1128 ASP A CG    1 
ATOM   1142  O  OD1   . ASP A  1 155 ? 34.791  21.462  2.901   1.00 21.99 ? 1128 ASP A OD1   1 
ATOM   1143  O  OD2   . ASP A  1 155 ? 32.972  21.961  4.033   1.00 27.44 ? 1128 ASP A OD2   1 
ATOM   1144  N  N     . ILE A  1 156 ? 37.254  25.001  2.032   1.00 24.03 ? 1129 ILE A N     1 
ATOM   1145  C  CA    . ILE A  1 156 ? 37.171  25.811  0.823   1.00 23.51 ? 1129 ILE A CA    1 
ATOM   1146  C  C     . ILE A  1 156 ? 37.060  24.892  -0.382  1.00 23.57 ? 1129 ILE A C     1 
ATOM   1147  O  O     . ILE A  1 156 ? 37.946  24.079  -0.649  1.00 20.99 ? 1129 ILE A O     1 
ATOM   1148  C  CB    . ILE A  1 156 ? 38.311  26.842  0.669   1.00 24.61 ? 1129 ILE A CB    1 
ATOM   1149  C  CG1   . ILE A  1 156 ? 38.304  27.813  1.850   1.00 19.02 ? 1129 ILE A CG1   1 
ATOM   1150  C  CG2   . ILE A  1 156 ? 38.147  27.618  -0.657  1.00 18.07 ? 1129 ILE A CG2   1 
ATOM   1151  C  CD1   . ILE A  1 156 ? 39.628  28.519  2.062   1.00 29.62 ? 1129 ILE A CD1   1 
ATOM   1152  N  N     . LYS A  1 157 ? 35.918  25.027  -1.053  1.00 26.01 ? 1130 LYS A N     1 
ATOM   1153  C  CA    . LYS A  1 157 ? 35.533  24.272  -2.240  1.00 25.28 ? 1130 LYS A CA    1 
ATOM   1154  C  C     . LYS A  1 157 ? 34.474  25.069  -2.993  1.00 22.84 ? 1130 LYS A C     1 
ATOM   1155  O  O     . LYS A  1 157 ? 34.004  26.088  -2.503  1.00 26.74 ? 1130 LYS A O     1 
ATOM   1156  C  CB    . LYS A  1 157 ? 34.987  22.898  -1.857  1.00 20.74 ? 1130 LYS A CB    1 
ATOM   1157  C  CG    . LYS A  1 157 ? 33.831  22.906  -0.891  1.00 20.35 ? 1130 LYS A CG    1 
ATOM   1158  C  CD    . LYS A  1 157 ? 33.333  21.495  -0.677  1.00 32.14 ? 1130 LYS A CD    1 
ATOM   1159  C  CE    . LYS A  1 157 ? 32.076  21.492  0.156   1.00 44.95 ? 1130 LYS A CE    1 
ATOM   1160  N  NZ    . LYS A  1 157 ? 31.213  20.334  -0.181  1.00 48.44 ? 1130 LYS A NZ    1 
ATOM   1161  N  N     . ASP A  1 158 ? 34.086  24.595  -4.170  1.00 28.59 ? 1131 ASP A N     1 
ATOM   1162  C  CA    . ASP A  1 158 ? 33.100  25.303  -5.005  1.00 27.39 ? 1131 ASP A CA    1 
ATOM   1163  C  C     . ASP A  1 158 ? 31.723  25.458  -4.365  1.00 26.46 ? 1131 ASP A C     1 
ATOM   1164  O  O     . ASP A  1 158 ? 31.066  26.481  -4.559  1.00 26.62 ? 1131 ASP A O     1 
ATOM   1165  C  CB    . ASP A  1 158 ? 32.982  24.650  -6.391  1.00 32.47 ? 1131 ASP A CB    1 
ATOM   1166  C  CG    . ASP A  1 158 ? 32.808  23.139  -6.330  1.00 37.53 ? 1131 ASP A CG    1 
ATOM   1167  O  OD1   . ASP A  1 158 ? 32.704  22.558  -5.223  1.00 38.26 ? 1131 ASP A OD1   1 
ATOM   1168  O  OD2   . ASP A  1 158 ? 32.781  22.528  -7.415  1.00 44.95 ? 1131 ASP A OD2   1 
ATOM   1169  N  N     . GLU A  1 159 ? 31.300  24.450  -3.603  1.00 22.21 ? 1132 GLU A N     1 
ATOM   1170  C  CA    . GLU A  1 159 ? 29.999  24.458  -2.930  1.00 22.95 ? 1132 GLU A CA    1 
ATOM   1171  C  C     . GLU A  1 159 ? 29.891  25.421  -1.749  1.00 20.13 ? 1132 GLU A C     1 
ATOM   1172  O  O     . GLU A  1 159 ? 28.793  25.737  -1.297  1.00 17.32 ? 1132 GLU A O     1 
ATOM   1173  C  CB    . GLU A  1 159 ? 29.638  23.050  -2.449  1.00 26.82 ? 1132 GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1 159 ? 29.059  22.141  -3.533  1.00 41.95 ? 1132 GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1 159 ? 28.076  21.100  -2.983  1.00 48.89 ? 1132 GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1 159 ? 27.298  20.530  -3.790  1.00 32.16 ? 1132 GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1 159 ? 28.079  20.863  -1.748  1.00 44.61 ? 1132 GLU A OE2   1 
ATOM   1178  N  N     . ASN A  1 160 ? 31.030  25.852  -1.223  1.00 24.25 ? 1133 ASN A N     1 
ATOM   1179  C  CA    . ASN A  1 160 ? 31.039  26.770  -0.096  1.00 25.36 ? 1133 ASN A CA    1 
ATOM   1180  C  C     . ASN A  1 160 ? 31.335  28.191  -0.552  1.00 22.25 ? 1133 ASN A C     1 
ATOM   1181  O  O     . ASN A  1 160 ? 31.680  29.058  0.241   1.00 23.42 ? 1133 ASN A O     1 
ATOM   1182  C  CB    . ASN A  1 160 ? 32.034  26.302  0.960   1.00 20.89 ? 1133 ASN A CB    1 
ATOM   1183  C  CG    . ASN A  1 160 ? 31.535  25.104  1.736   1.00 21.07 ? 1133 ASN A CG    1 
ATOM   1184  O  OD1   . ASN A  1 160 ? 30.331  24.866  1.838   1.00 28.34 ? 1133 ASN A OD1   1 
ATOM   1185  N  ND2   . ASN A  1 160 ? 32.459  24.357  2.315   1.00 20.17 ? 1133 ASN A ND2   1 
ATOM   1186  N  N     . ILE A  1 161 ? 31.213  28.408  -1.853  1.00 24.66 ? 1134 ILE A N     1 
ATOM   1187  C  CA    . ILE A  1 161 ? 31.369  29.733  -2.423  1.00 25.75 ? 1134 ILE A CA    1 
ATOM   1188  C  C     . ILE A  1 161 ? 30.116  30.059  -3.210  1.00 27.11 ? 1134 ILE A C     1 
ATOM   1189  O  O     . ILE A  1 161 ? 29.607  29.221  -3.960  1.00 25.39 ? 1134 ILE A O     1 
ATOM   1190  C  CB    . ILE A  1 161 ? 32.625  29.858  -3.314  1.00 24.04 ? 1134 ILE A CB    1 
ATOM   1191  C  CG1   . ILE A  1 161 ? 33.880  29.427  -2.538  1.00 16.48 ? 1134 ILE A CG1   1 
ATOM   1192  C  CG2   . ILE A  1 161 ? 32.763  31.296  -3.814  1.00 17.95 ? 1134 ILE A CG2   1 
ATOM   1193  C  CD1   . ILE A  1 161 ? 34.979  28.872  -3.399  1.00 11.16 ? 1134 ILE A CD1   1 
ATOM   1194  N  N     . VAL A  1 162 ? 29.642  31.288  -3.022  1.00 27.86 ? 1135 VAL A N     1 
ATOM   1195  C  CA    . VAL A  1 162 ? 28.389  31.779  -3.590  1.00 23.24 ? 1135 VAL A CA    1 
ATOM   1196  C  C     . VAL A  1 162 ? 28.658  32.961  -4.531  1.00 19.04 ? 1135 VAL A C     1 
ATOM   1197  O  O     . VAL A  1 162 ? 29.398  33.873  -4.179  1.00 25.13 ? 1135 VAL A O     1 
ATOM   1198  C  CB    . VAL A  1 162 ? 27.391  32.086  -2.426  1.00 22.90 ? 1135 VAL A CB    1 
ATOM   1199  C  CG1   . VAL A  1 162 ? 26.760  33.434  -2.546  1.00 23.63 ? 1135 VAL A CG1   1 
ATOM   1200  C  CG2   . VAL A  1 162 ? 26.352  30.973  -2.292  1.00 13.55 ? 1135 VAL A CG2   1 
ATOM   1201  N  N     . ILE A  1 163 ? 28.080  32.922  -5.736  1.00 22.50 ? 1136 ILE A N     1 
ATOM   1202  C  CA    . ILE A  1 163 ? 28.311  33.949  -6.774  1.00 19.84 ? 1136 ILE A CA    1 
ATOM   1203  C  C     . ILE A  1 163 ? 27.043  34.729  -7.177  1.00 22.79 ? 1136 ILE A C     1 
ATOM   1204  O  O     . ILE A  1 163 ? 25.977  34.140  -7.340  1.00 19.56 ? 1136 ILE A O     1 
ATOM   1205  C  CB    . ILE A  1 163 ? 28.984  33.339  -8.029  1.00 22.89 ? 1136 ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1 163 ? 29.478  34.447  -8.973  1.00 21.24 ? 1136 ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1 163 ? 28.039  32.347  -8.733  1.00 24.74 ? 1136 ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1 163 ? 30.574  34.022  -9.937  1.00 17.84 ? 1136 ILE A CD1   1 
ATOM   1209  N  N     . ALA A  1 164 ? 27.177  36.049  -7.329  1.00 23.40 ? 1137 ALA A N     1 
ATOM   1210  C  CA    . ALA A  1 164 ? 26.098  36.912  -7.836  1.00 22.78 ? 1137 ALA A CA    1 
ATOM   1211  C  C     . ALA A  1 164 ? 26.315  37.270  -9.313  1.00 24.86 ? 1137 ALA A C     1 
ATOM   1212  O  O     . ALA A  1 164 ? 27.353  36.919  -9.903  1.00 25.43 ? 1137 ALA A O     1 
ATOM   1213  C  CB    . ALA A  1 164 ? 25.986  38.195  -6.987  1.00 23.31 ? 1137 ALA A CB    1 
ATOM   1214  N  N     . GLU A  1 165 ? 25.351  37.990  -9.894  1.00 22.98 ? 1138 GLU A N     1 
ATOM   1215  C  CA    . GLU A  1 165 ? 25.350  38.298  -11.337 1.00 27.42 ? 1138 GLU A CA    1 
ATOM   1216  C  C     . GLU A  1 165 ? 26.334  39.375  -11.797 1.00 21.93 ? 1138 GLU A C     1 
ATOM   1217  O  O     . GLU A  1 165 ? 26.566  39.526  -12.994 1.00 31.12 ? 1138 GLU A O     1 
ATOM   1218  C  CB    . GLU A  1 165 ? 23.931  38.604  -11.841 1.00 30.00 ? 1138 GLU A CB    1 
ATOM   1219  C  CG    . GLU A  1 165 ? 22.990  37.392  -11.813 1.00 28.95 ? 1138 GLU A CG    1 
ATOM   1220  C  CD    . GLU A  1 165 ? 21.598  37.717  -12.338 1.00 36.82 ? 1138 GLU A CD    1 
ATOM   1221  O  OE1   . GLU A  1 165 ? 21.203  38.905  -12.291 1.00 40.15 ? 1138 GLU A OE1   1 
ATOM   1222  O  OE2   . GLU A  1 165 ? 20.897  36.780  -12.792 1.00 35.71 ? 1138 GLU A OE2   1 
ATOM   1223  N  N     . ASP A  1 166 ? 26.903  40.120  -10.854 1.00 18.65 ? 1139 ASP A N     1 
ATOM   1224  C  CA    . ASP A  1 166 ? 28.047  41.010  -11.128 1.00 22.62 ? 1139 ASP A CA    1 
ATOM   1225  C  C     . ASP A  1 166 ? 29.438  40.314  -10.989 1.00 21.91 ? 1139 ASP A C     1 
ATOM   1226  O  O     . ASP A  1 166 ? 30.480  40.987  -10.976 1.00 20.95 ? 1139 ASP A O     1 
ATOM   1227  C  CB    . ASP A  1 166 ? 27.963  42.266  -10.239 1.00 18.99 ? 1139 ASP A CB    1 
ATOM   1228  C  CG    . ASP A  1 166 ? 27.802  41.934  -8.771  1.00 20.92 ? 1139 ASP A CG    1 
ATOM   1229  O  OD1   . ASP A  1 166 ? 27.712  42.873  -7.959  1.00 31.13 ? 1139 ASP A OD1   1 
ATOM   1230  O  OD2   . ASP A  1 166 ? 27.779  40.737  -8.414  1.00 30.54 ? 1139 ASP A OD2   1 
ATOM   1231  N  N     . PHE A  1 167 ? 29.424  38.978  -10.890 1.00 20.99 ? 1140 PHE A N     1 
ATOM   1232  C  CA    . PHE A  1 167 ? 30.625  38.109  -10.712 1.00 21.66 ? 1140 PHE A CA    1 
ATOM   1233  C  C     . PHE A  1 167 ? 31.374  38.256  -9.378  1.00 19.16 ? 1140 PHE A C     1 
ATOM   1234  O  O     . PHE A  1 167 ? 32.504  37.769  -9.223  1.00 23.59 ? 1140 PHE A O     1 
ATOM   1235  C  CB    . PHE A  1 167 ? 31.587  38.174  -11.910 1.00 22.16 ? 1140 PHE A CB    1 
ATOM   1236  C  CG    . PHE A  1 167 ? 30.916  37.968  -13.245 1.00 26.81 ? 1140 PHE A CG    1 
ATOM   1237  C  CD1   . PHE A  1 167 ? 30.573  36.690  -13.680 1.00 29.52 ? 1140 PHE A CD1   1 
ATOM   1238  C  CD2   . PHE A  1 167 ? 30.623  39.060  -14.066 1.00 33.91 ? 1140 PHE A CD2   1 
ATOM   1239  C  CE1   . PHE A  1 167 ? 29.944  36.499  -14.911 1.00 31.93 ? 1140 PHE A CE1   1 
ATOM   1240  C  CE2   . PHE A  1 167 ? 29.993  38.879  -15.298 1.00 32.60 ? 1140 PHE A CE2   1 
ATOM   1241  C  CZ    . PHE A  1 167 ? 29.656  37.595  -15.721 1.00 22.36 ? 1140 PHE A CZ    1 
ATOM   1242  N  N     . THR A  1 168 ? 30.724  38.916  -8.425  1.00 19.32 ? 1141 THR A N     1 
ATOM   1243  C  CA    . THR A  1 168 ? 31.194  39.030  -7.052  1.00 20.19 ? 1141 THR A CA    1 
ATOM   1244  C  C     . THR A  1 168 ? 30.859  37.739  -6.297  1.00 22.00 ? 1141 THR A C     1 
ATOM   1245  O  O     . THR A  1 168 ? 29.762  37.188  -6.443  1.00 19.56 ? 1141 THR A O     1 
ATOM   1246  C  CB    . THR A  1 168 ? 30.568  40.279  -6.363  1.00 25.65 ? 1141 THR A CB    1 
ATOM   1247  O  OG1   . THR A  1 168 ? 31.250  41.464  -6.811  1.00 20.91 ? 1141 THR A OG1   1 
ATOM   1248  C  CG2   . THR A  1 168 ? 30.675  40.204  -4.852  1.00 30.97 ? 1141 THR A CG2   1 
ATOM   1249  N  N     . ILE A  1 169 ? 31.815  37.246  -5.510  1.00 22.37 ? 1142 ILE A N     1 
ATOM   1250  C  CA    . ILE A  1 169 ? 31.601  36.019  -4.739  1.00 19.52 ? 1142 ILE A CA    1 
ATOM   1251  C  C     . ILE A  1 169 ? 31.677  36.229  -3.223  1.00 16.73 ? 1142 ILE A C     1 
ATOM   1252  O  O     . ILE A  1 169 ? 32.360  37.134  -2.745  1.00 18.09 ? 1142 ILE A O     1 
ATOM   1253  C  CB    . ILE A  1 169 ? 32.564  34.855  -5.163  1.00 16.32 ? 1142 ILE A CB    1 
ATOM   1254  C  CG1   . ILE A  1 169 ? 34.028  35.198  -4.868  1.00 6.95  ? 1142 ILE A CG1   1 
ATOM   1255  C  CG2   . ILE A  1 169 ? 32.358  34.469  -6.627  1.00 17.03 ? 1142 ILE A CG2   1 
ATOM   1256  C  CD1   . ILE A  1 169 ? 34.948  33.991  -4.823  1.00 20.52 ? 1142 ILE A CD1   1 
ATOM   1257  N  N     . LYS A  1 170 ? 30.952  35.392  -2.483  1.00 16.05 ? 1143 LYS A N     1 
ATOM   1258  C  CA    . LYS A  1 170 ? 31.073  35.337  -1.029  1.00 19.19 ? 1143 LYS A CA    1 
ATOM   1259  C  C     . LYS A  1 170 ? 31.461  33.946  -0.540  1.00 22.45 ? 1143 LYS A C     1 
ATOM   1260  O  O     . LYS A  1 170 ? 30.967  32.925  -1.035  1.00 23.46 ? 1143 LYS A O     1 
ATOM   1261  C  CB    . LYS A  1 170 ? 29.791  35.796  -0.336  1.00 17.33 ? 1143 LYS A CB    1 
ATOM   1262  C  CG    . LYS A  1 170 ? 29.882  37.176  0.319   1.00 18.34 ? 1143 LYS A CG    1 
ATOM   1263  C  CD    . LYS A  1 170 ? 29.422  38.276  -0.586  1.00 21.81 ? 1143 LYS A CD    1 
ATOM   1264  C  CE    . LYS A  1 170 ? 29.327  39.590  0.154   1.00 32.42 ? 1143 LYS A CE    1 
ATOM   1265  N  NZ    . LYS A  1 170 ? 28.570  40.598  -0.621  1.00 34.56 ? 1143 LYS A NZ    1 
ATOM   1266  N  N     . LEU A  1 171 ? 32.376  33.924  0.420   1.00 21.84 ? 1144 LEU A N     1 
ATOM   1267  C  CA    . LEU A  1 171 ? 32.642  32.734  1.204   1.00 20.40 ? 1144 LEU A CA    1 
ATOM   1268  C  C     . LEU A  1 171 ? 31.538  32.525  2.250   1.00 20.91 ? 1144 LEU A C     1 
ATOM   1269  O  O     . LEU A  1 171 ? 31.143  33.456  2.962   1.00 23.78 ? 1144 LEU A O     1 
ATOM   1270  C  CB    . LEU A  1 171 ? 34.023  32.837  1.863   1.00 21.19 ? 1144 LEU A CB    1 
ATOM   1271  C  CG    . LEU A  1 171 ? 34.640  31.550  2.418   1.00 23.11 ? 1144 LEU A CG    1 
ATOM   1272  C  CD1   . LEU A  1 171 ? 34.591  30.408  1.389   1.00 14.21 ? 1144 LEU A CD1   1 
ATOM   1273  C  CD2   . LEU A  1 171 ? 36.069  31.799  2.914   1.00 17.83 ? 1144 LEU A CD2   1 
ATOM   1274  N  N     . ILE A  1 172 ? 31.040  31.291  2.316   1.00 19.14 ? 1145 ILE A N     1 
ATOM   1275  C  CA    . ILE A  1 172 ? 29.982  30.890  3.233   1.00 14.37 ? 1145 ILE A CA    1 
ATOM   1276  C  C     . ILE A  1 172 ? 30.430  29.631  3.989   1.00 13.48 ? 1145 ILE A C     1 
ATOM   1277  O  O     . ILE A  1 172 ? 31.533  29.123  3.770   1.00 17.73 ? 1145 ILE A O     1 
ATOM   1278  C  CB    . ILE A  1 172 ? 28.620  30.614  2.470   1.00 24.21 ? 1145 ILE A CB    1 
ATOM   1279  C  CG1   . ILE A  1 172 ? 28.816  29.646  1.287   1.00 18.07 ? 1145 ILE A CG1   1 
ATOM   1280  C  CG2   . ILE A  1 172 ? 27.978  31.915  1.967   1.00 6.29  ? 1145 ILE A CG2   1 
ATOM   1281  C  CD1   . ILE A  1 172 ? 27.658  28.716  1.045   1.00 12.34 ? 1145 ILE A CD1   1 
ATOM   1282  N  N     . ASP A  1 173 ? 29.578  29.150  4.885   1.00 16.35 ? 1146 ASP A N     1 
ATOM   1283  C  CA    . ASP A  1 173 ? 29.723  27.840  5.550   1.00 18.65 ? 1146 ASP A CA    1 
ATOM   1284  C  C     . ASP A  1 173 ? 30.965  27.692  6.439   1.00 22.12 ? 1146 ASP A C     1 
ATOM   1285  O  O     . ASP A  1 173 ? 31.968  27.061  6.063   1.00 26.22 ? 1146 ASP A O     1 
ATOM   1286  C  CB    . ASP A  1 173 ? 29.616  26.691  4.537   1.00 15.96 ? 1146 ASP A CB    1 
ATOM   1287  C  CG    . ASP A  1 173 ? 29.527  25.320  5.201   1.00 19.28 ? 1146 ASP A CG    1 
ATOM   1288  O  OD1   . ASP A  1 173 ? 29.539  25.238  6.447   1.00 16.77 ? 1146 ASP A OD1   1 
ATOM   1289  O  OD2   . ASP A  1 173 ? 29.426  24.307  4.468   1.00 13.59 ? 1146 ASP A OD2   1 
ATOM   1290  N  N     . PHE A  1 174 ? 30.865  28.252  7.639   1.00 20.65 ? 1147 PHE A N     1 
ATOM   1291  C  CA    . PHE A  1 174 ? 31.979  28.305  8.566   1.00 19.86 ? 1147 PHE A CA    1 
ATOM   1292  C  C     . PHE A  1 174 ? 31.858  27.226  9.641   1.00 20.11 ? 1147 PHE A C     1 
ATOM   1293  O  O     . PHE A  1 174 ? 32.407  27.361  10.734  1.00 18.71 ? 1147 PHE A O     1 
ATOM   1294  C  CB    . PHE A  1 174 ? 32.103  29.720  9.159   1.00 21.42 ? 1147 PHE A CB    1 
ATOM   1295  C  CG    . PHE A  1 174 ? 32.740  30.710  8.220   1.00 22.79 ? 1147 PHE A CG    1 
ATOM   1296  C  CD1   . PHE A  1 174 ? 32.039  31.195  7.101   1.00 21.60 ? 1147 PHE A CD1   1 
ATOM   1297  C  CD2   . PHE A  1 174 ? 34.044  31.146  8.437   1.00 18.06 ? 1147 PHE A CD2   1 
ATOM   1298  C  CE1   . PHE A  1 174 ? 32.628  32.095  6.216   1.00 22.56 ? 1147 PHE A CE1   1 
ATOM   1299  C  CE2   . PHE A  1 174 ? 34.652  32.054  7.561   1.00 21.87 ? 1147 PHE A CE2   1 
ATOM   1300  C  CZ    . PHE A  1 174 ? 33.941  32.533  6.448   1.00 26.85 ? 1147 PHE A CZ    1 
ATOM   1301  N  N     . GLY A  1 175 ? 31.175  26.132  9.291   1.00 18.64 ? 1148 GLY A N     1 
ATOM   1302  C  CA    . GLY A  1 175 ? 30.936  25.025  10.211  1.00 17.67 ? 1148 GLY A CA    1 
ATOM   1303  C  C     . GLY A  1 175 ? 32.152  24.195  10.546  1.00 18.73 ? 1148 GLY A C     1 
ATOM   1304  O  O     . GLY A  1 175 ? 32.131  23.429  11.500  1.00 26.46 ? 1148 GLY A O     1 
ATOM   1305  N  N     . SER A  1 176 ? 33.214  24.336  9.760   1.00 20.41 ? 1149 SER A N     1 
ATOM   1306  C  CA    . SER A  1 176 ? 34.469  23.635  10.018  1.00 18.29 ? 1149 SER A CA    1 
ATOM   1307  C  C     . SER A  1 176 ? 35.564  24.591  10.437  1.00 17.01 ? 1149 SER A C     1 
ATOM   1308  O  O     . SER A  1 176 ? 36.672  24.158  10.729  1.00 25.12 ? 1149 SER A O     1 
ATOM   1309  C  CB    . SER A  1 176 ? 34.956  22.889  8.771   1.00 20.68 ? 1149 SER A CB    1 
ATOM   1310  O  OG    . SER A  1 176 ? 33.928  22.146  8.155   1.00 27.25 ? 1149 SER A OG    1 
ATOM   1311  N  N     . ALA A  1 177 ? 35.278  25.889  10.432  1.00 18.08 ? 1150 ALA A N     1 
ATOM   1312  C  CA    . ALA A  1 177 ? 36.306  26.899  10.704  1.00 13.30 ? 1150 ALA A CA    1 
ATOM   1313  C  C     . ALA A  1 177 ? 36.886  26.777  12.117  1.00 21.07 ? 1150 ALA A C     1 
ATOM   1314  O  O     . ALA A  1 177 ? 36.183  26.443  13.076  1.00 24.35 ? 1150 ALA A O     1 
ATOM   1315  C  CB    . ALA A  1 177 ? 35.774  28.310  10.437  1.00 10.40 ? 1150 ALA A CB    1 
ATOM   1316  N  N     . ALA A  1 178 ? 38.188  27.024  12.227  1.00 23.61 ? 1151 ALA A N     1 
ATOM   1317  C  CA    . ALA A  1 178 ? 38.897  26.874  13.488  1.00 21.93 ? 1151 ALA A CA    1 
ATOM   1318  C  C     . ALA A  1 178 ? 39.966  27.947  13.568  1.00 22.07 ? 1151 ALA A C     1 
ATOM   1319  O  O     . ALA A  1 178 ? 40.350  28.531  12.552  1.00 22.18 ? 1151 ALA A O     1 
ATOM   1320  C  CB    . ALA A  1 178 ? 39.524  25.464  13.601  1.00 16.31 ? 1151 ALA A CB    1 
ATOM   1321  N  N     . TYR A  1 179 ? 40.432  28.206  14.783  1.00 23.61 ? 1152 TYR A N     1 
ATOM   1322  C  CA    . TYR A  1 179 ? 41.555  29.100  15.005  1.00 25.77 ? 1152 TYR A CA    1 
ATOM   1323  C  C     . TYR A  1 179 ? 42.917  28.417  14.830  1.00 27.70 ? 1152 TYR A C     1 
ATOM   1324  O  O     . TYR A  1 179 ? 43.092  27.250  15.183  1.00 25.54 ? 1152 TYR A O     1 
ATOM   1325  C  CB    . TYR A  1 179 ? 41.429  29.767  16.381  1.00 27.96 ? 1152 TYR A CB    1 
ATOM   1326  C  CG    . TYR A  1 179 ? 40.350  30.833  16.418  1.00 22.75 ? 1152 TYR A CG    1 
ATOM   1327  C  CD1   . TYR A  1 179 ? 40.624  32.136  16.004  1.00 26.89 ? 1152 TYR A CD1   1 
ATOM   1328  C  CD2   . TYR A  1 179 ? 39.054  30.532  16.835  1.00 21.69 ? 1152 TYR A CD2   1 
ATOM   1329  C  CE1   . TYR A  1 179 ? 39.642  33.119  16.018  1.00 21.01 ? 1152 TYR A CE1   1 
ATOM   1330  C  CE2   . TYR A  1 179 ? 38.061  31.502  16.843  1.00 16.41 ? 1152 TYR A CE2   1 
ATOM   1331  C  CZ    . TYR A  1 179 ? 38.367  32.799  16.442  1.00 29.98 ? 1152 TYR A CZ    1 
ATOM   1332  O  OH    . TYR A  1 179 ? 37.405  33.781  16.458  1.00 27.70 ? 1152 TYR A OH    1 
ATOM   1333  N  N     . LEU A  1 180 ? 43.856  29.154  14.234  1.00 32.33 ? 1153 LEU A N     1 
ATOM   1334  C  CA    . LEU A  1 180 ? 45.278  28.813  14.250  1.00 31.32 ? 1153 LEU A CA    1 
ATOM   1335  C  C     . LEU A  1 180 ? 45.840  29.261  15.591  1.00 32.74 ? 1153 LEU A C     1 
ATOM   1336  O  O     . LEU A  1 180 ? 45.565  30.375  16.034  1.00 32.02 ? 1153 LEU A O     1 
ATOM   1337  C  CB    . LEU A  1 180 ? 46.048  29.559  13.148  1.00 27.41 ? 1153 LEU A CB    1 
ATOM   1338  C  CG    . LEU A  1 180 ? 46.306  29.064  11.719  1.00 28.44 ? 1153 LEU A CG    1 
ATOM   1339  C  CD1   . LEU A  1 180 ? 45.934  27.573  11.478  1.00 5.61  ? 1153 LEU A CD1   1 
ATOM   1340  C  CD2   . LEU A  1 180 ? 45.607  29.984  10.733  1.00 15.96 ? 1153 LEU A CD2   1 
ATOM   1341  N  N     . GLU A  1 181 ? 46.630  28.399  16.226  1.00 33.02 ? 1154 GLU A N     1 
ATOM   1342  C  CA    . GLU A  1 181 ? 47.253  28.717  17.507  1.00 33.77 ? 1154 GLU A CA    1 
ATOM   1343  C  C     . GLU A  1 181 ? 48.718  28.303  17.501  1.00 35.19 ? 1154 GLU A C     1 
ATOM   1344  O  O     . GLU A  1 181 ? 49.085  27.333  16.842  1.00 34.24 ? 1154 GLU A O     1 
ATOM   1345  C  CB    . GLU A  1 181 ? 46.509  28.024  18.652  1.00 35.31 ? 1154 GLU A CB    1 
ATOM   1346  C  CG    . GLU A  1 181 ? 45.100  28.540  18.875  1.00 31.83 ? 1154 GLU A CG    1 
ATOM   1347  C  CD    . GLU A  1 181 ? 44.337  27.743  19.905  1.00 43.95 ? 1154 GLU A CD    1 
ATOM   1348  O  OE1   . GLU A  1 181 ? 44.894  27.483  20.995  1.00 47.08 ? 1154 GLU A OE1   1 
ATOM   1349  O  OE2   . GLU A  1 181 ? 43.170  27.386  19.627  1.00 43.88 ? 1154 GLU A OE2   1 
ATOM   1350  N  N     . ARG A  1 182 ? 49.547  29.041  18.239  1.00 41.20 ? 1155 ARG A N     1 
ATOM   1351  C  CA    . ARG A  1 182 ? 50.997  28.814  18.254  1.00 46.43 ? 1155 ARG A CA    1 
ATOM   1352  C  C     . ARG A  1 182 ? 51.355  27.411  18.764  1.00 45.99 ? 1155 ARG A C     1 
ATOM   1353  O  O     . ARG A  1 182 ? 51.028  27.049  19.897  1.00 46.12 ? 1155 ARG A O     1 
ATOM   1354  C  CB    . ARG A  1 182 ? 51.707  29.893  19.085  1.00 50.64 ? 1155 ARG A CB    1 
ATOM   1355  C  CG    . ARG A  1 182 ? 53.212  30.036  18.824  1.00 51.72 ? 1155 ARG A CG    1 
ATOM   1356  C  CD    . ARG A  1 182 ? 53.507  31.095  17.764  1.00 48.54 ? 1155 ARG A CD    1 
ATOM   1357  N  N     . GLY A  1 183 ? 52.005  26.632  17.898  1.00 47.45 ? 1156 GLY A N     1 
ATOM   1358  C  CA    . GLY A  1 183 ? 52.484  25.288  18.225  1.00 48.81 ? 1156 GLY A CA    1 
ATOM   1359  C  C     . GLY A  1 183 ? 51.419  24.203  18.218  1.00 47.46 ? 1156 GLY A C     1 
ATOM   1360  O  O     . GLY A  1 183 ? 51.610  23.140  18.805  1.00 51.65 ? 1156 GLY A O     1 
ATOM   1361  N  N     . LYS A  1 184 ? 50.301  24.464  17.550  1.00 43.92 ? 1157 LYS A N     1 
ATOM   1362  C  CA    . LYS A  1 184 ? 49.176  23.533  17.541  1.00 38.33 ? 1157 LYS A CA    1 
ATOM   1363  C  C     . LYS A  1 184 ? 49.093  22.787  16.209  1.00 33.97 ? 1157 LYS A C     1 
ATOM   1364  O  O     . LYS A  1 184 ? 49.384  23.350  15.150  1.00 32.10 ? 1157 LYS A O     1 
ATOM   1365  C  CB    . LYS A  1 184 ? 47.875  24.292  17.833  1.00 39.07 ? 1157 LYS A CB    1 
ATOM   1366  C  CG    . LYS A  1 184 ? 46.606  23.448  17.822  1.00 40.66 ? 1157 LYS A CG    1 
ATOM   1367  C  CD    . LYS A  1 184 ? 45.372  24.317  17.652  1.00 44.08 ? 1157 LYS A CD    1 
ATOM   1368  C  CE    . LYS A  1 184 ? 44.122  23.474  17.463  1.00 39.46 ? 1157 LYS A CE    1 
ATOM   1369  N  NZ    . LYS A  1 184 ? 42.914  24.326  17.409  1.00 43.46 ? 1157 LYS A NZ    1 
ATOM   1370  N  N     . LEU A  1 185 ? 48.720  21.512  16.272  1.00 30.32 ? 1158 LEU A N     1 
ATOM   1371  C  CA    . LEU A  1 185 ? 48.422  20.737  15.064  1.00 31.37 ? 1158 LEU A CA    1 
ATOM   1372  C  C     . LEU A  1 185 ? 46.982  20.236  15.146  1.00 26.36 ? 1158 LEU A C     1 
ATOM   1373  O  O     . LEU A  1 185 ? 46.446  20.106  16.243  1.00 27.32 ? 1158 LEU A O     1 
ATOM   1374  C  CB    . LEU A  1 185 ? 49.419  19.577  14.871  1.00 28.28 ? 1158 LEU A CB    1 
ATOM   1375  C  CG    . LEU A  1 185 ? 50.891  19.886  14.547  1.00 37.33 ? 1158 LEU A CG    1 
ATOM   1376  C  CD1   . LEU A  1 185 ? 51.721  18.600  14.440  1.00 29.47 ? 1158 LEU A CD1   1 
ATOM   1377  C  CD2   . LEU A  1 185 ? 51.069  20.733  13.277  1.00 35.85 ? 1158 LEU A CD2   1 
ATOM   1378  N  N     . PHE A  1 186 ? 46.350  19.998  13.993  1.00 24.11 ? 1159 PHE A N     1 
ATOM   1379  C  CA    . PHE A  1 186 ? 44.981  19.467  13.950  1.00 18.66 ? 1159 PHE A CA    1 
ATOM   1380  C  C     . PHE A  1 186 ? 45.037  17.955  13.739  1.00 19.73 ? 1159 PHE A C     1 
ATOM   1381  O  O     . PHE A  1 186 ? 45.788  17.475  12.895  1.00 23.09 ? 1159 PHE A O     1 
ATOM   1382  C  CB    . PHE A  1 186 ? 44.135  20.141  12.845  1.00 16.64 ? 1159 PHE A CB    1 
ATOM   1383  C  CG    . PHE A  1 186 ? 43.776  21.593  13.128  1.00 24.53 ? 1159 PHE A CG    1 
ATOM   1384  C  CD1   . PHE A  1 186 ? 44.546  22.630  12.603  1.00 26.06 ? 1159 PHE A CD1   1 
ATOM   1385  C  CD2   . PHE A  1 186 ? 42.675  21.918  13.925  1.00 18.36 ? 1159 PHE A CD2   1 
ATOM   1386  C  CE1   . PHE A  1 186 ? 44.230  23.962  12.868  1.00 18.37 ? 1159 PHE A CE1   1 
ATOM   1387  C  CE2   . PHE A  1 186 ? 42.349  23.241  14.200  1.00 16.11 ? 1159 PHE A CE2   1 
ATOM   1388  C  CZ    . PHE A  1 186 ? 43.128  24.271  13.662  1.00 17.77 ? 1159 PHE A CZ    1 
ATOM   1389  N  N     . TYR A  1 187 ? 44.235  17.208  14.500  1.00 24.53 ? 1160 TYR A N     1 
ATOM   1390  C  CA    . TYR A  1 187 ? 44.302  15.739  14.494  1.00 26.36 ? 1160 TYR A CA    1 
ATOM   1391  C  C     . TYR A  1 187 ? 43.067  15.062  13.903  1.00 26.73 ? 1160 TYR A C     1 
ATOM   1392  O  O     . TYR A  1 187 ? 42.952  13.831  13.910  1.00 22.77 ? 1160 TYR A O     1 
ATOM   1393  C  CB    . TYR A  1 187 ? 44.605  15.206  15.901  1.00 29.29 ? 1160 TYR A CB    1 
ATOM   1394  C  CG    . TYR A  1 187 ? 46.030  15.468  16.345  1.00 25.14 ? 1160 TYR A CG    1 
ATOM   1395  C  CD1   . TYR A  1 187 ? 46.999  14.470  16.272  1.00 38.21 ? 1160 TYR A CD1   1 
ATOM   1396  C  CD2   . TYR A  1 187 ? 46.409  16.716  16.830  1.00 29.06 ? 1160 TYR A CD2   1 
ATOM   1397  C  CE1   . TYR A  1 187 ? 48.319  14.713  16.681  1.00 32.38 ? 1160 TYR A CE1   1 
ATOM   1398  C  CE2   . TYR A  1 187 ? 47.716  16.971  17.234  1.00 34.25 ? 1160 TYR A CE2   1 
ATOM   1399  C  CZ    . TYR A  1 187 ? 48.665  15.969  17.158  1.00 39.41 ? 1160 TYR A CZ    1 
ATOM   1400  O  OH    . TYR A  1 187 ? 49.960  16.229  17.564  1.00 43.33 ? 1160 TYR A OH    1 
ATOM   1401  N  N     . THR A  1 188 ? 42.142  15.877  13.404  1.00 25.17 ? 1161 THR A N     1 
ATOM   1402  C  CA    . THR A  1 188 ? 41.055  15.388  12.562  1.00 30.60 ? 1161 THR A CA    1 
ATOM   1403  C  C     . THR A  1 188 ? 41.031  16.183  11.265  1.00 28.84 ? 1161 THR A C     1 
ATOM   1404  O  O     . THR A  1 188 ? 41.416  17.352  11.239  1.00 33.64 ? 1161 THR A O     1 
ATOM   1405  C  CB    . THR A  1 188 ? 39.676  15.481  13.257  1.00 30.76 ? 1161 THR A CB    1 
ATOM   1406  O  OG1   . THR A  1 188 ? 39.531  16.773  13.858  1.00 41.59 ? 1161 THR A OG1   1 
ATOM   1407  C  CG2   . THR A  1 188 ? 39.528  14.396  14.334  1.00 33.52 ? 1161 THR A CG2   1 
ATOM   1408  N  N     . PHE A  1 189 ? 40.614  15.536  10.186  1.00 24.81 ? 1162 PHE A N     1 
ATOM   1409  C  CA    . PHE A  1 189 ? 40.302  16.243  8.967   1.00 29.63 ? 1162 PHE A CA    1 
ATOM   1410  C  C     . PHE A  1 189 ? 38.787  16.447  8.921   1.00 33.85 ? 1162 PHE A C     1 
ATOM   1411  O  O     . PHE A  1 189 ? 38.018  15.493  9.053   1.00 34.91 ? 1162 PHE A O     1 
ATOM   1412  C  CB    . PHE A  1 189 ? 40.822  15.496  7.735   1.00 28.90 ? 1162 PHE A CB    1 
ATOM   1413  C  CG    . PHE A  1 189 ? 40.644  16.256  6.441   1.00 24.39 ? 1162 PHE A CG    1 
ATOM   1414  C  CD1   . PHE A  1 189 ? 41.365  17.412  6.190   1.00 31.67 ? 1162 PHE A CD1   1 
ATOM   1415  C  CD2   . PHE A  1 189 ? 39.759  15.802  5.470   1.00 34.81 ? 1162 PHE A CD2   1 
ATOM   1416  C  CE1   . PHE A  1 189 ? 41.200  18.112  4.992   1.00 33.43 ? 1162 PHE A CE1   1 
ATOM   1417  C  CE2   . PHE A  1 189 ? 39.592  16.489  4.276   1.00 23.74 ? 1162 PHE A CE2   1 
ATOM   1418  C  CZ    . PHE A  1 189 ? 40.313  17.648  4.038   1.00 27.00 ? 1162 PHE A CZ    1 
ATOM   1419  N  N     . CYS A  1 190 ? 38.375  17.704  8.759   1.00 35.81 ? 1163 CYS A N     1 
ATOM   1420  C  CA    . CYS A  1 190 ? 36.969  18.087  8.854   1.00 36.69 ? 1163 CYS A CA    1 
ATOM   1421  C  C     . CYS A  1 190 ? 36.426  18.611  7.529   1.00 34.49 ? 1163 CYS A C     1 
ATOM   1422  O  O     . CYS A  1 190 ? 35.282  19.064  7.454   1.00 38.83 ? 1163 CYS A O     1 
ATOM   1423  C  CB    . CYS A  1 190 ? 36.774  19.130  9.968   1.00 34.48 ? 1163 CYS A CB    1 
ATOM   1424  S  SG    . CYS A  1 190 ? 37.299  18.564  11.613  1.00 43.42 ? 1163 CYS A SG    1 
ATOM   1425  N  N     . GLY A  1 191 ? 37.240  18.532  6.482   1.00 31.88 ? 1164 GLY A N     1 
ATOM   1426  C  CA    . GLY A  1 191 ? 36.860  19.069  5.181   1.00 31.61 ? 1164 GLY A CA    1 
ATOM   1427  C  C     . GLY A  1 191 ? 36.281  18.061  4.203   1.00 34.28 ? 1164 GLY A C     1 
ATOM   1428  O  O     . GLY A  1 191 ? 35.717  17.034  4.592   1.00 33.53 ? 1164 GLY A O     1 
ATOM   1429  N  N     . THR A  1 192 ? 36.423  18.385  2.922   1.00 34.48 ? 1165 THR A N     1 
ATOM   1430  C  CA    . THR A  1 192 ? 35.995  17.543  1.814   1.00 33.88 ? 1165 THR A CA    1 
ATOM   1431  C  C     . THR A  1 192 ? 37.239  16.816  1.325   1.00 33.59 ? 1165 THR A C     1 
ATOM   1432  O  O     . THR A  1 192 ? 38.238  17.462  0.978   1.00 33.72 ? 1165 THR A O     1 
ATOM   1433  C  CB    . THR A  1 192 ? 35.392  18.427  0.693   1.00 34.92 ? 1165 THR A CB    1 
ATOM   1434  O  OG1   . THR A  1 192 ? 34.298  19.179  1.231   1.00 35.89 ? 1165 THR A OG1   1 
ATOM   1435  C  CG2   . THR A  1 192 ? 34.903  17.601  -0.496  1.00 25.55 ? 1165 THR A CG2   1 
ATOM   1436  N  N     . ILE A  1 193 ? 37.182  15.481  1.322   1.00 30.85 ? 1166 ILE A N     1 
ATOM   1437  C  CA    . ILE A  1 193 ? 38.353  14.631  1.031   1.00 29.86 ? 1166 ILE A CA    1 
ATOM   1438  C  C     . ILE A  1 193 ? 38.887  14.760  -0.414  1.00 25.47 ? 1166 ILE A C     1 
ATOM   1439  O  O     . ILE A  1 193 ? 40.047  14.437  -0.682  1.00 26.20 ? 1166 ILE A O     1 
ATOM   1440  C  CB    . ILE A  1 193 ? 38.101  13.141  1.465   1.00 31.18 ? 1166 ILE A CB    1 
ATOM   1441  C  CG1   . ILE A  1 193 ? 38.326  12.961  2.976   1.00 39.85 ? 1166 ILE A CG1   1 
ATOM   1442  C  CG2   . ILE A  1 193 ? 38.973  12.163  0.696   1.00 42.57 ? 1166 ILE A CG2   1 
ATOM   1443  C  CD1   . ILE A  1 193 ? 39.793  12.768  3.429   1.00 26.58 ? 1166 ILE A CD1   1 
ATOM   1444  N  N     . GLU A  1 194 ? 38.058  15.258  -1.329  1.00 26.54 ? 1167 GLU A N     1 
ATOM   1445  C  CA    . GLU A  1 194 ? 38.512  15.603  -2.689  1.00 29.98 ? 1167 GLU A CA    1 
ATOM   1446  C  C     . GLU A  1 194 ? 39.374  16.867  -2.700  1.00 29.84 ? 1167 GLU A C     1 
ATOM   1447  O  O     . GLU A  1 194 ? 40.050  17.154  -3.693  1.00 30.22 ? 1167 GLU A O     1 
ATOM   1448  C  CB    . GLU A  1 194 ? 37.338  15.808  -3.658  1.00 31.28 ? 1167 GLU A CB    1 
ATOM   1449  C  CG    . GLU A  1 194 ? 36.415  14.619  -3.826  1.00 40.76 ? 1167 GLU A CG    1 
ATOM   1450  C  CD    . GLU A  1 194 ? 35.129  14.784  -3.047  1.00 47.59 ? 1167 GLU A CD    1 
ATOM   1451  O  OE1   . GLU A  1 194 ? 34.422  15.797  -3.267  1.00 59.49 ? 1167 GLU A OE1   1 
ATOM   1452  O  OE2   . GLU A  1 194 ? 34.817  13.902  -2.221  1.00 47.88 ? 1167 GLU A OE2   1 
ATOM   1453  N  N     . TYR A  1 195 ? 39.335  17.621  -1.603  1.00 27.01 ? 1168 TYR A N     1 
ATOM   1454  C  CA    . TYR A  1 195 ? 40.096  18.861  -1.487  1.00 27.56 ? 1168 TYR A CA    1 
ATOM   1455  C  C     . TYR A  1 195 ? 41.284  18.704  -0.559  1.00 26.86 ? 1168 TYR A C     1 
ATOM   1456  O  O     . TYR A  1 195 ? 42.020  19.659  -0.301  1.00 28.45 ? 1168 TYR A O     1 
ATOM   1457  C  CB    . TYR A  1 195 ? 39.177  19.999  -1.045  1.00 25.52 ? 1168 TYR A CB    1 
ATOM   1458  C  CG    . TYR A  1 195 ? 38.327  20.472  -2.184  1.00 23.55 ? 1168 TYR A CG    1 
ATOM   1459  C  CD1   . TYR A  1 195 ? 37.281  19.686  -2.670  1.00 13.31 ? 1168 TYR A CD1   1 
ATOM   1460  C  CD2   . TYR A  1 195 ? 38.602  21.679  -2.821  1.00 12.25 ? 1168 TYR A CD2   1 
ATOM   1461  C  CE1   . TYR A  1 195 ? 36.513  20.103  -3.737  1.00 15.85 ? 1168 TYR A CE1   1 
ATOM   1462  C  CE2   . TYR A  1 195 ? 37.853  22.091  -3.889  1.00 14.76 ? 1168 TYR A CE2   1 
ATOM   1463  C  CZ    . TYR A  1 195 ? 36.806  21.308  -4.342  1.00 19.76 ? 1168 TYR A CZ    1 
ATOM   1464  O  OH    . TYR A  1 195 ? 36.053  21.746  -5.409  1.00 27.73 ? 1168 TYR A OH    1 
ATOM   1465  N  N     . CYS A  1 196 ? 41.473  17.469  -0.106  1.00 27.48 ? 1169 CYS A N     1 
ATOM   1466  C  CA    . CYS A  1 196 ? 42.478  17.099  0.878   1.00 24.74 ? 1169 CYS A CA    1 
ATOM   1467  C  C     . CYS A  1 196 ? 43.873  16.938  0.294   1.00 21.71 ? 1169 CYS A C     1 
ATOM   1468  O  O     . CYS A  1 196 ? 44.054  16.259  -0.716  1.00 22.31 ? 1169 CYS A O     1 
ATOM   1469  C  CB    . CYS A  1 196 ? 42.077  15.791  1.545   1.00 26.65 ? 1169 CYS A CB    1 
ATOM   1470  S  SG    . CYS A  1 196 ? 42.882  15.528  3.107   1.00 31.42 ? 1169 CYS A SG    1 
ATOM   1471  N  N     . ALA A  1 197 ? 44.843  17.562  0.962   1.00 17.34 ? 1170 ALA A N     1 
ATOM   1472  C  CA    . ALA A  1 197 ? 46.261  17.502  0.598   1.00 21.14 ? 1170 ALA A CA    1 
ATOM   1473  C  C     . ALA A  1 197 ? 46.838  16.090  0.806   1.00 20.00 ? 1170 ALA A C     1 
ATOM   1474  O  O     . ALA A  1 197 ? 46.426  15.392  1.726   1.00 18.61 ? 1170 ALA A O     1 
ATOM   1475  C  CB    . ALA A  1 197 ? 47.044  18.535  1.427   1.00 16.14 ? 1170 ALA A CB    1 
ATOM   1476  N  N     . PRO A  1 198 ? 47.792  15.665  -0.048  1.00 23.31 ? 1171 PRO A N     1 
ATOM   1477  C  CA    . PRO A  1 198 ? 48.384  14.318  0.068   1.00 25.01 ? 1171 PRO A CA    1 
ATOM   1478  C  C     . PRO A  1 198 ? 48.977  14.001  1.445   1.00 26.62 ? 1171 PRO A C     1 
ATOM   1479  O  O     . PRO A  1 198 ? 48.741  12.909  1.968   1.00 25.32 ? 1171 PRO A O     1 
ATOM   1480  C  CB    . PRO A  1 198 ? 49.475  14.300  -1.017  1.00 25.94 ? 1171 PRO A CB    1 
ATOM   1481  C  CG    . PRO A  1 198 ? 49.650  15.730  -1.438  1.00 23.98 ? 1171 PRO A CG    1 
ATOM   1482  C  CD    . PRO A  1 198 ? 48.351  16.413  -1.185  1.00 22.77 ? 1171 PRO A CD    1 
ATOM   1483  N  N     . GLU A  1 199 ? 49.710  14.943  2.045   1.00 28.64 ? 1172 GLU A N     1 
ATOM   1484  C  CA    . GLU A  1 199 ? 50.284  14.707  3.380   1.00 26.91 ? 1172 GLU A CA    1 
ATOM   1485  C  C     . GLU A  1 199 ? 49.211  14.378  4.433   1.00 29.82 ? 1172 GLU A C     1 
ATOM   1486  O  O     . GLU A  1 199 ? 49.489  13.693  5.412   1.00 30.51 ? 1172 GLU A O     1 
ATOM   1487  C  CB    . GLU A  1 199 ? 51.176  15.876  3.831   1.00 29.95 ? 1172 GLU A CB    1 
ATOM   1488  C  CG    . GLU A  1 199 ? 50.454  17.168  4.256   1.00 23.88 ? 1172 GLU A CG    1 
ATOM   1489  C  CD    . GLU A  1 199 ? 50.180  18.170  3.125   1.00 30.25 ? 1172 GLU A CD    1 
ATOM   1490  O  OE1   . GLU A  1 199 ? 50.366  17.849  1.927   1.00 23.98 ? 1172 GLU A OE1   1 
ATOM   1491  O  OE2   . GLU A  1 199 ? 49.760  19.303  3.455   1.00 25.67 ? 1172 GLU A OE2   1 
ATOM   1492  N  N     . VAL A  1 200 ? 47.983  14.853  4.215   1.00 31.54 ? 1173 VAL A N     1 
ATOM   1493  C  CA    . VAL A  1 200 ? 46.892  14.638  5.169   1.00 25.39 ? 1173 VAL A CA    1 
ATOM   1494  C  C     . VAL A  1 200 ? 46.130  13.338  4.887   1.00 20.65 ? 1173 VAL A C     1 
ATOM   1495  O  O     . VAL A  1 200 ? 45.757  12.625  5.816   1.00 24.62 ? 1173 VAL A O     1 
ATOM   1496  C  CB    . VAL A  1 200 ? 45.944  15.868  5.247   1.00 26.56 ? 1173 VAL A CB    1 
ATOM   1497  C  CG1   . VAL A  1 200 ? 44.726  15.566  6.115   1.00 16.28 ? 1173 VAL A CG1   1 
ATOM   1498  C  CG2   . VAL A  1 200 ? 46.693  17.075  5.790   1.00 23.82 ? 1173 VAL A CG2   1 
ATOM   1499  N  N     . LEU A  1 201 ? 45.921  13.031  3.611   1.00 21.24 ? 1174 LEU A N     1 
ATOM   1500  C  CA    . LEU A  1 201 ? 45.352  11.748  3.179   1.00 28.59 ? 1174 LEU A CA    1 
ATOM   1501  C  C     . LEU A  1 201 ? 46.189  10.542  3.644   1.00 32.15 ? 1174 LEU A C     1 
ATOM   1502  O  O     . LEU A  1 201 ? 45.707  9.403   3.676   1.00 38.46 ? 1174 LEU A O     1 
ATOM   1503  C  CB    . LEU A  1 201 ? 45.200  11.718  1.654   1.00 22.17 ? 1174 LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1 201 ? 44.122  12.604  1.014   1.00 32.37 ? 1174 LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1 201 ? 44.400  12.820  -0.474  1.00 24.58 ? 1174 LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1 201 ? 42.733  12.010  1.207   1.00 31.58 ? 1174 LEU A CD2   1 
ATOM   1507  N  N     . MET A  1 202 ? 47.437  10.810  4.004   1.00 31.66 ? 1175 MET A N     1 
ATOM   1508  C  CA    . MET A  1 202 ? 48.351  9.796   4.491   1.00 31.42 ? 1175 MET A CA    1 
ATOM   1509  C  C     . MET A  1 202 ? 48.394  9.720   6.012   1.00 30.94 ? 1175 MET A C     1 
ATOM   1510  O  O     . MET A  1 202 ? 49.206  8.986   6.576   1.00 31.52 ? 1175 MET A O     1 
ATOM   1511  C  CB    . MET A  1 202 ? 49.742  10.037  3.910   1.00 30.25 ? 1175 MET A CB    1 
ATOM   1512  C  CG    . MET A  1 202 ? 49.732  9.924   2.401   1.00 34.44 ? 1175 MET A CG    1 
ATOM   1513  S  SD    . MET A  1 202 ? 51.349  9.921   1.669   1.00 36.26 ? 1175 MET A SD    1 
ATOM   1514  C  CE    . MET A  1 202 ? 51.562  8.192   1.300   1.00 32.96 ? 1175 MET A CE    1 
ATOM   1515  N  N     . GLY A  1 203 ? 47.529  10.488  6.670   1.00 24.85 ? 1176 GLY A N     1 
ATOM   1516  C  CA    . GLY A  1 203 ? 47.288  10.319  8.104   1.00 20.60 ? 1176 GLY A CA    1 
ATOM   1517  C  C     . GLY A  1 203 ? 48.107  11.222  8.996   1.00 21.57 ? 1176 GLY A C     1 
ATOM   1518  O  O     . GLY A  1 203 ? 48.252  10.958  10.187  1.00 18.44 ? 1176 GLY A O     1 
ATOM   1519  N  N     . ASN A  1 204 ? 48.635  12.298  8.423   1.00 22.19 ? 1177 ASN A N     1 
ATOM   1520  C  CA    . ASN A  1 204 ? 49.486  13.206  9.174   1.00 26.82 ? 1177 ASN A CA    1 
ATOM   1521  C  C     . ASN A  1 204 ? 48.709  14.397  9.740   1.00 26.44 ? 1177 ASN A C     1 
ATOM   1522  O  O     . ASN A  1 204 ? 47.902  15.006  9.035   1.00 27.15 ? 1177 ASN A O     1 
ATOM   1523  C  CB    . ASN A  1 204 ? 50.704  13.648  8.344   1.00 23.15 ? 1177 ASN A CB    1 
ATOM   1524  C  CG    . ASN A  1 204 ? 51.686  12.501  8.084   1.00 30.25 ? 1177 ASN A CG    1 
ATOM   1525  O  OD1   . ASN A  1 204 ? 52.268  11.944  9.015   1.00 30.91 ? 1177 ASN A OD1   1 
ATOM   1526  N  ND2   . ASN A  1 204 ? 51.864  12.141  6.812   1.00 23.93 ? 1177 ASN A ND2   1 
ATOM   1527  N  N     . PRO A  1 205 ? 48.908  14.694  11.037  1.00 25.48 ? 1178 PRO A N     1 
ATOM   1528  C  CA    . PRO A  1 205 ? 48.343  15.908  11.608  1.00 26.74 ? 1178 PRO A CA    1 
ATOM   1529  C  C     . PRO A  1 205 ? 48.924  17.153  10.920  1.00 22.99 ? 1178 PRO A C     1 
ATOM   1530  O  O     . PRO A  1 205 ? 50.090  17.153  10.506  1.00 24.80 ? 1178 PRO A O     1 
ATOM   1531  C  CB    . PRO A  1 205 ? 48.745  15.832  13.093  1.00 27.68 ? 1178 PRO A CB    1 
ATOM   1532  C  CG    . PRO A  1 205 ? 49.090  14.414  13.344  1.00 28.36 ? 1178 PRO A CG    1 
ATOM   1533  C  CD    . PRO A  1 205 ? 49.635  13.895  12.041  1.00 31.47 ? 1178 PRO A CD    1 
ATOM   1534  N  N     . TYR A  1 206 ? 48.099  18.186  10.771  1.00 22.92 ? 1179 TYR A N     1 
ATOM   1535  C  CA    . TYR A  1 206 ? 48.464  19.357  9.957   1.00 20.53 ? 1179 TYR A CA    1 
ATOM   1536  C  C     . TYR A  1 206 ? 48.389  20.652  10.748  1.00 17.81 ? 1179 TYR A C     1 
ATOM   1537  O  O     . TYR A  1 206 ? 47.609  20.773  11.699  1.00 21.01 ? 1179 TYR A O     1 
ATOM   1538  C  CB    . TYR A  1 206 ? 47.602  19.437  8.682   1.00 18.75 ? 1179 TYR A CB    1 
ATOM   1539  C  CG    . TYR A  1 206 ? 46.109  19.545  8.939   1.00 19.23 ? 1179 TYR A CG    1 
ATOM   1540  C  CD1   . TYR A  1 206 ? 45.317  18.401  9.065   1.00 15.11 ? 1179 TYR A CD1   1 
ATOM   1541  C  CD2   . TYR A  1 206 ? 45.495  20.785  9.061   1.00 16.50 ? 1179 TYR A CD2   1 
ATOM   1542  C  CE1   . TYR A  1 206 ? 43.955  18.491  9.315   1.00 31.10 ? 1179 TYR A CE1   1 
ATOM   1543  C  CE2   . TYR A  1 206 ? 44.127  20.891  9.319   1.00 20.51 ? 1179 TYR A CE2   1 
ATOM   1544  C  CZ    . TYR A  1 206 ? 43.363  19.738  9.437   1.00 28.96 ? 1179 TYR A CZ    1 
ATOM   1545  O  OH    . TYR A  1 206 ? 42.009  19.831  9.677   1.00 28.38 ? 1179 TYR A OH    1 
ATOM   1546  N  N     . ARG A  1 207 ? 49.207  21.617  10.345  1.00 21.72 ? 1180 ARG A N     1 
ATOM   1547  C  CA    . ARG A  1 207 ? 49.206  22.956  10.941  1.00 24.80 ? 1180 ARG A CA    1 
ATOM   1548  C  C     . ARG A  1 207 ? 47.999  23.804  10.493  1.00 23.72 ? 1180 ARG A C     1 
ATOM   1549  O  O     . ARG A  1 207 ? 47.405  24.524  11.295  1.00 24.49 ? 1180 ARG A O     1 
ATOM   1550  C  CB    . ARG A  1 207 ? 50.515  23.674  10.603  1.00 25.09 ? 1180 ARG A CB    1 
ATOM   1551  C  CG    . ARG A  1 207 ? 50.989  24.631  11.676  1.00 32.47 ? 1180 ARG A CG    1 
ATOM   1552  C  CD    . ARG A  1 207 ? 52.289  25.327  11.264  1.00 32.05 ? 1180 ARG A CD    1 
ATOM   1553  N  NE    . ARG A  1 207 ? 52.032  26.662  10.729  1.00 44.98 ? 1180 ARG A NE    1 
ATOM   1554  C  CZ    . ARG A  1 207 ? 52.422  27.101  9.535   1.00 40.70 ? 1180 ARG A CZ    1 
ATOM   1555  N  NH1   . ARG A  1 207 ? 53.125  26.328  8.718   1.00 33.57 ? 1180 ARG A NH1   1 
ATOM   1556  N  NH2   . ARG A  1 207 ? 52.123  28.339  9.171   1.00 43.21 ? 1180 ARG A NH2   1 
ATOM   1557  N  N     . GLY A  1 208 ? 47.644  23.716  9.215   1.00 24.45 ? 1181 GLY A N     1 
ATOM   1558  C  CA    . GLY A  1 208 ? 46.510  24.461  8.680   1.00 20.43 ? 1181 GLY A CA    1 
ATOM   1559  C  C     . GLY A  1 208 ? 46.808  25.136  7.358   1.00 22.31 ? 1181 GLY A C     1 
ATOM   1560  O  O     . GLY A  1 208 ? 46.163  24.827  6.360   1.00 24.06 ? 1181 GLY A O     1 
ATOM   1561  N  N     . PRO A  1 209 ? 47.769  26.086  7.348   1.00 25.07 ? 1182 PRO A N     1 
ATOM   1562  C  CA    . PRO A  1 209 ? 48.171  26.840  6.147   1.00 22.72 ? 1182 PRO A CA    1 
ATOM   1563  C  C     . PRO A  1 209 ? 48.415  26.047  4.872   1.00 20.69 ? 1182 PRO A C     1 
ATOM   1564  O  O     . PRO A  1 209 ? 47.852  26.397  3.849   1.00 22.54 ? 1182 PRO A O     1 
ATOM   1565  C  CB    . PRO A  1 209 ? 49.443  27.564  6.611   1.00 18.68 ? 1182 PRO A CB    1 
ATOM   1566  C  CG    . PRO A  1 209 ? 49.145  27.847  8.043   1.00 20.30 ? 1182 PRO A CG    1 
ATOM   1567  C  CD    . PRO A  1 209 ? 48.487  26.586  8.542   1.00 22.23 ? 1182 PRO A CD    1 
ATOM   1568  N  N     . GLU A  1 210 ? 49.245  25.003  4.920   1.00 24.11 ? 1183 GLU A N     1 
ATOM   1569  C  CA    . GLU A  1 210 ? 49.626  24.275  3.702   1.00 25.53 ? 1183 GLU A CA    1 
ATOM   1570  C  C     . GLU A  1 210 ? 48.451  23.516  3.090   1.00 22.51 ? 1183 GLU A C     1 
ATOM   1571  O  O     . GLU A  1 210 ? 48.332  23.437  1.877   1.00 22.58 ? 1183 GLU A O     1 
ATOM   1572  C  CB    . GLU A  1 210 ? 50.824  23.336  3.938   1.00 30.87 ? 1183 GLU A CB    1 
ATOM   1573  C  CG    . GLU A  1 210 ? 52.040  23.986  4.639   1.00 28.36 ? 1183 GLU A CG    1 
ATOM   1574  C  CD    . GLU A  1 210 ? 52.059  23.727  6.148   1.00 34.40 ? 1183 GLU A CD    1 
ATOM   1575  O  OE1   . GLU A  1 210 ? 51.095  24.105  6.847   1.00 22.28 ? 1183 GLU A OE1   1 
ATOM   1576  O  OE2   . GLU A  1 210 ? 53.047  23.143  6.641   1.00 42.06 ? 1183 GLU A OE2   1 
ATOM   1577  N  N     . LEU A  1 211 ? 47.587  22.965  3.938   1.00 21.48 ? 1184 LEU A N     1 
ATOM   1578  C  CA    . LEU A  1 211 ? 46.396  22.241  3.477   1.00 21.98 ? 1184 LEU A CA    1 
ATOM   1579  C  C     . LEU A  1 211 ? 45.355  23.212  2.895   1.00 17.17 ? 1184 LEU A C     1 
ATOM   1580  O  O     . LEU A  1 211 ? 44.735  22.918  1.880   1.00 17.25 ? 1184 LEU A O     1 
ATOM   1581  C  CB    . LEU A  1 211 ? 45.816  21.396  4.618   1.00 22.00 ? 1184 LEU A CB    1 
ATOM   1582  C  CG    . LEU A  1 211 ? 44.440  20.747  4.483   1.00 19.87 ? 1184 LEU A CG    1 
ATOM   1583  C  CD1   . LEU A  1 211 ? 44.517  19.428  3.758   1.00 31.14 ? 1184 LEU A CD1   1 
ATOM   1584  C  CD2   . LEU A  1 211 ? 43.856  20.548  5.854   1.00 14.85 ? 1184 LEU A CD2   1 
ATOM   1585  N  N     . GLU A  1 212 ? 45.196  24.379  3.524   1.00 19.03 ? 1185 GLU A N     1 
ATOM   1586  C  CA    . GLU A  1 212 ? 44.397  25.470  2.947   1.00 16.39 ? 1185 GLU A CA    1 
ATOM   1587  C  C     . GLU A  1 212 ? 44.840  25.825  1.531   1.00 18.29 ? 1185 GLU A C     1 
ATOM   1588  O  O     . GLU A  1 212 ? 43.992  26.001  0.650   1.00 21.56 ? 1185 GLU A O     1 
ATOM   1589  C  CB    . GLU A  1 212 ? 44.435  26.708  3.841   1.00 17.32 ? 1185 GLU A CB    1 
ATOM   1590  C  CG    . GLU A  1 212 ? 43.796  27.952  3.233   1.00 12.73 ? 1185 GLU A CG    1 
ATOM   1591  C  CD    . GLU A  1 212 ? 43.271  28.878  4.299   1.00 32.03 ? 1185 GLU A CD    1 
ATOM   1592  O  OE1   . GLU A  1 212 ? 44.020  29.795  4.683   1.00 43.79 ? 1185 GLU A OE1   1 
ATOM   1593  O  OE2   . GLU A  1 212 ? 42.120  28.687  4.761   1.00 31.11 ? 1185 GLU A OE2   1 
ATOM   1594  N  N     . MET A  1 213 ? 46.163  25.916  1.333   1.00 11.67 ? 1186 MET A N     1 
ATOM   1595  C  CA    . MET A  1 213 ? 46.773  26.283  0.060   1.00 11.52 ? 1186 MET A CA    1 
ATOM   1596  C  C     . MET A  1 213 ? 46.555  25.269  -1.041  1.00 14.94 ? 1186 MET A C     1 
ATOM   1597  O  O     . MET A  1 213 ? 46.404  25.652  -2.207  1.00 16.33 ? 1186 MET A O     1 
ATOM   1598  C  CB    . MET A  1 213 ? 48.286  26.539  0.215   1.00 14.97 ? 1186 MET A CB    1 
ATOM   1599  C  CG    . MET A  1 213 ? 48.666  27.753  1.113   1.00 15.78 ? 1186 MET A CG    1 
ATOM   1600  S  SD    . MET A  1 213 ? 47.717  29.289  0.949   1.00 19.88 ? 1186 MET A SD    1 
ATOM   1601  C  CE    . MET A  1 213 ? 48.037  29.733  -0.753  1.00 17.24 ? 1186 MET A CE    1 
ATOM   1602  N  N     . TRP A  1 214 ? 46.587  23.985  -0.667  1.00 18.27 ? 1187 TRP A N     1 
ATOM   1603  C  CA    . TRP A  1 214 ? 46.283  22.867  -1.559  1.00 13.78 ? 1187 TRP A CA    1 
ATOM   1604  C  C     . TRP A  1 214 ? 44.822  22.906  -2.019  1.00 13.08 ? 1187 TRP A C     1 
ATOM   1605  O  O     . TRP A  1 214 ? 44.531  22.687  -3.193  1.00 17.22 ? 1187 TRP A O     1 
ATOM   1606  C  CB    . TRP A  1 214 ? 46.592  21.506  -0.882  1.00 14.11 ? 1187 TRP A CB    1 
ATOM   1607  C  CG    . TRP A  1 214 ? 46.136  20.338  -1.727  1.00 7.38  ? 1187 TRP A CG    1 
ATOM   1608  C  CD1   . TRP A  1 214 ? 44.860  19.855  -1.827  1.00 12.54 ? 1187 TRP A CD1   1 
ATOM   1609  C  CD2   . TRP A  1 214 ? 46.931  19.544  -2.625  1.00 7.04  ? 1187 TRP A CD2   1 
ATOM   1610  N  NE1   . TRP A  1 214 ? 44.815  18.815  -2.713  1.00 7.91  ? 1187 TRP A NE1   1 
ATOM   1611  C  CE2   . TRP A  1 214 ? 46.064  18.607  -3.228  1.00 10.14 ? 1187 TRP A CE2   1 
ATOM   1612  C  CE3   . TRP A  1 214 ? 48.289  19.530  -2.972  1.00 17.59 ? 1187 TRP A CE3   1 
ATOM   1613  C  CZ2   . TRP A  1 214 ? 46.509  17.653  -4.156  1.00 20.92 ? 1187 TRP A CZ2   1 
ATOM   1614  C  CZ3   . TRP A  1 214 ? 48.734  18.587  -3.903  1.00 20.97 ? 1187 TRP A CZ3   1 
ATOM   1615  C  CH2   . TRP A  1 214 ? 47.844  17.658  -4.480  1.00 21.02 ? 1187 TRP A CH2   1 
ATOM   1616  N  N     . SER A  1 215 ? 43.910  23.178  -1.084  1.00 13.40 ? 1188 SER A N     1 
ATOM   1617  C  CA    . SER A  1 215 ? 42.491  23.221  -1.383  1.00 13.02 ? 1188 SER A CA    1 
ATOM   1618  C  C     . SER A  1 215 ? 42.118  24.429  -2.266  1.00 19.65 ? 1188 SER A C     1 
ATOM   1619  O  O     . SER A  1 215 ? 41.105  24.386  -2.974  1.00 21.41 ? 1188 SER A O     1 
ATOM   1620  C  CB    . SER A  1 215 ? 41.660  23.167  -0.103  1.00 6.40  ? 1188 SER A CB    1 
ATOM   1621  O  OG    . SER A  1 215 ? 41.544  24.445  0.521   1.00 22.38 ? 1188 SER A OG    1 
ATOM   1622  N  N     . LEU A  1 216 ? 42.941  25.485  -2.226  1.00 11.51 ? 1189 LEU A N     1 
ATOM   1623  C  CA    . LEU A  1 216 ? 42.800  26.621  -3.131  1.00 14.70 ? 1189 LEU A CA    1 
ATOM   1624  C  C     . LEU A  1 216 ? 43.238  26.238  -4.542  1.00 15.24 ? 1189 LEU A C     1 
ATOM   1625  O  O     . LEU A  1 216 ? 42.724  26.770  -5.516  1.00 19.67 ? 1189 LEU A O     1 
ATOM   1626  C  CB    . LEU A  1 216 ? 43.585  27.851  -2.629  1.00 11.62 ? 1189 LEU A CB    1 
ATOM   1627  C  CG    . LEU A  1 216 ? 42.966  28.648  -1.479  1.00 16.85 ? 1189 LEU A CG    1 
ATOM   1628  C  CD1   . LEU A  1 216 ? 43.981  29.626  -0.862  1.00 17.18 ? 1189 LEU A CD1   1 
ATOM   1629  C  CD2   . LEU A  1 216 ? 41.739  29.391  -1.963  1.00 12.68 ? 1189 LEU A CD2   1 
ATOM   1630  N  N     . GLY A  1 217 ? 44.185  25.307  -4.627  1.00 26.70 ? 1190 GLY A N     1 
ATOM   1631  C  CA    . GLY A  1 217 ? 44.658  24.752  -5.894  1.00 20.68 ? 1190 GLY A CA    1 
ATOM   1632  C  C     . GLY A  1 217 ? 43.603  23.915  -6.590  1.00 17.34 ? 1190 GLY A C     1 
ATOM   1633  O  O     . GLY A  1 217 ? 43.439  24.020  -7.802  1.00 20.80 ? 1190 GLY A O     1 
ATOM   1634  N  N     . VAL A  1 218 ? 42.905  23.078  -5.822  1.00 16.98 ? 1191 VAL A N     1 
ATOM   1635  C  CA    . VAL A  1 218 ? 41.808  22.244  -6.326  1.00 14.65 ? 1191 VAL A CA    1 
ATOM   1636  C  C     . VAL A  1 218 ? 40.625  23.100  -6.779  1.00 18.62 ? 1191 VAL A C     1 
ATOM   1637  O  O     . VAL A  1 218 ? 40.031  22.847  -7.836  1.00 17.89 ? 1191 VAL A O     1 
ATOM   1638  C  CB    . VAL A  1 218 ? 41.310  21.206  -5.268  1.00 14.64 ? 1191 VAL A CB    1 
ATOM   1639  C  CG1   . VAL A  1 218 ? 40.235  20.249  -5.877  1.00 6.31  ? 1191 VAL A CG1   1 
ATOM   1640  C  CG2   . VAL A  1 218 ? 42.467  20.400  -4.695  1.00 17.23 ? 1191 VAL A CG2   1 
ATOM   1641  N  N     . THR A  1 219 ? 40.278  24.092  -5.957  1.00 19.97 ? 1192 THR A N     1 
ATOM   1642  C  CA    . THR A  1 219 ? 39.207  25.045  -6.264  1.00 18.05 ? 1192 THR A CA    1 
ATOM   1643  C  C     . THR A  1 219 ? 39.510  25.849  -7.537  1.00 20.16 ? 1192 THR A C     1 
ATOM   1644  O  O     . THR A  1 219 ? 38.635  26.031  -8.406  1.00 18.58 ? 1192 THR A O     1 
ATOM   1645  C  CB    . THR A  1 219 ? 38.955  25.984  -5.063  1.00 16.17 ? 1192 THR A CB    1 
ATOM   1646  O  OG1   . THR A  1 219 ? 38.652  25.191  -3.911  1.00 22.33 ? 1192 THR A OG1   1 
ATOM   1647  C  CG2   . THR A  1 219 ? 37.794  26.925  -5.326  1.00 19.57 ? 1192 THR A CG2   1 
ATOM   1648  N  N     . LEU A  1 220 ? 40.752  26.321  -7.642  1.00 21.31 ? 1193 LEU A N     1 
ATOM   1649  C  CA    . LEU A  1 220 ? 41.212  27.039  -8.824  1.00 20.69 ? 1193 LEU A CA    1 
ATOM   1650  C  C     . LEU A  1 220 ? 41.114  26.165  -10.067 1.00 19.36 ? 1193 LEU A C     1 
ATOM   1651  O  O     . LEU A  1 220 ? 40.534  26.576  -11.083 1.00 18.95 ? 1193 LEU A O     1 
ATOM   1652  C  CB    . LEU A  1 220 ? 42.654  27.506  -8.625  1.00 24.45 ? 1193 LEU A CB    1 
ATOM   1653  C  CG    . LEU A  1 220 ? 43.388  28.200  -9.769  1.00 21.97 ? 1193 LEU A CG    1 
ATOM   1654  C  CD1   . LEU A  1 220 ? 42.609  29.417  -10.303 1.00 18.16 ? 1193 LEU A CD1   1 
ATOM   1655  C  CD2   . LEU A  1 220 ? 44.745  28.621  -9.244  1.00 22.32 ? 1193 LEU A CD2   1 
ATOM   1656  N  N     . TYR A  1 221 ? 41.686  24.963  -9.972  1.00 17.61 ? 1194 TYR A N     1 
ATOM   1657  C  CA    . TYR A  1 221 ? 41.666  23.980  -11.053 1.00 19.75 ? 1194 TYR A CA    1 
ATOM   1658  C  C     . TYR A  1 221 ? 40.236  23.658  -11.519 1.00 20.12 ? 1194 TYR A C     1 
ATOM   1659  O  O     . TYR A  1 221 ? 39.985  23.575  -12.717 1.00 21.83 ? 1194 TYR A O     1 
ATOM   1660  C  CB    . TYR A  1 221 ? 42.431  22.704  -10.639 1.00 20.38 ? 1194 TYR A CB    1 
ATOM   1661  C  CG    . TYR A  1 221 ? 42.654  21.725  -11.774 1.00 20.20 ? 1194 TYR A CG    1 
ATOM   1662  C  CD1   . TYR A  1 221 ? 41.604  20.935  -12.257 1.00 13.86 ? 1194 TYR A CD1   1 
ATOM   1663  C  CD2   . TYR A  1 221 ? 43.906  21.595  -12.376 1.00 18.70 ? 1194 TYR A CD2   1 
ATOM   1664  C  CE1   . TYR A  1 221 ? 41.791  20.054  -13.315 1.00 16.49 ? 1194 TYR A CE1   1 
ATOM   1665  C  CE2   . TYR A  1 221 ? 44.105  20.698  -13.433 1.00 19.43 ? 1194 TYR A CE2   1 
ATOM   1666  C  CZ    . TYR A  1 221 ? 43.046  19.929  -13.886 1.00 11.51 ? 1194 TYR A CZ    1 
ATOM   1667  O  OH    . TYR A  1 221 ? 43.218  19.045  -14.928 1.00 22.43 ? 1194 TYR A OH    1 
ATOM   1668  N  N     . THR A  1 222 ? 39.312  23.481  -10.574 1.00 23.11 ? 1195 THR A N     1 
ATOM   1669  C  CA    . THR A  1 222 ? 37.892  23.211  -10.884 1.00 25.13 ? 1195 THR A CA    1 
ATOM   1670  C  C     . THR A  1 222 ? 37.191  24.398  -11.562 1.00 24.83 ? 1195 THR A C     1 
ATOM   1671  O  O     . THR A  1 222 ? 36.371  24.220  -12.454 1.00 24.53 ? 1195 THR A O     1 
ATOM   1672  C  CB    . THR A  1 222 ? 37.093  22.794  -9.611  1.00 25.54 ? 1195 THR A CB    1 
ATOM   1673  O  OG1   . THR A  1 222 ? 37.829  21.801  -8.886  1.00 35.15 ? 1195 THR A OG1   1 
ATOM   1674  C  CG2   . THR A  1 222 ? 35.739  22.200  -9.983  1.00 27.56 ? 1195 THR A CG2   1 
ATOM   1675  N  N     . LEU A  1 223 ? 37.519  25.605  -11.126 1.00 27.31 ? 1196 LEU A N     1 
ATOM   1676  C  CA    . LEU A  1 223 ? 36.957  26.816  -11.706 1.00 29.67 ? 1196 LEU A CA    1 
ATOM   1677  C  C     . LEU A  1 223 ? 37.298  26.945  -13.197 1.00 28.08 ? 1196 LEU A C     1 
ATOM   1678  O  O     . LEU A  1 223 ? 36.402  27.087  -14.030 1.00 26.70 ? 1196 LEU A O     1 
ATOM   1679  C  CB    . LEU A  1 223 ? 37.411  28.050  -10.909 1.00 29.13 ? 1196 LEU A CB    1 
ATOM   1680  C  CG    . LEU A  1 223 ? 37.073  29.449  -11.431 1.00 31.96 ? 1196 LEU A CG    1 
ATOM   1681  C  CD1   . LEU A  1 223 ? 35.612  29.787  -11.165 1.00 25.61 ? 1196 LEU A CD1   1 
ATOM   1682  C  CD2   . LEU A  1 223 ? 37.995  30.476  -10.790 1.00 25.47 ? 1196 LEU A CD2   1 
ATOM   1683  N  N     . VAL A  1 224 ? 38.579  26.873  -13.541 1.00 28.79 ? 1197 VAL A N     1 
ATOM   1684  C  CA    . VAL A  1 224 ? 38.962  27.067  -14.937 1.00 29.29 ? 1197 VAL A CA    1 
ATOM   1685  C  C     . VAL A  1 224 ? 38.750  25.807  -15.798 1.00 28.78 ? 1197 VAL A C     1 
ATOM   1686  O  O     . VAL A  1 224 ? 38.191  25.896  -16.893 1.00 28.16 ? 1197 VAL A O     1 
ATOM   1687  C  CB    . VAL A  1 224 ? 40.382  27.732  -15.117 1.00 34.88 ? 1197 VAL A CB    1 
ATOM   1688  C  CG1   . VAL A  1 224 ? 40.835  28.447  -13.834 1.00 36.25 ? 1197 VAL A CG1   1 
ATOM   1689  C  CG2   . VAL A  1 224 ? 41.436  26.744  -15.589 1.00 27.03 ? 1197 VAL A CG2   1 
ATOM   1690  N  N     . PHE A  1 225 ? 39.140  24.640  -15.290 1.00 27.41 ? 1198 PHE A N     1 
ATOM   1691  C  CA    . PHE A  1 225 ? 39.124  23.415  -16.107 1.00 28.87 ? 1198 PHE A CA    1 
ATOM   1692  C  C     . PHE A  1 225 ? 37.828  22.627  -16.045 1.00 27.45 ? 1198 PHE A C     1 
ATOM   1693  O  O     . PHE A  1 225 ? 37.634  21.705  -16.833 1.00 32.84 ? 1198 PHE A O     1 
ATOM   1694  C  CB    . PHE A  1 225 ? 40.332  22.524  -15.797 1.00 27.73 ? 1198 PHE A CB    1 
ATOM   1695  C  CG    . PHE A  1 225 ? 41.650  23.142  -16.192 1.00 26.17 ? 1198 PHE A CG    1 
ATOM   1696  C  CD1   . PHE A  1 225 ? 41.917  23.452  -17.516 1.00 24.45 ? 1198 PHE A CD1   1 
ATOM   1697  C  CD2   . PHE A  1 225 ? 42.618  23.412  -15.241 1.00 13.11 ? 1198 PHE A CD2   1 
ATOM   1698  C  CE1   . PHE A  1 225 ? 43.135  24.020  -17.883 1.00 26.96 ? 1198 PHE A CE1   1 
ATOM   1699  C  CE2   . PHE A  1 225 ? 43.830  23.979  -15.595 1.00 21.79 ? 1198 PHE A CE2   1 
ATOM   1700  C  CZ    . PHE A  1 225 ? 44.086  24.289  -16.924 1.00 21.47 ? 1198 PHE A CZ    1 
ATOM   1701  N  N     . GLU A  1 226 ? 36.957  22.996  -15.109 1.00 29.84 ? 1199 GLU A N     1 
ATOM   1702  C  CA    . GLU A  1 226 ? 35.600  22.449  -14.990 1.00 34.16 ? 1199 GLU A CA    1 
ATOM   1703  C  C     . GLU A  1 226 ? 35.566  20.945  -14.705 1.00 34.90 ? 1199 GLU A C     1 
ATOM   1704  O  O     . GLU A  1 226 ? 34.678  20.220  -15.166 1.00 32.11 ? 1199 GLU A O     1 
ATOM   1705  C  CB    . GLU A  1 226 ? 34.742  22.840  -16.203 1.00 36.19 ? 1199 GLU A CB    1 
ATOM   1706  C  CG    . GLU A  1 226 ? 34.461  24.336  -16.259 1.00 38.89 ? 1199 GLU A CG    1 
ATOM   1707  C  CD    . GLU A  1 226 ? 34.031  24.819  -17.627 1.00 42.28 ? 1199 GLU A CD    1 
ATOM   1708  O  OE1   . GLU A  1 226 ? 34.521  24.292  -18.648 1.00 53.34 ? 1199 GLU A OE1   1 
ATOM   1709  O  OE2   . GLU A  1 226 ? 33.207  25.752  -17.693 1.00 42.17 ? 1199 GLU A OE2   1 
ATOM   1710  N  N     . GLU A  1 227 ? 36.552  20.510  -13.924 1.00 34.34 ? 1200 GLU A N     1 
ATOM   1711  C  CA    . GLU A  1 227 ? 36.682  19.138  -13.450 1.00 34.54 ? 1200 GLU A CA    1 
ATOM   1712  C  C     . GLU A  1 227 ? 37.721  19.130  -12.339 1.00 30.25 ? 1200 GLU A C     1 
ATOM   1713  O  O     . GLU A  1 227 ? 38.642  19.948  -12.341 1.00 27.68 ? 1200 GLU A O     1 
ATOM   1714  C  CB    . GLU A  1 227 ? 37.124  18.195  -14.581 1.00 33.90 ? 1200 GLU A CB    1 
ATOM   1715  C  CG    . GLU A  1 227 ? 38.520  18.490  -15.136 1.00 32.62 ? 1200 GLU A CG    1 
ATOM   1716  C  CD    . GLU A  1 227 ? 38.938  17.544  -16.249 1.00 39.34 ? 1200 GLU A CD    1 
ATOM   1717  O  OE1   . GLU A  1 227 ? 40.156  17.450  -16.509 1.00 36.98 ? 1200 GLU A OE1   1 
ATOM   1718  O  OE2   . GLU A  1 227 ? 38.058  16.904  -16.866 1.00 40.82 ? 1200 GLU A OE2   1 
ATOM   1719  N  N     . ASN A  1 228 ? 37.568  18.204  -11.395 1.00 31.61 ? 1201 ASN A N     1 
ATOM   1720  C  CA    . ASN A  1 228 ? 38.570  17.977  -10.359 1.00 30.90 ? 1201 ASN A CA    1 
ATOM   1721  C  C     . ASN A  1 228 ? 39.855  17.429  -10.991 1.00 26.51 ? 1201 ASN A C     1 
ATOM   1722  O  O     . ASN A  1 228 ? 39.788  16.652  -11.949 1.00 25.09 ? 1201 ASN A O     1 
ATOM   1723  C  CB    . ASN A  1 228 ? 38.027  17.027  -9.286  1.00 37.70 ? 1201 ASN A CB    1 
ATOM   1724  C  CG    . ASN A  1 228 ? 36.793  17.587  -8.572  1.00 52.04 ? 1201 ASN A CG    1 
ATOM   1725  O  OD1   . ASN A  1 228 ? 36.817  18.699  -8.026  1.00 56.96 ? 1201 ASN A OD1   1 
ATOM   1726  N  ND2   . ASN A  1 228 ? 35.709  16.814  -8.574  1.00 52.34 ? 1201 ASN A ND2   1 
ATOM   1727  N  N     . PRO A  1 229 ? 41.025  17.859  -10.475 1.00 21.92 ? 1202 PRO A N     1 
ATOM   1728  C  CA    . PRO A  1 229 ? 42.319  17.466  -11.048 1.00 22.92 ? 1202 PRO A CA    1 
ATOM   1729  C  C     . PRO A  1 229 ? 42.696  15.980  -10.909 1.00 25.70 ? 1202 PRO A C     1 
ATOM   1730  O  O     . PRO A  1 229 ? 43.510  15.482  -11.692 1.00 24.28 ? 1202 PRO A O     1 
ATOM   1731  C  CB    . PRO A  1 229 ? 43.333  18.360  -10.314 1.00 22.42 ? 1202 PRO A CB    1 
ATOM   1732  C  CG    . PRO A  1 229 ? 42.630  18.923  -9.144  1.00 11.89 ? 1202 PRO A CG    1 
ATOM   1733  C  CD    . PRO A  1 229 ? 41.161  18.759  -9.310  1.00 11.44 ? 1202 PRO A CD    1 
ATOM   1734  N  N     . PHE A  1 230 ? 42.097  15.287  -9.945  1.00 30.20 ? 1203 PHE A N     1 
ATOM   1735  C  CA    . PHE A  1 230 ? 42.470  13.903  -9.630  1.00 34.18 ? 1203 PHE A CA    1 
ATOM   1736  C  C     . PHE A  1 230 ? 41.246  13.001  -9.508  1.00 36.66 ? 1203 PHE A C     1 
ATOM   1737  O  O     . PHE A  1 230 ? 40.421  13.193  -8.612  1.00 40.59 ? 1203 PHE A O     1 
ATOM   1738  C  CB    . PHE A  1 230 ? 43.287  13.858  -8.332  1.00 30.71 ? 1203 PHE A CB    1 
ATOM   1739  C  CG    . PHE A  1 230 ? 44.411  14.859  -8.287  1.00 23.46 ? 1203 PHE A CG    1 
ATOM   1740  C  CD1   . PHE A  1 230 ? 45.562  14.664  -9.038  1.00 21.44 ? 1203 PHE A CD1   1 
ATOM   1741  C  CD2   . PHE A  1 230 ? 44.312  15.997  -7.495  1.00 27.18 ? 1203 PHE A CD2   1 
ATOM   1742  C  CE1   . PHE A  1 230 ? 46.589  15.583  -9.009  1.00 29.40 ? 1203 PHE A CE1   1 
ATOM   1743  C  CE2   . PHE A  1 230 ? 45.337  16.926  -7.460  1.00 18.96 ? 1203 PHE A CE2   1 
ATOM   1744  C  CZ    . PHE A  1 230 ? 46.480  16.719  -8.214  1.00 28.09 ? 1203 PHE A CZ    1 
ATOM   1745  N  N     . CYS A  1 231 ? 41.135  12.027  -10.414 1.00 40.59 ? 1204 CYS A N     1 
ATOM   1746  C  CA    . CYS A  1 231 ? 40.053  11.026  -10.396 1.00 43.93 ? 1204 CYS A CA    1 
ATOM   1747  C  C     . CYS A  1 231 ? 40.055  10.177  -9.118  1.00 42.39 ? 1204 CYS A C     1 
ATOM   1748  O  O     . CYS A  1 231 ? 38.999  9.869   -8.559  1.00 38.69 ? 1204 CYS A O     1 
ATOM   1749  C  CB    . CYS A  1 231 ? 40.163  10.094  -11.609 1.00 43.18 ? 1204 CYS A CB    1 
ATOM   1750  S  SG    . CYS A  1 231 ? 40.039  10.910  -13.212 1.00 63.49 ? 1204 CYS A SG    1 
ATOM   1751  N  N     . GLU A  1 232 ? 41.251  9.792   -8.680  1.00 44.10 ? 1205 GLU A N     1 
ATOM   1752  C  CA    . GLU A  1 232 ? 41.420  8.963   -7.499  1.00 45.24 ? 1205 GLU A CA    1 
ATOM   1753  C  C     . GLU A  1 232 ? 42.180  9.756   -6.454  1.00 46.22 ? 1205 GLU A C     1 
ATOM   1754  O  O     . GLU A  1 232 ? 43.074  10.542  -6.789  1.00 51.39 ? 1205 GLU A O     1 
ATOM   1755  C  CB    . GLU A  1 232 ? 42.181  7.671   -7.830  1.00 44.35 ? 1205 GLU A CB    1 
ATOM   1756  C  CG    . GLU A  1 232 ? 41.533  6.779   -8.894  1.00 51.11 ? 1205 GLU A CG    1 
ATOM   1757  C  CD    . GLU A  1 232 ? 40.091  6.398   -8.581  1.00 53.69 ? 1205 GLU A CD    1 
ATOM   1758  O  OE1   . GLU A  1 232 ? 39.264  6.390   -9.522  1.00 54.93 ? 1205 GLU A OE1   1 
ATOM   1759  O  OE2   . GLU A  1 232 ? 39.783  6.111   -7.404  1.00 47.08 ? 1205 GLU A OE2   1 
ATOM   1760  N  N     . LEU A  1 233 ? 41.821  9.546   -5.190  1.00 39.49 ? 1206 LEU A N     1 
ATOM   1761  C  CA    . LEU A  1 233 ? 42.491  10.208  -4.073  1.00 36.77 ? 1206 LEU A CA    1 
ATOM   1762  C  C     . LEU A  1 233 ? 43.982  9.922   -4.033  1.00 36.23 ? 1206 LEU A C     1 
ATOM   1763  O  O     . LEU A  1 233 ? 44.755  10.764  -3.600  1.00 34.94 ? 1206 LEU A O     1 
ATOM   1764  C  CB    . LEU A  1 233 ? 41.856  9.799   -2.749  1.00 34.60 ? 1206 LEU A CB    1 
ATOM   1765  C  CG    . LEU A  1 233 ? 40.693  10.610  -2.177  1.00 36.16 ? 1206 LEU A CG    1 
ATOM   1766  C  CD1   . LEU A  1 233 ? 40.229  11.759  -3.081  1.00 27.26 ? 1206 LEU A CD1   1 
ATOM   1767  C  CD2   . LEU A  1 233 ? 39.548  9.669   -1.843  1.00 38.12 ? 1206 LEU A CD2   1 
ATOM   1768  N  N     . GLU A  1 234 ? 44.381  8.744   -4.503  1.00 37.53 ? 1207 GLU A N     1 
ATOM   1769  C  CA    . GLU A  1 234 ? 45.782  8.331   -4.449  1.00 36.83 ? 1207 GLU A CA    1 
ATOM   1770  C  C     . GLU A  1 234 ? 46.685  8.951   -5.503  1.00 35.53 ? 1207 GLU A C     1 
ATOM   1771  O  O     . GLU A  1 234 ? 47.892  9.040   -5.288  1.00 36.92 ? 1207 GLU A O     1 
ATOM   1772  C  CB    . GLU A  1 234 ? 45.893  6.816   -4.504  1.00 38.65 ? 1207 GLU A CB    1 
ATOM   1773  C  CG    . GLU A  1 234 ? 45.589  6.151   -3.179  1.00 35.09 ? 1207 GLU A CG    1 
ATOM   1774  C  CD    . GLU A  1 234 ? 45.611  4.649   -3.274  1.00 35.45 ? 1207 GLU A CD    1 
ATOM   1775  O  OE1   . GLU A  1 234 ? 45.709  4.121   -4.403  1.00 35.48 ? 1207 GLU A OE1   1 
ATOM   1776  O  OE2   . GLU A  1 234 ? 45.518  3.989   -2.218  1.00 36.18 ? 1207 GLU A OE2   1 
ATOM   1777  N  N     . GLU A  1 235 ? 46.114  9.381   -6.629  1.00 37.92 ? 1208 GLU A N     1 
ATOM   1778  C  CA    . GLU A  1 235 ? 46.904  10.051  -7.681  1.00 41.87 ? 1208 GLU A CA    1 
ATOM   1779  C  C     . GLU A  1 235 ? 47.287  11.480  -7.270  1.00 38.29 ? 1208 GLU A C     1 
ATOM   1780  O  O     . GLU A  1 235 ? 47.858  12.250  -8.045  1.00 38.68 ? 1208 GLU A O     1 
ATOM   1781  C  CB    . GLU A  1 235 ? 46.219  9.977   -9.064  1.00 41.81 ? 1208 GLU A CB    1 
ATOM   1782  C  CG    . GLU A  1 235 ? 45.074  10.954  -9.306  1.00 47.24 ? 1208 GLU A CG    1 
ATOM   1783  C  CD    . GLU A  1 235 ? 44.406  10.764  -10.669 1.00 49.17 ? 1208 GLU A CD    1 
ATOM   1784  O  OE1   . GLU A  1 235 ? 44.474  11.699  -11.502 1.00 52.09 ? 1208 GLU A OE1   1 
ATOM   1785  O  OE2   . GLU A  1 235 ? 43.816  9.684   -10.907 1.00 46.06 ? 1208 GLU A OE2   1 
ATOM   1786  N  N     . THR A  1 236 ? 46.994  11.785  -6.012  1.00 38.37 ? 1209 THR A N     1 
ATOM   1787  C  CA    . THR A  1 236 ? 47.288  13.061  -5.389  1.00 40.41 ? 1209 THR A CA    1 
ATOM   1788  C  C     . THR A  1 236 ? 48.735  13.136  -4.883  1.00 41.61 ? 1209 THR A C     1 
ATOM   1789  O  O     . THR A  1 236 ? 49.260  14.232  -4.658  1.00 43.13 ? 1209 THR A O     1 
ATOM   1790  C  CB    . THR A  1 236 ? 46.305  13.311  -4.223  1.00 39.92 ? 1209 THR A CB    1 
ATOM   1791  O  OG1   . THR A  1 236 ? 46.081  14.713  -4.068  1.00 41.13 ? 1209 THR A OG1   1 
ATOM   1792  C  CG2   . THR A  1 236 ? 46.819  12.695  -2.905  1.00 29.27 ? 1209 THR A CG2   1 
ATOM   1793  N  N     . VAL A  1 237 ? 49.366  11.971  -4.711  1.00 40.34 ? 1210 VAL A N     1 
ATOM   1794  C  CA    . VAL A  1 237 ? 50.729  11.880  -4.173  1.00 37.12 ? 1210 VAL A CA    1 
ATOM   1795  C  C     . VAL A  1 237 ? 51.778  12.269  -5.221  1.00 34.58 ? 1210 VAL A C     1 
ATOM   1796  O  O     . VAL A  1 237 ? 52.798  12.883  -4.895  1.00 34.59 ? 1210 VAL A O     1 
ATOM   1797  C  CB    . VAL A  1 237 ? 51.050  10.477  -3.528  1.00 37.27 ? 1210 VAL A CB    1 
ATOM   1798  C  CG1   . VAL A  1 237 ? 50.017  10.103  -2.465  1.00 31.40 ? 1210 VAL A CG1   1 
ATOM   1799  C  CG2   . VAL A  1 237 ? 51.168  9.375   -4.578  1.00 45.18 ? 1210 VAL A CG2   1 
ATOM   1800  N  N     . GLU A  1 238 ? 51.524  11.897  -6.471  1.00 31.74 ? 1211 GLU A N     1 
ATOM   1801  C  CA    . GLU A  1 238 ? 52.332  12.349  -7.591  1.00 34.50 ? 1211 GLU A CA    1 
ATOM   1802  C  C     . GLU A  1 238 ? 51.886  13.760  -7.962  1.00 36.20 ? 1211 GLU A C     1 
ATOM   1803  O  O     . GLU A  1 238 ? 52.708  14.612  -8.310  1.00 36.31 ? 1211 GLU A O     1 
ATOM   1804  C  CB    . GLU A  1 238 ? 52.169  11.413  -8.791  1.00 35.33 ? 1211 GLU A CB    1 
ATOM   1805  N  N     . ALA A  1 239 ? 50.578  13.992  -7.846  1.00 36.62 ? 1212 ALA A N     1 
ATOM   1806  C  CA    . ALA A  1 239 ? 49.936  15.260  -8.190  1.00 36.80 ? 1212 ALA A CA    1 
ATOM   1807  C  C     . ALA A  1 239 ? 50.215  15.658  -9.636  1.00 38.52 ? 1212 ALA A C     1 
ATOM   1808  O  O     . ALA A  1 239 ? 50.472  16.827  -9.940  1.00 38.32 ? 1212 ALA A O     1 
ATOM   1809  C  CB    . ALA A  1 239 ? 50.329  16.366  -7.214  1.00 33.76 ? 1212 ALA A CB    1 
ATOM   1810  N  N     . ALA A  1 240 ? 50.163  14.658  -10.516 1.00 39.75 ? 1213 ALA A N     1 
ATOM   1811  C  CA    . ALA A  1 240 ? 50.348  14.853  -11.947 1.00 37.93 ? 1213 ALA A CA    1 
ATOM   1812  C  C     . ALA A  1 240 ? 49.029  15.279  -12.557 1.00 38.90 ? 1213 ALA A C     1 
ATOM   1813  O  O     . ALA A  1 240 ? 48.031  14.555  -12.464 1.00 41.96 ? 1213 ALA A O     1 
ATOM   1814  C  CB    . ALA A  1 240 ? 50.849  13.581  -12.593 1.00 36.75 ? 1213 ALA A CB    1 
ATOM   1815  N  N     . ILE A  1 241 ? 49.028  16.463  -13.166 1.00 40.77 ? 1214 ILE A N     1 
ATOM   1816  C  CA    . ILE A  1 241 ? 47.815  17.020  -13.772 1.00 44.69 ? 1214 ILE A CA    1 
ATOM   1817  C  C     . ILE A  1 241 ? 47.882  17.090  -15.302 1.00 44.47 ? 1214 ILE A C     1 
ATOM   1818  O  O     . ILE A  1 241 ? 48.887  17.518  -15.885 1.00 47.07 ? 1214 ILE A O     1 
ATOM   1819  C  CB    . ILE A  1 241 ? 47.428  18.409  -13.177 1.00 44.04 ? 1214 ILE A CB    1 
ATOM   1820  C  CG1   . ILE A  1 241 ? 48.542  19.443  -13.397 1.00 44.36 ? 1214 ILE A CG1   1 
ATOM   1821  C  CG2   . ILE A  1 241 ? 47.067  18.272  -11.693 1.00 46.27 ? 1214 ILE A CG2   1 
ATOM   1822  C  CD1   . ILE A  1 241 ? 48.090  20.881  -13.247 1.00 44.65 ? 1214 ILE A CD1   1 
ATOM   1823  N  N     . HIS A  1 242 ? 46.798  16.664  -15.937 1.00 43.10 ? 1215 HIS A N     1 
ATOM   1824  C  CA    . HIS A  1 242 ? 46.673  16.733  -17.387 1.00 43.97 ? 1215 HIS A CA    1 
ATOM   1825  C  C     . HIS A  1 242 ? 45.460  17.606  -17.722 1.00 38.32 ? 1215 HIS A C     1 
ATOM   1826  O  O     . HIS A  1 242 ? 44.341  17.098  -17.882 1.00 39.35 ? 1215 HIS A O     1 
ATOM   1827  C  CB    . HIS A  1 242 ? 46.581  15.322  -17.985 1.00 44.81 ? 1215 HIS A CB    1 
ATOM   1828  C  CG    . HIS A  1 242 ? 47.674  14.408  -17.523 1.00 57.40 ? 1215 HIS A CG    1 
ATOM   1829  N  ND1   . HIS A  1 242 ? 48.854  14.245  -18.217 1.00 61.70 ? 1215 HIS A ND1   1 
ATOM   1830  C  CD2   . HIS A  1 242 ? 47.778  13.630  -16.417 1.00 60.94 ? 1215 HIS A CD2   1 
ATOM   1831  C  CE1   . HIS A  1 242 ? 49.631  13.395  -17.568 1.00 64.66 ? 1215 HIS A CE1   1 
ATOM   1832  N  NE2   . HIS A  1 242 ? 49.002  13.009  -16.472 1.00 63.89 ? 1215 HIS A NE2   1 
ATOM   1833  N  N     . PRO A  1 243 ? 45.680  18.933  -17.802 1.00 33.74 ? 1216 PRO A N     1 
ATOM   1834  C  CA    . PRO A  1 243 ? 44.608  19.917  -17.962 1.00 34.64 ? 1216 PRO A CA    1 
ATOM   1835  C  C     . PRO A  1 243 ? 43.928  19.767  -19.318 1.00 33.27 ? 1216 PRO A C     1 
ATOM   1836  O  O     . PRO A  1 243 ? 44.626  19.656  -20.332 1.00 33.90 ? 1216 PRO A O     1 
ATOM   1837  C  CB    . PRO A  1 243 ? 45.347  21.257  -17.877 1.00 34.34 ? 1216 PRO A CB    1 
ATOM   1838  C  CG    . PRO A  1 243 ? 46.666  20.941  -17.274 1.00 33.20 ? 1216 PRO A CG    1 
ATOM   1839  C  CD    . PRO A  1 243 ? 46.998  19.586  -17.763 1.00 31.99 ? 1216 PRO A CD    1 
ATOM   1840  N  N     . PRO A  1 244 ? 42.575  19.739  -19.337 1.00 29.93 ? 1217 PRO A N     1 
ATOM   1841  C  CA    . PRO A  1 244 ? 41.811  19.481  -20.560 1.00 28.90 ? 1217 PRO A CA    1 
ATOM   1842  C  C     . PRO A  1 244 ? 41.813  20.648  -21.559 1.00 30.00 ? 1217 PRO A C     1 
ATOM   1843  O  O     . PRO A  1 244 ? 41.546  20.448  -22.750 1.00 27.03 ? 1217 PRO A O     1 
ATOM   1844  C  CB    . PRO A  1 244 ? 40.396  19.218  -20.033 1.00 26.67 ? 1217 PRO A CB    1 
ATOM   1845  C  CG    . PRO A  1 244 ? 40.321  19.985  -18.776 1.00 26.01 ? 1217 PRO A CG    1 
ATOM   1846  C  CD    . PRO A  1 244 ? 41.690  19.946  -18.175 1.00 25.81 ? 1217 PRO A CD    1 
ATOM   1847  N  N     . TYR A  1 245 ? 42.117  21.843  -21.056 1.00 32.64 ? 1218 TYR A N     1 
ATOM   1848  C  CA    . TYR A  1 245 ? 42.090  23.081  -21.824 1.00 32.96 ? 1218 TYR A CA    1 
ATOM   1849  C  C     . TYR A  1 245 ? 43.506  23.622  -21.919 1.00 36.25 ? 1218 TYR A C     1 
ATOM   1850  O  O     . TYR A  1 245 ? 44.306  23.437  -21.000 1.00 35.74 ? 1218 TYR A O     1 
ATOM   1851  C  CB    . TYR A  1 245 ? 41.219  24.154  -21.134 1.00 27.41 ? 1218 TYR A CB    1 
ATOM   1852  C  CG    . TYR A  1 245 ? 39.766  23.790  -20.877 1.00 25.70 ? 1218 TYR A CG    1 
ATOM   1853  C  CD1   . TYR A  1 245 ? 39.120  22.814  -21.630 1.00 23.74 ? 1218 TYR A CD1   1 
ATOM   1854  C  CD2   . TYR A  1 245 ? 39.027  24.460  -19.905 1.00 25.81 ? 1218 TYR A CD2   1 
ATOM   1855  C  CE1   . TYR A  1 245 ? 37.788  22.488  -21.408 1.00 18.97 ? 1218 TYR A CE1   1 
ATOM   1856  C  CE2   . TYR A  1 245 ? 37.689  24.149  -19.676 1.00 28.56 ? 1218 TYR A CE2   1 
ATOM   1857  C  CZ    . TYR A  1 245 ? 37.077  23.158  -20.435 1.00 30.31 ? 1218 TYR A CZ    1 
ATOM   1858  O  OH    . TYR A  1 245 ? 35.753  22.831  -20.222 1.00 24.07 ? 1218 TYR A OH    1 
ATOM   1859  N  N     . LEU A  1 246 ? 43.814  24.295  -23.023 1.00 33.76 ? 1219 LEU A N     1 
ATOM   1860  C  CA    . LEU A  1 246 ? 45.077  24.992  -23.139 1.00 41.32 ? 1219 LEU A CA    1 
ATOM   1861  C  C     . LEU A  1 246 ? 44.918  26.356  -22.465 1.00 40.23 ? 1219 LEU A C     1 
ATOM   1862  O  O     . LEU A  1 246 ? 43.986  27.114  -22.768 1.00 38.93 ? 1219 LEU A O     1 
ATOM   1863  C  CB    . LEU A  1 246 ? 45.515  25.109  -24.613 1.00 44.67 ? 1219 LEU A CB    1 
ATOM   1864  C  CG    . LEU A  1 246 ? 46.955  25.525  -24.960 1.00 47.55 ? 1219 LEU A CG    1 
ATOM   1865  C  CD1   . LEU A  1 246 ? 47.998  24.552  -24.410 1.00 50.41 ? 1219 LEU A CD1   1 
ATOM   1866  C  CD2   . LEU A  1 246 ? 47.119  25.686  -26.468 1.00 46.40 ? 1219 LEU A CD2   1 
ATOM   1867  N  N     . VAL A  1 247 ? 45.805  26.632  -21.513 1.00 41.79 ? 1220 VAL A N     1 
ATOM   1868  C  CA    . VAL A  1 247 ? 45.807  27.895  -20.781 1.00 40.67 ? 1220 VAL A CA    1 
ATOM   1869  C  C     . VAL A  1 247 ? 47.203  28.489  -20.827 1.00 40.34 ? 1220 VAL A C     1 
ATOM   1870  O  O     . VAL A  1 247 ? 48.144  27.828  -21.266 1.00 41.45 ? 1220 VAL A O     1 
ATOM   1871  C  CB    . VAL A  1 247 ? 45.353  27.728  -19.299 1.00 39.76 ? 1220 VAL A CB    1 
ATOM   1872  C  CG1   . VAL A  1 247 ? 43.887  27.284  -19.217 1.00 37.54 ? 1220 VAL A CG1   1 
ATOM   1873  C  CG2   . VAL A  1 247 ? 46.270  26.766  -18.542 1.00 37.00 ? 1220 VAL A CG2   1 
ATOM   1874  N  N     . SER A  1 248 ? 47.328  29.727  -20.356 1.00 40.79 ? 1221 SER A N     1 
ATOM   1875  C  CA    . SER A  1 248 ? 48.602  30.434  -20.297 1.00 39.63 ? 1221 SER A CA    1 
ATOM   1876  C  C     . SER A  1 248 ? 49.621  29.747  -19.385 1.00 43.22 ? 1221 SER A C     1 
ATOM   1877  O  O     . SER A  1 248 ? 49.256  28.939  -18.520 1.00 41.93 ? 1221 SER A O     1 
ATOM   1878  C  CB    . SER A  1 248 ? 48.386  31.882  -19.841 1.00 39.52 ? 1221 SER A CB    1 
ATOM   1879  O  OG    . SER A  1 248 ? 47.914  31.945  -18.503 1.00 35.70 ? 1221 SER A OG    1 
ATOM   1880  N  N     . LYS A  1 249 ? 50.895  30.087  -19.597 1.00 40.35 ? 1222 LYS A N     1 
ATOM   1881  C  CA    . LYS A  1 249 ? 52.013  29.605  -18.791 1.00 35.20 ? 1222 LYS A CA    1 
ATOM   1882  C  C     . LYS A  1 249 ? 51.951  30.096  -17.347 1.00 33.47 ? 1222 LYS A C     1 
ATOM   1883  O  O     . LYS A  1 249 ? 52.478  29.442  -16.440 1.00 29.91 ? 1222 LYS A O     1 
ATOM   1884  C  CB    . LYS A  1 249 ? 53.334  30.060  -19.417 1.00 31.25 ? 1222 LYS A CB    1 
ATOM   1885  N  N     . GLU A  1 250 ? 51.329  31.261  -17.159 1.00 33.18 ? 1223 GLU A N     1 
ATOM   1886  C  CA    . GLU A  1 250 ? 51.196  31.910  -15.854 1.00 35.02 ? 1223 GLU A CA    1 
ATOM   1887  C  C     . GLU A  1 250 ? 50.151  31.252  -14.937 1.00 30.57 ? 1223 GLU A C     1 
ATOM   1888  O  O     . GLU A  1 250 ? 50.289  31.283  -13.718 1.00 33.02 ? 1223 GLU A O     1 
ATOM   1889  C  CB    . GLU A  1 250 ? 50.866  33.395  -16.027 1.00 37.27 ? 1223 GLU A CB    1 
ATOM   1890  C  CG    . GLU A  1 250 ? 52.038  34.275  -16.485 1.00 45.27 ? 1223 GLU A CG    1 
ATOM   1891  C  CD    . GLU A  1 250 ? 52.264  34.272  -17.999 1.00 46.08 ? 1223 GLU A CD    1 
ATOM   1892  O  OE1   . GLU A  1 250 ? 51.458  33.667  -18.743 1.00 36.00 ? 1223 GLU A OE1   1 
ATOM   1893  O  OE2   . GLU A  1 250 ? 53.262  34.881  -18.444 1.00 51.41 ? 1223 GLU A OE2   1 
ATOM   1894  N  N     . LEU A  1 251 ? 49.106  30.681  -15.528 1.00 28.84 ? 1224 LEU A N     1 
ATOM   1895  C  CA    . LEU A  1 251 ? 48.118  29.911  -14.783 1.00 27.69 ? 1224 LEU A CA    1 
ATOM   1896  C  C     . LEU A  1 251 ? 48.714  28.556  -14.425 1.00 32.43 ? 1224 LEU A C     1 
ATOM   1897  O  O     . LEU A  1 251 ? 48.565  28.090  -13.295 1.00 30.60 ? 1224 LEU A O     1 
ATOM   1898  C  CB    . LEU A  1 251 ? 46.819  29.721  -15.590 1.00 26.31 ? 1224 LEU A CB    1 
ATOM   1899  C  CG    . LEU A  1 251 ? 45.669  28.917  -14.936 1.00 28.14 ? 1224 LEU A CG    1 
ATOM   1900  C  CD1   . LEU A  1 251 ? 45.319  29.423  -13.540 1.00 20.66 ? 1224 LEU A CD1   1 
ATOM   1901  C  CD2   . LEU A  1 251 ? 44.436  28.945  -15.801 1.00 18.46 ? 1224 LEU A CD2   1 
ATOM   1902  N  N     . MET A  1 252 ? 49.396  27.936  -15.388 1.00 31.38 ? 1225 MET A N     1 
ATOM   1903  C  CA    . MET A  1 252 ? 49.906  26.584  -15.209 1.00 33.04 ? 1225 MET A CA    1 
ATOM   1904  C  C     . MET A  1 252 ? 50.874  26.479  -14.041 1.00 33.16 ? 1225 MET A C     1 
ATOM   1905  O  O     . MET A  1 252 ? 50.776  25.544  -13.251 1.00 33.95 ? 1225 MET A O     1 
ATOM   1906  C  CB    . MET A  1 252 ? 50.537  26.043  -16.488 1.00 29.55 ? 1225 MET A CB    1 
ATOM   1907  C  CG    . MET A  1 252 ? 50.284  24.558  -16.699 1.00 39.18 ? 1225 MET A CG    1 
ATOM   1908  S  SD    . MET A  1 252 ? 48.658  24.204  -17.409 1.00 44.14 ? 1225 MET A SD    1 
ATOM   1909  C  CE    . MET A  1 252 ? 47.585  24.224  -15.977 1.00 30.95 ? 1225 MET A CE    1 
ATOM   1910  N  N     . SER A  1 253 ? 51.777  27.452  -13.921 1.00 29.80 ? 1226 SER A N     1 
ATOM   1911  C  CA    . SER A  1 253 ? 52.750  27.480  -12.828 1.00 29.99 ? 1226 SER A CA    1 
ATOM   1912  C  C     . SER A  1 253 ? 52.093  27.861  -11.503 1.00 29.66 ? 1226 SER A C     1 
ATOM   1913  O  O     . SER A  1 253 ? 52.557  27.450  -10.435 1.00 27.16 ? 1226 SER A O     1 
ATOM   1914  C  CB    . SER A  1 253 ? 53.911  28.426  -13.151 1.00 29.22 ? 1226 SER A CB    1 
ATOM   1915  O  OG    . SER A  1 253 ? 53.470  29.766  -13.262 1.00 38.18 ? 1226 SER A OG    1 
ATOM   1916  N  N     . LEU A  1 254 ? 51.020  28.653  -11.590 1.00 29.99 ? 1227 LEU A N     1 
ATOM   1917  C  CA    . LEU A  1 254 ? 50.186  29.004  -10.435 1.00 27.31 ? 1227 LEU A CA    1 
ATOM   1918  C  C     . LEU A  1 254 ? 49.470  27.784  -9.830  1.00 21.17 ? 1227 LEU A C     1 
ATOM   1919  O  O     . LEU A  1 254 ? 49.543  27.563  -8.619  1.00 21.50 ? 1227 LEU A O     1 
ATOM   1920  C  CB    . LEU A  1 254 ? 49.164  30.099  -10.794 1.00 25.60 ? 1227 LEU A CB    1 
ATOM   1921  C  CG    . LEU A  1 254 ? 48.094  30.336  -9.718  1.00 28.04 ? 1227 LEU A CG    1 
ATOM   1922  C  CD1   . LEU A  1 254 ? 48.716  30.881  -8.438  1.00 22.52 ? 1227 LEU A CD1   1 
ATOM   1923  C  CD2   . LEU A  1 254 ? 46.988  31.244  -10.208 1.00 25.55 ? 1227 LEU A CD2   1 
ATOM   1924  N  N     . VAL A  1 255 ? 48.787  27.008  -10.669 1.00 20.67 ? 1228 VAL A N     1 
ATOM   1925  C  CA    . VAL A  1 255 ? 48.101  25.796  -10.211 1.00 27.47 ? 1228 VAL A CA    1 
ATOM   1926  C  C     . VAL A  1 255 ? 49.075  24.698  -9.763  1.00 27.43 ? 1228 VAL A C     1 
ATOM   1927  O  O     . VAL A  1 255 ? 48.817  24.022  -8.775  1.00 30.48 ? 1228 VAL A O     1 
ATOM   1928  C  CB    . VAL A  1 255 ? 47.021  25.262  -11.229 1.00 29.08 ? 1228 VAL A CB    1 
ATOM   1929  C  CG1   . VAL A  1 255 ? 46.186  26.406  -11.779 1.00 29.17 ? 1228 VAL A CG1   1 
ATOM   1930  C  CG2   . VAL A  1 255 ? 47.641  24.496  -12.363 1.00 32.10 ? 1228 VAL A CG2   1 
ATOM   1931  N  N     . SER A  1 256 ? 50.195  24.553  -10.477 1.00 30.55 ? 1229 SER A N     1 
ATOM   1932  C  CA    . SER A  1 256 ? 51.237  23.583  -10.150 1.00 30.64 ? 1229 SER A CA    1 
ATOM   1933  C  C     . SER A  1 256 ? 51.966  23.881  -8.829  1.00 24.92 ? 1229 SER A C     1 
ATOM   1934  O  O     . SER A  1 256 ? 52.369  22.959  -8.126  1.00 22.24 ? 1229 SER A O     1 
ATOM   1935  C  CB    . SER A  1 256 ? 52.266  23.506  -11.285 1.00 35.41 ? 1229 SER A CB    1 
ATOM   1936  O  OG    . SER A  1 256 ? 51.676  23.018  -12.472 1.00 42.05 ? 1229 SER A OG    1 
ATOM   1937  N  N     . GLY A  1 257 ? 52.152  25.160  -8.516  1.00 22.43 ? 1230 GLY A N     1 
ATOM   1938  C  CA    . GLY A  1 257 ? 52.765  25.574  -7.252  1.00 21.71 ? 1230 GLY A CA    1 
ATOM   1939  C  C     . GLY A  1 257 ? 51.871  25.319  -6.049  1.00 25.32 ? 1230 GLY A C     1 
ATOM   1940  O  O     . GLY A  1 257 ? 52.357  24.959  -4.970  1.00 29.50 ? 1230 GLY A O     1 
ATOM   1941  N  N     . LEU A  1 258 ? 50.564  25.505  -6.244  1.00 29.53 ? 1231 LEU A N     1 
ATOM   1942  C  CA    . LEU A  1 258 ? 49.547  25.266  -5.203  1.00 30.41 ? 1231 LEU A CA    1 
ATOM   1943  C  C     . LEU A  1 258 ? 49.254  23.778  -5.024  1.00 28.22 ? 1231 LEU A C     1 
ATOM   1944  O  O     . LEU A  1 258 ? 48.918  23.331  -3.926  1.00 30.32 ? 1231 LEU A O     1 
ATOM   1945  C  CB    . LEU A  1 258 ? 48.241  25.992  -5.544  1.00 27.10 ? 1231 LEU A CB    1 
ATOM   1946  C  CG    . LEU A  1 258 ? 48.135  27.515  -5.474  1.00 25.68 ? 1231 LEU A CG    1 
ATOM   1947  C  CD1   . LEU A  1 258 ? 46.820  27.964  -6.092  1.00 10.76 ? 1231 LEU A CD1   1 
ATOM   1948  C  CD2   . LEU A  1 258 ? 48.253  28.039  -4.049  1.00 21.38 ? 1231 LEU A CD2   1 
ATOM   1949  N  N     . LEU A  1 259 ? 49.374  23.028  -6.116  1.00 25.18 ? 1232 LEU A N     1 
ATOM   1950  C  CA    . LEU A  1 259 ? 49.114  21.597  -6.126  1.00 26.47 ? 1232 LEU A CA    1 
ATOM   1951  C  C     . LEU A  1 259 ? 50.408  20.785  -6.086  1.00 24.70 ? 1232 LEU A C     1 
ATOM   1952  O  O     . LEU A  1 259 ? 50.550  19.786  -6.787  1.00 22.01 ? 1232 LEU A O     1 
ATOM   1953  C  CB    . LEU A  1 259 ? 48.251  21.208  -7.341  1.00 28.58 ? 1232 LEU A CB    1 
ATOM   1954  C  CG    . LEU A  1 259 ? 46.777  21.646  -7.354  1.00 28.05 ? 1232 LEU A CG    1 
ATOM   1955  C  CD1   . LEU A  1 259 ? 46.083  21.246  -8.658  1.00 19.60 ? 1232 LEU A CD1   1 
ATOM   1956  C  CD2   . LEU A  1 259 ? 46.044  21.075  -6.166  1.00 19.06 ? 1232 LEU A CD2   1 
ATOM   1957  N  N     . GLN A  1 260 ? 51.335  21.232  -5.242  1.00 28.34 ? 1233 GLN A N     1 
ATOM   1958  C  CA    . GLN A  1 260 ? 52.612  20.565  -5.012  1.00 23.45 ? 1233 GLN A CA    1 
ATOM   1959  C  C     . GLN A  1 260 ? 52.444  19.565  -3.861  1.00 24.32 ? 1233 GLN A C     1 
ATOM   1960  O  O     . GLN A  1 260 ? 51.994  19.936  -2.782  1.00 23.83 ? 1233 GLN A O     1 
ATOM   1961  C  CB    . GLN A  1 260 ? 53.689  21.618  -4.711  1.00 24.59 ? 1233 GLN A CB    1 
ATOM   1962  C  CG    . GLN A  1 260 ? 54.966  21.120  -4.030  1.00 27.53 ? 1233 GLN A CG    1 
ATOM   1963  C  CD    . GLN A  1 260 ? 55.830  20.210  -4.894  1.00 29.05 ? 1233 GLN A CD    1 
ATOM   1964  O  OE1   . GLN A  1 260 ? 56.385  19.225  -4.399  1.00 32.41 ? 1233 GLN A OE1   1 
ATOM   1965  N  NE2   . GLN A  1 260 ? 55.950  20.531  -6.180  1.00 20.44 ? 1233 GLN A NE2   1 
ATOM   1966  N  N     . PRO A  1 261 ? 52.789  18.281  -4.096  1.00 26.62 ? 1234 PRO A N     1 
ATOM   1967  C  CA    . PRO A  1 261 ? 52.511  17.272  -3.074  1.00 23.21 ? 1234 PRO A CA    1 
ATOM   1968  C  C     . PRO A  1 261 ? 53.377  17.399  -1.816  1.00 23.56 ? 1234 PRO A C     1 
ATOM   1969  O  O     . PRO A  1 261 ? 52.956  16.978  -0.742  1.00 25.00 ? 1234 PRO A O     1 
ATOM   1970  C  CB    . PRO A  1 261 ? 52.787  15.937  -3.788  1.00 28.45 ? 1234 PRO A CB    1 
ATOM   1971  C  CG    . PRO A  1 261 ? 53.140  16.259  -5.202  1.00 22.08 ? 1234 PRO A CG    1 
ATOM   1972  C  CD    . PRO A  1 261 ? 53.450  17.713  -5.288  1.00 23.43 ? 1234 PRO A CD    1 
ATOM   1973  N  N     . VAL A  1 262 ? 54.581  17.953  -1.952  1.00 23.84 ? 1235 VAL A N     1 
ATOM   1974  C  CA    . VAL A  1 262 ? 55.440  18.219  -0.799  1.00 22.31 ? 1235 VAL A CA    1 
ATOM   1975  C  C     . VAL A  1 262 ? 55.021  19.537  -0.148  1.00 25.38 ? 1235 VAL A C     1 
ATOM   1976  O  O     . VAL A  1 262 ? 55.205  20.594  -0.748  1.00 31.64 ? 1235 VAL A O     1 
ATOM   1977  C  CB    . VAL A  1 262 ? 56.951  18.278  -1.187  1.00 25.43 ? 1235 VAL A CB    1 
ATOM   1978  C  CG1   . VAL A  1 262 ? 57.809  18.484  0.034   1.00 21.51 ? 1235 VAL A CG1   1 
ATOM   1979  C  CG2   . VAL A  1 262 ? 57.386  17.018  -1.923  1.00 26.31 ? 1235 VAL A CG2   1 
ATOM   1980  N  N     . PRO A  1 263 ? 54.472  19.481  1.089   1.00 23.08 ? 1236 PRO A N     1 
ATOM   1981  C  CA    . PRO A  1 263 ? 53.867  20.652  1.728   1.00 23.43 ? 1236 PRO A CA    1 
ATOM   1982  C  C     . PRO A  1 263 ? 54.802  21.861  1.879   1.00 32.22 ? 1236 PRO A C     1 
ATOM   1983  O  O     . PRO A  1 263 ? 54.338  23.012  1.839   1.00 27.37 ? 1236 PRO A O     1 
ATOM   1984  C  CB    . PRO A  1 263 ? 53.427  20.123  3.105   1.00 17.36 ? 1236 PRO A CB    1 
ATOM   1985  C  CG    . PRO A  1 263 ? 54.126  18.859  3.293   1.00 24.49 ? 1236 PRO A CG    1 
ATOM   1986  C  CD    . PRO A  1 263 ? 54.395  18.288  1.953   1.00 19.39 ? 1236 PRO A CD    1 
ATOM   1987  N  N     . GLU A  1 264 ? 56.098  21.592  2.039   1.00 34.11 ? 1237 GLU A N     1 
ATOM   1988  C  CA    . GLU A  1 264 ? 57.109  22.628  2.270   1.00 32.42 ? 1237 GLU A CA    1 
ATOM   1989  C  C     . GLU A  1 264 ? 57.572  23.341  0.992   1.00 32.23 ? 1237 GLU A C     1 
ATOM   1990  O  O     . GLU A  1 264 ? 58.105  24.443  1.066   1.00 36.17 ? 1237 GLU A O     1 
ATOM   1991  C  CB    . GLU A  1 264 ? 58.307  22.078  3.075   1.00 37.98 ? 1237 GLU A CB    1 
ATOM   1992  C  CG    . GLU A  1 264 ? 58.706  20.613  2.799   1.00 37.10 ? 1237 GLU A CG    1 
ATOM   1993  C  CD    . GLU A  1 264 ? 57.865  19.585  3.576   1.00 32.77 ? 1237 GLU A CD    1 
ATOM   1994  O  OE1   . GLU A  1 264 ? 57.599  18.505  3.028   1.00 39.88 ? 1237 GLU A OE1   1 
ATOM   1995  O  OE2   . GLU A  1 264 ? 57.462  19.842  4.727   1.00 37.13 ? 1237 GLU A OE2   1 
ATOM   1996  N  N     . ARG A  1 265 ? 57.341  22.714  -0.165  1.00 31.62 ? 1238 ARG A N     1 
ATOM   1997  C  CA    . ARG A  1 265 ? 57.599  23.301  -1.487  1.00 28.65 ? 1238 ARG A CA    1 
ATOM   1998  C  C     . ARG A  1 265 ? 56.371  24.004  -2.107  1.00 28.78 ? 1238 ARG A C     1 
ATOM   1999  O  O     . ARG A  1 265 ? 56.464  24.581  -3.199  1.00 21.19 ? 1238 ARG A O     1 
ATOM   2000  C  CB    . ARG A  1 265 ? 58.079  22.225  -2.463  1.00 31.06 ? 1238 ARG A CB    1 
ATOM   2001  C  CG    . ARG A  1 265 ? 59.471  21.641  -2.197  1.00 33.04 ? 1238 ARG A CG    1 
ATOM   2002  C  CD    . ARG A  1 265 ? 60.042  21.083  -3.493  1.00 42.81 ? 1238 ARG A CD    1 
ATOM   2003  N  NE    . ARG A  1 265 ? 60.243  22.156  -4.471  1.00 55.98 ? 1238 ARG A NE    1 
ATOM   2004  C  CZ    . ARG A  1 265 ? 60.016  22.058  -5.781  1.00 51.97 ? 1238 ARG A CZ    1 
ATOM   2005  N  NH1   . ARG A  1 265 ? 59.567  20.928  -6.316  1.00 49.81 ? 1238 ARG A NH1   1 
ATOM   2006  N  NH2   . ARG A  1 265 ? 60.227  23.109  -6.561  1.00 54.18 ? 1238 ARG A NH2   1 
ATOM   2007  N  N     . ARG A  1 266 ? 55.244  23.957  -1.395  1.00 24.06 ? 1239 ARG A N     1 
ATOM   2008  C  CA    . ARG A  1 266 ? 53.957  24.449  -1.873  1.00 22.90 ? 1239 ARG A CA    1 
ATOM   2009  C  C     . ARG A  1 266 ? 53.819  25.961  -1.701  1.00 22.00 ? 1239 ARG A C     1 
ATOM   2010  O  O     . ARG A  1 266 ? 54.226  26.527  -0.676  1.00 17.36 ? 1239 ARG A O     1 
ATOM   2011  C  CB    . ARG A  1 266 ? 52.830  23.719  -1.131  1.00 22.57 ? 1239 ARG A CB    1 
ATOM   2012  C  CG    . ARG A  1 266 ? 51.431  23.857  -1.729  1.00 28.18 ? 1239 ARG A CG    1 
ATOM   2013  C  CD    . ARG A  1 266 ? 50.423  23.040  -0.938  1.00 21.78 ? 1239 ARG A CD    1 
ATOM   2014  N  NE    . ARG A  1 266 ? 50.685  21.610  -1.074  1.00 26.24 ? 1239 ARG A NE    1 
ATOM   2015  C  CZ    . ARG A  1 266 ? 50.447  20.705  -0.135  1.00 25.13 ? 1239 ARG A CZ    1 
ATOM   2016  N  NH1   . ARG A  1 266 ? 49.949  21.069  1.037   1.00 24.09 ? 1239 ARG A NH1   1 
ATOM   2017  N  NH2   . ARG A  1 266 ? 50.723  19.429  -0.366  1.00 23.86 ? 1239 ARG A NH2   1 
ATOM   2018  N  N     . THR A  1 267 ? 53.242  26.608  -2.714  1.00 24.40 ? 1240 THR A N     1 
ATOM   2019  C  CA    . THR A  1 267 ? 52.970  28.048  -2.677  1.00 24.20 ? 1240 THR A CA    1 
ATOM   2020  C  C     . THR A  1 267 ? 52.300  28.446  -1.369  1.00 21.54 ? 1240 THR A C     1 
ATOM   2021  O  O     . THR A  1 267 ? 51.352  27.802  -0.918  1.00 25.85 ? 1240 THR A O     1 
ATOM   2022  C  CB    . THR A  1 267 ? 52.101  28.497  -3.884  1.00 24.28 ? 1240 THR A CB    1 
ATOM   2023  O  OG1   . THR A  1 267 ? 52.769  28.163  -5.099  1.00 24.05 ? 1240 THR A OG1   1 
ATOM   2024  C  CG2   . THR A  1 267 ? 51.847  29.996  -3.875  1.00 20.42 ? 1240 THR A CG2   1 
ATOM   2025  N  N     . THR A  1 268 ? 52.831  29.503  -0.769  1.00 20.87 ? 1241 THR A N     1 
ATOM   2026  C  CA    . THR A  1 268 ? 52.309  30.102  0.452   1.00 24.24 ? 1241 THR A CA    1 
ATOM   2027  C  C     . THR A  1 268 ? 51.283  31.188  0.105   1.00 25.38 ? 1241 THR A C     1 
ATOM   2028  O  O     . THR A  1 268 ? 51.142  31.560  -1.063  1.00 27.82 ? 1241 THR A O     1 
ATOM   2029  C  CB    . THR A  1 268 ? 53.467  30.701  1.295   1.00 27.43 ? 1241 THR A CB    1 
ATOM   2030  O  OG1   . THR A  1 268 ? 52.983  31.072  2.592   1.00 45.44 ? 1241 THR A OG1   1 
ATOM   2031  C  CG2   . THR A  1 268 ? 54.065  31.916  0.615   1.00 24.63 ? 1241 THR A CG2   1 
ATOM   2032  N  N     . LEU A  1 269 ? 50.558  31.676  1.109   1.00 20.03 ? 1242 LEU A N     1 
ATOM   2033  C  CA    . LEU A  1 269 ? 49.520  32.678  0.897   1.00 21.24 ? 1242 LEU A CA    1 
ATOM   2034  C  C     . LEU A  1 269 ? 50.108  34.031  0.469   1.00 26.56 ? 1242 LEU A C     1 
ATOM   2035  O  O     . LEU A  1 269 ? 49.563  34.688  -0.416  1.00 30.31 ? 1242 LEU A O     1 
ATOM   2036  C  CB    . LEU A  1 269 ? 48.624  32.813  2.136   1.00 12.05 ? 1242 LEU A CB    1 
ATOM   2037  C  CG    . LEU A  1 269 ? 47.420  33.759  2.048   1.00 25.09 ? 1242 LEU A CG    1 
ATOM   2038  C  CD1   . LEU A  1 269 ? 46.488  33.428  0.860   1.00 28.07 ? 1242 LEU A CD1   1 
ATOM   2039  C  CD2   . LEU A  1 269 ? 46.651  33.744  3.334   1.00 19.91 ? 1242 LEU A CD2   1 
ATOM   2040  N  N     . GLU A  1 270 ? 51.226  34.420  1.088   1.00 28.89 ? 1243 GLU A N     1 
ATOM   2041  C  CA    . GLU A  1 270 ? 51.936  35.669  0.758   1.00 32.37 ? 1243 GLU A CA    1 
ATOM   2042  C  C     . GLU A  1 270 ? 52.441  35.696  -0.692  1.00 33.57 ? 1243 GLU A C     1 
ATOM   2043  O  O     . GLU A  1 270 ? 52.447  36.746  -1.321  1.00 36.53 ? 1243 GLU A O     1 
ATOM   2044  C  CB    . GLU A  1 270 ? 53.100  35.917  1.725   1.00 28.94 ? 1243 GLU A CB    1 
ATOM   2045  C  CG    . GLU A  1 270 ? 52.708  36.062  3.198   1.00 41.64 ? 1243 GLU A CG    1 
ATOM   2046  C  CD    . GLU A  1 270 ? 52.053  34.806  3.776   1.00 48.13 ? 1243 GLU A CD    1 
ATOM   2047  O  OE1   . GLU A  1 270 ? 52.513  33.677  3.461   1.00 40.82 ? 1243 GLU A OE1   1 
ATOM   2048  O  OE2   . GLU A  1 270 ? 51.072  34.956  4.539   1.00 40.17 ? 1243 GLU A OE2   1 
ATOM   2049  N  N     . LYS A  1 271 ? 52.866  34.540  -1.202  1.00 37.39 ? 1244 LYS A N     1 
ATOM   2050  C  CA    . LYS A  1 271 ? 53.305  34.392  -2.594  1.00 36.97 ? 1244 LYS A CA    1 
ATOM   2051  C  C     . LYS A  1 271 ? 52.108  34.393  -3.551  1.00 37.67 ? 1244 LYS A C     1 
ATOM   2052  O  O     . LYS A  1 271 ? 52.191  34.929  -4.658  1.00 37.86 ? 1244 LYS A O     1 
ATOM   2053  C  CB    . LYS A  1 271 ? 54.109  33.094  -2.762  1.00 37.68 ? 1244 LYS A CB    1 
ATOM   2054  C  CG    . LYS A  1 271 ? 54.767  32.894  -4.136  1.00 39.31 ? 1244 LYS A CG    1 
ATOM   2055  C  CD    . LYS A  1 271 ? 55.083  31.418  -4.471  1.00 38.06 ? 1244 LYS A CD    1 
ATOM   2056  C  CE    . LYS A  1 271 ? 56.267  30.850  -3.676  1.00 43.10 ? 1244 LYS A CE    1 
ATOM   2057  N  NZ    . LYS A  1 271 ? 55.888  30.360  -2.305  1.00 40.55 ? 1244 LYS A NZ    1 
ATOM   2058  N  N     . LEU A  1 272 ? 51.004  33.780  -3.119  1.00 36.20 ? 1245 LEU A N     1 
ATOM   2059  C  CA    . LEU A  1 272 ? 49.773  33.710  -3.916  1.00 30.42 ? 1245 LEU A CA    1 
ATOM   2060  C  C     . LEU A  1 272 ? 49.065  35.068  -4.039  1.00 29.91 ? 1245 LEU A C     1 
ATOM   2061  O  O     . LEU A  1 272 ? 48.566  35.414  -5.110  1.00 31.39 ? 1245 LEU A O     1 
ATOM   2062  C  CB    . LEU A  1 272 ? 48.816  32.658  -3.339  1.00 29.09 ? 1245 LEU A CB    1 
ATOM   2063  C  CG    . LEU A  1 272 ? 47.426  32.560  -3.973  1.00 14.91 ? 1245 LEU A CG    1 
ATOM   2064  C  CD1   . LEU A  1 272 ? 47.529  31.988  -5.370  1.00 23.47 ? 1245 LEU A CD1   1 
ATOM   2065  C  CD2   . LEU A  1 272 ? 46.469  31.758  -3.125  1.00 24.94 ? 1245 LEU A CD2   1 
ATOM   2066  N  N     . VAL A  1 273 ? 49.012  35.816  -2.937  1.00 28.32 ? 1246 VAL A N     1 
ATOM   2067  C  CA    . VAL A  1 273 ? 48.473  37.175  -2.922  1.00 32.10 ? 1246 VAL A CA    1 
ATOM   2068  C  C     . VAL A  1 273 ? 49.141  38.054  -3.996  1.00 35.93 ? 1246 VAL A C     1 
ATOM   2069  O  O     . VAL A  1 273 ? 48.499  38.918  -4.607  1.00 36.24 ? 1246 VAL A O     1 
ATOM   2070  C  CB    . VAL A  1 273 ? 48.630  37.811  -1.507  1.00 32.53 ? 1246 VAL A CB    1 
ATOM   2071  C  CG1   . VAL A  1 273 ? 48.607  39.341  -1.558  1.00 30.34 ? 1246 VAL A CG1   1 
ATOM   2072  C  CG2   . VAL A  1 273 ? 47.553  37.289  -0.552  1.00 27.65 ? 1246 VAL A CG2   1 
ATOM   2073  N  N     . THR A  1 274 ? 50.420  37.788  -4.239  1.00 39.68 ? 1247 THR A N     1 
ATOM   2074  C  CA    . THR A  1 274 ? 51.268  38.644  -5.066  1.00 42.01 ? 1247 THR A CA    1 
ATOM   2075  C  C     . THR A  1 274 ? 51.329  38.188  -6.535  1.00 39.74 ? 1247 THR A C     1 
ATOM   2076  O  O     . THR A  1 274 ? 51.817  38.922  -7.403  1.00 44.12 ? 1247 THR A O     1 
ATOM   2077  C  CB    . THR A  1 274 ? 52.690  38.774  -4.416  1.00 42.73 ? 1247 THR A CB    1 
ATOM   2078  O  OG1   . THR A  1 274 ? 53.119  40.140  -4.446  1.00 52.04 ? 1247 THR A OG1   1 
ATOM   2079  C  CG2   . THR A  1 274 ? 53.738  37.858  -5.080  1.00 39.78 ? 1247 THR A CG2   1 
ATOM   2080  N  N     . ASP A  1 275 ? 50.809  36.988  -6.794  1.00 32.03 ? 1248 ASP A N     1 
ATOM   2081  C  CA    . ASP A  1 275 ? 50.886  36.315  -8.099  1.00 32.84 ? 1248 ASP A CA    1 
ATOM   2082  C  C     . ASP A  1 275 ? 50.322  37.137  -9.276  1.00 31.03 ? 1248 ASP A C     1 
ATOM   2083  O  O     . ASP A  1 275 ? 49.251  37.722  -9.146  1.00 30.79 ? 1248 ASP A O     1 
ATOM   2084  C  CB    . ASP A  1 275 ? 50.177  34.961  -7.992  1.00 30.20 ? 1248 ASP A CB    1 
ATOM   2085  C  CG    . ASP A  1 275 ? 50.460  34.054  -9.160  1.00 27.89 ? 1248 ASP A CG    1 
ATOM   2086  O  OD1   . ASP A  1 275 ? 49.910  34.293  -10.255 1.00 36.68 ? 1248 ASP A OD1   1 
ATOM   2087  O  OD2   . ASP A  1 275 ? 51.225  33.085  -8.980  1.00 41.02 ? 1248 ASP A OD2   1 
ATOM   2088  N  N     . PRO A  1 276 ? 51.057  37.197  -10.419 1.00 34.83 ? 1249 PRO A N     1 
ATOM   2089  C  CA    . PRO A  1 276 ? 50.652  37.964  -11.625 1.00 31.69 ? 1249 PRO A CA    1 
ATOM   2090  C  C     . PRO A  1 276 ? 49.338  37.536  -12.295 1.00 31.34 ? 1249 PRO A C     1 
ATOM   2091  O  O     . PRO A  1 276 ? 48.629  38.384  -12.828 1.00 33.48 ? 1249 PRO A O     1 
ATOM   2092  C  CB    . PRO A  1 276 ? 51.833  37.767  -12.593 1.00 31.98 ? 1249 PRO A CB    1 
ATOM   2093  C  CG    . PRO A  1 276 ? 52.981  37.362  -11.726 1.00 33.62 ? 1249 PRO A CG    1 
ATOM   2094  C  CD    . PRO A  1 276 ? 52.374  36.557  -10.615 1.00 34.67 ? 1249 PRO A CD    1 
ATOM   2095  N  N     . TRP A  1 277 ? 49.028  36.241  -12.291 1.00 33.33 ? 1250 TRP A N     1 
ATOM   2096  C  CA    . TRP A  1 277 ? 47.718  35.765  -12.758 1.00 30.32 ? 1250 TRP A CA    1 
ATOM   2097  C  C     . TRP A  1 277 ? 46.591  36.225  -11.839 1.00 29.26 ? 1250 TRP A C     1 
ATOM   2098  O  O     . TRP A  1 277 ? 45.536  36.632  -12.317 1.00 30.04 ? 1250 TRP A O     1 
ATOM   2099  C  CB    . TRP A  1 277 ? 47.682  34.239  -12.883 1.00 25.42 ? 1250 TRP A CB    1 
ATOM   2100  C  CG    . TRP A  1 277 ? 46.488  33.728  -13.643 1.00 22.75 ? 1250 TRP A CG    1 
ATOM   2101  C  CD1   . TRP A  1 277 ? 46.387  33.580  -14.998 1.00 16.42 ? 1250 TRP A CD1   1 
ATOM   2102  C  CD2   . TRP A  1 277 ? 45.224  33.302  -13.097 1.00 11.74 ? 1250 TRP A CD2   1 
ATOM   2103  N  NE1   . TRP A  1 277 ? 45.150  33.082  -15.329 1.00 22.33 ? 1250 TRP A NE1   1 
ATOM   2104  C  CE2   . TRP A  1 277 ? 44.415  32.903  -14.185 1.00 20.34 ? 1250 TRP A CE2   1 
ATOM   2105  C  CE3   . TRP A  1 277 ? 44.705  33.211  -11.797 1.00 14.90 ? 1250 TRP A CE3   1 
ATOM   2106  C  CZ2   . TRP A  1 277 ? 43.108  32.418  -14.016 1.00 12.75 ? 1250 TRP A CZ2   1 
ATOM   2107  C  CZ3   . TRP A  1 277 ? 43.404  32.730  -11.627 1.00 16.45 ? 1250 TRP A CZ3   1 
ATOM   2108  C  CH2   . TRP A  1 277 ? 42.624  32.333  -12.738 1.00 14.80 ? 1250 TRP A CH2   1 
ATOM   2109  N  N     . VAL A  1 278 ? 46.832  36.165  -10.528 1.00 29.98 ? 1251 VAL A N     1 
ATOM   2110  C  CA    . VAL A  1 278 ? 45.853  36.573  -9.516  1.00 30.18 ? 1251 VAL A CA    1 
ATOM   2111  C  C     . VAL A  1 278 ? 45.564  38.078  -9.583  1.00 34.39 ? 1251 VAL A C     1 
ATOM   2112  O  O     . VAL A  1 278 ? 44.449  38.507  -9.301  1.00 33.78 ? 1251 VAL A O     1 
ATOM   2113  C  CB    . VAL A  1 278 ? 46.301  36.157  -8.076  1.00 32.57 ? 1251 VAL A CB    1 
ATOM   2114  C  CG1   . VAL A  1 278 ? 45.435  36.816  -6.985  1.00 24.36 ? 1251 VAL A CG1   1 
ATOM   2115  C  CG2   . VAL A  1 278 ? 46.285  34.642  -7.923  1.00 18.83 ? 1251 VAL A CG2   1 
ATOM   2116  N  N     . THR A  1 279 ? 46.569  38.861  -9.976  1.00 34.92 ? 1252 THR A N     1 
ATOM   2117  C  CA    . THR A  1 279 ? 46.465  40.322  -10.010 1.00 34.01 ? 1252 THR A CA    1 
ATOM   2118  C  C     . THR A  1 279 ? 46.302  40.925  -11.420 1.00 34.14 ? 1252 THR A C     1 
ATOM   2119  O  O     . THR A  1 279 ? 46.272  42.148  -11.564 1.00 37.81 ? 1252 THR A O     1 
ATOM   2120  C  CB    . THR A  1 279 ? 47.681  40.993  -9.311  1.00 32.72 ? 1252 THR A CB    1 
ATOM   2121  O  OG1   . THR A  1 279 ? 48.894  40.476  -9.863  1.00 37.75 ? 1252 THR A OG1   1 
ATOM   2122  C  CG2   . THR A  1 279 ? 47.666  40.748  -7.807  1.00 30.89 ? 1252 THR A CG2   1 
ATOM   2123  N  N     . GLN A  1 280 ? 46.171  40.080  -12.445 1.00 31.41 ? 1253 GLN A N     1 
ATOM   2124  C  CA    . GLN A  1 280 ? 46.113  40.545  -13.841 1.00 30.71 ? 1253 GLN A CA    1 
ATOM   2125  C  C     . GLN A  1 280 ? 44.989  41.558  -14.100 1.00 34.91 ? 1253 GLN A C     1 
ATOM   2126  O  O     . GLN A  1 280 ? 44.007  41.590  -13.357 1.00 36.55 ? 1253 GLN A O     1 
ATOM   2127  C  CB    . GLN A  1 280 ? 46.035  39.366  -14.834 1.00 24.77 ? 1253 GLN A CB    1 
ATOM   2128  C  CG    . GLN A  1 280 ? 44.681  38.661  -14.889 1.00 23.12 ? 1253 GLN A CG    1 
ATOM   2129  C  CD    . GLN A  1 280 ? 44.631  37.554  -15.911 1.00 26.82 ? 1253 GLN A CD    1 
ATOM   2130  O  OE1   . GLN A  1 280 ? 44.697  36.369  -15.573 1.00 26.33 ? 1253 GLN A OE1   1 
ATOM   2131  N  NE2   . GLN A  1 280 ? 44.521  37.929  -17.175 1.00 34.94 ? 1253 GLN A NE2   1 
ATOM   2132  N  N     . PRO A  1 281 ? 45.142  42.401  -15.147 1.00 39.00 ? 1254 PRO A N     1 
ATOM   2133  C  CA    . PRO A  1 281 ? 44.073  43.316  -15.548 1.00 37.95 ? 1254 PRO A CA    1 
ATOM   2134  C  C     . PRO A  1 281 ? 42.846  42.584  -16.097 1.00 33.23 ? 1254 PRO A C     1 
ATOM   2135  O  O     . PRO A  1 281 ? 42.974  41.664  -16.905 1.00 36.01 ? 1254 PRO A O     1 
ATOM   2136  C  CB    . PRO A  1 281 ? 44.722  44.166  -16.659 1.00 40.13 ? 1254 PRO A CB    1 
ATOM   2137  C  CG    . PRO A  1 281 ? 46.193  43.968  -16.504 1.00 46.86 ? 1254 PRO A CG    1 
ATOM   2138  C  CD    . PRO A  1 281 ? 46.334  42.560  -16.000 1.00 42.03 ? 1254 PRO A CD    1 
ATOM   2139  N  N     . VAL A  1 282 ? 41.673  43.003  -15.637 1.00 34.41 ? 1255 VAL A N     1 
ATOM   2140  C  CA    . VAL A  1 282 ? 40.390  42.501  -16.119 1.00 34.50 ? 1255 VAL A CA    1 
ATOM   2141  C  C     . VAL A  1 282 ? 39.446  43.695  -16.374 1.00 37.86 ? 1255 VAL A C     1 
ATOM   2142  O  O     . VAL A  1 282 ? 39.396  44.648  -15.586 1.00 34.69 ? 1255 VAL A O     1 
ATOM   2143  C  CB    . VAL A  1 282 ? 39.775  41.413  -15.148 1.00 31.79 ? 1255 VAL A CB    1 
ATOM   2144  C  CG1   . VAL A  1 282 ? 39.744  41.899  -13.709 1.00 31.34 ? 1255 VAL A CG1   1 
ATOM   2145  C  CG2   . VAL A  1 282 ? 38.382  40.945  -15.604 1.00 27.61 ? 1255 VAL A CG2   1 
ATOM   2146  N  N     . ASN A  1 283 ? 38.747  43.646  -17.507 1.00 38.75 ? 1256 ASN A N     1 
ATOM   2147  C  CA    . ASN A  1 283 ? 37.701  44.604  -17.834 1.00 38.70 ? 1256 ASN A CA    1 
ATOM   2148  C  C     . ASN A  1 283 ? 36.343  43.950  -17.649 1.00 35.55 ? 1256 ASN A C     1 
ATOM   2149  O  O     . ASN A  1 283 ? 35.936  43.102  -18.441 1.00 35.97 ? 1256 ASN A O     1 
ATOM   2150  C  CB    . ASN A  1 283 ? 37.854  45.116  -19.275 1.00 44.71 ? 1256 ASN A CB    1 
ATOM   2151  C  CG    . ASN A  1 283 ? 36.803  46.158  -19.645 1.00 51.25 ? 1256 ASN A CG    1 
ATOM   2152  O  OD1   . ASN A  1 283 ? 36.592  47.133  -18.917 1.00 48.70 ? 1256 ASN A OD1   1 
ATOM   2153  N  ND2   . ASN A  1 283 ? 36.141  45.955  -20.783 1.00 50.54 ? 1256 ASN A ND2   1 
ATOM   2154  N  N     . LEU A  1 284 ? 35.647  44.356  -16.596 1.00 31.68 ? 1257 LEU A N     1 
ATOM   2155  C  CA    . LEU A  1 284 ? 34.388  43.739  -16.218 1.00 31.31 ? 1257 LEU A CA    1 
ATOM   2156  C  C     . LEU A  1 284 ? 33.223  44.120  -17.120 1.00 32.09 ? 1257 LEU A C     1 
ATOM   2157  O  O     . LEU A  1 284 ? 32.272  43.343  -17.276 1.00 26.01 ? 1257 LEU A O     1 
ATOM   2158  C  CB    . LEU A  1 284 ? 34.068  44.061  -14.753 1.00 32.00 ? 1257 LEU A CB    1 
ATOM   2159  C  CG    . LEU A  1 284 ? 34.725  43.148  -13.721 1.00 28.20 ? 1257 LEU A CG    1 
ATOM   2160  C  CD1   . LEU A  1 284 ? 34.476  43.715  -12.345 1.00 36.65 ? 1257 LEU A CD1   1 
ATOM   2161  C  CD2   . LEU A  1 284 ? 34.173  41.718  -13.829 1.00 19.96 ? 1257 LEU A CD2   1 
ATOM   2162  N  N     . ALA A  1 285 ? 33.308  45.314  -17.710 1.00 36.18 ? 1258 ALA A N     1 
ATOM   2163  C  CA    . ALA A  1 285 ? 32.309  45.811  -18.662 1.00 38.47 ? 1258 ALA A CA    1 
ATOM   2164  C  C     . ALA A  1 285 ? 32.290  44.992  -19.960 1.00 40.67 ? 1258 ALA A C     1 
ATOM   2165  O  O     . ALA A  1 285 ? 31.397  45.161  -20.801 1.00 44.89 ? 1258 ALA A O     1 
ATOM   2166  C  CB    . ALA A  1 285 ? 32.556  47.289  -18.956 1.00 38.79 ? 1258 ALA A CB    1 
ATOM   2167  N  N     . ASP A  1 286 ? 33.273  44.098  -20.095 1.00 40.81 ? 1259 ASP A N     1 
ATOM   2168  C  CA    . ASP A  1 286 ? 33.407  43.193  -21.236 1.00 37.71 ? 1259 ASP A CA    1 
ATOM   2169  C  C     . ASP A  1 286 ? 32.633  41.886  -21.067 1.00 37.71 ? 1259 ASP A C     1 
ATOM   2170  O  O     . ASP A  1 286 ? 32.497  41.124  -22.028 1.00 36.26 ? 1259 ASP A O     1 
ATOM   2171  C  CB    . ASP A  1 286 ? 34.887  42.887  -21.506 1.00 36.10 ? 1259 ASP A CB    1 
ATOM   2172  N  N     . TYR A  1 287 ? 32.124  41.627  -19.860 1.00 39.61 ? 1260 TYR A N     1 
ATOM   2173  C  CA    . TYR A  1 287 ? 31.373  40.389  -19.591 1.00 38.34 ? 1260 TYR A CA    1 
ATOM   2174  C  C     . TYR A  1 287 ? 29.924  40.621  -19.193 1.00 39.24 ? 1260 TYR A C     1 
ATOM   2175  O  O     . TYR A  1 287 ? 29.607  41.550  -18.446 1.00 40.09 ? 1260 TYR A O     1 
ATOM   2176  C  CB    . TYR A  1 287 ? 32.066  39.536  -18.519 1.00 36.99 ? 1260 TYR A CB    1 
ATOM   2177  C  CG    . TYR A  1 287 ? 33.540  39.344  -18.761 1.00 30.26 ? 1260 TYR A CG    1 
ATOM   2178  C  CD1   . TYR A  1 287 ? 34.000  38.383  -19.654 1.00 19.97 ? 1260 TYR A CD1   1 
ATOM   2179  C  CD2   . TYR A  1 287 ? 34.473  40.131  -18.101 1.00 26.71 ? 1260 TYR A CD2   1 
ATOM   2180  C  CE1   . TYR A  1 287 ? 35.355  38.219  -19.885 1.00 31.33 ? 1260 TYR A CE1   1 
ATOM   2181  C  CE2   . TYR A  1 287 ? 35.827  39.972  -18.321 1.00 31.99 ? 1260 TYR A CE2   1 
ATOM   2182  C  CZ    . TYR A  1 287 ? 36.262  39.020  -19.212 1.00 31.40 ? 1260 TYR A CZ    1 
ATOM   2183  O  OH    . TYR A  1 287 ? 37.609  38.868  -19.414 1.00 30.07 ? 1260 TYR A OH    1 
ATOM   2184  N  N     . THR A  1 288 ? 29.058  39.746  -19.694 1.00 40.45 ? 1261 THR A N     1 
ATOM   2185  C  CA    . THR A  1 288 ? 27.632  39.772  -19.402 1.00 38.94 ? 1261 THR A CA    1 
ATOM   2186  C  C     . THR A  1 288 ? 27.274  38.450  -18.752 1.00 35.29 ? 1261 THR A C     1 
ATOM   2187  O  O     . THR A  1 288 ? 27.678  37.403  -19.247 1.00 40.63 ? 1261 THR A O     1 
ATOM   2188  C  CB    . THR A  1 288 ? 26.801  39.986  -20.703 1.00 40.71 ? 1261 THR A CB    1 
ATOM   2189  O  OG1   . THR A  1 288 ? 26.911  41.353  -21.117 1.00 48.42 ? 1261 THR A OG1   1 
ATOM   2190  C  CG2   . THR A  1 288 ? 25.322  39.648  -20.500 1.00 31.73 ? 1261 THR A CG2   1 
ATOM   2191  N  N     . TRP A  1 289 ? 26.522  38.504  -17.650 1.00 32.71 ? 1262 TRP A N     1 
ATOM   2192  C  CA    . TRP A  1 289 ? 26.108  37.303  -16.931 1.00 33.03 ? 1262 TRP A CA    1 
ATOM   2193  C  C     . TRP A  1 289 ? 25.421  36.282  -17.843 1.00 34.56 ? 1262 TRP A C     1 
ATOM   2194  O  O     . TRP A  1 289 ? 25.748  35.099  -17.801 1.00 36.51 ? 1262 TRP A O     1 
ATOM   2195  C  CB    . TRP A  1 289 ? 25.227  37.638  -15.705 1.00 33.22 ? 1262 TRP A CB    1 
ATOM   2196  C  CG    . TRP A  1 289 ? 24.725  36.387  -14.985 1.00 33.47 ? 1262 TRP A CG    1 
ATOM   2197  C  CD1   . TRP A  1 289 ? 23.531  35.747  -15.189 1.00 35.47 ? 1262 TRP A CD1   1 
ATOM   2198  C  CD2   . TRP A  1 289 ? 25.419  35.621  -13.987 1.00 32.09 ? 1262 TRP A CD2   1 
ATOM   2199  N  NE1   . TRP A  1 289 ? 23.437  34.641  -14.383 1.00 35.28 ? 1262 TRP A NE1   1 
ATOM   2200  C  CE2   . TRP A  1 289 ? 24.579  34.538  -13.631 1.00 39.64 ? 1262 TRP A CE2   1 
ATOM   2201  C  CE3   . TRP A  1 289 ? 26.667  35.743  -13.356 1.00 38.49 ? 1262 TRP A CE3   1 
ATOM   2202  C  CZ2   . TRP A  1 289 ? 24.947  33.583  -12.669 1.00 33.06 ? 1262 TRP A CZ2   1 
ATOM   2203  C  CZ3   . TRP A  1 289 ? 27.029  34.796  -12.397 1.00 35.31 ? 1262 TRP A CZ3   1 
ATOM   2204  C  CH2   . TRP A  1 289 ? 26.170  33.730  -12.066 1.00 35.54 ? 1262 TRP A CH2   1 
ATOM   2205  N  N     . GLU A  1 290 ? 24.492  36.745  -18.677 1.00 36.06 ? 1263 GLU A N     1 
ATOM   2206  C  CA    . GLU A  1 290 ? 23.701  35.853  -19.540 1.00 35.85 ? 1263 GLU A CA    1 
ATOM   2207  C  C     . GLU A  1 290 ? 24.488  35.161  -20.670 1.00 36.02 ? 1263 GLU A C     1 
ATOM   2208  O  O     . GLU A  1 290 ? 24.107  34.076  -21.114 1.00 40.91 ? 1263 GLU A O     1 
ATOM   2209  C  CB    . GLU A  1 290 ? 22.471  36.584  -20.098 1.00 38.34 ? 1263 GLU A CB    1 
ATOM   2210  N  N     . GLU A  1 291 ? 25.571  35.782  -21.135 1.00 34.46 ? 1264 GLU A N     1 
ATOM   2211  C  CA    . GLU A  1 291 ? 26.454  35.153  -22.134 1.00 34.98 ? 1264 GLU A CA    1 
ATOM   2212  C  C     . GLU A  1 291 ? 27.422  34.160  -21.482 1.00 34.64 ? 1264 GLU A C     1 
ATOM   2213  O  O     . GLU A  1 291 ? 27.773  33.138  -22.075 1.00 33.03 ? 1264 GLU A O     1 
ATOM   2214  C  CB    . GLU A  1 291 ? 27.247  36.207  -22.913 1.00 32.47 ? 1264 GLU A CB    1 
ATOM   2215  C  CG    . GLU A  1 291 ? 26.385  37.221  -23.653 1.00 38.22 ? 1264 GLU A CG    1 
ATOM   2216  C  CD    . GLU A  1 291 ? 27.193  38.311  -24.329 1.00 36.11 ? 1264 GLU A CD    1 
ATOM   2217  O  OE1   . GLU A  1 291 ? 28.435  38.316  -24.200 1.00 37.69 ? 1264 GLU A OE1   1 
ATOM   2218  O  OE2   . GLU A  1 291 ? 26.580  39.179  -24.985 1.00 47.32 ? 1264 GLU A OE2   1 
ATOM   2219  N  N     . VAL A  1 292 ? 27.847  34.487  -20.262 1.00 31.74 ? 1265 VAL A N     1 
ATOM   2220  C  CA    . VAL A  1 292 ? 28.756  33.663  -19.472 1.00 30.20 ? 1265 VAL A CA    1 
ATOM   2221  C  C     . VAL A  1 292 ? 28.022  32.482  -18.842 1.00 30.22 ? 1265 VAL A C     1 
ATOM   2222  O  O     . VAL A  1 292 ? 28.561  31.375  -18.755 1.00 30.03 ? 1265 VAL A O     1 
ATOM   2223  C  CB    . VAL A  1 292 ? 29.424  34.510  -18.351 1.00 32.07 ? 1265 VAL A CB    1 
ATOM   2224  C  CG1   . VAL A  1 292 ? 30.268  33.625  -17.427 1.00 21.94 ? 1265 VAL A CG1   1 
ATOM   2225  C  CG2   . VAL A  1 292 ? 30.245  35.668  -18.963 1.00 20.00 ? 1265 VAL A CG2   1 
ATOM   2226  N  N     . PHE A  1 293 ? 26.793  32.738  -18.400 1.00 33.15 ? 1266 PHE A N     1 
ATOM   2227  C  CA    . PHE A  1 293 ? 25.970  31.751  -17.722 1.00 32.55 ? 1266 PHE A CA    1 
ATOM   2228  C  C     . PHE A  1 293 ? 24.571  31.744  -18.322 1.00 27.91 ? 1266 PHE A C     1 
ATOM   2229  O  O     . PHE A  1 293 ? 24.036  30.681  -18.641 1.00 28.73 ? 1266 PHE A O     1 
ATOM   2230  C  CB    . PHE A  1 293 ? 25.906  32.069  -16.224 1.00 34.31 ? 1266 PHE A CB    1 
ATOM   2231  C  CG    . PHE A  1 293 ? 25.341  30.951  -15.381 1.00 33.62 ? 1266 PHE A CG    1 
ATOM   2232  C  CD1   . PHE A  1 293 ? 26.111  29.833  -15.075 1.00 34.50 ? 1266 PHE A CD1   1 
ATOM   2233  C  CD2   . PHE A  1 293 ? 24.038  31.020  -14.889 1.00 42.27 ? 1266 PHE A CD2   1 
ATOM   2234  C  CE1   . PHE A  1 293 ? 25.598  28.803  -14.295 1.00 33.25 ? 1266 PHE A CE1   1 
ATOM   2235  C  CE2   . PHE A  1 293 ? 23.512  29.992  -14.104 1.00 36.51 ? 1266 PHE A CE2   1 
ATOM   2236  C  CZ    . PHE A  1 293 ? 24.294  28.880  -13.808 1.00 35.19 ? 1266 PHE A CZ    1 
ATOM   2237  N  N     . ALA B  1 9   ? 29.900  -8.483  11.039  1.00 45.82 ? 982  ALA B N     1 
ATOM   2238  C  CA    . ALA B  1 9   ? 29.353  -9.863  11.205  1.00 47.63 ? 982  ALA B CA    1 
ATOM   2239  C  C     . ALA B  1 9   ? 27.832  -9.885  11.045  1.00 47.83 ? 982  ALA B C     1 
ATOM   2240  O  O     . ALA B  1 9   ? 27.125  -9.065  11.641  1.00 47.82 ? 982  ALA B O     1 
ATOM   2241  C  CB    . ALA B  1 9   ? 29.754  -10.437 12.555  1.00 43.44 ? 982  ALA B CB    1 
ATOM   2242  N  N     . VAL B  1 10  ? 27.348  -10.818 10.225  1.00 47.10 ? 983  VAL B N     1 
ATOM   2243  C  CA    . VAL B  1 10  ? 25.916  -11.045 10.041  1.00 40.98 ? 983  VAL B CA    1 
ATOM   2244  C  C     . VAL B  1 10  ? 25.462  -12.161 10.977  1.00 39.96 ? 983  VAL B C     1 
ATOM   2245  O  O     . VAL B  1 10  ? 25.904  -13.300 10.847  1.00 33.39 ? 983  VAL B O     1 
ATOM   2246  C  CB    . VAL B  1 10  ? 25.553  -11.434 8.580   1.00 43.07 ? 983  VAL B CB    1 
ATOM   2247  C  CG1   . VAL B  1 10  ? 24.039  -11.444 8.390   1.00 39.14 ? 983  VAL B CG1   1 
ATOM   2248  C  CG2   . VAL B  1 10  ? 26.201  -10.480 7.571   1.00 44.98 ? 983  VAL B CG2   1 
ATOM   2249  N  N     . GLU B  1 11  ? 24.582  -11.815 11.916  1.00 40.56 ? 984  GLU B N     1 
ATOM   2250  C  CA    . GLU B  1 11  ? 23.949  -12.771 12.823  1.00 44.34 ? 984  GLU B CA    1 
ATOM   2251  C  C     . GLU B  1 11  ? 23.240  -13.892 12.047  1.00 41.66 ? 984  GLU B C     1 
ATOM   2252  O  O     . GLU B  1 11  ? 22.516  -13.633 11.085  1.00 44.14 ? 984  GLU B O     1 
ATOM   2253  C  CB    . GLU B  1 11  ? 22.945  -12.047 13.733  1.00 47.20 ? 984  GLU B CB    1 
ATOM   2254  C  CG    . GLU B  1 11  ? 23.467  -10.756 14.388  1.00 48.87 ? 984  GLU B CG    1 
ATOM   2255  C  CD    . GLU B  1 11  ? 22.350  -9.785  14.793  1.00 52.67 ? 984  GLU B CD    1 
ATOM   2256  O  OE1   . GLU B  1 11  ? 21.152  -10.148 14.679  1.00 56.95 ? 984  GLU B OE1   1 
ATOM   2257  O  OE2   . GLU B  1 11  ? 22.672  -8.653  15.226  1.00 42.84 ? 984  GLU B OE2   1 
ATOM   2258  N  N     . LEU B  1 12  ? 23.469  -15.133 12.469  1.00 37.60 ? 985  LEU B N     1 
ATOM   2259  C  CA    . LEU B  1 12  ? 22.874  -16.311 11.842  1.00 33.78 ? 985  LEU B CA    1 
ATOM   2260  C  C     . LEU B  1 12  ? 21.766  -16.895 12.730  1.00 35.77 ? 985  LEU B C     1 
ATOM   2261  O  O     . LEU B  1 12  ? 22.010  -17.723 13.619  1.00 34.32 ? 985  LEU B O     1 
ATOM   2262  C  CB    . LEU B  1 12  ? 23.963  -17.349 11.526  1.00 28.43 ? 985  LEU B CB    1 
ATOM   2263  C  CG    . LEU B  1 12  ? 24.652  -17.429 10.155  1.00 29.98 ? 985  LEU B CG    1 
ATOM   2264  C  CD1   . LEU B  1 12  ? 24.720  -16.111 9.382   1.00 31.24 ? 985  LEU B CD1   1 
ATOM   2265  C  CD2   . LEU B  1 12  ? 26.040  -18.024 10.322  1.00 23.77 ? 985  LEU B CD2   1 
ATOM   2266  N  N     . GLU B  1 13  ? 20.540  -16.461 12.462  1.00 40.26 ? 986  GLU B N     1 
ATOM   2267  C  CA    . GLU B  1 13  ? 19.439  -16.606 13.410  1.00 42.42 ? 986  GLU B CA    1 
ATOM   2268  C  C     . GLU B  1 13  ? 18.269  -17.417 12.858  1.00 42.05 ? 986  GLU B C     1 
ATOM   2269  O  O     . GLU B  1 13  ? 17.126  -17.222 13.264  1.00 43.68 ? 986  GLU B O     1 
ATOM   2270  C  CB    . GLU B  1 13  ? 18.966  -15.216 13.848  1.00 44.64 ? 986  GLU B CB    1 
ATOM   2271  C  CG    . GLU B  1 13  ? 19.983  -14.440 14.674  1.00 52.36 ? 986  GLU B CG    1 
ATOM   2272  C  CD    . GLU B  1 13  ? 19.691  -14.453 16.169  1.00 60.24 ? 986  GLU B CD    1 
ATOM   2273  O  OE1   . GLU B  1 13  ? 18.803  -15.215 16.613  1.00 62.87 ? 986  GLU B OE1   1 
ATOM   2274  O  OE2   . GLU B  1 13  ? 20.356  -13.690 16.904  1.00 64.53 ? 986  GLU B OE2   1 
ATOM   2275  N  N     . GLY B  1 14  ? 18.568  -18.337 11.945  1.00 41.92 ? 987  GLY B N     1 
ATOM   2276  C  CA    . GLY B  1 14  ? 17.556  -19.189 11.330  1.00 42.81 ? 987  GLY B CA    1 
ATOM   2277  C  C     . GLY B  1 14  ? 16.858  -20.126 12.297  1.00 45.53 ? 987  GLY B C     1 
ATOM   2278  O  O     . GLY B  1 14  ? 15.677  -20.430 12.123  1.00 45.18 ? 987  GLY B O     1 
ATOM   2279  N  N     . LEU B  1 15  ? 17.586  -20.576 13.319  1.00 47.38 ? 988  LEU B N     1 
ATOM   2280  C  CA    . LEU B  1 15  ? 17.062  -21.553 14.284  1.00 46.38 ? 988  LEU B CA    1 
ATOM   2281  C  C     . LEU B  1 15  ? 16.284  -20.887 15.415  1.00 44.65 ? 988  LEU B C     1 
ATOM   2282  O  O     . LEU B  1 15  ? 15.267  -21.412 15.870  1.00 42.94 ? 988  LEU B O     1 
ATOM   2283  C  CB    . LEU B  1 15  ? 18.189  -22.424 14.852  1.00 48.20 ? 988  LEU B CB    1 
ATOM   2284  C  CG    . LEU B  1 15  ? 19.055  -23.245 13.885  1.00 50.73 ? 988  LEU B CG    1 
ATOM   2285  C  CD1   . LEU B  1 15  ? 20.273  -23.809 14.615  1.00 49.25 ? 988  LEU B CD1   1 
ATOM   2286  C  CD2   . LEU B  1 15  ? 18.253  -24.361 13.217  1.00 50.43 ? 988  LEU B CD2   1 
ATOM   2287  N  N     . ALA B  1 16  ? 16.769  -19.731 15.863  1.00 42.16 ? 989  ALA B N     1 
ATOM   2288  C  CA    . ALA B  1 16  ? 16.077  -18.939 16.879  1.00 40.49 ? 989  ALA B CA    1 
ATOM   2289  C  C     . ALA B  1 16  ? 14.790  -18.275 16.346  1.00 38.00 ? 989  ALA B C     1 
ATOM   2290  O  O     . ALA B  1 16  ? 13.859  -18.013 17.111  1.00 38.35 ? 989  ALA B O     1 
ATOM   2291  C  CB    . ALA B  1 16  ? 17.021  -17.895 17.464  1.00 35.42 ? 989  ALA B CB    1 
ATOM   2292  N  N     . ALA B  1 17  ? 14.751  -18.000 15.042  1.00 33.79 ? 990  ALA B N     1 
ATOM   2293  C  CA    . ALA B  1 17  ? 13.584  -17.376 14.404  1.00 35.77 ? 990  ALA B CA    1 
ATOM   2294  C  C     . ALA B  1 17  ? 12.416  -18.344 14.186  1.00 37.86 ? 990  ALA B C     1 
ATOM   2295  O  O     . ALA B  1 17  ? 11.260  -17.915 14.150  1.00 36.44 ? 990  ALA B O     1 
ATOM   2296  C  CB    . ALA B  1 17  ? 13.982  -16.710 13.082  1.00 27.86 ? 990  ALA B CB    1 
ATOM   2297  N  N     . CYS B  1 18  ? 12.734  -19.634 14.037  1.00 39.70 ? 991  CYS B N     1 
ATOM   2298  C  CA    . CYS B  1 18  ? 11.757  -20.702 13.776  1.00 41.52 ? 991  CYS B CA    1 
ATOM   2299  C  C     . CYS B  1 18  ? 11.329  -21.482 15.028  1.00 41.25 ? 991  CYS B C     1 
ATOM   2300  O  O     . CYS B  1 18  ? 10.326  -22.198 15.000  1.00 40.56 ? 991  CYS B O     1 
ATOM   2301  C  CB    . CYS B  1 18  ? 12.325  -21.705 12.757  1.00 37.20 ? 991  CYS B CB    1 
ATOM   2302  S  SG    . CYS B  1 18  ? 12.586  -21.060 11.096  1.00 48.89 ? 991  CYS B SG    1 
ATOM   2303  N  N     . GLU B  1 19  ? 12.091  -21.342 16.109  1.00 41.89 ? 992  GLU B N     1 
ATOM   2304  C  CA    . GLU B  1 19  ? 11.933  -22.178 17.309  1.00 47.74 ? 992  GLU B CA    1 
ATOM   2305  C  C     . GLU B  1 19  ? 10.519  -22.186 17.907  1.00 45.06 ? 992  GLU B C     1 
ATOM   2306  O  O     . GLU B  1 19  ? 9.889   -21.141 18.046  1.00 47.03 ? 992  GLU B O     1 
ATOM   2307  C  CB    . GLU B  1 19  ? 12.991  -21.803 18.369  1.00 46.64 ? 992  GLU B CB    1 
ATOM   2308  C  CG    . GLU B  1 19  ? 12.797  -22.412 19.773  1.00 57.88 ? 992  GLU B CG    1 
ATOM   2309  C  CD    . GLU B  1 19  ? 12.807  -23.945 19.799  1.00 63.44 ? 992  GLU B CD    1 
ATOM   2310  O  OE1   . GLU B  1 19  ? 12.307  -24.520 20.794  1.00 54.62 ? 992  GLU B OE1   1 
ATOM   2311  O  OE2   . GLU B  1 19  ? 13.308  -24.572 18.834  1.00 61.03 ? 992  GLU B OE2   1 
ATOM   2312  N  N     . GLY B  1 20  ? 10.027  -23.383 18.229  1.00 46.22 ? 993  GLY B N     1 
ATOM   2313  C  CA    . GLY B  1 20  ? 8.776   -23.541 18.975  1.00 43.88 ? 993  GLY B CA    1 
ATOM   2314  C  C     . GLY B  1 20  ? 7.555   -23.906 18.154  1.00 43.30 ? 993  GLY B C     1 
ATOM   2315  O  O     . GLY B  1 20  ? 7.614   -24.767 17.273  1.00 42.43 ? 993  GLY B O     1 
ATOM   2316  N  N     . GLU B  1 21  ? 6.444   -23.230 18.447  1.00 47.61 ? 994  GLU B N     1 
ATOM   2317  C  CA    . GLU B  1 21  ? 5.135   -23.570 17.883  1.00 47.29 ? 994  GLU B CA    1 
ATOM   2318  C  C     . GLU B  1 21  ? 5.055   -23.386 16.365  1.00 44.77 ? 994  GLU B C     1 
ATOM   2319  O  O     . GLU B  1 21  ? 4.358   -24.149 15.686  1.00 44.12 ? 994  GLU B O     1 
ATOM   2320  C  CB    . GLU B  1 21  ? 4.033   -22.775 18.583  1.00 48.80 ? 994  GLU B CB    1 
ATOM   2321  C  CG    . GLU B  1 21  ? 2.633   -23.365 18.428  1.00 56.54 ? 994  GLU B CG    1 
ATOM   2322  C  CD    . GLU B  1 21  ? 1.567   -22.567 19.168  1.00 53.13 ? 994  GLU B CD    1 
ATOM   2323  O  OE1   . GLU B  1 21  ? 1.924   -21.718 20.022  1.00 51.57 ? 994  GLU B OE1   1 
ATOM   2324  O  OE2   . GLU B  1 21  ? 0.367   -22.793 18.888  1.00 57.27 ? 994  GLU B OE2   1 
ATOM   2325  N  N     . TYR B  1 22  ? 5.774   -22.391 15.837  1.00 40.97 ? 995  TYR B N     1 
ATOM   2326  C  CA    . TYR B  1 22  ? 5.810   -22.151 14.389  1.00 35.98 ? 995  TYR B CA    1 
ATOM   2327  C  C     . TYR B  1 22  ? 6.352   -23.363 13.636  1.00 35.00 ? 995  TYR B C     1 
ATOM   2328  O  O     . TYR B  1 22  ? 5.717   -23.842 12.683  1.00 34.81 ? 995  TYR B O     1 
ATOM   2329  C  CB    . TYR B  1 22  ? 6.605   -20.882 14.040  1.00 35.75 ? 995  TYR B CB    1 
ATOM   2330  C  CG    . TYR B  1 22  ? 6.960   -20.777 12.569  1.00 32.80 ? 995  TYR B CG    1 
ATOM   2331  C  CD1   . TYR B  1 22  ? 6.043   -20.287 11.645  1.00 30.60 ? 995  TYR B CD1   1 
ATOM   2332  C  CD2   . TYR B  1 22  ? 8.213   -21.186 12.100  1.00 37.12 ? 995  TYR B CD2   1 
ATOM   2333  C  CE1   . TYR B  1 22  ? 6.360   -20.202 10.292  1.00 28.03 ? 995  TYR B CE1   1 
ATOM   2334  C  CE2   . TYR B  1 22  ? 8.537   -21.103 10.751  1.00 29.56 ? 995  TYR B CE2   1 
ATOM   2335  C  CZ    . TYR B  1 22  ? 7.604   -20.609 9.856   1.00 26.62 ? 995  TYR B CZ    1 
ATOM   2336  O  OH    . TYR B  1 22  ? 7.916   -20.524 8.524   1.00 24.17 ? 995  TYR B OH    1 
ATOM   2337  N  N     . SER B  1 23  ? 7.507   -23.857 14.088  1.00 37.17 ? 996  SER B N     1 
ATOM   2338  C  CA    . SER B  1 23  ? 8.193   -25.024 13.501  1.00 39.31 ? 996  SER B CA    1 
ATOM   2339  C  C     . SER B  1 23  ? 7.355   -26.297 13.481  1.00 39.06 ? 996  SER B C     1 
ATOM   2340  O  O     . SER B  1 23  ? 7.538   -27.145 12.606  1.00 39.61 ? 996  SER B O     1 
ATOM   2341  C  CB    . SER B  1 23  ? 9.502   -25.310 14.246  1.00 40.42 ? 996  SER B CB    1 
ATOM   2342  O  OG    . SER B  1 23  ? 10.522  -24.406 13.871  1.00 40.93 ? 996  SER B OG    1 
ATOM   2343  N  N     . GLN B  1 24  ? 6.460   -26.430 14.458  1.00 40.81 ? 997  GLN B N     1 
ATOM   2344  C  CA    . GLN B  1 24  ? 5.532   -27.558 14.538  1.00 42.12 ? 997  GLN B CA    1 
ATOM   2345  C  C     . GLN B  1 24  ? 4.509   -27.567 13.398  1.00 41.91 ? 997  GLN B C     1 
ATOM   2346  O  O     . GLN B  1 24  ? 4.118   -28.633 12.923  1.00 43.47 ? 997  GLN B O     1 
ATOM   2347  C  CB    . GLN B  1 24  ? 4.803   -27.559 15.890  1.00 44.91 ? 997  GLN B CB    1 
ATOM   2348  C  CG    . GLN B  1 24  ? 5.705   -27.775 17.124  1.00 48.13 ? 997  GLN B CG    1 
ATOM   2349  C  CD    . GLN B  1 24  ? 6.272   -29.195 17.231  1.00 56.84 ? 997  GLN B CD    1 
ATOM   2350  O  OE1   . GLN B  1 24  ? 7.346   -29.398 17.799  1.00 60.28 ? 997  GLN B OE1   1 
ATOM   2351  N  NE2   . GLN B  1 24  ? 5.548   -30.178 16.690  1.00 59.31 ? 997  GLN B NE2   1 
ATOM   2352  N  N     . LYS B  1 25  ? 4.097   -26.377 12.963  1.00 38.17 ? 998  LYS B N     1 
ATOM   2353  C  CA    . LYS B  1 25  ? 3.017   -26.202 11.988  1.00 36.04 ? 998  LYS B CA    1 
ATOM   2354  C  C     . LYS B  1 25  ? 3.527   -25.958 10.558  1.00 33.53 ? 998  LYS B C     1 
ATOM   2355  O  O     . LYS B  1 25  ? 2.955   -26.460 9.588   1.00 35.95 ? 998  LYS B O     1 
ATOM   2356  C  CB    . LYS B  1 25  ? 2.128   -25.032 12.427  1.00 34.51 ? 998  LYS B CB    1 
ATOM   2357  C  CG    . LYS B  1 25  ? 0.675   -25.111 11.965  1.00 43.51 ? 998  LYS B CG    1 
ATOM   2358  C  CD    . LYS B  1 25  ? -0.174  -24.015 12.622  1.00 37.91 ? 998  LYS B CD    1 
ATOM   2359  C  CE    . LYS B  1 25  ? -1.655  -24.120 12.250  1.00 48.69 ? 998  LYS B CE    1 
ATOM   2360  N  NZ    . LYS B  1 25  ? -1.890  -24.000 10.783  1.00 31.89 ? 998  LYS B NZ    1 
ATOM   2361  N  N     . TYR B  1 26  ? 4.602   -25.186 10.436  1.00 35.78 ? 999  TYR B N     1 
ATOM   2362  C  CA    . TYR B  1 26  ? 5.073   -24.717 9.127   1.00 34.46 ? 999  TYR B CA    1 
ATOM   2363  C  C     . TYR B  1 26  ? 6.542   -25.015 8.896   1.00 28.37 ? 999  TYR B C     1 
ATOM   2364  O  O     . TYR B  1 26  ? 7.335   -25.050 9.835   1.00 24.79 ? 999  TYR B O     1 
ATOM   2365  C  CB    . TYR B  1 26  ? 4.869   -23.198 8.980   1.00 34.07 ? 999  TYR B CB    1 
ATOM   2366  C  CG    . TYR B  1 26  ? 3.455   -22.699 9.192   1.00 26.48 ? 999  TYR B CG    1 
ATOM   2367  C  CD1   . TYR B  1 26  ? 2.516   -22.752 8.166   1.00 36.41 ? 999  TYR B CD1   1 
ATOM   2368  C  CD2   . TYR B  1 26  ? 3.067   -22.150 10.409  1.00 24.73 ? 999  TYR B CD2   1 
ATOM   2369  C  CE1   . TYR B  1 26  ? 1.211   -22.291 8.352   1.00 33.48 ? 999  TYR B CE1   1 
ATOM   2370  C  CE2   . TYR B  1 26  ? 1.772   -21.680 10.606  1.00 32.59 ? 999  TYR B CE2   1 
ATOM   2371  C  CZ    . TYR B  1 26  ? 0.850   -21.754 9.571   1.00 27.79 ? 999  TYR B CZ    1 
ATOM   2372  O  OH    . TYR B  1 26  ? -0.434  -21.286 9.752   1.00 33.58 ? 999  TYR B OH    1 
ATOM   2373  N  N     . SER B  1 27  ? 6.892   -25.208 7.631   1.00 28.47 ? 1000 SER B N     1 
ATOM   2374  C  CA    . SER B  1 27  ? 8.282   -25.312 7.220   1.00 33.96 ? 1000 SER B CA    1 
ATOM   2375  C  C     . SER B  1 27  ? 8.635   -24.088 6.379   1.00 32.17 ? 1000 SER B C     1 
ATOM   2376  O  O     . SER B  1 27  ? 7.872   -23.721 5.486   1.00 30.41 ? 1000 SER B O     1 
ATOM   2377  C  CB    . SER B  1 27  ? 8.509   -26.597 6.426   1.00 33.03 ? 1000 SER B CB    1 
ATOM   2378  O  OG    . SER B  1 27  ? 9.875   -26.732 6.077   1.00 51.44 ? 1000 SER B OG    1 
ATOM   2379  N  N     . THR B  1 28  ? 9.776   -23.456 6.671   1.00 32.31 ? 1001 THR B N     1 
ATOM   2380  C  CA    . THR B  1 28  ? 10.227  -22.268 5.916   1.00 33.12 ? 1001 THR B CA    1 
ATOM   2381  C  C     . THR B  1 28  ? 10.977  -22.652 4.637   1.00 28.35 ? 1001 THR B C     1 
ATOM   2382  O  O     . THR B  1 28  ? 11.976  -23.357 4.692   1.00 30.66 ? 1001 THR B O     1 
ATOM   2383  C  CB    . THR B  1 28  ? 11.098  -21.325 6.781   1.00 33.26 ? 1001 THR B CB    1 
ATOM   2384  O  OG1   . THR B  1 28  ? 10.401  -20.993 7.988   1.00 26.20 ? 1001 THR B OG1   1 
ATOM   2385  C  CG2   . THR B  1 28  ? 11.418  -20.042 6.024   1.00 36.06 ? 1001 THR B CG2   1 
ATOM   2386  N  N     . MET B  1 29  ? 10.499  -22.166 3.493   1.00 30.54 ? 1002 MET B N     1 
ATOM   2387  C  CA    . MET B  1 29  ? 11.002  -22.617 2.193   1.00 30.68 ? 1002 MET B CA    1 
ATOM   2388  C  C     . MET B  1 29  ? 12.018  -21.675 1.529   1.00 31.39 ? 1002 MET B C     1 
ATOM   2389  O  O     . MET B  1 29  ? 13.222  -21.933 1.587   1.00 35.51 ? 1002 MET B O     1 
ATOM   2390  C  CB    . MET B  1 29  ? 9.846   -22.957 1.241   1.00 25.25 ? 1002 MET B CB    1 
ATOM   2391  C  CG    . MET B  1 29  ? 8.886   -24.014 1.778   1.00 40.26 ? 1002 MET B CG    1 
ATOM   2392  S  SD    . MET B  1 29  ? 9.628   -25.597 2.249   1.00 43.84 ? 1002 MET B SD    1 
ATOM   2393  C  CE    . MET B  1 29  ? 9.782   -26.388 0.643   1.00 41.40 ? 1002 MET B CE    1 
ATOM   2394  N  N     . SER B  1 30  ? 11.529  -20.587 0.928   1.00 30.77 ? 1003 SER B N     1 
ATOM   2395  C  CA    . SER B  1 30  ? 12.356  -19.662 0.149   1.00 31.82 ? 1003 SER B CA    1 
ATOM   2396  C  C     . SER B  1 30  ? 12.038  -18.184 0.449   1.00 34.26 ? 1003 SER B C     1 
ATOM   2397  O  O     . SER B  1 30  ? 10.903  -17.858 0.786   1.00 34.24 ? 1003 SER B O     1 
ATOM   2398  C  CB    . SER B  1 30  ? 12.168  -19.942 -1.341  1.00 24.43 ? 1003 SER B CB    1 
ATOM   2399  O  OG    . SER B  1 30  ? 10.792  -19.966 -1.675  1.00 35.75 ? 1003 SER B OG    1 
ATOM   2400  N  N     . PRO B  1 31  ? 13.040  -17.281 0.313   1.00 34.95 ? 1004 PRO B N     1 
ATOM   2401  C  CA    . PRO B  1 31  ? 12.821  -15.860 0.621   1.00 34.16 ? 1004 PRO B CA    1 
ATOM   2402  C  C     . PRO B  1 31  ? 11.864  -15.173 -0.366  1.00 33.51 ? 1004 PRO B C     1 
ATOM   2403  O  O     . PRO B  1 31  ? 11.731  -15.613 -1.513  1.00 25.23 ? 1004 PRO B O     1 
ATOM   2404  C  CB    . PRO B  1 31  ? 14.231  -15.264 0.525   1.00 32.18 ? 1004 PRO B CB    1 
ATOM   2405  C  CG    . PRO B  1 31  ? 14.940  -16.156 -0.424  1.00 39.24 ? 1004 PRO B CG    1 
ATOM   2406  C  CD    . PRO B  1 31  ? 14.421  -17.530 -0.139  1.00 30.41 ? 1004 PRO B CD    1 
ATOM   2407  N  N     . LEU B  1 32  ? 11.200  -14.112 0.091   1.00 34.86 ? 1005 LEU B N     1 
ATOM   2408  C  CA    . LEU B  1 32  ? 10.203  -13.413 -0.729  1.00 35.62 ? 1005 LEU B CA    1 
ATOM   2409  C  C     . LEU B  1 32  ? 10.523  -11.941 -0.938  1.00 38.81 ? 1005 LEU B C     1 
ATOM   2410  O  O     . LEU B  1 32  ? 11.189  -11.317 -0.104  1.00 33.24 ? 1005 LEU B O     1 
ATOM   2411  C  CB    . LEU B  1 32  ? 8.798   -13.529 -0.119  1.00 32.69 ? 1005 LEU B CB    1 
ATOM   2412  C  CG    . LEU B  1 32  ? 7.745   -14.496 -0.670  1.00 33.00 ? 1005 LEU B CG    1 
ATOM   2413  C  CD1   . LEU B  1 32  ? 6.405   -14.045 -0.170  1.00 22.25 ? 1005 LEU B CD1   1 
ATOM   2414  C  CD2   . LEU B  1 32  ? 7.707   -14.566 -2.198  1.00 26.38 ? 1005 LEU B CD2   1 
ATOM   2415  N  N     . GLY B  1 33  ? 10.008  -11.620 -2.193  1.00 41.66 ? 1006 GLY B N     1 
ATOM   2416  C  CA    . GLY B  1 33  ? 9.886   -10.200 -2.527  1.00 44.79 ? 1006 GLY B CA    1 
ATOM   2417  C  C     . GLY B  1 33  ? 11.182  -9.424  -2.656  1.00 51.71 ? 1006 GLY B C     1 
ATOM   2418  O  O     . GLY B  1 33  ? 12.253  -9.931  -2.310  1.00 52.62 ? 1006 GLY B O     1 
ATOM   2419  N  N     . SER B  1 34  ? 11.011  -8.201  -3.144  1.00 51.65 ? 1007 SER B N     1 
ATOM   2420  C  CA    . SER B  1 34  ? 12.096  -7.196  -3.120  1.00 53.63 ? 1007 SER B CA    1 
ATOM   2421  C  C     . SER B  1 34  ? 13.471  -7.649  -3.630  1.00 55.55 ? 1007 SER B C     1 
ATOM   2422  O  O     . SER B  1 34  ? 13.646  -7.863  -4.834  1.00 56.57 ? 1007 SER B O     1 
ATOM   2423  C  CB    . SER B  1 34  ? 12.222  -6.573  -1.722  1.00 56.56 ? 1007 SER B CB    1 
ATOM   2424  N  N     . GLY B  1 35  ? 14.416  -7.907  -2.743  1.00 55.79 ? 1008 GLY B N     1 
ATOM   2425  C  CA    . GLY B  1 35  ? 15.684  -8.533  -3.126  1.00 53.72 ? 1008 GLY B CA    1 
ATOM   2426  C  C     . GLY B  1 35  ? 16.633  -8.918  -2.003  1.00 50.91 ? 1008 GLY B C     1 
ATOM   2427  O  O     . GLY B  1 35  ? 16.738  -8.211  -0.998  1.00 51.05 ? 1008 GLY B O     1 
ATOM   2428  N  N     . ALA B  1 36  ? 17.407  -10.070 -2.141  1.00 48.73 ? 1009 ALA B N     1 
ATOM   2429  C  CA    . ALA B  1 36  ? 18.431  -10.509 -1.169  1.00 43.62 ? 1009 ALA B CA    1 
ATOM   2430  C  C     . ALA B  1 36  ? 17.917  -10.927 0.226   1.00 41.49 ? 1009 ALA B C     1 
ATOM   2431  O  O     . ALA B  1 36  ? 18.248  -10.306 1.246   1.00 36.34 ? 1009 ALA B O     1 
ATOM   2432  C  CB    . ALA B  1 36  ? 19.582  -9.482  -1.072  1.00 44.88 ? 1009 ALA B CB    1 
ATOM   2433  N  N     . PHE B  1 37  ? 17.123  -11.999 0.251   1.00 40.19 ? 1010 PHE B N     1 
ATOM   2434  C  CA    . PHE B  1 37  ? 16.594  -12.597 1.493   1.00 39.85 ? 1010 PHE B CA    1 
ATOM   2435  C  C     . PHE B  1 37  ? 15.974  -11.561 2.434   1.00 40.59 ? 1010 PHE B C     1 
ATOM   2436  O  O     . PHE B  1 37  ? 15.321  -10.615 1.979   1.00 40.15 ? 1010 PHE B O     1 
ATOM   2437  C  CB    . PHE B  1 37  ? 17.661  -13.448 2.217   1.00 37.85 ? 1010 PHE B CB    1 
ATOM   2438  C  CG    . PHE B  1 37  ? 18.412  -14.392 1.310   1.00 37.00 ? 1010 PHE B CG    1 
ATOM   2439  C  CD1   . PHE B  1 37  ? 17.977  -15.702 1.135   1.00 38.22 ? 1010 PHE B CD1   1 
ATOM   2440  C  CD2   . PHE B  1 37  ? 19.554  -13.968 0.628   1.00 32.85 ? 1010 PHE B CD2   1 
ATOM   2441  C  CE1   . PHE B  1 37  ? 18.662  -16.581 0.284   1.00 38.59 ? 1010 PHE B CE1   1 
ATOM   2442  C  CE2   . PHE B  1 37  ? 20.240  -14.832 -0.226  1.00 39.89 ? 1010 PHE B CE2   1 
ATOM   2443  C  CZ    . PHE B  1 37  ? 19.792  -16.145 -0.396  1.00 38.50 ? 1010 PHE B CZ    1 
ATOM   2444  N  N     . GLY B  1 38  ? 16.193  -11.738 3.737   1.00 39.75 ? 1011 GLY B N     1 
ATOM   2445  C  CA    . GLY B  1 38  ? 15.583  -10.891 4.757   1.00 35.92 ? 1011 GLY B CA    1 
ATOM   2446  C  C     . GLY B  1 38  ? 14.757  -11.699 5.745   1.00 36.93 ? 1011 GLY B C     1 
ATOM   2447  O  O     . GLY B  1 38  ? 15.096  -12.846 6.072   1.00 37.42 ? 1011 GLY B O     1 
ATOM   2448  N  N     . PHE B  1 39  ? 13.668  -11.097 6.215   1.00 33.49 ? 1012 PHE B N     1 
ATOM   2449  C  CA    . PHE B  1 39  ? 12.815  -11.697 7.242   1.00 30.21 ? 1012 PHE B CA    1 
ATOM   2450  C  C     . PHE B  1 39  ? 11.446  -12.131 6.733   1.00 22.32 ? 1012 PHE B C     1 
ATOM   2451  O  O     . PHE B  1 39  ? 10.645  -12.637 7.499   1.00 22.51 ? 1012 PHE B O     1 
ATOM   2452  C  CB    . PHE B  1 39  ? 12.656  -10.744 8.430   1.00 32.50 ? 1012 PHE B CB    1 
ATOM   2453  C  CG    . PHE B  1 39  ? 13.916  -10.546 9.210   1.00 36.86 ? 1012 PHE B CG    1 
ATOM   2454  C  CD1   . PHE B  1 39  ? 14.350  -11.514 10.109  1.00 35.88 ? 1012 PHE B CD1   1 
ATOM   2455  C  CD2   . PHE B  1 39  ? 14.683  -9.397  9.037   1.00 44.80 ? 1012 PHE B CD2   1 
ATOM   2456  C  CE1   . PHE B  1 39  ? 15.527  -11.342 10.826  1.00 37.43 ? 1012 PHE B CE1   1 
ATOM   2457  C  CE2   . PHE B  1 39  ? 15.863  -9.214  9.754   1.00 49.34 ? 1012 PHE B CE2   1 
ATOM   2458  C  CZ    . PHE B  1 39  ? 16.286  -10.190 10.648  1.00 45.27 ? 1012 PHE B CZ    1 
ATOM   2459  N  N     . VAL B  1 40  ? 11.187  -11.943 5.442   1.00 24.02 ? 1013 VAL B N     1 
ATOM   2460  C  CA    . VAL B  1 40  ? 9.930   -12.392 4.834   1.00 26.00 ? 1013 VAL B CA    1 
ATOM   2461  C  C     . VAL B  1 40  ? 10.198  -13.604 3.929   1.00 24.57 ? 1013 VAL B C     1 
ATOM   2462  O  O     . VAL B  1 40  ? 11.082  -13.569 3.078   1.00 24.12 ? 1013 VAL B O     1 
ATOM   2463  C  CB    . VAL B  1 40  ? 9.202   -11.265 4.046   1.00 25.08 ? 1013 VAL B CB    1 
ATOM   2464  C  CG1   . VAL B  1 40  ? 7.787   -11.728 3.596   1.00 8.40  ? 1013 VAL B CG1   1 
ATOM   2465  C  CG2   . VAL B  1 40  ? 9.114   -9.994  4.880   1.00 21.60 ? 1013 VAL B CG2   1 
ATOM   2466  N  N     . TRP B  1 41  ? 9.436   -14.675 4.132   1.00 24.34 ? 1014 TRP B N     1 
ATOM   2467  C  CA    . TRP B  1 41  ? 9.700   -15.951 3.453   1.00 23.68 ? 1014 TRP B CA    1 
ATOM   2468  C  C     . TRP B  1 41  ? 8.433   -16.680 3.059   1.00 22.51 ? 1014 TRP B C     1 
ATOM   2469  O  O     . TRP B  1 41  ? 7.382   -16.516 3.680   1.00 18.97 ? 1014 TRP B O     1 
ATOM   2470  C  CB    . TRP B  1 41  ? 10.528  -16.871 4.359   1.00 20.33 ? 1014 TRP B CB    1 
ATOM   2471  C  CG    . TRP B  1 41  ? 11.927  -16.381 4.651   1.00 22.99 ? 1014 TRP B CG    1 
ATOM   2472  C  CD1   . TRP B  1 41  ? 12.279  -15.316 5.426   1.00 25.06 ? 1014 TRP B CD1   1 
ATOM   2473  C  CD2   . TRP B  1 41  ? 13.155  -16.972 4.206   1.00 27.73 ? 1014 TRP B CD2   1 
ATOM   2474  N  NE1   . TRP B  1 41  ? 13.646  -15.188 5.475   1.00 30.24 ? 1014 TRP B NE1   1 
ATOM   2475  C  CE2   . TRP B  1 41  ? 14.212  -16.193 4.738   1.00 27.50 ? 1014 TRP B CE2   1 
ATOM   2476  C  CE3   . TRP B  1 41  ? 13.468  -18.082 3.413   1.00 30.28 ? 1014 TRP B CE3   1 
ATOM   2477  C  CZ2   . TRP B  1 41  ? 15.558  -16.478 4.490   1.00 25.86 ? 1014 TRP B CZ2   1 
ATOM   2478  C  CZ3   . TRP B  1 41  ? 14.819  -18.371 3.170   1.00 32.13 ? 1014 TRP B CZ3   1 
ATOM   2479  C  CH2   . TRP B  1 41  ? 15.843  -17.569 3.704   1.00 22.39 ? 1014 TRP B CH2   1 
ATOM   2480  N  N     . THR B  1 42  ? 8.537   -17.473 2.003   1.00 27.31 ? 1015 THR B N     1 
ATOM   2481  C  CA    . THR B  1 42  ? 7.549   -18.506 1.738   1.00 27.60 ? 1015 THR B CA    1 
ATOM   2482  C  C     . THR B  1 42  ? 7.742   -19.615 2.781   1.00 30.29 ? 1015 THR B C     1 
ATOM   2483  O  O     . THR B  1 42  ? 8.876   -20.030 3.079   1.00 23.89 ? 1015 THR B O     1 
ATOM   2484  C  CB    . THR B  1 42  ? 7.674   -19.070 0.297   1.00 28.11 ? 1015 THR B CB    1 
ATOM   2485  O  OG1   . THR B  1 42  ? 7.292   -18.061 -0.649  1.00 35.57 ? 1015 THR B OG1   1 
ATOM   2486  C  CG2   . THR B  1 42  ? 6.773   -20.290 0.096   1.00 17.51 ? 1015 THR B CG2   1 
ATOM   2487  N  N     . ALA B  1 43  ? 6.624   -20.053 3.353   1.00 31.82 ? 1016 ALA B N     1 
ATOM   2488  C  CA    . ALA B  1 43  ? 6.578   -21.229 4.209   1.00 29.27 ? 1016 ALA B CA    1 
ATOM   2489  C  C     . ALA B  1 43  ? 5.454   -22.171 3.741   1.00 29.51 ? 1016 ALA B C     1 
ATOM   2490  O  O     . ALA B  1 43  ? 4.591   -21.779 2.956   1.00 26.49 ? 1016 ALA B O     1 
ATOM   2491  C  CB    . ALA B  1 43  ? 6.394   -20.826 5.667   1.00 25.54 ? 1016 ALA B CB    1 
ATOM   2492  N  N     . VAL B  1 44  ? 5.490   -23.422 4.190   1.00 30.39 ? 1017 VAL B N     1 
ATOM   2493  C  CA    . VAL B  1 44  ? 4.459   -24.387 3.829   1.00 28.78 ? 1017 VAL B CA    1 
ATOM   2494  C  C     . VAL B  1 44  ? 3.728   -24.874 5.074   1.00 25.66 ? 1017 VAL B C     1 
ATOM   2495  O  O     . VAL B  1 44  ? 4.360   -25.258 6.046   1.00 26.13 ? 1017 VAL B O     1 
ATOM   2496  C  CB    . VAL B  1 44  ? 5.033   -25.578 3.030   1.00 28.07 ? 1017 VAL B CB    1 
ATOM   2497  C  CG1   . VAL B  1 44  ? 3.933   -26.619 2.740   1.00 33.50 ? 1017 VAL B CG1   1 
ATOM   2498  C  CG2   . VAL B  1 44  ? 5.626   -25.093 1.729   1.00 21.67 ? 1017 VAL B CG2   1 
ATOM   2499  N  N     . ASP B  1 45  ? 2.397   -24.815 5.050   1.00 28.20 ? 1018 ASP B N     1 
ATOM   2500  C  CA    . ASP B  1 45  ? 1.583   -25.456 6.081   1.00 29.12 ? 1018 ASP B CA    1 
ATOM   2501  C  C     . ASP B  1 45  ? 1.685   -26.970 5.871   1.00 29.06 ? 1018 ASP B C     1 
ATOM   2502  O  O     . ASP B  1 45  ? 1.156   -27.510 4.888   1.00 29.65 ? 1018 ASP B O     1 
ATOM   2503  C  CB    . ASP B  1 45  ? 0.134   -24.960 6.028   1.00 24.07 ? 1018 ASP B CB    1 
ATOM   2504  C  CG    . ASP B  1 45  ? -0.787  -25.713 6.987   1.00 36.90 ? 1018 ASP B CG    1 
ATOM   2505  O  OD1   . ASP B  1 45  ? -1.461  -25.064 7.812   1.00 33.62 ? 1018 ASP B OD1   1 
ATOM   2506  O  OD2   . ASP B  1 45  ? -0.841  -26.958 6.919   1.00 35.51 ? 1018 ASP B OD2   1 
ATOM   2507  N  N     . LYS B  1 46  ? 2.393   -27.638 6.783   1.00 29.28 ? 1019 LYS B N     1 
ATOM   2508  C  CA    . LYS B  1 46  ? 2.704   -29.081 6.648   1.00 30.49 ? 1019 LYS B CA    1 
ATOM   2509  C  C     . LYS B  1 46  ? 1.482   -29.965 6.393   1.00 31.10 ? 1019 LYS B C     1 
ATOM   2510  O  O     . LYS B  1 46  ? 1.500   -30.830 5.508   1.00 33.93 ? 1019 LYS B O     1 
ATOM   2511  C  CB    . LYS B  1 46  ? 3.464   -29.585 7.874   1.00 29.88 ? 1019 LYS B CB    1 
ATOM   2512  C  CG    . LYS B  1 46  ? 4.952   -29.281 7.837   1.00 48.43 ? 1019 LYS B CG    1 
ATOM   2513  C  CD    . LYS B  1 46  ? 5.666   -29.853 9.041   1.00 56.47 ? 1019 LYS B CD    1 
ATOM   2514  C  CE    . LYS B  1 46  ? 5.669   -28.874 10.192  1.00 57.30 ? 1019 LYS B CE    1 
ATOM   2515  N  NZ    . LYS B  1 46  ? 6.327   -29.454 11.394  1.00 62.16 ? 1019 LYS B NZ    1 
ATOM   2516  N  N     . GLU B  1 47  ? 0.421   -29.726 7.159   1.00 33.15 ? 1020 GLU B N     1 
ATOM   2517  C  CA    . GLU B  1 47  ? -0.815  -30.496 7.050   1.00 36.31 ? 1020 GLU B CA    1 
ATOM   2518  C  C     . GLU B  1 47  ? -1.618  -30.184 5.784   1.00 38.76 ? 1020 GLU B C     1 
ATOM   2519  O  O     . GLU B  1 47  ? -1.935  -31.089 5.006   1.00 37.84 ? 1020 GLU B O     1 
ATOM   2520  C  CB    . GLU B  1 47  ? -1.675  -30.273 8.286   1.00 32.89 ? 1020 GLU B CB    1 
ATOM   2521  C  CG    . GLU B  1 47  ? -1.019  -30.722 9.581   1.00 38.51 ? 1020 GLU B CG    1 
ATOM   2522  C  CD    . GLU B  1 47  ? -2.014  -30.860 10.711  1.00 40.96 ? 1020 GLU B CD    1 
ATOM   2523  O  OE1   . GLU B  1 47  ? -3.209  -30.549 10.504  1.00 40.75 ? 1020 GLU B OE1   1 
ATOM   2524  O  OE2   . GLU B  1 47  ? -1.600  -31.282 11.809  1.00 47.34 ? 1020 GLU B OE2   1 
ATOM   2525  N  N     . LYS B  1 48  ? -1.927  -28.902 5.582   1.00 42.32 ? 1021 LYS B N     1 
ATOM   2526  C  CA    . LYS B  1 48  ? -2.746  -28.452 4.455   1.00 44.65 ? 1021 LYS B CA    1 
ATOM   2527  C  C     . LYS B  1 48  ? -2.019  -28.523 3.114   1.00 46.49 ? 1021 LYS B C     1 
ATOM   2528  O  O     . LYS B  1 48  ? -2.661  -28.477 2.059   1.00 51.73 ? 1021 LYS B O     1 
ATOM   2529  C  CB    . LYS B  1 48  ? -3.277  -27.033 4.698   1.00 43.12 ? 1021 LYS B CB    1 
ATOM   2530  N  N     . ASN B  1 49  ? -0.689  -28.640 3.163   1.00 46.55 ? 1022 ASN B N     1 
ATOM   2531  C  CA    . ASN B  1 49  ? 0.169   -28.631 1.968   1.00 45.72 ? 1022 ASN B CA    1 
ATOM   2532  C  C     . ASN B  1 49  ? 0.088   -27.312 1.190   1.00 42.12 ? 1022 ASN B C     1 
ATOM   2533  O  O     . ASN B  1 49  ? 0.241   -27.289 -0.035  1.00 42.56 ? 1022 ASN B O     1 
ATOM   2534  C  CB    . ASN B  1 49  ? -0.146  -29.821 1.045   1.00 49.91 ? 1022 ASN B CB    1 
ATOM   2535  C  CG    . ASN B  1 49  ? -0.152  -31.153 1.777   1.00 53.62 ? 1022 ASN B CG    1 
ATOM   2536  O  OD1   . ASN B  1 49  ? -1.196  -31.802 1.908   1.00 56.19 ? 1022 ASN B OD1   1 
ATOM   2537  N  ND2   . ASN B  1 49  ? 1.014   -31.569 2.256   1.00 57.98 ? 1022 ASN B ND2   1 
ATOM   2538  N  N     . LYS B  1 50  ? -0.152  -26.217 1.909   1.00 39.86 ? 1023 LYS B N     1 
ATOM   2539  C  CA    . LYS B  1 50  ? -0.339  -24.909 1.282   1.00 36.87 ? 1023 LYS B CA    1 
ATOM   2540  C  C     . LYS B  1 50  ? 0.779   -23.914 1.590   1.00 28.00 ? 1023 LYS B C     1 
ATOM   2541  O  O     . LYS B  1 50  ? 1.237   -23.799 2.726   1.00 22.35 ? 1023 LYS B O     1 
ATOM   2542  C  CB    . LYS B  1 50  ? -1.713  -24.316 1.643   1.00 38.23 ? 1023 LYS B CB    1 
ATOM   2543  C  CG    . LYS B  1 50  ? -1.885  -23.889 3.088   1.00 37.51 ? 1023 LYS B CG    1 
ATOM   2544  C  CD    . LYS B  1 50  ? -3.318  -23.454 3.368   1.00 41.49 ? 1023 LYS B CD    1 
ATOM   2545  C  CE    . LYS B  1 50  ? -3.403  -22.469 4.526   1.00 33.25 ? 1023 LYS B CE    1 
ATOM   2546  N  NZ    . LYS B  1 50  ? -2.712  -22.968 5.734   1.00 43.23 ? 1023 LYS B NZ    1 
ATOM   2547  N  N     . GLU B  1 51  ? 1.194   -23.193 0.554   1.00 30.96 ? 1024 GLU B N     1 
ATOM   2548  C  CA    . GLU B  1 51  ? 2.148   -22.094 0.681   1.00 30.96 ? 1024 GLU B CA    1 
ATOM   2549  C  C     . GLU B  1 51  ? 1.547   -20.919 1.443   1.00 33.00 ? 1024 GLU B C     1 
ATOM   2550  O  O     . GLU B  1 51  ? 0.430   -20.486 1.154   1.00 35.77 ? 1024 GLU B O     1 
ATOM   2551  C  CB    . GLU B  1 51  ? 2.610   -21.630 -0.703  1.00 28.00 ? 1024 GLU B CB    1 
ATOM   2552  C  CG    . GLU B  1 51  ? 3.624   -22.558 -1.366  1.00 31.09 ? 1024 GLU B CG    1 
ATOM   2553  C  CD    . GLU B  1 51  ? 4.411   -21.880 -2.475  1.00 41.38 ? 1024 GLU B CD    1 
ATOM   2554  O  OE1   . GLU B  1 51  ? 4.192   -20.673 -2.729  1.00 37.31 ? 1024 GLU B OE1   1 
ATOM   2555  O  OE2   . GLU B  1 51  ? 5.256   -22.559 -3.098  1.00 44.72 ? 1024 GLU B OE2   1 
ATOM   2556  N  N     . VAL B  1 52  ? 2.296   -20.430 2.430   1.00 34.38 ? 1025 VAL B N     1 
ATOM   2557  C  CA    . VAL B  1 52  ? 1.936   -19.248 3.219   1.00 27.51 ? 1025 VAL B CA    1 
ATOM   2558  C  C     . VAL B  1 52  ? 3.088   -18.238 3.210   1.00 26.81 ? 1025 VAL B C     1 
ATOM   2559  O  O     . VAL B  1 52  ? 4.122   -18.481 2.579   1.00 26.12 ? 1025 VAL B O     1 
ATOM   2560  C  CB    . VAL B  1 52  ? 1.569   -19.608 4.693   1.00 28.60 ? 1025 VAL B CB    1 
ATOM   2561  C  CG1   . VAL B  1 52  ? 0.348   -20.530 4.747   1.00 28.32 ? 1025 VAL B CG1   1 
ATOM   2562  C  CG2   . VAL B  1 52  ? 2.771   -20.218 5.434   1.00 19.97 ? 1025 VAL B CG2   1 
ATOM   2563  N  N     . VAL B  1 53  ? 2.899   -17.111 3.905   1.00 24.77 ? 1026 VAL B N     1 
ATOM   2564  C  CA    . VAL B  1 53  ? 3.937   -16.102 4.056   1.00 22.82 ? 1026 VAL B CA    1 
ATOM   2565  C  C     . VAL B  1 53  ? 4.166   -15.869 5.534   1.00 24.99 ? 1026 VAL B C     1 
ATOM   2566  O  O     . VAL B  1 53  ? 3.216   -15.633 6.275   1.00 24.69 ? 1026 VAL B O     1 
ATOM   2567  C  CB    . VAL B  1 53  ? 3.588   -14.767 3.320   1.00 22.07 ? 1026 VAL B CB    1 
ATOM   2568  C  CG1   . VAL B  1 53  ? 4.657   -13.693 3.568   1.00 16.69 ? 1026 VAL B CG1   1 
ATOM   2569  C  CG2   . VAL B  1 53  ? 3.474   -15.010 1.858   1.00 16.42 ? 1026 VAL B CG2   1 
ATOM   2570  N  N     . VAL B  1 54  ? 5.432   -15.982 5.949   1.00 25.62 ? 1027 VAL B N     1 
ATOM   2571  C  CA    . VAL B  1 54  ? 5.855   -15.694 7.310   1.00 24.33 ? 1027 VAL B CA    1 
ATOM   2572  C  C     . VAL B  1 54  ? 6.782   -14.472 7.341   1.00 26.29 ? 1027 VAL B C     1 
ATOM   2573  O  O     . VAL B  1 54  ? 7.729   -14.366 6.569   1.00 25.44 ? 1027 VAL B O     1 
ATOM   2574  C  CB    . VAL B  1 54  ? 6.541   -16.923 7.996   1.00 26.80 ? 1027 VAL B CB    1 
ATOM   2575  C  CG1   . VAL B  1 54  ? 7.792   -17.393 7.216   1.00 32.70 ? 1027 VAL B CG1   1 
ATOM   2576  C  CG2   . VAL B  1 54  ? 6.892   -16.625 9.465   1.00 15.64 ? 1027 VAL B CG2   1 
ATOM   2577  N  N     . LYS B  1 55  ? 6.481   -13.555 8.248   1.00 28.42 ? 1028 LYS B N     1 
ATOM   2578  C  CA    . LYS B  1 55  ? 7.344   -12.432 8.533   1.00 28.34 ? 1028 LYS B CA    1 
ATOM   2579  C  C     . LYS B  1 55  ? 7.967   -12.688 9.891   1.00 27.60 ? 1028 LYS B C     1 
ATOM   2580  O  O     . LYS B  1 55  ? 7.257   -12.848 10.885  1.00 26.05 ? 1028 LYS B O     1 
ATOM   2581  C  CB    . LYS B  1 55  ? 6.542   -11.135 8.545   1.00 24.40 ? 1028 LYS B CB    1 
ATOM   2582  C  CG    . LYS B  1 55  ? 7.387   -9.873  8.609   1.00 26.40 ? 1028 LYS B CG    1 
ATOM   2583  C  CD    . LYS B  1 55  ? 6.669   -8.741  7.909   1.00 23.91 ? 1028 LYS B CD    1 
ATOM   2584  C  CE    . LYS B  1 55  ? 7.290   -7.405  8.244   1.00 34.05 ? 1028 LYS B CE    1 
ATOM   2585  N  NZ    . LYS B  1 55  ? 6.470   -6.295  7.686   1.00 45.17 ? 1028 LYS B NZ    1 
ATOM   2586  N  N     . PHE B  1 56  ? 9.294   -12.751 9.928   1.00 24.77 ? 1029 PHE B N     1 
ATOM   2587  C  CA    . PHE B  1 56  ? 9.993   -12.850 11.202  1.00 27.19 ? 1029 PHE B CA    1 
ATOM   2588  C  C     . PHE B  1 56  ? 10.221  -11.465 11.756  1.00 28.27 ? 1029 PHE B C     1 
ATOM   2589  O  O     . PHE B  1 56  ? 10.688  -10.577 11.045  1.00 28.44 ? 1029 PHE B O     1 
ATOM   2590  C  CB    . PHE B  1 56  ? 11.300  -13.647 11.070  1.00 23.46 ? 1029 PHE B CB    1 
ATOM   2591  C  CG    . PHE B  1 56  ? 11.087  -15.045 10.588  1.00 17.81 ? 1029 PHE B CG    1 
ATOM   2592  C  CD1   . PHE B  1 56  ? 10.612  -16.023 11.446  1.00 15.91 ? 1029 PHE B CD1   1 
ATOM   2593  C  CD2   . PHE B  1 56  ? 11.321  -15.376 9.265   1.00 9.65  ? 1029 PHE B CD2   1 
ATOM   2594  C  CE1   . PHE B  1 56  ? 10.393  -17.320 10.985  1.00 17.97 ? 1029 PHE B CE1   1 
ATOM   2595  C  CE2   . PHE B  1 56  ? 11.113  -16.667 8.804   1.00 15.71 ? 1029 PHE B CE2   1 
ATOM   2596  C  CZ    . PHE B  1 56  ? 10.644  -17.637 9.668   1.00 13.82 ? 1029 PHE B CZ    1 
ATOM   2597  N  N     . ILE B  1 57  ? 9.851   -11.283 13.022  1.00 32.58 ? 1030 ILE B N     1 
ATOM   2598  C  CA    . ILE B  1 57  ? 10.015  -10.009 13.718  1.00 31.47 ? 1030 ILE B CA    1 
ATOM   2599  C  C     . ILE B  1 57  ? 10.886  -10.211 14.951  1.00 31.68 ? 1030 ILE B C     1 
ATOM   2600  O  O     . ILE B  1 57  ? 10.517  -10.952 15.855  1.00 33.78 ? 1030 ILE B O     1 
ATOM   2601  C  CB    . ILE B  1 57  ? 8.641   -9.386  14.113  1.00 31.74 ? 1030 ILE B CB    1 
ATOM   2602  C  CG1   . ILE B  1 57  ? 7.829   -9.026  12.864  1.00 29.43 ? 1030 ILE B CG1   1 
ATOM   2603  C  CG2   . ILE B  1 57  ? 8.832   -8.125  14.958  1.00 36.47 ? 1030 ILE B CG2   1 
ATOM   2604  C  CD1   . ILE B  1 57  ? 6.374   -9.497  12.914  1.00 34.69 ? 1030 ILE B CD1   1 
ATOM   2605  N  N     . LYS B  1 58  ? 12.043  -9.551  14.967  1.00 35.57 ? 1031 LYS B N     1 
ATOM   2606  C  CA    . LYS B  1 58  ? 12.970  -9.584  16.099  1.00 39.63 ? 1031 LYS B CA    1 
ATOM   2607  C  C     . LYS B  1 58  ? 12.784  -8.370  17.006  1.00 44.03 ? 1031 LYS B C     1 
ATOM   2608  O  O     . LYS B  1 58  ? 12.653  -7.246  16.524  1.00 47.94 ? 1031 LYS B O     1 
ATOM   2609  C  CB    . LYS B  1 58  ? 14.415  -9.617  15.598  1.00 35.80 ? 1031 LYS B CB    1 
ATOM   2610  N  N     . LYS B  1 59  ? 12.779  -8.600  18.317  1.00 50.97 ? 1032 LYS B N     1 
ATOM   2611  C  CA    . LYS B  1 59  ? 12.749  -7.509  19.302  1.00 54.02 ? 1032 LYS B CA    1 
ATOM   2612  C  C     . LYS B  1 59  ? 14.089  -6.759  19.299  1.00 57.26 ? 1032 LYS B C     1 
ATOM   2613  O  O     . LYS B  1 59  ? 14.979  -7.033  20.113  1.00 56.06 ? 1032 LYS B O     1 
ATOM   2614  C  CB    . LYS B  1 59  ? 12.415  -8.037  20.705  1.00 54.51 ? 1032 LYS B CB    1 
ATOM   2615  C  CG    . LYS B  1 59  ? 11.073  -8.783  20.828  1.00 52.08 ? 1032 LYS B CG    1 
ATOM   2616  C  CD    . LYS B  1 59  ? 11.197  -10.241 20.421  1.00 40.43 ? 1032 LYS B CD    1 
ATOM   2617  C  CE    . LYS B  1 59  ? 9.938   -11.029 20.718  1.00 36.83 ? 1032 LYS B CE    1 
ATOM   2618  N  NZ    . LYS B  1 59  ? 9.917   -11.518 22.122  1.00 40.12 ? 1032 LYS B NZ    1 
ATOM   2619  N  N     . GLU B  1 60  ? 14.214  -5.815  18.368  1.00 59.99 ? 1033 GLU B N     1 
ATOM   2620  C  CA    . GLU B  1 60  ? 15.471  -5.121  18.113  1.00 62.72 ? 1033 GLU B CA    1 
ATOM   2621  C  C     . GLU B  1 60  ? 15.321  -3.615  18.316  1.00 65.38 ? 1033 GLU B C     1 
ATOM   2622  O  O     . GLU B  1 60  ? 16.213  -2.835  17.971  1.00 67.07 ? 1033 GLU B O     1 
ATOM   2623  C  CB    . GLU B  1 60  ? 15.960  -5.424  16.691  1.00 61.40 ? 1033 GLU B CB    1 
ATOM   2624  N  N     . TRP B  1 67  ? 5.711   -1.707  21.534  1.00 67.94 ? 1040 TRP B N     1 
ATOM   2625  C  CA    . TRP B  1 67  ? 5.074   -2.134  22.778  1.00 66.69 ? 1040 TRP B CA    1 
ATOM   2626  C  C     . TRP B  1 67  ? 3.572   -1.837  22.780  1.00 64.33 ? 1040 TRP B C     1 
ATOM   2627  O  O     . TRP B  1 67  ? 3.161   -0.679  22.858  1.00 62.00 ? 1040 TRP B O     1 
ATOM   2628  C  CB    . TRP B  1 67  ? 5.754   -1.479  23.987  1.00 67.32 ? 1040 TRP B CB    1 
ATOM   2629  N  N     . ILE B  1 68  ? 2.768   -2.896  22.685  1.00 64.44 ? 1041 ILE B N     1 
ATOM   2630  C  CA    . ILE B  1 68  ? 1.304   -2.798  22.701  1.00 63.56 ? 1041 ILE B CA    1 
ATOM   2631  C  C     . ILE B  1 68  ? 0.694   -3.934  23.534  1.00 63.28 ? 1041 ILE B C     1 
ATOM   2632  O  O     . ILE B  1 68  ? 0.972   -5.110  23.295  1.00 59.94 ? 1041 ILE B O     1 
ATOM   2633  C  CB    . ILE B  1 68  ? 0.695   -2.803  21.250  1.00 63.04 ? 1041 ILE B CB    1 
ATOM   2634  C  CG1   . ILE B  1 68  ? 1.036   -1.514  20.483  1.00 58.33 ? 1041 ILE B CG1   1 
ATOM   2635  C  CG2   . ILE B  1 68  ? -0.822  -3.027  21.273  1.00 65.70 ? 1041 ILE B CG2   1 
ATOM   2636  C  CD1   . ILE B  1 68  ? 0.404   -0.232  21.039  1.00 60.01 ? 1041 ILE B CD1   1 
ATOM   2637  N  N     . GLU B  1 69  ? -0.130  -3.574  24.515  1.00 65.01 ? 1042 GLU B N     1 
ATOM   2638  C  CA    . GLU B  1 69  ? -0.906  -4.562  25.258  1.00 67.25 ? 1042 GLU B CA    1 
ATOM   2639  C  C     . GLU B  1 69  ? -2.274  -4.787  24.611  1.00 67.56 ? 1042 GLU B C     1 
ATOM   2640  O  O     . GLU B  1 69  ? -3.237  -4.078  24.908  1.00 69.37 ? 1042 GLU B O     1 
ATOM   2641  C  CB    . GLU B  1 69  ? -1.049  -4.167  26.735  1.00 69.27 ? 1042 GLU B CB    1 
ATOM   2642  C  CG    . GLU B  1 69  ? -0.064  -4.859  27.684  1.00 70.46 ? 1042 GLU B CG    1 
ATOM   2643  C  CD    . GLU B  1 69  ? 1.361   -4.317  27.599  1.00 78.82 ? 1042 GLU B CD    1 
ATOM   2644  O  OE1   . GLU B  1 69  ? 2.279   -4.992  28.117  1.00 79.90 ? 1042 GLU B OE1   1 
ATOM   2645  O  OE2   . GLU B  1 69  ? 1.571   -3.224  27.025  1.00 81.99 ? 1042 GLU B OE2   1 
ATOM   2646  N  N     . ASP B  1 70  ? -2.339  -5.764  23.707  1.00 67.76 ? 1043 ASP B N     1 
ATOM   2647  C  CA    . ASP B  1 70  ? -3.601  -6.192  23.115  1.00 69.01 ? 1043 ASP B CA    1 
ATOM   2648  C  C     . ASP B  1 70  ? -4.239  -7.220  24.060  1.00 70.57 ? 1043 ASP B C     1 
ATOM   2649  O  O     . ASP B  1 70  ? -3.605  -8.225  24.399  1.00 71.99 ? 1043 ASP B O     1 
ATOM   2650  C  CB    . ASP B  1 70  ? -3.370  -6.786  21.716  1.00 68.57 ? 1043 ASP B CB    1 
ATOM   2651  C  CG    . ASP B  1 70  ? -4.592  -6.656  20.800  1.00 68.31 ? 1043 ASP B CG    1 
ATOM   2652  O  OD1   . ASP B  1 70  ? -4.507  -5.903  19.806  1.00 65.57 ? 1043 ASP B OD1   1 
ATOM   2653  O  OD2   . ASP B  1 70  ? -5.631  -7.306  21.058  1.00 62.66 ? 1043 ASP B OD2   1 
ATOM   2654  N  N     . PRO B  1 71  ? -5.486  -6.960  24.509  1.00 70.21 ? 1044 PRO B N     1 
ATOM   2655  C  CA    . PRO B  1 71  ? -6.176  -7.818  25.484  1.00 70.66 ? 1044 PRO B CA    1 
ATOM   2656  C  C     . PRO B  1 71  ? -6.318  -9.287  25.070  1.00 72.11 ? 1044 PRO B C     1 
ATOM   2657  O  O     . PRO B  1 71  ? -6.601  -10.136 25.920  1.00 74.06 ? 1044 PRO B O     1 
ATOM   2658  C  CB    . PRO B  1 71  ? -7.559  -7.164  25.621  1.00 69.61 ? 1044 PRO B CB    1 
ATOM   2659  C  CG    . PRO B  1 71  ? -7.696  -6.274  24.434  1.00 71.45 ? 1044 PRO B CG    1 
ATOM   2660  C  CD    . PRO B  1 71  ? -6.316  -5.806  24.124  1.00 69.36 ? 1044 PRO B CD    1 
ATOM   2661  N  N     . LYS B  1 72  ? -6.117  -9.579  23.787  1.00 70.87 ? 1045 LYS B N     1 
ATOM   2662  C  CA    . LYS B  1 72  ? -6.205  -10.948 23.275  1.00 70.00 ? 1045 LYS B CA    1 
ATOM   2663  C  C     . LYS B  1 72  ? -4.821  -11.560 23.043  1.00 68.78 ? 1045 LYS B C     1 
ATOM   2664  O  O     . LYS B  1 72  ? -4.600  -12.739 23.327  1.00 67.41 ? 1045 LYS B O     1 
ATOM   2665  C  CB    . LYS B  1 72  ? -7.013  -10.987 21.973  1.00 70.56 ? 1045 LYS B CB    1 
ATOM   2666  C  CG    . LYS B  1 72  ? -8.390  -10.351 22.062  1.00 70.60 ? 1045 LYS B CG    1 
ATOM   2667  C  CD    . LYS B  1 72  ? -9.011  -10.201 20.685  1.00 73.71 ? 1045 LYS B CD    1 
ATOM   2668  C  CE    . LYS B  1 72  ? -10.219 -9.277  20.720  1.00 69.67 ? 1045 LYS B CE    1 
ATOM   2669  N  NZ    . LYS B  1 72  ? -10.943 -9.278  19.419  1.00 66.28 ? 1045 LYS B NZ    1 
ATOM   2670  N  N     . LEU B  1 73  ? -3.897  -10.745 22.536  1.00 68.86 ? 1046 LEU B N     1 
ATOM   2671  C  CA    . LEU B  1 73  ? -2.576  -11.208 22.100  1.00 66.83 ? 1046 LEU B CA    1 
ATOM   2672  C  C     . LEU B  1 73  ? -1.509  -11.203 23.201  1.00 64.87 ? 1046 LEU B C     1 
ATOM   2673  O  O     . LEU B  1 73  ? -0.705  -12.131 23.294  1.00 64.10 ? 1046 LEU B O     1 
ATOM   2674  C  CB    . LEU B  1 73  ? -2.087  -10.379 20.903  1.00 65.78 ? 1046 LEU B CB    1 
ATOM   2675  C  CG    . LEU B  1 73  ? -2.910  -10.305 19.610  1.00 65.96 ? 1046 LEU B CG    1 
ATOM   2676  C  CD1   . LEU B  1 73  ? -2.375  -9.185  18.729  1.00 65.84 ? 1046 LEU B CD1   1 
ATOM   2677  C  CD2   . LEU B  1 73  ? -2.923  -11.631 18.846  1.00 66.21 ? 1046 LEU B CD2   1 
ATOM   2678  N  N     . GLY B  1 74  ? -1.506  -10.160 24.028  1.00 64.16 ? 1047 GLY B N     1 
ATOM   2679  C  CA    . GLY B  1 74  ? -0.469  -9.969  25.043  1.00 61.75 ? 1047 GLY B CA    1 
ATOM   2680  C  C     . GLY B  1 74  ? 0.407   -8.793  24.666  1.00 61.06 ? 1047 GLY B C     1 
ATOM   2681  O  O     . GLY B  1 74  ? -0.096  -7.754  24.238  1.00 63.02 ? 1047 GLY B O     1 
ATOM   2682  N  N     . LYS B  1 75  ? 1.719   -8.946  24.822  1.00 60.39 ? 1048 LYS B N     1 
ATOM   2683  C  CA    . LYS B  1 75  ? 2.653   -7.925  24.351  1.00 58.25 ? 1048 LYS B CA    1 
ATOM   2684  C  C     . LYS B  1 75  ? 3.064   -8.243  22.913  1.00 53.90 ? 1048 LYS B C     1 
ATOM   2685  O  O     . LYS B  1 75  ? 3.651   -9.293  22.643  1.00 53.76 ? 1048 LYS B O     1 
ATOM   2686  C  CB    . LYS B  1 75  ? 3.882   -7.819  25.264  1.00 59.08 ? 1048 LYS B CB    1 
ATOM   2687  C  CG    . LYS B  1 75  ? 4.354   -6.382  25.539  1.00 57.67 ? 1048 LYS B CG    1 
ATOM   2688  C  CD    . LYS B  1 75  ? 4.737   -5.608  24.274  1.00 60.26 ? 1048 LYS B CD    1 
ATOM   2689  C  CE    . LYS B  1 75  ? 6.102   -6.018  23.745  1.00 57.86 ? 1048 LYS B CE    1 
ATOM   2690  N  NZ    . LYS B  1 75  ? 6.397   -5.422  22.409  1.00 53.87 ? 1048 LYS B NZ    1 
ATOM   2691  N  N     . VAL B  1 76  ? 2.731   -7.327  22.006  1.00 51.10 ? 1049 VAL B N     1 
ATOM   2692  C  CA    . VAL B  1 76  ? 3.004   -7.448  20.569  1.00 44.34 ? 1049 VAL B CA    1 
ATOM   2693  C  C     . VAL B  1 76  ? 3.458   -6.097  20.004  1.00 42.56 ? 1049 VAL B C     1 
ATOM   2694  O  O     . VAL B  1 76  ? 3.510   -5.108  20.736  1.00 46.04 ? 1049 VAL B O     1 
ATOM   2695  C  CB    . VAL B  1 76  ? 1.755   -7.956  19.794  1.00 47.23 ? 1049 VAL B CB    1 
ATOM   2696  C  CG1   . VAL B  1 76  ? 1.463   -9.430  20.120  1.00 43.13 ? 1049 VAL B CG1   1 
ATOM   2697  C  CG2   . VAL B  1 76  ? 0.526   -7.069  20.062  1.00 40.59 ? 1049 VAL B CG2   1 
ATOM   2698  N  N     . THR B  1 77  ? 3.800   -6.058  18.715  1.00 39.71 ? 1050 THR B N     1 
ATOM   2699  C  CA    . THR B  1 77  ? 4.067   -4.791  18.008  1.00 36.06 ? 1050 THR B CA    1 
ATOM   2700  C  C     . THR B  1 77  ? 2.788   -4.187  17.397  1.00 35.81 ? 1050 THR B C     1 
ATOM   2701  O  O     . THR B  1 77  ? 1.761   -4.864  17.294  1.00 37.10 ? 1050 THR B O     1 
ATOM   2702  C  CB    . THR B  1 77  ? 5.132   -4.963  16.901  1.00 34.84 ? 1050 THR B CB    1 
ATOM   2703  O  OG1   . THR B  1 77  ? 5.445   -3.689  16.321  1.00 44.94 ? 1050 THR B OG1   1 
ATOM   2704  C  CG2   . THR B  1 77  ? 4.625   -5.869  15.805  1.00 27.39 ? 1050 THR B CG2   1 
ATOM   2705  N  N     . LEU B  1 78  ? 2.872   -2.927  16.967  1.00 33.76 ? 1051 LEU B N     1 
ATOM   2706  C  CA    . LEU B  1 78  ? 1.734   -2.209  16.378  1.00 37.33 ? 1051 LEU B CA    1 
ATOM   2707  C  C     . LEU B  1 78  ? 1.335   -2.761  15.011  1.00 37.97 ? 1051 LEU B C     1 
ATOM   2708  O  O     . LEU B  1 78  ? 0.181   -2.653  14.611  1.00 43.33 ? 1051 LEU B O     1 
ATOM   2709  C  CB    . LEU B  1 78  ? 2.022   -0.705  16.292  1.00 34.75 ? 1051 LEU B CB    1 
ATOM   2710  C  CG    . LEU B  1 78  ? 0.861   0.298   16.286  1.00 41.39 ? 1051 LEU B CG    1 
ATOM   2711  C  CD1   . LEU B  1 78  ? -0.147  0.035   17.402  1.00 36.51 ? 1051 LEU B CD1   1 
ATOM   2712  C  CD2   . LEU B  1 78  ? 1.387   1.728   16.373  1.00 37.21 ? 1051 LEU B CD2   1 
ATOM   2713  N  N     . GLU B  1 79  ? 2.294   -3.348  14.305  1.00 37.19 ? 1052 GLU B N     1 
ATOM   2714  C  CA    . GLU B  1 79  ? 2.033   -4.038  13.050  1.00 36.86 ? 1052 GLU B CA    1 
ATOM   2715  C  C     . GLU B  1 79  ? 1.176   -5.272  13.294  1.00 34.12 ? 1052 GLU B C     1 
ATOM   2716  O  O     . GLU B  1 79  ? 0.223   -5.520  12.567  1.00 31.87 ? 1052 GLU B O     1 
ATOM   2717  C  CB    . GLU B  1 79  ? 3.350   -4.449  12.387  1.00 34.99 ? 1052 GLU B CB    1 
ATOM   2718  C  CG    . GLU B  1 79  ? 3.189   -5.435  11.241  1.00 38.71 ? 1052 GLU B CG    1 
ATOM   2719  C  CD    . GLU B  1 79  ? 4.434   -5.575  10.381  1.00 40.28 ? 1052 GLU B CD    1 
ATOM   2720  O  OE1   . GLU B  1 79  ? 5.551   -5.323  10.889  1.00 40.28 ? 1052 GLU B OE1   1 
ATOM   2721  O  OE2   . GLU B  1 79  ? 4.286   -5.947  9.194   1.00 34.53 ? 1052 GLU B OE2   1 
ATOM   2722  N  N     . ILE B  1 80  ? 1.542   -6.035  14.323  1.00 31.86 ? 1053 ILE B N     1 
ATOM   2723  C  CA    . ILE B  1 80  ? 0.855   -7.260  14.695  1.00 29.86 ? 1053 ILE B CA    1 
ATOM   2724  C  C     . ILE B  1 80  ? -0.525  -6.951  15.283  1.00 26.68 ? 1053 ILE B C     1 
ATOM   2725  O  O     . ILE B  1 80  ? -1.512  -7.530  14.857  1.00 30.39 ? 1053 ILE B O     1 
ATOM   2726  C  CB    . ILE B  1 80  ? 1.718   -8.118  15.668  1.00 29.75 ? 1053 ILE B CB    1 
ATOM   2727  C  CG1   . ILE B  1 80  ? 2.875   -8.779  14.905  1.00 31.36 ? 1053 ILE B CG1   1 
ATOM   2728  C  CG2   . ILE B  1 80  ? 0.871   -9.164  16.384  1.00 28.94 ? 1053 ILE B CG2   1 
ATOM   2729  C  CD1   . ILE B  1 80  ? 3.882   -9.500  15.789  1.00 29.42 ? 1053 ILE B CD1   1 
ATOM   2730  N  N     . ALA B  1 81  ? -0.572  -6.017  16.229  1.00 24.49 ? 1054 ALA B N     1 
ATOM   2731  C  CA    . ALA B  1 81  ? -1.815  -5.582  16.867  1.00 25.61 ? 1054 ALA B CA    1 
ATOM   2732  C  C     . ALA B  1 81  ? -2.855  -5.059  15.880  1.00 26.29 ? 1054 ALA B C     1 
ATOM   2733  O  O     . ALA B  1 81  ? -4.001  -5.500  15.913  1.00 31.08 ? 1054 ALA B O     1 
ATOM   2734  C  CB    . ALA B  1 81  ? -1.524  -4.536  17.964  1.00 20.63 ? 1054 ALA B CB    1 
ATOM   2735  N  N     . ILE B  1 82  ? -2.455  -4.122  15.016  1.00 30.69 ? 1055 ILE B N     1 
ATOM   2736  C  CA    . ILE B  1 82  ? -3.323  -3.583  13.957  1.00 27.26 ? 1055 ILE B CA    1 
ATOM   2737  C  C     . ILE B  1 82  ? -3.755  -4.671  12.955  1.00 30.13 ? 1055 ILE B C     1 
ATOM   2738  O  O     . ILE B  1 82  ? -4.956  -4.837  12.699  1.00 24.80 ? 1055 ILE B O     1 
ATOM   2739  C  CB    . ILE B  1 82  ? -2.667  -2.358  13.243  1.00 28.19 ? 1055 ILE B CB    1 
ATOM   2740  C  CG1   . ILE B  1 82  ? -2.646  -1.157  14.194  1.00 27.33 ? 1055 ILE B CG1   1 
ATOM   2741  C  CG2   . ILE B  1 82  ? -3.407  -1.999  11.936  1.00 25.96 ? 1055 ILE B CG2   1 
ATOM   2742  C  CD1   . ILE B  1 82  ? -1.794  0.015   13.738  1.00 31.15 ? 1055 ILE B CD1   1 
ATOM   2743  N  N     . LEU B  1 83  ? -2.782  -5.421  12.419  1.00 32.62 ? 1056 LEU B N     1 
ATOM   2744  C  CA    . LEU B  1 83  ? -3.052  -6.542  11.502  1.00 34.17 ? 1056 LEU B CA    1 
ATOM   2745  C  C     . LEU B  1 83  ? -3.966  -7.633  12.074  1.00 34.70 ? 1056 LEU B C     1 
ATOM   2746  O  O     . LEU B  1 83  ? -4.705  -8.285  11.331  1.00 34.42 ? 1056 LEU B O     1 
ATOM   2747  C  CB    . LEU B  1 83  ? -1.755  -7.179  10.991  1.00 34.48 ? 1056 LEU B CB    1 
ATOM   2748  C  CG    . LEU B  1 83  ? -1.420  -7.056  9.503   1.00 30.64 ? 1056 LEU B CG    1 
ATOM   2749  C  CD1   . LEU B  1 83  ? -0.265  -7.986  9.182   1.00 28.74 ? 1056 LEU B CD1   1 
ATOM   2750  C  CD2   . LEU B  1 83  ? -2.616  -7.388  8.627   1.00 25.45 ? 1056 LEU B CD2   1 
ATOM   2751  N  N     . SER B  1 84  ? -3.894  -7.834  13.384  1.00 31.02 ? 1057 SER B N     1 
ATOM   2752  C  CA    . SER B  1 84  ? -4.807  -8.735  14.090  1.00 37.96 ? 1057 SER B CA    1 
ATOM   2753  C  C     . SER B  1 84  ? -6.244  -8.193  14.198  1.00 37.68 ? 1057 SER B C     1 
ATOM   2754  O  O     . SER B  1 84  ? -7.184  -8.960  14.397  1.00 35.08 ? 1057 SER B O     1 
ATOM   2755  C  CB    . SER B  1 84  ? -4.269  -9.013  15.493  1.00 30.82 ? 1057 SER B CB    1 
ATOM   2756  O  OG    . SER B  1 84  ? -3.036  -9.699  15.412  1.00 45.01 ? 1057 SER B OG    1 
ATOM   2757  N  N     . ARG B  1 85  ? -6.396  -6.872  14.086  1.00 40.33 ? 1058 ARG B N     1 
ATOM   2758  C  CA    . ARG B  1 85  ? -7.683  -6.204  14.312  1.00 39.01 ? 1058 ARG B CA    1 
ATOM   2759  C  C     . ARG B  1 85  ? -8.507  -6.004  13.038  1.00 40.83 ? 1058 ARG B C     1 
ATOM   2760  O  O     . ARG B  1 85  ? -9.740  -5.907  13.098  1.00 43.71 ? 1058 ARG B O     1 
ATOM   2761  C  CB    . ARG B  1 85  ? -7.467  -4.858  15.011  1.00 36.30 ? 1058 ARG B CB    1 
ATOM   2762  C  CG    . ARG B  1 85  ? -7.076  -4.969  16.482  1.00 36.11 ? 1058 ARG B CG    1 
ATOM   2763  C  CD    . ARG B  1 85  ? -6.594  -3.636  17.023  1.00 29.34 ? 1058 ARG B CD    1 
ATOM   2764  N  NE    . ARG B  1 85  ? -5.955  -3.782  18.331  1.00 48.93 ? 1058 ARG B NE    1 
ATOM   2765  C  CZ    . ARG B  1 85  ? -5.115  -2.900  18.875  1.00 48.13 ? 1058 ARG B CZ    1 
ATOM   2766  N  NH1   . ARG B  1 85  ? -4.781  -1.791  18.229  1.00 44.78 ? 1058 ARG B NH1   1 
ATOM   2767  N  NH2   . ARG B  1 85  ? -4.590  -3.137  20.069  1.00 48.81 ? 1058 ARG B NH2   1 
ATOM   2768  N  N     . VAL B  1 86  ? -7.829  -5.946  11.893  1.00 37.30 ? 1059 VAL B N     1 
ATOM   2769  C  CA    . VAL B  1 86  ? -8.488  -5.615  10.630  1.00 33.12 ? 1059 VAL B CA    1 
ATOM   2770  C  C     . VAL B  1 86  ? -8.905  -6.845  9.823   1.00 32.89 ? 1059 VAL B C     1 
ATOM   2771  O  O     . VAL B  1 86  ? -8.296  -7.909  9.920   1.00 33.31 ? 1059 VAL B O     1 
ATOM   2772  C  CB    . VAL B  1 86  ? -7.660  -4.612  9.763   1.00 31.77 ? 1059 VAL B CB    1 
ATOM   2773  C  CG1   . VAL B  1 86  ? -7.406  -3.315  10.537  1.00 30.86 ? 1059 VAL B CG1   1 
ATOM   2774  C  CG2   . VAL B  1 86  ? -6.355  -5.222  9.285   1.00 29.49 ? 1059 VAL B CG2   1 
ATOM   2775  N  N     . GLU B  1 87  ? -9.963  -6.678  9.036   1.00 32.48 ? 1060 GLU B N     1 
ATOM   2776  C  CA    . GLU B  1 87  ? -10.541 -7.754  8.249   1.00 31.60 ? 1060 GLU B CA    1 
ATOM   2777  C  C     . GLU B  1 87  ? -11.278 -7.108  7.093   1.00 27.55 ? 1060 GLU B C     1 
ATOM   2778  O  O     . GLU B  1 87  ? -12.297 -6.440  7.288   1.00 29.37 ? 1060 GLU B O     1 
ATOM   2779  C  CB    . GLU B  1 87  ? -11.484 -8.596  9.110   1.00 33.89 ? 1060 GLU B CB    1 
ATOM   2780  C  CG    . GLU B  1 87  ? -11.846 -9.955  8.514   1.00 46.10 ? 1060 GLU B CG    1 
ATOM   2781  C  CD    . GLU B  1 87  ? -12.297 -10.960 9.569   1.00 49.33 ? 1060 GLU B CD    1 
ATOM   2782  O  OE1   . GLU B  1 87  ? -12.404 -12.159 9.234   1.00 54.07 ? 1060 GLU B OE1   1 
ATOM   2783  O  OE2   . GLU B  1 87  ? -12.534 -10.558 10.730  1.00 46.59 ? 1060 GLU B OE2   1 
ATOM   2784  N  N     . HIS B  1 88  ? -10.733 -7.290  5.891   1.00 26.32 ? 1061 HIS B N     1 
ATOM   2785  C  CA    . HIS B  1 88  ? -11.219 -6.619  4.699   1.00 21.96 ? 1061 HIS B CA    1 
ATOM   2786  C  C     . HIS B  1 88  ? -10.765 -7.379  3.464   1.00 23.67 ? 1061 HIS B C     1 
ATOM   2787  O  O     . HIS B  1 88  ? -9.660  -7.908  3.428   1.00 28.05 ? 1061 HIS B O     1 
ATOM   2788  C  CB    . HIS B  1 88  ? -10.712 -5.173  4.667   1.00 22.22 ? 1061 HIS B CB    1 
ATOM   2789  C  CG    . HIS B  1 88  ? -11.223 -4.379  3.509   1.00 22.41 ? 1061 HIS B CG    1 
ATOM   2790  N  ND1   . HIS B  1 88  ? -10.494 -4.192  2.356   1.00 33.67 ? 1061 HIS B ND1   1 
ATOM   2791  C  CD2   . HIS B  1 88  ? -12.392 -3.722  3.324   1.00 24.07 ? 1061 HIS B CD2   1 
ATOM   2792  C  CE1   . HIS B  1 88  ? -11.193 -3.458  1.509   1.00 28.14 ? 1061 HIS B CE1   1 
ATOM   2793  N  NE2   . HIS B  1 88  ? -12.345 -3.154  2.075   1.00 17.73 ? 1061 HIS B NE2   1 
ATOM   2794  N  N     . ALA B  1 89  ? -11.622 -7.420  2.448   1.00 25.42 ? 1062 ALA B N     1 
ATOM   2795  C  CA    . ALA B  1 89  ? -11.345 -8.149  1.210   1.00 28.30 ? 1062 ALA B CA    1 
ATOM   2796  C  C     . ALA B  1 89  ? -10.009 -7.790  0.540   1.00 27.20 ? 1062 ALA B C     1 
ATOM   2797  O  O     . ALA B  1 89  ? -9.481  -8.573  -0.251  1.00 31.79 ? 1062 ALA B O     1 
ATOM   2798  C  CB    . ALA B  1 89  ? -12.514 -7.977  0.214   1.00 21.94 ? 1062 ALA B CB    1 
ATOM   2799  N  N     . ASN B  1 90  ? -9.470  -6.614  0.863   1.00 28.78 ? 1063 ASN B N     1 
ATOM   2800  C  CA    . ASN B  1 90  ? -8.262  -6.088  0.211   1.00 25.42 ? 1063 ASN B CA    1 
ATOM   2801  C  C     . ASN B  1 90  ? -7.092  -5.779  1.164   1.00 22.33 ? 1063 ASN B C     1 
ATOM   2802  O  O     . ASN B  1 90  ? -6.182  -5.019  0.833   1.00 19.26 ? 1063 ASN B O     1 
ATOM   2803  C  CB    . ASN B  1 90  ? -8.621  -4.857  -0.634  1.00 32.90 ? 1063 ASN B CB    1 
ATOM   2804  C  CG    . ASN B  1 90  ? -9.685  -5.157  -1.696  1.00 27.45 ? 1063 ASN B CG    1 
ATOM   2805  O  OD1   . ASN B  1 90  ? -10.808 -4.679  -1.611  1.00 27.37 ? 1063 ASN B OD1   1 
ATOM   2806  N  ND2   . ASN B  1 90  ? -9.325  -5.956  -2.687  1.00 30.82 ? 1063 ASN B ND2   1 
ATOM   2807  N  N     . ILE B  1 91  ? -7.138  -6.390  2.342   1.00 24.55 ? 1064 ILE B N     1 
ATOM   2808  C  CA    . ILE B  1 91  ? -6.075  -6.335  3.335   1.00 22.11 ? 1064 ILE B CA    1 
ATOM   2809  C  C     . ILE B  1 91  ? -5.703  -7.793  3.593   1.00 26.00 ? 1064 ILE B C     1 
ATOM   2810  O  O     . ILE B  1 91  ? -6.581  -8.658  3.671   1.00 24.87 ? 1064 ILE B O     1 
ATOM   2811  C  CB    . ILE B  1 91  ? -6.530  -5.602  4.644   1.00 22.20 ? 1064 ILE B CB    1 
ATOM   2812  C  CG1   . ILE B  1 91  ? -6.688  -4.096  4.379   1.00 24.37 ? 1064 ILE B CG1   1 
ATOM   2813  C  CG2   . ILE B  1 91  ? -5.560  -5.836  5.793   1.00 23.89 ? 1064 ILE B CG2   1 
ATOM   2814  C  CD1   . ILE B  1 91  ? -7.136  -3.262  5.585   1.00 10.34 ? 1064 ILE B CD1   1 
ATOM   2815  N  N     . ILE B  1 92  ? -4.400  -8.053  3.671   1.00 24.07 ? 1065 ILE B N     1 
ATOM   2816  C  CA    . ILE B  1 92  ? -3.862  -9.396  3.835   1.00 24.17 ? 1065 ILE B CA    1 
ATOM   2817  C  C     . ILE B  1 92  ? -4.396  -10.101 5.085   1.00 24.36 ? 1065 ILE B C     1 
ATOM   2818  O  O     . ILE B  1 92  ? -4.464  -9.512  6.166   1.00 24.64 ? 1065 ILE B O     1 
ATOM   2819  C  CB    . ILE B  1 92  ? -2.288  -9.405  3.786   1.00 19.94 ? 1065 ILE B CB    1 
ATOM   2820  C  CG1   . ILE B  1 92  ? -1.750  -10.798 3.444   1.00 16.69 ? 1065 ILE B CG1   1 
ATOM   2821  C  CG2   . ILE B  1 92  ? -1.664  -8.868  5.071   1.00 15.45 ? 1065 ILE B CG2   1 
ATOM   2822  C  CD1   . ILE B  1 92  ? -1.883  -11.173 1.965   1.00 19.17 ? 1065 ILE B CD1   1 
ATOM   2823  N  N     . LYS B  1 93  ? -4.771  -11.365 4.903   1.00 30.09 ? 1066 LYS B N     1 
ATOM   2824  C  CA    . LYS B  1 93  ? -5.285  -12.227 5.974   1.00 33.27 ? 1066 LYS B CA    1 
ATOM   2825  C  C     . LYS B  1 93  ? -4.156  -12.826 6.840   1.00 29.49 ? 1066 LYS B C     1 
ATOM   2826  O  O     . LYS B  1 93  ? -3.147  -13.321 6.324   1.00 26.48 ? 1066 LYS B O     1 
ATOM   2827  C  CB    . LYS B  1 93  ? -6.165  -13.325 5.345   1.00 33.86 ? 1066 LYS B CB    1 
ATOM   2828  C  CG    . LYS B  1 93  ? -6.810  -14.329 6.292   1.00 41.69 ? 1066 LYS B CG    1 
ATOM   2829  C  CD    . LYS B  1 93  ? -7.861  -15.170 5.556   1.00 40.02 ? 1066 LYS B CD    1 
ATOM   2830  C  CE    . LYS B  1 93  ? -8.063  -16.543 6.202   1.00 46.09 ? 1066 LYS B CE    1 
ATOM   2831  N  NZ    . LYS B  1 93  ? -8.405  -16.476 7.657   1.00 40.22 ? 1066 LYS B NZ    1 
ATOM   2832  N  N     . VAL B  1 94  ? -4.339  -12.747 8.155   1.00 29.59 ? 1067 VAL B N     1 
ATOM   2833  C  CA    . VAL B  1 94  ? -3.455  -13.376 9.129   1.00 28.36 ? 1067 VAL B CA    1 
ATOM   2834  C  C     . VAL B  1 94  ? -3.948  -14.796 9.429   1.00 31.38 ? 1067 VAL B C     1 
ATOM   2835  O  O     . VAL B  1 94  ? -5.117  -15.001 9.777   1.00 26.26 ? 1067 VAL B O     1 
ATOM   2836  C  CB    . VAL B  1 94  ? -3.363  -12.555 10.439  1.00 28.89 ? 1067 VAL B CB    1 
ATOM   2837  C  CG1   . VAL B  1 94  ? -2.687  -13.360 11.558  1.00 28.03 ? 1067 VAL B CG1   1 
ATOM   2838  C  CG2   . VAL B  1 94  ? -2.619  -11.259 10.202  1.00 31.24 ? 1067 VAL B CG2   1 
ATOM   2839  N  N     . LEU B  1 95  ? -3.042  -15.764 9.280   1.00 32.03 ? 1068 LEU B N     1 
ATOM   2840  C  CA    . LEU B  1 95  ? -3.340  -17.173 9.526   1.00 29.88 ? 1068 LEU B CA    1 
ATOM   2841  C  C     . LEU B  1 95  ? -2.923  -17.624 10.919  1.00 32.75 ? 1068 LEU B C     1 
ATOM   2842  O  O     . LEU B  1 95  ? -3.562  -18.496 11.504  1.00 37.57 ? 1068 LEU B O     1 
ATOM   2843  C  CB    . LEU B  1 95  ? -2.668  -18.057 8.472   1.00 24.42 ? 1068 LEU B CB    1 
ATOM   2844  C  CG    . LEU B  1 95  ? -3.252  -17.997 7.064   1.00 25.03 ? 1068 LEU B CG    1 
ATOM   2845  C  CD1   . LEU B  1 95  ? -2.302  -18.648 6.085   1.00 25.17 ? 1068 LEU B CD1   1 
ATOM   2846  C  CD2   . LEU B  1 95  ? -4.633  -18.658 7.000   1.00 29.33 ? 1068 LEU B CD2   1 
ATOM   2847  N  N     . ASP B  1 96  ? -1.850  -17.033 11.439  1.00 29.74 ? 1069 ASP B N     1 
ATOM   2848  C  CA    . ASP B  1 96  ? -1.288  -17.409 12.732  1.00 30.95 ? 1069 ASP B CA    1 
ATOM   2849  C  C     . ASP B  1 96  ? -0.288  -16.377 13.190  1.00 28.71 ? 1069 ASP B C     1 
ATOM   2850  O  O     . ASP B  1 96  ? 0.479   -15.850 12.396  1.00 32.00 ? 1069 ASP B O     1 
ATOM   2851  C  CB    . ASP B  1 96  ? -0.547  -18.749 12.638  1.00 32.58 ? 1069 ASP B CB    1 
ATOM   2852  C  CG    . ASP B  1 96  ? -1.460  -19.935 12.802  1.00 34.80 ? 1069 ASP B CG    1 
ATOM   2853  O  OD1   . ASP B  1 96  ? -2.245  -19.946 13.771  1.00 36.83 ? 1069 ASP B OD1   1 
ATOM   2854  O  OD2   . ASP B  1 96  ? -1.390  -20.856 11.960  1.00 40.53 ? 1069 ASP B OD2   1 
ATOM   2855  N  N     . ILE B  1 97  ? -0.282  -16.107 14.482  1.00 32.47 ? 1070 ILE B N     1 
ATOM   2856  C  CA    . ILE B  1 97  ? 0.798   -15.340 15.072  1.00 33.11 ? 1070 ILE B CA    1 
ATOM   2857  C  C     . ILE B  1 97  ? 1.373   -16.101 16.273  1.00 30.50 ? 1070 ILE B C     1 
ATOM   2858  O  O     . ILE B  1 97  ? 0.685   -16.323 17.265  1.00 30.37 ? 1070 ILE B O     1 
ATOM   2859  C  CB    . ILE B  1 97  ? 0.387   -13.854 15.373  1.00 33.68 ? 1070 ILE B CB    1 
ATOM   2860  C  CG1   . ILE B  1 97  ? 1.388   -13.197 16.336  1.00 25.37 ? 1070 ILE B CG1   1 
ATOM   2861  C  CG2   . ILE B  1 97  ? -1.078  -13.760 15.827  1.00 40.88 ? 1070 ILE B CG2   1 
ATOM   2862  C  CD1   . ILE B  1 97  ? 0.778   -12.254 17.336  1.00 41.30 ? 1070 ILE B CD1   1 
ATOM   2863  N  N     . PHE B  1 98  ? 2.624   -16.545 16.131  1.00 33.33 ? 1071 PHE B N     1 
ATOM   2864  C  CA    . PHE B  1 98  ? 3.360   -17.223 17.204  1.00 35.01 ? 1071 PHE B CA    1 
ATOM   2865  C  C     . PHE B  1 98  ? 4.461   -16.324 17.770  1.00 36.65 ? 1071 PHE B C     1 
ATOM   2866  O  O     . PHE B  1 98  ? 4.676   -15.212 17.282  1.00 37.52 ? 1071 PHE B O     1 
ATOM   2867  C  CB    . PHE B  1 98  ? 3.956   -18.557 16.726  1.00 30.00 ? 1071 PHE B CB    1 
ATOM   2868  C  CG    . PHE B  1 98  ? 2.964   -19.468 16.044  1.00 29.68 ? 1071 PHE B CG    1 
ATOM   2869  C  CD1   . PHE B  1 98  ? 1.931   -20.074 16.764  1.00 27.14 ? 1071 PHE B CD1   1 
ATOM   2870  C  CD2   . PHE B  1 98  ? 3.071   -19.727 14.682  1.00 28.63 ? 1071 PHE B CD2   1 
ATOM   2871  C  CE1   . PHE B  1 98  ? 1.015   -20.922 16.132  1.00 25.40 ? 1071 PHE B CE1   1 
ATOM   2872  C  CE2   . PHE B  1 98  ? 2.161   -20.581 14.038  1.00 38.59 ? 1071 PHE B CE2   1 
ATOM   2873  C  CZ    . PHE B  1 98  ? 1.133   -21.178 14.768  1.00 28.18 ? 1071 PHE B CZ    1 
ATOM   2874  N  N     . GLU B  1 99  ? 5.134   -16.811 18.809  1.00 36.93 ? 1072 GLU B N     1 
ATOM   2875  C  CA    . GLU B  1 99  ? 6.227   -16.094 19.468  1.00 42.93 ? 1072 GLU B CA    1 
ATOM   2876  C  C     . GLU B  1 99  ? 7.148   -17.104 20.163  1.00 41.99 ? 1072 GLU B C     1 
ATOM   2877  O  O     . GLU B  1 99  ? 6.699   -18.191 20.543  1.00 37.28 ? 1072 GLU B O     1 
ATOM   2878  C  CB    . GLU B  1 99  ? 5.669   -15.077 20.469  1.00 45.08 ? 1072 GLU B CB    1 
ATOM   2879  C  CG    . GLU B  1 99  ? 6.638   -13.956 20.856  1.00 57.01 ? 1072 GLU B CG    1 
ATOM   2880  C  CD    . GLU B  1 99  ? 7.062   -13.996 22.314  1.00 63.47 ? 1072 GLU B CD    1 
ATOM   2881  O  OE1   . GLU B  1 99  ? 6.193   -14.270 23.171  1.00 63.56 ? 1072 GLU B OE1   1 
ATOM   2882  O  OE2   . GLU B  1 99  ? 8.256   -13.733 22.602  1.00 57.81 ? 1072 GLU B OE2   1 
ATOM   2883  N  N     . ASN B  1 100 ? 8.428   -16.759 20.316  1.00 43.58 ? 1073 ASN B N     1 
ATOM   2884  C  CA    . ASN B  1 100 ? 9.382   -17.683 20.950  1.00 44.25 ? 1073 ASN B CA    1 
ATOM   2885  C  C     . ASN B  1 100 ? 10.487  -17.094 21.838  1.00 45.78 ? 1073 ASN B C     1 
ATOM   2886  O  O     . ASN B  1 100 ? 11.483  -17.772 22.105  1.00 51.46 ? 1073 ASN B O     1 
ATOM   2887  C  CB    . ASN B  1 100 ? 9.984   -18.656 19.914  1.00 42.71 ? 1073 ASN B CB    1 
ATOM   2888  C  CG    . ASN B  1 100 ? 10.991  -17.992 18.973  1.00 36.08 ? 1073 ASN B CG    1 
ATOM   2889  O  OD1   . ASN B  1 100 ? 11.554  -16.933 19.263  1.00 35.09 ? 1073 ASN B OD1   1 
ATOM   2890  N  ND2   . ASN B  1 100 ? 11.222  -18.632 17.836  1.00 26.25 ? 1073 ASN B ND2   1 
ATOM   2891  N  N     . GLN B  1 101 ? 10.306  -15.855 22.295  1.00 46.41 ? 1074 GLN B N     1 
ATOM   2892  C  CA    . GLN B  1 101 ? 11.261  -15.174 23.209  1.00 47.71 ? 1074 GLN B CA    1 
ATOM   2893  C  C     . GLN B  1 101 ? 12.391  -14.421 22.505  1.00 46.84 ? 1074 GLN B C     1 
ATOM   2894  O  O     . GLN B  1 101 ? 12.975  -13.492 23.075  1.00 50.58 ? 1074 GLN B O     1 
ATOM   2895  C  CB    . GLN B  1 101 ? 11.832  -16.127 24.270  1.00 49.49 ? 1074 GLN B CB    1 
ATOM   2896  N  N     . GLY B  1 102 ? 12.698  -14.821 21.276  1.00 43.43 ? 1075 GLY B N     1 
ATOM   2897  C  CA    . GLY B  1 102 ? 13.573  -14.042 20.421  1.00 42.30 ? 1075 GLY B CA    1 
ATOM   2898  C  C     . GLY B  1 102 ? 12.801  -13.360 19.304  1.00 42.49 ? 1075 GLY B C     1 
ATOM   2899  O  O     . GLY B  1 102 ? 13.171  -12.271 18.856  1.00 43.47 ? 1075 GLY B O     1 
ATOM   2900  N  N     . PHE B  1 103 ? 11.726  -14.007 18.851  1.00 41.02 ? 1076 PHE B N     1 
ATOM   2901  C  CA    . PHE B  1 103 ? 11.001  -13.579 17.650  1.00 34.75 ? 1076 PHE B CA    1 
ATOM   2902  C  C     . PHE B  1 103 ? 9.478   -13.696 17.784  1.00 33.15 ? 1076 PHE B C     1 
ATOM   2903  O  O     . PHE B  1 103 ? 8.971   -14.458 18.602  1.00 30.65 ? 1076 PHE B O     1 
ATOM   2904  C  CB    . PHE B  1 103 ? 11.458  -14.407 16.437  1.00 33.78 ? 1076 PHE B CB    1 
ATOM   2905  C  CG    . PHE B  1 103 ? 12.819  -14.030 15.897  1.00 37.92 ? 1076 PHE B CG    1 
ATOM   2906  C  CD1   . PHE B  1 103 ? 12.931  -13.266 14.738  1.00 38.85 ? 1076 PHE B CD1   1 
ATOM   2907  C  CD2   . PHE B  1 103 ? 13.985  -14.469 16.518  1.00 43.79 ? 1076 PHE B CD2   1 
ATOM   2908  C  CE1   . PHE B  1 103 ? 14.181  -12.927 14.217  1.00 41.83 ? 1076 PHE B CE1   1 
ATOM   2909  C  CE2   . PHE B  1 103 ? 15.243  -14.132 16.009  1.00 44.69 ? 1076 PHE B CE2   1 
ATOM   2910  C  CZ    . PHE B  1 103 ? 15.341  -13.357 14.861  1.00 38.98 ? 1076 PHE B CZ    1 
ATOM   2911  N  N     . PHE B  1 104 ? 8.764   -12.901 16.989  1.00 34.14 ? 1077 PHE B N     1 
ATOM   2912  C  CA    . PHE B  1 104 ? 7.384   -13.190 16.625  1.00 31.13 ? 1077 PHE B CA    1 
ATOM   2913  C  C     . PHE B  1 104 ? 7.456   -13.791 15.234  1.00 31.30 ? 1077 PHE B C     1 
ATOM   2914  O  O     . PHE B  1 104 ? 8.324   -13.405 14.439  1.00 30.98 ? 1077 PHE B O     1 
ATOM   2915  C  CB    . PHE B  1 104 ? 6.547   -11.911 16.505  1.00 34.31 ? 1077 PHE B CB    1 
ATOM   2916  C  CG    . PHE B  1 104 ? 6.334   -11.171 17.794  1.00 30.02 ? 1077 PHE B CG    1 
ATOM   2917  C  CD1   . PHE B  1 104 ? 7.036   -10.005 18.057  1.00 32.50 ? 1077 PHE B CD1   1 
ATOM   2918  C  CD2   . PHE B  1 104 ? 5.384   -11.602 18.715  1.00 36.90 ? 1077 PHE B CD2   1 
ATOM   2919  C  CE1   . PHE B  1 104 ? 6.820   -9.292  19.235  1.00 32.35 ? 1077 PHE B CE1   1 
ATOM   2920  C  CE2   . PHE B  1 104 ? 5.165   -10.899 19.898  1.00 32.91 ? 1077 PHE B CE2   1 
ATOM   2921  C  CZ    . PHE B  1 104 ? 5.883   -9.745  20.157  1.00 32.78 ? 1077 PHE B CZ    1 
ATOM   2922  N  N     . GLN B  1 105 ? 6.555   -14.729 14.944  1.00 26.90 ? 1078 GLN B N     1 
ATOM   2923  C  CA    . GLN B  1 105 ? 6.335   -15.209 13.584  1.00 27.52 ? 1078 GLN B CA    1 
ATOM   2924  C  C     . GLN B  1 105 ? 4.931   -14.801 13.137  1.00 30.63 ? 1078 GLN B C     1 
ATOM   2925  O  O     . GLN B  1 105 ? 3.919   -15.323 13.645  1.00 26.58 ? 1078 GLN B O     1 
ATOM   2926  C  CB    . GLN B  1 105 ? 6.508   -16.737 13.463  1.00 29.30 ? 1078 GLN B CB    1 
ATOM   2927  C  CG    . GLN B  1 105 ? 7.897   -17.276 13.809  1.00 23.62 ? 1078 GLN B CG    1 
ATOM   2928  C  CD    . GLN B  1 105 ? 8.091   -17.490 15.302  1.00 33.72 ? 1078 GLN B CD    1 
ATOM   2929  O  OE1   . GLN B  1 105 ? 9.220   -17.520 15.802  1.00 32.32 ? 1078 GLN B OE1   1 
ATOM   2930  N  NE2   . GLN B  1 105 ? 6.989   -17.643 16.022  1.00 33.59 ? 1078 GLN B NE2   1 
ATOM   2931  N  N     . LEU B  1 106 ? 4.876   -13.858 12.195  1.00 25.56 ? 1079 LEU B N     1 
ATOM   2932  C  CA    . LEU B  1 106 ? 3.617   -13.406 11.640  1.00 23.15 ? 1079 LEU B CA    1 
ATOM   2933  C  C     . LEU B  1 106 ? 3.308   -14.210 10.381  1.00 24.26 ? 1079 LEU B C     1 
ATOM   2934  O  O     . LEU B  1 106 ? 3.904   -13.987 9.330   1.00 24.06 ? 1079 LEU B O     1 
ATOM   2935  C  CB    . LEU B  1 106 ? 3.674   -11.898 11.365  1.00 24.15 ? 1079 LEU B CB    1 
ATOM   2936  C  CG    . LEU B  1 106 ? 2.489   -11.078 10.826  1.00 29.28 ? 1079 LEU B CG    1 
ATOM   2937  C  CD1   . LEU B  1 106 ? 1.233   -11.095 11.735  1.00 27.28 ? 1079 LEU B CD1   1 
ATOM   2938  C  CD2   . LEU B  1 106 ? 2.966   -9.648  10.602  1.00 29.91 ? 1079 LEU B CD2   1 
ATOM   2939  N  N     . VAL B  1 107 ? 2.385   -15.161 10.497  1.00 22.74 ? 1080 VAL B N     1 
ATOM   2940  C  CA    . VAL B  1 107 ? 2.030   -16.020 9.365   1.00 25.76 ? 1080 VAL B CA    1 
ATOM   2941  C  C     . VAL B  1 107 ? 0.764   -15.495 8.688   1.00 26.81 ? 1080 VAL B C     1 
ATOM   2942  O  O     . VAL B  1 107 ? -0.245  -15.233 9.339   1.00 25.34 ? 1080 VAL B O     1 
ATOM   2943  C  CB    . VAL B  1 107 ? 1.953   -17.535 9.758   1.00 28.18 ? 1080 VAL B CB    1 
ATOM   2944  C  CG1   . VAL B  1 107 ? 1.737   -18.421 8.528   1.00 27.56 ? 1080 VAL B CG1   1 
ATOM   2945  C  CG2   . VAL B  1 107 ? 3.232   -17.968 10.463  1.00 26.59 ? 1080 VAL B CG2   1 
ATOM   2946  N  N     . MET B  1 108 ? 0.860   -15.307 7.374   1.00 27.45 ? 1081 MET B N     1 
ATOM   2947  C  CA    . MET B  1 108 ? -0.187  -14.686 6.574   1.00 24.40 ? 1081 MET B CA    1 
ATOM   2948  C  C     . MET B  1 108 ? -0.535  -15.590 5.401   1.00 24.06 ? 1081 MET B C     1 
ATOM   2949  O  O     . MET B  1 108 ? 0.298   -16.394 4.962   1.00 23.49 ? 1081 MET B O     1 
ATOM   2950  C  CB    . MET B  1 108 ? 0.295   -13.343 6.007   1.00 21.83 ? 1081 MET B CB    1 
ATOM   2951  C  CG    . MET B  1 108 ? 0.480   -12.209 7.010   1.00 30.29 ? 1081 MET B CG    1 
ATOM   2952  S  SD    . MET B  1 108 ? 1.568   -10.929 6.322   1.00 28.46 ? 1081 MET B SD    1 
ATOM   2953  C  CE    . MET B  1 108 ? 3.182   -11.566 6.807   1.00 29.20 ? 1081 MET B CE    1 
ATOM   2954  N  N     . GLU B  1 109 ? -1.758  -15.454 4.885   1.00 19.52 ? 1082 GLU B N     1 
ATOM   2955  C  CA    . GLU B  1 109 ? -2.081  -16.045 3.596   1.00 26.46 ? 1082 GLU B CA    1 
ATOM   2956  C  C     . GLU B  1 109 ? -1.060  -15.521 2.568   1.00 28.57 ? 1082 GLU B C     1 
ATOM   2957  O  O     . GLU B  1 109 ? -0.614  -14.365 2.645   1.00 27.76 ? 1082 GLU B O     1 
ATOM   2958  C  CB    . GLU B  1 109 ? -3.500  -15.660 3.153   1.00 24.28 ? 1082 GLU B CB    1 
ATOM   2959  C  CG    . GLU B  1 109 ? -3.565  -14.265 2.537   1.00 25.10 ? 1082 GLU B CG    1 
ATOM   2960  C  CD    . GLU B  1 109 ? -4.927  -13.857 2.041   1.00 28.21 ? 1082 GLU B CD    1 
ATOM   2961  O  OE1   . GLU B  1 109 ? -5.499  -14.574 1.191   1.00 38.52 ? 1082 GLU B OE1   1 
ATOM   2962  O  OE2   . GLU B  1 109 ? -5.404  -12.787 2.479   1.00 29.03 ? 1082 GLU B OE2   1 
ATOM   2963  N  N     . LYS B  1 110 ? -0.677  -16.381 1.631   1.00 27.31 ? 1083 LYS B N     1 
ATOM   2964  C  CA    . LYS B  1 110 ? 0.093   -15.944 0.487   1.00 29.18 ? 1083 LYS B CA    1 
ATOM   2965  C  C     . LYS B  1 110 ? -0.864  -15.546 -0.626  1.00 29.74 ? 1083 LYS B C     1 
ATOM   2966  O  O     . LYS B  1 110 ? -1.593  -16.377 -1.162  1.00 27.52 ? 1083 LYS B O     1 
ATOM   2967  C  CB    . LYS B  1 110 ? 1.070   -17.019 0.012   1.00 22.88 ? 1083 LYS B CB    1 
ATOM   2968  C  CG    . LYS B  1 110 ? 1.929   -16.569 -1.163  1.00 25.50 ? 1083 LYS B CG    1 
ATOM   2969  C  CD    . LYS B  1 110 ? 3.233   -17.318 -1.223  1.00 19.46 ? 1083 LYS B CD    1 
ATOM   2970  C  CE    . LYS B  1 110 ? 3.889   -17.129 -2.577  1.00 27.37 ? 1083 LYS B CE    1 
ATOM   2971  N  NZ    . LYS B  1 110 ? 5.173   -17.855 -2.682  1.00 14.22 ? 1083 LYS B NZ    1 
ATOM   2972  N  N     . HIS B  1 111 ? -0.857  -14.260 -0.957  1.00 31.42 ? 1084 HIS B N     1 
ATOM   2973  C  CA    . HIS B  1 111 ? -1.698  -13.751 -2.018  1.00 29.33 ? 1084 HIS B CA    1 
ATOM   2974  C  C     . HIS B  1 111 ? -0.938  -13.737 -3.336  1.00 32.34 ? 1084 HIS B C     1 
ATOM   2975  O  O     . HIS B  1 111 ? 0.010   -12.968 -3.514  1.00 36.73 ? 1084 HIS B O     1 
ATOM   2976  C  CB    . HIS B  1 111 ? -2.266  -12.370 -1.671  1.00 23.13 ? 1084 HIS B CB    1 
ATOM   2977  C  CG    . HIS B  1 111 ? -3.345  -11.926 -2.608  1.00 30.63 ? 1084 HIS B CG    1 
ATOM   2978  N  ND1   . HIS B  1 111 ? -4.552  -12.585 -2.713  1.00 29.43 ? 1084 HIS B ND1   1 
ATOM   2979  C  CD2   . HIS B  1 111 ? -3.379  -10.927 -3.521  1.00 18.22 ? 1084 HIS B CD2   1 
ATOM   2980  C  CE1   . HIS B  1 111 ? -5.292  -11.995 -3.634  1.00 28.94 ? 1084 HIS B CE1   1 
ATOM   2981  N  NE2   . HIS B  1 111 ? -4.602  -10.989 -4.141  1.00 21.13 ? 1084 HIS B NE2   1 
ATOM   2982  N  N     . GLY B  1 112 ? -1.363  -14.603 -4.250  1.00 34.12 ? 1085 GLY B N     1 
ATOM   2983  C  CA    . GLY B  1 112 ? -0.697  -14.777 -5.532  1.00 35.35 ? 1085 GLY B CA    1 
ATOM   2984  C  C     . GLY B  1 112 ? 0.617   -15.535 -5.431  1.00 38.81 ? 1085 GLY B C     1 
ATOM   2985  O  O     . GLY B  1 112 ? 0.747   -16.486 -4.653  1.00 39.44 ? 1085 GLY B O     1 
ATOM   2986  N  N     . SER B  1 113 ? 1.591   -15.107 -6.230  1.00 37.84 ? 1086 SER B N     1 
ATOM   2987  C  CA    . SER B  1 113 ? 2.927   -15.694 -6.232  1.00 37.15 ? 1086 SER B CA    1 
ATOM   2988  C  C     . SER B  1 113 ? 3.903   -14.881 -5.375  1.00 35.97 ? 1086 SER B C     1 
ATOM   2989  O  O     . SER B  1 113 ? 5.115   -15.078 -5.447  1.00 37.79 ? 1086 SER B O     1 
ATOM   2990  C  CB    . SER B  1 113 ? 3.445   -15.794 -7.669  1.00 38.77 ? 1086 SER B CB    1 
ATOM   2991  O  OG    . SER B  1 113 ? 3.574   -14.505 -8.261  1.00 37.75 ? 1086 SER B OG    1 
ATOM   2992  N  N     . GLY B  1 114 ? 3.370   -13.977 -4.555  1.00 34.68 ? 1087 GLY B N     1 
ATOM   2993  C  CA    . GLY B  1 114 ? 4.201   -13.079 -3.770  1.00 33.36 ? 1087 GLY B CA    1 
ATOM   2994  C  C     . GLY B  1 114 ? 4.679   -11.898 -4.593  1.00 36.89 ? 1087 GLY B C     1 
ATOM   2995  O  O     . GLY B  1 114 ? 5.679   -11.257 -4.250  1.00 38.49 ? 1087 GLY B O     1 
ATOM   2996  N  N     . LEU B  1 115 ? 3.954   -11.611 -5.675  1.00 33.80 ? 1088 LEU B N     1 
ATOM   2997  C  CA    . LEU B  1 115 ? 4.302   -10.528 -6.592  1.00 33.09 ? 1088 LEU B CA    1 
ATOM   2998  C  C     . LEU B  1 115 ? 3.708   -9.199  -6.123  1.00 28.94 ? 1088 LEU B C     1 
ATOM   2999  O  O     . LEU B  1 115 ? 2.487   -9.051  -6.020  1.00 28.19 ? 1088 LEU B O     1 
ATOM   3000  C  CB    . LEU B  1 115 ? 3.820   -10.861 -8.013  1.00 31.03 ? 1088 LEU B CB    1 
ATOM   3001  C  CG    . LEU B  1 115 ? 4.087   -9.884  -9.163  1.00 33.40 ? 1088 LEU B CG    1 
ATOM   3002  C  CD1   . LEU B  1 115 ? 5.483   -10.087 -9.729  1.00 40.90 ? 1088 LEU B CD1   1 
ATOM   3003  C  CD2   . LEU B  1 115 ? 3.043   -10.054 -10.257 1.00 29.98 ? 1088 LEU B CD2   1 
ATOM   3004  N  N     . ASP B  1 116 ? 4.569   -8.230  -5.841  1.00 25.38 ? 1089 ASP B N     1 
ATOM   3005  C  CA    . ASP B  1 116 ? 4.071   -6.907  -5.470  1.00 29.41 ? 1089 ASP B CA    1 
ATOM   3006  C  C     . ASP B  1 116 ? 3.828   -6.063  -6.714  1.00 30.08 ? 1089 ASP B C     1 
ATOM   3007  O  O     . ASP B  1 116 ? 4.220   -6.445  -7.820  1.00 28.06 ? 1089 ASP B O     1 
ATOM   3008  C  CB    . ASP B  1 116 ? 4.951   -6.198  -4.417  1.00 24.82 ? 1089 ASP B CB    1 
ATOM   3009  C  CG    . ASP B  1 116 ? 6.390   -6.026  -4.854  1.00 33.19 ? 1089 ASP B CG    1 
ATOM   3010  O  OD1   . ASP B  1 116 ? 6.656   -5.180  -5.731  1.00 26.93 ? 1089 ASP B OD1   1 
ATOM   3011  O  OD2   . ASP B  1 116 ? 7.269   -6.721  -4.294  1.00 40.46 ? 1089 ASP B OD2   1 
ATOM   3012  N  N     . LEU B  1 117 ? 3.151   -4.935  -6.528  1.00 32.20 ? 1090 LEU B N     1 
ATOM   3013  C  CA    . LEU B  1 117 ? 2.820   -4.053  -7.630  1.00 31.62 ? 1090 LEU B CA    1 
ATOM   3014  C  C     . LEU B  1 117 ? 4.069   -3.391  -8.221  1.00 31.24 ? 1090 LEU B C     1 
ATOM   3015  O  O     . LEU B  1 117 ? 4.078   -3.026  -9.399  1.00 30.03 ? 1090 LEU B O     1 
ATOM   3016  C  CB    . LEU B  1 117 ? 1.788   -3.012  -7.188  1.00 31.95 ? 1090 LEU B CB    1 
ATOM   3017  C  CG    . LEU B  1 117 ? 0.591   -2.817  -8.112  1.00 28.47 ? 1090 LEU B CG    1 
ATOM   3018  C  CD1   . LEU B  1 117 ? -0.282  -4.070  -8.119  1.00 30.77 ? 1090 LEU B CD1   1 
ATOM   3019  C  CD2   . LEU B  1 117 ? -0.207  -1.611  -7.678  1.00 34.62 ? 1090 LEU B CD2   1 
ATOM   3020  N  N     . PHE B  1 118 ? 5.118   -3.244  -7.410  1.00 29.14 ? 1091 PHE B N     1 
ATOM   3021  C  CA    . PHE B  1 118 ? 6.401   -2.744  -7.909  1.00 27.76 ? 1091 PHE B CA    1 
ATOM   3022  C  C     . PHE B  1 118 ? 7.019   -3.715  -8.916  1.00 28.76 ? 1091 PHE B C     1 
ATOM   3023  O  O     . PHE B  1 118 ? 7.444   -3.300  -9.996  1.00 30.04 ? 1091 PHE B O     1 
ATOM   3024  C  CB    . PHE B  1 118 ? 7.380   -2.439  -6.766  1.00 28.93 ? 1091 PHE B CB    1 
ATOM   3025  C  CG    . PHE B  1 118 ? 8.656   -1.774  -7.225  1.00 36.42 ? 1091 PHE B CG    1 
ATOM   3026  C  CD1   . PHE B  1 118 ? 9.700   -2.527  -7.767  1.00 37.58 ? 1091 PHE B CD1   1 
ATOM   3027  C  CD2   . PHE B  1 118 ? 8.804   -0.394  -7.137  1.00 37.81 ? 1091 PHE B CD2   1 
ATOM   3028  C  CE1   . PHE B  1 118 ? 10.870  -1.917  -8.203  1.00 45.01 ? 1091 PHE B CE1   1 
ATOM   3029  C  CE2   . PHE B  1 118 ? 9.972   0.227   -7.574  1.00 42.50 ? 1091 PHE B CE2   1 
ATOM   3030  C  CZ    . PHE B  1 118 ? 11.007  -0.538  -8.107  1.00 42.46 ? 1091 PHE B CZ    1 
ATOM   3031  N  N     . ALA B  1 119 ? 7.052   -5.004  -8.569  1.00 30.27 ? 1092 ALA B N     1 
ATOM   3032  C  CA    . ALA B  1 119 ? 7.549   -6.036  -9.484  1.00 32.49 ? 1092 ALA B CA    1 
ATOM   3033  C  C     . ALA B  1 119 ? 6.610   -6.266  -10.677 1.00 33.94 ? 1092 ALA B C     1 
ATOM   3034  O  O     . ALA B  1 119 ? 7.059   -6.677  -11.741 1.00 36.54 ? 1092 ALA B O     1 
ATOM   3035  C  CB    . ALA B  1 119 ? 7.828   -7.354  -8.732  1.00 30.83 ? 1092 ALA B CB    1 
ATOM   3036  N  N     . PHE B  1 120 ? 5.315   -6.001  -10.483 1.00 34.87 ? 1093 PHE B N     1 
ATOM   3037  C  CA    . PHE B  1 120 ? 4.303   -6.037  -11.547 1.00 33.40 ? 1093 PHE B CA    1 
ATOM   3038  C  C     . PHE B  1 120 ? 4.546   -4.916  -12.570 1.00 35.67 ? 1093 PHE B C     1 
ATOM   3039  O  O     . PHE B  1 120 ? 4.567   -5.168  -13.776 1.00 36.17 ? 1093 PHE B O     1 
ATOM   3040  C  CB    . PHE B  1 120 ? 2.894   -5.937  -10.933 1.00 33.32 ? 1093 PHE B CB    1 
ATOM   3041  C  CG    . PHE B  1 120 ? 1.756   -5.945  -11.944 1.00 38.89 ? 1093 PHE B CG    1 
ATOM   3042  C  CD1   . PHE B  1 120 ? 1.388   -7.125  -12.609 1.00 32.96 ? 1093 PHE B CD1   1 
ATOM   3043  C  CD2   . PHE B  1 120 ? 1.024   -4.783  -12.197 1.00 36.95 ? 1093 PHE B CD2   1 
ATOM   3044  C  CE1   . PHE B  1 120 ? 0.329   -7.142  -13.532 1.00 22.54 ? 1093 PHE B CE1   1 
ATOM   3045  C  CE2   . PHE B  1 120 ? -0.038  -4.790  -13.120 1.00 35.97 ? 1093 PHE B CE2   1 
ATOM   3046  C  CZ    . PHE B  1 120 ? -0.386  -5.974  -13.783 1.00 31.42 ? 1093 PHE B CZ    1 
ATOM   3047  N  N     . ILE B  1 121 ? 4.739   -3.693  -12.069 1.00 37.82 ? 1094 ILE B N     1 
ATOM   3048  C  CA    . ILE B  1 121 ? 5.074   -2.506  -12.877 1.00 32.90 ? 1094 ILE B CA    1 
ATOM   3049  C  C     . ILE B  1 121 ? 6.457   -2.630  -13.543 1.00 34.78 ? 1094 ILE B C     1 
ATOM   3050  O  O     . ILE B  1 121 ? 6.656   -2.174  -14.668 1.00 37.68 ? 1094 ILE B O     1 
ATOM   3051  C  CB    . ILE B  1 121 ? 4.923   -1.194  -12.030 1.00 37.13 ? 1094 ILE B CB    1 
ATOM   3052  C  CG1   . ILE B  1 121 ? 3.439   -0.967  -11.670 1.00 34.10 ? 1094 ILE B CG1   1 
ATOM   3053  C  CG2   . ILE B  1 121 ? 5.500   0.022   -12.761 1.00 33.23 ? 1094 ILE B CG2   1 
ATOM   3054  C  CD1   . ILE B  1 121 ? 3.161   -0.024  -10.491 1.00 24.93 ? 1094 ILE B CD1   1 
ATOM   3055  N  N     . ASP B  1 122 ? 7.386   -3.293  -12.862 1.00 39.62 ? 1095 ASP B N     1 
ATOM   3056  C  CA    . ASP B  1 122 ? 8.751   -3.486  -13.357 1.00 44.47 ? 1095 ASP B CA    1 
ATOM   3057  C  C     . ASP B  1 122 ? 8.817   -4.358  -14.615 1.00 46.40 ? 1095 ASP B C     1 
ATOM   3058  O  O     . ASP B  1 122 ? 9.679   -4.154  -15.467 1.00 47.24 ? 1095 ASP B O     1 
ATOM   3059  C  CB    . ASP B  1 122 ? 9.623   -4.106  -12.259 1.00 45.55 ? 1095 ASP B CB    1 
ATOM   3060  C  CG    . ASP B  1 122 ? 11.075  -3.682  -12.350 1.00 48.89 ? 1095 ASP B CG    1 
ATOM   3061  O  OD1   . ASP B  1 122 ? 11.341  -2.490  -12.610 1.00 45.29 ? 1095 ASP B OD1   1 
ATOM   3062  O  OD2   . ASP B  1 122 ? 11.956  -4.540  -12.138 1.00 52.08 ? 1095 ASP B OD2   1 
ATOM   3063  N  N     . ARG B  1 123 ? 7.903   -5.321  -14.719 1.00 46.71 ? 1096 ARG B N     1 
ATOM   3064  C  CA    . ARG B  1 123 ? 7.865   -6.273  -15.833 1.00 46.54 ? 1096 ARG B CA    1 
ATOM   3065  C  C     . ARG B  1 123 ? 7.069   -5.769  -17.046 1.00 45.57 ? 1096 ARG B C     1 
ATOM   3066  O  O     . ARG B  1 123 ? 6.747   -6.547  -17.948 1.00 48.24 ? 1096 ARG B O     1 
ATOM   3067  C  CB    . ARG B  1 123 ? 7.299   -7.610  -15.346 1.00 48.01 ? 1096 ARG B CB    1 
ATOM   3068  C  CG    . ARG B  1 123 ? 8.254   -8.445  -14.496 1.00 47.26 ? 1096 ARG B CG    1 
ATOM   3069  C  CD    . ARG B  1 123 ? 8.769   -9.652  -15.275 1.00 58.07 ? 1096 ARG B CD    1 
ATOM   3070  N  NE    . ARG B  1 123 ? 7.779   -10.732 -15.326 1.00 64.63 ? 1096 ARG B NE    1 
ATOM   3071  C  CZ    . ARG B  1 123 ? 7.870   -11.819 -16.094 1.00 67.64 ? 1096 ARG B CZ    1 
ATOM   3072  N  NH1   . ARG B  1 123 ? 8.911   -11.993 -16.900 1.00 64.62 ? 1096 ARG B NH1   1 
ATOM   3073  N  NH2   . ARG B  1 123 ? 6.909   -12.735 -16.058 1.00 65.16 ? 1096 ARG B NH2   1 
ATOM   3074  N  N     . HIS B  1 124 ? 6.756   -4.470  -17.043 1.00 46.69 ? 1097 HIS B N     1 
ATOM   3075  C  CA    . HIS B  1 124 ? 6.062   -3.756  -18.137 1.00 42.98 ? 1097 HIS B CA    1 
ATOM   3076  C  C     . HIS B  1 124 ? 4.664   -4.291  -18.484 1.00 38.38 ? 1097 HIS B C     1 
ATOM   3077  O  O     . HIS B  1 124 ? 4.436   -4.772  -19.600 1.00 36.60 ? 1097 HIS B O     1 
ATOM   3078  C  CB    . HIS B  1 124 ? 6.947   -3.666  -19.389 1.00 48.99 ? 1097 HIS B CB    1 
ATOM   3079  C  CG    . HIS B  1 124 ? 8.349   -3.232  -19.103 1.00 51.61 ? 1097 HIS B CG    1 
ATOM   3080  N  ND1   . HIS B  1 124 ? 8.764   -1.924  -19.233 1.00 57.37 ? 1097 HIS B ND1   1 
ATOM   3081  C  CD2   . HIS B  1 124 ? 9.430   -3.930  -18.681 1.00 56.80 ? 1097 HIS B CD2   1 
ATOM   3082  C  CE1   . HIS B  1 124 ? 10.041  -1.836  -18.909 1.00 63.62 ? 1097 HIS B CE1   1 
ATOM   3083  N  NE2   . HIS B  1 124 ? 10.468  -3.038  -18.565 1.00 61.61 ? 1097 HIS B NE2   1 
ATOM   3084  N  N     . PRO B  1 125 ? 3.715   -4.175  -17.539 1.00 32.71 ? 1098 PRO B N     1 
ATOM   3085  C  CA    . PRO B  1 125 ? 2.375   -4.729  -17.748 1.00 35.76 ? 1098 PRO B CA    1 
ATOM   3086  C  C     . PRO B  1 125 ? 1.549   -3.960  -18.782 1.00 34.94 ? 1098 PRO B C     1 
ATOM   3087  O  O     . PRO B  1 125 ? 1.753   -2.759  -18.994 1.00 34.74 ? 1098 PRO B O     1 
ATOM   3088  C  CB    . PRO B  1 125 ? 1.728   -4.633  -16.365 1.00 35.66 ? 1098 PRO B CB    1 
ATOM   3089  C  CG    . PRO B  1 125 ? 2.443   -3.538  -15.687 1.00 38.06 ? 1098 PRO B CG    1 
ATOM   3090  C  CD    . PRO B  1 125 ? 3.839   -3.503  -16.233 1.00 29.60 ? 1098 PRO B CD    1 
ATOM   3091  N  N     . ARG B  1 126 ? 0.624   -4.661  -19.424 1.00 32.25 ? 1099 ARG B N     1 
ATOM   3092  C  CA    . ARG B  1 126 ? -0.189  -4.047  -20.458 1.00 30.66 ? 1099 ARG B CA    1 
ATOM   3093  C  C     . ARG B  1 126 ? -1.561  -3.653  -19.930 1.00 28.18 ? 1099 ARG B C     1 
ATOM   3094  O  O     . ARG B  1 126 ? -2.538  -4.380  -20.091 1.00 33.87 ? 1099 ARG B O     1 
ATOM   3095  C  CB    . ARG B  1 126 ? -0.278  -4.950  -21.694 1.00 29.77 ? 1099 ARG B CB    1 
ATOM   3096  C  CG    . ARG B  1 126 ? 0.984   -4.927  -22.541 1.00 13.37 ? 1099 ARG B CG    1 
ATOM   3097  C  CD    . ARG B  1 126 ? 0.877   -5.919  -23.684 1.00 26.62 ? 1099 ARG B CD    1 
ATOM   3098  N  NE    . ARG B  1 126 ? 2.114   -5.988  -24.459 1.00 26.17 ? 1099 ARG B NE    1 
ATOM   3099  C  CZ    . ARG B  1 126 ? 2.176   -6.244  -25.764 1.00 18.73 ? 1099 ARG B CZ    1 
ATOM   3100  N  NH1   . ARG B  1 126 ? 1.070   -6.469  -26.470 1.00 19.97 ? 1099 ARG B NH1   1 
ATOM   3101  N  NH2   . ARG B  1 126 ? 3.352   -6.257  -26.366 1.00 21.75 ? 1099 ARG B NH2   1 
ATOM   3102  N  N     . LEU B  1 127 ? -1.622  -2.483  -19.302 1.00 28.73 ? 1100 LEU B N     1 
ATOM   3103  C  CA    . LEU B  1 127 ? -2.854  -2.020  -18.670 1.00 28.90 ? 1100 LEU B CA    1 
ATOM   3104  C  C     . LEU B  1 127 ? -3.586  -0.970  -19.495 1.00 26.28 ? 1100 LEU B C     1 
ATOM   3105  O  O     . LEU B  1 127 ? -2.970  -0.081  -20.069 1.00 16.54 ? 1100 LEU B O     1 
ATOM   3106  C  CB    . LEU B  1 127 ? -2.559  -1.461  -17.267 1.00 30.53 ? 1100 LEU B CB    1 
ATOM   3107  C  CG    . LEU B  1 127 ? -2.170  -2.439  -16.147 1.00 29.76 ? 1100 LEU B CG    1 
ATOM   3108  C  CD1   . LEU B  1 127 ? -1.774  -1.679  -14.896 1.00 25.05 ? 1100 LEU B CD1   1 
ATOM   3109  C  CD2   . LEU B  1 127 ? -3.328  -3.374  -15.841 1.00 24.08 ? 1100 LEU B CD2   1 
ATOM   3110  N  N     . ASP B  1 128 ? -4.911  -1.081  -19.544 1.00 29.47 ? 1101 ASP B N     1 
ATOM   3111  C  CA    . ASP B  1 128 ? -5.741  0.009   -20.036 1.00 24.42 ? 1101 ASP B CA    1 
ATOM   3112  C  C     . ASP B  1 128 ? -6.346  0.700   -18.834 1.00 25.67 ? 1101 ASP B C     1 
ATOM   3113  O  O     . ASP B  1 128 ? -6.122  0.275   -17.692 1.00 30.31 ? 1101 ASP B O     1 
ATOM   3114  C  CB    . ASP B  1 128 ? -6.827  -0.512  -20.981 1.00 27.07 ? 1101 ASP B CB    1 
ATOM   3115  C  CG    . ASP B  1 128 ? -7.782  -1.475  -20.312 1.00 22.92 ? 1101 ASP B CG    1 
ATOM   3116  O  OD1   . ASP B  1 128 ? -7.507  -1.926  -19.180 1.00 30.17 ? 1101 ASP B OD1   1 
ATOM   3117  O  OD2   . ASP B  1 128 ? -8.814  -1.788  -20.934 1.00 36.14 ? 1101 ASP B OD2   1 
ATOM   3118  N  N     . GLU B  1 129 ? -7.130  1.745   -19.071 1.00 25.88 ? 1102 GLU B N     1 
ATOM   3119  C  CA    . GLU B  1 129 ? -7.702  2.493   -17.964 1.00 24.25 ? 1102 GLU B CA    1 
ATOM   3120  C  C     . GLU B  1 129 ? -8.701  1.705   -17.117 1.00 23.30 ? 1102 GLU B C     1 
ATOM   3121  O  O     . GLU B  1 129 ? -8.604  1.744   -15.891 1.00 22.51 ? 1102 GLU B O     1 
ATOM   3122  C  CB    . GLU B  1 129 ? -8.272  3.851   -18.420 1.00 26.98 ? 1102 GLU B CB    1 
ATOM   3123  C  CG    . GLU B  1 129 ? -7.187  4.870   -18.789 1.00 19.50 ? 1102 GLU B CG    1 
ATOM   3124  C  CD    . GLU B  1 129 ? -7.716  6.275   -18.995 1.00 24.99 ? 1102 GLU B CD    1 
ATOM   3125  O  OE1   . GLU B  1 129 ? -8.606  6.717   -18.241 1.00 27.65 ? 1102 GLU B OE1   1 
ATOM   3126  O  OE2   . GLU B  1 129 ? -7.232  6.948   -19.920 1.00 28.51 ? 1102 GLU B OE2   1 
ATOM   3127  N  N     . PRO B  1 130 ? -9.670  0.997   -17.751 1.00 27.91 ? 1103 PRO B N     1 
ATOM   3128  C  CA    . PRO B  1 130 ? -10.647 0.247   -16.937 1.00 26.59 ? 1103 PRO B CA    1 
ATOM   3129  C  C     . PRO B  1 130 ? -10.023 -0.741  -15.939 1.00 22.62 ? 1103 PRO B C     1 
ATOM   3130  O  O     . PRO B  1 130 ? -10.449 -0.780  -14.789 1.00 29.74 ? 1103 PRO B O     1 
ATOM   3131  C  CB    . PRO B  1 130 ? -11.495 -0.493  -17.984 1.00 25.75 ? 1103 PRO B CB    1 
ATOM   3132  C  CG    . PRO B  1 130 ? -11.366 0.325   -19.215 1.00 30.89 ? 1103 PRO B CG    1 
ATOM   3133  C  CD    . PRO B  1 130 ? -9.966  0.874   -19.195 1.00 28.87 ? 1103 PRO B CD    1 
ATOM   3134  N  N     . LEU B  1 131 ? -9.029  -1.515  -16.370 1.00 23.82 ? 1104 LEU B N     1 
ATOM   3135  C  CA    . LEU B  1 131 ? -8.366  -2.504  -15.501 1.00 27.18 ? 1104 LEU B CA    1 
ATOM   3136  C  C     . LEU B  1 131 ? -7.430  -1.872  -14.461 1.00 27.34 ? 1104 LEU B C     1 
ATOM   3137  O  O     . LEU B  1 131 ? -7.301  -2.386  -13.349 1.00 27.53 ? 1104 LEU B O     1 
ATOM   3138  C  CB    . LEU B  1 131 ? -7.613  -3.557  -16.330 1.00 26.44 ? 1104 LEU B CB    1 
ATOM   3139  C  CG    . LEU B  1 131 ? -6.766  -4.630  -15.616 1.00 25.38 ? 1104 LEU B CG    1 
ATOM   3140  C  CD1   . LEU B  1 131 ? -7.615  -5.628  -14.828 1.00 24.24 ? 1104 LEU B CD1   1 
ATOM   3141  C  CD2   . LEU B  1 131 ? -5.896  -5.357  -16.619 1.00 22.64 ? 1104 LEU B CD2   1 
ATOM   3142  N  N     . ALA B  1 132 ? -6.770  -0.776  -14.834 1.00 26.08 ? 1105 ALA B N     1 
ATOM   3143  C  CA    . ALA B  1 132 ? -5.998  0.031   -13.886 1.00 24.40 ? 1105 ALA B CA    1 
ATOM   3144  C  C     . ALA B  1 132 ? -6.937  0.557   -12.796 1.00 24.84 ? 1105 ALA B C     1 
ATOM   3145  O  O     . ALA B  1 132 ? -6.597  0.574   -11.613 1.00 29.12 ? 1105 ALA B O     1 
ATOM   3146  C  CB    . ALA B  1 132 ? -5.302  1.190   -14.621 1.00 16.84 ? 1105 ALA B CB    1 
ATOM   3147  N  N     . SER B  1 133 ? -8.130  0.966   -13.219 1.00 23.19 ? 1106 SER B N     1 
ATOM   3148  C  CA    . SER B  1 133 ? -9.210  1.399   -12.332 1.00 24.70 ? 1106 SER B CA    1 
ATOM   3149  C  C     . SER B  1 133 ? -9.716  0.282   -11.419 1.00 22.93 ? 1106 SER B C     1 
ATOM   3150  O  O     . SER B  1 133 ? -10.066 0.524   -10.261 1.00 24.36 ? 1106 SER B O     1 
ATOM   3151  C  CB    . SER B  1 133 ? -10.359 1.963   -13.177 1.00 27.24 ? 1106 SER B CB    1 
ATOM   3152  O  OG    . SER B  1 133 ? -11.489 2.272   -12.393 1.00 40.66 ? 1106 SER B OG    1 
ATOM   3153  N  N     . TYR B  1 134 ? -9.767  -0.938  -11.947 1.00 26.63 ? 1107 TYR B N     1 
ATOM   3154  C  CA    . TYR B  1 134 ? -10.170 -2.099  -11.155 1.00 27.53 ? 1107 TYR B CA    1 
ATOM   3155  C  C     . TYR B  1 134 ? -9.194  -2.355  -10.001 1.00 24.44 ? 1107 TYR B C     1 
ATOM   3156  O  O     . TYR B  1 134 ? -9.607  -2.579  -8.868  1.00 26.76 ? 1107 TYR B O     1 
ATOM   3157  C  CB    . TYR B  1 134 ? -10.323 -3.353  -12.037 1.00 26.27 ? 1107 TYR B CB    1 
ATOM   3158  C  CG    . TYR B  1 134 ? -10.592 -4.590  -11.218 1.00 33.45 ? 1107 TYR B CG    1 
ATOM   3159  C  CD1   . TYR B  1 134 ? -11.762 -4.706  -10.464 1.00 34.82 ? 1107 TYR B CD1   1 
ATOM   3160  C  CD2   . TYR B  1 134 ? -9.662  -5.629  -11.160 1.00 28.93 ? 1107 TYR B CD2   1 
ATOM   3161  C  CE1   . TYR B  1 134 ? -12.004 -5.828  -9.689  1.00 36.30 ? 1107 TYR B CE1   1 
ATOM   3162  C  CE2   . TYR B  1 134 ? -9.898  -6.754  -10.390 1.00 25.67 ? 1107 TYR B CE2   1 
ATOM   3163  C  CZ    . TYR B  1 134 ? -11.068 -6.845  -9.658  1.00 29.03 ? 1107 TYR B CZ    1 
ATOM   3164  O  OH    . TYR B  1 134 ? -11.308 -7.953  -8.886  1.00 36.82 ? 1107 TYR B OH    1 
ATOM   3165  N  N     . ILE B  1 135 ? -7.904  -2.315  -10.318 1.00 24.74 ? 1108 ILE B N     1 
ATOM   3166  C  CA    . ILE B  1 135 ? -6.819  -2.451  -9.347  1.00 25.84 ? 1108 ILE B CA    1 
ATOM   3167  C  C     . ILE B  1 135 ? -6.818  -1.320  -8.295  1.00 23.28 ? 1108 ILE B C     1 
ATOM   3168  O  O     . ILE B  1 135 ? -6.761  -1.584  -7.100  1.00 23.31 ? 1108 ILE B O     1 
ATOM   3169  C  CB    . ILE B  1 135 ? -5.430  -2.593  -10.085 1.00 24.89 ? 1108 ILE B CB    1 
ATOM   3170  C  CG1   . ILE B  1 135 ? -5.419  -3.862  -10.948 1.00 22.60 ? 1108 ILE B CG1   1 
ATOM   3171  C  CG2   . ILE B  1 135 ? -4.260  -2.588  -9.095  1.00 22.02 ? 1108 ILE B CG2   1 
ATOM   3172  C  CD1   . ILE B  1 135 ? -4.447  -3.862  -12.116 1.00 25.16 ? 1108 ILE B CD1   1 
ATOM   3173  N  N     . PHE B  1 136 ? -6.901  -0.072  -8.743  1.00 25.07 ? 1109 PHE B N     1 
ATOM   3174  C  CA    . PHE B  1 136 ? -6.865  1.091   -7.845  1.00 24.59 ? 1109 PHE B CA    1 
ATOM   3175  C  C     . PHE B  1 136 ? -8.062  1.178   -6.888  1.00 23.77 ? 1109 PHE B C     1 
ATOM   3176  O  O     . PHE B  1 136 ? -7.904  1.556   -5.725  1.00 27.00 ? 1109 PHE B O     1 
ATOM   3177  C  CB    . PHE B  1 136 ? -6.741  2.384   -8.677  1.00 27.42 ? 1109 PHE B CB    1 
ATOM   3178  C  CG    . PHE B  1 136 ? -6.532  3.638   -7.861  1.00 27.72 ? 1109 PHE B CG    1 
ATOM   3179  C  CD1   . PHE B  1 136 ? -5.352  3.841   -7.141  1.00 30.51 ? 1109 PHE B CD1   1 
ATOM   3180  C  CD2   . PHE B  1 136 ? -7.501  4.639   -7.849  1.00 31.87 ? 1109 PHE B CD2   1 
ATOM   3181  C  CE1   . PHE B  1 136 ? -5.158  5.013   -6.402  1.00 27.10 ? 1109 PHE B CE1   1 
ATOM   3182  C  CE2   . PHE B  1 136 ? -7.310  5.818   -7.117  1.00 19.28 ? 1109 PHE B CE2   1 
ATOM   3183  C  CZ    . PHE B  1 136 ? -6.141  6.002   -6.393  1.00 13.12 ? 1109 PHE B CZ    1 
ATOM   3184  N  N     . ARG B  1 137 ? -9.255  0.837   -7.369  1.00 24.85 ? 1110 ARG B N     1 
ATOM   3185  C  CA    . ARG B  1 137 ? -10.470 0.936   -6.542  1.00 23.39 ? 1110 ARG B CA    1 
ATOM   3186  C  C     . ARG B  1 137 ? -10.453 -0.020  -5.340  1.00 18.35 ? 1110 ARG B C     1 
ATOM   3187  O  O     . ARG B  1 137 ? -11.063 0.266   -4.304  1.00 20.38 ? 1110 ARG B O     1 
ATOM   3188  C  CB    . ARG B  1 137 ? -11.753 0.791   -7.387  1.00 23.68 ? 1110 ARG B CB    1 
ATOM   3189  C  CG    . ARG B  1 137 ? -12.131 -0.645  -7.784  1.00 32.78 ? 1110 ARG B CG    1 
ATOM   3190  C  CD    . ARG B  1 137 ? -13.305 -0.689  -8.760  1.00 25.00 ? 1110 ARG B CD    1 
ATOM   3191  N  NE    . ARG B  1 137 ? -12.939 -0.211  -10.092 1.00 26.57 ? 1110 ARG B NE    1 
ATOM   3192  C  CZ    . ARG B  1 137 ? -13.810 0.047   -11.068 1.00 40.13 ? 1110 ARG B CZ    1 
ATOM   3193  N  NH1   . ARG B  1 137 ? -15.112 -0.132  -10.869 1.00 30.34 ? 1110 ARG B NH1   1 
ATOM   3194  N  NH2   . ARG B  1 137 ? -13.381 0.491   -12.250 1.00 26.50 ? 1110 ARG B NH2   1 
ATOM   3195  N  N     . GLN B  1 138 ? -9.725  -1.127  -5.470  1.00 17.77 ? 1111 GLN B N     1 
ATOM   3196  C  CA    . GLN B  1 138 ? -9.516  -2.072  -4.363  1.00 18.87 ? 1111 GLN B CA    1 
ATOM   3197  C  C     . GLN B  1 138 ? -8.613  -1.530  -3.252  1.00 19.33 ? 1111 GLN B C     1 
ATOM   3198  O  O     . GLN B  1 138 ? -8.761  -1.904  -2.079  1.00 17.49 ? 1111 GLN B O     1 
ATOM   3199  C  CB    . GLN B  1 138 ? -8.899  -3.372  -4.875  1.00 20.39 ? 1111 GLN B CB    1 
ATOM   3200  C  CG    . GLN B  1 138 ? -9.711  -4.137  -5.894  1.00 20.78 ? 1111 GLN B CG    1 
ATOM   3201  C  CD    . GLN B  1 138 ? -8.930  -5.321  -6.427  1.00 21.69 ? 1111 GLN B CD    1 
ATOM   3202  O  OE1   . GLN B  1 138 ? -8.640  -6.272  -5.694  1.00 29.54 ? 1111 GLN B OE1   1 
ATOM   3203  N  NE2   . GLN B  1 138 ? -8.576  -5.269  -7.697  1.00 23.52 ? 1111 GLN B NE2   1 
ATOM   3204  N  N     . LEU B  1 139 ? -7.645  -0.700  -3.637  1.00 18.89 ? 1112 LEU B N     1 
ATOM   3205  C  CA    . LEU B  1 139 ? -6.788  -0.022  -2.684  1.00 19.70 ? 1112 LEU B CA    1 
ATOM   3206  C  C     . LEU B  1 139 ? -7.614  1.030   -1.938  1.00 19.05 ? 1112 LEU B C     1 
ATOM   3207  O  O     . LEU B  1 139 ? -7.525  1.140   -0.719  1.00 24.75 ? 1112 LEU B O     1 
ATOM   3208  C  CB    . LEU B  1 139 ? -5.556  0.594   -3.394  1.00 21.12 ? 1112 LEU B CB    1 
ATOM   3209  C  CG    . LEU B  1 139 ? -4.540  1.339   -2.512  1.00 22.05 ? 1112 LEU B CG    1 
ATOM   3210  C  CD1   . LEU B  1 139 ? -3.851  0.411   -1.487  1.00 7.37  ? 1112 LEU B CD1   1 
ATOM   3211  C  CD2   . LEU B  1 139 ? -3.519  2.093   -3.351  1.00 17.16 ? 1112 LEU B CD2   1 
ATOM   3212  N  N     . VAL B  1 140 ? -8.440  1.771   -2.674  1.00 19.29 ? 1113 VAL B N     1 
ATOM   3213  C  CA    . VAL B  1 140 ? -9.355  2.760   -2.088  1.00 18.75 ? 1113 VAL B CA    1 
ATOM   3214  C  C     . VAL B  1 140 ? -10.301 2.128   -1.058  1.00 20.48 ? 1113 VAL B C     1 
ATOM   3215  O  O     . VAL B  1 140 ? -10.464 2.665   0.042   1.00 19.71 ? 1113 VAL B O     1 
ATOM   3216  C  CB    . VAL B  1 140 ? -10.173 3.513   -3.170  1.00 16.25 ? 1113 VAL B CB    1 
ATOM   3217  C  CG1   . VAL B  1 140 ? -11.070 4.561   -2.527  1.00 21.64 ? 1113 VAL B CG1   1 
ATOM   3218  C  CG2   . VAL B  1 140 ? -9.257  4.164   -4.197  1.00 14.67 ? 1113 VAL B CG2   1 
ATOM   3219  N  N     . SER B  1 141 ? -10.924 0.997   -1.412  1.00 23.20 ? 1114 SER B N     1 
ATOM   3220  C  CA    . SER B  1 141 ? -11.780 0.251   -0.462  1.00 20.02 ? 1114 SER B CA    1 
ATOM   3221  C  C     . SER B  1 141 ? -11.026 -0.096  0.808   1.00 12.38 ? 1114 SER B C     1 
ATOM   3222  O  O     . SER B  1 141 ? -11.565 0.043   1.892   1.00 23.71 ? 1114 SER B O     1 
ATOM   3223  C  CB    . SER B  1 141 ? -12.355 -1.037  -1.075  1.00 15.94 ? 1114 SER B CB    1 
ATOM   3224  O  OG    . SER B  1 141 ? -12.661 -0.848  -2.442  1.00 27.62 ? 1114 SER B OG    1 
ATOM   3225  N  N     . ALA B  1 142 ? -9.782  -0.558  0.664   1.00 19.58 ? 1115 ALA B N     1 
ATOM   3226  C  CA    . ALA B  1 142 ? -8.912  -0.871  1.804   1.00 19.24 ? 1115 ALA B CA    1 
ATOM   3227  C  C     . ALA B  1 142 ? -8.652  0.365   2.671   1.00 12.18 ? 1115 ALA B C     1 
ATOM   3228  O  O     . ALA B  1 142 ? -8.707  0.309   3.894   1.00 17.16 ? 1115 ALA B O     1 
ATOM   3229  C  CB    . ALA B  1 142 ? -7.581  -1.491  1.321   1.00 18.41 ? 1115 ALA B CB    1 
ATOM   3230  N  N     . VAL B  1 143 ? -8.374  1.478   2.011   1.00 19.37 ? 1116 VAL B N     1 
ATOM   3231  C  CA    . VAL B  1 143 ? -8.008  2.728   2.673   1.00 20.88 ? 1116 VAL B CA    1 
ATOM   3232  C  C     . VAL B  1 143 ? -9.260  3.389   3.247   1.00 21.58 ? 1116 VAL B C     1 
ATOM   3233  O  O     . VAL B  1 143 ? -9.219  4.004   4.321   1.00 26.34 ? 1116 VAL B O     1 
ATOM   3234  C  CB    . VAL B  1 143 ? -7.233  3.654   1.687   1.00 23.96 ? 1116 VAL B CB    1 
ATOM   3235  C  CG1   . VAL B  1 143 ? -6.997  5.041   2.274   1.00 18.93 ? 1116 VAL B CG1   1 
ATOM   3236  C  CG2   . VAL B  1 143 ? -5.908  2.996   1.298   1.00 10.63 ? 1116 VAL B CG2   1 
ATOM   3237  N  N     . GLY B  1 144 ? -10.370 3.227   2.535   1.00 19.81 ? 1117 GLY B N     1 
ATOM   3238  C  CA    . GLY B  1 144 ? -11.694 3.614   3.029   1.00 21.28 ? 1117 GLY B CA    1 
ATOM   3239  C  C     . GLY B  1 144 ? -12.059 2.899   4.310   1.00 16.31 ? 1117 GLY B C     1 
ATOM   3240  O  O     . GLY B  1 144 ? -12.551 3.517   5.250   1.00 19.21 ? 1117 GLY B O     1 
ATOM   3241  N  N     . TYR B  1 145 ? -11.808 1.592   4.342   1.00 17.66 ? 1118 TYR B N     1 
ATOM   3242  C  CA    . TYR B  1 145 ? -12.022 0.771   5.534   1.00 15.94 ? 1118 TYR B CA    1 
ATOM   3243  C  C     . TYR B  1 145 ? -11.093 1.157   6.690   1.00 19.65 ? 1118 TYR B C     1 
ATOM   3244  O  O     . TYR B  1 145 ? -11.547 1.279   7.836   1.00 22.02 ? 1118 TYR B O     1 
ATOM   3245  C  CB    . TYR B  1 145 ? -11.867 -0.712  5.178   1.00 21.51 ? 1118 TYR B CB    1 
ATOM   3246  C  CG    . TYR B  1 145 ? -11.769 -1.644  6.364   1.00 18.75 ? 1118 TYR B CG    1 
ATOM   3247  C  CD1   . TYR B  1 145 ? -12.915 -2.219  6.923   1.00 18.61 ? 1118 TYR B CD1   1 
ATOM   3248  C  CD2   . TYR B  1 145 ? -10.519 -1.971  6.919   1.00 19.71 ? 1118 TYR B CD2   1 
ATOM   3249  C  CE1   . TYR B  1 145 ? -12.818 -3.088  8.020   1.00 25.01 ? 1118 TYR B CE1   1 
ATOM   3250  C  CE2   . TYR B  1 145 ? -10.413 -2.824  8.015   1.00 22.33 ? 1118 TYR B CE2   1 
ATOM   3251  C  CZ    . TYR B  1 145 ? -11.568 -3.383  8.554   1.00 23.79 ? 1118 TYR B CZ    1 
ATOM   3252  O  OH    . TYR B  1 145 ? -11.467 -4.225  9.629   1.00 27.61 ? 1118 TYR B OH    1 
ATOM   3253  N  N     . LEU B  1 146 ? -9.799  1.333   6.398   1.00 14.17 ? 1119 LEU B N     1 
ATOM   3254  C  CA    . LEU B  1 146 ? -8.836  1.732   7.432   1.00 20.48 ? 1119 LEU B CA    1 
ATOM   3255  C  C     . LEU B  1 146 ? -9.201  3.077   8.060   1.00 16.94 ? 1119 LEU B C     1 
ATOM   3256  O  O     . LEU B  1 146 ? -9.224  3.192   9.285   1.00 20.46 ? 1119 LEU B O     1 
ATOM   3257  C  CB    . LEU B  1 146 ? -7.376  1.696   6.926   1.00 16.89 ? 1119 LEU B CB    1 
ATOM   3258  C  CG    . LEU B  1 146 ? -6.702  0.316   6.758   1.00 25.63 ? 1119 LEU B CG    1 
ATOM   3259  C  CD1   . LEU B  1 146 ? -5.385  0.393   5.968   1.00 17.54 ? 1119 LEU B CD1   1 
ATOM   3260  C  CD2   . LEU B  1 146 ? -6.470  -0.416  8.086   1.00 15.25 ? 1119 LEU B CD2   1 
ATOM   3261  N  N     . ARG B  1 147 ? -9.526  4.072   7.234   1.00 20.83 ? 1120 ARG B N     1 
ATOM   3262  C  CA    . ARG B  1 147 ? -9.960  5.388   7.728   1.00 23.40 ? 1120 ARG B CA    1 
ATOM   3263  C  C     . ARG B  1 147 ? -11.037 5.270   8.800   1.00 27.76 ? 1120 ARG B C     1 
ATOM   3264  O  O     . ARG B  1 147 ? -10.907 5.833   9.886   1.00 28.14 ? 1120 ARG B O     1 
ATOM   3265  C  CB    . ARG B  1 147 ? -10.474 6.260   6.580   1.00 27.00 ? 1120 ARG B CB    1 
ATOM   3266  C  CG    . ARG B  1 147 ? -10.878 7.688   6.997   1.00 29.26 ? 1120 ARG B CG    1 
ATOM   3267  C  CD    . ARG B  1 147 ? -9.663  8.529   7.461   1.00 25.91 ? 1120 ARG B CD    1 
ATOM   3268  N  NE    . ARG B  1 147 ? -8.584  8.548   6.467   1.00 25.65 ? 1120 ARG B NE    1 
ATOM   3269  C  CZ    . ARG B  1 147 ? -8.494  9.402   5.449   1.00 21.56 ? 1120 ARG B CZ    1 
ATOM   3270  N  NH1   . ARG B  1 147 ? -9.416  10.337  5.255   1.00 20.34 ? 1120 ARG B NH1   1 
ATOM   3271  N  NH2   . ARG B  1 147 ? -7.471  9.321   4.614   1.00 16.82 ? 1120 ARG B NH2   1 
ATOM   3272  N  N     . LEU B  1 148 ? -12.090 4.519   8.466   1.00 32.30 ? 1121 LEU B N     1 
ATOM   3273  C  CA    . LEU B  1 148 ? -13.211 4.196   9.345   1.00 30.83 ? 1121 LEU B CA    1 
ATOM   3274  C  C     . LEU B  1 148 ? -12.797 3.515   10.668  1.00 30.93 ? 1121 LEU B C     1 
ATOM   3275  O  O     . LEU B  1 148 ? -13.484 3.654   11.684  1.00 31.85 ? 1121 LEU B O     1 
ATOM   3276  C  CB    . LEU B  1 148 ? -14.197 3.321   8.550   1.00 32.89 ? 1121 LEU B CB    1 
ATOM   3277  C  CG    . LEU B  1 148 ? -15.594 2.921   9.042   1.00 41.57 ? 1121 LEU B CG    1 
ATOM   3278  C  CD1   . LEU B  1 148 ? -16.587 4.079   8.963   1.00 36.76 ? 1121 LEU B CD1   1 
ATOM   3279  C  CD2   . LEU B  1 148 ? -16.097 1.726   8.229   1.00 34.48 ? 1121 LEU B CD2   1 
ATOM   3280  N  N     . LYS B  1 149 ? -11.685 2.778   10.650  1.00 30.80 ? 1122 LYS B N     1 
ATOM   3281  C  CA    . LYS B  1 149 ? -11.127 2.146   11.863  1.00 29.87 ? 1122 LYS B CA    1 
ATOM   3282  C  C     . LYS B  1 149 ? -10.149 3.065   12.621  1.00 29.09 ? 1122 LYS B C     1 
ATOM   3283  O  O     . LYS B  1 149 ? -9.538  2.646   13.606  1.00 30.70 ? 1122 LYS B O     1 
ATOM   3284  C  CB    . LYS B  1 149 ? -10.415 0.821   11.521  1.00 28.65 ? 1122 LYS B CB    1 
ATOM   3285  C  CG    . LYS B  1 149 ? -11.281 -0.242  10.830  1.00 36.13 ? 1122 LYS B CG    1 
ATOM   3286  C  CD    . LYS B  1 149 ? -11.833 -1.294  11.796  1.00 31.90 ? 1122 LYS B CD    1 
ATOM   3287  C  CE    . LYS B  1 149 ? -13.119 -0.855  12.463  1.00 33.86 ? 1122 LYS B CE    1 
ATOM   3288  N  NZ    . LYS B  1 149 ? -12.883 -0.114  13.734  1.00 42.54 ? 1122 LYS B NZ    1 
ATOM   3289  N  N     . ASP B  1 150 ? -10.012 4.307   12.157  1.00 28.12 ? 1123 ASP B N     1 
ATOM   3290  C  CA    . ASP B  1 150 ? -9.053  5.275   12.715  1.00 30.67 ? 1123 ASP B CA    1 
ATOM   3291  C  C     . ASP B  1 150 ? -7.596  4.859   12.480  1.00 27.56 ? 1123 ASP B C     1 
ATOM   3292  O  O     . ASP B  1 150 ? -6.715  5.130   13.292  1.00 23.01 ? 1123 ASP B O     1 
ATOM   3293  C  CB    . ASP B  1 150 ? -9.342  5.550   14.203  1.00 27.75 ? 1123 ASP B CB    1 
ATOM   3294  C  CG    . ASP B  1 150 ? -10.667 6.280   14.414  1.00 26.23 ? 1123 ASP B CG    1 
ATOM   3295  O  OD1   . ASP B  1 150 ? -11.006 7.152   13.590  1.00 27.49 ? 1123 ASP B OD1   1 
ATOM   3296  O  OD2   . ASP B  1 150 ? -11.368 5.984   15.402  1.00 37.16 ? 1123 ASP B OD2   1 
ATOM   3297  N  N     . ILE B  1 151 ? -7.362  4.190   11.356  1.00 28.34 ? 1124 ILE B N     1 
ATOM   3298  C  CA    . ILE B  1 151 ? -6.040  3.684   11.033  1.00 26.01 ? 1124 ILE B CA    1 
ATOM   3299  C  C     . ILE B  1 151 ? -5.493  4.334   9.778   1.00 27.00 ? 1124 ILE B C     1 
ATOM   3300  O  O     . ILE B  1 151 ? -6.168  4.446   8.734   1.00 19.87 ? 1124 ILE B O     1 
ATOM   3301  C  CB    . ILE B  1 151 ? -5.981  2.145   10.897  1.00 25.14 ? 1124 ILE B CB    1 
ATOM   3302  C  CG1   . ILE B  1 151 ? -6.448  1.474   12.186  1.00 24.65 ? 1124 ILE B CG1   1 
ATOM   3303  C  CG2   . ILE B  1 151 ? -4.539  1.687   10.566  1.00 32.03 ? 1124 ILE B CG2   1 
ATOM   3304  C  CD1   . ILE B  1 151 ? -6.705  -0.012  12.059  1.00 27.56 ? 1124 ILE B CD1   1 
ATOM   3305  N  N     . ILE B  1 152 ? -4.250  4.772   9.910   1.00 25.19 ? 1125 ILE B N     1 
ATOM   3306  C  CA    . ILE B  1 152 ? -3.502  5.277   8.786   1.00 23.79 ? 1125 ILE B CA    1 
ATOM   3307  C  C     . ILE B  1 152 ? -2.280  4.368   8.599   1.00 17.82 ? 1125 ILE B C     1 
ATOM   3308  O  O     . ILE B  1 152 ? -1.495  4.166   9.521   1.00 29.16 ? 1125 ILE B O     1 
ATOM   3309  C  CB    . ILE B  1 152 ? -3.197  6.797   8.984   1.00 22.10 ? 1125 ILE B CB    1 
ATOM   3310  C  CG1   . ILE B  1 152 ? -3.200  7.532   7.657   1.00 23.57 ? 1125 ILE B CG1   1 
ATOM   3311  C  CG2   . ILE B  1 152 ? -1.948  7.039   9.820   1.00 21.16 ? 1125 ILE B CG2   1 
ATOM   3312  C  CD1   . ILE B  1 152 ? -4.494  8.220   7.375   1.00 37.72 ? 1125 ILE B CD1   1 
ATOM   3313  N  N     . HIS B  1 153 ? -2.167  3.791   7.408   1.00 22.19 ? 1126 HIS B N     1 
ATOM   3314  C  CA    . HIS B  1 153 ? -1.119  2.823   7.046   1.00 22.61 ? 1126 HIS B CA    1 
ATOM   3315  C  C     . HIS B  1 153 ? 0.289   3.436   6.997   1.00 21.57 ? 1126 HIS B C     1 
ATOM   3316  O  O     . HIS B  1 153 ? 1.253   2.829   7.475   1.00 20.80 ? 1126 HIS B O     1 
ATOM   3317  C  CB    . HIS B  1 153 ? -1.486  2.176   5.698   1.00 24.46 ? 1126 HIS B CB    1 
ATOM   3318  C  CG    . HIS B  1 153 ? -0.587  1.053   5.280   1.00 22.38 ? 1126 HIS B CG    1 
ATOM   3319  N  ND1   . HIS B  1 153 ? 0.573   1.255   4.561   1.00 26.74 ? 1126 HIS B ND1   1 
ATOM   3320  C  CD2   . HIS B  1 153 ? -0.699  -0.285  5.441   1.00 12.74 ? 1126 HIS B CD2   1 
ATOM   3321  C  CE1   . HIS B  1 153 ? 1.146   0.090   4.318   1.00 17.92 ? 1126 HIS B CE1   1 
ATOM   3322  N  NE2   . HIS B  1 153 ? 0.390   -0.860  4.836   1.00 21.14 ? 1126 HIS B NE2   1 
ATOM   3323  N  N     . ARG B  1 154 ? 0.391   4.624   6.406   1.00 22.38 ? 1127 ARG B N     1 
ATOM   3324  C  CA    . ARG B  1 154 ? 1.639   5.420   6.337   1.00 21.55 ? 1127 ARG B CA    1 
ATOM   3325  C  C     . ARG B  1 154 ? 2.744   4.939   5.389   1.00 16.22 ? 1127 ARG B C     1 
ATOM   3326  O  O     . ARG B  1 154 ? 3.788   5.581   5.281   1.00 19.21 ? 1127 ARG B O     1 
ATOM   3327  C  CB    . ARG B  1 154 ? 2.217   5.704   7.729   1.00 26.18 ? 1127 ARG B CB    1 
ATOM   3328  C  CG    . ARG B  1 154 ? 1.330   6.572   8.604   1.00 25.86 ? 1127 ARG B CG    1 
ATOM   3329  C  CD    . ARG B  1 154 ? 1.695   6.369   10.045  1.00 28.80 ? 1127 ARG B CD    1 
ATOM   3330  N  NE    . ARG B  1 154 ? 2.518   7.456   10.539  1.00 38.25 ? 1127 ARG B NE    1 
ATOM   3331  C  CZ    . ARG B  1 154 ? 3.466   7.332   11.461  1.00 36.31 ? 1127 ARG B CZ    1 
ATOM   3332  N  NH1   . ARG B  1 154 ? 3.759   6.143   11.984  1.00 24.31 ? 1127 ARG B NH1   1 
ATOM   3333  N  NH2   . ARG B  1 154 ? 4.134   8.411   11.841  1.00 27.48 ? 1127 ARG B NH2   1 
ATOM   3334  N  N     . ASP B  1 155 ? 2.515   3.846   4.678   1.00 19.25 ? 1128 ASP B N     1 
ATOM   3335  C  CA    . ASP B  1 155 ? 3.488   3.395   3.690   1.00 20.25 ? 1128 ASP B CA    1 
ATOM   3336  C  C     . ASP B  1 155 ? 2.781   2.750   2.495   1.00 17.69 ? 1128 ASP B C     1 
ATOM   3337  O  O     . ASP B  1 155 ? 3.146   1.659   2.043   1.00 21.05 ? 1128 ASP B O     1 
ATOM   3338  C  CB    . ASP B  1 155 ? 4.528   2.455   4.338   1.00 23.92 ? 1128 ASP B CB    1 
ATOM   3339  C  CG    . ASP B  1 155 ? 5.895   2.491   3.634   1.00 25.68 ? 1128 ASP B CG    1 
ATOM   3340  O  OD1   . ASP B  1 155 ? 6.086   3.290   2.689   1.00 26.42 ? 1128 ASP B OD1   1 
ATOM   3341  O  OD2   . ASP B  1 155 ? 6.786   1.706   4.033   1.00 34.47 ? 1128 ASP B OD2   1 
ATOM   3342  N  N     . ILE B  1 156 ? 1.769   3.442   1.982   1.00 19.54 ? 1129 ILE B N     1 
ATOM   3343  C  CA    . ILE B  1 156 ? 1.070   2.995   0.794   1.00 18.00 ? 1129 ILE B CA    1 
ATOM   3344  C  C     . ILE B  1 156 ? 1.925   3.331   -0.422  1.00 21.43 ? 1129 ILE B C     1 
ATOM   3345  O  O     . ILE B  1 156 ? 2.218   4.506   -0.695  1.00 19.35 ? 1129 ILE B O     1 
ATOM   3346  C  CB    . ILE B  1 156 ? -0.358  3.597   0.656   1.00 20.62 ? 1129 ILE B CB    1 
ATOM   3347  C  CG1   . ILE B  1 156 ? -1.196  3.271   1.896   1.00 14.14 ? 1129 ILE B CG1   1 
ATOM   3348  C  CG2   . ILE B  1 156 ? -1.038  3.091   -0.662  1.00 13.56 ? 1129 ILE B CG2   1 
ATOM   3349  C  CD1   . ILE B  1 156 ? -2.478  4.075   2.018   1.00 15.14 ? 1129 ILE B CD1   1 
ATOM   3350  N  N     . LYS B  1 157 ? 2.309   2.272   -1.132  1.00 20.47 ? 1130 LYS B N     1 
ATOM   3351  C  CA    . LYS B  1 157 ? 3.213   2.320   -2.276  1.00 21.19 ? 1130 LYS B CA    1 
ATOM   3352  C  C     . LYS B  1 157 ? 3.104   0.999   -3.013  1.00 18.83 ? 1130 LYS B C     1 
ATOM   3353  O  O     . LYS B  1 157 ? 2.519   0.052   -2.489  1.00 27.87 ? 1130 LYS B O     1 
ATOM   3354  C  CB    . LYS B  1 157 ? 4.662   2.572   -1.830  1.00 18.12 ? 1130 LYS B CB    1 
ATOM   3355  C  CG    . LYS B  1 157 ? 5.233   1.533   -0.906  1.00 12.47 ? 1130 LYS B CG    1 
ATOM   3356  C  CD    . LYS B  1 157 ? 6.737   1.616   -0.815  1.00 27.96 ? 1130 LYS B CD    1 
ATOM   3357  C  CE    . LYS B  1 157 ? 7.258   0.617   0.207   1.00 39.07 ? 1130 LYS B CE    1 
ATOM   3358  N  NZ    . LYS B  1 157 ? 8.658   0.173   -0.073  1.00 42.26 ? 1130 LYS B NZ    1 
ATOM   3359  N  N     . ASP B  1 158 ? 3.682   0.922   -4.207  1.00 19.99 ? 1131 ASP B N     1 
ATOM   3360  C  CA    . ASP B  1 158 ? 3.573   -0.290  -5.040  1.00 23.95 ? 1131 ASP B CA    1 
ATOM   3361  C  C     . ASP B  1 158 ? 4.214   -1.558  -4.456  1.00 23.10 ? 1131 ASP B C     1 
ATOM   3362  O  O     . ASP B  1 158 ? 3.773   -2.673  -4.756  1.00 22.09 ? 1131 ASP B O     1 
ATOM   3363  C  CB    . ASP B  1 158 ? 4.057   -0.033  -6.481  1.00 24.92 ? 1131 ASP B CB    1 
ATOM   3364  C  CG    . ASP B  1 158 ? 5.407   0.672   -6.545  1.00 35.05 ? 1131 ASP B CG    1 
ATOM   3365  O  OD1   . ASP B  1 158 ? 6.123   0.743   -5.518  1.00 42.69 ? 1131 ASP B OD1   1 
ATOM   3366  O  OD2   . ASP B  1 158 ? 5.748   1.165   -7.639  1.00 36.30 ? 1131 ASP B OD2   1 
ATOM   3367  N  N     . GLU B  1 159 ? 5.240   -1.396  -3.626  1.00 19.26 ? 1132 GLU B N     1 
ATOM   3368  C  CA    . GLU B  1 159 ? 5.859   -2.545  -2.955  1.00 27.62 ? 1132 GLU B CA    1 
ATOM   3369  C  C     . GLU B  1 159 ? 5.029   -3.107  -1.799  1.00 22.83 ? 1132 GLU B C     1 
ATOM   3370  O  O     . GLU B  1 159 ? 5.250   -4.237  -1.359  1.00 23.14 ? 1132 GLU B O     1 
ATOM   3371  C  CB    . GLU B  1 159 ? 7.261   -2.203  -2.451  1.00 29.78 ? 1132 GLU B CB    1 
ATOM   3372  C  CG    . GLU B  1 159 ? 8.377   -2.745  -3.325  1.00 37.94 ? 1132 GLU B CG    1 
ATOM   3373  C  CD    . GLU B  1 159 ? 9.755   -2.263  -2.901  1.00 35.50 ? 1132 GLU B CD    1 
ATOM   3374  O  OE1   . GLU B  1 159 ? 10.743  -2.640  -3.572  1.00 38.47 ? 1132 GLU B OE1   1 
ATOM   3375  O  OE2   . GLU B  1 159 ? 9.849   -1.513  -1.901  1.00 44.77 ? 1132 GLU B OE2   1 
ATOM   3376  N  N     . ASN B  1 160 ? 4.089   -2.314  -1.301  1.00 21.83 ? 1133 ASN B N     1 
ATOM   3377  C  CA    . ASN B  1 160 ? 3.275   -2.747  -0.177  1.00 25.21 ? 1133 ASN B CA    1 
ATOM   3378  C  C     . ASN B  1 160 ? 1.900   -3.216  -0.634  1.00 20.12 ? 1133 ASN B C     1 
ATOM   3379  O  O     . ASN B  1 160 ? 0.969   -3.333  0.152   1.00 20.37 ? 1133 ASN B O     1 
ATOM   3380  C  CB    . ASN B  1 160 ? 3.204   -1.658  0.900   1.00 20.92 ? 1133 ASN B CB    1 
ATOM   3381  C  CG    . ASN B  1 160 ? 4.493   -1.539  1.687   1.00 22.93 ? 1133 ASN B CG    1 
ATOM   3382  O  OD1   . ASN B  1 160 ? 5.302   -2.459  1.699   1.00 29.04 ? 1133 ASN B OD1   1 
ATOM   3383  N  ND2   . ASN B  1 160 ? 4.677   -0.414  2.376   1.00 24.27 ? 1133 ASN B ND2   1 
ATOM   3384  N  N     . ILE B  1 161 ? 1.801   -3.501  -1.923  1.00 22.34 ? 1134 ILE B N     1 
ATOM   3385  C  CA    . ILE B  1 161 ? 0.585   -4.031  -2.510  1.00 22.44 ? 1134 ILE B CA    1 
ATOM   3386  C  C     . ILE B  1 161 ? 0.940   -5.300  -3.293  1.00 25.96 ? 1134 ILE B C     1 
ATOM   3387  O  O     . ILE B  1 161 ? 1.795   -5.250  -4.181  1.00 29.40 ? 1134 ILE B O     1 
ATOM   3388  C  CB    . ILE B  1 161 ? -0.084  -2.981  -3.427  1.00 18.30 ? 1134 ILE B CB    1 
ATOM   3389  C  CG1   . ILE B  1 161 ? -0.298  -1.651  -2.671  1.00 13.12 ? 1134 ILE B CG1   1 
ATOM   3390  C  CG2   . ILE B  1 161 ? -1.402  -3.519  -3.998  1.00 20.55 ? 1134 ILE B CG2   1 
ATOM   3391  C  CD1   . ILE B  1 161 ? -0.574  -0.459  -3.571  1.00 16.98 ? 1134 ILE B CD1   1 
ATOM   3392  N  N     . VAL B  1 162 ? 0.313   -6.430  -2.942  1.00 25.47 ? 1135 VAL B N     1 
ATOM   3393  C  CA    . VAL B  1 162 ? 0.482   -7.682  -3.708  1.00 23.96 ? 1135 VAL B CA    1 
ATOM   3394  C  C     . VAL B  1 162 ? -0.712  -7.988  -4.599  1.00 24.73 ? 1135 VAL B C     1 
ATOM   3395  O  O     . VAL B  1 162 ? -1.849  -7.751  -4.219  1.00 30.42 ? 1135 VAL B O     1 
ATOM   3396  C  CB    . VAL B  1 162 ? 0.837   -8.938  -2.835  1.00 23.24 ? 1135 VAL B CB    1 
ATOM   3397  C  CG1   . VAL B  1 162 ? 2.218   -8.801  -2.209  1.00 16.55 ? 1135 VAL B CG1   1 
ATOM   3398  C  CG2   . VAL B  1 162 ? -0.234  -9.232  -1.777  1.00 20.56 ? 1135 VAL B CG2   1 
ATOM   3399  N  N     . ILE B  1 163 ? -0.437  -8.525  -5.786  1.00 26.30 ? 1136 ILE B N     1 
ATOM   3400  C  CA    . ILE B  1 163 ? -1.472  -8.807  -6.780  1.00 27.08 ? 1136 ILE B CA    1 
ATOM   3401  C  C     . ILE B  1 163 ? -1.490  -10.301 -7.176  1.00 30.99 ? 1136 ILE B C     1 
ATOM   3402  O  O     . ILE B  1 163 ? -0.435  -10.937 -7.288  1.00 21.96 ? 1136 ILE B O     1 
ATOM   3403  C  CB    . ILE B  1 163 ? -1.317  -7.887  -8.029  1.00 26.20 ? 1136 ILE B CB    1 
ATOM   3404  C  CG1   . ILE B  1 163 ? -2.474  -8.104  -9.017  1.00 27.40 ? 1136 ILE B CG1   1 
ATOM   3405  C  CG2   . ILE B  1 163 ? 0.062   -8.073  -8.686  1.00 22.84 ? 1136 ILE B CG2   1 
ATOM   3406  C  CD1   . ILE B  1 163 ? -2.625  -7.019  -10.068 1.00 26.11 ? 1136 ILE B CD1   1 
ATOM   3407  N  N     . ALA B  1 164 ? -2.694  -10.845 -7.363  1.00 31.09 ? 1137 ALA B N     1 
ATOM   3408  C  CA    . ALA B  1 164 ? -2.881  -12.237 -7.792  1.00 29.45 ? 1137 ALA B CA    1 
ATOM   3409  C  C     . ALA B  1 164 ? -3.282  -12.298 -9.267  1.00 30.74 ? 1137 ALA B C     1 
ATOM   3410  O  O     . ALA B  1 164 ? -3.367  -11.259 -9.927  1.00 30.24 ? 1137 ALA B O     1 
ATOM   3411  C  CB    . ALA B  1 164 ? -3.917  -12.930 -6.913  1.00 26.97 ? 1137 ALA B CB    1 
ATOM   3412  N  N     . GLU B  1 165 ? -3.526  -13.508 -9.776  1.00 28.85 ? 1138 GLU B N     1 
ATOM   3413  C  CA    . GLU B  1 165 ? -3.789  -13.725 -11.210 1.00 28.47 ? 1138 GLU B CA    1 
ATOM   3414  C  C     . GLU B  1 165 ? -5.171  -13.255 -11.644 1.00 25.13 ? 1138 GLU B C     1 
ATOM   3415  O  O     . GLU B  1 165 ? -5.389  -12.951 -12.815 1.00 29.59 ? 1138 GLU B O     1 
ATOM   3416  C  CB    . GLU B  1 165 ? -3.588  -15.195 -11.603 1.00 31.63 ? 1138 GLU B CB    1 
ATOM   3417  N  N     . ASP B  1 166 ? -6.100  -13.215 -10.698 1.00 22.54 ? 1139 ASP B N     1 
ATOM   3418  C  CA    . ASP B  1 166 ? -7.424  -12.644 -10.931 1.00 26.49 ? 1139 ASP B CA    1 
ATOM   3419  C  C     . ASP B  1 166 ? -7.475  -11.094 -10.853 1.00 25.38 ? 1139 ASP B C     1 
ATOM   3420  O  O     . ASP B  1 166 ? -8.561  -10.510 -10.853 1.00 24.57 ? 1139 ASP B O     1 
ATOM   3421  C  CB    . ASP B  1 166 ? -8.464  -13.296 -9.997  1.00 29.56 ? 1139 ASP B CB    1 
ATOM   3422  C  CG    . ASP B  1 166 ? -8.076  -13.229 -8.516  1.00 29.74 ? 1139 ASP B CG    1 
ATOM   3423  O  OD1   . ASP B  1 166 ? -8.955  -13.474 -7.666  1.00 37.08 ? 1139 ASP B OD1   1 
ATOM   3424  O  OD2   . ASP B  1 166 ? -6.910  -12.943 -8.186  1.00 36.75 ? 1139 ASP B OD2   1 
ATOM   3425  N  N     . PHE B  1 167 ? -6.301  -10.449 -10.833 1.00 27.21 ? 1140 PHE B N     1 
ATOM   3426  C  CA    . PHE B  1 167 ? -6.151  -8.975  -10.708 1.00 27.14 ? 1140 PHE B CA    1 
ATOM   3427  C  C     . PHE B  1 167 ? -6.679  -8.401  -9.385  1.00 25.85 ? 1140 PHE B C     1 
ATOM   3428  O  O     . PHE B  1 167 ? -6.936  -7.192  -9.273  1.00 28.32 ? 1140 PHE B O     1 
ATOM   3429  C  CB    . PHE B  1 167 ? -6.738  -8.211  -11.907 1.00 20.81 ? 1140 PHE B CB    1 
ATOM   3430  C  CG    . PHE B  1 167 ? -6.108  -8.563  -13.224 1.00 23.97 ? 1140 PHE B CG    1 
ATOM   3431  C  CD1   . PHE B  1 167 ? -4.870  -8.038  -13.588 1.00 15.73 ? 1140 PHE B CD1   1 
ATOM   3432  C  CD2   . PHE B  1 167 ? -6.757  -9.427  -14.105 1.00 23.81 ? 1140 PHE B CD2   1 
ATOM   3433  C  CE1   . PHE B  1 167 ? -4.293  -8.373  -14.805 1.00 19.48 ? 1140 PHE B CE1   1 
ATOM   3434  C  CE2   . PHE B  1 167 ? -6.189  -9.759  -15.316 1.00 19.16 ? 1140 PHE B CE2   1 
ATOM   3435  C  CZ    . PHE B  1 167 ? -4.955  -9.232  -15.669 1.00 18.66 ? 1140 PHE B CZ    1 
ATOM   3436  N  N     . THR B  1 168 ? -6.824  -9.284  -8.399  1.00 26.42 ? 1141 THR B N     1 
ATOM   3437  C  CA    . THR B  1 168 ? -7.172  -8.930  -7.025  1.00 30.42 ? 1141 THR B CA    1 
ATOM   3438  C  C     . THR B  1 168 ? -5.901  -8.520  -6.281  1.00 27.81 ? 1141 THR B C     1 
ATOM   3439  O  O     . THR B  1 168 ? -4.863  -9.151  -6.450  1.00 20.86 ? 1141 THR B O     1 
ATOM   3440  C  CB    . THR B  1 168 ? -7.844  -10.118 -6.309  1.00 31.65 ? 1141 THR B CB    1 
ATOM   3441  O  OG1   . THR B  1 168 ? -9.152  -10.315 -6.855  1.00 36.26 ? 1141 THR B OG1   1 
ATOM   3442  C  CG2   . THR B  1 168 ? -7.970  -9.869  -4.800  1.00 41.82 ? 1141 THR B CG2   1 
ATOM   3443  N  N     . ILE B  1 169 ? -5.992  -7.458  -5.477  1.00 26.96 ? 1142 ILE B N     1 
ATOM   3444  C  CA    . ILE B  1 169 ? -4.836  -6.939  -4.732  1.00 25.54 ? 1142 ILE B CA    1 
ATOM   3445  C  C     . ILE B  1 169 ? -5.034  -6.962  -3.212  1.00 19.57 ? 1142 ILE B C     1 
ATOM   3446  O  O     . ILE B  1 169 ? -6.164  -6.909  -2.713  1.00 13.96 ? 1142 ILE B O     1 
ATOM   3447  C  CB    . ILE B  1 169 ? -4.391  -5.505  -5.214  1.00 26.11 ? 1142 ILE B CB    1 
ATOM   3448  C  CG1   . ILE B  1 169 ? -5.368  -4.419  -4.749  1.00 24.20 ? 1142 ILE B CG1   1 
ATOM   3449  C  CG2   . ILE B  1 169 ? -4.193  -5.472  -6.728  1.00 28.00 ? 1142 ILE B CG2   1 
ATOM   3450  C  CD1   . ILE B  1 169 ? -4.918  -2.996  -5.064  1.00 31.89 ? 1142 ILE B CD1   1 
ATOM   3451  N  N     . LYS B  1 170 ? -3.918  -7.084  -2.498  1.00 18.30 ? 1143 LYS B N     1 
ATOM   3452  C  CA    . LYS B  1 170 ? -3.898  -7.078  -1.041  1.00 21.66 ? 1143 LYS B CA    1 
ATOM   3453  C  C     . LYS B  1 170 ? -2.871  -6.095  -0.532  1.00 22.09 ? 1143 LYS B C     1 
ATOM   3454  O  O     . LYS B  1 170 ? -1.726  -6.097  -0.997  1.00 22.16 ? 1143 LYS B O     1 
ATOM   3455  C  CB    . LYS B  1 170 ? -3.563  -8.460  -0.478  1.00 19.54 ? 1143 LYS B CB    1 
ATOM   3456  C  CG    . LYS B  1 170 ? -4.648  -9.074  0.343   1.00 28.64 ? 1143 LYS B CG    1 
ATOM   3457  C  CD    . LYS B  1 170 ? -5.691  -9.693  -0.506  1.00 25.45 ? 1143 LYS B CD    1 
ATOM   3458  C  CE    . LYS B  1 170 ? -6.624  -10.512 0.323   1.00 34.93 ? 1143 LYS B CE    1 
ATOM   3459  N  NZ    . LYS B  1 170 ? -7.286  -11.513 -0.534  1.00 27.11 ? 1143 LYS B NZ    1 
ATOM   3460  N  N     . LEU B  1 171 ? -3.305  -5.261  0.415   1.00 23.42 ? 1144 LEU B N     1 
ATOM   3461  C  CA    . LEU B  1 171 ? -2.426  -4.387  1.176   1.00 23.41 ? 1144 LEU B CA    1 
ATOM   3462  C  C     . LEU B  1 171 ? -1.743  -5.195  2.269   1.00 22.72 ? 1144 LEU B C     1 
ATOM   3463  O  O     . LEU B  1 171 ? -2.394  -5.917  3.039   1.00 19.23 ? 1144 LEU B O     1 
ATOM   3464  C  CB    . LEU B  1 171 ? -3.203  -3.203  1.786   1.00 21.48 ? 1144 LEU B CB    1 
ATOM   3465  C  CG    . LEU B  1 171 ? -2.419  -1.998  2.332   1.00 22.99 ? 1144 LEU B CG    1 
ATOM   3466  C  CD1   . LEU B  1 171 ? -1.394  -1.438  1.309   1.00 11.10 ? 1144 LEU B CD1   1 
ATOM   3467  C  CD2   . LEU B  1 171 ? -3.374  -0.898  2.820   1.00 22.56 ? 1144 LEU B CD2   1 
ATOM   3468  N  N     . ILE B  1 172 ? -0.421  -5.042  2.311   1.00 26.02 ? 1145 ILE B N     1 
ATOM   3469  C  CA    . ILE B  1 172 ? 0.473   -5.734  3.229   1.00 19.03 ? 1145 ILE B CA    1 
ATOM   3470  C  C     . ILE B  1 172 ? 1.333   -4.698  3.969   1.00 17.76 ? 1145 ILE B C     1 
ATOM   3471  O  O     . ILE B  1 172 ? 1.191   -3.490  3.749   1.00 10.95 ? 1145 ILE B O     1 
ATOM   3472  C  CB    . ILE B  1 172 ? 1.392   -6.757  2.469   1.00 21.24 ? 1145 ILE B CB    1 
ATOM   3473  C  CG1   . ILE B  1 172 ? 2.156   -6.073  1.332   1.00 18.33 ? 1145 ILE B CG1   1 
ATOM   3474  C  CG2   . ILE B  1 172 ? 0.573   -7.949  1.914   1.00 24.56 ? 1145 ILE B CG2   1 
ATOM   3475  C  CD1   . ILE B  1 172 ? 3.516   -6.646  1.061   1.00 10.69 ? 1145 ILE B CD1   1 
ATOM   3476  N  N     . ASP B  1 173 ? 2.201   -5.181  4.861   1.00 23.76 ? 1146 ASP B N     1 
ATOM   3477  C  CA    . ASP B  1 173 ? 3.224   -4.368  5.535   1.00 24.97 ? 1146 ASP B CA    1 
ATOM   3478  C  C     . ASP B  1 173 ? 2.625   -3.244  6.382   1.00 24.81 ? 1146 ASP B C     1 
ATOM   3479  O  O     . ASP B  1 173 ? 2.581   -2.081  5.963   1.00 29.41 ? 1146 ASP B O     1 
ATOM   3480  C  CB    . ASP B  1 173 ? 4.262   -3.827  4.523   1.00 23.98 ? 1146 ASP B CB    1 
ATOM   3481  C  CG    . ASP B  1 173 ? 5.509   -3.255  5.197   1.00 28.44 ? 1146 ASP B CG    1 
ATOM   3482  O  OD1   . ASP B  1 173 ? 5.619   -3.335  6.437   1.00 18.44 ? 1146 ASP B OD1   1 
ATOM   3483  O  OD2   . ASP B  1 173 ? 6.402   -2.731  4.485   1.00 16.79 ? 1146 ASP B OD2   1 
ATOM   3484  N  N     . PHE B  1 174 ? 2.183   -3.610  7.582   1.00 23.89 ? 1147 PHE B N     1 
ATOM   3485  C  CA    . PHE B  1 174 ? 1.604   -2.677  8.538   1.00 13.88 ? 1147 PHE B CA    1 
ATOM   3486  C  C     . PHE B  1 174 ? 2.610   -2.211  9.598   1.00 17.53 ? 1147 PHE B C     1 
ATOM   3487  O  O     . PHE B  1 174 ? 2.226   -1.719  10.664  1.00 18.90 ? 1147 PHE B O     1 
ATOM   3488  C  CB    . PHE B  1 174 ? 0.324   -3.272  9.153   1.00 18.20 ? 1147 PHE B CB    1 
ATOM   3489  C  CG    . PHE B  1 174 ? -0.854  -3.233  8.223   1.00 14.87 ? 1147 PHE B CG    1 
ATOM   3490  C  CD1   . PHE B  1 174 ? -0.910  -4.082  7.115   1.00 21.25 ? 1147 PHE B CD1   1 
ATOM   3491  C  CD2   . PHE B  1 174 ? -1.894  -2.336  8.432   1.00 21.95 ? 1147 PHE B CD2   1 
ATOM   3492  C  CE1   . PHE B  1 174 ? -1.984  -4.036  6.228   1.00 24.09 ? 1147 PHE B CE1   1 
ATOM   3493  C  CE2   . PHE B  1 174 ? -2.988  -2.282  7.546   1.00 14.35 ? 1147 PHE B CE2   1 
ATOM   3494  C  CZ    . PHE B  1 174 ? -3.026  -3.129  6.446   1.00 22.25 ? 1147 PHE B CZ    1 
ATOM   3495  N  N     . GLY B  1 175 ? 3.901   -2.316  9.267   1.00 20.52 ? 1148 GLY B N     1 
ATOM   3496  C  CA    . GLY B  1 175 ? 4.979   -1.966  10.186  1.00 21.73 ? 1148 GLY B CA    1 
ATOM   3497  C  C     . GLY B  1 175 ? 5.169   -0.484  10.425  1.00 24.83 ? 1148 GLY B C     1 
ATOM   3498  O  O     . GLY B  1 175 ? 5.968   -0.091  11.272  1.00 31.20 ? 1148 GLY B O     1 
ATOM   3499  N  N     . SER B  1 176 ? 4.439   0.335   9.672   1.00 27.50 ? 1149 SER B N     1 
ATOM   3500  C  CA    . SER B  1 176 ? 4.457   1.792   9.812   1.00 23.60 ? 1149 SER B CA    1 
ATOM   3501  C  C     . SER B  1 176 ? 3.102   2.302   10.271  1.00 19.59 ? 1149 SER B C     1 
ATOM   3502  O  O     . SER B  1 176 ? 2.945   3.495   10.523  1.00 25.23 ? 1149 SER B O     1 
ATOM   3503  C  CB    . SER B  1 176 ? 4.782   2.455   8.466   1.00 24.63 ? 1149 SER B CB    1 
ATOM   3504  O  OG    . SER B  1 176 ? 6.157   2.373   8.144   1.00 31.28 ? 1149 SER B OG    1 
ATOM   3505  N  N     . ALA B  1 177 ? 2.120   1.408   10.359  1.00 19.36 ? 1150 ALA B N     1 
ATOM   3506  C  CA    . ALA B  1 177 ? 0.734   1.816   10.588  1.00 22.98 ? 1150 ALA B CA    1 
ATOM   3507  C  C     . ALA B  1 177 ? 0.511   2.359   11.997  1.00 27.04 ? 1150 ALA B C     1 
ATOM   3508  O  O     . ALA B  1 177 ? 1.078   1.860   12.971  1.00 26.86 ? 1150 ALA B O     1 
ATOM   3509  C  CB    . ALA B  1 177 ? -0.242  0.680   10.267  1.00 19.32 ? 1150 ALA B CB    1 
ATOM   3510  N  N     . ALA B  1 178 ? -0.314  3.398   12.080  1.00 28.07 ? 1151 ALA B N     1 
ATOM   3511  C  CA    . ALA B  1 178 ? -0.597  4.063   13.339  1.00 27.60 ? 1151 ALA B CA    1 
ATOM   3512  C  C     . ALA B  1 178 ? -2.088  4.355   13.479  1.00 27.59 ? 1151 ALA B C     1 
ATOM   3513  O  O     . ALA B  1 178 ? -2.862  4.151   12.545  1.00 25.93 ? 1151 ALA B O     1 
ATOM   3514  C  CB    . ALA B  1 178 ? 0.223   5.351   13.453  1.00 19.06 ? 1151 ALA B CB    1 
ATOM   3515  N  N     . TYR B  1 179 ? -2.476  4.821   14.661  1.00 33.12 ? 1152 TYR B N     1 
ATOM   3516  C  CA    . TYR B  1 179 ? -3.836  5.257   14.917  1.00 33.31 ? 1152 TYR B CA    1 
ATOM   3517  C  C     . TYR B  1 179 ? -4.017  6.768   14.755  1.00 35.03 ? 1152 TYR B C     1 
ATOM   3518  O  O     . TYR B  1 179 ? -3.151  7.562   15.126  1.00 34.49 ? 1152 TYR B O     1 
ATOM   3519  C  CB    . TYR B  1 179 ? -4.285  4.794   16.308  1.00 36.60 ? 1152 TYR B CB    1 
ATOM   3520  C  CG    . TYR B  1 179 ? -4.751  3.351   16.330  1.00 39.36 ? 1152 TYR B CG    1 
ATOM   3521  C  CD1   . TYR B  1 179 ? -6.053  3.020   15.950  1.00 33.71 ? 1152 TYR B CD1   1 
ATOM   3522  C  CD2   . TYR B  1 179 ? -3.892  2.321   16.715  1.00 38.71 ? 1152 TYR B CD2   1 
ATOM   3523  C  CE1   . TYR B  1 179 ? -6.492  1.707   15.950  1.00 31.02 ? 1152 TYR B CE1   1 
ATOM   3524  C  CE2   . TYR B  1 179 ? -4.326  0.992   16.723  1.00 40.21 ? 1152 TYR B CE2   1 
ATOM   3525  C  CZ    . TYR B  1 179 ? -5.630  0.697   16.337  1.00 41.49 ? 1152 TYR B CZ    1 
ATOM   3526  O  OH    . TYR B  1 179 ? -6.086  -0.604  16.332  1.00 39.74 ? 1152 TYR B OH    1 
ATOM   3527  N  N     . LEU B  1 180 ? -5.145  7.139   14.160  1.00 39.38 ? 1153 LEU B N     1 
ATOM   3528  C  CA    . LEU B  1 180 ? -5.642  8.511   14.126  1.00 41.28 ? 1153 LEU B CA    1 
ATOM   3529  C  C     . LEU B  1 180 ? -6.364  8.823   15.438  1.00 42.47 ? 1153 LEU B C     1 
ATOM   3530  O  O     . LEU B  1 180 ? -7.271  8.088   15.842  1.00 43.18 ? 1153 LEU B O     1 
ATOM   3531  C  CB    . LEU B  1 180 ? -6.634  8.662   12.968  1.00 37.73 ? 1153 LEU B CB    1 
ATOM   3532  C  CG    . LEU B  1 180 ? -6.315  9.389   11.661  1.00 37.67 ? 1153 LEU B CG    1 
ATOM   3533  C  CD1   . LEU B  1 180 ? -4.814  9.675   11.415  1.00 21.21 ? 1153 LEU B CD1   1 
ATOM   3534  C  CD2   . LEU B  1 180 ? -6.951  8.621   10.502  1.00 23.86 ? 1153 LEU B CD2   1 
ATOM   3535  N  N     . GLU B  1 181 ? -5.969  9.910   16.096  1.00 40.46 ? 1154 GLU B N     1 
ATOM   3536  C  CA    . GLU B  1 181 ? -6.580  10.303  17.364  1.00 42.51 ? 1154 GLU B CA    1 
ATOM   3537  C  C     . GLU B  1 181 ? -7.061  11.751  17.330  1.00 44.85 ? 1154 GLU B C     1 
ATOM   3538  O  O     . GLU B  1 181 ? -6.537  12.566  16.569  1.00 41.32 ? 1154 GLU B O     1 
ATOM   3539  C  CB    . GLU B  1 181 ? -5.596  10.092  18.517  1.00 41.93 ? 1154 GLU B CB    1 
ATOM   3540  N  N     . ARG B  1 182 ? -8.062  12.060  18.155  1.00 51.46 ? 1155 ARG B N     1 
ATOM   3541  C  CA    . ARG B  1 182 ? -8.607  13.421  18.259  1.00 53.77 ? 1155 ARG B CA    1 
ATOM   3542  C  C     . ARG B  1 182 ? -7.510  14.451  18.548  1.00 51.78 ? 1155 ARG B C     1 
ATOM   3543  O  O     . ARG B  1 182 ? -6.932  14.471  19.639  1.00 53.38 ? 1155 ARG B O     1 
ATOM   3544  C  CB    . ARG B  1 182 ? -9.707  13.489  19.333  1.00 55.01 ? 1155 ARG B CB    1 
ATOM   3545  C  CG    . ARG B  1 182 ? -10.351 14.869  19.503  1.00 53.77 ? 1155 ARG B CG    1 
ATOM   3546  C  CD    . ARG B  1 182 ? -11.674 14.978  18.757  1.00 58.77 ? 1155 ARG B CD    1 
ATOM   3547  N  NE    . ARG B  1 182 ? -11.715 16.163  17.904  1.00 61.88 ? 1155 ARG B NE    1 
ATOM   3548  C  CZ    . ARG B  1 182 ? -11.582 16.142  16.579  1.00 62.84 ? 1155 ARG B CZ    1 
ATOM   3549  N  NH1   . ARG B  1 182 ? -11.417 14.991  15.933  1.00 56.81 ? 1155 ARG B NH1   1 
ATOM   3550  N  NH2   . ARG B  1 182 ? -11.626 17.278  15.895  1.00 58.13 ? 1155 ARG B NH2   1 
ATOM   3551  N  N     . GLY B  1 183 ? -7.223  15.287  17.551  1.00 52.07 ? 1156 GLY B N     1 
ATOM   3552  C  CA    . GLY B  1 183 ? -6.237  16.360  17.679  1.00 50.51 ? 1156 GLY B CA    1 
ATOM   3553  C  C     . GLY B  1 183 ? -4.816  15.915  17.984  1.00 50.27 ? 1156 GLY B C     1 
ATOM   3554  O  O     . GLY B  1 183 ? -4.176  16.433  18.904  1.00 51.03 ? 1156 GLY B O     1 
ATOM   3555  N  N     . LYS B  1 184 ? -4.324  14.946  17.220  1.00 49.15 ? 1157 LYS B N     1 
ATOM   3556  C  CA    . LYS B  1 184 ? -2.914  14.568  17.283  1.00 44.89 ? 1157 LYS B CA    1 
ATOM   3557  C  C     . LYS B  1 184 ? -2.238  14.852  15.946  1.00 38.15 ? 1157 LYS B C     1 
ATOM   3558  O  O     . LYS B  1 184 ? -2.852  14.739  14.885  1.00 33.86 ? 1157 LYS B O     1 
ATOM   3559  C  CB    . LYS B  1 184 ? -2.747  13.094  17.681  1.00 44.81 ? 1157 LYS B CB    1 
ATOM   3560  C  CG    . LYS B  1 184 ? -1.299  12.649  17.987  1.00 48.63 ? 1157 LYS B CG    1 
ATOM   3561  C  CD    . LYS B  1 184 ? -0.831  13.057  19.397  1.00 50.72 ? 1157 LYS B CD    1 
ATOM   3562  C  CE    . LYS B  1 184 ? 0.170   14.211  19.385  1.00 52.65 ? 1157 LYS B CE    1 
ATOM   3563  N  NZ    . LYS B  1 184 ? 1.565   13.737  19.149  1.00 51.51 ? 1157 LYS B NZ    1 
ATOM   3564  N  N     . LEU B  1 185 ? -0.976  15.253  16.011  1.00 35.56 ? 1158 LEU B N     1 
ATOM   3565  C  CA    . LEU B  1 185 ? -0.160  15.397  14.819  1.00 33.88 ? 1158 LEU B CA    1 
ATOM   3566  C  C     . LEU B  1 185 ? 1.025   14.450  14.951  1.00 33.90 ? 1158 LEU B C     1 
ATOM   3567  O  O     . LEU B  1 185 ? 1.428   14.101  16.064  1.00 37.16 ? 1158 LEU B O     1 
ATOM   3568  C  CB    . LEU B  1 185 ? 0.278   16.857  14.617  1.00 30.69 ? 1158 LEU B CB    1 
ATOM   3569  C  CG    . LEU B  1 185 ? -0.814  17.909  14.355  1.00 29.84 ? 1158 LEU B CG    1 
ATOM   3570  C  CD1   . LEU B  1 185 ? -0.261  19.328  14.471  1.00 33.76 ? 1158 LEU B CD1   1 
ATOM   3571  C  CD2   . LEU B  1 185 ? -1.534  17.739  13.005  1.00 28.01 ? 1158 LEU B CD2   1 
ATOM   3572  N  N     . PHE B  1 186 ? 1.554   13.994  13.823  1.00 30.95 ? 1159 PHE B N     1 
ATOM   3573  C  CA    . PHE B  1 186 ? 2.717   13.118  13.842  1.00 29.33 ? 1159 PHE B CA    1 
ATOM   3574  C  C     . PHE B  1 186 ? 3.958   13.968  13.574  1.00 30.93 ? 1159 PHE B C     1 
ATOM   3575  O  O     . PHE B  1 186 ? 3.949   14.854  12.708  1.00 28.91 ? 1159 PHE B O     1 
ATOM   3576  C  CB    . PHE B  1 186 ? 2.605   11.998  12.798  1.00 31.31 ? 1159 PHE B CB    1 
ATOM   3577  C  CG    . PHE B  1 186 ? 1.427   11.061  12.993  1.00 29.77 ? 1159 PHE B CG    1 
ATOM   3578  C  CD1   . PHE B  1 186 ? 0.185   11.350  12.427  1.00 33.25 ? 1159 PHE B CD1   1 
ATOM   3579  C  CD2   . PHE B  1 186 ? 1.576   9.873   13.702  1.00 30.57 ? 1159 PHE B CD2   1 
ATOM   3580  C  CE1   . PHE B  1 186 ? -0.895  10.488  12.590  1.00 31.69 ? 1159 PHE B CE1   1 
ATOM   3581  C  CE2   . PHE B  1 186 ? 0.506   8.996   13.868  1.00 25.03 ? 1159 PHE B CE2   1 
ATOM   3582  C  CZ    . PHE B  1 186 ? -0.732  9.302   13.311  1.00 33.18 ? 1159 PHE B CZ    1 
ATOM   3583  N  N     . TYR B  1 187 ? 5.024   13.686  14.317  1.00 33.94 ? 1160 TYR B N     1 
ATOM   3584  C  CA    . TYR B  1 187 ? 6.222   14.530  14.323  1.00 34.59 ? 1160 TYR B CA    1 
ATOM   3585  C  C     . TYR B  1 187 ? 7.409   13.776  13.752  1.00 34.57 ? 1160 TYR B C     1 
ATOM   3586  O  O     . TYR B  1 187 ? 8.551   14.248  13.785  1.00 28.24 ? 1160 TYR B O     1 
ATOM   3587  C  CB    . TYR B  1 187 ? 6.506   15.032  15.745  1.00 36.93 ? 1160 TYR B CB    1 
ATOM   3588  C  CG    . TYR B  1 187 ? 5.423   15.939  16.292  1.00 32.79 ? 1160 TYR B CG    1 
ATOM   3589  C  CD1   . TYR B  1 187 ? 5.518   17.324  16.166  1.00 41.47 ? 1160 TYR B CD1   1 
ATOM   3590  C  CD2   . TYR B  1 187 ? 4.299   15.411  16.924  1.00 37.41 ? 1160 TYR B CD2   1 
ATOM   3591  C  CE1   . TYR B  1 187 ? 4.523   18.164  16.660  1.00 44.24 ? 1160 TYR B CE1   1 
ATOM   3592  C  CE2   . TYR B  1 187 ? 3.296   16.240  17.423  1.00 45.32 ? 1160 TYR B CE2   1 
ATOM   3593  C  CZ    . TYR B  1 187 ? 3.415   17.614  17.291  1.00 48.28 ? 1160 TYR B CZ    1 
ATOM   3594  O  OH    . TYR B  1 187 ? 2.426   18.436  17.791  1.00 48.03 ? 1160 TYR B OH    1 
ATOM   3595  N  N     . THR B  1 188 ? 7.102   12.598  13.213  1.00 37.50 ? 1161 THR B N     1 
ATOM   3596  C  CA    . THR B  1 188 ? 8.060   11.752  12.517  1.00 36.90 ? 1161 THR B CA    1 
ATOM   3597  C  C     . THR B  1 188 ? 7.445   11.302  11.188  1.00 33.18 ? 1161 THR B C     1 
ATOM   3598  O  O     . THR B  1 188 ? 6.259   10.972  11.126  1.00 26.87 ? 1161 THR B O     1 
ATOM   3599  C  CB    . THR B  1 188 ? 8.431   10.528  13.391  1.00 36.65 ? 1161 THR B CB    1 
ATOM   3600  O  OG1   . THR B  1 188 ? 8.911   10.981  14.661  1.00 48.55 ? 1161 THR B OG1   1 
ATOM   3601  C  CG2   . THR B  1 188 ? 9.513   9.693   12.744  1.00 46.38 ? 1161 THR B CG2   1 
ATOM   3602  N  N     . PHE B  1 189 ? 8.245   11.315  10.124  1.00 35.21 ? 1162 PHE B N     1 
ATOM   3603  C  CA    . PHE B  1 189 ? 7.839   10.703  8.860   1.00 37.07 ? 1162 PHE B CA    1 
ATOM   3604  C  C     . PHE B  1 189 ? 8.383   9.278   8.774   1.00 36.48 ? 1162 PHE B C     1 
ATOM   3605  O  O     . PHE B  1 189 ? 9.594   9.067   8.828   1.00 39.78 ? 1162 PHE B O     1 
ATOM   3606  C  CB    . PHE B  1 189 ? 8.265   11.540  7.644   1.00 34.83 ? 1162 PHE B CB    1 
ATOM   3607  C  CG    . PHE B  1 189 ? 7.817   10.955  6.327   1.00 35.29 ? 1162 PHE B CG    1 
ATOM   3608  C  CD1   . PHE B  1 189 ? 6.461   10.754  6.061   1.00 29.16 ? 1162 PHE B CD1   1 
ATOM   3609  C  CD2   . PHE B  1 189 ? 8.745   10.596  5.358   1.00 33.45 ? 1162 PHE B CD2   1 
ATOM   3610  C  CE1   . PHE B  1 189 ? 6.042   10.207  4.848   1.00 26.64 ? 1162 PHE B CE1   1 
ATOM   3611  C  CE2   . PHE B  1 189 ? 8.334   10.063  4.142   1.00 23.82 ? 1162 PHE B CE2   1 
ATOM   3612  C  CZ    . PHE B  1 189 ? 6.979   9.862   3.893   1.00 28.87 ? 1162 PHE B CZ    1 
ATOM   3613  N  N     . CYS B  1 190 ? 7.473   8.313   8.647   1.00 38.75 ? 1163 CYS B N     1 
ATOM   3614  C  CA    . CYS B  1 190 ? 7.791   6.889   8.806   1.00 39.66 ? 1163 CYS B CA    1 
ATOM   3615  C  C     . CYS B  1 190 ? 7.544   6.085   7.533   1.00 39.89 ? 1163 CYS B C     1 
ATOM   3616  O  O     . CYS B  1 190 ? 7.363   4.862   7.584   1.00 40.02 ? 1163 CYS B O     1 
ATOM   3617  C  CB    . CYS B  1 190 ? 6.962   6.289   9.948   1.00 36.33 ? 1163 CYS B CB    1 
ATOM   3618  S  SG    . CYS B  1 190 ? 7.230   7.036   11.577  1.00 43.98 ? 1163 CYS B SG    1 
ATOM   3619  N  N     . GLY B  1 191 ? 7.536   6.774   6.396   1.00 39.20 ? 1164 GLY B N     1 
ATOM   3620  C  CA    . GLY B  1 191 ? 7.260   6.140   5.112   1.00 35.12 ? 1164 GLY B CA    1 
ATOM   3621  C  C     . GLY B  1 191 ? 8.376   6.297   4.100   1.00 33.46 ? 1164 GLY B C     1 
ATOM   3622  O  O     . GLY B  1 191 ? 9.531   6.507   4.461   1.00 30.26 ? 1164 GLY B O     1 
ATOM   3623  N  N     . THR B  1 192 ? 8.000   6.200   2.829   1.00 33.55 ? 1165 THR B N     1 
ATOM   3624  C  CA    . THR B  1 192 ? 8.917   6.240   1.700   1.00 30.17 ? 1165 THR B CA    1 
ATOM   3625  C  C     . THR B  1 192 ? 8.937   7.658   1.132   1.00 31.59 ? 1165 THR B C     1 
ATOM   3626  O  O     . THR B  1 192 ? 7.890   8.215   0.792   1.00 32.46 ? 1165 THR B O     1 
ATOM   3627  C  CB    . THR B  1 192 ? 8.485   5.203   0.623   1.00 32.03 ? 1165 THR B CB    1 
ATOM   3628  O  OG1   . THR B  1 192 ? 8.346   3.917   1.238   1.00 23.63 ? 1165 THR B OG1   1 
ATOM   3629  C  CG2   . THR B  1 192 ? 9.502   5.098   -0.507  1.00 25.32 ? 1165 THR B CG2   1 
ATOM   3630  N  N     . ILE B  1 193 ? 10.133  8.238   1.044   1.00 32.15 ? 1166 ILE B N     1 
ATOM   3631  C  CA    . ILE B  1 193 ? 10.292  9.661   0.729   1.00 30.55 ? 1166 ILE B CA    1 
ATOM   3632  C  C     . ILE B  1 193 ? 9.740   10.050  -0.655  1.00 29.61 ? 1166 ILE B C     1 
ATOM   3633  O  O     . ILE B  1 193 ? 9.300   11.185  -0.865  1.00 28.75 ? 1166 ILE B O     1 
ATOM   3634  C  CB    . ILE B  1 193 ? 11.773  10.134  0.966   1.00 34.60 ? 1166 ILE B CB    1 
ATOM   3635  C  CG1   . ILE B  1 193 ? 11.822  11.599  1.415   1.00 34.02 ? 1166 ILE B CG1   1 
ATOM   3636  C  CG2   . ILE B  1 193 ? 12.689  9.849   -0.244  1.00 38.24 ? 1166 ILE B CG2   1 
ATOM   3637  C  CD1   . ILE B  1 193 ? 11.515  11.807  2.885   1.00 31.94 ? 1166 ILE B CD1   1 
ATOM   3638  N  N     . GLU B  1 194 ? 9.736   9.085   -1.574  1.00 31.94 ? 1167 GLU B N     1 
ATOM   3639  C  CA    . GLU B  1 194 ? 9.182   9.251   -2.922  1.00 31.61 ? 1167 GLU B CA    1 
ATOM   3640  C  C     . GLU B  1 194 ? 7.654   9.396   -2.925  1.00 29.49 ? 1167 GLU B C     1 
ATOM   3641  O  O     . GLU B  1 194 ? 7.063   9.874   -3.900  1.00 27.85 ? 1167 GLU B O     1 
ATOM   3642  C  CB    . GLU B  1 194 ? 9.603   8.077   -3.819  1.00 33.93 ? 1167 GLU B CB    1 
ATOM   3643  C  CG    . GLU B  1 194 ? 11.094  8.056   -4.196  1.00 41.38 ? 1167 GLU B CG    1 
ATOM   3644  C  CD    . GLU B  1 194 ? 11.990  7.465   -3.105  1.00 53.16 ? 1167 GLU B CD    1 
ATOM   3645  O  OE1   . GLU B  1 194 ? 11.544  6.554   -2.377  1.00 49.91 ? 1167 GLU B OE1   1 
ATOM   3646  O  OE2   . GLU B  1 194 ? 13.154  7.909   -2.978  1.00 58.14 ? 1167 GLU B OE2   1 
ATOM   3647  N  N     . TYR B  1 195 ? 7.030   8.993   -1.821  1.00 30.21 ? 1168 TYR B N     1 
ATOM   3648  C  CA    . TYR B  1 195 ? 5.576   9.054   -1.653  1.00 30.47 ? 1168 TYR B CA    1 
ATOM   3649  C  C     . TYR B  1 195 ? 5.139   10.182  -0.712  1.00 29.56 ? 1168 TYR B C     1 
ATOM   3650  O  O     . TYR B  1 195 ? 3.976   10.282  -0.317  1.00 29.03 ? 1168 TYR B O     1 
ATOM   3651  C  CB    . TYR B  1 195 ? 5.068   7.687   -1.183  1.00 27.02 ? 1168 TYR B CB    1 
ATOM   3652  C  CG    . TYR B  1 195 ? 5.078   6.673   -2.301  1.00 20.61 ? 1168 TYR B CG    1 
ATOM   3653  C  CD1   . TYR B  1 195 ? 6.269   6.096   -2.737  1.00 20.34 ? 1168 TYR B CD1   1 
ATOM   3654  C  CD2   . TYR B  1 195 ? 3.895   6.324   -2.958  1.00 14.71 ? 1168 TYR B CD2   1 
ATOM   3655  C  CE1   . TYR B  1 195 ? 6.282   5.171   -3.790  1.00 28.92 ? 1168 TYR B CE1   1 
ATOM   3656  C  CE2   . TYR B  1 195 ? 3.899   5.410   -4.000  1.00 25.08 ? 1168 TYR B CE2   1 
ATOM   3657  C  CZ    . TYR B  1 195 ? 5.092   4.833   -4.412  1.00 24.53 ? 1168 TYR B CZ    1 
ATOM   3658  O  OH    . TYR B  1 195 ? 5.074   3.923   -5.450  1.00 25.93 ? 1168 TYR B OH    1 
ATOM   3659  N  N     . CYS B  1 196 ? 6.086   11.057  -0.401  1.00 28.51 ? 1169 CYS B N     1 
ATOM   3660  C  CA    . CYS B  1 196 ? 5.897   12.082  0.604   1.00 25.76 ? 1169 CYS B CA    1 
ATOM   3661  C  C     . CYS B  1 196 ? 5.364   13.392  0.037   1.00 23.37 ? 1169 CYS B C     1 
ATOM   3662  O  O     . CYS B  1 196 ? 5.886   13.913  -0.953  1.00 27.83 ? 1169 CYS B O     1 
ATOM   3663  C  CB    . CYS B  1 196 ? 7.202   12.311  1.354   1.00 23.48 ? 1169 CYS B CB    1 
ATOM   3664  S  SG    . CYS B  1 196 ? 7.005   13.227  2.843   1.00 33.31 ? 1169 CYS B SG    1 
ATOM   3665  N  N     . ALA B  1 197 ? 4.323   13.910  0.693   1.00 17.54 ? 1170 ALA B N     1 
ATOM   3666  C  CA    . ALA B  1 197 ? 3.656   15.147  0.313   1.00 21.54 ? 1170 ALA B CA    1 
ATOM   3667  C  C     . ALA B  1 197 ? 4.581   16.359  0.508   1.00 26.02 ? 1170 ALA B C     1 
ATOM   3668  O  O     . ALA B  1 197 ? 5.449   16.329  1.384   1.00 20.54 ? 1170 ALA B O     1 
ATOM   3669  C  CB    . ALA B  1 197 ? 2.379   15.310  1.126   1.00 17.14 ? 1170 ALA B CB    1 
ATOM   3670  N  N     . PRO B  1 198 ? 4.403   17.420  -0.315  1.00 30.38 ? 1171 PRO B N     1 
ATOM   3671  C  CA    . PRO B  1 198 ? 5.254   18.627  -0.240  1.00 33.36 ? 1171 PRO B CA    1 
ATOM   3672  C  C     . PRO B  1 198 ? 5.297   19.269  1.152   1.00 33.51 ? 1171 PRO B C     1 
ATOM   3673  O  O     . PRO B  1 198 ? 6.358   19.712  1.583   1.00 35.43 ? 1171 PRO B O     1 
ATOM   3674  C  CB    . PRO B  1 198 ? 4.599   19.599  -1.236  1.00 31.58 ? 1171 PRO B CB    1 
ATOM   3675  C  CG    . PRO B  1 198 ? 3.768   18.768  -2.116  1.00 22.11 ? 1171 PRO B CG    1 
ATOM   3676  C  CD    . PRO B  1 198 ? 3.377   17.534  -1.368  1.00 27.44 ? 1171 PRO B CD    1 
ATOM   3677  N  N     . GLU B  1 199 ? 4.155   19.310  1.841   1.00 34.61 ? 1172 GLU B N     1 
ATOM   3678  C  CA    . GLU B  1 199 ? 4.061   19.967  3.147   1.00 31.13 ? 1172 GLU B CA    1 
ATOM   3679  C  C     . GLU B  1 199 ? 4.873   19.243  4.221   1.00 34.59 ? 1172 GLU B C     1 
ATOM   3680  O  O     . GLU B  1 199 ? 5.262   19.848  5.220   1.00 31.14 ? 1172 GLU B O     1 
ATOM   3681  C  CB    . GLU B  1 199 ? 2.594   20.163  3.579   1.00 32.80 ? 1172 GLU B CB    1 
ATOM   3682  C  CG    . GLU B  1 199 ? 1.825   18.896  4.000   1.00 33.73 ? 1172 GLU B CG    1 
ATOM   3683  C  CD    . GLU B  1 199 ? 1.181   18.134  2.835   1.00 25.95 ? 1172 GLU B CD    1 
ATOM   3684  O  OE1   . GLU B  1 199 ? 1.457   18.464  1.663   1.00 20.51 ? 1172 GLU B OE1   1 
ATOM   3685  O  OE2   . GLU B  1 199 ? 0.399   17.191  3.098   1.00 26.65 ? 1172 GLU B OE2   1 
ATOM   3686  N  N     . VAL B  1 200 ? 5.146   17.955  3.989   1.00 31.70 ? 1173 VAL B N     1 
ATOM   3687  C  CA    . VAL B  1 200 ? 5.863   17.116  4.950   1.00 26.61 ? 1173 VAL B CA    1 
ATOM   3688  C  C     . VAL B  1 200 ? 7.364   17.062  4.663   1.00 28.34 ? 1173 VAL B C     1 
ATOM   3689  O  O     . VAL B  1 200 ? 8.168   16.972  5.585   1.00 33.06 ? 1173 VAL B O     1 
ATOM   3690  C  CB    . VAL B  1 200 ? 5.236   15.697  5.041   1.00 29.03 ? 1173 VAL B CB    1 
ATOM   3691  C  CG1   . VAL B  1 200 ? 6.055   14.792  5.932   1.00 17.88 ? 1173 VAL B CG1   1 
ATOM   3692  C  CG2   . VAL B  1 200 ? 3.824   15.796  5.584   1.00 26.06 ? 1173 VAL B CG2   1 
ATOM   3693  N  N     . LEU B  1 201 ? 7.733   17.141  3.386   1.00 30.00 ? 1174 LEU B N     1 
ATOM   3694  C  CA    . LEU B  1 201 ? 9.125   17.268  2.986   1.00 32.30 ? 1174 LEU B CA    1 
ATOM   3695  C  C     . LEU B  1 201 ? 9.704   18.613  3.461   1.00 33.19 ? 1174 LEU B C     1 
ATOM   3696  O  O     . LEU B  1 201 ? 10.919  18.802  3.505   1.00 34.02 ? 1174 LEU B O     1 
ATOM   3697  C  CB    . LEU B  1 201 ? 9.257   17.132  1.468   1.00 29.40 ? 1174 LEU B CB    1 
ATOM   3698  C  CG    . LEU B  1 201 ? 8.897   15.813  0.767   1.00 38.34 ? 1174 LEU B CG    1 
ATOM   3699  C  CD1   . LEU B  1 201 ? 8.699   16.033  -0.715  1.00 27.00 ? 1174 LEU B CD1   1 
ATOM   3700  C  CD2   . LEU B  1 201 ? 9.941   14.736  0.989   1.00 36.49 ? 1174 LEU B CD2   1 
ATOM   3701  N  N     . MET B  1 202 ? 8.814   19.528  3.831   1.00 35.22 ? 1175 MET B N     1 
ATOM   3702  C  CA    . MET B  1 202 ? 9.190   20.841  4.338   1.00 38.07 ? 1175 MET B CA    1 
ATOM   3703  C  C     . MET B  1 202 ? 9.161   20.935  5.870   1.00 36.20 ? 1175 MET B C     1 
ATOM   3704  O  O     . MET B  1 202 ? 9.233   22.030  6.433   1.00 35.24 ? 1175 MET B O     1 
ATOM   3705  C  CB    . MET B  1 202 ? 8.316   21.917  3.700   1.00 34.48 ? 1175 MET B CB    1 
ATOM   3706  C  CG    . MET B  1 202 ? 8.614   22.088  2.233   1.00 40.26 ? 1175 MET B CG    1 
ATOM   3707  S  SD    . MET B  1 202 ? 8.158   23.700  1.620   1.00 44.33 ? 1175 MET B SD    1 
ATOM   3708  C  CE    . MET B  1 202 ? 9.325   23.887  0.274   1.00 40.06 ? 1175 MET B CE    1 
ATOM   3709  N  N     . GLY B  1 203 ? 9.051   19.779  6.524   1.00 32.11 ? 1176 GLY B N     1 
ATOM   3710  C  CA    . GLY B  1 203 ? 9.235   19.665  7.970   1.00 29.95 ? 1176 GLY B CA    1 
ATOM   3711  C  C     . GLY B  1 203 ? 7.999   19.946  8.796   1.00 30.68 ? 1176 GLY B C     1 
ATOM   3712  O  O     . GLY B  1 203 ? 8.093   20.164  10.011  1.00 31.06 ? 1176 GLY B O     1 
ATOM   3713  N  N     . ASN B  1 204 ? 6.839   19.949  8.146   1.00 30.97 ? 1177 ASN B N     1 
ATOM   3714  C  CA    . ASN B  1 204 ? 5.577   20.182  8.841   1.00 36.08 ? 1177 ASN B CA    1 
ATOM   3715  C  C     . ASN B  1 204 ? 4.944   18.892  9.351   1.00 40.05 ? 1177 ASN B C     1 
ATOM   3716  O  O     . ASN B  1 204 ? 4.671   17.977  8.564   1.00 43.28 ? 1177 ASN B O     1 
ATOM   3717  C  CB    . ASN B  1 204 ? 4.587   20.944  7.960   1.00 36.48 ? 1177 ASN B CB    1 
ATOM   3718  C  CG    . ASN B  1 204 ? 5.081   22.328  7.590   1.00 45.37 ? 1177 ASN B CG    1 
ATOM   3719  O  OD1   . ASN B  1 204 ? 5.255   23.192  8.454   1.00 50.39 ? 1177 ASN B OD1   1 
ATOM   3720  N  ND2   . ASN B  1 204 ? 5.302   22.550  6.300   1.00 40.67 ? 1177 ASN B ND2   1 
ATOM   3721  N  N     . PRO B  1 205 ? 4.735   18.805  10.680  1.00 40.04 ? 1178 PRO B N     1 
ATOM   3722  C  CA    . PRO B  1 205 ? 3.957   17.740  11.308  1.00 38.84 ? 1178 PRO B CA    1 
ATOM   3723  C  C     . PRO B  1 205 ? 2.575   17.551  10.660  1.00 35.66 ? 1178 PRO B C     1 
ATOM   3724  O  O     . PRO B  1 205 ? 1.903   18.523  10.318  1.00 33.65 ? 1178 PRO B O     1 
ATOM   3725  C  CB    . PRO B  1 205 ? 3.824   18.226  12.752  1.00 40.66 ? 1178 PRO B CB    1 
ATOM   3726  C  CG    . PRO B  1 205 ? 5.067   19.002  12.977  1.00 39.20 ? 1178 PRO B CG    1 
ATOM   3727  C  CD    . PRO B  1 205 ? 5.288   19.735  11.686  1.00 38.80 ? 1178 PRO B CD    1 
ATOM   3728  N  N     . TYR B  1 206 ? 2.165   16.296  10.496  1.00 35.92 ? 1179 TYR B N     1 
ATOM   3729  C  CA    . TYR B  1 206 ? 0.982   15.977  9.697   1.00 31.93 ? 1179 TYR B CA    1 
ATOM   3730  C  C     . TYR B  1 206 ? -0.139  15.350  10.514  1.00 27.89 ? 1179 TYR B C     1 
ATOM   3731  O  O     . TYR B  1 206 ? 0.107   14.686  11.514  1.00 25.96 ? 1179 TYR B O     1 
ATOM   3732  C  CB    . TYR B  1 206 ? 1.356   15.085  8.502   1.00 30.23 ? 1179 TYR B CB    1 
ATOM   3733  C  CG    . TYR B  1 206 ? 1.995   13.768  8.884   1.00 24.76 ? 1179 TYR B CG    1 
ATOM   3734  C  CD1   . TYR B  1 206 ? 3.367   13.679  9.112   1.00 21.25 ? 1179 TYR B CD1   1 
ATOM   3735  C  CD2   . TYR B  1 206 ? 1.227   12.612  9.010   1.00 25.05 ? 1179 TYR B CD2   1 
ATOM   3736  C  CE1   . TYR B  1 206 ? 3.953   12.481  9.466   1.00 32.74 ? 1179 TYR B CE1   1 
ATOM   3737  C  CE2   . TYR B  1 206 ? 1.801   11.404  9.357   1.00 22.74 ? 1179 TYR B CE2   1 
ATOM   3738  C  CZ    . TYR B  1 206 ? 3.165   11.346  9.585   1.00 34.79 ? 1179 TYR B CZ    1 
ATOM   3739  O  OH    . TYR B  1 206 ? 3.740   10.156  9.943   1.00 38.45 ? 1179 TYR B OH    1 
ATOM   3740  N  N     . ARG B  1 207 ? -1.368  15.576  10.065  1.00 29.80 ? 1180 ARG B N     1 
ATOM   3741  C  CA    . ARG B  1 207 ? -2.552  14.952  10.649  1.00 32.17 ? 1180 ARG B CA    1 
ATOM   3742  C  C     . ARG B  1 207 ? -2.682  13.481  10.217  1.00 31.31 ? 1180 ARG B C     1 
ATOM   3743  O  O     . ARG B  1 207 ? -2.916  12.604  11.049  1.00 26.87 ? 1180 ARG B O     1 
ATOM   3744  C  CB    . ARG B  1 207 ? -3.797  15.753  10.247  1.00 34.00 ? 1180 ARG B CB    1 
ATOM   3745  C  CG    . ARG B  1 207 ? -5.062  15.392  10.971  1.00 31.83 ? 1180 ARG B CG    1 
ATOM   3746  C  CD    . ARG B  1 207 ? -6.185  16.329  10.554  1.00 34.74 ? 1180 ARG B CD    1 
ATOM   3747  N  NE    . ARG B  1 207 ? -7.412  15.590  10.268  1.00 36.35 ? 1180 ARG B NE    1 
ATOM   3748  C  CZ    . ARG B  1 207 ? -7.944  15.454  9.055   1.00 37.58 ? 1180 ARG B CZ    1 
ATOM   3749  N  NH1   . ARG B  1 207 ? -7.376  16.021  8.002   1.00 30.23 ? 1180 ARG B NH1   1 
ATOM   3750  N  NH2   . ARG B  1 207 ? -9.059  14.755  8.895   1.00 46.70 ? 1180 ARG B NH2   1 
ATOM   3751  N  N     . GLY B  1 208 ? -2.528  13.219  8.919   1.00 29.99 ? 1181 GLY B N     1 
ATOM   3752  C  CA    . GLY B  1 208 ? -2.649  11.858  8.392   1.00 23.53 ? 1181 GLY B CA    1 
ATOM   3753  C  C     . GLY B  1 208 ? -3.281  11.807  7.014   1.00 21.78 ? 1181 GLY B C     1 
ATOM   3754  O  O     . GLY B  1 208 ? -2.578  11.600  6.029   1.00 23.43 ? 1181 GLY B O     1 
ATOM   3755  N  N     . PRO B  1 209 ? -4.617  12.000  6.938   1.00 22.50 ? 1182 PRO B N     1 
ATOM   3756  C  CA    . PRO B  1 209 ? -5.409  11.917  5.711   1.00 21.75 ? 1182 PRO B CA    1 
ATOM   3757  C  C     . PRO B  1 209 ? -4.806  12.598  4.483   1.00 26.76 ? 1182 PRO B C     1 
ATOM   3758  O  O     . PRO B  1 209 ? -4.769  11.985  3.412   1.00 29.69 ? 1182 PRO B O     1 
ATOM   3759  C  CB    . PRO B  1 209 ? -6.720  12.603  6.115   1.00 18.87 ? 1182 PRO B CB    1 
ATOM   3760  C  CG    . PRO B  1 209 ? -6.870  12.235  7.510   1.00 13.89 ? 1182 PRO B CG    1 
ATOM   3761  C  CD    . PRO B  1 209 ? -5.484  12.304  8.095   1.00 17.96 ? 1182 PRO B CD    1 
ATOM   3762  N  N     . GLU B  1 210 ? -4.348  13.845  4.632   1.00 22.05 ? 1183 GLU B N     1 
ATOM   3763  C  CA    . GLU B  1 210 ? -3.813  14.615  3.498   1.00 26.96 ? 1183 GLU B CA    1 
ATOM   3764  C  C     . GLU B  1 210 ? -2.567  13.977  2.903   1.00 22.77 ? 1183 GLU B C     1 
ATOM   3765  O  O     . GLU B  1 210 ? -2.407  13.959  1.686   1.00 25.63 ? 1183 GLU B O     1 
ATOM   3766  C  CB    . GLU B  1 210 ? -3.517  16.073  3.883   1.00 30.03 ? 1183 GLU B CB    1 
ATOM   3767  C  CG    . GLU B  1 210 ? -4.749  16.902  4.295   1.00 32.99 ? 1183 GLU B CG    1 
ATOM   3768  C  CD    . GLU B  1 210 ? -4.989  16.942  5.804   1.00 40.74 ? 1183 GLU B CD    1 
ATOM   3769  O  OE1   . GLU B  1 210 ? -4.170  16.406  6.585   1.00 28.91 ? 1183 GLU B OE1   1 
ATOM   3770  O  OE2   . GLU B  1 210 ? -6.012  17.533  6.212   1.00 48.07 ? 1183 GLU B OE2   1 
ATOM   3771  N  N     . LEU B  1 211 ? -1.697  13.456  3.767   1.00 24.67 ? 1184 LEU B N     1 
ATOM   3772  C  CA    . LEU B  1 211 ? -0.473  12.768  3.339   1.00 26.50 ? 1184 LEU B CA    1 
ATOM   3773  C  C     . LEU B  1 211 ? -0.778  11.395  2.707   1.00 21.85 ? 1184 LEU B C     1 
ATOM   3774  O  O     . LEU B  1 211 ? -0.144  11.006  1.734   1.00 21.14 ? 1184 LEU B O     1 
ATOM   3775  C  CB    . LEU B  1 211 ? 0.506   12.644  4.510   1.00 25.86 ? 1184 LEU B CB    1 
ATOM   3776  C  CG    . LEU B  1 211 ? 1.794   11.842  4.302   1.00 24.20 ? 1184 LEU B CG    1 
ATOM   3777  C  CD1   . LEU B  1 211 ? 2.830   12.628  3.507   1.00 24.74 ? 1184 LEU B CD1   1 
ATOM   3778  C  CD2   . LEU B  1 211 ? 2.353   11.403  5.642   1.00 14.73 ? 1184 LEU B CD2   1 
ATOM   3779  N  N     . GLU B  1 212 ? -1.751  10.679  3.266   1.00 21.12 ? 1185 GLU B N     1 
ATOM   3780  C  CA    . GLU B  1 212 ? -2.264  9.440   2.672   1.00 18.82 ? 1185 GLU B CA    1 
ATOM   3781  C  C     . GLU B  1 212 ? -2.762  9.676   1.246   1.00 18.08 ? 1185 GLU B C     1 
ATOM   3782  O  O     . GLU B  1 212 ? -2.452  8.908   0.338   1.00 21.36 ? 1185 GLU B O     1 
ATOM   3783  C  CB    . GLU B  1 212 ? -3.389  8.876   3.549   1.00 21.73 ? 1185 GLU B CB    1 
ATOM   3784  C  CG    . GLU B  1 212 ? -4.007  7.564   3.069   1.00 16.45 ? 1185 GLU B CG    1 
ATOM   3785  C  CD    . GLU B  1 212 ? -4.873  6.933   4.135   1.00 27.98 ? 1185 GLU B CD    1 
ATOM   3786  O  OE1   . GLU B  1 212 ? -6.032  7.374   4.284   1.00 35.19 ? 1185 GLU B OE1   1 
ATOM   3787  O  OE2   . GLU B  1 212 ? -4.401  5.997   4.828   1.00 30.36 ? 1185 GLU B OE2   1 
ATOM   3788  N  N     . MET B  1 213 ? -3.513  10.762  1.061   1.00 19.54 ? 1186 MET B N     1 
ATOM   3789  C  CA    . MET B  1 213 ? -4.107  11.115  -0.226  1.00 18.37 ? 1186 MET B CA    1 
ATOM   3790  C  C     . MET B  1 213 ? -3.086  11.423  -1.301  1.00 21.27 ? 1186 MET B C     1 
ATOM   3791  O  O     . MET B  1 213 ? -3.274  11.028  -2.457  1.00 21.59 ? 1186 MET B O     1 
ATOM   3792  C  CB    . MET B  1 213 ? -5.084  12.284  -0.079  1.00 18.51 ? 1186 MET B CB    1 
ATOM   3793  C  CG    . MET B  1 213 ? -6.242  12.035  0.904   1.00 21.81 ? 1186 MET B CG    1 
ATOM   3794  S  SD    . MET B  1 213 ? -7.108  10.458  0.739   1.00 24.53 ? 1186 MET B SD    1 
ATOM   3795  C  CE    . MET B  1 213 ? -7.593  10.494  -0.976  1.00 19.67 ? 1186 MET B CE    1 
ATOM   3796  N  N     . TRP B  1 214 ? -2.024  12.143  -0.920  1.00 19.33 ? 1187 TRP B N     1 
ATOM   3797  C  CA    . TRP B  1 214 ? -0.878  12.359  -1.791  1.00 17.35 ? 1187 TRP B CA    1 
ATOM   3798  C  C     . TRP B  1 214 ? -0.234  11.039  -2.224  1.00 16.01 ? 1187 TRP B C     1 
ATOM   3799  O  O     . TRP B  1 214 ? 0.090   10.859  -3.405  1.00 17.66 ? 1187 TRP B O     1 
ATOM   3800  C  CB    . TRP B  1 214 ? 0.173   13.263  -1.123  1.00 16.98 ? 1187 TRP B CB    1 
ATOM   3801  C  CG    . TRP B  1 214 ? 1.401   13.468  -1.998  1.00 13.46 ? 1187 TRP B CG    1 
ATOM   3802  C  CD1   . TRP B  1 214 ? 2.499   12.664  -2.062  1.00 19.04 ? 1187 TRP B CD1   1 
ATOM   3803  C  CD2   . TRP B  1 214 ? 1.636   14.536  -2.928  1.00 16.74 ? 1187 TRP B CD2   1 
ATOM   3804  N  NE1   . TRP B  1 214 ? 3.399   13.161  -2.960  1.00 14.26 ? 1187 TRP B NE1   1 
ATOM   3805  C  CE2   . TRP B  1 214 ? 2.901   14.308  -3.509  1.00 15.11 ? 1187 TRP B CE2   1 
ATOM   3806  C  CE3   . TRP B  1 214 ? 0.903   15.667  -3.323  1.00 22.95 ? 1187 TRP B CE3   1 
ATOM   3807  C  CZ2   . TRP B  1 214 ? 3.455   15.165  -4.469  1.00 22.73 ? 1187 TRP B CZ2   1 
ATOM   3808  C  CZ3   . TRP B  1 214 ? 1.456   16.527  -4.278  1.00 20.45 ? 1187 TRP B CZ3   1 
ATOM   3809  C  CH2   . TRP B  1 214 ? 2.720   16.267  -4.841  1.00 21.51 ? 1187 TRP B CH2   1 
ATOM   3810  N  N     . SER B  1 215 ? -0.026  10.135  -1.262  1.00 17.08 ? 1188 SER B N     1 
ATOM   3811  C  CA    . SER B  1 215 ? 0.583   8.826   -1.532  1.00 18.90 ? 1188 SER B CA    1 
ATOM   3812  C  C     . SER B  1 215 ? -0.280  7.949   -2.463  1.00 18.37 ? 1188 SER B C     1 
ATOM   3813  O  O     . SER B  1 215 ? 0.256   7.133   -3.219  1.00 20.38 ? 1188 SER B O     1 
ATOM   3814  C  CB    . SER B  1 215 ? 0.915   8.103   -0.219  1.00 16.61 ? 1188 SER B CB    1 
ATOM   3815  O  OG    . SER B  1 215 ? -0.252  7.564   0.398   1.00 23.83 ? 1188 SER B OG    1 
ATOM   3816  N  N     . LEU B  1 216 ? -1.603  8.122   -2.402  1.00 18.08 ? 1189 LEU B N     1 
ATOM   3817  C  CA    . LEU B  1 216 ? -2.545  7.475   -3.343  1.00 18.61 ? 1189 LEU B CA    1 
ATOM   3818  C  C     . LEU B  1 216 ? -2.400  8.009   -4.760  1.00 20.41 ? 1189 LEU B C     1 
ATOM   3819  O  O     . LEU B  1 216 ? -2.529  7.253   -5.736  1.00 21.00 ? 1189 LEU B O     1 
ATOM   3820  C  CB    . LEU B  1 216 ? -4.004  7.627   -2.880  1.00 15.91 ? 1189 LEU B CB    1 
ATOM   3821  C  CG    . LEU B  1 216 ? -4.389  6.768   -1.674  1.00 19.49 ? 1189 LEU B CG    1 
ATOM   3822  C  CD1   . LEU B  1 216 ? -5.732  7.186   -1.116  1.00 21.26 ? 1189 LEU B CD1   1 
ATOM   3823  C  CD2   . LEU B  1 216 ? -4.408  5.290   -2.039  1.00 19.30 ? 1189 LEU B CD2   1 
ATOM   3824  N  N     . GLY B  1 217 ? -2.133  9.312   -4.863  1.00 21.49 ? 1190 GLY B N     1 
ATOM   3825  C  CA    . GLY B  1 217 ? -1.793  9.945   -6.130  1.00 15.66 ? 1190 GLY B CA    1 
ATOM   3826  C  C     . GLY B  1 217 ? -0.533  9.388   -6.761  1.00 18.00 ? 1190 GLY B C     1 
ATOM   3827  O  O     . GLY B  1 217 ? -0.524  9.103   -7.958  1.00 21.56 ? 1190 GLY B O     1 
ATOM   3828  N  N     . VAL B  1 218 ? 0.531   9.238   -5.967  1.00 17.62 ? 1191 VAL B N     1 
ATOM   3829  C  CA    . VAL B  1 218 ? 1.805   8.686   -6.463  1.00 16.90 ? 1191 VAL B CA    1 
ATOM   3830  C  C     . VAL B  1 218 ? 1.674   7.204   -6.860  1.00 19.91 ? 1191 VAL B C     1 
ATOM   3831  O  O     . VAL B  1 218 ? 2.258   6.762   -7.848  1.00 18.72 ? 1191 VAL B O     1 
ATOM   3832  C  CB    . VAL B  1 218 ? 2.978   8.838   -5.442  1.00 16.63 ? 1191 VAL B CB    1 
ATOM   3833  C  CG1   . VAL B  1 218 ? 4.311   8.394   -6.071  1.00 2.72  ? 1191 VAL B CG1   1 
ATOM   3834  C  CG2   . VAL B  1 218 ? 3.096   10.274  -4.927  1.00 23.41 ? 1191 VAL B CG2   1 
ATOM   3835  N  N     . THR B  1 219 ? 0.937   6.443   -6.058  1.00 19.62 ? 1192 THR B N     1 
ATOM   3836  C  CA    . THR B  1 219 ? 0.681   5.031   -6.333  1.00 19.94 ? 1192 THR B CA    1 
ATOM   3837  C  C     . THR B  1 219 ? -0.109  4.900   -7.643  1.00 22.57 ? 1192 THR B C     1 
ATOM   3838  O  O     . THR B  1 219 ? 0.225   4.071   -8.507  1.00 18.57 ? 1192 THR B O     1 
ATOM   3839  C  CB    . THR B  1 219 ? -0.094  4.383   -5.163  1.00 16.37 ? 1192 THR B CB    1 
ATOM   3840  O  OG1   . THR B  1 219 ? 0.630   4.594   -3.942  1.00 19.76 ? 1192 THR B OG1   1 
ATOM   3841  C  CG2   . THR B  1 219 ? -0.287  2.896   -5.375  1.00 18.48 ? 1192 THR B CG2   1 
ATOM   3842  N  N     . LEU B  1 220 ? -1.139  5.739   -7.786  1.00 24.77 ? 1193 LEU B N     1 
ATOM   3843  C  CA    . LEU B  1 220 ? -1.956  5.771   -8.995  1.00 23.43 ? 1193 LEU B CA    1 
ATOM   3844  C  C     . LEU B  1 220 ? -1.151  6.175   -10.222 1.00 25.30 ? 1193 LEU B C     1 
ATOM   3845  O  O     . LEU B  1 220 ? -1.228  5.501   -11.246 1.00 28.54 ? 1193 LEU B O     1 
ATOM   3846  C  CB    . LEU B  1 220 ? -3.147  6.711   -8.832  1.00 25.04 ? 1193 LEU B CB    1 
ATOM   3847  C  CG    . LEU B  1 220 ? -4.078  6.939   -10.029 1.00 29.88 ? 1193 LEU B CG    1 
ATOM   3848  C  CD1   . LEU B  1 220 ? -4.797  5.641   -10.476 1.00 24.52 ? 1193 LEU B CD1   1 
ATOM   3849  C  CD2   . LEU B  1 220 ? -5.076  8.006   -9.665  1.00 22.63 ? 1193 LEU B CD2   1 
ATOM   3850  N  N     . TYR B  1 221 ? -0.406  7.281   -10.124 1.00 21.19 ? 1194 TYR B N     1 
ATOM   3851  C  CA    . TYR B  1 221 ? 0.411   7.749   -11.236 1.00 21.70 ? 1194 TYR B CA    1 
ATOM   3852  C  C     . TYR B  1 221 ? 1.407   6.668   -11.652 1.00 22.71 ? 1194 TYR B C     1 
ATOM   3853  O  O     . TYR B  1 221 ? 1.612   6.449   -12.844 1.00 24.73 ? 1194 TYR B O     1 
ATOM   3854  C  CB    . TYR B  1 221 ? 1.122   9.070   -10.899 1.00 22.04 ? 1194 TYR B CB    1 
ATOM   3855  C  CG    . TYR B  1 221 ? 1.918   9.669   -12.048 1.00 22.31 ? 1194 TYR B CG    1 
ATOM   3856  C  CD1   . TYR B  1 221 ? 3.076   9.050   -12.514 1.00 22.15 ? 1194 TYR B CD1   1 
ATOM   3857  C  CD2   . TYR B  1 221 ? 1.526   10.868  -12.656 1.00 25.69 ? 1194 TYR B CD2   1 
ATOM   3858  C  CE1   . TYR B  1 221 ? 3.821   9.587   -13.564 1.00 11.72 ? 1194 TYR B CE1   1 
ATOM   3859  C  CE2   . TYR B  1 221 ? 2.273   11.414  -13.715 1.00 19.15 ? 1194 TYR B CE2   1 
ATOM   3860  C  CZ    . TYR B  1 221 ? 3.414   10.760  -14.156 1.00 12.31 ? 1194 TYR B CZ    1 
ATOM   3861  O  OH    . TYR B  1 221 ? 4.173   11.266  -15.185 1.00 22.28 ? 1194 TYR B OH    1 
ATOM   3862  N  N     . THR B  1 222 ? 1.998   5.983   -10.672 1.00 20.72 ? 1195 THR B N     1 
ATOM   3863  C  CA    . THR B  1 222 ? 2.944   4.886   -10.945 1.00 23.22 ? 1195 THR B CA    1 
ATOM   3864  C  C     . THR B  1 222 ? 2.318   3.679   -11.663 1.00 23.10 ? 1195 THR B C     1 
ATOM   3865  O  O     . THR B  1 222 ? 2.928   3.108   -12.560 1.00 26.08 ? 1195 THR B O     1 
ATOM   3866  C  CB    . THR B  1 222 ? 3.709   4.435   -9.666  1.00 18.64 ? 1195 THR B CB    1 
ATOM   3867  O  OG1   . THR B  1 222 ? 4.259   5.587   -9.015  1.00 27.46 ? 1195 THR B OG1   1 
ATOM   3868  C  CG2   . THR B  1 222 ? 4.864   3.505   -10.033 1.00 18.25 ? 1195 THR B CG2   1 
ATOM   3869  N  N     . LEU B  1 223 ? 1.106   3.305   -11.269 1.00 28.02 ? 1196 LEU B N     1 
ATOM   3870  C  CA    . LEU B  1 223 ? 0.415   2.158   -11.856 1.00 26.63 ? 1196 LEU B CA    1 
ATOM   3871  C  C     . LEU B  1 223 ? 0.091   2.411   -13.319 1.00 28.13 ? 1196 LEU B C     1 
ATOM   3872  O  O     . LEU B  1 223 ? 0.389   1.583   -14.182 1.00 25.04 ? 1196 LEU B O     1 
ATOM   3873  C  CB    . LEU B  1 223 ? -0.860  1.834   -11.057 1.00 28.55 ? 1196 LEU B CB    1 
ATOM   3874  C  CG    . LEU B  1 223 ? -1.745  0.650   -11.481 1.00 31.23 ? 1196 LEU B CG    1 
ATOM   3875  C  CD1   . LEU B  1 223 ? -1.048  -0.688  -11.221 1.00 33.06 ? 1196 LEU B CD1   1 
ATOM   3876  C  CD2   . LEU B  1 223 ? -3.115  0.708   -10.787 1.00 24.87 ? 1196 LEU B CD2   1 
ATOM   3877  N  N     . VAL B  1 224 ? -0.493  3.575   -13.598 1.00 31.92 ? 1197 VAL B N     1 
ATOM   3878  C  CA    . VAL B  1 224 ? -0.896  3.925   -14.960 1.00 32.99 ? 1197 VAL B CA    1 
ATOM   3879  C  C     . VAL B  1 224 ? 0.289   4.293   -15.866 1.00 35.33 ? 1197 VAL B C     1 
ATOM   3880  O  O     . VAL B  1 224 ? 0.431   3.737   -16.963 1.00 30.63 ? 1197 VAL B O     1 
ATOM   3881  C  CB    . VAL B  1 224 ? -2.031  4.994   -14.991 1.00 33.55 ? 1197 VAL B CB    1 
ATOM   3882  C  CG1   . VAL B  1 224 ? -3.293  4.444   -14.330 1.00 36.95 ? 1197 VAL B CG1   1 
ATOM   3883  C  CG2   . VAL B  1 224 ? -1.615  6.272   -14.295 1.00 41.80 ? 1197 VAL B CG2   1 
ATOM   3884  N  N     . PHE B  1 225 ? 1.144   5.208   -15.397 1.00 33.97 ? 1198 PHE B N     1 
ATOM   3885  C  CA    . PHE B  1 225 ? 2.200   5.778   -16.238 1.00 32.35 ? 1198 PHE B CA    1 
ATOM   3886  C  C     . PHE B  1 225 ? 3.526   5.044   -16.131 1.00 32.73 ? 1198 PHE B C     1 
ATOM   3887  O  O     . PHE B  1 225 ? 4.466   5.368   -16.859 1.00 36.52 ? 1198 PHE B O     1 
ATOM   3888  C  CB    . PHE B  1 225 ? 2.370   7.284   -15.977 1.00 31.18 ? 1198 PHE B CB    1 
ATOM   3889  C  CG    . PHE B  1 225 ? 1.139   8.092   -16.293 1.00 27.26 ? 1198 PHE B CG    1 
ATOM   3890  C  CD1   . PHE B  1 225 ? 0.644   8.151   -17.589 1.00 21.00 ? 1198 PHE B CD1   1 
ATOM   3891  C  CD2   . PHE B  1 225 ? 0.470   8.778   -15.294 1.00 13.88 ? 1198 PHE B CD2   1 
ATOM   3892  C  CE1   . PHE B  1 225 ? -0.502  8.875   -17.878 1.00 24.65 ? 1198 PHE B CE1   1 
ATOM   3893  C  CE2   . PHE B  1 225 ? -0.677  9.507   -15.569 1.00 23.30 ? 1198 PHE B CE2   1 
ATOM   3894  C  CZ    . PHE B  1 225 ? -1.167  9.556   -16.864 1.00 28.58 ? 1198 PHE B CZ    1 
ATOM   3895  N  N     . GLU B  1 226 ? 3.587   4.068   -15.222 1.00 33.02 ? 1199 GLU B N     1 
ATOM   3896  C  CA    . GLU B  1 226 ? 4.743   3.171   -15.038 1.00 34.16 ? 1199 GLU B CA    1 
ATOM   3897  C  C     . GLU B  1 226 ? 6.060   3.872   -14.718 1.00 36.10 ? 1199 GLU B C     1 
ATOM   3898  O  O     . GLU B  1 226 ? 7.138   3.348   -14.996 1.00 39.22 ? 1199 GLU B O     1 
ATOM   3899  C  CB    . GLU B  1 226 ? 4.911   2.230   -16.232 1.00 33.35 ? 1199 GLU B CB    1 
ATOM   3900  C  CG    . GLU B  1 226 ? 3.883   1.124   -16.278 1.00 39.07 ? 1199 GLU B CG    1 
ATOM   3901  C  CD    . GLU B  1 226 ? 4.089   0.189   -17.452 1.00 43.23 ? 1199 GLU B CD    1 
ATOM   3902  O  OE1   . GLU B  1 226 ? 5.244   0.040   -17.916 1.00 45.59 ? 1199 GLU B OE1   1 
ATOM   3903  O  OE2   . GLU B  1 226 ? 3.094   -0.405  -17.908 1.00 32.99 ? 1199 GLU B OE2   1 
ATOM   3904  N  N     . GLU B  1 227 ? 5.952   5.056   -14.126 1.00 36.85 ? 1200 GLU B N     1 
ATOM   3905  C  CA    . GLU B  1 227 ? 7.099   5.836   -13.672 1.00 34.50 ? 1200 GLU B CA    1 
ATOM   3906  C  C     . GLU B  1 227 ? 6.631   6.716   -12.533 1.00 29.21 ? 1200 GLU B C     1 
ATOM   3907  O  O     . GLU B  1 227 ? 5.438   6.986   -12.411 1.00 31.60 ? 1200 GLU B O     1 
ATOM   3908  C  CB    . GLU B  1 227 ? 7.653   6.704   -14.807 1.00 34.26 ? 1200 GLU B CB    1 
ATOM   3909  C  CG    . GLU B  1 227 ? 6.647   7.675   -15.411 1.00 28.01 ? 1200 GLU B CG    1 
ATOM   3910  C  CD    . GLU B  1 227 ? 7.215   8.453   -16.576 1.00 38.70 ? 1200 GLU B CD    1 
ATOM   3911  O  OE1   . GLU B  1 227 ? 7.452   9.665   -16.411 1.00 41.59 ? 1200 GLU B OE1   1 
ATOM   3912  O  OE2   . GLU B  1 227 ? 7.431   7.854   -17.654 1.00 51.23 ? 1200 GLU B OE2   1 
ATOM   3913  N  N     . ASN B  1 228 ? 7.563   7.159   -11.697 1.00 32.44 ? 1201 ASN B N     1 
ATOM   3914  C  CA    . ASN B  1 228 ? 7.234   8.108   -10.639 1.00 29.60 ? 1201 ASN B CA    1 
ATOM   3915  C  C     . ASN B  1 228 ? 6.955   9.487   -11.211 1.00 26.47 ? 1201 ASN B C     1 
ATOM   3916  O  O     . ASN B  1 228 ? 7.575   9.881   -12.200 1.00 24.80 ? 1201 ASN B O     1 
ATOM   3917  C  CB    . ASN B  1 228 ? 8.328   8.159   -9.573  1.00 37.26 ? 1201 ASN B CB    1 
ATOM   3918  C  CG    . ASN B  1 228 ? 7.983   7.327   -8.352  1.00 44.57 ? 1201 ASN B CG    1 
ATOM   3919  O  OD1   . ASN B  1 228 ? 7.422   7.838   -7.378  1.00 52.75 ? 1201 ASN B OD1   1 
ATOM   3920  N  ND2   . ASN B  1 228 ? 8.295   6.038   -8.404  1.00 45.73 ? 1201 ASN B ND2   1 
ATOM   3921  N  N     . PRO B  1 229 ? 6.007   10.224  -10.603 1.00 25.36 ? 1202 PRO B N     1 
ATOM   3922  C  CA    . PRO B  1 229 ? 5.659   11.535  -11.147 1.00 28.35 ? 1202 PRO B CA    1 
ATOM   3923  C  C     . PRO B  1 229 ? 6.795   12.564  -11.028 1.00 32.68 ? 1202 PRO B C     1 
ATOM   3924  O  O     . PRO B  1 229 ? 6.855   13.497  -11.828 1.00 34.97 ? 1202 PRO B O     1 
ATOM   3925  C  CB    . PRO B  1 229 ? 4.454   11.972  -10.305 1.00 27.88 ? 1202 PRO B CB    1 
ATOM   3926  C  CG    . PRO B  1 229 ? 4.098   10.827  -9.444  1.00 15.60 ? 1202 PRO B CG    1 
ATOM   3927  C  CD    . PRO B  1 229 ? 5.248   9.903   -9.384  1.00 17.50 ? 1202 PRO B CD    1 
ATOM   3928  N  N     . PHE B  1 230 ? 7.678   12.389  -10.045 1.00 37.12 ? 1203 PHE B N     1 
ATOM   3929  C  CA    . PHE B  1 230 ? 8.736   13.368  -9.767  1.00 40.08 ? 1203 PHE B CA    1 
ATOM   3930  C  C     . PHE B  1 230 ? 10.112  12.732  -9.617  1.00 44.25 ? 1203 PHE B C     1 
ATOM   3931  O  O     . PHE B  1 230 ? 10.331  11.900  -8.728  1.00 45.77 ? 1203 PHE B O     1 
ATOM   3932  C  CB    . PHE B  1 230 ? 8.388   14.193  -8.522  1.00 36.41 ? 1203 PHE B CB    1 
ATOM   3933  C  CG    . PHE B  1 230 ? 6.973   14.690  -8.509  1.00 28.70 ? 1203 PHE B CG    1 
ATOM   3934  C  CD1   . PHE B  1 230 ? 6.574   15.709  -9.366  1.00 28.33 ? 1203 PHE B CD1   1 
ATOM   3935  C  CD2   . PHE B  1 230 ? 6.035   14.122  -7.657  1.00 29.16 ? 1203 PHE B CD2   1 
ATOM   3936  C  CE1   . PHE B  1 230 ? 5.267   16.159  -9.371  1.00 26.21 ? 1203 PHE B CE1   1 
ATOM   3937  C  CE2   . PHE B  1 230 ? 4.720   14.556  -7.656  1.00 21.32 ? 1203 PHE B CE2   1 
ATOM   3938  C  CZ    . PHE B  1 230 ? 4.333   15.584  -8.511  1.00 33.85 ? 1203 PHE B CZ    1 
ATOM   3939  N  N     . CYS B  1 231 ? 11.028  13.124  -10.502 1.00 48.69 ? 1204 CYS B N     1 
ATOM   3940  C  CA    . CYS B  1 231 ? 12.425  12.668  -10.459 1.00 54.82 ? 1204 CYS B CA    1 
ATOM   3941  C  C     . CYS B  1 231 ? 13.143  13.147  -9.196  1.00 52.28 ? 1204 CYS B C     1 
ATOM   3942  O  O     . CYS B  1 231 ? 13.866  12.383  -8.555  1.00 49.38 ? 1204 CYS B O     1 
ATOM   3943  C  CB    . CYS B  1 231 ? 13.193  13.157  -11.689 1.00 54.94 ? 1204 CYS B CB    1 
ATOM   3944  S  SG    . CYS B  1 231 ? 12.663  12.418  -13.235 1.00 70.26 ? 1204 CYS B SG    1 
ATOM   3945  N  N     . GLU B  1 232 ? 12.932  14.417  -8.857  1.00 52.37 ? 1205 GLU B N     1 
ATOM   3946  C  CA    . GLU B  1 232 ? 13.556  15.030  -7.694  1.00 49.64 ? 1205 GLU B CA    1 
ATOM   3947  C  C     . GLU B  1 232 ? 12.523  15.315  -6.616  1.00 48.65 ? 1205 GLU B C     1 
ATOM   3948  O  O     . GLU B  1 232 ? 11.364  15.630  -6.912  1.00 46.26 ? 1205 GLU B O     1 
ATOM   3949  C  CB    . GLU B  1 232 ? 14.277  16.319  -8.092  1.00 51.05 ? 1205 GLU B CB    1 
ATOM   3950  N  N     . LEU B  1 233 ? 12.969  15.208  -5.367  1.00 50.01 ? 1206 LEU B N     1 
ATOM   3951  C  CA    . LEU B  1 233 ? 12.133  15.390  -4.177  1.00 48.99 ? 1206 LEU B CA    1 
ATOM   3952  C  C     . LEU B  1 233 ? 11.542  16.797  -4.067  1.00 47.73 ? 1206 LEU B C     1 
ATOM   3953  O  O     . LEU B  1 233 ? 10.395  16.956  -3.649  1.00 49.00 ? 1206 LEU B O     1 
ATOM   3954  C  CB    . LEU B  1 233 ? 12.956  15.073  -2.927  1.00 48.52 ? 1206 LEU B CB    1 
ATOM   3955  C  CG    . LEU B  1 233 ? 12.359  14.240  -1.795  1.00 50.81 ? 1206 LEU B CG    1 
ATOM   3956  C  CD1   . LEU B  1 233 ? 12.156  12.787  -2.214  1.00 46.26 ? 1206 LEU B CD1   1 
ATOM   3957  C  CD2   . LEU B  1 233 ? 13.263  14.322  -0.576  1.00 49.27 ? 1206 LEU B CD2   1 
ATOM   3958  N  N     . GLU B  1 234 ? 12.322  17.808  -4.448  1.00 44.85 ? 1207 GLU B N     1 
ATOM   3959  C  CA    . GLU B  1 234 ? 11.887  19.209  -4.366  1.00 44.79 ? 1207 GLU B CA    1 
ATOM   3960  C  C     . GLU B  1 234 ? 10.902  19.614  -5.455  1.00 43.47 ? 1207 GLU B C     1 
ATOM   3961  O  O     . GLU B  1 234 ? 10.093  20.516  -5.246  1.00 42.10 ? 1207 GLU B O     1 
ATOM   3962  C  CB    . GLU B  1 234 ? 13.088  20.151  -4.405  1.00 46.52 ? 1207 GLU B CB    1 
ATOM   3963  C  CG    . GLU B  1 234 ? 13.791  20.330  -3.066  1.00 45.25 ? 1207 GLU B CG    1 
ATOM   3964  C  CD    . GLU B  1 234 ? 15.063  21.143  -3.182  1.00 45.57 ? 1207 GLU B CD    1 
ATOM   3965  O  OE1   . GLU B  1 234 ? 15.621  21.238  -4.295  1.00 54.71 ? 1207 GLU B OE1   1 
ATOM   3966  O  OE2   . GLU B  1 234 ? 15.523  21.682  -2.157  1.00 49.18 ? 1207 GLU B OE2   1 
ATOM   3967  N  N     . GLU B  1 235 ? 10.978  18.952  -6.611  1.00 46.93 ? 1208 GLU B N     1 
ATOM   3968  C  CA    . GLU B  1 235 ? 10.076  19.219  -7.745  1.00 48.33 ? 1208 GLU B CA    1 
ATOM   3969  C  C     . GLU B  1 235 ? 8.645   18.776  -7.441  1.00 46.84 ? 1208 GLU B C     1 
ATOM   3970  O  O     . GLU B  1 235 ? 7.789   18.748  -8.326  1.00 47.52 ? 1208 GLU B O     1 
ATOM   3971  C  CB    . GLU B  1 235 ? 10.587  18.537  -9.023  1.00 50.81 ? 1208 GLU B CB    1 
ATOM   3972  N  N     . THR B  1 236 ? 8.417   18.440  -6.174  1.00 43.27 ? 1209 THR B N     1 
ATOM   3973  C  CA    . THR B  1 236 ? 7.139   17.988  -5.657  1.00 47.37 ? 1209 THR B CA    1 
ATOM   3974  C  C     . THR B  1 236 ? 6.281   19.170  -5.164  1.00 48.49 ? 1209 THR B C     1 
ATOM   3975  O  O     . THR B  1 236 ? 5.044   19.118  -5.241  1.00 46.76 ? 1209 THR B O     1 
ATOM   3976  C  CB    . THR B  1 236 ? 7.372   16.925  -4.534  1.00 49.70 ? 1209 THR B CB    1 
ATOM   3977  O  OG1   . THR B  1 236 ? 7.533   15.627  -5.122  1.00 38.88 ? 1209 THR B OG1   1 
ATOM   3978  C  CG2   . THR B  1 236 ? 6.234   16.874  -3.556  1.00 50.92 ? 1209 THR B CG2   1 
ATOM   3979  N  N     . VAL B  1 237 ? 6.943   20.226  -4.681  1.00 45.03 ? 1210 VAL B N     1 
ATOM   3980  C  CA    . VAL B  1 237 ? 6.258   21.423  -4.153  1.00 44.82 ? 1210 VAL B CA    1 
ATOM   3981  C  C     . VAL B  1 237 ? 5.447   22.203  -5.204  1.00 43.73 ? 1210 VAL B C     1 
ATOM   3982  O  O     . VAL B  1 237 ? 4.400   22.770  -4.879  1.00 43.44 ? 1210 VAL B O     1 
ATOM   3983  C  CB    . VAL B  1 237 ? 7.218   22.379  -3.351  1.00 46.51 ? 1210 VAL B CB    1 
ATOM   3984  C  CG1   . VAL B  1 237 ? 8.017   21.600  -2.303  1.00 49.33 ? 1210 VAL B CG1   1 
ATOM   3985  C  CG2   . VAL B  1 237 ? 8.155   23.136  -4.264  1.00 48.48 ? 1210 VAL B CG2   1 
ATOM   3986  N  N     . GLU B  1 238 ? 5.936   22.226  -6.445  1.00 43.45 ? 1211 GLU B N     1 
ATOM   3987  C  CA    . GLU B  1 238 ? 5.192   22.785  -7.579  1.00 44.65 ? 1211 GLU B CA    1 
ATOM   3988  C  C     . GLU B  1 238 ? 4.261   21.739  -8.180  1.00 45.95 ? 1211 GLU B C     1 
ATOM   3989  O  O     . GLU B  1 238 ? 3.207   22.080  -8.730  1.00 46.91 ? 1211 GLU B O     1 
ATOM   3990  C  CB    . GLU B  1 238 ? 6.145   23.305  -8.662  1.00 46.29 ? 1211 GLU B CB    1 
ATOM   3991  N  N     . ALA B  1 239 ? 4.671   20.473  -8.079  1.00 46.93 ? 1212 ALA B N     1 
ATOM   3992  C  CA    . ALA B  1 239 ? 3.894   19.306  -8.532  1.00 46.56 ? 1212 ALA B CA    1 
ATOM   3993  C  C     . ALA B  1 239 ? 3.454   19.338  -10.002 1.00 48.28 ? 1212 ALA B C     1 
ATOM   3994  O  O     . ALA B  1 239 ? 2.339   18.913  -10.336 1.00 47.66 ? 1212 ALA B O     1 
ATOM   3995  C  CB    . ALA B  1 239 ? 2.697   19.053  -7.607  1.00 42.90 ? 1212 ALA B CB    1 
ATOM   3996  N  N     . ALA B  1 240 ? 4.339   19.834  -10.867 1.00 48.41 ? 1213 ALA B N     1 
ATOM   3997  C  CA    . ALA B  1 240 ? 4.102   19.862  -12.311 1.00 49.23 ? 1213 ALA B CA    1 
ATOM   3998  C  C     . ALA B  1 240 ? 4.314   18.472  -12.912 1.00 49.07 ? 1213 ALA B C     1 
ATOM   3999  O  O     . ALA B  1 240 ? 5.435   17.947  -12.911 1.00 47.92 ? 1213 ALA B O     1 
ATOM   4000  C  CB    . ALA B  1 240 ? 5.020   20.886  -12.985 1.00 49.19 ? 1213 ALA B CB    1 
ATOM   4001  N  N     . ILE B  1 241 ? 3.235   17.881  -13.421 1.00 49.58 ? 1214 ILE B N     1 
ATOM   4002  C  CA    . ILE B  1 241 ? 3.296   16.531  -13.988 1.00 52.39 ? 1214 ILE B CA    1 
ATOM   4003  C  C     . ILE B  1 241 ? 3.081   16.512  -15.504 1.00 51.33 ? 1214 ILE B C     1 
ATOM   4004  O  O     . ILE B  1 241 ? 2.110   17.075  -16.019 1.00 52.56 ? 1214 ILE B O     1 
ATOM   4005  C  CB    . ILE B  1 241 ? 2.317   15.533  -13.284 1.00 53.04 ? 1214 ILE B CB    1 
ATOM   4006  C  CG1   . ILE B  1 241 ? 0.863   16.026  -13.352 1.00 55.95 ? 1214 ILE B CG1   1 
ATOM   4007  C  CG2   . ILE B  1 241 ? 2.746   15.287  -11.837 1.00 55.37 ? 1214 ILE B CG2   1 
ATOM   4008  C  CD1   . ILE B  1 241 ? -0.167  14.915  -13.338 1.00 46.65 ? 1214 ILE B CD1   1 
ATOM   4009  N  N     . HIS B  1 242 ? 4.001   15.863  -16.211 1.00 49.69 ? 1215 HIS B N     1 
ATOM   4010  C  CA    . HIS B  1 242 ? 3.861   15.686  -17.652 1.00 48.49 ? 1215 HIS B CA    1 
ATOM   4011  C  C     . HIS B  1 242 ? 3.828   14.194  -17.989 1.00 44.87 ? 1215 HIS B C     1 
ATOM   4012  O  O     . HIS B  1 242 ? 4.878   13.568  -18.196 1.00 42.49 ? 1215 HIS B O     1 
ATOM   4013  C  CB    . HIS B  1 242 ? 4.947   16.456  -18.417 1.00 51.78 ? 1215 HIS B CB    1 
ATOM   4014  C  CG    . HIS B  1 242 ? 4.861   17.943  -18.239 1.00 52.99 ? 1215 HIS B CG    1 
ATOM   4015  N  ND1   . HIS B  1 242 ? 4.286   18.775  -19.176 1.00 59.03 ? 1215 HIS B ND1   1 
ATOM   4016  C  CD2   . HIS B  1 242 ? 5.260   18.744  -17.221 1.00 55.69 ? 1215 HIS B CD2   1 
ATOM   4017  C  CE1   . HIS B  1 242 ? 4.344   20.025  -18.749 1.00 56.97 ? 1215 HIS B CE1   1 
ATOM   4018  N  NE2   . HIS B  1 242 ? 4.930   20.034  -17.566 1.00 56.46 ? 1215 HIS B NE2   1 
ATOM   4019  N  N     . PRO B  1 243 ? 2.605   13.619  -18.018 1.00 40.03 ? 1216 PRO B N     1 
ATOM   4020  C  CA    . PRO B  1 243 ? 2.351   12.185  -18.217 1.00 38.27 ? 1216 PRO B CA    1 
ATOM   4021  C  C     . PRO B  1 243 ? 2.857   11.689  -19.569 1.00 34.43 ? 1216 PRO B C     1 
ATOM   4022  O  O     . PRO B  1 243 ? 2.616   12.341  -20.586 1.00 31.77 ? 1216 PRO B O     1 
ATOM   4023  C  CB    . PRO B  1 243 ? 0.822   12.085  -18.157 1.00 36.62 ? 1216 PRO B CB    1 
ATOM   4024  C  CG    . PRO B  1 243 ? 0.379   13.311  -17.442 1.00 33.33 ? 1216 PRO B CG    1 
ATOM   4025  C  CD    . PRO B  1 243 ? 1.346   14.368  -17.851 1.00 38.66 ? 1216 PRO B CD    1 
ATOM   4026  N  N     . PRO B  1 244 ? 3.564   10.542  -19.576 1.00 31.60 ? 1217 PRO B N     1 
ATOM   4027  C  CA    . PRO B  1 244 ? 4.171   9.982   -20.787 1.00 30.97 ? 1217 PRO B CA    1 
ATOM   4028  C  C     . PRO B  1 244 ? 3.142   9.447   -21.787 1.00 30.13 ? 1217 PRO B C     1 
ATOM   4029  O  O     . PRO B  1 244 ? 3.439   9.339   -22.983 1.00 29.98 ? 1217 PRO B O     1 
ATOM   4030  C  CB    . PRO B  1 244 ? 5.027   8.832   -20.246 1.00 32.10 ? 1217 PRO B CB    1 
ATOM   4031  C  CG    . PRO B  1 244 ? 4.363   8.430   -18.979 1.00 27.64 ? 1217 PRO B CG    1 
ATOM   4032  C  CD    . PRO B  1 244 ? 3.826   9.702   -18.392 1.00 27.76 ? 1217 PRO B CD    1 
ATOM   4033  N  N     . TYR B  1 245 ? 1.948   9.129   -21.290 1.00 30.64 ? 1218 TYR B N     1 
ATOM   4034  C  CA    . TYR B  1 245 ? 0.892   8.512   -22.084 1.00 29.32 ? 1218 TYR B CA    1 
ATOM   4035  C  C     . TYR B  1 245 ? -0.285  9.450   -22.257 1.00 34.76 ? 1218 TYR B C     1 
ATOM   4036  O  O     . TYR B  1 245 ? -0.529  10.321  -21.420 1.00 37.30 ? 1218 TYR B O     1 
ATOM   4037  C  CB    . TYR B  1 245 ? 0.366   7.239   -21.406 1.00 21.92 ? 1218 TYR B CB    1 
ATOM   4038  C  CG    . TYR B  1 245 ? 1.391   6.170   -21.082 1.00 18.33 ? 1218 TYR B CG    1 
ATOM   4039  C  CD1   . TYR B  1 245 ? 2.582   6.062   -21.798 1.00 23.99 ? 1218 TYR B CD1   1 
ATOM   4040  C  CD2   . TYR B  1 245 ? 1.138   5.231   -20.085 1.00 26.47 ? 1218 TYR B CD2   1 
ATOM   4041  C  CE1   . TYR B  1 245 ? 3.516   5.074   -21.506 1.00 25.82 ? 1218 TYR B CE1   1 
ATOM   4042  C  CE2   . TYR B  1 245 ? 2.063   4.229   -19.787 1.00 30.11 ? 1218 TYR B CE2   1 
ATOM   4043  C  CZ    . TYR B  1 245 ? 3.244   4.157   -20.502 1.00 23.77 ? 1218 TYR B CZ    1 
ATOM   4044  O  OH    . TYR B  1 245 ? 4.148   3.166   -20.219 1.00 23.95 ? 1218 TYR B OH    1 
ATOM   4045  N  N     . LEU B  1 246 ? -1.025  9.241   -23.341 1.00 36.89 ? 1219 LEU B N     1 
ATOM   4046  C  CA    . LEU B  1 246 ? -2.322  9.866   -23.539 1.00 41.89 ? 1219 LEU B CA    1 
ATOM   4047  C  C     . LEU B  1 246 ? -3.404  9.074   -22.791 1.00 38.83 ? 1219 LEU B C     1 
ATOM   4048  O  O     . LEU B  1 246 ? -3.559  7.866   -22.994 1.00 34.08 ? 1219 LEU B O     1 
ATOM   4049  C  CB    . LEU B  1 246 ? -2.631  9.936   -25.039 1.00 44.50 ? 1219 LEU B CB    1 
ATOM   4050  C  CG    . LEU B  1 246 ? -3.737  10.839  -25.577 1.00 41.95 ? 1219 LEU B CG    1 
ATOM   4051  C  CD1   . LEU B  1 246 ? -3.570  12.282  -25.126 1.00 43.54 ? 1219 LEU B CD1   1 
ATOM   4052  C  CD2   . LEU B  1 246 ? -3.743  10.743  -27.100 1.00 43.99 ? 1219 LEU B CD2   1 
ATOM   4053  N  N     . VAL B  1 247 ? -4.126  9.764   -21.911 1.00 38.25 ? 1220 VAL B N     1 
ATOM   4054  C  CA    . VAL B  1 247 ? -5.189  9.164   -21.102 1.00 38.68 ? 1220 VAL B CA    1 
ATOM   4055  C  C     . VAL B  1 247 ? -6.420  10.063  -21.129 1.00 41.54 ? 1220 VAL B C     1 
ATOM   4056  O  O     . VAL B  1 247 ? -6.402  11.116  -21.773 1.00 44.38 ? 1220 VAL B O     1 
ATOM   4057  C  CB    . VAL B  1 247 ? -4.749  8.928   -19.618 1.00 39.48 ? 1220 VAL B CB    1 
ATOM   4058  C  CG1   . VAL B  1 247 ? -3.583  7.953   -19.541 1.00 37.19 ? 1220 VAL B CG1   1 
ATOM   4059  C  CG2   . VAL B  1 247 ? -4.410  10.247  -18.910 1.00 35.01 ? 1220 VAL B CG2   1 
ATOM   4060  N  N     . SER B  1 248 ? -7.471  9.661   -20.415 1.00 40.27 ? 1221 SER B N     1 
ATOM   4061  C  CA    . SER B  1 248 ? -8.712  10.430  -20.356 1.00 41.48 ? 1221 SER B CA    1 
ATOM   4062  C  C     . SER B  1 248 ? -8.570  11.716  -19.538 1.00 45.01 ? 1221 SER B C     1 
ATOM   4063  O  O     . SER B  1 248 ? -7.633  11.863  -18.751 1.00 46.59 ? 1221 SER B O     1 
ATOM   4064  C  CB    . SER B  1 248 ? -9.848  9.574   -19.789 1.00 41.46 ? 1221 SER B CB    1 
ATOM   4065  O  OG    . SER B  1 248 ? -9.751  9.460   -18.381 1.00 40.60 ? 1221 SER B OG    1 
ATOM   4066  N  N     . LYS B  1 249 ? -9.505  12.643  -19.744 1.00 45.69 ? 1222 LYS B N     1 
ATOM   4067  C  CA    . LYS B  1 249 ? -9.606  13.856  -18.929 1.00 45.12 ? 1222 LYS B CA    1 
ATOM   4068  C  C     . LYS B  1 249 ? -9.955  13.480  -17.500 1.00 42.97 ? 1222 LYS B C     1 
ATOM   4069  O  O     . LYS B  1 249 ? -9.533  14.151  -16.559 1.00 42.61 ? 1222 LYS B O     1 
ATOM   4070  C  CB    . LYS B  1 249 ? -10.678 14.803  -19.485 1.00 41.11 ? 1222 LYS B CB    1 
ATOM   4071  N  N     . GLU B  1 250 ? -10.727 12.399  -17.361 1.00 44.37 ? 1223 GLU B N     1 
ATOM   4072  C  CA    . GLU B  1 250 ? -11.228 11.911  -16.070 1.00 42.69 ? 1223 GLU B CA    1 
ATOM   4073  C  C     . GLU B  1 250 ? -10.112 11.378  -15.170 1.00 36.32 ? 1223 GLU B C     1 
ATOM   4074  O  O     . GLU B  1 250 ? -10.113 11.639  -13.966 1.00 36.62 ? 1223 GLU B O     1 
ATOM   4075  C  CB    . GLU B  1 250 ? -12.314 10.839  -16.268 1.00 45.50 ? 1223 GLU B CB    1 
ATOM   4076  C  CG    . GLU B  1 250 ? -13.669 11.371  -16.785 1.00 51.49 ? 1223 GLU B CG    1 
ATOM   4077  C  CD    . GLU B  1 250 ? -13.694 11.643  -18.291 1.00 43.70 ? 1223 GLU B CD    1 
ATOM   4078  O  OE1   . GLU B  1 250 ? -12.928 11.000  -19.033 1.00 39.54 ? 1223 GLU B OE1   1 
ATOM   4079  O  OE2   . GLU B  1 250 ? -14.491 12.501  -18.734 1.00 53.76 ? 1223 GLU B OE2   1 
ATOM   4080  N  N     . LEU B  1 251 ? -9.177  10.630  -15.753 1.00 30.60 ? 1224 LEU B N     1 
ATOM   4081  C  CA    . LEU B  1 251 ? -7.962  10.221  -15.039 1.00 32.30 ? 1224 LEU B CA    1 
ATOM   4082  C  C     . LEU B  1 251 ? -7.072  11.416  -14.684 1.00 34.04 ? 1224 LEU B C     1 
ATOM   4083  O  O     . LEU B  1 251 ? -6.619  11.526  -13.546 1.00 33.03 ? 1224 LEU B O     1 
ATOM   4084  C  CB    . LEU B  1 251 ? -7.162  9.178   -15.831 1.00 27.53 ? 1224 LEU B CB    1 
ATOM   4085  C  CG    . LEU B  1 251 ? -5.936  8.518   -15.172 1.00 28.80 ? 1224 LEU B CG    1 
ATOM   4086  C  CD1   . LEU B  1 251 ? -6.194  8.082   -13.729 1.00 27.31 ? 1224 LEU B CD1   1 
ATOM   4087  C  CD2   . LEU B  1 251 ? -5.478  7.333   -15.996 1.00 26.41 ? 1224 LEU B CD2   1 
ATOM   4088  N  N     . MET B  1 252 ? -6.828  12.299  -15.657 1.00 36.25 ? 1225 MET B N     1 
ATOM   4089  C  CA    . MET B  1 252 ? -6.017  13.505  -15.429 1.00 36.27 ? 1225 MET B CA    1 
ATOM   4090  C  C     . MET B  1 252 ? -6.494  14.350  -14.256 1.00 30.67 ? 1225 MET B C     1 
ATOM   4091  O  O     . MET B  1 252 ? -5.686  14.744  -13.429 1.00 30.32 ? 1225 MET B O     1 
ATOM   4092  C  CB    . MET B  1 252 ? -5.896  14.366  -16.693 1.00 32.94 ? 1225 MET B CB    1 
ATOM   4093  C  CG    . MET B  1 252 ? -4.827  13.898  -17.676 1.00 47.38 ? 1225 MET B CG    1 
ATOM   4094  S  SD    . MET B  1 252 ? -3.172  13.617  -16.978 1.00 51.96 ? 1225 MET B SD    1 
ATOM   4095  C  CE    . MET B  1 252 ? -2.743  15.257  -16.378 1.00 52.86 ? 1225 MET B CE    1 
ATOM   4096  N  N     . SER B  1 253 ? -7.801  14.605  -14.174 1.00 35.56 ? 1226 SER B N     1 
ATOM   4097  C  CA    . SER B  1 253 ? -8.359  15.417  -13.084 1.00 36.96 ? 1226 SER B CA    1 
ATOM   4098  C  C     . SER B  1 253 ? -8.242  14.711  -11.739 1.00 35.66 ? 1226 SER B C     1 
ATOM   4099  O  O     . SER B  1 253 ? -8.039  15.355  -10.705 1.00 36.57 ? 1226 SER B O     1 
ATOM   4100  C  CB    . SER B  1 253 ? -9.812  15.819  -13.368 1.00 39.39 ? 1226 SER B CB    1 
ATOM   4101  O  OG    . SER B  1 253 ? -10.712 14.743  -13.160 1.00 47.57 ? 1226 SER B OG    1 
ATOM   4102  N  N     . LEU B  1 254 ? -8.372  13.383  -11.774 1.00 35.52 ? 1227 LEU B N     1 
ATOM   4103  C  CA    . LEU B  1 254 ? -8.156  12.517  -10.613 1.00 28.54 ? 1227 LEU B CA    1 
ATOM   4104  C  C     . LEU B  1 254 ? -6.714  12.587  -10.083 1.00 24.37 ? 1227 LEU B C     1 
ATOM   4105  O  O     . LEU B  1 254 ? -6.512  12.842  -8.898  1.00 22.74 ? 1227 LEU B O     1 
ATOM   4106  C  CB    . LEU B  1 254 ? -8.546  11.070  -10.946 1.00 26.07 ? 1227 LEU B CB    1 
ATOM   4107  C  CG    . LEU B  1 254 ? -8.180  9.947   -9.971  1.00 33.71 ? 1227 LEU B CG    1 
ATOM   4108  C  CD1   . LEU B  1 254 ? -8.818  10.175  -8.602  1.00 33.20 ? 1227 LEU B CD1   1 
ATOM   4109  C  CD2   . LEU B  1 254 ? -8.574  8.577   -10.536 1.00 21.00 ? 1227 LEU B CD2   1 
ATOM   4110  N  N     . VAL B  1 255 ? -5.728  12.361  -10.952 1.00 25.76 ? 1228 VAL B N     1 
ATOM   4111  C  CA    . VAL B  1 255 ? -4.315  12.397  -10.538 1.00 29.08 ? 1228 VAL B CA    1 
ATOM   4112  C  C     . VAL B  1 255 ? -3.880  13.772  -10.036 1.00 27.76 ? 1228 VAL B C     1 
ATOM   4113  O  O     . VAL B  1 255 ? -3.150  13.857  -9.057  1.00 28.04 ? 1228 VAL B O     1 
ATOM   4114  C  CB    . VAL B  1 255 ? -3.306  11.855  -11.620 1.00 28.19 ? 1228 VAL B CB    1 
ATOM   4115  C  CG1   . VAL B  1 255 ? -3.672  10.452  -12.051 1.00 31.11 ? 1228 VAL B CG1   1 
ATOM   4116  C  CG2   . VAL B  1 255 ? -3.216  12.764  -12.820 1.00 41.15 ? 1228 VAL B CG2   1 
ATOM   4117  N  N     . SER B  1 256 ? -4.357  14.832  -10.697 1.00 31.78 ? 1229 SER B N     1 
ATOM   4118  C  CA    . SER B  1 256 ? -4.039  16.215  -10.344 1.00 31.75 ? 1229 SER B CA    1 
ATOM   4119  C  C     . SER B  1 256 ? -4.664  16.639  -9.019  1.00 29.59 ? 1229 SER B C     1 
ATOM   4120  O  O     . SER B  1 256 ? -4.043  17.355  -8.246  1.00 36.08 ? 1229 SER B O     1 
ATOM   4121  C  CB    . SER B  1 256 ? -4.492  17.172  -11.455 1.00 34.52 ? 1229 SER B CB    1 
ATOM   4122  O  OG    . SER B  1 256 ? -3.914  16.825  -12.701 1.00 35.93 ? 1229 SER B OG    1 
ATOM   4123  N  N     . GLY B  1 257 ? -5.898  16.211  -8.772  1.00 28.06 ? 1230 GLY B N     1 
ATOM   4124  C  CA    . GLY B  1 257 ? -6.560  16.448  -7.496  1.00 28.88 ? 1230 GLY B CA    1 
ATOM   4125  C  C     . GLY B  1 257 ? -5.796  15.883  -6.307  1.00 31.60 ? 1230 GLY B C     1 
ATOM   4126  O  O     . GLY B  1 257 ? -5.579  16.586  -5.319  1.00 35.63 ? 1230 GLY B O     1 
ATOM   4127  N  N     . LEU B  1 258 ? -5.381  14.617  -6.406  1.00 31.35 ? 1231 LEU B N     1 
ATOM   4128  C  CA    . LEU B  1 258 ? -4.628  13.937  -5.332  1.00 28.30 ? 1231 LEU B CA    1 
ATOM   4129  C  C     . LEU B  1 258 ? -3.187  14.417  -5.233  1.00 28.07 ? 1231 LEU B C     1 
ATOM   4130  O  O     . LEU B  1 258 ? -2.571  14.306  -4.172  1.00 24.52 ? 1231 LEU B O     1 
ATOM   4131  C  CB    . LEU B  1 258 ? -4.608  12.426  -5.547  1.00 27.82 ? 1231 LEU B CB    1 
ATOM   4132  C  CG    . LEU B  1 258 ? -5.892  11.610  -5.496  1.00 29.08 ? 1231 LEU B CG    1 
ATOM   4133  C  CD1   . LEU B  1 258 ? -5.708  10.357  -6.331  1.00 18.01 ? 1231 LEU B CD1   1 
ATOM   4134  C  CD2   . LEU B  1 258 ? -6.241  11.266  -4.067  1.00 21.77 ? 1231 LEU B CD2   1 
ATOM   4135  N  N     . LEU B  1 259 ? -2.650  14.910  -6.352  1.00 26.47 ? 1232 LEU B N     1 
ATOM   4136  C  CA    . LEU B  1 259 ? -1.288  15.448  -6.404  1.00 29.19 ? 1232 LEU B CA    1 
ATOM   4137  C  C     . LEU B  1 259 ? -1.294  16.979  -6.353  1.00 29.48 ? 1232 LEU B C     1 
ATOM   4138  O  O     . LEU B  1 259 ? -0.478  17.644  -6.989  1.00 28.84 ? 1232 LEU B O     1 
ATOM   4139  C  CB    . LEU B  1 259 ? -0.525  14.924  -7.639  1.00 28.52 ? 1232 LEU B CB    1 
ATOM   4140  C  CG    . LEU B  1 259 ? -0.168  13.427  -7.658  1.00 25.49 ? 1232 LEU B CG    1 
ATOM   4141  C  CD1   . LEU B  1 259 ? 0.454   13.036  -8.975  1.00 14.66 ? 1232 LEU B CD1   1 
ATOM   4142  C  CD2   . LEU B  1 259 ? 0.739   13.040  -6.502  1.00 23.25 ? 1232 LEU B CD2   1 
ATOM   4143  N  N     . GLN B  1 260 ? -2.234  17.515  -5.583  1.00 35.71 ? 1233 GLN B N     1 
ATOM   4144  C  CA    . GLN B  1 260 ? -2.320  18.943  -5.295  1.00 36.51 ? 1233 GLN B CA    1 
ATOM   4145  C  C     . GLN B  1 260 ? -1.333  19.298  -4.164  1.00 35.15 ? 1233 GLN B C     1 
ATOM   4146  O  O     . GLN B  1 260 ? -1.424  18.738  -3.071  1.00 32.56 ? 1233 GLN B O     1 
ATOM   4147  C  CB    . GLN B  1 260 ? -3.774  19.311  -4.945  1.00 31.40 ? 1233 GLN B CB    1 
ATOM   4148  C  CG    . GLN B  1 260 ? -3.982  20.650  -4.230  1.00 41.04 ? 1233 GLN B CG    1 
ATOM   4149  C  CD    . GLN B  1 260 ? -3.747  21.871  -5.109  1.00 29.94 ? 1233 GLN B CD    1 
ATOM   4150  O  OE1   . GLN B  1 260 ? -3.272  22.899  -4.635  1.00 42.61 ? 1233 GLN B OE1   1 
ATOM   4151  N  NE2   . GLN B  1 260 ? -4.072  21.760  -6.390  1.00 34.18 ? 1233 GLN B NE2   1 
ATOM   4152  N  N     . PRO B  1 261 ? -0.363  20.201  -4.444  1.00 36.89 ? 1234 PRO B N     1 
ATOM   4153  C  CA    . PRO B  1 261 ? 0.660   20.658  -3.488  1.00 33.75 ? 1234 PRO B CA    1 
ATOM   4154  C  C     . PRO B  1 261 ? 0.124   21.210  -2.166  1.00 32.42 ? 1234 PRO B C     1 
ATOM   4155  O  O     . PRO B  1 261 ? 0.754   21.024  -1.116  1.00 34.19 ? 1234 PRO B O     1 
ATOM   4156  C  CB    . PRO B  1 261 ? 1.368   21.786  -4.248  1.00 35.49 ? 1234 PRO B CB    1 
ATOM   4157  C  CG    . PRO B  1 261 ? 1.169   21.484  -5.649  1.00 28.53 ? 1234 PRO B CG    1 
ATOM   4158  C  CD    . PRO B  1 261 ? -0.181  20.837  -5.762  1.00 35.04 ? 1234 PRO B CD    1 
ATOM   4159  N  N     . VAL B  1 262 ? -1.007  21.909  -2.223  1.00 31.07 ? 1235 VAL B N     1 
ATOM   4160  C  CA    . VAL B  1 262 ? -1.623  22.493  -1.033  1.00 29.79 ? 1235 VAL B CA    1 
ATOM   4161  C  C     . VAL B  1 262 ? -2.510  21.443  -0.372  1.00 29.68 ? 1235 VAL B C     1 
ATOM   4162  O  O     . VAL B  1 262 ? -3.489  21.009  -0.980  1.00 36.49 ? 1235 VAL B O     1 
ATOM   4163  C  CB    . VAL B  1 262 ? -2.455  23.766  -1.373  1.00 30.61 ? 1235 VAL B CB    1 
ATOM   4164  C  CG1   . VAL B  1 262 ? -3.065  24.355  -0.115  1.00 19.51 ? 1235 VAL B CG1   1 
ATOM   4165  C  CG2   . VAL B  1 262 ? -1.592  24.804  -2.094  1.00 24.86 ? 1235 VAL B CG2   1 
ATOM   4166  N  N     . PRO B  1 263 ? -2.175  21.038  0.874   1.00 26.13 ? 1236 PRO B N     1 
ATOM   4167  C  CA    . PRO B  1 263 ? -2.863  19.954  1.588   1.00 27.87 ? 1236 PRO B CA    1 
ATOM   4168  C  C     . PRO B  1 263 ? -4.380  20.107  1.723   1.00 34.01 ? 1236 PRO B C     1 
ATOM   4169  O  O     . PRO B  1 263 ? -5.100  19.107  1.628   1.00 38.08 ? 1236 PRO B O     1 
ATOM   4170  C  CB    . PRO B  1 263 ? -2.194  19.945  2.976   1.00 26.37 ? 1236 PRO B CB    1 
ATOM   4171  C  CG    . PRO B  1 263 ? -1.441  21.234  3.073   1.00 18.70 ? 1236 PRO B CG    1 
ATOM   4172  C  CD    . PRO B  1 263 ? -1.081  21.611  1.679   1.00 19.34 ? 1236 PRO B CD    1 
ATOM   4173  N  N     . GLU B  1 264 ? -4.864  21.333  1.937   1.00 37.69 ? 1237 GLU B N     1 
ATOM   4174  C  CA    . GLU B  1 264 ? -6.305  21.555  2.182   1.00 34.08 ? 1237 GLU B CA    1 
ATOM   4175  C  C     . GLU B  1 264 ? -7.142  21.728  0.909   1.00 31.52 ? 1237 GLU B C     1 
ATOM   4176  O  O     . GLU B  1 264 ? -8.365  21.769  0.982   1.00 35.97 ? 1237 GLU B O     1 
ATOM   4177  C  CB    . GLU B  1 264 ? -6.554  22.696  3.185   1.00 37.47 ? 1237 GLU B CB    1 
ATOM   4178  C  CG    . GLU B  1 264 ? -6.016  24.076  2.777   1.00 37.01 ? 1237 GLU B CG    1 
ATOM   4179  C  CD    . GLU B  1 264 ? -4.584  24.318  3.243   1.00 40.61 ? 1237 GLU B CD    1 
ATOM   4180  O  OE1   . GLU B  1 264 ? -3.794  24.844  2.440   1.00 40.58 ? 1237 GLU B OE1   1 
ATOM   4181  O  OE2   . GLU B  1 264 ? -4.245  23.985  4.403   1.00 40.37 ? 1237 GLU B OE2   1 
ATOM   4182  N  N     . ARG B  1 265 ? -6.472  21.809  -0.240  1.00 29.97 ? 1238 ARG B N     1 
ATOM   4183  C  CA    . ARG B  1 265 ? -7.098  21.807  -1.561  1.00 30.72 ? 1238 ARG B CA    1 
ATOM   4184  C  C     . ARG B  1 265 ? -7.006  20.433  -2.253  1.00 31.97 ? 1238 ARG B C     1 
ATOM   4185  O  O     . ARG B  1 265 ? -7.524  20.250  -3.360  1.00 26.59 ? 1238 ARG B O     1 
ATOM   4186  C  CB    . ARG B  1 265 ? -6.445  22.862  -2.455  1.00 35.35 ? 1238 ARG B CB    1 
ATOM   4187  C  CG    . ARG B  1 265 ? -6.691  24.311  -2.018  1.00 44.19 ? 1238 ARG B CG    1 
ATOM   4188  C  CD    . ARG B  1 265 ? -5.722  25.276  -2.694  1.00 40.61 ? 1238 ARG B CD    1 
ATOM   4189  N  NE    . ARG B  1 265 ? -5.803  25.233  -4.154  1.00 51.30 ? 1238 ARG B NE    1 
ATOM   4190  C  CZ    . ARG B  1 265 ? -6.470  26.108  -4.905  1.00 59.36 ? 1238 ARG B CZ    1 
ATOM   4191  N  NH1   . ARG B  1 265 ? -7.132  27.117  -4.348  1.00 59.53 ? 1238 ARG B NH1   1 
ATOM   4192  N  NH2   . ARG B  1 265 ? -6.477  25.970  -6.224  1.00 62.09 ? 1238 ARG B NH2   1 
ATOM   4193  N  N     . ARG B  1 266 ? -6.346  19.480  -1.594  1.00 29.04 ? 1239 ARG B N     1 
ATOM   4194  C  CA    . ARG B  1 266 ? -6.162  18.121  -2.117  1.00 28.29 ? 1239 ARG B CA    1 
ATOM   4195  C  C     . ARG B  1 266 ? -7.467  17.309  -2.047  1.00 27.84 ? 1239 ARG B C     1 
ATOM   4196  O  O     . ARG B  1 266 ? -8.237  17.431  -1.082  1.00 22.81 ? 1239 ARG B O     1 
ATOM   4197  C  CB    . ARG B  1 266 ? -5.064  17.421  -1.306  1.00 23.56 ? 1239 ARG B CB    1 
ATOM   4198  C  CG    . ARG B  1 266 ? -4.507  16.111  -1.876  1.00 22.91 ? 1239 ARG B CG    1 
ATOM   4199  C  CD    . ARG B  1 266 ? -3.236  15.735  -1.125  1.00 23.07 ? 1239 ARG B CD    1 
ATOM   4200  N  NE    . ARG B  1 266 ? -2.202  16.760  -1.289  1.00 18.38 ? 1239 ARG B NE    1 
ATOM   4201  C  CZ    . ARG B  1 266 ? -1.227  17.020  -0.419  1.00 21.25 ? 1239 ARG B CZ    1 
ATOM   4202  N  NH1   . ARG B  1 266 ? -1.124  16.333  0.704   1.00 19.19 ? 1239 ARG B NH1   1 
ATOM   4203  N  NH2   . ARG B  1 266 ? -0.343  17.980  -0.676  1.00 14.71 ? 1239 ARG B NH2   1 
ATOM   4204  N  N     . THR B  1 267 ? -7.709  16.490  -3.070  1.00 28.33 ? 1240 THR B N     1 
ATOM   4205  C  CA    . THR B  1 267 ? -8.811  15.523  -3.046  1.00 26.55 ? 1240 THR B CA    1 
ATOM   4206  C  C     . THR B  1 267 ? -8.821  14.756  -1.729  1.00 27.95 ? 1240 THR B C     1 
ATOM   4207  O  O     . THR B  1 267 ? -7.781  14.274  -1.264  1.00 31.08 ? 1240 THR B O     1 
ATOM   4208  C  CB    . THR B  1 267 ? -8.721  14.527  -4.193  1.00 20.54 ? 1240 THR B CB    1 
ATOM   4209  O  OG1   . THR B  1 267 ? -8.683  15.228  -5.435  1.00 33.03 ? 1240 THR B OG1   1 
ATOM   4210  C  CG2   . THR B  1 267 ? -9.922  13.592  -4.194  1.00 31.02 ? 1240 THR B CG2   1 
ATOM   4211  N  N     . THR B  1 268 ? -10.003 14.686  -1.128  1.00 26.20 ? 1241 THR B N     1 
ATOM   4212  C  CA    . THR B  1 268 ? -10.237 13.961  0.108   1.00 25.27 ? 1241 THR B CA    1 
ATOM   4213  C  C     . THR B  1 268 ? -10.666 12.520  -0.211  1.00 27.34 ? 1241 THR B C     1 
ATOM   4214  O  O     . THR B  1 268 ? -10.980 12.209  -1.366  1.00 26.59 ? 1241 THR B O     1 
ATOM   4215  C  CB    . THR B  1 268 ? -11.286 14.703  0.970   1.00 27.31 ? 1241 THR B CB    1 
ATOM   4216  O  OG1   . THR B  1 268 ? -11.157 14.312  2.343   1.00 48.48 ? 1241 THR B OG1   1 
ATOM   4217  C  CG2   . THR B  1 268 ? -12.710 14.442  0.487   1.00 17.11 ? 1241 THR B CG2   1 
ATOM   4218  N  N     . LEU B  1 269 ? -10.669 11.654  0.805   1.00 26.50 ? 1242 LEU B N     1 
ATOM   4219  C  CA    . LEU B  1 269 ? -11.061 10.247  0.650   1.00 28.00 ? 1242 LEU B CA    1 
ATOM   4220  C  C     . LEU B  1 269 ? -12.533 10.076  0.240   1.00 31.63 ? 1242 LEU B C     1 
ATOM   4221  O  O     . LEU B  1 269 ? -12.845 9.331   -0.697  1.00 33.92 ? 1242 LEU B O     1 
ATOM   4222  C  CB    . LEU B  1 269 ? -10.766 9.445   1.927   1.00 19.46 ? 1242 LEU B CB    1 
ATOM   4223  C  CG    . LEU B  1 269 ? -10.912 7.920   1.792   1.00 25.68 ? 1242 LEU B CG    1 
ATOM   4224  C  CD1   . LEU B  1 269 ? -9.878  7.300   0.832   1.00 17.82 ? 1242 LEU B CD1   1 
ATOM   4225  C  CD2   . LEU B  1 269 ? -10.836 7.260   3.140   1.00 24.33 ? 1242 LEU B CD2   1 
ATOM   4226  N  N     . GLU B  1 270 ? -13.423 10.774  0.938   1.00 32.83 ? 1243 GLU B N     1 
ATOM   4227  C  CA    . GLU B  1 270 ? -14.852 10.755  0.629   1.00 36.93 ? 1243 GLU B CA    1 
ATOM   4228  C  C     . GLU B  1 270 ? -15.110 11.146  -0.831  1.00 35.00 ? 1243 GLU B C     1 
ATOM   4229  O  O     . GLU B  1 270 ? -15.980 10.572  -1.485  1.00 37.83 ? 1243 GLU B O     1 
ATOM   4230  C  CB    . GLU B  1 270 ? -15.625 11.667  1.592   1.00 35.50 ? 1243 GLU B CB    1 
ATOM   4231  C  CG    . GLU B  1 270 ? -15.620 11.206  3.063   1.00 49.37 ? 1243 GLU B CG    1 
ATOM   4232  C  CD    . GLU B  1 270 ? -14.255 11.323  3.761   1.00 54.32 ? 1243 GLU B CD    1 
ATOM   4233  O  OE1   . GLU B  1 270 ? -13.412 12.150  3.333   1.00 57.29 ? 1243 GLU B OE1   1 
ATOM   4234  O  OE2   . GLU B  1 270 ? -14.033 10.582  4.751   1.00 40.72 ? 1243 GLU B OE2   1 
ATOM   4235  N  N     . LYS B  1 271 ? -14.336 12.111  -1.327  1.00 32.06 ? 1244 LYS B N     1 
ATOM   4236  C  CA    . LYS B  1 271 ? -14.363 12.539  -2.726  1.00 33.48 ? 1244 LYS B CA    1 
ATOM   4237  C  C     . LYS B  1 271 ? -13.800 11.480  -3.688  1.00 37.68 ? 1244 LYS B C     1 
ATOM   4238  O  O     . LYS B  1 271 ? -14.346 11.257  -4.770  1.00 39.76 ? 1244 LYS B O     1 
ATOM   4239  C  CB    . LYS B  1 271 ? -13.554 13.827  -2.855  1.00 32.90 ? 1244 LYS B CB    1 
ATOM   4240  C  CG    . LYS B  1 271 ? -13.665 14.577  -4.170  1.00 28.77 ? 1244 LYS B CG    1 
ATOM   4241  C  CD    . LYS B  1 271 ? -12.721 15.794  -4.180  1.00 36.84 ? 1244 LYS B CD    1 
ATOM   4242  C  CE    . LYS B  1 271 ? -12.645 16.483  -2.808  1.00 35.66 ? 1244 LYS B CE    1 
ATOM   4243  N  NZ    . LYS B  1 271 ? -11.509 17.435  -2.693  1.00 31.44 ? 1244 LYS B NZ    1 
ATOM   4244  N  N     . LEU B  1 272 ? -12.696 10.844  -3.297  1.00 40.35 ? 1245 LEU B N     1 
ATOM   4245  C  CA    . LEU B  1 272 ? -12.038 9.833   -4.129  1.00 36.11 ? 1245 LEU B CA    1 
ATOM   4246  C  C     . LEU B  1 272 ? -12.942 8.613   -4.345  1.00 35.38 ? 1245 LEU B C     1 
ATOM   4247  O  O     . LEU B  1 272 ? -13.052 8.099   -5.461  1.00 31.72 ? 1245 LEU B O     1 
ATOM   4248  C  CB    . LEU B  1 272 ? -10.701 9.406   -3.496  1.00 33.51 ? 1245 LEU B CB    1 
ATOM   4249  C  CG    . LEU B  1 272 ? -9.900  8.272   -4.143  1.00 21.59 ? 1245 LEU B CG    1 
ATOM   4250  C  CD1   . LEU B  1 272 ? -9.571  8.594   -5.582  1.00 29.48 ? 1245 LEU B CD1   1 
ATOM   4251  C  CD2   . LEU B  1 272 ? -8.628  7.990   -3.379  1.00 31.65 ? 1245 LEU B CD2   1 
ATOM   4252  N  N     . VAL B  1 273 ? -13.578 8.170   -3.263  1.00 36.80 ? 1246 VAL B N     1 
ATOM   4253  C  CA    . VAL B  1 273 ? -14.471 7.010   -3.261  1.00 40.17 ? 1246 VAL B CA    1 
ATOM   4254  C  C     . VAL B  1 273 ? -15.584 7.136   -4.310  1.00 41.22 ? 1246 VAL B C     1 
ATOM   4255  O  O     . VAL B  1 273 ? -16.038 6.131   -4.859  1.00 42.70 ? 1246 VAL B O     1 
ATOM   4256  C  CB    . VAL B  1 273 ? -15.081 6.795   -1.847  1.00 38.84 ? 1246 VAL B CB    1 
ATOM   4257  C  CG1   . VAL B  1 273 ? -16.175 5.724   -1.857  1.00 47.00 ? 1246 VAL B CG1   1 
ATOM   4258  C  CG2   . VAL B  1 273 ? -13.998 6.432   -0.847  1.00 35.46 ? 1246 VAL B CG2   1 
ATOM   4259  N  N     . THR B  1 274 ? -15.995 8.373   -4.595  1.00 42.85 ? 1247 THR B N     1 
ATOM   4260  C  CA    . THR B  1 274 ? -17.153 8.649   -5.458  1.00 42.74 ? 1247 THR B CA    1 
ATOM   4261  C  C     . THR B  1 274 ? -16.805 9.021   -6.899  1.00 41.57 ? 1247 THR B C     1 
ATOM   4262  O  O     . THR B  1 274 ? -17.701 9.138   -7.739  1.00 47.33 ? 1247 THR B O     1 
ATOM   4263  C  CB    . THR B  1 274 ? -18.092 9.731   -4.839  1.00 43.51 ? 1247 THR B CB    1 
ATOM   4264  O  OG1   . THR B  1 274 ? -19.311 9.792   -5.587  1.00 50.42 ? 1247 THR B OG1   1 
ATOM   4265  C  CG2   . THR B  1 274 ? -17.436 11.117  -4.837  1.00 42.92 ? 1247 THR B CG2   1 
ATOM   4266  N  N     . ASP B  1 275 ? -15.515 9.211   -7.172  1.00 37.34 ? 1248 ASP B N     1 
ATOM   4267  C  CA    . ASP B  1 275 ? -15.021 9.647   -8.481  1.00 39.45 ? 1248 ASP B CA    1 
ATOM   4268  C  C     . ASP B  1 275 ? -15.445 8.696   -9.623  1.00 41.36 ? 1248 ASP B C     1 
ATOM   4269  O  O     . ASP B  1 275 ? -15.449 7.476   -9.431  1.00 43.67 ? 1248 ASP B O     1 
ATOM   4270  C  CB    . ASP B  1 275 ? -13.492 9.786   -8.411  1.00 37.81 ? 1248 ASP B CB    1 
ATOM   4271  C  CG    . ASP B  1 275 ? -12.879 10.248  -9.717  1.00 38.57 ? 1248 ASP B CG    1 
ATOM   4272  O  OD1   . ASP B  1 275 ? -12.400 9.390   -10.481 1.00 44.51 ? 1248 ASP B OD1   1 
ATOM   4273  O  OD2   . ASP B  1 275 ? -12.872 11.465  -9.986  1.00 47.27 ? 1248 ASP B OD2   1 
ATOM   4274  N  N     . PRO B  1 276 ? -15.811 9.251   -10.806 1.00 41.37 ? 1249 PRO B N     1 
ATOM   4275  C  CA    . PRO B  1 276 ? -16.246 8.445   -11.971 1.00 37.05 ? 1249 PRO B CA    1 
ATOM   4276  C  C     . PRO B  1 276 ? -15.186 7.516   -12.585 1.00 36.64 ? 1249 PRO B C     1 
ATOM   4277  O  O     . PRO B  1 276 ? -15.534 6.496   -13.182 1.00 35.08 ? 1249 PRO B O     1 
ATOM   4278  C  CB    . PRO B  1 276 ? -16.670 9.502   -13.000 1.00 37.36 ? 1249 PRO B CB    1 
ATOM   4279  C  CG    . PRO B  1 276 ? -16.845 10.773  -12.223 1.00 38.62 ? 1249 PRO B CG    1 
ATOM   4280  C  CD    . PRO B  1 276 ? -15.865 10.697  -11.106 1.00 41.32 ? 1249 PRO B CD    1 
ATOM   4281  N  N     . TRP B  1 277 ? -13.910 7.868   -12.454 1.00 36.58 ? 1250 TRP B N     1 
ATOM   4282  C  CA    . TRP B  1 277 ? -12.834 6.993   -12.915 1.00 32.76 ? 1250 TRP B CA    1 
ATOM   4283  C  C     . TRP B  1 277 ? -12.665 5.754   -12.036 1.00 33.14 ? 1250 TRP B C     1 
ATOM   4284  O  O     . TRP B  1 277 ? -12.415 4.663   -12.548 1.00 34.39 ? 1250 TRP B O     1 
ATOM   4285  C  CB    . TRP B  1 277 ? -11.507 7.748   -13.009 1.00 29.23 ? 1250 TRP B CB    1 
ATOM   4286  C  CG    . TRP B  1 277 ? -10.492 7.021   -13.827 1.00 23.50 ? 1250 TRP B CG    1 
ATOM   4287  C  CD1   . TRP B  1 277 ? -10.334 7.086   -15.186 1.00 24.42 ? 1250 TRP B CD1   1 
ATOM   4288  C  CD2   . TRP B  1 277 ? -9.500  6.098   -13.349 1.00 22.93 ? 1250 TRP B CD2   1 
ATOM   4289  N  NE1   . TRP B  1 277 ? -9.295  6.273   -15.583 1.00 28.92 ? 1250 TRP B NE1   1 
ATOM   4290  C  CE2   . TRP B  1 277 ? -8.767  5.653   -14.478 1.00 29.91 ? 1250 TRP B CE2   1 
ATOM   4291  C  CE3   . TRP B  1 277 ? -9.151  5.613   -12.078 1.00 23.26 ? 1250 TRP B CE3   1 
ATOM   4292  C  CZ2   . TRP B  1 277 ? -7.709  4.742   -14.373 1.00 17.16 ? 1250 TRP B CZ2   1 
ATOM   4293  C  CZ3   . TRP B  1 277 ? -8.094  4.709   -11.973 1.00 21.57 ? 1250 TRP B CZ3   1 
ATOM   4294  C  CH2   . TRP B  1 277 ? -7.386  4.286   -13.117 1.00 21.26 ? 1250 TRP B CH2   1 
ATOM   4295  N  N     . VAL B  1 278 ? -12.794 5.945   -10.722 1.00 31.57 ? 1251 VAL B N     1 
ATOM   4296  C  CA    . VAL B  1 278 ? -12.603 4.899   -9.715  1.00 29.95 ? 1251 VAL B CA    1 
ATOM   4297  C  C     . VAL B  1 278 ? -13.764 3.907   -9.768  1.00 35.87 ? 1251 VAL B C     1 
ATOM   4298  O  O     . VAL B  1 278 ? -13.618 2.733   -9.408  1.00 29.12 ? 1251 VAL B O     1 
ATOM   4299  C  CB    . VAL B  1 278 ? -12.493 5.527   -8.295  1.00 30.88 ? 1251 VAL B CB    1 
ATOM   4300  C  CG1   . VAL B  1 278 ? -12.585 4.484   -7.191  1.00 24.11 ? 1251 VAL B CG1   1 
ATOM   4301  C  CG2   . VAL B  1 278 ? -11.206 6.342   -8.160  1.00 23.07 ? 1251 VAL B CG2   1 
ATOM   4302  N  N     . THR B  1 279 ? -14.910 4.395   -10.244 1.00 38.08 ? 1252 THR B N     1 
ATOM   4303  C  CA    . THR B  1 279 ? -16.152 3.636   -10.261 1.00 38.18 ? 1252 THR B CA    1 
ATOM   4304  C  C     . THR B  1 279 ? -16.590 3.221   -11.673 1.00 38.04 ? 1252 THR B C     1 
ATOM   4305  O  O     . THR B  1 279 ? -17.687 2.690   -11.843 1.00 38.29 ? 1252 THR B O     1 
ATOM   4306  C  CB    . THR B  1 279 ? -17.289 4.430   -9.576  1.00 39.16 ? 1252 THR B CB    1 
ATOM   4307  O  OG1   . THR B  1 279 ? -17.385 5.736   -10.160 1.00 45.87 ? 1252 THR B OG1   1 
ATOM   4308  C  CG2   . THR B  1 279 ? -17.033 4.570   -8.071  1.00 40.86 ? 1252 THR B CG2   1 
ATOM   4309  N  N     . GLN B  1 280 ? -15.724 3.439   -12.670 1.00 38.01 ? 1253 GLN B N     1 
ATOM   4310  C  CA    . GLN B  1 280 ? -16.063 3.206   -14.088 1.00 34.89 ? 1253 GLN B CA    1 
ATOM   4311  C  C     . GLN B  1 280 ? -16.390 1.735   -14.401 1.00 38.39 ? 1253 GLN B C     1 
ATOM   4312  O  O     . GLN B  1 280 ? -15.970 0.843   -13.660 1.00 38.85 ? 1253 GLN B O     1 
ATOM   4313  C  CB    . GLN B  1 280 ? -14.962 3.744   -15.018 1.00 36.34 ? 1253 GLN B CB    1 
ATOM   4314  C  CG    . GLN B  1 280 ? -13.741 2.838   -15.200 1.00 28.52 ? 1253 GLN B CG    1 
ATOM   4315  C  CD    . GLN B  1 280 ? -12.618 3.515   -15.966 1.00 26.80 ? 1253 GLN B CD    1 
ATOM   4316  O  OE1   . GLN B  1 280 ? -11.854 4.296   -15.405 1.00 29.54 ? 1253 GLN B OE1   1 
ATOM   4317  N  NE2   . GLN B  1 280 ? -12.500 3.204   -17.247 1.00 28.99 ? 1253 GLN B NE2   1 
ATOM   4318  N  N     . PRO B  1 281 ? -17.152 1.480   -15.492 1.00 41.92 ? 1254 PRO B N     1 
ATOM   4319  C  CA    . PRO B  1 281 ? -17.507 0.096   -15.823 1.00 42.19 ? 1254 PRO B CA    1 
ATOM   4320  C  C     . PRO B  1 281 ? -16.296 -0.702  -16.305 1.00 40.74 ? 1254 PRO B C     1 
ATOM   4321  O  O     . PRO B  1 281 ? -15.528 -0.216  -17.147 1.00 41.99 ? 1254 PRO B O     1 
ATOM   4322  C  CB    . PRO B  1 281 ? -18.541 0.247   -16.958 1.00 43.58 ? 1254 PRO B CB    1 
ATOM   4323  C  CG    . PRO B  1 281 ? -18.937 1.697   -16.956 1.00 44.46 ? 1254 PRO B CG    1 
ATOM   4324  C  CD    . PRO B  1 281 ? -17.728 2.428   -16.464 1.00 40.42 ? 1254 PRO B CD    1 
ATOM   4325  N  N     . VAL B  1 282 ? -16.136 -1.910  -15.761 1.00 36.91 ? 1255 VAL B N     1 
ATOM   4326  C  CA    . VAL B  1 282 ? -15.022 -2.791  -16.117 1.00 36.87 ? 1255 VAL B CA    1 
ATOM   4327  C  C     . VAL B  1 282 ? -15.493 -4.248  -16.314 1.00 38.79 ? 1255 VAL B C     1 
ATOM   4328  O  O     . VAL B  1 282 ? -16.101 -4.846  -15.423 1.00 40.44 ? 1255 VAL B O     1 
ATOM   4329  C  CB    . VAL B  1 282 ? -13.826 -2.652  -15.096 1.00 33.91 ? 1255 VAL B CB    1 
ATOM   4330  C  CG1   . VAL B  1 282 ? -14.278 -2.912  -13.668 1.00 36.07 ? 1255 VAL B CG1   1 
ATOM   4331  C  CG2   . VAL B  1 282 ? -12.644 -3.535  -15.480 1.00 32.04 ? 1255 VAL B CG2   1 
ATOM   4332  N  N     . ASN B  1 283 ? -15.236 -4.791  -17.502 1.00 38.82 ? 1256 ASN B N     1 
ATOM   4333  C  CA    . ASN B  1 283 ? -15.515 -6.196  -17.791 1.00 40.15 ? 1256 ASN B CA    1 
ATOM   4334  C  C     . ASN B  1 283 ? -14.253 -7.027  -17.589 1.00 36.91 ? 1256 ASN B C     1 
ATOM   4335  O  O     . ASN B  1 283 ? -13.323 -6.966  -18.398 1.00 37.29 ? 1256 ASN B O     1 
ATOM   4336  C  CB    . ASN B  1 283 ? -16.058 -6.369  -19.219 1.00 41.38 ? 1256 ASN B CB    1 
ATOM   4337  C  CG    . ASN B  1 283 ? -16.797 -7.688  -19.414 1.00 39.42 ? 1256 ASN B CG    1 
ATOM   4338  O  OD1   . ASN B  1 283 ? -16.207 -8.764  -19.346 1.00 43.24 ? 1256 ASN B OD1   1 
ATOM   4339  N  ND2   . ASN B  1 283 ? -18.097 -7.603  -19.671 1.00 45.27 ? 1256 ASN B ND2   1 
ATOM   4340  N  N     . LEU B  1 284 ? -14.226 -7.792  -16.504 1.00 35.42 ? 1257 LEU B N     1 
ATOM   4341  C  CA    . LEU B  1 284 ? -13.046 -8.569  -16.120 1.00 37.21 ? 1257 LEU B CA    1 
ATOM   4342  C  C     . LEU B  1 284 ? -12.766 -9.748  -17.045 1.00 38.98 ? 1257 LEU B C     1 
ATOM   4343  O  O     . LEU B  1 284 ? -11.616 -10.179 -17.179 1.00 36.42 ? 1257 LEU B O     1 
ATOM   4344  C  CB    . LEU B  1 284 ? -13.153 -9.039  -14.660 1.00 38.44 ? 1257 LEU B CB    1 
ATOM   4345  C  CG    . LEU B  1 284 ? -12.709 -8.010  -13.612 1.00 41.35 ? 1257 LEU B CG    1 
ATOM   4346  C  CD1   . LEU B  1 284 ? -13.155 -8.412  -12.213 1.00 37.14 ? 1257 LEU B CD1   1 
ATOM   4347  C  CD2   . LEU B  1 284 ? -11.195 -7.796  -13.665 1.00 35.21 ? 1257 LEU B CD2   1 
ATOM   4348  N  N     . ALA B  1 285 ? -13.820 -10.255 -17.686 1.00 41.98 ? 1258 ALA B N     1 
ATOM   4349  C  CA    . ALA B  1 285 ? -13.709 -11.358 -18.642 1.00 42.36 ? 1258 ALA B CA    1 
ATOM   4350  C  C     . ALA B  1 285 ? -13.036 -10.909 -19.947 1.00 44.38 ? 1258 ALA B C     1 
ATOM   4351  O  O     . ALA B  1 285 ? -12.755 -11.732 -20.826 1.00 45.93 ? 1258 ALA B O     1 
ATOM   4352  C  CB    . ALA B  1 285 ? -15.085 -11.957 -18.915 1.00 42.59 ? 1258 ALA B CB    1 
ATOM   4353  N  N     . ASP B  1 286 ? -12.776 -9.603  -20.049 1.00 43.88 ? 1259 ASP B N     1 
ATOM   4354  C  CA    . ASP B  1 286 ? -12.052 -8.998  -21.169 1.00 41.48 ? 1259 ASP B CA    1 
ATOM   4355  C  C     . ASP B  1 286 ? -10.529 -9.100  -21.037 1.00 40.47 ? 1259 ASP B C     1 
ATOM   4356  O  O     . ASP B  1 286 ? -9.808  -8.866  -22.010 1.00 41.45 ? 1259 ASP B O     1 
ATOM   4357  C  CB    . ASP B  1 286 ? -12.443 -7.518  -21.317 1.00 45.76 ? 1259 ASP B CB    1 
ATOM   4358  C  CG    . ASP B  1 286 ? -13.712 -7.307  -22.148 1.00 53.51 ? 1259 ASP B CG    1 
ATOM   4359  O  OD1   . ASP B  1 286 ? -14.238 -8.277  -22.742 1.00 56.75 ? 1259 ASP B OD1   1 
ATOM   4360  O  OD2   . ASP B  1 286 ? -14.180 -6.148  -22.211 1.00 52.50 ? 1259 ASP B OD2   1 
ATOM   4361  N  N     . TYR B  1 287 ? -10.043 -9.452  -19.844 1.00 41.42 ? 1260 TYR B N     1 
ATOM   4362  C  CA    . TYR B  1 287 ? -8.599  -9.433  -19.548 1.00 37.61 ? 1260 TYR B CA    1 
ATOM   4363  C  C     . TYR B  1 287 ? -8.044  -10.781 -19.109 1.00 37.73 ? 1260 TYR B C     1 
ATOM   4364  O  O     . TYR B  1 287 ? -8.668  -11.503 -18.332 1.00 36.42 ? 1260 TYR B O     1 
ATOM   4365  C  CB    . TYR B  1 287 ? -8.271  -8.356  -18.495 1.00 34.07 ? 1260 TYR B CB    1 
ATOM   4366  C  CG    . TYR B  1 287 ? -8.835  -7.000  -18.851 1.00 26.72 ? 1260 TYR B CG    1 
ATOM   4367  C  CD1   . TYR B  1 287 ? -8.184  -6.175  -19.766 1.00 20.30 ? 1260 TYR B CD1   1 
ATOM   4368  C  CD2   . TYR B  1 287 ? -10.032 -6.556  -18.296 1.00 12.73 ? 1260 TYR B CD2   1 
ATOM   4369  C  CE1   . TYR B  1 287 ? -8.706  -4.933  -20.109 1.00 30.25 ? 1260 TYR B CE1   1 
ATOM   4370  C  CE2   . TYR B  1 287 ? -10.563 -5.319  -18.632 1.00 27.01 ? 1260 TYR B CE2   1 
ATOM   4371  C  CZ    . TYR B  1 287 ? -9.895  -4.514  -19.540 1.00 32.58 ? 1260 TYR B CZ    1 
ATOM   4372  O  OH    . TYR B  1 287 ? -10.415 -3.291  -19.876 1.00 38.25 ? 1260 TYR B OH    1 
ATOM   4373  N  N     . THR B  1 288 ? -6.850  -11.090 -19.608 1.00 38.28 ? 1261 THR B N     1 
ATOM   4374  C  CA    . THR B  1 288 ? -6.182  -12.358 -19.356 1.00 37.01 ? 1261 THR B CA    1 
ATOM   4375  C  C     . THR B  1 288 ? -4.850  -12.050 -18.702 1.00 33.81 ? 1261 THR B C     1 
ATOM   4376  O  O     . THR B  1 288 ? -4.126  -11.179 -19.179 1.00 37.67 ? 1261 THR B O     1 
ATOM   4377  C  CB    . THR B  1 288 ? -5.926  -13.133 -20.687 1.00 39.06 ? 1261 THR B CB    1 
ATOM   4378  O  OG1   . THR B  1 288 ? -7.141  -13.220 -21.444 1.00 40.93 ? 1261 THR B OG1   1 
ATOM   4379  C  CG2   . THR B  1 288 ? -5.397  -14.537 -20.418 1.00 29.71 ? 1261 THR B CG2   1 
ATOM   4380  N  N     . TRP B  1 289 ? -4.534  -12.760 -17.618 1.00 30.08 ? 1262 TRP B N     1 
ATOM   4381  C  CA    . TRP B  1 289 ? -3.265  -12.582 -16.919 1.00 29.61 ? 1262 TRP B CA    1 
ATOM   4382  C  C     . TRP B  1 289 ? -2.077  -12.689 -17.871 1.00 33.55 ? 1262 TRP B C     1 
ATOM   4383  O  O     . TRP B  1 289 ? -1.245  -11.781 -17.929 1.00 31.40 ? 1262 TRP B O     1 
ATOM   4384  C  CB    . TRP B  1 289 ? -3.094  -13.590 -15.777 1.00 30.38 ? 1262 TRP B CB    1 
ATOM   4385  C  CG    . TRP B  1 289 ? -1.803  -13.350 -15.029 1.00 37.27 ? 1262 TRP B CG    1 
ATOM   4386  C  CD1   . TRP B  1 289 ? -0.622  -14.032 -15.174 1.00 35.02 ? 1262 TRP B CD1   1 
ATOM   4387  C  CD2   . TRP B  1 289 ? -1.554  -12.322 -14.061 1.00 31.72 ? 1262 TRP B CD2   1 
ATOM   4388  N  NE1   . TRP B  1 289 ? 0.336   -13.500 -14.345 1.00 33.74 ? 1262 TRP B NE1   1 
ATOM   4389  C  CE2   . TRP B  1 289 ? -0.210  -12.452 -13.649 1.00 38.27 ? 1262 TRP B CE2   1 
ATOM   4390  C  CE3   . TRP B  1 289 ? -2.342  -11.311 -13.493 1.00 34.98 ? 1262 TRP B CE3   1 
ATOM   4391  C  CZ2   . TRP B  1 289 ? 0.365   -11.607 -12.692 1.00 35.91 ? 1262 TRP B CZ2   1 
ATOM   4392  C  CZ3   . TRP B  1 289 ? -1.767  -10.470 -12.544 1.00 36.05 ? 1262 TRP B CZ3   1 
ATOM   4393  C  CH2   . TRP B  1 289 ? -0.428  -10.625 -12.156 1.00 35.26 ? 1262 TRP B CH2   1 
ATOM   4394  N  N     . GLU B  1 290 ? -2.019  -13.797 -18.617 1.00 33.07 ? 1263 GLU B N     1 
ATOM   4395  C  CA    . GLU B  1 290 ? -0.940  -14.070 -19.573 1.00 37.52 ? 1263 GLU B CA    1 
ATOM   4396  C  C     . GLU B  1 290 ? -0.738  -12.958 -20.614 1.00 39.59 ? 1263 GLU B C     1 
ATOM   4397  O  O     . GLU B  1 290 ? 0.376   -12.764 -21.123 1.00 40.52 ? 1263 GLU B O     1 
ATOM   4398  C  CB    . GLU B  1 290 ? -1.175  -15.416 -20.268 1.00 39.85 ? 1263 GLU B CB    1 
ATOM   4399  N  N     . GLU B  1 291 ? -1.812  -12.231 -20.920 1.00 39.33 ? 1264 GLU B N     1 
ATOM   4400  C  CA    . GLU B  1 291 ? -1.756  -11.125 -21.877 1.00 41.76 ? 1264 GLU B CA    1 
ATOM   4401  C  C     . GLU B  1 291 ? -1.359  -9.784  -21.249 1.00 41.97 ? 1264 GLU B C     1 
ATOM   4402  O  O     . GLU B  1 291 ? -0.712  -8.961  -21.896 1.00 42.27 ? 1264 GLU B O     1 
ATOM   4403  C  CB    . GLU B  1 291 ? -3.092  -10.983 -22.600 1.00 41.61 ? 1264 GLU B CB    1 
ATOM   4404  C  CG    . GLU B  1 291 ? -3.422  -12.151 -23.507 1.00 44.15 ? 1264 GLU B CG    1 
ATOM   4405  C  CD    . GLU B  1 291 ? -4.746  -11.984 -24.197 1.00 44.62 ? 1264 GLU B CD    1 
ATOM   4406  O  OE1   . GLU B  1 291 ? -5.308  -10.874 -24.134 1.00 46.30 ? 1264 GLU B OE1   1 
ATOM   4407  O  OE2   . GLU B  1 291 ? -5.230  -12.963 -24.803 1.00 52.30 ? 1264 GLU B OE2   1 
ATOM   4408  N  N     . VAL B  1 292 ? -1.753  -9.564  -19.998 1.00 37.76 ? 1265 VAL B N     1 
ATOM   4409  C  CA    . VAL B  1 292 ? -1.470  -8.304  -19.312 1.00 37.30 ? 1265 VAL B CA    1 
ATOM   4410  C  C     . VAL B  1 292 ? -0.061  -8.326  -18.698 1.00 39.43 ? 1265 VAL B C     1 
ATOM   4411  O  O     . VAL B  1 292 ? 0.743   -7.412  -18.916 1.00 30.50 ? 1265 VAL B O     1 
ATOM   4412  C  CB    . VAL B  1 292 ? -2.554  -7.993  -18.241 1.00 38.64 ? 1265 VAL B CB    1 
ATOM   4413  C  CG1   . VAL B  1 292 ? -2.252  -6.679  -17.508 1.00 35.27 ? 1265 VAL B CG1   1 
ATOM   4414  C  CG2   . VAL B  1 292 ? -3.957  -7.964  -18.885 1.00 22.77 ? 1265 VAL B CG2   1 
ATOM   4415  N  N     . PHE B  1 293 ? 0.219   -9.384  -17.938 1.00 41.88 ? 1266 PHE B N     1 
ATOM   4416  C  CA    . PHE B  1 293 ? 1.520   -9.593  -17.331 1.00 42.39 ? 1266 PHE B CA    1 
ATOM   4417  C  C     . PHE B  1 293 ? 2.241   -10.716 -18.071 1.00 41.95 ? 1266 PHE B C     1 
ATOM   4418  O  O     . PHE B  1 293 ? 1.719   -11.824 -18.197 1.00 42.54 ? 1266 PHE B O     1 
ATOM   4419  C  CB    . PHE B  1 293 ? 1.363   -9.909  -15.839 1.00 42.96 ? 1266 PHE B CB    1 
ATOM   4420  C  CG    . PHE B  1 293 ? 2.664   -9.940  -15.079 1.00 41.67 ? 1266 PHE B CG    1 
ATOM   4421  C  CD1   . PHE B  1 293 ? 3.332   -8.762  -14.767 1.00 45.01 ? 1266 PHE B CD1   1 
ATOM   4422  C  CD2   . PHE B  1 293 ? 3.216   -11.150 -14.670 1.00 44.40 ? 1266 PHE B CD2   1 
ATOM   4423  C  CE1   . PHE B  1 293 ? 4.524   -8.788  -14.062 1.00 42.13 ? 1266 PHE B CE1   1 
ATOM   4424  C  CE2   . PHE B  1 293 ? 4.407   -11.186 -13.968 1.00 42.26 ? 1266 PHE B CE2   1 
ATOM   4425  C  CZ    . PHE B  1 293 ? 5.063   -10.001 -13.663 1.00 45.76 ? 1266 PHE B CZ    1 
ATOM   4426  N  N     . ARG B  1 294 ? 3.442   -10.412 -18.558 1.00 41.53 ? 1267 ARG B N     1 
ATOM   4427  C  CA    . ARG B  1 294 ? 4.185   -11.298 -19.452 1.00 41.24 ? 1267 ARG B CA    1 
ATOM   4428  C  C     . ARG B  1 294 ? 5.630   -11.506 -18.994 1.00 43.60 ? 1267 ARG B C     1 
ATOM   4429  O  O     . ARG B  1 294 ? 6.550   -11.571 -19.815 1.00 43.24 ? 1267 ARG B O     1 
ATOM   4430  C  CB    . ARG B  1 294 ? 4.172   -10.740 -20.879 1.00 37.21 ? 1267 ARG B CB    1 
ATOM   4431  C  CG    . ARG B  1 294 ? 2.827   -10.749 -21.559 1.00 34.57 ? 1267 ARG B CG    1 
ATOM   4432  C  CD    . ARG B  1 294 ? 2.913   -10.460 -23.038 1.00 36.95 ? 1267 ARG B CD    1 
ATOM   4433  N  NE    . ARG B  1 294 ? 1.656   -9.904  -23.535 1.00 40.69 ? 1267 ARG B NE    1 
ATOM   4434  C  CZ    . ARG B  1 294 ? 1.420   -9.553  -24.798 1.00 42.70 ? 1267 ARG B CZ    1 
ATOM   4435  N  NH1   . ARG B  1 294 ? 2.355   -9.679  -25.720 1.00 51.81 ? 1267 ARG B NH1   1 
ATOM   4436  N  NH2   . ARG B  1 294 ? 0.244   -9.063  -25.145 1.00 31.53 ? 1267 ARG B NH2   1 
ATOM   4437  N  N     . ALA C  1 9   ? 34.098  13.662  10.812  1.00 44.07 ? 982  ALA C N     1 
ATOM   4438  C  CA    . ALA C  1 9   ? 35.531  14.031  10.950  1.00 41.98 ? 982  ALA C CA    1 
ATOM   4439  C  C     . ALA C  1 9   ? 36.419  12.796  10.830  1.00 43.48 ? 982  ALA C C     1 
ATOM   4440  O  O     . ALA C  1 9   ? 36.026  11.691  11.219  1.00 44.03 ? 982  ALA C O     1 
ATOM   4441  C  CB    . ALA C  1 9   ? 35.783  14.756  12.273  1.00 40.89 ? 982  ALA C CB    1 
ATOM   4442  N  N     . VAL C  1 10  ? 37.616  13.000  10.286  1.00 39.81 ? 983  VAL C N     1 
ATOM   4443  C  CA    . VAL C  1 10  ? 38.527  11.916  9.957   1.00 36.88 ? 983  VAL C CA    1 
ATOM   4444  C  C     . VAL C  1 10  ? 39.745  11.974  10.870  1.00 38.29 ? 983  VAL C C     1 
ATOM   4445  O  O     . VAL C  1 10  ? 40.569  12.877  10.746  1.00 38.21 ? 983  VAL C O     1 
ATOM   4446  C  CB    . VAL C  1 10  ? 38.954  11.981  8.459   1.00 39.82 ? 983  VAL C CB    1 
ATOM   4447  C  CG1   . VAL C  1 10  ? 39.901  10.835  8.108   1.00 26.89 ? 983  VAL C CG1   1 
ATOM   4448  C  CG2   . VAL C  1 10  ? 37.708  11.979  7.528   1.00 27.00 ? 983  VAL C CG2   1 
ATOM   4449  N  N     . GLU C  1 11  ? 39.844  11.017  11.794  1.00 37.37 ? 984  GLU C N     1 
ATOM   4450  C  CA    . GLU C  1 11  ? 40.994  10.924  12.694  1.00 38.95 ? 984  GLU C CA    1 
ATOM   4451  C  C     . GLU C  1 11  ? 42.299  10.726  11.920  1.00 36.74 ? 984  GLU C C     1 
ATOM   4452  O  O     . GLU C  1 11  ? 42.358  9.950   10.959  1.00 35.07 ? 984  GLU C O     1 
ATOM   4453  C  CB    . GLU C  1 11  ? 40.804  9.799   13.717  1.00 41.36 ? 984  GLU C CB    1 
ATOM   4454  C  CG    . GLU C  1 11  ? 39.952  10.179  14.928  1.00 45.48 ? 984  GLU C CG    1 
ATOM   4455  C  CD    . GLU C  1 11  ? 40.002  9.130   16.030  1.00 46.94 ? 984  GLU C CD    1 
ATOM   4456  O  OE1   . GLU C  1 11  ? 40.303  9.495   17.190  1.00 51.92 ? 984  GLU C OE1   1 
ATOM   4457  O  OE2   . GLU C  1 11  ? 39.754  7.938   15.735  1.00 55.26 ? 984  GLU C OE2   1 
ATOM   4458  N  N     . LEU C  1 12  ? 43.336  11.450  12.337  1.00 34.19 ? 985  LEU C N     1 
ATOM   4459  C  CA    . LEU C  1 12  ? 44.635  11.385  11.679  1.00 29.79 ? 985  LEU C CA    1 
ATOM   4460  C  C     . LEU C  1 12  ? 45.646  10.721  12.612  1.00 28.65 ? 985  LEU C C     1 
ATOM   4461  O  O     . LEU C  1 12  ? 46.324  11.383  13.404  1.00 27.90 ? 985  LEU C O     1 
ATOM   4462  C  CB    . LEU C  1 12  ? 45.089  12.787  11.218  1.00 26.36 ? 985  LEU C CB    1 
ATOM   4463  C  CG    . LEU C  1 12  ? 44.135  13.564  10.295  1.00 19.89 ? 985  LEU C CG    1 
ATOM   4464  C  CD1   . LEU C  1 12  ? 44.646  14.965  10.059  1.00 21.00 ? 985  LEU C CD1   1 
ATOM   4465  C  CD2   . LEU C  1 12  ? 43.890  12.856  8.960   1.00 14.59 ? 985  LEU C CD2   1 
ATOM   4466  N  N     . GLU C  1 13  ? 45.725  9.397   12.510  1.00 33.06 ? 986  GLU C N     1 
ATOM   4467  C  CA    . GLU C  1 13  ? 46.508  8.574   13.432  1.00 34.90 ? 986  GLU C CA    1 
ATOM   4468  C  C     . GLU C  1 13  ? 47.831  8.086   12.820  1.00 31.03 ? 986  GLU C C     1 
ATOM   4469  O  O     . GLU C  1 13  ? 48.374  7.074   13.244  1.00 35.08 ? 986  GLU C O     1 
ATOM   4470  C  CB    . GLU C  1 13  ? 45.662  7.383   13.904  1.00 40.91 ? 986  GLU C CB    1 
ATOM   4471  C  CG    . GLU C  1 13  ? 44.566  7.721   14.936  1.00 46.50 ? 986  GLU C CG    1 
ATOM   4472  C  CD    . GLU C  1 13  ? 45.045  7.655   16.390  1.00 53.25 ? 986  GLU C CD    1 
ATOM   4473  O  OE1   . GLU C  1 13  ? 46.094  7.030   16.662  1.00 59.16 ? 986  GLU C OE1   1 
ATOM   4474  O  OE2   . GLU C  1 13  ? 44.361  8.219   17.272  1.00 47.42 ? 986  GLU C OE2   1 
ATOM   4475  N  N     . GLY C  1 14  ? 48.347  8.811   11.831  1.00 28.17 ? 987  GLY C N     1 
ATOM   4476  C  CA    . GLY C  1 14  ? 49.613  8.455   11.176  1.00 32.59 ? 987  GLY C CA    1 
ATOM   4477  C  C     . GLY C  1 14  ? 50.817  8.316   12.098  1.00 33.50 ? 987  GLY C C     1 
ATOM   4478  O  O     . GLY C  1 14  ? 51.601  7.380   11.961  1.00 32.60 ? 987  GLY C O     1 
ATOM   4479  N  N     . LEU C  1 15  ? 50.967  9.242   13.041  1.00 36.14 ? 988  LEU C N     1 
ATOM   4480  C  CA    . LEU C  1 15  ? 52.113  9.227   13.954  1.00 37.48 ? 988  LEU C CA    1 
ATOM   4481  C  C     . LEU C  1 15  ? 51.946  8.190   15.073  1.00 38.29 ? 988  LEU C C     1 
ATOM   4482  O  O     . LEU C  1 15  ? 52.913  7.527   15.454  1.00 38.70 ? 988  LEU C O     1 
ATOM   4483  C  CB    . LEU C  1 15  ? 52.373  10.624  14.537  1.00 38.42 ? 988  LEU C CB    1 
ATOM   4484  C  CG    . LEU C  1 15  ? 52.742  11.798  13.615  1.00 40.99 ? 988  LEU C CG    1 
ATOM   4485  C  CD1   . LEU C  1 15  ? 52.506  13.124  14.331  1.00 47.17 ? 988  LEU C CD1   1 
ATOM   4486  C  CD2   . LEU C  1 15  ? 54.186  11.712  13.115  1.00 41.74 ? 988  LEU C CD2   1 
ATOM   4487  N  N     . ALA C  1 16  ? 50.720  8.050   15.582  1.00 37.95 ? 989  ALA C N     1 
ATOM   4488  C  CA    . ALA C  1 16  ? 50.411  7.065   16.628  1.00 36.96 ? 989  ALA C CA    1 
ATOM   4489  C  C     . ALA C  1 16  ? 50.424  5.609   16.130  1.00 33.46 ? 989  ALA C C     1 
ATOM   4490  O  O     . ALA C  1 16  ? 50.671  4.685   16.913  1.00 30.93 ? 989  ALA C O     1 
ATOM   4491  C  CB    . ALA C  1 16  ? 49.079  7.390   17.291  1.00 35.24 ? 989  ALA C CB    1 
ATOM   4492  N  N     . ALA C  1 17  ? 50.154  5.412   14.841  1.00 26.28 ? 990  ALA C N     1 
ATOM   4493  C  CA    . ALA C  1 17  ? 50.191  4.079   14.242  1.00 28.31 ? 990  ALA C CA    1 
ATOM   4494  C  C     . ALA C  1 17  ? 51.627  3.585   14.034  1.00 31.96 ? 990  ALA C C     1 
ATOM   4495  O  O     . ALA C  1 17  ? 51.879  2.387   14.065  1.00 29.61 ? 990  ALA C O     1 
ATOM   4496  C  CB    . ALA C  1 17  ? 49.413  4.054   12.925  1.00 22.97 ? 990  ALA C CB    1 
ATOM   4497  N  N     . CYS C  1 18  ? 52.555  4.522   13.843  1.00 35.22 ? 991  CYS C N     1 
ATOM   4498  C  CA    . CYS C  1 18  ? 53.955  4.219   13.535  1.00 36.33 ? 991  CYS C CA    1 
ATOM   4499  C  C     . CYS C  1 18  ? 54.913  4.320   14.728  1.00 36.19 ? 991  CYS C C     1 
ATOM   4500  O  O     . CYS C  1 18  ? 56.053  3.869   14.639  1.00 38.43 ? 991  CYS C O     1 
ATOM   4501  C  CB    . CYS C  1 18  ? 54.454  5.122   12.395  1.00 30.55 ? 991  CYS C CB    1 
ATOM   4502  S  SG    . CYS C  1 18  ? 53.635  4.821   10.824  1.00 39.82 ? 991  CYS C SG    1 
ATOM   4503  N  N     . GLU C  1 19  ? 54.445  4.900   15.832  1.00 37.33 ? 992  GLU C N     1 
ATOM   4504  C  CA    . GLU C  1 19  ? 55.271  5.123   17.030  1.00 39.75 ? 992  GLU C CA    1 
ATOM   4505  C  C     . GLU C  1 19  ? 55.908  3.852   17.602  1.00 37.94 ? 992  GLU C C     1 
ATOM   4506  O  O     . GLU C  1 19  ? 55.258  2.803   17.678  1.00 38.87 ? 992  GLU C O     1 
ATOM   4507  C  CB    . GLU C  1 19  ? 54.456  5.859   18.116  1.00 39.68 ? 992  GLU C CB    1 
ATOM   4508  C  CG    . GLU C  1 19  ? 55.145  6.032   19.490  1.00 48.66 ? 992  GLU C CG    1 
ATOM   4509  C  CD    . GLU C  1 19  ? 56.469  6.813   19.441  1.00 60.46 ? 992  GLU C CD    1 
ATOM   4510  O  OE1   . GLU C  1 19  ? 56.660  7.647   18.520  1.00 58.14 ? 992  GLU C OE1   1 
ATOM   4511  O  OE2   . GLU C  1 19  ? 57.322  6.591   20.337  1.00 51.95 ? 992  GLU C OE2   1 
ATOM   4512  N  N     . GLY C  1 20  ? 57.185  3.965   17.981  1.00 35.48 ? 993  GLY C N     1 
ATOM   4513  C  CA    . GLY C  1 20  ? 57.890  2.927   18.743  1.00 31.34 ? 993  GLY C CA    1 
ATOM   4514  C  C     . GLY C  1 20  ? 58.834  2.060   17.938  1.00 31.18 ? 993  GLY C C     1 
ATOM   4515  O  O     . GLY C  1 20  ? 59.447  2.516   16.968  1.00 31.03 ? 993  GLY C O     1 
ATOM   4516  N  N     . GLU C  1 21  ? 58.929  0.797   18.347  1.00 31.27 ? 994  GLU C N     1 
ATOM   4517  C  CA    . GLU C  1 21  ? 59.833  -0.195  17.758  1.00 34.84 ? 994  GLU C CA    1 
ATOM   4518  C  C     . GLU C  1 21  ? 59.705  -0.337  16.239  1.00 32.43 ? 994  GLU C C     1 
ATOM   4519  O  O     . GLU C  1 21  ? 60.696  -0.597  15.557  1.00 29.92 ? 994  GLU C O     1 
ATOM   4520  C  CB    . GLU C  1 21  ? 59.606  -1.545  18.431  1.00 38.34 ? 994  GLU C CB    1 
ATOM   4521  C  CG    . GLU C  1 21  ? 60.801  -2.487  18.407  1.00 49.18 ? 994  GLU C CG    1 
ATOM   4522  C  CD    . GLU C  1 21  ? 60.545  -3.769  19.188  1.00 45.91 ? 994  GLU C CD    1 
ATOM   4523  O  OE1   . GLU C  1 21  ? 59.724  -3.747  20.134  1.00 51.94 ? 994  GLU C OE1   1 
ATOM   4524  O  OE2   . GLU C  1 21  ? 61.172  -4.799  18.858  1.00 61.57 ? 994  GLU C OE2   1 
ATOM   4525  N  N     . TYR C  1 22  ? 58.486  -0.162  15.721  1.00 33.17 ? 995  TYR C N     1 
ATOM   4526  C  CA    . TYR C  1 22  ? 58.239  -0.153  14.276  1.00 28.25 ? 995  TYR C CA    1 
ATOM   4527  C  C     . TYR C  1 22  ? 59.069  0.895   13.511  1.00 24.72 ? 995  TYR C C     1 
ATOM   4528  O  O     . TYR C  1 22  ? 59.704  0.578   12.499  1.00 24.40 ? 995  TYR C O     1 
ATOM   4529  C  CB    . TYR C  1 22  ? 56.739  0.023   13.961  1.00 23.64 ? 995  TYR C CB    1 
ATOM   4530  C  CG    . TYR C  1 22  ? 56.486  0.256   12.477  1.00 20.18 ? 995  TYR C CG    1 
ATOM   4531  C  CD1   . TYR C  1 22  ? 56.560  -0.793  11.574  1.00 14.67 ? 995  TYR C CD1   1 
ATOM   4532  C  CD2   . TYR C  1 22  ? 56.203  1.533   11.981  1.00 18.25 ? 995  TYR C CD2   1 
ATOM   4533  C  CE1   . TYR C  1 22  ? 56.356  -0.595  10.224  1.00 13.51 ? 995  TYR C CE1   1 
ATOM   4534  C  CE2   . TYR C  1 22  ? 56.000  1.745   10.627  1.00 12.13 ? 995  TYR C CE2   1 
ATOM   4535  C  CZ    . TYR C  1 22  ? 56.082  0.670   9.750   1.00 20.79 ? 995  TYR C CZ    1 
ATOM   4536  O  OH    . TYR C  1 22  ? 55.880  0.842   8.393   1.00 20.49 ? 995  TYR C OH    1 
ATOM   4537  N  N     . SER C  1 23  ? 59.044  2.137   13.991  1.00 29.31 ? 996  SER C N     1 
ATOM   4538  C  CA    . SER C  1 23  ? 59.701  3.262   13.307  1.00 36.34 ? 996  SER C CA    1 
ATOM   4539  C  C     . SER C  1 23  ? 61.230  3.194   13.300  1.00 36.69 ? 996  SER C C     1 
ATOM   4540  O  O     . SER C  1 23  ? 61.872  3.730   12.395  1.00 40.68 ? 996  SER C O     1 
ATOM   4541  C  CB    . SER C  1 23  ? 59.230  4.597   13.885  1.00 35.35 ? 996  SER C CB    1 
ATOM   4542  O  OG    . SER C  1 23  ? 57.946  4.912   13.383  1.00 50.86 ? 996  SER C OG    1 
ATOM   4543  N  N     . GLN C  1 24  ? 61.807  2.541   14.302  1.00 40.19 ? 997  GLN C N     1 
ATOM   4544  C  CA    . GLN C  1 24  ? 63.254  2.307   14.336  1.00 44.60 ? 997  GLN C CA    1 
ATOM   4545  C  C     . GLN C  1 24  ? 63.704  1.424   13.165  1.00 41.22 ? 997  GLN C C     1 
ATOM   4546  O  O     . GLN C  1 24  ? 64.804  1.611   12.634  1.00 43.53 ? 997  GLN C O     1 
ATOM   4547  C  CB    . GLN C  1 24  ? 63.679  1.672   15.672  1.00 46.34 ? 997  GLN C CB    1 
ATOM   4548  C  CG    . GLN C  1 24  ? 63.222  2.427   16.927  1.00 52.99 ? 997  GLN C CG    1 
ATOM   4549  C  CD    . GLN C  1 24  ? 64.022  3.696   17.193  1.00 59.26 ? 997  GLN C CD    1 
ATOM   4550  O  OE1   . GLN C  1 24  ? 63.482  4.803   17.163  1.00 58.34 ? 997  GLN C OE1   1 
ATOM   4551  N  NE2   . GLN C  1 24  ? 65.317  3.537   17.454  1.00 65.07 ? 997  GLN C NE2   1 
ATOM   4552  N  N     . LYS C  1 25  ? 62.835  0.496   12.755  1.00 34.03 ? 998  LYS C N     1 
ATOM   4553  C  CA    . LYS C  1 25  ? 63.168  -0.545  11.766  1.00 32.16 ? 998  LYS C CA    1 
ATOM   4554  C  C     . LYS C  1 25  ? 62.660  -0.262  10.345  1.00 29.22 ? 998  LYS C C     1 
ATOM   4555  O  O     . LYS C  1 25  ? 63.372  -0.497  9.363   1.00 27.87 ? 998  LYS C O     1 
ATOM   4556  C  CB    . LYS C  1 25  ? 62.650  -1.903  12.251  1.00 28.70 ? 998  LYS C CB    1 
ATOM   4557  C  CG    . LYS C  1 25  ? 63.236  -3.119  11.545  1.00 33.08 ? 998  LYS C CG    1 
ATOM   4558  C  CD    . LYS C  1 25  ? 62.976  -4.383  12.372  1.00 33.85 ? 998  LYS C CD    1 
ATOM   4559  C  CE    . LYS C  1 25  ? 63.904  -5.538  11.997  1.00 45.91 ? 998  LYS C CE    1 
ATOM   4560  N  NZ    . LYS C  1 25  ? 63.753  -5.967  10.579  1.00 33.85 ? 998  LYS C NZ    1 
ATOM   4561  N  N     . TYR C  1 26  ? 61.428  0.233   10.238  1.00 32.30 ? 999  TYR C N     1 
ATOM   4562  C  CA    . TYR C  1 26  ? 60.796  0.441   8.928   1.00 29.75 ? 999  TYR C CA    1 
ATOM   4563  C  C     . TYR C  1 26  ? 60.363  1.879   8.717   1.00 26.38 ? 999  TYR C C     1 
ATOM   4564  O  O     . TYR C  1 26  ? 60.027  2.584   9.664   1.00 26.86 ? 999  TYR C O     1 
ATOM   4565  C  CB    . TYR C  1 26  ? 59.574  -0.474  8.734   1.00 27.43 ? 999  TYR C CB    1 
ATOM   4566  C  CG    . TYR C  1 26  ? 59.824  -1.941  8.994   1.00 26.53 ? 999  TYR C CG    1 
ATOM   4567  C  CD1   . TYR C  1 26  ? 60.239  -2.791  7.973   1.00 26.91 ? 999  TYR C CD1   1 
ATOM   4568  C  CD2   . TYR C  1 26  ? 59.633  -2.479  10.264  1.00 23.65 ? 999  TYR C CD2   1 
ATOM   4569  C  CE1   . TYR C  1 26  ? 60.482  -4.145  8.218   1.00 32.72 ? 999  TYR C CE1   1 
ATOM   4570  C  CE2   . TYR C  1 26  ? 59.865  -3.828  10.516  1.00 28.03 ? 999  TYR C CE2   1 
ATOM   4571  C  CZ    . TYR C  1 26  ? 60.290  -4.653  9.496   1.00 25.83 ? 999  TYR C CZ    1 
ATOM   4572  O  OH    . TYR C  1 26  ? 60.510  -5.991  9.762   1.00 29.33 ? 999  TYR C OH    1 
ATOM   4573  N  N     . SER C  1 27  ? 60.370  2.286   7.455   1.00 27.74 ? 1000 SER C N     1 
ATOM   4574  C  CA    . SER C  1 27  ? 59.797  3.545   7.022   1.00 29.58 ? 1000 SER C CA    1 
ATOM   4575  C  C     . SER C  1 27  ? 58.613  3.188   6.133   1.00 27.40 ? 1000 SER C C     1 
ATOM   4576  O  O     . SER C  1 27  ? 58.763  2.397   5.200   1.00 25.97 ? 1000 SER C O     1 
ATOM   4577  C  CB    . SER C  1 27  ? 60.835  4.354   6.231   1.00 31.11 ? 1000 SER C CB    1 
ATOM   4578  O  OG    . SER C  1 27  ? 60.604  5.748   6.357   1.00 45.65 ? 1000 SER C OG    1 
ATOM   4579  N  N     . THR C  1 28  ? 57.443  3.757   6.430   1.00 29.18 ? 1001 THR C N     1 
ATOM   4580  C  CA    . THR C  1 28  ? 56.215  3.511   5.648   1.00 31.90 ? 1001 THR C CA    1 
ATOM   4581  C  C     . THR C  1 28  ? 56.188  4.392   4.394   1.00 31.87 ? 1001 THR C C     1 
ATOM   4582  O  O     . THR C  1 28  ? 56.370  5.608   4.484   1.00 27.93 ? 1001 THR C O     1 
ATOM   4583  C  CB    . THR C  1 28  ? 54.934  3.759   6.494   1.00 30.78 ? 1001 THR C CB    1 
ATOM   4584  O  OG1   . THR C  1 28  ? 55.094  3.183   7.798   1.00 33.90 ? 1001 THR C OG1   1 
ATOM   4585  C  CG2   . THR C  1 28  ? 53.701  3.156   5.824   1.00 25.87 ? 1001 THR C CG2   1 
ATOM   4586  N  N     . MET C  1 29  ? 55.945  3.777   3.234   1.00 30.28 ? 1002 MET C N     1 
ATOM   4587  C  CA    . MET C  1 29  ? 56.082  4.482   1.956   1.00 34.65 ? 1002 MET C CA    1 
ATOM   4588  C  C     . MET C  1 29  ? 54.758  4.888   1.294   1.00 32.93 ? 1002 MET C C     1 
ATOM   4589  O  O     . MET C  1 29  ? 54.466  6.070   1.170   1.00 37.76 ? 1002 MET C O     1 
ATOM   4590  C  CB    . MET C  1 29  ? 56.960  3.699   0.963   1.00 31.74 ? 1002 MET C CB    1 
ATOM   4591  C  CG    . MET C  1 29  ? 58.363  3.352   1.454   1.00 34.82 ? 1002 MET C CG    1 
ATOM   4592  S  SD    . MET C  1 29  ? 59.405  4.731   1.977   1.00 40.50 ? 1002 MET C SD    1 
ATOM   4593  C  CE    . MET C  1 29  ? 59.958  5.360   0.392   1.00 44.07 ? 1002 MET C CE    1 
ATOM   4594  N  N     . SER C  1 30  ? 53.969  3.900   0.880   1.00 34.24 ? 1003 SER C N     1 
ATOM   4595  C  CA    . SER C  1 30  ? 52.803  4.120   0.030   1.00 31.28 ? 1003 SER C CA    1 
ATOM   4596  C  C     . SER C  1 30  ? 51.697  3.113   0.349   1.00 32.66 ? 1003 SER C C     1 
ATOM   4597  O  O     . SER C  1 30  ? 52.000  2.001   0.802   1.00 31.02 ? 1003 SER C O     1 
ATOM   4598  C  CB    . SER C  1 30  ? 53.207  4.009   -1.447  1.00 28.51 ? 1003 SER C CB    1 
ATOM   4599  O  OG    . SER C  1 30  ? 53.908  2.801   -1.697  1.00 31.56 ? 1003 SER C OG    1 
ATOM   4600  N  N     . PRO C  1 31  ? 50.414  3.503   0.132   1.00 30.69 ? 1004 PRO C N     1 
ATOM   4601  C  CA    . PRO C  1 31  ? 49.281  2.609   0.403   1.00 29.47 ? 1004 PRO C CA    1 
ATOM   4602  C  C     . PRO C  1 31  ? 49.228  1.440   -0.579  1.00 27.71 ? 1004 PRO C C     1 
ATOM   4603  O  O     . PRO C  1 31  ? 49.619  1.591   -1.737  1.00 25.74 ? 1004 PRO C O     1 
ATOM   4604  C  CB    . PRO C  1 31  ? 48.053  3.525   0.228   1.00 24.90 ? 1004 PRO C CB    1 
ATOM   4605  C  CG    . PRO C  1 31  ? 48.505  4.588   -0.715  1.00 29.27 ? 1004 PRO C CG    1 
ATOM   4606  C  CD    . PRO C  1 31  ? 49.961  4.817   -0.376  1.00 29.46 ? 1004 PRO C CD    1 
ATOM   4607  N  N     . LEU C  1 32  ? 48.758  0.285   -0.110  1.00 32.20 ? 1005 LEU C N     1 
ATOM   4608  C  CA    . LEU C  1 32  ? 48.595  -0.899  -0.965  1.00 31.67 ? 1005 LEU C CA    1 
ATOM   4609  C  C     . LEU C  1 32  ? 47.128  -1.300  -1.136  1.00 33.46 ? 1005 LEU C C     1 
ATOM   4610  O  O     . LEU C  1 32  ? 46.280  -0.960  -0.313  1.00 29.84 ? 1005 LEU C O     1 
ATOM   4611  C  CB    . LEU C  1 32  ? 49.368  -2.088  -0.399  1.00 28.41 ? 1005 LEU C CB    1 
ATOM   4612  C  CG    . LEU C  1 32  ? 50.724  -2.547  -0.932  1.00 36.12 ? 1005 LEU C CG    1 
ATOM   4613  C  CD1   . LEU C  1 32  ? 50.905  -3.983  -0.484  1.00 30.18 ? 1005 LEU C CD1   1 
ATOM   4614  C  CD2   . LEU C  1 32  ? 50.879  -2.447  -2.459  1.00 19.68 ? 1005 LEU C CD2   1 
ATOM   4615  N  N     . GLY C  1 33  ? 46.840  -2.022  -2.217  1.00 39.60 ? 1006 GLY C N     1 
ATOM   4616  C  CA    . GLY C  1 33  ? 45.536  -2.657  -2.412  1.00 40.77 ? 1006 GLY C CA    1 
ATOM   4617  C  C     . GLY C  1 33  ? 44.512  -1.797  -3.126  1.00 44.85 ? 1006 GLY C C     1 
ATOM   4618  O  O     . GLY C  1 33  ? 44.796  -0.657  -3.495  1.00 39.61 ? 1006 GLY C O     1 
ATOM   4619  N  N     . SER C  1 34  ? 43.321  -2.362  -3.328  1.00 46.36 ? 1007 SER C N     1 
ATOM   4620  C  CA    . SER C  1 34  ? 42.191  -1.640  -3.903  1.00 49.02 ? 1007 SER C CA    1 
ATOM   4621  C  C     . SER C  1 34  ? 41.590  -0.675  -2.883  1.00 49.72 ? 1007 SER C C     1 
ATOM   4622  O  O     . SER C  1 34  ? 41.607  -0.938  -1.680  1.00 52.20 ? 1007 SER C O     1 
ATOM   4623  C  CB    . SER C  1 34  ? 41.121  -2.619  -4.398  1.00 49.82 ? 1007 SER C CB    1 
ATOM   4624  N  N     . GLY C  1 35  ? 41.049  0.438   -3.372  1.00 50.97 ? 1008 GLY C N     1 
ATOM   4625  C  CA    . GLY C  1 35  ? 40.518  1.482   -2.498  1.00 47.36 ? 1008 GLY C CA    1 
ATOM   4626  C  C     . GLY C  1 35  ? 41.590  2.493   -2.148  1.00 43.80 ? 1008 GLY C C     1 
ATOM   4627  O  O     . GLY C  1 35  ? 42.775  2.291   -2.461  1.00 38.33 ? 1008 GLY C O     1 
ATOM   4628  N  N     . ALA C  1 36  ? 41.174  3.577   -1.495  1.00 42.65 ? 1009 ALA C N     1 
ATOM   4629  C  CA    . ALA C  1 36  ? 42.069  4.692   -1.181  1.00 38.62 ? 1009 ALA C CA    1 
ATOM   4630  C  C     . ALA C  1 36  ? 42.683  4.533   0.198   1.00 35.69 ? 1009 ALA C C     1 
ATOM   4631  O  O     . ALA C  1 36  ? 41.969  4.407   1.192   1.00 34.81 ? 1009 ALA C O     1 
ATOM   4632  C  CB    . ALA C  1 36  ? 41.334  6.026   -1.297  1.00 38.05 ? 1009 ALA C CB    1 
ATOM   4633  N  N     . PHE C  1 37  ? 44.014  4.538   0.241   1.00 35.05 ? 1010 PHE C N     1 
ATOM   4634  C  CA    . PHE C  1 37  ? 44.779  4.439   1.494   1.00 33.97 ? 1010 PHE C CA    1 
ATOM   4635  C  C     . PHE C  1 37  ? 44.213  3.347   2.417   1.00 34.12 ? 1010 PHE C C     1 
ATOM   4636  O  O     . PHE C  1 37  ? 43.901  2.239   1.954   1.00 27.06 ? 1010 PHE C O     1 
ATOM   4637  C  CB    . PHE C  1 37  ? 44.913  5.821   2.182   1.00 32.18 ? 1010 PHE C CB    1 
ATOM   4638  C  CG    . PHE C  1 37  ? 45.318  6.941   1.234   1.00 29.70 ? 1010 PHE C CG    1 
ATOM   4639  C  CD1   . PHE C  1 37  ? 46.660  7.270   1.050   1.00 33.18 ? 1010 PHE C CD1   1 
ATOM   4640  C  CD2   . PHE C  1 37  ? 44.354  7.644   0.505   1.00 31.49 ? 1010 PHE C CD2   1 
ATOM   4641  C  CE1   . PHE C  1 37  ? 47.043  8.292   0.169   1.00 21.15 ? 1010 PHE C CE1   1 
ATOM   4642  C  CE2   . PHE C  1 37  ? 44.724  8.664   -0.388  1.00 34.35 ? 1010 PHE C CE2   1 
ATOM   4643  C  CZ    . PHE C  1 37  ? 46.078  8.990   -0.551  1.00 26.80 ? 1010 PHE C CZ    1 
ATOM   4644  N  N     . GLY C  1 38  ? 44.069  3.653   3.704   1.00 33.96 ? 1011 GLY C N     1 
ATOM   4645  C  CA    . GLY C  1 38  ? 43.601  2.664   4.668   1.00 31.26 ? 1011 GLY C CA    1 
ATOM   4646  C  C     . GLY C  1 38  ? 44.714  2.233   5.610   1.00 34.28 ? 1011 GLY C C     1 
ATOM   4647  O  O     . GLY C  1 38  ? 45.548  3.045   6.014   1.00 37.22 ? 1011 GLY C O     1 
ATOM   4648  N  N     . PHE C  1 39  ? 44.732  0.947   5.953   1.00 30.64 ? 1012 PHE C N     1 
ATOM   4649  C  CA    . PHE C  1 39  ? 45.605  0.461   7.016   1.00 24.65 ? 1012 PHE C CA    1 
ATOM   4650  C  C     . PHE C  1 39  ? 46.700  -0.474  6.536   1.00 16.89 ? 1012 PHE C C     1 
ATOM   4651  O  O     . PHE C  1 39  ? 47.524  -0.897  7.324   1.00 15.31 ? 1012 PHE C O     1 
ATOM   4652  C  CB    . PHE C  1 39  ? 44.781  -0.142  8.160   1.00 26.07 ? 1012 PHE C CB    1 
ATOM   4653  C  CG    . PHE C  1 39  ? 44.025  0.891   8.948   1.00 35.11 ? 1012 PHE C CG    1 
ATOM   4654  C  CD1   . PHE C  1 39  ? 44.670  1.650   9.925   1.00 31.67 ? 1012 PHE C CD1   1 
ATOM   4655  C  CD2   . PHE C  1 39  ? 42.683  1.149   8.680   1.00 43.66 ? 1012 PHE C CD2   1 
ATOM   4656  C  CE1   . PHE C  1 39  ? 43.983  2.635   10.637  1.00 26.48 ? 1012 PHE C CE1   1 
ATOM   4657  C  CE2   . PHE C  1 39  ? 41.988  2.132   9.393   1.00 40.57 ? 1012 PHE C CE2   1 
ATOM   4658  C  CZ    . PHE C  1 39  ? 42.644  2.872   10.374  1.00 36.00 ? 1012 PHE C CZ    1 
ATOM   4659  N  N     . VAL C  1 40  ? 46.718  -0.761  5.234   1.00 16.41 ? 1013 VAL C N     1 
ATOM   4660  C  CA    . VAL C  1 40  ? 47.753  -1.609  4.628   1.00 21.37 ? 1013 VAL C CA    1 
ATOM   4661  C  C     . VAL C  1 40  ? 48.699  -0.765  3.746   1.00 21.81 ? 1013 VAL C C     1 
ATOM   4662  O  O     . VAL C  1 40  ? 48.254  0.039   2.921   1.00 20.69 ? 1013 VAL C O     1 
ATOM   4663  C  CB    . VAL C  1 40  ? 47.144  -2.762  3.796   1.00 20.82 ? 1013 VAL C CB    1 
ATOM   4664  C  CG1   . VAL C  1 40  ? 48.201  -3.773  3.444   1.00 11.88 ? 1013 VAL C CG1   1 
ATOM   4665  C  CG2   . VAL C  1 40  ? 45.970  -3.428  4.542   1.00 18.15 ? 1013 VAL C CG2   1 
ATOM   4666  N  N     . TRP C  1 41  ? 50.003  -0.936  3.939   1.00 19.76 ? 1014 TRP C N     1 
ATOM   4667  C  CA    . TRP C  1 41  ? 50.980  -0.080  3.266   1.00 19.06 ? 1014 TRP C CA    1 
ATOM   4668  C  C     . TRP C  1 41  ? 52.229  -0.842  2.876   1.00 20.71 ? 1014 TRP C C     1 
ATOM   4669  O  O     . TRP C  1 41  ? 52.616  -1.813  3.542   1.00 17.63 ? 1014 TRP C O     1 
ATOM   4670  C  CB    . TRP C  1 41  ? 51.379  1.097   4.170   1.00 18.40 ? 1014 TRP C CB    1 
ATOM   4671  C  CG    . TRP C  1 41  ? 50.258  2.068   4.506   1.00 17.33 ? 1014 TRP C CG    1 
ATOM   4672  C  CD1   . TRP C  1 41  ? 49.188  1.834   5.319   1.00 28.96 ? 1014 TRP C CD1   1 
ATOM   4673  C  CD2   . TRP C  1 41  ? 50.131  3.426   4.064   1.00 26.60 ? 1014 TRP C CD2   1 
ATOM   4674  N  NE1   . TRP C  1 41  ? 48.389  2.955   5.398   1.00 29.53 ? 1014 TRP C NE1   1 
ATOM   4675  C  CE2   . TRP C  1 41  ? 48.947  3.949   4.642   1.00 28.66 ? 1014 TRP C CE2   1 
ATOM   4676  C  CE3   . TRP C  1 41  ? 50.909  4.260   3.246   1.00 24.08 ? 1014 TRP C CE3   1 
ATOM   4677  C  CZ2   . TRP C  1 41  ? 48.513  5.264   4.417   1.00 26.43 ? 1014 TRP C CZ2   1 
ATOM   4678  C  CZ3   . TRP C  1 41  ? 50.480  5.576   3.028   1.00 26.01 ? 1014 TRP C CZ3   1 
ATOM   4679  C  CH2   . TRP C  1 41  ? 49.289  6.057   3.604   1.00 25.19 ? 1014 TRP C CH2   1 
ATOM   4680  N  N     . THR C  1 42  ? 52.847  -0.399  1.786   1.00 25.81 ? 1015 THR C N     1 
ATOM   4681  C  CA    . THR C  1 42  ? 54.226  -0.764  1.485   1.00 26.33 ? 1015 THR C CA    1 
ATOM   4682  C  C     . THR C  1 42  ? 55.144  -0.013  2.454   1.00 27.65 ? 1015 THR C C     1 
ATOM   4683  O  O     . THR C  1 42  ? 55.010  1.207   2.635   1.00 26.35 ? 1015 THR C O     1 
ATOM   4684  C  CB    . THR C  1 42  ? 54.607  -0.440  0.015   1.00 26.09 ? 1015 THR C CB    1 
ATOM   4685  O  OG1   . THR C  1 42  ? 53.927  -1.340  -0.869  1.00 33.21 ? 1015 THR C OG1   1 
ATOM   4686  C  CG2   . THR C  1 42  ? 56.109  -0.574  -0.212  1.00 17.26 ? 1015 THR C CG2   1 
ATOM   4687  N  N     . ALA C  1 43  ? 56.055  -0.757  3.085   1.00 27.49 ? 1016 ALA C N     1 
ATOM   4688  C  CA    . ALA C  1 43  ? 57.088  -0.180  3.945   1.00 26.31 ? 1016 ALA C CA    1 
ATOM   4689  C  C     . ALA C  1 43  ? 58.473  -0.616  3.456   1.00 26.76 ? 1016 ALA C C     1 
ATOM   4690  O  O     . ALA C  1 43  ? 58.591  -1.485  2.591   1.00 24.06 ? 1016 ALA C O     1 
ATOM   4691  C  CB    . ALA C  1 43  ? 56.866  -0.582  5.402   1.00 21.39 ? 1016 ALA C CB    1 
ATOM   4692  N  N     . VAL C  1 44  ? 59.518  0.005   3.989   1.00 27.81 ? 1017 VAL C N     1 
ATOM   4693  C  CA    . VAL C  1 44  ? 60.885  -0.365  3.634   1.00 27.29 ? 1017 VAL C CA    1 
ATOM   4694  C  C     . VAL C  1 44  ? 61.681  -0.735  4.883   1.00 24.49 ? 1017 VAL C C     1 
ATOM   4695  O  O     . VAL C  1 44  ? 61.699  0.019   5.854   1.00 25.42 ? 1017 VAL C O     1 
ATOM   4696  C  CB    . VAL C  1 44  ? 61.593  0.728   2.773   1.00 29.17 ? 1017 VAL C CB    1 
ATOM   4697  C  CG1   . VAL C  1 44  ? 63.076  0.413   2.585   1.00 35.22 ? 1017 VAL C CG1   1 
ATOM   4698  C  CG2   . VAL C  1 44  ? 60.937  0.819   1.408   1.00 28.68 ? 1017 VAL C CG2   1 
ATOM   4699  N  N     . ASP C  1 45  ? 62.299  -1.918  4.863   1.00 22.33 ? 1018 ASP C N     1 
ATOM   4700  C  CA    . ASP C  1 45  ? 63.248  -2.307  5.904   1.00 24.49 ? 1018 ASP C CA    1 
ATOM   4701  C  C     . ASP C  1 45  ? 64.508  -1.466  5.710   1.00 25.22 ? 1018 ASP C C     1 
ATOM   4702  O  O     . ASP C  1 45  ? 65.261  -1.708  4.775   1.00 23.59 ? 1018 ASP C O     1 
ATOM   4703  C  CB    . ASP C  1 45  ? 63.598  -3.800  5.805   1.00 22.26 ? 1018 ASP C CB    1 
ATOM   4704  C  CG    . ASP C  1 45  ? 64.600  -4.241  6.865   1.00 27.84 ? 1018 ASP C CG    1 
ATOM   4705  O  OD1   . ASP C  1 45  ? 64.284  -5.182  7.622   1.00 36.66 ? 1018 ASP C OD1   1 
ATOM   4706  O  OD2   . ASP C  1 45  ? 65.699  -3.644  6.959   1.00 29.32 ? 1018 ASP C OD2   1 
ATOM   4707  N  N     . LYS C  1 46  ? 64.740  -0.494  6.591   1.00 27.41 ? 1019 LYS C N     1 
ATOM   4708  C  CA    . LYS C  1 46  ? 65.842  0.474   6.399   1.00 30.97 ? 1019 LYS C CA    1 
ATOM   4709  C  C     . LYS C  1 46  ? 67.225  -0.144  6.124   1.00 30.59 ? 1019 LYS C C     1 
ATOM   4710  O  O     . LYS C  1 46  ? 67.914  0.266   5.185   1.00 32.32 ? 1019 LYS C O     1 
ATOM   4711  C  CB    . LYS C  1 46  ? 65.905  1.476   7.553   1.00 27.13 ? 1019 LYS C CB    1 
ATOM   4712  C  CG    . LYS C  1 46  ? 64.956  2.643   7.377   1.00 36.53 ? 1019 LYS C CG    1 
ATOM   4713  C  CD    . LYS C  1 46  ? 65.016  3.604   8.548   1.00 47.37 ? 1019 LYS C CD    1 
ATOM   4714  C  CE    . LYS C  1 46  ? 64.097  3.170   9.670   1.00 51.02 ? 1019 LYS C CE    1 
ATOM   4715  N  NZ    . LYS C  1 46  ? 63.893  4.274   10.645  1.00 57.96 ? 1019 LYS C NZ    1 
ATOM   4716  N  N     . GLU C  1 47  ? 67.609  -1.128  6.929   1.00 31.05 ? 1020 GLU C N     1 
ATOM   4717  C  CA    . GLU C  1 47  ? 68.895  -1.812  6.778   1.00 35.42 ? 1020 GLU C CA    1 
ATOM   4718  C  C     . GLU C  1 47  ? 68.999  -2.630  5.486   1.00 39.50 ? 1020 GLU C C     1 
ATOM   4719  O  O     . GLU C  1 47  ? 69.996  -2.530  4.758   1.00 38.52 ? 1020 GLU C O     1 
ATOM   4720  C  CB    . GLU C  1 47  ? 69.171  -2.703  7.991   1.00 36.70 ? 1020 GLU C CB    1 
ATOM   4721  C  CG    . GLU C  1 47  ? 69.277  -1.947  9.301   1.00 29.69 ? 1020 GLU C CG    1 
ATOM   4722  C  CD    . GLU C  1 47  ? 69.688  -2.829  10.460  1.00 38.55 ? 1020 GLU C CD    1 
ATOM   4723  O  OE1   . GLU C  1 47  ? 69.555  -4.071  10.366  1.00 42.12 ? 1020 GLU C OE1   1 
ATOM   4724  O  OE2   . GLU C  1 47  ? 70.146  -2.271  11.477  1.00 41.05 ? 1020 GLU C OE2   1 
ATOM   4725  N  N     . LYS C  1 48  ? 67.965  -3.423  5.199   1.00 37.57 ? 1021 LYS C N     1 
ATOM   4726  C  CA    . LYS C  1 48  ? 67.954  -4.278  4.013   1.00 33.88 ? 1021 LYS C CA    1 
ATOM   4727  C  C     . LYS C  1 48  ? 67.559  -3.519  2.753   1.00 37.84 ? 1021 LYS C C     1 
ATOM   4728  O  O     . LYS C  1 48  ? 67.795  -3.990  1.636   1.00 39.72 ? 1021 LYS C O     1 
ATOM   4729  C  CB    . LYS C  1 48  ? 67.016  -5.468  4.224   1.00 34.66 ? 1021 LYS C CB    1 
ATOM   4730  N  N     . ASN C  1 49  ? 66.966  -2.342  2.944   1.00 40.58 ? 1022 ASN C N     1 
ATOM   4731  C  CA    . ASN C  1 49  ? 66.296  -1.584  1.881   1.00 39.82 ? 1022 ASN C CA    1 
ATOM   4732  C  C     . ASN C  1 49  ? 65.374  -2.437  0.996   1.00 40.36 ? 1022 ASN C C     1 
ATOM   4733  O  O     . ASN C  1 49  ? 65.319  -2.268  -0.233  1.00 40.16 ? 1022 ASN C O     1 
ATOM   4734  C  CB    . ASN C  1 49  ? 67.296  -0.762  1.068   1.00 43.18 ? 1022 ASN C CB    1 
ATOM   4735  C  CG    . ASN C  1 49  ? 67.799  0.445   1.826   1.00 54.73 ? 1022 ASN C CG    1 
ATOM   4736  O  OD1   . ASN C  1 49  ? 68.997  0.573   2.076   1.00 64.76 ? 1022 ASN C OD1   1 
ATOM   4737  N  ND2   . ASN C  1 49  ? 66.883  1.338   2.209   1.00 55.76 ? 1022 ASN C ND2   1 
ATOM   4738  N  N     . LYS C  1 50  ? 64.656  -3.355  1.637   1.00 34.08 ? 1023 LYS C N     1 
ATOM   4739  C  CA    . LYS C  1 50  ? 63.699  -4.192  0.933   1.00 35.36 ? 1023 LYS C CA    1 
ATOM   4740  C  C     . LYS C  1 50  ? 62.262  -3.804  1.259   1.00 31.37 ? 1023 LYS C C     1 
ATOM   4741  O  O     . LYS C  1 50  ? 61.944  -3.403  2.384   1.00 27.10 ? 1023 LYS C O     1 
ATOM   4742  C  CB    . LYS C  1 50  ? 63.954  -5.687  1.180   1.00 38.25 ? 1023 LYS C CB    1 
ATOM   4743  C  CG    . LYS C  1 50  ? 63.485  -6.232  2.521   1.00 38.64 ? 1023 LYS C CG    1 
ATOM   4744  C  CD    . LYS C  1 50  ? 63.510  -7.754  2.524   1.00 37.49 ? 1023 LYS C CD    1 
ATOM   4745  C  CE    . LYS C  1 50  ? 62.746  -8.321  3.712   1.00 41.99 ? 1023 LYS C CE    1 
ATOM   4746  N  NZ    . LYS C  1 50  ? 63.265  -7.847  5.025   1.00 31.48 ? 1023 LYS C NZ    1 
ATOM   4747  N  N     . GLU C  1 51  ? 61.408  -3.917  0.246   1.00 36.34 ? 1024 GLU C N     1 
ATOM   4748  C  CA    . GLU C  1 51  ? 59.987  -3.650  0.392   1.00 34.43 ? 1024 GLU C CA    1 
ATOM   4749  C  C     . GLU C  1 51  ? 59.311  -4.759  1.187   1.00 33.88 ? 1024 GLU C C     1 
ATOM   4750  O  O     . GLU C  1 51  ? 59.476  -5.953  0.900   1.00 31.74 ? 1024 GLU C O     1 
ATOM   4751  C  CB    . GLU C  1 51  ? 59.322  -3.495  -0.975  1.00 37.63 ? 1024 GLU C CB    1 
ATOM   4752  C  CG    . GLU C  1 51  ? 59.595  -2.159  -1.668  1.00 30.50 ? 1024 GLU C CG    1 
ATOM   4753  C  CD    . GLU C  1 51  ? 58.514  -1.790  -2.680  1.00 44.28 ? 1024 GLU C CD    1 
ATOM   4754  O  OE1   . GLU C  1 51  ? 57.781  -2.695  -3.151  1.00 38.52 ? 1024 GLU C OE1   1 
ATOM   4755  O  OE2   . GLU C  1 51  ? 58.395  -0.586  -3.005  1.00 43.92 ? 1024 GLU C OE2   1 
ATOM   4756  N  N     . VAL C  1 52  ? 58.578  -4.343  2.214   1.00 33.29 ? 1025 VAL C N     1 
ATOM   4757  C  CA    . VAL C  1 52  ? 57.744  -5.234  3.012   1.00 27.14 ? 1025 VAL C CA    1 
ATOM   4758  C  C     . VAL C  1 52  ? 56.334  -4.636  3.028   1.00 28.06 ? 1025 VAL C C     1 
ATOM   4759  O  O     . VAL C  1 52  ? 56.108  -3.555  2.466   1.00 23.80 ? 1025 VAL C O     1 
ATOM   4760  C  CB    . VAL C  1 52  ? 58.282  -5.389  4.466   1.00 27.44 ? 1025 VAL C CB    1 
ATOM   4761  C  CG1   . VAL C  1 52  ? 59.718  -5.907  4.466   1.00 25.98 ? 1025 VAL C CG1   1 
ATOM   4762  C  CG2   . VAL C  1 52  ? 58.189  -4.065  5.219   1.00 20.83 ? 1025 VAL C CG2   1 
ATOM   4763  N  N     . VAL C  1 53  ? 55.395  -5.341  3.662   1.00 21.44 ? 1026 VAL C N     1 
ATOM   4764  C  CA    . VAL C  1 53  ? 54.041  -4.854  3.808   1.00 21.27 ? 1026 VAL C CA    1 
ATOM   4765  C  C     . VAL C  1 53  ? 53.753  -4.744  5.292   1.00 20.78 ? 1026 VAL C C     1 
ATOM   4766  O  O     . VAL C  1 53  ? 54.002  -5.673  6.048   1.00 20.70 ? 1026 VAL C O     1 
ATOM   4767  C  CB    . VAL C  1 53  ? 52.993  -5.777  3.093   1.00 21.16 ? 1026 VAL C CB    1 
ATOM   4768  C  CG1   . VAL C  1 53  ? 51.562  -5.336  3.394   1.00 15.93 ? 1026 VAL C CG1   1 
ATOM   4769  C  CG2   . VAL C  1 53  ? 53.211  -5.781  1.606   1.00 13.25 ? 1026 VAL C CG2   1 
ATOM   4770  N  N     . VAL C  1 54  ? 53.259  -3.583  5.703   1.00 21.71 ? 1027 VAL C N     1 
ATOM   4771  C  CA    . VAL C  1 54  ? 52.791  -3.385  7.065   1.00 19.11 ? 1027 VAL C CA    1 
ATOM   4772  C  C     . VAL C  1 54  ? 51.255  -3.259  7.069   1.00 19.32 ? 1027 VAL C C     1 
ATOM   4773  O  O     . VAL C  1 54  ? 50.655  -2.643  6.179   1.00 18.54 ? 1027 VAL C O     1 
ATOM   4774  C  CB    . VAL C  1 54  ? 53.500  -2.181  7.782   1.00 14.91 ? 1027 VAL C CB    1 
ATOM   4775  C  CG1   . VAL C  1 54  ? 53.319  -0.864  7.011   1.00 21.07 ? 1027 VAL C CG1   1 
ATOM   4776  C  CG2   . VAL C  1 54  ? 53.012  -2.038  9.228   1.00 6.49  ? 1027 VAL C CG2   1 
ATOM   4777  N  N     . LYS C  1 55  ? 50.638  -3.886  8.060   1.00 18.94 ? 1028 LYS C N     1 
ATOM   4778  C  CA    . LYS C  1 55  ? 49.215  -3.757  8.296   1.00 19.37 ? 1028 LYS C CA    1 
ATOM   4779  C  C     . LYS C  1 55  ? 49.064  -3.190  9.709   1.00 17.79 ? 1028 LYS C C     1 
ATOM   4780  O  O     . LYS C  1 55  ? 49.456  -3.822  10.684  1.00 15.71 ? 1028 LYS C O     1 
ATOM   4781  C  CB    . LYS C  1 55  ? 48.522  -5.111  8.120   1.00 18.68 ? 1028 LYS C CB    1 
ATOM   4782  C  CG    . LYS C  1 55  ? 46.996  -5.093  8.164   1.00 23.00 ? 1028 LYS C CG    1 
ATOM   4783  C  CD    . LYS C  1 55  ? 46.462  -6.420  7.635   1.00 28.81 ? 1028 LYS C CD    1 
ATOM   4784  C  CE    . LYS C  1 55  ? 44.945  -6.497  7.644   1.00 33.82 ? 1028 LYS C CE    1 
ATOM   4785  N  NZ    . LYS C  1 55  ? 44.483  -7.870  7.242   1.00 30.18 ? 1028 LYS C NZ    1 
ATOM   4786  N  N     . PHE C  1 56  ? 48.533  -1.971  9.799   1.00 18.56 ? 1029 PHE C N     1 
ATOM   4787  C  CA    . PHE C  1 56  ? 48.252  -1.339  11.087  1.00 19.89 ? 1029 PHE C CA    1 
ATOM   4788  C  C     . PHE C  1 56  ? 46.912  -1.835  11.614  1.00 20.90 ? 1029 PHE C C     1 
ATOM   4789  O  O     . PHE C  1 56  ? 45.925  -1.908  10.877  1.00 25.54 ? 1029 PHE C O     1 
ATOM   4790  C  CB    . PHE C  1 56  ? 48.276  0.192   10.969  1.00 16.30 ? 1029 PHE C CB    1 
ATOM   4791  C  CG    . PHE C  1 56  ? 49.572  0.733   10.426  1.00 18.62 ? 1029 PHE C CG    1 
ATOM   4792  C  CD1   . PHE C  1 56  ? 50.660  0.940   11.265  1.00 14.47 ? 1029 PHE C CD1   1 
ATOM   4793  C  CD2   . PHE C  1 56  ? 49.709  1.017   9.071   1.00 7.84  ? 1029 PHE C CD2   1 
ATOM   4794  C  CE1   . PHE C  1 56  ? 51.866  1.433   10.762  1.00 18.95 ? 1029 PHE C CE1   1 
ATOM   4795  C  CE2   . PHE C  1 56  ? 50.915  1.506   8.557   1.00 13.72 ? 1029 PHE C CE2   1 
ATOM   4796  C  CZ    . PHE C  1 56  ? 51.985  1.722   9.404   1.00 11.91 ? 1029 PHE C CZ    1 
ATOM   4797  N  N     . ILE C  1 57  ? 46.907  -2.212  12.886  1.00 24.33 ? 1030 ILE C N     1 
ATOM   4798  C  CA    . ILE C  1 57  ? 45.739  -2.769  13.552  1.00 21.76 ? 1030 ILE C CA    1 
ATOM   4799  C  C     . ILE C  1 57  ? 45.512  -1.971  14.826  1.00 21.70 ? 1030 ILE C C     1 
ATOM   4800  O  O     . ILE C  1 57  ? 46.291  -2.060  15.779  1.00 19.12 ? 1030 ILE C O     1 
ATOM   4801  C  CB    . ILE C  1 57  ? 45.916  -4.286  13.852  1.00 20.52 ? 1030 ILE C CB    1 
ATOM   4802  C  CG1   . ILE C  1 57  ? 46.071  -5.076  12.539  1.00 22.48 ? 1030 ILE C CG1   1 
ATOM   4803  C  CG2   . ILE C  1 57  ? 44.711  -4.832  14.651  1.00 20.14 ? 1030 ILE C CG2   1 
ATOM   4804  C  CD1   . ILE C  1 57  ? 46.943  -6.339  12.646  1.00 21.73 ? 1030 ILE C CD1   1 
ATOM   4805  N  N     . LYS C  1 58  ? 44.434  -1.190  14.810  1.00 30.04 ? 1031 LYS C N     1 
ATOM   4806  C  CA    . LYS C  1 58  ? 44.053  -0.284  15.891  1.00 32.58 ? 1031 LYS C CA    1 
ATOM   4807  C  C     . LYS C  1 58  ? 43.418  -1.037  17.054  1.00 33.75 ? 1031 LYS C C     1 
ATOM   4808  O  O     . LYS C  1 58  ? 42.502  -1.839  16.851  1.00 29.13 ? 1031 LYS C O     1 
ATOM   4809  C  CB    . LYS C  1 58  ? 43.073  0.772   15.362  1.00 30.72 ? 1031 LYS C CB    1 
ATOM   4810  C  CG    . LYS C  1 58  ? 42.764  1.883   16.357  1.00 29.99 ? 1031 LYS C CG    1 
ATOM   4811  C  CD    . LYS C  1 58  ? 41.680  2.811   15.851  1.00 38.57 ? 1031 LYS C CD    1 
ATOM   4812  C  CE    . LYS C  1 58  ? 41.300  3.837   16.908  1.00 40.92 ? 1031 LYS C CE    1 
ATOM   4813  N  NZ    . LYS C  1 58  ? 42.402  4.798   17.162  1.00 33.52 ? 1031 LYS C NZ    1 
ATOM   4814  N  N     . LYS C  1 59  ? 43.905  -0.763  18.267  1.00 36.39 ? 1032 LYS C N     1 
ATOM   4815  C  CA    . LYS C  1 59  ? 43.334  -1.332  19.501  1.00 39.39 ? 1032 LYS C CA    1 
ATOM   4816  C  C     . LYS C  1 59  ? 41.954  -0.747  19.832  1.00 38.22 ? 1032 LYS C C     1 
ATOM   4817  O  O     . LYS C  1 59  ? 41.810  0.098   20.720  1.00 36.42 ? 1032 LYS C O     1 
ATOM   4818  C  CB    . LYS C  1 59  ? 44.283  -1.134  20.686  1.00 38.63 ? 1032 LYS C CB    1 
ATOM   4819  C  CG    . LYS C  1 59  ? 45.250  -2.268  20.915  1.00 41.10 ? 1032 LYS C CG    1 
ATOM   4820  C  CD    . LYS C  1 59  ? 46.548  -2.043  20.198  1.00 35.48 ? 1032 LYS C CD    1 
ATOM   4821  C  CE    . LYS C  1 59  ? 47.710  -2.546  21.030  1.00 47.76 ? 1032 LYS C CE    1 
ATOM   4822  N  NZ    . LYS C  1 59  ? 47.820  -1.835  22.326  1.00 31.61 ? 1032 LYS C NZ    1 
ATOM   4823  N  N     . GLU C  1 60  ? 40.946  -1.219  19.108  1.00 38.77 ? 1033 GLU C N     1 
ATOM   4824  C  CA    . GLU C  1 60  ? 39.583  -0.717  19.221  1.00 37.14 ? 1033 GLU C CA    1 
ATOM   4825  C  C     . GLU C  1 60  ? 38.645  -1.914  19.304  1.00 36.86 ? 1033 GLU C C     1 
ATOM   4826  O  O     . GLU C  1 60  ? 39.023  -3.024  18.901  1.00 36.26 ? 1033 GLU C O     1 
ATOM   4827  C  CB    . GLU C  1 60  ? 39.234  0.123   17.983  1.00 36.00 ? 1033 GLU C CB    1 
ATOM   4828  C  CG    . GLU C  1 60  ? 38.903  -0.719  16.741  1.00 30.95 ? 1033 GLU C CG    1 
ATOM   4829  C  CD    . GLU C  1 60  ? 38.804  0.084   15.461  1.00 39.20 ? 1033 GLU C CD    1 
ATOM   4830  O  OE1   . GLU C  1 60  ? 38.851  -0.529  14.370  1.00 41.36 ? 1033 GLU C OE1   1 
ATOM   4831  O  OE2   . GLU C  1 60  ? 38.686  1.321   15.539  1.00 33.15 ? 1033 GLU C OE2   1 
ATOM   4832  N  N     . LYS C  1 61  ? 37.426  -1.679  19.793  1.00 33.88 ? 1034 LYS C N     1 
ATOM   4833  C  CA    . LYS C  1 61  ? 36.376  -2.714  19.899  1.00 31.09 ? 1034 LYS C CA    1 
ATOM   4834  C  C     . LYS C  1 61  ? 36.942  -4.079  20.289  1.00 29.49 ? 1034 LYS C C     1 
ATOM   4835  O  O     . LYS C  1 61  ? 36.754  -5.082  19.586  1.00 26.30 ? 1034 LYS C O     1 
ATOM   4836  C  CB    . LYS C  1 61  ? 35.554  -2.824  18.603  1.00 30.73 ? 1034 LYS C CB    1 
ATOM   4837  C  CG    . LYS C  1 61  ? 35.107  -1.495  18.000  1.00 33.44 ? 1034 LYS C CG    1 
ATOM   4838  C  CD    . LYS C  1 61  ? 34.232  -1.688  16.762  1.00 32.58 ? 1034 LYS C CD    1 
ATOM   4839  C  CE    . LYS C  1 61  ? 34.878  -2.592  15.714  1.00 38.20 ? 1034 LYS C CE    1 
ATOM   4840  N  NZ    . LYS C  1 61  ? 33.944  -2.907  14.584  1.00 43.47 ? 1034 LYS C NZ    1 
ATOM   4841  N  N     . VAL C  1 62  ? 37.647  -4.091  21.413  1.00 33.70 ? 1035 VAL C N     1 
ATOM   4842  C  CA    . VAL C  1 62  ? 38.299  -5.289  21.928  1.00 38.07 ? 1035 VAL C CA    1 
ATOM   4843  C  C     . VAL C  1 62  ? 37.274  -6.253  22.533  1.00 39.09 ? 1035 VAL C C     1 
ATOM   4844  O  O     . VAL C  1 62  ? 37.545  -7.445  22.691  1.00 43.85 ? 1035 VAL C O     1 
ATOM   4845  C  CB    . VAL C  1 62  ? 39.392  -4.913  22.958  1.00 37.62 ? 1035 VAL C CB    1 
ATOM   4846  C  CG1   . VAL C  1 62  ? 38.782  -4.594  24.335  1.00 32.51 ? 1035 VAL C CG1   1 
ATOM   4847  C  CG2   . VAL C  1 62  ? 40.439  -6.010  23.051  1.00 49.32 ? 1035 VAL C CG2   1 
ATOM   4848  N  N     . ILE C  1 68  ? 41.161  -13.100 22.776  1.00 61.82 ? 1041 ILE C N     1 
ATOM   4849  C  CA    . ILE C  1 68  ? 42.181  -14.088 22.454  1.00 62.23 ? 1041 ILE C CA    1 
ATOM   4850  C  C     . ILE C  1 68  ? 43.546  -13.606 22.951  1.00 65.10 ? 1041 ILE C C     1 
ATOM   4851  O  O     . ILE C  1 68  ? 43.863  -12.417 22.841  1.00 59.89 ? 1041 ILE C O     1 
ATOM   4852  C  CB    . ILE C  1 68  ? 42.248  -14.372 20.917  1.00 60.46 ? 1041 ILE C CB    1 
ATOM   4853  C  CG1   . ILE C  1 68  ? 40.844  -14.567 20.310  1.00 53.61 ? 1041 ILE C CG1   1 
ATOM   4854  C  CG2   . ILE C  1 68  ? 43.207  -15.526 20.603  1.00 51.82 ? 1041 ILE C CG2   1 
ATOM   4855  C  CD1   . ILE C  1 68  ? 40.057  -15.759 20.822  1.00 52.83 ? 1041 ILE C CD1   1 
ATOM   4856  N  N     . GLU C  1 69  ? 44.339  -14.537 23.492  1.00 68.91 ? 1042 GLU C N     1 
ATOM   4857  C  CA    . GLU C  1 69  ? 45.697  -14.257 23.970  1.00 68.80 ? 1042 GLU C CA    1 
ATOM   4858  C  C     . GLU C  1 69  ? 46.641  -15.458 23.817  1.00 68.56 ? 1042 GLU C C     1 
ATOM   4859  O  O     . GLU C  1 69  ? 46.584  -16.403 24.606  1.00 66.80 ? 1042 GLU C O     1 
ATOM   4860  C  CB    . GLU C  1 69  ? 45.666  -13.795 25.431  1.00 69.95 ? 1042 GLU C CB    1 
ATOM   4861  N  N     . ASP C  1 70  ? 47.500  -15.411 22.796  1.00 68.50 ? 1043 ASP C N     1 
ATOM   4862  C  CA    . ASP C  1 70  ? 48.562  -16.404 22.607  1.00 67.82 ? 1043 ASP C CA    1 
ATOM   4863  C  C     . ASP C  1 70  ? 49.713  -16.170 23.597  1.00 70.33 ? 1043 ASP C C     1 
ATOM   4864  O  O     . ASP C  1 70  ? 50.208  -15.043 23.712  1.00 70.66 ? 1043 ASP C O     1 
ATOM   4865  C  CB    . ASP C  1 70  ? 49.088  -16.385 21.163  1.00 65.29 ? 1043 ASP C CB    1 
ATOM   4866  C  CG    . ASP C  1 70  ? 48.663  -17.615 20.353  1.00 65.78 ? 1043 ASP C CG    1 
ATOM   4867  O  OD1   . ASP C  1 70  ? 47.452  -17.941 20.323  1.00 55.09 ? 1043 ASP C OD1   1 
ATOM   4868  O  OD2   . ASP C  1 70  ? 49.550  -18.249 19.730  1.00 49.43 ? 1043 ASP C OD2   1 
ATOM   4869  N  N     . PRO C  1 71  ? 50.141  -17.237 24.311  1.00 71.72 ? 1044 PRO C N     1 
ATOM   4870  C  CA    . PRO C  1 71  ? 51.162  -17.165 25.365  1.00 72.40 ? 1044 PRO C CA    1 
ATOM   4871  C  C     . PRO C  1 71  ? 52.499  -16.576 24.912  1.00 72.96 ? 1044 PRO C C     1 
ATOM   4872  O  O     . PRO C  1 71  ? 53.009  -15.662 25.562  1.00 73.28 ? 1044 PRO C O     1 
ATOM   4873  C  CB    . PRO C  1 71  ? 51.340  -18.631 25.784  1.00 72.89 ? 1044 PRO C CB    1 
ATOM   4874  C  CG    . PRO C  1 71  ? 50.071  -19.294 25.396  1.00 72.22 ? 1044 PRO C CG    1 
ATOM   4875  C  CD    . PRO C  1 71  ? 49.641  -18.614 24.139  1.00 72.02 ? 1044 PRO C CD    1 
ATOM   4876  N  N     . LYS C  1 72  ? 53.046  -17.095 23.811  1.00 73.10 ? 1045 LYS C N     1 
ATOM   4877  C  CA    . LYS C  1 72  ? 54.332  -16.639 23.265  1.00 72.75 ? 1045 LYS C CA    1 
ATOM   4878  C  C     . LYS C  1 72  ? 54.318  -15.159 22.864  1.00 73.83 ? 1045 LYS C C     1 
ATOM   4879  O  O     . LYS C  1 72  ? 55.339  -14.470 22.965  1.00 72.76 ? 1045 LYS C O     1 
ATOM   4880  C  CB    . LYS C  1 72  ? 54.752  -17.504 22.069  1.00 71.59 ? 1045 LYS C CB    1 
ATOM   4881  C  CG    . LYS C  1 72  ? 55.115  -18.941 22.423  1.00 70.65 ? 1045 LYS C CG    1 
ATOM   4882  N  N     . LEU C  1 73  ? 53.157  -14.682 22.416  1.00 74.51 ? 1046 LEU C N     1 
ATOM   4883  C  CA    . LEU C  1 73  ? 52.976  -13.278 22.039  1.00 74.14 ? 1046 LEU C CA    1 
ATOM   4884  C  C     . LEU C  1 73  ? 52.623  -12.405 23.249  1.00 72.31 ? 1046 LEU C C     1 
ATOM   4885  O  O     . LEU C  1 73  ? 53.493  -11.734 23.808  1.00 70.85 ? 1046 LEU C O     1 
ATOM   4886  C  CB    . LEU C  1 73  ? 51.910  -13.142 20.942  1.00 73.11 ? 1046 LEU C CB    1 
ATOM   4887  C  CG    . LEU C  1 73  ? 52.101  -13.921 19.637  1.00 73.76 ? 1046 LEU C CG    1 
ATOM   4888  C  CD1   . LEU C  1 73  ? 50.780  -14.008 18.895  1.00 65.06 ? 1046 LEU C CD1   1 
ATOM   4889  C  CD2   . LEU C  1 73  ? 53.193  -13.305 18.761  1.00 68.85 ? 1046 LEU C CD2   1 
ATOM   4890  N  N     . GLY C  1 74  ? 51.352  -12.429 23.649  1.00 71.08 ? 1047 GLY C N     1 
ATOM   4891  C  CA    . GLY C  1 74  ? 50.861  -11.614 24.758  1.00 69.74 ? 1047 GLY C CA    1 
ATOM   4892  C  C     . GLY C  1 74  ? 49.351  -11.509 24.727  1.00 67.34 ? 1047 GLY C C     1 
ATOM   4893  O  O     . GLY C  1 74  ? 48.656  -12.474 25.044  1.00 66.04 ? 1047 GLY C O     1 
ATOM   4894  N  N     . LYS C  1 75  ? 48.851  -10.329 24.357  1.00 67.32 ? 1048 LYS C N     1 
ATOM   4895  C  CA    . LYS C  1 75  ? 47.419  -10.111 24.109  1.00 65.89 ? 1048 LYS C CA    1 
ATOM   4896  C  C     . LYS C  1 75  ? 47.245  -9.592  22.676  1.00 63.13 ? 1048 LYS C C     1 
ATOM   4897  O  O     . LYS C  1 75  ? 47.886  -8.613  22.280  1.00 62.54 ? 1048 LYS C O     1 
ATOM   4898  C  CB    . LYS C  1 75  ? 46.823  -9.130  25.129  1.00 65.61 ? 1048 LYS C CB    1 
ATOM   4899  C  CG    . LYS C  1 75  ? 45.544  -9.625  25.813  1.00 57.63 ? 1048 LYS C CG    1 
ATOM   4900  C  CD    . LYS C  1 75  ? 44.357  -9.726  24.865  1.00 54.80 ? 1048 LYS C CD    1 
ATOM   4901  C  CE    . LYS C  1 75  ? 43.595  -8.413  24.765  1.00 47.32 ? 1048 LYS C CE    1 
ATOM   4902  N  NZ    . LYS C  1 75  ? 42.489  -8.513  23.783  1.00 40.29 ? 1048 LYS C NZ    1 
ATOM   4903  N  N     . VAL C  1 76  ? 46.381  -10.255 21.905  1.00 57.12 ? 1049 VAL C N     1 
ATOM   4904  C  CA    . VAL C  1 76  ? 46.399  -10.137 20.443  1.00 46.36 ? 1049 VAL C CA    1 
ATOM   4905  C  C     . VAL C  1 76  ? 45.021  -10.202 19.786  1.00 44.60 ? 1049 VAL C C     1 
ATOM   4906  O  O     . VAL C  1 76  ? 44.002  -10.419 20.450  1.00 41.03 ? 1049 VAL C O     1 
ATOM   4907  C  CB    . VAL C  1 76  ? 47.257  -11.267 19.813  1.00 47.64 ? 1049 VAL C CB    1 
ATOM   4908  C  CG1   . VAL C  1 76  ? 48.710  -11.177 20.270  1.00 46.68 ? 1049 VAL C CG1   1 
ATOM   4909  C  CG2   . VAL C  1 76  ? 46.663  -12.654 20.125  1.00 38.39 ? 1049 VAL C CG2   1 
ATOM   4910  N  N     . THR C  1 77  ? 45.003  -10.011 18.468  1.00 39.77 ? 1050 THR C N     1 
ATOM   4911  C  CA    . THR C  1 77  ? 43.848  -10.388 17.667  1.00 32.28 ? 1050 THR C CA    1 
ATOM   4912  C  C     . THR C  1 77  ? 44.074  -11.790 17.070  1.00 33.28 ? 1050 THR C C     1 
ATOM   4913  O  O     . THR C  1 77  ? 45.206  -12.289 17.051  1.00 32.94 ? 1050 THR C O     1 
ATOM   4914  C  CB    . THR C  1 77  ? 43.507  -9.334  16.584  1.00 29.45 ? 1050 THR C CB    1 
ATOM   4915  O  OG1   . THR C  1 77  ? 42.239  -9.649  15.995  1.00 35.83 ? 1050 THR C OG1   1 
ATOM   4916  C  CG2   . THR C  1 77  ? 44.570  -9.274  15.493  1.00 18.43 ? 1050 THR C CG2   1 
ATOM   4917  N  N     . LEU C  1 78  ? 42.998  -12.416 16.597  1.00 27.85 ? 1051 LEU C N     1 
ATOM   4918  C  CA    . LEU C  1 78  ? 43.064  -13.751 16.002  1.00 29.57 ? 1051 LEU C CA    1 
ATOM   4919  C  C     . LEU C  1 78  ? 43.894  -13.778 14.713  1.00 29.48 ? 1051 LEU C C     1 
ATOM   4920  O  O     . LEU C  1 78  ? 44.488  -14.803 14.374  1.00 32.73 ? 1051 LEU C O     1 
ATOM   4921  C  CB    . LEU C  1 78  ? 41.652  -14.295 15.763  1.00 26.39 ? 1051 LEU C CB    1 
ATOM   4922  C  CG    . LEU C  1 78  ? 41.284  -15.741 16.126  1.00 33.30 ? 1051 LEU C CG    1 
ATOM   4923  C  CD1   . LEU C  1 78  ? 42.085  -16.311 17.290  1.00 31.17 ? 1051 LEU C CD1   1 
ATOM   4924  C  CD2   . LEU C  1 78  ? 39.802  -15.817 16.426  1.00 20.96 ? 1051 LEU C CD2   1 
ATOM   4925  N  N     . GLU C  1 79  ? 43.945  -12.648 14.014  1.00 28.61 ? 1052 GLU C N     1 
ATOM   4926  C  CA    . GLU C  1 79  ? 44.800  -12.494 12.833  1.00 29.81 ? 1052 GLU C CA    1 
ATOM   4927  C  C     . GLU C  1 79  ? 46.278  -12.595 13.194  1.00 27.74 ? 1052 GLU C C     1 
ATOM   4928  O  O     . GLU C  1 79  ? 47.052  -13.180 12.455  1.00 25.66 ? 1052 GLU C O     1 
ATOM   4929  C  CB    . GLU C  1 79  ? 44.526  -11.159 12.133  1.00 26.72 ? 1052 GLU C CB    1 
ATOM   4930  C  CG    . GLU C  1 79  ? 45.554  -10.777 11.060  1.00 32.04 ? 1052 GLU C CG    1 
ATOM   4931  C  CD    . GLU C  1 79  ? 45.038  -9.743  10.068  1.00 29.48 ? 1052 GLU C CD    1 
ATOM   4932  O  OE1   . GLU C  1 79  ? 44.236  -8.877  10.470  1.00 34.84 ? 1052 GLU C OE1   1 
ATOM   4933  O  OE2   . GLU C  1 79  ? 45.437  -9.800  8.883   1.00 33.66 ? 1052 GLU C OE2   1 
ATOM   4934  N  N     . ILE C  1 80  ? 46.645  -12.004 14.327  1.00 26.64 ? 1053 ILE C N     1 
ATOM   4935  C  CA    . ILE C  1 80  ? 48.016  -11.993 14.813  1.00 26.72 ? 1053 ILE C CA    1 
ATOM   4936  C  C     . ILE C  1 80  ? 48.407  -13.336 15.450  1.00 29.96 ? 1053 ILE C C     1 
ATOM   4937  O  O     . ILE C  1 80  ? 49.486  -13.863 15.160  1.00 31.04 ? 1053 ILE C O     1 
ATOM   4938  C  CB    . ILE C  1 80  ? 48.256  -10.782 15.758  1.00 24.29 ? 1053 ILE C CB    1 
ATOM   4939  C  CG1   . ILE C  1 80  ? 48.429  -9.507  14.922  1.00 28.21 ? 1053 ILE C CG1   1 
ATOM   4940  C  CG2   . ILE C  1 80  ? 49.469  -10.993 16.662  1.00 23.20 ? 1053 ILE C CG2   1 
ATOM   4941  C  CD1   . ILE C  1 80  ? 48.101  -8.235  15.669  1.00 34.13 ? 1053 ILE C CD1   1 
ATOM   4942  N  N     . ALA C  1 81  ? 47.526  -13.881 16.293  1.00 27.92 ? 1054 ALA C N     1 
ATOM   4943  C  CA    . ALA C  1 81  ? 47.706  -15.212 16.896  1.00 30.35 ? 1054 ALA C CA    1 
ATOM   4944  C  C     . ALA C  1 81  ? 47.958  -16.286 15.845  1.00 27.43 ? 1054 ALA C C     1 
ATOM   4945  O  O     . ALA C  1 81  ? 48.966  -16.985 15.903  1.00 33.25 ? 1054 ALA C O     1 
ATOM   4946  C  CB    . ALA C  1 81  ? 46.488  -15.594 17.772  1.00 27.28 ? 1054 ALA C CB    1 
ATOM   4947  N  N     . ILE C  1 82  ? 47.038  -16.398 14.890  1.00 30.30 ? 1055 ILE C N     1 
ATOM   4948  C  CA    . ILE C  1 82  ? 47.129  -17.361 13.792  1.00 29.12 ? 1055 ILE C CA    1 
ATOM   4949  C  C     . ILE C  1 82  ? 48.371  -17.120 12.933  1.00 33.00 ? 1055 ILE C C     1 
ATOM   4950  O  O     . ILE C  1 82  ? 49.106  -18.062 12.633  1.00 32.82 ? 1055 ILE C O     1 
ATOM   4951  C  CB    . ILE C  1 82  ? 45.816  -17.383 12.943  1.00 28.91 ? 1055 ILE C CB    1 
ATOM   4952  C  CG1   . ILE C  1 82  ? 44.712  -18.124 13.704  1.00 23.93 ? 1055 ILE C CG1   1 
ATOM   4953  C  CG2   . ILE C  1 82  ? 46.032  -18.027 11.564  1.00 26.73 ? 1055 ILE C CG2   1 
ATOM   4954  C  CD1   . ILE C  1 82  ? 43.297  -17.777 13.274  1.00 26.79 ? 1055 ILE C CD1   1 
ATOM   4955  N  N     . LEU C  1 83  ? 48.627  -15.862 12.571  1.00 35.97 ? 1056 LEU C N     1 
ATOM   4956  C  CA    . LEU C  1 83  ? 49.762  -15.545 11.687  1.00 38.92 ? 1056 LEU C CA    1 
ATOM   4957  C  C     . LEU C  1 83  ? 51.143  -15.764 12.304  1.00 38.41 ? 1056 LEU C C     1 
ATOM   4958  O  O     . LEU C  1 83  ? 52.110  -16.013 11.582  1.00 43.04 ? 1056 LEU C O     1 
ATOM   4959  C  CB    . LEU C  1 83  ? 49.653  -14.143 11.073  1.00 35.43 ? 1056 LEU C CB    1 
ATOM   4960  C  CG    . LEU C  1 83  ? 48.954  -14.076 9.721   1.00 28.80 ? 1056 LEU C CG    1 
ATOM   4961  C  CD1   . LEU C  1 83  ? 48.901  -12.628 9.237   1.00 33.08 ? 1056 LEU C CD1   1 
ATOM   4962  C  CD2   . LEU C  1 83  ? 49.649  -14.968 8.685   1.00 30.66 ? 1056 LEU C CD2   1 
ATOM   4963  N  N     . SER C  1 84  ? 51.230  -15.658 13.627  1.00 40.25 ? 1057 SER C N     1 
ATOM   4964  C  CA    . SER C  1 84  ? 52.449  -16.013 14.367  1.00 42.66 ? 1057 SER C CA    1 
ATOM   4965  C  C     . SER C  1 84  ? 52.784  -17.510 14.288  1.00 42.38 ? 1057 SER C C     1 
ATOM   4966  O  O     . SER C  1 84  ? 53.937  -17.905 14.463  1.00 46.63 ? 1057 SER C O     1 
ATOM   4967  C  CB    . SER C  1 84  ? 52.289  -15.642 15.841  1.00 42.04 ? 1057 SER C CB    1 
ATOM   4968  O  OG    . SER C  1 84  ? 51.974  -14.280 15.987  1.00 48.74 ? 1057 SER C OG    1 
ATOM   4969  N  N     . ARG C  1 85  ? 51.763  -18.326 14.038  1.00 40.95 ? 1058 ARG C N     1 
ATOM   4970  C  CA    . ARG C  1 85  ? 51.846  -19.775 14.192  1.00 44.98 ? 1058 ARG C CA    1 
ATOM   4971  C  C     . ARG C  1 85  ? 52.085  -20.488 12.865  1.00 44.30 ? 1058 ARG C C     1 
ATOM   4972  O  O     . ARG C  1 85  ? 52.972  -21.337 12.757  1.00 48.58 ? 1058 ARG C O     1 
ATOM   4973  C  CB    . ARG C  1 85  ? 50.555  -20.305 14.828  1.00 45.30 ? 1058 ARG C CB    1 
ATOM   4974  C  CG    . ARG C  1 85  ? 50.389  -20.035 16.327  1.00 47.51 ? 1058 ARG C CG    1 
ATOM   4975  C  CD    . ARG C  1 85  ? 48.908  -20.076 16.741  1.00 47.94 ? 1058 ARG C CD    1 
ATOM   4976  N  NE    . ARG C  1 85  ? 48.195  -21.241 16.204  1.00 62.38 ? 1058 ARG C NE    1 
ATOM   4977  C  CZ    . ARG C  1 85  ? 47.648  -22.216 16.932  1.00 61.26 ? 1058 ARG C CZ    1 
ATOM   4978  N  NH1   . ARG C  1 85  ? 47.700  -22.190 18.260  1.00 51.06 ? 1058 ARG C NH1   1 
ATOM   4979  N  NH2   . ARG C  1 85  ? 47.033  -23.223 16.323  1.00 63.52 ? 1058 ARG C NH2   1 
ATOM   4980  N  N     . VAL C  1 86  ? 51.289  -20.131 11.863  1.00 40.20 ? 1059 VAL C N     1 
ATOM   4981  C  CA    . VAL C  1 86  ? 51.286  -20.828 10.584  1.00 37.19 ? 1059 VAL C CA    1 
ATOM   4982  C  C     . VAL C  1 86  ? 52.528  -20.541 9.739   1.00 36.79 ? 1059 VAL C C     1 
ATOM   4983  O  O     . VAL C  1 86  ? 52.939  -19.388 9.573   1.00 35.70 ? 1059 VAL C O     1 
ATOM   4984  C  CB    . VAL C  1 86  ? 49.978  -20.564 9.773   1.00 33.13 ? 1059 VAL C CB    1 
ATOM   4985  C  CG1   . VAL C  1 86  ? 48.751  -20.809 10.650  1.00 33.60 ? 1059 VAL C CG1   1 
ATOM   4986  C  CG2   . VAL C  1 86  ? 49.949  -19.156 9.199   1.00 35.11 ? 1059 VAL C CG2   1 
ATOM   4987  N  N     . GLU C  1 87  ? 53.129  -21.613 9.237   1.00 32.94 ? 1060 GLU C N     1 
ATOM   4988  C  CA    . GLU C  1 87  ? 54.195  -21.528 8.266   1.00 31.64 ? 1060 GLU C CA    1 
ATOM   4989  C  C     . GLU C  1 87  ? 53.879  -22.513 7.156   1.00 29.60 ? 1060 GLU C C     1 
ATOM   4990  O  O     . GLU C  1 87  ? 53.781  -23.721 7.392   1.00 33.56 ? 1060 GLU C O     1 
ATOM   4991  C  CB    . GLU C  1 87  ? 55.551  -21.835 8.909   1.00 34.69 ? 1060 GLU C CB    1 
ATOM   4992  N  N     . HIS C  1 88  ? 53.699  -21.974 5.952   1.00 25.85 ? 1061 HIS C N     1 
ATOM   4993  C  CA    . HIS C  1 88  ? 53.382  -22.746 4.764   1.00 21.61 ? 1061 HIS C CA    1 
ATOM   4994  C  C     . HIS C  1 88  ? 53.860  -21.994 3.538   1.00 25.57 ? 1061 HIS C C     1 
ATOM   4995  O  O     . HIS C  1 88  ? 53.922  -20.764 3.544   1.00 32.83 ? 1061 HIS C O     1 
ATOM   4996  C  CB    . HIS C  1 88  ? 51.872  -22.995 4.653   1.00 20.83 ? 1061 HIS C CB    1 
ATOM   4997  C  CG    . HIS C  1 88  ? 51.495  -23.883 3.506   1.00 16.34 ? 1061 HIS C CG    1 
ATOM   4998  N  ND1   . HIS C  1 88  ? 51.110  -23.389 2.280   1.00 21.11 ? 1061 HIS C ND1   1 
ATOM   4999  C  CD2   . HIS C  1 88  ? 51.465  -25.232 3.393   1.00 13.86 ? 1061 HIS C CD2   1 
ATOM   5000  C  CE1   . HIS C  1 88  ? 50.855  -24.394 1.461   1.00 20.95 ? 1061 HIS C CE1   1 
ATOM   5001  N  NE2   . HIS C  1 88  ? 51.077  -25.522 2.109   1.00 10.45 ? 1061 HIS C NE2   1 
ATOM   5002  N  N     . ALA C  1 89  ? 54.163  -22.734 2.475   1.00 22.94 ? 1062 ALA C N     1 
ATOM   5003  C  CA    . ALA C  1 89  ? 54.661  -22.153 1.234   1.00 23.42 ? 1062 ALA C CA    1 
ATOM   5004  C  C     . ALA C  1 89  ? 53.703  -21.154 0.561   1.00 24.64 ? 1062 ALA C C     1 
ATOM   5005  O  O     . ALA C  1 89  ? 54.151  -20.257 -0.162  1.00 24.96 ? 1062 ALA C O     1 
ATOM   5006  C  CB    . ALA C  1 89  ? 55.068  -23.263 0.256   1.00 24.50 ? 1062 ALA C CB    1 
ATOM   5007  N  N     . ASN C  1 90  ? 52.398  -21.305 0.803   1.00 23.26 ? 1063 ASN C N     1 
ATOM   5008  C  CA    . ASN C  1 90  ? 51.388  -20.468 0.147   1.00 24.41 ? 1063 ASN C CA    1 
ATOM   5009  C  C     . ASN C  1 90  ? 50.556  -19.572 1.102   1.00 21.86 ? 1063 ASN C C     1 
ATOM   5010  O  O     . ASN C  1 90  ? 49.468  -19.117 0.756   1.00 20.65 ? 1063 ASN C O     1 
ATOM   5011  C  CB    . ASN C  1 90  ? 50.495  -21.316 -0.773  1.00 24.06 ? 1063 ASN C CB    1 
ATOM   5012  C  CG    . ASN C  1 90  ? 51.279  -21.986 -1.903  1.00 26.02 ? 1063 ASN C CG    1 
ATOM   5013  O  OD1   . ASN C  1 90  ? 51.462  -23.201 -1.905  1.00 25.67 ? 1063 ASN C OD1   1 
ATOM   5014  N  ND2   . ASN C  1 90  ? 51.744  -21.192 -2.862  1.00 27.77 ? 1063 ASN C ND2   1 
ATOM   5015  N  N     . ILE C  1 91  ? 51.106  -19.326 2.286   1.00 22.03 ? 1064 ILE C N     1 
ATOM   5016  C  CA    . ILE C  1 91  ? 50.559  -18.400 3.271   1.00 24.42 ? 1064 ILE C CA    1 
ATOM   5017  C  C     . ILE C  1 91  ? 51.636  -17.349 3.513   1.00 23.81 ? 1064 ILE C C     1 
ATOM   5018  O  O     . ILE C  1 91  ? 52.819  -17.675 3.640   1.00 23.13 ? 1064 ILE C O     1 
ATOM   5019  C  CB    . ILE C  1 91  ? 50.192  -19.106 4.619   1.00 22.87 ? 1064 ILE C CB    1 
ATOM   5020  C  CG1   . ILE C  1 91  ? 49.072  -20.140 4.416   1.00 30.61 ? 1064 ILE C CG1   1 
ATOM   5021  C  CG2   . ILE C  1 91  ? 49.783  -18.090 5.683   1.00 24.88 ? 1064 ILE C CG2   1 
ATOM   5022  C  CD1   . ILE C  1 91  ? 48.822  -21.044 5.632   1.00 24.22 ? 1064 ILE C CD1   1 
ATOM   5023  N  N     . ILE C  1 92  ? 51.214  -16.091 3.548   1.00 25.34 ? 1065 ILE C N     1 
ATOM   5024  C  CA    . ILE C  1 92  ? 52.108  -14.950 3.708   1.00 23.24 ? 1065 ILE C CA    1 
ATOM   5025  C  C     . ILE C  1 92  ? 52.988  -15.082 4.954   1.00 23.36 ? 1065 ILE C C     1 
ATOM   5026  O  O     . ILE C  1 92  ? 52.497  -15.421 6.034   1.00 19.57 ? 1065 ILE C O     1 
ATOM   5027  C  CB    . ILE C  1 92  ? 51.305  -13.601 3.704   1.00 17.98 ? 1065 ILE C CB    1 
ATOM   5028  C  CG1   . ILE C  1 92  ? 52.187  -12.438 3.240   1.00 19.55 ? 1065 ILE C CG1   1 
ATOM   5029  C  CG2   . ILE C  1 92  ? 50.640  -13.322 5.064   1.00 15.04 ? 1065 ILE C CG2   1 
ATOM   5030  C  CD1   . ILE C  1 92  ? 52.454  -12.428 1.723   1.00 21.04 ? 1065 ILE C CD1   1 
ATOM   5031  N  N     . LYS C  1 93  ? 54.284  -14.815 4.795   1.00 24.85 ? 1066 LYS C N     1 
ATOM   5032  C  CA    . LYS C  1 93  ? 55.209  -14.844 5.940   1.00 29.42 ? 1066 LYS C CA    1 
ATOM   5033  C  C     . LYS C  1 93  ? 55.287  -13.522 6.725   1.00 26.39 ? 1066 LYS C C     1 
ATOM   5034  O  O     . LYS C  1 93  ? 55.322  -12.421 6.153   1.00 19.59 ? 1066 LYS C O     1 
ATOM   5035  C  CB    . LYS C  1 93  ? 56.609  -15.370 5.538   1.00 30.81 ? 1066 LYS C CB    1 
ATOM   5036  C  CG    . LYS C  1 93  ? 57.637  -14.305 5.132   1.00 42.03 ? 1066 LYS C CG    1 
ATOM   5037  C  CD    . LYS C  1 93  ? 58.972  -14.904 4.690   1.00 36.65 ? 1066 LYS C CD    1 
ATOM   5038  C  CE    . LYS C  1 93  ? 59.936  -15.033 5.856   1.00 49.73 ? 1066 LYS C CE    1 
ATOM   5039  N  NZ    . LYS C  1 93  ? 61.356  -14.991 5.395   1.00 48.16 ? 1066 LYS C NZ    1 
ATOM   5040  N  N     . VAL C  1 94  ? 55.291  -13.668 8.046   1.00 30.55 ? 1067 VAL C N     1 
ATOM   5041  C  CA    . VAL C  1 94  ? 55.386  -12.570 8.994   1.00 30.63 ? 1067 VAL C CA    1 
ATOM   5042  C  C     . VAL C  1 94  ? 56.865  -12.270 9.243   1.00 31.49 ? 1067 VAL C C     1 
ATOM   5043  O  O     . VAL C  1 94  ? 57.666  -13.184 9.475   1.00 25.77 ? 1067 VAL C O     1 
ATOM   5044  C  CB    . VAL C  1 94  ? 54.697  -12.943 10.338  1.00 27.95 ? 1067 VAL C CB    1 
ATOM   5045  C  CG1   . VAL C  1 94  ? 54.875  -11.843 11.376  1.00 33.84 ? 1067 VAL C CG1   1 
ATOM   5046  C  CG2   . VAL C  1 94  ? 53.223  -13.232 10.127  1.00 30.60 ? 1067 VAL C CG2   1 
ATOM   5047  N  N     . LEU C  1 95  ? 57.222  -10.989 9.191   1.00 29.20 ? 1068 LEU C N     1 
ATOM   5048  C  CA    . LEU C  1 95  ? 58.604  -10.581 9.412   1.00 31.09 ? 1068 LEU C CA    1 
ATOM   5049  C  C     . LEU C  1 95  ? 58.801  -10.024 10.811  1.00 29.80 ? 1068 LEU C C     1 
ATOM   5050  O  O     . LEU C  1 95  ? 59.836  -10.251 11.419  1.00 29.56 ? 1068 LEU C O     1 
ATOM   5051  C  CB    . LEU C  1 95  ? 59.065  -9.576  8.352   1.00 30.92 ? 1068 LEU C CB    1 
ATOM   5052  C  CG    . LEU C  1 95  ? 59.351  -10.129 6.952   1.00 33.41 ? 1068 LEU C CG    1 
ATOM   5053  C  CD1   . LEU C  1 95  ? 59.546  -8.987  5.988   1.00 30.05 ? 1068 LEU C CD1   1 
ATOM   5054  C  CD2   . LEU C  1 95  ? 60.578  -11.045 6.936   1.00 36.61 ? 1068 LEU C CD2   1 
ATOM   5055  N  N     . ASP C  1 96  ? 57.790  -9.314  11.309  1.00 27.13 ? 1069 ASP C N     1 
ATOM   5056  C  CA    . ASP C  1 96  ? 57.807  -8.699  12.632  1.00 30.64 ? 1069 ASP C CA    1 
ATOM   5057  C  C     . ASP C  1 96  ? 56.399  -8.442  13.126  1.00 29.10 ? 1069 ASP C C     1 
ATOM   5058  O  O     . ASP C  1 96  ? 55.492  -8.200  12.339  1.00 30.34 ? 1069 ASP C O     1 
ATOM   5059  C  CB    . ASP C  1 96  ? 58.547  -7.358  12.600  1.00 31.60 ? 1069 ASP C CB    1 
ATOM   5060  C  CG    . ASP C  1 96  ? 60.045  -7.511  12.741  1.00 36.01 ? 1069 ASP C CG    1 
ATOM   5061  O  OD1   . ASP C  1 96  ? 60.495  -7.897  13.837  1.00 38.27 ? 1069 ASP C OD1   1 
ATOM   5062  O  OD2   . ASP C  1 96  ? 60.767  -7.231  11.759  1.00 38.06 ? 1069 ASP C OD2   1 
ATOM   5063  N  N     . ILE C  1 97  ? 56.224  -8.498  14.438  1.00 30.81 ? 1070 ILE C N     1 
ATOM   5064  C  CA    . ILE C  1 97  ? 55.002  -8.034  15.064  1.00 32.75 ? 1070 ILE C CA    1 
ATOM   5065  C  C     . ILE C  1 97  ? 55.409  -7.067  16.154  1.00 31.73 ? 1070 ILE C C     1 
ATOM   5066  O  O     . ILE C  1 97  ? 56.048  -7.446  17.132  1.00 32.09 ? 1070 ILE C O     1 
ATOM   5067  C  CB    . ILE C  1 97  ? 54.119  -9.181  15.618  1.00 36.33 ? 1070 ILE C CB    1 
ATOM   5068  C  CG1   . ILE C  1 97  ? 53.750  -10.159 14.494  1.00 35.79 ? 1070 ILE C CG1   1 
ATOM   5069  C  CG2   . ILE C  1 97  ? 52.844  -8.616  16.266  1.00 36.83 ? 1070 ILE C CG2   1 
ATOM   5070  C  CD1   . ILE C  1 97  ? 52.864  -11.307 14.922  1.00 38.38 ? 1070 ILE C CD1   1 
ATOM   5071  N  N     . PHE C  1 98  ? 55.066  -5.800  15.949  1.00 31.97 ? 1071 PHE C N     1 
ATOM   5072  C  CA    . PHE C  1 98  ? 55.340  -4.774  16.929  1.00 27.08 ? 1071 PHE C CA    1 
ATOM   5073  C  C     . PHE C  1 98  ? 54.032  -4.292  17.539  1.00 26.13 ? 1071 PHE C C     1 
ATOM   5074  O  O     . PHE C  1 98  ? 52.947  -4.625  17.061  1.00 26.50 ? 1071 PHE C O     1 
ATOM   5075  C  CB    . PHE C  1 98  ? 56.094  -3.611  16.291  1.00 30.36 ? 1071 PHE C CB    1 
ATOM   5076  C  CG    . PHE C  1 98  ? 57.427  -3.980  15.693  1.00 28.62 ? 1071 PHE C CG    1 
ATOM   5077  C  CD1   . PHE C  1 98  ? 58.433  -4.544  16.474  1.00 37.11 ? 1071 PHE C CD1   1 
ATOM   5078  C  CD2   . PHE C  1 98  ? 57.693  -3.706  14.362  1.00 26.46 ? 1071 PHE C CD2   1 
ATOM   5079  C  CE1   . PHE C  1 98  ? 59.673  -4.857  15.924  1.00 29.98 ? 1071 PHE C CE1   1 
ATOM   5080  C  CE2   . PHE C  1 98  ? 58.928  -4.007  13.805  1.00 29.51 ? 1071 PHE C CE2   1 
ATOM   5081  C  CZ    . PHE C  1 98  ? 59.922  -4.579  14.586  1.00 28.19 ? 1071 PHE C CZ    1 
ATOM   5082  N  N     . GLU C  1 99  ? 54.146  -3.510  18.604  1.00 31.86 ? 1072 GLU C N     1 
ATOM   5083  C  CA    . GLU C  1 99  ? 52.999  -3.018  19.354  1.00 33.27 ? 1072 GLU C CA    1 
ATOM   5084  C  C     . GLU C  1 99  ? 53.367  -1.675  19.969  1.00 29.46 ? 1072 GLU C C     1 
ATOM   5085  O  O     . GLU C  1 99  ? 54.474  -1.505  20.474  1.00 28.00 ? 1072 GLU C O     1 
ATOM   5086  C  CB    . GLU C  1 99  ? 52.618  -4.025  20.455  1.00 35.25 ? 1072 GLU C CB    1 
ATOM   5087  C  CG    . GLU C  1 99  ? 51.450  -3.596  21.345  1.00 46.25 ? 1072 GLU C CG    1 
ATOM   5088  C  CD    . GLU C  1 99  ? 51.025  -4.659  22.352  1.00 39.47 ? 1072 GLU C CD    1 
ATOM   5089  O  OE1   . GLU C  1 99  ? 49.808  -4.920  22.458  1.00 55.80 ? 1072 GLU C OE1   1 
ATOM   5090  O  OE2   . GLU C  1 99  ? 51.893  -5.224  23.042  1.00 43.95 ? 1072 GLU C OE2   1 
ATOM   5091  N  N     . ASN C  1 100 ? 52.447  -0.717  19.896  1.00 31.80 ? 1073 ASN C N     1 
ATOM   5092  C  CA    . ASN C  1 100 ? 52.555  0.518   20.680  1.00 27.73 ? 1073 ASN C CA    1 
ATOM   5093  C  C     . ASN C  1 100 ? 51.277  0.709   21.506  1.00 27.80 ? 1073 ASN C C     1 
ATOM   5094  O  O     . ASN C  1 100 ? 50.517  -0.245  21.673  1.00 27.59 ? 1073 ASN C O     1 
ATOM   5095  C  CB    . ASN C  1 100 ? 52.936  1.740   19.812  1.00 21.82 ? 1073 ASN C CB    1 
ATOM   5096  C  CG    . ASN C  1 100 ? 51.918  2.044   18.714  1.00 16.95 ? 1073 ASN C CG    1 
ATOM   5097  O  OD1   . ASN C  1 100 ? 50.710  2.038   18.940  1.00 32.81 ? 1073 ASN C OD1   1 
ATOM   5098  N  ND2   . ASN C  1 100 ? 52.417  2.330   17.517  1.00 20.12 ? 1073 ASN C ND2   1 
ATOM   5099  N  N     . GLN C  1 101 ? 51.049  1.914   22.031  1.00 29.04 ? 1074 GLN C N     1 
ATOM   5100  C  CA    . GLN C  1 101 ? 49.892  2.173   22.904  1.00 30.39 ? 1074 GLN C CA    1 
ATOM   5101  C  C     . GLN C  1 101 ? 48.523  2.081   22.212  1.00 30.21 ? 1074 GLN C C     1 
ATOM   5102  O  O     . GLN C  1 101 ? 47.511  1.779   22.851  1.00 35.02 ? 1074 GLN C O     1 
ATOM   5103  C  CB    . GLN C  1 101 ? 50.041  3.538   23.583  1.00 37.03 ? 1074 GLN C CB    1 
ATOM   5104  N  N     . GLY C  1 102 ? 48.480  2.341   20.910  1.00 30.91 ? 1075 GLY C N     1 
ATOM   5105  C  CA    . GLY C  1 102 ? 47.205  2.350   20.197  1.00 28.67 ? 1075 GLY C CA    1 
ATOM   5106  C  C     . GLY C  1 102 ? 47.086  1.316   19.097  1.00 26.31 ? 1075 GLY C C     1 
ATOM   5107  O  O     . GLY C  1 102 ? 45.983  1.051   18.614  1.00 22.42 ? 1075 GLY C O     1 
ATOM   5108  N  N     . PHE C  1 103 ? 48.223  0.736   18.701  1.00 25.73 ? 1076 PHE C N     1 
ATOM   5109  C  CA    . PHE C  1 103 ? 48.316  -0.042  17.462  1.00 22.84 ? 1076 PHE C CA    1 
ATOM   5110  C  C     . PHE C  1 103 ? 49.221  -1.276  17.527  1.00 24.78 ? 1076 PHE C C     1 
ATOM   5111  O  O     . PHE C  1 103 ? 50.141  -1.358  18.344  1.00 23.37 ? 1076 PHE C O     1 
ATOM   5112  C  CB    . PHE C  1 103 ? 48.810  0.862   16.325  1.00 23.43 ? 1076 PHE C CB    1 
ATOM   5113  C  CG    . PHE C  1 103 ? 47.763  1.792   15.782  1.00 24.40 ? 1076 PHE C CG    1 
ATOM   5114  C  CD1   . PHE C  1 103 ? 47.099  1.489   14.604  1.00 16.32 ? 1076 PHE C CD1   1 
ATOM   5115  C  CD2   . PHE C  1 103 ? 47.459  2.993   16.437  1.00 34.65 ? 1076 PHE C CD2   1 
ATOM   5116  C  CE1   . PHE C  1 103 ? 46.139  2.345   14.092  1.00 25.86 ? 1076 PHE C CE1   1 
ATOM   5117  C  CE2   . PHE C  1 103 ? 46.491  3.859   15.939  1.00 20.43 ? 1076 PHE C CE2   1 
ATOM   5118  C  CZ    . PHE C  1 103 ? 45.833  3.535   14.764  1.00 24.64 ? 1076 PHE C CZ    1 
ATOM   5119  N  N     . PHE C  1 104 ? 48.933  -2.238  16.652  1.00 25.83 ? 1077 PHE C N     1 
ATOM   5120  C  CA    . PHE C  1 104 ? 49.857  -3.308  16.332  1.00 22.78 ? 1077 PHE C CA    1 
ATOM   5121  C  C     . PHE C  1 104 ? 50.397  -2.980  14.957  1.00 25.74 ? 1077 PHE C C     1 
ATOM   5122  O  O     . PHE C  1 104 ? 49.698  -2.371  14.147  1.00 25.13 ? 1077 PHE C O     1 
ATOM   5123  C  CB    . PHE C  1 104 ? 49.161  -4.670  16.255  1.00 23.11 ? 1077 PHE C CB    1 
ATOM   5124  C  CG    . PHE C  1 104 ? 48.767  -5.239  17.582  1.00 20.05 ? 1077 PHE C CG    1 
ATOM   5125  C  CD1   . PHE C  1 104 ? 47.448  -5.169  18.015  1.00 27.64 ? 1077 PHE C CD1   1 
ATOM   5126  C  CD2   . PHE C  1 104 ? 49.708  -5.893  18.383  1.00 26.58 ? 1077 PHE C CD2   1 
ATOM   5127  C  CE1   . PHE C  1 104 ? 47.071  -5.716  19.246  1.00 24.53 ? 1077 PHE C CE1   1 
ATOM   5128  C  CE2   . PHE C  1 104 ? 49.348  -6.439  19.605  1.00 26.27 ? 1077 PHE C CE2   1 
ATOM   5129  C  CZ    . PHE C  1 104 ? 48.029  -6.347  20.043  1.00 26.22 ? 1077 PHE C CZ    1 
ATOM   5130  N  N     . GLN C  1 105 ? 51.649  -3.359  14.718  1.00 24.68 ? 1078 GLN C N     1 
ATOM   5131  C  CA    . GLN C  1 105 ? 52.245  -3.303  13.393  1.00 26.41 ? 1078 GLN C CA    1 
ATOM   5132  C  C     . GLN C  1 105 ? 52.591  -4.730  12.977  1.00 28.60 ? 1078 GLN C C     1 
ATOM   5133  O  O     . GLN C  1 105 ? 53.523  -5.343  13.512  1.00 26.04 ? 1078 GLN C O     1 
ATOM   5134  C  CB    . GLN C  1 105 ? 53.488  -2.406  13.373  1.00 23.93 ? 1078 GLN C CB    1 
ATOM   5135  C  CG    . GLN C  1 105 ? 53.211  -0.936  13.697  1.00 18.56 ? 1078 GLN C CG    1 
ATOM   5136  C  CD    . GLN C  1 105 ? 53.265  -0.634  15.186  1.00 19.91 ? 1078 GLN C CD    1 
ATOM   5137  O  OE1   . GLN C  1 105 ? 52.519  0.201   15.683  1.00 29.85 ? 1078 GLN C OE1   1 
ATOM   5138  N  NE2   . GLN C  1 105 ? 54.148  -1.314  15.902  1.00 20.84 ? 1078 GLN C NE2   1 
ATOM   5139  N  N     . LEU C  1 106 ? 51.795  -5.254  12.047  1.00 24.20 ? 1079 LEU C N     1 
ATOM   5140  C  CA    . LEU C  1 106 ? 51.962  -6.582  11.503  1.00 23.44 ? 1079 LEU C CA    1 
ATOM   5141  C  C     . LEU C  1 106 ? 52.816  -6.435  10.253  1.00 17.32 ? 1079 LEU C C     1 
ATOM   5142  O  O     . LEU C  1 106 ? 52.356  -5.925  9.243   1.00 17.69 ? 1079 LEU C O     1 
ATOM   5143  C  CB    . LEU C  1 106 ? 50.580  -7.153  11.126  1.00 26.07 ? 1079 LEU C CB    1 
ATOM   5144  C  CG    . LEU C  1 106 ? 50.256  -8.645  10.936  1.00 30.08 ? 1079 LEU C CG    1 
ATOM   5145  C  CD1   . LEU C  1 106 ? 49.099  -8.786  9.947   1.00 39.06 ? 1079 LEU C CD1   1 
ATOM   5146  C  CD2   . LEU C  1 106 ? 51.437  -9.526  10.501  1.00 34.14 ? 1079 LEU C CD2   1 
ATOM   5147  N  N     . VAL C  1 107 ? 54.066  -6.864  10.314  1.00 21.86 ? 1080 VAL C N     1 
ATOM   5148  C  CA    . VAL C  1 107 ? 54.935  -6.719  9.156   1.00 21.46 ? 1080 VAL C CA    1 
ATOM   5149  C  C     . VAL C  1 107 ? 55.141  -8.061  8.442   1.00 20.12 ? 1080 VAL C C     1 
ATOM   5150  O  O     . VAL C  1 107 ? 55.464  -9.076  9.058   1.00 20.55 ? 1080 VAL C O     1 
ATOM   5151  C  CB    . VAL C  1 107 ? 56.268  -5.963  9.489   1.00 23.32 ? 1080 VAL C CB    1 
ATOM   5152  C  CG1   . VAL C  1 107 ? 57.036  -5.641  8.215   1.00 15.23 ? 1080 VAL C CG1   1 
ATOM   5153  C  CG2   . VAL C  1 107 ? 55.966  -4.673  10.206  1.00 14.87 ? 1080 VAL C CG2   1 
ATOM   5154  N  N     . MET C  1 108 ? 54.916  -8.038  7.133   1.00 20.58 ? 1081 MET C N     1 
ATOM   5155  C  CA    . MET C  1 108 ? 54.955  -9.214  6.294   1.00 21.80 ? 1081 MET C CA    1 
ATOM   5156  C  C     . MET C  1 108 ? 55.864  -8.973  5.117   1.00 23.35 ? 1081 MET C C     1 
ATOM   5157  O  O     . MET C  1 108 ? 56.013  -7.841  4.665   1.00 24.40 ? 1081 MET C O     1 
ATOM   5158  C  CB    . MET C  1 108 ? 53.576  -9.497  5.703   1.00 19.42 ? 1081 MET C CB    1 
ATOM   5159  C  CG    . MET C  1 108 ? 52.488  -9.836  6.678   1.00 24.22 ? 1081 MET C CG    1 
ATOM   5160  S  SD    . MET C  1 108 ? 50.925  -9.513  5.867   1.00 29.00 ? 1081 MET C SD    1 
ATOM   5161  C  CE    . MET C  1 108 ? 50.768  -7.731  6.190   1.00 20.36 ? 1081 MET C CE    1 
ATOM   5162  N  N     . GLU C  1 109 ? 56.433  -10.056 4.594   1.00 25.66 ? 1082 GLU C N     1 
ATOM   5163  C  CA    . GLU C  1 109 ? 57.008  -10.043 3.262   1.00 30.68 ? 1082 GLU C CA    1 
ATOM   5164  C  C     . GLU C  1 109 ? 56.032  -9.354  2.312   1.00 28.57 ? 1082 GLU C C     1 
ATOM   5165  O  O     . GLU C  1 109 ? 54.815  -9.469  2.458   1.00 27.90 ? 1082 GLU C O     1 
ATOM   5166  C  CB    . GLU C  1 109 ? 57.249  -11.477 2.772   1.00 28.44 ? 1082 GLU C CB    1 
ATOM   5167  C  CG    . GLU C  1 109 ? 55.953  -12.288 2.612   1.00 37.89 ? 1082 GLU C CG    1 
ATOM   5168  C  CD    . GLU C  1 109 ? 56.135  -13.620 1.911   1.00 40.61 ? 1082 GLU C CD    1 
ATOM   5169  O  OE1   . GLU C  1 109 ? 56.799  -13.664 0.850   1.00 56.67 ? 1082 GLU C OE1   1 
ATOM   5170  O  OE2   . GLU C  1 109 ? 55.589  -14.626 2.416   1.00 49.37 ? 1082 GLU C OE2   1 
ATOM   5171  N  N     . LYS C  1 110 ? 56.571  -8.630  1.344   1.00 27.63 ? 1083 LYS C N     1 
ATOM   5172  C  CA    . LYS C  1 110 ? 55.775  -8.201  0.226   1.00 22.94 ? 1083 LYS C CA    1 
ATOM   5173  C  C     . LYS C  1 110 ? 55.906  -9.253  -0.884  1.00 26.80 ? 1083 LYS C C     1 
ATOM   5174  O  O     . LYS C  1 110 ? 56.979  -9.437  -1.457  1.00 30.42 ? 1083 LYS C O     1 
ATOM   5175  C  CB    . LYS C  1 110 ? 56.211  -6.817  -0.243  1.00 13.87 ? 1083 LYS C CB    1 
ATOM   5176  C  CG    . LYS C  1 110 ? 55.367  -6.283  -1.406  1.00 19.94 ? 1083 LYS C CG    1 
ATOM   5177  C  CD    . LYS C  1 110 ? 55.499  -4.797  -1.541  1.00 21.26 ? 1083 LYS C CD    1 
ATOM   5178  C  CE    . LYS C  1 110 ? 54.866  -4.321  -2.830  1.00 31.99 ? 1083 LYS C CE    1 
ATOM   5179  N  NZ    . LYS C  1 110 ? 55.005  -2.850  -3.010  1.00 28.74 ? 1083 LYS C NZ    1 
ATOM   5180  N  N     . HIS C  1 111 ? 54.813  -9.957  -1.162  1.00 28.27 ? 1084 HIS C N     1 
ATOM   5181  C  CA    . HIS C  1 111 ? 54.800  -10.975 -2.205  1.00 25.38 ? 1084 HIS C CA    1 
ATOM   5182  C  C     . HIS C  1 111 ? 54.372  -10.377 -3.542  1.00 26.89 ? 1084 HIS C C     1 
ATOM   5183  O  O     . HIS C  1 111 ? 53.191  -10.100 -3.764  1.00 31.87 ? 1084 HIS C O     1 
ATOM   5184  C  CB    . HIS C  1 111 ? 53.903  -12.152 -1.813  1.00 22.28 ? 1084 HIS C CB    1 
ATOM   5185  C  CG    . HIS C  1 111 ? 53.914  -13.270 -2.812  1.00 27.23 ? 1084 HIS C CG    1 
ATOM   5186  N  ND1   . HIS C  1 111 ? 54.949  -14.178 -2.905  1.00 23.26 ? 1084 HIS C ND1   1 
ATOM   5187  C  CD2   . HIS C  1 111 ? 53.033  -13.603 -3.785  1.00 24.81 ? 1084 HIS C CD2   1 
ATOM   5188  C  CE1   . HIS C  1 111 ? 54.695  -15.032 -3.880  1.00 21.09 ? 1084 HIS C CE1   1 
ATOM   5189  N  NE2   . HIS C  1 111 ? 53.537  -14.707 -4.427  1.00 20.25 ? 1084 HIS C NE2   1 
ATOM   5190  N  N     . GLY C  1 112 ? 55.347  -10.185 -4.428  1.00 27.29 ? 1085 GLY C N     1 
ATOM   5191  C  CA    . GLY C  1 112 ? 55.141  -9.489  -5.689  1.00 26.99 ? 1085 GLY C CA    1 
ATOM   5192  C  C     . GLY C  1 112 ? 55.057  -7.981  -5.497  1.00 30.95 ? 1085 GLY C C     1 
ATOM   5193  O  O     . GLY C  1 112 ? 55.688  -7.424  -4.594  1.00 31.18 ? 1085 GLY C O     1 
ATOM   5194  N  N     . SER C  1 113 ? 54.270  -7.322  -6.346  1.00 29.98 ? 1086 SER C N     1 
ATOM   5195  C  CA    . SER C  1 113 ? 54.107  -5.865  -6.291  1.00 37.94 ? 1086 SER C CA    1 
ATOM   5196  C  C     . SER C  1 113 ? 52.858  -5.436  -5.516  1.00 38.30 ? 1086 SER C C     1 
ATOM   5197  O  O     . SER C  1 113 ? 52.399  -4.296  -5.646  1.00 40.66 ? 1086 SER C O     1 
ATOM   5198  C  CB    . SER C  1 113 ? 54.072  -5.273  -7.706  1.00 37.94 ? 1086 SER C CB    1 
ATOM   5199  O  OG    . SER C  1 113 ? 52.851  -5.581  -8.359  1.00 42.61 ? 1086 SER C OG    1 
ATOM   5200  N  N     . GLY C  1 114 ? 52.326  -6.342  -4.698  1.00 36.90 ? 1087 GLY C N     1 
ATOM   5201  C  CA    . GLY C  1 114 ? 51.080  -6.087  -3.984  1.00 37.77 ? 1087 GLY C CA    1 
ATOM   5202  C  C     . GLY C  1 114 ? 49.854  -6.297  -4.852  1.00 33.83 ? 1087 GLY C C     1 
ATOM   5203  O  O     . GLY C  1 114 ? 48.771  -5.806  -4.538  1.00 32.53 ? 1087 GLY C O     1 
ATOM   5204  N  N     . LEU C  1 115 ? 50.031  -7.039  -5.944  1.00 36.65 ? 1088 LEU C N     1 
ATOM   5205  C  CA    . LEU C  1 115 ? 48.938  -7.362  -6.862  1.00 35.50 ? 1088 LEU C CA    1 
ATOM   5206  C  C     . LEU C  1 115 ? 48.122  -8.537  -6.322  1.00 33.93 ? 1088 LEU C C     1 
ATOM   5207  O  O     . LEU C  1 115 ? 48.654  -9.634  -6.090  1.00 33.33 ? 1088 LEU C O     1 
ATOM   5208  C  CB    . LEU C  1 115 ? 49.485  -7.676  -8.261  1.00 32.23 ? 1088 LEU C CB    1 
ATOM   5209  C  CG    . LEU C  1 115 ? 48.526  -8.021  -9.403  1.00 39.19 ? 1088 LEU C CG    1 
ATOM   5210  C  CD1   . LEU C  1 115 ? 47.834  -6.766  -9.958  1.00 37.03 ? 1088 LEU C CD1   1 
ATOM   5211  C  CD2   . LEU C  1 115 ? 49.280  -8.749  -10.509 1.00 29.47 ? 1088 LEU C CD2   1 
ATOM   5212  N  N     . ASP C  1 116 ? 46.835  -8.296  -6.108  1.00 29.29 ? 1089 ASP C N     1 
ATOM   5213  C  CA    . ASP C  1 116 ? 45.939  -9.364  -5.686  1.00 34.88 ? 1089 ASP C CA    1 
ATOM   5214  C  C     . ASP C  1 116 ? 45.197  -9.951  -6.880  1.00 34.51 ? 1089 ASP C C     1 
ATOM   5215  O  O     . ASP C  1 116 ? 45.149  -9.343  -7.956  1.00 31.51 ? 1089 ASP C O     1 
ATOM   5216  C  CB    . ASP C  1 116 ? 44.995  -8.926  -4.545  1.00 31.19 ? 1089 ASP C CB    1 
ATOM   5217  C  CG    . ASP C  1 116 ? 44.127  -7.746  -4.909  1.00 30.78 ? 1089 ASP C CG    1 
ATOM   5218  O  OD1   . ASP C  1 116 ? 43.095  -7.948  -5.585  1.00 34.30 ? 1089 ASP C OD1   1 
ATOM   5219  O  OD2   . ASP C  1 116 ? 44.463  -6.611  -4.494  1.00 36.60 ? 1089 ASP C OD2   1 
ATOM   5220  N  N     . LEU C  1 117 ? 44.632  -11.138 -6.680  1.00 33.41 ? 1090 LEU C N     1 
ATOM   5221  C  CA    . LEU C  1 117 ? 44.001  -11.881 -7.758  1.00 33.54 ? 1090 LEU C CA    1 
ATOM   5222  C  C     . LEU C  1 117 ? 42.767  -11.189 -8.332  1.00 35.42 ? 1090 LEU C C     1 
ATOM   5223  O  O     . LEU C  1 117 ? 42.415  -11.424 -9.488  1.00 36.10 ? 1090 LEU C O     1 
ATOM   5224  C  CB    . LEU C  1 117 ? 43.679  -13.308 -7.305  1.00 35.91 ? 1090 LEU C CB    1 
ATOM   5225  C  CG    . LEU C  1 117 ? 44.132  -14.465 -8.195  1.00 27.76 ? 1090 LEU C CG    1 
ATOM   5226  C  CD1   . LEU C  1 117 ? 45.611  -14.363 -8.558  1.00 24.18 ? 1090 LEU C CD1   1 
ATOM   5227  C  CD2   . LEU C  1 117 ? 43.852  -15.771 -7.481  1.00 32.77 ? 1090 LEU C CD2   1 
ATOM   5228  N  N     . PHE C  1 118 ? 42.113  -10.340 -7.537  1.00 35.87 ? 1091 PHE C N     1 
ATOM   5229  C  CA    . PHE C  1 118 ? 41.024  -9.512  -8.059  1.00 36.79 ? 1091 PHE C CA    1 
ATOM   5230  C  C     . PHE C  1 118 ? 41.545  -8.490  -9.083  1.00 36.44 ? 1091 PHE C C     1 
ATOM   5231  O  O     . PHE C  1 118 ? 40.952  -8.321  -10.155 1.00 37.14 ? 1091 PHE C O     1 
ATOM   5232  C  CB    . PHE C  1 118 ? 40.247  -8.803  -6.940  1.00 35.19 ? 1091 PHE C CB    1 
ATOM   5233  C  CG    . PHE C  1 118 ? 39.117  -7.936  -7.449  1.00 38.58 ? 1091 PHE C CG    1 
ATOM   5234  C  CD1   . PHE C  1 118 ? 39.350  -6.614  -7.834  1.00 36.77 ? 1091 PHE C CD1   1 
ATOM   5235  C  CD2   . PHE C  1 118 ? 37.830  -8.449  -7.570  1.00 38.80 ? 1091 PHE C CD2   1 
ATOM   5236  C  CE1   . PHE C  1 118 ? 38.318  -5.815  -8.321  1.00 42.86 ? 1091 PHE C CE1   1 
ATOM   5237  C  CE2   . PHE C  1 118 ? 36.790  -7.656  -8.056  1.00 42.34 ? 1091 PHE C CE2   1 
ATOM   5238  C  CZ    . PHE C  1 118 ? 37.037  -6.335  -8.432  1.00 44.10 ? 1091 PHE C CZ    1 
ATOM   5239  N  N     . ALA C  1 119 ? 42.639  -7.814  -8.730  1.00 36.24 ? 1092 ALA C N     1 
ATOM   5240  C  CA    . ALA C  1 119 ? 43.309  -6.839  -9.598  1.00 34.58 ? 1092 ALA C CA    1 
ATOM   5241  C  C     . ALA C  1 119 ? 43.918  -7.504  -10.838 1.00 35.88 ? 1092 ALA C C     1 
ATOM   5242  O  O     . ALA C  1 119 ? 43.927  -6.917  -11.922 1.00 41.94 ? 1092 ALA C O     1 
ATOM   5243  C  CB    . ALA C  1 119 ? 44.383  -6.091  -8.811  1.00 32.00 ? 1092 ALA C CB    1 
ATOM   5244  N  N     . PHE C  1 120 ? 44.435  -8.719  -10.651 1.00 32.54 ? 1093 PHE C N     1 
ATOM   5245  C  CA    . PHE C  1 120 ? 44.926  -9.590  -11.718 1.00 31.77 ? 1093 PHE C CA    1 
ATOM   5246  C  C     . PHE C  1 120 ? 43.803  -9.894  -12.724 1.00 33.96 ? 1093 PHE C C     1 
ATOM   5247  O  O     . PHE C  1 120 ? 43.977  -9.691  -13.931 1.00 29.80 ? 1093 PHE C O     1 
ATOM   5248  C  CB    . PHE C  1 120 ? 45.476  -10.876 -11.077 1.00 30.26 ? 1093 PHE C CB    1 
ATOM   5249  C  CG    . PHE C  1 120 ? 46.083  -11.871 -12.050 1.00 38.53 ? 1093 PHE C CG    1 
ATOM   5250  C  CD1   . PHE C  1 120 ? 47.255  -11.574 -12.751 1.00 31.41 ? 1093 PHE C CD1   1 
ATOM   5251  C  CD2   . PHE C  1 120 ? 45.511  -13.137 -12.215 1.00 40.03 ? 1093 PHE C CD2   1 
ATOM   5252  C  CE1   . PHE C  1 120 ? 47.822  -12.504 -13.629 1.00 27.84 ? 1093 PHE C CE1   1 
ATOM   5253  C  CE2   . PHE C  1 120 ? 46.075  -14.080 -13.097 1.00 29.30 ? 1093 PHE C CE2   1 
ATOM   5254  C  CZ    . PHE C  1 120 ? 47.230  -13.763 -13.796 1.00 26.90 ? 1093 PHE C CZ    1 
ATOM   5255  N  N     . ILE C  1 121 ? 42.650  -10.334 -12.207 1.00 31.83 ? 1094 ILE C N     1 
ATOM   5256  C  CA    . ILE C  1 121 ? 41.468  -10.687 -13.013 1.00 31.74 ? 1094 ILE C CA    1 
ATOM   5257  C  C     . ILE C  1 121 ? 40.804  -9.467  -13.672 1.00 33.41 ? 1094 ILE C C     1 
ATOM   5258  O  O     . ILE C  1 121 ? 40.366  -9.534  -14.828 1.00 34.03 ? 1094 ILE C O     1 
ATOM   5259  C  CB    . ILE C  1 121 ? 40.446  -11.524 -12.181 1.00 29.91 ? 1094 ILE C CB    1 
ATOM   5260  C  CG1   . ILE C  1 121 ? 40.959  -12.963 -11.995 1.00 34.01 ? 1094 ILE C CG1   1 
ATOM   5261  C  CG2   . ILE C  1 121 ? 39.075  -11.539 -12.831 1.00 28.29 ? 1094 ILE C CG2   1 
ATOM   5262  C  CD1   . ILE C  1 121 ? 40.389  -13.707 -10.775 1.00 31.83 ? 1094 ILE C CD1   1 
ATOM   5263  N  N     . ASP C  1 122 ? 40.744  -8.361  -12.933 1.00 36.21 ? 1095 ASP C N     1 
ATOM   5264  C  CA    . ASP C  1 122 ? 40.250  -7.079  -13.443 1.00 41.16 ? 1095 ASP C CA    1 
ATOM   5265  C  C     . ASP C  1 122 ? 41.005  -6.671  -14.715 1.00 42.19 ? 1095 ASP C C     1 
ATOM   5266  O  O     . ASP C  1 122 ? 40.402  -6.175  -15.661 1.00 44.90 ? 1095 ASP C O     1 
ATOM   5267  C  CB    . ASP C  1 122 ? 40.404  -5.993  -12.368 1.00 42.86 ? 1095 ASP C CB    1 
ATOM   5268  C  CG    . ASP C  1 122 ? 39.265  -4.980  -12.369 1.00 47.19 ? 1095 ASP C CG    1 
ATOM   5269  O  OD1   . ASP C  1 122 ? 38.088  -5.374  -12.534 1.00 45.35 ? 1095 ASP C OD1   1 
ATOM   5270  O  OD2   . ASP C  1 122 ? 39.549  -3.779  -12.169 1.00 49.90 ? 1095 ASP C OD2   1 
ATOM   5271  N  N     . ARG C  1 123 ? 42.318  -6.906  -14.728 1.00 44.24 ? 1096 ARG C N     1 
ATOM   5272  C  CA    . ARG C  1 123 ? 43.187  -6.582  -15.869 1.00 46.28 ? 1096 ARG C CA    1 
ATOM   5273  C  C     . ARG C  1 123 ? 43.125  -7.597  -17.030 1.00 47.39 ? 1096 ARG C C     1 
ATOM   5274  O  O     . ARG C  1 123 ? 43.940  -7.533  -17.957 1.00 48.11 ? 1096 ARG C O     1 
ATOM   5275  C  CB    . ARG C  1 123 ? 44.638  -6.421  -15.396 1.00 46.98 ? 1096 ARG C CB    1 
ATOM   5276  C  CG    . ARG C  1 123 ? 44.933  -5.159  -14.584 1.00 50.62 ? 1096 ARG C CG    1 
ATOM   5277  C  CD    . ARG C  1 123 ? 45.544  -4.066  -15.452 1.00 63.32 ? 1096 ARG C CD    1 
ATOM   5278  N  NE    . ARG C  1 123 ? 46.957  -4.313  -15.748 1.00 66.81 ? 1096 ARG C NE    1 
ATOM   5279  C  CZ    . ARG C  1 123 ? 47.699  -3.579  -16.576 1.00 67.46 ? 1096 ARG C CZ    1 
ATOM   5280  N  NH1   . ARG C  1 123 ? 47.171  -2.539  -17.212 1.00 68.94 ? 1096 ARG C NH1   1 
ATOM   5281  N  NH2   . ARG C  1 123 ? 48.976  -3.885  -16.769 1.00 68.85 ? 1096 ARG C NH2   1 
ATOM   5282  N  N     . HIS C  1 124 ? 42.169  -8.528  -16.963 1.00 49.60 ? 1097 HIS C N     1 
ATOM   5283  C  CA    . HIS C  1 124 ? 41.913  -9.546  -18.008 1.00 47.51 ? 1097 HIS C CA    1 
ATOM   5284  C  C     . HIS C  1 124 ? 43.116  -10.436 -18.395 1.00 44.12 ? 1097 HIS C C     1 
ATOM   5285  O  O     . HIS C  1 124 ? 43.690  -10.260 -19.470 1.00 41.48 ? 1097 HIS C O     1 
ATOM   5286  C  CB    . HIS C  1 124 ? 41.297  -8.908  -19.261 1.00 49.40 ? 1097 HIS C CB    1 
ATOM   5287  C  CG    . HIS C  1 124 ? 39.894  -8.422  -19.070 1.00 54.73 ? 1097 HIS C CG    1 
ATOM   5288  N  ND1   . HIS C  1 124 ? 38.798  -9.252  -19.175 1.00 61.53 ? 1097 HIS C ND1   1 
ATOM   5289  C  CD2   . HIS C  1 124 ? 39.407  -7.191  -18.787 1.00 60.23 ? 1097 HIS C CD2   1 
ATOM   5290  C  CE1   . HIS C  1 124 ? 37.697  -8.554  -18.961 1.00 64.45 ? 1097 HIS C CE1   1 
ATOM   5291  N  NE2   . HIS C  1 124 ? 38.039  -7.300  -18.723 1.00 66.28 ? 1097 HIS C NE2   1 
ATOM   5292  N  N     . PRO C  1 125 ? 43.474  -11.414 -17.537 1.00 41.93 ? 1098 PRO C N     1 
ATOM   5293  C  CA    . PRO C  1 125 ? 44.624  -12.277 -17.833 1.00 41.46 ? 1098 PRO C CA    1 
ATOM   5294  C  C     . PRO C  1 125 ? 44.333  -13.300 -18.928 1.00 38.79 ? 1098 PRO C C     1 
ATOM   5295  O  O     . PRO C  1 125 ? 43.185  -13.717 -19.109 1.00 39.11 ? 1098 PRO C O     1 
ATOM   5296  C  CB    . PRO C  1 125 ? 44.895  -13.001 -16.504 1.00 39.14 ? 1098 PRO C CB    1 
ATOM   5297  C  CG    . PRO C  1 125 ? 43.937  -12.442 -15.512 1.00 40.37 ? 1098 PRO C CG    1 
ATOM   5298  C  CD    . PRO C  1 125 ? 42.830  -11.790 -16.269 1.00 44.05 ? 1098 PRO C CD    1 
ATOM   5299  N  N     . ARG C  1 126 ? 45.374  -13.697 -19.651 1.00 36.85 ? 1099 ARG C N     1 
ATOM   5300  C  CA    . ARG C  1 126 ? 45.228  -14.661 -20.731 1.00 34.20 ? 1099 ARG C CA    1 
ATOM   5301  C  C     . ARG C  1 126 ? 45.622  -16.049 -20.234 1.00 34.09 ? 1099 ARG C C     1 
ATOM   5302  O  O     . ARG C  1 126 ? 46.724  -16.535 -20.490 1.00 36.83 ? 1099 ARG C O     1 
ATOM   5303  C  CB    . ARG C  1 126 ? 46.029  -14.227 -21.962 1.00 35.00 ? 1099 ARG C CB    1 
ATOM   5304  C  CG    . ARG C  1 126 ? 45.426  -13.035 -22.715 1.00 25.72 ? 1099 ARG C CG    1 
ATOM   5305  C  CD    . ARG C  1 126 ? 46.408  -12.489 -23.749 1.00 35.09 ? 1099 ARG C CD    1 
ATOM   5306  N  NE    . ARG C  1 126 ? 45.831  -11.466 -24.629 1.00 35.40 ? 1099 ARG C NE    1 
ATOM   5307  C  CZ    . ARG C  1 126 ? 45.903  -11.474 -25.963 1.00 38.65 ? 1099 ARG C CZ    1 
ATOM   5308  N  NH1   . ARG C  1 126 ? 46.537  -12.451 -26.603 1.00 25.34 ? 1099 ARG C NH1   1 
ATOM   5309  N  NH2   . ARG C  1 126 ? 45.353  -10.489 -26.668 1.00 32.55 ? 1099 ARG C NH2   1 
ATOM   5310  N  N     . LEU C  1 127 ? 44.695  -16.677 -19.516 1.00 34.43 ? 1100 LEU C N     1 
ATOM   5311  C  CA    . LEU C  1 127 ? 44.957  -17.942 -18.837 1.00 34.41 ? 1100 LEU C CA    1 
ATOM   5312  C  C     . LEU C  1 127 ? 44.377  -19.121 -19.595 1.00 31.54 ? 1100 LEU C C     1 
ATOM   5313  O  O     . LEU C  1 127 ? 43.284  -19.031 -20.147 1.00 30.13 ? 1100 LEU C O     1 
ATOM   5314  C  CB    . LEU C  1 127 ? 44.357  -17.932 -17.413 1.00 33.95 ? 1100 LEU C CB    1 
ATOM   5315  C  CG    . LEU C  1 127 ? 44.930  -17.065 -16.278 1.00 32.10 ? 1100 LEU C CG    1 
ATOM   5316  C  CD1   . LEU C  1 127 ? 44.202  -17.365 -14.958 1.00 24.70 ? 1100 LEU C CD1   1 
ATOM   5317  C  CD2   . LEU C  1 127 ? 46.424  -17.288 -16.111 1.00 30.91 ? 1100 LEU C CD2   1 
ATOM   5318  N  N     . ASP C  1 128 ? 45.112  -20.228 -19.606 1.00 29.97 ? 1101 ASP C N     1 
ATOM   5319  C  CA    . ASP C  1 128 ? 44.554  -21.513 -20.009 1.00 32.11 ? 1101 ASP C CA    1 
ATOM   5320  C  C     . ASP C  1 128 ? 44.265  -22.356 -18.766 1.00 33.54 ? 1101 ASP C C     1 
ATOM   5321  O  O     . ASP C  1 128 ? 44.512  -21.916 -17.634 1.00 35.70 ? 1101 ASP C O     1 
ATOM   5322  C  CB    . ASP C  1 128 ? 45.487  -22.248 -20.985 1.00 35.79 ? 1101 ASP C CB    1 
ATOM   5323  C  CG    . ASP C  1 128 ? 46.860  -22.534 -20.399 1.00 41.06 ? 1101 ASP C CG    1 
ATOM   5324  O  OD1   . ASP C  1 128 ? 47.231  -21.925 -19.372 1.00 48.38 ? 1101 ASP C OD1   1 
ATOM   5325  O  OD2   . ASP C  1 128 ? 47.580  -23.374 -20.981 1.00 48.15 ? 1101 ASP C OD2   1 
ATOM   5326  N  N     . GLU C  1 129 ? 43.752  -23.565 -18.973 1.00 31.57 ? 1102 GLU C N     1 
ATOM   5327  C  CA    . GLU C  1 129 ? 43.384  -24.437 -17.853 1.00 28.61 ? 1102 GLU C CA    1 
ATOM   5328  C  C     . GLU C  1 129 ? 44.573  -24.944 -17.031 1.00 25.02 ? 1102 GLU C C     1 
ATOM   5329  O  O     . GLU C  1 129 ? 44.481  -24.982 -15.801 1.00 27.36 ? 1102 GLU C O     1 
ATOM   5330  C  CB    . GLU C  1 129 ? 42.487  -25.602 -18.314 1.00 28.96 ? 1102 GLU C CB    1 
ATOM   5331  C  CG    . GLU C  1 129 ? 41.142  -25.156 -18.868 1.00 14.98 ? 1102 GLU C CG    1 
ATOM   5332  C  CD    . GLU C  1 129 ? 40.111  -26.275 -18.921 1.00 24.13 ? 1102 GLU C CD    1 
ATOM   5333  O  OE1   . GLU C  1 129 ? 40.169  -27.205 -18.103 1.00 23.54 ? 1102 GLU C OE1   1 
ATOM   5334  O  OE2   . GLU C  1 129 ? 39.237  -26.224 -19.795 1.00 23.68 ? 1102 GLU C OE2   1 
ATOM   5335  N  N     . PRO C  1 130 ? 45.675  -25.371 -17.695 1.00 27.82 ? 1103 PRO C N     1 
ATOM   5336  C  CA    . PRO C  1 130 ? 46.851  -25.788 -16.912 1.00 24.95 ? 1103 PRO C CA    1 
ATOM   5337  C  C     . PRO C  1 130 ? 47.429  -24.720 -15.963 1.00 22.82 ? 1103 PRO C C     1 
ATOM   5338  O  O     . PRO C  1 130 ? 47.779  -25.049 -14.824 1.00 24.33 ? 1103 PRO C O     1 
ATOM   5339  C  CB    . PRO C  1 130 ? 47.870  -26.212 -17.987 1.00 24.03 ? 1103 PRO C CB    1 
ATOM   5340  C  CG    . PRO C  1 130 ? 47.043  -26.556 -19.183 1.00 27.47 ? 1103 PRO C CG    1 
ATOM   5341  C  CD    . PRO C  1 130 ? 45.890  -25.582 -19.145 1.00 28.62 ? 1103 PRO C CD    1 
ATOM   5342  N  N     . LEU C  1 131 ? 47.516  -23.470 -16.412 1.00 23.75 ? 1104 LEU C N     1 
ATOM   5343  C  CA    . LEU C  1 131 ? 48.048  -22.379 -15.575 1.00 25.03 ? 1104 LEU C CA    1 
ATOM   5344  C  C     . LEU C  1 131 ? 47.041  -21.930 -14.501 1.00 24.01 ? 1104 LEU C C     1 
ATOM   5345  O  O     . LEU C  1 131 ? 47.407  -21.754 -13.339 1.00 20.87 ? 1104 LEU C O     1 
ATOM   5346  C  CB    . LEU C  1 131 ? 48.520  -21.189 -16.436 1.00 24.40 ? 1104 LEU C CB    1 
ATOM   5347  C  CG    . LEU C  1 131 ? 49.228  -20.002 -15.741 1.00 24.83 ? 1104 LEU C CG    1 
ATOM   5348  C  CD1   . LEU C  1 131 ? 50.505  -20.423 -15.031 1.00 27.17 ? 1104 LEU C CD1   1 
ATOM   5349  C  CD2   . LEU C  1 131 ? 49.532  -18.898 -16.728 1.00 26.55 ? 1104 LEU C CD2   1 
ATOM   5350  N  N     . ALA C  1 132 ? 45.778  -21.753 -14.890 1.00 26.10 ? 1105 ALA C N     1 
ATOM   5351  C  CA    . ALA C  1 132 ? 44.698  -21.540 -13.916 1.00 26.43 ? 1105 ALA C CA    1 
ATOM   5352  C  C     . ALA C  1 132 ? 44.715  -22.628 -12.833 1.00 26.38 ? 1105 ALA C C     1 
ATOM   5353  O  O     . ALA C  1 132 ? 44.476  -22.337 -11.661 1.00 30.05 ? 1105 ALA C O     1 
ATOM   5354  C  CB    . ALA C  1 132 ? 43.331  -21.478 -14.614 1.00 20.80 ? 1105 ALA C CB    1 
ATOM   5355  N  N     . SER C  1 133 ? 45.031  -23.865 -13.225 1.00 23.74 ? 1106 SER C N     1 
ATOM   5356  C  CA    . SER C  1 133 ? 45.128  -24.985 -12.277 1.00 26.30 ? 1106 SER C CA    1 
ATOM   5357  C  C     . SER C  1 133 ? 46.378  -24.935 -11.406 1.00 20.31 ? 1106 SER C C     1 
ATOM   5358  O  O     . SER C  1 133 ? 46.351  -25.352 -10.252 1.00 24.89 ? 1106 SER C O     1 
ATOM   5359  C  CB    . SER C  1 133 ? 45.017  -26.348 -12.986 1.00 25.87 ? 1106 SER C CB    1 
ATOM   5360  O  OG    . SER C  1 133 ? 46.253  -26.780 -13.528 1.00 34.93 ? 1106 SER C OG    1 
ATOM   5361  N  N     . TYR C  1 134 ? 47.476  -24.430 -11.958 1.00 22.37 ? 1107 TYR C N     1 
ATOM   5362  C  CA    . TYR C  1 134 ? 48.666  -24.201 -11.154 1.00 22.75 ? 1107 TYR C CA    1 
ATOM   5363  C  C     . TYR C  1 134 ? 48.394  -23.202 -10.018 1.00 20.71 ? 1107 TYR C C     1 
ATOM   5364  O  O     . TYR C  1 134 ? 48.815  -23.417 -8.882  1.00 26.37 ? 1107 TYR C O     1 
ATOM   5365  C  CB    . TYR C  1 134 ? 49.854  -23.758 -12.023 1.00 25.08 ? 1107 TYR C CB    1 
ATOM   5366  C  CG    . TYR C  1 134 ? 51.089  -23.475 -11.203 1.00 28.04 ? 1107 TYR C CG    1 
ATOM   5367  C  CD1   . TYR C  1 134 ? 51.743  -24.500 -10.525 1.00 30.62 ? 1107 TYR C CD1   1 
ATOM   5368  C  CD2   . TYR C  1 134 ? 51.591  -22.178 -11.086 1.00 35.84 ? 1107 TYR C CD2   1 
ATOM   5369  C  CE1   . TYR C  1 134 ? 52.868  -24.246 -9.761  1.00 36.65 ? 1107 TYR C CE1   1 
ATOM   5370  C  CE2   . TYR C  1 134 ? 52.723  -21.915 -10.329 1.00 30.89 ? 1107 TYR C CE2   1 
ATOM   5371  C  CZ    . TYR C  1 134 ? 53.352  -22.952 -9.669  1.00 28.37 ? 1107 TYR C CZ    1 
ATOM   5372  O  OH    . TYR C  1 134 ? 54.468  -22.709 -8.910  1.00 34.61 ? 1107 TYR C OH    1 
ATOM   5373  N  N     . ILE C  1 135 ? 47.693  -22.118 -10.340 1.00 22.34 ? 1108 ILE C N     1 
ATOM   5374  C  CA    . ILE C  1 135 ? 47.302  -21.096 -9.360  1.00 28.98 ? 1108 ILE C CA    1 
ATOM   5375  C  C     . ILE C  1 135 ? 46.339  -21.641 -8.283  1.00 29.39 ? 1108 ILE C C     1 
ATOM   5376  O  O     . ILE C  1 135 ? 46.516  -21.369 -7.098  1.00 29.11 ? 1108 ILE C O     1 
ATOM   5377  C  CB    . ILE C  1 135 ? 46.702  -19.824 -10.073 1.00 26.17 ? 1108 ILE C CB    1 
ATOM   5378  C  CG1   . ILE C  1 135 ? 47.756  -19.162 -10.969 1.00 26.83 ? 1108 ILE C CG1   1 
ATOM   5379  C  CG2   . ILE C  1 135 ? 46.147  -18.823 -9.066  1.00 18.18 ? 1108 ILE C CG2   1 
ATOM   5380  C  CD1   . ILE C  1 135 ? 47.195  -18.218 -12.036 1.00 25.03 ? 1108 ILE C CD1   1 
ATOM   5381  N  N     . PHE C  1 136 ? 45.334  -22.412 -8.700  1.00 30.41 ? 1109 PHE C N     1 
ATOM   5382  C  CA    . PHE C  1 136 ? 44.285  -22.887 -7.785  1.00 26.80 ? 1109 PHE C CA    1 
ATOM   5383  C  C     . PHE C  1 136 ? 44.768  -23.972 -6.816  1.00 26.99 ? 1109 PHE C C     1 
ATOM   5384  O  O     . PHE C  1 136 ? 44.350  -23.996 -5.656  1.00 29.65 ? 1109 PHE C O     1 
ATOM   5385  C  CB    . PHE C  1 136 ? 43.047  -23.342 -8.580  1.00 30.10 ? 1109 PHE C CB    1 
ATOM   5386  C  CG    . PHE C  1 136 ? 41.885  -23.811 -7.721  1.00 27.13 ? 1109 PHE C CG    1 
ATOM   5387  C  CD1   . PHE C  1 136 ? 41.142  -22.906 -6.965  1.00 31.70 ? 1109 PHE C CD1   1 
ATOM   5388  C  CD2   . PHE C  1 136 ? 41.519  -25.155 -7.702  1.00 28.29 ? 1109 PHE C CD2   1 
ATOM   5389  C  CE1   . PHE C  1 136 ? 40.070  -23.338 -6.183  1.00 33.14 ? 1109 PHE C CE1   1 
ATOM   5390  C  CE2   . PHE C  1 136 ? 40.440  -25.594 -6.935  1.00 23.01 ? 1109 PHE C CE2   1 
ATOM   5391  C  CZ    . PHE C  1 136 ? 39.719  -24.686 -6.174  1.00 29.85 ? 1109 PHE C CZ    1 
ATOM   5392  N  N     . ARG C  1 137 ? 45.655  -24.849 -7.288  1.00 26.78 ? 1110 ARG C N     1 
ATOM   5393  C  CA    . ARG C  1 137 ? 46.214  -25.934 -6.467  1.00 22.87 ? 1110 ARG C CA    1 
ATOM   5394  C  C     . ARG C  1 137 ? 47.075  -25.439 -5.310  1.00 20.73 ? 1110 ARG C C     1 
ATOM   5395  O  O     . ARG C  1 137 ? 47.210  -26.126 -4.296  1.00 28.06 ? 1110 ARG C O     1 
ATOM   5396  C  CB    . ARG C  1 137 ? 47.020  -26.914 -7.333  1.00 27.28 ? 1110 ARG C CB    1 
ATOM   5397  C  CG    . ARG C  1 137 ? 48.485  -26.517 -7.592  1.00 22.59 ? 1110 ARG C CG    1 
ATOM   5398  C  CD    . ARG C  1 137 ? 49.160  -27.470 -8.565  1.00 25.21 ? 1110 ARG C CD    1 
ATOM   5399  N  NE    . ARG C  1 137 ? 48.576  -27.384 -9.902  1.00 22.78 ? 1110 ARG C NE    1 
ATOM   5400  C  CZ    . ARG C  1 137 ? 48.822  -28.239 -10.891 1.00 36.66 ? 1110 ARG C CZ    1 
ATOM   5401  N  NH1   . ARG C  1 137 ? 49.650  -29.261 -10.699 1.00 31.84 ? 1110 ARG C NH1   1 
ATOM   5402  N  NH2   . ARG C  1 137 ? 48.233  -28.075 -12.073 1.00 25.60 ? 1110 ARG C NH2   1 
ATOM   5403  N  N     . GLN C  1 138 ? 47.684  -24.267 -5.485  1.00 20.79 ? 1111 GLN C N     1 
ATOM   5404  C  CA    . GLN C  1 138 ? 48.479  -23.621 -4.435  1.00 16.56 ? 1111 GLN C CA    1 
ATOM   5405  C  C     . GLN C  1 138 ? 47.584  -23.137 -3.304  1.00 15.30 ? 1111 GLN C C     1 
ATOM   5406  O  O     . GLN C  1 138 ? 47.961  -23.172 -2.137  1.00 20.30 ? 1111 GLN C O     1 
ATOM   5407  C  CB    . GLN C  1 138 ? 49.237  -22.421 -5.014  1.00 14.49 ? 1111 GLN C CB    1 
ATOM   5408  C  CG    . GLN C  1 138 ? 50.383  -22.764 -5.926  1.00 18.19 ? 1111 GLN C CG    1 
ATOM   5409  C  CD    . GLN C  1 138 ? 51.059  -21.526 -6.479  1.00 15.63 ? 1111 GLN C CD    1 
ATOM   5410  O  OE1   . GLN C  1 138 ? 51.883  -20.893 -5.811  1.00 17.21 ? 1111 GLN C OE1   1 
ATOM   5411  N  NE2   . GLN C  1 138 ? 50.714  -21.175 -7.701  1.00 17.11 ? 1111 GLN C NE2   1 
ATOM   5412  N  N     . LEU C  1 139 ? 46.410  -22.642 -3.675  1.00 20.74 ? 1112 LEU C N     1 
ATOM   5413  C  CA    . LEU C  1 139 ? 45.394  -22.251 -2.718  1.00 23.95 ? 1112 LEU C CA    1 
ATOM   5414  C  C     . LEU C  1 139 ? 44.857  -23.478 -1.988  1.00 19.95 ? 1112 LEU C C     1 
ATOM   5415  O  O     . LEU C  1 139 ? 44.672  -23.434 -0.788  1.00 27.85 ? 1112 LEU C O     1 
ATOM   5416  C  CB    . LEU C  1 139 ? 44.261  -21.461 -3.409  1.00 17.36 ? 1112 LEU C CB    1 
ATOM   5417  C  CG    . LEU C  1 139 ? 43.125  -20.980 -2.505  1.00 24.23 ? 1112 LEU C CG    1 
ATOM   5418  C  CD1   . LEU C  1 139 ? 43.614  -19.998 -1.403  1.00 6.81  ? 1112 LEU C CD1   1 
ATOM   5419  C  CD2   . LEU C  1 139 ? 42.009  -20.385 -3.345  1.00 22.11 ? 1112 LEU C CD2   1 
ATOM   5420  N  N     . VAL C  1 140 ? 44.616  -24.563 -2.726  1.00 25.97 ? 1113 VAL C N     1 
ATOM   5421  C  CA    . VAL C  1 140 ? 44.169  -25.843 -2.146  1.00 21.86 ? 1113 VAL C CA    1 
ATOM   5422  C  C     . VAL C  1 140 ? 45.162  -26.353 -1.112  1.00 18.59 ? 1113 VAL C C     1 
ATOM   5423  O  O     . VAL C  1 140 ? 44.749  -26.825 -0.053  1.00 21.42 ? 1113 VAL C O     1 
ATOM   5424  C  CB    . VAL C  1 140 ? 43.907  -26.944 -3.239  1.00 22.31 ? 1113 VAL C CB    1 
ATOM   5425  C  CG1   . VAL C  1 140 ? 43.437  -28.261 -2.607  1.00 23.24 ? 1113 VAL C CG1   1 
ATOM   5426  C  CG2   . VAL C  1 140 ? 42.868  -26.489 -4.224  1.00 5.88  ? 1113 VAL C CG2   1 
ATOM   5427  N  N     . SER C  1 141 ? 46.465  -26.254 -1.423  1.00 24.13 ? 1114 SER C N     1 
ATOM   5428  C  CA    . SER C  1 141 ? 47.549  -26.636 -0.490  1.00 21.05 ? 1114 SER C CA    1 
ATOM   5429  C  C     . SER C  1 141 ? 47.484  -25.866 0.823   1.00 15.26 ? 1114 SER C C     1 
ATOM   5430  O  O     . SER C  1 141 ? 47.640  -26.446 1.894   1.00 20.20 ? 1114 SER C O     1 
ATOM   5431  C  CB    . SER C  1 141 ? 48.958  -26.422 -1.105  1.00 20.69 ? 1114 SER C CB    1 
ATOM   5432  O  OG    . SER C  1 141 ? 49.028  -26.887 -2.431  1.00 29.22 ? 1114 SER C OG    1 
ATOM   5433  N  N     . ALA C  1 142 ? 47.284  -24.551 0.718   1.00 20.58 ? 1115 ALA C N     1 
ATOM   5434  C  CA    . ALA C  1 142 ? 47.256  -23.634 1.865   1.00 20.05 ? 1115 ALA C CA    1 
ATOM   5435  C  C     . ALA C  1 142 ? 46.042  -23.911 2.723   1.00 17.74 ? 1115 ALA C C     1 
ATOM   5436  O  O     . ALA C  1 142 ? 46.088  -23.831 3.942   1.00 20.04 ? 1115 ALA C O     1 
ATOM   5437  C  CB    . ALA C  1 142 ? 47.229  -22.171 1.378   1.00 16.35 ? 1115 ALA C CB    1 
ATOM   5438  N  N     . VAL C  1 143 ? 44.942  -24.220 2.057   1.00 17.32 ? 1116 VAL C N     1 
ATOM   5439  C  CA    . VAL C  1 143 ? 43.671  -24.426 2.724   1.00 20.72 ? 1116 VAL C CA    1 
ATOM   5440  C  C     . VAL C  1 143 ? 43.653  -25.825 3.370   1.00 25.18 ? 1116 VAL C C     1 
ATOM   5441  O  O     . VAL C  1 143 ? 43.098  -26.000 4.459   1.00 30.84 ? 1116 VAL C O     1 
ATOM   5442  C  CB    . VAL C  1 143 ? 42.499  -24.107 1.744   1.00 19.87 ? 1116 VAL C CB    1 
ATOM   5443  C  CG1   . VAL C  1 143 ? 41.162  -24.504 2.305   1.00 10.27 ? 1116 VAL C CG1   1 
ATOM   5444  C  CG2   . VAL C  1 143 ? 42.517  -22.605 1.395   1.00 10.88 ? 1116 VAL C CG2   1 
ATOM   5445  N  N     . GLY C  1 144 ? 44.308  -26.791 2.720   1.00 22.87 ? 1117 GLY C N     1 
ATOM   5446  C  CA    . GLY C  1 144 ? 44.540  -28.128 3.294   1.00 22.59 ? 1117 GLY C CA    1 
ATOM   5447  C  C     . GLY C  1 144 ? 45.454  -28.136 4.516   1.00 21.59 ? 1117 GLY C C     1 
ATOM   5448  O  O     . GLY C  1 144 ? 45.197  -28.853 5.480   1.00 21.79 ? 1117 GLY C O     1 
ATOM   5449  N  N     . TYR C  1 145 ? 46.525  -27.343 4.473   1.00 21.95 ? 1118 TYR C N     1 
ATOM   5450  C  CA    . TYR C  1 145 ? 47.398  -27.122 5.638   1.00 16.15 ? 1118 TYR C CA    1 
ATOM   5451  C  C     . TYR C  1 145 ? 46.662  -26.499 6.830   1.00 17.66 ? 1118 TYR C C     1 
ATOM   5452  O  O     . TYR C  1 145 ? 46.834  -26.929 7.969   1.00 23.39 ? 1118 TYR C O     1 
ATOM   5453  C  CB    . TYR C  1 145 ? 48.624  -26.270 5.250   1.00 16.79 ? 1118 TYR C CB    1 
ATOM   5454  C  CG    . TYR C  1 145 ? 49.393  -25.689 6.430   1.00 18.51 ? 1118 TYR C CG    1 
ATOM   5455  C  CD1   . TYR C  1 145 ? 50.408  -26.411 7.057   1.00 20.67 ? 1118 TYR C CD1   1 
ATOM   5456  C  CD2   . TYR C  1 145 ? 49.093  -24.420 6.926   1.00 17.96 ? 1118 TYR C CD2   1 
ATOM   5457  C  CE1   . TYR C  1 145 ? 51.102  -25.880 8.150   1.00 12.96 ? 1118 TYR C CE1   1 
ATOM   5458  C  CE2   . TYR C  1 145 ? 49.777  -23.886 8.017   1.00 17.13 ? 1118 TYR C CE2   1 
ATOM   5459  C  CZ    . TYR C  1 145 ? 50.782  -24.618 8.619   1.00 17.26 ? 1118 TYR C CZ    1 
ATOM   5460  O  OH    . TYR C  1 145 ? 51.457  -24.085 9.701   1.00 22.73 ? 1118 TYR C OH    1 
ATOM   5461  N  N     . LEU C  1 146 ? 45.860  -25.474 6.571   1.00 20.07 ? 1119 LEU C N     1 
ATOM   5462  C  CA    . LEU C  1 146 ? 45.112  -24.806 7.637   1.00 23.18 ? 1119 LEU C CA    1 
ATOM   5463  C  C     . LEU C  1 146 ? 44.081  -25.733 8.300   1.00 17.55 ? 1119 LEU C C     1 
ATOM   5464  O  O     . LEU C  1 146 ? 43.938  -25.710 9.514   1.00 14.67 ? 1119 LEU C O     1 
ATOM   5465  C  CB    . LEU C  1 146 ? 44.458  -23.505 7.135   1.00 20.61 ? 1119 LEU C CB    1 
ATOM   5466  C  CG    . LEU C  1 146 ? 45.323  -22.273 6.797   1.00 27.61 ? 1119 LEU C CG    1 
ATOM   5467  C  CD1   . LEU C  1 146 ? 44.536  -21.264 5.954   1.00 23.26 ? 1119 LEU C CD1   1 
ATOM   5468  C  CD2   . LEU C  1 146 ? 45.916  -21.575 8.025   1.00 16.98 ? 1119 LEU C CD2   1 
ATOM   5469  N  N     . ARG C  1 147 ? 43.381  -26.544 7.505   1.00 19.45 ? 1120 ARG C N     1 
ATOM   5470  C  CA    . ARG C  1 147 ? 42.439  -27.540 8.040   1.00 25.84 ? 1120 ARG C CA    1 
ATOM   5471  C  C     . ARG C  1 147 ? 43.140  -28.495 9.007   1.00 29.81 ? 1120 ARG C C     1 
ATOM   5472  O  O     . ARG C  1 147 ? 42.636  -28.771 10.099  1.00 31.06 ? 1120 ARG C O     1 
ATOM   5473  C  CB    . ARG C  1 147 ? 41.753  -28.316 6.906   1.00 29.99 ? 1120 ARG C CB    1 
ATOM   5474  C  CG    . ARG C  1 147 ? 40.560  -29.200 7.352   1.00 31.55 ? 1120 ARG C CG    1 
ATOM   5475  C  CD    . ARG C  1 147 ? 39.259  -28.388 7.595   1.00 21.85 ? 1120 ARG C CD    1 
ATOM   5476  N  NE    . ARG C  1 147 ? 38.821  -27.649 6.406   1.00 18.92 ? 1120 ARG C NE    1 
ATOM   5477  C  CZ    . ARG C  1 147 ? 38.143  -28.181 5.395   1.00 18.83 ? 1120 ARG C CZ    1 
ATOM   5478  N  NH1   . ARG C  1 147 ? 37.799  -29.466 5.415   1.00 24.24 ? 1120 ARG C NH1   1 
ATOM   5479  N  NH2   . ARG C  1 147 ? 37.801  -27.428 4.359   1.00 18.95 ? 1120 ARG C NH2   1 
ATOM   5480  N  N     . LEU C  1 148 ? 44.320  -28.969 8.606   1.00 34.30 ? 1121 LEU C N     1 
ATOM   5481  C  CA    . LEU C  1 148 ? 45.200  -29.764 9.462   1.00 31.77 ? 1121 LEU C CA    1 
ATOM   5482  C  C     . LEU C  1 148 ? 45.520  -29.040 10.775  1.00 29.30 ? 1121 LEU C C     1 
ATOM   5483  O  O     . LEU C  1 148 ? 45.652  -29.667 11.828  1.00 28.33 ? 1121 LEU C O     1 
ATOM   5484  C  CB    . LEU C  1 148 ? 46.489  -30.095 8.701   1.00 37.86 ? 1121 LEU C CB    1 
ATOM   5485  C  CG    . LEU C  1 148 ? 47.364  -31.288 9.094   1.00 42.54 ? 1121 LEU C CG    1 
ATOM   5486  C  CD1   . LEU C  1 148 ? 46.823  -32.586 8.501   1.00 41.96 ? 1121 LEU C CD1   1 
ATOM   5487  C  CD2   . LEU C  1 148 ? 48.781  -31.041 8.612   1.00 37.43 ? 1121 LEU C CD2   1 
ATOM   5488  N  N     . LYS C  1 149 ? 45.622  -27.714 10.710  1.00 31.50 ? 1122 LYS C N     1 
ATOM   5489  C  CA    . LYS C  1 149 ? 45.858  -26.883 11.900  1.00 30.49 ? 1122 LYS C CA    1 
ATOM   5490  C  C     . LYS C  1 149 ? 44.584  -26.549 12.685  1.00 26.53 ? 1122 LYS C C     1 
ATOM   5491  O  O     . LYS C  1 149 ? 44.664  -25.907 13.736  1.00 27.83 ? 1122 LYS C O     1 
ATOM   5492  C  CB    . LYS C  1 149 ? 46.593  -25.584 11.522  1.00 32.96 ? 1122 LYS C CB    1 
ATOM   5493  C  CG    . LYS C  1 149 ? 47.984  -25.777 10.908  1.00 30.13 ? 1122 LYS C CG    1 
ATOM   5494  C  CD    . LYS C  1 149 ? 49.109  -25.532 11.906  1.00 43.19 ? 1122 LYS C CD    1 
ATOM   5495  C  CE    . LYS C  1 149 ? 49.602  -26.815 12.550  1.00 43.21 ? 1122 LYS C CE    1 
ATOM   5496  N  NZ    . LYS C  1 149 ? 48.740  -27.250 13.679  1.00 53.35 ? 1122 LYS C NZ    1 
ATOM   5497  N  N     . ASP C  1 150 ? 43.430  -27.016 12.193  1.00 28.56 ? 1123 ASP C N     1 
ATOM   5498  C  CA    . ASP C  1 150 ? 42.091  -26.654 12.722  1.00 30.32 ? 1123 ASP C CA    1 
ATOM   5499  C  C     . ASP C  1 150 ? 41.790  -25.152 12.564  1.00 29.01 ? 1123 ASP C C     1 
ATOM   5500  O  O     . ASP C  1 150 ? 41.198  -24.522 13.447  1.00 23.64 ? 1123 ASP C O     1 
ATOM   5501  C  CB    . ASP C  1 150 ? 41.909  -27.098 14.186  1.00 28.32 ? 1123 ASP C CB    1 
ATOM   5502  C  CG    . ASP C  1 150 ? 41.930  -28.611 14.356  1.00 39.43 ? 1123 ASP C CG    1 
ATOM   5503  O  OD1   . ASP C  1 150 ? 41.435  -29.342 13.464  1.00 40.73 ? 1123 ASP C OD1   1 
ATOM   5504  O  OD2   . ASP C  1 150 ? 42.430  -29.068 15.405  1.00 39.88 ? 1123 ASP C OD2   1 
ATOM   5505  N  N     . ILE C  1 151 ? 42.219  -24.592 11.434  1.00 29.40 ? 1124 ILE C N     1 
ATOM   5506  C  CA    . ILE C  1 151 ? 41.996  -23.179 11.125  1.00 29.05 ? 1124 ILE C CA    1 
ATOM   5507  C  C     . ILE C  1 151 ? 41.133  -23.006 9.877   1.00 26.43 ? 1124 ILE C C     1 
ATOM   5508  O  O     . ILE C  1 151 ? 41.394  -23.599 8.812   1.00 28.59 ? 1124 ILE C O     1 
ATOM   5509  C  CB    . ILE C  1 151 ? 43.321  -22.374 11.003  1.00 27.18 ? 1124 ILE C CB    1 
ATOM   5510  C  CG1   . ILE C  1 151 ? 44.019  -22.330 12.366  1.00 27.20 ? 1124 ILE C CG1   1 
ATOM   5511  C  CG2   . ILE C  1 151 ? 43.053  -20.942 10.470  1.00 21.74 ? 1124 ILE C CG2   1 
ATOM   5512  C  CD1   . ILE C  1 151 ? 45.425  -21.715 12.360  1.00 29.03 ? 1124 ILE C CD1   1 
ATOM   5513  N  N     . ILE C  1 152 ? 40.079  -22.217 10.039  1.00 20.79 ? 1125 ILE C N     1 
ATOM   5514  C  CA    . ILE C  1 152 ? 39.257  -21.800 8.918   1.00 16.68 ? 1125 ILE C CA    1 
ATOM   5515  C  C     . ILE C  1 152 ? 39.504  -20.302 8.714   1.00 15.54 ? 1125 ILE C C     1 
ATOM   5516  O  O     . ILE C  1 152 ? 39.411  -19.506 9.653   1.00 22.97 ? 1125 ILE C O     1 
ATOM   5517  C  CB    . ILE C  1 152 ? 37.762  -22.238 9.125   1.00 24.79 ? 1125 ILE C CB    1 
ATOM   5518  C  CG1   . ILE C  1 152 ? 37.111  -22.670 7.814   1.00 27.32 ? 1125 ILE C CG1   1 
ATOM   5519  C  CG2   . ILE C  1 152 ? 36.929  -21.247 9.931   1.00 27.98 ? 1125 ILE C CG2   1 
ATOM   5520  C  CD1   . ILE C  1 152 ? 37.074  -24.185 7.668   1.00 33.89 ? 1125 ILE C CD1   1 
ATOM   5521  N  N     . HIS C  1 153 ? 39.891  -19.949 7.493   1.00 15.98 ? 1126 HIS C N     1 
ATOM   5522  C  CA    . HIS C  1 153 ? 40.280  -18.595 7.115   1.00 15.47 ? 1126 HIS C CA    1 
ATOM   5523  C  C     . HIS C  1 153 ? 39.059  -17.682 6.970   1.00 19.74 ? 1126 HIS C C     1 
ATOM   5524  O  O     . HIS C  1 153 ? 39.106  -16.509 7.362   1.00 17.42 ? 1126 HIS C O     1 
ATOM   5525  C  CB    . HIS C  1 153 ? 41.106  -18.667 5.815   1.00 20.57 ? 1126 HIS C CB    1 
ATOM   5526  C  CG    . HIS C  1 153 ? 41.550  -17.337 5.279   1.00 19.64 ? 1126 HIS C CG    1 
ATOM   5527  N  ND1   . HIS C  1 153 ? 40.698  -16.479 4.622   1.00 19.86 ? 1126 HIS C ND1   1 
ATOM   5528  C  CD2   . HIS C  1 153 ? 42.768  -16.748 5.255   1.00 17.07 ? 1126 HIS C CD2   1 
ATOM   5529  C  CE1   . HIS C  1 153 ? 41.366  -15.404 4.244   1.00 21.77 ? 1126 HIS C CE1   1 
ATOM   5530  N  NE2   . HIS C  1 153 ? 42.624  -15.545 4.615   1.00 20.19 ? 1126 HIS C NE2   1 
ATOM   5531  N  N     . ARG C  1 154 ? 37.984  -18.225 6.392   1.00 22.53 ? 1127 ARG C N     1 
ATOM   5532  C  CA    . ARG C  1 154 ? 36.643  -17.586 6.353   1.00 22.14 ? 1127 ARG C CA    1 
ATOM   5533  C  C     . ARG C  1 154 ? 36.461  -16.394 5.407   1.00 22.49 ? 1127 ARG C C     1 
ATOM   5534  O  O     . ARG C  1 154 ? 35.368  -15.832 5.315   1.00 21.67 ? 1127 ARG C O     1 
ATOM   5535  C  CB    . ARG C  1 154 ? 36.153  -17.210 7.752   1.00 18.09 ? 1127 ARG C CB    1 
ATOM   5536  C  CG    . ARG C  1 154 ? 35.889  -18.388 8.659   1.00 23.09 ? 1127 ARG C CG    1 
ATOM   5537  C  CD    . ARG C  1 154 ? 35.923  -17.925 10.096  1.00 22.22 ? 1127 ARG C CD    1 
ATOM   5538  N  NE    . ARG C  1 154 ? 34.608  -17.646 10.640  1.00 27.82 ? 1127 ARG C NE    1 
ATOM   5539  C  CZ    . ARG C  1 154 ? 34.347  -16.741 11.585  1.00 17.98 ? 1127 ARG C CZ    1 
ATOM   5540  N  NH1   . ARG C  1 154 ? 35.296  -15.962 12.085  1.00 13.74 ? 1127 ARG C NH1   1 
ATOM   5541  N  NH2   . ARG C  1 154 ? 33.112  -16.606 12.013  1.00 22.59 ? 1127 ARG C NH2   1 
ATOM   5542  N  N     . ASP C  1 155 ? 37.515  -16.020 4.696   1.00 26.62 ? 1128 ASP C N     1 
ATOM   5543  C  CA    . ASP C  1 155 ? 37.396  -14.978 3.684   1.00 29.03 ? 1128 ASP C CA    1 
ATOM   5544  C  C     . ASP C  1 155 ? 38.270  -15.310 2.482   1.00 25.57 ? 1128 ASP C C     1 
ATOM   5545  O  O     . ASP C  1 155 ? 39.052  -14.477 2.007   1.00 31.27 ? 1128 ASP C O     1 
ATOM   5546  C  CB    . ASP C  1 155 ? 37.724  -13.596 4.275   1.00 26.74 ? 1128 ASP C CB    1 
ATOM   5547  C  CG    . ASP C  1 155 ? 37.058  -12.453 3.509   1.00 35.52 ? 1128 ASP C CG    1 
ATOM   5548  O  OD1   . ASP C  1 155 ? 36.236  -12.742 2.607   1.00 27.17 ? 1128 ASP C OD1   1 
ATOM   5549  O  OD2   . ASP C  1 155 ? 37.364  -11.268 3.809   1.00 30.78 ? 1128 ASP C OD2   1 
ATOM   5550  N  N     . ILE C  1 156 ? 38.138  -16.540 1.993   1.00 25.62 ? 1129 ILE C N     1 
ATOM   5551  C  CA    . ILE C  1 156 ? 38.880  -16.958 0.810   1.00 24.98 ? 1129 ILE C CA    1 
ATOM   5552  C  C     . ILE C  1 156 ? 38.189  -16.348 -0.389  1.00 21.03 ? 1129 ILE C C     1 
ATOM   5553  O  O     . ILE C  1 156 ? 37.013  -16.622 -0.654  1.00 22.94 ? 1129 ILE C O     1 
ATOM   5554  C  CB    . ILE C  1 156 ? 39.032  -18.508 0.669   1.00 23.94 ? 1129 ILE C CB    1 
ATOM   5555  C  CG1   . ILE C  1 156 ? 39.741  -19.095 1.893   1.00 24.73 ? 1129 ILE C CG1   1 
ATOM   5556  C  CG2   . ILE C  1 156 ? 39.805  -18.859 -0.624  1.00 17.60 ? 1129 ILE C CG2   1 
ATOM   5557  C  CD1   . ILE C  1 156 ? 39.408  -20.565 2.162   1.00 16.79 ? 1129 ILE C CD1   1 
ATOM   5558  N  N     . LYS C  1 157 ? 38.927  -15.477 -1.069  1.00 20.67 ? 1130 LYS C N     1 
ATOM   5559  C  CA    . LYS C  1 157 ? 38.464  -14.797 -2.271  1.00 21.23 ? 1130 LYS C CA    1 
ATOM   5560  C  C     . LYS C  1 157 ? 39.671  -14.231 -3.001  1.00 20.72 ? 1130 LYS C C     1 
ATOM   5561  O  O     . LYS C  1 157 ? 40.754  -14.148 -2.433  1.00 22.18 ? 1130 LYS C O     1 
ATOM   5562  C  CB    . LYS C  1 157 ? 37.483  -13.665 -1.926  1.00 21.64 ? 1130 LYS C CB    1 
ATOM   5563  C  CG    . LYS C  1 157 ? 38.038  -12.605 -1.003  1.00 21.89 ? 1130 LYS C CG    1 
ATOM   5564  C  CD    . LYS C  1 157 ? 37.130  -11.393 -0.925  1.00 28.91 ? 1130 LYS C CD    1 
ATOM   5565  C  CE    . LYS C  1 157 ? 37.714  -10.377 0.047   1.00 38.25 ? 1130 LYS C CE    1 
ATOM   5566  N  NZ    . LYS C  1 157 ? 37.012  -9.066  -0.009  1.00 38.22 ? 1130 LYS C NZ    1 
ATOM   5567  N  N     . ASP C  1 158 ? 39.467  -13.831 -4.252  1.00 22.89 ? 1131 ASP C N     1 
ATOM   5568  C  CA    . ASP C  1 158 ? 40.534  -13.306 -5.102  1.00 29.71 ? 1131 ASP C CA    1 
ATOM   5569  C  C     . ASP C  1 158 ? 41.273  -12.103 -4.512  1.00 26.86 ? 1131 ASP C C     1 
ATOM   5570  O  O     . ASP C  1 158 ? 42.461  -11.928 -4.763  1.00 26.23 ? 1131 ASP C O     1 
ATOM   5571  C  CB    . ASP C  1 158 ? 39.990  -12.980 -6.509  1.00 35.13 ? 1131 ASP C CB    1 
ATOM   5572  C  CG    . ASP C  1 158 ? 38.764  -12.072 -6.486  1.00 46.64 ? 1131 ASP C CG    1 
ATOM   5573  O  OD1   . ASP C  1 158 ? 38.380  -11.570 -5.402  1.00 58.60 ? 1131 ASP C OD1   1 
ATOM   5574  O  OD2   . ASP C  1 158 ? 38.176  -11.856 -7.568  1.00 52.62 ? 1131 ASP C OD2   1 
ATOM   5575  N  N     . GLU C  1 159 ? 40.568  -11.282 -3.734  1.00 28.06 ? 1132 GLU C N     1 
ATOM   5576  C  CA    . GLU C  1 159 ? 41.169  -10.113 -3.083  1.00 32.50 ? 1132 GLU C CA    1 
ATOM   5577  C  C     . GLU C  1 159 ? 42.094  -10.459 -1.927  1.00 26.95 ? 1132 GLU C C     1 
ATOM   5578  O  O     . GLU C  1 159 ? 42.928  -9.644  -1.528  1.00 27.34 ? 1132 GLU C O     1 
ATOM   5579  C  CB    . GLU C  1 159 ? 40.095  -9.131  -2.596  1.00 32.89 ? 1132 GLU C CB    1 
ATOM   5580  C  CG    . GLU C  1 159 ? 39.790  -8.000  -3.575  1.00 36.41 ? 1132 GLU C CG    1 
ATOM   5581  C  CD    . GLU C  1 159 ? 39.152  -6.770  -2.914  1.00 44.23 ? 1132 GLU C CD    1 
ATOM   5582  O  OE1   . GLU C  1 159 ? 38.919  -5.769  -3.638  1.00 46.95 ? 1132 GLU C OE1   1 
ATOM   5583  O  OE2   . GLU C  1 159 ? 38.897  -6.795  -1.681  1.00 41.70 ? 1132 GLU C OE2   1 
ATOM   5584  N  N     . ASN C  1 160 ? 41.941  -11.664 -1.387  1.00 27.85 ? 1133 ASN C N     1 
ATOM   5585  C  CA    . ASN C  1 160 ? 42.750  -12.108 -0.262  1.00 24.72 ? 1133 ASN C CA    1 
ATOM   5586  C  C     . ASN C  1 160 ? 43.845  -13.074 -0.692  1.00 24.55 ? 1133 ASN C C     1 
ATOM   5587  O  O     . ASN C  1 160 ? 44.474  -13.741 0.132   1.00 27.17 ? 1133 ASN C O     1 
ATOM   5588  C  CB    . ASN C  1 160 ? 41.867  -12.691 0.844   1.00 22.59 ? 1133 ASN C CB    1 
ATOM   5589  C  CG    . ASN C  1 160 ? 41.137  -11.616 1.640   1.00 24.25 ? 1133 ASN C CG    1 
ATOM   5590  O  OD1   . ASN C  1 160 ? 41.511  -10.446 1.621   1.00 34.00 ? 1133 ASN C OD1   1 
ATOM   5591  N  ND2   . ASN C  1 160 ? 40.101  -12.016 2.356   1.00 26.41 ? 1133 ASN C ND2   1 
ATOM   5592  N  N     . ILE C  1 161 ? 44.065  -13.133 -1.996  1.00 24.17 ? 1134 ILE C N     1 
ATOM   5593  C  CA    . ILE C  1 161 ? 45.170  -13.883 -2.562  1.00 27.09 ? 1134 ILE C CA    1 
ATOM   5594  C  C     . ILE C  1 161 ? 46.065  -12.904 -3.309  1.00 23.39 ? 1134 ILE C C     1 
ATOM   5595  O  O     . ILE C  1 161 ? 45.584  -12.069 -4.072  1.00 22.73 ? 1134 ILE C O     1 
ATOM   5596  C  CB    . ILE C  1 161 ? 44.682  -15.017 -3.508  1.00 30.82 ? 1134 ILE C CB    1 
ATOM   5597  C  CG1   . ILE C  1 161 ? 43.748  -15.987 -2.767  1.00 31.20 ? 1134 ILE C CG1   1 
ATOM   5598  C  CG2   . ILE C  1 161 ? 45.865  -15.782 -4.093  1.00 28.00 ? 1134 ILE C CG2   1 
ATOM   5599  C  CD1   . ILE C  1 161 ? 42.781  -16.721 -3.684  1.00 35.51 ? 1134 ILE C CD1   1 
ATOM   5600  N  N     . VAL C  1 162 ? 47.366  -12.994 -3.053  1.00 27.47 ? 1135 VAL C N     1 
ATOM   5601  C  CA    . VAL C  1 162 ? 48.360  -12.220 -3.804  1.00 20.52 ? 1135 VAL C CA    1 
ATOM   5602  C  C     . VAL C  1 162 ? 49.197  -13.154 -4.683  1.00 21.44 ? 1135 VAL C C     1 
ATOM   5603  O  O     . VAL C  1 162 ? 49.618  -14.227 -4.233  1.00 24.60 ? 1135 VAL C O     1 
ATOM   5604  C  CB    . VAL C  1 162 ? 49.262  -11.324 -2.891  1.00 15.25 ? 1135 VAL C CB    1 
ATOM   5605  C  CG1   . VAL C  1 162 ? 48.474  -10.162 -2.317  1.00 11.33 ? 1135 VAL C CG1   1 
ATOM   5606  C  CG2   . VAL C  1 162 ? 49.944  -12.127 -1.768  1.00 9.69  ? 1135 VAL C CG2   1 
ATOM   5607  N  N     . ILE C  1 163 ? 49.414  -12.737 -5.930  1.00 18.03 ? 1136 ILE C N     1 
ATOM   5608  C  CA    . ILE C  1 163 ? 50.220  -13.475 -6.906  1.00 22.45 ? 1136 ILE C CA    1 
ATOM   5609  C  C     . ILE C  1 163 ? 51.490  -12.692 -7.294  1.00 27.89 ? 1136 ILE C C     1 
ATOM   5610  O  O     . ILE C  1 163 ? 51.451  -11.468 -7.449  1.00 32.37 ? 1136 ILE C O     1 
ATOM   5611  C  CB    . ILE C  1 163 ? 49.376  -13.811 -8.179  1.00 21.43 ? 1136 ILE C CB    1 
ATOM   5612  C  CG1   . ILE C  1 163 ? 50.100  -14.825 -9.080  1.00 23.32 ? 1136 ILE C CG1   1 
ATOM   5613  C  CG2   . ILE C  1 163 ? 48.969  -12.534 -8.941  1.00 21.02 ? 1136 ILE C CG2   1 
ATOM   5614  C  CD1   . ILE C  1 163 ? 49.238  -15.378 -10.217 1.00 24.02 ? 1136 ILE C CD1   1 
ATOM   5615  N  N     . ALA C  1 164 ? 52.609  -13.395 -7.442  1.00 29.58 ? 1137 ALA C N     1 
ATOM   5616  C  CA    . ALA C  1 164 ? 53.842  -12.775 -7.935  1.00 27.67 ? 1137 ALA C CA    1 
ATOM   5617  C  C     . ALA C  1 164 ? 54.006  -13.033 -9.439  1.00 30.46 ? 1137 ALA C C     1 
ATOM   5618  O  O     . ALA C  1 164 ? 53.067  -13.499 -10.097 1.00 31.68 ? 1137 ALA C O     1 
ATOM   5619  C  CB    . ALA C  1 164 ? 55.050  -13.271 -7.143  1.00 24.93 ? 1137 ALA C CB    1 
ATOM   5620  N  N     . GLU C  1 165 ? 55.185  -12.731 -9.982  1.00 31.17 ? 1138 GLU C N     1 
ATOM   5621  C  CA    . GLU C  1 165 ? 55.427  -12.846 -11.433 1.00 33.33 ? 1138 GLU C CA    1 
ATOM   5622  C  C     . GLU C  1 165 ? 55.928  -14.220 -11.912 1.00 29.07 ? 1138 GLU C C     1 
ATOM   5623  O  O     . GLU C  1 165 ? 55.975  -14.476 -13.110 1.00 33.73 ? 1138 GLU C O     1 
ATOM   5624  C  CB    . GLU C  1 165 ? 56.322  -11.703 -11.941 1.00 32.17 ? 1138 GLU C CB    1 
ATOM   5625  C  CG    . GLU C  1 165 ? 55.626  -10.342 -11.899 1.00 36.08 ? 1138 GLU C CG    1 
ATOM   5626  C  CD    . GLU C  1 165 ? 56.386  -9.241  -12.616 1.00 39.79 ? 1138 GLU C CD    1 
ATOM   5627  O  OE1   . GLU C  1 165 ? 56.052  -8.057  -12.404 1.00 46.44 ? 1138 GLU C OE1   1 
ATOM   5628  O  OE2   . GLU C  1 165 ? 57.316  -9.550  -13.390 1.00 60.82 ? 1138 GLU C OE2   1 
ATOM   5629  N  N     . ASP C  1 166 ? 56.290  -15.098 -10.982 1.00 28.90 ? 1139 ASP C N     1 
ATOM   5630  C  CA    . ASP C  1 166 ? 56.466  -16.524 -11.297 1.00 31.02 ? 1139 ASP C CA    1 
ATOM   5631  C  C     . ASP C  1 166 ? 55.163  -17.369 -11.156 1.00 27.14 ? 1139 ASP C C     1 
ATOM   5632  O  O     . ASP C  1 166 ? 55.219  -18.597 -11.101 1.00 27.40 ? 1139 ASP C O     1 
ATOM   5633  C  CB    . ASP C  1 166 ? 57.599  -17.118 -10.452 1.00 28.65 ? 1139 ASP C CB    1 
ATOM   5634  C  CG    . ASP C  1 166 ? 57.392  -16.917 -8.963  1.00 33.14 ? 1139 ASP C CG    1 
ATOM   5635  O  OD1   . ASP C  1 166 ? 58.163  -17.505 -8.180  1.00 41.37 ? 1139 ASP C OD1   1 
ATOM   5636  O  OD2   . ASP C  1 166 ? 56.463  -16.179 -8.566  1.00 42.57 ? 1139 ASP C OD2   1 
ATOM   5637  N  N     . PHE C  1 167 ? 54.012  -16.694 -11.103 1.00 28.75 ? 1140 PHE C N     1 
ATOM   5638  C  CA    . PHE C  1 167 ? 52.670  -17.318 -10.940 1.00 32.10 ? 1140 PHE C CA    1 
ATOM   5639  C  C     . PHE C  1 167 ? 52.432  -18.042 -9.608  1.00 29.73 ? 1140 PHE C C     1 
ATOM   5640  O  O     . PHE C  1 167 ? 51.486  -18.827 -9.474  1.00 31.88 ? 1140 PHE C O     1 
ATOM   5641  C  CB    . PHE C  1 167 ? 52.304  -18.211 -12.137 1.00 32.20 ? 1140 PHE C CB    1 
ATOM   5642  C  CG    . PHE C  1 167 ? 52.427  -17.517 -13.453 1.00 31.16 ? 1140 PHE C CG    1 
ATOM   5643  C  CD1   . PHE C  1 167 ? 51.454  -16.609 -13.867 1.00 29.45 ? 1140 PHE C CD1   1 
ATOM   5644  C  CD2   . PHE C  1 167 ? 53.528  -17.743 -14.266 1.00 31.40 ? 1140 PHE C CD2   1 
ATOM   5645  C  CE1   . PHE C  1 167 ? 51.576  -15.944 -15.074 1.00 34.41 ? 1140 PHE C CE1   1 
ATOM   5646  C  CE2   . PHE C  1 167 ? 53.658  -17.082 -15.471 1.00 28.96 ? 1140 PHE C CE2   1 
ATOM   5647  C  CZ    . PHE C  1 167 ? 52.679  -16.180 -15.880 1.00 27.80 ? 1140 PHE C CZ    1 
ATOM   5648  N  N     . THR C  1 168 ? 53.286  -17.750 -8.631  1.00 29.20 ? 1141 THR C N     1 
ATOM   5649  C  CA    . THR C  1 168 ? 53.172  -18.293 -7.277  1.00 31.65 ? 1141 THR C CA    1 
ATOM   5650  C  C     . THR C  1 168 ? 52.276  -17.378 -6.438  1.00 30.17 ? 1141 THR C C     1 
ATOM   5651  O  O     . THR C  1 168 ? 52.359  -16.151 -6.544  1.00 26.54 ? 1141 THR C O     1 
ATOM   5652  C  CB    . THR C  1 168 ? 54.568  -18.480 -6.628  1.00 34.08 ? 1141 THR C CB    1 
ATOM   5653  O  OG1   . THR C  1 168 ? 55.180  -19.666 -7.154  1.00 37.67 ? 1141 THR C OG1   1 
ATOM   5654  C  CG2   . THR C  1 168 ? 54.473  -18.616 -5.119  1.00 41.52 ? 1141 THR C CG2   1 
ATOM   5655  N  N     . ILE C  1 169 ? 51.409  -17.989 -5.630  1.00 27.42 ? 1142 ILE C N     1 
ATOM   5656  C  CA    . ILE C  1 169 ? 50.416  -17.254 -4.863  1.00 22.10 ? 1142 ILE C CA    1 
ATOM   5657  C  C     . ILE C  1 169 ? 50.571  -17.405 -3.336  1.00 20.05 ? 1142 ILE C C     1 
ATOM   5658  O  O     . ILE C  1 169 ? 51.103  -18.399 -2.836  1.00 17.18 ? 1142 ILE C O     1 
ATOM   5659  C  CB    . ILE C  1 169 ? 48.948  -17.561 -5.337  1.00 26.56 ? 1142 ILE C CB    1 
ATOM   5660  C  CG1   . ILE C  1 169 ? 48.544  -19.014 -5.079  1.00 21.45 ? 1142 ILE C CG1   1 
ATOM   5661  C  CG2   . ILE C  1 169 ? 48.771  -17.247 -6.806  1.00 23.01 ? 1142 ILE C CG2   1 
ATOM   5662  C  CD1   . ILE C  1 169 ? 47.031  -19.237 -5.050  1.00 24.81 ? 1142 ILE C CD1   1 
ATOM   5663  N  N     . LYS C  1 170 ? 50.133  -16.376 -2.620  1.00 14.84 ? 1143 LYS C N     1 
ATOM   5664  C  CA    . LYS C  1 170 ? 50.109  -16.359 -1.168  1.00 20.98 ? 1143 LYS C CA    1 
ATOM   5665  C  C     . LYS C  1 170 ? 48.736  -15.923 -0.681  1.00 22.71 ? 1143 LYS C C     1 
ATOM   5666  O  O     . LYS C  1 170 ? 48.162  -14.942 -1.171  1.00 25.67 ? 1143 LYS C O     1 
ATOM   5667  C  CB    . LYS C  1 170 ? 51.164  -15.403 -0.609  1.00 21.39 ? 1143 LYS C CB    1 
ATOM   5668  C  CG    . LYS C  1 170 ? 52.269  -16.057 0.184   1.00 24.60 ? 1143 LYS C CG    1 
ATOM   5669  C  CD    . LYS C  1 170 ? 53.346  -16.564 -0.699  1.00 23.20 ? 1143 LYS C CD    1 
ATOM   5670  C  CE    . LYS C  1 170 ? 54.570  -16.908 0.096   1.00 28.57 ? 1143 LYS C CE    1 
ATOM   5671  N  NZ    . LYS C  1 170 ? 55.695  -16.998 -0.831  1.00 28.24 ? 1143 LYS C NZ    1 
ATOM   5672  N  N     . LEU C  1 171 ? 48.215  -16.672 0.277   1.00 22.66 ? 1144 LEU C N     1 
ATOM   5673  C  CA    . LEU C  1 171 ? 46.994  -16.305 0.972   1.00 21.92 ? 1144 LEU C CA    1 
ATOM   5674  C  C     . LEU C  1 171 ? 47.317  -15.314 2.091   1.00 17.78 ? 1144 LEU C C     1 
ATOM   5675  O  O     . LEU C  1 171 ? 48.199  -15.558 2.926   1.00 16.60 ? 1144 LEU C O     1 
ATOM   5676  C  CB    . LEU C  1 171 ? 46.296  -17.564 1.521   1.00 24.67 ? 1144 LEU C CB    1 
ATOM   5677  C  CG    . LEU C  1 171 ? 44.935  -17.460 2.218   1.00 25.34 ? 1144 LEU C CG    1 
ATOM   5678  C  CD1   . LEU C  1 171 ? 43.817  -16.932 1.296   1.00 15.12 ? 1144 LEU C CD1   1 
ATOM   5679  C  CD2   . LEU C  1 171 ? 44.570  -18.809 2.810   1.00 19.21 ? 1144 LEU C CD2   1 
ATOM   5680  N  N     . ILE C  1 172 ? 46.576  -14.208 2.091   1.00 17.54 ? 1145 ILE C N     1 
ATOM   5681  C  CA    . ILE C  1 172 ? 46.719  -13.119 3.047   1.00 15.51 ? 1145 ILE C CA    1 
ATOM   5682  C  C     . ILE C  1 172 ? 45.402  -12.897 3.804   1.00 16.01 ? 1145 ILE C C     1 
ATOM   5683  O  O     . ILE C  1 172 ? 44.415  -13.607 3.593   1.00 17.61 ? 1145 ILE C O     1 
ATOM   5684  C  CB    . ILE C  1 172 ? 47.157  -11.774 2.333   1.00 21.89 ? 1145 ILE C CB    1 
ATOM   5685  C  CG1   . ILE C  1 172 ? 46.215  -11.434 1.166   1.00 12.55 ? 1145 ILE C CG1   1 
ATOM   5686  C  CG2   . ILE C  1 172 ? 48.616  -11.842 1.833   1.00 17.21 ? 1145 ILE C CG2   1 
ATOM   5687  C  CD1   . ILE C  1 172 ? 46.113  -9.989  0.853   1.00 15.45 ? 1145 ILE C CD1   1 
ATOM   5688  N  N     . ASP C  1 173 ? 45.414  -11.909 4.690   1.00 20.06 ? 1146 ASP C N     1 
ATOM   5689  C  CA    . ASP C  1 173 ? 44.233  -11.391 5.378   1.00 20.94 ? 1146 ASP C CA    1 
ATOM   5690  C  C     . ASP C  1 173 ? 43.509  -12.413 6.264   1.00 23.64 ? 1146 ASP C C     1 
ATOM   5691  O  O     . ASP C  1 173 ? 42.501  -13.006 5.877   1.00 23.69 ? 1146 ASP C O     1 
ATOM   5692  C  CB    . ASP C  1 173 ? 43.284  -10.703 4.388   1.00 20.16 ? 1146 ASP C CB    1 
ATOM   5693  C  CG    . ASP C  1 173 ? 42.150  -9.974  5.077   1.00 25.63 ? 1146 ASP C CG    1 
ATOM   5694  O  OD1   . ASP C  1 173 ? 42.144  -9.952  6.325   1.00 11.83 ? 1146 ASP C OD1   1 
ATOM   5695  O  OD2   . ASP C  1 173 ? 41.273  -9.409  4.374   1.00 17.89 ? 1146 ASP C OD2   1 
ATOM   5696  N  N     . PHE C  1 174 ? 44.041  -12.580 7.469   1.00 27.01 ? 1147 PHE C N     1 
ATOM   5697  C  CA    . PHE C  1 174 ? 43.558  -13.556 8.430   1.00 26.15 ? 1147 PHE C CA    1 
ATOM   5698  C  C     . PHE C  1 174 ? 42.657  -12.933 9.497   1.00 26.22 ? 1147 PHE C C     1 
ATOM   5699  O  O     . PHE C  1 174 ? 42.501  -13.486 10.589  1.00 23.84 ? 1147 PHE C O     1 
ATOM   5700  C  CB    . PHE C  1 174 ? 44.755  -14.299 9.048   1.00 25.24 ? 1147 PHE C CB    1 
ATOM   5701  C  CG    . PHE C  1 174 ? 45.279  -15.402 8.178   1.00 21.27 ? 1147 PHE C CG    1 
ATOM   5702  C  CD1   . PHE C  1 174 ? 46.091  -15.115 7.071   1.00 20.48 ? 1147 PHE C CD1   1 
ATOM   5703  C  CD2   . PHE C  1 174 ? 44.932  -16.724 8.431   1.00 20.82 ? 1147 PHE C CD2   1 
ATOM   5704  C  CE1   . PHE C  1 174 ? 46.568  -16.132 6.245   1.00 22.58 ? 1147 PHE C CE1   1 
ATOM   5705  C  CE2   . PHE C  1 174 ? 45.405  -17.759 7.611   1.00 24.33 ? 1147 PHE C CE2   1 
ATOM   5706  C  CZ    . PHE C  1 174 ? 46.229  -17.459 6.515   1.00 27.25 ? 1147 PHE C CZ    1 
ATOM   5707  N  N     . GLY C  1 175 ? 42.045  -11.796 9.146   1.00 28.05 ? 1148 GLY C N     1 
ATOM   5708  C  CA    . GLY C  1 175 ? 41.217  -11.010 10.065  1.00 27.60 ? 1148 GLY C CA    1 
ATOM   5709  C  C     . GLY C  1 175 ? 39.891  -11.646 10.439  1.00 26.54 ? 1148 GLY C C     1 
ATOM   5710  O  O     . GLY C  1 175 ? 39.342  -11.341 11.485  1.00 22.86 ? 1148 GLY C O     1 
ATOM   5711  N  N     . SER C  1 176 ? 39.377  -12.524 9.577   1.00 29.21 ? 1149 SER C N     1 
ATOM   5712  C  CA    . SER C  1 176 ? 38.138  -13.265 9.830   1.00 25.91 ? 1149 SER C CA    1 
ATOM   5713  C  C     . SER C  1 176 ? 38.419  -14.681 10.311  1.00 27.56 ? 1149 SER C C     1 
ATOM   5714  O  O     . SER C  1 176 ? 37.486  -15.429 10.589  1.00 32.31 ? 1149 SER C O     1 
ATOM   5715  C  CB    . SER C  1 176 ? 37.297  -13.366 8.555   1.00 27.79 ? 1149 SER C CB    1 
ATOM   5716  O  OG    . SER C  1 176 ? 36.831  -12.105 8.107   1.00 30.37 ? 1149 SER C OG    1 
ATOM   5717  N  N     . ALA C  1 177 ? 39.695  -15.062 10.386  1.00 25.84 ? 1150 ALA C N     1 
ATOM   5718  C  CA    . ALA C  1 177 ? 40.056  -16.460 10.654  1.00 24.50 ? 1150 ALA C CA    1 
ATOM   5719  C  C     . ALA C  1 177 ? 39.671  -16.942 12.055  1.00 26.61 ? 1150 ALA C C     1 
ATOM   5720  O  O     . ALA C  1 177 ? 39.707  -16.182 13.023  1.00 26.43 ? 1150 ALA C O     1 
ATOM   5721  C  CB    . ALA C  1 177 ? 41.540  -16.716 10.376  1.00 21.44 ? 1150 ALA C CB    1 
ATOM   5722  N  N     . ALA C  1 178 ? 39.298  -18.216 12.145  1.00 23.23 ? 1151 ALA C N     1 
ATOM   5723  C  CA    . ALA C  1 178 ? 38.916  -18.805 13.408  1.00 19.83 ? 1151 ALA C CA    1 
ATOM   5724  C  C     . ALA C  1 178 ? 39.405  -20.248 13.528  1.00 21.96 ? 1151 ALA C C     1 
ATOM   5725  O  O     . ALA C  1 178 ? 39.859  -20.851 12.549  1.00 20.44 ? 1151 ALA C O     1 
ATOM   5726  C  CB    . ALA C  1 178 ? 37.383  -18.717 13.602  1.00 12.87 ? 1151 ALA C CB    1 
ATOM   5727  N  N     . TYR C  1 179 ? 39.319  -20.778 14.743  1.00 23.68 ? 1152 TYR C N     1 
ATOM   5728  C  CA    . TYR C  1 179 ? 39.645  -22.160 15.018  1.00 30.16 ? 1152 TYR C CA    1 
ATOM   5729  C  C     . TYR C  1 179 ? 38.415  -23.056 14.943  1.00 33.99 ? 1152 TYR C C     1 
ATOM   5730  O  O     . TYR C  1 179 ? 37.341  -22.726 15.469  1.00 29.64 ? 1152 TYR C O     1 
ATOM   5731  C  CB    . TYR C  1 179 ? 40.311  -22.299 16.386  1.00 31.36 ? 1152 TYR C CB    1 
ATOM   5732  C  CG    . TYR C  1 179 ? 41.697  -21.700 16.451  1.00 37.99 ? 1152 TYR C CG    1 
ATOM   5733  C  CD1   . TYR C  1 179 ? 42.810  -22.413 16.004  1.00 40.66 ? 1152 TYR C CD1   1 
ATOM   5734  C  CD2   . TYR C  1 179 ? 41.895  -20.419 16.965  1.00 34.70 ? 1152 TYR C CD2   1 
ATOM   5735  C  CE1   . TYR C  1 179 ? 44.088  -21.859 16.067  1.00 46.63 ? 1152 TYR C CE1   1 
ATOM   5736  C  CE2   . TYR C  1 179 ? 43.159  -19.860 17.033  1.00 41.05 ? 1152 TYR C CE2   1 
ATOM   5737  C  CZ    . TYR C  1 179 ? 44.251  -20.578 16.587  1.00 46.34 ? 1152 TYR C CZ    1 
ATOM   5738  O  OH    . TYR C  1 179 ? 45.504  -20.005 16.658  1.00 47.44 ? 1152 TYR C OH    1 
ATOM   5739  N  N     . LEU C  1 180 ? 38.592  -24.181 14.256  1.00 35.69 ? 1153 LEU C N     1 
ATOM   5740  C  CA    . LEU C  1 180 ? 37.635  -25.275 14.254  1.00 35.59 ? 1153 LEU C CA    1 
ATOM   5741  C  C     . LEU C  1 180 ? 37.710  -25.974 15.603  1.00 36.59 ? 1153 LEU C C     1 
ATOM   5742  O  O     . LEU C  1 180 ? 38.801  -26.237 16.109  1.00 35.98 ? 1153 LEU C O     1 
ATOM   5743  C  CB    . LEU C  1 180 ? 37.984  -26.261 13.143  1.00 31.98 ? 1153 LEU C CB    1 
ATOM   5744  C  CG    . LEU C  1 180 ? 37.358  -26.198 11.746  1.00 36.41 ? 1153 LEU C CG    1 
ATOM   5745  C  CD1   . LEU C  1 180 ? 36.625  -24.892 11.421  1.00 29.93 ? 1153 LEU C CD1   1 
ATOM   5746  C  CD2   . LEU C  1 180 ? 38.429  -26.525 10.716  1.00 17.58 ? 1153 LEU C CD2   1 
ATOM   5747  N  N     . GLU C  1 181 ? 36.549  -26.250 16.185  1.00 38.89 ? 1154 GLU C N     1 
ATOM   5748  C  CA    . GLU C  1 181 ? 36.461  -26.919 17.479  1.00 41.71 ? 1154 GLU C CA    1 
ATOM   5749  C  C     . GLU C  1 181 ? 35.474  -28.074 17.403  1.00 43.17 ? 1154 GLU C C     1 
ATOM   5750  O  O     . GLU C  1 181 ? 34.435  -27.964 16.751  1.00 43.64 ? 1154 GLU C O     1 
ATOM   5751  C  CB    . GLU C  1 181 ? 36.039  -25.931 18.575  1.00 41.56 ? 1154 GLU C CB    1 
ATOM   5752  N  N     . ARG C  1 182 ? 35.809  -29.177 18.070  1.00 48.23 ? 1155 ARG C N     1 
ATOM   5753  C  CA    . ARG C  1 182 ? 34.954  -30.362 18.113  1.00 51.78 ? 1155 ARG C CA    1 
ATOM   5754  C  C     . ARG C  1 182 ? 33.537  -29.975 18.528  1.00 50.66 ? 1155 ARG C C     1 
ATOM   5755  O  O     . ARG C  1 182 ? 33.333  -29.416 19.609  1.00 49.33 ? 1155 ARG C O     1 
ATOM   5756  C  CB    . ARG C  1 182 ? 35.527  -31.405 19.081  1.00 54.47 ? 1155 ARG C CB    1 
ATOM   5757  C  CG    . ARG C  1 182 ? 34.743  -32.711 19.143  1.00 60.11 ? 1155 ARG C CG    1 
ATOM   5758  C  CD    . ARG C  1 182 ? 35.269  -33.729 18.142  1.00 63.05 ? 1155 ARG C CD    1 
ATOM   5759  N  NE    . ARG C  1 182 ? 34.326  -34.825 17.929  1.00 65.68 ? 1155 ARG C NE    1 
ATOM   5760  C  CZ    . ARG C  1 182 ? 34.678  -36.088 17.703  1.00 71.78 ? 1155 ARG C CZ    1 
ATOM   5761  N  NH1   . ARG C  1 182 ? 35.961  -36.438 17.677  1.00 70.00 ? 1155 ARG C NH1   1 
ATOM   5762  N  NH2   . ARG C  1 182 ? 33.745  -37.012 17.515  1.00 72.98 ? 1155 ARG C NH2   1 
ATOM   5763  N  N     . GLY C  1 183 ? 32.580  -30.249 17.643  1.00 50.10 ? 1156 GLY C N     1 
ATOM   5764  C  CA    . GLY C  1 183 ? 31.164  -29.965 17.883  1.00 49.93 ? 1156 GLY C CA    1 
ATOM   5765  C  C     . GLY C  1 183 ? 30.840  -28.505 18.146  1.00 49.37 ? 1156 GLY C C     1 
ATOM   5766  O  O     . GLY C  1 183 ? 30.106  -28.192 19.081  1.00 50.17 ? 1156 GLY C O     1 
ATOM   5767  N  N     . LYS C  1 184 ? 31.396  -27.613 17.328  1.00 49.28 ? 1157 LYS C N     1 
ATOM   5768  C  CA    . LYS C  1 184 ? 31.099  -26.181 17.422  1.00 47.05 ? 1157 LYS C CA    1 
ATOM   5769  C  C     . LYS C  1 184 ? 30.416  -25.669 16.157  1.00 45.85 ? 1157 LYS C C     1 
ATOM   5770  O  O     . LYS C  1 184 ? 30.672  -26.161 15.055  1.00 43.95 ? 1157 LYS C O     1 
ATOM   5771  C  CB    . LYS C  1 184 ? 32.372  -25.369 17.688  1.00 49.73 ? 1157 LYS C CB    1 
ATOM   5772  C  CG    . LYS C  1 184 ? 32.123  -23.885 17.941  1.00 44.82 ? 1157 LYS C CG    1 
ATOM   5773  C  CD    . LYS C  1 184 ? 33.382  -23.059 17.735  1.00 44.97 ? 1157 LYS C CD    1 
ATOM   5774  C  CE    . LYS C  1 184 ? 33.052  -21.572 17.661  1.00 39.34 ? 1157 LYS C CE    1 
ATOM   5775  N  NZ    . LYS C  1 184 ? 34.270  -20.759 17.396  1.00 45.25 ? 1157 LYS C NZ    1 
ATOM   5776  N  N     . LEU C  1 185 ? 29.536  -24.686 16.335  1.00 42.87 ? 1158 LEU C N     1 
ATOM   5777  C  CA    . LEU C  1 185 ? 28.912  -23.991 15.222  1.00 42.11 ? 1158 LEU C CA    1 
ATOM   5778  C  C     . LEU C  1 185 ? 29.181  -22.495 15.331  1.00 38.09 ? 1158 LEU C C     1 
ATOM   5779  O  O     . LEU C  1 185 ? 29.264  -21.942 16.433  1.00 42.10 ? 1158 LEU C O     1 
ATOM   5780  C  CB    . LEU C  1 185 ? 27.406  -24.274 15.170  1.00 43.35 ? 1158 LEU C CB    1 
ATOM   5781  C  CG    . LEU C  1 185 ? 26.994  -25.671 14.707  1.00 45.19 ? 1158 LEU C CG    1 
ATOM   5782  C  CD1   . LEU C  1 185 ? 25.794  -26.175 15.499  1.00 50.55 ? 1158 LEU C CD1   1 
ATOM   5783  C  CD2   . LEU C  1 185 ? 26.708  -25.702 13.207  1.00 54.54 ? 1158 LEU C CD2   1 
ATOM   5784  N  N     . PHE C  1 186 ? 29.342  -21.856 14.178  1.00 31.73 ? 1159 PHE C N     1 
ATOM   5785  C  CA    . PHE C  1 186 ? 29.524  -20.417 14.112  1.00 27.44 ? 1159 PHE C CA    1 
ATOM   5786  C  C     . PHE C  1 186 ? 28.174  -19.769 13.859  1.00 25.01 ? 1159 PHE C C     1 
ATOM   5787  O  O     . PHE C  1 186 ? 27.410  -20.235 13.012  1.00 23.66 ? 1159 PHE C O     1 
ATOM   5788  C  CB    . PHE C  1 186 ? 30.493  -20.043 12.988  1.00 29.87 ? 1159 PHE C CB    1 
ATOM   5789  C  CG    . PHE C  1 186 ? 31.927  -20.404 13.260  1.00 26.92 ? 1159 PHE C CG    1 
ATOM   5790  C  CD1   . PHE C  1 186 ? 32.451  -21.609 12.806  1.00 32.87 ? 1159 PHE C CD1   1 
ATOM   5791  C  CD2   . PHE C  1 186 ? 32.759  -19.530 13.943  1.00 27.58 ? 1159 PHE C CD2   1 
ATOM   5792  C  CE1   . PHE C  1 186 ? 33.779  -21.944 13.045  1.00 36.48 ? 1159 PHE C CE1   1 
ATOM   5793  C  CE2   . PHE C  1 186 ? 34.089  -19.850 14.182  1.00 26.52 ? 1159 PHE C CE2   1 
ATOM   5794  C  CZ    . PHE C  1 186 ? 34.600  -21.061 13.734  1.00 32.88 ? 1159 PHE C CZ    1 
ATOM   5795  N  N     . TYR C  1 187 ? 27.904  -18.682 14.576  1.00 26.86 ? 1160 TYR C N     1 
ATOM   5796  C  CA    . TYR C  1 187 ? 26.590  -18.031 14.580  1.00 32.90 ? 1160 TYR C CA    1 
ATOM   5797  C  C     . TYR C  1 187 ? 26.669  -16.615 14.039  1.00 32.45 ? 1160 TYR C C     1 
ATOM   5798  O  O     . TYR C  1 187 ? 25.715  -15.838 14.141  1.00 32.70 ? 1160 TYR C O     1 
ATOM   5799  C  CB    . TYR C  1 187 ? 25.995  -18.033 15.996  1.00 36.28 ? 1160 TYR C CB    1 
ATOM   5800  C  CG    . TYR C  1 187 ? 25.798  -19.422 16.565  1.00 45.06 ? 1160 TYR C CG    1 
ATOM   5801  C  CD1   . TYR C  1 187 ? 24.668  -20.168 16.249  1.00 44.21 ? 1160 TYR C CD1   1 
ATOM   5802  C  CD2   . TYR C  1 187 ? 26.745  -19.991 17.417  1.00 49.81 ? 1160 TYR C CD2   1 
ATOM   5803  C  CE1   . TYR C  1 187 ? 24.482  -21.446 16.761  1.00 48.98 ? 1160 TYR C CE1   1 
ATOM   5804  C  CE2   . TYR C  1 187 ? 26.568  -21.272 17.938  1.00 52.95 ? 1160 TYR C CE2   1 
ATOM   5805  C  CZ    . TYR C  1 187 ? 25.435  -21.990 17.605  1.00 47.19 ? 1160 TYR C CZ    1 
ATOM   5806  O  OH    . TYR C  1 187 ? 25.251  -23.253 18.115  1.00 50.31 ? 1160 TYR C OH    1 
ATOM   5807  N  N     . THR C  1 188 ? 27.825  -16.289 13.474  1.00 32.61 ? 1161 THR C N     1 
ATOM   5808  C  CA    . THR C  1 188 ? 28.037  -15.033 12.770  1.00 32.89 ? 1161 THR C CA    1 
ATOM   5809  C  C     . THR C  1 188 ? 28.706  -15.337 11.434  1.00 30.71 ? 1161 THR C C     1 
ATOM   5810  O  O     . THR C  1 188 ? 29.535  -16.233 11.342  1.00 30.44 ? 1161 THR C O     1 
ATOM   5811  C  CB    . THR C  1 188 ? 28.928  -14.078 13.586  1.00 33.39 ? 1161 THR C CB    1 
ATOM   5812  N  N     . PHE C  1 189 ? 28.327  -14.608 10.398  1.00 31.88 ? 1162 PHE C N     1 
ATOM   5813  C  CA    . PHE C  1 189 ? 28.995  -14.723 9.122   1.00 35.54 ? 1162 PHE C CA    1 
ATOM   5814  C  C     . PHE C  1 189 ? 29.912  -13.517 8.937   1.00 41.00 ? 1162 PHE C C     1 
ATOM   5815  O  O     . PHE C  1 189 ? 29.451  -12.384 8.761   1.00 44.34 ? 1162 PHE C O     1 
ATOM   5816  C  CB    . PHE C  1 189 ? 27.997  -14.884 7.966   1.00 30.42 ? 1162 PHE C CB    1 
ATOM   5817  C  CG    . PHE C  1 189 ? 28.634  -14.815 6.609   1.00 27.00 ? 1162 PHE C CG    1 
ATOM   5818  C  CD1   . PHE C  1 189 ? 29.485  -15.826 6.171   1.00 25.60 ? 1162 PHE C CD1   1 
ATOM   5819  C  CD2   . PHE C  1 189 ? 28.401  -13.726 5.772   1.00 39.32 ? 1162 PHE C CD2   1 
ATOM   5820  C  CE1   . PHE C  1 189 ? 30.090  -15.760 4.915   1.00 20.17 ? 1162 PHE C CE1   1 
ATOM   5821  C  CE2   . PHE C  1 189 ? 28.996  -13.653 4.510   1.00 37.30 ? 1162 PHE C CE2   1 
ATOM   5822  C  CZ    . PHE C  1 189 ? 29.845  -14.674 4.086   1.00 34.41 ? 1162 PHE C CZ    1 
ATOM   5823  N  N     . CYS C  1 190 ? 31.216  -13.782 9.006   1.00 45.23 ? 1163 CYS C N     1 
ATOM   5824  C  CA    . CYS C  1 190 ? 32.241  -12.743 9.018   1.00 44.36 ? 1163 CYS C CA    1 
ATOM   5825  C  C     . CYS C  1 190 ? 33.025  -12.719 7.709   1.00 43.22 ? 1163 CYS C C     1 
ATOM   5826  O  O     . CYS C  1 190 ? 34.165  -12.258 7.667   1.00 48.21 ? 1163 CYS C O     1 
ATOM   5827  C  CB    . CYS C  1 190 ? 33.199  -12.961 10.193  1.00 45.19 ? 1163 CYS C CB    1 
ATOM   5828  S  SG    . CYS C  1 190 ? 32.408  -13.120 11.818  1.00 51.90 ? 1163 CYS C SG    1 
ATOM   5829  N  N     . GLY C  1 191 ? 32.411  -13.219 6.644   1.00 41.60 ? 1164 GLY C N     1 
ATOM   5830  C  CA    . GLY C  1 191 ? 33.052  -13.253 5.337   1.00 39.43 ? 1164 GLY C CA    1 
ATOM   5831  C  C     . GLY C  1 191 ? 32.418  -12.329 4.315   1.00 38.30 ? 1164 GLY C C     1 
ATOM   5832  O  O     . GLY C  1 191 ? 31.696  -11.396 4.653   1.00 34.78 ? 1164 GLY C O     1 
ATOM   5833  N  N     . THR C  1 192 ? 32.706  -12.605 3.050   1.00 40.92 ? 1165 THR C N     1 
ATOM   5834  C  CA    . THR C  1 192 ? 32.219  -11.817 1.931   1.00 36.14 ? 1165 THR C CA    1 
ATOM   5835  C  C     . THR C  1 192 ? 30.960  -12.487 1.401   1.00 37.02 ? 1165 THR C C     1 
ATOM   5836  O  O     . THR C  1 192 ? 30.974  -13.675 1.064   1.00 37.88 ? 1165 THR C O     1 
ATOM   5837  C  CB    . THR C  1 192 ? 33.309  -11.719 0.846   1.00 34.62 ? 1165 THR C CB    1 
ATOM   5838  O  OG1   . THR C  1 192 ? 34.481  -11.136 1.427   1.00 29.10 ? 1165 THR C OG1   1 
ATOM   5839  C  CG2   . THR C  1 192 ? 32.851  -10.883 -0.349  1.00 25.77 ? 1165 THR C CG2   1 
ATOM   5840  N  N     . ILE C  1 193 ? 29.875  -11.713 1.353   1.00 38.22 ? 1166 ILE C N     1 
ATOM   5841  C  CA    . ILE C  1 193 ? 28.537  -12.199 0.988   1.00 37.99 ? 1166 ILE C CA    1 
ATOM   5842  C  C     . ILE C  1 193 ? 28.440  -12.858 -0.407  1.00 33.93 ? 1166 ILE C C     1 
ATOM   5843  O  O     . ILE C  1 193 ? 27.632  -13.769 -0.611  1.00 32.38 ? 1166 ILE C O     1 
ATOM   5844  C  CB    . ILE C  1 193 ? 27.470  -11.070 1.211   1.00 42.01 ? 1166 ILE C CB    1 
ATOM   5845  C  CG1   . ILE C  1 193 ? 26.859  -11.158 2.622   1.00 45.76 ? 1166 ILE C CG1   1 
ATOM   5846  C  CG2   . ILE C  1 193 ? 26.388  -11.069 0.139   1.00 47.19 ? 1166 ILE C CG2   1 
ATOM   5847  C  CD1   . ILE C  1 193 ? 25.961  -12.388 2.893   1.00 34.52 ? 1166 ILE C CD1   1 
ATOM   5848  N  N     . GLU C  1 194 ? 29.275  -12.411 -1.347  1.00 35.16 ? 1167 GLU C N     1 
ATOM   5849  C  CA    . GLU C  1 194 ? 29.328  -12.990 -2.704  1.00 30.90 ? 1167 GLU C CA    1 
ATOM   5850  C  C     . GLU C  1 194 ? 29.967  -14.376 -2.759  1.00 26.91 ? 1167 GLU C C     1 
ATOM   5851  O  O     . GLU C  1 194 ? 29.788  -15.108 -3.737  1.00 25.34 ? 1167 GLU C O     1 
ATOM   5852  C  CB    . GLU C  1 194 ? 30.063  -12.062 -3.672  1.00 33.58 ? 1167 GLU C CB    1 
ATOM   5853  C  CG    . GLU C  1 194 ? 29.223  -10.913 -4.189  1.00 33.05 ? 1167 GLU C CG    1 
ATOM   5854  C  CD    . GLU C  1 194 ? 29.276  -9.693  -3.289  1.00 39.14 ? 1167 GLU C CD    1 
ATOM   5855  O  OE1   . GLU C  1 194 ? 29.901  -9.750  -2.202  1.00 32.55 ? 1167 GLU C OE1   1 
ATOM   5856  O  OE2   . GLU C  1 194 ? 28.680  -8.666  -3.679  1.00 46.19 ? 1167 GLU C OE2   1 
ATOM   5857  N  N     . TYR C  1 195 ? 30.709  -14.724 -1.712  1.00 24.32 ? 1168 TYR C N     1 
ATOM   5858  C  CA    . TYR C  1 195 ? 31.395  -15.997 -1.635  1.00 29.28 ? 1168 TYR C CA    1 
ATOM   5859  C  C     . TYR C  1 195 ? 30.676  -16.962 -0.715  1.00 29.55 ? 1168 TYR C C     1 
ATOM   5860  O  O     . TYR C  1 195 ? 31.146  -18.080 -0.475  1.00 34.30 ? 1168 TYR C O     1 
ATOM   5861  C  CB    . TYR C  1 195 ? 32.845  -15.774 -1.194  1.00 29.05 ? 1168 TYR C CB    1 
ATOM   5862  C  CG    . TYR C  1 195 ? 33.693  -15.248 -2.328  1.00 26.83 ? 1168 TYR C CG    1 
ATOM   5863  C  CD1   . TYR C  1 195 ? 33.638  -13.907 -2.709  1.00 23.09 ? 1168 TYR C CD1   1 
ATOM   5864  C  CD2   . TYR C  1 195 ? 34.521  -16.102 -3.046  1.00 19.07 ? 1168 TYR C CD2   1 
ATOM   5865  C  CE1   . TYR C  1 195 ? 34.397  -13.432 -3.775  1.00 23.26 ? 1168 TYR C CE1   1 
ATOM   5866  C  CE2   . TYR C  1 195 ? 35.279  -15.639 -4.102  1.00 26.86 ? 1168 TYR C CE2   1 
ATOM   5867  C  CZ    . TYR C  1 195 ? 35.214  -14.306 -4.463  1.00 22.32 ? 1168 TYR C CZ    1 
ATOM   5868  O  OH    . TYR C  1 195 ? 35.985  -13.867 -5.509  1.00 34.19 ? 1168 TYR C OH    1 
ATOM   5869  N  N     . CYS C  1 196 ? 29.520  -16.520 -0.230  1.00 29.36 ? 1169 CYS C N     1 
ATOM   5870  C  CA    . CYS C  1 196 ? 28.757  -17.207 0.811   1.00 27.24 ? 1169 CYS C CA    1 
ATOM   5871  C  C     . CYS C  1 196 ? 27.847  -18.306 0.261   1.00 26.24 ? 1169 CYS C C     1 
ATOM   5872  O  O     . CYS C  1 196 ? 27.196  -18.138 -0.768  1.00 26.76 ? 1169 CYS C O     1 
ATOM   5873  C  CB    . CYS C  1 196 ? 27.934  -16.186 1.597   1.00 29.62 ? 1169 CYS C CB    1 
ATOM   5874  S  SG    . CYS C  1 196 ? 27.024  -16.823 3.028   1.00 32.85 ? 1169 CYS C SG    1 
ATOM   5875  N  N     . ALA C  1 197 ? 27.801  -19.417 0.989   1.00 24.69 ? 1170 ALA C N     1 
ATOM   5876  C  CA    . ALA C  1 197 ? 27.036  -20.606 0.613   1.00 22.97 ? 1170 ALA C CA    1 
ATOM   5877  C  C     . ALA C  1 197 ? 25.528  -20.437 0.843   1.00 24.26 ? 1170 ALA C C     1 
ATOM   5878  O  O     . ALA C  1 197 ? 25.121  -19.775 1.803   1.00 27.35 ? 1170 ALA C O     1 
ATOM   5879  C  CB    . ALA C  1 197 ? 27.565  -21.810 1.393   1.00 10.37 ? 1170 ALA C CB    1 
ATOM   5880  N  N     . PRO C  1 198 ? 24.685  -21.056 -0.018  1.00 29.59 ? 1171 PRO C N     1 
ATOM   5881  C  CA    . PRO C  1 198 ? 23.225  -20.923 0.152   1.00 28.71 ? 1171 PRO C CA    1 
ATOM   5882  C  C     . PRO C  1 198 ? 22.750  -21.172 1.591   1.00 30.37 ? 1171 PRO C C     1 
ATOM   5883  O  O     . PRO C  1 198 ? 22.159  -20.277 2.192   1.00 33.05 ? 1171 PRO C O     1 
ATOM   5884  C  CB    . PRO C  1 198 ? 22.639  -21.959 -0.818  1.00 28.36 ? 1171 PRO C CB    1 
ATOM   5885  C  CG    . PRO C  1 198 ? 23.805  -22.712 -1.374  1.00 32.70 ? 1171 PRO C CG    1 
ATOM   5886  C  CD    . PRO C  1 198 ? 25.030  -21.904 -1.172  1.00 20.45 ? 1171 PRO C CD    1 
ATOM   5887  N  N     . GLU C  1 199 ? 23.056  -22.345 2.151   1.00 35.15 ? 1172 GLU C N     1 
ATOM   5888  C  CA    . GLU C  1 199 ? 22.623  -22.720 3.516   1.00 33.45 ? 1172 GLU C CA    1 
ATOM   5889  C  C     . GLU C  1 199 ? 22.969  -21.699 4.614   1.00 34.46 ? 1172 GLU C C     1 
ATOM   5890  O  O     . GLU C  1 199 ? 22.346  -21.688 5.680   1.00 35.05 ? 1172 GLU C O     1 
ATOM   5891  C  CB    . GLU C  1 199 ? 23.136  -24.125 3.895   1.00 35.43 ? 1172 GLU C CB    1 
ATOM   5892  C  CG    . GLU C  1 199 ? 24.612  -24.222 4.322   1.00 31.65 ? 1172 GLU C CG    1 
ATOM   5893  C  CD    . GLU C  1 199 ? 25.624  -24.289 3.159   1.00 32.39 ? 1172 GLU C CD    1 
ATOM   5894  O  OE1   . GLU C  1 199 ? 25.238  -24.197 1.971   1.00 24.66 ? 1172 GLU C OE1   1 
ATOM   5895  O  OE2   . GLU C  1 199 ? 26.830  -24.430 3.451   1.00 39.51 ? 1172 GLU C OE2   1 
ATOM   5896  N  N     . VAL C  1 200 ? 23.952  -20.841 4.341   1.00 35.24 ? 1173 VAL C N     1 
ATOM   5897  C  CA    . VAL C  1 200 ? 24.337  -19.761 5.264   1.00 32.80 ? 1173 VAL C CA    1 
ATOM   5898  C  C     . VAL C  1 200 ? 23.570  -18.461 4.948   1.00 30.59 ? 1173 VAL C C     1 
ATOM   5899  O  O     . VAL C  1 200 ? 23.104  -17.775 5.858   1.00 31.30 ? 1173 VAL C O     1 
ATOM   5900  C  CB    . VAL C  1 200 ? 25.882  -19.545 5.275   1.00 28.92 ? 1173 VAL C CB    1 
ATOM   5901  C  CG1   . VAL C  1 200 ? 26.278  -18.381 6.173   1.00 20.23 ? 1173 VAL C CG1   1 
ATOM   5902  C  CG2   . VAL C  1 200 ? 26.573  -20.812 5.725   1.00 36.04 ? 1173 VAL C CG2   1 
ATOM   5903  N  N     . LEU C  1 201 ? 23.421  -18.147 3.663   1.00 28.95 ? 1174 LEU C N     1 
ATOM   5904  C  CA    . LEU C  1 201 ? 22.598  -17.018 3.221   1.00 35.99 ? 1174 LEU C CA    1 
ATOM   5905  C  C     . LEU C  1 201 ? 21.167  -17.146 3.764   1.00 40.63 ? 1174 LEU C C     1 
ATOM   5906  O  O     . LEU C  1 201 ? 20.500  -16.142 4.037   1.00 42.82 ? 1174 LEU C O     1 
ATOM   5907  C  CB    . LEU C  1 201 ? 22.564  -16.921 1.684   1.00 31.64 ? 1174 LEU C CB    1 
ATOM   5908  C  CG    . LEU C  1 201 ? 23.797  -16.524 0.854   1.00 34.62 ? 1174 LEU C CG    1 
ATOM   5909  C  CD1   . LEU C  1 201 ? 23.523  -16.637 -0.649  1.00 25.31 ? 1174 LEU C CD1   1 
ATOM   5910  C  CD2   . LEU C  1 201 ? 24.261  -15.118 1.175   1.00 39.48 ? 1174 LEU C CD2   1 
ATOM   5911  N  N     . MET C  1 202 ? 20.714  -18.388 3.926   1.00 40.57 ? 1175 MET C N     1 
ATOM   5912  C  CA    . MET C  1 202 ? 19.381  -18.686 4.449   1.00 40.05 ? 1175 MET C CA    1 
ATOM   5913  C  C     . MET C  1 202 ? 19.315  -18.621 5.974   1.00 36.85 ? 1175 MET C C     1 
ATOM   5914  O  O     . MET C  1 202 ? 18.254  -18.824 6.567   1.00 37.53 ? 1175 MET C O     1 
ATOM   5915  C  CB    . MET C  1 202 ? 18.897  -20.048 3.949   1.00 39.68 ? 1175 MET C CB    1 
ATOM   5916  C  CG    . MET C  1 202 ? 19.160  -20.274 2.483   1.00 36.95 ? 1175 MET C CG    1 
ATOM   5917  S  SD    . MET C  1 202 ? 17.883  -21.206 1.663   1.00 51.07 ? 1175 MET C SD    1 
ATOM   5918  C  CE    . MET C  1 202 ? 16.910  -19.888 0.958   1.00 48.99 ? 1175 MET C CE    1 
ATOM   5919  N  N     . GLY C  1 203 ? 20.453  -18.347 6.604   1.00 32.51 ? 1176 GLY C N     1 
ATOM   5920  C  CA    . GLY C  1 203 ? 20.482  -18.003 8.022   1.00 31.20 ? 1176 GLY C CA    1 
ATOM   5921  C  C     . GLY C  1 203 ? 20.831  -19.131 8.965   1.00 26.15 ? 1176 GLY C C     1 
ATOM   5922  O  O     . GLY C  1 203 ? 20.589  -19.029 10.156  1.00 30.10 ? 1176 GLY C O     1 
ATOM   5923  N  N     . ASN C  1 204 ? 21.406  -20.205 8.437   1.00 30.61 ? 1177 ASN C N     1 
ATOM   5924  C  CA    . ASN C  1 204 ? 21.797  -21.349 9.263   1.00 32.54 ? 1177 ASN C CA    1 
ATOM   5925  C  C     . ASN C  1 204 ? 23.243  -21.235 9.757   1.00 32.88 ? 1177 ASN C C     1 
ATOM   5926  O  O     . ASN C  1 204 ? 24.129  -20.851 8.987   1.00 32.24 ? 1177 ASN C O     1 
ATOM   5927  C  CB    . ASN C  1 204 ? 21.594  -22.665 8.505   1.00 31.77 ? 1177 ASN C CB    1 
ATOM   5928  C  CG    . ASN C  1 204 ? 20.154  -22.875 8.066   1.00 42.04 ? 1177 ASN C CG    1 
ATOM   5929  O  OD1   . ASN C  1 204 ? 19.278  -23.167 8.882   1.00 43.22 ? 1177 ASN C OD1   1 
ATOM   5930  N  ND2   . ASN C  1 204 ? 19.903  -22.730 6.766   1.00 39.94 ? 1177 ASN C ND2   1 
ATOM   5931  N  N     . PRO C  1 205 ? 23.483  -21.564 11.043  1.00 30.91 ? 1178 PRO C N     1 
ATOM   5932  C  CA    . PRO C  1 205 ? 24.838  -21.574 11.589  1.00 30.03 ? 1178 PRO C CA    1 
ATOM   5933  C  C     . PRO C  1 205 ? 25.675  -22.698 10.960  1.00 30.93 ? 1178 PRO C C     1 
ATOM   5934  O  O     . PRO C  1 205 ? 25.139  -23.759 10.633  1.00 27.46 ? 1178 PRO C O     1 
ATOM   5935  C  CB    . PRO C  1 205 ? 24.619  -21.824 13.092  1.00 29.97 ? 1178 PRO C CB    1 
ATOM   5936  C  CG    . PRO C  1 205 ? 23.151  -21.578 13.341  1.00 28.53 ? 1178 PRO C CG    1 
ATOM   5937  C  CD    . PRO C  1 205 ? 22.485  -21.954 12.059  1.00 34.30 ? 1178 PRO C CD    1 
ATOM   5938  N  N     . TYR C  1 206 ? 26.974  -22.459 10.780  1.00 30.52 ? 1179 TYR C N     1 
ATOM   5939  C  CA    . TYR C  1 206 ? 27.823  -23.395 10.026  1.00 29.43 ? 1179 TYR C CA    1 
ATOM   5940  C  C     . TYR C  1 206 ? 28.926  -24.013 10.878  1.00 25.88 ? 1179 TYR C C     1 
ATOM   5941  O  O     . TYR C  1 206 ? 29.336  -23.448 11.899  1.00 25.56 ? 1179 TYR C O     1 
ATOM   5942  C  CB    . TYR C  1 206 ? 28.415  -22.715 8.774   1.00 30.77 ? 1179 TYR C CB    1 
ATOM   5943  C  CG    . TYR C  1 206 ? 29.215  -21.470 9.082   1.00 23.15 ? 1179 TYR C CG    1 
ATOM   5944  C  CD1   . TYR C  1 206 ? 28.578  -20.253 9.331   1.00 27.17 ? 1179 TYR C CD1   1 
ATOM   5945  C  CD2   . TYR C  1 206 ? 30.604  -21.506 9.129   1.00 26.32 ? 1179 TYR C CD2   1 
ATOM   5946  C  CE1   . TYR C  1 206 ? 29.306  -19.098 9.635   1.00 34.26 ? 1179 TYR C CE1   1 
ATOM   5947  C  CE2   . TYR C  1 206 ? 31.349  -20.352 9.431   1.00 31.57 ? 1179 TYR C CE2   1 
ATOM   5948  C  CZ    . TYR C  1 206 ? 30.688  -19.154 9.679   1.00 35.92 ? 1179 TYR C CZ    1 
ATOM   5949  O  OH    . TYR C  1 206 ? 31.401  -18.017 9.977   1.00 37.54 ? 1179 TYR C OH    1 
ATOM   5950  N  N     . ARG C  1 207 ? 29.401  -25.180 10.451  1.00 25.58 ? 1180 ARG C N     1 
ATOM   5951  C  CA    . ARG C  1 207 ? 30.583  -25.789 11.059  1.00 24.84 ? 1180 ARG C CA    1 
ATOM   5952  C  C     . ARG C  1 207 ? 31.894  -25.168 10.516  1.00 23.85 ? 1180 ARG C C     1 
ATOM   5953  O  O     . ARG C  1 207 ? 32.784  -24.801 11.287  1.00 22.88 ? 1180 ARG C O     1 
ATOM   5954  C  CB    . ARG C  1 207 ? 30.564  -27.311 10.881  1.00 21.11 ? 1180 ARG C CB    1 
ATOM   5955  C  CG    . ARG C  1 207 ? 31.456  -28.026 11.879  1.00 29.15 ? 1180 ARG C CG    1 
ATOM   5956  C  CD    . ARG C  1 207 ? 31.336  -29.536 11.776  1.00 40.01 ? 1180 ARG C CD    1 
ATOM   5957  N  NE    . ARG C  1 207 ? 31.936  -30.046 10.551  1.00 33.32 ? 1180 ARG C NE    1 
ATOM   5958  C  CZ    . ARG C  1 207 ? 31.248  -30.453 9.490   1.00 34.84 ? 1180 ARG C CZ    1 
ATOM   5959  N  NH1   . ARG C  1 207 ? 29.923  -30.415 9.497   1.00 35.14 ? 1180 ARG C NH1   1 
ATOM   5960  N  NH2   . ARG C  1 207 ? 31.889  -30.895 8.420   1.00 25.47 ? 1180 ARG C NH2   1 
ATOM   5961  N  N     . GLY C  1 208 ? 31.994  -25.036 9.196   1.00 24.76 ? 1181 GLY C N     1 
ATOM   5962  C  CA    . GLY C  1 208 ? 33.148  -24.385 8.571   1.00 25.65 ? 1181 GLY C CA    1 
ATOM   5963  C  C     . GLY C  1 208 ? 33.530  -24.974 7.226   1.00 23.95 ? 1181 GLY C C     1 
ATOM   5964  O  O     . GLY C  1 208 ? 33.389  -24.306 6.208   1.00 22.43 ? 1181 GLY C O     1 
ATOM   5965  N  N     . PRO C  1 209 ? 34.037  -26.228 7.218   1.00 29.87 ? 1182 PRO C N     1 
ATOM   5966  C  CA    . PRO C  1 209 ? 34.475  -26.932 6.006   1.00 25.63 ? 1182 PRO C CA    1 
ATOM   5967  C  C     . PRO C  1 209 ? 33.586  -26.745 4.782   1.00 27.67 ? 1182 PRO C C     1 
ATOM   5968  O  O     . PRO C  1 209 ? 34.105  -26.432 3.712   1.00 33.80 ? 1182 PRO C O     1 
ATOM   5969  C  CB    . PRO C  1 209 ? 34.507  -28.396 6.459   1.00 23.46 ? 1182 PRO C CB    1 
ATOM   5970  C  CG    . PRO C  1 209 ? 34.963  -28.284 7.882   1.00 23.52 ? 1182 PRO C CG    1 
ATOM   5971  C  CD    . PRO C  1 209 ? 34.274  -27.054 8.424   1.00 26.97 ? 1182 PRO C CD    1 
ATOM   5972  N  N     . GLU C  1 210 ? 32.272  -26.925 4.934   1.00 24.48 ? 1183 GLU C N     1 
ATOM   5973  C  CA    . GLU C  1 210 ? 31.346  -26.876 3.803   1.00 25.04 ? 1183 GLU C CA    1 
ATOM   5974  C  C     . GLU C  1 210 ? 31.235  -25.490 3.180   1.00 24.20 ? 1183 GLU C C     1 
ATOM   5975  O  O     . GLU C  1 210 ? 31.232  -25.361 1.956   1.00 22.39 ? 1183 GLU C O     1 
ATOM   5976  C  CB    . GLU C  1 210 ? 29.953  -27.381 4.200   1.00 33.79 ? 1183 GLU C CB    1 
ATOM   5977  C  CG    . GLU C  1 210 ? 29.922  -28.822 4.705   1.00 35.88 ? 1183 GLU C CG    1 
ATOM   5978  C  CD    . GLU C  1 210 ? 30.065  -28.930 6.217   1.00 43.12 ? 1183 GLU C CD    1 
ATOM   5979  O  OE1   . GLU C  1 210 ? 30.216  -27.895 6.904   1.00 29.97 ? 1183 GLU C OE1   1 
ATOM   5980  O  OE2   . GLU C  1 210 ? 30.017  -30.069 6.721   1.00 53.49 ? 1183 GLU C OE2   1 
ATOM   5981  N  N     . LEU C  1 211 ? 31.131  -24.467 4.028   1.00 24.12 ? 1184 LEU C N     1 
ATOM   5982  C  CA    . LEU C  1 211 ? 31.143  -23.070 3.586   1.00 27.96 ? 1184 LEU C CA    1 
ATOM   5983  C  C     . LEU C  1 211 ? 32.488  -22.687 2.925   1.00 24.88 ? 1184 LEU C C     1 
ATOM   5984  O  O     . LEU C  1 211 ? 32.503  -22.025 1.892   1.00 26.51 ? 1184 LEU C O     1 
ATOM   5985  C  CB    . LEU C  1 211 ? 30.804  -22.142 4.760   1.00 26.67 ? 1184 LEU C CB    1 
ATOM   5986  C  CG    . LEU C  1 211 ? 30.929  -20.622 4.584   1.00 19.78 ? 1184 LEU C CG    1 
ATOM   5987  C  CD1   . LEU C  1 211 ? 29.754  -20.005 3.853   1.00 27.85 ? 1184 LEU C CD1   1 
ATOM   5988  C  CD2   . LEU C  1 211 ? 31.084  -19.999 5.939   1.00 11.75 ? 1184 LEU C CD2   1 
ATOM   5989  N  N     . GLU C  1 212 ? 33.600  -23.118 3.519   1.00 20.93 ? 1185 GLU C N     1 
ATOM   5990  C  CA    . GLU C  1 212 ? 34.925  -23.008 2.890   1.00 22.34 ? 1185 GLU C CA    1 
ATOM   5991  C  C     . GLU C  1 212 ? 34.980  -23.576 1.471   1.00 22.89 ? 1185 GLU C C     1 
ATOM   5992  O  O     . GLU C  1 212 ? 35.481  -22.918 0.553   1.00 23.90 ? 1185 GLU C O     1 
ATOM   5993  C  CB    . GLU C  1 212 ? 35.982  -23.691 3.760   1.00 26.23 ? 1185 GLU C CB    1 
ATOM   5994  C  CG    . GLU C  1 212 ? 37.396  -23.542 3.250   1.00 23.83 ? 1185 GLU C CG    1 
ATOM   5995  C  CD    . GLU C  1 212 ? 38.393  -23.830 4.313   1.00 33.29 ? 1185 GLU C CD    1 
ATOM   5996  O  OE1   . GLU C  1 212 ? 38.643  -25.026 4.571   1.00 44.42 ? 1185 GLU C OE1   1 
ATOM   5997  O  OE2   . GLU C  1 212 ? 38.924  -22.864 4.900   1.00 30.61 ? 1185 GLU C OE2   1 
ATOM   5998  N  N     . MET C  1 213 ? 34.452  -24.788 1.296   1.00 20.25 ? 1186 MET C N     1 
ATOM   5999  C  CA    . MET C  1 213 ? 34.431  -25.452 -0.007  1.00 19.17 ? 1186 MET C CA    1 
ATOM   6000  C  C     . MET C  1 213 ? 33.639  -24.708 -1.080  1.00 22.56 ? 1186 MET C C     1 
ATOM   6001  O  O     . MET C  1 213 ? 33.999  -24.762 -2.261  1.00 20.94 ? 1186 MET C O     1 
ATOM   6002  C  CB    . MET C  1 213 ? 33.927  -26.902 0.117   1.00 22.82 ? 1186 MET C CB    1 
ATOM   6003  C  CG    . MET C  1 213 ? 34.745  -27.806 1.080   1.00 19.82 ? 1186 MET C CG    1 
ATOM   6004  S  SD    . MET C  1 213 ? 36.557  -27.661 0.995   1.00 29.86 ? 1186 MET C SD    1 
ATOM   6005  C  CE    . MET C  1 213 ? 36.842  -27.957 -0.754  1.00 16.11 ? 1186 MET C CE    1 
ATOM   6006  N  N     . TRP C  1 214 ? 32.554  -24.041 -0.673  1.00 25.19 ? 1187 TRP C N     1 
ATOM   6007  C  CA    . TRP C  1 214 ? 31.750  -23.212 -1.578  1.00 23.71 ? 1187 TRP C CA    1 
ATOM   6008  C  C     . TRP C  1 214 ? 32.516  -21.972 -2.036  1.00 18.56 ? 1187 TRP C C     1 
ATOM   6009  O  O     . TRP C  1 214 ? 32.467  -21.603 -3.211  1.00 22.58 ? 1187 TRP C O     1 
ATOM   6010  C  CB    . TRP C  1 214 ? 30.426  -22.788 -0.921  1.00 23.31 ? 1187 TRP C CB    1 
ATOM   6011  C  CG    . TRP C  1 214 ? 29.632  -21.823 -1.782  1.00 17.70 ? 1187 TRP C CG    1 
ATOM   6012  C  CD1   . TRP C  1 214 ? 29.775  -20.461 -1.836  1.00 22.66 ? 1187 TRP C CD1   1 
ATOM   6013  C  CD2   . TRP C  1 214 ? 28.589  -22.149 -2.712  1.00 25.01 ? 1187 TRP C CD2   1 
ATOM   6014  N  NE1   . TRP C  1 214 ? 28.888  -19.925 -2.735  1.00 18.47 ? 1187 TRP C NE1   1 
ATOM   6015  C  CE2   . TRP C  1 214 ? 28.154  -20.937 -3.294  1.00 13.30 ? 1187 TRP C CE2   1 
ATOM   6016  C  CE3   . TRP C  1 214 ? 27.970  -23.350 -3.104  1.00 32.43 ? 1187 TRP C CE3   1 
ATOM   6017  C  CZ2   . TRP C  1 214 ? 27.127  -20.886 -4.239  1.00 24.91 ? 1187 TRP C CZ2   1 
ATOM   6018  C  CZ3   . TRP C  1 214 ? 26.955  -23.298 -4.061  1.00 24.14 ? 1187 TRP C CZ3   1 
ATOM   6019  C  CH2   . TRP C  1 214 ? 26.542  -22.076 -4.611  1.00 25.59 ? 1187 TRP C CH2   1 
ATOM   6020  N  N     . SER C  1 215 ? 33.204  -21.333 -1.096  1.00 18.55 ? 1188 SER C N     1 
ATOM   6021  C  CA    . SER C  1 215 ? 34.025  -20.158 -1.375  1.00 23.47 ? 1188 SER C CA    1 
ATOM   6022  C  C     . SER C  1 215 ? 35.186  -20.480 -2.337  1.00 25.16 ? 1188 SER C C     1 
ATOM   6023  O  O     . SER C  1 215 ? 35.602  -19.631 -3.122  1.00 21.36 ? 1188 SER C O     1 
ATOM   6024  C  CB    . SER C  1 215 ? 34.538  -19.549 -0.062  1.00 20.35 ? 1188 SER C CB    1 
ATOM   6025  O  OG    . SER C  1 215 ? 35.626  -20.286 0.488   1.00 28.89 ? 1188 SER C OG    1 
ATOM   6026  N  N     . LEU C  1 216 ? 35.690  -21.715 -2.272  1.00 26.22 ? 1189 LEU C N     1 
ATOM   6027  C  CA    . LEU C  1 216 ? 36.717  -22.193 -3.203  1.00 25.50 ? 1189 LEU C CA    1 
ATOM   6028  C  C     . LEU C  1 216 ? 36.148  -22.432 -4.588  1.00 23.42 ? 1189 LEU C C     1 
ATOM   6029  O  O     . LEU C  1 216 ? 36.846  -22.265 -5.580  1.00 25.86 ? 1189 LEU C O     1 
ATOM   6030  C  CB    . LEU C  1 216 ? 37.394  -23.461 -2.682  1.00 19.63 ? 1189 LEU C CB    1 
ATOM   6031  C  CG    . LEU C  1 216 ? 38.320  -23.273 -1.492  1.00 20.13 ? 1189 LEU C CG    1 
ATOM   6032  C  CD1   . LEU C  1 216 ? 38.607  -24.633 -0.850  1.00 23.66 ? 1189 LEU C CD1   1 
ATOM   6033  C  CD2   . LEU C  1 216 ? 39.609  -22.585 -1.902  1.00 18.06 ? 1189 LEU C CD2   1 
ATOM   6034  N  N     . GLY C  1 217 ? 34.878  -22.827 -4.647  1.00 27.53 ? 1190 GLY C N     1 
ATOM   6035  C  CA    . GLY C  1 217 ? 34.139  -22.891 -5.908  1.00 19.71 ? 1190 GLY C CA    1 
ATOM   6036  C  C     . GLY C  1 217 ? 34.006  -21.533 -6.577  1.00 18.19 ? 1190 GLY C C     1 
ATOM   6037  O  O     . GLY C  1 217 ? 34.242  -21.411 -7.776  1.00 17.89 ? 1190 GLY C O     1 
ATOM   6038  N  N     . VAL C  1 218 ? 33.627  -20.517 -5.801  1.00 19.11 ? 1191 VAL C N     1 
ATOM   6039  C  CA    . VAL C  1 218 ? 33.471  -19.152 -6.313  1.00 19.61 ? 1191 VAL C CA    1 
ATOM   6040  C  C     . VAL C  1 218 ? 34.797  -18.555 -6.799  1.00 20.81 ? 1191 VAL C C     1 
ATOM   6041  O  O     . VAL C  1 218 ? 34.834  -17.916 -7.855  1.00 21.25 ? 1191 VAL C O     1 
ATOM   6042  C  CB    . VAL C  1 218 ? 32.798  -18.202 -5.300  1.00 19.01 ? 1191 VAL C CB    1 
ATOM   6043  C  CG1   . VAL C  1 218 ? 32.449  -16.844 -5.978  1.00 14.97 ? 1191 VAL C CG1   1 
ATOM   6044  C  CG2   . VAL C  1 218 ? 31.537  -18.832 -4.725  1.00 24.11 ? 1191 VAL C CG2   1 
ATOM   6045  N  N     . THR C  1 219 ? 35.863  -18.766 -6.025  1.00 20.18 ? 1192 THR C N     1 
ATOM   6046  C  CA    . THR C  1 219 ? 37.226  -18.327 -6.371  1.00 20.68 ? 1192 THR C CA    1 
ATOM   6047  C  C     . THR C  1 219 ? 37.683  -18.987 -7.667  1.00 23.56 ? 1192 THR C C     1 
ATOM   6048  O  O     . THR C  1 219 ? 38.274  -18.336 -8.537  1.00 25.98 ? 1192 THR C O     1 
ATOM   6049  C  CB    . THR C  1 219 ? 38.222  -18.677 -5.233  1.00 16.76 ? 1192 THR C CB    1 
ATOM   6050  O  OG1   . THR C  1 219 ? 37.670  -18.264 -3.988  1.00 19.51 ? 1192 THR C OG1   1 
ATOM   6051  C  CG2   . THR C  1 219 ? 39.561  -17.993 -5.408  1.00 20.29 ? 1192 THR C CG2   1 
ATOM   6052  N  N     . LEU C  1 220 ? 37.399  -20.282 -7.797  1.00 28.60 ? 1193 LEU C N     1 
ATOM   6053  C  CA    . LEU C  1 220 ? 37.758  -21.023 -8.998  1.00 27.13 ? 1193 LEU C CA    1 
ATOM   6054  C  C     . LEU C  1 220 ? 37.008  -20.507 -10.214 1.00 26.16 ? 1193 LEU C C     1 
ATOM   6055  O  O     . LEU C  1 220 ? 37.623  -20.233 -11.244 1.00 33.85 ? 1193 LEU C O     1 
ATOM   6056  C  CB    . LEU C  1 220 ? 37.531  -22.524 -8.810  1.00 33.00 ? 1193 LEU C CB    1 
ATOM   6057  C  CG    . LEU C  1 220 ? 37.788  -23.450 -10.004 1.00 28.72 ? 1193 LEU C CG    1 
ATOM   6058  C  CD1   . LEU C  1 220 ? 39.192  -23.266 -10.613 1.00 21.46 ? 1193 LEU C CD1   1 
ATOM   6059  C  CD2   . LEU C  1 220 ? 37.581  -24.875 -9.559  1.00 26.32 ? 1193 LEU C CD2   1 
ATOM   6060  N  N     . TYR C  1 221 ? 35.688  -20.372 -10.094 1.00 22.99 ? 1194 TYR C N     1 
ATOM   6061  C  CA    . TYR C  1 221 ? 34.869  -19.858 -11.183 1.00 21.62 ? 1194 TYR C CA    1 
ATOM   6062  C  C     . TYR C  1 221 ? 35.304  -18.451 -11.638 1.00 24.45 ? 1194 TYR C C     1 
ATOM   6063  O  O     . TYR C  1 221 ? 35.317  -18.149 -12.835 1.00 23.54 ? 1194 TYR C O     1 
ATOM   6064  C  CB    . TYR C  1 221 ? 33.387  -19.855 -10.790 1.00 22.56 ? 1194 TYR C CB    1 
ATOM   6065  C  CG    . TYR C  1 221 ? 32.457  -19.521 -11.941 1.00 22.25 ? 1194 TYR C CG    1 
ATOM   6066  C  CD1   . TYR C  1 221 ? 32.331  -18.212 -12.405 1.00 22.11 ? 1194 TYR C CD1   1 
ATOM   6067  C  CD2   . TYR C  1 221 ? 31.702  -20.512 -12.564 1.00 24.77 ? 1194 TYR C CD2   1 
ATOM   6068  C  CE1   . TYR C  1 221 ? 31.497  -17.896 -13.469 1.00 17.65 ? 1194 TYR C CE1   1 
ATOM   6069  C  CE2   . TYR C  1 221 ? 30.850  -20.200 -13.621 1.00 21.78 ? 1194 TYR C CE2   1 
ATOM   6070  C  CZ    . TYR C  1 221 ? 30.759  -18.892 -14.068 1.00 20.40 ? 1194 TYR C CZ    1 
ATOM   6071  O  OH    . TYR C  1 221 ? 29.924  -18.567 -15.113 1.00 30.73 ? 1194 TYR C OH    1 
ATOM   6072  N  N     . THR C  1 222 ? 35.633  -17.596 -10.676 1.00 23.13 ? 1195 THR C N     1 
ATOM   6073  C  CA    . THR C  1 222 ? 36.090  -16.241 -10.966 1.00 25.90 ? 1195 THR C CA    1 
ATOM   6074  C  C     . THR C  1 222 ? 37.465  -16.231 -11.623 1.00 25.44 ? 1195 THR C C     1 
ATOM   6075  O  O     . THR C  1 222 ? 37.723  -15.401 -12.484 1.00 31.52 ? 1195 THR C O     1 
ATOM   6076  C  CB    . THR C  1 222 ? 36.075  -15.346 -9.698  1.00 25.47 ? 1195 THR C CB    1 
ATOM   6077  O  OG1   . THR C  1 222 ? 34.851  -15.566 -8.979  1.00 22.93 ? 1195 THR C OG1   1 
ATOM   6078  C  CG2   . THR C  1 222 ? 36.154  -13.872 -10.082 1.00 22.04 ? 1195 THR C CG2   1 
ATOM   6079  N  N     . LEU C  1 223 ? 38.336  -17.160 -11.232 1.00 28.66 ? 1196 LEU C N     1 
ATOM   6080  C  CA    . LEU C  1 223 ? 39.670  -17.246 -11.825 1.00 29.52 ? 1196 LEU C CA    1 
ATOM   6081  C  C     . LEU C  1 223 ? 39.606  -17.649 -13.297 1.00 28.19 ? 1196 LEU C C     1 
ATOM   6082  O  O     . LEU C  1 223 ? 40.250  -17.029 -14.142 1.00 23.39 ? 1196 LEU C O     1 
ATOM   6083  C  CB    . LEU C  1 223 ? 40.581  -18.200 -11.035 1.00 32.73 ? 1196 LEU C CB    1 
ATOM   6084  C  CG    . LEU C  1 223 ? 41.978  -18.477 -11.625 1.00 37.88 ? 1196 LEU C CG    1 
ATOM   6085  C  CD1   . LEU C  1 223 ? 42.968  -17.329 -11.330 1.00 28.37 ? 1196 LEU C CD1   1 
ATOM   6086  C  CD2   . LEU C  1 223 ? 42.524  -19.811 -11.122 1.00 27.04 ? 1196 LEU C CD2   1 
ATOM   6087  N  N     . VAL C  1 224 ? 38.816  -18.675 -13.603 1.00 27.87 ? 1197 VAL C N     1 
ATOM   6088  C  CA    . VAL C  1 224 ? 38.777  -19.199 -14.966 1.00 31.89 ? 1197 VAL C CA    1 
ATOM   6089  C  C     . VAL C  1 224 ? 37.853  -18.388 -15.885 1.00 33.46 ? 1197 VAL C C     1 
ATOM   6090  O  O     . VAL C  1 224 ? 38.262  -17.996 -16.984 1.00 32.99 ? 1197 VAL C O     1 
ATOM   6091  C  CB    . VAL C  1 224 ? 38.528  -20.748 -15.014 1.00 36.31 ? 1197 VAL C CB    1 
ATOM   6092  C  CG1   . VAL C  1 224 ? 39.591  -21.469 -14.186 1.00 33.23 ? 1197 VAL C CG1   1 
ATOM   6093  C  CG2   . VAL C  1 224 ? 37.155  -21.125 -14.494 1.00 40.57 ? 1197 VAL C CG2   1 
ATOM   6094  N  N     . PHE C  1 225 ? 36.637  -18.106 -15.419 1.00 33.72 ? 1198 PHE C N     1 
ATOM   6095  C  CA    . PHE C  1 225 ? 35.618  -17.469 -16.260 1.00 33.96 ? 1198 PHE C CA    1 
ATOM   6096  C  C     . PHE C  1 225 ? 35.592  -15.952 -16.133 1.00 32.24 ? 1198 PHE C C     1 
ATOM   6097  O  O     . PHE C  1 225 ? 34.801  -15.280 -16.799 1.00 34.03 ? 1198 PHE C O     1 
ATOM   6098  C  CB    . PHE C  1 225 ? 34.233  -18.076 -15.995 1.00 32.93 ? 1198 PHE C CB    1 
ATOM   6099  C  CG    . PHE C  1 225 ? 34.164  -19.561 -16.242 1.00 34.33 ? 1198 PHE C CG    1 
ATOM   6100  C  CD1   . PHE C  1 225 ? 34.337  -20.081 -17.520 1.00 38.60 ? 1198 PHE C CD1   1 
ATOM   6101  C  CD2   . PHE C  1 225 ? 33.925  -20.440 -15.196 1.00 36.86 ? 1198 PHE C CD2   1 
ATOM   6102  C  CE1   . PHE C  1 225 ? 34.277  -21.449 -17.742 1.00 31.70 ? 1198 PHE C CE1   1 
ATOM   6103  C  CE2   . PHE C  1 225 ? 33.858  -21.812 -15.408 1.00 29.15 ? 1198 PHE C CE2   1 
ATOM   6104  C  CZ    . PHE C  1 225 ? 34.037  -22.317 -16.681 1.00 37.28 ? 1198 PHE C CZ    1 
ATOM   6105  N  N     . GLU C  1 226 ? 36.464  -15.433 -15.272 1.00 32.43 ? 1199 GLU C N     1 
ATOM   6106  C  CA    . GLU C  1 226 ? 36.699  -13.993 -15.085 1.00 34.64 ? 1199 GLU C CA    1 
ATOM   6107  C  C     . GLU C  1 226 ? 35.460  -13.179 -14.677 1.00 34.51 ? 1199 GLU C C     1 
ATOM   6108  O  O     . GLU C  1 226 ? 35.426  -11.958 -14.829 1.00 28.90 ? 1199 GLU C O     1 
ATOM   6109  C  CB    . GLU C  1 226 ? 37.420  -13.395 -16.302 1.00 33.34 ? 1199 GLU C CB    1 
ATOM   6110  C  CG    . GLU C  1 226 ? 38.804  -14.016 -16.528 1.00 36.38 ? 1199 GLU C CG    1 
ATOM   6111  C  CD    . GLU C  1 226 ? 39.478  -13.552 -17.805 1.00 39.04 ? 1199 GLU C CD    1 
ATOM   6112  O  OE1   . GLU C  1 226 ? 38.786  -13.309 -18.818 1.00 53.73 ? 1199 GLU C OE1   1 
ATOM   6113  O  OE2   . GLU C  1 226 ? 40.718  -13.434 -17.809 1.00 42.53 ? 1199 GLU C OE2   1 
ATOM   6114  N  N     . GLU C  1 227 ? 34.460  -13.875 -14.144 1.00 33.28 ? 1200 GLU C N     1 
ATOM   6115  C  CA    . GLU C  1 227 ? 33.269  -13.248 -13.583 1.00 35.06 ? 1200 GLU C CA    1 
ATOM   6116  C  C     . GLU C  1 227 ? 32.714  -14.105 -12.456 1.00 32.83 ? 1200 GLU C C     1 
ATOM   6117  O  O     . GLU C  1 227 ? 33.004  -15.299 -12.383 1.00 33.71 ? 1200 GLU C O     1 
ATOM   6118  C  CB    . GLU C  1 227 ? 32.203  -13.014 -14.661 1.00 35.39 ? 1200 GLU C CB    1 
ATOM   6119  C  CG    . GLU C  1 227 ? 31.709  -14.262 -15.392 1.00 35.94 ? 1200 GLU C CG    1 
ATOM   6120  C  CD    . GLU C  1 227 ? 30.928  -13.914 -16.653 1.00 42.49 ? 1200 GLU C CD    1 
ATOM   6121  O  OE1   . GLU C  1 227 ? 31.504  -13.257 -17.551 1.00 56.59 ? 1200 GLU C OE1   1 
ATOM   6122  O  OE2   . GLU C  1 227 ? 29.740  -14.293 -16.750 1.00 40.27 ? 1200 GLU C OE2   1 
ATOM   6123  N  N     . ASN C  1 228 ? 31.933  -13.490 -11.570 1.00 31.90 ? 1201 ASN C N     1 
ATOM   6124  C  CA    . ASN C  1 228 ? 31.221  -14.234 -10.541 1.00 29.36 ? 1201 ASN C CA    1 
ATOM   6125  C  C     . ASN C  1 228 ? 30.202  -15.204 -11.137 1.00 29.12 ? 1201 ASN C C     1 
ATOM   6126  O  O     . ASN C  1 228 ? 29.609  -14.918 -12.183 1.00 25.89 ? 1201 ASN C O     1 
ATOM   6127  C  CB    . ASN C  1 228 ? 30.561  -13.298 -9.526  1.00 35.29 ? 1201 ASN C CB    1 
ATOM   6128  C  CG    . ASN C  1 228 ? 31.420  -13.086 -8.289  1.00 41.30 ? 1201 ASN C CG    1 
ATOM   6129  O  OD1   . ASN C  1 228 ? 31.130  -13.621 -7.220  1.00 50.68 ? 1201 ASN C OD1   1 
ATOM   6130  N  ND2   . ASN C  1 228 ? 32.492  -12.317 -8.435  1.00 44.22 ? 1201 ASN C ND2   1 
ATOM   6131  N  N     . PRO C  1 229 ? 30.029  -16.374 -10.488 1.00 28.92 ? 1202 PRO C N     1 
ATOM   6132  C  CA    . PRO C  1 229 ? 29.055  -17.385 -10.894 1.00 30.09 ? 1202 PRO C CA    1 
ATOM   6133  C  C     . PRO C  1 229 ? 27.618  -16.865 -10.887 1.00 35.69 ? 1202 PRO C C     1 
ATOM   6134  O  O     . PRO C  1 229 ? 26.824  -17.249 -11.750 1.00 37.13 ? 1202 PRO C O     1 
ATOM   6135  C  CB    . PRO C  1 229 ? 29.213  -18.478 -9.839  1.00 29.85 ? 1202 PRO C CB    1 
ATOM   6136  C  CG    . PRO C  1 229 ? 30.521  -18.235 -9.193  1.00 28.23 ? 1202 PRO C CG    1 
ATOM   6137  C  CD    . PRO C  1 229 ? 30.807  -16.790 -9.306  1.00 23.79 ? 1202 PRO C CD    1 
ATOM   6138  N  N     . PHE C  1 230 ? 27.299  -15.997 -9.928  1.00 35.55 ? 1203 PHE C N     1 
ATOM   6139  C  CA    . PHE C  1 230 ? 25.923  -15.555 -9.711  1.00 39.88 ? 1203 PHE C CA    1 
ATOM   6140  C  C     . PHE C  1 230 ? 25.820  -14.042 -9.543  1.00 42.08 ? 1203 PHE C C     1 
ATOM   6141  O  O     . PHE C  1 230 ? 26.370  -13.472 -8.595  1.00 40.69 ? 1203 PHE C O     1 
ATOM   6142  C  CB    . PHE C  1 230 ? 25.309  -16.281 -8.504  1.00 36.76 ? 1203 PHE C CB    1 
ATOM   6143  C  CG    . PHE C  1 230 ? 25.630  -17.752 -8.455  1.00 34.09 ? 1203 PHE C CG    1 
ATOM   6144  C  CD1   . PHE C  1 230 ? 25.058  -18.635 -9.368  1.00 37.19 ? 1203 PHE C CD1   1 
ATOM   6145  C  CD2   . PHE C  1 230 ? 26.514  -18.253 -7.502  1.00 33.69 ? 1203 PHE C CD2   1 
ATOM   6146  C  CE1   . PHE C  1 230 ? 25.368  -19.994 -9.335  1.00 33.13 ? 1203 PHE C CE1   1 
ATOM   6147  C  CE2   . PHE C  1 230 ? 26.827  -19.611 -7.458  1.00 24.60 ? 1203 PHE C CE2   1 
ATOM   6148  C  CZ    . PHE C  1 230 ? 26.257  -20.480 -8.378  1.00 34.64 ? 1203 PHE C CZ    1 
ATOM   6149  N  N     . CYS C  1 231 ? 25.112  -13.411 -10.480 1.00 47.62 ? 1204 CYS C N     1 
ATOM   6150  C  CA    . CYS C  1 231 ? 24.839  -11.969 -10.456 1.00 53.57 ? 1204 CYS C CA    1 
ATOM   6151  C  C     . CYS C  1 231 ? 24.005  -11.545 -9.238  1.00 55.69 ? 1204 CYS C C     1 
ATOM   6152  O  O     . CYS C  1 231 ? 24.261  -10.502 -8.627  1.00 55.99 ? 1204 CYS C O     1 
ATOM   6153  C  CB    . CYS C  1 231 ? 24.122  -11.543 -11.745 1.00 53.96 ? 1204 CYS C CB    1 
ATOM   6154  N  N     . GLU C  1 232 ? 23.008  -12.358 -8.897  1.00 57.18 ? 1205 GLU C N     1 
ATOM   6155  C  CA    . GLU C  1 232 ? 22.156  -12.088 -7.744  1.00 55.62 ? 1205 GLU C CA    1 
ATOM   6156  C  C     . GLU C  1 232 ? 22.416  -13.094 -6.634  1.00 51.93 ? 1205 GLU C C     1 
ATOM   6157  O  O     . GLU C  1 232 ? 22.745  -14.252 -6.891  1.00 49.89 ? 1205 GLU C O     1 
ATOM   6158  C  CB    . GLU C  1 232 ? 20.674  -12.088 -8.140  1.00 58.13 ? 1205 GLU C CB    1 
ATOM   6159  C  CG    . GLU C  1 232 ? 20.311  -11.112 -9.271  1.00 61.20 ? 1205 GLU C CG    1 
ATOM   6160  C  CD    . GLU C  1 232 ? 20.508  -9.650  -8.900  1.00 63.97 ? 1205 GLU C CD    1 
ATOM   6161  O  OE1   . GLU C  1 232 ? 20.978  -8.884  -9.770  1.00 64.39 ? 1205 GLU C OE1   1 
ATOM   6162  O  OE2   . GLU C  1 232 ? 20.194  -9.265  -7.751  1.00 61.16 ? 1205 GLU C OE2   1 
ATOM   6163  N  N     . LEU C  1 233 ? 22.261  -12.634 -5.398  1.00 49.12 ? 1206 LEU C N     1 
ATOM   6164  C  CA    . LEU C  1 233 ? 22.531  -13.443 -4.212  1.00 47.25 ? 1206 LEU C CA    1 
ATOM   6165  C  C     . LEU C  1 233 ? 21.621  -14.668 -4.096  1.00 46.82 ? 1206 LEU C C     1 
ATOM   6166  O  O     . LEU C  1 233 ? 22.025  -15.704 -3.565  1.00 40.32 ? 1206 LEU C O     1 
ATOM   6167  C  CB    . LEU C  1 233 ? 22.386  -12.574 -2.968  1.00 45.35 ? 1206 LEU C CB    1 
ATOM   6168  C  CG    . LEU C  1 233 ? 23.471  -12.708 -1.907  1.00 45.77 ? 1206 LEU C CG    1 
ATOM   6169  C  CD1   . LEU C  1 233 ? 24.849  -12.506 -2.528  1.00 39.57 ? 1206 LEU C CD1   1 
ATOM   6170  C  CD2   . LEU C  1 233 ? 23.211  -11.710 -0.790  1.00 38.18 ? 1206 LEU C CD2   1 
ATOM   6171  N  N     . GLU C  1 234 ? 20.403  -14.549 -4.614  1.00 50.03 ? 1207 GLU C N     1 
ATOM   6172  C  CA    . GLU C  1 234 ? 19.406  -15.605 -4.468  1.00 52.74 ? 1207 GLU C CA    1 
ATOM   6173  C  C     . GLU C  1 234 ? 19.443  -16.690 -5.536  1.00 53.81 ? 1207 GLU C C     1 
ATOM   6174  O  O     . GLU C  1 234 ? 18.953  -17.796 -5.299  1.00 54.43 ? 1207 GLU C O     1 
ATOM   6175  C  CB    . GLU C  1 234 ? 18.011  -15.009 -4.349  1.00 51.74 ? 1207 GLU C CB    1 
ATOM   6176  C  CG    . GLU C  1 234 ? 17.767  -14.355 -2.998  1.00 47.68 ? 1207 GLU C CG    1 
ATOM   6177  C  CD    . GLU C  1 234 ? 16.381  -13.781 -2.879  1.00 49.06 ? 1207 GLU C CD    1 
ATOM   6178  O  OE1   . GLU C  1 234 ? 15.656  -13.754 -3.897  1.00 44.35 ? 1207 GLU C OE1   1 
ATOM   6179  O  OE2   . GLU C  1 234 ? 16.015  -13.349 -1.767  1.00 48.91 ? 1207 GLU C OE2   1 
ATOM   6180  N  N     . GLU C  1 235 ? 20.030  -16.392 -6.695  1.00 55.37 ? 1208 GLU C N     1 
ATOM   6181  C  CA    . GLU C  1 235 ? 20.216  -17.415 -7.743  1.00 56.94 ? 1208 GLU C CA    1 
ATOM   6182  C  C     . GLU C  1 235 ? 21.347  -18.395 -7.387  1.00 51.51 ? 1208 GLU C C     1 
ATOM   6183  O  O     . GLU C  1 235 ? 21.932  -19.043 -8.258  1.00 53.08 ? 1208 GLU C O     1 
ATOM   6184  C  CB    . GLU C  1 235 ? 20.409  -16.778 -9.134  1.00 58.47 ? 1208 GLU C CB    1 
ATOM   6185  C  CG    . GLU C  1 235 ? 21.600  -15.830 -9.269  1.00 58.62 ? 1208 GLU C CG    1 
ATOM   6186  C  CD    . GLU C  1 235 ? 21.477  -14.881 -10.459 1.00 61.29 ? 1208 GLU C CD    1 
ATOM   6187  O  OE1   . GLU C  1 235 ? 20.341  -14.647 -10.933 1.00 65.44 ? 1208 GLU C OE1   1 
ATOM   6188  O  OE2   . GLU C  1 235 ? 22.518  -14.358 -10.914 1.00 55.02 ? 1208 GLU C OE2   1 
ATOM   6189  N  N     . THR C  1 236 ? 21.613  -18.491 -6.086  1.00 47.85 ? 1209 THR C N     1 
ATOM   6190  C  CA    . THR C  1 236 ? 22.642  -19.337 -5.496  1.00 50.00 ? 1209 THR C CA    1 
ATOM   6191  C  C     . THR C  1 236 ? 22.037  -20.594 -4.849  1.00 51.32 ? 1209 THR C C     1 
ATOM   6192  O  O     . THR C  1 236 ? 22.729  -21.610 -4.697  1.00 51.04 ? 1209 THR C O     1 
ATOM   6193  C  CB    . THR C  1 236 ? 23.482  -18.522 -4.461  1.00 51.46 ? 1209 THR C CB    1 
ATOM   6194  O  OG1   . THR C  1 236 ? 24.687  -18.051 -5.077  1.00 48.93 ? 1209 THR C OG1   1 
ATOM   6195  C  CG2   . THR C  1 236 ? 23.850  -19.344 -3.246  1.00 47.34 ? 1209 THR C CG2   1 
ATOM   6196  N  N     . VAL C  1 237 ? 20.752  -20.523 -4.479  1.00 48.70 ? 1210 VAL C N     1 
ATOM   6197  C  CA    . VAL C  1 237 ? 20.024  -21.686 -3.940  1.00 43.65 ? 1210 VAL C CA    1 
ATOM   6198  C  C     . VAL C  1 237 ? 19.798  -22.781 -5.001  1.00 43.98 ? 1210 VAL C C     1 
ATOM   6199  O  O     . VAL C  1 237 ? 19.666  -23.960 -4.665  1.00 47.36 ? 1210 VAL C O     1 
ATOM   6200  C  CB    . VAL C  1 237 ? 18.681  -21.297 -3.232  1.00 43.81 ? 1210 VAL C CB    1 
ATOM   6201  C  CG1   . VAL C  1 237 ? 18.851  -20.051 -2.351  1.00 44.67 ? 1210 VAL C CG1   1 
ATOM   6202  C  CG2   . VAL C  1 237 ? 17.551  -21.096 -4.232  1.00 48.03 ? 1210 VAL C CG2   1 
ATOM   6203  N  N     . GLU C  1 238 ? 19.750  -22.384 -6.272  1.00 42.74 ? 1211 GLU C N     1 
ATOM   6204  C  CA    . GLU C  1 238 ? 19.690  -23.332 -7.385  1.00 43.62 ? 1211 GLU C CA    1 
ATOM   6205  C  C     . GLU C  1 238 ? 21.089  -23.589 -7.932  1.00 45.14 ? 1211 GLU C C     1 
ATOM   6206  O  O     . GLU C  1 238 ? 21.389  -24.689 -8.405  1.00 45.64 ? 1211 GLU C O     1 
ATOM   6207  C  CB    . GLU C  1 238 ? 18.771  -22.818 -8.497  1.00 41.84 ? 1211 GLU C CB    1 
ATOM   6208  N  N     . ALA C  1 239 ? 21.937  -22.564 -7.849  1.00 47.61 ? 1212 ALA C N     1 
ATOM   6209  C  CA    . ALA C  1 239 ? 23.327  -22.616 -8.310  1.00 49.61 ? 1212 ALA C CA    1 
ATOM   6210  C  C     . ALA C  1 239 ? 23.480  -23.105 -9.756  1.00 52.26 ? 1212 ALA C C     1 
ATOM   6211  O  O     . ALA C  1 239 ? 24.278  -24.001 -10.046 1.00 53.82 ? 1212 ALA C O     1 
ATOM   6212  C  CB    . ALA C  1 239 ? 24.196  -23.428 -7.344  1.00 46.46 ? 1212 ALA C CB    1 
ATOM   6213  N  N     . ALA C  1 240 ? 22.704  -22.502 -10.654 1.00 53.95 ? 1213 ALA C N     1 
ATOM   6214  C  CA    . ALA C  1 240 ? 22.780  -22.798 -12.083 1.00 55.18 ? 1213 ALA C CA    1 
ATOM   6215  C  C     . ALA C  1 240 ? 23.876  -21.966 -12.751 1.00 56.05 ? 1213 ALA C C     1 
ATOM   6216  O  O     . ALA C  1 240 ? 23.734  -20.749 -12.921 1.00 56.27 ? 1213 ALA C O     1 
ATOM   6217  C  CB    . ALA C  1 240 ? 21.426  -22.556 -12.755 1.00 53.76 ? 1213 ALA C CB    1 
ATOM   6218  N  N     . ILE C  1 241 ? 24.970  -22.628 -13.118 1.00 57.55 ? 1214 ILE C N     1 
ATOM   6219  C  CA    . ILE C  1 241 ? 26.085  -21.957 -13.791 1.00 57.82 ? 1214 ILE C CA    1 
ATOM   6220  C  C     . ILE C  1 241 ? 26.060  -22.137 -15.314 1.00 58.60 ? 1214 ILE C C     1 
ATOM   6221  O  O     . ILE C  1 241 ? 25.962  -23.261 -15.825 1.00 59.94 ? 1214 ILE C O     1 
ATOM   6222  C  CB    . ILE C  1 241 ? 27.476  -22.353 -13.202 1.00 59.33 ? 1214 ILE C CB    1 
ATOM   6223  C  CG1   . ILE C  1 241 ? 27.643  -23.879 -13.128 1.00 59.49 ? 1214 ILE C CG1   1 
ATOM   6224  C  CG2   . ILE C  1 241 ? 27.680  -21.690 -11.834 1.00 63.19 ? 1214 ILE C CG2   1 
ATOM   6225  C  CD1   . ILE C  1 241 ? 29.072  -24.354 -12.904 1.00 55.08 ? 1214 ILE C CD1   1 
ATOM   6226  N  N     . HIS C  1 242 ? 26.133  -21.016 -16.028 1.00 56.65 ? 1215 HIS C N     1 
ATOM   6227  C  CA    . HIS C  1 242 ? 26.248  -21.027 -17.482 1.00 55.79 ? 1215 HIS C CA    1 
ATOM   6228  C  C     . HIS C  1 242 ? 27.528  -20.302 -17.898 1.00 49.91 ? 1215 HIS C C     1 
ATOM   6229  O  O     . HIS C  1 242 ? 27.507  -19.095 -18.148 1.00 50.66 ? 1215 HIS C O     1 
ATOM   6230  C  CB    . HIS C  1 242 ? 25.006  -20.415 -18.139 1.00 59.30 ? 1215 HIS C CB    1 
ATOM   6231  C  CG    . HIS C  1 242 ? 23.761  -21.226 -17.945 1.00 64.88 ? 1215 HIS C CG    1 
ATOM   6232  N  ND1   . HIS C  1 242 ? 23.340  -22.174 -18.853 1.00 66.02 ? 1215 HIS C ND1   1 
ATOM   6233  C  CD2   . HIS C  1 242 ? 22.849  -21.235 -16.942 1.00 62.74 ? 1215 HIS C CD2   1 
ATOM   6234  C  CE1   . HIS C  1 242 ? 22.222  -22.730 -18.420 1.00 67.00 ? 1215 HIS C CE1   1 
ATOM   6235  N  NE2   . HIS C  1 242 ? 21.903  -22.178 -17.263 1.00 63.22 ? 1215 HIS C NE2   1 
ATOM   6236  N  N     . PRO C  1 243 ? 28.650  -21.044 -17.962 1.00 45.52 ? 1216 PRO C N     1 
ATOM   6237  C  CA    . PRO C  1 243 ? 29.993  -20.510 -18.221 1.00 44.42 ? 1216 PRO C CA    1 
ATOM   6238  C  C     . PRO C  1 243 ? 30.116  -19.788 -19.561 1.00 41.36 ? 1216 PRO C C     1 
ATOM   6239  O  O     . PRO C  1 243 ? 29.587  -20.274 -20.560 1.00 41.23 ? 1216 PRO C O     1 
ATOM   6240  C  CB    . PRO C  1 243 ? 30.867  -21.765 -18.235 1.00 44.14 ? 1216 PRO C CB    1 
ATOM   6241  C  CG    . PRO C  1 243 ? 30.107  -22.771 -17.469 1.00 43.64 ? 1216 PRO C CG    1 
ATOM   6242  C  CD    . PRO C  1 243 ? 28.682  -22.505 -17.781 1.00 43.83 ? 1216 PRO C CD    1 
ATOM   6243  N  N     . PRO C  1 244 ? 30.810  -18.630 -19.582 1.00 39.32 ? 1217 PRO C N     1 
ATOM   6244  C  CA    . PRO C  1 244 ? 31.048  -17.875 -20.819 1.00 37.03 ? 1217 PRO C CA    1 
ATOM   6245  C  C     . PRO C  1 244 ? 32.040  -18.561 -21.765 1.00 34.64 ? 1217 PRO C C     1 
ATOM   6246  O  O     . PRO C  1 244 ? 31.993  -18.345 -22.975 1.00 31.47 ? 1217 PRO C O     1 
ATOM   6247  C  CB    . PRO C  1 244 ? 31.638  -16.554 -20.314 1.00 37.17 ? 1217 PRO C CB    1 
ATOM   6248  C  CG    . PRO C  1 244 ? 32.271  -16.896 -19.016 1.00 34.66 ? 1217 PRO C CG    1 
ATOM   6249  C  CD    . PRO C  1 244 ? 31.406  -17.961 -18.409 1.00 37.76 ? 1217 PRO C CD    1 
ATOM   6250  N  N     . TYR C  1 245 ? 32.923  -19.381 -21.203 1.00 34.76 ? 1218 TYR C N     1 
ATOM   6251  C  CA    . TYR C  1 245 ? 34.013  -20.000 -21.951 1.00 35.93 ? 1218 TYR C CA    1 
ATOM   6252  C  C     . TYR C  1 245 ? 33.758  -21.488 -22.144 1.00 37.41 ? 1218 TYR C C     1 
ATOM   6253  O  O     . TYR C  1 245 ? 33.097  -22.130 -21.318 1.00 35.93 ? 1218 TYR C O     1 
ATOM   6254  C  CB    . TYR C  1 245 ? 35.355  -19.825 -21.211 1.00 31.04 ? 1218 TYR C CB    1 
ATOM   6255  C  CG    . TYR C  1 245 ? 35.799  -18.396 -20.966 1.00 28.15 ? 1218 TYR C CG    1 
ATOM   6256  C  CD1   . TYR C  1 245 ? 35.222  -17.331 -21.657 1.00 26.27 ? 1218 TYR C CD1   1 
ATOM   6257  C  CD2   . TYR C  1 245 ? 36.828  -18.115 -20.068 1.00 28.99 ? 1218 TYR C CD2   1 
ATOM   6258  C  CE1   . TYR C  1 245 ? 35.630  -16.021 -21.444 1.00 20.24 ? 1218 TYR C CE1   1 
ATOM   6259  C  CE2   . TYR C  1 245 ? 37.254  -16.800 -19.848 1.00 32.11 ? 1218 TYR C CE2   1 
ATOM   6260  C  CZ    . TYR C  1 245 ? 36.650  -15.759 -20.546 1.00 30.69 ? 1218 TYR C CZ    1 
ATOM   6261  O  OH    . TYR C  1 245 ? 37.056  -14.450 -20.353 1.00 27.57 ? 1218 TYR C OH    1 
ATOM   6262  N  N     . LEU C  1 246 ? 34.299  -22.032 -23.230 1.00 37.49 ? 1219 LEU C N     1 
ATOM   6263  C  CA    . LEU C  1 246 ? 34.336  -23.474 -23.406 1.00 42.41 ? 1219 LEU C CA    1 
ATOM   6264  C  C     . LEU C  1 246 ? 35.529  -24.033 -22.634 1.00 41.31 ? 1219 LEU C C     1 
ATOM   6265  O  O     . LEU C  1 246 ? 36.675  -23.633 -22.853 1.00 40.41 ? 1219 LEU C O     1 
ATOM   6266  C  CB    . LEU C  1 246 ? 34.391  -23.861 -24.893 1.00 45.12 ? 1219 LEU C CB    1 
ATOM   6267  C  CG    . LEU C  1 246 ? 34.061  -25.311 -25.280 1.00 39.66 ? 1219 LEU C CG    1 
ATOM   6268  C  CD1   . LEU C  1 246 ? 32.764  -25.799 -24.650 1.00 40.91 ? 1219 LEU C CD1   1 
ATOM   6269  C  CD2   . LEU C  1 246 ? 33.994  -25.447 -26.787 1.00 45.13 ? 1219 LEU C CD2   1 
ATOM   6270  N  N     . VAL C  1 247 ? 35.233  -24.930 -21.701 1.00 40.79 ? 1220 VAL C N     1 
ATOM   6271  C  CA    . VAL C  1 247 ? 36.247  -25.559 -20.870 1.00 41.90 ? 1220 VAL C CA    1 
ATOM   6272  C  C     . VAL C  1 247 ? 36.021  -27.063 -20.874 1.00 42.78 ? 1220 VAL C C     1 
ATOM   6273  O  O     . VAL C  1 247 ? 34.943  -27.529 -21.256 1.00 47.71 ? 1220 VAL C O     1 
ATOM   6274  C  CB    . VAL C  1 247 ? 36.237  -25.017 -19.400 1.00 41.69 ? 1220 VAL C CB    1 
ATOM   6275  C  CG1   . VAL C  1 247 ? 36.761  -23.573 -19.336 1.00 35.33 ? 1220 VAL C CG1   1 
ATOM   6276  C  CG2   . VAL C  1 247 ? 34.849  -25.126 -18.773 1.00 35.64 ? 1220 VAL C CG2   1 
ATOM   6277  N  N     . SER C  1 248 ? 37.034  -27.810 -20.443 1.00 38.75 ? 1221 SER C N     1 
ATOM   6278  C  CA    . SER C  1 248 ? 36.980  -29.266 -20.410 1.00 41.65 ? 1221 SER C CA    1 
ATOM   6279  C  C     . SER C  1 248 ? 35.872  -29.775 -19.499 1.00 46.32 ? 1221 SER C C     1 
ATOM   6280  O  O     . SER C  1 248 ? 35.409  -29.059 -18.605 1.00 49.87 ? 1221 SER C O     1 
ATOM   6281  C  CB    . SER C  1 248 ? 38.326  -29.836 -19.959 1.00 40.98 ? 1221 SER C CB    1 
ATOM   6282  O  OG    . SER C  1 248 ? 38.709  -29.290 -18.711 1.00 37.04 ? 1221 SER C OG    1 
ATOM   6283  N  N     . LYS C  1 249 ? 35.448  -31.015 -19.738 1.00 47.00 ? 1222 LYS C N     1 
ATOM   6284  C  CA    . LYS C  1 249 ? 34.468  -31.681 -18.882 1.00 44.69 ? 1222 LYS C CA    1 
ATOM   6285  C  C     . LYS C  1 249 ? 34.992  -31.831 -17.461 1.00 41.46 ? 1222 LYS C C     1 
ATOM   6286  O  O     . LYS C  1 249 ? 34.210  -31.847 -16.512 1.00 45.69 ? 1222 LYS C O     1 
ATOM   6287  C  CB    . LYS C  1 249 ? 34.113  -33.061 -19.441 1.00 43.16 ? 1222 LYS C CB    1 
ATOM   6288  N  N     . GLU C  1 250 ? 36.314  -31.938 -17.330 1.00 41.73 ? 1223 GLU C N     1 
ATOM   6289  C  CA    . GLU C  1 250 ? 36.974  -32.200 -16.044 1.00 41.41 ? 1223 GLU C CA    1 
ATOM   6290  C  C     . GLU C  1 250 ? 36.966  -30.998 -15.092 1.00 39.61 ? 1223 GLU C C     1 
ATOM   6291  O  O     . GLU C  1 250 ? 36.885  -31.170 -13.873 1.00 42.05 ? 1223 GLU C O     1 
ATOM   6292  C  CB    . GLU C  1 250 ? 38.408  -32.700 -16.259 1.00 44.33 ? 1223 GLU C CB    1 
ATOM   6293  C  CG    . GLU C  1 250 ? 38.521  -34.140 -16.815 1.00 49.96 ? 1223 GLU C CG    1 
ATOM   6294  C  CD    . GLU C  1 250 ? 38.437  -34.237 -18.346 1.00 49.92 ? 1223 GLU C CD    1 
ATOM   6295  O  OE1   . GLU C  1 250 ? 38.299  -33.197 -19.028 1.00 44.38 ? 1223 GLU C OE1   1 
ATOM   6296  O  OE2   . GLU C  1 250 ? 38.509  -35.370 -18.870 1.00 53.68 ? 1223 GLU C OE2   1 
ATOM   6297  N  N     . LEU C  1 251 ? 37.070  -29.791 -15.644 1.00 37.66 ? 1224 LEU C N     1 
ATOM   6298  C  CA    . LEU C  1 251 ? 36.916  -28.571 -14.846 1.00 38.82 ? 1224 LEU C CA    1 
ATOM   6299  C  C     . LEU C  1 251 ? 35.438  -28.361 -14.548 1.00 41.91 ? 1224 LEU C C     1 
ATOM   6300  O  O     . LEU C  1 251 ? 35.059  -28.075 -13.410 1.00 42.91 ? 1224 LEU C O     1 
ATOM   6301  C  CB    . LEU C  1 251 ? 37.491  -27.337 -15.559 1.00 35.29 ? 1224 LEU C CB    1 
ATOM   6302  C  CG    . LEU C  1 251 ? 37.343  -25.976 -14.854 1.00 31.63 ? 1224 LEU C CG    1 
ATOM   6303  C  CD1   . LEU C  1 251 ? 37.896  -25.992 -13.415 1.00 18.90 ? 1224 LEU C CD1   1 
ATOM   6304  C  CD2   . LEU C  1 251 ? 38.012  -24.882 -15.660 1.00 21.91 ? 1224 LEU C CD2   1 
ATOM   6305  N  N     . MET C  1 252 ? 34.615  -28.508 -15.584 1.00 41.02 ? 1225 MET C N     1 
ATOM   6306  C  CA    . MET C  1 252 ? 33.173  -28.379 -15.453 1.00 41.53 ? 1225 MET C CA    1 
ATOM   6307  C  C     . MET C  1 252 ? 32.592  -29.198 -14.309 1.00 36.44 ? 1225 MET C C     1 
ATOM   6308  O  O     . MET C  1 252 ? 31.742  -28.704 -13.567 1.00 35.79 ? 1225 MET C O     1 
ATOM   6309  C  CB    . MET C  1 252 ? 32.465  -28.701 -16.770 1.00 43.52 ? 1225 MET C CB    1 
ATOM   6310  C  CG    . MET C  1 252 ? 32.137  -27.470 -17.605 1.00 46.70 ? 1225 MET C CG    1 
ATOM   6311  S  SD    . MET C  1 252 ? 31.330  -26.153 -16.660 1.00 60.98 ? 1225 MET C SD    1 
ATOM   6312  C  CE    . MET C  1 252 ? 29.827  -26.967 -16.108 1.00 54.57 ? 1225 MET C CE    1 
ATOM   6313  N  N     . SER C  1 253 ? 33.061  -30.431 -14.152 1.00 36.29 ? 1226 SER C N     1 
ATOM   6314  C  CA    . SER C  1 253 ? 32.604  -31.269 -13.041 1.00 37.87 ? 1226 SER C CA    1 
ATOM   6315  C  C     . SER C  1 253 ? 33.182  -30.807 -11.703 1.00 35.63 ? 1226 SER C C     1 
ATOM   6316  O  O     . SER C  1 253 ? 32.519  -30.931 -10.675 1.00 35.63 ? 1226 SER C O     1 
ATOM   6317  C  CB    . SER C  1 253 ? 32.894  -32.760 -13.295 1.00 39.85 ? 1226 SER C CB    1 
ATOM   6318  O  OG    . SER C  1 253 ? 34.281  -33.054 -13.242 1.00 48.70 ? 1226 SER C OG    1 
ATOM   6319  N  N     . LEU C  1 254 ? 34.405  -30.267 -11.729 1.00 33.98 ? 1227 LEU C N     1 
ATOM   6320  C  CA    . LEU C  1 254 ? 35.062  -29.726 -10.527 1.00 33.23 ? 1227 LEU C CA    1 
ATOM   6321  C  C     . LEU C  1 254 ? 34.333  -28.520 -9.921  1.00 30.41 ? 1227 LEU C C     1 
ATOM   6322  O  O     . LEU C  1 254 ? 34.121  -28.486 -8.708  1.00 31.18 ? 1227 LEU C O     1 
ATOM   6323  C  CB    . LEU C  1 254 ? 36.548  -29.393 -10.791 1.00 35.82 ? 1227 LEU C CB    1 
ATOM   6324  C  CG    . LEU C  1 254 ? 37.353  -28.628 -9.722  1.00 30.38 ? 1227 LEU C CG    1 
ATOM   6325  C  CD1   . LEU C  1 254 ? 37.443  -29.386 -8.413  1.00 26.21 ? 1227 LEU C CD1   1 
ATOM   6326  C  CD2   . LEU C  1 254 ? 38.745  -28.308 -10.223 1.00 33.46 ? 1227 LEU C CD2   1 
ATOM   6327  N  N     . VAL C  1 255 ? 33.965  -27.541 -10.750 1.00 32.47 ? 1228 VAL C N     1 
ATOM   6328  C  CA    . VAL C  1 255 ? 33.216  -26.360 -10.276 1.00 35.85 ? 1228 VAL C CA    1 
ATOM   6329  C  C     . VAL C  1 255 ? 31.802  -26.691 -9.804  1.00 33.84 ? 1228 VAL C C     1 
ATOM   6330  O  O     . VAL C  1 255 ? 31.346  -26.167 -8.788  1.00 33.45 ? 1228 VAL C O     1 
ATOM   6331  C  CB    . VAL C  1 255 ? 33.158  -25.182 -11.317 1.00 37.61 ? 1228 VAL C CB    1 
ATOM   6332  C  CG1   . VAL C  1 255 ? 34.456  -24.425 -11.347 1.00 41.05 ? 1228 VAL C CG1   1 
ATOM   6333  C  CG2   . VAL C  1 255 ? 32.800  -25.664 -12.707 1.00 42.59 ? 1228 VAL C CG2   1 
ATOM   6334  N  N     . SER C  1 256 ? 31.114  -27.556 -10.547 1.00 36.97 ? 1229 SER C N     1 
ATOM   6335  C  CA    . SER C  1 256 ? 29.778  -28.015 -10.181 1.00 36.67 ? 1229 SER C CA    1 
ATOM   6336  C  C     . SER C  1 256 ? 29.782  -28.765 -8.843  1.00 34.01 ? 1229 SER C C     1 
ATOM   6337  O  O     . SER C  1 256 ? 28.876  -28.594 -8.025  1.00 33.03 ? 1229 SER C O     1 
ATOM   6338  C  CB    . SER C  1 256 ? 29.200  -28.904 -11.288 1.00 42.37 ? 1229 SER C CB    1 
ATOM   6339  O  OG    . SER C  1 256 ? 29.136  -28.207 -12.521 1.00 39.42 ? 1229 SER C OG    1 
ATOM   6340  N  N     . GLY C  1 257 ? 30.802  -29.591 -8.626  1.00 29.97 ? 1230 GLY C N     1 
ATOM   6341  C  CA    . GLY C  1 257 ? 30.986  -30.275 -7.346  1.00 32.08 ? 1230 GLY C CA    1 
ATOM   6342  C  C     . GLY C  1 257 ? 31.042  -29.308 -6.173  1.00 33.30 ? 1230 GLY C C     1 
ATOM   6343  O  O     . GLY C  1 257 ? 30.325  -29.481 -5.184  1.00 33.98 ? 1230 GLY C O     1 
ATOM   6344  N  N     . LEU C  1 258 ? 31.873  -28.275 -6.298  1.00 32.67 ? 1231 LEU C N     1 
ATOM   6345  C  CA    . LEU C  1 258 ? 32.075  -27.285 -5.220  1.00 33.94 ? 1231 LEU C CA    1 
ATOM   6346  C  C     . LEU C  1 258 ? 30.933  -26.283 -5.106  1.00 30.66 ? 1231 LEU C C     1 
ATOM   6347  O  O     . LEU C  1 258 ? 30.666  -25.761 -4.021  1.00 30.55 ? 1231 LEU C O     1 
ATOM   6348  C  CB    . LEU C  1 258 ? 33.394  -26.518 -5.409  1.00 29.78 ? 1231 LEU C CB    1 
ATOM   6349  C  CG    . LEU C  1 258 ? 34.727  -27.262 -5.428  1.00 24.01 ? 1231 LEU C CG    1 
ATOM   6350  C  CD1   . LEU C  1 258 ? 35.796  -26.395 -6.093  1.00 20.55 ? 1231 LEU C CD1   1 
ATOM   6351  C  CD2   . LEU C  1 258 ? 35.163  -27.668 -4.039  1.00 28.54 ? 1231 LEU C CD2   1 
ATOM   6352  N  N     . LEU C  1 259 ? 30.284  -25.999 -6.234  1.00 32.42 ? 1232 LEU C N     1 
ATOM   6353  C  CA    . LEU C  1 259 ? 29.151  -25.076 -6.267  1.00 32.98 ? 1232 LEU C CA    1 
ATOM   6354  C  C     . LEU C  1 259 ? 27.819  -25.836 -6.212  1.00 34.73 ? 1232 LEU C C     1 
ATOM   6355  O  O     . LEU C  1 259 ? 26.870  -25.520 -6.935  1.00 32.29 ? 1232 LEU C O     1 
ATOM   6356  C  CB    . LEU C  1 259 ? 29.237  -24.122 -7.476  1.00 33.66 ? 1232 LEU C CB    1 
ATOM   6357  C  CG    . LEU C  1 259 ? 30.430  -23.137 -7.497  1.00 27.49 ? 1232 LEU C CG    1 
ATOM   6358  C  CD1   . LEU C  1 259 ? 30.480  -22.342 -8.780  1.00 11.69 ? 1232 LEU C CD1   1 
ATOM   6359  C  CD2   . LEU C  1 259 ? 30.424  -22.204 -6.302  1.00 16.63 ? 1232 LEU C CD2   1 
ATOM   6360  N  N     . GLN C  1 260 ? 27.776  -26.837 -5.334  1.00 32.15 ? 1233 GLN C N     1 
ATOM   6361  C  CA    . GLN C  1 260 ? 26.593  -27.655 -5.102  1.00 35.58 ? 1233 GLN C CA    1 
ATOM   6362  C  C     . GLN C  1 260 ? 25.833  -27.077 -3.907  1.00 36.71 ? 1233 GLN C C     1 
ATOM   6363  O  O     . GLN C  1 260 ? 26.399  -26.956 -2.818  1.00 35.97 ? 1233 GLN C O     1 
ATOM   6364  C  CB    . GLN C  1 260 ? 27.004  -29.122 -4.877  1.00 36.13 ? 1233 GLN C CB    1 
ATOM   6365  C  CG    . GLN C  1 260 ? 26.031  -29.985 -4.067  1.00 43.42 ? 1233 GLN C CG    1 
ATOM   6366  C  CD    . GLN C  1 260 ? 24.796  -30.422 -4.842  1.00 37.48 ? 1233 GLN C CD    1 
ATOM   6367  O  OE1   . GLN C  1 260 ? 23.667  -30.200 -4.402  1.00 42.15 ? 1233 GLN C OE1   1 
ATOM   6368  N  NE2   . GLN C  1 260 ? 25.003  -31.046 -5.991  1.00 30.80 ? 1233 GLN C NE2   1 
ATOM   6369  N  N     . PRO C  1 261 ? 24.548  -26.712 -4.113  1.00 36.97 ? 1234 PRO C N     1 
ATOM   6370  C  CA    . PRO C  1 261 ? 23.724  -26.027 -3.119  1.00 34.56 ? 1234 PRO C CA    1 
ATOM   6371  C  C     . PRO C  1 261 ? 23.494  -26.813 -1.825  1.00 30.87 ? 1234 PRO C C     1 
ATOM   6372  O  O     . PRO C  1 261 ? 23.310  -26.207 -0.766  1.00 31.92 ? 1234 PRO C O     1 
ATOM   6373  C  CB    . PRO C  1 261 ? 22.388  -25.822 -3.847  1.00 37.03 ? 1234 PRO C CB    1 
ATOM   6374  C  CG    . PRO C  1 261 ? 22.692  -25.960 -5.279  1.00 34.40 ? 1234 PRO C CG    1 
ATOM   6375  C  CD    . PRO C  1 261 ? 23.795  -26.957 -5.357  1.00 38.93 ? 1234 PRO C CD    1 
ATOM   6376  N  N     . VAL C  1 262 ? 23.483  -28.141 -1.923  1.00 32.22 ? 1235 VAL C N     1 
ATOM   6377  C  CA    . VAL C  1 262 ? 23.317  -29.027 -0.763  1.00 31.86 ? 1235 VAL C CA    1 
ATOM   6378  C  C     . VAL C  1 262 ? 24.678  -29.327 -0.135  1.00 33.11 ? 1235 VAL C C     1 
ATOM   6379  O  O     . VAL C  1 262 ? 25.499  -30.001 -0.756  1.00 38.06 ? 1235 VAL C O     1 
ATOM   6380  C  CB    . VAL C  1 262 ? 22.625  -30.373 -1.134  1.00 27.47 ? 1235 VAL C CB    1 
ATOM   6381  C  CG1   . VAL C  1 262 ? 22.176  -31.102 0.126   1.00 24.23 ? 1235 VAL C CG1   1 
ATOM   6382  C  CG2   . VAL C  1 262 ? 21.437  -30.146 -2.050  1.00 32.14 ? 1235 VAL C CG2   1 
ATOM   6383  N  N     . PRO C  1 263 ? 24.907  -28.848 1.108   1.00 29.57 ? 1236 PRO C N     1 
ATOM   6384  C  CA    . PRO C  1 263 ? 26.186  -28.965 1.814   1.00 33.51 ? 1236 PRO C CA    1 
ATOM   6385  C  C     . PRO C  1 263 ? 26.751  -30.383 1.826   1.00 40.21 ? 1236 PRO C C     1 
ATOM   6386  O  O     . PRO C  1 263 ? 27.970  -30.560 1.700   1.00 42.24 ? 1236 PRO C O     1 
ATOM   6387  C  CB    . PRO C  1 263 ? 25.848  -28.538 3.248   1.00 28.37 ? 1236 PRO C CB    1 
ATOM   6388  C  CG    . PRO C  1 263 ? 24.628  -27.724 3.141   1.00 27.98 ? 1236 PRO C CG    1 
ATOM   6389  C  CD    . PRO C  1 263 ? 23.889  -28.147 1.914   1.00 28.92 ? 1236 PRO C CD    1 
ATOM   6390  N  N     . GLU C  1 264 ? 25.871  -31.375 1.975   1.00 40.51 ? 1237 GLU C N     1 
ATOM   6391  C  CA    . GLU C  1 264 ? 26.277  -32.780 2.131   1.00 40.64 ? 1237 GLU C CA    1 
ATOM   6392  C  C     . GLU C  1 264 ? 26.508  -33.487 0.794   1.00 38.41 ? 1237 GLU C C     1 
ATOM   6393  O  O     . GLU C  1 264 ? 26.987  -34.618 0.754   1.00 44.90 ? 1237 GLU C O     1 
ATOM   6394  C  CB    . GLU C  1 264 ? 25.279  -33.561 3.012   1.00 43.62 ? 1237 GLU C CB    1 
ATOM   6395  C  CG    . GLU C  1 264 ? 23.793  -33.183 2.851   1.00 48.36 ? 1237 GLU C CG    1 
ATOM   6396  C  CD    . GLU C  1 264 ? 23.354  -32.037 3.769   1.00 51.72 ? 1237 GLU C CD    1 
ATOM   6397  O  OE1   . GLU C  1 264 ? 22.690  -31.102 3.278   1.00 48.95 ? 1237 GLU C OE1   1 
ATOM   6398  O  OE2   . GLU C  1 264 ? 23.670  -32.063 4.979   1.00 52.94 ? 1237 GLU C OE2   1 
ATOM   6399  N  N     . ARG C  1 265 ? 26.172  -32.814 -0.299  1.00 36.14 ? 1238 ARG C N     1 
ATOM   6400  C  CA    . ARG C  1 265 ? 26.475  -33.327 -1.624  1.00 33.32 ? 1238 ARG C CA    1 
ATOM   6401  C  C     . ARG C  1 265 ? 27.713  -32.633 -2.223  1.00 34.27 ? 1238 ARG C C     1 
ATOM   6402  O  O     . ARG C  1 265 ? 28.238  -33.070 -3.248  1.00 34.33 ? 1238 ARG C O     1 
ATOM   6403  C  CB    . ARG C  1 265 ? 25.264  -33.175 -2.549  1.00 36.33 ? 1238 ARG C CB    1 
ATOM   6404  C  CG    . ARG C  1 265 ? 23.964  -33.821 -2.039  1.00 33.55 ? 1238 ARG C CG    1 
ATOM   6405  C  CD    . ARG C  1 265 ? 22.847  -33.676 -3.066  1.00 32.42 ? 1238 ARG C CD    1 
ATOM   6406  N  NE    . ARG C  1 265 ? 22.947  -34.690 -4.118  1.00 48.75 ? 1238 ARG C NE    1 
ATOM   6407  C  CZ    . ARG C  1 265 ? 22.089  -34.830 -5.127  1.00 51.54 ? 1238 ARG C CZ    1 
ATOM   6408  N  NH1   . ARG C  1 265 ? 21.040  -34.018 -5.252  1.00 54.95 ? 1238 ARG C NH1   1 
ATOM   6409  N  NH2   . ARG C  1 265 ? 22.282  -35.793 -6.017  1.00 47.03 ? 1238 ARG C NH2   1 
ATOM   6410  N  N     . ARG C  1 266 ? 28.172  -31.567 -1.566  1.00 30.72 ? 1239 ARG C N     1 
ATOM   6411  C  CA    . ARG C  1 266 ? 29.288  -30.736 -2.039  1.00 32.23 ? 1239 ARG C CA    1 
ATOM   6412  C  C     . ARG C  1 266 ? 30.665  -31.371 -1.815  1.00 29.09 ? 1239 ARG C C     1 
ATOM   6413  O  O     . ARG C  1 266 ? 30.969  -31.852 -0.714  1.00 20.34 ? 1239 ARG C O     1 
ATOM   6414  C  CB    . ARG C  1 266 ? 29.228  -29.371 -1.348  1.00 33.90 ? 1239 ARG C CB    1 
ATOM   6415  C  CG    . ARG C  1 266 ? 30.234  -28.319 -1.824  1.00 32.13 ? 1239 ARG C CG    1 
ATOM   6416  C  CD    . ARG C  1 266 ? 30.078  -27.044 -0.995  1.00 28.14 ? 1239 ARG C CD    1 
ATOM   6417  N  NE    . ARG C  1 266 ? 28.740  -26.476 -1.159  1.00 32.84 ? 1239 ARG C NE    1 
ATOM   6418  C  CZ    . ARG C  1 266 ? 28.051  -25.845 -0.210  1.00 31.30 ? 1239 ARG C CZ    1 
ATOM   6419  N  NH1   . ARG C  1 266 ? 28.556  -25.692 1.007   1.00 27.29 ? 1239 ARG C NH1   1 
ATOM   6420  N  NH2   . ARG C  1 266 ? 26.837  -25.379 -0.479  1.00 36.93 ? 1239 ARG C NH2   1 
ATOM   6421  N  N     . THR C  1 267 ? 31.490  -31.353 -2.865  1.00 31.83 ? 1240 THR C N     1 
ATOM   6422  C  CA    . THR C  1 267 ? 32.900  -31.804 -2.807  1.00 32.78 ? 1240 THR C CA    1 
ATOM   6423  C  C     . THR C  1 267 ? 33.582  -31.450 -1.489  1.00 27.95 ? 1240 THR C C     1 
ATOM   6424  O  O     . THR C  1 267 ? 33.488  -30.309 -1.021  1.00 30.78 ? 1240 THR C O     1 
ATOM   6425  C  CB    . THR C  1 267 ? 33.723  -31.218 -3.970  1.00 28.88 ? 1240 THR C CB    1 
ATOM   6426  O  OG1   . THR C  1 267 ? 33.115  -31.581 -5.209  1.00 41.30 ? 1240 THR C OG1   1 
ATOM   6427  C  CG2   . THR C  1 267 ? 35.153  -31.736 -3.962  1.00 27.02 ? 1240 THR C CG2   1 
ATOM   6428  N  N     . THR C  1 268 ? 34.245  -32.438 -0.892  1.00 26.77 ? 1241 THR C N     1 
ATOM   6429  C  CA    . THR C  1 268 ? 35.010  -32.250 0.347   1.00 29.78 ? 1241 THR C CA    1 
ATOM   6430  C  C     . THR C  1 268 ? 36.441  -31.794 0.000   1.00 27.39 ? 1241 THR C C     1 
ATOM   6431  O  O     . THR C  1 268 ? 36.826  -31.834 -1.167  1.00 28.02 ? 1241 THR C O     1 
ATOM   6432  C  CB    . THR C  1 268 ? 35.003  -33.537 1.223   1.00 32.12 ? 1241 THR C CB    1 
ATOM   6433  O  OG1   . THR C  1 268 ? 35.702  -33.298 2.451   1.00 46.17 ? 1241 THR C OG1   1 
ATOM   6434  C  CG2   . THR C  1 268 ? 35.655  -34.710 0.509   1.00 30.80 ? 1241 THR C CG2   1 
ATOM   6435  N  N     . LEU C  1 269 ? 37.205  -31.334 0.990   1.00 23.48 ? 1242 LEU C N     1 
ATOM   6436  C  CA    . LEU C  1 269 ? 38.624  -30.990 0.776   1.00 25.33 ? 1242 LEU C CA    1 
ATOM   6437  C  C     . LEU C  1 269 ? 39.471  -32.218 0.430   1.00 30.17 ? 1242 LEU C C     1 
ATOM   6438  O  O     . LEU C  1 269 ? 40.324  -32.169 -0.458  1.00 33.36 ? 1242 LEU C O     1 
ATOM   6439  C  CB    . LEU C  1 269 ? 39.222  -30.269 1.988   1.00 16.34 ? 1242 LEU C CB    1 
ATOM   6440  C  CG    . LEU C  1 269 ? 40.652  -29.719 1.828   1.00 24.92 ? 1242 LEU C CG    1 
ATOM   6441  C  CD1   . LEU C  1 269 ? 40.737  -28.444 0.950   1.00 15.96 ? 1242 LEU C CD1   1 
ATOM   6442  C  CD2   . LEU C  1 269 ? 41.250  -29.474 3.183   1.00 13.74 ? 1242 LEU C CD2   1 
ATOM   6443  N  N     . GLU C  1 270 ? 39.223  -33.317 1.135   1.00 35.79 ? 1243 GLU C N     1 
ATOM   6444  C  CA    . GLU C  1 270 ? 39.890  -34.592 0.864   1.00 38.51 ? 1243 GLU C CA    1 
ATOM   6445  C  C     . GLU C  1 270 ? 39.747  -35.010 -0.611  1.00 36.58 ? 1243 GLU C C     1 
ATOM   6446  O  O     . GLU C  1 270 ? 40.714  -35.459 -1.224  1.00 42.94 ? 1243 GLU C O     1 
ATOM   6447  C  CB    . GLU C  1 270 ? 39.364  -35.675 1.813   1.00 39.23 ? 1243 GLU C CB    1 
ATOM   6448  C  CG    . GLU C  1 270 ? 39.767  -35.494 3.295   1.00 44.69 ? 1243 GLU C CG    1 
ATOM   6449  C  CD    . GLU C  1 270 ? 39.156  -34.251 3.970   1.00 55.96 ? 1243 GLU C CD    1 
ATOM   6450  O  OE1   . GLU C  1 270 ? 38.079  -33.775 3.537   1.00 50.53 ? 1243 GLU C OE1   1 
ATOM   6451  O  OE2   . GLU C  1 270 ? 39.761  -33.749 4.946   1.00 52.41 ? 1243 GLU C OE2   1 
ATOM   6452  N  N     . LYS C  1 271 ? 38.552  -34.832 -1.172  1.00 35.25 ? 1244 LYS C N     1 
ATOM   6453  C  CA    . LYS C  1 271 ? 38.290  -35.088 -2.591  1.00 36.66 ? 1244 LYS C CA    1 
ATOM   6454  C  C     . LYS C  1 271 ? 38.904  -34.017 -3.506  1.00 39.21 ? 1244 LYS C C     1 
ATOM   6455  O  O     . LYS C  1 271 ? 39.336  -34.322 -4.621  1.00 42.53 ? 1244 LYS C O     1 
ATOM   6456  C  CB    . LYS C  1 271 ? 36.779  -35.168 -2.844  1.00 35.03 ? 1244 LYS C CB    1 
ATOM   6457  C  CG    . LYS C  1 271 ? 36.378  -35.808 -4.179  1.00 37.94 ? 1244 LYS C CG    1 
ATOM   6458  C  CD    . LYS C  1 271 ? 34.931  -35.505 -4.603  1.00 40.21 ? 1244 LYS C CD    1 
ATOM   6459  C  CE    . LYS C  1 271 ? 33.874  -36.074 -3.650  1.00 38.26 ? 1244 LYS C CE    1 
ATOM   6460  N  NZ    . LYS C  1 271 ? 33.587  -35.165 -2.489  1.00 33.22 ? 1244 LYS C NZ    1 
ATOM   6461  N  N     . LEU C  1 272 ? 38.912  -32.765 -3.043  1.00 39.21 ? 1245 LEU C N     1 
ATOM   6462  C  CA    . LEU C  1 272 ? 39.415  -31.633 -3.829  1.00 38.09 ? 1245 LEU C CA    1 
ATOM   6463  C  C     . LEU C  1 272 ? 40.894  -31.782 -4.189  1.00 34.68 ? 1245 LEU C C     1 
ATOM   6464  O  O     . LEU C  1 272 ? 41.276  -31.610 -5.345  1.00 34.36 ? 1245 LEU C O     1 
ATOM   6465  C  CB    . LEU C  1 272 ? 39.224  -30.320 -3.062  1.00 37.68 ? 1245 LEU C CB    1 
ATOM   6466  C  CG    . LEU C  1 272 ? 38.890  -29.022 -3.806  1.00 28.28 ? 1245 LEU C CG    1 
ATOM   6467  C  CD1   . LEU C  1 272 ? 39.515  -27.846 -3.078  1.00 33.14 ? 1245 LEU C CD1   1 
ATOM   6468  C  CD2   . LEU C  1 272 ? 39.319  -29.031 -5.259  1.00 22.73 ? 1245 LEU C CD2   1 
ATOM   6469  N  N     . VAL C  1 273 ? 41.710  -32.093 -3.184  1.00 35.91 ? 1246 VAL C N     1 
ATOM   6470  C  CA    . VAL C  1 273 ? 43.159  -32.238 -3.340  1.00 39.85 ? 1246 VAL C CA    1 
ATOM   6471  C  C     . VAL C  1 273 ? 43.537  -33.344 -4.336  1.00 42.50 ? 1246 VAL C C     1 
ATOM   6472  O  O     . VAL C  1 273 ? 44.552  -33.240 -5.030  1.00 45.19 ? 1246 VAL C O     1 
ATOM   6473  C  CB    . VAL C  1 273 ? 43.848  -32.512 -1.977  1.00 38.23 ? 1246 VAL C CB    1 
ATOM   6474  C  CG1   . VAL C  1 273 ? 45.374  -32.444 -2.108  1.00 43.68 ? 1246 VAL C CG1   1 
ATOM   6475  C  CG2   . VAL C  1 273 ? 43.380  -31.526 -0.939  1.00 30.34 ? 1246 VAL C CG2   1 
ATOM   6476  N  N     . THR C  1 274 ? 42.705  -34.382 -4.407  1.00 43.76 ? 1247 THR C N     1 
ATOM   6477  C  CA    . THR C  1 274 ? 42.976  -35.572 -5.221  1.00 44.98 ? 1247 THR C CA    1 
ATOM   6478  C  C     . THR C  1 274 ? 42.420  -35.473 -6.647  1.00 42.48 ? 1247 THR C C     1 
ATOM   6479  O  O     . THR C  1 274 ? 42.560  -36.405 -7.439  1.00 44.70 ? 1247 THR C O     1 
ATOM   6480  C  CB    . THR C  1 274 ? 42.472  -36.871 -4.503  1.00 43.81 ? 1247 THR C CB    1 
ATOM   6481  O  OG1   . THR C  1 274 ? 43.208  -38.001 -4.975  1.00 54.71 ? 1247 THR C OG1   1 
ATOM   6482  C  CG2   . THR C  1 274 ? 40.976  -37.113 -4.725  1.00 48.22 ? 1247 THR C CG2   1 
ATOM   6483  N  N     . ASP C  1 275 ? 41.806  -34.335 -6.961  1.00 41.12 ? 1248 ASP C N     1 
ATOM   6484  C  CA    . ASP C  1 275 ? 41.134  -34.094 -8.240  1.00 38.97 ? 1248 ASP C CA    1 
ATOM   6485  C  C     . ASP C  1 275 ? 42.115  -34.036 -9.420  1.00 39.74 ? 1248 ASP C C     1 
ATOM   6486  O  O     . ASP C  1 275 ? 43.183  -33.429 -9.298  1.00 40.58 ? 1248 ASP C O     1 
ATOM   6487  C  CB    . ASP C  1 275 ? 40.335  -32.792 -8.140  1.00 38.82 ? 1248 ASP C CB    1 
ATOM   6488  C  CG    . ASP C  1 275 ? 39.403  -32.572 -9.313  1.00 43.48 ? 1248 ASP C CG    1 
ATOM   6489  O  OD1   . ASP C  1 275 ? 39.880  -32.191 -10.400 1.00 45.74 ? 1248 ASP C OD1   1 
ATOM   6490  O  OD2   . ASP C  1 275 ? 38.180  -32.758 -9.139  1.00 55.83 ? 1248 ASP C OD2   1 
ATOM   6491  N  N     . PRO C  1 276 ? 41.765  -34.686 -10.554 1.00 36.63 ? 1249 PRO C N     1 
ATOM   6492  C  CA    . PRO C  1 276 ? 42.597  -34.696 -11.772 1.00 35.29 ? 1249 PRO C CA    1 
ATOM   6493  C  C     . PRO C  1 276 ? 42.837  -33.324 -12.430 1.00 37.24 ? 1249 PRO C C     1 
ATOM   6494  O  O     . PRO C  1 276 ? 43.897  -33.116 -13.032 1.00 35.54 ? 1249 PRO C O     1 
ATOM   6495  C  CB    . PRO C  1 276 ? 41.824  -35.622 -12.729 1.00 33.68 ? 1249 PRO C CB    1 
ATOM   6496  C  CG    . PRO C  1 276 ? 40.942  -36.439 -11.854 1.00 36.87 ? 1249 PRO C CG    1 
ATOM   6497  C  CD    . PRO C  1 276 ? 40.558  -35.518 -10.727 1.00 35.92 ? 1249 PRO C CD    1 
ATOM   6498  N  N     . TRP C  1 277 ? 41.872  -32.409 -12.336 1.00 36.42 ? 1250 TRP C N     1 
ATOM   6499  C  CA    . TRP C  1 277 ? 42.092  -31.036 -12.801 1.00 35.50 ? 1250 TRP C CA    1 
ATOM   6500  C  C     . TRP C  1 277 ? 43.105  -30.288 -11.927 1.00 36.78 ? 1250 TRP C C     1 
ATOM   6501  O  O     . TRP C  1 277 ? 43.957  -29.563 -12.447 1.00 37.76 ? 1250 TRP C O     1 
ATOM   6502  C  CB    . TRP C  1 277 ? 40.787  -30.243 -12.890 1.00 32.08 ? 1250 TRP C CB    1 
ATOM   6503  C  CG    . TRP C  1 277 ? 40.945  -28.997 -13.721 1.00 31.31 ? 1250 TRP C CG    1 
ATOM   6504  C  CD1   . TRP C  1 277 ? 40.879  -28.904 -15.089 1.00 27.54 ? 1250 TRP C CD1   1 
ATOM   6505  C  CD2   . TRP C  1 277 ? 41.232  -27.677 -13.242 1.00 24.53 ? 1250 TRP C CD2   1 
ATOM   6506  N  NE1   . TRP C  1 277 ? 41.085  -27.607 -15.483 1.00 24.78 ? 1250 TRP C NE1   1 
ATOM   6507  C  CE2   . TRP C  1 277 ? 41.301  -26.831 -14.370 1.00 29.30 ? 1250 TRP C CE2   1 
ATOM   6508  C  CE3   . TRP C  1 277 ? 41.419  -27.122 -11.963 1.00 28.07 ? 1250 TRP C CE3   1 
ATOM   6509  C  CZ2   . TRP C  1 277 ? 41.561  -25.456 -14.261 1.00 21.69 ? 1250 TRP C CZ2   1 
ATOM   6510  C  CZ3   . TRP C  1 277 ? 41.667  -25.755 -11.857 1.00 26.10 ? 1250 TRP C CZ3   1 
ATOM   6511  C  CH2   . TRP C  1 277 ? 41.737  -24.941 -13.002 1.00 22.18 ? 1250 TRP C CH2   1 
ATOM   6512  N  N     . VAL C  1 278 ? 43.007  -30.488 -10.611 1.00 36.10 ? 1251 VAL C N     1 
ATOM   6513  C  CA    . VAL C  1 278 ? 43.881  -29.847 -9.618  1.00 33.00 ? 1251 VAL C CA    1 
ATOM   6514  C  C     . VAL C  1 278 ? 45.323  -30.353 -9.713  1.00 33.10 ? 1251 VAL C C     1 
ATOM   6515  O  O     . VAL C  1 278 ? 46.265  -29.602 -9.465  1.00 30.81 ? 1251 VAL C O     1 
ATOM   6516  C  CB    . VAL C  1 278 ? 43.319  -30.043 -8.162  1.00 31.48 ? 1251 VAL C CB    1 
ATOM   6517  C  CG1   . VAL C  1 278 ? 44.309  -29.590 -7.092  1.00 28.81 ? 1251 VAL C CG1   1 
ATOM   6518  C  CG2   . VAL C  1 278 ? 41.994  -29.306 -7.987  1.00 23.97 ? 1251 VAL C CG2   1 
ATOM   6519  N  N     . THR C  1 279 ? 45.479  -31.627 -10.082 1.00 36.68 ? 1252 THR C N     1 
ATOM   6520  C  CA    . THR C  1 279 ? 46.784  -32.291 -10.125 1.00 35.51 ? 1252 THR C CA    1 
ATOM   6521  C  C     . THR C  1 279 ? 47.418  -32.377 -11.524 1.00 37.89 ? 1252 THR C C     1 
ATOM   6522  O  O     . THR C  1 279 ? 48.566  -32.797 -11.649 1.00 41.00 ? 1252 THR C O     1 
ATOM   6523  C  CB    . THR C  1 279 ? 46.723  -33.703 -9.503  1.00 37.59 ? 1252 THR C CB    1 
ATOM   6524  O  OG1   . THR C  1 279 ? 45.580  -34.410 -10.007 1.00 39.63 ? 1252 THR C OG1   1 
ATOM   6525  C  CG2   . THR C  1 279 ? 46.643  -33.622 -7.978  1.00 39.51 ? 1252 THR C CG2   1 
ATOM   6526  N  N     . GLN C  1 280 ? 46.686  -31.951 -12.556 1.00 38.95 ? 1253 GLN C N     1 
ATOM   6527  C  CA    . GLN C  1 280 ? 47.113  -32.090 -13.962 1.00 37.27 ? 1253 GLN C CA    1 
ATOM   6528  C  C     . GLN C  1 280 ? 48.544  -31.615 -14.262 1.00 43.49 ? 1253 GLN C C     1 
ATOM   6529  O  O     . GLN C  1 280 ? 49.044  -30.692 -13.607 1.00 45.07 ? 1253 GLN C O     1 
ATOM   6530  C  CB    . GLN C  1 280 ? 46.110  -31.416 -14.914 1.00 35.43 ? 1253 GLN C CB    1 
ATOM   6531  C  CG    . GLN C  1 280 ? 46.056  -29.893 -14.838 1.00 33.23 ? 1253 GLN C CG    1 
ATOM   6532  C  CD    . GLN C  1 280 ? 45.173  -29.278 -15.910 1.00 32.93 ? 1253 GLN C CD    1 
ATOM   6533  O  OE1   . GLN C  1 280 ? 44.090  -28.771 -15.623 1.00 33.08 ? 1253 GLN C OE1   1 
ATOM   6534  N  NE2   . GLN C  1 280 ? 45.633  -29.317 -17.150 1.00 39.75 ? 1253 GLN C NE2   1 
ATOM   6535  N  N     . PRO C  1 281 ? 49.214  -32.259 -15.244 1.00 45.93 ? 1254 PRO C N     1 
ATOM   6536  C  CA    . PRO C  1 281 ? 50.529  -31.796 -15.698 1.00 44.54 ? 1254 PRO C CA    1 
ATOM   6537  C  C     . PRO C  1 281 ? 50.519  -30.330 -16.127 1.00 43.61 ? 1254 PRO C C     1 
ATOM   6538  O  O     . PRO C  1 281 ? 49.624  -29.902 -16.860 1.00 41.61 ? 1254 PRO C O     1 
ATOM   6539  C  CB    . PRO C  1 281 ? 50.817  -32.697 -16.907 1.00 44.89 ? 1254 PRO C CB    1 
ATOM   6540  C  CG    . PRO C  1 281 ? 50.067  -33.948 -16.618 1.00 48.11 ? 1254 PRO C CG    1 
ATOM   6541  C  CD    . PRO C  1 281 ? 48.793  -33.482 -15.957 1.00 46.85 ? 1254 PRO C CD    1 
ATOM   6542  N  N     . VAL C  1 282 ? 51.504  -29.574 -15.648 1.00 42.82 ? 1255 VAL C N     1 
ATOM   6543  C  CA    . VAL C  1 282 ? 51.709  -28.191 -16.076 1.00 41.88 ? 1255 VAL C CA    1 
ATOM   6544  C  C     . VAL C  1 282 ? 53.212  -27.920 -16.278 1.00 43.28 ? 1255 VAL C C     1 
ATOM   6545  O  O     . VAL C  1 282 ? 54.032  -28.185 -15.396 1.00 43.43 ? 1255 VAL C O     1 
ATOM   6546  C  CB    . VAL C  1 282 ? 51.023  -27.156 -15.106 1.00 40.69 ? 1255 VAL C CB    1 
ATOM   6547  C  CG1   . VAL C  1 282 ? 51.585  -27.252 -13.676 1.00 35.81 ? 1255 VAL C CG1   1 
ATOM   6548  C  CG2   . VAL C  1 282 ? 51.128  -25.734 -15.649 1.00 30.42 ? 1255 VAL C CG2   1 
ATOM   6549  N  N     . ASN C  1 283 ? 53.558  -27.431 -17.465 1.00 44.66 ? 1256 ASN C N     1 
ATOM   6550  C  CA    . ASN C  1 283 ? 54.920  -27.013 -17.767 1.00 42.35 ? 1256 ASN C CA    1 
ATOM   6551  C  C     . ASN C  1 283 ? 55.011  -25.499 -17.669 1.00 38.00 ? 1256 ASN C C     1 
ATOM   6552  O  O     . ASN C  1 283 ? 54.541  -24.774 -18.556 1.00 36.19 ? 1256 ASN C O     1 
ATOM   6553  C  CB    . ASN C  1 283 ? 55.350  -27.495 -19.157 1.00 45.07 ? 1256 ASN C CB    1 
ATOM   6554  C  CG    . ASN C  1 283 ? 56.860  -27.464 -19.346 1.00 46.65 ? 1256 ASN C CG    1 
ATOM   6555  O  OD1   . ASN C  1 283 ? 57.464  -26.398 -19.463 1.00 44.47 ? 1256 ASN C OD1   1 
ATOM   6556  N  ND2   . ASN C  1 283 ? 57.475  -28.641 -19.378 1.00 49.30 ? 1256 ASN C ND2   1 
ATOM   6557  N  N     . LEU C  1 284 ? 55.613  -25.037 -16.579 1.00 35.07 ? 1257 LEU C N     1 
ATOM   6558  C  CA    . LEU C  1 284 ? 55.685  -23.615 -16.256 1.00 36.31 ? 1257 LEU C CA    1 
ATOM   6559  C  C     . LEU C  1 284 ? 56.551  -22.793 -17.207 1.00 37.28 ? 1257 LEU C C     1 
ATOM   6560  O  O     . LEU C  1 284 ? 56.328  -21.593 -17.362 1.00 35.61 ? 1257 LEU C O     1 
ATOM   6561  C  CB    . LEU C  1 284 ? 56.156  -23.423 -14.812 1.00 38.09 ? 1257 LEU C CB    1 
ATOM   6562  C  CG    . LEU C  1 284 ? 55.133  -23.624 -13.692 1.00 35.97 ? 1257 LEU C CG    1 
ATOM   6563  C  CD1   . LEU C  1 284 ? 55.831  -23.571 -12.341 1.00 35.14 ? 1257 LEU C CD1   1 
ATOM   6564  C  CD2   . LEU C  1 284 ? 54.023  -22.579 -13.768 1.00 30.31 ? 1257 LEU C CD2   1 
ATOM   6565  N  N     . ALA C  1 285 ? 57.528  -23.442 -17.844 1.00 43.43 ? 1258 ALA C N     1 
ATOM   6566  C  CA    . ALA C  1 285 ? 58.401  -22.791 -18.831 1.00 45.58 ? 1258 ALA C CA    1 
ATOM   6567  C  C     . ALA C  1 285 ? 57.636  -22.321 -20.077 1.00 48.96 ? 1258 ALA C C     1 
ATOM   6568  O  O     . ALA C  1 285 ? 58.133  -21.484 -20.847 1.00 50.06 ? 1258 ALA C O     1 
ATOM   6569  C  CB    . ALA C  1 285 ? 59.538  -23.714 -19.219 1.00 47.51 ? 1258 ALA C CB    1 
ATOM   6570  N  N     . ASP C  1 286 ? 56.427  -22.857 -20.258 1.00 45.60 ? 1259 ASP C N     1 
ATOM   6571  C  CA    . ASP C  1 286 ? 55.536  -22.457 -21.346 1.00 44.77 ? 1259 ASP C CA    1 
ATOM   6572  C  C     . ASP C  1 286 ? 54.878  -21.103 -21.099 1.00 43.08 ? 1259 ASP C C     1 
ATOM   6573  O  O     . ASP C  1 286 ? 54.226  -20.558 -21.996 1.00 43.67 ? 1259 ASP C O     1 
ATOM   6574  C  CB    . ASP C  1 286 ? 54.441  -23.515 -21.565 1.00 46.43 ? 1259 ASP C CB    1 
ATOM   6575  C  CG    . ASP C  1 286 ? 54.966  -24.794 -22.205 1.00 51.38 ? 1259 ASP C CG    1 
ATOM   6576  O  OD1   . ASP C  1 286 ? 56.040  -25.290 -21.795 1.00 56.60 ? 1259 ASP C OD1   1 
ATOM   6577  O  OD2   . ASP C  1 286 ? 54.291  -25.314 -23.118 1.00 51.16 ? 1259 ASP C OD2   1 
ATOM   6578  N  N     . TYR C  1 287 ? 55.039  -20.563 -19.890 1.00 43.06 ? 1260 TYR C N     1 
ATOM   6579  C  CA    . TYR C  1 287 ? 54.313  -19.349 -19.501 1.00 42.57 ? 1260 TYR C CA    1 
ATOM   6580  C  C     . TYR C  1 287 ? 55.210  -18.174 -19.135 1.00 42.52 ? 1260 TYR C C     1 
ATOM   6581  O  O     . TYR C  1 287 ? 56.181  -18.316 -18.382 1.00 41.94 ? 1260 TYR C O     1 
ATOM   6582  C  CB    . TYR C  1 287 ? 53.302  -19.650 -18.383 1.00 41.09 ? 1260 TYR C CB    1 
ATOM   6583  C  CG    . TYR C  1 287 ? 52.369  -20.795 -18.725 1.00 32.02 ? 1260 TYR C CG    1 
ATOM   6584  C  CD1   . TYR C  1 287 ? 51.335  -20.629 -19.645 1.00 30.09 ? 1260 TYR C CD1   1 
ATOM   6585  C  CD2   . TYR C  1 287 ? 52.536  -22.049 -18.142 1.00 33.02 ? 1260 TYR C CD2   1 
ATOM   6586  C  CE1   . TYR C  1 287 ? 50.485  -21.687 -19.976 1.00 33.01 ? 1260 TYR C CE1   1 
ATOM   6587  C  CE2   . TYR C  1 287 ? 51.692  -23.111 -18.463 1.00 36.84 ? 1260 TYR C CE2   1 
ATOM   6588  C  CZ    . TYR C  1 287 ? 50.669  -22.923 -19.377 1.00 36.35 ? 1260 TYR C CZ    1 
ATOM   6589  O  OH    . TYR C  1 287 ? 49.835  -23.976 -19.687 1.00 39.11 ? 1260 TYR C OH    1 
ATOM   6590  N  N     . THR C  1 288 ? 54.870  -17.017 -19.695 1.00 41.64 ? 1261 THR C N     1 
ATOM   6591  C  CA    . THR C  1 288 ? 55.592  -15.775 -19.451 1.00 41.84 ? 1261 THR C CA    1 
ATOM   6592  C  C     . THR C  1 288 ? 54.622  -14.758 -18.866 1.00 38.90 ? 1261 THR C C     1 
ATOM   6593  O  O     . THR C  1 288 ? 53.512  -14.605 -19.371 1.00 41.56 ? 1261 THR C O     1 
ATOM   6594  C  CB    . THR C  1 288 ? 56.219  -15.224 -20.760 1.00 43.59 ? 1261 THR C CB    1 
ATOM   6595  O  OG1   . THR C  1 288 ? 56.957  -16.265 -21.414 1.00 43.64 ? 1261 THR C OG1   1 
ATOM   6596  C  CG2   . THR C  1 288 ? 57.152  -14.047 -20.477 1.00 40.79 ? 1261 THR C CG2   1 
ATOM   6597  N  N     . TRP C  1 289 ? 55.045  -14.078 -17.801 1.00 36.46 ? 1262 TRP C N     1 
ATOM   6598  C  CA    . TRP C  1 289 ? 54.218  -13.090 -17.109 1.00 34.70 ? 1262 TRP C CA    1 
ATOM   6599  C  C     . TRP C  1 289 ? 53.750  -11.959 -18.028 1.00 36.26 ? 1262 TRP C C     1 
ATOM   6600  O  O     . TRP C  1 289 ? 52.582  -11.562 -17.993 1.00 36.22 ? 1262 TRP C O     1 
ATOM   6601  C  CB    . TRP C  1 289 ? 54.967  -12.515 -15.893 1.00 38.26 ? 1262 TRP C CB    1 
ATOM   6602  C  CG    . TRP C  1 289 ? 54.178  -11.459 -15.150 1.00 43.06 ? 1262 TRP C CG    1 
ATOM   6603  C  CD1   . TRP C  1 289 ? 54.318  -10.100 -15.250 1.00 42.03 ? 1262 TRP C CD1   1 
ATOM   6604  C  CD2   . TRP C  1 289 ? 53.113  -11.684 -14.213 1.00 44.36 ? 1262 TRP C CD2   1 
ATOM   6605  N  NE1   . TRP C  1 289 ? 53.409  -9.467  -14.429 1.00 39.45 ? 1262 TRP C NE1   1 
ATOM   6606  C  CE2   . TRP C  1 289 ? 52.659  -10.415 -13.782 1.00 41.68 ? 1262 TRP C CE2   1 
ATOM   6607  C  CE3   . TRP C  1 289 ? 52.501  -12.835 -13.692 1.00 48.38 ? 1262 TRP C CE3   1 
ATOM   6608  C  CZ2   . TRP C  1 289 ? 51.620  -10.267 -12.853 1.00 43.60 ? 1262 TRP C CZ2   1 
ATOM   6609  C  CZ3   . TRP C  1 289 ? 51.469  -12.685 -12.767 1.00 44.24 ? 1262 TRP C CZ3   1 
ATOM   6610  C  CH2   . TRP C  1 289 ? 51.038  -11.410 -12.361 1.00 42.24 ? 1262 TRP C CH2   1 
ATOM   6611  N  N     . GLU C  1 290 ? 54.668  -11.447 -18.850 1.00 38.68 ? 1263 GLU C N     1 
ATOM   6612  C  CA    . GLU C  1 290 ? 54.388  -10.327 -19.751 1.00 37.66 ? 1263 GLU C CA    1 
ATOM   6613  C  C     . GLU C  1 290 ? 53.360  -10.672 -20.844 1.00 37.62 ? 1263 GLU C C     1 
ATOM   6614  O  O     . GLU C  1 290 ? 52.783  -9.778  -21.480 1.00 37.44 ? 1263 GLU C O     1 
ATOM   6615  C  CB    . GLU C  1 290 ? 55.696  -9.810  -20.367 1.00 38.98 ? 1263 GLU C CB    1 
ATOM   6616  N  N     . GLU C  1 291 ? 53.123  -11.966 -21.041 1.00 35.58 ? 1264 GLU C N     1 
ATOM   6617  C  CA    . GLU C  1 291 ? 52.188  -12.446 -22.060 1.00 38.63 ? 1264 GLU C CA    1 
ATOM   6618  C  C     . GLU C  1 291 ? 50.841  -12.878 -21.463 1.00 38.72 ? 1264 GLU C C     1 
ATOM   6619  O  O     . GLU C  1 291 ? 49.822  -12.878 -22.149 1.00 37.56 ? 1264 GLU C O     1 
ATOM   6620  C  CB    . GLU C  1 291 ? 52.818  -13.594 -22.848 1.00 39.44 ? 1264 GLU C CB    1 
ATOM   6621  C  CG    . GLU C  1 291 ? 54.220  -13.277 -23.378 1.00 43.28 ? 1264 GLU C CG    1 
ATOM   6622  C  CD    . GLU C  1 291 ? 54.829  -14.395 -24.201 1.00 40.33 ? 1264 GLU C CD    1 
ATOM   6623  O  OE1   . GLU C  1 291 ? 54.206  -15.470 -24.330 1.00 46.79 ? 1264 GLU C OE1   1 
ATOM   6624  O  OE2   . GLU C  1 291 ? 55.945  -14.196 -24.720 1.00 46.17 ? 1264 GLU C OE2   1 
ATOM   6625  N  N     . VAL C  1 292 ? 50.853  -13.249 -20.186 1.00 36.84 ? 1265 VAL C N     1 
ATOM   6626  C  CA    . VAL C  1 292 ? 49.633  -13.583 -19.447 1.00 35.68 ? 1265 VAL C CA    1 
ATOM   6627  C  C     . VAL C  1 292 ? 48.977  -12.311 -18.869 1.00 36.61 ? 1265 VAL C C     1 
ATOM   6628  O  O     . VAL C  1 292 ? 47.759  -12.128 -18.963 1.00 31.64 ? 1265 VAL C O     1 
ATOM   6629  C  CB    . VAL C  1 292 ? 49.931  -14.614 -18.328 1.00 32.05 ? 1265 VAL C CB    1 
ATOM   6630  C  CG1   . VAL C  1 292 ? 48.690  -14.900 -17.498 1.00 40.17 ? 1265 VAL C CG1   1 
ATOM   6631  C  CG2   . VAL C  1 292 ? 50.500  -15.911 -18.923 1.00 21.83 ? 1265 VAL C CG2   1 
ATOM   6632  N  N     . PHE C  1 293 ? 49.804  -11.440 -18.289 1.00 37.41 ? 1266 PHE C N     1 
ATOM   6633  C  CA    . PHE C  1 293 ? 49.353  -10.209 -17.644 1.00 36.04 ? 1266 PHE C CA    1 
ATOM   6634  C  C     . PHE C  1 293 ? 50.027  -9.011  -18.312 1.00 36.72 ? 1266 PHE C C     1 
ATOM   6635  O  O     . PHE C  1 293 ? 51.253  -8.892  -18.303 1.00 38.96 ? 1266 PHE C O     1 
ATOM   6636  C  CB    . PHE C  1 293 ? 49.675  -10.266 -16.148 1.00 33.77 ? 1266 PHE C CB    1 
ATOM   6637  C  CG    . PHE C  1 293 ? 49.092  -9.132  -15.347 1.00 38.12 ? 1266 PHE C CG    1 
ATOM   6638  C  CD1   . PHE C  1 293 ? 47.725  -9.063  -15.099 1.00 34.20 ? 1266 PHE C CD1   1 
ATOM   6639  C  CD2   . PHE C  1 293 ? 49.917  -8.142  -14.820 1.00 38.73 ? 1266 PHE C CD2   1 
ATOM   6640  C  CE1   . PHE C  1 293 ? 47.195  -8.025  -14.344 1.00 40.84 ? 1266 PHE C CE1   1 
ATOM   6641  C  CE2   . PHE C  1 293 ? 49.393  -7.099  -14.065 1.00 36.55 ? 1266 PHE C CE2   1 
ATOM   6642  C  CZ    . PHE C  1 293 ? 48.033  -7.038  -13.827 1.00 36.86 ? 1266 PHE C CZ    1 
ATOM   6643  N  N     . ARG C  1 294 ? 49.213  -8.133  -18.893 1.00 40.04 ? 1267 ARG C N     1 
ATOM   6644  C  CA    . ARG C  1 294 ? 49.694  -7.090  -19.803 1.00 44.46 ? 1267 ARG C CA    1 
ATOM   6645  C  C     . ARG C  1 294 ? 49.208  -5.702  -19.390 1.00 46.63 ? 1267 ARG C C     1 
ATOM   6646  O  O     . ARG C  1 294 ? 48.948  -4.841  -20.236 1.00 45.99 ? 1267 ARG C O     1 
ATOM   6647  C  CB    . ARG C  1 294 ? 49.244  -7.409  -21.237 1.00 44.32 ? 1267 ARG C CB    1 
ATOM   6648  C  CG    . ARG C  1 294 ? 49.924  -8.625  -21.829 1.00 43.97 ? 1267 ARG C CG    1 
ATOM   6649  C  CD    . ARG C  1 294 ? 48.922  -9.598  -22.399 1.00 38.17 ? 1267 ARG C CD    1 
ATOM   6650  N  NE    . ARG C  1 294 ? 48.786  -9.485  -23.845 1.00 43.45 ? 1267 ARG C NE    1 
ATOM   6651  C  CZ    . ARG C  1 294 ? 49.148  -10.423 -24.717 1.00 39.71 ? 1267 ARG C CZ    1 
ATOM   6652  N  NH1   . ARG C  1 294 ? 49.670  -11.567 -24.311 1.00 44.81 ? 1267 ARG C NH1   1 
ATOM   6653  N  NH2   . ARG C  1 294 ? 48.973  -10.222 -26.009 1.00 37.07 ? 1267 ARG C NH2   1 
ATOM   6654  N  N     . ALA D  1 9   ? 32.779  66.698  34.562  1.00 50.69 ? 982  ALA D N     1 
ATOM   6655  C  CA    . ALA D  1 9   ? 31.417  66.181  34.231  1.00 54.21 ? 982  ALA D CA    1 
ATOM   6656  C  C     . ALA D  1 9   ? 31.431  64.659  34.124  1.00 56.72 ? 982  ALA D C     1 
ATOM   6657  O  O     . ALA D  1 9   ? 31.811  64.103  33.089  1.00 57.98 ? 982  ALA D O     1 
ATOM   6658  C  CB    . ALA D  1 9   ? 30.908  66.809  32.946  1.00 52.60 ? 982  ALA D CB    1 
ATOM   6659  N  N     . VAL D  1 10  ? 31.010  63.998  35.202  1.00 57.83 ? 983  VAL D N     1 
ATOM   6660  C  CA    . VAL D  1 10  ? 31.082  62.536  35.323  1.00 55.30 ? 983  VAL D CA    1 
ATOM   6661  C  C     . VAL D  1 10  ? 30.042  61.843  34.435  1.00 54.30 ? 983  VAL D C     1 
ATOM   6662  O  O     . VAL D  1 10  ? 28.842  62.124  34.531  1.00 50.61 ? 983  VAL D O     1 
ATOM   6663  C  CB    . VAL D  1 10  ? 30.918  62.076  36.800  1.00 56.38 ? 983  VAL D CB    1 
ATOM   6664  C  CG1   . VAL D  1 10  ? 31.305  60.608  36.963  1.00 57.60 ? 983  VAL D CG1   1 
ATOM   6665  C  CG2   . VAL D  1 10  ? 31.743  62.958  37.741  1.00 56.77 ? 983  VAL D CG2   1 
ATOM   6666  N  N     . GLU D  1 11  ? 30.523  60.948  33.569  1.00 56.01 ? 984  GLU D N     1 
ATOM   6667  C  CA    . GLU D  1 11  ? 29.676  60.169  32.662  1.00 55.62 ? 984  GLU D CA    1 
ATOM   6668  C  C     . GLU D  1 11  ? 28.812  59.176  33.433  1.00 54.88 ? 984  GLU D C     1 
ATOM   6669  O  O     . GLU D  1 11  ? 29.314  58.429  34.275  1.00 55.08 ? 984  GLU D O     1 
ATOM   6670  C  CB    . GLU D  1 11  ? 30.529  59.409  31.641  1.00 55.36 ? 984  GLU D CB    1 
ATOM   6671  C  CG    . GLU D  1 11  ? 30.807  60.148  30.334  1.00 55.78 ? 984  GLU D CG    1 
ATOM   6672  C  CD    . GLU D  1 11  ? 31.653  59.322  29.370  1.00 56.08 ? 984  GLU D CD    1 
ATOM   6673  O  OE1   . GLU D  1 11  ? 31.325  59.272  28.162  1.00 52.74 ? 984  GLU D OE1   1 
ATOM   6674  O  OE2   . GLU D  1 11  ? 32.644  58.712  29.824  1.00 58.53 ? 984  GLU D OE2   1 
ATOM   6675  N  N     . LEU D  1 12  ? 27.516  59.173  33.136  1.00 53.33 ? 985  LEU D N     1 
ATOM   6676  C  CA    . LEU D  1 12  ? 26.580  58.265  33.788  1.00 50.49 ? 985  LEU D CA    1 
ATOM   6677  C  C     . LEU D  1 12  ? 26.400  57.017  32.925  1.00 51.41 ? 985  LEU D C     1 
ATOM   6678  O  O     . LEU D  1 12  ? 25.507  56.947  32.074  1.00 49.29 ? 985  LEU D O     1 
ATOM   6679  C  CB    . LEU D  1 12  ? 25.249  58.978  34.089  1.00 49.69 ? 985  LEU D CB    1 
ATOM   6680  C  CG    . LEU D  1 12  ? 25.090  59.801  35.385  1.00 45.61 ? 985  LEU D CG    1 
ATOM   6681  C  CD1   . LEU D  1 12  ? 26.408  60.271  36.001  1.00 44.88 ? 985  LEU D CD1   1 
ATOM   6682  C  CD2   . LEU D  1 12  ? 24.142  60.978  35.174  1.00 45.23 ? 985  LEU D CD2   1 
ATOM   6683  N  N     . GLU D  1 13  ? 27.267  56.036  33.174  1.00 52.01 ? 986  GLU D N     1 
ATOM   6684  C  CA    . GLU D  1 13  ? 27.436  54.860  32.315  1.00 52.00 ? 986  GLU D CA    1 
ATOM   6685  C  C     . GLU D  1 13  ? 26.620  53.638  32.757  1.00 50.97 ? 986  GLU D C     1 
ATOM   6686  O  O     . GLU D  1 13  ? 26.947  52.505  32.402  1.00 48.65 ? 986  GLU D O     1 
ATOM   6687  C  CB    . GLU D  1 13  ? 28.927  54.487  32.242  1.00 53.77 ? 986  GLU D CB    1 
ATOM   6688  C  CG    . GLU D  1 13  ? 29.835  55.527  31.569  1.00 58.09 ? 986  GLU D CG    1 
ATOM   6689  C  CD    . GLU D  1 13  ? 29.504  55.742  30.099  1.00 64.73 ? 986  GLU D CD    1 
ATOM   6690  O  OE1   . GLU D  1 13  ? 29.282  54.742  29.380  1.00 64.52 ? 986  GLU D OE1   1 
ATOM   6691  O  OE2   . GLU D  1 13  ? 29.466  56.914  29.662  1.00 61.13 ? 986  GLU D OE2   1 
ATOM   6692  N  N     . GLY D  1 14  ? 25.557  53.870  33.520  1.00 51.13 ? 987  GLY D N     1 
ATOM   6693  C  CA    . GLY D  1 14  ? 24.723  52.788  34.049  1.00 52.37 ? 987  GLY D CA    1 
ATOM   6694  C  C     . GLY D  1 14  ? 24.107  51.896  32.987  1.00 52.03 ? 987  GLY D C     1 
ATOM   6695  O  O     . GLY D  1 14  ? 24.182  50.670  33.083  1.00 51.11 ? 987  GLY D O     1 
ATOM   6696  N  N     . LEU D  1 15  ? 23.505  52.517  31.975  1.00 51.33 ? 988  LEU D N     1 
ATOM   6697  C  CA    . LEU D  1 15  ? 22.854  51.799  30.873  1.00 51.50 ? 988  LEU D CA    1 
ATOM   6698  C  C     . LEU D  1 15  ? 23.842  51.093  29.931  1.00 50.94 ? 988  LEU D C     1 
ATOM   6699  O  O     . LEU D  1 15  ? 23.579  49.977  29.466  1.00 50.98 ? 988  LEU D O     1 
ATOM   6700  C  CB    . LEU D  1 15  ? 21.950  52.750  30.078  1.00 52.93 ? 988  LEU D CB    1 
ATOM   6701  N  N     . ALA D  1 16  ? 24.974  51.743  29.666  1.00 48.48 ? 989  ALA D N     1 
ATOM   6702  C  CA    . ALA D  1 16  ? 25.998  51.215  28.757  1.00 45.42 ? 989  ALA D CA    1 
ATOM   6703  C  C     . ALA D  1 16  ? 26.813  50.062  29.347  1.00 43.07 ? 989  ALA D C     1 
ATOM   6704  O  O     . ALA D  1 16  ? 27.340  49.225  28.610  1.00 41.74 ? 989  ALA D O     1 
ATOM   6705  C  CB    . ALA D  1 16  ? 26.923  52.332  28.304  1.00 43.03 ? 989  ALA D CB    1 
ATOM   6706  N  N     . ALA D  1 17  ? 26.917  50.027  30.671  1.00 41.77 ? 990  ALA D N     1 
ATOM   6707  C  CA    . ALA D  1 17  ? 27.719  49.020  31.364  1.00 42.45 ? 990  ALA D CA    1 
ATOM   6708  C  C     . ALA D  1 17  ? 27.011  47.672  31.443  1.00 45.20 ? 990  ALA D C     1 
ATOM   6709  O  O     . ALA D  1 17  ? 27.666  46.626  31.481  1.00 45.18 ? 990  ALA D O     1 
ATOM   6710  C  CB    . ALA D  1 17  ? 28.102  49.507  32.765  1.00 39.80 ? 990  ALA D CB    1 
ATOM   6711  N  N     . CYS D  1 18  ? 25.679  47.709  31.451  1.00 45.69 ? 991  CYS D N     1 
ATOM   6712  C  CA    . CYS D  1 18  ? 24.856  46.526  31.706  1.00 46.59 ? 991  CYS D CA    1 
ATOM   6713  C  C     . CYS D  1 18  ? 24.220  45.900  30.467  1.00 45.00 ? 991  CYS D C     1 
ATOM   6714  O  O     . CYS D  1 18  ? 24.015  44.685  30.437  1.00 47.64 ? 991  CYS D O     1 
ATOM   6715  C  CB    . CYS D  1 18  ? 23.764  46.856  32.729  1.00 46.33 ? 991  CYS D CB    1 
ATOM   6716  S  SG    . CYS D  1 18  ? 24.398  47.119  34.389  1.00 55.54 ? 991  CYS D SG    1 
ATOM   6717  N  N     . GLU D  1 19  ? 23.915  46.715  29.457  1.00 43.42 ? 992  GLU D N     1 
ATOM   6718  C  CA    . GLU D  1 19  ? 23.136  46.263  28.291  1.00 44.93 ? 992  GLU D CA    1 
ATOM   6719  C  C     . GLU D  1 19  ? 23.684  44.987  27.634  1.00 43.65 ? 992  GLU D C     1 
ATOM   6720  O  O     . GLU D  1 19  ? 24.890  44.723  27.658  1.00 42.88 ? 992  GLU D O     1 
ATOM   6721  C  CB    . GLU D  1 19  ? 22.940  47.394  27.255  1.00 43.33 ? 992  GLU D CB    1 
ATOM   6722  C  CG    . GLU D  1 19  ? 24.112  47.644  26.292  1.00 45.17 ? 992  GLU D CG    1 
ATOM   6723  C  CD    . GLU D  1 19  ? 24.025  46.852  24.979  1.00 55.83 ? 992  GLU D CD    1 
ATOM   6724  O  OE1   . GLU D  1 19  ? 24.898  47.059  24.104  1.00 57.73 ? 992  GLU D OE1   1 
ATOM   6725  O  OE2   . GLU D  1 19  ? 23.095  46.028  24.811  1.00 52.94 ? 992  GLU D OE2   1 
ATOM   6726  N  N     . GLY D  1 20  ? 22.781  44.208  27.048  1.00 42.58 ? 993  GLY D N     1 
ATOM   6727  C  CA    . GLY D  1 20  ? 23.155  42.970  26.377  1.00 40.62 ? 993  GLY D CA    1 
ATOM   6728  C  C     . GLY D  1 20  ? 23.081  41.769  27.292  1.00 36.65 ? 993  GLY D C     1 
ATOM   6729  O  O     . GLY D  1 20  ? 22.254  41.722  28.203  1.00 39.17 ? 993  GLY D O     1 
ATOM   6730  N  N     . GLU D  1 21  ? 23.974  40.812  27.056  1.00 37.38 ? 994  GLU D N     1 
ATOM   6731  C  CA    . GLU D  1 21  ? 23.919  39.483  27.673  1.00 37.44 ? 994  GLU D CA    1 
ATOM   6732  C  C     . GLU D  1 21  ? 24.011  39.469  29.208  1.00 41.24 ? 994  GLU D C     1 
ATOM   6733  O  O     . GLU D  1 21  ? 23.420  38.590  29.854  1.00 38.83 ? 994  GLU D O     1 
ATOM   6734  C  CB    . GLU D  1 21  ? 25.012  38.599  27.068  1.00 37.18 ? 994  GLU D CB    1 
ATOM   6735  C  CG    . GLU D  1 21  ? 24.691  37.104  27.039  1.00 49.54 ? 994  GLU D CG    1 
ATOM   6736  C  CD    . GLU D  1 21  ? 23.750  36.706  25.922  1.00 47.07 ? 994  GLU D CD    1 
ATOM   6737  O  OE1   . GLU D  1 21  ? 23.541  37.506  24.985  1.00 51.84 ? 994  GLU D OE1   1 
ATOM   6738  O  OE2   . GLU D  1 21  ? 23.218  35.580  25.983  1.00 60.48 ? 994  GLU D OE2   1 
ATOM   6739  N  N     . TYR D  1 22  ? 24.755  40.422  29.781  1.00 39.19 ? 995  TYR D N     1 
ATOM   6740  C  CA    . TYR D  1 22  ? 24.856  40.558  31.234  1.00 40.36 ? 995  TYR D CA    1 
ATOM   6741  C  C     . TYR D  1 22  ? 23.497  40.868  31.871  1.00 39.81 ? 995  TYR D C     1 
ATOM   6742  O  O     . TYR D  1 22  ? 23.151  40.296  32.907  1.00 39.99 ? 995  TYR D O     1 
ATOM   6743  C  CB    . TYR D  1 22  ? 25.892  41.624  31.646  1.00 40.25 ? 995  TYR D CB    1 
ATOM   6744  C  CG    . TYR D  1 22  ? 25.810  41.977  33.123  1.00 36.69 ? 995  TYR D CG    1 
ATOM   6745  C  CD1   . TYR D  1 22  ? 26.467  41.204  34.081  1.00 40.30 ? 995  TYR D CD1   1 
ATOM   6746  C  CD2   . TYR D  1 22  ? 25.044  43.063  33.565  1.00 37.78 ? 995  TYR D CD2   1 
ATOM   6747  C  CE1   . TYR D  1 22  ? 26.374  41.508  35.441  1.00 36.64 ? 995  TYR D CE1   1 
ATOM   6748  C  CE2   . TYR D  1 22  ? 24.940  43.375  34.925  1.00 38.98 ? 995  TYR D CE2   1 
ATOM   6749  C  CZ    . TYR D  1 22  ? 25.611  42.591  35.854  1.00 43.40 ? 995  TYR D CZ    1 
ATOM   6750  O  OH    . TYR D  1 22  ? 25.527  42.885  37.194  1.00 41.85 ? 995  TYR D OH    1 
ATOM   6751  N  N     . SER D  1 23  ? 22.747  41.778  31.247  1.00 41.24 ? 996  SER D N     1 
ATOM   6752  C  CA    . SER D  1 23  ? 21.422  42.209  31.727  1.00 40.53 ? 996  SER D CA    1 
ATOM   6753  C  C     . SER D  1 23  ? 20.338  41.134  31.682  1.00 39.10 ? 996  SER D C     1 
ATOM   6754  O  O     . SER D  1 23  ? 19.341  41.237  32.396  1.00 43.71 ? 996  SER D O     1 
ATOM   6755  C  CB    . SER D  1 23  ? 20.940  43.422  30.933  1.00 43.70 ? 996  SER D CB    1 
ATOM   6756  O  OG    . SER D  1 23  ? 21.652  44.584  31.298  1.00 46.33 ? 996  SER D OG    1 
ATOM   6757  N  N     . GLN D  1 24  ? 20.518  40.127  30.828  1.00 38.58 ? 997  GLN D N     1 
ATOM   6758  C  CA    . GLN D  1 24  ? 19.584  39.001  30.732  1.00 41.61 ? 997  GLN D CA    1 
ATOM   6759  C  C     . GLN D  1 24  ? 19.740  38.004  31.883  1.00 44.22 ? 997  GLN D C     1 
ATOM   6760  O  O     . GLN D  1 24  ? 18.790  37.294  32.231  1.00 43.60 ? 997  GLN D O     1 
ATOM   6761  C  CB    . GLN D  1 24  ? 19.787  38.249  29.417  1.00 40.76 ? 997  GLN D CB    1 
ATOM   6762  C  CG    . GLN D  1 24  ? 19.413  39.016  28.160  1.00 40.10 ? 997  GLN D CG    1 
ATOM   6763  C  CD    . GLN D  1 24  ? 20.034  38.414  26.913  1.00 37.97 ? 997  GLN D CD    1 
ATOM   6764  O  OE1   . GLN D  1 24  ? 20.402  39.132  25.984  1.00 38.40 ? 997  GLN D OE1   1 
ATOM   6765  N  NE2   . GLN D  1 24  ? 20.167  37.085  26.892  1.00 43.79 ? 997  GLN D NE2   1 
ATOM   6766  N  N     . LYS D  1 25  ? 20.944  37.955  32.458  1.00 44.78 ? 998  LYS D N     1 
ATOM   6767  C  CA    . LYS D  1 25  ? 21.310  36.946  33.458  1.00 42.57 ? 998  LYS D CA    1 
ATOM   6768  C  C     . LYS D  1 25  ? 21.389  37.511  34.878  1.00 41.24 ? 998  LYS D C     1 
ATOM   6769  O  O     . LYS D  1 25  ? 20.908  36.888  35.830  1.00 42.66 ? 998  LYS D O     1 
ATOM   6770  C  CB    . LYS D  1 25  ? 22.647  36.294  33.075  1.00 40.87 ? 998  LYS D CB    1 
ATOM   6771  C  CG    . LYS D  1 25  ? 22.831  34.857  33.569  1.00 43.81 ? 998  LYS D CG    1 
ATOM   6772  C  CD    . LYS D  1 25  ? 24.160  34.283  33.077  1.00 41.43 ? 998  LYS D CD    1 
ATOM   6773  C  CE    . LYS D  1 25  ? 24.201  32.755  33.112  1.00 48.32 ? 998  LYS D CE    1 
ATOM   6774  N  NZ    . LYS D  1 25  ? 24.433  32.183  34.464  1.00 35.77 ? 998  LYS D NZ    1 
ATOM   6775  N  N     . TYR D  1 26  ? 21.988  38.694  35.012  1.00 39.84 ? 999  TYR D N     1 
ATOM   6776  C  CA    . TYR D  1 26  ? 22.312  39.255  36.326  1.00 37.22 ? 999  TYR D CA    1 
ATOM   6777  C  C     . TYR D  1 26  ? 21.645  40.592  36.631  1.00 37.32 ? 999  TYR D C     1 
ATOM   6778  O  O     . TYR D  1 26  ? 21.380  41.403  35.734  1.00 38.16 ? 999  TYR D O     1 
ATOM   6779  C  CB    . TYR D  1 26  ? 23.828  39.410  36.494  1.00 34.24 ? 999  TYR D CB    1 
ATOM   6780  C  CG    . TYR D  1 26  ? 24.622  38.129  36.353  1.00 33.23 ? 999  TYR D CG    1 
ATOM   6781  C  CD1   . TYR D  1 26  ? 24.750  37.239  37.423  1.00 34.29 ? 999  TYR D CD1   1 
ATOM   6782  C  CD2   . TYR D  1 26  ? 25.263  37.816  35.155  1.00 26.85 ? 999  TYR D CD2   1 
ATOM   6783  C  CE1   . TYR D  1 26  ? 25.482  36.060  37.298  1.00 31.16 ? 999  TYR D CE1   1 
ATOM   6784  C  CE2   . TYR D  1 26  ? 25.999  36.644  35.020  1.00 38.91 ? 999  TYR D CE2   1 
ATOM   6785  C  CZ    . TYR D  1 26  ? 26.106  35.768  36.096  1.00 38.65 ? 999  TYR D CZ    1 
ATOM   6786  O  OH    . TYR D  1 26  ? 26.839  34.607  35.963  1.00 33.16 ? 999  TYR D OH    1 
ATOM   6787  N  N     . SER D  1 27  ? 21.393  40.809  37.918  1.00 36.40 ? 1000 SER D N     1 
ATOM   6788  C  CA    . SER D  1 27  ? 20.925  42.085  38.419  1.00 40.10 ? 1000 SER D CA    1 
ATOM   6789  C  C     . SER D  1 27  ? 21.991  42.660  39.340  1.00 41.23 ? 1000 SER D C     1 
ATOM   6790  O  O     . SER D  1 27  ? 22.382  42.012  40.318  1.00 39.78 ? 1000 SER D O     1 
ATOM   6791  C  CB    . SER D  1 27  ? 19.604  41.910  39.174  1.00 41.38 ? 1000 SER D CB    1 
ATOM   6792  O  OG    . SER D  1 27  ? 19.066  43.163  39.557  1.00 51.29 ? 1000 SER D OG    1 
ATOM   6793  N  N     . THR D  1 28  ? 22.464  43.867  39.016  1.00 40.08 ? 1001 THR D N     1 
ATOM   6794  C  CA    . THR D  1 28  ? 23.439  44.574  39.849  1.00 42.48 ? 1001 THR D CA    1 
ATOM   6795  C  C     . THR D  1 28  ? 22.783  45.205  41.084  1.00 42.12 ? 1001 THR D C     1 
ATOM   6796  O  O     . THR D  1 28  ? 21.825  45.977  40.964  1.00 39.56 ? 1001 THR D O     1 
ATOM   6797  C  CB    . THR D  1 28  ? 24.230  45.638  39.055  1.00 36.05 ? 1001 THR D CB    1 
ATOM   6798  O  OG1   . THR D  1 28  ? 24.703  45.062  37.841  1.00 39.04 ? 1001 THR D OG1   1 
ATOM   6799  C  CG2   . THR D  1 28  ? 25.430  46.115  39.855  1.00 40.87 ? 1001 THR D CG2   1 
ATOM   6800  N  N     . MET D  1 29  ? 23.339  44.884  42.256  1.00 44.32 ? 1002 MET D N     1 
ATOM   6801  C  CA    . MET D  1 29  ? 22.736  45.204  43.557  1.00 45.34 ? 1002 MET D CA    1 
ATOM   6802  C  C     . MET D  1 29  ? 23.413  46.350  44.328  1.00 41.34 ? 1002 MET D C     1 
ATOM   6803  O  O     . MET D  1 29  ? 22.737  47.284  44.754  1.00 39.34 ? 1002 MET D O     1 
ATOM   6804  C  CB    . MET D  1 29  ? 22.701  43.947  44.437  1.00 48.29 ? 1002 MET D CB    1 
ATOM   6805  C  CG    . MET D  1 29  ? 22.062  42.733  43.782  1.00 51.42 ? 1002 MET D CG    1 
ATOM   6806  S  SD    . MET D  1 29  ? 20.264  42.762  43.852  1.00 61.13 ? 1002 MET D SD    1 
ATOM   6807  C  CE    . MET D  1 29  ? 19.973  42.184  45.530  1.00 58.84 ? 1002 MET D CE    1 
ATOM   6808  N  N     . SER D  1 30  ? 24.735  46.266  44.511  1.00 41.08 ? 1003 SER D N     1 
ATOM   6809  C  CA    . SER D  1 30  ? 25.490  47.230  45.336  1.00 38.57 ? 1003 SER D CA    1 
ATOM   6810  C  C     . SER D  1 30  ? 27.014  47.195  45.098  1.00 38.31 ? 1003 SER D C     1 
ATOM   6811  O  O     . SER D  1 30  ? 27.563  46.155  44.731  1.00 39.03 ? 1003 SER D O     1 
ATOM   6812  C  CB    . SER D  1 30  ? 25.192  47.008  46.826  1.00 35.57 ? 1003 SER D CB    1 
ATOM   6813  O  OG    . SER D  1 30  ? 25.571  45.707  47.230  1.00 36.61 ? 1003 SER D OG    1 
ATOM   6814  N  N     . PRO D  1 31  ? 27.697  48.342  45.297  1.00 39.31 ? 1004 PRO D N     1 
ATOM   6815  C  CA    . PRO D  1 31  ? 29.158  48.450  45.145  1.00 38.27 ? 1004 PRO D CA    1 
ATOM   6816  C  C     . PRO D  1 31  ? 29.975  47.619  46.141  1.00 39.17 ? 1004 PRO D C     1 
ATOM   6817  O  O     . PRO D  1 31  ? 29.495  47.305  47.232  1.00 39.98 ? 1004 PRO D O     1 
ATOM   6818  C  CB    . PRO D  1 31  ? 29.421  49.944  45.359  1.00 37.14 ? 1004 PRO D CB    1 
ATOM   6819  C  CG    . PRO D  1 31  ? 28.261  50.422  46.152  1.00 41.85 ? 1004 PRO D CG    1 
ATOM   6820  C  CD    . PRO D  1 31  ? 27.094  49.641  45.655  1.00 36.52 ? 1004 PRO D CD    1 
ATOM   6821  N  N     . LEU D  1 32  ? 31.205  47.277  45.750  1.00 40.01 ? 1005 LEU D N     1 
ATOM   6822  C  CA    . LEU D  1 32  ? 32.091  46.423  46.549  1.00 40.91 ? 1005 LEU D CA    1 
ATOM   6823  C  C     . LEU D  1 32  ? 33.476  47.026  46.779  1.00 42.13 ? 1005 LEU D C     1 
ATOM   6824  O  O     . LEU D  1 32  ? 33.984  47.770  45.938  1.00 42.66 ? 1005 LEU D O     1 
ATOM   6825  C  CB    . LEU D  1 32  ? 32.253  45.047  45.898  1.00 37.26 ? 1005 LEU D CB    1 
ATOM   6826  C  CG    . LEU D  1 32  ? 31.582  43.804  46.480  1.00 35.03 ? 1005 LEU D CG    1 
ATOM   6827  C  CD1   . LEU D  1 32  ? 32.036  42.599  45.691  1.00 36.16 ? 1005 LEU D CD1   1 
ATOM   6828  C  CD2   . LEU D  1 32  ? 31.917  43.604  47.947  1.00 25.52 ? 1005 LEU D CD2   1 
ATOM   6829  N  N     . GLY D  1 33  ? 34.063  46.690  47.930  1.00 43.47 ? 1006 GLY D N     1 
ATOM   6830  C  CA    . GLY D  1 33  ? 35.412  47.109  48.330  1.00 44.87 ? 1006 GLY D CA    1 
ATOM   6831  C  C     . GLY D  1 33  ? 35.711  48.596  48.271  1.00 46.44 ? 1006 GLY D C     1 
ATOM   6832  O  O     . GLY D  1 33  ? 34.802  49.423  48.356  1.00 47.43 ? 1006 GLY D O     1 
ATOM   6833  N  N     . SER D  1 34  ? 37.003  48.916  48.171  1.00 48.44 ? 1007 SER D N     1 
ATOM   6834  C  CA    . SER D  1 34  ? 37.506  50.218  47.693  1.00 48.54 ? 1007 SER D CA    1 
ATOM   6835  C  C     . SER D  1 34  ? 36.929  51.474  48.354  1.00 48.81 ? 1007 SER D C     1 
ATOM   6836  O  O     . SER D  1 34  ? 36.629  51.482  49.551  1.00 48.87 ? 1007 SER D O     1 
ATOM   6837  C  CB    . SER D  1 34  ? 37.342  50.316  46.170  1.00 48.22 ? 1007 SER D CB    1 
ATOM   6838  N  N     . GLY D  1 35  ? 36.810  52.536  47.557  1.00 47.20 ? 1008 GLY D N     1 
ATOM   6839  C  CA    . GLY D  1 35  ? 36.224  53.794  47.996  1.00 44.70 ? 1008 GLY D CA    1 
ATOM   6840  C  C     . GLY D  1 35  ? 34.740  53.831  47.691  1.00 42.86 ? 1008 GLY D C     1 
ATOM   6841  O  O     . GLY D  1 35  ? 34.007  52.895  48.021  1.00 42.09 ? 1008 GLY D O     1 
ATOM   6842  N  N     . ALA D  1 36  ? 34.303  54.912  47.050  1.00 40.96 ? 1009 ALA D N     1 
ATOM   6843  C  CA    . ALA D  1 36  ? 32.897  55.096  46.701  1.00 39.34 ? 1009 ALA D CA    1 
ATOM   6844  C  C     . ALA D  1 36  ? 32.546  54.516  45.324  1.00 35.64 ? 1009 ALA D C     1 
ATOM   6845  O  O     . ALA D  1 36  ? 33.076  54.946  44.298  1.00 34.23 ? 1009 ALA D O     1 
ATOM   6846  C  CB    . ALA D  1 36  ? 32.512  56.572  46.784  1.00 35.10 ? 1009 ALA D CB    1 
ATOM   6847  N  N     . PHE D  1 37  ? 31.638  53.543  45.327  1.00 35.43 ? 1010 PHE D N     1 
ATOM   6848  C  CA    . PHE D  1 37  ? 31.095  52.925  44.106  1.00 38.93 ? 1010 PHE D CA    1 
ATOM   6849  C  C     . PHE D  1 37  ? 32.200  52.391  43.182  1.00 35.11 ? 1010 PHE D C     1 
ATOM   6850  O  O     . PHE D  1 37  ? 33.167  51.794  43.645  1.00 31.53 ? 1010 PHE D O     1 
ATOM   6851  C  CB    . PHE D  1 37  ? 30.132  53.890  43.380  1.00 37.91 ? 1010 PHE D CB    1 
ATOM   6852  C  CG    . PHE D  1 37  ? 29.035  54.434  44.264  1.00 40.36 ? 1010 PHE D CG    1 
ATOM   6853  C  CD1   . PHE D  1 37  ? 27.887  53.677  44.524  1.00 42.30 ? 1010 PHE D CD1   1 
ATOM   6854  C  CD2   . PHE D  1 37  ? 29.150  55.699  44.844  1.00 36.48 ? 1010 PHE D CD2   1 
ATOM   6855  C  CE1   . PHE D  1 37  ? 26.866  54.178  45.348  1.00 41.63 ? 1010 PHE D CE1   1 
ATOM   6856  C  CE2   . PHE D  1 37  ? 28.141  56.204  45.670  1.00 31.74 ? 1010 PHE D CE2   1 
ATOM   6857  C  CZ    . PHE D  1 37  ? 26.997  55.441  45.923  1.00 34.99 ? 1010 PHE D CZ    1 
ATOM   6858  N  N     . GLY D  1 38  ? 32.063  52.619  41.884  1.00 41.06 ? 1011 GLY D N     1 
ATOM   6859  C  CA    . GLY D  1 38  ? 33.119  52.268  40.945  1.00 42.57 ? 1011 GLY D CA    1 
ATOM   6860  C  C     . GLY D  1 38  ? 32.662  51.261  39.920  1.00 41.39 ? 1011 GLY D C     1 
ATOM   6861  O  O     . GLY D  1 38  ? 31.551  51.361  39.399  1.00 44.55 ? 1011 GLY D O     1 
ATOM   6862  N  N     . PHE D  1 39  ? 33.527  50.285  39.650  1.00 41.42 ? 1012 PHE D N     1 
ATOM   6863  C  CA    . PHE D  1 39  ? 33.305  49.294  38.601  1.00 41.19 ? 1012 PHE D CA    1 
ATOM   6864  C  C     . PHE D  1 39  ? 33.137  47.880  39.150  1.00 38.63 ? 1012 PHE D C     1 
ATOM   6865  O  O     . PHE D  1 39  ? 32.796  46.961  38.400  1.00 37.36 ? 1012 PHE D O     1 
ATOM   6866  C  CB    . PHE D  1 39  ? 34.455  49.319  37.583  1.00 44.66 ? 1012 PHE D CB    1 
ATOM   6867  C  CG    . PHE D  1 39  ? 34.560  50.604  36.805  1.00 46.56 ? 1012 PHE D CG    1 
ATOM   6868  C  CD1   . PHE D  1 39  ? 33.432  51.185  36.225  1.00 52.15 ? 1012 PHE D CD1   1 
ATOM   6869  C  CD2   . PHE D  1 39  ? 35.794  51.224  36.631  1.00 51.71 ? 1012 PHE D CD2   1 
ATOM   6870  C  CE1   . PHE D  1 39  ? 33.530  52.374  35.497  1.00 48.89 ? 1012 PHE D CE1   1 
ATOM   6871  C  CE2   . PHE D  1 39  ? 35.902  52.415  35.909  1.00 51.03 ? 1012 PHE D CE2   1 
ATOM   6872  C  CZ    . PHE D  1 39  ? 34.766  52.989  35.341  1.00 51.96 ? 1012 PHE D CZ    1 
ATOM   6873  N  N     . VAL D  1 40  ? 33.383  47.712  40.448  1.00 32.82 ? 1013 VAL D N     1 
ATOM   6874  C  CA    . VAL D  1 40  ? 33.205  46.423  41.117  1.00 32.35 ? 1013 VAL D CA    1 
ATOM   6875  C  C     . VAL D  1 40  ? 31.948  46.468  41.982  1.00 31.64 ? 1013 VAL D C     1 
ATOM   6876  O  O     . VAL D  1 40  ? 31.780  47.378  42.792  1.00 39.48 ? 1013 VAL D O     1 
ATOM   6877  C  CB    . VAL D  1 40  ? 34.446  46.013  41.946  1.00 30.55 ? 1013 VAL D CB    1 
ATOM   6878  C  CG1   . VAL D  1 40  ? 34.236  44.643  42.604  1.00 32.70 ? 1013 VAL D CG1   1 
ATOM   6879  C  CG2   . VAL D  1 40  ? 35.668  45.986  41.078  1.00 21.51 ? 1013 VAL D CG2   1 
ATOM   6880  N  N     . TRP D  1 41  ? 31.057  45.500  41.774  1.00 32.13 ? 1014 TRP D N     1 
ATOM   6881  C  CA    . TRP D  1 41  ? 29.736  45.496  42.395  1.00 27.42 ? 1014 TRP D CA    1 
ATOM   6882  C  C     . TRP D  1 41  ? 29.307  44.080  42.765  1.00 32.16 ? 1014 TRP D C     1 
ATOM   6883  O  O     . TRP D  1 41  ? 29.810  43.104  42.215  1.00 31.80 ? 1014 TRP D O     1 
ATOM   6884  C  CB    . TRP D  1 41  ? 28.694  46.087  41.442  1.00 27.32 ? 1014 TRP D CB    1 
ATOM   6885  C  CG    . TRP D  1 41  ? 28.865  47.553  41.113  1.00 29.06 ? 1014 TRP D CG    1 
ATOM   6886  C  CD1   . TRP D  1 41  ? 29.891  48.123  40.427  1.00 28.44 ? 1014 TRP D CD1   1 
ATOM   6887  C  CD2   . TRP D  1 41  ? 27.957  48.618  41.432  1.00 32.96 ? 1014 TRP D CD2   1 
ATOM   6888  N  NE1   . TRP D  1 41  ? 29.701  49.478  40.316  1.00 34.70 ? 1014 TRP D NE1   1 
ATOM   6889  C  CE2   . TRP D  1 41  ? 28.517  49.811  40.919  1.00 34.57 ? 1014 TRP D CE2   1 
ATOM   6890  C  CE3   . TRP D  1 41  ? 26.723  48.680  42.093  1.00 24.84 ? 1014 TRP D CE3   1 
ATOM   6891  C  CZ2   . TRP D  1 41  ? 27.892  51.060  41.057  1.00 31.44 ? 1014 TRP D CZ2   1 
ATOM   6892  C  CZ3   . TRP D  1 41  ? 26.100  49.922  42.231  1.00 30.35 ? 1014 TRP D CZ3   1 
ATOM   6893  C  CH2   . TRP D  1 41  ? 26.688  51.095  41.713  1.00 31.64 ? 1014 TRP D CH2   1 
ATOM   6894  N  N     . THR D  1 42  ? 28.375  43.982  43.706  1.00 35.77 ? 1015 THR D N     1 
ATOM   6895  C  CA    . THR D  1 42  ? 27.667  42.736  43.967  1.00 34.91 ? 1015 THR D CA    1 
ATOM   6896  C  C     . THR D  1 42  ? 26.490  42.635  43.003  1.00 35.49 ? 1015 THR D C     1 
ATOM   6897  O  O     . THR D  1 42  ? 25.714  43.587  42.832  1.00 34.79 ? 1015 THR D O     1 
ATOM   6898  C  CB    . THR D  1 42  ? 27.161  42.664  45.427  1.00 32.58 ? 1015 THR D CB    1 
ATOM   6899  O  OG1   . THR D  1 42  ? 28.281  42.612  46.312  1.00 32.21 ? 1015 THR D OG1   1 
ATOM   6900  C  CG2   . THR D  1 42  ? 26.308  41.425  45.648  1.00 35.66 ? 1015 THR D CG2   1 
ATOM   6901  N  N     . ALA D  1 43  ? 26.374  41.479  42.364  1.00 36.74 ? 1016 ALA D N     1 
ATOM   6902  C  CA    . ALA D  1 43  ? 25.294  41.217  41.438  1.00 36.30 ? 1016 ALA D CA    1 
ATOM   6903  C  C     . ALA D  1 43  ? 24.588  39.937  41.867  1.00 41.88 ? 1016 ALA D C     1 
ATOM   6904  O  O     . ALA D  1 43  ? 25.083  39.212  42.736  1.00 44.52 ? 1016 ALA D O     1 
ATOM   6905  C  CB    . ALA D  1 43  ? 25.838  41.101  40.021  1.00 37.61 ? 1016 ALA D CB    1 
ATOM   6906  N  N     . VAL D  1 44  ? 23.425  39.673  41.278  1.00 44.29 ? 1017 VAL D N     1 
ATOM   6907  C  CA    . VAL D  1 44  ? 22.642  38.485  41.609  1.00 43.61 ? 1017 VAL D CA    1 
ATOM   6908  C  C     . VAL D  1 44  ? 22.261  37.720  40.351  1.00 43.98 ? 1017 VAL D C     1 
ATOM   6909  O  O     . VAL D  1 44  ? 21.710  38.289  39.408  1.00 41.82 ? 1017 VAL D O     1 
ATOM   6910  C  CB    . VAL D  1 44  ? 21.387  38.840  42.466  1.00 44.59 ? 1017 VAL D CB    1 
ATOM   6911  C  CG1   . VAL D  1 44  ? 20.267  37.806  42.299  1.00 49.43 ? 1017 VAL D CG1   1 
ATOM   6912  C  CG2   . VAL D  1 44  ? 21.769  38.968  43.934  1.00 41.76 ? 1017 VAL D CG2   1 
ATOM   6913  N  N     . ASP D  1 45  ? 22.600  36.434  40.340  1.00 50.09 ? 1018 ASP D N     1 
ATOM   6914  C  CA    . ASP D  1 45  ? 22.146  35.502  39.315  1.00 52.42 ? 1018 ASP D CA    1 
ATOM   6915  C  C     . ASP D  1 45  ? 20.639  35.311  39.504  1.00 55.07 ? 1018 ASP D C     1 
ATOM   6916  O  O     . ASP D  1 45  ? 20.203  34.631  40.432  1.00 58.65 ? 1018 ASP D O     1 
ATOM   6917  C  CB    . ASP D  1 45  ? 22.908  34.173  39.441  1.00 52.27 ? 1018 ASP D CB    1 
ATOM   6918  C  CG    . ASP D  1 45  ? 22.539  33.156  38.357  1.00 55.51 ? 1018 ASP D CG    1 
ATOM   6919  O  OD1   . ASP D  1 45  ? 23.137  32.062  38.366  1.00 54.46 ? 1018 ASP D OD1   1 
ATOM   6920  O  OD2   . ASP D  1 45  ? 21.663  33.425  37.505  1.00 57.51 ? 1018 ASP D OD2   1 
ATOM   6921  N  N     . LYS D  1 46  ? 19.856  35.937  38.627  1.00 55.32 ? 1019 LYS D N     1 
ATOM   6922  C  CA    . LYS D  1 46  ? 18.398  35.992  38.763  1.00 56.83 ? 1019 LYS D CA    1 
ATOM   6923  C  C     . LYS D  1 46  ? 17.694  34.636  38.699  1.00 60.45 ? 1019 LYS D C     1 
ATOM   6924  O  O     . LYS D  1 46  ? 16.592  34.483  39.236  1.00 63.36 ? 1019 LYS D O     1 
ATOM   6925  C  CB    . LYS D  1 46  ? 17.796  36.949  37.733  1.00 54.39 ? 1019 LYS D CB    1 
ATOM   6926  C  CG    . LYS D  1 46  ? 18.052  38.418  38.032  1.00 45.59 ? 1019 LYS D CG    1 
ATOM   6927  C  CD    . LYS D  1 46  ? 17.419  39.314  36.975  1.00 52.75 ? 1019 LYS D CD    1 
ATOM   6928  C  CE    . LYS D  1 46  ? 18.196  39.295  35.660  1.00 41.62 ? 1019 LYS D CE    1 
ATOM   6929  N  NZ    . LYS D  1 46  ? 17.331  39.723  34.535  1.00 36.89 ? 1019 LYS D NZ    1 
ATOM   6930  N  N     . GLU D  1 47  ? 18.323  33.657  38.052  1.00 61.85 ? 1020 GLU D N     1 
ATOM   6931  C  CA    . GLU D  1 47  ? 17.776  32.303  38.017  1.00 64.94 ? 1020 GLU D CA    1 
ATOM   6932  C  C     . GLU D  1 47  ? 18.059  31.532  39.311  1.00 64.49 ? 1020 GLU D C     1 
ATOM   6933  O  O     . GLU D  1 47  ? 17.125  31.090  39.984  1.00 66.25 ? 1020 GLU D O     1 
ATOM   6934  C  CB    . GLU D  1 47  ? 18.261  31.537  36.779  1.00 64.39 ? 1020 GLU D CB    1 
ATOM   6935  C  CG    . GLU D  1 47  ? 17.568  31.972  35.484  1.00 67.41 ? 1020 GLU D CG    1 
ATOM   6936  C  CD    . GLU D  1 47  ? 17.719  30.971  34.345  1.00 67.44 ? 1020 GLU D CD    1 
ATOM   6937  O  OE1   . GLU D  1 47  ? 17.842  29.754  34.617  1.00 70.97 ? 1020 GLU D OE1   1 
ATOM   6938  O  OE2   . GLU D  1 47  ? 17.705  31.405  33.171  1.00 65.01 ? 1020 GLU D OE2   1 
ATOM   6939  N  N     . LYS D  1 48  ? 19.338  31.398  39.663  1.00 64.12 ? 1021 LYS D N     1 
ATOM   6940  C  CA    . LYS D  1 48  ? 19.764  30.637  40.846  1.00 63.65 ? 1021 LYS D CA    1 
ATOM   6941  C  C     . LYS D  1 48  ? 19.536  31.366  42.174  1.00 63.00 ? 1021 LYS D C     1 
ATOM   6942  O  O     . LYS D  1 48  ? 19.424  30.729  43.228  1.00 62.96 ? 1021 LYS D O     1 
ATOM   6943  C  CB    . LYS D  1 48  ? 21.237  30.233  40.720  1.00 63.93 ? 1021 LYS D CB    1 
ATOM   6944  N  N     . ASN D  1 49  ? 19.470  32.696  42.113  1.00 61.85 ? 1022 ASN D N     1 
ATOM   6945  C  CA    . ASN D  1 49  ? 19.284  33.560  43.291  1.00 62.10 ? 1022 ASN D CA    1 
ATOM   6946  C  C     . ASN D  1 49  ? 20.424  33.569  44.314  1.00 60.97 ? 1022 ASN D C     1 
ATOM   6947  O  O     . ASN D  1 49  ? 20.187  33.555  45.527  1.00 61.12 ? 1022 ASN D O     1 
ATOM   6948  C  CB    . ASN D  1 49  ? 17.933  33.308  43.976  1.00 62.19 ? 1022 ASN D CB    1 
ATOM   6949  C  CG    . ASN D  1 49  ? 16.947  34.422  43.736  1.00 59.03 ? 1022 ASN D CG    1 
ATOM   6950  O  OD1   . ASN D  1 49  ? 15.967  34.251  43.010  1.00 60.89 ? 1022 ASN D OD1   1 
ATOM   6951  N  ND2   . ASN D  1 49  ? 17.204  35.583  44.339  1.00 50.19 ? 1022 ASN D ND2   1 
ATOM   6952  N  N     . LYS D  1 50  ? 21.655  33.599  43.815  1.00 59.89 ? 1023 LYS D N     1 
ATOM   6953  C  CA    . LYS D  1 50  ? 22.827  33.750  44.669  1.00 58.19 ? 1023 LYS D CA    1 
ATOM   6954  C  C     . LYS D  1 50  ? 23.627  34.991  44.277  1.00 54.60 ? 1023 LYS D C     1 
ATOM   6955  O  O     . LYS D  1 50  ? 23.506  35.483  43.154  1.00 57.22 ? 1023 LYS D O     1 
ATOM   6956  C  CB    . LYS D  1 50  ? 23.699  32.486  44.642  1.00 59.11 ? 1023 LYS D CB    1 
ATOM   6957  C  CG    . LYS D  1 50  ? 24.611  32.335  43.430  1.00 62.69 ? 1023 LYS D CG    1 
ATOM   6958  C  CD    . LYS D  1 50  ? 25.821  31.470  43.773  1.00 64.00 ? 1023 LYS D CD    1 
ATOM   6959  C  CE    . LYS D  1 50  ? 26.830  31.422  42.632  1.00 67.16 ? 1023 LYS D CE    1 
ATOM   6960  N  NZ    . LYS D  1 50  ? 26.369  30.579  41.492  1.00 63.62 ? 1023 LYS D NZ    1 
ATOM   6961  N  N     . GLU D  1 51  ? 24.431  35.492  45.213  1.00 51.39 ? 1024 GLU D N     1 
ATOM   6962  C  CA    . GLU D  1 51  ? 25.300  36.644  44.977  1.00 44.53 ? 1024 GLU D CA    1 
ATOM   6963  C  C     . GLU D  1 51  ? 26.518  36.282  44.142  1.00 42.01 ? 1024 GLU D C     1 
ATOM   6964  O  O     . GLU D  1 51  ? 27.143  35.239  44.352  1.00 41.13 ? 1024 GLU D O     1 
ATOM   6965  C  CB    . GLU D  1 51  ? 25.784  37.235  46.296  1.00 40.82 ? 1024 GLU D CB    1 
ATOM   6966  C  CG    . GLU D  1 51  ? 24.785  38.118  46.996  1.00 46.33 ? 1024 GLU D CG    1 
ATOM   6967  C  CD    . GLU D  1 51  ? 25.423  38.938  48.102  1.00 50.93 ? 1024 GLU D CD    1 
ATOM   6968  O  OE1   . GLU D  1 51  ? 26.459  38.505  48.653  1.00 52.94 ? 1024 GLU D OE1   1 
ATOM   6969  O  OE2   . GLU D  1 51  ? 24.890  40.022  48.417  1.00 55.43 ? 1024 GLU D OE2   1 
ATOM   6970  N  N     . VAL D  1 52  ? 26.849  37.157  43.196  1.00 38.35 ? 1025 VAL D N     1 
ATOM   6971  C  CA    . VAL D  1 52  ? 28.082  37.043  42.416  1.00 37.26 ? 1025 VAL D CA    1 
ATOM   6972  C  C     . VAL D  1 52  ? 28.809  38.390  42.491  1.00 33.43 ? 1025 VAL D C     1 
ATOM   6973  O  O     . VAL D  1 52  ? 28.302  39.326  43.105  1.00 25.23 ? 1025 VAL D O     1 
ATOM   6974  C  CB    . VAL D  1 52  ? 27.808  36.631  40.934  1.00 36.88 ? 1025 VAL D CB    1 
ATOM   6975  C  CG1   . VAL D  1 52  ? 27.007  35.335  40.870  1.00 42.33 ? 1025 VAL D CG1   1 
ATOM   6976  C  CG2   . VAL D  1 52  ? 27.071  37.739  40.186  1.00 36.24 ? 1025 VAL D CG2   1 
ATOM   6977  N  N     . VAL D  1 53  ? 29.989  38.479  41.880  1.00 33.99 ? 1026 VAL D N     1 
ATOM   6978  C  CA    . VAL D  1 53  ? 30.709  39.751  41.769  1.00 37.51 ? 1026 VAL D CA    1 
ATOM   6979  C  C     . VAL D  1 53  ? 30.923  40.123  40.306  1.00 35.23 ? 1026 VAL D C     1 
ATOM   6980  O  O     . VAL D  1 53  ? 31.432  39.317  39.528  1.00 35.79 ? 1026 VAL D O     1 
ATOM   6981  C  CB    . VAL D  1 53  ? 32.068  39.721  42.531  1.00 37.20 ? 1026 VAL D CB    1 
ATOM   6982  C  CG1   . VAL D  1 53  ? 33.004  40.851  42.071  1.00 34.50 ? 1026 VAL D CG1   1 
ATOM   6983  C  CG2   . VAL D  1 53  ? 31.825  39.827  44.008  1.00 32.73 ? 1026 VAL D CG2   1 
ATOM   6984  N  N     . VAL D  1 54  ? 30.527  41.344  39.948  1.00 34.01 ? 1027 VAL D N     1 
ATOM   6985  C  CA    . VAL D  1 54  ? 30.735  41.867  38.593  1.00 30.18 ? 1027 VAL D CA    1 
ATOM   6986  C  C     . VAL D  1 54  ? 31.809  42.972  38.550  1.00 26.51 ? 1027 VAL D C     1 
ATOM   6987  O  O     . VAL D  1 54  ? 31.847  43.872  39.388  1.00 26.81 ? 1027 VAL D O     1 
ATOM   6988  C  CB    . VAL D  1 54  ? 29.382  42.305  37.912  1.00 29.93 ? 1027 VAL D CB    1 
ATOM   6989  C  CG1   . VAL D  1 54  ? 28.756  43.520  38.611  1.00 27.99 ? 1027 VAL D CG1   1 
ATOM   6990  C  CG2   . VAL D  1 54  ? 29.568  42.568  36.406  1.00 21.31 ? 1027 VAL D CG2   1 
ATOM   6991  N  N     . LYS D  1 55  ? 32.696  42.869  37.574  1.00 31.97 ? 1028 LYS D N     1 
ATOM   6992  C  CA    . LYS D  1 55  ? 33.686  43.899  37.304  1.00 28.93 ? 1028 LYS D CA    1 
ATOM   6993  C  C     . LYS D  1 55  ? 33.431  44.426  35.895  1.00 30.17 ? 1028 LYS D C     1 
ATOM   6994  O  O     . LYS D  1 55  ? 33.533  43.680  34.910  1.00 32.25 ? 1028 LYS D O     1 
ATOM   6995  C  CB    . LYS D  1 55  ? 35.097  43.320  37.439  1.00 28.47 ? 1028 LYS D CB    1 
ATOM   6996  C  CG    . LYS D  1 55  ? 36.229  44.318  37.262  1.00 22.80 ? 1028 LYS D CG    1 
ATOM   6997  C  CD    . LYS D  1 55  ? 37.531  43.701  37.704  1.00 19.67 ? 1028 LYS D CD    1 
ATOM   6998  C  CE    . LYS D  1 55  ? 38.517  44.744  38.178  1.00 21.56 ? 1028 LYS D CE    1 
ATOM   6999  N  NZ    . LYS D  1 55  ? 39.870  44.137  38.280  1.00 32.57 ? 1028 LYS D NZ    1 
ATOM   7000  N  N     . PHE D  1 56  ? 33.056  45.700  35.816  1.00 31.87 ? 1029 PHE D N     1 
ATOM   7001  C  CA    . PHE D  1 56  ? 32.860  46.384  34.544  1.00 27.48 ? 1029 PHE D CA    1 
ATOM   7002  C  C     . PHE D  1 56  ? 34.190  46.949  34.061  1.00 31.85 ? 1029 PHE D C     1 
ATOM   7003  O  O     . PHE D  1 56  ? 34.916  47.585  34.826  1.00 29.18 ? 1029 PHE D O     1 
ATOM   7004  C  CB    . PHE D  1 56  ? 31.805  47.490  34.660  1.00 25.73 ? 1029 PHE D CB    1 
ATOM   7005  C  CG    . PHE D  1 56  ? 30.456  47.002  35.115  1.00 25.02 ? 1029 PHE D CG    1 
ATOM   7006  C  CD1   . PHE D  1 56  ? 29.580  46.382  34.221  1.00 30.24 ? 1029 PHE D CD1   1 
ATOM   7007  C  CD2   . PHE D  1 56  ? 30.051  47.173  36.440  1.00 28.09 ? 1029 PHE D CD2   1 
ATOM   7008  C  CE1   . PHE D  1 56  ? 28.319  45.938  34.639  1.00 27.00 ? 1029 PHE D CE1   1 
ATOM   7009  C  CE2   . PHE D  1 56  ? 28.801  46.730  36.873  1.00 23.72 ? 1029 PHE D CE2   1 
ATOM   7010  C  CZ    . PHE D  1 56  ? 27.929  46.112  35.970  1.00 31.23 ? 1029 PHE D CZ    1 
ATOM   7011  N  N     . ILE D  1 57  ? 34.505  46.669  32.796  1.00 35.57 ? 1030 ILE D N     1 
ATOM   7012  C  CA    . ILE D  1 57  ? 35.743  47.088  32.160  1.00 37.19 ? 1030 ILE D CA    1 
ATOM   7013  C  C     . ILE D  1 57  ? 35.399  47.901  30.915  1.00 38.02 ? 1030 ILE D C     1 
ATOM   7014  O  O     . ILE D  1 57  ? 34.971  47.356  29.885  1.00 35.20 ? 1030 ILE D O     1 
ATOM   7015  C  CB    . ILE D  1 57  ? 36.679  45.876  31.833  1.00 42.06 ? 1030 ILE D CB    1 
ATOM   7016  C  CG1   . ILE D  1 57  ? 37.223  45.252  33.129  1.00 39.33 ? 1030 ILE D CG1   1 
ATOM   7017  C  CG2   . ILE D  1 57  ? 37.846  46.299  30.926  1.00 37.81 ? 1030 ILE D CG2   1 
ATOM   7018  C  CD1   . ILE D  1 57  ? 37.755  43.822  32.985  1.00 37.61 ? 1030 ILE D CD1   1 
ATOM   7019  N  N     . LYS D  1 58  ? 35.560  49.215  31.037  1.00 38.13 ? 1031 LYS D N     1 
ATOM   7020  C  CA    . LYS D  1 58  ? 35.278  50.141  29.947  1.00 41.55 ? 1031 LYS D CA    1 
ATOM   7021  C  C     . LYS D  1 58  ? 36.338  49.949  28.873  1.00 40.26 ? 1031 LYS D C     1 
ATOM   7022  O  O     . LYS D  1 58  ? 37.532  50.066  29.153  1.00 40.34 ? 1031 LYS D O     1 
ATOM   7023  C  CB    . LYS D  1 58  ? 35.260  51.585  30.470  1.00 40.97 ? 1031 LYS D CB    1 
ATOM   7024  C  CG    . LYS D  1 58  ? 35.064  52.659  29.410  1.00 43.43 ? 1031 LYS D CG    1 
ATOM   7025  C  CD    . LYS D  1 58  ? 34.869  54.033  30.049  1.00 42.83 ? 1031 LYS D CD    1 
ATOM   7026  C  CE    . LYS D  1 58  ? 33.438  54.513  29.933  1.00 52.06 ? 1031 LYS D CE    1 
ATOM   7027  N  NZ    . LYS D  1 58  ? 33.086  54.860  28.517  1.00 51.44 ? 1031 LYS D NZ    1 
ATOM   7028  N  N     . LYS D  1 59  ? 35.888  49.616  27.661  1.00 41.07 ? 1032 LYS D N     1 
ATOM   7029  C  CA    . LYS D  1 59  ? 36.778  49.340  26.526  1.00 42.45 ? 1032 LYS D CA    1 
ATOM   7030  C  C     . LYS D  1 59  ? 37.684  50.500  26.175  1.00 43.26 ? 1032 LYS D C     1 
ATOM   7031  O  O     . LYS D  1 59  ? 38.851  50.287  25.854  1.00 41.53 ? 1032 LYS D O     1 
ATOM   7032  C  CB    . LYS D  1 59  ? 35.976  48.973  25.277  1.00 44.28 ? 1032 LYS D CB    1 
ATOM   7033  C  CG    . LYS D  1 59  ? 35.945  47.502  24.962  1.00 42.82 ? 1032 LYS D CG    1 
ATOM   7034  C  CD    . LYS D  1 59  ? 34.761  46.846  25.600  1.00 38.71 ? 1032 LYS D CD    1 
ATOM   7035  C  CE    . LYS D  1 59  ? 34.219  45.782  24.699  1.00 40.82 ? 1032 LYS D CE    1 
ATOM   7036  N  NZ    . LYS D  1 59  ? 33.853  46.335  23.369  1.00 32.38 ? 1032 LYS D NZ    1 
ATOM   7037  N  N     . GLU D  1 60  ? 37.130  51.715  26.216  1.00 44.92 ? 1033 GLU D N     1 
ATOM   7038  C  CA    . GLU D  1 60  ? 37.877  52.936  25.915  1.00 49.60 ? 1033 GLU D CA    1 
ATOM   7039  C  C     . GLU D  1 60  ? 39.077  53.140  26.847  1.00 51.09 ? 1033 GLU D C     1 
ATOM   7040  O  O     . GLU D  1 60  ? 40.114  53.643  26.421  1.00 50.34 ? 1033 GLU D O     1 
ATOM   7041  C  CB    . GLU D  1 60  ? 36.958  54.157  25.967  1.00 50.82 ? 1033 GLU D CB    1 
ATOM   7042  N  N     . LYS D  1 61  ? 38.929  52.736  28.108  1.00 54.05 ? 1034 LYS D N     1 
ATOM   7043  C  CA    . LYS D  1 61  ? 39.978  52.901  29.117  1.00 58.07 ? 1034 LYS D CA    1 
ATOM   7044  C  C     . LYS D  1 61  ? 41.069  51.824  29.077  1.00 60.81 ? 1034 LYS D C     1 
ATOM   7045  O  O     . LYS D  1 61  ? 42.103  51.972  29.733  1.00 61.87 ? 1034 LYS D O     1 
ATOM   7046  C  CB    . LYS D  1 61  ? 39.362  52.969  30.522  1.00 59.66 ? 1034 LYS D CB    1 
ATOM   7047  C  CG    . LYS D  1 61  ? 39.150  54.378  31.088  1.00 64.23 ? 1034 LYS D CG    1 
ATOM   7048  C  CD    . LYS D  1 61  ? 38.170  55.226  30.274  1.00 63.41 ? 1034 LYS D CD    1 
ATOM   7049  C  CE    . LYS D  1 61  ? 37.584  56.371  31.103  1.00 64.94 ? 1034 LYS D CE    1 
ATOM   7050  N  NZ    . LYS D  1 61  ? 38.616  57.272  31.700  1.00 59.87 ? 1034 LYS D NZ    1 
ATOM   7051  N  N     . VAL D  1 62  ? 40.840  50.752  28.314  1.00 63.06 ? 1035 VAL D N     1 
ATOM   7052  C  CA    . VAL D  1 62  ? 41.780  49.622  28.242  1.00 64.49 ? 1035 VAL D CA    1 
ATOM   7053  C  C     . VAL D  1 62  ? 43.084  50.032  27.560  1.00 65.91 ? 1035 VAL D C     1 
ATOM   7054  O  O     . VAL D  1 62  ? 43.073  50.652  26.493  1.00 65.73 ? 1035 VAL D O     1 
ATOM   7055  C  CB    . VAL D  1 62  ? 41.167  48.372  27.529  1.00 64.86 ? 1035 VAL D CB    1 
ATOM   7056  C  CG1   . VAL D  1 62  ? 42.183  47.230  27.442  1.00 58.79 ? 1035 VAL D CG1   1 
ATOM   7057  C  CG2   . VAL D  1 62  ? 39.909  47.891  28.246  1.00 61.03 ? 1035 VAL D CG2   1 
ATOM   7058  N  N     . LEU D  1 63  ? 44.200  49.683  28.194  1.00 67.41 ? 1036 LEU D N     1 
ATOM   7059  C  CA    . LEU D  1 63  ? 45.525  50.025  27.692  1.00 70.34 ? 1036 LEU D CA    1 
ATOM   7060  C  C     . LEU D  1 63  ? 46.028  48.974  26.704  1.00 70.71 ? 1036 LEU D C     1 
ATOM   7061  O  O     . LEU D  1 63  ? 46.584  49.307  25.657  1.00 70.69 ? 1036 LEU D O     1 
ATOM   7062  C  CB    . LEU D  1 63  ? 46.515  50.178  28.855  1.00 71.58 ? 1036 LEU D CB    1 
ATOM   7063  C  CG    . LEU D  1 63  ? 46.516  51.459  29.703  1.00 69.44 ? 1036 LEU D CG    1 
ATOM   7064  C  CD1   . LEU D  1 63  ? 45.373  51.501  30.710  1.00 72.05 ? 1036 LEU D CD1   1 
ATOM   7065  C  CD2   . LEU D  1 63  ? 47.845  51.578  30.419  1.00 71.47 ? 1036 LEU D CD2   1 
ATOM   7066  N  N     . ASP D  1 65  ? 48.622  47.749  25.040  1.00 66.10 ? 1038 ASP D N     1 
ATOM   7067  C  CA    . ASP D  1 65  ? 49.143  46.386  25.001  1.00 66.26 ? 1038 ASP D CA    1 
ATOM   7068  C  C     . ASP D  1 65  ? 48.514  45.499  26.086  1.00 65.58 ? 1038 ASP D C     1 
ATOM   7069  O  O     . ASP D  1 65  ? 49.151  44.578  26.612  1.00 62.95 ? 1038 ASP D O     1 
ATOM   7070  C  CB    . ASP D  1 65  ? 50.683  46.382  25.073  1.00 67.53 ? 1038 ASP D CB    1 
ATOM   7071  C  CG    . ASP D  1 65  ? 51.225  46.994  26.365  1.00 70.55 ? 1038 ASP D CG    1 
ATOM   7072  O  OD1   . ASP D  1 65  ? 50.613  47.953  26.889  1.00 70.15 ? 1038 ASP D OD1   1 
ATOM   7073  O  OD2   . ASP D  1 65  ? 52.275  46.516  26.849  1.00 63.35 ? 1038 ASP D OD2   1 
ATOM   7074  N  N     . CYS D  1 66  ? 47.255  45.792  26.406  1.00 66.22 ? 1039 CYS D N     1 
ATOM   7075  C  CA    . CYS D  1 66  ? 46.457  44.965  27.311  1.00 65.83 ? 1039 CYS D CA    1 
ATOM   7076  C  C     . CYS D  1 66  ? 45.512  44.041  26.549  1.00 64.46 ? 1039 CYS D C     1 
ATOM   7077  O  O     . CYS D  1 66  ? 44.928  43.131  27.136  1.00 65.29 ? 1039 CYS D O     1 
ATOM   7078  C  CB    . CYS D  1 66  ? 45.649  45.832  28.276  1.00 65.77 ? 1039 CYS D CB    1 
ATOM   7079  S  SG    . CYS D  1 66  ? 46.552  46.330  29.739  1.00 63.68 ? 1039 CYS D SG    1 
ATOM   7080  N  N     . TRP D  1 67  ? 45.365  44.286  25.249  1.00 62.27 ? 1040 TRP D N     1 
ATOM   7081  C  CA    . TRP D  1 67  ? 44.490  43.484  24.402  1.00 61.02 ? 1040 TRP D CA    1 
ATOM   7082  C  C     . TRP D  1 67  ? 45.170  42.192  23.962  1.00 60.60 ? 1040 TRP D C     1 
ATOM   7083  O  O     . TRP D  1 67  ? 46.380  42.161  23.719  1.00 60.05 ? 1040 TRP D O     1 
ATOM   7084  C  CB    . TRP D  1 67  ? 44.051  44.272  23.169  1.00 60.31 ? 1040 TRP D CB    1 
ATOM   7085  C  CG    . TRP D  1 67  ? 43.196  45.469  23.461  1.00 61.43 ? 1040 TRP D CG    1 
ATOM   7086  C  CD1   . TRP D  1 67  ? 43.610  46.767  23.545  1.00 58.76 ? 1040 TRP D CD1   1 
ATOM   7087  C  CD2   . TRP D  1 67  ? 41.777  45.485  23.684  1.00 63.00 ? 1040 TRP D CD2   1 
ATOM   7088  N  NE1   . TRP D  1 67  ? 42.543  47.589  23.812  1.00 60.66 ? 1040 TRP D NE1   1 
ATOM   7089  C  CE2   . TRP D  1 67  ? 41.405  46.830  23.903  1.00 59.17 ? 1040 TRP D CE2   1 
ATOM   7090  C  CE3   . TRP D  1 67  ? 40.787  44.494  23.731  1.00 59.65 ? 1040 TRP D CE3   1 
ATOM   7091  C  CZ2   . TRP D  1 67  ? 40.083  47.213  24.164  1.00 57.43 ? 1040 TRP D CZ2   1 
ATOM   7092  C  CZ3   . TRP D  1 67  ? 39.466  44.877  23.987  1.00 62.02 ? 1040 TRP D CZ3   1 
ATOM   7093  C  CH2   . TRP D  1 67  ? 39.131  46.225  24.201  1.00 58.55 ? 1040 TRP D CH2   1 
ATOM   7094  N  N     . ILE D  1 68  ? 44.369  41.134  23.865  1.00 57.64 ? 1041 ILE D N     1 
ATOM   7095  C  CA    . ILE D  1 68  ? 44.818  39.826  23.414  1.00 54.87 ? 1041 ILE D CA    1 
ATOM   7096  C  C     . ILE D  1 68  ? 43.751  39.221  22.496  1.00 54.16 ? 1041 ILE D C     1 
ATOM   7097  O  O     . ILE D  1 68  ? 42.547  39.384  22.732  1.00 52.18 ? 1041 ILE D O     1 
ATOM   7098  C  CB    . ILE D  1 68  ? 45.144  38.891  24.627  1.00 55.22 ? 1041 ILE D CB    1 
ATOM   7099  C  CG1   . ILE D  1 68  ? 46.591  39.100  25.097  1.00 61.46 ? 1041 ILE D CG1   1 
ATOM   7100  C  CG2   . ILE D  1 68  ? 44.877  37.404  24.320  1.00 55.25 ? 1041 ILE D CG2   1 
ATOM   7101  C  CD1   . ILE D  1 68  ? 47.685  38.660  24.110  1.00 64.52 ? 1041 ILE D CD1   1 
ATOM   7102  N  N     . GLU D  1 69  ? 44.196  38.550  21.436  1.00 52.62 ? 1042 GLU D N     1 
ATOM   7103  C  CA    . GLU D  1 69  ? 43.283  37.808  20.576  1.00 49.30 ? 1042 GLU D CA    1 
ATOM   7104  C  C     . GLU D  1 69  ? 43.170  36.375  21.086  1.00 47.00 ? 1042 GLU D C     1 
ATOM   7105  O  O     . GLU D  1 69  ? 44.156  35.634  21.117  1.00 49.56 ? 1042 GLU D O     1 
ATOM   7106  C  CB    . GLU D  1 69  ? 43.747  37.836  19.121  1.00 48.89 ? 1042 GLU D CB    1 
ATOM   7107  C  CG    . GLU D  1 69  ? 42.605  37.771  18.117  1.00 49.86 ? 1042 GLU D CG    1 
ATOM   7108  C  CD    . GLU D  1 69  ? 41.804  39.061  18.046  1.00 51.04 ? 1042 GLU D CD    1 
ATOM   7109  O  OE1   . GLU D  1 69  ? 40.555  38.984  18.052  1.00 48.04 ? 1042 GLU D OE1   1 
ATOM   7110  O  OE2   . GLU D  1 69  ? 42.423  40.149  17.980  1.00 48.96 ? 1042 GLU D OE2   1 
ATOM   7111  N  N     . ASP D  1 70  ? 41.966  36.000  21.504  1.00 43.73 ? 1043 ASP D N     1 
ATOM   7112  C  CA    . ASP D  1 70  ? 41.728  34.687  22.103  1.00 40.01 ? 1043 ASP D CA    1 
ATOM   7113  C  C     . ASP D  1 70  ? 40.719  33.868  21.275  1.00 38.31 ? 1043 ASP D C     1 
ATOM   7114  O  O     . ASP D  1 70  ? 39.620  34.346  20.973  1.00 35.31 ? 1043 ASP D O     1 
ATOM   7115  C  CB    . ASP D  1 70  ? 41.263  34.849  23.560  1.00 38.14 ? 1043 ASP D CB    1 
ATOM   7116  C  CG    . ASP D  1 70  ? 40.925  33.528  24.220  1.00 38.58 ? 1043 ASP D CG    1 
ATOM   7117  O  OD1   . ASP D  1 70  ? 41.850  32.744  24.507  1.00 45.97 ? 1043 ASP D OD1   1 
ATOM   7118  O  OD2   . ASP D  1 70  ? 39.729  33.271  24.453  1.00 44.77 ? 1043 ASP D OD2   1 
ATOM   7119  N  N     . PRO D  1 71  ? 41.101  32.638  20.891  1.00 38.01 ? 1044 PRO D N     1 
ATOM   7120  C  CA    . PRO D  1 71  ? 40.231  31.735  20.133  1.00 39.50 ? 1044 PRO D CA    1 
ATOM   7121  C  C     . PRO D  1 71  ? 38.831  31.516  20.740  1.00 39.99 ? 1044 PRO D C     1 
ATOM   7122  O  O     . PRO D  1 71  ? 37.845  31.532  20.011  1.00 42.80 ? 1044 PRO D O     1 
ATOM   7123  C  CB    . PRO D  1 71  ? 41.029  30.427  20.115  1.00 41.16 ? 1044 PRO D CB    1 
ATOM   7124  C  CG    . PRO D  1 71  ? 42.442  30.864  20.203  1.00 34.80 ? 1044 PRO D CG    1 
ATOM   7125  C  CD    . PRO D  1 71  ? 42.420  32.026  21.147  1.00 40.18 ? 1044 PRO D CD    1 
ATOM   7126  N  N     . LYS D  1 72  ? 38.749  31.328  22.054  1.00 41.73 ? 1045 LYS D N     1 
ATOM   7127  C  CA    . LYS D  1 72  ? 37.477  31.057  22.733  1.00 42.65 ? 1045 LYS D CA    1 
ATOM   7128  C  C     . LYS D  1 72  ? 36.621  32.298  23.022  1.00 43.27 ? 1045 LYS D C     1 
ATOM   7129  O  O     . LYS D  1 72  ? 35.388  32.212  23.034  1.00 39.29 ? 1045 LYS D O     1 
ATOM   7130  C  CB    . LYS D  1 72  ? 37.716  30.277  24.035  1.00 40.17 ? 1045 LYS D CB    1 
ATOM   7131  C  CG    . LYS D  1 72  ? 38.261  28.869  23.817  1.00 45.67 ? 1045 LYS D CG    1 
ATOM   7132  C  CD    . LYS D  1 72  ? 38.249  28.045  25.093  1.00 46.84 ? 1045 LYS D CD    1 
ATOM   7133  C  CE    . LYS D  1 72  ? 38.750  26.628  24.825  1.00 59.03 ? 1045 LYS D CE    1 
ATOM   7134  N  NZ    . LYS D  1 72  ? 38.798  25.774  26.053  1.00 58.37 ? 1045 LYS D NZ    1 
ATOM   7135  N  N     . LEU D  1 73  ? 37.267  33.440  23.270  1.00 42.51 ? 1046 LEU D N     1 
ATOM   7136  C  CA    . LEU D  1 73  ? 36.552  34.649  23.710  1.00 37.18 ? 1046 LEU D CA    1 
ATOM   7137  C  C     . LEU D  1 73  ? 36.626  35.791  22.699  1.00 34.71 ? 1046 LEU D C     1 
ATOM   7138  O  O     . LEU D  1 73  ? 35.794  36.698  22.719  1.00 38.44 ? 1046 LEU D O     1 
ATOM   7139  C  CB    . LEU D  1 73  ? 37.063  35.139  25.075  1.00 34.62 ? 1046 LEU D CB    1 
ATOM   7140  C  CG    . LEU D  1 73  ? 37.146  34.209  26.293  1.00 42.79 ? 1046 LEU D CG    1 
ATOM   7141  C  CD1   . LEU D  1 73  ? 37.989  34.847  27.385  1.00 39.59 ? 1046 LEU D CD1   1 
ATOM   7142  C  CD2   . LEU D  1 73  ? 35.776  33.837  26.835  1.00 43.25 ? 1046 LEU D CD2   1 
ATOM   7143  N  N     . GLY D  1 74  ? 37.625  35.755  21.828  1.00 31.46 ? 1047 GLY D N     1 
ATOM   7144  C  CA    . GLY D  1 74  ? 37.804  36.813  20.830  1.00 32.30 ? 1047 GLY D CA    1 
ATOM   7145  C  C     . GLY D  1 74  ? 38.755  37.893  21.305  1.00 30.49 ? 1047 GLY D C     1 
ATOM   7146  O  O     . GLY D  1 74  ? 39.751  37.608  21.992  1.00 27.59 ? 1047 GLY D O     1 
ATOM   7147  N  N     . LYS D  1 75  ? 38.456  39.135  20.936  1.00 29.42 ? 1048 LYS D N     1 
ATOM   7148  C  CA    . LYS D  1 75  ? 39.301  40.256  21.333  1.00 35.49 ? 1048 LYS D CA    1 
ATOM   7149  C  C     . LYS D  1 75  ? 38.898  40.744  22.728  1.00 34.39 ? 1048 LYS D C     1 
ATOM   7150  O  O     . LYS D  1 75  ? 37.937  41.500  22.898  1.00 35.90 ? 1048 LYS D O     1 
ATOM   7151  C  CB    . LYS D  1 75  ? 39.264  41.383  20.295  1.00 37.30 ? 1048 LYS D CB    1 
ATOM   7152  C  CG    . LYS D  1 75  ? 40.621  42.045  20.064  1.00 35.01 ? 1048 LYS D CG    1 
ATOM   7153  C  CD    . LYS D  1 75  ? 40.619  43.495  20.461  1.00 39.65 ? 1048 LYS D CD    1 
ATOM   7154  C  CE    . LYS D  1 75  ? 39.929  44.361  19.410  1.00 45.76 ? 1048 LYS D CE    1 
ATOM   7155  N  NZ    . LYS D  1 75  ? 39.670  45.737  19.918  1.00 43.36 ? 1048 LYS D NZ    1 
ATOM   7156  N  N     . VAL D  1 76  ? 39.638  40.263  23.719  1.00 32.30 ? 1049 VAL D N     1 
ATOM   7157  C  CA    . VAL D  1 76  ? 39.420  40.613  25.108  1.00 33.69 ? 1049 VAL D CA    1 
ATOM   7158  C  C     . VAL D  1 76  ? 40.654  41.342  25.639  1.00 34.46 ? 1049 VAL D C     1 
ATOM   7159  O  O     . VAL D  1 76  ? 41.615  41.596  24.892  1.00 29.46 ? 1049 VAL D O     1 
ATOM   7160  C  CB    . VAL D  1 76  ? 39.117  39.355  25.997  1.00 33.00 ? 1049 VAL D CB    1 
ATOM   7161  C  CG1   . VAL D  1 76  ? 37.730  38.786  25.698  1.00 22.44 ? 1049 VAL D CG1   1 
ATOM   7162  C  CG2   . VAL D  1 76  ? 40.217  38.285  25.859  1.00 23.90 ? 1049 VAL D CG2   1 
ATOM   7163  N  N     . THR D  1 77  ? 40.609  41.674  26.925  1.00 32.25 ? 1050 THR D N     1 
ATOM   7164  C  CA    . THR D  1 77  ? 41.779  42.165  27.643  1.00 38.54 ? 1050 THR D CA    1 
ATOM   7165  C  C     . THR D  1 77  ? 42.586  41.005  28.241  1.00 40.18 ? 1050 THR D C     1 
ATOM   7166  O  O     . THR D  1 77  ? 42.086  39.884  28.379  1.00 38.93 ? 1050 THR D O     1 
ATOM   7167  C  CB    . THR D  1 77  ? 41.400  43.201  28.747  1.00 37.15 ? 1050 THR D CB    1 
ATOM   7168  O  OG1   . THR D  1 77  ? 42.588  43.818  29.252  1.00 47.59 ? 1050 THR D OG1   1 
ATOM   7169  C  CG2   . THR D  1 77  ? 40.673  42.540  29.897  1.00 27.79 ? 1050 THR D CG2   1 
ATOM   7170  N  N     . LEU D  1 78  ? 43.835  41.296  28.596  1.00 41.48 ? 1051 LEU D N     1 
ATOM   7171  C  CA    . LEU D  1 78  ? 44.744  40.315  29.167  1.00 42.61 ? 1051 LEU D CA    1 
ATOM   7172  C  C     . LEU D  1 78  ? 44.326  39.868  30.570  1.00 43.24 ? 1051 LEU D C     1 
ATOM   7173  O  O     . LEU D  1 78  ? 44.702  38.784  31.018  1.00 49.38 ? 1051 LEU D O     1 
ATOM   7174  C  CB    . LEU D  1 78  ? 46.170  40.879  29.165  1.00 43.82 ? 1051 LEU D CB    1 
ATOM   7175  C  CG    . LEU D  1 78  ? 47.383  39.985  29.422  1.00 40.63 ? 1051 LEU D CG    1 
ATOM   7176  C  CD1   . LEU D  1 78  ? 47.363  38.740  28.561  1.00 36.92 ? 1051 LEU D CD1   1 
ATOM   7177  C  CD2   . LEU D  1 78  ? 48.649  40.784  29.182  1.00 39.29 ? 1051 LEU D CD2   1 
ATOM   7178  N  N     . GLU D  1 79  ? 43.546  40.703  31.253  1.00 43.49 ? 1052 GLU D N     1 
ATOM   7179  C  CA    . GLU D  1 79  ? 42.996  40.369  32.567  1.00 40.33 ? 1052 GLU D CA    1 
ATOM   7180  C  C     . GLU D  1 79  ? 41.943  39.268  32.453  1.00 37.32 ? 1052 GLU D C     1 
ATOM   7181  O  O     . GLU D  1 79  ? 41.927  38.307  33.234  1.00 36.76 ? 1052 GLU D O     1 
ATOM   7182  C  CB    . GLU D  1 79  ? 42.386  41.620  33.212  1.00 40.02 ? 1052 GLU D CB    1 
ATOM   7183  C  CG    . GLU D  1 79  ? 41.452  41.348  34.403  1.00 38.82 ? 1052 GLU D CG    1 
ATOM   7184  C  CD    . GLU D  1 79  ? 41.120  42.608  35.200  1.00 44.70 ? 1052 GLU D CD    1 
ATOM   7185  O  OE1   . GLU D  1 79  ? 41.120  43.711  34.612  1.00 45.82 ? 1052 GLU D OE1   1 
ATOM   7186  O  OE2   . GLU D  1 79  ? 40.866  42.495  36.420  1.00 42.69 ? 1052 GLU D OE2   1 
ATOM   7187  N  N     . ILE D  1 80  ? 41.055  39.434  31.480  1.00 33.50 ? 1053 ILE D N     1 
ATOM   7188  C  CA    . ILE D  1 80  ? 39.994  38.471  31.224  1.00 34.16 ? 1053 ILE D CA    1 
ATOM   7189  C  C     . ILE D  1 80  ? 40.570  37.158  30.685  1.00 33.01 ? 1053 ILE D C     1 
ATOM   7190  O  O     . ILE D  1 80  ? 40.241  36.078  31.190  1.00 35.10 ? 1053 ILE D O     1 
ATOM   7191  C  CB    . ILE D  1 80  ? 38.918  39.072  30.292  1.00 33.94 ? 1053 ILE D CB    1 
ATOM   7192  C  CG1   . ILE D  1 80  ? 38.046  40.052  31.088  1.00 35.33 ? 1053 ILE D CG1   1 
ATOM   7193  C  CG2   . ILE D  1 80  ? 38.067  37.975  29.671  1.00 32.51 ? 1053 ILE D CG2   1 
ATOM   7194  C  CD1   . ILE D  1 80  ? 37.342  41.103  30.253  1.00 43.39 ? 1053 ILE D CD1   1 
ATOM   7195  N  N     . ALA D  1 81  ? 41.454  37.272  29.693  1.00 33.65 ? 1054 ALA D N     1 
ATOM   7196  C  CA    . ALA D  1 81  ? 42.088  36.122  29.041  1.00 31.85 ? 1054 ALA D CA    1 
ATOM   7197  C  C     . ALA D  1 81  ? 42.884  35.268  30.024  1.00 34.05 ? 1054 ALA D C     1 
ATOM   7198  O  O     . ALA D  1 81  ? 42.741  34.052  30.032  1.00 37.93 ? 1054 ALA D O     1 
ATOM   7199  C  CB    . ALA D  1 81  ? 42.974  36.583  27.878  1.00 31.91 ? 1054 ALA D CB    1 
ATOM   7200  N  N     . ILE D  1 82  ? 43.706  35.902  30.858  1.00 34.44 ? 1055 ILE D N     1 
ATOM   7201  C  CA    . ILE D  1 82  ? 44.474  35.177  31.875  1.00 37.26 ? 1055 ILE D CA    1 
ATOM   7202  C  C     . ILE D  1 82  ? 43.569  34.466  32.898  1.00 38.20 ? 1055 ILE D C     1 
ATOM   7203  O  O     . ILE D  1 82  ? 43.788  33.286  33.198  1.00 40.15 ? 1055 ILE D O     1 
ATOM   7204  C  CB    . ILE D  1 82  ? 45.548  36.087  32.564  1.00 38.85 ? 1055 ILE D CB    1 
ATOM   7205  C  CG1   . ILE D  1 82  ? 46.788  36.186  31.672  1.00 36.56 ? 1055 ILE D CG1   1 
ATOM   7206  C  CG2   . ILE D  1 82  ? 45.937  35.553  33.952  1.00 37.98 ? 1055 ILE D CG2   1 
ATOM   7207  C  CD1   . ILE D  1 82  ? 47.739  37.299  32.028  1.00 38.92 ? 1055 ILE D CD1   1 
ATOM   7208  N  N     . LEU D  1 83  ? 42.555  35.178  33.402  1.00 37.24 ? 1056 LEU D N     1 
ATOM   7209  C  CA    . LEU D  1 83  ? 41.614  34.638  34.396  1.00 38.50 ? 1056 LEU D CA    1 
ATOM   7210  C  C     . LEU D  1 83  ? 40.672  33.559  33.861  1.00 42.82 ? 1056 LEU D C     1 
ATOM   7211  O  O     . LEU D  1 83  ? 40.069  32.813  34.642  1.00 44.13 ? 1056 LEU D O     1 
ATOM   7212  C  CB    . LEU D  1 83  ? 40.788  35.758  35.050  1.00 38.78 ? 1056 LEU D CB    1 
ATOM   7213  C  CG    . LEU D  1 83  ? 41.052  36.183  36.500  1.00 32.79 ? 1056 LEU D CG    1 
ATOM   7214  C  CD1   . LEU D  1 83  ? 39.881  37.014  36.993  1.00 31.29 ? 1056 LEU D CD1   1 
ATOM   7215  C  CD2   . LEU D  1 83  ? 41.265  34.985  37.430  1.00 36.32 ? 1056 LEU D CD2   1 
ATOM   7216  N  N     . SER D  1 84  ? 40.532  33.491  32.538  1.00 43.54 ? 1057 SER D N     1 
ATOM   7217  C  CA    . SER D  1 84  ? 39.779  32.417  31.890  1.00 44.39 ? 1057 SER D CA    1 
ATOM   7218  C  C     . SER D  1 84  ? 40.615  31.150  31.744  1.00 44.60 ? 1057 SER D C     1 
ATOM   7219  O  O     . SER D  1 84  ? 40.070  30.056  31.587  1.00 46.38 ? 1057 SER D O     1 
ATOM   7220  C  CB    . SER D  1 84  ? 39.261  32.862  30.520  1.00 42.54 ? 1057 SER D CB    1 
ATOM   7221  O  OG    . SER D  1 84  ? 38.060  33.599  30.664  1.00 51.33 ? 1057 SER D OG    1 
ATOM   7222  N  N     . ARG D  1 85  ? 41.935  31.302  31.804  1.00 45.26 ? 1058 ARG D N     1 
ATOM   7223  C  CA    . ARG D  1 85  ? 42.853  30.196  31.527  1.00 49.08 ? 1058 ARG D CA    1 
ATOM   7224  C  C     . ARG D  1 85  ? 43.403  29.537  32.795  1.00 47.96 ? 1058 ARG D C     1 
ATOM   7225  O  O     . ARG D  1 85  ? 44.164  28.568  32.721  1.00 46.08 ? 1058 ARG D O     1 
ATOM   7226  C  CB    . ARG D  1 85  ? 44.005  30.676  30.638  1.00 52.17 ? 1058 ARG D CB    1 
ATOM   7227  C  CG    . ARG D  1 85  ? 43.588  31.187  29.263  1.00 53.48 ? 1058 ARG D CG    1 
ATOM   7228  C  CD    . ARG D  1 85  ? 44.807  31.698  28.513  1.00 57.14 ? 1058 ARG D CD    1 
ATOM   7229  N  NE    . ARG D  1 85  ? 44.515  32.120  27.145  1.00 55.98 ? 1058 ARG D NE    1 
ATOM   7230  C  CZ    . ARG D  1 85  ? 44.831  33.309  26.634  1.00 53.10 ? 1058 ARG D CZ    1 
ATOM   7231  N  NH1   . ARG D  1 85  ? 45.459  34.216  27.373  1.00 57.93 ? 1058 ARG D NH1   1 
ATOM   7232  N  NH2   . ARG D  1 85  ? 44.532  33.586  25.372  1.00 40.33 ? 1058 ARG D NH2   1 
ATOM   7233  N  N     . VAL D  1 86  ? 43.012  30.063  33.953  1.00 49.20 ? 1059 VAL D N     1 
ATOM   7234  C  CA    . VAL D  1 86  ? 43.474  29.533  35.237  1.00 47.09 ? 1059 VAL D CA    1 
ATOM   7235  C  C     . VAL D  1 86  ? 42.335  29.032  36.124  1.00 46.43 ? 1059 VAL D C     1 
ATOM   7236  O  O     . VAL D  1 86  ? 41.238  29.589  36.126  1.00 42.55 ? 1059 VAL D O     1 
ATOM   7237  C  CB    . VAL D  1 86  ? 44.356  30.552  36.018  1.00 48.21 ? 1059 VAL D CB    1 
ATOM   7238  C  CG1   . VAL D  1 86  ? 45.700  30.738  35.322  1.00 44.40 ? 1059 VAL D CG1   1 
ATOM   7239  C  CG2   . VAL D  1 86  ? 43.641  31.890  36.200  1.00 41.38 ? 1059 VAL D CG2   1 
ATOM   7240  N  N     . GLU D  1 87  ? 42.615  27.961  36.862  1.00 47.18 ? 1060 GLU D N     1 
ATOM   7241  C  CA    . GLU D  1 87  ? 41.697  27.421  37.856  1.00 45.60 ? 1060 GLU D CA    1 
ATOM   7242  C  C     . GLU D  1 87  ? 42.511  26.883  39.023  1.00 41.60 ? 1060 GLU D C     1 
ATOM   7243  O  O     . GLU D  1 87  ? 43.239  25.899  38.884  1.00 45.28 ? 1060 GLU D O     1 
ATOM   7244  C  CB    . GLU D  1 87  ? 40.816  26.318  37.253  1.00 47.88 ? 1060 GLU D CB    1 
ATOM   7245  N  N     . HIS D  1 88  ? 42.405  27.552  40.167  1.00 40.13 ? 1061 HIS D N     1 
ATOM   7246  C  CA    . HIS D  1 88  ? 43.129  27.147  41.366  1.00 33.75 ? 1061 HIS D CA    1 
ATOM   7247  C  C     . HIS D  1 88  ? 42.266  27.373  42.598  1.00 34.36 ? 1061 HIS D C     1 
ATOM   7248  O  O     . HIS D  1 88  ? 41.373  28.218  42.588  1.00 33.70 ? 1061 HIS D O     1 
ATOM   7249  C  CB    . HIS D  1 88  ? 44.453  27.911  41.486  1.00 37.27 ? 1061 HIS D CB    1 
ATOM   7250  C  CG    . HIS D  1 88  ? 45.384  27.349  42.517  1.00 34.36 ? 1061 HIS D CG    1 
ATOM   7251  N  ND1   . HIS D  1 88  ? 45.344  27.729  43.842  1.00 35.68 ? 1061 HIS D ND1   1 
ATOM   7252  C  CD2   . HIS D  1 88  ? 46.367  26.424  42.420  1.00 35.62 ? 1061 HIS D CD2   1 
ATOM   7253  C  CE1   . HIS D  1 88  ? 46.265  27.063  44.517  1.00 34.81 ? 1061 HIS D CE1   1 
ATOM   7254  N  NE2   . HIS D  1 88  ? 46.903  26.270  43.676  1.00 38.94 ? 1061 HIS D NE2   1 
ATOM   7255  N  N     . ALA D  1 89  ? 42.534  26.603  43.653  1.00 31.57 ? 1062 ALA D N     1 
ATOM   7256  C  CA    . ALA D  1 89  ? 41.810  26.720  44.915  1.00 28.95 ? 1062 ALA D CA    1 
ATOM   7257  C  C     . ALA D  1 89  ? 41.880  28.113  45.546  1.00 27.70 ? 1062 ALA D C     1 
ATOM   7258  O  O     . ALA D  1 89  ? 41.001  28.480  46.315  1.00 34.73 ? 1062 ALA D O     1 
ATOM   7259  C  CB    . ALA D  1 89  ? 42.300  25.661  45.902  1.00 30.68 ? 1062 ALA D CB    1 
ATOM   7260  N  N     . ASN D  1 90  ? 42.917  28.883  45.218  1.00 27.68 ? 1063 ASN D N     1 
ATOM   7261  C  CA    . ASN D  1 90  ? 43.162  30.174  45.860  1.00 27.10 ? 1063 ASN D CA    1 
ATOM   7262  C  C     . ASN D  1 90  ? 43.092  31.369  44.894  1.00 30.22 ? 1063 ASN D C     1 
ATOM   7263  O  O     . ASN D  1 90  ? 43.471  32.496  45.240  1.00 30.48 ? 1063 ASN D O     1 
ATOM   7264  C  CB    . ASN D  1 90  ? 44.502  30.143  46.610  1.00 28.17 ? 1063 ASN D CB    1 
ATOM   7265  C  CG    . ASN D  1 90  ? 44.543  29.073  47.721  1.00 31.55 ? 1063 ASN D CG    1 
ATOM   7266  O  OD1   . ASN D  1 90  ? 45.358  28.151  47.675  1.00 34.08 ? 1063 ASN D OD1   1 
ATOM   7267  N  ND2   . ASN D  1 90  ? 43.664  29.203  48.717  1.00 20.40 ? 1063 ASN D ND2   1 
ATOM   7268  N  N     . ILE D  1 91  ? 42.599  31.113  43.688  1.00 26.60 ? 1064 ILE D N     1 
ATOM   7269  C  CA    . ILE D  1 91  ? 42.409  32.150  42.681  1.00 29.24 ? 1064 ILE D CA    1 
ATOM   7270  C  C     . ILE D  1 91  ? 40.904  32.268  42.432  1.00 30.86 ? 1064 ILE D C     1 
ATOM   7271  O  O     . ILE D  1 91  ? 40.210  31.255  42.344  1.00 34.09 ? 1064 ILE D O     1 
ATOM   7272  C  CB    . ILE D  1 91  ? 43.223  31.834  41.384  1.00 28.82 ? 1064 ILE D CB    1 
ATOM   7273  C  CG1   . ILE D  1 91  ? 44.727  31.917  41.682  1.00 28.22 ? 1064 ILE D CG1   1 
ATOM   7274  C  CG2   . ILE D  1 91  ? 42.860  32.776  40.244  1.00 24.22 ? 1064 ILE D CG2   1 
ATOM   7275  C  CD1   . ILE D  1 91  ? 45.636  31.307  40.625  1.00 29.45 ? 1064 ILE D CD1   1 
ATOM   7276  N  N     . ILE D  1 92  ? 40.396  33.500  42.366  1.00 30.57 ? 1065 ILE D N     1 
ATOM   7277  C  CA    . ILE D  1 92  ? 38.961  33.719  42.172  1.00 32.21 ? 1065 ILE D CA    1 
ATOM   7278  C  C     . ILE D  1 92  ? 38.481  33.049  40.879  1.00 36.26 ? 1065 ILE D C     1 
ATOM   7279  O  O     . ILE D  1 92  ? 39.215  32.983  39.883  1.00 33.38 ? 1065 ILE D O     1 
ATOM   7280  C  CB    . ILE D  1 92  ? 38.565  35.229  42.251  1.00 29.74 ? 1065 ILE D CB    1 
ATOM   7281  C  CG1   . ILE D  1 92  ? 37.146  35.396  42.801  1.00 31.33 ? 1065 ILE D CG1   1 
ATOM   7282  C  CG2   . ILE D  1 92  ? 38.735  35.946  40.914  1.00 32.58 ? 1065 ILE D CG2   1 
ATOM   7283  C  CD1   . ILE D  1 92  ? 37.029  35.174  44.310  1.00 34.11 ? 1065 ILE D CD1   1 
ATOM   7284  N  N     . LYS D  1 93  ? 37.260  32.524  40.923  1.00 38.33 ? 1066 LYS D N     1 
ATOM   7285  C  CA    . LYS D  1 93  ? 36.691  31.776  39.807  1.00 36.43 ? 1066 LYS D CA    1 
ATOM   7286  C  C     . LYS D  1 93  ? 35.761  32.660  38.975  1.00 30.88 ? 1066 LYS D C     1 
ATOM   7287  O  O     . LYS D  1 93  ? 34.907  33.363  39.514  1.00 28.64 ? 1066 LYS D O     1 
ATOM   7288  C  CB    . LYS D  1 93  ? 35.974  30.521  40.332  1.00 36.49 ? 1066 LYS D CB    1 
ATOM   7289  C  CG    . LYS D  1 93  ? 35.066  29.805  39.335  1.00 38.87 ? 1066 LYS D CG    1 
ATOM   7290  C  CD    . LYS D  1 93  ? 34.541  28.497  39.918  1.00 44.96 ? 1066 LYS D CD    1 
ATOM   7291  C  CE    . LYS D  1 93  ? 33.096  28.218  39.498  1.00 53.84 ? 1066 LYS D CE    1 
ATOM   7292  N  NZ    . LYS D  1 93  ? 32.893  28.230  38.019  1.00 57.86 ? 1066 LYS D NZ    1 
ATOM   7293  N  N     . VAL D  1 94  ? 35.957  32.616  37.663  1.00 32.89 ? 1067 VAL D N     1 
ATOM   7294  C  CA    . VAL D  1 94  ? 35.112  33.307  36.691  1.00 36.66 ? 1067 VAL D CA    1 
ATOM   7295  C  C     . VAL D  1 94  ? 33.860  32.472  36.405  1.00 36.60 ? 1067 VAL D C     1 
ATOM   7296  O  O     . VAL D  1 94  ? 33.954  31.283  36.117  1.00 37.82 ? 1067 VAL D O     1 
ATOM   7297  C  CB    . VAL D  1 94  ? 35.890  33.566  35.380  1.00 37.22 ? 1067 VAL D CB    1 
ATOM   7298  C  CG1   . VAL D  1 94  ? 35.033  34.312  34.364  1.00 41.71 ? 1067 VAL D CG1   1 
ATOM   7299  C  CG2   . VAL D  1 94  ? 37.167  34.341  35.668  1.00 41.85 ? 1067 VAL D CG2   1 
ATOM   7300  N  N     . LEU D  1 95  ? 32.694  33.104  36.511  1.00 37.23 ? 1068 LEU D N     1 
ATOM   7301  C  CA    . LEU D  1 95  ? 31.421  32.436  36.277  1.00 39.91 ? 1068 LEU D CA    1 
ATOM   7302  C  C     . LEU D  1 95  ? 30.918  32.721  34.873  1.00 43.36 ? 1068 LEU D C     1 
ATOM   7303  O  O     . LEU D  1 95  ? 30.311  31.862  34.234  1.00 46.94 ? 1068 LEU D O     1 
ATOM   7304  C  CB    . LEU D  1 95  ? 30.374  32.890  37.295  1.00 37.70 ? 1068 LEU D CB    1 
ATOM   7305  C  CG    . LEU D  1 95  ? 30.652  32.742  38.792  1.00 36.37 ? 1068 LEU D CG    1 
ATOM   7306  C  CD1   . LEU D  1 95  ? 29.456  33.253  39.572  1.00 24.94 ? 1068 LEU D CD1   1 
ATOM   7307  C  CD2   . LEU D  1 95  ? 30.995  31.302  39.190  1.00 27.48 ? 1068 LEU D CD2   1 
ATOM   7308  N  N     . ASP D  1 96  ? 31.167  33.946  34.417  1.00 45.67 ? 1069 ASP D N     1 
ATOM   7309  C  CA    . ASP D  1 96  ? 30.790  34.404  33.090  1.00 42.75 ? 1069 ASP D CA    1 
ATOM   7310  C  C     . ASP D  1 96  ? 31.670  35.558  32.665  1.00 44.21 ? 1069 ASP D C     1 
ATOM   7311  O  O     . ASP D  1 96  ? 32.207  36.292  33.504  1.00 45.68 ? 1069 ASP D O     1 
ATOM   7312  C  CB    . ASP D  1 96  ? 29.339  34.870  33.068  1.00 43.73 ? 1069 ASP D CB    1 
ATOM   7313  C  CG    . ASP D  1 96  ? 28.378  33.766  32.692  1.00 45.55 ? 1069 ASP D CG    1 
ATOM   7314  O  OD1   . ASP D  1 96  ? 28.578  33.136  31.631  1.00 48.11 ? 1069 ASP D OD1   1 
ATOM   7315  O  OD2   . ASP D  1 96  ? 27.414  33.541  33.452  1.00 47.85 ? 1069 ASP D OD2   1 
ATOM   7316  N  N     . ILE D  1 97  ? 31.837  35.690  31.354  1.00 38.00 ? 1070 ILE D N     1 
ATOM   7317  C  CA    . ILE D  1 97  ? 32.404  36.895  30.776  1.00 35.54 ? 1070 ILE D CA    1 
ATOM   7318  C  C     . ILE D  1 97  ? 31.534  37.354  29.611  1.00 30.08 ? 1070 ILE D C     1 
ATOM   7319  O  O     . ILE D  1 97  ? 31.324  36.615  28.650  1.00 33.55 ? 1070 ILE D O     1 
ATOM   7320  C  CB    . ILE D  1 97  ? 33.921  36.767  30.405  1.00 33.72 ? 1070 ILE D CB    1 
ATOM   7321  C  CG1   . ILE D  1 97  ? 34.259  37.697  29.229  1.00 32.32 ? 1070 ILE D CG1   1 
ATOM   7322  C  CG2   . ILE D  1 97  ? 34.331  35.306  30.201  1.00 47.67 ? 1070 ILE D CG2   1 
ATOM   7323  C  CD1   . ILE D  1 97  ? 35.306  37.204  28.287  1.00 36.17 ? 1070 ILE D CD1   1 
ATOM   7324  N  N     . PHE D  1 98  ? 30.994  38.563  29.741  1.00 29.46 ? 1071 PHE D N     1 
ATOM   7325  C  CA    . PHE D  1 98  ? 30.175  39.174  28.704  1.00 28.55 ? 1071 PHE D CA    1 
ATOM   7326  C  C     . PHE D  1 98  ? 30.829  40.450  28.155  1.00 30.45 ? 1071 PHE D C     1 
ATOM   7327  O  O     . PHE D  1 98  ? 31.825  40.929  28.703  1.00 32.04 ? 1071 PHE D O     1 
ATOM   7328  C  CB    . PHE D  1 98  ? 28.759  39.459  29.225  1.00 26.49 ? 1071 PHE D CB    1 
ATOM   7329  C  CG    . PHE D  1 98  ? 28.023  38.235  29.716  1.00 27.08 ? 1071 PHE D CG    1 
ATOM   7330  C  CD1   . PHE D  1 98  ? 27.660  37.217  28.836  1.00 29.17 ? 1071 PHE D CD1   1 
ATOM   7331  C  CD2   . PHE D  1 98  ? 27.682  38.107  31.062  1.00 32.90 ? 1071 PHE D CD2   1 
ATOM   7332  C  CE1   . PHE D  1 98  ? 26.966  36.092  29.286  1.00 27.62 ? 1071 PHE D CE1   1 
ATOM   7333  C  CE2   . PHE D  1 98  ? 26.994  36.986  31.522  1.00 33.22 ? 1071 PHE D CE2   1 
ATOM   7334  C  CZ    . PHE D  1 98  ? 26.627  35.980  30.626  1.00 29.50 ? 1071 PHE D CZ    1 
ATOM   7335  N  N     . GLU D  1 99  ? 30.263  40.979  27.068  1.00 33.58 ? 1072 GLU D N     1 
ATOM   7336  C  CA    . GLU D  1 99  ? 30.768  42.175  26.376  1.00 35.44 ? 1072 GLU D CA    1 
ATOM   7337  C  C     . GLU D  1 99  ? 29.612  42.811  25.603  1.00 36.68 ? 1072 GLU D C     1 
ATOM   7338  O  O     . GLU D  1 99  ? 28.769  42.093  25.056  1.00 38.67 ? 1072 GLU D O     1 
ATOM   7339  C  CB    . GLU D  1 99  ? 31.915  41.783  25.433  1.00 35.83 ? 1072 GLU D CB    1 
ATOM   7340  C  CG    . GLU D  1 99  ? 32.390  42.840  24.441  1.00 37.05 ? 1072 GLU D CG    1 
ATOM   7341  C  CD    . GLU D  1 99  ? 33.467  42.321  23.490  1.00 40.08 ? 1072 GLU D CD    1 
ATOM   7342  O  OE1   . GLU D  1 99  ? 34.307  43.134  23.044  1.00 51.85 ? 1072 GLU D OE1   1 
ATOM   7343  O  OE2   . GLU D  1 99  ? 33.480  41.105  23.177  1.00 28.65 ? 1072 GLU D OE2   1 
ATOM   7344  N  N     . ASN D  1 100 ? 29.552  44.146  25.579  1.00 37.16 ? 1073 ASN D N     1 
ATOM   7345  C  CA    . ASN D  1 100 ? 28.518  44.853  24.801  1.00 32.32 ? 1073 ASN D CA    1 
ATOM   7346  C  C     . ASN D  1 100 ? 29.064  45.948  23.886  1.00 38.85 ? 1073 ASN D C     1 
ATOM   7347  O  O     . ASN D  1 100 ? 28.326  46.855  23.469  1.00 43.51 ? 1073 ASN D O     1 
ATOM   7348  C  CB    . ASN D  1 100 ? 27.380  45.381  25.695  1.00 35.55 ? 1073 ASN D CB    1 
ATOM   7349  C  CG    . ASN D  1 100 ? 27.847  46.383  26.756  1.00 30.13 ? 1073 ASN D CG    1 
ATOM   7350  O  OD1   . ASN D  1 100 ? 28.923  46.973  26.666  1.00 33.24 ? 1073 ASN D OD1   1 
ATOM   7351  N  ND2   . ASN D  1 100 ? 27.017  46.579  27.768  1.00 37.36 ? 1073 ASN D ND2   1 
ATOM   7352  N  N     . GLN D  1 101 ? 30.358  45.850  23.584  1.00 38.26 ? 1074 GLN D N     1 
ATOM   7353  C  CA    . GLN D  1 101 ? 31.059  46.764  22.667  1.00 48.52 ? 1074 GLN D CA    1 
ATOM   7354  C  C     . GLN D  1 101 ? 31.395  48.123  23.289  1.00 48.44 ? 1074 GLN D C     1 
ATOM   7355  O  O     . GLN D  1 101 ? 32.374  48.762  22.893  1.00 50.49 ? 1074 GLN D O     1 
ATOM   7356  C  CB    . GLN D  1 101 ? 30.333  46.917  21.317  1.00 50.12 ? 1074 GLN D CB    1 
ATOM   7357  N  N     . GLY D  1 102 ? 30.583  48.554  24.251  1.00 47.11 ? 1075 GLY D N     1 
ATOM   7358  C  CA    . GLY D  1 102 ? 30.939  49.662  25.139  1.00 38.27 ? 1075 GLY D CA    1 
ATOM   7359  C  C     . GLY D  1 102 ? 31.793  49.181  26.302  1.00 32.62 ? 1075 GLY D C     1 
ATOM   7360  O  O     . GLY D  1 102 ? 32.810  49.796  26.621  1.00 31.65 ? 1075 GLY D O     1 
ATOM   7361  N  N     . PHE D  1 103 ? 31.382  48.066  26.916  1.00 29.45 ? 1076 PHE D N     1 
ATOM   7362  C  CA    . PHE D  1 103 ? 32.006  47.527  28.131  1.00 26.49 ? 1076 PHE D CA    1 
ATOM   7363  C  C     . PHE D  1 103 ? 32.310  46.022  28.062  1.00 28.59 ? 1076 PHE D C     1 
ATOM   7364  O  O     . PHE D  1 103 ? 31.818  45.320  27.183  1.00 28.28 ? 1076 PHE D O     1 
ATOM   7365  C  CB    . PHE D  1 103 ? 31.083  47.766  29.340  1.00 27.30 ? 1076 PHE D CB    1 
ATOM   7366  C  CG    . PHE D  1 103 ? 31.115  49.168  29.878  1.00 28.86 ? 1076 PHE D CG    1 
ATOM   7367  C  CD1   . PHE D  1 103 ? 31.801  49.453  31.056  1.00 34.67 ? 1076 PHE D CD1   1 
ATOM   7368  C  CD2   . PHE D  1 103 ? 30.449  50.201  29.221  1.00 32.22 ? 1076 PHE D CD2   1 
ATOM   7369  C  CE1   . PHE D  1 103 ? 31.833  50.752  31.569  1.00 40.91 ? 1076 PHE D CE1   1 
ATOM   7370  C  CE2   . PHE D  1 103 ? 30.476  51.506  29.723  1.00 34.53 ? 1076 PHE D CE2   1 
ATOM   7371  C  CZ    . PHE D  1 103 ? 31.164  51.780  30.899  1.00 29.87 ? 1076 PHE D CZ    1 
ATOM   7372  N  N     . PHE D  1 104 ? 33.131  45.550  29.004  1.00 30.28 ? 1077 PHE D N     1 
ATOM   7373  C  CA    . PHE D  1 104 ? 33.216  44.137  29.379  1.00 28.47 ? 1077 PHE D CA    1 
ATOM   7374  C  C     . PHE D  1 104 ? 32.534  43.985  30.742  1.00 28.17 ? 1077 PHE D C     1 
ATOM   7375  O  O     . PHE D  1 104 ? 32.564  44.907  31.566  1.00 29.79 ? 1077 PHE D O     1 
ATOM   7376  C  CB    . PHE D  1 104 ? 34.677  43.666  29.505  1.00 33.42 ? 1077 PHE D CB    1 
ATOM   7377  C  CG    . PHE D  1 104 ? 35.346  43.340  28.193  1.00 35.78 ? 1077 PHE D CG    1 
ATOM   7378  C  CD1   . PHE D  1 104 ? 36.353  44.162  27.687  1.00 35.51 ? 1077 PHE D CD1   1 
ATOM   7379  C  CD2   . PHE D  1 104 ? 34.985  42.202  27.473  1.00 41.34 ? 1077 PHE D CD2   1 
ATOM   7380  C  CE1   . PHE D  1 104 ? 36.978  43.868  26.476  1.00 35.08 ? 1077 PHE D CE1   1 
ATOM   7381  C  CE2   . PHE D  1 104 ? 35.603  41.898  26.257  1.00 38.64 ? 1077 PHE D CE2   1 
ATOM   7382  C  CZ    . PHE D  1 104 ? 36.597  42.735  25.757  1.00 32.83 ? 1077 PHE D CZ    1 
ATOM   7383  N  N     . GLN D  1 105 ? 31.905  42.833  30.965  1.00 28.72 ? 1078 GLN D N     1 
ATOM   7384  C  CA    . GLN D  1 105 ? 31.338  42.475  32.269  1.00 29.94 ? 1078 GLN D CA    1 
ATOM   7385  C  C     . GLN D  1 105 ? 31.940  41.149  32.743  1.00 31.91 ? 1078 GLN D C     1 
ATOM   7386  O  O     . GLN D  1 105 ? 31.522  40.069  32.302  1.00 35.22 ? 1078 GLN D O     1 
ATOM   7387  C  CB    . GLN D  1 105 ? 29.807  42.375  32.224  1.00 29.91 ? 1078 GLN D CB    1 
ATOM   7388  C  CG    . GLN D  1 105 ? 29.072  43.634  31.769  1.00 26.96 ? 1078 GLN D CG    1 
ATOM   7389  C  CD    . GLN D  1 105 ? 29.017  43.790  30.250  1.00 30.87 ? 1078 GLN D CD    1 
ATOM   7390  O  OE1   . GLN D  1 105 ? 28.979  44.906  29.731  1.00 28.84 ? 1078 GLN D OE1   1 
ATOM   7391  N  NE2   . GLN D  1 105 ? 29.005  42.672  29.537  1.00 26.63 ? 1078 GLN D NE2   1 
ATOM   7392  N  N     . LEU D  1 106 ? 32.943  41.249  33.617  1.00 32.80 ? 1079 LEU D N     1 
ATOM   7393  C  CA    . LEU D  1 106 ? 33.628  40.089  34.180  1.00 33.12 ? 1079 LEU D CA    1 
ATOM   7394  C  C     . LEU D  1 106 ? 32.910  39.673  35.454  1.00 33.40 ? 1079 LEU D C     1 
ATOM   7395  O  O     . LEU D  1 106 ? 32.994  40.363  36.478  1.00 36.82 ? 1079 LEU D O     1 
ATOM   7396  C  CB    . LEU D  1 106 ? 35.095  40.425  34.495  1.00 29.54 ? 1079 LEU D CB    1 
ATOM   7397  C  CG    . LEU D  1 106 ? 36.248  39.405  34.547  1.00 38.21 ? 1079 LEU D CG    1 
ATOM   7398  C  CD1   . LEU D  1 106 ? 37.231  39.809  35.648  1.00 29.94 ? 1079 LEU D CD1   1 
ATOM   7399  C  CD2   . LEU D  1 106 ? 35.830  37.940  34.733  1.00 41.11 ? 1079 LEU D CD2   1 
ATOM   7400  N  N     . VAL D  1 107 ? 32.203  38.548  35.383  1.00 34.04 ? 1080 VAL D N     1 
ATOM   7401  C  CA    . VAL D  1 107 ? 31.467  38.005  36.527  1.00 29.83 ? 1080 VAL D CA    1 
ATOM   7402  C  C     . VAL D  1 107 ? 32.261  36.875  37.187  1.00 30.85 ? 1080 VAL D C     1 
ATOM   7403  O  O     . VAL D  1 107 ? 32.684  35.920  36.529  1.00 29.60 ? 1080 VAL D O     1 
ATOM   7404  C  CB    . VAL D  1 107 ? 30.061  37.496  36.126  1.00 31.19 ? 1080 VAL D CB    1 
ATOM   7405  C  CG1   . VAL D  1 107 ? 29.270  37.025  37.358  1.00 33.45 ? 1080 VAL D CG1   1 
ATOM   7406  C  CG2   . VAL D  1 107 ? 29.294  38.562  35.393  1.00 25.93 ? 1080 VAL D CG2   1 
ATOM   7407  N  N     . MET D  1 108 ? 32.454  37.001  38.497  1.00 32.11 ? 1081 MET D N     1 
ATOM   7408  C  CA    . MET D  1 108 ? 33.234  36.044  39.276  1.00 29.84 ? 1081 MET D CA    1 
ATOM   7409  C  C     . MET D  1 108 ? 32.421  35.491  40.450  1.00 30.32 ? 1081 MET D C     1 
ATOM   7410  O  O     . MET D  1 108 ? 31.391  36.051  40.823  1.00 28.61 ? 1081 MET D O     1 
ATOM   7411  C  CB    . MET D  1 108 ? 34.490  36.730  39.822  1.00 25.12 ? 1081 MET D CB    1 
ATOM   7412  C  CG    . MET D  1 108 ? 35.350  37.453  38.786  1.00 25.29 ? 1081 MET D CG    1 
ATOM   7413  S  SD    . MET D  1 108 ? 36.436  38.671  39.575  1.00 32.45 ? 1081 MET D SD    1 
ATOM   7414  C  CE    . MET D  1 108 ? 35.399  40.133  39.430  1.00 26.82 ? 1081 MET D CE    1 
ATOM   7415  N  N     . GLU D  1 109 ? 32.889  34.399  41.047  1.00 34.85 ? 1082 GLU D N     1 
ATOM   7416  C  CA    . GLU D  1 109 ? 32.345  33.971  42.335  1.00 38.09 ? 1082 GLU D CA    1 
ATOM   7417  C  C     . GLU D  1 109 ? 32.538  35.099  43.355  1.00 36.73 ? 1082 GLU D C     1 
ATOM   7418  O  O     . GLU D  1 109 ? 33.486  35.882  43.259  1.00 35.78 ? 1082 GLU D O     1 
ATOM   7419  C  CB    . GLU D  1 109 ? 33.021  32.691  42.839  1.00 35.34 ? 1082 GLU D CB    1 
ATOM   7420  C  CG    . GLU D  1 109 ? 34.532  32.832  43.042  1.00 45.62 ? 1082 GLU D CG    1 
ATOM   7421  C  CD    . GLU D  1 109 ? 35.115  31.833  44.020  1.00 48.13 ? 1082 GLU D CD    1 
ATOM   7422  O  OE1   . GLU D  1 109 ? 34.629  31.756  45.170  1.00 57.14 ? 1082 GLU D OE1   1 
ATOM   7423  O  OE2   . GLU D  1 109 ? 36.079  31.138  43.642  1.00 51.28 ? 1082 GLU D OE2   1 
ATOM   7424  N  N     . LYS D  1 110 ? 31.626  35.190  44.316  1.00 37.09 ? 1083 LYS D N     1 
ATOM   7425  C  CA    . LYS D  1 110 ? 31.844  36.066  45.450  1.00 38.14 ? 1083 LYS D CA    1 
ATOM   7426  C  C     . LYS D  1 110 ? 32.391  35.250  46.616  1.00 36.57 ? 1083 LYS D C     1 
ATOM   7427  O  O     . LYS D  1 110 ? 31.764  34.296  47.067  1.00 39.05 ? 1083 LYS D O     1 
ATOM   7428  C  CB    . LYS D  1 110 ? 30.574  36.825  45.837  1.00 33.99 ? 1083 LYS D CB    1 
ATOM   7429  C  CG    . LYS D  1 110 ? 30.826  37.903  46.882  1.00 35.58 ? 1083 LYS D CG    1 
ATOM   7430  C  CD    . LYS D  1 110 ? 29.637  38.817  47.039  1.00 29.27 ? 1083 LYS D CD    1 
ATOM   7431  C  CE    . LYS D  1 110 ? 29.861  39.764  48.182  1.00 31.31 ? 1083 LYS D CE    1 
ATOM   7432  N  NZ    . LYS D  1 110 ? 28.569  40.150  48.776  1.00 25.89 ? 1083 LYS D NZ    1 
ATOM   7433  N  N     . HIS D  1 111 ? 33.577  35.632  47.075  1.00 40.76 ? 1084 HIS D N     1 
ATOM   7434  C  CA    . HIS D  1 111 ? 34.252  34.986  48.195  1.00 39.37 ? 1084 HIS D CA    1 
ATOM   7435  C  C     . HIS D  1 111 ? 34.006  35.818  49.449  1.00 39.93 ? 1084 HIS D C     1 
ATOM   7436  O  O     . HIS D  1 111 ? 34.361  37.001  49.495  1.00 41.50 ? 1084 HIS D O     1 
ATOM   7437  C  CB    . HIS D  1 111 ? 35.750  34.871  47.891  1.00 37.90 ? 1084 HIS D CB    1 
ATOM   7438  C  CG    . HIS D  1 111 ? 36.510  34.023  48.863  1.00 41.33 ? 1084 HIS D CG    1 
ATOM   7439  N  ND1   . HIS D  1 111 ? 36.406  32.648  48.894  1.00 41.75 ? 1084 HIS D ND1   1 
ATOM   7440  C  CD2   . HIS D  1 111 ? 37.403  34.354  49.826  1.00 29.73 ? 1084 HIS D CD2   1 
ATOM   7441  C  CE1   . HIS D  1 111 ? 37.196  32.170  49.838  1.00 32.79 ? 1084 HIS D CE1   1 
ATOM   7442  N  NE2   . HIS D  1 111 ? 37.813  33.184  50.418  1.00 28.58 ? 1084 HIS D NE2   1 
ATOM   7443  N  N     . GLY D  1 112 ? 33.371  35.203  50.448  1.00 40.57 ? 1085 GLY D N     1 
ATOM   7444  C  CA    . GLY D  1 112 ? 32.996  35.895  51.683  1.00 41.89 ? 1085 GLY D CA    1 
ATOM   7445  C  C     . GLY D  1 112 ? 32.090  37.098  51.472  1.00 42.90 ? 1085 GLY D C     1 
ATOM   7446  O  O     . GLY D  1 112 ? 31.226  37.086  50.593  1.00 46.21 ? 1085 GLY D O     1 
ATOM   7447  N  N     . SER D  1 113 ? 32.299  38.138  52.277  1.00 43.67 ? 1086 SER D N     1 
ATOM   7448  C  CA    . SER D  1 113 ? 31.491  39.359  52.224  1.00 41.87 ? 1086 SER D CA    1 
ATOM   7449  C  C     . SER D  1 113 ? 32.125  40.454  51.362  1.00 42.80 ? 1086 SER D C     1 
ATOM   7450  O  O     . SER D  1 113 ? 31.726  41.619  51.430  1.00 40.22 ? 1086 SER D O     1 
ATOM   7451  C  CB    . SER D  1 113 ? 31.247  39.896  53.636  1.00 45.23 ? 1086 SER D CB    1 
ATOM   7452  O  OG    . SER D  1 113 ? 32.442  40.414  54.200  1.00 49.46 ? 1086 SER D OG    1 
ATOM   7453  N  N     . GLY D  1 114 ? 33.097  40.072  50.538  1.00 44.87 ? 1087 GLY D N     1 
ATOM   7454  C  CA    . GLY D  1 114 ? 33.863  41.036  49.760  1.00 44.94 ? 1087 GLY D CA    1 
ATOM   7455  C  C     . GLY D  1 114 ? 34.838  41.757  50.663  1.00 45.87 ? 1087 GLY D C     1 
ATOM   7456  O  O     . GLY D  1 114 ? 34.997  42.973  50.578  1.00 49.74 ? 1087 GLY D O     1 
ATOM   7457  N  N     . LEU D  1 115 ? 35.484  40.988  51.535  1.00 45.02 ? 1088 LEU D N     1 
ATOM   7458  C  CA    . LEU D  1 115 ? 36.415  41.511  52.523  1.00 43.25 ? 1088 LEU D CA    1 
ATOM   7459  C  C     . LEU D  1 115 ? 37.836  41.106  52.150  1.00 37.77 ? 1088 LEU D C     1 
ATOM   7460  O  O     . LEU D  1 115 ? 38.190  39.924  52.193  1.00 37.39 ? 1088 LEU D O     1 
ATOM   7461  C  CB    . LEU D  1 115 ? 36.054  40.974  53.917  1.00 45.69 ? 1088 LEU D CB    1 
ATOM   7462  C  CG    . LEU D  1 115 ? 36.843  41.436  55.142  1.00 44.61 ? 1088 LEU D CG    1 
ATOM   7463  C  CD1   . LEU D  1 115 ? 36.181  42.641  55.786  1.00 55.65 ? 1088 LEU D CD1   1 
ATOM   7464  C  CD2   . LEU D  1 115 ? 36.922  40.300  56.133  1.00 51.74 ? 1088 LEU D CD2   1 
ATOM   7465  N  N     . ASP D  1 116 ? 38.651  42.090  51.789  1.00 33.32 ? 1089 ASP D N     1 
ATOM   7466  C  CA    . ASP D  1 116 ? 40.038  41.818  51.428  1.00 34.76 ? 1089 ASP D CA    1 
ATOM   7467  C  C     . ASP D  1 116 ? 40.969  41.850  52.649  1.00 37.09 ? 1089 ASP D C     1 
ATOM   7468  O  O     . ASP D  1 116 ? 40.540  42.164  53.763  1.00 40.18 ? 1089 ASP D O     1 
ATOM   7469  C  CB    . ASP D  1 116 ? 40.519  42.754  50.305  1.00 33.27 ? 1089 ASP D CB    1 
ATOM   7470  C  CG    . ASP D  1 116 ? 40.334  44.218  50.635  1.00 27.62 ? 1089 ASP D CG    1 
ATOM   7471  O  OD1   . ASP D  1 116 ? 41.056  44.742  51.507  1.00 39.37 ? 1089 ASP D OD1   1 
ATOM   7472  O  OD2   . ASP D  1 116 ? 39.472  44.853  50.007  1.00 39.04 ? 1089 ASP D OD2   1 
ATOM   7473  N  N     . LEU D  1 117 ? 42.241  41.536  52.427  1.00 32.60 ? 1090 LEU D N     1 
ATOM   7474  C  CA    . LEU D  1 117 ? 43.206  41.418  53.506  1.00 27.66 ? 1090 LEU D CA    1 
ATOM   7475  C  C     . LEU D  1 117 ? 43.574  42.767  54.147  1.00 32.11 ? 1090 LEU D C     1 
ATOM   7476  O  O     . LEU D  1 117 ? 43.979  42.806  55.314  1.00 32.91 ? 1090 LEU D O     1 
ATOM   7477  C  CB    . LEU D  1 117 ? 44.440  40.657  53.012  1.00 26.34 ? 1090 LEU D CB    1 
ATOM   7478  C  CG    . LEU D  1 117 ? 44.996  39.478  53.823  1.00 33.98 ? 1090 LEU D CG    1 
ATOM   7479  C  CD1   . LEU D  1 117 ? 43.922  38.467  54.205  1.00 25.59 ? 1090 LEU D CD1   1 
ATOM   7480  C  CD2   . LEU D  1 117 ? 46.133  38.793  53.058  1.00 25.69 ? 1090 LEU D CD2   1 
ATOM   7481  N  N     . PHE D  1 118 ? 43.412  43.858  53.392  1.00 31.05 ? 1091 PHE D N     1 
ATOM   7482  C  CA    . PHE D  1 118 ? 43.608  45.216  53.899  1.00 34.41 ? 1091 PHE D CA    1 
ATOM   7483  C  C     . PHE D  1 118 ? 42.508  45.537  54.911  1.00 38.84 ? 1091 PHE D C     1 
ATOM   7484  O  O     . PHE D  1 118 ? 42.772  46.121  55.974  1.00 38.75 ? 1091 PHE D O     1 
ATOM   7485  C  CB    . PHE D  1 118 ? 43.583  46.238  52.746  1.00 34.65 ? 1091 PHE D CB    1 
ATOM   7486  C  CG    . PHE D  1 118 ? 43.959  47.642  53.158  1.00 34.49 ? 1091 PHE D CG    1 
ATOM   7487  C  CD1   . PHE D  1 118 ? 43.010  48.509  53.696  1.00 39.86 ? 1091 PHE D CD1   1 
ATOM   7488  C  CD2   . PHE D  1 118 ? 45.260  48.103  52.992  1.00 42.44 ? 1091 PHE D CD2   1 
ATOM   7489  C  CE1   . PHE D  1 118 ? 43.358  49.805  54.087  1.00 38.46 ? 1091 PHE D CE1   1 
ATOM   7490  C  CE2   . PHE D  1 118 ? 45.615  49.403  53.371  1.00 39.67 ? 1091 PHE D CE2   1 
ATOM   7491  C  CZ    . PHE D  1 118 ? 44.661  50.249  53.927  1.00 35.46 ? 1091 PHE D CZ    1 
ATOM   7492  N  N     . ALA D  1 119 ? 41.278  45.158  54.560  1.00 37.41 ? 1092 ALA D N     1 
ATOM   7493  C  CA    . ALA D  1 119 ? 40.124  45.305  55.442  1.00 39.56 ? 1092 ALA D CA    1 
ATOM   7494  C  C     . ALA D  1 119 ? 40.255  44.428  56.689  1.00 38.54 ? 1092 ALA D C     1 
ATOM   7495  O  O     . ALA D  1 119 ? 39.960  44.884  57.788  1.00 40.47 ? 1092 ALA D O     1 
ATOM   7496  C  CB    . ALA D  1 119 ? 38.829  44.998  54.689  1.00 37.59 ? 1092 ALA D CB    1 
ATOM   7497  N  N     . PHE D  1 120 ? 40.708  43.185  56.497  1.00 36.18 ? 1093 PHE D N     1 
ATOM   7498  C  CA    . PHE D  1 120 ? 40.989  42.224  57.576  1.00 36.92 ? 1093 PHE D CA    1 
ATOM   7499  C  C     . PHE D  1 120 ? 42.002  42.754  58.602  1.00 39.35 ? 1093 PHE D C     1 
ATOM   7500  O  O     . PHE D  1 120 ? 41.741  42.740  59.808  1.00 39.81 ? 1093 PHE D O     1 
ATOM   7501  C  CB    . PHE D  1 120 ? 41.479  40.908  56.953  1.00 38.65 ? 1093 PHE D CB    1 
ATOM   7502  C  CG    . PHE D  1 120 ? 41.767  39.810  57.943  1.00 35.82 ? 1093 PHE D CG    1 
ATOM   7503  C  CD1   . PHE D  1 120 ? 40.729  39.056  58.498  1.00 34.85 ? 1093 PHE D CD1   1 
ATOM   7504  C  CD2   . PHE D  1 120 ? 43.084  39.492  58.283  1.00 37.19 ? 1093 PHE D CD2   1 
ATOM   7505  C  CE1   . PHE D  1 120 ? 40.998  38.020  59.409  1.00 30.88 ? 1093 PHE D CE1   1 
ATOM   7506  C  CE2   . PHE D  1 120 ? 43.364  38.457  59.192  1.00 34.79 ? 1093 PHE D CE2   1 
ATOM   7507  C  CZ    . PHE D  1 120 ? 42.316  37.721  59.753  1.00 37.25 ? 1093 PHE D CZ    1 
ATOM   7508  N  N     . ILE D  1 121 ? 43.148  43.218  58.103  1.00 40.94 ? 1094 ILE D N     1 
ATOM   7509  C  CA    . ILE D  1 121 ? 44.240  43.773  58.909  1.00 39.15 ? 1094 ILE D CA    1 
ATOM   7510  C  C     . ILE D  1 121 ? 43.860  45.073  59.638  1.00 42.88 ? 1094 ILE D C     1 
ATOM   7511  O  O     . ILE D  1 121 ? 44.297  45.308  60.770  1.00 43.40 ? 1094 ILE D O     1 
ATOM   7512  C  CB    . ILE D  1 121 ? 45.508  44.000  58.023  1.00 40.22 ? 1094 ILE D CB    1 
ATOM   7513  C  CG1   . ILE D  1 121 ? 46.191  42.665  57.698  1.00 40.84 ? 1094 ILE D CG1   1 
ATOM   7514  C  CG2   . ILE D  1 121 ? 46.495  44.951  58.678  1.00 32.38 ? 1094 ILE D CG2   1 
ATOM   7515  C  CD1   . ILE D  1 121 ? 46.918  42.641  56.340  1.00 33.00 ? 1094 ILE D CD1   1 
ATOM   7516  N  N     . ASP D  1 122 ? 43.043  45.901  58.986  1.00 45.94 ? 1095 ASP D N     1 
ATOM   7517  C  CA    . ASP D  1 122 ? 42.638  47.214  59.510  1.00 45.65 ? 1095 ASP D CA    1 
ATOM   7518  C  C     . ASP D  1 122 ? 41.870  47.141  60.836  1.00 43.87 ? 1095 ASP D C     1 
ATOM   7519  O  O     . ASP D  1 122 ? 41.850  48.108  61.593  1.00 45.88 ? 1095 ASP D O     1 
ATOM   7520  C  CB    . ASP D  1 122 ? 41.813  47.967  58.454  1.00 50.00 ? 1095 ASP D CB    1 
ATOM   7521  C  CG    . ASP D  1 122 ? 41.631  49.444  58.782  1.00 55.74 ? 1095 ASP D CG    1 
ATOM   7522  O  OD1   . ASP D  1 122 ? 40.683  49.781  59.523  1.00 62.63 ? 1095 ASP D OD1   1 
ATOM   7523  O  OD2   . ASP D  1 122 ? 42.420  50.272  58.278  1.00 55.50 ? 1095 ASP D OD2   1 
ATOM   7524  N  N     . ARG D  1 123 ? 41.251  45.997  61.118  1.00 42.43 ? 1096 ARG D N     1 
ATOM   7525  C  CA    . ARG D  1 123 ? 40.468  45.828  62.343  1.00 43.69 ? 1096 ARG D CA    1 
ATOM   7526  C  C     . ARG D  1 123 ? 41.310  45.335  63.536  1.00 43.37 ? 1096 ARG D C     1 
ATOM   7527  O  O     . ARG D  1 123 ? 40.774  45.063  64.616  1.00 42.77 ? 1096 ARG D O     1 
ATOM   7528  C  CB    . ARG D  1 123 ? 39.275  44.901  62.086  1.00 43.46 ? 1096 ARG D CB    1 
ATOM   7529  C  CG    . ARG D  1 123 ? 38.535  45.182  60.772  1.00 55.22 ? 1096 ARG D CG    1 
ATOM   7530  C  CD    . ARG D  1 123 ? 37.623  46.411  60.836  1.00 60.79 ? 1096 ARG D CD    1 
ATOM   7531  N  NE    . ARG D  1 123 ? 36.313  46.093  61.400  1.00 63.18 ? 1096 ARG D NE    1 
ATOM   7532  C  CZ    . ARG D  1 123 ? 35.210  46.814  61.206  1.00 65.75 ? 1096 ARG D CZ    1 
ATOM   7533  N  NH1   . ARG D  1 123 ? 35.241  47.905  60.450  1.00 69.48 ? 1096 ARG D NH1   1 
ATOM   7534  N  NH2   . ARG D  1 123 ? 34.066  46.440  61.766  1.00 63.68 ? 1096 ARG D NH2   1 
ATOM   7535  N  N     . HIS D  1 124 ? 42.626  45.259  63.329  1.00 39.57 ? 1097 HIS D N     1 
ATOM   7536  C  CA    . HIS D  1 124 ? 43.587  44.706  64.288  1.00 36.09 ? 1097 HIS D CA    1 
ATOM   7537  C  C     . HIS D  1 124 ? 43.144  43.349  64.847  1.00 36.81 ? 1097 HIS D C     1 
ATOM   7538  O  O     . HIS D  1 124 ? 42.824  43.243  66.035  1.00 39.82 ? 1097 HIS D O     1 
ATOM   7539  C  CB    . HIS D  1 124 ? 43.904  45.710  65.405  1.00 36.67 ? 1097 HIS D CB    1 
ATOM   7540  C  CG    . HIS D  1 124 ? 44.187  47.095  64.909  1.00 35.42 ? 1097 HIS D CG    1 
ATOM   7541  N  ND1   . HIS D  1 124 ? 45.272  47.394  64.113  1.00 34.41 ? 1097 HIS D ND1   1 
ATOM   7542  C  CD2   . HIS D  1 124 ? 43.524  48.261  65.093  1.00 29.66 ? 1097 HIS D CD2   1 
ATOM   7543  C  CE1   . HIS D  1 124 ? 45.265  48.683  63.828  1.00 29.44 ? 1097 HIS D CE1   1 
ATOM   7544  N  NE2   . HIS D  1 124 ? 44.216  49.232  64.410  1.00 31.74 ? 1097 HIS D NE2   1 
ATOM   7545  N  N     . PRO D  1 125 ? 43.130  42.304  63.988  1.00 34.70 ? 1098 PRO D N     1 
ATOM   7546  C  CA    . PRO D  1 125 ? 42.611  40.990  64.366  1.00 34.83 ? 1098 PRO D CA    1 
ATOM   7547  C  C     . PRO D  1 125 ? 43.479  40.261  65.399  1.00 38.07 ? 1098 PRO D C     1 
ATOM   7548  O  O     . PRO D  1 125 ? 44.664  40.560  65.540  1.00 34.57 ? 1098 PRO D O     1 
ATOM   7549  C  CB    . PRO D  1 125 ? 42.644  40.219  63.040  1.00 31.99 ? 1098 PRO D CB    1 
ATOM   7550  C  CG    . PRO D  1 125 ? 43.769  40.839  62.287  1.00 24.68 ? 1098 PRO D CG    1 
ATOM   7551  C  CD    . PRO D  1 125 ? 43.620  42.301  62.595  1.00 33.83 ? 1098 PRO D CD    1 
ATOM   7552  N  N     . ARG D  1 126 ? 42.879  39.307  66.108  1.00 41.70 ? 1099 ARG D N     1 
ATOM   7553  C  CA    . ARG D  1 126 ? 43.634  38.396  66.957  1.00 44.52 ? 1099 ARG D CA    1 
ATOM   7554  C  C     . ARG D  1 126 ? 44.235  37.310  66.066  1.00 41.61 ? 1099 ARG D C     1 
ATOM   7555  O  O     . ARG D  1 126 ? 43.715  36.195  65.975  1.00 41.14 ? 1099 ARG D O     1 
ATOM   7556  C  CB    . ARG D  1 126 ? 42.749  37.803  68.063  1.00 45.26 ? 1099 ARG D CB    1 
ATOM   7557  N  N     . LEU D  1 127 ? 45.329  37.671  65.397  1.00 42.50 ? 1100 LEU D N     1 
ATOM   7558  C  CA    . LEU D  1 127 ? 45.996  36.822  64.412  1.00 37.96 ? 1100 LEU D CA    1 
ATOM   7559  C  C     . LEU D  1 127 ? 47.348  36.397  64.969  1.00 37.32 ? 1100 LEU D C     1 
ATOM   7560  O  O     . LEU D  1 127 ? 48.145  37.241  65.388  1.00 29.56 ? 1100 LEU D O     1 
ATOM   7561  C  CB    . LEU D  1 127 ? 46.219  37.609  63.120  1.00 36.36 ? 1100 LEU D CB    1 
ATOM   7562  C  CG    . LEU D  1 127 ? 46.156  37.016  61.708  1.00 37.96 ? 1100 LEU D CG    1 
ATOM   7563  C  CD1   . LEU D  1 127 ? 47.387  37.481  60.941  1.00 27.02 ? 1100 LEU D CD1   1 
ATOM   7564  C  CD2   . LEU D  1 127 ? 46.032  35.492  61.658  1.00 30.04 ? 1100 LEU D CD2   1 
ATOM   7565  N  N     . ASP D  1 128 ? 47.600  35.090  64.983  1.00 36.26 ? 1101 ASP D N     1 
ATOM   7566  C  CA    . ASP D  1 128 ? 48.871  34.566  65.465  1.00 38.48 ? 1101 ASP D CA    1 
ATOM   7567  C  C     . ASP D  1 128 ? 49.675  33.988  64.300  1.00 40.05 ? 1101 ASP D C     1 
ATOM   7568  O  O     . ASP D  1 128 ? 49.154  33.854  63.190  1.00 41.94 ? 1101 ASP D O     1 
ATOM   7569  C  CB    . ASP D  1 128 ? 48.651  33.533  66.588  1.00 37.31 ? 1101 ASP D CB    1 
ATOM   7570  C  CG    . ASP D  1 128 ? 47.789  32.356  66.156  1.00 39.02 ? 1101 ASP D CG    1 
ATOM   7571  O  OD1   . ASP D  1 128 ? 47.221  32.387  65.043  1.00 45.04 ? 1101 ASP D OD1   1 
ATOM   7572  O  OD2   . ASP D  1 128 ? 47.679  31.386  66.935  1.00 39.58 ? 1101 ASP D OD2   1 
ATOM   7573  N  N     . GLU D  1 129 ? 50.937  33.651  64.556  1.00 40.56 ? 1102 GLU D N     1 
ATOM   7574  C  CA    . GLU D  1 129 ? 51.835  33.129  63.515  1.00 36.72 ? 1102 GLU D CA    1 
ATOM   7575  C  C     . GLU D  1 129 ? 51.351  31.870  62.778  1.00 38.56 ? 1102 GLU D C     1 
ATOM   7576  O  O     . GLU D  1 129 ? 51.522  31.785  61.562  1.00 44.44 ? 1102 GLU D O     1 
ATOM   7577  C  CB    . GLU D  1 129 ? 53.241  32.908  64.068  1.00 34.88 ? 1102 GLU D CB    1 
ATOM   7578  C  CG    . GLU D  1 129 ? 53.918  34.171  64.560  1.00 28.30 ? 1102 GLU D CG    1 
ATOM   7579  C  CD    . GLU D  1 129 ? 55.370  33.952  64.861  1.00 33.68 ? 1102 GLU D CD    1 
ATOM   7580  O  OE1   . GLU D  1 129 ? 56.032  33.263  64.054  1.00 37.65 ? 1102 GLU D OE1   1 
ATOM   7581  O  OE2   . GLU D  1 129 ? 55.854  34.472  65.894  1.00 39.04 ? 1102 GLU D OE2   1 
ATOM   7582  N  N     . PRO D  1 130 ? 50.798  30.870  63.503  1.00 38.04 ? 1103 PRO D N     1 
ATOM   7583  C  CA    . PRO D  1 130 ? 50.228  29.691  62.829  1.00 37.95 ? 1103 PRO D CA    1 
ATOM   7584  C  C     . PRO D  1 130 ? 49.106  29.988  61.818  1.00 38.39 ? 1103 PRO D C     1 
ATOM   7585  O  O     . PRO D  1 130 ? 49.148  29.474  60.701  1.00 39.47 ? 1103 PRO D O     1 
ATOM   7586  C  CB    . PRO D  1 130 ? 49.696  28.850  63.995  1.00 35.08 ? 1103 PRO D CB    1 
ATOM   7587  C  CG    . PRO D  1 130 ? 50.547  29.252  65.145  1.00 35.61 ? 1103 PRO D CG    1 
ATOM   7588  C  CD    . PRO D  1 130 ? 50.738  30.718  64.969  1.00 35.30 ? 1103 PRO D CD    1 
ATOM   7589  N  N     . LEU D  1 131 ? 48.122  30.798  62.208  1.00 36.94 ? 1104 LEU D N     1 
ATOM   7590  C  CA    . LEU D  1 131 ? 47.014  31.155  61.316  1.00 32.79 ? 1104 LEU D CA    1 
ATOM   7591  C  C     . LEU D  1 131 ? 47.419  32.195  60.267  1.00 33.19 ? 1104 LEU D C     1 
ATOM   7592  O  O     . LEU D  1 131 ? 46.838  32.226  59.182  1.00 34.33 ? 1104 LEU D O     1 
ATOM   7593  C  CB    . LEU D  1 131 ? 45.787  31.619  62.115  1.00 30.29 ? 1104 LEU D CB    1 
ATOM   7594  C  CG    . LEU D  1 131 ? 44.511  32.107  61.409  1.00 33.79 ? 1104 LEU D CG    1 
ATOM   7595  C  CD1   . LEU D  1 131 ? 43.844  31.027  60.548  1.00 25.06 ? 1104 LEU D CD1   1 
ATOM   7596  C  CD2   . LEU D  1 131 ? 43.549  32.651  62.440  1.00 22.83 ? 1104 LEU D CD2   1 
ATOM   7597  N  N     . ALA D  1 132 ? 48.401  33.037  60.591  1.00 34.36 ? 1105 ALA D N     1 
ATOM   7598  C  CA    . ALA D  1 132 ? 49.031  33.924  59.600  1.00 37.49 ? 1105 ALA D CA    1 
ATOM   7599  C  C     . ALA D  1 132 ? 49.690  33.127  58.469  1.00 40.18 ? 1105 ALA D C     1 
ATOM   7600  O  O     . ALA D  1 132 ? 49.543  33.476  57.294  1.00 40.65 ? 1105 ALA D O     1 
ATOM   7601  C  CB    . ALA D  1 132 ? 50.060  34.842  60.261  1.00 35.40 ? 1105 ALA D CB    1 
ATOM   7602  N  N     . SER D  1 133 ? 50.408  32.061  58.838  1.00 39.52 ? 1106 SER D N     1 
ATOM   7603  C  CA    . SER D  1 133 ? 51.130  31.210  57.888  1.00 38.04 ? 1106 SER D CA    1 
ATOM   7604  C  C     . SER D  1 133 ? 50.203  30.356  57.033  1.00 36.33 ? 1106 SER D C     1 
ATOM   7605  O  O     . SER D  1 133 ? 50.590  29.921  55.952  1.00 38.22 ? 1106 SER D O     1 
ATOM   7606  C  CB    . SER D  1 133 ? 52.134  30.312  58.619  1.00 40.08 ? 1106 SER D CB    1 
ATOM   7607  O  OG    . SER D  1 133 ? 51.486  29.267  59.323  1.00 43.80 ? 1106 SER D OG    1 
ATOM   7608  N  N     . TYR D  1 134 ? 48.996  30.103  57.538  1.00 38.59 ? 1107 TYR D N     1 
ATOM   7609  C  CA    . TYR D  1 134 ? 47.960  29.377  56.800  1.00 38.09 ? 1107 TYR D CA    1 
ATOM   7610  C  C     . TYR D  1 134 ? 47.396  30.252  55.681  1.00 36.84 ? 1107 TYR D C     1 
ATOM   7611  O  O     . TYR D  1 134 ? 47.123  29.772  54.577  1.00 37.93 ? 1107 TYR D O     1 
ATOM   7612  C  CB    . TYR D  1 134 ? 46.838  28.923  57.750  1.00 38.24 ? 1107 TYR D CB    1 
ATOM   7613  C  CG    . TYR D  1 134 ? 45.605  28.381  57.049  1.00 36.83 ? 1107 TYR D CG    1 
ATOM   7614  C  CD1   . TYR D  1 134 ? 45.657  27.185  56.332  1.00 44.80 ? 1107 TYR D CD1   1 
ATOM   7615  C  CD2   . TYR D  1 134 ? 44.388  29.063  57.104  1.00 31.56 ? 1107 TYR D CD2   1 
ATOM   7616  C  CE1   . TYR D  1 134 ? 44.533  26.684  55.682  1.00 47.02 ? 1107 TYR D CE1   1 
ATOM   7617  C  CE2   . TYR D  1 134 ? 43.251  28.564  56.454  1.00 26.17 ? 1107 TYR D CE2   1 
ATOM   7618  C  CZ    . TYR D  1 134 ? 43.336  27.377  55.748  1.00 35.33 ? 1107 TYR D CZ    1 
ATOM   7619  O  OH    . TYR D  1 134 ? 42.234  26.864  55.104  1.00 41.76 ? 1107 TYR D OH    1 
ATOM   7620  N  N     . ILE D  1 135 ? 47.219  31.535  55.991  1.00 33.31 ? 1108 ILE D N     1 
ATOM   7621  C  CA    . ILE D  1 135 ? 46.765  32.534  55.029  1.00 31.68 ? 1108 ILE D CA    1 
ATOM   7622  C  C     . ILE D  1 135 ? 47.843  32.751  53.952  1.00 33.82 ? 1108 ILE D C     1 
ATOM   7623  O  O     . ILE D  1 135 ? 47.530  32.769  52.760  1.00 32.37 ? 1108 ILE D O     1 
ATOM   7624  C  CB    . ILE D  1 135 ? 46.336  33.851  55.753  1.00 32.14 ? 1108 ILE D CB    1 
ATOM   7625  C  CG1   . ILE D  1 135 ? 45.145  33.576  56.689  1.00 28.88 ? 1108 ILE D CG1   1 
ATOM   7626  C  CG2   . ILE D  1 135 ? 46.004  34.971  54.760  1.00 20.83 ? 1108 ILE D CG2   1 
ATOM   7627  C  CD1   . ILE D  1 135 ? 44.867  34.681  57.717  1.00 30.78 ? 1108 ILE D CD1   1 
ATOM   7628  N  N     . PHE D  1 136 ? 49.105  32.864  54.377  1.00 32.31 ? 1109 PHE D N     1 
ATOM   7629  C  CA    . PHE D  1 136 ? 50.225  33.094  53.465  1.00 28.92 ? 1109 PHE D CA    1 
ATOM   7630  C  C     . PHE D  1 136 ? 50.572  31.905  52.573  1.00 29.46 ? 1109 PHE D C     1 
ATOM   7631  O  O     . PHE D  1 136 ? 50.947  32.103  51.420  1.00 30.02 ? 1109 PHE D O     1 
ATOM   7632  C  CB    . PHE D  1 136 ? 51.475  33.583  54.220  1.00 30.84 ? 1109 PHE D CB    1 
ATOM   7633  C  CG    . PHE D  1 136 ? 52.586  34.076  53.311  1.00 33.09 ? 1109 PHE D CG    1 
ATOM   7634  C  CD1   . PHE D  1 136 ? 52.446  35.270  52.591  1.00 33.32 ? 1109 PHE D CD1   1 
ATOM   7635  C  CD2   . PHE D  1 136 ? 53.771  33.351  53.179  1.00 29.63 ? 1109 PHE D CD2   1 
ATOM   7636  C  CE1   . PHE D  1 136 ? 53.475  35.726  51.749  1.00 26.46 ? 1109 PHE D CE1   1 
ATOM   7637  C  CE2   . PHE D  1 136 ? 54.802  33.800  52.347  1.00 22.26 ? 1109 PHE D CE2   1 
ATOM   7638  C  CZ    . PHE D  1 136 ? 54.648  34.982  51.623  1.00 21.95 ? 1109 PHE D CZ    1 
ATOM   7639  N  N     . ARG D  1 137 ? 50.458  30.682  53.094  1.00 32.07 ? 1110 ARG D N     1 
ATOM   7640  C  CA    . ARG D  1 137 ? 50.808  29.483  52.318  1.00 34.82 ? 1110 ARG D CA    1 
ATOM   7641  C  C     . ARG D  1 137 ? 49.836  29.258  51.164  1.00 30.58 ? 1110 ARG D C     1 
ATOM   7642  O  O     . ARG D  1 137 ? 50.217  28.752  50.114  1.00 32.40 ? 1110 ARG D O     1 
ATOM   7643  C  CB    . ARG D  1 137 ? 50.937  28.226  53.207  1.00 36.76 ? 1110 ARG D CB    1 
ATOM   7644  C  CG    . ARG D  1 137 ? 49.611  27.601  53.676  1.00 43.01 ? 1110 ARG D CG    1 
ATOM   7645  C  CD    . ARG D  1 137 ? 49.831  26.484  54.690  1.00 38.57 ? 1110 ARG D CD    1 
ATOM   7646  N  NE    . ARG D  1 137 ? 50.476  26.977  55.906  1.00 38.20 ? 1110 ARG D NE    1 
ATOM   7647  C  CZ    . ARG D  1 137 ? 50.662  26.263  57.011  1.00 38.63 ? 1110 ARG D CZ    1 
ATOM   7648  N  NH1   . ARG D  1 137 ? 50.249  25.005  57.072  1.00 39.62 ? 1110 ARG D NH1   1 
ATOM   7649  N  NH2   . ARG D  1 137 ? 51.266  26.815  58.057  1.00 25.52 ? 1110 ARG D NH2   1 
ATOM   7650  N  N     . GLN D  1 138 ? 48.581  29.648  51.369  1.00 35.43 ? 1111 GLN D N     1 
ATOM   7651  C  CA    . GLN D  1 138 ? 47.564  29.615  50.325  1.00 34.43 ? 1111 GLN D CA    1 
ATOM   7652  C  C     . GLN D  1 138 ? 47.856  30.620  49.209  1.00 33.97 ? 1111 GLN D C     1 
ATOM   7653  O  O     . GLN D  1 138 ? 47.476  30.404  48.058  1.00 35.52 ? 1111 GLN D O     1 
ATOM   7654  C  CB    . GLN D  1 138 ? 46.201  29.936  50.916  1.00 39.83 ? 1111 GLN D CB    1 
ATOM   7655  C  CG    . GLN D  1 138 ? 45.627  28.908  51.857  1.00 32.91 ? 1111 GLN D CG    1 
ATOM   7656  C  CD    . GLN D  1 138 ? 44.282  29.349  52.378  1.00 29.08 ? 1111 GLN D CD    1 
ATOM   7657  O  OE1   . GLN D  1 138 ? 43.281  29.280  51.671  1.00 34.98 ? 1111 GLN D OE1   1 
ATOM   7658  N  NE2   . GLN D  1 138 ? 44.256  29.834  53.613  1.00 32.74 ? 1111 GLN D NE2   1 
ATOM   7659  N  N     . LEU D  1 139 ? 48.508  31.723  49.569  1.00 32.76 ? 1112 LEU D N     1 
ATOM   7660  C  CA    . LEU D  1 139 ? 48.937  32.741  48.611  1.00 31.31 ? 1112 LEU D CA    1 
ATOM   7661  C  C     . LEU D  1 139 ? 50.168  32.276  47.822  1.00 29.91 ? 1112 LEU D C     1 
ATOM   7662  O  O     . LEU D  1 139 ? 50.280  32.531  46.626  1.00 29.38 ? 1112 LEU D O     1 
ATOM   7663  C  CB    . LEU D  1 139 ? 49.203  34.078  49.328  1.00 29.15 ? 1112 LEU D CB    1 
ATOM   7664  C  CG    . LEU D  1 139 ? 49.875  35.221  48.556  1.00 33.81 ? 1112 LEU D CG    1 
ATOM   7665  C  CD1   . LEU D  1 139 ? 49.030  35.681  47.363  1.00 33.79 ? 1112 LEU D CD1   1 
ATOM   7666  C  CD2   . LEU D  1 139 ? 50.195  36.374  49.492  1.00 24.58 ? 1112 LEU D CD2   1 
ATOM   7667  N  N     . VAL D  1 140 ? 51.081  31.592  48.505  1.00 33.45 ? 1113 VAL D N     1 
ATOM   7668  C  CA    . VAL D  1 140 ? 52.252  30.968  47.871  1.00 35.84 ? 1113 VAL D CA    1 
ATOM   7669  C  C     . VAL D  1 140 ? 51.841  29.815  46.937  1.00 32.72 ? 1113 VAL D C     1 
ATOM   7670  O  O     . VAL D  1 140 ? 52.461  29.596  45.901  1.00 34.53 ? 1113 VAL D O     1 
ATOM   7671  C  CB    . VAL D  1 140 ? 53.272  30.494  48.938  1.00 34.43 ? 1113 VAL D CB    1 
ATOM   7672  C  CG1   . VAL D  1 140 ? 54.380  29.658  48.321  1.00 34.70 ? 1113 VAL D CG1   1 
ATOM   7673  C  CG2   . VAL D  1 140 ? 53.867  31.691  49.653  1.00 39.04 ? 1113 VAL D CG2   1 
ATOM   7674  N  N     . SER D  1 141 ? 50.782  29.101  47.304  1.00 35.56 ? 1114 SER D N     1 
ATOM   7675  C  CA    . SER D  1 141 ? 50.266  28.002  46.487  1.00 37.14 ? 1114 SER D CA    1 
ATOM   7676  C  C     . SER D  1 141 ? 49.654  28.512  45.191  1.00 35.42 ? 1114 SER D C     1 
ATOM   7677  O  O     . SER D  1 141 ? 49.777  27.860  44.155  1.00 40.63 ? 1114 SER D O     1 
ATOM   7678  C  CB    . SER D  1 141 ? 49.236  27.183  47.266  1.00 40.21 ? 1114 SER D CB    1 
ATOM   7679  O  OG    . SER D  1 141 ? 48.777  26.083  46.504  1.00 42.31 ? 1114 SER D OG    1 
ATOM   7680  N  N     . ALA D  1 142 ? 49.000  29.673  45.264  1.00 31.20 ? 1115 ALA D N     1 
ATOM   7681  C  CA    . ALA D  1 142 ? 48.411  30.341  44.104  1.00 25.90 ? 1115 ALA D CA    1 
ATOM   7682  C  C     . ALA D  1 142 ? 49.475  30.875  43.141  1.00 24.68 ? 1115 ALA D C     1 
ATOM   7683  O  O     . ALA D  1 142 ? 49.346  30.718  41.931  1.00 25.25 ? 1115 ALA D O     1 
ATOM   7684  C  CB    . ALA D  1 142 ? 47.485  31.458  44.554  1.00 25.96 ? 1115 ALA D CB    1 
ATOM   7685  N  N     . VAL D  1 143 ? 50.523  31.489  43.693  1.00 30.68 ? 1116 VAL D N     1 
ATOM   7686  C  CA    . VAL D  1 143 ? 51.667  32.029  42.922  1.00 31.47 ? 1116 VAL D CA    1 
ATOM   7687  C  C     . VAL D  1 143 ? 52.552  30.930  42.303  1.00 33.33 ? 1116 VAL D C     1 
ATOM   7688  O  O     . VAL D  1 143 ? 53.071  31.097  41.198  1.00 35.38 ? 1116 VAL D O     1 
ATOM   7689  C  CB    . VAL D  1 143 ? 52.532  33.007  43.790  1.00 29.99 ? 1116 VAL D CB    1 
ATOM   7690  C  CG1   . VAL D  1 143 ? 53.786  33.472  43.056  1.00 32.66 ? 1116 VAL D CG1   1 
ATOM   7691  C  CG2   . VAL D  1 143 ? 51.718  34.206  44.216  1.00 25.43 ? 1116 VAL D CG2   1 
ATOM   7692  N  N     . GLY D  1 144 ? 52.727  29.821  43.023  1.00 35.32 ? 1117 GLY D N     1 
ATOM   7693  C  CA    . GLY D  1 144 ? 53.426  28.644  42.496  1.00 32.92 ? 1117 GLY D CA    1 
ATOM   7694  C  C     . GLY D  1 144 ? 52.729  28.054  41.281  1.00 35.79 ? 1117 GLY D C     1 
ATOM   7695  O  O     . GLY D  1 144 ? 53.379  27.654  40.308  1.00 30.96 ? 1117 GLY D O     1 
ATOM   7696  N  N     . TYR D  1 145 ? 51.398  28.008  41.349  1.00 38.11 ? 1118 TYR D N     1 
ATOM   7697  C  CA    . TYR D  1 145 ? 50.562  27.602  40.226  1.00 42.49 ? 1118 TYR D CA    1 
ATOM   7698  C  C     . TYR D  1 145 ? 50.780  28.519  39.016  1.00 43.19 ? 1118 TYR D C     1 
ATOM   7699  O  O     . TYR D  1 145 ? 51.244  28.057  37.971  1.00 45.54 ? 1118 TYR D O     1 
ATOM   7700  C  CB    . TYR D  1 145 ? 49.088  27.567  40.647  1.00 43.99 ? 1118 TYR D CB    1 
ATOM   7701  C  CG    . TYR D  1 145 ? 48.114  27.301  39.518  1.00 47.95 ? 1118 TYR D CG    1 
ATOM   7702  C  CD1   . TYR D  1 145 ? 47.852  25.997  39.083  1.00 48.81 ? 1118 TYR D CD1   1 
ATOM   7703  C  CD2   . TYR D  1 145 ? 47.442  28.353  38.894  1.00 46.03 ? 1118 TYR D CD2   1 
ATOM   7704  C  CE1   . TYR D  1 145 ? 46.952  25.754  38.046  1.00 50.60 ? 1118 TYR D CE1   1 
ATOM   7705  C  CE2   . TYR D  1 145 ? 46.548  28.126  37.858  1.00 49.29 ? 1118 TYR D CE2   1 
ATOM   7706  C  CZ    . TYR D  1 145 ? 46.302  26.826  37.441  1.00 52.83 ? 1118 TYR D CZ    1 
ATOM   7707  O  OH    . TYR D  1 145 ? 45.410  26.609  36.414  1.00 55.78 ? 1118 TYR D OH    1 
ATOM   7708  N  N     . LEU D  1 146 ? 50.461  29.808  39.174  1.00 40.51 ? 1119 LEU D N     1 
ATOM   7709  C  CA    . LEU D  1 146 ? 50.667  30.814  38.126  1.00 35.74 ? 1119 LEU D CA    1 
ATOM   7710  C  C     . LEU D  1 146 ? 52.099  30.816  37.566  1.00 38.34 ? 1119 LEU D C     1 
ATOM   7711  O  O     . LEU D  1 146 ? 52.289  30.995  36.357  1.00 35.48 ? 1119 LEU D O     1 
ATOM   7712  C  CB    . LEU D  1 146 ? 50.304  32.215  38.633  1.00 38.74 ? 1119 LEU D CB    1 
ATOM   7713  C  CG    . LEU D  1 146 ? 48.863  32.546  39.050  1.00 33.78 ? 1119 LEU D CG    1 
ATOM   7714  C  CD1   . LEU D  1 146 ? 48.820  33.867  39.809  1.00 33.09 ? 1119 LEU D CD1   1 
ATOM   7715  C  CD2   . LEU D  1 146 ? 47.904  32.591  37.864  1.00 20.72 ? 1119 LEU D CD2   1 
ATOM   7716  N  N     . ARG D  1 147 ? 53.094  30.612  38.437  1.00 34.53 ? 1120 ARG D N     1 
ATOM   7717  C  CA    . ARG D  1 147 ? 54.501  30.542  38.012  1.00 38.25 ? 1120 ARG D CA    1 
ATOM   7718  C  C     . ARG D  1 147 ? 54.712  29.467  36.955  1.00 40.91 ? 1120 ARG D C     1 
ATOM   7719  O  O     . ARG D  1 147 ? 55.347  29.715  35.928  1.00 40.57 ? 1120 ARG D O     1 
ATOM   7720  C  CB    . ARG D  1 147 ? 55.427  30.273  39.204  1.00 35.41 ? 1120 ARG D CB    1 
ATOM   7721  C  CG    . ARG D  1 147 ? 56.905  30.092  38.843  1.00 38.74 ? 1120 ARG D CG    1 
ATOM   7722  C  CD    . ARG D  1 147 ? 57.519  31.352  38.223  1.00 33.86 ? 1120 ARG D CD    1 
ATOM   7723  N  NE    . ARG D  1 147 ? 57.393  32.519  39.099  1.00 36.56 ? 1120 ARG D NE    1 
ATOM   7724  C  CZ    . ARG D  1 147 ? 58.270  32.854  40.038  1.00 35.69 ? 1120 ARG D CZ    1 
ATOM   7725  N  NH1   . ARG D  1 147 ? 59.348  32.113  40.237  1.00 31.77 ? 1120 ARG D NH1   1 
ATOM   7726  N  NH2   . ARG D  1 147 ? 58.066  33.934  40.783  1.00 38.99 ? 1120 ARG D NH2   1 
ATOM   7727  N  N     . LEU D  1 148 ? 54.181  28.277  37.240  1.00 44.07 ? 1121 LEU D N     1 
ATOM   7728  C  CA    . LEU D  1 148 ? 54.165  27.137  36.320  1.00 47.59 ? 1121 LEU D CA    1 
ATOM   7729  C  C     . LEU D  1 148 ? 53.407  27.449  35.018  1.00 45.51 ? 1121 LEU D C     1 
ATOM   7730  O  O     . LEU D  1 148 ? 53.756  26.930  33.955  1.00 49.31 ? 1121 LEU D O     1 
ATOM   7731  C  CB    . LEU D  1 148 ? 53.565  25.912  37.030  1.00 47.39 ? 1121 LEU D CB    1 
ATOM   7732  C  CG    . LEU D  1 148 ? 53.428  24.568  36.310  1.00 54.40 ? 1121 LEU D CG    1 
ATOM   7733  C  CD1   . LEU D  1 148 ? 54.776  23.874  36.156  1.00 55.05 ? 1121 LEU D CD1   1 
ATOM   7734  C  CD2   . LEU D  1 148 ? 52.450  23.676  37.067  1.00 52.74 ? 1121 LEU D CD2   1 
ATOM   7735  N  N     . LYS D  1 149 ? 52.384  28.304  35.110  1.00 42.33 ? 1122 LYS D N     1 
ATOM   7736  C  CA    . LYS D  1 149 ? 51.637  28.790  33.938  1.00 38.22 ? 1122 LYS D CA    1 
ATOM   7737  C  C     . LYS D  1 149 ? 52.383  29.903  33.189  1.00 38.02 ? 1122 LYS D C     1 
ATOM   7738  O  O     . LYS D  1 149 ? 51.861  30.469  32.227  1.00 42.43 ? 1122 LYS D O     1 
ATOM   7739  C  CB    . LYS D  1 149 ? 50.260  29.332  34.356  1.00 39.51 ? 1122 LYS D CB    1 
ATOM   7740  C  CG    . LYS D  1 149 ? 49.475  28.496  35.364  1.00 41.70 ? 1122 LYS D CG    1 
ATOM   7741  C  CD    . LYS D  1 149 ? 48.487  27.537  34.709  1.00 44.24 ? 1122 LYS D CD    1 
ATOM   7742  C  CE    . LYS D  1 149 ? 49.075  26.143  34.543  1.00 41.42 ? 1122 LYS D CE    1 
ATOM   7743  N  NZ    . LYS D  1 149 ? 49.907  26.043  33.319  1.00 43.02 ? 1122 LYS D NZ    1 
ATOM   7744  N  N     . ASP D  1 150 ? 53.599  30.214  33.634  1.00 37.46 ? 1123 ASP D N     1 
ATOM   7745  C  CA    . ASP D  1 150 ? 54.343  31.393  33.176  1.00 37.76 ? 1123 ASP D CA    1 
ATOM   7746  C  C     . ASP D  1 150 ? 53.552  32.702  33.350  1.00 37.58 ? 1123 ASP D C     1 
ATOM   7747  O  O     . ASP D  1 150 ? 53.657  33.625  32.539  1.00 38.92 ? 1123 ASP D O     1 
ATOM   7748  C  CB    . ASP D  1 150 ? 54.840  31.218  31.732  1.00 38.93 ? 1123 ASP D CB    1 
ATOM   7749  C  CG    . ASP D  1 150 ? 55.977  30.222  31.624  1.00 40.97 ? 1123 ASP D CG    1 
ATOM   7750  O  OD1   . ASP D  1 150 ? 57.152  30.655  31.603  1.00 49.74 ? 1123 ASP D OD1   1 
ATOM   7751  O  OD2   . ASP D  1 150 ? 55.699  29.007  31.571  1.00 42.25 ? 1123 ASP D OD2   1 
ATOM   7752  N  N     . ILE D  1 151 ? 52.760  32.774  34.417  1.00 36.63 ? 1124 ILE D N     1 
ATOM   7753  C  CA    . ILE D  1 151 ? 51.979  33.970  34.718  1.00 32.69 ? 1124 ILE D CA    1 
ATOM   7754  C  C     . ILE D  1 151 ? 52.561  34.710  35.919  1.00 33.75 ? 1124 ILE D C     1 
ATOM   7755  O  O     . ILE D  1 151 ? 52.912  34.109  36.945  1.00 32.34 ? 1124 ILE D O     1 
ATOM   7756  C  CB    . ILE D  1 151 ? 50.472  33.655  34.942  1.00 33.08 ? 1124 ILE D CB    1 
ATOM   7757  C  CG1   . ILE D  1 151 ? 49.818  33.203  33.629  1.00 26.52 ? 1124 ILE D CG1   1 
ATOM   7758  C  CG2   . ILE D  1 151 ? 49.727  34.887  35.505  1.00 37.39 ? 1124 ILE D CG2   1 
ATOM   7759  C  CD1   . ILE D  1 151 ? 48.411  32.627  33.780  1.00 30.06 ? 1124 ILE D CD1   1 
ATOM   7760  N  N     . ILE D  1 152 ? 52.672  36.022  35.763  1.00 34.77 ? 1125 ILE D N     1 
ATOM   7761  C  CA    . ILE D  1 152 ? 53.106  36.899  36.835  1.00 30.97 ? 1125 ILE D CA    1 
ATOM   7762  C  C     . ILE D  1 152 ? 51.980  37.917  37.071  1.00 27.68 ? 1125 ILE D C     1 
ATOM   7763  O  O     . ILE D  1 152 ? 51.583  38.645  36.155  1.00 28.92 ? 1125 ILE D O     1 
ATOM   7764  C  CB    . ILE D  1 152 ? 54.540  37.483  36.528  1.00 35.88 ? 1125 ILE D CB    1 
ATOM   7765  C  CG1   . ILE D  1 152 ? 55.440  37.428  37.761  1.00 35.16 ? 1125 ILE D CG1   1 
ATOM   7766  C  CG2   . ILE D  1 152 ? 54.520  38.847  35.814  1.00 39.51 ? 1125 ILE D CG2   1 
ATOM   7767  C  CD1   . ILE D  1 152 ? 56.197  36.117  37.888  1.00 45.59 ? 1125 ILE D CD1   1 
ATOM   7768  N  N     . HIS D  1 153 ? 51.430  37.897  38.287  1.00 24.58 ? 1126 HIS D N     1 
ATOM   7769  C  CA    . HIS D  1 153 ? 50.247  38.686  38.670  1.00 20.34 ? 1126 HIS D CA    1 
ATOM   7770  C  C     . HIS D  1 153 ? 50.521  40.190  38.668  1.00 20.73 ? 1126 HIS D C     1 
ATOM   7771  O  O     . HIS D  1 153 ? 49.674  40.971  38.218  1.00 24.75 ? 1126 HIS D O     1 
ATOM   7772  C  CB    . HIS D  1 153 ? 49.749  38.231  40.053  1.00 21.39 ? 1126 HIS D CB    1 
ATOM   7773  C  CG    . HIS D  1 153 ? 48.488  38.898  40.508  1.00 21.78 ? 1126 HIS D CG    1 
ATOM   7774  N  ND1   . HIS D  1 153 ? 48.484  40.102  41.178  1.00 25.35 ? 1126 HIS D ND1   1 
ATOM   7775  C  CD2   . HIS D  1 153 ? 47.192  38.516  40.415  1.00 24.04 ? 1126 HIS D CD2   1 
ATOM   7776  C  CE1   . HIS D  1 153 ? 47.239  40.447  41.454  1.00 22.29 ? 1126 HIS D CE1   1 
ATOM   7777  N  NE2   . HIS D  1 153 ? 46.436  39.501  41.004  1.00 23.18 ? 1126 HIS D NE2   1 
ATOM   7778  N  N     . ARG D  1 154 ? 51.683  40.571  39.209  1.00 23.57 ? 1127 ARG D N     1 
ATOM   7779  C  CA    . ARG D  1 154 ? 52.233  41.952  39.223  1.00 25.07 ? 1127 ARG D CA    1 
ATOM   7780  C  C     . ARG D  1 154 ? 51.632  42.972  40.193  1.00 26.10 ? 1127 ARG D C     1 
ATOM   7781  O  O     . ARG D  1 154 ? 52.110  44.100  40.263  1.00 28.11 ? 1127 ARG D O     1 
ATOM   7782  C  CB    . ARG D  1 154 ? 52.301  42.564  37.816  1.00 29.55 ? 1127 ARG D CB    1 
ATOM   7783  C  CG    . ARG D  1 154 ? 53.342  41.940  36.924  1.00 23.66 ? 1127 ARG D CG    1 
ATOM   7784  C  CD    . ARG D  1 154 ? 53.052  42.284  35.480  1.00 35.21 ? 1127 ARG D CD    1 
ATOM   7785  N  NE    . ARG D  1 154 ? 53.874  43.390  35.015  1.00 39.31 ? 1127 ARG D NE    1 
ATOM   7786  C  CZ    . ARG D  1 154 ? 53.590  44.158  33.971  1.00 35.13 ? 1127 ARG D CZ    1 
ATOM   7787  N  NH1   . ARG D  1 154 ? 52.479  43.969  33.272  1.00 30.42 ? 1127 ARG D NH1   1 
ATOM   7788  N  NH2   . ARG D  1 154 ? 54.421  45.132  33.638  1.00 43.93 ? 1127 ARG D NH2   1 
ATOM   7789  N  N     . ASP D  1 155 ? 50.594  42.595  40.930  1.00 25.98 ? 1128 ASP D N     1 
ATOM   7790  C  CA    . ASP D  1 155 ? 49.973  43.514  41.875  1.00 23.81 ? 1128 ASP D CA    1 
ATOM   7791  C  C     . ASP D  1 155 ? 49.619  42.766  43.155  1.00 20.47 ? 1128 ASP D C     1 
ATOM   7792  O  O     . ASP D  1 155 ? 48.564  42.983  43.738  1.00 25.58 ? 1128 ASP D O     1 
ATOM   7793  C  CB    . ASP D  1 155 ? 48.728  44.173  41.247  1.00 29.78 ? 1128 ASP D CB    1 
ATOM   7794  C  CG    . ASP D  1 155 ? 48.435  45.574  41.807  1.00 31.24 ? 1128 ASP D CG    1 
ATOM   7795  O  OD1   . ASP D  1 155 ? 49.207  46.090  42.648  1.00 33.14 ? 1128 ASP D OD1   1 
ATOM   7796  O  OD2   . ASP D  1 155 ? 47.418  46.171  41.386  1.00 36.77 ? 1128 ASP D OD2   1 
ATOM   7797  N  N     . ILE D  1 156 ? 50.508  41.880  43.597  1.00 24.56 ? 1129 ILE D N     1 
ATOM   7798  C  CA    . ILE D  1 156 ? 50.245  41.114  44.807  1.00 22.99 ? 1129 ILE D CA    1 
ATOM   7799  C  C     . ILE D  1 156 ? 50.351  42.026  46.024  1.00 24.06 ? 1129 ILE D C     1 
ATOM   7800  O  O     . ILE D  1 156 ? 51.383  42.665  46.257  1.00 18.57 ? 1129 ILE D O     1 
ATOM   7801  C  CB    . ILE D  1 156 ? 51.137  39.855  44.943  1.00 25.25 ? 1129 ILE D CB    1 
ATOM   7802  C  CG1   . ILE D  1 156 ? 50.882  38.893  43.780  1.00 16.05 ? 1129 ILE D CG1   1 
ATOM   7803  C  CG2   . ILE D  1 156 ? 50.850  39.134  46.266  1.00 21.73 ? 1129 ILE D CG2   1 
ATOM   7804  C  CD1   . ILE D  1 156 ? 51.962  37.837  43.609  1.00 24.64 ? 1129 ILE D CD1   1 
ATOM   7805  N  N     . LYS D  1 157 ? 49.243  42.098  46.762  1.00 23.15 ? 1130 LYS D N     1 
ATOM   7806  C  CA    . LYS D  1 157 ? 49.116  42.949  47.936  1.00 22.62 ? 1130 LYS D CA    1 
ATOM   7807  C  C     . LYS D  1 157 ? 47.818  42.608  48.655  1.00 24.47 ? 1130 LYS D C     1 
ATOM   7808  O  O     . LYS D  1 157 ? 46.943  41.951  48.081  1.00 25.74 ? 1130 LYS D O     1 
ATOM   7809  C  CB    . LYS D  1 157 ? 49.150  44.435  47.547  1.00 22.96 ? 1130 LYS D CB    1 
ATOM   7810  C  CG    . LYS D  1 157 ? 48.110  44.874  46.533  1.00 17.33 ? 1130 LYS D CG    1 
ATOM   7811  C  CD    . LYS D  1 157 ? 48.008  46.384  46.498  1.00 21.28 ? 1130 LYS D CD    1 
ATOM   7812  C  CE    . LYS D  1 157 ? 46.964  46.850  45.478  1.00 28.08 ? 1130 LYS D CE    1 
ATOM   7813  N  NZ    . LYS D  1 157 ? 46.876  48.342  45.476  1.00 27.10 ? 1130 LYS D NZ    1 
ATOM   7814  N  N     . ASP D  1 158 ? 47.695  43.071  49.900  1.00 20.56 ? 1131 ASP D N     1 
ATOM   7815  C  CA    . ASP D  1 158 ? 46.512  42.836  50.741  1.00 19.27 ? 1131 ASP D CA    1 
ATOM   7816  C  C     . ASP D  1 158 ? 45.159  43.175  50.097  1.00 24.95 ? 1131 ASP D C     1 
ATOM   7817  O  O     . ASP D  1 158 ? 44.212  42.402  50.211  1.00 25.42 ? 1131 ASP D O     1 
ATOM   7818  C  CB    . ASP D  1 158 ? 46.660  43.550  52.095  1.00 21.59 ? 1131 ASP D CB    1 
ATOM   7819  C  CG    . ASP D  1 158 ? 47.088  45.017  51.969  1.00 26.22 ? 1131 ASP D CG    1 
ATOM   7820  O  OD1   . ASP D  1 158 ? 47.031  45.619  50.863  1.00 34.51 ? 1131 ASP D OD1   1 
ATOM   7821  O  OD2   . ASP D  1 158 ? 47.488  45.578  53.005  1.00 36.42 ? 1131 ASP D OD2   1 
ATOM   7822  N  N     . GLU D  1 159 ? 45.083  44.330  49.432  1.00 29.37 ? 1132 GLU D N     1 
ATOM   7823  C  CA    . GLU D  1 159 ? 43.903  44.760  48.675  1.00 30.64 ? 1132 GLU D CA    1 
ATOM   7824  C  C     . GLU D  1 159 ? 43.396  43.774  47.613  1.00 29.86 ? 1132 GLU D C     1 
ATOM   7825  O  O     . GLU D  1 159 ? 42.189  43.695  47.363  1.00 30.33 ? 1132 GLU D O     1 
ATOM   7826  C  CB    . GLU D  1 159 ? 44.183  46.095  47.996  1.00 33.46 ? 1132 GLU D CB    1 
ATOM   7827  C  CG    . GLU D  1 159 ? 43.441  47.270  48.582  1.00 39.79 ? 1132 GLU D CG    1 
ATOM   7828  C  CD    . GLU D  1 159 ? 43.263  48.386  47.563  1.00 52.02 ? 1132 GLU D CD    1 
ATOM   7829  O  OE1   . GLU D  1 159 ? 42.124  48.888  47.418  1.00 46.34 ? 1132 GLU D OE1   1 
ATOM   7830  O  OE2   . GLU D  1 159 ? 44.261  48.747  46.894  1.00 58.74 ? 1132 GLU D OE2   1 
ATOM   7831  N  N     . ASN D  1 160 ? 44.320  43.049  46.985  1.00 29.26 ? 1133 ASN D N     1 
ATOM   7832  C  CA    . ASN D  1 160 ? 43.990  42.094  45.925  1.00 27.13 ? 1133 ASN D CA    1 
ATOM   7833  C  C     . ASN D  1 160 ? 43.918  40.635  46.419  1.00 29.59 ? 1133 ASN D C     1 
ATOM   7834  O  O     . ASN D  1 160 ? 44.066  39.699  45.633  1.00 29.75 ? 1133 ASN D O     1 
ATOM   7835  C  CB    . ASN D  1 160 ? 45.002  42.191  44.771  1.00 21.40 ? 1133 ASN D CB    1 
ATOM   7836  C  CG    . ASN D  1 160 ? 45.012  43.545  44.090  1.00 17.87 ? 1133 ASN D CG    1 
ATOM   7837  O  OD1   . ASN D  1 160 ? 43.997  44.242  44.003  1.00 23.76 ? 1133 ASN D OD1   1 
ATOM   7838  N  ND2   . ASN D  1 160 ? 46.166  43.911  43.573  1.00 18.89 ? 1133 ASN D ND2   1 
ATOM   7839  N  N     . ILE D  1 161 ? 43.719  40.455  47.723  1.00 31.14 ? 1134 ILE D N     1 
ATOM   7840  C  CA    . ILE D  1 161 ? 43.509  39.135  48.322  1.00 30.77 ? 1134 ILE D CA    1 
ATOM   7841  C  C     . ILE D  1 161 ? 42.209  39.201  49.119  1.00 33.46 ? 1134 ILE D C     1 
ATOM   7842  O  O     . ILE D  1 161 ? 42.043  40.098  49.950  1.00 32.15 ? 1134 ILE D O     1 
ATOM   7843  C  CB    . ILE D  1 161 ? 44.667  38.723  49.279  1.00 30.27 ? 1134 ILE D CB    1 
ATOM   7844  C  CG1   . ILE D  1 161 ? 46.000  38.604  48.532  1.00 28.42 ? 1134 ILE D CG1   1 
ATOM   7845  C  CG2   . ILE D  1 161 ? 44.335  37.406  50.018  1.00 19.98 ? 1134 ILE D CG2   1 
ATOM   7846  C  CD1   . ILE D  1 161 ? 47.199  38.895  49.415  1.00 27.65 ? 1134 ILE D CD1   1 
ATOM   7847  N  N     . VAL D  1 162 ? 41.303  38.254  48.869  1.00 30.73 ? 1135 VAL D N     1 
ATOM   7848  C  CA    . VAL D  1 162 ? 40.007  38.208  49.560  1.00 30.84 ? 1135 VAL D CA    1 
ATOM   7849  C  C     . VAL D  1 162 ? 39.941  37.055  50.571  1.00 32.21 ? 1135 VAL D C     1 
ATOM   7850  O  O     . VAL D  1 162 ? 40.319  35.922  50.264  1.00 32.79 ? 1135 VAL D O     1 
ATOM   7851  C  CB    . VAL D  1 162 ? 38.831  38.130  48.549  1.00 31.67 ? 1135 VAL D CB    1 
ATOM   7852  C  CG1   . VAL D  1 162 ? 37.493  38.012  49.268  1.00 32.04 ? 1135 VAL D CG1   1 
ATOM   7853  C  CG2   . VAL D  1 162 ? 38.834  39.363  47.635  1.00 33.18 ? 1135 VAL D CG2   1 
ATOM   7854  N  N     . ILE D  1 163 ? 39.464  37.350  51.778  1.00 35.79 ? 1136 ILE D N     1 
ATOM   7855  C  CA    . ILE D  1 163 ? 39.400  36.346  52.846  1.00 35.33 ? 1136 ILE D CA    1 
ATOM   7856  C  C     . ILE D  1 163 ? 37.960  36.075  53.325  1.00 37.60 ? 1136 ILE D C     1 
ATOM   7857  O  O     . ILE D  1 163 ? 37.183  37.014  53.558  1.00 38.34 ? 1136 ILE D O     1 
ATOM   7858  C  CB    . ILE D  1 163 ? 40.357  36.705  54.030  1.00 32.45 ? 1136 ILE D CB    1 
ATOM   7859  C  CG1   . ILE D  1 163 ? 40.437  35.546  55.035  1.00 29.41 ? 1136 ILE D CG1   1 
ATOM   7860  C  CG2   . ILE D  1 163 ? 39.973  38.063  54.681  1.00 29.38 ? 1136 ILE D CG2   1 
ATOM   7861  C  CD1   . ILE D  1 163 ? 41.424  35.754  56.176  1.00 32.03 ? 1136 ILE D CD1   1 
ATOM   7862  N  N     . ALA D  1 164 ? 37.615  34.791  53.449  1.00 37.43 ? 1137 ALA D N     1 
ATOM   7863  C  CA    . ALA D  1 164 ? 36.307  34.368  53.969  1.00 39.61 ? 1137 ALA D CA    1 
ATOM   7864  C  C     . ALA D  1 164 ? 36.348  34.056  55.474  1.00 41.98 ? 1137 ALA D C     1 
ATOM   7865  O  O     . ALA D  1 164 ? 37.407  34.135  56.103  1.00 41.24 ? 1137 ALA D O     1 
ATOM   7866  C  CB    . ALA D  1 164 ? 35.792  33.165  53.185  1.00 41.44 ? 1137 ALA D CB    1 
ATOM   7867  N  N     . GLU D  1 165 ? 35.191  33.688  56.035  1.00 46.41 ? 1138 GLU D N     1 
ATOM   7868  C  CA    . GLU D  1 165 ? 35.044  33.397  57.473  1.00 45.86 ? 1138 GLU D CA    1 
ATOM   7869  C  C     . GLU D  1 165 ? 35.884  32.213  57.972  1.00 48.57 ? 1138 GLU D C     1 
ATOM   7870  O  O     . GLU D  1 165 ? 36.320  32.205  59.127  1.00 49.44 ? 1138 GLU D O     1 
ATOM   7871  C  CB    . GLU D  1 165 ? 33.571  33.183  57.830  1.00 46.37 ? 1138 GLU D CB    1 
ATOM   7872  N  N     . ASP D  1 166 ? 36.107  31.225  57.102  1.00 49.76 ? 1139 ASP D N     1 
ATOM   7873  C  CA    . ASP D  1 166 ? 36.929  30.051  57.425  1.00 48.46 ? 1139 ASP D CA    1 
ATOM   7874  C  C     . ASP D  1 166 ? 38.431  30.258  57.147  1.00 48.12 ? 1139 ASP D C     1 
ATOM   7875  O  O     . ASP D  1 166 ? 39.215  29.303  57.177  1.00 52.32 ? 1139 ASP D O     1 
ATOM   7876  C  CB    . ASP D  1 166 ? 36.406  28.809  56.690  1.00 49.55 ? 1139 ASP D CB    1 
ATOM   7877  C  CG    . ASP D  1 166 ? 36.517  28.923  55.166  1.00 57.21 ? 1139 ASP D CG    1 
ATOM   7878  O  OD1   . ASP D  1 166 ? 36.696  27.869  54.516  1.00 50.89 ? 1139 ASP D OD1   1 
ATOM   7879  O  OD2   . ASP D  1 166 ? 36.422  30.049  54.618  1.00 50.54 ? 1139 ASP D OD2   1 
ATOM   7880  N  N     . PHE D  1 167 ? 38.812  31.511  56.887  1.00 42.04 ? 1140 PHE D N     1 
ATOM   7881  C  CA    . PHE D  1 167 ? 40.207  31.939  56.675  1.00 38.14 ? 1140 PHE D CA    1 
ATOM   7882  C  C     . PHE D  1 167 ? 40.829  31.516  55.338  1.00 36.06 ? 1140 PHE D C     1 
ATOM   7883  O  O     . PHE D  1 167 ? 42.040  31.643  55.147  1.00 36.40 ? 1140 PHE D O     1 
ATOM   7884  C  CB    . PHE D  1 167 ? 41.110  31.551  57.854  1.00 34.36 ? 1140 PHE D CB    1 
ATOM   7885  C  CG    . PHE D  1 167 ? 40.573  31.969  59.197  1.00 36.96 ? 1140 PHE D CG    1 
ATOM   7886  C  CD1   . PHE D  1 167 ? 40.535  33.313  59.564  1.00 34.44 ? 1140 PHE D CD1   1 
ATOM   7887  C  CD2   . PHE D  1 167 ? 40.116  31.013  60.103  1.00 40.87 ? 1140 PHE D CD2   1 
ATOM   7888  C  CE1   . PHE D  1 167 ? 40.042  33.697  60.811  1.00 30.18 ? 1140 PHE D CE1   1 
ATOM   7889  C  CE2   . PHE D  1 167 ? 39.615  31.390  61.349  1.00 31.36 ? 1140 PHE D CE2   1 
ATOM   7890  C  CZ    . PHE D  1 167 ? 39.582  32.730  61.702  1.00 27.63 ? 1140 PHE D CZ    1 
ATOM   7891  N  N     . THR D  1 168 ? 39.996  31.018  54.428  1.00 36.12 ? 1141 THR D N     1 
ATOM   7892  C  CA    . THR D  1 168 ? 40.412  30.694  53.069  1.00 37.15 ? 1141 THR D CA    1 
ATOM   7893  C  C     . THR D  1 168 ? 40.502  31.992  52.261  1.00 35.53 ? 1141 THR D C     1 
ATOM   7894  O  O     . THR D  1 168 ? 39.649  32.872  52.391  1.00 33.51 ? 1141 THR D O     1 
ATOM   7895  C  CB    . THR D  1 168 ? 39.443  29.676  52.406  1.00 39.58 ? 1141 THR D CB    1 
ATOM   7896  O  OG1   . THR D  1 168 ? 39.568  28.405  53.057  1.00 41.07 ? 1141 THR D OG1   1 
ATOM   7897  C  CG2   . THR D  1 168 ? 39.755  29.483  50.924  1.00 41.05 ? 1141 THR D CG2   1 
ATOM   7898  N  N     . ILE D  1 169 ? 41.548  32.101  51.444  1.00 31.36 ? 1142 ILE D N     1 
ATOM   7899  C  CA    . ILE D  1 169 ? 41.837  33.321  50.700  1.00 29.16 ? 1142 ILE D CA    1 
ATOM   7900  C  C     . ILE D  1 169 ? 41.795  33.120  49.185  1.00 29.23 ? 1142 ILE D C     1 
ATOM   7901  O  O     . ILE D  1 169 ? 42.125  32.040  48.685  1.00 29.09 ? 1142 ILE D O     1 
ATOM   7902  C  CB    . ILE D  1 169 ? 43.217  33.955  51.101  1.00 30.96 ? 1142 ILE D CB    1 
ATOM   7903  C  CG1   . ILE D  1 169 ? 44.378  32.984  50.853  1.00 26.06 ? 1142 ILE D CG1   1 
ATOM   7904  C  CG2   . ILE D  1 169 ? 43.205  34.448  52.550  1.00 27.15 ? 1142 ILE D CG2   1 
ATOM   7905  C  CD1   . ILE D  1 169 ? 45.618  33.659  50.305  1.00 39.75 ? 1142 ILE D CD1   1 
ATOM   7906  N  N     . LYS D  1 170 ? 41.394  34.173  48.473  1.00 29.87 ? 1143 LYS D N     1 
ATOM   7907  C  CA    . LYS D  1 170 ? 41.383  34.196  47.009  1.00 32.49 ? 1143 LYS D CA    1 
ATOM   7908  C  C     . LYS D  1 170 ? 42.106  35.412  46.412  1.00 30.38 ? 1143 LYS D C     1 
ATOM   7909  O  O     . LYS D  1 170 ? 41.825  36.551  46.776  1.00 27.47 ? 1143 LYS D O     1 
ATOM   7910  C  CB    . LYS D  1 170 ? 39.948  34.134  46.481  1.00 34.28 ? 1143 LYS D CB    1 
ATOM   7911  C  CG    . LYS D  1 170 ? 39.584  32.836  45.799  1.00 39.36 ? 1143 LYS D CG    1 
ATOM   7912  C  CD    . LYS D  1 170 ? 39.149  31.761  46.759  1.00 38.68 ? 1143 LYS D CD    1 
ATOM   7913  C  CE    . LYS D  1 170 ? 38.597  30.576  45.992  1.00 38.39 ? 1143 LYS D CE    1 
ATOM   7914  N  NZ    . LYS D  1 170 ? 37.790  29.681  46.858  1.00 45.67 ? 1143 LYS D NZ    1 
ATOM   7915  N  N     . LEU D  1 171 ? 43.043  35.144  45.503  1.00 30.22 ? 1144 LEU D N     1 
ATOM   7916  C  CA    . LEU D  1 171 ? 43.741  36.171  44.737  1.00 27.41 ? 1144 LEU D CA    1 
ATOM   7917  C  C     . LEU D  1 171 ? 42.823  36.739  43.668  1.00 27.63 ? 1144 LEU D C     1 
ATOM   7918  O  O     . LEU D  1 171 ? 42.276  35.999  42.853  1.00 29.64 ? 1144 LEU D O     1 
ATOM   7919  C  CB    . LEU D  1 171 ? 45.002  35.587  44.084  1.00 26.50 ? 1144 LEU D CB    1 
ATOM   7920  C  CG    . LEU D  1 171 ? 45.960  36.489  43.295  1.00 23.24 ? 1144 LEU D CG    1 
ATOM   7921  C  CD1   . LEU D  1 171 ? 46.595  37.571  44.182  1.00 21.89 ? 1144 LEU D CD1   1 
ATOM   7922  C  CD2   . LEU D  1 171 ? 47.041  35.653  42.641  1.00 23.88 ? 1144 LEU D CD2   1 
ATOM   7923  N  N     . ILE D  1 172 ? 42.646  38.057  43.693  1.00 28.55 ? 1145 ILE D N     1 
ATOM   7924  C  CA    . ILE D  1 172 ? 41.808  38.752  42.718  1.00 27.84 ? 1145 ILE D CA    1 
ATOM   7925  C  C     . ILE D  1 172 ? 42.617  39.785  41.917  1.00 26.24 ? 1145 ILE D C     1 
ATOM   7926  O  O     . ILE D  1 172 ? 43.850  39.884  42.049  1.00 26.10 ? 1145 ILE D O     1 
ATOM   7927  C  CB    . ILE D  1 172 ? 40.568  39.442  43.385  1.00 30.27 ? 1145 ILE D CB    1 
ATOM   7928  C  CG1   . ILE D  1 172 ? 41.012  40.456  44.439  1.00 30.55 ? 1145 ILE D CG1   1 
ATOM   7929  C  CG2   . ILE D  1 172 ? 39.624  38.413  44.001  1.00 34.91 ? 1145 ILE D CG2   1 
ATOM   7930  C  CD1   . ILE D  1 172 ? 40.059  41.587  44.659  1.00 17.16 ? 1145 ILE D CD1   1 
ATOM   7931  N  N     . ASP D  1 173 ? 41.903  40.544  41.087  1.00 27.93 ? 1146 ASP D N     1 
ATOM   7932  C  CA    . ASP D  1 173 ? 42.455  41.664  40.319  1.00 25.17 ? 1146 ASP D CA    1 
ATOM   7933  C  C     . ASP D  1 173 ? 43.619  41.252  39.422  1.00 24.58 ? 1146 ASP D C     1 
ATOM   7934  O  O     . ASP D  1 173 ? 44.788  41.415  39.774  1.00 27.86 ? 1146 ASP D O     1 
ATOM   7935  C  CB    . ASP D  1 173 ? 42.848  42.815  41.253  1.00 23.51 ? 1146 ASP D CB    1 
ATOM   7936  C  CG    . ASP D  1 173 ? 42.941  44.150  40.543  1.00 27.94 ? 1146 ASP D CG    1 
ATOM   7937  O  OD1   . ASP D  1 173 ? 42.768  44.224  39.304  1.00 21.66 ? 1146 ASP D OD1   1 
ATOM   7938  O  OD2   . ASP D  1 173 ? 43.180  45.150  41.246  1.00 20.56 ? 1146 ASP D OD2   1 
ATOM   7939  N  N     . PHE D  1 174 ? 43.286  40.719  38.254  1.00 27.11 ? 1147 PHE D N     1 
ATOM   7940  C  CA    . PHE D  1 174 ? 44.306  40.347  37.271  1.00 27.72 ? 1147 PHE D CA    1 
ATOM   7941  C  C     . PHE D  1 174 ? 44.550  41.415  36.189  1.00 22.10 ? 1147 PHE D C     1 
ATOM   7942  O  O     . PHE D  1 174 ? 45.125  41.126  35.156  1.00 27.99 ? 1147 PHE D O     1 
ATOM   7943  C  CB    . PHE D  1 174 ? 43.976  38.976  36.668  1.00 30.59 ? 1147 PHE D CB    1 
ATOM   7944  C  CG    . PHE D  1 174 ? 44.300  37.829  37.581  1.00 32.14 ? 1147 PHE D CG    1 
ATOM   7945  C  CD1   . PHE D  1 174 ? 43.569  37.623  38.753  1.00 21.97 ? 1147 PHE D CD1   1 
ATOM   7946  C  CD2   . PHE D  1 174 ? 45.343  36.963  37.278  1.00 32.10 ? 1147 PHE D CD2   1 
ATOM   7947  C  CE1   . PHE D  1 174 ? 43.867  36.567  39.598  1.00 22.80 ? 1147 PHE D CE1   1 
ATOM   7948  C  CE2   . PHE D  1 174 ? 45.651  35.903  38.120  1.00 32.98 ? 1147 PHE D CE2   1 
ATOM   7949  C  CZ    . PHE D  1 174 ? 44.909  35.704  39.282  1.00 32.61 ? 1147 PHE D CZ    1 
ATOM   7950  N  N     . GLY D  1 175 ? 44.161  42.657  36.471  1.00 28.41 ? 1148 GLY D N     1 
ATOM   7951  C  CA    . GLY D  1 175 ? 44.345  43.784  35.547  1.00 28.69 ? 1148 GLY D CA    1 
ATOM   7952  C  C     . GLY D  1 175 ? 45.768  44.179  35.189  1.00 29.13 ? 1148 GLY D C     1 
ATOM   7953  O  O     . GLY D  1 175 ? 45.975  44.940  34.243  1.00 34.99 ? 1148 GLY D O     1 
ATOM   7954  N  N     . SER D  1 176 ? 46.745  43.675  35.939  1.00 25.85 ? 1149 SER D N     1 
ATOM   7955  C  CA    . SER D  1 176 ? 48.162  43.889  35.636  1.00 23.63 ? 1149 SER D CA    1 
ATOM   7956  C  C     . SER D  1 176 ? 48.876  42.591  35.258  1.00 24.65 ? 1149 SER D C     1 
ATOM   7957  O  O     . SER D  1 176 ? 50.070  42.606  34.959  1.00 27.08 ? 1149 SER D O     1 
ATOM   7958  C  CB    . SER D  1 176 ? 48.888  44.517  36.834  1.00 27.31 ? 1149 SER D CB    1 
ATOM   7959  O  OG    . SER D  1 176 ? 48.335  45.772  37.182  1.00 42.62 ? 1149 SER D OG    1 
ATOM   7960  N  N     . ALA D  1 177 ? 48.156  41.470  35.283  1.00 24.92 ? 1150 ALA D N     1 
ATOM   7961  C  CA    . ALA D  1 177 ? 48.763  40.174  35.034  1.00 29.92 ? 1150 ALA D CA    1 
ATOM   7962  C  C     . ALA D  1 177 ? 49.372  40.104  33.632  1.00 34.57 ? 1150 ALA D C     1 
ATOM   7963  O  O     . ALA D  1 177 ? 48.885  40.746  32.696  1.00 36.86 ? 1150 ALA D O     1 
ATOM   7964  C  CB    . ALA D  1 177 ? 47.755  39.061  35.255  1.00 30.82 ? 1150 ALA D CB    1 
ATOM   7965  N  N     . ALA D  1 178 ? 50.453  39.336  33.513  1.00 36.17 ? 1151 ALA D N     1 
ATOM   7966  C  CA    . ALA D  1 178 ? 51.220  39.223  32.283  1.00 34.78 ? 1151 ALA D CA    1 
ATOM   7967  C  C     . ALA D  1 178 ? 51.951  37.886  32.244  1.00 37.09 ? 1151 ALA D C     1 
ATOM   7968  O  O     . ALA D  1 178 ? 52.206  37.282  33.293  1.00 37.37 ? 1151 ALA D O     1 
ATOM   7969  C  CB    . ALA D  1 178 ? 52.220  40.365  32.187  1.00 37.77 ? 1151 ALA D CB    1 
ATOM   7970  N  N     . TYR D  1 179 ? 52.293  37.443  31.032  1.00 37.05 ? 1152 TYR D N     1 
ATOM   7971  C  CA    . TYR D  1 179 ? 53.046  36.205  30.812  1.00 38.02 ? 1152 TYR D CA    1 
ATOM   7972  C  C     . TYR D  1 179 ? 54.558  36.387  30.816  1.00 38.96 ? 1152 TYR D C     1 
ATOM   7973  O  O     . TYR D  1 179 ? 55.069  37.401  30.347  1.00 37.04 ? 1152 TYR D O     1 
ATOM   7974  C  CB    . TYR D  1 179 ? 52.657  35.572  29.476  1.00 38.52 ? 1152 TYR D CB    1 
ATOM   7975  C  CG    . TYR D  1 179 ? 51.285  34.955  29.459  1.00 39.54 ? 1152 TYR D CG    1 
ATOM   7976  C  CD1   . TYR D  1 179 ? 51.076  33.676  29.963  1.00 28.05 ? 1152 TYR D CD1   1 
ATOM   7977  C  CD2   . TYR D  1 179 ? 50.195  35.646  28.925  1.00 35.61 ? 1152 TYR D CD2   1 
ATOM   7978  C  CE1   . TYR D  1 179 ? 49.823  33.100  29.945  1.00 36.66 ? 1152 TYR D CE1   1 
ATOM   7979  C  CE2   . TYR D  1 179 ? 48.934  35.078  28.905  1.00 40.67 ? 1152 TYR D CE2   1 
ATOM   7980  C  CZ    . TYR D  1 179 ? 48.757  33.802  29.416  1.00 38.31 ? 1152 TYR D CZ    1 
ATOM   7981  O  OH    . TYR D  1 179 ? 47.512  33.222  29.399  1.00 47.83 ? 1152 TYR D OH    1 
ATOM   7982  N  N     . LEU D  1 180 ? 55.259  35.382  31.340  1.00 45.05 ? 1153 LEU D N     1 
ATOM   7983  C  CA    . LEU D  1 180 ? 56.708  35.276  31.200  1.00 45.15 ? 1153 LEU D CA    1 
ATOM   7984  C  C     . LEU D  1 180 ? 57.060  34.687  29.835  1.00 47.45 ? 1153 LEU D C     1 
ATOM   7985  O  O     . LEU D  1 180 ? 56.520  33.650  29.434  1.00 46.81 ? 1153 LEU D O     1 
ATOM   7986  C  CB    . LEU D  1 180 ? 57.316  34.385  32.295  1.00 45.93 ? 1153 LEU D CB    1 
ATOM   7987  C  CG    . LEU D  1 180 ? 57.610  34.825  33.735  1.00 35.30 ? 1153 LEU D CG    1 
ATOM   7988  C  CD1   . LEU D  1 180 ? 57.764  36.340  33.867  1.00 34.17 ? 1153 LEU D CD1   1 
ATOM   7989  C  CD2   . LEU D  1 180 ? 56.537  34.312  34.660  1.00 30.38 ? 1153 LEU D CD2   1 
ATOM   7990  N  N     . GLU D  1 181 ? 57.967  35.359  29.132  1.00 49.66 ? 1154 GLU D N     1 
ATOM   7991  C  CA    . GLU D  1 181 ? 58.511  34.867  27.874  1.00 51.60 ? 1154 GLU D CA    1 
ATOM   7992  C  C     . GLU D  1 181 ? 60.014  34.697  28.043  1.00 54.31 ? 1154 GLU D C     1 
ATOM   7993  O  O     . GLU D  1 181 ? 60.667  35.523  28.686  1.00 53.78 ? 1154 GLU D O     1 
ATOM   7994  C  CB    . GLU D  1 181 ? 58.209  35.844  26.736  1.00 51.26 ? 1154 GLU D CB    1 
ATOM   7995  N  N     . ARG D  1 182 ? 60.551  33.616  27.477  1.00 56.00 ? 1155 ARG D N     1 
ATOM   7996  C  CA    . ARG D  1 182 ? 61.983  33.318  27.536  1.00 56.12 ? 1155 ARG D CA    1 
ATOM   7997  C  C     . ARG D  1 182 ? 62.842  34.521  27.132  1.00 57.35 ? 1155 ARG D C     1 
ATOM   7998  O  O     . ARG D  1 182 ? 62.691  35.064  26.032  1.00 55.26 ? 1155 ARG D O     1 
ATOM   7999  C  CB    . ARG D  1 182 ? 62.305  32.113  26.650  1.00 57.37 ? 1155 ARG D CB    1 
ATOM   8000  N  N     . GLY D  1 183 ? 63.717  34.946  28.046  1.00 58.05 ? 1156 GLY D N     1 
ATOM   8001  C  CA    . GLY D  1 183 ? 64.656  36.048  27.804  1.00 56.47 ? 1156 GLY D CA    1 
ATOM   8002  C  C     . GLY D  1 183 ? 64.050  37.435  27.651  1.00 57.96 ? 1156 GLY D C     1 
ATOM   8003  O  O     . GLY D  1 183 ? 64.700  38.345  27.122  1.00 58.07 ? 1156 GLY D O     1 
ATOM   8004  N  N     . LYS D  1 184 ? 62.815  37.605  28.125  1.00 56.88 ? 1157 LYS D N     1 
ATOM   8005  C  CA    . LYS D  1 184 ? 62.108  38.881  28.011  1.00 54.95 ? 1157 LYS D CA    1 
ATOM   8006  C  C     . LYS D  1 184 ? 62.095  39.672  29.325  1.00 52.03 ? 1157 LYS D C     1 
ATOM   8007  O  O     . LYS D  1 184 ? 61.823  39.119  30.390  1.00 50.31 ? 1157 LYS D O     1 
ATOM   8008  C  CB    . LYS D  1 184 ? 60.677  38.659  27.504  1.00 56.66 ? 1157 LYS D CB    1 
ATOM   8009  C  CG    . LYS D  1 184 ? 59.998  39.897  26.900  1.00 58.68 ? 1157 LYS D CG    1 
ATOM   8010  C  CD    . LYS D  1 184 ? 60.204  40.016  25.376  1.00 59.51 ? 1157 LYS D CD    1 
ATOM   8011  C  CE    . LYS D  1 184 ? 61.531  40.682  24.999  1.00 57.70 ? 1157 LYS D CE    1 
ATOM   8012  N  NZ    . LYS D  1 184 ? 61.658  42.075  25.523  1.00 59.78 ? 1157 LYS D NZ    1 
ATOM   8013  N  N     . LEU D  1 185 ? 62.390  40.967  29.229  1.00 49.65 ? 1158 LEU D N     1 
ATOM   8014  C  CA    . LEU D  1 185 ? 62.358  41.870  30.379  1.00 52.41 ? 1158 LEU D CA    1 
ATOM   8015  C  C     . LEU D  1 185 ? 61.274  42.934  30.209  1.00 51.06 ? 1158 LEU D C     1 
ATOM   8016  O  O     . LEU D  1 185 ? 61.017  43.392  29.091  1.00 55.26 ? 1158 LEU D O     1 
ATOM   8017  C  CB    . LEU D  1 185 ? 63.729  42.536  30.603  1.00 50.49 ? 1158 LEU D CB    1 
ATOM   8018  C  CG    . LEU D  1 185 ? 64.990  41.685  30.845  1.00 51.15 ? 1158 LEU D CG    1 
ATOM   8019  C  CD1   . LEU D  1 185 ? 66.234  42.557  30.738  1.00 54.27 ? 1158 LEU D CD1   1 
ATOM   8020  C  CD2   . LEU D  1 185 ? 64.986  40.941  32.181  1.00 38.07 ? 1158 LEU D CD2   1 
ATOM   8021  N  N     . PHE D  1 186 ? 60.643  43.316  31.320  1.00 48.00 ? 1159 PHE D N     1 
ATOM   8022  C  CA    . PHE D  1 186 ? 59.618  44.368  31.330  1.00 43.02 ? 1159 PHE D CA    1 
ATOM   8023  C  C     . PHE D  1 186 ? 60.235  45.741  31.624  1.00 41.49 ? 1159 PHE D C     1 
ATOM   8024  O  O     . PHE D  1 186 ? 61.028  45.885  32.551  1.00 40.18 ? 1159 PHE D O     1 
ATOM   8025  C  CB    . PHE D  1 186 ? 58.541  44.068  32.378  1.00 39.88 ? 1159 PHE D CB    1 
ATOM   8026  C  CG    . PHE D  1 186 ? 57.783  42.789  32.142  1.00 34.85 ? 1159 PHE D CG    1 
ATOM   8027  C  CD1   . PHE D  1 186 ? 58.240  41.583  32.668  1.00 36.32 ? 1159 PHE D CD1   1 
ATOM   8028  C  CD2   . PHE D  1 186 ? 56.593  42.794  31.418  1.00 35.87 ? 1159 PHE D CD2   1 
ATOM   8029  C  CE1   . PHE D  1 186 ? 57.534  40.398  32.464  1.00 38.04 ? 1159 PHE D CE1   1 
ATOM   8030  C  CE2   . PHE D  1 186 ? 55.878  41.613  31.207  1.00 34.52 ? 1159 PHE D CE2   1 
ATOM   8031  C  CZ    . PHE D  1 186 ? 56.348  40.413  31.731  1.00 33.44 ? 1159 PHE D CZ    1 
ATOM   8032  N  N     . TYR D  1 187 ? 59.850  46.749  30.846  1.00 44.24 ? 1160 TYR D N     1 
ATOM   8033  C  CA    . TYR D  1 187 ? 60.430  48.092  30.968  1.00 45.94 ? 1160 TYR D CA    1 
ATOM   8034  C  C     . TYR D  1 187 ? 59.452  49.109  31.558  1.00 47.18 ? 1160 TYR D C     1 
ATOM   8035  O  O     . TYR D  1 187 ? 59.732  50.313  31.597  1.00 47.62 ? 1160 TYR D O     1 
ATOM   8036  C  CB    . TYR D  1 187 ? 60.964  48.565  29.610  1.00 47.90 ? 1160 TYR D CB    1 
ATOM   8037  C  CG    . TYR D  1 187 ? 62.267  47.909  29.216  1.00 48.41 ? 1160 TYR D CG    1 
ATOM   8038  C  CD1   . TYR D  1 187 ? 63.478  48.559  29.421  1.00 54.96 ? 1160 TYR D CD1   1 
ATOM   8039  C  CD2   . TYR D  1 187 ? 62.289  46.631  28.648  1.00 50.50 ? 1160 TYR D CD2   1 
ATOM   8040  C  CE1   . TYR D  1 187 ? 64.683  47.961  29.069  1.00 58.42 ? 1160 TYR D CE1   1 
ATOM   8041  C  CE2   . TYR D  1 187 ? 63.489  46.024  28.291  1.00 51.57 ? 1160 TYR D CE2   1 
ATOM   8042  C  CZ    . TYR D  1 187 ? 64.682  46.697  28.507  1.00 53.09 ? 1160 TYR D CZ    1 
ATOM   8043  O  OH    . TYR D  1 187 ? 65.879  46.117  28.158  1.00 54.91 ? 1160 TYR D OH    1 
ATOM   8044  N  N     . THR D  1 188 ? 58.305  48.611  32.011  1.00 44.43 ? 1161 THR D N     1 
ATOM   8045  C  CA    . THR D  1 188 ? 57.310  49.425  32.696  1.00 45.24 ? 1161 THR D CA    1 
ATOM   8046  C  C     . THR D  1 188 ? 56.847  48.695  33.963  1.00 42.72 ? 1161 THR D C     1 
ATOM   8047  O  O     . THR D  1 188 ? 56.603  47.487  33.944  1.00 40.89 ? 1161 THR D O     1 
ATOM   8048  C  CB    . THR D  1 188 ? 56.092  49.732  31.778  1.00 49.43 ? 1161 THR D CB    1 
ATOM   8049  O  OG1   . THR D  1 188 ? 56.540  50.021  30.446  1.00 48.80 ? 1161 THR D OG1   1 
ATOM   8050  C  CG2   . THR D  1 188 ? 55.307  50.922  32.297  1.00 51.22 ? 1161 THR D CG2   1 
ATOM   8051  N  N     . PHE D  1 189 ? 56.758  49.431  35.066  1.00 42.17 ? 1162 PHE D N     1 
ATOM   8052  C  CA    . PHE D  1 189 ? 56.221  48.902  36.315  1.00 37.16 ? 1162 PHE D CA    1 
ATOM   8053  C  C     . PHE D  1 189 ? 54.734  49.229  36.380  1.00 38.72 ? 1162 PHE D C     1 
ATOM   8054  O  O     . PHE D  1 189 ? 54.326  50.363  36.111  1.00 38.38 ? 1162 PHE D O     1 
ATOM   8055  C  CB    . PHE D  1 189 ? 56.976  49.469  37.525  1.00 36.48 ? 1162 PHE D CB    1 
ATOM   8056  C  CG    . PHE D  1 189 ? 56.441  48.999  38.853  1.00 29.33 ? 1162 PHE D CG    1 
ATOM   8057  C  CD1   . PHE D  1 189 ? 56.676  47.709  39.298  1.00 30.26 ? 1162 PHE D CD1   1 
ATOM   8058  C  CD2   . PHE D  1 189 ? 55.699  49.850  39.656  1.00 31.29 ? 1162 PHE D CD2   1 
ATOM   8059  C  CE1   . PHE D  1 189 ? 56.171  47.278  40.517  1.00 22.93 ? 1162 PHE D CE1   1 
ATOM   8060  C  CE2   . PHE D  1 189 ? 55.192  49.419  40.876  1.00 23.86 ? 1162 PHE D CE2   1 
ATOM   8061  C  CZ    . PHE D  1 189 ? 55.433  48.133  41.303  1.00 24.02 ? 1162 PHE D CZ    1 
ATOM   8062  N  N     . CYS D  1 190 ? 53.932  48.226  36.728  1.00 42.15 ? 1163 CYS D N     1 
ATOM   8063  C  CA    . CYS D  1 190 ? 52.475  48.340  36.671  1.00 45.48 ? 1163 CYS D CA    1 
ATOM   8064  C  C     . CYS D  1 190 ? 51.769  47.970  37.975  1.00 43.11 ? 1163 CYS D C     1 
ATOM   8065  O  O     . CYS D  1 190 ? 50.538  47.883  38.012  1.00 43.36 ? 1163 CYS D O     1 
ATOM   8066  C  CB    . CYS D  1 190 ? 51.930  47.488  35.522  1.00 48.46 ? 1163 CYS D CB    1 
ATOM   8067  S  SG    . CYS D  1 190 ? 52.494  48.013  33.887  1.00 58.11 ? 1163 CYS D SG    1 
ATOM   8068  N  N     . GLY D  1 191 ? 52.544  47.770  39.038  1.00 38.59 ? 1164 GLY D N     1 
ATOM   8069  C  CA    . GLY D  1 191 ? 51.987  47.415  40.342  1.00 37.42 ? 1164 GLY D CA    1 
ATOM   8070  C  C     . GLY D  1 191 ? 51.883  48.576  41.312  1.00 37.56 ? 1164 GLY D C     1 
ATOM   8071  O  O     . GLY D  1 191 ? 51.783  49.735  40.916  1.00 37.07 ? 1164 GLY D O     1 
ATOM   8072  N  N     . THR D  1 192 ? 51.900  48.258  42.599  1.00 41.40 ? 1165 THR D N     1 
ATOM   8073  C  CA    . THR D  1 192 ? 51.855  49.273  43.645  1.00 37.88 ? 1165 THR D CA    1 
ATOM   8074  C  C     . THR D  1 192 ? 53.281  49.607  44.075  1.00 35.89 ? 1165 THR D C     1 
ATOM   8075  O  O     . THR D  1 192 ? 54.077  48.710  44.356  1.00 34.76 ? 1165 THR D O     1 
ATOM   8076  C  CB    . THR D  1 192 ? 51.008  48.794  44.830  1.00 37.85 ? 1165 THR D CB    1 
ATOM   8077  O  OG1   . THR D  1 192 ? 49.755  48.317  44.332  1.00 33.21 ? 1165 THR D OG1   1 
ATOM   8078  C  CG2   . THR D  1 192 ? 50.755  49.928  45.826  1.00 26.79 ? 1165 THR D CG2   1 
ATOM   8079  N  N     . ILE D  1 193 ? 53.595  50.900  44.108  1.00 34.96 ? 1166 ILE D N     1 
ATOM   8080  C  CA    . ILE D  1 193 ? 54.957  51.370  44.389  1.00 34.15 ? 1166 ILE D CA    1 
ATOM   8081  C  C     . ILE D  1 193 ? 55.465  50.916  45.759  1.00 33.40 ? 1166 ILE D C     1 
ATOM   8082  O  O     . ILE D  1 193 ? 56.642  50.612  45.903  1.00 32.32 ? 1166 ILE D O     1 
ATOM   8083  C  CB    . ILE D  1 193 ? 55.088  52.910  44.169  1.00 36.47 ? 1166 ILE D CB    1 
ATOM   8084  C  CG1   . ILE D  1 193 ? 55.200  53.236  42.666  1.00 45.44 ? 1166 ILE D CG1   1 
ATOM   8085  C  CG2   . ILE D  1 193 ? 56.268  53.497  44.921  1.00 40.76 ? 1166 ILE D CG2   1 
ATOM   8086  C  CD1   . ILE D  1 193 ? 56.449  52.683  41.955  1.00 39.62 ? 1166 ILE D CD1   1 
ATOM   8087  N  N     . GLU D  1 194 ? 54.560  50.835  46.739  1.00 33.04 ? 1167 GLU D N     1 
ATOM   8088  C  CA    . GLU D  1 194 ? 54.862  50.312  48.079  1.00 34.61 ? 1167 GLU D CA    1 
ATOM   8089  C  C     . GLU D  1 194 ? 55.279  48.840  48.099  1.00 34.46 ? 1167 GLU D C     1 
ATOM   8090  O  O     . GLU D  1 194 ? 55.856  48.371  49.083  1.00 35.95 ? 1167 GLU D O     1 
ATOM   8091  C  CB    . GLU D  1 194 ? 53.670  50.518  49.022  1.00 36.11 ? 1167 GLU D CB    1 
ATOM   8092  C  CG    . GLU D  1 194 ? 53.475  51.963  49.493  1.00 40.28 ? 1167 GLU D CG    1 
ATOM   8093  C  CD    . GLU D  1 194 ? 52.876  52.882  48.425  1.00 45.70 ? 1167 GLU D CD    1 
ATOM   8094  O  OE1   . GLU D  1 194 ? 52.223  52.379  47.478  1.00 37.32 ? 1167 GLU D OE1   1 
ATOM   8095  O  OE2   . GLU D  1 194 ? 53.051  54.117  48.544  1.00 44.52 ? 1167 GLU D OE2   1 
ATOM   8096  N  N     . TYR D  1 195 ? 54.990  48.126  47.014  1.00 32.99 ? 1168 TYR D N     1 
ATOM   8097  C  CA    . TYR D  1 195 ? 55.315  46.702  46.875  1.00 32.96 ? 1168 TYR D CA    1 
ATOM   8098  C  C     . TYR D  1 195 ? 56.426  46.459  45.850  1.00 32.00 ? 1168 TYR D C     1 
ATOM   8099  O  O     . TYR D  1 195 ? 56.617  45.341  45.373  1.00 34.28 ? 1168 TYR D O     1 
ATOM   8100  C  CB    . TYR D  1 195 ? 54.047  45.927  46.508  1.00 31.94 ? 1168 TYR D CB    1 
ATOM   8101  C  CG    . TYR D  1 195 ? 53.058  45.871  47.652  1.00 30.73 ? 1168 TYR D CG    1 
ATOM   8102  C  CD1   . TYR D  1 195 ? 52.280  46.983  47.989  1.00 26.91 ? 1168 TYR D CD1   1 
ATOM   8103  C  CD2   . TYR D  1 195 ? 52.922  44.719  48.415  1.00 22.57 ? 1168 TYR D CD2   1 
ATOM   8104  C  CE1   . TYR D  1 195 ? 51.397  46.940  49.056  1.00 33.26 ? 1168 TYR D CE1   1 
ATOM   8105  C  CE2   . TYR D  1 195 ? 52.041  44.666  49.475  1.00 24.97 ? 1168 TYR D CE2   1 
ATOM   8106  C  CZ    . TYR D  1 195 ? 51.284  45.774  49.792  1.00 28.28 ? 1168 TYR D CZ    1 
ATOM   8107  O  OH    . TYR D  1 195 ? 50.406  45.700  50.843  1.00 37.53 ? 1168 TYR D OH    1 
ATOM   8108  N  N     . CYS D  1 196 ? 57.168  47.521  45.550  1.00 29.68 ? 1169 CYS D N     1 
ATOM   8109  C  CA    . CYS D  1 196 ? 58.154  47.535  44.477  1.00 28.90 ? 1169 CYS D CA    1 
ATOM   8110  C  C     . CYS D  1 196 ? 59.559  47.305  45.007  1.00 30.09 ? 1169 CYS D C     1 
ATOM   8111  O  O     . CYS D  1 196 ? 59.989  47.960  45.963  1.00 30.36 ? 1169 CYS D O     1 
ATOM   8112  C  CB    . CYS D  1 196 ? 58.090  48.876  43.735  1.00 30.49 ? 1169 CYS D CB    1 
ATOM   8113  S  SG    . CYS D  1 196 ? 58.955  48.930  42.179  1.00 31.39 ? 1169 CYS D SG    1 
ATOM   8114  N  N     . ALA D  1 197 ? 60.257  46.363  44.374  1.00 27.15 ? 1170 ALA D N     1 
ATOM   8115  C  CA    . ALA D  1 197 ? 61.633  46.016  44.708  1.00 27.08 ? 1170 ALA D CA    1 
ATOM   8116  C  C     . ALA D  1 197 ? 62.599  47.192  44.478  1.00 28.52 ? 1170 ALA D C     1 
ATOM   8117  O  O     . ALA D  1 197 ? 62.357  48.023  43.609  1.00 27.79 ? 1170 ALA D O     1 
ATOM   8118  C  CB    . ALA D  1 197 ? 62.055  44.810  43.899  1.00 26.08 ? 1170 ALA D CB    1 
ATOM   8119  N  N     . PRO D  1 198 ? 63.700  47.259  45.257  1.00 32.38 ? 1171 PRO D N     1 
ATOM   8120  C  CA    . PRO D  1 198 ? 64.667  48.361  45.165  1.00 34.10 ? 1171 PRO D CA    1 
ATOM   8121  C  C     . PRO D  1 198 ? 65.259  48.577  43.764  1.00 37.82 ? 1171 PRO D C     1 
ATOM   8122  O  O     . PRO D  1 198 ? 65.421  49.727  43.343  1.00 37.29 ? 1171 PRO D O     1 
ATOM   8123  C  CB    . PRO D  1 198 ? 65.780  47.930  46.132  1.00 35.94 ? 1171 PRO D CB    1 
ATOM   8124  C  CG    . PRO D  1 198 ? 65.139  46.990  47.059  1.00 28.54 ? 1171 PRO D CG    1 
ATOM   8125  C  CD    . PRO D  1 198 ? 64.098  46.275  46.279  1.00 30.02 ? 1171 PRO D CD    1 
ATOM   8126  N  N     . GLU D  1 199 ? 65.582  47.483  43.064  1.00 39.56 ? 1172 GLU D N     1 
ATOM   8127  C  CA    . GLU D  1 199 ? 66.173  47.546  41.717  1.00 38.64 ? 1172 GLU D CA    1 
ATOM   8128  C  C     . GLU D  1 199 ? 65.219  48.154  40.671  1.00 39.69 ? 1172 GLU D C     1 
ATOM   8129  O  O     . GLU D  1 199 ? 65.652  48.872  39.770  1.00 41.19 ? 1172 GLU D O     1 
ATOM   8130  C  CB    . GLU D  1 199 ? 66.719  46.178  41.274  1.00 39.35 ? 1172 GLU D CB    1 
ATOM   8131  C  CG    . GLU D  1 199 ? 65.671  45.085  41.004  1.00 48.14 ? 1172 GLU D CG    1 
ATOM   8132  C  CD    . GLU D  1 199 ? 65.206  44.333  42.250  1.00 49.21 ? 1172 GLU D CD    1 
ATOM   8133  O  OE1   . GLU D  1 199 ? 65.595  44.705  43.380  1.00 52.77 ? 1172 GLU D OE1   1 
ATOM   8134  O  OE2   . GLU D  1 199 ? 64.442  43.354  42.093  1.00 48.35 ? 1172 GLU D OE2   1 
ATOM   8135  N  N     . VAL D  1 200 ? 63.924  47.883  40.817  1.00 37.82 ? 1173 VAL D N     1 
ATOM   8136  C  CA    . VAL D  1 200 ? 62.902  48.464  39.944  1.00 34.59 ? 1173 VAL D CA    1 
ATOM   8137  C  C     . VAL D  1 200 ? 62.597  49.941  40.310  1.00 35.75 ? 1173 VAL D C     1 
ATOM   8138  O  O     . VAL D  1 200 ? 62.295  50.750  39.431  1.00 37.37 ? 1173 VAL D O     1 
ATOM   8139  C  CB    . VAL D  1 200 ? 61.621  47.572  39.910  1.00 31.07 ? 1173 VAL D CB    1 
ATOM   8140  C  CG1   . VAL D  1 200 ? 60.497  48.220  39.110  1.00 17.95 ? 1173 VAL D CG1   1 
ATOM   8141  C  CG2   . VAL D  1 200 ? 61.942  46.215  39.334  1.00 23.08 ? 1173 VAL D CG2   1 
ATOM   8142  N  N     . LEU D  1 201 ? 62.693  50.287  41.595  1.00 33.05 ? 1174 LEU D N     1 
ATOM   8143  C  CA    . LEU D  1 201 ? 62.506  51.673  42.044  1.00 37.94 ? 1174 LEU D CA    1 
ATOM   8144  C  C     . LEU D  1 201 ? 63.669  52.597  41.644  1.00 41.21 ? 1174 LEU D C     1 
ATOM   8145  O  O     . LEU D  1 201 ? 63.582  53.819  41.793  1.00 40.85 ? 1174 LEU D O     1 
ATOM   8146  C  CB    . LEU D  1 201 ? 62.276  51.740  43.563  1.00 38.73 ? 1174 LEU D CB    1 
ATOM   8147  C  CG    . LEU D  1 201 ? 60.884  51.489  44.159  1.00 39.16 ? 1174 LEU D CG    1 
ATOM   8148  C  CD1   . LEU D  1 201 ? 60.984  51.428  45.671  1.00 35.98 ? 1174 LEU D CD1   1 
ATOM   8149  C  CD2   . LEU D  1 201 ? 59.867  52.551  43.745  1.00 41.27 ? 1174 LEU D CD2   1 
ATOM   8150  N  N     . MET D  1 202 ? 64.753  52.012  41.140  1.00 45.04 ? 1175 MET D N     1 
ATOM   8151  C  CA    . MET D  1 202 ? 65.879  52.794  40.635  1.00 47.08 ? 1175 MET D CA    1 
ATOM   8152  C  C     . MET D  1 202 ? 65.896  52.918  39.106  1.00 48.35 ? 1175 MET D C     1 
ATOM   8153  O  O     . MET D  1 202 ? 66.650  53.717  38.545  1.00 48.31 ? 1175 MET D O     1 
ATOM   8154  C  CB    . MET D  1 202 ? 67.201  52.274  41.205  1.00 50.30 ? 1175 MET D CB    1 
ATOM   8155  C  CG    . MET D  1 202 ? 67.414  52.746  42.636  1.00 50.81 ? 1175 MET D CG    1 
ATOM   8156  S  SD    . MET D  1 202 ? 68.804  52.035  43.513  1.00 47.23 ? 1175 MET D SD    1 
ATOM   8157  C  CE    . MET D  1 202 ? 68.958  53.205  44.850  1.00 48.08 ? 1175 MET D CE    1 
ATOM   8158  N  N     . GLY D  1 203 ? 65.044  52.140  38.443  1.00 49.86 ? 1176 GLY D N     1 
ATOM   8159  C  CA    . GLY D  1 203 ? 64.789  52.313  37.017  1.00 48.14 ? 1176 GLY D CA    1 
ATOM   8160  C  C     . GLY D  1 203 ? 65.137  51.132  36.138  1.00 47.60 ? 1176 GLY D C     1 
ATOM   8161  O  O     . GLY D  1 203 ? 64.932  51.183  34.928  1.00 49.59 ? 1176 GLY D O     1 
ATOM   8162  N  N     . ASN D  1 204 ? 65.652  50.067  36.746  1.00 48.79 ? 1177 ASN D N     1 
ATOM   8163  C  CA    . ASN D  1 204 ? 66.116  48.890  36.008  1.00 48.50 ? 1177 ASN D CA    1 
ATOM   8164  C  C     . ASN D  1 204 ? 64.973  47.966  35.579  1.00 46.91 ? 1177 ASN D C     1 
ATOM   8165  O  O     . ASN D  1 204 ? 64.037  47.748  36.354  1.00 48.56 ? 1177 ASN D O     1 
ATOM   8166  C  CB    . ASN D  1 204 ? 67.147  48.117  36.842  1.00 49.66 ? 1177 ASN D CB    1 
ATOM   8167  C  CG    . ASN D  1 204 ? 68.276  49.007  37.352  1.00 53.42 ? 1177 ASN D CG    1 
ATOM   8168  O  OD1   . ASN D  1 204 ? 68.972  49.664  36.571  1.00 52.69 ? 1177 ASN D OD1   1 
ATOM   8169  N  ND2   . ASN D  1 204 ? 68.457  49.034  38.671  1.00 46.32 ? 1177 ASN D ND2   1 
ATOM   8170  N  N     . PRO D  1 205 ? 65.041  47.424  34.343  1.00 44.25 ? 1178 PRO D N     1 
ATOM   8171  C  CA    . PRO D  1 205 ? 64.013  46.512  33.837  1.00 41.74 ? 1178 PRO D CA    1 
ATOM   8172  C  C     . PRO D  1 205 ? 64.063  45.159  34.541  1.00 37.75 ? 1178 PRO D C     1 
ATOM   8173  O  O     . PRO D  1 205 ? 65.113  44.778  35.062  1.00 36.99 ? 1178 PRO D O     1 
ATOM   8174  C  CB    . PRO D  1 205 ? 64.385  46.354  32.360  1.00 44.39 ? 1178 PRO D CB    1 
ATOM   8175  C  CG    . PRO D  1 205 ? 65.853  46.563  32.323  1.00 43.11 ? 1178 PRO D CG    1 
ATOM   8176  C  CD    . PRO D  1 205 ? 66.104  47.643  33.344  1.00 46.49 ? 1178 PRO D CD    1 
ATOM   8177  N  N     . TYR D  1 206 ? 62.947  44.432  34.536  1.00 35.73 ? 1179 TYR D N     1 
ATOM   8178  C  CA    . TYR D  1 206 ? 62.828  43.232  35.368  1.00 36.36 ? 1179 TYR D CA    1 
ATOM   8179  C  C     . TYR D  1 206 ? 62.332  41.986  34.644  1.00 34.98 ? 1179 TYR D C     1 
ATOM   8180  O  O     . TYR D  1 206 ? 61.533  42.074  33.714  1.00 35.56 ? 1179 TYR D O     1 
ATOM   8181  C  CB    . TYR D  1 206 ? 61.966  43.523  36.610  1.00 32.82 ? 1179 TYR D CB    1 
ATOM   8182  C  CG    . TYR D  1 206 ? 60.534  43.893  36.312  1.00 29.00 ? 1179 TYR D CG    1 
ATOM   8183  C  CD1   . TYR D  1 206 ? 60.167  45.222  36.126  1.00 24.89 ? 1179 TYR D CD1   1 
ATOM   8184  C  CD2   . TYR D  1 206 ? 59.540  42.913  36.240  1.00 17.79 ? 1179 TYR D CD2   1 
ATOM   8185  C  CE1   . TYR D  1 206 ? 58.851  45.569  35.850  1.00 29.54 ? 1179 TYR D CE1   1 
ATOM   8186  C  CE2   . TYR D  1 206 ? 58.228  43.247  35.965  1.00 28.55 ? 1179 TYR D CE2   1 
ATOM   8187  C  CZ    . TYR D  1 206 ? 57.888  44.579  35.774  1.00 29.17 ? 1179 TYR D CZ    1 
ATOM   8188  O  OH    . TYR D  1 206 ? 56.582  44.916  35.510  1.00 37.69 ? 1179 TYR D OH    1 
ATOM   8189  N  N     . ARG D  1 207 ? 62.821  40.831  35.097  1.00 39.07 ? 1180 ARG D N     1 
ATOM   8190  C  CA    . ARG D  1 207 ? 62.403  39.520  34.593  1.00 40.26 ? 1180 ARG D CA    1 
ATOM   8191  C  C     . ARG D  1 207 ? 60.966  39.187  34.995  1.00 38.43 ? 1180 ARG D C     1 
ATOM   8192  O  O     . ARG D  1 207 ? 60.165  38.760  34.166  1.00 42.45 ? 1180 ARG D O     1 
ATOM   8193  C  CB    . ARG D  1 207 ? 63.351  38.430  35.105  1.00 40.09 ? 1180 ARG D CB    1 
ATOM   8194  C  CG    . ARG D  1 207 ? 63.610  37.314  34.102  1.00 48.43 ? 1180 ARG D CG    1 
ATOM   8195  C  CD    . ARG D  1 207 ? 64.632  36.307  34.619  1.00 47.75 ? 1180 ARG D CD    1 
ATOM   8196  N  NE    . ARG D  1 207 ? 64.007  35.049  35.031  1.00 58.13 ? 1180 ARG D NE    1 
ATOM   8197  C  CZ    . ARG D  1 207 ? 63.882  34.633  36.290  1.00 61.42 ? 1180 ARG D CZ    1 
ATOM   8198  N  NH1   . ARG D  1 207 ? 64.342  35.369  37.298  1.00 60.85 ? 1180 ARG D NH1   1 
ATOM   8199  N  NH2   . ARG D  1 207 ? 63.295  33.469  36.542  1.00 59.49 ? 1180 ARG D NH2   1 
ATOM   8200  N  N     . GLY D  1 208 ? 60.641  39.391  36.270  1.00 34.07 ? 1181 GLY D N     1 
ATOM   8201  C  CA    . GLY D  1 208 ? 59.321  39.057  36.790  1.00 30.29 ? 1181 GLY D CA    1 
ATOM   8202  C  C     . GLY D  1 208 ? 59.377  38.406  38.162  1.00 32.06 ? 1181 GLY D C     1 
ATOM   8203  O  O     . GLY D  1 208 ? 58.896  38.991  39.137  1.00 30.70 ? 1181 GLY D O     1 
ATOM   8204  N  N     . PRO D  1 209 ? 59.945  37.179  38.242  1.00 33.18 ? 1182 PRO D N     1 
ATOM   8205  C  CA    . PRO D  1 209 ? 60.068  36.413  39.497  1.00 32.53 ? 1182 PRO D CA    1 
ATOM   8206  C  C     . PRO D  1 209 ? 60.692  37.127  40.710  1.00 32.38 ? 1182 PRO D C     1 
ATOM   8207  O  O     . PRO D  1 209 ? 60.129  37.048  41.794  1.00 35.55 ? 1182 PRO D O     1 
ATOM   8208  C  CB    . PRO D  1 209 ? 60.907  35.198  39.084  1.00 33.97 ? 1182 PRO D CB    1 
ATOM   8209  C  CG    . PRO D  1 209 ? 60.580  35.016  37.620  1.00 34.63 ? 1182 PRO D CG    1 
ATOM   8210  C  CD    . PRO D  1 209 ? 60.457  36.409  37.087  1.00 28.03 ? 1182 PRO D CD    1 
ATOM   8211  N  N     . GLU D  1 210 ? 61.827  37.807  40.537  1.00 34.22 ? 1183 GLU D N     1 
ATOM   8212  C  CA    . GLU D  1 210 ? 62.484  38.531  41.642  1.00 34.53 ? 1183 GLU D CA    1 
ATOM   8213  C  C     . GLU D  1 210 ? 61.635  39.661  42.232  1.00 35.67 ? 1183 GLU D C     1 
ATOM   8214  O  O     . GLU D  1 210 ? 61.637  39.870  43.448  1.00 38.12 ? 1183 GLU D O     1 
ATOM   8215  C  CB    . GLU D  1 210 ? 63.842  39.105  41.212  1.00 36.15 ? 1183 GLU D CB    1 
ATOM   8216  C  CG    . GLU D  1 210 ? 64.949  38.071  41.006  1.00 43.29 ? 1183 GLU D CG    1 
ATOM   8217  C  CD    . GLU D  1 210 ? 65.018  37.526  39.583  1.00 44.29 ? 1183 GLU D CD    1 
ATOM   8218  O  OE1   . GLU D  1 210 ? 64.016  37.605  38.834  1.00 40.05 ? 1183 GLU D OE1   1 
ATOM   8219  O  OE2   . GLU D  1 210 ? 66.090  37.007  39.214  1.00 49.74 ? 1183 GLU D OE2   1 
ATOM   8220  N  N     . LEU D  1 211 ? 60.931  40.392  41.364  1.00 32.02 ? 1184 LEU D N     1 
ATOM   8221  C  CA    . LEU D  1 211 ? 60.057  41.492  41.782  1.00 29.75 ? 1184 LEU D CA    1 
ATOM   8222  C  C     . LEU D  1 211 ? 58.828  40.971  42.507  1.00 27.65 ? 1184 LEU D C     1 
ATOM   8223  O  O     . LEU D  1 211 ? 58.311  41.620  43.416  1.00 27.05 ? 1184 LEU D O     1 
ATOM   8224  C  CB    . LEU D  1 211 ? 59.647  42.358  40.582  1.00 31.55 ? 1184 LEU D CB    1 
ATOM   8225  C  CG    . LEU D  1 211 ? 58.596  43.461  40.776  1.00 23.95 ? 1184 LEU D CG    1 
ATOM   8226  C  CD1   . LEU D  1 211 ? 59.101  44.567  41.687  1.00 21.15 ? 1184 LEU D CD1   1 
ATOM   8227  C  CD2   . LEU D  1 211 ? 58.196  44.037  39.436  1.00 26.31 ? 1184 LEU D CD2   1 
ATOM   8228  N  N     . GLU D  1 212 ? 58.374  39.793  42.095  1.00 30.37 ? 1185 GLU D N     1 
ATOM   8229  C  CA    . GLU D  1 212 ? 57.256  39.116  42.734  1.00 25.23 ? 1185 GLU D CA    1 
ATOM   8230  C  C     . GLU D  1 212 ? 57.600  38.609  44.134  1.00 25.35 ? 1185 GLU D C     1 
ATOM   8231  O  O     . GLU D  1 212 ? 56.741  38.587  45.011  1.00 27.01 ? 1185 GLU D O     1 
ATOM   8232  C  CB    . GLU D  1 212 ? 56.799  37.950  41.870  1.00 23.12 ? 1185 GLU D CB    1 
ATOM   8233  C  CG    . GLU D  1 212 ? 55.525  37.305  42.352  1.00 22.60 ? 1185 GLU D CG    1 
ATOM   8234  C  CD    . GLU D  1 212 ? 54.847  36.499  41.278  1.00 33.52 ? 1185 GLU D CD    1 
ATOM   8235  O  OE1   . GLU D  1 212 ? 55.380  35.427  40.923  1.00 46.65 ? 1185 GLU D OE1   1 
ATOM   8236  O  OE2   . GLU D  1 212 ? 53.773  36.930  40.802  1.00 35.62 ? 1185 GLU D OE2   1 
ATOM   8237  N  N     . MET D  1 213 ? 58.851  38.197  44.337  1.00 24.99 ? 1186 MET D N     1 
ATOM   8238  C  CA    . MET D  1 213 ? 59.267  37.627  45.621  1.00 26.65 ? 1186 MET D CA    1 
ATOM   8239  C  C     . MET D  1 213 ? 59.395  38.711  46.672  1.00 26.01 ? 1186 MET D C     1 
ATOM   8240  O  O     . MET D  1 213 ? 59.180  38.462  47.864  1.00 31.73 ? 1186 MET D O     1 
ATOM   8241  C  CB    . MET D  1 213 ? 60.578  36.848  45.489  1.00 25.41 ? 1186 MET D CB    1 
ATOM   8242  C  CG    . MET D  1 213 ? 60.513  35.676  44.507  1.00 27.65 ? 1186 MET D CG    1 
ATOM   8243  S  SD    . MET D  1 213 ? 59.065  34.631  44.709  1.00 31.57 ? 1186 MET D SD    1 
ATOM   8244  C  CE    . MET D  1 213 ? 59.437  33.931  46.315  1.00 28.54 ? 1186 MET D CE    1 
ATOM   8245  N  N     . TRP D  1 214 ? 59.748  39.907  46.206  1.00 23.70 ? 1187 TRP D N     1 
ATOM   8246  C  CA    . TRP D  1 214 ? 59.757  41.101  47.022  1.00 26.07 ? 1187 TRP D CA    1 
ATOM   8247  C  C     . TRP D  1 214 ? 58.335  41.512  47.407  1.00 21.65 ? 1187 TRP D C     1 
ATOM   8248  O  O     . TRP D  1 214 ? 58.104  41.859  48.555  1.00 19.80 ? 1187 TRP D O     1 
ATOM   8249  C  CB    . TRP D  1 214 ? 60.487  42.251  46.314  1.00 23.76 ? 1187 TRP D CB    1 
ATOM   8250  C  CG    . TRP D  1 214 ? 60.492  43.501  47.124  1.00 26.02 ? 1187 TRP D CG    1 
ATOM   8251  C  CD1   . TRP D  1 214 ? 59.489  44.432  47.202  1.00 24.48 ? 1187 TRP D CD1   1 
ATOM   8252  C  CD2   . TRP D  1 214 ? 61.535  43.959  47.997  1.00 20.39 ? 1187 TRP D CD2   1 
ATOM   8253  N  NE1   . TRP D  1 214 ? 59.846  45.434  48.065  1.00 26.64 ? 1187 TRP D NE1   1 
ATOM   8254  C  CE2   . TRP D  1 214 ? 61.097  45.170  48.567  1.00 26.51 ? 1187 TRP D CE2   1 
ATOM   8255  C  CE3   . TRP D  1 214 ? 62.802  43.464  48.348  1.00 16.81 ? 1187 TRP D CE3   1 
ATOM   8256  C  CZ2   . TRP D  1 214 ? 61.881  45.900  49.467  1.00 23.03 ? 1187 TRP D CZ2   1 
ATOM   8257  C  CZ3   . TRP D  1 214 ? 63.576  44.187  49.247  1.00 22.13 ? 1187 TRP D CZ3   1 
ATOM   8258  C  CH2   . TRP D  1 214 ? 63.115  45.393  49.791  1.00 27.91 ? 1187 TRP D CH2   1 
ATOM   8259  N  N     . SER D  1 215 ? 57.387  41.475  46.466  1.00 23.35 ? 1188 SER D N     1 
ATOM   8260  C  CA    . SER D  1 215 ? 55.989  41.841  46.793  1.00 21.28 ? 1188 SER D CA    1 
ATOM   8261  C  C     . SER D  1 215 ? 55.362  40.884  47.811  1.00 20.62 ? 1188 SER D C     1 
ATOM   8262  O  O     . SER D  1 215 ? 54.620  41.309  48.686  1.00 22.73 ? 1188 SER D O     1 
ATOM   8263  C  CB    . SER D  1 215 ? 55.114  41.993  45.534  1.00 23.62 ? 1188 SER D CB    1 
ATOM   8264  O  OG    . SER D  1 215 ? 54.816  40.753  44.912  1.00 32.67 ? 1188 SER D OG    1 
ATOM   8265  N  N     . LEU D  1 216 ? 55.675  39.593  47.698  1.00 21.18 ? 1189 LEU D N     1 
ATOM   8266  C  CA    . LEU D  1 216 ? 55.242  38.595  48.682  1.00 19.75 ? 1189 LEU D CA    1 
ATOM   8267  C  C     . LEU D  1 216 ? 55.819  38.840  50.090  1.00 22.56 ? 1189 LEU D C     1 
ATOM   8268  O  O     . LEU D  1 216 ? 55.117  38.656  51.096  1.00 24.57 ? 1189 LEU D O     1 
ATOM   8269  C  CB    . LEU D  1 216 ? 55.588  37.187  48.184  1.00 25.83 ? 1189 LEU D CB    1 
ATOM   8270  C  CG    . LEU D  1 216 ? 54.800  36.742  46.940  1.00 24.65 ? 1189 LEU D CG    1 
ATOM   8271  C  CD1   . LEU D  1 216 ? 55.438  35.512  46.302  1.00 22.85 ? 1189 LEU D CD1   1 
ATOM   8272  C  CD2   . LEU D  1 216 ? 53.333  36.472  47.288  1.00 26.41 ? 1189 LEU D CD2   1 
ATOM   8273  N  N     . GLY D  1 217 ? 57.086  39.273  50.139  1.00 23.42 ? 1190 GLY D N     1 
ATOM   8274  C  CA    . GLY D  1 217 ? 57.751  39.725  51.363  1.00 21.48 ? 1190 GLY D CA    1 
ATOM   8275  C  C     . GLY D  1 217 ? 57.082  40.909  52.047  1.00 23.96 ? 1190 GLY D C     1 
ATOM   8276  O  O     . GLY D  1 217 ? 56.959  40.919  53.270  1.00 27.17 ? 1190 GLY D O     1 
ATOM   8277  N  N     . VAL D  1 218 ? 56.654  41.902  51.260  1.00 25.32 ? 1191 VAL D N     1 
ATOM   8278  C  CA    . VAL D  1 218 ? 55.912  43.070  51.760  1.00 23.47 ? 1191 VAL D CA    1 
ATOM   8279  C  C     . VAL D  1 218 ? 54.526  42.654  52.249  1.00 27.79 ? 1191 VAL D C     1 
ATOM   8280  O  O     . VAL D  1 218 ? 54.068  43.099  53.307  1.00 27.81 ? 1191 VAL D O     1 
ATOM   8281  C  CB    . VAL D  1 218 ? 55.771  44.197  50.676  1.00 24.91 ? 1191 VAL D CB    1 
ATOM   8282  C  CG1   . VAL D  1 218 ? 54.991  45.385  51.220  1.00 22.78 ? 1191 VAL D CG1   1 
ATOM   8283  C  CG2   . VAL D  1 218 ? 57.132  44.685  50.187  1.00 21.21 ? 1191 VAL D CG2   1 
ATOM   8284  N  N     . THR D  1 219 ? 53.864  41.803  51.467  1.00 30.59 ? 1192 THR D N     1 
ATOM   8285  C  CA    . THR D  1 219 ? 52.539  41.273  51.809  1.00 29.13 ? 1192 THR D CA    1 
ATOM   8286  C  C     . THR D  1 219 ? 52.553  40.467  53.118  1.00 29.41 ? 1192 THR D C     1 
ATOM   8287  O  O     . THR D  1 219 ? 51.616  40.555  53.904  1.00 26.08 ? 1192 THR D O     1 
ATOM   8288  C  CB    . THR D  1 219 ? 51.976  40.414  50.651  1.00 29.38 ? 1192 THR D CB    1 
ATOM   8289  O  OG1   . THR D  1 219 ? 51.917  41.211  49.471  1.00 25.88 ? 1192 THR D OG1   1 
ATOM   8290  C  CG2   . THR D  1 219 ? 50.567  39.870  50.961  1.00 28.77 ? 1192 THR D CG2   1 
ATOM   8291  N  N     . LEU D  1 220 ? 53.612  39.684  53.334  1.00 31.34 ? 1193 LEU D N     1 
ATOM   8292  C  CA    . LEU D  1 220 ? 53.783  38.951  54.582  1.00 30.83 ? 1193 LEU D CA    1 
ATOM   8293  C  C     . LEU D  1 220 ? 54.034  39.893  55.755  1.00 27.69 ? 1193 LEU D C     1 
ATOM   8294  O  O     . LEU D  1 220 ? 53.488  39.705  56.837  1.00 28.80 ? 1193 LEU D O     1 
ATOM   8295  C  CB    . LEU D  1 220 ? 54.920  37.935  54.466  1.00 33.63 ? 1193 LEU D CB    1 
ATOM   8296  C  CG    . LEU D  1 220 ? 55.296  37.102  55.696  1.00 26.97 ? 1193 LEU D CG    1 
ATOM   8297  C  CD1   . LEU D  1 220 ? 54.129  36.260  56.194  1.00 25.56 ? 1193 LEU D CD1   1 
ATOM   8298  C  CD2   . LEU D  1 220 ? 56.485  36.216  55.371  1.00 32.71 ? 1193 LEU D CD2   1 
ATOM   8299  N  N     . TYR D  1 221 ? 54.860  40.904  55.536  1.00 27.14 ? 1194 TYR D N     1 
ATOM   8300  C  CA    . TYR D  1 221 ? 55.198  41.860  56.586  1.00 27.21 ? 1194 TYR D CA    1 
ATOM   8301  C  C     . TYR D  1 221 ? 53.975  42.679  56.999  1.00 28.20 ? 1194 TYR D C     1 
ATOM   8302  O  O     . TYR D  1 221 ? 53.718  42.869  58.186  1.00 29.57 ? 1194 TYR D O     1 
ATOM   8303  C  CB    . TYR D  1 221 ? 56.328  42.770  56.107  1.00 22.66 ? 1194 TYR D CB    1 
ATOM   8304  C  CG    . TYR D  1 221 ? 56.971  43.637  57.171  1.00 27.47 ? 1194 TYR D CG    1 
ATOM   8305  C  CD1   . TYR D  1 221 ? 56.302  44.737  57.713  1.00 28.30 ? 1194 TYR D CD1   1 
ATOM   8306  C  CD2   . TYR D  1 221 ? 58.269  43.375  57.609  1.00 29.87 ? 1194 TYR D CD2   1 
ATOM   8307  C  CE1   . TYR D  1 221 ? 56.904  45.538  58.688  1.00 33.24 ? 1194 TYR D CE1   1 
ATOM   8308  C  CE2   . TYR D  1 221 ? 58.881  44.171  58.573  1.00 31.00 ? 1194 TYR D CE2   1 
ATOM   8309  C  CZ    . TYR D  1 221 ? 58.193  45.248  59.105  1.00 24.56 ? 1194 TYR D CZ    1 
ATOM   8310  O  OH    . TYR D  1 221 ? 58.806  46.034  60.041  1.00 29.49 ? 1194 TYR D OH    1 
ATOM   8311  N  N     . THR D  1 222 ? 53.229  43.160  56.004  1.00 31.45 ? 1195 THR D N     1 
ATOM   8312  C  CA    . THR D  1 222 ? 52.001  43.927  56.217  1.00 26.27 ? 1195 THR D CA    1 
ATOM   8313  C  C     . THR D  1 222 ? 50.911  43.075  56.876  1.00 24.81 ? 1195 THR D C     1 
ATOM   8314  O  O     . THR D  1 222 ? 50.092  43.595  57.625  1.00 29.35 ? 1195 THR D O     1 
ATOM   8315  C  CB    . THR D  1 222 ? 51.493  44.530  54.877  1.00 26.24 ? 1195 THR D CB    1 
ATOM   8316  O  OG1   . THR D  1 222 ? 52.520  45.356  54.309  1.00 25.04 ? 1195 THR D OG1   1 
ATOM   8317  C  CG2   . THR D  1 222 ? 50.233  45.360  55.075  1.00 30.01 ? 1195 THR D CG2   1 
ATOM   8318  N  N     . LEU D  1 223 ? 50.902  41.774  56.598  1.00 23.66 ? 1196 LEU D N     1 
ATOM   8319  C  CA    . LEU D  1 223 ? 49.918  40.875  57.206  1.00 28.79 ? 1196 LEU D CA    1 
ATOM   8320  C  C     . LEU D  1 223 ? 50.141  40.696  58.700  1.00 26.80 ? 1196 LEU D C     1 
ATOM   8321  O  O     . LEU D  1 223 ? 49.201  40.793  59.483  1.00 21.10 ? 1196 LEU D O     1 
ATOM   8322  C  CB    . LEU D  1 223 ? 49.883  39.501  56.517  1.00 25.73 ? 1196 LEU D CB    1 
ATOM   8323  C  CG    . LEU D  1 223 ? 49.043  38.422  57.224  1.00 28.96 ? 1196 LEU D CG    1 
ATOM   8324  C  CD1   . LEU D  1 223 ? 47.532  38.691  57.136  1.00 22.39 ? 1196 LEU D CD1   1 
ATOM   8325  C  CD2   . LEU D  1 223 ? 49.389  37.033  56.706  1.00 29.72 ? 1196 LEU D CD2   1 
ATOM   8326  N  N     . VAL D  1 224 ? 51.387  40.426  59.078  1.00 29.34 ? 1197 VAL D N     1 
ATOM   8327  C  CA    . VAL D  1 224 ? 51.715  40.095  60.459  1.00 29.90 ? 1197 VAL D CA    1 
ATOM   8328  C  C     . VAL D  1 224 ? 51.883  41.353  61.320  1.00 29.15 ? 1197 VAL D C     1 
ATOM   8329  O  O     . VAL D  1 224 ? 51.344  41.433  62.429  1.00 25.63 ? 1197 VAL D O     1 
ATOM   8330  C  CB    . VAL D  1 224 ? 52.937  39.113  60.559  1.00 28.72 ? 1197 VAL D CB    1 
ATOM   8331  C  CG1   . VAL D  1 224 ? 52.655  37.828  59.809  1.00 26.99 ? 1197 VAL D CG1   1 
ATOM   8332  C  CG2   . VAL D  1 224 ? 54.192  39.724  60.006  1.00 38.37 ? 1197 VAL D CG2   1 
ATOM   8333  N  N     . PHE D  1 225 ? 52.578  42.349  60.770  1.00 28.44 ? 1198 PHE D N     1 
ATOM   8334  C  CA    . PHE D  1 225 ? 52.929  43.576  61.486  1.00 25.36 ? 1198 PHE D CA    1 
ATOM   8335  C  C     . PHE D  1 225 ? 51.968  44.767  61.285  1.00 30.28 ? 1198 PHE D C     1 
ATOM   8336  O  O     . PHE D  1 225 ? 52.026  45.743  62.037  1.00 28.66 ? 1198 PHE D O     1 
ATOM   8337  C  CB    . PHE D  1 225 ? 54.372  43.964  61.147  1.00 28.19 ? 1198 PHE D CB    1 
ATOM   8338  C  CG    . PHE D  1 225 ? 55.384  42.910  61.528  1.00 26.00 ? 1198 PHE D CG    1 
ATOM   8339  C  CD1   . PHE D  1 225 ? 55.561  42.547  62.867  1.00 26.13 ? 1198 PHE D CD1   1 
ATOM   8340  C  CD2   . PHE D  1 225 ? 56.155  42.277  60.555  1.00 24.48 ? 1198 PHE D CD2   1 
ATOM   8341  C  CE1   . PHE D  1 225 ? 56.489  41.566  63.230  1.00 25.99 ? 1198 PHE D CE1   1 
ATOM   8342  C  CE2   . PHE D  1 225 ? 57.092  41.290  60.904  1.00 19.41 ? 1198 PHE D CE2   1 
ATOM   8343  C  CZ    . PHE D  1 225 ? 57.260  40.939  62.240  1.00 24.98 ? 1198 PHE D CZ    1 
ATOM   8344  N  N     . GLU D  1 226 ? 51.095  44.675  60.277  1.00 32.59 ? 1199 GLU D N     1 
ATOM   8345  C  CA    . GLU D  1 226 ? 50.022  45.652  60.015  1.00 31.39 ? 1199 GLU D CA    1 
ATOM   8346  C  C     . GLU D  1 226 ? 50.548  47.066  59.682  1.00 32.83 ? 1199 GLU D C     1 
ATOM   8347  O  O     . GLU D  1 226 ? 49.882  48.075  59.900  1.00 31.36 ? 1199 GLU D O     1 
ATOM   8348  C  CB    . GLU D  1 226 ? 48.976  45.648  61.151  1.00 34.63 ? 1199 GLU D CB    1 
ATOM   8349  C  CG    . GLU D  1 226 ? 48.656  44.243  61.694  1.00 26.81 ? 1199 GLU D CG    1 
ATOM   8350  C  CD    . GLU D  1 226 ? 47.406  44.177  62.561  1.00 29.44 ? 1199 GLU D CD    1 
ATOM   8351  O  OE1   . GLU D  1 226 ? 47.242  45.006  63.482  1.00 35.44 ? 1199 GLU D OE1   1 
ATOM   8352  O  OE2   . GLU D  1 226 ? 46.588  43.267  62.328  1.00 23.92 ? 1199 GLU D OE2   1 
ATOM   8353  N  N     . GLU D  1 227 ? 51.762  47.109  59.144  1.00 34.61 ? 1200 GLU D N     1 
ATOM   8354  C  CA    . GLU D  1 227 ? 52.367  48.325  58.615  1.00 33.10 ? 1200 GLU D CA    1 
ATOM   8355  C  C     . GLU D  1 227 ? 53.345  47.882  57.539  1.00 31.17 ? 1200 GLU D C     1 
ATOM   8356  O  O     . GLU D  1 227 ? 53.709  46.707  57.481  1.00 32.39 ? 1200 GLU D O     1 
ATOM   8357  C  CB    . GLU D  1 227 ? 53.093  49.113  59.717  1.00 30.02 ? 1200 GLU D CB    1 
ATOM   8358  C  CG    . GLU D  1 227 ? 54.209  48.332  60.424  1.00 34.14 ? 1200 GLU D CG    1 
ATOM   8359  C  CD    . GLU D  1 227 ? 54.816  49.071  61.614  1.00 36.97 ? 1200 GLU D CD    1 
ATOM   8360  O  OE1   . GLU D  1 227 ? 56.055  49.027  61.766  1.00 39.78 ? 1200 GLU D OE1   1 
ATOM   8361  O  OE2   . GLU D  1 227 ? 54.060  49.677  62.406  1.00 39.44 ? 1200 GLU D OE2   1 
ATOM   8362  N  N     . ASN D  1 228 ? 53.767  48.817  56.696  1.00 30.69 ? 1201 ASN D N     1 
ATOM   8363  C  CA    . ASN D  1 228 ? 54.750  48.536  55.657  1.00 31.79 ? 1201 ASN D CA    1 
ATOM   8364  C  C     . ASN D  1 228 ? 56.168  48.444  56.244  1.00 34.76 ? 1201 ASN D C     1 
ATOM   8365  O  O     . ASN D  1 228 ? 56.515  49.232  57.132  1.00 37.77 ? 1201 ASN D O     1 
ATOM   8366  C  CB    . ASN D  1 228 ? 54.694  49.620  54.575  1.00 31.33 ? 1201 ASN D CB    1 
ATOM   8367  C  CG    . ASN D  1 228 ? 55.387  49.199  53.284  1.00 37.47 ? 1201 ASN D CG    1 
ATOM   8368  O  OD1   . ASN D  1 228 ? 56.538  49.563  53.035  1.00 35.49 ? 1201 ASN D OD1   1 
ATOM   8369  N  ND2   . ASN D  1 228 ? 54.691  48.417  52.466  1.00 33.36 ? 1201 ASN D ND2   1 
ATOM   8370  N  N     . PRO D  1 229 ? 56.989  47.484  55.754  1.00 32.12 ? 1202 PRO D N     1 
ATOM   8371  C  CA    . PRO D  1 229 ? 58.396  47.350  56.189  1.00 30.31 ? 1202 PRO D CA    1 
ATOM   8372  C  C     . PRO D  1 229 ? 59.265  48.611  56.088  1.00 33.14 ? 1202 PRO D C     1 
ATOM   8373  O  O     . PRO D  1 229 ? 60.305  48.681  56.741  1.00 38.20 ? 1202 PRO D O     1 
ATOM   8374  C  CB    . PRO D  1 229 ? 58.954  46.261  55.260  1.00 29.31 ? 1202 PRO D CB    1 
ATOM   8375  C  CG    . PRO D  1 229 ? 57.942  46.125  54.142  1.00 27.39 ? 1202 PRO D CG    1 
ATOM   8376  C  CD    . PRO D  1 229 ? 56.633  46.442  54.771  1.00 27.10 ? 1202 PRO D CD    1 
ATOM   8377  N  N     . PHE D  1 230 ? 58.861  49.577  55.266  1.00 35.05 ? 1203 PHE D N     1 
ATOM   8378  C  CA    . PHE D  1 230 ? 59.651  50.788  55.026  1.00 40.19 ? 1203 PHE D CA    1 
ATOM   8379  C  C     . PHE D  1 230 ? 58.739  52.011  54.890  1.00 44.62 ? 1203 PHE D C     1 
ATOM   8380  O  O     . PHE D  1 230 ? 57.959  52.109  53.937  1.00 43.52 ? 1203 PHE D O     1 
ATOM   8381  C  CB    . PHE D  1 230 ? 60.529  50.638  53.765  1.00 39.71 ? 1203 PHE D CB    1 
ATOM   8382  C  CG    . PHE D  1 230 ? 61.245  49.315  53.674  1.00 39.78 ? 1203 PHE D CG    1 
ATOM   8383  C  CD1   . PHE D  1 230 ? 62.348  49.043  54.485  1.00 40.24 ? 1203 PHE D CD1   1 
ATOM   8384  C  CD2   . PHE D  1 230 ? 60.808  48.333  52.782  1.00 33.36 ? 1203 PHE D CD2   1 
ATOM   8385  C  CE1   . PHE D  1 230 ? 62.993  47.813  54.420  1.00 33.41 ? 1203 PHE D CE1   1 
ATOM   8386  C  CE2   . PHE D  1 230 ? 61.447  47.100  52.707  1.00 18.97 ? 1203 PHE D CE2   1 
ATOM   8387  C  CZ    . PHE D  1 230 ? 62.544  46.840  53.524  1.00 39.02 ? 1203 PHE D CZ    1 
ATOM   8388  N  N     . CYS D  1 231 ? 58.838  52.933  55.848  1.00 47.49 ? 1204 CYS D N     1 
ATOM   8389  C  CA    . CYS D  1 231 ? 58.083  54.188  55.809  1.00 52.53 ? 1204 CYS D CA    1 
ATOM   8390  C  C     . CYS D  1 231 ? 58.423  54.981  54.556  1.00 50.79 ? 1204 CYS D C     1 
ATOM   8391  O  O     . CYS D  1 231 ? 57.536  55.488  53.874  1.00 51.98 ? 1204 CYS D O     1 
ATOM   8392  C  CB    . CYS D  1 231 ? 58.383  55.058  57.033  1.00 54.40 ? 1204 CYS D CB    1 
ATOM   8393  S  SG    . CYS D  1 231 ? 58.415  54.198  58.602  1.00 68.64 ? 1204 CYS D SG    1 
ATOM   8394  N  N     . GLU D  1 232 ? 59.717  55.071  54.263  1.00 52.56 ? 1205 GLU D N     1 
ATOM   8395  C  CA    . GLU D  1 232 ? 60.217  55.840  53.130  1.00 51.29 ? 1205 GLU D CA    1 
ATOM   8396  C  C     . GLU D  1 232 ? 60.623  54.912  51.988  1.00 50.09 ? 1205 GLU D C     1 
ATOM   8397  O  O     . GLU D  1 232 ? 61.312  53.912  52.201  1.00 49.11 ? 1205 GLU D O     1 
ATOM   8398  C  CB    . GLU D  1 232 ? 61.407  56.711  53.551  1.00 50.16 ? 1205 GLU D CB    1 
ATOM   8399  C  CG    . GLU D  1 232 ? 61.241  57.433  54.893  1.00 59.44 ? 1205 GLU D CG    1 
ATOM   8400  C  CD    . GLU D  1 232 ? 60.014  58.338  54.949  1.00 64.23 ? 1205 GLU D CD    1 
ATOM   8401  O  OE1   . GLU D  1 232 ? 59.195  58.167  55.879  1.00 63.95 ? 1205 GLU D OE1   1 
ATOM   8402  O  OE2   . GLU D  1 232 ? 59.866  59.214  54.068  1.00 66.94 ? 1205 GLU D OE2   1 
ATOM   8403  N  N     . LEU D  1 233 ? 60.188  55.264  50.780  1.00 46.60 ? 1206 LEU D N     1 
ATOM   8404  C  CA    . LEU D  1 233 ? 60.483  54.515  49.557  1.00 45.19 ? 1206 LEU D CA    1 
ATOM   8405  C  C     . LEU D  1 233 ? 61.968  54.157  49.396  1.00 42.30 ? 1206 LEU D C     1 
ATOM   8406  O  O     . LEU D  1 233 ? 62.298  53.091  48.877  1.00 37.33 ? 1206 LEU D O     1 
ATOM   8407  C  CB    . LEU D  1 233 ? 60.012  55.330  48.349  1.00 44.87 ? 1206 LEU D CB    1 
ATOM   8408  C  CG    . LEU D  1 233 ? 59.048  54.750  47.314  1.00 46.21 ? 1206 LEU D CG    1 
ATOM   8409  C  CD1   . LEU D  1 233 ? 57.837  54.088  47.967  1.00 41.69 ? 1206 LEU D CD1   1 
ATOM   8410  C  CD2   . LEU D  1 233 ? 58.613  55.869  46.382  1.00 46.68 ? 1206 LEU D CD2   1 
ATOM   8411  N  N     . GLU D  1 234 ? 62.848  55.048  49.854  1.00 39.67 ? 1207 GLU D N     1 
ATOM   8412  C  CA    . GLU D  1 234 ? 64.300  54.877  49.723  1.00 39.78 ? 1207 GLU D CA    1 
ATOM   8413  C  C     . GLU D  1 234 ? 64.939  53.961  50.770  1.00 39.61 ? 1207 GLU D C     1 
ATOM   8414  O  O     . GLU D  1 234 ? 66.039  53.444  50.550  1.00 38.75 ? 1207 GLU D O     1 
ATOM   8415  C  CB    . GLU D  1 234 ? 65.001  56.240  49.728  1.00 40.13 ? 1207 GLU D CB    1 
ATOM   8416  C  CG    . GLU D  1 234 ? 64.937  56.971  48.388  1.00 42.27 ? 1207 GLU D CG    1 
ATOM   8417  C  CD    . GLU D  1 234 ? 65.044  58.476  48.530  1.00 46.82 ? 1207 GLU D CD    1 
ATOM   8418  O  OE1   . GLU D  1 234 ? 65.010  58.986  49.669  1.00 49.84 ? 1207 GLU D OE1   1 
ATOM   8419  O  OE2   . GLU D  1 234 ? 65.157  59.160  47.496  1.00 54.92 ? 1207 GLU D OE2   1 
ATOM   8420  N  N     . GLU D  1 235 ? 64.262  53.774  51.904  1.00 37.51 ? 1208 GLU D N     1 
ATOM   8421  C  CA    . GLU D  1 235 ? 64.710  52.833  52.938  1.00 41.10 ? 1208 GLU D CA    1 
ATOM   8422  C  C     . GLU D  1 235 ? 64.760  51.401  52.410  1.00 39.64 ? 1208 GLU D C     1 
ATOM   8423  O  O     . GLU D  1 235 ? 65.261  50.496  53.079  1.00 42.73 ? 1208 GLU D O     1 
ATOM   8424  C  CB    . GLU D  1 235 ? 63.801  52.907  54.170  1.00 43.00 ? 1208 GLU D CB    1 
ATOM   8425  N  N     . THR D  1 236 ? 64.257  51.222  51.192  1.00 42.20 ? 1209 THR D N     1 
ATOM   8426  C  CA    . THR D  1 236 ? 64.131  49.917  50.550  1.00 43.68 ? 1209 THR D CA    1 
ATOM   8427  C  C     . THR D  1 236 ? 65.473  49.318  50.092  1.00 44.16 ? 1209 THR D C     1 
ATOM   8428  O  O     . THR D  1 236 ? 65.625  48.097  50.044  1.00 47.10 ? 1209 THR D O     1 
ATOM   8429  C  CB    . THR D  1 236 ? 63.083  49.978  49.390  1.00 43.78 ? 1209 THR D CB    1 
ATOM   8430  O  OG1   . THR D  1 236 ? 62.421  48.720  49.257  1.00 53.47 ? 1209 THR D OG1   1 
ATOM   8431  C  CG2   . THR D  1 236 ? 63.706  50.385  48.052  1.00 31.00 ? 1209 THR D CG2   1 
ATOM   8432  N  N     . VAL D  1 237 ? 66.447  50.174  49.789  1.00 46.64 ? 1210 VAL D N     1 
ATOM   8433  C  CA    . VAL D  1 237 ? 67.722  49.718  49.214  1.00 50.81 ? 1210 VAL D CA    1 
ATOM   8434  C  C     . VAL D  1 237 ? 68.728  49.200  50.252  1.00 49.53 ? 1210 VAL D C     1 
ATOM   8435  O  O     . VAL D  1 237 ? 69.575  48.363  49.932  1.00 49.18 ? 1210 VAL D O     1 
ATOM   8436  C  CB    . VAL D  1 237 ? 68.360  50.770  48.263  1.00 52.27 ? 1210 VAL D CB    1 
ATOM   8437  C  CG1   . VAL D  1 237 ? 67.334  51.253  47.248  1.00 53.35 ? 1210 VAL D CG1   1 
ATOM   8438  C  CG2   . VAL D  1 237 ? 68.945  51.944  49.038  1.00 58.30 ? 1210 VAL D CG2   1 
ATOM   8439  N  N     . GLU D  1 238 ? 68.635  49.700  51.483  1.00 49.22 ? 1211 GLU D N     1 
ATOM   8440  C  CA    . GLU D  1 238 ? 69.338  49.089  52.614  1.00 49.63 ? 1211 GLU D CA    1 
ATOM   8441  C  C     . GLU D  1 238 ? 68.513  47.911  53.136  1.00 47.96 ? 1211 GLU D C     1 
ATOM   8442  O  O     . GLU D  1 238 ? 69.053  46.843  53.450  1.00 48.75 ? 1211 GLU D O     1 
ATOM   8443  C  CB    . GLU D  1 238 ? 69.578  50.108  53.733  1.00 50.86 ? 1211 GLU D CB    1 
ATOM   8444  N  N     . ALA D  1 239 ? 67.199  48.126  53.202  1.00 44.50 ? 1212 ALA D N     1 
ATOM   8445  C  CA    . ALA D  1 239 ? 66.222  47.148  53.680  1.00 43.75 ? 1212 ALA D CA    1 
ATOM   8446  C  C     . ALA D  1 239 ? 66.421  46.744  55.146  1.00 43.12 ? 1212 ALA D C     1 
ATOM   8447  O  O     . ALA D  1 239 ? 66.371  45.555  55.495  1.00 39.98 ? 1212 ALA D O     1 
ATOM   8448  C  CB    . ALA D  1 239 ? 66.151  45.922  52.751  1.00 45.57 ? 1212 ALA D CB    1 
ATOM   8449  N  N     . ALA D  1 240 ? 66.642  47.753  55.993  1.00 41.58 ? 1213 ALA D N     1 
ATOM   8450  C  CA    . ALA D  1 240 ? 66.715  47.569  57.440  1.00 42.56 ? 1213 ALA D CA    1 
ATOM   8451  C  C     . ALA D  1 240 ? 65.307  47.420  57.996  1.00 42.59 ? 1213 ALA D C     1 
ATOM   8452  O  O     . ALA D  1 240 ? 64.523  48.372  57.983  1.00 41.38 ? 1213 ALA D O     1 
ATOM   8453  C  CB    . ALA D  1 240 ? 67.432  48.743  58.104  1.00 41.13 ? 1213 ALA D CB    1 
ATOM   8454  N  N     . ILE D  1 241 ? 64.987  46.218  58.468  1.00 44.80 ? 1214 ILE D N     1 
ATOM   8455  C  CA    . ILE D  1 241 ? 63.659  45.938  59.013  1.00 47.52 ? 1214 ILE D CA    1 
ATOM   8456  C  C     . ILE D  1 241 ? 63.641  46.041  60.532  1.00 44.69 ? 1214 ILE D C     1 
ATOM   8457  O  O     . ILE D  1 241 ? 64.461  45.438  61.221  1.00 44.42 ? 1214 ILE D O     1 
ATOM   8458  C  CB    . ILE D  1 241 ? 63.075  44.576  58.528  1.00 49.06 ? 1214 ILE D CB    1 
ATOM   8459  C  CG1   . ILE D  1 241 ? 64.114  43.449  58.642  1.00 51.98 ? 1214 ILE D CG1   1 
ATOM   8460  C  CG2   . ILE D  1 241 ? 62.550  44.708  57.090  1.00 47.98 ? 1214 ILE D CG2   1 
ATOM   8461  C  CD1   . ILE D  1 241 ? 63.549  42.042  58.427  1.00 51.14 ? 1214 ILE D CD1   1 
ATOM   8462  N  N     . HIS D  1 242 ? 62.710  46.843  61.034  1.00 42.83 ? 1215 HIS D N     1 
ATOM   8463  C  CA    . HIS D  1 242 ? 62.510  47.015  62.458  1.00 39.41 ? 1215 HIS D CA    1 
ATOM   8464  C  C     . HIS D  1 242 ? 61.016  46.859  62.755  1.00 38.54 ? 1215 HIS D C     1 
ATOM   8465  O  O     . HIS D  1 242 ? 60.266  47.843  62.727  1.00 36.67 ? 1215 HIS D O     1 
ATOM   8466  C  CB    . HIS D  1 242 ? 63.033  48.381  62.920  1.00 40.71 ? 1215 HIS D CB    1 
ATOM   8467  C  CG    . HIS D  1 242 ? 64.465  48.638  62.558  1.00 44.68 ? 1215 HIS D CG    1 
ATOM   8468  N  ND1   . HIS D  1 242 ? 65.517  48.232  63.350  1.00 50.26 ? 1215 HIS D ND1   1 
ATOM   8469  C  CD2   . HIS D  1 242 ? 65.016  49.275  61.497  1.00 42.21 ? 1215 HIS D CD2   1 
ATOM   8470  C  CE1   . HIS D  1 242 ? 66.656  48.603  62.790  1.00 51.89 ? 1215 HIS D CE1   1 
ATOM   8471  N  NE2   . HIS D  1 242 ? 66.380  49.239  61.665  1.00 41.99 ? 1215 HIS D NE2   1 
ATOM   8472  N  N     . PRO D  1 243 ? 60.571  45.611  63.008  1.00 36.93 ? 1216 PRO D N     1 
ATOM   8473  C  CA    . PRO D  1 243 ? 59.152  45.344  63.214  1.00 34.55 ? 1216 PRO D CA    1 
ATOM   8474  C  C     . PRO D  1 243 ? 58.606  45.968  64.498  1.00 33.10 ? 1216 PRO D C     1 
ATOM   8475  O  O     . PRO D  1 243 ? 59.371  46.209  65.435  1.00 33.63 ? 1216 PRO D O     1 
ATOM   8476  C  CB    . PRO D  1 243 ? 59.087  43.809  63.276  1.00 32.95 ? 1216 PRO D CB    1 
ATOM   8477  C  CG    . PRO D  1 243 ? 60.353  43.337  62.687  1.00 32.72 ? 1216 PRO D CG    1 
ATOM   8478  C  CD    . PRO D  1 243 ? 61.359  44.368  63.074  1.00 36.24 ? 1216 PRO D CD    1 
ATOM   8479  N  N     . PRO D  1 244 ? 57.289  46.251  64.531  1.00 30.54 ? 1217 PRO D N     1 
ATOM   8480  C  CA    . PRO D  1 244 ? 56.642  46.822  65.706  1.00 28.43 ? 1217 PRO D CA    1 
ATOM   8481  C  C     . PRO D  1 244 ? 56.532  45.863  66.889  1.00 28.70 ? 1217 PRO D C     1 
ATOM   8482  O  O     . PRO D  1 244 ? 56.236  46.305  68.000  1.00 30.78 ? 1217 PRO D O     1 
ATOM   8483  C  CB    . PRO D  1 244 ? 55.238  47.181  65.191  1.00 22.54 ? 1217 PRO D CB    1 
ATOM   8484  C  CG    . PRO D  1 244 ? 54.994  46.243  64.109  1.00 23.59 ? 1217 PRO D CG    1 
ATOM   8485  C  CD    . PRO D  1 244 ? 56.326  46.069  63.429  1.00 30.10 ? 1217 PRO D CD    1 
ATOM   8486  N  N     . TYR D  1 245 ? 56.728  44.567  66.651  1.00 28.03 ? 1218 TYR D N     1 
ATOM   8487  C  CA    . TYR D  1 245 ? 56.714  43.592  67.746  1.00 28.96 ? 1218 TYR D CA    1 
ATOM   8488  C  C     . TYR D  1 245 ? 57.568  42.344  67.487  1.00 29.35 ? 1218 TYR D C     1 
ATOM   8489  O  O     . TYR D  1 245 ? 57.918  42.031  66.339  1.00 24.97 ? 1218 TYR D O     1 
ATOM   8490  C  CB    . TYR D  1 245 ? 55.281  43.242  68.188  1.00 23.79 ? 1218 TYR D CB    1 
ATOM   8491  C  CG    . TYR D  1 245 ? 54.482  42.385  67.233  1.00 17.89 ? 1218 TYR D CG    1 
ATOM   8492  C  CD1   . TYR D  1 245 ? 53.816  42.949  66.134  1.00 18.10 ? 1218 TYR D CD1   1 
ATOM   8493  C  CD2   . TYR D  1 245 ? 54.348  41.017  67.456  1.00 25.26 ? 1218 TYR D CD2   1 
ATOM   8494  C  CE1   . TYR D  1 245 ? 53.071  42.157  65.267  1.00 15.46 ? 1218 TYR D CE1   1 
ATOM   8495  C  CE2   . TYR D  1 245 ? 53.604  40.217  66.598  1.00 22.99 ? 1218 TYR D CE2   1 
ATOM   8496  C  CZ    . TYR D  1 245 ? 52.976  40.792  65.503  1.00 25.36 ? 1218 TYR D CZ    1 
ATOM   8497  O  OH    . TYR D  1 245 ? 52.245  39.991  64.662  1.00 26.43 ? 1218 TYR D OH    1 
ATOM   8498  N  N     . LEU D  1 246 ? 57.912  41.667  68.583  1.00 28.60 ? 1219 LEU D N     1 
ATOM   8499  C  CA    . LEU D  1 246 ? 58.789  40.499  68.581  1.00 26.35 ? 1219 LEU D CA    1 
ATOM   8500  C  C     . LEU D  1 246 ? 58.030  39.270  68.122  1.00 24.19 ? 1219 LEU D C     1 
ATOM   8501  O  O     . LEU D  1 246 ? 56.957  38.959  68.644  1.00 24.11 ? 1219 LEU D O     1 
ATOM   8502  C  CB    . LEU D  1 246 ? 59.367  40.267  69.987  1.00 27.27 ? 1219 LEU D CB    1 
ATOM   8503  C  CG    . LEU D  1 246 ? 60.675  40.903  70.487  1.00 30.35 ? 1219 LEU D CG    1 
ATOM   8504  C  CD1   . LEU D  1 246 ? 61.072  42.184  69.770  1.00 27.43 ? 1219 LEU D CD1   1 
ATOM   8505  C  CD2   . LEU D  1 246 ? 60.616  41.133  71.997  1.00 21.52 ? 1219 LEU D CD2   1 
ATOM   8506  N  N     . VAL D  1 247 ? 58.589  38.590  67.123  1.00 28.10 ? 1220 VAL D N     1 
ATOM   8507  C  CA    . VAL D  1 247 ? 58.038  37.340  66.597  1.00 28.30 ? 1220 VAL D CA    1 
ATOM   8508  C  C     . VAL D  1 247 ? 59.148  36.290  66.497  1.00 27.73 ? 1220 VAL D C     1 
ATOM   8509  O  O     . VAL D  1 247 ? 60.330  36.614  66.665  1.00 23.36 ? 1220 VAL D O     1 
ATOM   8510  C  CB    . VAL D  1 247 ? 57.369  37.521  65.193  1.00 30.97 ? 1220 VAL D CB    1 
ATOM   8511  C  CG1   . VAL D  1 247 ? 56.131  38.408  65.276  1.00 25.53 ? 1220 VAL D CG1   1 
ATOM   8512  C  CG2   . VAL D  1 247 ? 58.370  38.042  64.163  1.00 29.86 ? 1220 VAL D CG2   1 
ATOM   8513  N  N     . SER D  1 248 ? 58.756  35.047  66.202  1.00 30.50 ? 1221 SER D N     1 
ATOM   8514  C  CA    . SER D  1 248 ? 59.694  33.926  66.050  1.00 32.60 ? 1221 SER D CA    1 
ATOM   8515  C  C     . SER D  1 248 ? 60.819  34.235  65.064  1.00 35.15 ? 1221 SER D C     1 
ATOM   8516  O  O     . SER D  1 248 ? 60.610  34.936  64.069  1.00 35.63 ? 1221 SER D O     1 
ATOM   8517  C  CB    . SER D  1 248 ? 58.962  32.641  65.632  1.00 30.71 ? 1221 SER D CB    1 
ATOM   8518  O  OG    . SER D  1 248 ? 58.618  32.643  64.252  1.00 34.82 ? 1221 SER D OG    1 
ATOM   8519  N  N     . LYS D  1 249 ? 62.003  33.693  65.350  1.00 33.34 ? 1222 LYS D N     1 
ATOM   8520  C  CA    . LYS D  1 249 ? 63.193  33.922  64.533  1.00 34.28 ? 1222 LYS D CA    1 
ATOM   8521  C  C     . LYS D  1 249 ? 63.066  33.315  63.131  1.00 31.86 ? 1222 LYS D C     1 
ATOM   8522  O  O     . LYS D  1 249 ? 63.741  33.757  62.207  1.00 31.93 ? 1222 LYS D O     1 
ATOM   8523  C  CB    . LYS D  1 249 ? 64.442  33.385  65.242  1.00 36.87 ? 1222 LYS D CB    1 
ATOM   8524  N  N     . GLU D  1 250 ? 62.191  32.319  62.984  1.00 28.93 ? 1223 GLU D N     1 
ATOM   8525  C  CA    . GLU D  1 250 ? 61.959  31.647  61.700  1.00 30.39 ? 1223 GLU D CA    1 
ATOM   8526  C  C     . GLU D  1 250 ? 61.164  32.531  60.720  1.00 31.32 ? 1223 GLU D C     1 
ATOM   8527  O  O     . GLU D  1 250 ? 61.439  32.540  59.512  1.00 31.16 ? 1223 GLU D O     1 
ATOM   8528  C  CB    . GLU D  1 250 ? 61.260  30.294  61.903  1.00 26.54 ? 1223 GLU D CB    1 
ATOM   8529  C  CG    . GLU D  1 250 ? 62.141  29.191  62.497  1.00 39.52 ? 1223 GLU D CG    1 
ATOM   8530  C  CD    . GLU D  1 250 ? 62.262  29.245  64.023  1.00 47.70 ? 1223 GLU D CD    1 
ATOM   8531  O  OE1   . GLU D  1 250 ? 61.308  29.688  64.706  1.00 48.02 ? 1223 GLU D OE1   1 
ATOM   8532  O  OE2   . GLU D  1 250 ? 63.320  28.826  64.546  1.00 52.88 ? 1223 GLU D OE2   1 
ATOM   8533  N  N     . LEU D  1 251 ? 60.180  33.261  61.249  1.00 29.76 ? 1224 LEU D N     1 
ATOM   8534  C  CA    . LEU D  1 251 ? 59.465  34.274  60.481  1.00 29.16 ? 1224 LEU D CA    1 
ATOM   8535  C  C     . LEU D  1 251 ? 60.410  35.399  60.079  1.00 29.67 ? 1224 LEU D C     1 
ATOM   8536  O  O     . LEU D  1 251 ? 60.440  35.787  58.914  1.00 28.78 ? 1224 LEU D O     1 
ATOM   8537  C  CB    . LEU D  1 251 ? 58.251  34.825  61.247  1.00 24.71 ? 1224 LEU D CB    1 
ATOM   8538  C  CG    . LEU D  1 251 ? 57.402  35.878  60.519  1.00 27.79 ? 1224 LEU D CG    1 
ATOM   8539  C  CD1   . LEU D  1 251 ? 57.006  35.448  59.096  1.00 11.89 ? 1224 LEU D CD1   1 
ATOM   8540  C  CD2   . LEU D  1 251 ? 56.172  36.239  61.333  1.00 25.38 ? 1224 LEU D CD2   1 
ATOM   8541  N  N     . MET D  1 252 ? 61.187  35.899  61.039  1.00 29.84 ? 1225 MET D N     1 
ATOM   8542  C  CA    . MET D  1 252 ? 62.179  36.951  60.770  1.00 30.14 ? 1225 MET D CA    1 
ATOM   8543  C  C     . MET D  1 252 ? 63.199  36.601  59.690  1.00 29.05 ? 1225 MET D C     1 
ATOM   8544  O  O     . MET D  1 252 ? 63.603  37.472  58.931  1.00 31.10 ? 1225 MET D O     1 
ATOM   8545  C  CB    . MET D  1 252 ? 62.893  37.406  62.052  1.00 27.14 ? 1225 MET D CB    1 
ATOM   8546  C  CG    . MET D  1 252 ? 62.010  38.233  62.988  1.00 31.31 ? 1225 MET D CG    1 
ATOM   8547  S  SD    . MET D  1 252 ? 61.160  39.624  62.190  1.00 38.59 ? 1225 MET D SD    1 
ATOM   8548  C  CE    . MET D  1 252 ? 62.540  40.732  61.896  1.00 42.63 ? 1225 MET D CE    1 
ATOM   8549  N  N     . SER D  1 253 ? 63.611  35.338  59.619  1.00 31.49 ? 1226 SER D N     1 
ATOM   8550  C  CA    . SER D  1 253 ? 64.544  34.906  58.575  1.00 34.73 ? 1226 SER D CA    1 
ATOM   8551  C  C     . SER D  1 253 ? 63.852  34.743  57.218  1.00 29.95 ? 1226 SER D C     1 
ATOM   8552  O  O     . SER D  1 253 ? 64.486  34.898  56.186  1.00 32.33 ? 1226 SER D O     1 
ATOM   8553  C  CB    . SER D  1 253 ? 65.296  33.631  58.982  1.00 37.94 ? 1226 SER D CB    1 
ATOM   8554  O  OG    . SER D  1 253 ? 64.406  32.585  59.313  1.00 39.53 ? 1226 SER D OG    1 
ATOM   8555  N  N     . LEU D  1 254 ? 62.553  34.446  57.245  1.00 32.11 ? 1227 LEU D N     1 
ATOM   8556  C  CA    . LEU D  1 254 ? 61.706  34.352  56.049  1.00 30.39 ? 1227 LEU D CA    1 
ATOM   8557  C  C     . LEU D  1 254 ? 61.470  35.706  55.384  1.00 30.72 ? 1227 LEU D C     1 
ATOM   8558  O  O     . LEU D  1 254 ? 61.632  35.832  54.163  1.00 31.67 ? 1227 LEU D O     1 
ATOM   8559  C  CB    . LEU D  1 254 ? 60.359  33.700  56.398  1.00 32.17 ? 1227 LEU D CB    1 
ATOM   8560  C  CG    . LEU D  1 254 ? 59.239  33.635  55.345  1.00 32.13 ? 1227 LEU D CG    1 
ATOM   8561  C  CD1   . LEU D  1 254 ? 59.691  32.954  54.057  1.00 34.83 ? 1227 LEU D CD1   1 
ATOM   8562  C  CD2   . LEU D  1 254 ? 58.037  32.928  55.910  1.00 28.37 ? 1227 LEU D CD2   1 
ATOM   8563  N  N     . VAL D  1 255 ? 61.075  36.705  56.181  1.00 32.11 ? 1228 VAL D N     1 
ATOM   8564  C  CA    . VAL D  1 255 ? 60.902  38.082  55.691  1.00 33.50 ? 1228 VAL D CA    1 
ATOM   8565  C  C     . VAL D  1 255 ? 62.220  38.728  55.268  1.00 29.92 ? 1228 VAL D C     1 
ATOM   8566  O  O     . VAL D  1 255 ? 62.228  39.565  54.370  1.00 32.28 ? 1228 VAL D O     1 
ATOM   8567  C  CB    . VAL D  1 255 ? 60.140  39.026  56.700  1.00 37.19 ? 1228 VAL D CB    1 
ATOM   8568  C  CG1   . VAL D  1 255 ? 58.668  38.694  56.755  1.00 33.92 ? 1228 VAL D CG1   1 
ATOM   8569  C  CG2   . VAL D  1 255 ? 60.747  38.992  58.092  1.00 44.83 ? 1228 VAL D CG2   1 
ATOM   8570  N  N     . SER D  1 256 ? 63.322  38.332  55.909  1.00 32.08 ? 1229 SER D N     1 
ATOM   8571  C  CA    . SER D  1 256 ? 64.665  38.839  55.586  1.00 31.83 ? 1229 SER D CA    1 
ATOM   8572  C  C     . SER D  1 256 ? 65.150  38.405  54.214  1.00 27.42 ? 1229 SER D C     1 
ATOM   8573  O  O     . SER D  1 256 ? 65.737  39.197  53.486  1.00 31.86 ? 1229 SER D O     1 
ATOM   8574  C  CB    . SER D  1 256 ? 65.695  38.398  56.637  1.00 32.11 ? 1229 SER D CB    1 
ATOM   8575  O  OG    . SER D  1 256 ? 65.503  39.089  57.858  1.00 44.33 ? 1229 SER D OG    1 
ATOM   8576  N  N     . GLY D  1 257 ? 64.931  37.136  53.882  1.00 29.15 ? 1230 GLY D N     1 
ATOM   8577  C  CA    . GLY D  1 257 ? 65.313  36.596  52.588  1.00 27.22 ? 1230 GLY D CA    1 
ATOM   8578  C  C     . GLY D  1 257 ? 64.438  37.152  51.485  1.00 27.66 ? 1230 GLY D C     1 
ATOM   8579  O  O     . GLY D  1 257 ? 64.905  37.399  50.372  1.00 35.02 ? 1230 GLY D O     1 
ATOM   8580  N  N     . LEU D  1 258 ? 63.168  37.376  51.804  1.00 26.99 ? 1231 LEU D N     1 
ATOM   8581  C  CA    . LEU D  1 258 ? 62.214  37.917  50.840  1.00 29.61 ? 1231 LEU D CA    1 
ATOM   8582  C  C     . LEU D  1 258 ? 62.407  39.409  50.598  1.00 32.50 ? 1231 LEU D C     1 
ATOM   8583  O  O     . LEU D  1 258 ? 62.130  39.905  49.506  1.00 33.74 ? 1231 LEU D O     1 
ATOM   8584  C  CB    . LEU D  1 258 ? 60.785  37.622  51.280  1.00 28.92 ? 1231 LEU D CB    1 
ATOM   8585  C  CG    . LEU D  1 258 ? 60.313  36.175  51.156  1.00 26.21 ? 1231 LEU D CG    1 
ATOM   8586  C  CD1   . LEU D  1 258 ? 58.930  36.005  51.788  1.00 25.90 ? 1231 LEU D CD1   1 
ATOM   8587  C  CD2   . LEU D  1 258 ? 60.304  35.746  49.695  1.00 23.48 ? 1231 LEU D CD2   1 
ATOM   8588  N  N     . LEU D  1 259 ? 62.889  40.112  51.621  1.00 34.95 ? 1232 LEU D N     1 
ATOM   8589  C  CA    . LEU D  1 259 ? 63.210  41.535  51.522  1.00 32.91 ? 1232 LEU D CA    1 
ATOM   8590  C  C     . LEU D  1 259 ? 64.723  41.776  51.462  1.00 34.82 ? 1232 LEU D C     1 
ATOM   8591  O  O     . LEU D  1 259 ? 65.243  42.734  52.034  1.00 37.65 ? 1232 LEU D O     1 
ATOM   8592  C  CB    . LEU D  1 259 ? 62.563  42.322  52.669  1.00 30.91 ? 1232 LEU D CB    1 
ATOM   8593  C  CG    . LEU D  1 259 ? 61.033  42.257  52.760  1.00 34.47 ? 1232 LEU D CG    1 
ATOM   8594  C  CD1   . LEU D  1 259 ? 60.522  42.840  54.072  1.00 37.17 ? 1232 LEU D CD1   1 
ATOM   8595  C  CD2   . LEU D  1 259 ? 60.375  42.933  51.567  1.00 24.63 ? 1232 LEU D CD2   1 
ATOM   8596  N  N     . GLN D  1 260 ? 65.419  40.888  50.762  1.00 36.09 ? 1233 GLN D N     1 
ATOM   8597  C  CA    . GLN D  1 260 ? 66.820  41.079  50.435  1.00 37.26 ? 1233 GLN D CA    1 
ATOM   8598  C  C     . GLN D  1 260 ? 66.889  42.046  49.256  1.00 35.43 ? 1233 GLN D C     1 
ATOM   8599  O  O     . GLN D  1 260 ? 66.326  41.761  48.205  1.00 35.29 ? 1233 GLN D O     1 
ATOM   8600  C  CB    . GLN D  1 260 ? 67.467  39.726  50.097  1.00 38.35 ? 1233 GLN D CB    1 
ATOM   8601  C  CG    . GLN D  1 260 ? 68.829  39.801  49.409  1.00 41.59 ? 1233 GLN D CG    1 
ATOM   8602  C  CD    . GLN D  1 260 ? 69.970  40.195  50.341  1.00 43.14 ? 1233 GLN D CD    1 
ATOM   8603  O  OE1   . GLN D  1 260 ? 70.718  41.130  50.054  1.00 39.98 ? 1233 GLN D OE1   1 
ATOM   8604  N  NE2   . GLN D  1 260 ? 70.110  39.480  51.456  1.00 39.69 ? 1233 GLN D NE2   1 
ATOM   8605  N  N     . PRO D  1 261 ? 67.561  43.201  49.437  1.00 36.65 ? 1234 PRO D N     1 
ATOM   8606  C  CA    . PRO D  1 261 ? 67.607  44.265  48.421  1.00 37.05 ? 1234 PRO D CA    1 
ATOM   8607  C  C     . PRO D  1 261 ? 68.351  43.913  47.117  1.00 39.26 ? 1234 PRO D C     1 
ATOM   8608  O  O     . PRO D  1 261 ? 68.092  44.535  46.084  1.00 37.04 ? 1234 PRO D O     1 
ATOM   8609  C  CB    . PRO D  1 261 ? 68.301  45.422  49.151  1.00 36.84 ? 1234 PRO D CB    1 
ATOM   8610  C  CG    . PRO D  1 261 ? 69.109  44.772  50.219  1.00 35.47 ? 1234 PRO D CG    1 
ATOM   8611  C  CD    . PRO D  1 261 ? 68.317  43.569  50.651  1.00 36.82 ? 1234 PRO D CD    1 
ATOM   8612  N  N     . VAL D  1 262 ? 69.259  42.937  47.166  1.00 39.43 ? 1235 VAL D N     1 
ATOM   8613  C  CA    . VAL D  1 262 ? 69.956  42.471  45.968  1.00 36.93 ? 1235 VAL D CA    1 
ATOM   8614  C  C     . VAL D  1 262 ? 69.170  41.290  45.405  1.00 37.05 ? 1235 VAL D C     1 
ATOM   8615  O  O     . VAL D  1 262 ? 69.041  40.267  46.076  1.00 40.01 ? 1235 VAL D O     1 
ATOM   8616  C  CB    . VAL D  1 262 ? 71.437  42.057  46.250  1.00 41.33 ? 1235 VAL D CB    1 
ATOM   8617  C  CG1   . VAL D  1 262 ? 72.258  42.081  44.962  1.00 37.10 ? 1235 VAL D CG1   1 
ATOM   8618  C  CG2   . VAL D  1 262 ? 72.085  42.978  47.282  1.00 39.01 ? 1235 VAL D CG2   1 
ATOM   8619  N  N     . PRO D  1 263 ? 68.634  41.429  44.172  1.00 36.95 ? 1236 PRO D N     1 
ATOM   8620  C  CA    . PRO D  1 263 ? 67.689  40.445  43.617  1.00 37.00 ? 1236 PRO D CA    1 
ATOM   8621  C  C     . PRO D  1 263 ? 68.215  39.006  43.459  1.00 39.20 ? 1236 PRO D C     1 
ATOM   8622  O  O     . PRO D  1 263 ? 67.423  38.059  43.509  1.00 35.67 ? 1236 PRO D O     1 
ATOM   8623  C  CB    . PRO D  1 263 ? 67.306  41.046  42.257  1.00 35.01 ? 1236 PRO D CB    1 
ATOM   8624  C  CG    . PRO D  1 263 ? 68.408  41.991  41.927  1.00 40.70 ? 1236 PRO D CG    1 
ATOM   8625  C  CD    . PRO D  1 263 ? 68.876  42.542  43.235  1.00 32.44 ? 1236 PRO D CD    1 
ATOM   8626  N  N     . GLU D  1 264 ? 69.525  38.844  43.278  1.00 43.12 ? 1237 GLU D N     1 
ATOM   8627  C  CA    . GLU D  1 264 ? 70.126  37.508  43.122  1.00 45.73 ? 1237 GLU D CA    1 
ATOM   8628  C  C     . GLU D  1 264 ? 70.252  36.752  44.450  1.00 44.87 ? 1237 GLU D C     1 
ATOM   8629  O  O     . GLU D  1 264 ? 70.315  35.519  44.468  1.00 45.15 ? 1237 GLU D O     1 
ATOM   8630  C  CB    . GLU D  1 264 ? 71.479  37.565  42.386  1.00 48.03 ? 1237 GLU D CB    1 
ATOM   8631  C  CG    . GLU D  1 264 ? 72.485  38.600  42.910  1.00 53.63 ? 1237 GLU D CG    1 
ATOM   8632  C  CD    . GLU D  1 264 ? 72.540  39.872  42.069  1.00 60.48 ? 1237 GLU D CD    1 
ATOM   8633  O  OE1   . GLU D  1 264 ? 73.640  40.454  41.954  1.00 63.78 ? 1237 GLU D OE1   1 
ATOM   8634  O  OE2   . GLU D  1 264 ? 71.498  40.293  41.520  1.00 60.96 ? 1237 GLU D OE2   1 
ATOM   8635  N  N     . ARG D  1 265 ? 70.265  37.496  45.553  1.00 42.28 ? 1238 ARG D N     1 
ATOM   8636  C  CA    . ARG D  1 265 ? 70.395  36.918  46.888  1.00 40.11 ? 1238 ARG D CA    1 
ATOM   8637  C  C     . ARG D  1 265 ? 69.044  36.725  47.590  1.00 41.31 ? 1238 ARG D C     1 
ATOM   8638  O  O     . ARG D  1 265 ? 68.981  36.126  48.671  1.00 44.07 ? 1238 ARG D O     1 
ATOM   8639  C  CB    . ARG D  1 265 ? 71.325  37.791  47.728  1.00 44.33 ? 1238 ARG D CB    1 
ATOM   8640  C  CG    . ARG D  1 265 ? 72.708  37.987  47.102  1.00 46.12 ? 1238 ARG D CG    1 
ATOM   8641  C  CD    . ARG D  1 265 ? 73.427  39.190  47.680  1.00 53.07 ? 1238 ARG D CD    1 
ATOM   8642  N  NE    . ARG D  1 265 ? 73.591  39.090  49.128  1.00 54.64 ? 1238 ARG D NE    1 
ATOM   8643  C  CZ    . ARG D  1 265 ? 74.442  39.822  49.841  1.00 61.65 ? 1238 ARG D CZ    1 
ATOM   8644  N  NH1   . ARG D  1 265 ? 75.231  40.713  49.246  1.00 62.67 ? 1238 ARG D NH1   1 
ATOM   8645  N  NH2   . ARG D  1 265 ? 74.514  39.653  51.154  1.00 62.66 ? 1238 ARG D NH2   1 
ATOM   8646  N  N     . ARG D  1 266 ? 67.977  37.219  46.955  1.00 37.29 ? 1239 ARG D N     1 
ATOM   8647  C  CA    . ARG D  1 266 ? 66.601  37.176  47.469  1.00 32.70 ? 1239 ARG D CA    1 
ATOM   8648  C  C     . ARG D  1 266 ? 66.022  35.757  47.440  1.00 32.47 ? 1239 ARG D C     1 
ATOM   8649  O  O     . ARG D  1 266 ? 66.418  34.952  46.605  1.00 33.65 ? 1239 ARG D O     1 
ATOM   8650  C  CB    . ARG D  1 266 ? 65.733  38.126  46.637  1.00 27.90 ? 1239 ARG D CB    1 
ATOM   8651  C  CG    . ARG D  1 266 ? 64.338  38.414  47.170  1.00 30.70 ? 1239 ARG D CG    1 
ATOM   8652  C  CD    . ARG D  1 266 ? 63.662  39.503  46.340  1.00 29.47 ? 1239 ARG D CD    1 
ATOM   8653  N  NE    . ARG D  1 266 ? 64.383  40.769  46.456  1.00 27.42 ? 1239 ARG D NE    1 
ATOM   8654  C  CZ    . ARG D  1 266 ? 64.526  41.658  45.476  1.00 25.69 ? 1239 ARG D CZ    1 
ATOM   8655  N  NH1   . ARG D  1 266 ? 63.995  41.437  44.278  1.00 25.54 ? 1239 ARG D NH1   1 
ATOM   8656  N  NH2   . ARG D  1 266 ? 65.214  42.768  45.695  1.00 25.65 ? 1239 ARG D NH2   1 
ATOM   8657  N  N     . THR D  1 267 ? 65.090  35.464  48.353  1.00 32.80 ? 1240 THR D N     1 
ATOM   8658  C  CA    . THR D  1 267 ? 64.440  34.150  48.443  1.00 33.98 ? 1240 THR D CA    1 
ATOM   8659  C  C     . THR D  1 267 ? 63.654  33.810  47.166  1.00 37.48 ? 1240 THR D C     1 
ATOM   8660  O  O     . THR D  1 267 ? 62.815  34.585  46.696  1.00 37.39 ? 1240 THR D O     1 
ATOM   8661  C  CB    . THR D  1 267 ? 63.516  34.024  49.693  1.00 31.45 ? 1240 THR D CB    1 
ATOM   8662  O  OG1   . THR D  1 267 ? 64.298  34.042  50.889  1.00 36.33 ? 1240 THR D OG1   1 
ATOM   8663  C  CG2   . THR D  1 267 ? 62.710  32.717  49.673  1.00 33.98 ? 1240 THR D CG2   1 
ATOM   8664  N  N     . THR D  1 268 ? 63.952  32.635  46.628  1.00 36.58 ? 1241 THR D N     1 
ATOM   8665  C  CA    . THR D  1 268 ? 63.366  32.127  45.396  1.00 37.42 ? 1241 THR D CA    1 
ATOM   8666  C  C     . THR D  1 268 ? 62.021  31.446  45.697  1.00 38.07 ? 1241 THR D C     1 
ATOM   8667  O  O     . THR D  1 268 ? 61.778  31.043  46.830  1.00 37.21 ? 1241 THR D O     1 
ATOM   8668  C  CB    . THR D  1 268 ? 64.403  31.185  44.716  1.00 36.47 ? 1241 THR D CB    1 
ATOM   8669  O  OG1   . THR D  1 268 ? 65.027  31.866  43.616  1.00 35.83 ? 1241 THR D OG1   1 
ATOM   8670  C  CG2   . THR D  1 268 ? 63.795  29.905  44.237  1.00 28.55 ? 1241 THR D CG2   1 
ATOM   8671  N  N     . LEU D  1 269 ? 61.138  31.351  44.701  1.00 38.26 ? 1242 LEU D N     1 
ATOM   8672  C  CA    . LEU D  1 269 ? 59.834  30.703  44.899  1.00 37.64 ? 1242 LEU D CA    1 
ATOM   8673  C  C     . LEU D  1 269 ? 59.933  29.212  45.252  1.00 41.99 ? 1242 LEU D C     1 
ATOM   8674  O  O     . LEU D  1 269 ? 59.106  28.691  46.008  1.00 45.06 ? 1242 LEU D O     1 
ATOM   8675  C  CB    . LEU D  1 269 ? 58.899  30.923  43.701  1.00 34.36 ? 1242 LEU D CB    1 
ATOM   8676  C  CG    . LEU D  1 269 ? 57.448  30.446  43.906  1.00 39.29 ? 1242 LEU D CG    1 
ATOM   8677  C  CD1   . LEU D  1 269 ? 56.692  31.282  44.963  1.00 27.59 ? 1242 LEU D CD1   1 
ATOM   8678  C  CD2   . LEU D  1 269 ? 56.693  30.415  42.596  1.00 33.37 ? 1242 LEU D CD2   1 
ATOM   8679  N  N     . GLU D  1 270 ? 60.941  28.540  44.700  1.00 43.99 ? 1243 GLU D N     1 
ATOM   8680  C  CA    . GLU D  1 270 ? 61.237  27.144  45.018  1.00 46.41 ? 1243 GLU D CA    1 
ATOM   8681  C  C     . GLU D  1 270 ? 61.570  27.005  46.510  1.00 45.16 ? 1243 GLU D C     1 
ATOM   8682  O  O     . GLU D  1 270 ? 61.099  26.085  47.182  1.00 43.98 ? 1243 GLU D O     1 
ATOM   8683  C  CB    . GLU D  1 270 ? 62.402  26.638  44.149  1.00 47.62 ? 1243 GLU D CB    1 
ATOM   8684  C  CG    . GLU D  1 270 ? 62.052  26.329  42.676  1.00 56.51 ? 1243 GLU D CG    1 
ATOM   8685  C  CD    . GLU D  1 270 ? 61.687  27.562  41.835  1.00 63.70 ? 1243 GLU D CD    1 
ATOM   8686  O  OE1   . GLU D  1 270 ? 62.266  28.649  42.048  1.00 62.52 ? 1243 GLU D OE1   1 
ATOM   8687  O  OE2   . GLU D  1 270 ? 60.815  27.437  40.946  1.00 61.64 ? 1243 GLU D OE2   1 
ATOM   8688  N  N     . LYS D  1 271 ? 62.369  27.950  47.002  1.00 45.35 ? 1244 LYS D N     1 
ATOM   8689  C  CA    . LYS D  1 271 ? 62.807  28.044  48.396  1.00 44.67 ? 1244 LYS D CA    1 
ATOM   8690  C  C     . LYS D  1 271 ? 61.670  28.363  49.381  1.00 43.50 ? 1244 LYS D C     1 
ATOM   8691  O  O     . LYS D  1 271 ? 61.646  27.834  50.495  1.00 41.69 ? 1244 LYS D O     1 
ATOM   8692  C  CB    . LYS D  1 271 ? 63.879  29.132  48.476  1.00 45.12 ? 1244 LYS D CB    1 
ATOM   8693  C  CG    . LYS D  1 271 ? 64.685  29.231  49.765  1.00 51.55 ? 1244 LYS D CG    1 
ATOM   8694  C  CD    . LYS D  1 271 ? 65.682  30.396  49.658  1.00 47.68 ? 1244 LYS D CD    1 
ATOM   8695  C  CE    . LYS D  1 271 ? 66.575  30.261  48.407  1.00 52.84 ? 1244 LYS D CE    1 
ATOM   8696  N  NZ    . LYS D  1 271 ? 66.917  31.568  47.764  1.00 45.41 ? 1244 LYS D NZ    1 
ATOM   8697  N  N     . LEU D  1 272 ? 60.749  29.232  48.959  1.00 42.32 ? 1245 LEU D N     1 
ATOM   8698  C  CA    . LEU D  1 272 ? 59.645  29.728  49.796  1.00 42.44 ? 1245 LEU D CA    1 
ATOM   8699  C  C     . LEU D  1 272 ? 58.602  28.657  50.150  1.00 42.16 ? 1245 LEU D C     1 
ATOM   8700  O  O     . LEU D  1 272 ? 58.192  28.556  51.304  1.00 40.16 ? 1245 LEU D O     1 
ATOM   8701  C  CB    . LEU D  1 272 ? 58.943  30.906  49.103  1.00 39.73 ? 1245 LEU D CB    1 
ATOM   8702  C  CG    . LEU D  1 272 ? 58.391  32.123  49.864  1.00 43.00 ? 1245 LEU D CG    1 
ATOM   8703  C  CD1   . LEU D  1 272 ? 57.395  32.872  48.981  1.00 34.77 ? 1245 LEU D CD1   1 
ATOM   8704  C  CD2   . LEU D  1 272 ? 57.745  31.788  51.196  1.00 31.35 ? 1245 LEU D CD2   1 
ATOM   8705  N  N     . VAL D  1 273 ? 58.164  27.880  49.158  1.00 43.14 ? 1246 VAL D N     1 
ATOM   8706  C  CA    . VAL D  1 273 ? 57.162  26.818  49.370  1.00 45.39 ? 1246 VAL D CA    1 
ATOM   8707  C  C     . VAL D  1 273 ? 57.610  25.781  50.418  1.00 44.66 ? 1246 VAL D C     1 
ATOM   8708  O  O     . VAL D  1 273 ? 56.786  25.230  51.156  1.00 43.85 ? 1246 VAL D O     1 
ATOM   8709  C  CB    . VAL D  1 273 ? 56.781  26.102  48.043  1.00 45.77 ? 1246 VAL D CB    1 
ATOM   8710  C  CG1   . VAL D  1 273 ? 55.590  25.174  48.248  1.00 50.68 ? 1246 VAL D CG1   1 
ATOM   8711  C  CG2   . VAL D  1 273 ? 56.460  27.113  46.956  1.00 43.50 ? 1246 VAL D CG2   1 
ATOM   8712  N  N     . THR D  1 274 ? 58.918  25.545  50.492  1.00 45.17 ? 1247 THR D N     1 
ATOM   8713  C  CA    . THR D  1 274 ? 59.484  24.568  51.422  1.00 46.46 ? 1247 THR D CA    1 
ATOM   8714  C  C     . THR D  1 274 ? 59.911  25.153  52.787  1.00 47.40 ? 1247 THR D C     1 
ATOM   8715  O  O     . THR D  1 274 ? 60.323  24.411  53.688  1.00 49.87 ? 1247 THR D O     1 
ATOM   8716  C  CB    . THR D  1 274 ? 60.643  23.764  50.762  1.00 45.78 ? 1247 THR D CB    1 
ATOM   8717  O  OG1   . THR D  1 274 ? 60.904  22.584  51.524  1.00 50.86 ? 1247 THR D OG1   1 
ATOM   8718  C  CG2   . THR D  1 274 ? 61.922  24.590  50.661  1.00 48.59 ? 1247 THR D CG2   1 
ATOM   8719  N  N     . ASP D  1 275 ? 59.798  26.474  52.934  1.00 45.43 ? 1248 ASP D N     1 
ATOM   8720  C  CA    . ASP D  1 275 ? 60.167  27.176  54.173  1.00 44.75 ? 1248 ASP D CA    1 
ATOM   8721  C  C     . ASP D  1 275 ? 59.442  26.570  55.387  1.00 42.40 ? 1248 ASP D C     1 
ATOM   8722  O  O     . ASP D  1 275 ? 58.249  26.278  55.304  1.00 39.04 ? 1248 ASP D O     1 
ATOM   8723  C  CB    . ASP D  1 275 ? 59.861  28.676  54.037  1.00 45.26 ? 1248 ASP D CB    1 
ATOM   8724  C  CG    . ASP D  1 275 ? 60.580  29.524  55.069  1.00 48.47 ? 1248 ASP D CG    1 
ATOM   8725  O  OD1   . ASP D  1 275 ? 60.081  29.613  56.211  1.00 58.83 ? 1248 ASP D OD1   1 
ATOM   8726  O  OD2   . ASP D  1 275 ? 61.631  30.119  54.735  1.00 46.21 ? 1248 ASP D OD2   1 
ATOM   8727  N  N     . PRO D  1 276 ? 60.169  26.352  56.505  1.00 42.90 ? 1249 PRO D N     1 
ATOM   8728  C  CA    . PRO D  1 276 ? 59.579  25.743  57.711  1.00 43.23 ? 1249 PRO D CA    1 
ATOM   8729  C  C     . PRO D  1 276 ? 58.433  26.544  58.348  1.00 41.39 ? 1249 PRO D C     1 
ATOM   8730  O  O     . PRO D  1 276 ? 57.530  25.947  58.938  1.00 41.05 ? 1249 PRO D O     1 
ATOM   8731  C  CB    . PRO D  1 276 ? 60.769  25.634  58.675  1.00 42.22 ? 1249 PRO D CB    1 
ATOM   8732  C  CG    . PRO D  1 276 ? 61.977  25.706  57.805  1.00 46.41 ? 1249 PRO D CG    1 
ATOM   8733  C  CD    . PRO D  1 276 ? 61.605  26.631  56.692  1.00 40.13 ? 1249 PRO D CD    1 
ATOM   8734  N  N     . TRP D  1 277 ? 58.464  27.870  58.221  1.00 38.00 ? 1250 TRP D N     1 
ATOM   8735  C  CA    . TRP D  1 277 ? 57.380  28.721  58.730  1.00 37.79 ? 1250 TRP D CA    1 
ATOM   8736  C  C     . TRP D  1 277 ? 56.129  28.653  57.843  1.00 36.76 ? 1250 TRP D C     1 
ATOM   8737  O  O     . TRP D  1 277 ? 55.009  28.884  58.306  1.00 34.40 ? 1250 TRP D O     1 
ATOM   8738  C  CB    . TRP D  1 277 ? 57.852  30.171  58.889  1.00 31.26 ? 1250 TRP D CB    1 
ATOM   8739  C  CG    . TRP D  1 277 ? 56.909  31.026  59.685  1.00 36.70 ? 1250 TRP D CG    1 
ATOM   8740  C  CD1   . TRP D  1 277 ? 56.890  31.177  61.043  1.00 35.51 ? 1250 TRP D CD1   1 
ATOM   8741  C  CD2   . TRP D  1 277 ? 55.847  31.853  59.176  1.00 34.99 ? 1250 TRP D CD2   1 
ATOM   8742  N  NE1   . TRP D  1 277 ? 55.884  32.040  61.411  1.00 30.94 ? 1250 TRP D NE1   1 
ATOM   8743  C  CE2   . TRP D  1 277 ? 55.232  32.474  60.286  1.00 32.88 ? 1250 TRP D CE2   1 
ATOM   8744  C  CE3   . TRP D  1 277 ? 55.360  32.131  57.892  1.00 32.00 ? 1250 TRP D CE3   1 
ATOM   8745  C  CZ2   . TRP D  1 277 ? 54.146  33.355  60.152  1.00 32.98 ? 1250 TRP D CZ2   1 
ATOM   8746  C  CZ3   . TRP D  1 277 ? 54.282  33.010  57.760  1.00 34.31 ? 1250 TRP D CZ3   1 
ATOM   8747  C  CH2   . TRP D  1 277 ? 53.690  33.610  58.885  1.00 22.67 ? 1250 TRP D CH2   1 
ATOM   8748  N  N     . VAL D  1 278 ? 56.332  28.333  56.568  1.00 37.24 ? 1251 VAL D N     1 
ATOM   8749  C  CA    . VAL D  1 278 ? 55.235  28.206  55.609  1.00 38.98 ? 1251 VAL D CA    1 
ATOM   8750  C  C     . VAL D  1 278 ? 54.581  26.826  55.744  1.00 39.91 ? 1251 VAL D C     1 
ATOM   8751  O  O     . VAL D  1 278 ? 53.365  26.699  55.636  1.00 35.92 ? 1251 VAL D O     1 
ATOM   8752  C  CB    . VAL D  1 278 ? 55.722  28.460  54.142  1.00 35.68 ? 1251 VAL D CB    1 
ATOM   8753  C  CG1   . VAL D  1 278 ? 54.604  28.221  53.126  1.00 31.32 ? 1251 VAL D CG1   1 
ATOM   8754  C  CG2   . VAL D  1 278 ? 56.251  29.873  54.001  1.00 26.98 ? 1251 VAL D CG2   1 
ATOM   8755  N  N     . THR D  1 279 ? 55.406  25.811  56.005  1.00 42.98 ? 1252 THR D N     1 
ATOM   8756  C  CA    . THR D  1 279 ? 54.976  24.408  56.053  1.00 44.62 ? 1252 THR D CA    1 
ATOM   8757  C  C     . THR D  1 279 ? 54.462  23.941  57.430  1.00 45.51 ? 1252 THR D C     1 
ATOM   8758  O  O     . THR D  1 279 ? 53.884  22.854  57.541  1.00 49.36 ? 1252 THR D O     1 
ATOM   8759  C  CB    . THR D  1 279 ? 56.121  23.474  55.590  1.00 44.26 ? 1252 THR D CB    1 
ATOM   8760  N  N     . GLN D  1 280 ? 54.662  24.769  58.457  1.00 42.23 ? 1253 GLN D N     1 
ATOM   8761  C  CA    . GLN D  1 280 ? 54.344  24.433  59.850  1.00 41.67 ? 1253 GLN D CA    1 
ATOM   8762  C  C     . GLN D  1 280 ? 52.914  23.917  60.086  1.00 45.99 ? 1253 GLN D C     1 
ATOM   8763  O  O     . GLN D  1 280 ? 51.999  24.245  59.323  1.00 47.42 ? 1253 GLN D O     1 
ATOM   8764  C  CB    . GLN D  1 280 ? 54.630  25.638  60.765  1.00 40.42 ? 1253 GLN D CB    1 
ATOM   8765  C  CG    . GLN D  1 280 ? 53.573  26.736  60.729  1.00 38.37 ? 1253 GLN D CG    1 
ATOM   8766  C  CD    . GLN D  1 280 ? 53.681  27.699  61.897  1.00 40.83 ? 1253 GLN D CD    1 
ATOM   8767  O  OE1   . GLN D  1 280 ? 54.176  28.814  61.750  1.00 33.92 ? 1253 GLN D OE1   1 
ATOM   8768  N  NE2   . GLN D  1 280 ? 53.220  27.271  63.065  1.00 47.15 ? 1253 GLN D NE2   1 
ATOM   8769  N  N     . PRO D  1 281 ? 52.718  23.101  61.147  1.00 47.32 ? 1254 PRO D N     1 
ATOM   8770  C  CA    . PRO D  1 281 ? 51.384  22.602  61.501  1.00 46.19 ? 1254 PRO D CA    1 
ATOM   8771  C  C     . PRO D  1 281 ? 50.444  23.697  62.019  1.00 42.92 ? 1254 PRO D C     1 
ATOM   8772  O  O     . PRO D  1 281 ? 50.861  24.565  62.788  1.00 39.12 ? 1254 PRO D O     1 
ATOM   8773  C  CB    . PRO D  1 281 ? 51.669  21.580  62.612  1.00 45.86 ? 1254 PRO D CB    1 
ATOM   8774  C  CG    . PRO D  1 281 ? 53.131  21.292  62.524  1.00 50.28 ? 1254 PRO D CG    1 
ATOM   8775  C  CD    . PRO D  1 281 ? 53.745  22.571  62.060  1.00 49.48 ? 1254 PRO D CD    1 
ATOM   8776  N  N     . VAL D  1 282 ? 49.187  23.644  61.585  1.00 42.12 ? 1255 VAL D N     1 
ATOM   8777  C  CA    . VAL D  1 282 ? 48.175  24.610  62.010  1.00 44.22 ? 1255 VAL D CA    1 
ATOM   8778  C  C     . VAL D  1 282 ? 46.834  23.919  62.296  1.00 46.30 ? 1255 VAL D C     1 
ATOM   8779  O  O     . VAL D  1 282 ? 46.300  23.177  61.463  1.00 45.57 ? 1255 VAL D O     1 
ATOM   8780  C  CB    . VAL D  1 282 ? 48.039  25.823  61.009  1.00 41.46 ? 1255 VAL D CB    1 
ATOM   8781  C  CG1   . VAL D  1 282 ? 47.562  25.374  59.640  1.00 38.87 ? 1255 VAL D CG1   1 
ATOM   8782  C  CG2   . VAL D  1 282 ? 47.121  26.904  61.578  1.00 44.36 ? 1255 VAL D CG2   1 
ATOM   8783  N  N     . ASN D  1 283 ? 46.314  24.153  63.495  1.00 48.45 ? 1256 ASN D N     1 
ATOM   8784  C  CA    . ASN D  1 283 ? 45.066  23.540  63.921  1.00 51.03 ? 1256 ASN D CA    1 
ATOM   8785  C  C     . ASN D  1 283 ? 43.946  24.554  63.803  1.00 49.91 ? 1256 ASN D C     1 
ATOM   8786  O  O     . ASN D  1 283 ? 43.858  25.489  64.596  1.00 51.84 ? 1256 ASN D O     1 
ATOM   8787  C  CB    . ASN D  1 283 ? 45.185  23.009  65.355  1.00 50.92 ? 1256 ASN D CB    1 
ATOM   8788  C  CG    . ASN D  1 283 ? 44.231  21.862  65.635  1.00 52.92 ? 1256 ASN D CG    1 
ATOM   8789  O  OD1   . ASN D  1 283 ? 43.225  22.033  66.322  1.00 61.11 ? 1256 ASN D OD1   1 
ATOM   8790  N  ND2   . ASN D  1 283 ? 44.541  20.685  65.098  1.00 50.31 ? 1256 ASN D ND2   1 
ATOM   8791  N  N     . LEU D  1 284 ? 43.103  24.368  62.793  1.00 52.28 ? 1257 LEU D N     1 
ATOM   8792  C  CA    . LEU D  1 284 ? 42.047  25.328  62.469  1.00 53.08 ? 1257 LEU D CA    1 
ATOM   8793  C  C     . LEU D  1 284 ? 40.853  25.232  63.421  1.00 54.02 ? 1257 LEU D C     1 
ATOM   8794  O  O     . LEU D  1 284 ? 39.988  26.106  63.423  1.00 53.62 ? 1257 LEU D O     1 
ATOM   8795  C  CB    . LEU D  1 284 ? 41.597  25.161  61.010  1.00 55.66 ? 1257 LEU D CB    1 
ATOM   8796  C  CG    . LEU D  1 284 ? 42.646  25.262  59.892  1.00 48.42 ? 1257 LEU D CG    1 
ATOM   8797  C  CD1   . LEU D  1 284 ? 42.114  24.645  58.602  1.00 53.38 ? 1257 LEU D CD1   1 
ATOM   8798  C  CD2   . LEU D  1 284 ? 43.086  26.702  59.662  1.00 49.10 ? 1257 LEU D CD2   1 
ATOM   8799  N  N     . ALA D  1 285 ? 40.817  24.169  64.227  1.00 56.25 ? 1258 ALA D N     1 
ATOM   8800  C  CA    . ALA D  1 285 ? 39.821  24.010  65.294  1.00 57.38 ? 1258 ALA D CA    1 
ATOM   8801  C  C     . ALA D  1 285 ? 40.079  24.965  66.466  1.00 56.79 ? 1258 ALA D C     1 
ATOM   8802  O  O     . ALA D  1 285 ? 39.234  25.117  67.352  1.00 58.95 ? 1258 ALA D O     1 
ATOM   8803  C  CB    . ALA D  1 285 ? 39.788  22.566  65.783  1.00 57.58 ? 1258 ALA D CB    1 
ATOM   8804  N  N     . ASP D  1 286 ? 41.247  25.604  66.459  1.00 52.95 ? 1259 ASP D N     1 
ATOM   8805  C  CA    . ASP D  1 286 ? 41.624  26.570  67.485  1.00 50.45 ? 1259 ASP D CA    1 
ATOM   8806  C  C     . ASP D  1 286 ? 41.248  27.999  67.093  1.00 48.62 ? 1259 ASP D C     1 
ATOM   8807  O  O     . ASP D  1 286 ? 41.506  28.940  67.847  1.00 46.37 ? 1259 ASP D O     1 
ATOM   8808  C  CB    . ASP D  1 286 ? 43.127  26.483  67.758  1.00 52.76 ? 1259 ASP D CB    1 
ATOM   8809  N  N     . TYR D  1 287 ? 40.632  28.154  65.919  1.00 47.95 ? 1260 TYR D N     1 
ATOM   8810  C  CA    . TYR D  1 287 ? 40.333  29.480  65.368  1.00 45.81 ? 1260 TYR D CA    1 
ATOM   8811  C  C     . TYR D  1 287 ? 38.891  29.625  64.893  1.00 43.30 ? 1260 TYR D C     1 
ATOM   8812  O  O     . TYR D  1 287 ? 38.412  28.855  64.065  1.00 41.31 ? 1260 TYR D O     1 
ATOM   8813  C  CB    . TYR D  1 287 ? 41.318  29.850  64.240  1.00 44.85 ? 1260 TYR D CB    1 
ATOM   8814  C  CG    . TYR D  1 287 ? 42.778  29.685  64.625  1.00 43.98 ? 1260 TYR D CG    1 
ATOM   8815  C  CD1   . TYR D  1 287 ? 43.380  30.539  65.549  1.00 44.35 ? 1260 TYR D CD1   1 
ATOM   8816  C  CD2   . TYR D  1 287 ? 43.549  28.666  64.076  1.00 44.43 ? 1260 TYR D CD2   1 
ATOM   8817  C  CE1   . TYR D  1 287 ? 44.716  30.375  65.916  1.00 42.25 ? 1260 TYR D CE1   1 
ATOM   8818  C  CE2   . TYR D  1 287 ? 44.881  28.501  64.429  1.00 41.14 ? 1260 TYR D CE2   1 
ATOM   8819  C  CZ    . TYR D  1 287 ? 45.459  29.356  65.349  1.00 42.06 ? 1260 TYR D CZ    1 
ATOM   8820  O  OH    . TYR D  1 287 ? 46.780  29.179  65.701  1.00 41.97 ? 1260 TYR D OH    1 
ATOM   8821  N  N     . THR D  1 288 ? 38.215  30.628  65.441  1.00 45.04 ? 1261 THR D N     1 
ATOM   8822  C  CA    . THR D  1 288 ? 36.860  30.992  65.052  1.00 44.19 ? 1261 THR D CA    1 
ATOM   8823  C  C     . THR D  1 288 ? 36.931  32.400  64.492  1.00 41.45 ? 1261 THR D C     1 
ATOM   8824  O  O     . THR D  1 288 ? 37.683  33.229  65.005  1.00 38.67 ? 1261 THR D O     1 
ATOM   8825  C  CB    . THR D  1 288 ? 35.897  30.991  66.275  1.00 41.09 ? 1261 THR D CB    1 
ATOM   8826  O  OG1   . THR D  1 288 ? 36.079  29.790  67.034  1.00 49.01 ? 1261 THR D OG1   1 
ATOM   8827  C  CG2   . THR D  1 288 ? 34.454  31.066  65.832  1.00 47.65 ? 1261 THR D CG2   1 
ATOM   8828  N  N     . TRP D  1 289 ? 36.140  32.667  63.452  1.00 44.19 ? 1262 TRP D N     1 
ATOM   8829  C  CA    . TRP D  1 289 ? 36.036  34.004  62.869  1.00 44.27 ? 1262 TRP D CA    1 
ATOM   8830  C  C     . TRP D  1 289 ? 35.721  35.074  63.907  1.00 45.71 ? 1262 TRP D C     1 
ATOM   8831  O  O     . TRP D  1 289 ? 36.314  36.151  63.888  1.00 46.58 ? 1262 TRP D O     1 
ATOM   8832  C  CB    . TRP D  1 289 ? 34.981  34.042  61.759  1.00 45.24 ? 1262 TRP D CB    1 
ATOM   8833  C  CG    . TRP D  1 289 ? 34.964  35.351  61.034  1.00 45.52 ? 1262 TRP D CG    1 
ATOM   8834  C  CD1   . TRP D  1 289 ? 34.021  36.330  61.134  1.00 47.03 ? 1262 TRP D CD1   1 
ATOM   8835  C  CD2   . TRP D  1 289 ? 35.953  35.836  60.115  1.00 50.19 ? 1262 TRP D CD2   1 
ATOM   8836  N  NE1   . TRP D  1 289 ? 34.352  37.392  60.327  1.00 46.42 ? 1262 TRP D NE1   1 
ATOM   8837  C  CE2   . TRP D  1 289 ? 35.532  37.115  59.688  1.00 50.94 ? 1262 TRP D CE2   1 
ATOM   8838  C  CE3   . TRP D  1 289 ? 37.151  35.313  59.605  1.00 47.75 ? 1262 TRP D CE3   1 
ATOM   8839  C  CZ2   . TRP D  1 289 ? 36.268  37.882  58.773  1.00 50.30 ? 1262 TRP D CZ2   1 
ATOM   8840  C  CZ3   . TRP D  1 289 ? 37.880  36.076  58.694  1.00 44.54 ? 1262 TRP D CZ3   1 
ATOM   8841  C  CH2   . TRP D  1 289 ? 37.433  37.345  58.289  1.00 43.90 ? 1262 TRP D CH2   1 
ATOM   8842  N  N     . GLU D  1 290 ? 34.794  34.763  64.812  1.00 46.26 ? 1263 GLU D N     1 
ATOM   8843  C  CA    . GLU D  1 290 ? 34.356  35.702  65.841  1.00 48.24 ? 1263 GLU D CA    1 
ATOM   8844  C  C     . GLU D  1 290 ? 35.499  36.157  66.754  1.00 49.33 ? 1263 GLU D C     1 
ATOM   8845  O  O     . GLU D  1 290 ? 35.589  37.337  67.105  1.00 48.45 ? 1263 GLU D O     1 
ATOM   8846  C  CB    . GLU D  1 290 ? 33.211  35.100  66.665  1.00 49.23 ? 1263 GLU D CB    1 
ATOM   8847  N  N     . GLU D  1 291 ? 36.374  35.219  67.114  1.00 51.73 ? 1264 GLU D N     1 
ATOM   8848  C  CA    . GLU D  1 291 ? 37.473  35.487  68.045  1.00 54.23 ? 1264 GLU D CA    1 
ATOM   8849  C  C     . GLU D  1 291 ? 38.754  35.995  67.379  1.00 54.25 ? 1264 GLU D C     1 
ATOM   8850  O  O     . GLU D  1 291 ? 39.559  36.674  68.023  1.00 57.89 ? 1264 GLU D O     1 
ATOM   8851  C  CB    . GLU D  1 291 ? 37.762  34.255  68.903  1.00 53.54 ? 1264 GLU D CB    1 
ATOM   8852  C  CG    . GLU D  1 291 ? 36.689  33.990  69.962  1.00 59.07 ? 1264 GLU D CG    1 
ATOM   8853  C  CD    . GLU D  1 291 ? 37.018  32.811  70.863  1.00 59.25 ? 1264 GLU D CD    1 
ATOM   8854  O  OE1   . GLU D  1 291 ? 38.188  32.692  71.298  1.00 61.52 ? 1264 GLU D OE1   1 
ATOM   8855  O  OE2   . GLU D  1 291 ? 36.100  32.007  71.140  1.00 57.05 ? 1264 GLU D OE2   1 
ATOM   8856  N  N     . VAL D  1 292 ? 38.944  35.662  66.103  1.00 50.65 ? 1265 VAL D N     1 
ATOM   8857  C  CA    . VAL D  1 292 ? 40.050  36.214  65.315  1.00 47.77 ? 1265 VAL D CA    1 
ATOM   8858  C  C     . VAL D  1 292 ? 39.688  37.612  64.775  1.00 46.70 ? 1265 VAL D C     1 
ATOM   8859  O  O     . VAL D  1 292 ? 40.489  38.546  64.859  1.00 41.69 ? 1265 VAL D O     1 
ATOM   8860  C  CB    . VAL D  1 292 ? 40.485  35.260  64.164  1.00 46.27 ? 1265 VAL D CB    1 
ATOM   8861  C  CG1   . VAL D  1 292 ? 41.640  35.858  63.365  1.00 52.26 ? 1265 VAL D CG1   1 
ATOM   8862  C  CG2   . VAL D  1 292 ? 40.889  33.891  64.711  1.00 33.07 ? 1265 VAL D CG2   1 
ATOM   8863  N  N     . PHE D  1 293 ? 38.475  37.748  64.246  1.00 50.16 ? 1266 PHE D N     1 
ATOM   8864  C  CA    . PHE D  1 293 ? 38.012  39.013  63.677  1.00 56.31 ? 1266 PHE D CA    1 
ATOM   8865  C  C     . PHE D  1 293 ? 37.053  39.736  64.613  1.00 58.72 ? 1266 PHE D C     1 
ATOM   8866  O  O     . PHE D  1 293 ? 37.205  40.934  64.860  1.00 61.80 ? 1266 PHE D O     1 
ATOM   8867  C  CB    . PHE D  1 293 ? 37.345  38.782  62.318  1.00 57.68 ? 1266 PHE D CB    1 
ATOM   8868  C  CG    . PHE D  1 293 ? 37.162  40.037  61.507  1.00 59.90 ? 1266 PHE D CG    1 
ATOM   8869  C  CD1   . PHE D  1 293 ? 38.179  40.498  60.676  1.00 59.15 ? 1266 PHE D CD1   1 
ATOM   8870  C  CD2   . PHE D  1 293 ? 35.969  40.754  61.568  1.00 63.00 ? 1266 PHE D CD2   1 
ATOM   8871  C  CE1   . PHE D  1 293 ? 38.016  41.652  59.925  1.00 60.44 ? 1266 PHE D CE1   1 
ATOM   8872  C  CE2   . PHE D  1 293 ? 35.793  41.910  60.819  1.00 62.01 ? 1266 PHE D CE2   1 
ATOM   8873  C  CZ    . PHE D  1 293 ? 36.818  42.358  59.994  1.00 63.83 ? 1266 PHE D CZ    1 
ATOM   8874  N  N     . ALA E  1 9   ? 8.512   -20.582 34.642  1.00 52.83 ? 982  ALA E N     1 
ATOM   8875  C  CA    . ALA E  1 9   ? 9.561   -21.635 34.540  1.00 54.11 ? 982  ALA E CA    1 
ATOM   8876  C  C     . ALA E  1 9   ? 10.935  -20.993 34.370  1.00 57.09 ? 982  ALA E C     1 
ATOM   8877  O  O     . ALA E  1 9   ? 11.259  -20.467 33.301  1.00 61.31 ? 982  ALA E O     1 
ATOM   8878  C  CB    . ALA E  1 9   ? 9.255   -22.583 33.386  1.00 54.11 ? 982  ALA E CB    1 
ATOM   8879  N  N     . VAL E  1 10  ? 11.733  -21.037 35.434  1.00 55.67 ? 983  VAL E N     1 
ATOM   8880  C  CA    . VAL E  1 10  ? 13.046  -20.391 35.466  1.00 51.86 ? 983  VAL E CA    1 
ATOM   8881  C  C     . VAL E  1 10  ? 14.054  -21.100 34.555  1.00 52.24 ? 983  VAL E C     1 
ATOM   8882  O  O     . VAL E  1 10  ? 14.367  -22.275 34.746  1.00 50.76 ? 983  VAL E O     1 
ATOM   8883  C  CB    . VAL E  1 10  ? 13.593  -20.294 36.915  1.00 49.96 ? 983  VAL E CB    1 
ATOM   8884  C  CG1   . VAL E  1 10  ? 14.919  -19.531 36.958  1.00 49.51 ? 983  VAL E CG1   1 
ATOM   8885  C  CG2   . VAL E  1 10  ? 12.569  -19.628 37.827  1.00 52.91 ? 983  VAL E CG2   1 
ATOM   8886  N  N     . GLU E  1 11  ? 14.550  -20.369 33.561  1.00 54.67 ? 984  GLU E N     1 
ATOM   8887  C  CA    . GLU E  1 11  ? 15.547  -20.883 32.628  1.00 55.85 ? 984  GLU E CA    1 
ATOM   8888  C  C     . GLU E  1 11  ? 16.930  -20.907 33.269  1.00 54.14 ? 984  GLU E C     1 
ATOM   8889  O  O     . GLU E  1 11  ? 17.347  -19.940 33.908  1.00 55.97 ? 984  GLU E O     1 
ATOM   8890  C  CB    . GLU E  1 11  ? 15.560  -20.042 31.354  1.00 59.64 ? 984  GLU E CB    1 
ATOM   8891  C  CG    . GLU E  1 11  ? 14.294  -20.178 30.516  1.00 66.03 ? 984  GLU E CG    1 
ATOM   8892  C  CD    . GLU E  1 11  ? 14.116  -19.046 29.518  1.00 73.92 ? 984  GLU E CD    1 
ATOM   8893  O  OE1   . GLU E  1 11  ? 15.103  -18.333 29.227  1.00 73.87 ? 984  GLU E OE1   1 
ATOM   8894  O  OE2   . GLU E  1 11  ? 12.980  -18.873 29.021  1.00 75.48 ? 984  GLU E OE2   1 
ATOM   8895  N  N     . LEU E  1 12  ? 17.635  -22.019 33.093  1.00 53.24 ? 985  LEU E N     1 
ATOM   8896  C  CA    . LEU E  1 12  ? 18.916  -22.242 33.759  1.00 55.40 ? 985  LEU E CA    1 
ATOM   8897  C  C     . LEU E  1 12  ? 20.076  -21.730 32.900  1.00 58.43 ? 985  LEU E C     1 
ATOM   8898  O  O     . LEU E  1 12  ? 20.537  -22.415 31.986  1.00 58.52 ? 985  LEU E O     1 
ATOM   8899  C  CB    . LEU E  1 12  ? 19.073  -23.728 34.130  1.00 52.77 ? 985  LEU E CB    1 
ATOM   8900  C  CG    . LEU E  1 12  ? 18.495  -24.299 35.441  1.00 48.35 ? 985  LEU E CG    1 
ATOM   8901  C  CD1   . LEU E  1 12  ? 17.391  -23.453 36.086  1.00 44.28 ? 985  LEU E CD1   1 
ATOM   8902  C  CD2   . LEU E  1 12  ? 18.012  -25.722 35.226  1.00 44.93 ? 985  LEU E CD2   1 
ATOM   8903  N  N     . GLU E  1 13  ? 20.540  -20.522 33.221  1.00 62.13 ? 986  GLU E N     1 
ATOM   8904  C  CA    . GLU E  1 13  ? 21.456  -19.754 32.365  1.00 63.36 ? 986  GLU E CA    1 
ATOM   8905  C  C     . GLU E  1 13  ? 22.916  -19.759 32.828  1.00 63.48 ? 986  GLU E C     1 
ATOM   8906  O  O     . GLU E  1 13  ? 23.701  -18.896 32.426  1.00 64.23 ? 986  GLU E O     1 
ATOM   8907  C  CB    . GLU E  1 13  ? 20.962  -18.304 32.246  1.00 65.82 ? 986  GLU E CB    1 
ATOM   8908  C  CG    . GLU E  1 13  ? 19.676  -18.113 31.433  1.00 71.89 ? 986  GLU E CG    1 
ATOM   8909  C  CD    . GLU E  1 13  ? 19.901  -18.214 29.932  1.00 74.13 ? 986  GLU E CD    1 
ATOM   8910  O  OE1   . GLU E  1 13  ? 20.365  -19.274 29.456  1.00 74.91 ? 986  GLU E OE1   1 
ATOM   8911  O  OE2   . GLU E  1 13  ? 19.604  -17.230 29.224  1.00 75.02 ? 986  GLU E OE2   1 
ATOM   8912  N  N     . GLY E  1 14  ? 23.277  -20.734 33.658  1.00 61.46 ? 987  GLY E N     1 
ATOM   8913  C  CA    . GLY E  1 14  ? 24.609  -20.796 34.254  1.00 58.84 ? 987  GLY E CA    1 
ATOM   8914  C  C     . GLY E  1 14  ? 25.752  -20.880 33.259  1.00 58.08 ? 987  GLY E C     1 
ATOM   8915  O  O     . GLY E  1 14  ? 26.684  -20.073 33.309  1.00 57.82 ? 987  GLY E O     1 
ATOM   8916  N  N     . LEU E  1 15  ? 25.667  -21.850 32.351  1.00 56.12 ? 988  LEU E N     1 
ATOM   8917  C  CA    . LEU E  1 15  ? 26.746  -22.148 31.398  1.00 55.77 ? 988  LEU E CA    1 
ATOM   8918  C  C     . LEU E  1 15  ? 26.900  -21.097 30.291  1.00 54.44 ? 988  LEU E C     1 
ATOM   8919  O  O     . LEU E  1 15  ? 27.986  -20.930 29.736  1.00 53.39 ? 988  LEU E O     1 
ATOM   8920  C  CB    . LEU E  1 15  ? 26.558  -23.544 30.781  1.00 56.04 ? 988  LEU E CB    1 
ATOM   8921  C  CG    . LEU E  1 15  ? 26.170  -24.720 31.692  1.00 55.86 ? 988  LEU E CG    1 
ATOM   8922  C  CD1   . LEU E  1 15  ? 25.934  -25.977 30.868  1.00 56.71 ? 988  LEU E CD1   1 
ATOM   8923  C  CD2   . LEU E  1 15  ? 27.212  -24.973 32.773  1.00 54.38 ? 988  LEU E CD2   1 
ATOM   8924  N  N     . ALA E  1 16  ? 25.808  -20.405 29.972  1.00 52.50 ? 989  ALA E N     1 
ATOM   8925  C  CA    . ALA E  1 16  ? 25.827  -19.326 28.986  1.00 49.00 ? 989  ALA E CA    1 
ATOM   8926  C  C     . ALA E  1 16  ? 26.407  -18.033 29.571  1.00 48.32 ? 989  ALA E C     1 
ATOM   8927  O  O     . ALA E  1 16  ? 26.976  -17.217 28.844  1.00 50.51 ? 989  ALA E O     1 
ATOM   8928  C  CB    . ALA E  1 16  ? 24.421  -19.086 28.436  1.00 46.55 ? 989  ALA E CB    1 
ATOM   8929  N  N     . ALA E  1 17  ? 26.260  -17.854 30.883  1.00 44.65 ? 990  ALA E N     1 
ATOM   8930  C  CA    . ALA E  1 17  ? 26.754  -16.658 31.568  1.00 43.96 ? 990  ALA E CA    1 
ATOM   8931  C  C     . ALA E  1 17  ? 28.269  -16.670 31.723  1.00 44.16 ? 990  ALA E C     1 
ATOM   8932  O  O     . ALA E  1 17  ? 28.901  -15.617 31.756  1.00 41.44 ? 990  ALA E O     1 
ATOM   8933  C  CB    . ALA E  1 17  ? 26.082  -16.502 32.926  1.00 40.46 ? 990  ALA E CB    1 
ATOM   8934  N  N     . CYS E  1 18  ? 28.841  -17.869 31.805  1.00 48.68 ? 991  CYS E N     1 
ATOM   8935  C  CA    . CYS E  1 18  ? 30.266  -18.045 32.071  1.00 51.33 ? 991  CYS E CA    1 
ATOM   8936  C  C     . CYS E  1 18  ? 31.074  -18.481 30.843  1.00 51.80 ? 991  CYS E C     1 
ATOM   8937  O  O     . CYS E  1 18  ? 32.281  -18.680 30.938  1.00 53.06 ? 991  CYS E O     1 
ATOM   8938  C  CB    . CYS E  1 18  ? 30.463  -19.045 33.213  1.00 50.01 ? 991  CYS E CB    1 
ATOM   8939  S  SG    . CYS E  1 18  ? 29.689  -18.556 34.771  1.00 65.26 ? 991  CYS E SG    1 
ATOM   8940  N  N     . GLU E  1 19  ? 30.411  -18.614 29.696  1.00 52.54 ? 992  GLU E N     1 
ATOM   8941  C  CA    . GLU E  1 19  ? 31.051  -19.108 28.469  1.00 52.68 ? 992  GLU E CA    1 
ATOM   8942  C  C     . GLU E  1 19  ? 32.263  -18.276 28.015  1.00 48.36 ? 992  GLU E C     1 
ATOM   8943  O  O     . GLU E  1 19  ? 32.184  -17.051 27.903  1.00 44.62 ? 992  GLU E O     1 
ATOM   8944  C  CB    . GLU E  1 19  ? 30.011  -19.233 27.337  1.00 53.87 ? 992  GLU E CB    1 
ATOM   8945  C  CG    . GLU E  1 19  ? 30.575  -19.255 25.900  1.00 59.59 ? 992  GLU E CG    1 
ATOM   8946  C  CD    . GLU E  1 19  ? 31.196  -20.593 25.505  1.00 63.61 ? 992  GLU E CD    1 
ATOM   8947  O  OE1   . GLU E  1 19  ? 32.113  -20.595 24.649  1.00 49.18 ? 992  GLU E OE1   1 
ATOM   8948  O  OE2   . GLU E  1 19  ? 30.764  -21.639 26.044  1.00 66.09 ? 992  GLU E OE2   1 
ATOM   8949  N  N     . GLY E  1 20  ? 33.380  -18.962 27.775  1.00 44.78 ? 993  GLY E N     1 
ATOM   8950  C  CA    . GLY E  1 20  ? 34.517  -18.384 27.068  1.00 44.33 ? 993  GLY E CA    1 
ATOM   8951  C  C     . GLY E  1 20  ? 35.614  -17.792 27.927  1.00 45.16 ? 993  GLY E C     1 
ATOM   8952  O  O     . GLY E  1 20  ? 36.025  -18.382 28.926  1.00 46.54 ? 993  GLY E O     1 
ATOM   8953  N  N     . GLU E  1 21  ? 36.072  -16.608 27.528  1.00 47.74 ? 994  GLU E N     1 
ATOM   8954  C  CA    . GLU E  1 21  ? 37.228  -15.940 28.134  1.00 48.84 ? 994  GLU E CA    1 
ATOM   8955  C  C     . GLU E  1 21  ? 37.111  -15.738 29.647  1.00 47.31 ? 994  GLU E C     1 
ATOM   8956  O  O     . GLU E  1 21  ? 38.118  -15.806 30.363  1.00 44.56 ? 994  GLU E O     1 
ATOM   8957  C  CB    . GLU E  1 21  ? 37.486  -14.604 27.434  1.00 46.20 ? 994  GLU E CB    1 
ATOM   8958  C  CG    . GLU E  1 21  ? 38.958  -14.247 27.307  1.00 53.97 ? 994  GLU E CG    1 
ATOM   8959  C  CD    . GLU E  1 21  ? 39.186  -12.921 26.600  1.00 53.68 ? 994  GLU E CD    1 
ATOM   8960  O  OE1   . GLU E  1 21  ? 38.603  -12.711 25.508  1.00 54.50 ? 994  GLU E OE1   1 
ATOM   8961  O  OE2   . GLU E  1 21  ? 39.956  -12.092 27.139  1.00 52.62 ? 994  GLU E OE2   1 
ATOM   8962  N  N     . TYR E  1 22  ? 35.889  -15.500 30.130  1.00 48.09 ? 995  TYR E N     1 
ATOM   8963  C  CA    . TYR E  1 22  ? 35.646  -15.359 31.568  1.00 45.46 ? 995  TYR E CA    1 
ATOM   8964  C  C     . TYR E  1 22  ? 36.019  -16.631 32.337  1.00 47.61 ? 995  TYR E C     1 
ATOM   8965  O  O     . TYR E  1 22  ? 36.738  -16.564 33.333  1.00 48.74 ? 995  TYR E O     1 
ATOM   8966  C  CB    . TYR E  1 22  ? 34.196  -14.943 31.866  1.00 47.16 ? 995  TYR E CB    1 
ATOM   8967  C  CG    . TYR E  1 22  ? 33.867  -15.018 33.342  1.00 43.48 ? 995  TYR E CG    1 
ATOM   8968  C  CD1   . TYR E  1 22  ? 34.303  -14.027 34.226  1.00 47.26 ? 995  TYR E CD1   1 
ATOM   8969  C  CD2   . TYR E  1 22  ? 33.153  -16.096 33.860  1.00 43.98 ? 995  TYR E CD2   1 
ATOM   8970  C  CE1   . TYR E  1 22  ? 34.023  -14.105 35.585  1.00 43.97 ? 995  TYR E CE1   1 
ATOM   8971  C  CE2   . TYR E  1 22  ? 32.869  -16.186 35.214  1.00 41.78 ? 995  TYR E CE2   1 
ATOM   8972  C  CZ    . TYR E  1 22  ? 33.308  -15.190 36.069  1.00 46.44 ? 995  TYR E CZ    1 
ATOM   8973  O  OH    . TYR E  1 22  ? 33.025  -15.280 37.406  1.00 47.03 ? 995  TYR E OH    1 
ATOM   8974  N  N     . SER E  1 23  ? 35.536  -17.781 31.866  1.00 49.93 ? 996  SER E N     1 
ATOM   8975  C  CA    . SER E  1 23  ? 35.826  -19.080 32.489  1.00 51.21 ? 996  SER E CA    1 
ATOM   8976  C  C     . SER E  1 23  ? 37.299  -19.471 32.417  1.00 52.32 ? 996  SER E C     1 
ATOM   8977  O  O     . SER E  1 23  ? 37.779  -20.251 33.247  1.00 54.72 ? 996  SER E O     1 
ATOM   8978  C  CB    . SER E  1 23  ? 34.979  -20.181 31.858  1.00 52.36 ? 996  SER E CB    1 
ATOM   8979  O  OG    . SER E  1 23  ? 33.620  -20.044 32.218  1.00 55.97 ? 996  SER E OG    1 
ATOM   8980  N  N     . GLN E  1 24  ? 38.004  -18.943 31.419  1.00 52.60 ? 997  GLN E N     1 
ATOM   8981  C  CA    . GLN E  1 24  ? 39.446  -19.154 31.288  1.00 52.75 ? 997  GLN E CA    1 
ATOM   8982  C  C     . GLN E  1 24  ? 40.223  -18.441 32.396  1.00 53.63 ? 997  GLN E C     1 
ATOM   8983  O  O     . GLN E  1 24  ? 41.233  -18.959 32.885  1.00 52.23 ? 997  GLN E O     1 
ATOM   8984  C  CB    . GLN E  1 24  ? 39.946  -18.694 29.912  1.00 50.98 ? 997  GLN E CB    1 
ATOM   8985  C  CG    . GLN E  1 24  ? 39.542  -19.602 28.752  1.00 55.55 ? 997  GLN E CG    1 
ATOM   8986  C  CD    . GLN E  1 24  ? 40.052  -21.033 28.900  1.00 61.52 ? 997  GLN E CD    1 
ATOM   8987  O  OE1   . GLN E  1 24  ? 39.270  -21.964 29.105  1.00 59.02 ? 997  GLN E OE1   1 
ATOM   8988  N  NE2   . GLN E  1 24  ? 41.368  -21.211 28.801  1.00 59.93 ? 997  GLN E NE2   1 
ATOM   8989  N  N     . LYS E  1 25  ? 39.729  -17.264 32.794  1.00 54.73 ? 998  LYS E N     1 
ATOM   8990  C  CA    . LYS E  1 25  ? 40.414  -16.399 33.760  1.00 52.30 ? 998  LYS E CA    1 
ATOM   8991  C  C     . LYS E  1 25  ? 39.859  -16.493 35.187  1.00 50.71 ? 998  LYS E C     1 
ATOM   8992  O  O     . LYS E  1 25  ? 40.625  -16.538 36.158  1.00 50.27 ? 998  LYS E O     1 
ATOM   8993  C  CB    . LYS E  1 25  ? 40.397  -14.945 33.276  1.00 52.27 ? 998  LYS E CB    1 
ATOM   8994  N  N     . TYR E  1 26  ? 38.535  -16.532 35.309  1.00 48.72 ? 999  TYR E N     1 
ATOM   8995  C  CA    . TYR E  1 26  ? 37.885  -16.542 36.622  1.00 48.89 ? 999  TYR E CA    1 
ATOM   8996  C  C     . TYR E  1 26  ? 36.964  -17.739 36.840  1.00 49.83 ? 999  TYR E C     1 
ATOM   8997  O  O     . TYR E  1 26  ? 36.253  -18.172 35.925  1.00 49.09 ? 999  TYR E O     1 
ATOM   8998  C  CB    . TYR E  1 26  ? 37.092  -15.246 36.856  1.00 47.41 ? 999  TYR E CB    1 
ATOM   8999  C  CG    . TYR E  1 26  ? 37.873  -13.970 36.614  1.00 47.90 ? 999  TYR E CG    1 
ATOM   9000  C  CD1   . TYR E  1 26  ? 38.614  -13.375 37.636  1.00 45.73 ? 999  TYR E CD1   1 
ATOM   9001  C  CD2   . TYR E  1 26  ? 37.859  -13.350 35.365  1.00 43.83 ? 999  TYR E CD2   1 
ATOM   9002  C  CE1   . TYR E  1 26  ? 39.328  -12.203 37.415  1.00 44.31 ? 999  TYR E CE1   1 
ATOM   9003  C  CE2   . TYR E  1 26  ? 38.566  -12.185 35.136  1.00 48.74 ? 999  TYR E CE2   1 
ATOM   9004  C  CZ    . TYR E  1 26  ? 39.299  -11.615 36.162  1.00 47.24 ? 999  TYR E CZ    1 
ATOM   9005  O  OH    . TYR E  1 26  ? 39.997  -10.454 35.922  1.00 50.53 ? 999  TYR E OH    1 
ATOM   9006  N  N     . SER E  1 27  ? 36.993  -18.262 38.064  1.00 50.10 ? 1000 SER E N     1 
ATOM   9007  C  CA    . SER E  1 27  ? 36.032  -19.259 38.516  1.00 51.76 ? 1000 SER E CA    1 
ATOM   9008  C  C     . SER E  1 27  ? 35.054  -18.602 39.490  1.00 51.69 ? 1000 SER E C     1 
ATOM   9009  O  O     . SER E  1 27  ? 35.459  -17.829 40.366  1.00 48.63 ? 1000 SER E O     1 
ATOM   9010  C  CB    . SER E  1 27  ? 36.741  -20.439 39.182  1.00 53.68 ? 1000 SER E CB    1 
ATOM   9011  O  OG    . SER E  1 27  ? 35.811  -21.458 39.514  1.00 58.99 ? 1000 SER E OG    1 
ATOM   9012  N  N     . THR E  1 28  ? 33.771  -18.918 39.324  1.00 50.93 ? 1001 THR E N     1 
ATOM   9013  C  CA    . THR E  1 28  ? 32.695  -18.299 40.096  1.00 48.07 ? 1001 THR E CA    1 
ATOM   9014  C  C     . THR E  1 28  ? 32.412  -19.050 41.400  1.00 47.23 ? 1001 THR E C     1 
ATOM   9015  O  O     . THR E  1 28  ? 32.218  -20.267 41.396  1.00 46.31 ? 1001 THR E O     1 
ATOM   9016  C  CB    . THR E  1 28  ? 31.417  -18.174 39.244  1.00 43.71 ? 1001 THR E CB    1 
ATOM   9017  O  OG1   . THR E  1 28  ? 31.728  -17.447 38.056  1.00 41.19 ? 1001 THR E OG1   1 
ATOM   9018  C  CG2   . THR E  1 28  ? 30.316  -17.439 39.992  1.00 45.26 ? 1001 THR E CG2   1 
ATOM   9019  N  N     . MET E  1 29  ? 32.377  -18.305 42.505  1.00 46.61 ? 1002 MET E N     1 
ATOM   9020  C  CA    . MET E  1 29  ? 32.219  -18.889 43.838  1.00 47.77 ? 1002 MET E CA    1 
ATOM   9021  C  C     . MET E  1 29  ? 30.812  -18.723 44.417  1.00 46.45 ? 1002 MET E C     1 
ATOM   9022  O  O     . MET E  1 29  ? 29.983  -19.628 44.304  1.00 48.57 ? 1002 MET E O     1 
ATOM   9023  C  CB    . MET E  1 29  ? 33.282  -18.343 44.802  1.00 49.33 ? 1002 MET E CB    1 
ATOM   9024  C  CG    . MET E  1 29  ? 34.731  -18.480 44.306  1.00 55.49 ? 1002 MET E CG    1 
ATOM   9025  S  SD    . MET E  1 29  ? 35.250  -20.145 43.806  1.00 61.87 ? 1002 MET E SD    1 
ATOM   9026  C  CE    . MET E  1 29  ? 35.082  -21.053 45.347  1.00 62.38 ? 1002 MET E CE    1 
ATOM   9027  N  N     . SER E  1 30  ? 30.542  -17.564 45.019  1.00 46.38 ? 1003 SER E N     1 
ATOM   9028  C  CA    . SER E  1 30  ? 29.293  -17.338 45.749  1.00 42.86 ? 1003 SER E CA    1 
ATOM   9029  C  C     . SER E  1 30  ? 28.610  -16.006 45.397  1.00 44.31 ? 1003 SER E C     1 
ATOM   9030  O  O     . SER E  1 30  ? 29.287  -15.032 45.059  1.00 42.88 ? 1003 SER E O     1 
ATOM   9031  C  CB    . SER E  1 30  ? 29.542  -17.437 47.261  1.00 43.94 ? 1003 SER E CB    1 
ATOM   9032  O  OG    . SER E  1 30  ? 30.691  -16.702 47.651  1.00 43.29 ? 1003 SER E OG    1 
ATOM   9033  N  N     . PRO E  1 31  ? 27.261  -15.965 45.479  1.00 44.21 ? 1004 PRO E N     1 
ATOM   9034  C  CA    . PRO E  1 31  ? 26.477  -14.759 45.184  1.00 44.73 ? 1004 PRO E CA    1 
ATOM   9035  C  C     . PRO E  1 31  ? 26.705  -13.593 46.161  1.00 47.05 ? 1004 PRO E C     1 
ATOM   9036  O  O     . PRO E  1 31  ? 27.288  -13.779 47.234  1.00 43.55 ? 1004 PRO E O     1 
ATOM   9037  C  CB    . PRO E  1 31  ? 25.028  -15.254 45.269  1.00 44.03 ? 1004 PRO E CB    1 
ATOM   9038  C  CG    . PRO E  1 31  ? 25.083  -16.458 46.126  1.00 42.90 ? 1004 PRO E CG    1 
ATOM   9039  C  CD    . PRO E  1 31  ? 26.395  -17.099 45.856  1.00 42.72 ? 1004 PRO E CD    1 
ATOM   9040  N  N     . LEU E  1 32  ? 26.249  -12.402 45.770  1.00 48.74 ? 1005 LEU E N     1 
ATOM   9041  C  CA    . LEU E  1 32  ? 26.419  -11.183 46.565  1.00 51.66 ? 1005 LEU E CA    1 
ATOM   9042  C  C     . LEU E  1 32  ? 25.136  -10.362 46.628  1.00 53.64 ? 1005 LEU E C     1 
ATOM   9043  O  O     . LEU E  1 32  ? 24.251  -10.516 45.784  1.00 55.11 ? 1005 LEU E O     1 
ATOM   9044  C  CB    . LEU E  1 32  ? 27.551  -10.315 46.000  1.00 49.30 ? 1005 LEU E CB    1 
ATOM   9045  C  CG    . LEU E  1 32  ? 28.987  -10.604 46.436  1.00 49.65 ? 1005 LEU E CG    1 
ATOM   9046  C  CD1   . LEU E  1 32  ? 29.954  -9.804  45.588  1.00 45.40 ? 1005 LEU E CD1   1 
ATOM   9047  C  CD2   . LEU E  1 32  ? 29.201  -10.294 47.916  1.00 50.54 ? 1005 LEU E CD2   1 
ATOM   9048  N  N     . GLY E  1 33  ? 25.046  -9.495  47.637  1.00 54.94 ? 1006 GLY E N     1 
ATOM   9049  C  CA    . GLY E  1 33  ? 23.922  -8.576  47.776  1.00 56.85 ? 1006 GLY E CA    1 
ATOM   9050  C  C     . GLY E  1 33  ? 22.950  -8.910  48.885  1.00 58.21 ? 1006 GLY E C     1 
ATOM   9051  O  O     . GLY E  1 33  ? 23.314  -9.579  49.855  1.00 59.08 ? 1006 GLY E O     1 
ATOM   9052  N  N     . SER E  1 34  ? 21.714  -8.428  48.732  1.00 59.59 ? 1007 SER E N     1 
ATOM   9053  C  CA    . SER E  1 34  ? 20.637  -8.637  49.706  1.00 60.60 ? 1007 SER E CA    1 
ATOM   9054  C  C     . SER E  1 34  ? 20.358  -10.123 49.928  1.00 59.20 ? 1007 SER E C     1 
ATOM   9055  O  O     . SER E  1 34  ? 20.391  -10.601 51.066  1.00 59.22 ? 1007 SER E O     1 
ATOM   9056  C  CB    . SER E  1 34  ? 19.352  -7.923  49.262  1.00 62.55 ? 1007 SER E CB    1 
ATOM   9057  O  OG    . SER E  1 34  ? 19.583  -6.553  48.983  1.00 67.79 ? 1007 SER E OG    1 
ATOM   9058  N  N     . GLY E  1 35  ? 20.089  -10.845 48.841  1.00 57.48 ? 1008 GLY E N     1 
ATOM   9059  C  CA    . GLY E  1 35  ? 19.909  -12.296 48.905  1.00 55.99 ? 1008 GLY E CA    1 
ATOM   9060  C  C     . GLY E  1 35  ? 19.146  -12.902 47.745  1.00 51.99 ? 1008 GLY E C     1 
ATOM   9061  O  O     . GLY E  1 35  ? 18.505  -12.188 46.974  1.00 51.35 ? 1008 GLY E O     1 
ATOM   9062  N  N     . ALA E  1 36  ? 19.218  -14.232 47.652  1.00 52.18 ? 1009 ALA E N     1 
ATOM   9063  C  CA    . ALA E  1 36  ? 18.577  -15.048 46.608  1.00 50.85 ? 1009 ALA E CA    1 
ATOM   9064  C  C     . ALA E  1 36  ? 19.362  -15.079 45.290  1.00 49.82 ? 1009 ALA E C     1 
ATOM   9065  O  O     . ALA E  1 36  ? 18.804  -14.860 44.212  1.00 48.12 ? 1009 ALA E O     1 
ATOM   9066  C  CB    . ALA E  1 36  ? 17.105  -14.646 46.385  1.00 54.40 ? 1009 ALA E CB    1 
ATOM   9067  N  N     . PHE E  1 37  ? 20.659  -15.360 45.402  1.00 48.28 ? 1010 PHE E N     1 
ATOM   9068  C  CA    . PHE E  1 37  ? 21.563  -15.505 44.250  1.00 51.00 ? 1010 PHE E CA    1 
ATOM   9069  C  C     . PHE E  1 37  ? 21.534  -14.278 43.328  1.00 48.20 ? 1010 PHE E C     1 
ATOM   9070  O  O     . PHE E  1 37  ? 21.524  -13.142 43.801  1.00 46.98 ? 1010 PHE E O     1 
ATOM   9071  C  CB    . PHE E  1 37  ? 21.277  -16.817 43.488  1.00 50.92 ? 1010 PHE E CB    1 
ATOM   9072  C  CG    . PHE E  1 37  ? 21.379  -18.054 44.347  1.00 49.58 ? 1010 PHE E CG    1 
ATOM   9073  C  CD1   . PHE E  1 37  ? 22.605  -18.691 44.530  1.00 48.86 ? 1010 PHE E CD1   1 
ATOM   9074  C  CD2   . PHE E  1 37  ? 20.251  -18.575 44.983  1.00 44.12 ? 1010 PHE E CD2   1 
ATOM   9075  C  CE1   . PHE E  1 37  ? 22.704  -19.834 45.330  1.00 45.92 ? 1010 PHE E CE1   1 
ATOM   9076  C  CE2   . PHE E  1 37  ? 20.341  -19.710 45.784  1.00 43.10 ? 1010 PHE E CE2   1 
ATOM   9077  C  CZ    . PHE E  1 37  ? 21.572  -20.341 45.958  1.00 43.72 ? 1010 PHE E CZ    1 
ATOM   9078  N  N     . GLY E  1 38  ? 21.527  -14.507 42.021  1.00 49.03 ? 1011 GLY E N     1 
ATOM   9079  C  CA    . GLY E  1 38  ? 21.347  -13.417 41.071  1.00 51.92 ? 1011 GLY E CA    1 
ATOM   9080  C  C     . GLY E  1 38  ? 22.437  -13.309 40.030  1.00 52.67 ? 1011 GLY E C     1 
ATOM   9081  O  O     . GLY E  1 38  ? 23.018  -14.313 39.615  1.00 52.03 ? 1011 GLY E O     1 
ATOM   9082  N  N     . PHE E  1 39  ? 22.700  -12.074 39.609  1.00 53.59 ? 1012 PHE E N     1 
ATOM   9083  C  CA    . PHE E  1 39  ? 23.670  -11.788 38.557  1.00 52.49 ? 1012 PHE E CA    1 
ATOM   9084  C  C     . PHE E  1 39  ? 24.977  -11.225 39.113  1.00 48.73 ? 1012 PHE E C     1 
ATOM   9085  O  O     . PHE E  1 39  ? 25.922  -10.987 38.363  1.00 48.10 ? 1012 PHE E O     1 
ATOM   9086  C  CB    . PHE E  1 39  ? 23.076  -10.812 37.534  1.00 56.46 ? 1012 PHE E CB    1 
ATOM   9087  C  CG    . PHE E  1 39  ? 21.952  -11.387 36.709  1.00 60.48 ? 1012 PHE E CG    1 
ATOM   9088  C  CD1   . PHE E  1 39  ? 22.086  -12.622 36.072  1.00 65.52 ? 1012 PHE E CD1   1 
ATOM   9089  C  CD2   . PHE E  1 39  ? 20.769  -10.673 36.537  1.00 63.27 ? 1012 PHE E CD2   1 
ATOM   9090  C  CE1   . PHE E  1 39  ? 21.046  -13.147 35.297  1.00 64.53 ? 1012 PHE E CE1   1 
ATOM   9091  C  CE2   . PHE E  1 39  ? 19.725  -11.188 35.764  1.00 62.44 ? 1012 PHE E CE2   1 
ATOM   9092  C  CZ    . PHE E  1 39  ? 19.866  -12.427 35.143  1.00 61.83 ? 1012 PHE E CZ    1 
ATOM   9093  N  N     . VAL E  1 40  ? 25.024  -11.006 40.425  1.00 43.60 ? 1013 VAL E N     1 
ATOM   9094  C  CA    . VAL E  1 40  ? 26.228  -10.499 41.077  1.00 41.29 ? 1013 VAL E CA    1 
ATOM   9095  C  C     . VAL E  1 40  ? 26.797  -11.585 41.985  1.00 39.96 ? 1013 VAL E C     1 
ATOM   9096  O  O     . VAL E  1 40  ? 26.084  -12.140 42.822  1.00 45.47 ? 1013 VAL E O     1 
ATOM   9097  C  CB    . VAL E  1 40  ? 25.974  -9.171  41.849  1.00 37.06 ? 1013 VAL E CB    1 
ATOM   9098  C  CG1   . VAL E  1 40  ? 27.281  -8.576  42.342  1.00 38.84 ? 1013 VAL E CG1   1 
ATOM   9099  C  CG2   . VAL E  1 40  ? 25.264  -8.166  40.965  1.00 35.91 ? 1013 VAL E CG2   1 
ATOM   9100  N  N     . TRP E  1 41  ? 28.075  -11.898 41.782  1.00 39.15 ? 1014 TRP E N     1 
ATOM   9101  C  CA    . TRP E  1 41  ? 28.752  -13.009 42.452  1.00 39.23 ? 1014 TRP E CA    1 
ATOM   9102  C  C     . TRP E  1 41  ? 30.180  -12.622 42.802  1.00 41.45 ? 1014 TRP E C     1 
ATOM   9103  O  O     . TRP E  1 41  ? 30.723  -11.666 42.252  1.00 43.88 ? 1014 TRP E O     1 
ATOM   9104  C  CB    . TRP E  1 41  ? 28.807  -14.246 41.544  1.00 37.02 ? 1014 TRP E CB    1 
ATOM   9105  C  CG    . TRP E  1 41  ? 27.485  -14.851 41.199  1.00 37.42 ? 1014 TRP E CG    1 
ATOM   9106  C  CD1   . TRP E  1 41  ? 26.524  -14.310 40.401  1.00 41.23 ? 1014 TRP E CD1   1 
ATOM   9107  C  CD2   . TRP E  1 41  ? 26.995  -16.136 41.600  1.00 42.68 ? 1014 TRP E CD2   1 
ATOM   9108  N  NE1   . TRP E  1 41  ? 25.455  -15.161 40.299  1.00 46.08 ? 1014 TRP E NE1   1 
ATOM   9109  C  CE2   . TRP E  1 41  ? 25.714  -16.291 41.026  1.00 45.59 ? 1014 TRP E CE2   1 
ATOM   9110  C  CE3   . TRP E  1 41  ? 27.507  -17.167 42.400  1.00 46.51 ? 1014 TRP E CE3   1 
ATOM   9111  C  CZ2   . TRP E  1 41  ? 24.933  -17.435 41.223  1.00 42.64 ? 1014 TRP E CZ2   1 
ATOM   9112  C  CZ3   . TRP E  1 41  ? 26.727  -18.308 42.597  1.00 45.10 ? 1014 TRP E CZ3   1 
ATOM   9113  C  CH2   . TRP E  1 41  ? 25.454  -18.428 42.007  1.00 41.19 ? 1014 TRP E CH2   1 
ATOM   9114  N  N     . THR E  1 42  ? 30.782  -13.384 43.714  1.00 45.73 ? 1015 THR E N     1 
ATOM   9115  C  CA    . THR E  1 42  ? 32.220  -13.323 43.982  1.00 44.68 ? 1015 THR E CA    1 
ATOM   9116  C  C     . THR E  1 42  ? 32.930  -14.379 43.120  1.00 46.59 ? 1015 THR E C     1 
ATOM   9117  O  O     . THR E  1 42  ? 32.494  -15.529 43.051  1.00 45.88 ? 1015 THR E O     1 
ATOM   9118  C  CB    . THR E  1 42  ? 32.521  -13.564 45.488  1.00 44.03 ? 1015 THR E CB    1 
ATOM   9119  O  OG1   . THR E  1 42  ? 31.930  -12.518 46.270  1.00 44.90 ? 1015 THR E OG1   1 
ATOM   9120  C  CG2   . THR E  1 42  ? 34.030  -13.613 45.771  1.00 37.11 ? 1015 THR E CG2   1 
ATOM   9121  N  N     . ALA E  1 43  ? 34.008  -13.974 42.455  1.00 48.38 ? 1016 ALA E N     1 
ATOM   9122  C  CA    . ALA E  1 43  ? 34.838  -14.889 41.675  1.00 50.88 ? 1016 ALA E CA    1 
ATOM   9123  C  C     . ALA E  1 43  ? 36.293  -14.893 42.178  1.00 53.22 ? 1016 ALA E C     1 
ATOM   9124  O  O     . ALA E  1 43  ? 36.671  -14.078 43.027  1.00 50.70 ? 1016 ALA E O     1 
ATOM   9125  C  CB    . ALA E  1 43  ? 34.773  -14.535 40.190  1.00 48.44 ? 1016 ALA E CB    1 
ATOM   9126  N  N     . VAL E  1 44  ? 37.095  -15.823 41.660  1.00 56.46 ? 1017 VAL E N     1 
ATOM   9127  C  CA    . VAL E  1 44  ? 38.498  -15.953 42.058  1.00 59.40 ? 1017 VAL E CA    1 
ATOM   9128  C  C     . VAL E  1 44  ? 39.412  -16.048 40.832  1.00 60.14 ? 1017 VAL E C     1 
ATOM   9129  O  O     . VAL E  1 44  ? 39.159  -16.837 39.916  1.00 61.89 ? 1017 VAL E O     1 
ATOM   9130  C  CB    . VAL E  1 44  ? 38.718  -17.168 43.016  1.00 60.57 ? 1017 VAL E CB    1 
ATOM   9131  C  CG1   . VAL E  1 44  ? 40.203  -17.462 43.210  1.00 62.61 ? 1017 VAL E CG1   1 
ATOM   9132  C  CG2   . VAL E  1 44  ? 38.059  -16.918 44.368  1.00 60.00 ? 1017 VAL E CG2   1 
ATOM   9133  N  N     . ASP E  1 45  ? 40.460  -15.224 40.826  1.00 60.85 ? 1018 ASP E N     1 
ATOM   9134  C  CA    . ASP E  1 45  ? 41.496  -15.248 39.791  1.00 60.83 ? 1018 ASP E CA    1 
ATOM   9135  C  C     . ASP E  1 45  ? 42.355  -16.503 39.958  1.00 61.36 ? 1018 ASP E C     1 
ATOM   9136  O  O     . ASP E  1 45  ? 42.822  -16.796 41.057  1.00 60.42 ? 1018 ASP E O     1 
ATOM   9137  C  CB    . ASP E  1 45  ? 42.371  -13.993 39.906  1.00 59.80 ? 1018 ASP E CB    1 
ATOM   9138  C  CG    . ASP E  1 45  ? 43.109  -13.659 38.618  1.00 59.98 ? 1018 ASP E CG    1 
ATOM   9139  O  OD1   . ASP E  1 45  ? 42.974  -12.510 38.155  1.00 59.06 ? 1018 ASP E OD1   1 
ATOM   9140  O  OD2   . ASP E  1 45  ? 43.826  -14.525 38.068  1.00 58.78 ? 1018 ASP E OD2   1 
ATOM   9141  N  N     . LYS E  1 46  ? 42.562  -17.239 38.868  1.00 64.15 ? 1019 LYS E N     1 
ATOM   9142  C  CA    . LYS E  1 46  ? 43.347  -18.479 38.914  1.00 65.52 ? 1019 LYS E CA    1 
ATOM   9143  C  C     . LYS E  1 46  ? 44.824  -18.256 38.558  1.00 66.69 ? 1019 LYS E C     1 
ATOM   9144  O  O     . LYS E  1 46  ? 45.437  -19.060 37.850  1.00 67.51 ? 1019 LYS E O     1 
ATOM   9145  C  CB    . LYS E  1 46  ? 42.708  -19.556 38.026  1.00 64.94 ? 1019 LYS E CB    1 
ATOM   9146  C  CG    . LYS E  1 46  ? 41.357  -20.067 38.538  1.00 64.87 ? 1019 LYS E CG    1 
ATOM   9147  C  CD    . LYS E  1 46  ? 40.652  -20.952 37.514  1.00 65.49 ? 1019 LYS E CD    1 
ATOM   9148  C  CE    . LYS E  1 46  ? 40.137  -20.145 36.328  1.00 62.81 ? 1019 LYS E CE    1 
ATOM   9149  N  NZ    . LYS E  1 46  ? 39.444  -21.003 35.333  1.00 60.39 ? 1019 LYS E NZ    1 
ATOM   9150  N  N     . GLU E  1 47  ? 45.380  -17.155 39.060  1.00 68.89 ? 1020 GLU E N     1 
ATOM   9151  C  CA    . GLU E  1 47  ? 46.796  -16.824 38.899  1.00 71.69 ? 1020 GLU E CA    1 
ATOM   9152  C  C     . GLU E  1 47  ? 47.346  -16.258 40.209  1.00 72.77 ? 1020 GLU E C     1 
ATOM   9153  O  O     . GLU E  1 47  ? 48.125  -16.920 40.903  1.00 73.55 ? 1020 GLU E O     1 
ATOM   9154  C  CB    . GLU E  1 47  ? 47.007  -15.818 37.760  1.00 71.47 ? 1020 GLU E CB    1 
ATOM   9155  C  CG    . GLU E  1 47  ? 47.028  -16.419 36.355  1.00 71.25 ? 1020 GLU E CG    1 
ATOM   9156  C  CD    . GLU E  1 47  ? 47.649  -15.484 35.322  1.00 73.16 ? 1020 GLU E CD    1 
ATOM   9157  O  OE1   . GLU E  1 47  ? 48.322  -14.506 35.716  1.00 74.64 ? 1020 GLU E OE1   1 
ATOM   9158  O  OE2   . GLU E  1 47  ? 47.471  -15.730 34.109  1.00 75.83 ? 1020 GLU E OE2   1 
ATOM   9159  N  N     . LYS E  1 48  ? 46.930  -15.035 40.537  1.00 72.67 ? 1021 LYS E N     1 
ATOM   9160  C  CA    . LYS E  1 48  ? 47.320  -14.377 41.783  1.00 71.46 ? 1021 LYS E CA    1 
ATOM   9161  C  C     . LYS E  1 48  ? 46.449  -14.836 42.956  1.00 69.96 ? 1021 LYS E C     1 
ATOM   9162  O  O     . LYS E  1 48  ? 46.793  -14.612 44.119  1.00 69.01 ? 1021 LYS E O     1 
ATOM   9163  C  CB    . LYS E  1 48  ? 47.252  -12.856 41.627  1.00 71.32 ? 1021 LYS E CB    1 
ATOM   9164  N  N     . ASN E  1 49  ? 45.329  -15.480 42.627  1.00 70.08 ? 1022 ASN E N     1 
ATOM   9165  C  CA    . ASN E  1 49  ? 44.380  -16.049 43.597  1.00 69.34 ? 1022 ASN E CA    1 
ATOM   9166  C  C     . ASN E  1 49  ? 43.751  -15.043 44.557  1.00 68.20 ? 1022 ASN E C     1 
ATOM   9167  O  O     . ASN E  1 49  ? 43.817  -15.196 45.783  1.00 67.93 ? 1022 ASN E O     1 
ATOM   9168  C  CB    . ASN E  1 49  ? 44.985  -17.251 44.334  1.00 70.38 ? 1022 ASN E CB    1 
ATOM   9169  C  CG    . ASN E  1 49  ? 45.119  -18.468 43.439  1.00 73.40 ? 1022 ASN E CG    1 
ATOM   9170  O  OD1   . ASN E  1 49  ? 44.120  -19.057 43.022  1.00 80.38 ? 1022 ASN E OD1   1 
ATOM   9171  N  ND2   . ASN E  1 49  ? 46.357  -18.853 43.139  1.00 68.71 ? 1022 ASN E ND2   1 
ATOM   9172  N  N     . LYS E  1 50  ? 43.132  -14.020 43.971  1.00 65.26 ? 1023 LYS E N     1 
ATOM   9173  C  CA    . LYS E  1 50  ? 42.472  -12.957 44.720  1.00 62.90 ? 1023 LYS E CA    1 
ATOM   9174  C  C     . LYS E  1 50  ? 40.976  -12.901 44.411  1.00 60.85 ? 1023 LYS E C     1 
ATOM   9175  O  O     . LYS E  1 50  ? 40.555  -13.147 43.275  1.00 60.08 ? 1023 LYS E O     1 
ATOM   9176  C  CB    . LYS E  1 50  ? 43.128  -11.606 44.417  1.00 62.72 ? 1023 LYS E CB    1 
ATOM   9177  N  N     . GLU E  1 51  ? 40.185  -12.578 45.435  1.00 58.00 ? 1024 GLU E N     1 
ATOM   9178  C  CA    . GLU E  1 51  ? 38.734  -12.449 45.302  1.00 55.53 ? 1024 GLU E CA    1 
ATOM   9179  C  C     . GLU E  1 51  ? 38.329  -11.209 44.509  1.00 51.96 ? 1024 GLU E C     1 
ATOM   9180  O  O     . GLU E  1 51  ? 38.807  -10.102 44.774  1.00 47.87 ? 1024 GLU E O     1 
ATOM   9181  C  CB    . GLU E  1 51  ? 38.068  -12.403 46.673  1.00 55.16 ? 1024 GLU E CB    1 
ATOM   9182  C  CG    . GLU E  1 51  ? 37.844  -13.748 47.325  1.00 60.83 ? 1024 GLU E CG    1 
ATOM   9183  C  CD    . GLU E  1 51  ? 37.017  -13.636 48.595  1.00 66.26 ? 1024 GLU E CD    1 
ATOM   9184  O  OE1   . GLU E  1 51  ? 36.840  -12.505 49.098  1.00 69.36 ? 1024 GLU E OE1   1 
ATOM   9185  O  OE2   . GLU E  1 51  ? 36.542  -14.679 49.093  1.00 69.01 ? 1024 GLU E OE2   1 
ATOM   9186  N  N     . VAL E  1 52  ? 37.442  -11.421 43.536  1.00 49.17 ? 1025 VAL E N     1 
ATOM   9187  C  CA    . VAL E  1 52  ? 36.867  -10.352 42.720  1.00 46.51 ? 1025 VAL E CA    1 
ATOM   9188  C  C     . VAL E  1 52  ? 35.337  -10.471 42.703  1.00 45.64 ? 1025 VAL E C     1 
ATOM   9189  O  O     . VAL E  1 52  ? 34.787  -11.450 43.205  1.00 46.23 ? 1025 VAL E O     1 
ATOM   9190  C  CB    . VAL E  1 52  ? 37.425  -10.351 41.263  1.00 43.19 ? 1025 VAL E CB    1 
ATOM   9191  C  CG1   . VAL E  1 52  ? 38.931  -10.165 41.259  1.00 45.00 ? 1025 VAL E CG1   1 
ATOM   9192  C  CG2   . VAL E  1 52  ? 37.047  -11.622 40.531  1.00 37.55 ? 1025 VAL E CG2   1 
ATOM   9193  N  N     . VAL E  1 53  ? 34.667  -9.468  42.134  1.00 43.45 ? 1026 VAL E N     1 
ATOM   9194  C  CA    . VAL E  1 53  ? 33.207  -9.461  41.979  1.00 44.04 ? 1026 VAL E CA    1 
ATOM   9195  C  C     . VAL E  1 53  ? 32.833  -9.484  40.496  1.00 40.27 ? 1026 VAL E C     1 
ATOM   9196  O  O     . VAL E  1 53  ? 33.361  -8.692  39.712  1.00 36.85 ? 1026 VAL E O     1 
ATOM   9197  C  CB    . VAL E  1 53  ? 32.549  -8.219  42.667  1.00 43.53 ? 1026 VAL E CB    1 
ATOM   9198  C  CG1   . VAL E  1 53  ? 31.067  -8.106  42.318  1.00 47.97 ? 1026 VAL E CG1   1 
ATOM   9199  C  CG2   . VAL E  1 53  ? 32.721  -8.285  44.170  1.00 40.08 ? 1026 VAL E CG2   1 
ATOM   9200  N  N     . VAL E  1 54  ? 31.924  -10.390 40.126  1.00 39.25 ? 1027 VAL E N     1 
ATOM   9201  C  CA    . VAL E  1 54  ? 31.414  -10.472 38.749  1.00 40.17 ? 1027 VAL E CA    1 
ATOM   9202  C  C     . VAL E  1 54  ? 29.920  -10.133 38.628  1.00 38.92 ? 1027 VAL E C     1 
ATOM   9203  O  O     . VAL E  1 54  ? 29.084  -10.622 39.391  1.00 40.14 ? 1027 VAL E O     1 
ATOM   9204  C  CB    . VAL E  1 54  ? 31.759  -11.839 38.049  1.00 38.26 ? 1027 VAL E CB    1 
ATOM   9205  C  CG1   . VAL E  1 54  ? 31.223  -13.031 38.837  1.00 41.78 ? 1027 VAL E CG1   1 
ATOM   9206  C  CG2   . VAL E  1 54  ? 31.258  -11.857 36.595  1.00 33.18 ? 1027 VAL E CG2   1 
ATOM   9207  N  N     . LYS E  1 55  ? 29.605  -9.280  37.664  1.00 38.27 ? 1028 LYS E N     1 
ATOM   9208  C  CA    . LYS E  1 55  ? 28.224  -8.961  37.337  1.00 35.55 ? 1028 LYS E CA    1 
ATOM   9209  C  C     . LYS E  1 55  ? 27.918  -9.475  35.929  1.00 36.21 ? 1028 LYS E C     1 
ATOM   9210  O  O     . LYS E  1 55  ? 28.559  -9.082  34.949  1.00 34.37 ? 1028 LYS E O     1 
ATOM   9211  C  CB    . LYS E  1 55  ? 27.989  -7.458  37.441  1.00 33.12 ? 1028 LYS E CB    1 
ATOM   9212  C  CG    . LYS E  1 55  ? 26.536  -7.033  37.435  1.00 30.44 ? 1028 LYS E CG    1 
ATOM   9213  C  CD    . LYS E  1 55  ? 26.421  -5.646  38.013  1.00 31.37 ? 1028 LYS E CD    1 
ATOM   9214  C  CE    . LYS E  1 55  ? 24.982  -5.244  38.214  1.00 35.24 ? 1028 LYS E CE    1 
ATOM   9215  N  NZ    . LYS E  1 55  ? 24.906  -3.816  38.621  1.00 38.12 ? 1028 LYS E NZ    1 
ATOM   9216  N  N     . PHE E  1 56  ? 26.957  -10.388 35.850  1.00 36.37 ? 1029 PHE E N     1 
ATOM   9217  C  CA    . PHE E  1 56  ? 26.506  -10.921 34.582  1.00 36.80 ? 1029 PHE E CA    1 
ATOM   9218  C  C     . PHE E  1 56  ? 25.403  -10.021 34.054  1.00 38.54 ? 1029 PHE E C     1 
ATOM   9219  O  O     . PHE E  1 56  ? 24.405  -9.771  34.738  1.00 35.31 ? 1029 PHE E O     1 
ATOM   9220  C  CB    . PHE E  1 56  ? 26.010  -12.362 34.728  1.00 30.70 ? 1029 PHE E CB    1 
ATOM   9221  C  CG    . PHE E  1 56  ? 27.051  -13.312 35.248  1.00 37.56 ? 1029 PHE E CG    1 
ATOM   9222  C  CD1   . PHE E  1 56  ? 27.991  -13.878 34.391  1.00 33.00 ? 1029 PHE E CD1   1 
ATOM   9223  C  CD2   . PHE E  1 56  ? 27.092  -13.648 36.599  1.00 37.75 ? 1029 PHE E CD2   1 
ATOM   9224  C  CE1   . PHE E  1 56  ? 28.954  -14.760 34.873  1.00 34.04 ? 1029 PHE E CE1   1 
ATOM   9225  C  CE2   . PHE E  1 56  ? 28.053  -14.529 37.088  1.00 32.95 ? 1029 PHE E CE2   1 
ATOM   9226  C  CZ    . PHE E  1 56  ? 28.984  -15.083 36.227  1.00 27.77 ? 1029 PHE E CZ    1 
ATOM   9227  N  N     . ILE E  1 57  ? 25.614  -9.519  32.840  1.00 41.91 ? 1030 ILE E N     1 
ATOM   9228  C  CA    . ILE E  1 57  ? 24.661  -8.643  32.178  1.00 42.21 ? 1030 ILE E CA    1 
ATOM   9229  C  C     . ILE E  1 57  ? 24.095  -9.371  30.965  1.00 44.94 ? 1030 ILE E C     1 
ATOM   9230  O  O     . ILE E  1 57  ? 24.773  -9.540  29.948  1.00 42.52 ? 1030 ILE E O     1 
ATOM   9231  C  CB    . ILE E  1 57  ? 25.302  -7.279  31.806  1.00 42.29 ? 1030 ILE E CB    1 
ATOM   9232  C  CG1   . ILE E  1 57  ? 25.689  -6.522  33.087  1.00 44.99 ? 1030 ILE E CG1   1 
ATOM   9233  C  CG2   . ILE E  1 57  ? 24.350  -6.438  30.949  1.00 42.09 ? 1030 ILE E CG2   1 
ATOM   9234  C  CD1   . ILE E  1 57  ? 26.796  -5.493  32.926  1.00 35.69 ? 1030 ILE E CD1   1 
ATOM   9235  N  N     . LYS E  1 58  ? 22.849  -9.820  31.099  1.00 47.23 ? 1031 LYS E N     1 
ATOM   9236  C  CA    . LYS E  1 58  ? 22.153  -10.513 30.024  1.00 46.81 ? 1031 LYS E CA    1 
ATOM   9237  C  C     . LYS E  1 58  ? 21.738  -9.506  28.953  1.00 47.49 ? 1031 LYS E C     1 
ATOM   9238  O  O     . LYS E  1 58  ? 21.002  -8.561  29.240  1.00 44.66 ? 1031 LYS E O     1 
ATOM   9239  C  CB    . LYS E  1 58  ? 20.943  -11.262 30.583  1.00 45.41 ? 1031 LYS E CB    1 
ATOM   9240  C  CG    . LYS E  1 58  ? 20.468  -12.408 29.718  1.00 40.82 ? 1031 LYS E CG    1 
ATOM   9241  C  CD    . LYS E  1 58  ? 19.325  -13.160 30.387  1.00 39.33 ? 1031 LYS E CD    1 
ATOM   9242  C  CE    . LYS E  1 58  ? 18.355  -13.727 29.352  1.00 46.42 ? 1031 LYS E CE    1 
ATOM   9243  N  NZ    . LYS E  1 58  ? 18.992  -14.691 28.409  1.00 41.20 ? 1031 LYS E NZ    1 
ATOM   9244  N  N     . LYS E  1 59  ? 22.237  -9.713  27.732  1.00 50.81 ? 1032 LYS E N     1 
ATOM   9245  C  CA    . LYS E  1 59  ? 21.985  -8.829  26.581  1.00 53.62 ? 1032 LYS E CA    1 
ATOM   9246  C  C     . LYS E  1 59  ? 20.511  -8.709  26.208  1.00 55.34 ? 1032 LYS E C     1 
ATOM   9247  O  O     . LYS E  1 59  ? 20.044  -7.623  25.849  1.00 52.00 ? 1032 LYS E O     1 
ATOM   9248  C  CB    . LYS E  1 59  ? 22.758  -9.313  25.348  1.00 55.36 ? 1032 LYS E CB    1 
ATOM   9249  C  CG    . LYS E  1 59  ? 24.104  -8.652  25.130  1.00 50.40 ? 1032 LYS E CG    1 
ATOM   9250  C  CD    . LYS E  1 59  ? 25.221  -9.474  25.716  1.00 48.76 ? 1032 LYS E CD    1 
ATOM   9251  C  CE    . LYS E  1 59  ? 26.424  -9.492  24.791  1.00 47.32 ? 1032 LYS E CE    1 
ATOM   9252  N  NZ    . LYS E  1 59  ? 26.219  -10.368 23.598  1.00 38.78 ? 1032 LYS E NZ    1 
ATOM   9253  N  N     . GLU E  1 60  ? 19.800  -9.837  26.285  1.00 58.16 ? 1033 GLU E N     1 
ATOM   9254  C  CA    . GLU E  1 60  ? 18.365  -9.915  26.007  1.00 58.64 ? 1033 GLU E CA    1 
ATOM   9255  C  C     . GLU E  1 60  ? 17.500  -9.036  26.920  1.00 58.72 ? 1033 GLU E C     1 
ATOM   9256  O  O     . GLU E  1 60  ? 16.379  -8.668  26.556  1.00 59.58 ? 1033 GLU E O     1 
ATOM   9257  C  CB    . GLU E  1 60  ? 17.898  -11.370 26.097  1.00 60.28 ? 1033 GLU E CB    1 
ATOM   9258  N  N     . LYS E  1 61  ? 18.032  -8.697  28.093  1.00 58.33 ? 1034 LYS E N     1 
ATOM   9259  C  CA    . LYS E  1 61  ? 17.296  -7.944  29.116  1.00 58.64 ? 1034 LYS E CA    1 
ATOM   9260  C  C     . LYS E  1 61  ? 17.567  -6.437  29.073  1.00 58.34 ? 1034 LYS E C     1 
ATOM   9261  O  O     . LYS E  1 61  ? 16.847  -5.659  29.703  1.00 58.84 ? 1034 LYS E O     1 
ATOM   9262  C  CB    . LYS E  1 61  ? 17.621  -8.495  30.509  1.00 59.58 ? 1034 LYS E CB    1 
ATOM   9263  C  CG    . LYS E  1 61  ? 17.475  -10.012 30.630  1.00 65.38 ? 1034 LYS E CG    1 
ATOM   9264  C  CD    . LYS E  1 61  ? 16.151  -10.444 31.249  1.00 70.44 ? 1034 LYS E CD    1 
ATOM   9265  C  CE    . LYS E  1 61  ? 16.305  -10.702 32.745  1.00 71.23 ? 1034 LYS E CE    1 
ATOM   9266  N  NZ    . LYS E  1 61  ? 15.123  -11.405 33.314  1.00 71.43 ? 1034 LYS E NZ    1 
ATOM   9267  N  N     . VAL E  1 62  ? 18.600  -6.033  28.331  1.00 56.65 ? 1035 VAL E N     1 
ATOM   9268  C  CA    . VAL E  1 62  ? 18.993  -4.625  28.239  1.00 53.00 ? 1035 VAL E CA    1 
ATOM   9269  C  C     . VAL E  1 62  ? 17.941  -3.840  27.462  1.00 54.60 ? 1035 VAL E C     1 
ATOM   9270  O  O     . VAL E  1 62  ? 17.532  -4.249  26.375  1.00 55.55 ? 1035 VAL E O     1 
ATOM   9271  C  CB    . VAL E  1 62  ? 20.382  -4.438  27.559  1.00 53.26 ? 1035 VAL E CB    1 
ATOM   9272  C  CG1   . VAL E  1 62  ? 20.837  -2.984  27.656  1.00 41.46 ? 1035 VAL E CG1   1 
ATOM   9273  C  CG2   . VAL E  1 62  ? 21.434  -5.369  28.170  1.00 49.12 ? 1035 VAL E CG2   1 
ATOM   9274  N  N     . TRP E  1 67  ? 22.743  1.058   25.978  1.00 46.77 ? 1040 TRP E N     1 
ATOM   9275  C  CA    . TRP E  1 67  ? 23.512  0.727   24.777  1.00 51.30 ? 1040 TRP E CA    1 
ATOM   9276  C  C     . TRP E  1 67  ? 24.281  1.922   24.234  1.00 51.08 ? 1040 TRP E C     1 
ATOM   9277  O  O     . TRP E  1 67  ? 23.715  2.991   24.002  1.00 53.17 ? 1040 TRP E O     1 
ATOM   9278  C  CB    . TRP E  1 67  ? 22.612  0.162   23.675  1.00 51.31 ? 1040 TRP E CB    1 
ATOM   9279  C  CG    . TRP E  1 67  ? 22.108  -1.226  23.926  1.00 52.94 ? 1040 TRP E CG    1 
ATOM   9280  C  CD1   . TRP E  1 67  ? 20.803  -1.611  24.050  1.00 50.10 ? 1040 TRP E CD1   1 
ATOM   9281  C  CD2   . TRP E  1 67  ? 22.896  -2.420  24.070  1.00 52.87 ? 1040 TRP E CD2   1 
ATOM   9282  N  NE1   . TRP E  1 67  ? 20.728  -2.966  24.266  1.00 47.99 ? 1040 TRP E NE1   1 
ATOM   9283  C  CE2   . TRP E  1 67  ? 21.995  -3.490  24.280  1.00 53.23 ? 1040 TRP E CE2   1 
ATOM   9284  C  CE3   . TRP E  1 67  ? 24.273  -2.689  24.048  1.00 51.16 ? 1040 TRP E CE3   1 
ATOM   9285  C  CZ2   . TRP E  1 67  ? 22.426  -4.814  24.466  1.00 52.45 ? 1040 TRP E CZ2   1 
ATOM   9286  C  CZ3   . TRP E  1 67  ? 24.703  -4.004  24.228  1.00 53.17 ? 1040 TRP E CZ3   1 
ATOM   9287  C  CH2   . TRP E  1 67  ? 23.779  -5.049  24.440  1.00 53.13 ? 1040 TRP E CH2   1 
ATOM   9288  N  N     . ILE E  1 68  ? 25.579  1.718   24.039  1.00 52.46 ? 1041 ILE E N     1 
ATOM   9289  C  CA    . ILE E  1 68  ? 26.484  2.734   23.514  1.00 52.61 ? 1041 ILE E CA    1 
ATOM   9290  C  C     . ILE E  1 68  ? 27.562  2.049   22.678  1.00 53.29 ? 1041 ILE E C     1 
ATOM   9291  O  O     . ILE E  1 68  ? 28.142  1.036   23.099  1.00 51.89 ? 1041 ILE E O     1 
ATOM   9292  C  CB    . ILE E  1 68  ? 27.134  3.583   24.663  1.00 53.33 ? 1041 ILE E CB    1 
ATOM   9293  C  CG1   . ILE E  1 68  ? 26.159  4.640   25.208  1.00 55.30 ? 1041 ILE E CG1   1 
ATOM   9294  C  CG2   . ILE E  1 68  ? 28.448  4.238   24.226  1.00 52.25 ? 1041 ILE E CG2   1 
ATOM   9295  C  CD1   . ILE E  1 68  ? 25.750  5.753   24.221  1.00 63.55 ? 1041 ILE E CD1   1 
ATOM   9296  N  N     . GLU E  1 69  ? 27.805  2.582   21.482  1.00 52.15 ? 1042 GLU E N     1 
ATOM   9297  C  CA    . GLU E  1 69  ? 29.001  2.223   20.733  1.00 51.62 ? 1042 GLU E CA    1 
ATOM   9298  C  C     . GLU E  1 69  ? 30.196  2.928   21.365  1.00 49.84 ? 1042 GLU E C     1 
ATOM   9299  O  O     . GLU E  1 69  ? 30.446  4.106   21.109  1.00 52.49 ? 1042 GLU E O     1 
ATOM   9300  C  CB    . GLU E  1 69  ? 28.865  2.576   19.250  1.00 51.94 ? 1042 GLU E CB    1 
ATOM   9301  C  CG    . GLU E  1 69  ? 28.619  1.374   18.346  1.00 58.85 ? 1042 GLU E CG    1 
ATOM   9302  C  CD    . GLU E  1 69  ? 27.155  0.972   18.243  1.00 66.96 ? 1042 GLU E CD    1 
ATOM   9303  O  OE1   . GLU E  1 69  ? 26.367  1.283   19.164  1.00 74.31 ? 1042 GLU E OE1   1 
ATOM   9304  O  OE2   . GLU E  1 69  ? 26.791  0.332   17.232  1.00 66.82 ? 1042 GLU E OE2   1 
ATOM   9305  N  N     . ASP E  1 70  ? 30.901  2.206   22.231  1.00 49.32 ? 1043 ASP E N     1 
ATOM   9306  C  CA    . ASP E  1 70  ? 32.115  2.713   22.854  1.00 46.00 ? 1043 ASP E CA    1 
ATOM   9307  C  C     . ASP E  1 70  ? 33.272  2.437   21.900  1.00 44.89 ? 1043 ASP E C     1 
ATOM   9308  O  O     . ASP E  1 70  ? 33.411  1.312   21.419  1.00 43.34 ? 1043 ASP E O     1 
ATOM   9309  C  CB    . ASP E  1 70  ? 32.354  2.047   24.214  1.00 41.58 ? 1043 ASP E CB    1 
ATOM   9310  C  CG    . ASP E  1 70  ? 33.530  2.660   24.976  1.00 53.00 ? 1043 ASP E CG    1 
ATOM   9311  O  OD1   . ASP E  1 70  ? 33.612  3.904   25.072  1.00 57.50 ? 1043 ASP E OD1   1 
ATOM   9312  O  OD2   . ASP E  1 70  ? 34.373  1.897   25.493  1.00 52.25 ? 1043 ASP E OD2   1 
ATOM   9313  N  N     . PRO E  1 71  ? 34.080  3.472   21.588  1.00 46.88 ? 1044 PRO E N     1 
ATOM   9314  C  CA    . PRO E  1 71  ? 35.263  3.308   20.734  1.00 43.99 ? 1044 PRO E CA    1 
ATOM   9315  C  C     . PRO E  1 71  ? 36.212  2.193   21.205  1.00 38.71 ? 1044 PRO E C     1 
ATOM   9316  O  O     . PRO E  1 71  ? 36.644  1.370   20.402  1.00 37.91 ? 1044 PRO E O     1 
ATOM   9317  C  CB    . PRO E  1 71  ? 35.951  4.685   20.814  1.00 43.46 ? 1044 PRO E CB    1 
ATOM   9318  C  CG    . PRO E  1 71  ? 35.306  5.392   21.971  1.00 47.14 ? 1044 PRO E CG    1 
ATOM   9319  C  CD    . PRO E  1 71  ? 33.910  4.875   22.005  1.00 45.90 ? 1044 PRO E CD    1 
ATOM   9320  N  N     . LYS E  1 72  ? 36.506  2.162   22.500  1.00 41.37 ? 1045 LYS E N     1 
ATOM   9321  C  CA    . LYS E  1 72  ? 37.470  1.215   23.059  1.00 44.92 ? 1045 LYS E CA    1 
ATOM   9322  C  C     . LYS E  1 72  ? 36.953  -0.225  23.160  1.00 46.85 ? 1045 LYS E C     1 
ATOM   9323  O  O     . LYS E  1 72  ? 37.732  -1.176  23.012  1.00 46.73 ? 1045 LYS E O     1 
ATOM   9324  C  CB    . LYS E  1 72  ? 37.965  1.703   24.427  1.00 46.46 ? 1045 LYS E CB    1 
ATOM   9325  C  CG    . LYS E  1 72  ? 38.651  3.062   24.372  1.00 51.54 ? 1045 LYS E CG    1 
ATOM   9326  C  CD    . LYS E  1 72  ? 39.462  3.355   25.621  1.00 58.02 ? 1045 LYS E CD    1 
ATOM   9327  C  CE    . LYS E  1 72  ? 40.198  4.681   25.484  1.00 60.90 ? 1045 LYS E CE    1 
ATOM   9328  N  NZ    . LYS E  1 72  ? 41.100  4.945   26.638  1.00 64.08 ? 1045 LYS E NZ    1 
ATOM   9329  N  N     . LEU E  1 73  ? 35.649  -0.380  23.399  1.00 46.93 ? 1046 LEU E N     1 
ATOM   9330  C  CA    . LEU E  1 73  ? 35.065  -1.693  23.706  1.00 45.31 ? 1046 LEU E CA    1 
ATOM   9331  C  C     . LEU E  1 73  ? 34.119  -2.233  22.635  1.00 43.96 ? 1046 LEU E C     1 
ATOM   9332  O  O     . LEU E  1 73  ? 34.114  -3.440  22.356  1.00 40.13 ? 1046 LEU E O     1 
ATOM   9333  C  CB    . LEU E  1 73  ? 34.351  -1.659  25.064  1.00 43.72 ? 1046 LEU E CB    1 
ATOM   9334  C  CG    . LEU E  1 73  ? 35.186  -1.394  26.319  1.00 45.08 ? 1046 LEU E CG    1 
ATOM   9335  C  CD1   . LEU E  1 73  ? 34.265  -1.084  27.492  1.00 41.52 ? 1046 LEU E CD1   1 
ATOM   9336  C  CD2   . LEU E  1 73  ? 36.113  -2.564  26.651  1.00 39.78 ? 1046 LEU E CD2   1 
ATOM   9337  N  N     . GLY E  1 74  ? 33.319  -1.342  22.051  1.00 41.22 ? 1047 GLY E N     1 
ATOM   9338  C  CA    . GLY E  1 74  ? 32.342  -1.719  21.027  1.00 43.32 ? 1047 GLY E CA    1 
ATOM   9339  C  C     . GLY E  1 74  ? 30.913  -1.444  21.461  1.00 43.26 ? 1047 GLY E C     1 
ATOM   9340  O  O     . GLY E  1 74  ? 30.650  -0.462  22.156  1.00 44.89 ? 1047 GLY E O     1 
ATOM   9341  N  N     . LYS E  1 75  ? 29.991  -2.315  21.054  1.00 42.70 ? 1048 LYS E N     1 
ATOM   9342  C  CA    . LYS E  1 75  ? 28.582  -2.174  21.419  1.00 45.10 ? 1048 LYS E CA    1 
ATOM   9343  C  C     . LYS E  1 75  ? 28.353  -2.755  22.818  1.00 45.38 ? 1048 LYS E C     1 
ATOM   9344  O  O     . LYS E  1 75  ? 28.094  -3.954  22.971  1.00 46.56 ? 1048 LYS E O     1 
ATOM   9345  C  CB    . LYS E  1 75  ? 27.685  -2.864  20.383  1.00 45.43 ? 1048 LYS E CB    1 
ATOM   9346  C  CG    . LYS E  1 75  ? 26.515  -2.012  19.898  1.00 46.52 ? 1048 LYS E CG    1 
ATOM   9347  C  CD    . LYS E  1 75  ? 25.260  -2.205  20.720  1.00 48.06 ? 1048 LYS E CD    1 
ATOM   9348  C  CE    . LYS E  1 75  ? 24.228  -3.061  19.988  1.00 58.49 ? 1048 LYS E CE    1 
ATOM   9349  N  NZ    . LYS E  1 75  ? 24.641  -4.486  19.825  1.00 58.91 ? 1048 LYS E NZ    1 
ATOM   9350  N  N     . VAL E  1 76  ? 28.478  -1.899  23.832  1.00 45.38 ? 1049 VAL E N     1 
ATOM   9351  C  CA    . VAL E  1 76  ? 28.323  -2.306  25.238  1.00 44.41 ? 1049 VAL E CA    1 
ATOM   9352  C  C     . VAL E  1 76  ? 27.236  -1.459  25.900  1.00 43.12 ? 1049 VAL E C     1 
ATOM   9353  O  O     . VAL E  1 76  ? 26.837  -0.440  25.346  1.00 46.25 ? 1049 VAL E O     1 
ATOM   9354  C  CB    . VAL E  1 76  ? 29.673  -2.216  26.032  1.00 43.68 ? 1049 VAL E CB    1 
ATOM   9355  C  CG1   . VAL E  1 76  ? 30.757  -3.079  25.373  1.00 39.94 ? 1049 VAL E CG1   1 
ATOM   9356  C  CG2   . VAL E  1 76  ? 30.148  -0.756  26.188  1.00 36.28 ? 1049 VAL E CG2   1 
ATOM   9357  N  N     . THR E  1 77  ? 26.755  -1.875  27.073  1.00 42.04 ? 1050 THR E N     1 
ATOM   9358  C  CA    . THR E  1 77  ? 25.741  -1.094  27.804  1.00 40.94 ? 1050 THR E CA    1 
ATOM   9359  C  C     . THR E  1 77  ? 26.334  0.172   28.419  1.00 39.83 ? 1050 THR E C     1 
ATOM   9360  O  O     . THR E  1 77  ? 27.553  0.342   28.464  1.00 44.47 ? 1050 THR E O     1 
ATOM   9361  C  CB    . THR E  1 77  ? 25.005  -1.911  28.920  1.00 38.84 ? 1050 THR E CB    1 
ATOM   9362  O  OG1   . THR E  1 77  ? 25.932  -2.280  29.949  1.00 35.13 ? 1050 THR E OG1   1 
ATOM   9363  C  CG2   . THR E  1 77  ? 24.349  -3.158  28.350  1.00 32.44 ? 1050 THR E CG2   1 
ATOM   9364  N  N     . LEU E  1 78  ? 25.454  1.044   28.902  1.00 36.93 ? 1051 LEU E N     1 
ATOM   9365  C  CA    . LEU E  1 78  ? 25.839  2.301   29.527  1.00 38.44 ? 1051 LEU E CA    1 
ATOM   9366  C  C     . LEU E  1 78  ? 26.534  2.124   30.889  1.00 42.43 ? 1051 LEU E C     1 
ATOM   9367  O  O     . LEU E  1 78  ? 27.401  2.926   31.255  1.00 43.27 ? 1051 LEU E O     1 
ATOM   9368  C  CB    . LEU E  1 78  ? 24.603  3.198   29.648  1.00 41.99 ? 1051 LEU E CB    1 
ATOM   9369  C  CG    . LEU E  1 78  ? 24.684  4.726   29.654  1.00 39.71 ? 1051 LEU E CG    1 
ATOM   9370  C  CD1   . LEU E  1 78  ? 25.787  5.254   28.752  1.00 45.19 ? 1051 LEU E CD1   1 
ATOM   9371  C  CD2   . LEU E  1 78  ? 23.340  5.297   29.247  1.00 34.43 ? 1051 LEU E CD2   1 
ATOM   9372  N  N     . GLU E  1 79  ? 26.167  1.081   31.636  1.00 41.87 ? 1052 GLU E N     1 
ATOM   9373  C  CA    . GLU E  1 79  ? 26.868  0.761   32.884  1.00 41.91 ? 1052 GLU E CA    1 
ATOM   9374  C  C     . GLU E  1 79  ? 28.317  0.330   32.618  1.00 39.65 ? 1052 GLU E C     1 
ATOM   9375  O  O     . GLU E  1 79  ? 29.237  0.728   33.339  1.00 38.51 ? 1052 GLU E O     1 
ATOM   9376  C  CB    . GLU E  1 79  ? 26.134  -0.322  33.691  1.00 41.86 ? 1052 GLU E CB    1 
ATOM   9377  C  CG    . GLU E  1 79  ? 26.818  -0.642  35.032  1.00 40.85 ? 1052 GLU E CG    1 
ATOM   9378  C  CD    . GLU E  1 79  ? 26.201  -1.810  35.799  1.00 45.30 ? 1052 GLU E CD    1 
ATOM   9379  O  OE1   . GLU E  1 79  ? 25.227  -2.425  35.308  1.00 42.44 ? 1052 GLU E OE1   1 
ATOM   9380  O  OE2   . GLU E  1 79  ? 26.707  -2.109  36.908  1.00 43.65 ? 1052 GLU E OE2   1 
ATOM   9381  N  N     . ILE E  1 80  ? 28.509  -0.489  31.587  1.00 34.77 ? 1053 ILE E N     1 
ATOM   9382  C  CA    . ILE E  1 80  ? 29.848  -0.923  31.209  1.00 35.29 ? 1053 ILE E CA    1 
ATOM   9383  C  C     . ILE E  1 80  ? 30.657  0.243   30.648  1.00 35.81 ? 1053 ILE E C     1 
ATOM   9384  O  O     . ILE E  1 80  ? 31.771  0.491   31.101  1.00 40.54 ? 1053 ILE E O     1 
ATOM   9385  C  CB    . ILE E  1 80  ? 29.829  -2.089  30.202  1.00 35.57 ? 1053 ILE E CB    1 
ATOM   9386  C  CG1   . ILE E  1 80  ? 29.074  -3.284  30.789  1.00 34.31 ? 1053 ILE E CG1   1 
ATOM   9387  C  CG2   . ILE E  1 80  ? 31.247  -2.487  29.856  1.00 29.14 ? 1053 ILE E CG2   1 
ATOM   9388  C  CD1   . ILE E  1 80  ? 28.665  -4.292  29.777  1.00 35.29 ? 1053 ILE E CD1   1 
ATOM   9389  N  N     . ALA E  1 81  ? 30.086  0.950   29.676  1.00 34.42 ? 1054 ALA E N     1 
ATOM   9390  C  CA    . ALA E  1 81  ? 30.731  2.119   29.069  1.00 38.58 ? 1054 ALA E CA    1 
ATOM   9391  C  C     . ALA E  1 81  ? 31.139  3.171   30.102  1.00 40.07 ? 1054 ALA E C     1 
ATOM   9392  O  O     . ALA E  1 81  ? 32.279  3.632   30.094  1.00 45.42 ? 1054 ALA E O     1 
ATOM   9393  C  CB    . ALA E  1 81  ? 29.836  2.732   27.986  1.00 35.50 ? 1054 ALA E CB    1 
ATOM   9394  N  N     . ILE E  1 82  ? 30.219  3.529   30.995  1.00 42.15 ? 1055 ILE E N     1 
ATOM   9395  C  CA    . ILE E  1 82  ? 30.494  4.509   32.055  1.00 42.89 ? 1055 ILE E CA    1 
ATOM   9396  C  C     . ILE E  1 82  ? 31.569  4.044   33.043  1.00 42.87 ? 1055 ILE E C     1 
ATOM   9397  O  O     . ILE E  1 82  ? 32.489  4.808   33.345  1.00 45.33 ? 1055 ILE E O     1 
ATOM   9398  C  CB    . ILE E  1 82  ? 29.187  4.973   32.779  1.00 43.07 ? 1055 ILE E CB    1 
ATOM   9399  C  CG1   . ILE E  1 82  ? 28.428  5.969   31.891  1.00 42.89 ? 1055 ILE E CG1   1 
ATOM   9400  C  CG2   . ILE E  1 82  ? 29.482  5.603   34.148  1.00 42.82 ? 1055 ILE E CG2   1 
ATOM   9401  C  CD1   . ILE E  1 82  ? 26.957  6.157   32.259  1.00 43.91 ? 1055 ILE E CD1   1 
ATOM   9402  N  N     . LEU E  1 83  ? 31.469  2.800   33.523  1.00 41.57 ? 1056 LEU E N     1 
ATOM   9403  C  CA    . LEU E  1 83  ? 32.457  2.254   34.469  1.00 42.03 ? 1056 LEU E CA    1 
ATOM   9404  C  C     . LEU E  1 83  ? 33.850  2.068   33.866  1.00 44.04 ? 1056 LEU E C     1 
ATOM   9405  O  O     . LEU E  1 83  ? 34.848  2.013   34.595  1.00 45.72 ? 1056 LEU E O     1 
ATOM   9406  C  CB    . LEU E  1 83  ? 31.982  0.935   35.091  1.00 40.33 ? 1056 LEU E CB    1 
ATOM   9407  C  CG    . LEU E  1 83  ? 31.360  0.907   36.490  1.00 38.81 ? 1056 LEU E CG    1 
ATOM   9408  C  CD1   . LEU E  1 83  ? 31.204  -0.543  36.948  1.00 30.66 ? 1056 LEU E CD1   1 
ATOM   9409  C  CD2   . LEU E  1 83  ? 32.171  1.697   37.512  1.00 32.82 ? 1056 LEU E CD2   1 
ATOM   9410  N  N     . SER E  1 84  ? 33.903  1.963   32.539  1.00 46.21 ? 1057 SER E N     1 
ATOM   9411  C  CA    . SER E  1 84  ? 35.158  1.921   31.781  1.00 46.16 ? 1057 SER E CA    1 
ATOM   9412  C  C     . SER E  1 84  ? 35.881  3.263   31.781  1.00 46.94 ? 1057 SER E C     1 
ATOM   9413  O  O     . SER E  1 84  ? 37.107  3.307   31.702  1.00 50.47 ? 1057 SER E O     1 
ATOM   9414  C  CB    . SER E  1 84  ? 34.885  1.523   30.330  1.00 38.09 ? 1057 SER E CB    1 
ATOM   9415  O  OG    . SER E  1 84  ? 34.134  0.334   30.286  1.00 46.97 ? 1057 SER E OG    1 
ATOM   9416  N  N     . ARG E  1 85  ? 35.115  4.348   31.862  1.00 46.42 ? 1058 ARG E N     1 
ATOM   9417  C  CA    . ARG E  1 85  ? 35.643  5.693   31.628  1.00 49.21 ? 1058 ARG E CA    1 
ATOM   9418  C  C     . ARG E  1 85  ? 35.993  6.458   32.907  1.00 51.46 ? 1058 ARG E C     1 
ATOM   9419  O  O     . ARG E  1 85  ? 36.802  7.394   32.871  1.00 50.71 ? 1058 ARG E O     1 
ATOM   9420  C  CB    . ARG E  1 85  ? 34.654  6.505   30.784  1.00 48.03 ? 1058 ARG E CB    1 
ATOM   9421  C  CG    . ARG E  1 85  ? 34.453  5.983   29.364  1.00 49.16 ? 1058 ARG E CG    1 
ATOM   9422  C  CD    . ARG E  1 85  ? 33.182  6.559   28.733  1.00 52.71 ? 1058 ARG E CD    1 
ATOM   9423  N  NE    . ARG E  1 85  ? 32.840  5.900   27.473  1.00 50.21 ? 1058 ARG E NE    1 
ATOM   9424  C  CZ    . ARG E  1 85  ? 31.731  6.123   26.769  1.00 53.47 ? 1058 ARG E CZ    1 
ATOM   9425  N  NH1   . ARG E  1 85  ? 30.821  7.000   27.184  1.00 56.02 ? 1058 ARG E NH1   1 
ATOM   9426  N  NH2   . ARG E  1 85  ? 31.530  5.464   25.638  1.00 46.91 ? 1058 ARG E NH2   1 
ATOM   9427  N  N     . VAL E  1 86  ? 35.384  6.057   34.025  1.00 51.19 ? 1059 VAL E N     1 
ATOM   9428  C  CA    . VAL E  1 86  ? 35.569  6.742   35.308  1.00 47.68 ? 1059 VAL E CA    1 
ATOM   9429  C  C     . VAL E  1 86  ? 36.535  6.016   36.248  1.00 50.20 ? 1059 VAL E C     1 
ATOM   9430  O  O     . VAL E  1 86  ? 36.496  4.785   36.370  1.00 52.77 ? 1059 VAL E O     1 
ATOM   9431  C  CB    . VAL E  1 86  ? 34.209  7.023   36.038  1.00 47.52 ? 1059 VAL E CB    1 
ATOM   9432  C  CG1   . VAL E  1 86  ? 33.307  7.902   35.179  1.00 40.43 ? 1059 VAL E CG1   1 
ATOM   9433  C  CG2   . VAL E  1 86  ? 33.492  5.734   36.428  1.00 36.86 ? 1059 VAL E CG2   1 
ATOM   9434  N  N     . GLU E  1 87  ? 37.402  6.791   36.898  1.00 48.39 ? 1060 GLU E N     1 
ATOM   9435  C  CA    . GLU E  1 87  ? 38.328  6.278   37.907  1.00 45.94 ? 1060 GLU E CA    1 
ATOM   9436  C  C     . GLU E  1 87  ? 38.393  7.239   39.097  1.00 43.34 ? 1060 GLU E C     1 
ATOM   9437  O  O     . GLU E  1 87  ? 38.676  8.429   38.930  1.00 48.48 ? 1060 GLU E O     1 
ATOM   9438  C  CB    . GLU E  1 87  ? 39.720  6.064   37.299  1.00 49.80 ? 1060 GLU E CB    1 
ATOM   9439  N  N     . HIS E  1 88  ? 38.104  6.721   40.288  1.00 40.73 ? 1061 HIS E N     1 
ATOM   9440  C  CA    . HIS E  1 88  ? 38.060  7.522   41.512  1.00 35.34 ? 1061 HIS E CA    1 
ATOM   9441  C  C     . HIS E  1 88  ? 38.311  6.635   42.738  1.00 39.40 ? 1061 HIS E C     1 
ATOM   9442  O  O     . HIS E  1 88  ? 37.979  5.445   42.731  1.00 38.16 ? 1061 HIS E O     1 
ATOM   9443  C  CB    . HIS E  1 88  ? 36.708  8.243   41.642  1.00 38.88 ? 1061 HIS E CB    1 
ATOM   9444  C  CG    . HIS E  1 88  ? 36.678  9.294   42.712  1.00 34.22 ? 1061 HIS E CG    1 
ATOM   9445  N  ND1   . HIS E  1 88  ? 36.233  9.043   43.993  1.00 33.89 ? 1061 HIS E ND1   1 
ATOM   9446  C  CD2   . HIS E  1 88  ? 37.048  10.596  42.693  1.00 31.34 ? 1061 HIS E CD2   1 
ATOM   9447  C  CE1   . HIS E  1 88  ? 36.334  10.143  44.718  1.00 31.13 ? 1061 HIS E CE1   1 
ATOM   9448  N  NE2   . HIS E  1 88  ? 36.824  11.101  43.951  1.00 35.68 ? 1061 HIS E NE2   1 
ATOM   9449  N  N     . ALA E  1 89  ? 38.897  7.225   43.783  1.00 38.18 ? 1062 ALA E N     1 
ATOM   9450  C  CA    . ALA E  1 89  ? 39.147  6.535   45.050  1.00 39.07 ? 1062 ALA E CA    1 
ATOM   9451  C  C     . ALA E  1 89  ? 37.867  5.952   45.641  1.00 39.19 ? 1062 ALA E C     1 
ATOM   9452  O  O     . ALA E  1 89  ? 37.914  5.000   46.423  1.00 43.97 ? 1062 ALA E O     1 
ATOM   9453  C  CB    . ALA E  1 89  ? 39.804  7.487   46.057  1.00 34.50 ? 1062 ALA E CB    1 
ATOM   9454  N  N     . ASN E  1 90  ? 36.729  6.535   45.268  1.00 38.29 ? 1063 ASN E N     1 
ATOM   9455  C  CA    . ASN E  1 90  ? 35.432  6.146   45.820  1.00 37.05 ? 1063 ASN E CA    1 
ATOM   9456  C  C     . ASN E  1 90  ? 34.473  5.539   44.799  1.00 33.08 ? 1063 ASN E C     1 
ATOM   9457  O  O     . ASN E  1 90  ? 33.304  5.303   45.101  1.00 32.73 ? 1063 ASN E O     1 
ATOM   9458  C  CB    . ASN E  1 90  ? 34.781  7.327   46.545  1.00 38.09 ? 1063 ASN E CB    1 
ATOM   9459  C  CG    . ASN E  1 90  ? 35.611  7.819   47.721  1.00 36.78 ? 1063 ASN E CG    1 
ATOM   9460  O  OD1   . ASN E  1 90  ? 36.045  8.974   47.745  1.00 36.15 ? 1063 ASN E OD1   1 
ATOM   9461  N  ND2   . ASN E  1 90  ? 35.845  6.941   48.698  1.00 25.37 ? 1063 ASN E ND2   1 
ATOM   9462  N  N     . ILE E  1 91  ? 34.976  5.267   43.600  1.00 31.53 ? 1064 ILE E N     1 
ATOM   9463  C  CA    . ILE E  1 91  ? 34.210  4.505   42.614  1.00 35.29 ? 1064 ILE E CA    1 
ATOM   9464  C  C     . ILE E  1 91  ? 34.856  3.138   42.376  1.00 35.93 ? 1064 ILE E C     1 
ATOM   9465  O  O     . ILE E  1 91  ? 36.078  3.025   42.256  1.00 34.56 ? 1064 ILE E O     1 
ATOM   9466  C  CB    . ILE E  1 91  ? 33.983  5.299   41.300  1.00 36.93 ? 1064 ILE E CB    1 
ATOM   9467  C  CG1   . ILE E  1 91  ? 33.225  6.603   41.611  1.00 31.12 ? 1064 ILE E CG1   1 
ATOM   9468  C  CG2   . ILE E  1 91  ? 33.232  4.445   40.276  1.00 32.64 ? 1064 ILE E CG2   1 
ATOM   9469  C  CD1   . ILE E  1 91  ? 33.026  7.530   40.434  1.00 33.18 ? 1064 ILE E CD1   1 
ATOM   9470  N  N     . ILE E  1 92  ? 34.020  2.103   42.349  1.00 37.37 ? 1065 ILE E N     1 
ATOM   9471  C  CA    . ILE E  1 92  ? 34.478  0.736   42.141  1.00 36.96 ? 1065 ILE E CA    1 
ATOM   9472  C  C     . ILE E  1 92  ? 35.267  0.606   40.838  1.00 39.77 ? 1065 ILE E C     1 
ATOM   9473  O  O     . ILE E  1 92  ? 34.865  1.132   39.799  1.00 36.80 ? 1065 ILE E O     1 
ATOM   9474  C  CB    . ILE E  1 92  ? 33.303  -0.286  42.218  1.00 37.30 ? 1065 ILE E CB    1 
ATOM   9475  C  CG1   . ILE E  1 92  ? 33.812  -1.661  42.646  1.00 33.63 ? 1065 ILE E CG1   1 
ATOM   9476  C  CG2   . ILE E  1 92  ? 32.474  -0.323  40.916  1.00 32.63 ? 1065 ILE E CG2   1 
ATOM   9477  C  CD1   . ILE E  1 92  ? 34.018  -1.795  44.141  1.00 36.78 ? 1065 ILE E CD1   1 
ATOM   9478  N  N     . LYS E  1 93  ? 36.406  -0.078  40.930  1.00 43.19 ? 1066 LYS E N     1 
ATOM   9479  C  CA    . LYS E  1 93  ? 37.337  -0.244  39.821  1.00 43.57 ? 1066 LYS E CA    1 
ATOM   9480  C  C     . LYS E  1 93  ? 37.069  -1.542  39.056  1.00 38.31 ? 1066 LYS E C     1 
ATOM   9481  O  O     . LYS E  1 93  ? 36.926  -2.609  39.649  1.00 34.34 ? 1066 LYS E O     1 
ATOM   9482  C  CB    . LYS E  1 93  ? 38.780  -0.212  40.348  1.00 45.15 ? 1066 LYS E CB    1 
ATOM   9483  C  CG    . LYS E  1 93  ? 39.869  -0.428  39.298  1.00 47.56 ? 1066 LYS E CG    1 
ATOM   9484  C  CD    . LYS E  1 93  ? 41.227  -0.613  39.968  1.00 51.70 ? 1066 LYS E CD    1 
ATOM   9485  C  CE    . LYS E  1 93  ? 42.292  -1.076  38.986  1.00 60.33 ? 1066 LYS E CE    1 
ATOM   9486  N  NZ    . LYS E  1 93  ? 43.566  -1.416  39.688  1.00 60.67 ? 1066 LYS E NZ    1 
ATOM   9487  N  N     . VAL E  1 94  ? 37.007  -1.422  37.734  1.00 38.85 ? 1067 VAL E N     1 
ATOM   9488  C  CA    . VAL E  1 94  ? 36.849  -2.552  36.818  1.00 37.64 ? 1067 VAL E CA    1 
ATOM   9489  C  C     . VAL E  1 94  ? 38.191  -3.271  36.646  1.00 40.50 ? 1067 VAL E C     1 
ATOM   9490  O  O     . VAL E  1 94  ? 39.228  -2.628  36.478  1.00 45.43 ? 1067 VAL E O     1 
ATOM   9491  C  CB    . VAL E  1 94  ? 36.343  -2.057  35.440  1.00 36.38 ? 1067 VAL E CB    1 
ATOM   9492  C  CG1   . VAL E  1 94  ? 36.132  -3.221  34.455  1.00 36.20 ? 1067 VAL E CG1   1 
ATOM   9493  C  CG2   . VAL E  1 94  ? 35.066  -1.243  35.613  1.00 26.51 ? 1067 VAL E CG2   1 
ATOM   9494  N  N     . LEU E  1 95  ? 38.174  -4.600  36.693  1.00 39.54 ? 1068 LEU E N     1 
ATOM   9495  C  CA    . LEU E  1 95  ? 39.397  -5.384  36.473  1.00 40.35 ? 1068 LEU E CA    1 
ATOM   9496  C  C     . LEU E  1 95  ? 39.457  -6.035  35.093  1.00 40.06 ? 1068 LEU E C     1 
ATOM   9497  O  O     . LEU E  1 95  ? 40.530  -6.152  34.502  1.00 39.19 ? 1068 LEU E O     1 
ATOM   9498  C  CB    . LEU E  1 95  ? 39.581  -6.438  37.569  1.00 37.66 ? 1068 LEU E CB    1 
ATOM   9499  C  CG    . LEU E  1 95  ? 39.771  -5.895  38.989  1.00 32.59 ? 1068 LEU E CG    1 
ATOM   9500  C  CD1   . LEU E  1 95  ? 39.785  -7.032  39.968  1.00 20.12 ? 1068 LEU E CD1   1 
ATOM   9501  C  CD2   . LEU E  1 95  ? 41.037  -5.053  39.119  1.00 34.89 ? 1068 LEU E CD2   1 
ATOM   9502  N  N     . ASP E  1 96  ? 38.294  -6.448  34.594  1.00 43.93 ? 1069 ASP E N     1 
ATOM   9503  C  CA    . ASP E  1 96  ? 38.162  -7.134  33.310  1.00 43.46 ? 1069 ASP E CA    1 
ATOM   9504  C  C     . ASP E  1 96  ? 36.715  -7.142  32.859  1.00 40.04 ? 1069 ASP E C     1 
ATOM   9505  O  O     . ASP E  1 96  ? 35.810  -7.293  33.667  1.00 42.97 ? 1069 ASP E O     1 
ATOM   9506  C  CB    . ASP E  1 96  ? 38.641  -8.584  33.417  1.00 43.54 ? 1069 ASP E CB    1 
ATOM   9507  C  CG    . ASP E  1 96  ? 40.067  -8.766  32.949  1.00 51.01 ? 1069 ASP E CG    1 
ATOM   9508  O  OD1   . ASP E  1 96  ? 40.419  -8.226  31.875  1.00 55.70 ? 1069 ASP E OD1   1 
ATOM   9509  O  OD2   . ASP E  1 96  ? 40.832  -9.464  33.648  1.00 54.49 ? 1069 ASP E OD2   1 
ATOM   9510  N  N     . ILE E  1 97  ? 36.496  -6.971  31.565  1.00 38.01 ? 1070 ILE E N     1 
ATOM   9511  C  CA    . ILE E  1 97  ? 35.166  -7.172  31.003  1.00 37.54 ? 1070 ILE E CA    1 
ATOM   9512  C  C     . ILE E  1 97  ? 35.227  -8.103  29.783  1.00 38.01 ? 1070 ILE E C     1 
ATOM   9513  O  O     . ILE E  1 97  ? 36.104  -7.968  28.923  1.00 34.25 ? 1070 ILE E O     1 
ATOM   9514  C  CB    . ILE E  1 97  ? 34.380  -5.824  30.767  1.00 37.34 ? 1070 ILE E CB    1 
ATOM   9515  C  CG1   . ILE E  1 97  ? 33.535  -5.892  29.486  1.00 33.68 ? 1070 ILE E CG1   1 
ATOM   9516  C  CG2   . ILE E  1 97  ? 35.321  -4.596  30.841  1.00 37.86 ? 1070 ILE E CG2   1 
ATOM   9517  C  CD1   . ILE E  1 97  ? 33.311  -4.573  28.789  1.00 32.78 ? 1070 ILE E CD1   1 
ATOM   9518  N  N     . PHE E  1 98  ? 34.313  -9.072  29.754  1.00 36.80 ? 1071 PHE E N     1 
ATOM   9519  C  CA    . PHE E  1 98  ? 34.240  -10.051 28.682  1.00 33.39 ? 1071 PHE E CA    1 
ATOM   9520  C  C     . PHE E  1 98  ? 32.858  -10.044 28.036  1.00 32.75 ? 1071 PHE E C     1 
ATOM   9521  O  O     . PHE E  1 98  ? 31.921  -9.455  28.565  1.00 28.79 ? 1071 PHE E O     1 
ATOM   9522  C  CB    . PHE E  1 98  ? 34.581  -11.447 29.211  1.00 31.97 ? 1071 PHE E CB    1 
ATOM   9523  C  CG    . PHE E  1 98  ? 35.876  -11.510 29.964  1.00 32.47 ? 1071 PHE E CG    1 
ATOM   9524  C  CD1   . PHE E  1 98  ? 37.091  -11.441 29.295  1.00 29.05 ? 1071 PHE E CD1   1 
ATOM   9525  C  CD2   . PHE E  1 98  ? 35.881  -11.635 31.352  1.00 39.76 ? 1071 PHE E CD2   1 
ATOM   9526  C  CE1   . PHE E  1 98  ? 38.297  -11.498 29.996  1.00 27.56 ? 1071 PHE E CE1   1 
ATOM   9527  C  CE2   . PHE E  1 98  ? 37.080  -11.690 32.062  1.00 32.72 ? 1071 PHE E CE2   1 
ATOM   9528  C  CZ    . PHE E  1 98  ? 38.289  -11.627 31.381  1.00 35.88 ? 1071 PHE E CZ    1 
ATOM   9529  N  N     . GLU E  1 99  ? 32.746  -10.697 26.884  1.00 37.63 ? 1072 GLU E N     1 
ATOM   9530  C  CA    . GLU E  1 99  ? 31.489  -10.781 26.146  1.00 39.31 ? 1072 GLU E CA    1 
ATOM   9531  C  C     . GLU E  1 99  ? 31.364  -12.164 25.513  1.00 40.52 ? 1072 GLU E C     1 
ATOM   9532  O  O     . GLU E  1 99  ? 32.366  -12.741 25.069  1.00 40.51 ? 1072 GLU E O     1 
ATOM   9533  C  CB    . GLU E  1 99  ? 31.446  -9.692  25.066  1.00 43.17 ? 1072 GLU E CB    1 
ATOM   9534  C  CG    . GLU E  1 99  ? 30.086  -9.475  24.398  1.00 46.54 ? 1072 GLU E CG    1 
ATOM   9535  C  CD    . GLU E  1 99  ? 29.902  -10.260 23.099  1.00 50.62 ? 1072 GLU E CD    1 
ATOM   9536  O  OE1   . GLU E  1 99  ? 30.834  -10.972 22.667  1.00 54.24 ? 1072 GLU E OE1   1 
ATOM   9537  O  OE2   . GLU E  1 99  ? 28.810  -10.162 22.499  1.00 57.26 ? 1072 GLU E OE2   1 
ATOM   9538  N  N     . ASN E  1 100 ? 30.141  -12.696 25.491  1.00 38.44 ? 1073 ASN E N     1 
ATOM   9539  C  CA    . ASN E  1 100 ? 29.826  -13.909 24.728  1.00 36.32 ? 1073 ASN E CA    1 
ATOM   9540  C  C     . ASN E  1 100 ? 28.500  -13.777 23.966  1.00 38.84 ? 1073 ASN E C     1 
ATOM   9541  O  O     . ASN E  1 100 ? 28.003  -12.669 23.767  1.00 41.54 ? 1073 ASN E O     1 
ATOM   9542  C  CB    . ASN E  1 100 ? 29.886  -15.173 25.610  1.00 32.49 ? 1073 ASN E CB    1 
ATOM   9543  C  CG    . ASN E  1 100 ? 28.965  -15.103 26.823  1.00 37.87 ? 1073 ASN E CG    1 
ATOM   9544  O  OD1   . ASN E  1 100 ? 27.989  -14.352 26.847  1.00 44.25 ? 1073 ASN E OD1   1 
ATOM   9545  N  ND2   . ASN E  1 100 ? 29.270  -15.901 27.834  1.00 34.05 ? 1073 ASN E ND2   1 
ATOM   9546  N  N     . GLN E  1 101 ? 27.936  -14.901 23.535  1.00 45.80 ? 1074 GLN E N     1 
ATOM   9547  C  CA    . GLN E  1 101 ? 26.700  -14.892 22.750  1.00 46.29 ? 1074 GLN E CA    1 
ATOM   9548  C  C     . GLN E  1 101 ? 25.580  -14.097 23.426  1.00 46.00 ? 1074 GLN E C     1 
ATOM   9549  O  O     . GLN E  1 101 ? 25.037  -13.158 22.837  1.00 47.44 ? 1074 GLN E O     1 
ATOM   9550  C  CB    . GLN E  1 101 ? 26.246  -16.323 22.438  1.00 44.71 ? 1074 GLN E CB    1 
ATOM   9551  N  N     . GLY E  1 102 ? 25.260  -14.450 24.670  1.00 46.38 ? 1075 GLY E N     1 
ATOM   9552  C  CA    . GLY E  1 102 ? 24.106  -13.864 25.350  1.00 43.25 ? 1075 GLY E CA    1 
ATOM   9553  C  C     . GLY E  1 102 ? 24.373  -12.917 26.503  1.00 42.02 ? 1075 GLY E C     1 
ATOM   9554  O  O     . GLY E  1 102 ? 23.463  -12.226 26.946  1.00 45.77 ? 1075 GLY E O     1 
ATOM   9555  N  N     . PHE E  1 103 ? 25.611  -12.878 26.990  1.00 41.58 ? 1076 PHE E N     1 
ATOM   9556  C  CA    . PHE E  1 103 ? 25.931  -12.168 28.235  1.00 40.94 ? 1076 PHE E CA    1 
ATOM   9557  C  C     . PHE E  1 103 ? 27.137  -11.220 28.119  1.00 40.17 ? 1076 PHE E C     1 
ATOM   9558  O  O     . PHE E  1 103 ? 27.980  -11.362 27.226  1.00 34.89 ? 1076 PHE E O     1 
ATOM   9559  C  CB    . PHE E  1 103 ? 26.215  -13.181 29.359  1.00 41.98 ? 1076 PHE E CB    1 
ATOM   9560  C  CG    . PHE E  1 103 ? 24.984  -13.799 29.980  1.00 39.54 ? 1076 PHE E CG    1 
ATOM   9561  C  CD1   . PHE E  1 103 ? 24.514  -13.346 31.215  1.00 41.76 ? 1076 PHE E CD1   1 
ATOM   9562  C  CD2   . PHE E  1 103 ? 24.320  -14.860 29.358  1.00 43.29 ? 1076 PHE E CD2   1 
ATOM   9563  C  CE1   . PHE E  1 103 ? 23.388  -13.922 31.812  1.00 41.36 ? 1076 PHE E CE1   1 
ATOM   9564  C  CE2   . PHE E  1 103 ? 23.188  -15.447 29.944  1.00 37.33 ? 1076 PHE E CE2   1 
ATOM   9565  C  CZ    . PHE E  1 103 ? 22.723  -14.976 31.174  1.00 40.35 ? 1076 PHE E CZ    1 
ATOM   9566  N  N     . PHE E  1 104 ? 27.191  -10.245 29.025  1.00 40.07 ? 1077 PHE E N     1 
ATOM   9567  C  CA    . PHE E  1 104 ? 28.432  -9.538  29.360  1.00 36.33 ? 1077 PHE E CA    1 
ATOM   9568  C  C     . PHE E  1 104 ? 28.885  -10.058 30.721  1.00 32.91 ? 1077 PHE E C     1 
ATOM   9569  O  O     . PHE E  1 104 ? 28.058  -10.509 31.518  1.00 27.93 ? 1077 PHE E O     1 
ATOM   9570  C  CB    . PHE E  1 104 ? 28.213  -8.023  29.465  1.00 34.23 ? 1077 PHE E CB    1 
ATOM   9571  C  CG    . PHE E  1 104 ? 28.157  -7.311  28.144  1.00 35.61 ? 1077 PHE E CG    1 
ATOM   9572  C  CD1   . PHE E  1 104 ? 26.944  -6.839  27.647  1.00 31.10 ? 1077 PHE E CD1   1 
ATOM   9573  C  CD2   . PHE E  1 104 ? 29.318  -7.086  27.406  1.00 40.61 ? 1077 PHE E CD2   1 
ATOM   9574  C  CE1   . PHE E  1 104 ? 26.884  -6.162  26.430  1.00 31.27 ? 1077 PHE E CE1   1 
ATOM   9575  C  CE2   . PHE E  1 104 ? 29.268  -6.412  26.180  1.00 42.02 ? 1077 PHE E CE2   1 
ATOM   9576  C  CZ    . PHE E  1 104 ? 28.046  -5.951  25.692  1.00 31.87 ? 1077 PHE E CZ    1 
ATOM   9577  N  N     . GLN E  1 105 ? 30.189  -10.001 30.982  1.00 31.67 ? 1078 GLN E N     1 
ATOM   9578  C  CA    . GLN E  1 105 ? 30.713  -10.259 32.320  1.00 32.69 ? 1078 GLN E CA    1 
ATOM   9579  C  C     . GLN E  1 105 ? 31.572  -9.088  32.769  1.00 34.31 ? 1078 GLN E C     1 
ATOM   9580  O  O     . GLN E  1 105 ? 32.693  -8.909  32.280  1.00 33.03 ? 1078 GLN E O     1 
ATOM   9581  C  CB    . GLN E  1 105 ? 31.509  -11.567 32.395  1.00 33.02 ? 1078 GLN E CB    1 
ATOM   9582  C  CG    . GLN E  1 105 ? 30.704  -12.825 32.048  1.00 31.08 ? 1078 GLN E CG    1 
ATOM   9583  C  CD    . GLN E  1 105 ? 30.698  -13.115 30.556  1.00 31.15 ? 1078 GLN E CD    1 
ATOM   9584  O  OE1   . GLN E  1 105 ? 29.652  -13.395 29.961  1.00 33.93 ? 1078 GLN E OE1   1 
ATOM   9585  N  NE2   . GLN E  1 105 ? 31.870  -13.034 29.940  1.00 22.57 ? 1078 GLN E NE2   1 
ATOM   9586  N  N     . LEU E  1 106 ? 31.020  -8.293  33.686  1.00 30.85 ? 1079 LEU E N     1 
ATOM   9587  C  CA    . LEU E  1 106 ? 31.692  -7.133  34.257  1.00 36.22 ? 1079 LEU E CA    1 
ATOM   9588  C  C     . LEU E  1 106 ? 32.423  -7.574  35.522  1.00 39.63 ? 1079 LEU E C     1 
ATOM   9589  O  O     . LEU E  1 106 ? 31.796  -7.992  36.498  1.00 40.60 ? 1079 LEU E O     1 
ATOM   9590  C  CB    . LEU E  1 106 ? 30.666  -6.042  34.596  1.00 37.08 ? 1079 LEU E CB    1 
ATOM   9591  C  CG    . LEU E  1 106 ? 30.918  -4.532  34.421  1.00 45.06 ? 1079 LEU E CG    1 
ATOM   9592  C  CD1   . LEU E  1 106 ? 29.900  -3.760  35.264  1.00 38.46 ? 1079 LEU E CD1   1 
ATOM   9593  C  CD2   . LEU E  1 106 ? 32.346  -4.053  34.739  1.00 33.09 ? 1079 LEU E CD2   1 
ATOM   9594  N  N     . VAL E  1 107 ? 33.751  -7.495  35.496  1.00 41.05 ? 1080 VAL E N     1 
ATOM   9595  C  CA    . VAL E  1 107 ? 34.569  -7.895  36.637  1.00 42.05 ? 1080 VAL E CA    1 
ATOM   9596  C  C     . VAL E  1 107 ? 35.108  -6.642  37.331  1.00 44.71 ? 1080 VAL E C     1 
ATOM   9597  O  O     . VAL E  1 107 ? 35.753  -5.797  36.702  1.00 44.40 ? 1080 VAL E O     1 
ATOM   9598  C  CB    . VAL E  1 107 ? 35.724  -8.854  36.212  1.00 45.00 ? 1080 VAL E CB    1 
ATOM   9599  C  CG1   . VAL E  1 107 ? 36.565  -9.285  37.413  1.00 41.37 ? 1080 VAL E CG1   1 
ATOM   9600  C  CG2   . VAL E  1 107 ? 35.171  -10.081 35.466  1.00 42.26 ? 1080 VAL E CG2   1 
ATOM   9601  N  N     . MET E  1 108 ? 34.819  -6.524  38.624  1.00 44.10 ? 1081 MET E N     1 
ATOM   9602  C  CA    . MET E  1 108 ? 35.239  -5.374  39.421  1.00 44.11 ? 1081 MET E CA    1 
ATOM   9603  C  C     . MET E  1 108 ? 36.107  -5.829  40.586  1.00 45.13 ? 1081 MET E C     1 
ATOM   9604  O  O     . MET E  1 108 ? 36.161  -7.025  40.902  1.00 44.94 ? 1081 MET E O     1 
ATOM   9605  C  CB    . MET E  1 108 ? 34.022  -4.629  39.984  1.00 43.76 ? 1081 MET E CB    1 
ATOM   9606  C  CG    . MET E  1 108 ? 33.057  -4.051  38.967  1.00 44.52 ? 1081 MET E CG    1 
ATOM   9607  S  SD    . MET E  1 108 ? 31.418  -3.768  39.694  1.00 43.01 ? 1081 MET E SD    1 
ATOM   9608  C  CE    . MET E  1 108 ? 30.743  -5.432  39.650  1.00 31.07 ? 1081 MET E CE    1 
ATOM   9609  N  N     . GLU E  1 109 ? 36.777  -4.870  41.225  1.00 46.54 ? 1082 GLU E N     1 
ATOM   9610  C  CA    . GLU E  1 109 ? 37.445  -5.117  42.503  1.00 49.53 ? 1082 GLU E CA    1 
ATOM   9611  C  C     . GLU E  1 109 ? 36.410  -5.522  43.550  1.00 50.18 ? 1082 GLU E C     1 
ATOM   9612  O  O     . GLU E  1 109 ? 35.271  -5.048  43.528  1.00 50.64 ? 1082 GLU E O     1 
ATOM   9613  C  CB    . GLU E  1 109 ? 38.226  -3.880  42.981  1.00 49.24 ? 1082 GLU E CB    1 
ATOM   9614  C  CG    . GLU E  1 109 ? 37.396  -2.586  43.056  1.00 56.66 ? 1082 GLU E CG    1 
ATOM   9615  C  CD    . GLU E  1 109 ? 37.888  -1.590  44.104  1.00 54.21 ? 1082 GLU E CD    1 
ATOM   9616  O  OE1   . GLU E  1 109 ? 38.214  -2.006  45.237  1.00 63.54 ? 1082 GLU E OE1   1 
ATOM   9617  O  OE2   . GLU E  1 109 ? 37.931  -0.379  43.798  1.00 45.71 ? 1082 GLU E OE2   1 
ATOM   9618  N  N     . LYS E  1 110 ? 36.792  -6.417  44.452  1.00 53.28 ? 1083 LYS E N     1 
ATOM   9619  C  CA    . LYS E  1 110 ? 35.955  -6.678  45.616  1.00 53.22 ? 1083 LYS E CA    1 
ATOM   9620  C  C     . LYS E  1 110 ? 36.371  -5.737  46.749  1.00 51.46 ? 1083 LYS E C     1 
ATOM   9621  O  O     . LYS E  1 110 ? 37.373  -5.978  47.436  1.00 51.14 ? 1083 LYS E O     1 
ATOM   9622  C  CB    . LYS E  1 110 ? 36.032  -8.144  46.053  1.00 51.19 ? 1083 LYS E CB    1 
ATOM   9623  C  CG    . LYS E  1 110 ? 34.950  -8.524  47.054  1.00 44.76 ? 1083 LYS E CG    1 
ATOM   9624  C  CD    . LYS E  1 110 ? 35.161  -9.909  47.610  1.00 37.07 ? 1083 LYS E CD    1 
ATOM   9625  C  CE    . LYS E  1 110 ? 33.910  -10.398 48.315  1.00 38.05 ? 1083 LYS E CE    1 
ATOM   9626  N  NZ    . LYS E  1 110 ? 34.181  -11.636 49.089  1.00 42.14 ? 1083 LYS E NZ    1 
ATOM   9627  N  N     . HIS E  1 111 ? 35.612  -4.653  46.910  1.00 49.30 ? 1084 HIS E N     1 
ATOM   9628  C  CA    . HIS E  1 111 ? 35.815  -3.711  48.010  1.00 49.32 ? 1084 HIS E CA    1 
ATOM   9629  C  C     . HIS E  1 111 ? 35.152  -4.261  49.263  1.00 49.21 ? 1084 HIS E C     1 
ATOM   9630  O  O     . HIS E  1 111 ? 33.953  -4.564  49.267  1.00 52.62 ? 1084 HIS E O     1 
ATOM   9631  C  CB    . HIS E  1 111 ? 35.258  -2.326  47.664  1.00 48.91 ? 1084 HIS E CB    1 
ATOM   9632  C  CG    . HIS E  1 111 ? 35.389  -1.320  48.771  1.00 48.40 ? 1084 HIS E CG    1 
ATOM   9633  N  ND1   . HIS E  1 111 ? 36.584  -0.713  49.089  1.00 40.43 ? 1084 HIS E ND1   1 
ATOM   9634  C  CD2   . HIS E  1 111 ? 34.469  -0.804  49.622  1.00 43.83 ? 1084 HIS E CD2   1 
ATOM   9635  C  CE1   . HIS E  1 111 ? 36.397  0.128   50.091  1.00 37.32 ? 1084 HIS E CE1   1 
ATOM   9636  N  NE2   . HIS E  1 111 ? 35.123  0.090   50.434  1.00 35.85 ? 1084 HIS E NE2   1 
ATOM   9637  N  N     . GLY E  1 112 ? 35.945  -4.398  50.319  1.00 47.37 ? 1085 GLY E N     1 
ATOM   9638  C  CA    . GLY E  1 112 ? 35.480  -5.004  51.555  1.00 45.24 ? 1085 GLY E CA    1 
ATOM   9639  C  C     . GLY E  1 112 ? 35.148  -6.469  51.364  1.00 44.58 ? 1085 GLY E C     1 
ATOM   9640  O  O     . GLY E  1 112 ? 35.914  -7.217  50.743  1.00 45.64 ? 1085 GLY E O     1 
ATOM   9641  N  N     . SER E  1 113 ? 33.992  -6.863  51.891  1.00 45.14 ? 1086 SER E N     1 
ATOM   9642  C  CA    . SER E  1 113 ? 33.530  -8.247  51.856  1.00 45.85 ? 1086 SER E CA    1 
ATOM   9643  C  C     . SER E  1 113 ? 32.120  -8.364  51.263  1.00 45.84 ? 1086 SER E C     1 
ATOM   9644  O  O     . SER E  1 113 ? 31.411  -9.341  51.516  1.00 41.78 ? 1086 SER E O     1 
ATOM   9645  C  CB    . SER E  1 113 ? 33.550  -8.839  53.269  1.00 44.54 ? 1086 SER E CB    1 
ATOM   9646  O  OG    . SER E  1 113 ? 32.508  -8.292  54.053  1.00 42.16 ? 1086 SER E OG    1 
ATOM   9647  N  N     . GLY E  1 114 ? 31.723  -7.367  50.473  1.00 46.36 ? 1087 GLY E N     1 
ATOM   9648  C  CA    . GLY E  1 114 ? 30.380  -7.324  49.895  1.00 42.74 ? 1087 GLY E CA    1 
ATOM   9649  C  C     . GLY E  1 114 ? 29.368  -6.734  50.859  1.00 41.16 ? 1087 GLY E C     1 
ATOM   9650  O  O     . GLY E  1 114 ? 28.166  -6.976  50.745  1.00 42.55 ? 1087 GLY E O     1 
ATOM   9651  N  N     . LEU E  1 115 ? 29.862  -5.962  51.818  1.00 41.05 ? 1088 LEU E N     1 
ATOM   9652  C  CA    . LEU E  1 115 ? 28.998  -5.294  52.780  1.00 40.23 ? 1088 LEU E CA    1 
ATOM   9653  C  C     . LEU E  1 115 ? 28.640  -3.892  52.289  1.00 38.13 ? 1088 LEU E C     1 
ATOM   9654  O  O     . LEU E  1 115 ? 29.512  -3.024  52.181  1.00 36.81 ? 1088 LEU E O     1 
ATOM   9655  C  CB    . LEU E  1 115 ? 29.673  -5.238  54.155  1.00 39.20 ? 1088 LEU E CB    1 
ATOM   9656  C  CG    . LEU E  1 115 ? 28.838  -4.770  55.349  1.00 39.75 ? 1088 LEU E CG    1 
ATOM   9657  C  CD1   . LEU E  1 115 ? 27.700  -5.728  55.642  1.00 40.71 ? 1088 LEU E CD1   1 
ATOM   9658  C  CD2   . LEU E  1 115 ? 29.731  -4.623  56.563  1.00 36.93 ? 1088 LEU E CD2   1 
ATOM   9659  N  N     . ASP E  1 116 ? 27.358  -3.686  51.988  1.00 33.12 ? 1089 ASP E N     1 
ATOM   9660  C  CA    . ASP E  1 116 ? 26.854  -2.365  51.610  1.00 38.12 ? 1089 ASP E CA    1 
ATOM   9661  C  C     . ASP E  1 116 ? 26.343  -1.552  52.809  1.00 38.63 ? 1089 ASP E C     1 
ATOM   9662  O  O     . ASP E  1 116 ? 26.254  -2.061  53.934  1.00 37.39 ? 1089 ASP E O     1 
ATOM   9663  C  CB    . ASP E  1 116 ? 25.795  -2.454  50.486  1.00 38.21 ? 1089 ASP E CB    1 
ATOM   9664  C  CG    . ASP E  1 116 ? 24.567  -3.260  50.881  1.00 35.82 ? 1089 ASP E CG    1 
ATOM   9665  O  OD1   . ASP E  1 116 ? 23.813  -2.819  51.771  1.00 44.06 ? 1089 ASP E OD1   1 
ATOM   9666  O  OD2   . ASP E  1 116 ? 24.338  -4.324  50.269  1.00 42.06 ? 1089 ASP E OD2   1 
ATOM   9667  N  N     . LEU E  1 117 ? 26.005  -0.291  52.543  1.00 37.76 ? 1090 LEU E N     1 
ATOM   9668  C  CA    . LEU E  1 117 ? 25.603  0.670   53.570  1.00 36.68 ? 1090 LEU E CA    1 
ATOM   9669  C  C     . LEU E  1 117 ? 24.219  0.377   54.167  1.00 34.42 ? 1090 LEU E C     1 
ATOM   9670  O  O     . LEU E  1 117 ? 23.933  0.788   55.287  1.00 31.48 ? 1090 LEU E O     1 
ATOM   9671  C  CB    . LEU E  1 117 ? 25.668  2.094   53.000  1.00 36.23 ? 1090 LEU E CB    1 
ATOM   9672  C  CG    . LEU E  1 117 ? 26.374  3.225   53.755  1.00 41.10 ? 1090 LEU E CG    1 
ATOM   9673  C  CD1   . LEU E  1 117 ? 27.852  2.926   54.024  1.00 37.14 ? 1090 LEU E CD1   1 
ATOM   9674  C  CD2   . LEU E  1 117 ? 26.228  4.522   52.968  1.00 39.59 ? 1090 LEU E CD2   1 
ATOM   9675  N  N     . PHE E  1 118 ? 23.374  -0.345  53.432  1.00 34.36 ? 1091 PHE E N     1 
ATOM   9676  C  CA    . PHE E  1 118 ? 22.078  -0.793  53.956  1.00 35.82 ? 1091 PHE E CA    1 
ATOM   9677  C  C     . PHE E  1 118 ? 22.298  -1.837  55.058  1.00 38.35 ? 1091 PHE E C     1 
ATOM   9678  O  O     . PHE E  1 118 ? 21.709  -1.748  56.141  1.00 33.26 ? 1091 PHE E O     1 
ATOM   9679  C  CB    . PHE E  1 118 ? 21.215  -1.374  52.829  1.00 34.94 ? 1091 PHE E CB    1 
ATOM   9680  C  CG    . PHE E  1 118 ? 19.852  -1.855  53.277  1.00 39.93 ? 1091 PHE E CG    1 
ATOM   9681  C  CD1   . PHE E  1 118 ? 19.683  -3.135  53.804  1.00 36.20 ? 1091 PHE E CD1   1 
ATOM   9682  C  CD2   . PHE E  1 118 ? 18.739  -1.032  53.154  1.00 38.83 ? 1091 PHE E CD2   1 
ATOM   9683  C  CE1   . PHE E  1 118 ? 18.434  -3.581  54.210  1.00 39.58 ? 1091 PHE E CE1   1 
ATOM   9684  C  CE2   . PHE E  1 118 ? 17.482  -1.472  53.557  1.00 42.57 ? 1091 PHE E CE2   1 
ATOM   9685  C  CZ    . PHE E  1 118 ? 17.329  -2.747  54.084  1.00 36.11 ? 1091 PHE E CZ    1 
ATOM   9686  N  N     . ALA E  1 119 ? 23.158  -2.812  54.763  1.00 37.39 ? 1092 ALA E N     1 
ATOM   9687  C  CA    . ALA E  1 119 ? 23.496  -3.888  55.690  1.00 40.41 ? 1092 ALA E CA    1 
ATOM   9688  C  C     . ALA E  1 119 ? 24.365  -3.402  56.851  1.00 39.30 ? 1092 ALA E C     1 
ATOM   9689  O  O     . ALA E  1 119 ? 24.251  -3.918  57.964  1.00 41.53 ? 1092 ALA E O     1 
ATOM   9690  C  CB    . ALA E  1 119 ? 24.181  -5.031  54.945  1.00 39.25 ? 1092 ALA E CB    1 
ATOM   9691  N  N     . PHE E  1 120 ? 25.231  -2.425  56.579  1.00 36.09 ? 1093 PHE E N     1 
ATOM   9692  C  CA    . PHE E  1 120 ? 25.993  -1.716  57.612  1.00 40.50 ? 1093 PHE E CA    1 
ATOM   9693  C  C     . PHE E  1 120 ? 25.058  -1.028  58.620  1.00 44.33 ? 1093 PHE E C     1 
ATOM   9694  O  O     . PHE E  1 120 ? 25.176  -1.256  59.829  1.00 49.00 ? 1093 PHE E O     1 
ATOM   9695  C  CB    . PHE E  1 120 ? 26.954  -0.709  56.954  1.00 42.91 ? 1093 PHE E CB    1 
ATOM   9696  C  CG    . PHE E  1 120 ? 27.750  0.132   57.926  1.00 43.58 ? 1093 PHE E CG    1 
ATOM   9697  C  CD1   . PHE E  1 120 ? 28.831  -0.406  58.620  1.00 49.82 ? 1093 PHE E CD1   1 
ATOM   9698  C  CD2   . PHE E  1 120 ? 27.444  1.478   58.110  1.00 45.63 ? 1093 PHE E CD2   1 
ATOM   9699  C  CE1   . PHE E  1 120 ? 29.577  0.377   59.511  1.00 48.34 ? 1093 PHE E CE1   1 
ATOM   9700  C  CE2   . PHE E  1 120 ? 28.184  2.266   58.992  1.00 46.20 ? 1093 PHE E CE2   1 
ATOM   9701  C  CZ    . PHE E  1 120 ? 29.254  1.711   59.695  1.00 45.94 ? 1093 PHE E CZ    1 
ATOM   9702  N  N     . ILE E  1 121 ? 24.134  -0.207  58.110  1.00 44.16 ? 1094 ILE E N     1 
ATOM   9703  C  CA    . ILE E  1 121 ? 23.102  0.484   58.910  1.00 42.12 ? 1094 ILE E CA    1 
ATOM   9704  C  C     . ILE E  1 121 ? 22.191  -0.488  59.668  1.00 42.32 ? 1094 ILE E C     1 
ATOM   9705  O  O     . ILE E  1 121 ? 21.800  -0.221  60.808  1.00 41.67 ? 1094 ILE E O     1 
ATOM   9706  C  CB    . ILE E  1 121 ? 22.246  1.432   58.012  1.00 43.26 ? 1094 ILE E CB    1 
ATOM   9707  C  CG1   . ILE E  1 121 ? 22.982  2.751   57.766  1.00 43.79 ? 1094 ILE E CG1   1 
ATOM   9708  C  CG2   . ILE E  1 121 ? 20.853  1.696   58.603  1.00 29.54 ? 1094 ILE E CG2   1 
ATOM   9709  C  CD1   . ILE E  1 121 ? 22.606  3.413   56.447  1.00 45.16 ? 1094 ILE E CD1   1 
ATOM   9710  N  N     . ASP E  1 122 ? 21.866  -1.607  59.022  1.00 42.43 ? 1095 ASP E N     1 
ATOM   9711  C  CA    . ASP E  1 122 ? 21.049  -2.676  59.608  1.00 45.25 ? 1095 ASP E CA    1 
ATOM   9712  C  C     . ASP E  1 122 ? 21.569  -3.189  60.962  1.00 43.43 ? 1095 ASP E C     1 
ATOM   9713  O  O     . ASP E  1 122 ? 20.781  -3.569  61.824  1.00 45.79 ? 1095 ASP E O     1 
ATOM   9714  C  CB    . ASP E  1 122 ? 20.937  -3.843  58.619  1.00 46.57 ? 1095 ASP E CB    1 
ATOM   9715  C  CG    . ASP E  1 122 ? 19.748  -4.740  58.902  1.00 51.88 ? 1095 ASP E CG    1 
ATOM   9716  O  OD1   . ASP E  1 122 ? 19.828  -5.553  59.848  1.00 45.17 ? 1095 ASP E OD1   1 
ATOM   9717  O  OD2   . ASP E  1 122 ? 18.738  -4.639  58.166  1.00 53.18 ? 1095 ASP E OD2   1 
ATOM   9718  N  N     . ARG E  1 123 ? 22.889  -3.196  61.139  1.00 44.13 ? 1096 ARG E N     1 
ATOM   9719  C  CA    . ARG E  1 123 ? 23.521  -3.646  62.384  1.00 46.21 ? 1096 ARG E CA    1 
ATOM   9720  C  C     . ARG E  1 123 ? 23.366  -2.683  63.572  1.00 45.69 ? 1096 ARG E C     1 
ATOM   9721  O  O     . ARG E  1 123 ? 23.761  -3.012  64.695  1.00 44.12 ? 1096 ARG E O     1 
ATOM   9722  C  CB    . ARG E  1 123 ? 25.007  -3.935  62.144  1.00 48.12 ? 1096 ARG E CB    1 
ATOM   9723  C  CG    . ARG E  1 123 ? 25.268  -5.308  61.544  1.00 61.91 ? 1096 ARG E CG    1 
ATOM   9724  C  CD    . ARG E  1 123 ? 25.467  -6.365  62.621  1.00 67.75 ? 1096 ARG E CD    1 
ATOM   9725  N  NE    . ARG E  1 123 ? 26.845  -6.396  63.109  1.00 65.63 ? 1096 ARG E NE    1 
ATOM   9726  C  CZ    . ARG E  1 123 ? 27.381  -7.411  63.782  1.00 68.23 ? 1096 ARG E CZ    1 
ATOM   9727  N  NH1   . ARG E  1 123 ? 26.661  -8.492  64.055  1.00 69.30 ? 1096 ARG E NH1   1 
ATOM   9728  N  NH2   . ARG E  1 123 ? 28.644  -7.349  64.178  1.00 70.61 ? 1096 ARG E NH2   1 
ATOM   9729  N  N     . HIS E  1 124 ? 22.776  -1.513  63.317  1.00 43.53 ? 1097 HIS E N     1 
ATOM   9730  C  CA    . HIS E  1 124 ? 22.728  -0.406  64.273  1.00 41.14 ? 1097 HIS E CA    1 
ATOM   9731  C  C     . HIS E  1 124 ? 24.134  -0.089  64.814  1.00 42.38 ? 1097 HIS E C     1 
ATOM   9732  O  O     . HIS E  1 124 ? 24.402  -0.284  66.003  1.00 41.26 ? 1097 HIS E O     1 
ATOM   9733  C  CB    . HIS E  1 124 ? 21.734  -0.678  65.415  1.00 43.71 ? 1097 HIS E CB    1 
ATOM   9734  C  CG    . HIS E  1 124 ? 20.370  -1.093  64.955  1.00 45.08 ? 1097 HIS E CG    1 
ATOM   9735  N  ND1   . HIS E  1 124 ? 19.559  -0.280  64.191  1.00 47.82 ? 1097 HIS E ND1   1 
ATOM   9736  C  CD2   . HIS E  1 124 ? 19.668  -2.232  65.164  1.00 40.90 ? 1097 HIS E CD2   1 
ATOM   9737  C  CE1   . HIS E  1 124 ? 18.422  -0.904  63.940  1.00 45.92 ? 1097 HIS E CE1   1 
ATOM   9738  N  NE2   . HIS E  1 124 ? 18.461  -2.089  64.523  1.00 41.58 ? 1097 HIS E NE2   1 
ATOM   9739  N  N     . PRO E  1 125 ? 25.033  0.409   63.935  1.00 39.66 ? 1098 PRO E N     1 
ATOM   9740  C  CA    . PRO E  1 125 ? 26.424  0.663   64.312  1.00 39.63 ? 1098 PRO E CA    1 
ATOM   9741  C  C     . PRO E  1 125 ? 26.560  1.736   65.390  1.00 38.78 ? 1098 PRO E C     1 
ATOM   9742  O  O     . PRO E  1 125 ? 25.615  2.477   65.644  1.00 37.85 ? 1098 PRO E O     1 
ATOM   9743  C  CB    . PRO E  1 125 ? 27.060  1.169   63.011  1.00 34.73 ? 1098 PRO E CB    1 
ATOM   9744  C  CG    . PRO E  1 125 ? 26.126  0.819   61.947  1.00 37.51 ? 1098 PRO E CG    1 
ATOM   9745  C  CD    . PRO E  1 125 ? 24.774  0.794   62.538  1.00 34.48 ? 1098 PRO E CD    1 
ATOM   9746  N  N     . ARG E  1 126 ? 27.727  1.787   66.027  1.00 40.12 ? 1099 ARG E N     1 
ATOM   9747  C  CA    . ARG E  1 126 ? 28.074  2.876   66.939  1.00 39.79 ? 1099 ARG E CA    1 
ATOM   9748  C  C     . ARG E  1 126 ? 28.694  3.983   66.085  1.00 36.78 ? 1099 ARG E C     1 
ATOM   9749  O  O     . ARG E  1 126 ? 29.905  4.192   66.074  1.00 36.04 ? 1099 ARG E O     1 
ATOM   9750  C  CB    . ARG E  1 126 ? 29.040  2.404   68.037  1.00 38.31 ? 1099 ARG E CB    1 
ATOM   9751  C  CG    . ARG E  1 126 ? 28.619  1.119   68.749  1.00 45.67 ? 1099 ARG E CG    1 
ATOM   9752  N  N     . LEU E  1 127 ? 27.835  4.666   65.341  1.00 40.28 ? 1100 LEU E N     1 
ATOM   9753  C  CA    . LEU E  1 127 ? 28.256  5.645   64.354  1.00 36.82 ? 1100 LEU E CA    1 
ATOM   9754  C  C     . LEU E  1 127 ? 27.917  7.023   64.899  1.00 36.75 ? 1100 LEU E C     1 
ATOM   9755  O  O     . LEU E  1 127 ? 26.771  7.280   65.300  1.00 31.19 ? 1100 LEU E O     1 
ATOM   9756  C  CB    . LEU E  1 127 ? 27.493  5.410   63.047  1.00 36.64 ? 1100 LEU E CB    1 
ATOM   9757  C  CG    . LEU E  1 127 ? 28.132  5.425   61.655  1.00 41.96 ? 1100 LEU E CG    1 
ATOM   9758  C  CD1   . LEU E  1 127 ? 27.128  6.020   60.678  1.00 43.97 ? 1100 LEU E CD1   1 
ATOM   9759  C  CD2   . LEU E  1 127 ? 29.445  6.183   61.576  1.00 34.25 ? 1100 LEU E CD2   1 
ATOM   9760  N  N     . ASP E  1 128 ? 28.910  7.905   64.933  1.00 37.58 ? 1101 ASP E N     1 
ATOM   9761  C  CA    . ASP E  1 128 ? 28.666  9.284   65.344  1.00 40.62 ? 1101 ASP E CA    1 
ATOM   9762  C  C     . ASP E  1 128 ? 28.784  10.225  64.147  1.00 39.89 ? 1101 ASP E C     1 
ATOM   9763  O  O     . ASP E  1 128 ? 29.174  9.801   63.059  1.00 35.02 ? 1101 ASP E O     1 
ATOM   9764  C  CB    . ASP E  1 128 ? 29.594  9.698   66.494  1.00 43.29 ? 1101 ASP E CB    1 
ATOM   9765  C  CG    . ASP E  1 128 ? 31.066  9.558   66.152  1.00 41.92 ? 1101 ASP E CG    1 
ATOM   9766  O  OD1   . ASP E  1 128 ? 31.400  9.129   65.028  1.00 52.08 ? 1101 ASP E OD1   1 
ATOM   9767  O  OD2   . ASP E  1 128 ? 31.900  9.886   67.021  1.00 51.71 ? 1101 ASP E OD2   1 
ATOM   9768  N  N     . GLU E  1 129 ? 28.442  11.495  64.359  1.00 41.01 ? 1102 GLU E N     1 
ATOM   9769  C  CA    . GLU E  1 129 ? 28.467  12.504  63.293  1.00 38.88 ? 1102 GLU E CA    1 
ATOM   9770  C  C     . GLU E  1 129 ? 29.816  12.666  62.576  1.00 39.77 ? 1102 GLU E C     1 
ATOM   9771  O  O     . GLU E  1 129 ? 29.827  12.769  61.354  1.00 43.69 ? 1102 GLU E O     1 
ATOM   9772  C  CB    . GLU E  1 129 ? 27.938  13.848  63.796  1.00 36.65 ? 1102 GLU E CB    1 
ATOM   9773  C  CG    . GLU E  1 129 ? 26.524  13.762  64.341  1.00 34.30 ? 1102 GLU E CG    1 
ATOM   9774  C  CD    . GLU E  1 129 ? 25.939  15.110  64.670  1.00 34.20 ? 1102 GLU E CD    1 
ATOM   9775  O  OE1   . GLU E  1 129 ? 25.957  15.991  63.787  1.00 39.29 ? 1102 GLU E OE1   1 
ATOM   9776  O  OE2   . GLU E  1 129 ? 25.446  15.282  65.810  1.00 35.51 ? 1102 GLU E OE2   1 
ATOM   9777  N  N     . PRO E  1 130 ? 30.946  12.733  63.321  1.00 41.28 ? 1103 PRO E N     1 
ATOM   9778  C  CA    . PRO E  1 130 ? 32.251  12.813  62.638  1.00 37.75 ? 1103 PRO E CA    1 
ATOM   9779  C  C     . PRO E  1 130 ? 32.610  11.626  61.730  1.00 35.24 ? 1103 PRO E C     1 
ATOM   9780  O  O     . PRO E  1 130 ? 33.149  11.842  60.635  1.00 32.77 ? 1103 PRO E O     1 
ATOM   9781  C  CB    . PRO E  1 130 ? 33.251  12.950  63.798  1.00 40.12 ? 1103 PRO E CB    1 
ATOM   9782  C  CG    . PRO E  1 130 ? 32.431  13.497  64.938  1.00 36.20 ? 1103 PRO E CG    1 
ATOM   9783  C  CD    . PRO E  1 130 ? 31.107  12.828  64.789  1.00 38.86 ? 1103 PRO E CD    1 
ATOM   9784  N  N     . LEU E  1 131 ? 32.330  10.399  62.168  1.00 30.59 ? 1104 LEU E N     1 
ATOM   9785  C  CA    . LEU E  1 131 ? 32.586  9.226   61.322  1.00 31.20 ? 1104 LEU E CA    1 
ATOM   9786  C  C     . LEU E  1 131 ? 31.557  9.110   60.202  1.00 27.64 ? 1104 LEU E C     1 
ATOM   9787  O  O     . LEU E  1 131 ? 31.922  8.806   59.073  1.00 29.59 ? 1104 LEU E O     1 
ATOM   9788  C  CB    . LEU E  1 131 ? 32.686  7.917   62.133  1.00 34.20 ? 1104 LEU E CB    1 
ATOM   9789  C  CG    . LEU E  1 131 ? 33.067  6.627   61.378  1.00 30.09 ? 1104 LEU E CG    1 
ATOM   9790  C  CD1   . LEU E  1 131 ? 34.386  6.760   60.618  1.00 27.94 ? 1104 LEU E CD1   1 
ATOM   9791  C  CD2   . LEU E  1 131 ? 33.120  5.445   62.324  1.00 25.16 ? 1104 LEU E CD2   1 
ATOM   9792  N  N     . ALA E  1 132 ? 30.285  9.372   60.510  1.00 31.78 ? 1105 ALA E N     1 
ATOM   9793  C  CA    . ALA E  1 132 ? 29.231  9.444   59.484  1.00 34.93 ? 1105 ALA E CA    1 
ATOM   9794  C  C     . ALA E  1 132 ? 29.568  10.495  58.429  1.00 38.71 ? 1105 ALA E C     1 
ATOM   9795  O  O     . ALA E  1 132 ? 29.257  10.317  57.250  1.00 40.77 ? 1105 ALA E O     1 
ATOM   9796  C  CB    . ALA E  1 132 ? 27.871  9.746   60.111  1.00 32.98 ? 1105 ALA E CB    1 
ATOM   9797  N  N     . SER E  1 133 ? 30.203  11.583  58.872  1.00 37.59 ? 1106 SER E N     1 
ATOM   9798  C  CA    . SER E  1 133 ? 30.676  12.654  57.994  1.00 39.04 ? 1106 SER E CA    1 
ATOM   9799  C  C     . SER E  1 133 ? 31.840  12.202  57.107  1.00 36.45 ? 1106 SER E C     1 
ATOM   9800  O  O     . SER E  1 133 ? 31.994  12.692  55.986  1.00 39.03 ? 1106 SER E O     1 
ATOM   9801  C  CB    . SER E  1 133 ? 31.084  13.877  58.825  1.00 41.34 ? 1106 SER E CB    1 
ATOM   9802  O  OG    . SER E  1 133 ? 31.787  14.827  58.049  1.00 45.28 ? 1106 SER E OG    1 
ATOM   9803  N  N     . TYR E  1 134 ? 32.659  11.283  57.618  1.00 34.72 ? 1107 TYR E N     1 
ATOM   9804  C  CA    . TYR E  1 134 ? 33.745  10.691  56.839  1.00 35.16 ? 1107 TYR E CA    1 
ATOM   9805  C  C     . TYR E  1 134 ? 33.189  9.810   55.714  1.00 34.95 ? 1107 TYR E C     1 
ATOM   9806  O  O     . TYR E  1 134 ? 33.583  9.956   54.556  1.00 37.03 ? 1107 TYR E O     1 
ATOM   9807  C  CB    . TYR E  1 134 ? 34.712  9.907   57.738  1.00 36.09 ? 1107 TYR E CB    1 
ATOM   9808  C  CG    . TYR E  1 134 ? 35.849  9.243   56.984  1.00 33.74 ? 1107 TYR E CG    1 
ATOM   9809  C  CD1   . TYR E  1 134 ? 36.874  10.006  56.416  1.00 34.91 ? 1107 TYR E CD1   1 
ATOM   9810  C  CD2   . TYR E  1 134 ? 35.896  7.854   56.836  1.00 30.69 ? 1107 TYR E CD2   1 
ATOM   9811  C  CE1   . TYR E  1 134 ? 37.919  9.403   55.724  1.00 37.43 ? 1107 TYR E CE1   1 
ATOM   9812  C  CE2   . TYR E  1 134 ? 36.936  7.238   56.141  1.00 28.20 ? 1107 TYR E CE2   1 
ATOM   9813  C  CZ    . TYR E  1 134 ? 37.943  8.021   55.585  1.00 36.36 ? 1107 TYR E CZ    1 
ATOM   9814  O  OH    . TYR E  1 134 ? 38.978  7.427   54.896  1.00 38.69 ? 1107 TYR E OH    1 
ATOM   9815  N  N     . ILE E  1 135 ? 32.258  8.924   56.063  1.00 35.52 ? 1108 ILE E N     1 
ATOM   9816  C  CA    . ILE E  1 135 ? 31.549  8.090   55.083  1.00 35.87 ? 1108 ILE E CA    1 
ATOM   9817  C  C     . ILE E  1 135 ? 30.870  8.956   54.009  1.00 35.77 ? 1108 ILE E C     1 
ATOM   9818  O  O     . ILE E  1 135 ? 30.928  8.635   52.819  1.00 36.03 ? 1108 ILE E O     1 
ATOM   9819  C  CB    . ILE E  1 135 ? 30.514  7.134   55.775  1.00 35.72 ? 1108 ILE E CB    1 
ATOM   9820  C  CG1   . ILE E  1 135 ? 31.211  6.210   56.778  1.00 30.74 ? 1108 ILE E CG1   1 
ATOM   9821  C  CG2   . ILE E  1 135 ? 29.716  6.312   54.743  1.00 35.27 ? 1108 ILE E CG2   1 
ATOM   9822  C  CD1   . ILE E  1 135 ? 30.260  5.314   57.579  1.00 33.22 ? 1108 ILE E CD1   1 
ATOM   9823  N  N     . PHE E  1 136 ? 30.260  10.066  54.437  1.00 37.54 ? 1109 PHE E N     1 
ATOM   9824  C  CA    . PHE E  1 136 ? 29.487  10.937  53.543  1.00 31.80 ? 1109 PHE E CA    1 
ATOM   9825  C  C     . PHE E  1 136 ? 30.320  11.790  52.591  1.00 32.21 ? 1109 PHE E C     1 
ATOM   9826  O  O     . PHE E  1 136 ? 29.916  11.987  51.442  1.00 34.23 ? 1109 PHE E O     1 
ATOM   9827  C  CB    . PHE E  1 136 ? 28.502  11.814  54.331  1.00 32.39 ? 1109 PHE E CB    1 
ATOM   9828  C  CG    . PHE E  1 136 ? 27.477  12.516  53.459  1.00 29.79 ? 1109 PHE E CG    1 
ATOM   9829  C  CD1   . PHE E  1 136 ? 26.584  11.783  52.678  1.00 22.82 ? 1109 PHE E CD1   1 
ATOM   9830  C  CD2   . PHE E  1 136 ? 27.406  13.909  53.427  1.00 25.60 ? 1109 PHE E CD2   1 
ATOM   9831  C  CE1   . PHE E  1 136 ? 25.644  12.423  51.876  1.00 30.59 ? 1109 PHE E CE1   1 
ATOM   9832  C  CE2   . PHE E  1 136 ? 26.466  14.558  52.633  1.00 23.35 ? 1109 PHE E CE2   1 
ATOM   9833  C  CZ    . PHE E  1 136 ? 25.585  13.814  51.854  1.00 28.73 ? 1109 PHE E CZ    1 
ATOM   9834  N  N     . ARG E  1 137 ? 31.460  12.306  53.060  1.00 34.88 ? 1110 ARG E N     1 
ATOM   9835  C  CA    . ARG E  1 137 ? 32.323  13.160  52.220  1.00 34.22 ? 1110 ARG E CA    1 
ATOM   9836  C  C     . ARG E  1 137 ? 32.958  12.380  51.074  1.00 34.54 ? 1110 ARG E C     1 
ATOM   9837  O  O     . ARG E  1 137 ? 33.246  12.941  50.018  1.00 37.81 ? 1110 ARG E O     1 
ATOM   9838  C  CB    . ARG E  1 137 ? 33.382  13.926  53.045  1.00 33.99 ? 1110 ARG E CB    1 
ATOM   9839  C  CG    . ARG E  1 137 ? 34.517  13.078  53.635  1.00 32.56 ? 1110 ARG E CG    1 
ATOM   9840  C  CD    . ARG E  1 137 ? 35.356  13.858  54.628  1.00 36.30 ? 1110 ARG E CD    1 
ATOM   9841  N  NE    . ARG E  1 137 ? 34.604  14.213  55.835  1.00 42.47 ? 1110 ARG E NE    1 
ATOM   9842  C  CZ    . ARG E  1 137 ? 35.097  14.904  56.863  1.00 43.72 ? 1110 ARG E CZ    1 
ATOM   9843  N  NH1   . ARG E  1 137 ? 36.351  15.328  56.847  1.00 45.78 ? 1110 ARG E NH1   1 
ATOM   9844  N  NH2   . ARG E  1 137 ? 34.328  15.180  57.908  1.00 31.73 ? 1110 ARG E NH2   1 
ATOM   9845  N  N     . GLN E  1 138 ? 33.162  11.084  51.292  1.00 36.97 ? 1111 GLN E N     1 
ATOM   9846  C  CA    . GLN E  1 138 ? 33.595  10.164  50.242  1.00 35.31 ? 1111 GLN E CA    1 
ATOM   9847  C  C     . GLN E  1 138 ? 32.538  9.948   49.149  1.00 36.55 ? 1111 GLN E C     1 
ATOM   9848  O  O     . GLN E  1 138 ? 32.885  9.784   47.980  1.00 38.15 ? 1111 GLN E O     1 
ATOM   9849  C  CB    . GLN E  1 138 ? 33.955  8.825   50.854  1.00 38.82 ? 1111 GLN E CB    1 
ATOM   9850  C  CG    . GLN E  1 138 ? 35.096  8.861   51.837  1.00 35.68 ? 1111 GLN E CG    1 
ATOM   9851  C  CD    . GLN E  1 138 ? 35.474  7.480   52.264  1.00 28.77 ? 1111 GLN E CD    1 
ATOM   9852  O  OE1   . GLN E  1 138 ? 36.152  6.761   51.534  1.00 30.79 ? 1111 GLN E OE1   1 
ATOM   9853  N  NE2   . GLN E  1 138 ? 35.020  7.082   53.441  1.00 32.86 ? 1111 GLN E NE2   1 
ATOM   9854  N  N     . LEU E  1 139 ? 31.262  9.928   49.542  1.00 35.43 ? 1112 LEU E N     1 
ATOM   9855  C  CA    . LEU E  1 139 ? 30.147  9.874   48.591  1.00 36.13 ? 1112 LEU E CA    1 
ATOM   9856  C  C     . LEU E  1 139 ? 30.011  11.171  47.792  1.00 36.14 ? 1112 LEU E C     1 
ATOM   9857  O  O     . LEU E  1 139 ? 29.798  11.135  46.577  1.00 34.81 ? 1112 LEU E O     1 
ATOM   9858  C  CB    . LEU E  1 139 ? 28.819  9.547   49.296  1.00 34.23 ? 1112 LEU E CB    1 
ATOM   9859  C  CG    . LEU E  1 139 ? 27.540  9.625   48.446  1.00 27.97 ? 1112 LEU E CG    1 
ATOM   9860  C  CD1   . LEU E  1 139 ? 27.564  8.684   47.225  1.00 27.19 ? 1112 LEU E CD1   1 
ATOM   9861  C  CD2   . LEU E  1 139 ? 26.312  9.380   49.304  1.00 34.02 ? 1112 LEU E CD2   1 
ATOM   9862  N  N     . VAL E  1 140 ? 30.123  12.306  48.482  1.00 35.01 ? 1113 VAL E N     1 
ATOM   9863  C  CA    . VAL E  1 140 ? 30.096  13.626  47.831  1.00 35.37 ? 1113 VAL E CA    1 
ATOM   9864  C  C     . VAL E  1 140 ? 31.272  13.821  46.859  1.00 34.74 ? 1113 VAL E C     1 
ATOM   9865  O  O     . VAL E  1 140 ? 31.130  14.524  45.858  1.00 38.62 ? 1113 VAL E O     1 
ATOM   9866  C  CB    . VAL E  1 140 ? 30.053  14.776  48.872  1.00 35.49 ? 1113 VAL E CB    1 
ATOM   9867  C  CG1   . VAL E  1 140 ? 30.150  16.146  48.199  1.00 33.51 ? 1113 VAL E CG1   1 
ATOM   9868  C  CG2   . VAL E  1 140 ? 28.788  14.685  49.708  1.00 33.83 ? 1113 VAL E CG2   1 
ATOM   9869  N  N     . SER E  1 141 ? 32.413  13.194  47.153  1.00 34.42 ? 1114 SER E N     1 
ATOM   9870  C  CA    . SER E  1 141 ? 33.607  13.262  46.297  1.00 33.81 ? 1114 SER E CA    1 
ATOM   9871  C  C     . SER E  1 141 ? 33.422  12.471  45.018  1.00 33.08 ? 1114 SER E C     1 
ATOM   9872  O  O     . SER E  1 141 ? 33.827  12.920  43.946  1.00 38.63 ? 1114 SER E O     1 
ATOM   9873  C  CB    . SER E  1 141 ? 34.859  12.751  47.023  1.00 32.80 ? 1114 SER E CB    1 
ATOM   9874  O  OG    . SER E  1 141 ? 35.090  13.466  48.221  1.00 33.24 ? 1114 SER E OG    1 
ATOM   9875  N  N     . ALA E  1 142 ? 32.824  11.289  45.139  1.00 32.98 ? 1115 ALA E N     1 
ATOM   9876  C  CA    . ALA E  1 142 ? 32.520  10.446  43.982  1.00 33.43 ? 1115 ALA E CA    1 
ATOM   9877  C  C     . ALA E  1 142 ? 31.536  11.155  43.063  1.00 32.52 ? 1115 ALA E C     1 
ATOM   9878  O  O     . ALA E  1 142 ? 31.711  11.152  41.846  1.00 35.70 ? 1115 ALA E O     1 
ATOM   9879  C  CB    . ALA E  1 142 ? 31.963  9.108   44.426  1.00 31.29 ? 1115 ALA E CB    1 
ATOM   9880  N  N     . VAL E  1 143 ? 30.509  11.760  43.659  1.00 32.45 ? 1116 VAL E N     1 
ATOM   9881  C  CA    . VAL E  1 143 ? 29.516  12.557  42.922  1.00 36.78 ? 1116 VAL E CA    1 
ATOM   9882  C  C     . VAL E  1 143 ? 30.152  13.833  42.353  1.00 36.34 ? 1116 VAL E C     1 
ATOM   9883  O  O     . VAL E  1 143 ? 29.921  14.180  41.196  1.00 38.07 ? 1116 VAL E O     1 
ATOM   9884  C  CB    . VAL E  1 143 ? 28.268  12.896  43.791  1.00 33.30 ? 1116 VAL E CB    1 
ATOM   9885  C  CG1   . VAL E  1 143 ? 27.208  13.615  42.968  1.00 35.51 ? 1116 VAL E CG1   1 
ATOM   9886  C  CG2   . VAL E  1 143 ? 27.669  11.633  44.376  1.00 29.03 ? 1116 VAL E CG2   1 
ATOM   9887  N  N     . GLY E  1 144 ? 30.958  14.514  43.166  1.00 38.29 ? 1117 GLY E N     1 
ATOM   9888  C  CA    . GLY E  1 144 ? 31.761  15.644  42.700  1.00 40.95 ? 1117 GLY E CA    1 
ATOM   9889  C  C     . GLY E  1 144 ? 32.509  15.302  41.424  1.00 41.80 ? 1117 GLY E C     1 
ATOM   9890  O  O     . GLY E  1 144 ? 32.439  16.038  40.431  1.00 44.24 ? 1117 GLY E O     1 
ATOM   9891  N  N     . TYR E  1 145 ? 33.207  14.168  41.460  1.00 37.04 ? 1118 TYR E N     1 
ATOM   9892  C  CA    . TYR E  1 145 ? 33.946  13.644  40.318  1.00 38.45 ? 1118 TYR E CA    1 
ATOM   9893  C  C     . TYR E  1 145 ? 33.049  13.327  39.116  1.00 37.54 ? 1118 TYR E C     1 
ATOM   9894  O  O     . TYR E  1 145 ? 33.351  13.755  38.001  1.00 38.73 ? 1118 TYR E O     1 
ATOM   9895  C  CB    . TYR E  1 145 ? 34.766  12.411  40.732  1.00 40.68 ? 1118 TYR E CB    1 
ATOM   9896  C  CG    . TYR E  1 145 ? 35.498  11.739  39.587  1.00 45.56 ? 1118 TYR E CG    1 
ATOM   9897  C  CD1   . TYR E  1 145 ? 36.780  12.154  39.207  1.00 39.74 ? 1118 TYR E CD1   1 
ATOM   9898  C  CD2   . TYR E  1 145 ? 34.906  10.689  38.880  1.00 42.91 ? 1118 TYR E CD2   1 
ATOM   9899  C  CE1   . TYR E  1 145 ? 37.448  11.538  38.154  1.00 44.18 ? 1118 TYR E CE1   1 
ATOM   9900  C  CE2   . TYR E  1 145 ? 35.561  10.072  37.823  1.00 43.22 ? 1118 TYR E CE2   1 
ATOM   9901  C  CZ    . TYR E  1 145 ? 36.831  10.497  37.467  1.00 45.63 ? 1118 TYR E CZ    1 
ATOM   9902  O  OH    . TYR E  1 145 ? 37.482  9.877   36.423  1.00 51.02 ? 1118 TYR E OH    1 
ATOM   9903  N  N     . LEU E  1 146 ? 31.966  12.574  39.343  1.00 38.02 ? 1119 LEU E N     1 
ATOM   9904  C  CA    . LEU E  1 146 ? 31.017  12.204  38.277  1.00 34.59 ? 1119 LEU E CA    1 
ATOM   9905  C  C     . LEU E  1 146 ? 30.350  13.402  37.618  1.00 35.99 ? 1119 LEU E C     1 
ATOM   9906  O  O     . LEU E  1 146 ? 30.221  13.437  36.392  1.00 38.53 ? 1119 LEU E O     1 
ATOM   9907  C  CB    . LEU E  1 146 ? 29.949  11.223  38.781  1.00 37.24 ? 1119 LEU E CB    1 
ATOM   9908  C  CG    . LEU E  1 146 ? 30.391  9.787   39.112  1.00 34.83 ? 1119 LEU E CG    1 
ATOM   9909  C  CD1   . LEU E  1 146 ? 29.375  9.099   40.007  1.00 30.81 ? 1119 LEU E CD1   1 
ATOM   9910  C  CD2   . LEU E  1 146 ? 30.664  8.951   37.861  1.00 33.11 ? 1119 LEU E CD2   1 
ATOM   9911  N  N     . ARG E  1 147 ? 29.928  14.376  38.427  1.00 39.99 ? 1120 ARG E N     1 
ATOM   9912  C  CA    . ARG E  1 147 ? 29.338  15.624  37.918  1.00 42.06 ? 1120 ARG E CA    1 
ATOM   9913  C  C     . ARG E  1 147 ? 30.300  16.385  37.014  1.00 43.96 ? 1120 ARG E C     1 
ATOM   9914  O  O     . ARG E  1 147 ? 29.908  16.874  35.958  1.00 47.08 ? 1120 ARG E O     1 
ATOM   9915  C  CB    . ARG E  1 147 ? 28.891  16.529  39.067  1.00 42.10 ? 1120 ARG E CB    1 
ATOM   9916  C  CG    . ARG E  1 147 ? 28.086  17.756  38.627  1.00 47.78 ? 1120 ARG E CG    1 
ATOM   9917  C  CD    . ARG E  1 147 ? 26.691  17.389  38.069  1.00 49.55 ? 1120 ARG E CD    1 
ATOM   9918  N  NE    . ARG E  1 147 ? 25.799  16.828  39.089  1.00 38.09 ? 1120 ARG E NE    1 
ATOM   9919  C  CZ    . ARG E  1 147 ? 25.220  17.538  40.058  1.00 40.60 ? 1120 ARG E CZ    1 
ATOM   9920  N  NH1   . ARG E  1 147 ? 25.439  18.842  40.155  1.00 29.95 ? 1120 ARG E NH1   1 
ATOM   9921  N  NH2   . ARG E  1 147 ? 24.428  16.940  40.942  1.00 40.50 ? 1120 ARG E NH2   1 
ATOM   9922  N  N     . LEU E  1 148 ? 31.555  16.484  37.449  1.00 48.87 ? 1121 LEU E N     1 
ATOM   9923  C  CA    . LEU E  1 148 ? 32.640  17.029  36.636  1.00 49.63 ? 1121 LEU E CA    1 
ATOM   9924  C  C     . LEU E  1 148 ? 32.724  16.332  35.271  1.00 46.46 ? 1121 LEU E C     1 
ATOM   9925  O  O     . LEU E  1 148 ? 32.941  16.986  34.253  1.00 43.48 ? 1121 LEU E O     1 
ATOM   9926  C  CB    . LEU E  1 148 ? 33.967  16.917  37.401  1.00 51.18 ? 1121 LEU E CB    1 
ATOM   9927  C  CG    . LEU E  1 148 ? 35.325  17.285  36.789  1.00 52.07 ? 1121 LEU E CG    1 
ATOM   9928  C  CD1   . LEU E  1 148 ? 35.398  18.756  36.383  1.00 53.92 ? 1121 LEU E CD1   1 
ATOM   9929  C  CD2   . LEU E  1 148 ? 36.437  16.946  37.779  1.00 51.22 ? 1121 LEU E CD2   1 
ATOM   9930  N  N     . LYS E  1 149 ? 32.531  15.014  35.261  1.00 48.75 ? 1122 LYS E N     1 
ATOM   9931  C  CA    . LYS E  1 149 ? 32.554  14.216  34.024  1.00 50.73 ? 1122 LYS E CA    1 
ATOM   9932  C  C     . LYS E  1 149 ? 31.166  14.106  33.368  1.00 49.97 ? 1122 LYS E C     1 
ATOM   9933  O  O     . LYS E  1 149 ? 30.931  13.214  32.543  1.00 48.17 ? 1122 LYS E O     1 
ATOM   9934  C  CB    . LYS E  1 149 ? 33.126  12.811  34.291  1.00 53.01 ? 1122 LYS E CB    1 
ATOM   9935  C  CG    . LYS E  1 149 ? 34.398  12.755  35.154  1.00 54.03 ? 1122 LYS E CG    1 
ATOM   9936  C  CD    . LYS E  1 149 ? 35.685  12.703  34.340  1.00 58.15 ? 1122 LYS E CD    1 
ATOM   9937  C  CE    . LYS E  1 149 ? 36.313  14.079  34.143  1.00 64.24 ? 1122 LYS E CE    1 
ATOM   9938  N  NZ    . LYS E  1 149 ? 35.813  14.779  32.923  1.00 67.03 ? 1122 LYS E NZ    1 
ATOM   9939  N  N     . ASP E  1 150 ? 30.261  15.015  33.746  1.00 49.38 ? 1123 ASP E N     1 
ATOM   9940  C  CA    . ASP E  1 150 ? 28.874  15.081  33.234  1.00 48.85 ? 1123 ASP E CA    1 
ATOM   9941  C  C     . ASP E  1 150 ? 28.044  13.801  33.422  1.00 47.36 ? 1123 ASP E C     1 
ATOM   9942  O  O     . ASP E  1 150 ? 27.123  13.528  32.644  1.00 47.18 ? 1123 ASP E O     1 
ATOM   9943  C  CB    . ASP E  1 150 ? 28.844  15.514  31.759  1.00 52.68 ? 1123 ASP E CB    1 
ATOM   9944  C  CG    . ASP E  1 150 ? 29.480  16.865  31.531  1.00 56.32 ? 1123 ASP E CG    1 
ATOM   9945  O  OD1   . ASP E  1 150 ? 29.120  17.836  32.236  1.00 62.27 ? 1123 ASP E OD1   1 
ATOM   9946  O  OD2   . ASP E  1 150 ? 30.341  16.954  30.631  1.00 62.34 ? 1123 ASP E OD2   1 
ATOM   9947  N  N     . ILE E  1 151 ? 28.365  13.023  34.453  1.00 44.86 ? 1124 ILE E N     1 
ATOM   9948  C  CA    . ILE E  1 151 ? 27.639  11.782  34.715  1.00 40.17 ? 1124 ILE E CA    1 
ATOM   9949  C  C     . ILE E  1 151 ? 26.700  11.921  35.912  1.00 37.54 ? 1124 ILE E C     1 
ATOM   9950  O  O     . ILE E  1 151 ? 27.011  12.589  36.899  1.00 33.96 ? 1124 ILE E O     1 
ATOM   9951  C  CB    . ILE E  1 151 ? 28.588  10.566  34.857  1.00 39.42 ? 1124 ILE E CB    1 
ATOM   9952  C  CG1   . ILE E  1 151 ? 29.254  10.271  33.504  1.00 38.82 ? 1124 ILE E CG1   1 
ATOM   9953  C  CG2   . ILE E  1 151 ? 27.831  9.331   35.379  1.00 42.59 ? 1124 ILE E CG2   1 
ATOM   9954  C  CD1   . ILE E  1 151 ? 30.389  9.246   33.536  1.00 36.61 ? 1124 ILE E CD1   1 
ATOM   9955  N  N     . ILE E  1 152 ? 25.534  11.304  35.774  1.00 38.15 ? 1125 ILE E N     1 
ATOM   9956  C  CA    . ILE E  1 152 ? 24.521  11.260  36.811  1.00 34.81 ? 1125 ILE E CA    1 
ATOM   9957  C  C     . ILE E  1 152 ? 24.233  9.771   37.075  1.00 29.79 ? 1125 ILE E C     1 
ATOM   9958  O  O     . ILE E  1 152 ? 23.821  9.042   36.167  1.00 26.69 ? 1125 ILE E O     1 
ATOM   9959  C  CB    . ILE E  1 152 ? 23.285  12.153  36.391  1.00 38.31 ? 1125 ILE E CB    1 
ATOM   9960  C  CG1   . ILE E  1 152 ? 22.709  12.915  37.582  1.00 42.71 ? 1125 ILE E CG1   1 
ATOM   9961  C  CG2   . ILE E  1 152 ? 22.232  11.418  35.547  1.00 37.10 ? 1125 ILE E CG2   1 
ATOM   9962  C  CD1   . ILE E  1 152 ? 23.285  14.296  37.713  1.00 48.20 ? 1125 ILE E CD1   1 
ATOM   9963  N  N     . HIS E  1 153 ? 24.540  9.316   38.293  1.00 30.35 ? 1126 HIS E N     1 
ATOM   9964  C  CA    . HIS E  1 153 ? 24.437  7.892   38.694  1.00 28.19 ? 1126 HIS E CA    1 
ATOM   9965  C  C     . HIS E  1 153 ? 22.977  7.423   38.659  1.00 30.40 ? 1126 HIS E C     1 
ATOM   9966  O  O     . HIS E  1 153 ? 22.687  6.302   38.222  1.00 29.51 ? 1126 HIS E O     1 
ATOM   9967  C  CB    . HIS E  1 153 ? 25.061  7.688   40.094  1.00 25.51 ? 1126 HIS E CB    1 
ATOM   9968  C  CG    . HIS E  1 153 ? 25.112  6.257   40.566  1.00 26.91 ? 1126 HIS E CG    1 
ATOM   9969  N  ND1   . HIS E  1 153 ? 24.028  5.613   41.126  1.00 30.39 ? 1126 HIS E ND1   1 
ATOM   9970  C  CD2   . HIS E  1 153 ? 26.139  5.376   40.634  1.00 25.57 ? 1126 HIS E CD2   1 
ATOM   9971  C  CE1   . HIS E  1 153 ? 24.373  4.386   41.476  1.00 16.44 ? 1126 HIS E CE1   1 
ATOM   9972  N  NE2   . HIS E  1 153 ? 25.649  4.216   41.189  1.00 22.51 ? 1126 HIS E NE2   1 
ATOM   9973  N  N     . ARG E  1 154 ? 22.082  8.296   39.132  1.00 32.81 ? 1127 ARG E N     1 
ATOM   9974  C  CA    . ARG E  1 154 ? 20.618  8.096   39.143  1.00 32.13 ? 1127 ARG E CA    1 
ATOM   9975  C  C     . ARG E  1 154 ? 20.057  7.135   40.200  1.00 30.97 ? 1127 ARG E C     1 
ATOM   9976  O  O     . ARG E  1 154 ? 18.847  7.134   40.447  1.00 28.29 ? 1127 ARG E O     1 
ATOM   9977  C  CB    . ARG E  1 154 ? 20.094  7.722   37.755  1.00 36.62 ? 1127 ARG E CB    1 
ATOM   9978  C  CG    . ARG E  1 154 ? 19.910  8.892   36.800  1.00 30.78 ? 1127 ARG E CG    1 
ATOM   9979  C  CD    . ARG E  1 154 ? 19.873  8.350   35.384  1.00 26.81 ? 1127 ARG E CD    1 
ATOM   9980  N  NE    . ARG E  1 154 ? 18.726  8.847   34.638  1.00 41.56 ? 1127 ARG E NE    1 
ATOM   9981  C  CZ    . ARG E  1 154 ? 18.110  8.171   33.677  1.00 37.37 ? 1127 ARG E CZ    1 
ATOM   9982  N  NH1   . ARG E  1 154 ? 18.522  6.954   33.340  1.00 37.51 ? 1127 ARG E NH1   1 
ATOM   9983  N  NH2   . ARG E  1 154 ? 17.073  8.711   33.057  1.00 43.18 ? 1127 ARG E NH2   1 
ATOM   9984  N  N     . ASP E  1 155 ? 20.920  6.335   40.825  1.00 29.83 ? 1128 ASP E N     1 
ATOM   9985  C  CA    . ASP E  1 155 ? 20.482  5.387   41.850  1.00 29.57 ? 1128 ASP E CA    1 
ATOM   9986  C  C     . ASP E  1 155 ? 21.370  5.405   43.109  1.00 30.19 ? 1128 ASP E C     1 
ATOM   9987  O  O     . ASP E  1 155 ? 21.845  4.362   43.578  1.00 33.96 ? 1128 ASP E O     1 
ATOM   9988  C  CB    . ASP E  1 155 ? 20.386  3.977   41.259  1.00 30.27 ? 1128 ASP E CB    1 
ATOM   9989  C  CG    . ASP E  1 155 ? 19.228  3.165   41.841  1.00 36.04 ? 1128 ASP E CG    1 
ATOM   9990  O  OD1   . ASP E  1 155 ? 18.439  3.707   42.647  1.00 33.41 ? 1128 ASP E OD1   1 
ATOM   9991  O  OD2   . ASP E  1 155 ? 19.105  1.973   41.480  1.00 42.16 ? 1128 ASP E OD2   1 
ATOM   9992  N  N     . ILE E  1 156 ? 21.579  6.598   43.658  1.00 29.43 ? 1129 ILE E N     1 
ATOM   9993  C  CA    . ILE E  1 156 ? 22.441  6.762   44.826  1.00 29.10 ? 1129 ILE E CA    1 
ATOM   9994  C  C     . ILE E  1 156 ? 21.638  6.411   46.069  1.00 26.15 ? 1129 ILE E C     1 
ATOM   9995  O  O     . ILE E  1 156 ? 20.620  7.034   46.364  1.00 26.64 ? 1129 ILE E O     1 
ATOM   9996  C  CB    . ILE E  1 156 ? 23.046  8.193   44.939  1.00 27.06 ? 1129 ILE E CB    1 
ATOM   9997  C  CG1   . ILE E  1 156 ? 24.037  8.453   43.808  1.00 26.89 ? 1129 ILE E CG1   1 
ATOM   9998  C  CG2   . ILE E  1 156 ? 23.748  8.380   46.298  1.00 28.07 ? 1129 ILE E CG2   1 
ATOM   9999  C  CD1   . ILE E  1 156 ? 24.499  9.896   43.713  1.00 30.15 ? 1129 ILE E CD1   1 
ATOM   10000 N  N     . LYS E  1 157 ? 22.109  5.397   46.784  1.00 24.23 ? 1130 LYS E N     1 
ATOM   10001 C  CA    . LYS E  1 157 ? 21.436  4.901   47.966  1.00 23.46 ? 1130 LYS E CA    1 
ATOM   10002 C  C     . LYS E  1 157 ? 22.366  3.960   48.704  1.00 24.95 ? 1130 LYS E C     1 
ATOM   10003 O  O     . LYS E  1 157 ? 23.379  3.523   48.153  1.00 27.49 ? 1130 LYS E O     1 
ATOM   10004 C  CB    . LYS E  1 157 ? 20.097  4.218   47.614  1.00 19.56 ? 1130 LYS E CB    1 
ATOM   10005 C  CG    . LYS E  1 157 ? 20.149  3.160   46.539  1.00 16.68 ? 1130 LYS E CG    1 
ATOM   10006 C  CD    . LYS E  1 157 ? 18.829  2.405   46.473  1.00 25.18 ? 1130 LYS E CD    1 
ATOM   10007 C  CE    . LYS E  1 157 ? 18.924  1.179   45.561  1.00 23.53 ? 1130 LYS E CE    1 
ATOM   10008 N  NZ    . LYS E  1 157 ? 17.585  0.522   45.428  1.00 25.15 ? 1130 LYS E NZ    1 
ATOM   10009 N  N     . ASP E  1 158 ? 22.021  3.663   49.954  1.00 26.69 ? 1131 ASP E N     1 
ATOM   10010 C  CA    . ASP E  1 158 ? 22.777  2.729   50.797  1.00 27.07 ? 1131 ASP E CA    1 
ATOM   10011 C  C     . ASP E  1 158 ? 23.124  1.379   50.142  1.00 27.88 ? 1131 ASP E C     1 
ATOM   10012 O  O     . ASP E  1 158 ? 24.246  0.900   50.272  1.00 28.84 ? 1131 ASP E O     1 
ATOM   10013 C  CB    . ASP E  1 158 ? 22.058  2.515   52.145  1.00 30.18 ? 1131 ASP E CB    1 
ATOM   10014 C  CG    . ASP E  1 158 ? 20.567  2.216   51.999  1.00 30.76 ? 1131 ASP E CG    1 
ATOM   10015 O  OD1   . ASP E  1 158 ? 20.108  1.756   50.924  1.00 36.18 ? 1131 ASP E OD1   1 
ATOM   10016 O  OD2   . ASP E  1 158 ? 19.844  2.433   52.989  1.00 36.11 ? 1131 ASP E OD2   1 
ATOM   10017 N  N     . GLU E  1 159 ? 22.168  0.781   49.433  1.00 31.51 ? 1132 GLU E N     1 
ATOM   10018 C  CA    . GLU E  1 159 ? 22.385  -0.496  48.727  1.00 36.79 ? 1132 GLU E CA    1 
ATOM   10019 C  C     . GLU E  1 159 ? 23.412  -0.423  47.598  1.00 35.94 ? 1132 GLU E C     1 
ATOM   10020 O  O     . GLU E  1 159 ? 24.061  -1.425  47.286  1.00 33.83 ? 1132 GLU E O     1 
ATOM   10021 C  CB    . GLU E  1 159 ? 21.070  -1.045  48.177  1.00 36.43 ? 1132 GLU E CB    1 
ATOM   10022 C  CG    . GLU E  1 159 ? 20.260  -1.838  49.184  1.00 48.52 ? 1132 GLU E CG    1 
ATOM   10023 C  CD    . GLU E  1 159 ? 18.805  -1.988  48.778  1.00 55.33 ? 1132 GLU E CD    1 
ATOM   10024 O  OE1   . GLU E  1 159 ? 17.923  -1.732  49.629  1.00 52.13 ? 1132 GLU E OE1   1 
ATOM   10025 O  OE2   . GLU E  1 159 ? 18.546  -2.351  47.609  1.00 61.80 ? 1132 GLU E OE2   1 
ATOM   10026 N  N     . ASN E  1 160 ? 23.550  0.761   46.999  1.00 36.05 ? 1133 ASN E N     1 
ATOM   10027 C  CA    . ASN E  1 160 ? 24.492  0.992   45.897  1.00 36.59 ? 1133 ASN E CA    1 
ATOM   10028 C  C     . ASN E  1 160 ? 25.824  1.607   46.328  1.00 37.58 ? 1133 ASN E C     1 
ATOM   10029 O  O     . ASN E  1 160 ? 26.537  2.203   45.511  1.00 37.86 ? 1133 ASN E O     1 
ATOM   10030 C  CB    . ASN E  1 160 ? 23.837  1.838   44.801  1.00 33.92 ? 1133 ASN E CB    1 
ATOM   10031 C  CG    . ASN E  1 160 ? 22.720  1.102   44.094  1.00 24.08 ? 1133 ASN E CG    1 
ATOM   10032 O  OD1   . ASN E  1 160 ? 22.654  -0.124  44.127  1.00 24.09 ? 1133 ASN E OD1   1 
ATOM   10033 N  ND2   . ASN E  1 160 ? 21.835  1.845   43.456  1.00 17.14 ? 1133 ASN E ND2   1 
ATOM   10034 N  N     . ILE E  1 161 ? 26.142  1.453   47.612  1.00 35.22 ? 1134 ILE E N     1 
ATOM   10035 C  CA    . ILE E  1 161 ? 27.388  1.937   48.200  1.00 34.26 ? 1134 ILE E CA    1 
ATOM   10036 C  C     . ILE E  1 161 ? 27.969  0.804   49.041  1.00 36.90 ? 1134 ILE E C     1 
ATOM   10037 O  O     . ILE E  1 161 ? 27.263  0.233   49.877  1.00 35.94 ? 1134 ILE E O     1 
ATOM   10038 C  CB    . ILE E  1 161 ? 27.177  3.195   49.097  1.00 28.68 ? 1134 ILE E CB    1 
ATOM   10039 C  CG1   . ILE E  1 161 ? 26.605  4.360   48.277  1.00 32.81 ? 1134 ILE E CG1   1 
ATOM   10040 C  CG2   . ILE E  1 161 ? 28.505  3.611   49.768  1.00 23.44 ? 1134 ILE E CG2   1 
ATOM   10041 C  CD1   . ILE E  1 161 ? 25.856  5.393   49.089  1.00 24.14 ? 1134 ILE E CD1   1 
ATOM   10042 N  N     . VAL E  1 162 ? 29.247  0.494   48.819  1.00 34.31 ? 1135 VAL E N     1 
ATOM   10043 C  CA    . VAL E  1 162 ? 29.944  -0.574  49.551  1.00 37.70 ? 1135 VAL E CA    1 
ATOM   10044 C  C     . VAL E  1 162 ? 30.962  0.003   50.551  1.00 36.08 ? 1135 VAL E C     1 
ATOM   10045 O  O     . VAL E  1 162 ? 31.668  0.963   50.240  1.00 35.31 ? 1135 VAL E O     1 
ATOM   10046 C  CB    . VAL E  1 162 ? 30.632  -1.575  48.568  1.00 38.59 ? 1135 VAL E CB    1 
ATOM   10047 C  CG1   . VAL E  1 162 ? 31.387  -2.647  49.319  1.00 42.36 ? 1135 VAL E CG1   1 
ATOM   10048 C  CG2   . VAL E  1 162 ? 29.601  -2.227  47.660  1.00 40.63 ? 1135 VAL E CG2   1 
ATOM   10049 N  N     . ILE E  1 163 ? 31.032  -0.586  51.746  1.00 37.17 ? 1136 ILE E N     1 
ATOM   10050 C  CA    . ILE E  1 163 ? 31.937  -0.102  52.801  1.00 34.80 ? 1136 ILE E CA    1 
ATOM   10051 C  C     . ILE E  1 163 ? 32.935  -1.162  53.305  1.00 36.73 ? 1136 ILE E C     1 
ATOM   10052 O  O     . ILE E  1 163 ? 32.577  -2.320  53.520  1.00 36.05 ? 1136 ILE E O     1 
ATOM   10053 C  CB    . ILE E  1 163 ? 31.140  0.541   53.981  1.00 35.21 ? 1136 ILE E CB    1 
ATOM   10054 C  CG1   . ILE E  1 163 ? 32.066  1.362   54.893  1.00 32.18 ? 1136 ILE E CG1   1 
ATOM   10055 C  CG2   . ILE E  1 163 ? 30.317  -0.515  54.759  1.00 32.08 ? 1136 ILE E CG2   1 
ATOM   10056 C  CD1   . ILE E  1 163 ? 31.365  1.993   56.078  1.00 21.97 ? 1136 ILE E CD1   1 
ATOM   10057 N  N     . ALA E  1 164 ? 34.187  -0.754  53.486  1.00 39.43 ? 1137 ALA E N     1 
ATOM   10058 C  CA    . ALA E  1 164 ? 35.220  -1.639  54.026  1.00 44.53 ? 1137 ALA E CA    1 
ATOM   10059 C  C     . ALA E  1 164 ? 35.391  -1.481  55.546  1.00 48.39 ? 1137 ALA E C     1 
ATOM   10060 O  O     . ALA E  1 164 ? 34.733  -0.639  56.170  1.00 48.04 ? 1137 ALA E O     1 
ATOM   10061 C  CB    . ALA E  1 164 ? 36.542  -1.415  53.304  1.00 41.46 ? 1137 ALA E CB    1 
ATOM   10062 N  N     . GLU E  1 165 ? 36.271  -2.303  56.126  1.00 50.41 ? 1138 GLU E N     1 
ATOM   10063 C  CA    . GLU E  1 165 ? 36.557  -2.285  57.564  1.00 51.56 ? 1138 GLU E CA    1 
ATOM   10064 C  C     . GLU E  1 165 ? 37.214  -0.981  58.017  1.00 53.93 ? 1138 GLU E C     1 
ATOM   10065 O  O     . GLU E  1 165 ? 36.985  -0.526  59.142  1.00 54.49 ? 1138 GLU E O     1 
ATOM   10066 C  CB    . GLU E  1 165 ? 37.425  -3.484  57.961  1.00 50.62 ? 1138 GLU E CB    1 
ATOM   10067 N  N     . ASP E  1 166 ? 38.018  -0.383  57.135  1.00 54.22 ? 1139 ASP E N     1 
ATOM   10068 C  CA    . ASP E  1 166 ? 38.646  0.917   57.399  1.00 52.80 ? 1139 ASP E CA    1 
ATOM   10069 C  C     . ASP E  1 166 ? 37.732  2.117   57.071  1.00 52.11 ? 1139 ASP E C     1 
ATOM   10070 O  O     . ASP E  1 166 ? 38.198  3.257   57.009  1.00 54.22 ? 1139 ASP E O     1 
ATOM   10071 C  CB    . ASP E  1 166 ? 39.994  1.032   56.665  1.00 53.68 ? 1139 ASP E CB    1 
ATOM   10072 C  CG    . ASP E  1 166 ? 39.859  0.928   55.150  1.00 52.67 ? 1139 ASP E CG    1 
ATOM   10073 O  OD1   . ASP E  1 166 ? 40.851  1.198   54.440  1.00 48.34 ? 1139 ASP E OD1   1 
ATOM   10074 O  OD2   . ASP E  1 166 ? 38.767  0.577   54.665  1.00 51.86 ? 1139 ASP E OD2   1 
ATOM   10075 N  N     . PHE E  1 167 ? 36.442  1.836   56.859  1.00 49.77 ? 1140 PHE E N     1 
ATOM   10076 C  CA    . PHE E  1 167 ? 35.378  2.840   56.621  1.00 47.62 ? 1140 PHE E CA    1 
ATOM   10077 C  C     . PHE E  1 167 ? 35.426  3.581   55.273  1.00 42.42 ? 1140 PHE E C     1 
ATOM   10078 O  O     . PHE E  1 167 ? 34.721  4.578   55.078  1.00 40.39 ? 1140 PHE E O     1 
ATOM   10079 C  CB    . PHE E  1 167 ? 35.253  3.832   57.795  1.00 43.97 ? 1140 PHE E CB    1 
ATOM   10080 C  CG    . PHE E  1 167 ? 35.102  3.173   59.135  1.00 42.50 ? 1140 PHE E CG    1 
ATOM   10081 C  CD1   . PHE E  1 167 ? 33.885  2.608   59.517  1.00 37.30 ? 1140 PHE E CD1   1 
ATOM   10082 C  CD2   . PHE E  1 167 ? 36.179  3.124   60.024  1.00 41.04 ? 1140 PHE E CD2   1 
ATOM   10083 C  CE1   . PHE E  1 167 ? 33.747  1.992   60.765  1.00 38.73 ? 1140 PHE E CE1   1 
ATOM   10084 C  CE2   . PHE E  1 167 ? 36.050  2.514   61.275  1.00 38.35 ? 1140 PHE E CE2   1 
ATOM   10085 C  CZ    . PHE E  1 167 ? 34.832  1.950   61.648  1.00 37.19 ? 1140 PHE E CZ    1 
ATOM   10086 N  N     . THR E  1 168 ? 36.251  3.088   54.353  1.00 41.28 ? 1141 THR E N     1 
ATOM   10087 C  CA    . THR E  1 168 ? 36.303  3.614   52.989  1.00 41.74 ? 1141 THR E CA    1 
ATOM   10088 C  C     . THR E  1 168 ? 35.150  3.020   52.184  1.00 37.56 ? 1141 THR E C     1 
ATOM   10089 O  O     . THR E  1 168 ? 34.827  1.845   52.337  1.00 36.55 ? 1141 THR E O     1 
ATOM   10090 C  CB    . THR E  1 168 ? 37.656  3.301   52.317  1.00 45.82 ? 1141 THR E CB    1 
ATOM   10091 O  OG1   . THR E  1 168 ? 38.717  3.841   53.119  1.00 55.11 ? 1141 THR E OG1   1 
ATOM   10092 C  CG2   . THR E  1 168 ? 37.734  3.904   50.913  1.00 41.57 ? 1141 THR E CG2   1 
ATOM   10093 N  N     . ILE E  1 169 ? 34.536  3.849   51.343  1.00 33.79 ? 1142 ILE E N     1 
ATOM   10094 C  CA    . ILE E  1 169 ? 33.308  3.496   50.631  1.00 29.97 ? 1142 ILE E CA    1 
ATOM   10095 C  C     . ILE E  1 169 ? 33.458  3.584   49.105  1.00 32.12 ? 1142 ILE E C     1 
ATOM   10096 O  O     . ILE E  1 169 ? 34.169  4.460   48.588  1.00 33.78 ? 1142 ILE E O     1 
ATOM   10097 C  CB    . ILE E  1 169 ? 32.068  4.322   51.128  1.00 28.25 ? 1142 ILE E CB    1 
ATOM   10098 C  CG1   . ILE E  1 169 ? 32.187  5.814   50.787  1.00 23.81 ? 1142 ILE E CG1   1 
ATOM   10099 C  CG2   . ILE E  1 169 ? 31.853  4.153   52.616  1.00 19.47 ? 1142 ILE E CG2   1 
ATOM   10100 C  CD1   . ILE E  1 169 ? 31.435  6.214   49.533  1.00 31.68 ? 1142 ILE E CD1   1 
ATOM   10101 N  N     . LYS E  1 170 ? 32.793  2.664   48.404  1.00 29.72 ? 1143 LYS E N     1 
ATOM   10102 C  CA    . LYS E  1 170 ? 32.807  2.606   46.939  1.00 32.12 ? 1143 LYS E CA    1 
ATOM   10103 C  C     . LYS E  1 170 ? 31.394  2.725   46.374  1.00 33.16 ? 1143 LYS E C     1 
ATOM   10104 O  O     . LYS E  1 170 ? 30.481  2.011   46.809  1.00 30.36 ? 1143 LYS E O     1 
ATOM   10105 C  CB    . LYS E  1 170 ? 33.459  1.309   46.446  1.00 36.71 ? 1143 LYS E CB    1 
ATOM   10106 C  CG    . LYS E  1 170 ? 34.886  1.445   45.914  1.00 43.65 ? 1143 LYS E CG    1 
ATOM   10107 C  CD    . LYS E  1 170 ? 35.877  1.828   46.992  1.00 48.51 ? 1143 LYS E CD    1 
ATOM   10108 C  CE    . LYS E  1 170 ? 37.306  1.721   46.489  1.00 51.25 ? 1143 LYS E CE    1 
ATOM   10109 N  NZ    . LYS E  1 170 ? 38.275  2.147   47.540  1.00 59.61 ? 1143 LYS E NZ    1 
ATOM   10110 N  N     . LEU E  1 171 ? 31.226  3.647   45.423  1.00 31.76 ? 1144 LEU E N     1 
ATOM   10111 C  CA    . LEU E  1 171 ? 29.973  3.819   44.706  1.00 33.22 ? 1144 LEU E CA    1 
ATOM   10112 C  C     . LEU E  1 171 ? 29.877  2.739   43.643  1.00 33.28 ? 1144 LEU E C     1 
ATOM   10113 O  O     . LEU E  1 171 ? 30.679  2.710   42.710  1.00 39.53 ? 1144 LEU E O     1 
ATOM   10114 C  CB    . LEU E  1 171 ? 29.886  5.224   44.086  1.00 33.35 ? 1144 LEU E CB    1 
ATOM   10115 C  CG    . LEU E  1 171 ? 28.561  5.785   43.534  1.00 33.63 ? 1144 LEU E CG    1 
ATOM   10116 C  CD1   . LEU E  1 171 ? 27.381  5.617   44.492  1.00 29.02 ? 1144 LEU E CD1   1 
ATOM   10117 C  CD2   . LEU E  1 171 ? 28.711  7.251   43.146  1.00 29.48 ? 1144 LEU E CD2   1 
ATOM   10118 N  N     . ILE E  1 172 ? 28.908  1.839   43.809  1.00 35.08 ? 1145 ILE E N     1 
ATOM   10119 C  CA    . ILE E  1 172 ? 28.708  0.704   42.898  1.00 32.99 ? 1145 ILE E CA    1 
ATOM   10120 C  C     . ILE E  1 172 ? 27.374  0.792   42.151  1.00 35.06 ? 1145 ILE E C     1 
ATOM   10121 O  O     . ILE E  1 172 ? 26.545  1.658   42.433  1.00 35.25 ? 1145 ILE E O     1 
ATOM   10122 C  CB    . ILE E  1 172 ? 28.792  -0.686  43.629  1.00 34.46 ? 1145 ILE E CB    1 
ATOM   10123 C  CG1   . ILE E  1 172 ? 27.737  -0.786  44.741  1.00 36.77 ? 1145 ILE E CG1   1 
ATOM   10124 C  CG2   . ILE E  1 172 ? 30.197  -0.939  44.174  1.00 36.85 ? 1145 ILE E CG2   1 
ATOM   10125 C  CD1   . ILE E  1 172 ? 27.032  -2.122  44.840  1.00 20.47 ? 1145 ILE E CD1   1 
ATOM   10126 N  N     . ASP E  1 173 ? 27.191  -0.116  41.191  1.00 36.05 ? 1146 ASP E N     1 
ATOM   10127 C  CA    . ASP E  1 173 ? 25.953  -0.258  40.423  1.00 36.06 ? 1146 ASP E CA    1 
ATOM   10128 C  C     . ASP E  1 173 ? 25.564  0.968   39.602  1.00 36.00 ? 1146 ASP E C     1 
ATOM   10129 O  O     . ASP E  1 173 ? 24.723  1.771   40.014  1.00 41.58 ? 1146 ASP E O     1 
ATOM   10130 C  CB    . ASP E  1 173 ? 24.797  -0.682  41.328  1.00 36.15 ? 1146 ASP E CB    1 
ATOM   10131 C  CG    . ASP E  1 173 ? 23.573  -1.096  40.553  1.00 39.03 ? 1146 ASP E CG    1 
ATOM   10132 O  OD1   . ASP E  1 173 ? 23.654  -1.280  39.316  1.00 37.81 ? 1146 ASP E OD1   1 
ATOM   10133 O  OD2   . ASP E  1 173 ? 22.514  -1.254  41.193  1.00 44.36 ? 1146 ASP E OD2   1 
ATOM   10134 N  N     . PHE E  1 174 ? 26.158  1.078   38.421  1.00 32.47 ? 1147 PHE E N     1 
ATOM   10135 C  CA    . PHE E  1 174 ? 25.876  2.178   37.502  1.00 31.72 ? 1147 PHE E CA    1 
ATOM   10136 C  C     . PHE E  1 174 ? 24.870  1.752   36.428  1.00 31.42 ? 1147 PHE E C     1 
ATOM   10137 O  O     . PHE E  1 174 ? 24.852  2.305   35.331  1.00 31.53 ? 1147 PHE E O     1 
ATOM   10138 C  CB    . PHE E  1 174 ? 27.184  2.675   36.867  1.00 29.67 ? 1147 PHE E CB    1 
ATOM   10139 C  CG    . PHE E  1 174 ? 28.059  3.452   37.808  1.00 28.03 ? 1147 PHE E CG    1 
ATOM   10140 C  CD1   . PHE E  1 174 ? 28.653  2.835   38.909  1.00 27.67 ? 1147 PHE E CD1   1 
ATOM   10141 C  CD2   . PHE E  1 174 ? 28.302  4.803   37.587  1.00 22.67 ? 1147 PHE E CD2   1 
ATOM   10142 C  CE1   . PHE E  1 174 ? 29.461  3.556   39.782  1.00 25.70 ? 1147 PHE E CE1   1 
ATOM   10143 C  CE2   . PHE E  1 174 ? 29.114  5.525   38.441  1.00 14.26 ? 1147 PHE E CE2   1 
ATOM   10144 C  CZ    . PHE E  1 174 ? 29.700  4.900   39.542  1.00 26.60 ? 1147 PHE E CZ    1 
ATOM   10145 N  N     . GLY E  1 175 ? 24.029  0.773   36.763  1.00 33.44 ? 1148 GLY E N     1 
ATOM   10146 C  CA    . GLY E  1 175 ? 22.994  0.268   35.857  1.00 30.92 ? 1148 GLY E CA    1 
ATOM   10147 C  C     . GLY E  1 175 ? 21.949  1.286   35.442  1.00 28.63 ? 1148 GLY E C     1 
ATOM   10148 O  O     . GLY E  1 175 ? 21.296  1.129   34.411  1.00 29.40 ? 1148 GLY E O     1 
ATOM   10149 N  N     . SER E  1 176 ? 21.790  2.327   36.250  1.00 24.50 ? 1149 SER E N     1 
ATOM   10150 C  CA    . SER E  1 176 ? 20.865  3.412   35.947  1.00 25.85 ? 1149 SER E CA    1 
ATOM   10151 C  C     . SER E  1 176 ? 21.573  4.647   35.412  1.00 19.69 ? 1149 SER E C     1 
ATOM   10152 O  O     . SER E  1 176 ? 20.918  5.599   35.019  1.00 27.56 ? 1149 SER E O     1 
ATOM   10153 C  CB    . SER E  1 176 ? 20.052  3.803   37.195  1.00 28.76 ? 1149 SER E CB    1 
ATOM   10154 O  OG    . SER E  1 176 ? 18.822  3.100   37.255  1.00 41.65 ? 1149 SER E OG    1 
ATOM   10155 N  N     . ALA E  1 177 ? 22.902  4.638   35.402  1.00 23.39 ? 1150 ALA E N     1 
ATOM   10156 C  CA    . ALA E  1 177 ? 23.665  5.848   35.095  1.00 30.02 ? 1150 ALA E CA    1 
ATOM   10157 C  C     . ALA E  1 177 ? 23.406  6.392   33.686  1.00 33.77 ? 1150 ALA E C     1 
ATOM   10158 O  O     . ALA E  1 177 ? 22.962  5.662   32.794  1.00 34.18 ? 1150 ALA E O     1 
ATOM   10159 C  CB    . ALA E  1 177 ? 25.150  5.638   35.348  1.00 30.38 ? 1150 ALA E CB    1 
ATOM   10160 N  N     . ALA E  1 178 ? 23.668  7.687   33.514  1.00 34.67 ? 1151 ALA E N     1 
ATOM   10161 C  CA    . ALA E  1 178 ? 23.342  8.410   32.296  1.00 32.79 ? 1151 ALA E CA    1 
ATOM   10162 C  C     . ALA E  1 178 ? 24.162  9.689   32.198  1.00 37.94 ? 1151 ALA E C     1 
ATOM   10163 O  O     . ALA E  1 178 ? 24.618  10.238  33.210  1.00 35.66 ? 1151 ALA E O     1 
ATOM   10164 C  CB    . ALA E  1 178 ? 21.841  8.745   32.259  1.00 33.44 ? 1151 ALA E CB    1 
ATOM   10165 N  N     . TYR E  1 179 ? 24.331  10.167  30.969  1.00 41.93 ? 1152 TYR E N     1 
ATOM   10166 C  CA    . TYR E  1 179 ? 25.062  11.404  30.708  1.00 40.33 ? 1152 TYR E CA    1 
ATOM   10167 C  C     . TYR E  1 179 ? 24.175  12.645  30.711  1.00 38.58 ? 1152 TYR E C     1 
ATOM   10168 O  O     . TYR E  1 179 ? 23.101  12.661  30.113  1.00 36.06 ? 1152 TYR E O     1 
ATOM   10169 C  CB    . TYR E  1 179 ? 25.814  11.309  29.379  1.00 37.75 ? 1152 TYR E CB    1 
ATOM   10170 C  CG    . TYR E  1 179 ? 27.077  10.494  29.464  1.00 38.68 ? 1152 TYR E CG    1 
ATOM   10171 C  CD1   . TYR E  1 179 ? 28.279  11.081  29.854  1.00 30.00 ? 1152 TYR E CD1   1 
ATOM   10172 C  CD2   . TYR E  1 179 ? 27.075  9.135   29.151  1.00 37.69 ? 1152 TYR E CD2   1 
ATOM   10173 C  CE1   . TYR E  1 179 ? 29.449  10.334  29.929  1.00 36.12 ? 1152 TYR E CE1   1 
ATOM   10174 C  CE2   . TYR E  1 179 ? 28.241  8.381   29.225  1.00 37.28 ? 1152 TYR E CE2   1 
ATOM   10175 C  CZ    . TYR E  1 179 ? 29.423  8.987   29.618  1.00 36.15 ? 1152 TYR E CZ    1 
ATOM   10176 O  OH    . TYR E  1 179 ? 30.586  8.248   29.702  1.00 41.04 ? 1152 TYR E OH    1 
ATOM   10177 N  N     . LEU E  1 180 ? 24.643  13.676  31.408  1.00 41.00 ? 1153 LEU E N     1 
ATOM   10178 C  CA    . LEU E  1 180 ? 24.095  15.020  31.294  1.00 43.02 ? 1153 LEU E CA    1 
ATOM   10179 C  C     . LEU E  1 180 ? 24.392  15.583  29.895  1.00 44.20 ? 1153 LEU E C     1 
ATOM   10180 O  O     . LEU E  1 180 ? 25.517  15.487  29.395  1.00 39.86 ? 1153 LEU E O     1 
ATOM   10181 C  CB    . LEU E  1 180 ? 24.692  15.924  32.387  1.00 42.55 ? 1153 LEU E CB    1 
ATOM   10182 C  CG    . LEU E  1 180 ? 23.996  16.161  33.741  1.00 43.84 ? 1153 LEU E CG    1 
ATOM   10183 C  CD1   . LEU E  1 180 ? 22.852  15.177  34.037  1.00 38.64 ? 1153 LEU E CD1   1 
ATOM   10184 C  CD2   . LEU E  1 180 ? 25.025  16.178  34.883  1.00 28.83 ? 1153 LEU E CD2   1 
ATOM   10185 N  N     . GLU E  1 181 ? 23.365  16.150  29.271  1.00 48.34 ? 1154 GLU E N     1 
ATOM   10186 C  CA    . GLU E  1 181 ? 23.474  16.751  27.949  1.00 53.27 ? 1154 GLU E CA    1 
ATOM   10187 C  C     . GLU E  1 181 ? 22.936  18.178  28.024  1.00 52.51 ? 1154 GLU E C     1 
ATOM   10188 O  O     . GLU E  1 181 ? 22.109  18.493  28.882  1.00 51.25 ? 1154 GLU E O     1 
ATOM   10189 C  CB    . GLU E  1 181 ? 22.690  15.922  26.923  1.00 55.64 ? 1154 GLU E CB    1 
ATOM   10190 C  CG    . GLU E  1 181 ? 23.191  16.031  25.485  1.00 61.22 ? 1154 GLU E CG    1 
ATOM   10191 C  CD    . GLU E  1 181 ? 22.320  15.275  24.488  1.00 60.09 ? 1154 GLU E CD    1 
ATOM   10192 O  OE1   . GLU E  1 181 ? 22.336  15.628  23.284  1.00 61.74 ? 1154 GLU E OE1   1 
ATOM   10193 O  OE2   . GLU E  1 181 ? 21.619  14.328  24.905  1.00 66.29 ? 1154 GLU E OE2   1 
ATOM   10194 N  N     . ARG E  1 182 ? 23.406  19.034  27.121  1.00 54.07 ? 1155 ARG E N     1 
ATOM   10195 C  CA    . ARG E  1 182 ? 23.066  20.457  27.143  1.00 54.59 ? 1155 ARG E CA    1 
ATOM   10196 C  C     . ARG E  1 182 ? 21.624  20.710  26.696  1.00 54.57 ? 1155 ARG E C     1 
ATOM   10197 O  O     . ARG E  1 182 ? 21.234  20.352  25.579  1.00 53.11 ? 1155 ARG E O     1 
ATOM   10198 C  CB    . ARG E  1 182 ? 24.049  21.270  26.290  1.00 54.45 ? 1155 ARG E CB    1 
ATOM   10199 C  CG    . ARG E  1 182 ? 25.521  21.142  26.693  1.00 55.69 ? 1155 ARG E CG    1 
ATOM   10200 C  CD    . ARG E  1 182 ? 26.135  19.821  26.226  1.00 66.07 ? 1155 ARG E CD    1 
ATOM   10201 N  NE    . ARG E  1 182 ? 26.027  19.640  24.779  1.00 68.02 ? 1155 ARG E NE    1 
ATOM   10202 C  CZ    . ARG E  1 182 ? 26.191  18.481  24.147  1.00 75.10 ? 1155 ARG E CZ    1 
ATOM   10203 N  NH1   . ARG E  1 182 ? 26.462  17.373  24.828  1.00 77.86 ? 1155 ARG E NH1   1 
ATOM   10204 N  NH2   . ARG E  1 182 ? 26.075  18.427  22.825  1.00 75.72 ? 1155 ARG E NH2   1 
ATOM   10205 N  N     . GLY E  1 183 ? 20.843  21.311  27.594  1.00 54.33 ? 1156 GLY E N     1 
ATOM   10206 C  CA    . GLY E  1 183 ? 19.442  21.651  27.345  1.00 55.31 ? 1156 GLY E CA    1 
ATOM   10207 C  C     . GLY E  1 183 ? 18.498  20.470  27.187  1.00 56.89 ? 1156 GLY E C     1 
ATOM   10208 O  O     . GLY E  1 183 ? 17.476  20.578  26.504  1.00 58.16 ? 1156 GLY E O     1 
ATOM   10209 N  N     . LYS E  1 184 ? 18.829  19.349  27.828  1.00 55.37 ? 1157 LYS E N     1 
ATOM   10210 C  CA    . LYS E  1 184 ? 18.034  18.127  27.716  1.00 51.83 ? 1157 LYS E CA    1 
ATOM   10211 C  C     . LYS E  1 184 ? 17.417  17.707  29.054  1.00 49.06 ? 1157 LYS E C     1 
ATOM   10212 O  O     . LYS E  1 184 ? 18.022  17.889  30.116  1.00 46.02 ? 1157 LYS E O     1 
ATOM   10213 C  CB    . LYS E  1 184 ? 18.893  16.997  27.140  1.00 52.47 ? 1157 LYS E CB    1 
ATOM   10214 C  CG    . LYS E  1 184 ? 18.128  15.801  26.551  1.00 60.20 ? 1157 LYS E CG    1 
ATOM   10215 C  CD    . LYS E  1 184 ? 17.304  16.155  25.307  1.00 56.23 ? 1157 LYS E CD    1 
ATOM   10216 C  CE    . LYS E  1 184 ? 15.809  16.266  25.625  1.00 60.33 ? 1157 LYS E CE    1 
ATOM   10217 N  NZ    . LYS E  1 184 ? 15.196  14.948  25.970  1.00 53.24 ? 1157 LYS E NZ    1 
ATOM   10218 N  N     . LEU E  1 185 ? 16.206  17.154  28.985  1.00 47.12 ? 1158 LEU E N     1 
ATOM   10219 C  CA    . LEU E  1 185 ? 15.495  16.654  30.162  1.00 46.10 ? 1158 LEU E CA    1 
ATOM   10220 C  C     . LEU E  1 185 ? 15.289  15.135  30.103  1.00 44.84 ? 1158 LEU E C     1 
ATOM   10221 O  O     . LEU E  1 185 ? 15.299  14.529  29.025  1.00 45.36 ? 1158 LEU E O     1 
ATOM   10222 C  CB    . LEU E  1 185 ? 14.147  17.378  30.353  1.00 42.03 ? 1158 LEU E CB    1 
ATOM   10223 C  CG    . LEU E  1 185 ? 14.084  18.903  30.543  1.00 38.03 ? 1158 LEU E CG    1 
ATOM   10224 C  CD1   . LEU E  1 185 ? 12.637  19.363  30.585  1.00 44.24 ? 1158 LEU E CD1   1 
ATOM   10225 C  CD2   . LEU E  1 185 ? 14.825  19.413  31.784  1.00 38.43 ? 1158 LEU E CD2   1 
ATOM   10226 N  N     . PHE E  1 186 ? 15.116  14.525  31.270  1.00 42.00 ? 1159 PHE E N     1 
ATOM   10227 C  CA    . PHE E  1 186 ? 14.823  13.101  31.350  1.00 38.14 ? 1159 PHE E CA    1 
ATOM   10228 C  C     . PHE E  1 186 ? 13.346  12.918  31.650  1.00 38.56 ? 1159 PHE E C     1 
ATOM   10229 O  O     . PHE E  1 186 ? 12.834  13.433  32.646  1.00 38.75 ? 1159 PHE E O     1 
ATOM   10230 C  CB    . PHE E  1 186 ? 15.666  12.426  32.424  1.00 37.49 ? 1159 PHE E CB    1 
ATOM   10231 C  CG    . PHE E  1 186 ? 17.145  12.493  32.178  1.00 33.33 ? 1159 PHE E CG    1 
ATOM   10232 C  CD1   . PHE E  1 186 ? 17.897  13.559  32.660  1.00 32.30 ? 1159 PHE E CD1   1 
ATOM   10233 C  CD2   . PHE E  1 186 ? 17.792  11.476  31.484  1.00 32.12 ? 1159 PHE E CD2   1 
ATOM   10234 C  CE1   . PHE E  1 186 ? 19.268  13.626  32.436  1.00 34.22 ? 1159 PHE E CE1   1 
ATOM   10235 C  CE2   . PHE E  1 186 ? 19.169  11.530  31.260  1.00 40.86 ? 1159 PHE E CE2   1 
ATOM   10236 C  CZ    . PHE E  1 186 ? 19.907  12.611  31.741  1.00 37.38 ? 1159 PHE E CZ    1 
ATOM   10237 N  N     . TYR E  1 187 ? 12.668  12.182  30.775  1.00 41.73 ? 1160 TYR E N     1 
ATOM   10238 C  CA    . TYR E  1 187 ? 11.219  12.019  30.844  1.00 42.14 ? 1160 TYR E CA    1 
ATOM   10239 C  C     . TYR E  1 187 ? 10.778  10.718  31.520  1.00 40.67 ? 1160 TYR E C     1 
ATOM   10240 O  O     . TYR E  1 187 ? 9.578   10.476  31.669  1.00 38.92 ? 1160 TYR E O     1 
ATOM   10241 C  CB    . TYR E  1 187 ? 10.614  12.128  29.441  1.00 44.85 ? 1160 TYR E CB    1 
ATOM   10242 C  CG    . TYR E  1 187 ? 10.422  13.549  28.959  1.00 45.12 ? 1160 TYR E CG    1 
ATOM   10243 C  CD1   . TYR E  1 187 ? 9.236   14.233  29.216  1.00 54.98 ? 1160 TYR E CD1   1 
ATOM   10244 C  CD2   . TYR E  1 187 ? 11.421  14.208  28.237  1.00 53.45 ? 1160 TYR E CD2   1 
ATOM   10245 C  CE1   . TYR E  1 187 ? 9.045   15.540  28.771  1.00 55.23 ? 1160 TYR E CE1   1 
ATOM   10246 C  CE2   . TYR E  1 187 ? 11.241  15.517  27.785  1.00 48.34 ? 1160 TYR E CE2   1 
ATOM   10247 C  CZ    . TYR E  1 187 ? 10.047  16.176  28.059  1.00 52.72 ? 1160 TYR E CZ    1 
ATOM   10248 O  OH    . TYR E  1 187 ? 9.844   17.469  27.624  1.00 51.42 ? 1160 TYR E OH    1 
ATOM   10249 N  N     . THR E  1 188 ? 11.746  9.885   31.908  1.00 38.26 ? 1161 THR E N     1 
ATOM   10250 C  CA    . THR E  1 188 ? 11.476  8.699   32.734  1.00 43.13 ? 1161 THR E CA    1 
ATOM   10251 C  C     . THR E  1 188 ? 12.348  8.676   33.996  1.00 41.10 ? 1161 THR E C     1 
ATOM   10252 O  O     . THR E  1 188 ? 13.451  9.221   34.010  1.00 43.53 ? 1161 THR E O     1 
ATOM   10253 C  CB    . THR E  1 188 ? 11.676  7.364   31.963  1.00 45.39 ? 1161 THR E CB    1 
ATOM   10254 O  OG1   . THR E  1 188 ? 12.946  7.377   31.303  1.00 54.66