data_3DLX
# 
_entry.id   3DLX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DLX         
RCSB  RCSB048202   
WWPDB D_1000048202 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DLX 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kavanagh, K.L.'                       1  
'Shafqat, N.'                          2  
'Yue, W.W.'                            3  
'Picaud, S.'                           4  
'Murray, J.W.'                         5  
'Maclean, E.M.'                        6  
'von Delft, F.'                        7  
'Roos, A.K.'                           8  
'Arrowsmith, C.H.'                     9  
'Wikstrom, M.'                         10 
'Edwards, A.M.'                        11 
'Bountra, C.'                          12 
'Oppermann, U.'                        13 
'Structural Genomics Consortium (SGC)' 14 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human 3-oxoacid CoA transferase 1.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kavanagh, K.L.'   1  
primary 'Shafqat, N.'      2  
primary 'Yue, W.W.'        3  
primary 'Picaud, S.'       4  
primary 'Murray, J.W.'     5  
primary 'Maclean, E.M.'    6  
primary 'von Delft, F.'    7  
primary 'Roos, A.K.'       8  
primary 'Arrowsmith, C.H.' 9  
primary 'Wikstrom, M.'     10 
primary 'Edwards, A.M.'    11 
primary 'Bountra, C.'      12 
primary 'Oppermann, U.'    13 
# 
_cell.entry_id           3DLX 
_cell.length_a           60.956 
_cell.length_b           168.492 
_cell.length_c           95.322 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.86 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DLX 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Succinyl-CoA:3-ketoacid-coenzyme A transferase 1' 53150.844 4   2.8.3.5 ? ? ? 
2 non-polymer syn GLYCEROL                                           92.094    2   ?       ? ? ? 
3 water       nat water                                              18.015    375 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Somatic-type succinyl CoA:3-oxoacid CoA-transferase, Scot-S' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGE
NAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFI
LEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKR
IERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHE
ADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVV
VTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQI
ANAENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGE
NAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFI
LEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKR
IERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHE
ADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVV
VTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQI
ANAENLYFQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   LYS n 
1 4   PHE n 
1 5   TYR n 
1 6   THR n 
1 7   ASP n 
1 8   PRO n 
1 9   VAL n 
1 10  GLU n 
1 11  ALA n 
1 12  VAL n 
1 13  LYS n 
1 14  ASP n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLY n 
1 19  ALA n 
1 20  THR n 
1 21  VAL n 
1 22  LEU n 
1 23  VAL n 
1 24  GLY n 
1 25  GLY n 
1 26  PHE n 
1 27  GLY n 
1 28  LEU n 
1 29  CYS n 
1 30  GLY n 
1 31  ILE n 
1 32  PRO n 
1 33  GLU n 
1 34  ASN n 
1 35  LEU n 
1 36  ILE n 
1 37  ASP n 
1 38  ALA n 
1 39  LEU n 
1 40  LEU n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  VAL n 
1 45  LYS n 
1 46  GLY n 
1 47  LEU n 
1 48  THR n 
1 49  ALA n 
1 50  VAL n 
1 51  SER n 
1 52  ASN n 
1 53  ASN n 
1 54  ALA n 
1 55  GLY n 
1 56  VAL n 
1 57  ASP n 
1 58  ASN n 
1 59  PHE n 
1 60  GLY n 
1 61  LEU n 
1 62  GLY n 
1 63  LEU n 
1 64  LEU n 
1 65  LEU n 
1 66  ARG n 
1 67  SER n 
1 68  LYS n 
1 69  GLN n 
1 70  ILE n 
1 71  LYS n 
1 72  ARG n 
1 73  MET n 
1 74  VAL n 
1 75  SER n 
1 76  SER n 
1 77  TYR n 
1 78  VAL n 
1 79  GLY n 
1 80  GLU n 
1 81  ASN n 
1 82  ALA n 
1 83  GLU n 
1 84  PHE n 
1 85  GLU n 
1 86  ARG n 
1 87  GLN n 
1 88  TYR n 
1 89  LEU n 
1 90  SER n 
1 91  GLY n 
1 92  GLU n 
1 93  LEU n 
1 94  GLU n 
1 95  VAL n 
1 96  GLU n 
1 97  LEU n 
1 98  THR n 
1 99  PRO n 
1 100 GLN n 
1 101 GLY n 
1 102 THR n 
1 103 LEU n 
1 104 ALA n 
1 105 GLU n 
1 106 ARG n 
1 107 ILE n 
1 108 ARG n 
1 109 ALA n 
1 110 GLY n 
1 111 GLY n 
1 112 ALA n 
1 113 GLY n 
1 114 VAL n 
1 115 PRO n 
1 116 ALA n 
1 117 PHE n 
1 118 TYR n 
1 119 THR n 
1 120 PRO n 
1 121 THR n 
1 122 GLY n 
1 123 TYR n 
1 124 GLY n 
1 125 THR n 
1 126 LEU n 
1 127 VAL n 
1 128 GLN n 
1 129 GLU n 
1 130 GLY n 
1 131 GLY n 
1 132 SER n 
1 133 PRO n 
1 134 ILE n 
1 135 LYS n 
1 136 TYR n 
1 137 ASN n 
1 138 LYS n 
1 139 ASP n 
1 140 GLY n 
1 141 SER n 
1 142 VAL n 
1 143 ALA n 
1 144 ILE n 
1 145 ALA n 
1 146 SER n 
1 147 LYS n 
1 148 PRO n 
1 149 ARG n 
1 150 GLU n 
1 151 VAL n 
1 152 ARG n 
1 153 GLU n 
1 154 PHE n 
1 155 ASN n 
1 156 GLY n 
1 157 GLN n 
1 158 HIS n 
1 159 PHE n 
1 160 ILE n 
1 161 LEU n 
1 162 GLU n 
1 163 GLU n 
1 164 ALA n 
1 165 ILE n 
1 166 THR n 
1 167 GLY n 
1 168 ASP n 
1 169 PHE n 
1 170 ALA n 
1 171 LEU n 
1 172 VAL n 
1 173 LYS n 
1 174 ALA n 
1 175 TRP n 
1 176 LYS n 
1 177 ALA n 
1 178 ASP n 
1 179 ARG n 
1 180 ALA n 
1 181 GLY n 
1 182 ASN n 
1 183 VAL n 
1 184 ILE n 
1 185 PHE n 
1 186 ARG n 
1 187 LYS n 
1 188 SER n 
1 189 ALA n 
1 190 ARG n 
1 191 ASN n 
1 192 PHE n 
1 193 ASN n 
1 194 LEU n 
1 195 PRO n 
1 196 MET n 
1 197 CYS n 
1 198 LYS n 
1 199 ALA n 
1 200 ALA n 
1 201 GLU n 
1 202 THR n 
1 203 THR n 
1 204 VAL n 
1 205 VAL n 
1 206 GLU n 
1 207 VAL n 
1 208 GLU n 
1 209 GLU n 
1 210 ILE n 
1 211 VAL n 
1 212 ASP n 
1 213 ILE n 
1 214 GLY n 
1 215 ALA n 
1 216 PHE n 
1 217 ALA n 
1 218 PRO n 
1 219 GLU n 
1 220 ASP n 
1 221 ILE n 
1 222 HIS n 
1 223 ILE n 
1 224 PRO n 
1 225 GLN n 
1 226 ILE n 
1 227 TYR n 
1 228 VAL n 
1 229 HIS n 
1 230 ARG n 
1 231 LEU n 
1 232 ILE n 
1 233 LYS n 
1 234 GLY n 
1 235 GLU n 
1 236 LYS n 
1 237 TYR n 
1 238 GLU n 
1 239 LYS n 
1 240 ARG n 
1 241 ILE n 
1 242 GLU n 
1 243 ARG n 
1 244 LEU n 
1 245 SER n 
1 246 ILE n 
1 247 ARG n 
1 248 LYS n 
1 249 GLU n 
1 250 GLY n 
1 251 ASP n 
1 252 GLY n 
1 253 GLU n 
1 254 ALA n 
1 255 LYS n 
1 256 SER n 
1 257 ALA n 
1 258 LYS n 
1 259 PRO n 
1 260 GLY n 
1 261 ASP n 
1 262 ASP n 
1 263 VAL n 
1 264 ARG n 
1 265 GLU n 
1 266 ARG n 
1 267 ILE n 
1 268 ILE n 
1 269 LYS n 
1 270 ARG n 
1 271 ALA n 
1 272 ALA n 
1 273 LEU n 
1 274 GLU n 
1 275 PHE n 
1 276 GLU n 
1 277 ASP n 
1 278 GLY n 
1 279 MET n 
1 280 TYR n 
1 281 ALA n 
1 282 ASN n 
1 283 LEU n 
1 284 GLY n 
1 285 ILE n 
1 286 GLY n 
1 287 ILE n 
1 288 PRO n 
1 289 LEU n 
1 290 LEU n 
1 291 ALA n 
1 292 SER n 
1 293 ASN n 
1 294 PHE n 
1 295 ILE n 
1 296 SER n 
1 297 PRO n 
1 298 ASN n 
1 299 ILE n 
1 300 THR n 
1 301 VAL n 
1 302 HIS n 
1 303 LEU n 
1 304 GLN n 
1 305 SER n 
1 306 GLU n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 LEU n 
1 311 GLY n 
1 312 LEU n 
1 313 GLY n 
1 314 PRO n 
1 315 TYR n 
1 316 PRO n 
1 317 ARG n 
1 318 GLN n 
1 319 HIS n 
1 320 GLU n 
1 321 ALA n 
1 322 ASP n 
1 323 ALA n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ASN n 
1 328 ALA n 
1 329 GLY n 
1 330 LYS n 
1 331 GLU n 
1 332 THR n 
1 333 VAL n 
1 334 THR n 
1 335 ILE n 
1 336 LEU n 
1 337 PRO n 
1 338 GLY n 
1 339 ALA n 
1 340 SER n 
1 341 PHE n 
1 342 PHE n 
1 343 SER n 
1 344 SER n 
1 345 ASP n 
1 346 GLU n 
1 347 SER n 
1 348 PHE n 
1 349 ALA n 
1 350 MET n 
1 351 ILE n 
1 352 ARG n 
1 353 GLY n 
1 354 GLY n 
1 355 HIS n 
1 356 VAL n 
1 357 ASP n 
1 358 LEU n 
1 359 THR n 
1 360 MET n 
1 361 LEU n 
1 362 GLY n 
1 363 ALA n 
1 364 MET n 
1 365 GLN n 
1 366 VAL n 
1 367 SER n 
1 368 LYS n 
1 369 TYR n 
1 370 GLY n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ASN n 
1 375 TRP n 
1 376 MET n 
1 377 ILE n 
1 378 PRO n 
1 379 GLY n 
1 380 LYS n 
1 381 MET n 
1 382 VAL n 
1 383 LYS n 
1 384 GLY n 
1 385 MET n 
1 386 GLY n 
1 387 GLY n 
1 388 ALA n 
1 389 MET n 
1 390 ASP n 
1 391 LEU n 
1 392 VAL n 
1 393 SER n 
1 394 SER n 
1 395 ALA n 
1 396 LYS n 
1 397 THR n 
1 398 LYS n 
1 399 VAL n 
1 400 VAL n 
1 401 VAL n 
1 402 THR n 
1 403 MET n 
1 404 GLU n 
1 405 HIS n 
1 406 SER n 
1 407 ALA n 
1 408 LYS n 
1 409 GLY n 
1 410 ASN n 
1 411 ALA n 
1 412 HIS n 
1 413 LYS n 
1 414 ILE n 
1 415 MET n 
1 416 GLU n 
1 417 LYS n 
1 418 CYS n 
1 419 THR n 
1 420 LEU n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 GLY n 
1 425 LYS n 
1 426 GLN n 
1 427 CYS n 
1 428 VAL n 
1 429 ASN n 
1 430 ARG n 
1 431 ILE n 
1 432 ILE n 
1 433 THR n 
1 434 GLU n 
1 435 LYS n 
1 436 ALA n 
1 437 VAL n 
1 438 PHE n 
1 439 ASP n 
1 440 VAL n 
1 441 ASP n 
1 442 LYS n 
1 443 LYS n 
1 444 LYS n 
1 445 GLY n 
1 446 LEU n 
1 447 THR n 
1 448 LEU n 
1 449 ILE n 
1 450 GLU n 
1 451 LEU n 
1 452 TRP n 
1 453 GLU n 
1 454 GLY n 
1 455 LEU n 
1 456 THR n 
1 457 VAL n 
1 458 ASP n 
1 459 ASP n 
1 460 VAL n 
1 461 GLN n 
1 462 LYS n 
1 463 SER n 
1 464 THR n 
1 465 GLY n 
1 466 CYS n 
1 467 ASP n 
1 468 PHE n 
1 469 ALA n 
1 470 VAL n 
1 471 SER n 
1 472 PRO n 
1 473 LYS n 
1 474 LEU n 
1 475 MET n 
1 476 PRO n 
1 477 MET n 
1 478 GLN n 
1 479 GLN n 
1 480 ILE n 
1 481 ALA n 
1 482 ASN n 
1 483 ALA n 
1 484 GLU n 
1 485 ASN n 
1 486 LEU n 
1 487 TYR n 
1 488 PHE n 
1 489 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'OXCT1, OXCT, SCOT' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNic-CTHF 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SCOT_HUMAN 
_struct_ref.pdbx_db_accession          P55809 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGEN
AEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFIL
EEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRI
ERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEA
DADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVV
TMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIA
N
;
_struct_ref.pdbx_align_begin           40 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DLX A 2 ? 482 ? P55809 40 ? 520 ? 40 520 
2 1 3DLX B 2 ? 482 ? P55809 40 ? 520 ? 40 520 
3 1 3DLX C 2 ? 482 ? P55809 40 ? 520 ? 40 520 
4 1 3DLX D 2 ? 482 ? P55809 40 ? 520 ? 40 520 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3DLX MET A 1   ? UNP P55809 ? ? 'EXPRESSION TAG' 39  1  
1 3DLX ALA A 483 ? UNP P55809 ? ? 'EXPRESSION TAG' 521 2  
1 3DLX GLU A 484 ? UNP P55809 ? ? 'EXPRESSION TAG' 522 3  
1 3DLX ASN A 485 ? UNP P55809 ? ? 'EXPRESSION TAG' 523 4  
1 3DLX LEU A 486 ? UNP P55809 ? ? 'EXPRESSION TAG' 524 5  
1 3DLX TYR A 487 ? UNP P55809 ? ? 'EXPRESSION TAG' 525 6  
1 3DLX PHE A 488 ? UNP P55809 ? ? 'EXPRESSION TAG' 526 7  
1 3DLX GLN A 489 ? UNP P55809 ? ? 'EXPRESSION TAG' 527 8  
2 3DLX MET B 1   ? UNP P55809 ? ? 'EXPRESSION TAG' 39  9  
2 3DLX ALA B 483 ? UNP P55809 ? ? 'EXPRESSION TAG' 521 10 
2 3DLX GLU B 484 ? UNP P55809 ? ? 'EXPRESSION TAG' 522 11 
2 3DLX ASN B 485 ? UNP P55809 ? ? 'EXPRESSION TAG' 523 12 
2 3DLX LEU B 486 ? UNP P55809 ? ? 'EXPRESSION TAG' 524 13 
2 3DLX TYR B 487 ? UNP P55809 ? ? 'EXPRESSION TAG' 525 14 
2 3DLX PHE B 488 ? UNP P55809 ? ? 'EXPRESSION TAG' 526 15 
2 3DLX GLN B 489 ? UNP P55809 ? ? 'EXPRESSION TAG' 527 16 
3 3DLX MET C 1   ? UNP P55809 ? ? 'EXPRESSION TAG' 39  17 
3 3DLX ALA C 483 ? UNP P55809 ? ? 'EXPRESSION TAG' 521 18 
3 3DLX GLU C 484 ? UNP P55809 ? ? 'EXPRESSION TAG' 522 19 
3 3DLX ASN C 485 ? UNP P55809 ? ? 'EXPRESSION TAG' 523 20 
3 3DLX LEU C 486 ? UNP P55809 ? ? 'EXPRESSION TAG' 524 21 
3 3DLX TYR C 487 ? UNP P55809 ? ? 'EXPRESSION TAG' 525 22 
3 3DLX PHE C 488 ? UNP P55809 ? ? 'EXPRESSION TAG' 526 23 
3 3DLX GLN C 489 ? UNP P55809 ? ? 'EXPRESSION TAG' 527 24 
4 3DLX MET D 1   ? UNP P55809 ? ? 'EXPRESSION TAG' 39  25 
4 3DLX ALA D 483 ? UNP P55809 ? ? 'EXPRESSION TAG' 521 26 
4 3DLX GLU D 484 ? UNP P55809 ? ? 'EXPRESSION TAG' 522 27 
4 3DLX ASN D 485 ? UNP P55809 ? ? 'EXPRESSION TAG' 523 28 
4 3DLX LEU D 486 ? UNP P55809 ? ? 'EXPRESSION TAG' 524 29 
4 3DLX TYR D 487 ? UNP P55809 ? ? 'EXPRESSION TAG' 525 30 
4 3DLX PHE D 488 ? UNP P55809 ? ? 'EXPRESSION TAG' 526 31 
4 3DLX GLN D 489 ? UNP P55809 ? ? 'EXPRESSION TAG' 527 32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3DLX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   44.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    
'25% PEG 3350, 0.2 M NaCl, 0.1 M Tris-HCl, pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-05-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(III)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9786 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9786 
# 
_reflns.entry_id                     3DLX 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.20 
_reflns.d_resolution_low             48.11 
_reflns.number_all                   92253 
_reflns.number_obs                   92253 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.4 
_reflns.B_iso_Wilson_estimate        30 
_reflns.pdbx_redundancy              2.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   97.0 
_reflns_shell.Rmerge_I_obs           0.526 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      13203 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3DLX 
_refine.ls_number_reflns_obs                     90754 
_refine.ls_number_reflns_all                     90754 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.11 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    98.41 
_refine.ls_R_factor_obs                          0.17887 
_refine.ls_R_factor_all                          0.17887 
_refine.ls_R_factor_R_work                       0.17821 
_refine.ls_R_factor_R_free                       0.22473 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.4 
_refine.ls_number_reflns_R_free                  1302 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               29.557 
_refine.aniso_B[1][1]                            0.11 
_refine.aniso_B[2][2]                            0.48 
_refine.aniso_B[3][3]                            -1.33 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.34 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. Extra density in the active site could not be interpreted and was left unmodelled.
;
_refine.pdbx_starting_model                      'PDB entry 1M3E' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.257 
_refine.pdbx_overall_ESU_R_Free                  0.198 
_refine.overall_SU_ML                            0.160 
_refine.overall_SU_B                             12.701 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13833 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             375 
_refine_hist.number_atoms_total               14220 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        48.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 14093 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 9361  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.556  1.969  ? 19096 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.966  3.000  ? 22940 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.987  5.000  ? 1852  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.750 24.432 ? 555   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.143 15.000 ? 2317  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.154 15.000 ? 75    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.090  0.200  ? 2207  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 15857 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2726  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.191  0.200  ? 2519  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.197  0.200  ? 9848  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.172  0.200  ? 6709  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.087  0.200  ? 7603  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.158  0.200  ? 523   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.263  0.200  ? 7     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.185  0.200  ? 28    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.097  0.200  ? 3     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.711  1.500  ? 9484  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.168  1.500  ? 3826  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.099  2.000  ? 14677 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.930  3.000  ? 5233  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.898  4.500  ? 4418  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.number_reflns_R_work             6472 
_refine_ls_shell.R_factor_R_work                  0.234 
_refine_ls_shell.percent_reflns_obs               94.76 
_refine_ls_shell.R_factor_R_free                  0.342 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             86 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DLX 
_struct.title                     'Crystal structure of human 3-oxoacid CoA transferase 1' 
_struct.pdbx_descriptor           'Succinyl-CoA:3-ketoacid-coenzyme A transferase 1 (E.C.2.8.3.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DLX 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;OXCT1, SCOT, Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, Disease mutation, Mitochondrion, Transit peptide, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 7   ? LYS A 13  ? ASP A 45  LYS A 51  1 ? 7  
HELX_P HELX_P2  2  PRO A 32  ? GLY A 43  ? PRO A 70  GLY A 81  1 ? 12 
HELX_P HELX_P3  3  LEU A 61  ? SER A 67  ? LEU A 99  SER A 105 1 ? 7  
HELX_P HELX_P4  4  ASN A 81  ? SER A 90  ? ASN A 119 SER A 128 1 ? 10 
HELX_P HELX_P5  5  PRO A 99  ? GLY A 113 ? PRO A 137 GLY A 151 1 ? 15 
HELX_P HELX_P6  6  THR A 125 ? GLY A 130 ? THR A 163 GLY A 168 1 ? 6  
HELX_P HELX_P7  7  ARG A 186 ? ARG A 190 ? ARG A 224 ARG A 228 5 ? 5  
HELX_P HELX_P8  8  PHE A 192 ? CYS A 197 ? PHE A 230 CYS A 235 1 ? 6  
HELX_P HELX_P9  9  ALA A 217 ? ILE A 221 ? ALA A 255 ILE A 259 5 ? 5  
HELX_P HELX_P10 10 PRO A 224 ? VAL A 228 ? PRO A 262 VAL A 266 5 ? 5  
HELX_P HELX_P11 11 ASP A 261 ? ALA A 272 ? ASP A 299 ALA A 310 1 ? 12 
HELX_P HELX_P12 12 LEU A 273 ? PHE A 275 ? LEU A 311 PHE A 313 5 ? 3  
HELX_P HELX_P13 13 GLY A 286 ? SER A 292 ? GLY A 324 SER A 330 1 ? 7  
HELX_P HELX_P14 14 ASN A 293 ? ILE A 295 ? ASN A 331 ILE A 333 5 ? 3  
HELX_P HELX_P15 15 ARG A 317 ? ALA A 321 ? ARG A 355 ALA A 359 5 ? 5  
HELX_P HELX_P16 16 SER A 343 ? GLY A 353 ? SER A 381 GLY A 391 1 ? 11 
HELX_P HELX_P17 17 GLY A 387 ? VAL A 392 ? GLY A 425 VAL A 430 1 ? 6  
HELX_P HELX_P18 18 ALA A 407 ? ALA A 411 ? ALA A 445 ALA A 449 5 ? 5  
HELX_P HELX_P19 19 THR A 456 ? LYS A 462 ? THR A 494 LYS A 500 1 ? 7  
HELX_P HELX_P20 20 ASP B 7   ? LYS B 13  ? ASP B 45  LYS B 51  1 ? 7  
HELX_P HELX_P21 21 ASN B 34  ? GLY B 43  ? ASN B 72  GLY B 81  1 ? 10 
HELX_P HELX_P22 22 GLY B 60  ? SER B 67  ? GLY B 98  SER B 105 1 ? 8  
HELX_P HELX_P23 23 ASN B 81  ? SER B 90  ? ASN B 119 SER B 128 1 ? 10 
HELX_P HELX_P24 24 PRO B 99  ? GLY B 113 ? PRO B 137 GLY B 151 1 ? 15 
HELX_P HELX_P25 25 THR B 125 ? GLY B 130 ? THR B 163 GLY B 168 1 ? 6  
HELX_P HELX_P26 26 ARG B 186 ? ARG B 190 ? ARG B 224 ARG B 228 5 ? 5  
HELX_P HELX_P27 27 PHE B 192 ? CYS B 197 ? PHE B 230 CYS B 235 1 ? 6  
HELX_P HELX_P28 28 ALA B 217 ? ILE B 221 ? ALA B 255 ILE B 259 5 ? 5  
HELX_P HELX_P29 29 PRO B 224 ? VAL B 228 ? PRO B 262 VAL B 266 5 ? 5  
HELX_P HELX_P30 30 ASP B 261 ? ALA B 272 ? ASP B 299 ALA B 310 1 ? 12 
HELX_P HELX_P31 31 LEU B 273 ? PHE B 275 ? LEU B 311 PHE B 313 5 ? 3  
HELX_P HELX_P32 32 GLY B 286 ? SER B 292 ? GLY B 324 SER B 330 1 ? 7  
HELX_P HELX_P33 33 ASN B 293 ? ILE B 295 ? ASN B 331 ILE B 333 5 ? 3  
HELX_P HELX_P34 34 ARG B 317 ? ALA B 321 ? ARG B 355 ALA B 359 5 ? 5  
HELX_P HELX_P35 35 SER B 343 ? GLY B 353 ? SER B 381 GLY B 391 1 ? 11 
HELX_P HELX_P36 36 GLY B 387 ? VAL B 392 ? GLY B 425 VAL B 430 1 ? 6  
HELX_P HELX_P37 37 LYS B 408 ? ASN B 410 ? LYS B 446 ASN B 448 5 ? 3  
HELX_P HELX_P38 38 THR B 456 ? SER B 463 ? THR B 494 SER B 501 1 ? 8  
HELX_P HELX_P39 39 ASP C 7   ? LYS C 13  ? ASP C 45  LYS C 51  1 ? 7  
HELX_P HELX_P40 40 PRO C 32  ? GLY C 43  ? PRO C 70  GLY C 81  1 ? 12 
HELX_P HELX_P41 41 LEU C 61  ? SER C 67  ? LEU C 99  SER C 105 1 ? 7  
HELX_P HELX_P42 42 ASN C 81  ? SER C 90  ? ASN C 119 SER C 128 1 ? 10 
HELX_P HELX_P43 43 PRO C 99  ? ALA C 112 ? PRO C 137 ALA C 150 1 ? 14 
HELX_P HELX_P44 44 THR C 125 ? GLY C 130 ? THR C 163 GLY C 168 1 ? 6  
HELX_P HELX_P45 45 ARG C 186 ? ARG C 190 ? ARG C 224 ARG C 228 5 ? 5  
HELX_P HELX_P46 46 PHE C 192 ? CYS C 197 ? PHE C 230 CYS C 235 1 ? 6  
HELX_P HELX_P47 47 ALA C 217 ? ILE C 221 ? ALA C 255 ILE C 259 5 ? 5  
HELX_P HELX_P48 48 PRO C 224 ? VAL C 228 ? PRO C 262 VAL C 266 5 ? 5  
HELX_P HELX_P49 49 ASP C 261 ? ALA C 272 ? ASP C 299 ALA C 310 1 ? 12 
HELX_P HELX_P50 50 LEU C 273 ? PHE C 275 ? LEU C 311 PHE C 313 5 ? 3  
HELX_P HELX_P51 51 GLY C 286 ? SER C 292 ? GLY C 324 SER C 330 1 ? 7  
HELX_P HELX_P52 52 ASN C 293 ? ILE C 295 ? ASN C 331 ILE C 333 5 ? 3  
HELX_P HELX_P53 53 ARG C 317 ? ALA C 321 ? ARG C 355 ALA C 359 5 ? 5  
HELX_P HELX_P54 54 SER C 343 ? GLY C 353 ? SER C 381 GLY C 391 1 ? 11 
HELX_P HELX_P55 55 GLY C 387 ? VAL C 392 ? GLY C 425 VAL C 430 1 ? 6  
HELX_P HELX_P56 56 ALA C 407 ? ALA C 411 ? ALA C 445 ALA C 449 5 ? 5  
HELX_P HELX_P57 57 THR C 456 ? LYS C 462 ? THR C 494 LYS C 500 1 ? 7  
HELX_P HELX_P58 58 ASP D 7   ? LYS D 13  ? ASP D 45  LYS D 51  1 ? 7  
HELX_P HELX_P59 59 PRO D 32  ? GLY D 43  ? PRO D 70  GLY D 81  1 ? 12 
HELX_P HELX_P60 60 LEU D 61  ? SER D 67  ? LEU D 99  SER D 105 1 ? 7  
HELX_P HELX_P61 61 ASN D 81  ? SER D 90  ? ASN D 119 SER D 128 1 ? 10 
HELX_P HELX_P62 62 PRO D 99  ? GLY D 113 ? PRO D 137 GLY D 151 1 ? 15 
HELX_P HELX_P63 63 THR D 125 ? GLY D 130 ? THR D 163 GLY D 168 1 ? 6  
HELX_P HELX_P64 64 ARG D 186 ? ARG D 190 ? ARG D 224 ARG D 228 5 ? 5  
HELX_P HELX_P65 65 PHE D 192 ? ALA D 199 ? PHE D 230 ALA D 237 1 ? 8  
HELX_P HELX_P66 66 ALA D 217 ? ILE D 221 ? ALA D 255 ILE D 259 5 ? 5  
HELX_P HELX_P67 67 PRO D 224 ? VAL D 228 ? PRO D 262 VAL D 266 5 ? 5  
HELX_P HELX_P68 68 ARG D 264 ? ALA D 272 ? ARG D 302 ALA D 310 1 ? 9  
HELX_P HELX_P69 69 LEU D 273 ? PHE D 275 ? LEU D 311 PHE D 313 5 ? 3  
HELX_P HELX_P70 70 GLY D 286 ? ILE D 295 ? GLY D 324 ILE D 333 5 ? 10 
HELX_P HELX_P71 71 SER D 343 ? GLY D 353 ? SER D 381 GLY D 391 1 ? 11 
HELX_P HELX_P72 72 GLY D 387 ? VAL D 392 ? GLY D 425 VAL D 430 1 ? 6  
HELX_P HELX_P73 73 ALA D 407 ? ALA D 411 ? ALA D 445 ALA D 449 5 ? 5  
HELX_P HELX_P74 74 VAL D 460 ? THR D 464 ? VAL D 498 THR D 502 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8  ? 
B ? 3  ? 
C ? 2  ? 
D ? 3  ? 
E ? 10 ? 
F ? 3  ? 
G ? 2  ? 
H ? 8  ? 
I ? 3  ? 
J ? 2  ? 
K ? 3  ? 
L ? 10 ? 
M ? 3  ? 
N ? 2  ? 
O ? 8  ? 
P ? 3  ? 
Q ? 2  ? 
R ? 3  ? 
S ? 10 ? 
T ? 3  ? 
U ? 8  ? 
V ? 3  ? 
W ? 2  ? 
X ? 3  ? 
Y ? 9  ? 
Z ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel      
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? parallel      
B 1 2  ? anti-parallel 
B 2 3  ? anti-parallel 
C 1 2  ? anti-parallel 
D 1 2  ? anti-parallel 
D 2 3  ? parallel      
E 1 2  ? anti-parallel 
E 2 3  ? anti-parallel 
E 3 4  ? parallel      
E 4 5  ? parallel      
E 5 6  ? parallel      
E 6 7  ? parallel      
E 7 8  ? anti-parallel 
E 8 9  ? anti-parallel 
E 9 10 ? parallel      
F 1 2  ? anti-parallel 
F 2 3  ? parallel      
G 1 2  ? anti-parallel 
H 1 2  ? parallel      
H 2 3  ? parallel      
H 3 4  ? parallel      
H 4 5  ? parallel      
H 5 6  ? parallel      
H 6 7  ? parallel      
H 7 8  ? parallel      
I 1 2  ? anti-parallel 
I 2 3  ? anti-parallel 
J 1 2  ? anti-parallel 
K 1 2  ? anti-parallel 
K 2 3  ? parallel      
L 1 2  ? anti-parallel 
L 2 3  ? anti-parallel 
L 3 4  ? parallel      
L 4 5  ? parallel      
L 5 6  ? parallel      
L 6 7  ? parallel      
L 7 8  ? anti-parallel 
L 8 9  ? anti-parallel 
L 9 10 ? parallel      
M 1 2  ? anti-parallel 
M 2 3  ? parallel      
N 1 2  ? anti-parallel 
O 1 2  ? parallel      
O 2 3  ? parallel      
O 3 4  ? parallel      
O 4 5  ? parallel      
O 5 6  ? parallel      
O 6 7  ? parallel      
O 7 8  ? parallel      
P 1 2  ? anti-parallel 
P 2 3  ? anti-parallel 
Q 1 2  ? anti-parallel 
R 1 2  ? anti-parallel 
R 2 3  ? parallel      
S 1 2  ? anti-parallel 
S 2 3  ? anti-parallel 
S 3 4  ? parallel      
S 4 5  ? parallel      
S 5 6  ? parallel      
S 6 7  ? parallel      
S 7 8  ? anti-parallel 
S 8 9  ? anti-parallel 
S 9 10 ? parallel      
T 1 2  ? anti-parallel 
T 2 3  ? parallel      
U 1 2  ? parallel      
U 2 3  ? parallel      
U 3 4  ? parallel      
U 4 5  ? parallel      
U 5 6  ? parallel      
U 6 7  ? parallel      
U 7 8  ? parallel      
V 1 2  ? anti-parallel 
V 2 3  ? anti-parallel 
W 1 2  ? anti-parallel 
X 1 2  ? anti-parallel 
X 2 3  ? parallel      
Y 1 2  ? anti-parallel 
Y 2 3  ? anti-parallel 
Y 3 4  ? parallel      
Y 4 5  ? parallel      
Y 5 6  ? parallel      
Y 6 7  ? parallel      
Y 7 8  ? anti-parallel 
Y 8 9  ? anti-parallel 
Z 1 2  ? anti-parallel 
Z 2 3  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LYS A 3   ? TYR A 5   ? LYS A 41  TYR A 43  
A 2  ARG A 230 ? LYS A 233 ? ARG A 268 LYS A 271 
A 3  ALA A 200 ? VAL A 207 ? ALA A 238 VAL A 245 
A 4  GLY A 167 ? LYS A 173 ? GLY A 205 LYS A 211 
A 5  THR A 20  ? VAL A 23  ? THR A 58  VAL A 61  
A 6  LEU A 47  ? VAL A 50  ? LEU A 85  VAL A 88  
A 7  ILE A 70  ? SER A 75  ? ILE A 108 SER A 113 
A 8  GLU A 94  ? LEU A 97  ? GLU A 132 LEU A 135 
B 1  ALA A 116 ? THR A 119 ? ALA A 154 THR A 157 
B 2  GLN A 157 ? GLU A 163 ? GLN A 195 GLU A 201 
B 3  VAL A 151 ? PHE A 154 ? VAL A 189 PHE A 192 
C 1  PRO A 133 ? TYR A 136 ? PRO A 171 TYR A 174 
C 2  VAL A 142 ? ALA A 145 ? VAL A 180 ALA A 183 
D 1  VAL A 183 ? ILE A 184 ? VAL A 221 ILE A 222 
D 2  LYS A 176 ? ASP A 178 ? LYS A 214 ASP A 216 
D 3  GLU A 209 ? VAL A 211 ? GLU A 247 VAL A 249 
E 1  ILE A 335 ? PHE A 341 ? ILE A 373 PHE A 379 
E 2  VAL A 309 ? LEU A 312 ? VAL A 347 LEU A 350 
E 3  HIS A 302 ? SER A 305 ? HIS A 340 SER A 343 
E 4  TYR A 280 ? LEU A 283 ? TYR A 318 LEU A 321 
E 5  LEU A 358 ? LEU A 361 ? LEU A 396 LEU A 399 
E 6  LYS A 398 ? THR A 402 ? LYS A 436 THR A 440 
E 7  ARG A 430 ? ILE A 432 ? ARG A 468 ILE A 470 
E 8  ALA A 436 ? ASP A 441 ? ALA A 474 ASP A 479 
E 9  GLY A 445 ? LEU A 451 ? GLY A 483 LEU A 489 
E 10 ALA A 469 ? PRO A 476 ? ALA A 507 PRO A 514 
F 1  LEU A 372 ? ALA A 373 ? LEU A 410 ALA A 411 
F 2  GLN A 365 ? SER A 367 ? GLN A 403 SER A 405 
F 3  ILE A 414 ? MET A 415 ? ILE A 452 MET A 453 
G 1  MET A 376 ? ILE A 377 ? MET A 414 ILE A 415 
G 2  MET A 381 ? VAL A 382 ? MET A 419 VAL A 420 
H 1  LYS B 3   ? PHE B 4   ? LYS B 41  PHE B 42  
H 2  ARG B 230 ? LYS B 233 ? ARG B 268 LYS B 271 
H 3  ALA B 200 ? VAL B 207 ? ALA B 238 VAL B 245 
H 4  GLY B 167 ? LYS B 173 ? GLY B 205 LYS B 211 
H 5  THR B 20  ? VAL B 23  ? THR B 58  VAL B 61  
H 6  LEU B 47  ? SER B 51  ? LEU B 85  SER B 89  
H 7  ILE B 70  ? SER B 75  ? ILE B 108 SER B 113 
H 8  GLU B 94  ? LEU B 97  ? GLU B 132 LEU B 135 
I 1  ALA B 116 ? THR B 119 ? ALA B 154 THR B 157 
I 2  GLN B 157 ? GLU B 163 ? GLN B 195 GLU B 201 
I 3  VAL B 151 ? PHE B 154 ? VAL B 189 PHE B 192 
J 1  PRO B 133 ? TYR B 136 ? PRO B 171 TYR B 174 
J 2  VAL B 142 ? ALA B 145 ? VAL B 180 ALA B 183 
K 1  VAL B 183 ? ILE B 184 ? VAL B 221 ILE B 222 
K 2  LYS B 176 ? ASP B 178 ? LYS B 214 ASP B 216 
K 3  GLU B 209 ? VAL B 211 ? GLU B 247 VAL B 249 
L 1  ILE B 335 ? PHE B 341 ? ILE B 373 PHE B 379 
L 2  VAL B 309 ? LEU B 312 ? VAL B 347 LEU B 350 
L 3  VAL B 301 ? SER B 305 ? VAL B 339 SER B 343 
L 4  MET B 279 ? LEU B 283 ? MET B 317 LEU B 321 
L 5  LEU B 358 ? LEU B 361 ? LEU B 396 LEU B 399 
L 6  LYS B 398 ? THR B 402 ? LYS B 436 THR B 440 
L 7  ARG B 430 ? ILE B 432 ? ARG B 468 ILE B 470 
L 8  ALA B 436 ? ASP B 441 ? ALA B 474 ASP B 479 
L 9  GLY B 445 ? LEU B 451 ? GLY B 483 LEU B 489 
L 10 ALA B 469 ? PRO B 476 ? ALA B 507 PRO B 514 
M 1  LEU B 372 ? ALA B 373 ? LEU B 410 ALA B 411 
M 2  GLN B 365 ? SER B 367 ? GLN B 403 SER B 405 
M 3  ILE B 414 ? MET B 415 ? ILE B 452 MET B 453 
N 1  SER B 406 ? ALA B 407 ? SER B 444 ALA B 445 
N 2  ALA B 411 ? HIS B 412 ? ALA B 449 HIS B 450 
O 1  LYS C 3   ? TYR C 5   ? LYS C 41  TYR C 43  
O 2  ARG C 230 ? LYS C 233 ? ARG C 268 LYS C 271 
O 3  ALA C 200 ? VAL C 207 ? ALA C 238 VAL C 245 
O 4  GLY C 167 ? LYS C 173 ? GLY C 205 LYS C 211 
O 5  THR C 20  ? VAL C 23  ? THR C 58  VAL C 61  
O 6  LEU C 47  ? VAL C 50  ? LEU C 85  VAL C 88  
O 7  ILE C 70  ? SER C 75  ? ILE C 108 SER C 113 
O 8  GLU C 94  ? LEU C 97  ? GLU C 132 LEU C 135 
P 1  ALA C 116 ? THR C 119 ? ALA C 154 THR C 157 
P 2  GLN C 157 ? GLU C 163 ? GLN C 195 GLU C 201 
P 3  VAL C 151 ? PHE C 154 ? VAL C 189 PHE C 192 
Q 1  PRO C 133 ? TYR C 136 ? PRO C 171 TYR C 174 
Q 2  VAL C 142 ? ALA C 145 ? VAL C 180 ALA C 183 
R 1  VAL C 183 ? ILE C 184 ? VAL C 221 ILE C 222 
R 2  LYS C 176 ? ASP C 178 ? LYS C 214 ASP C 216 
R 3  GLU C 209 ? VAL C 211 ? GLU C 247 VAL C 249 
S 1  ILE C 335 ? PHE C 341 ? ILE C 373 PHE C 379 
S 2  VAL C 309 ? LEU C 312 ? VAL C 347 LEU C 350 
S 3  VAL C 301 ? SER C 305 ? VAL C 339 SER C 343 
S 4  MET C 279 ? LEU C 283 ? MET C 317 LEU C 321 
S 5  LEU C 358 ? LEU C 361 ? LEU C 396 LEU C 399 
S 6  LYS C 398 ? THR C 402 ? LYS C 436 THR C 440 
S 7  ARG C 430 ? ILE C 432 ? ARG C 468 ILE C 470 
S 8  ALA C 436 ? ASP C 441 ? ALA C 474 ASP C 479 
S 9  GLY C 445 ? LEU C 451 ? GLY C 483 LEU C 489 
S 10 ALA C 469 ? PRO C 476 ? ALA C 507 PRO C 514 
T 1  LEU C 372 ? ALA C 373 ? LEU C 410 ALA C 411 
T 2  GLN C 365 ? SER C 367 ? GLN C 403 SER C 405 
T 3  ILE C 414 ? MET C 415 ? ILE C 452 MET C 453 
U 1  LYS D 3   ? TYR D 5   ? LYS D 41  TYR D 43  
U 2  ARG D 230 ? LYS D 233 ? ARG D 268 LYS D 271 
U 3  ALA D 200 ? VAL D 207 ? ALA D 238 VAL D 245 
U 4  GLY D 167 ? LYS D 173 ? GLY D 205 LYS D 211 
U 5  THR D 20  ? VAL D 23  ? THR D 58  VAL D 61  
U 6  LEU D 47  ? VAL D 50  ? LEU D 85  VAL D 88  
U 7  ILE D 70  ? SER D 75  ? ILE D 108 SER D 113 
U 8  GLU D 94  ? LEU D 97  ? GLU D 132 LEU D 135 
V 1  ALA D 116 ? THR D 119 ? ALA D 154 THR D 157 
V 2  GLN D 157 ? GLU D 163 ? GLN D 195 GLU D 201 
V 3  VAL D 151 ? PHE D 154 ? VAL D 189 PHE D 192 
W 1  PRO D 133 ? TYR D 136 ? PRO D 171 TYR D 174 
W 2  VAL D 142 ? ALA D 145 ? VAL D 180 ALA D 183 
X 1  VAL D 183 ? ILE D 184 ? VAL D 221 ILE D 222 
X 2  LYS D 176 ? ASP D 178 ? LYS D 214 ASP D 216 
X 3  GLU D 209 ? VAL D 211 ? GLU D 247 VAL D 249 
Y 1  THR D 334 ? PHE D 341 ? THR D 372 PHE D 379 
Y 2  VAL D 309 ? GLY D 313 ? VAL D 347 GLY D 351 
Y 3  HIS D 302 ? SER D 305 ? HIS D 340 SER D 343 
Y 4  TYR D 280 ? LEU D 283 ? TYR D 318 LEU D 321 
Y 5  LEU D 358 ? LEU D 361 ? LEU D 396 LEU D 399 
Y 6  LYS D 398 ? THR D 402 ? LYS D 436 THR D 440 
Y 7  ARG D 430 ? ILE D 432 ? ARG D 468 ILE D 470 
Y 8  ALA D 436 ? ASP D 441 ? ALA D 474 ASP D 479 
Y 9  GLY D 445 ? LEU D 451 ? GLY D 483 LEU D 489 
Z 1  LEU D 372 ? ALA D 373 ? LEU D 410 ALA D 411 
Z 2  GLN D 365 ? SER D 367 ? GLN D 403 SER D 405 
Z 3  ILE D 414 ? MET D 415 ? ILE D 452 MET D 453 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  N LYS A 3   ? N LYS A 41  O LEU A 231 ? O LEU A 269 
A 2 3  O ARG A 230 ? O ARG A 268 N VAL A 205 ? N VAL A 243 
A 3 4  O GLU A 206 ? O GLU A 244 N VAL A 172 ? N VAL A 210 
A 4 5  O LEU A 171 ? O LEU A 209 N LEU A 22  ? N LEU A 60  
A 5 6  N VAL A 23  ? N VAL A 61  O VAL A 50  ? O VAL A 88  
A 6 7  N LEU A 47  ? N LEU A 85  O LYS A 71  ? O LYS A 109 
A 7 8  N MET A 73  ? N MET A 111 O GLU A 96  ? O GLU A 134 
B 1 2  N THR A 119 ? N THR A 157 O ILE A 160 ? O ILE A 198 
B 2 3  O GLN A 157 ? O GLN A 195 N PHE A 154 ? N PHE A 192 
C 1 2  N ILE A 134 ? N ILE A 172 O ILE A 144 ? O ILE A 182 
D 1 2  O ILE A 184 ? O ILE A 222 N LYS A 176 ? N LYS A 214 
D 2 3  N ALA A 177 ? N ALA A 215 O VAL A 211 ? O VAL A 249 
E 1 2  O LEU A 336 ? O LEU A 374 N GLY A 311 ? N GLY A 349 
E 2 3  O VAL A 309 ? O VAL A 347 N SER A 305 ? N SER A 343 
E 3 4  O GLN A 304 ? O GLN A 342 N ALA A 281 ? N ALA A 319 
E 4 5  N ASN A 282 ? N ASN A 320 O LEU A 358 ? O LEU A 396 
E 5 6  N THR A 359 ? N THR A 397 O LYS A 398 ? O LYS A 436 
E 6 7  N VAL A 401 ? N VAL A 439 O ILE A 432 ? O ILE A 470 
E 7 8  N ILE A 431 ? N ILE A 469 O PHE A 438 ? O PHE A 476 
E 8 9  N ASP A 441 ? N ASP A 479 O GLY A 445 ? O GLY A 483 
E 9 10 N LEU A 448 ? N LEU A 486 O ALA A 469 ? O ALA A 507 
F 1 2  O ALA A 373 ? O ALA A 411 N GLN A 365 ? N GLN A 403 
F 2 3  N VAL A 366 ? N VAL A 404 O MET A 415 ? O MET A 453 
G 1 2  O ILE A 377 ? O ILE A 415 N MET A 381 ? N MET A 419 
H 1 2  N LYS B 3   ? N LYS B 41  O LEU B 231 ? O LEU B 269 
H 2 3  O ARG B 230 ? O ARG B 268 N VAL B 205 ? N VAL B 243 
H 3 4  O VAL B 204 ? O VAL B 242 N VAL B 172 ? N VAL B 210 
H 4 5  O LEU B 171 ? O LEU B 209 N LEU B 22  ? N LEU B 60  
H 5 6  N VAL B 23  ? N VAL B 61  O VAL B 50  ? O VAL B 88  
H 6 7  N LEU B 47  ? N LEU B 85  O LYS B 71  ? O LYS B 109 
H 7 8  N LYS B 71  ? N LYS B 109 O GLU B 94  ? O GLU B 132 
I 1 2  N THR B 119 ? N THR B 157 O ILE B 160 ? O ILE B 198 
I 2 3  O PHE B 159 ? O PHE B 197 N ARG B 152 ? N ARG B 190 
J 1 2  N ILE B 134 ? N ILE B 172 O ILE B 144 ? O ILE B 182 
K 1 2  O ILE B 184 ? O ILE B 222 N LYS B 176 ? N LYS B 214 
K 2 3  N ALA B 177 ? N ALA B 215 O VAL B 211 ? O VAL B 249 
L 1 2  O LEU B 336 ? O LEU B 374 N GLY B 311 ? N GLY B 349 
L 2 3  O VAL B 309 ? O VAL B 347 N SER B 305 ? N SER B 343 
L 3 4  O HIS B 302 ? O HIS B 340 N MET B 279 ? N MET B 317 
L 4 5  N ASN B 282 ? N ASN B 320 O LEU B 358 ? O LEU B 396 
L 5 6  N THR B 359 ? N THR B 397 O VAL B 400 ? O VAL B 438 
L 6 7  N VAL B 401 ? N VAL B 439 O ILE B 432 ? O ILE B 470 
L 7 8  N ILE B 431 ? N ILE B 469 O PHE B 438 ? O PHE B 476 
L 8 9  N ASP B 439 ? N ASP B 477 O THR B 447 ? O THR B 485 
L 9 10 N LEU B 448 ? N LEU B 486 O ALA B 469 ? O ALA B 507 
M 1 2  O ALA B 373 ? O ALA B 411 N GLN B 365 ? N GLN B 403 
M 2 3  N VAL B 366 ? N VAL B 404 O MET B 415 ? O MET B 453 
N 1 2  N ALA B 407 ? N ALA B 445 O ALA B 411 ? O ALA B 449 
O 1 2  N TYR C 5   ? N TYR C 43  O LEU C 231 ? O LEU C 269 
O 2 3  O ARG C 230 ? O ARG C 268 N VAL C 205 ? N VAL C 243 
O 3 4  O VAL C 204 ? O VAL C 242 N ALA C 170 ? N ALA C 208 
O 4 5  O LEU C 171 ? O LEU C 209 N LEU C 22  ? N LEU C 60  
O 5 6  N VAL C 23  ? N VAL C 61  O VAL C 50  ? O VAL C 88  
O 6 7  N LEU C 47  ? N LEU C 85  O LYS C 71  ? O LYS C 109 
O 7 8  N MET C 73  ? N MET C 111 O GLU C 96  ? O GLU C 134 
P 1 2  N THR C 119 ? N THR C 157 O ILE C 160 ? O ILE C 198 
P 2 3  O GLN C 157 ? O GLN C 195 N PHE C 154 ? N PHE C 192 
Q 1 2  N ILE C 134 ? N ILE C 172 O ILE C 144 ? O ILE C 182 
R 1 2  O ILE C 184 ? O ILE C 222 N LYS C 176 ? N LYS C 214 
R 2 3  N ALA C 177 ? N ALA C 215 O VAL C 211 ? O VAL C 249 
S 1 2  O LEU C 336 ? O LEU C 374 N GLY C 311 ? N GLY C 349 
S 2 3  O GLY C 311 ? O GLY C 349 N LEU C 303 ? N LEU C 341 
S 3 4  O GLN C 304 ? O GLN C 342 N ALA C 281 ? N ALA C 319 
S 4 5  N ASN C 282 ? N ASN C 320 O LEU C 358 ? O LEU C 396 
S 5 6  N THR C 359 ? N THR C 397 O LYS C 398 ? O LYS C 436 
S 6 7  N VAL C 401 ? N VAL C 439 O ILE C 432 ? O ILE C 470 
S 7 8  N ILE C 431 ? N ILE C 469 O PHE C 438 ? O PHE C 476 
S 8 9  N VAL C 437 ? N VAL C 475 O ILE C 449 ? O ILE C 487 
S 9 10 N LEU C 448 ? N LEU C 486 O ALA C 469 ? O ALA C 507 
T 1 2  O ALA C 373 ? O ALA C 411 N GLN C 365 ? N GLN C 403 
T 2 3  N VAL C 366 ? N VAL C 404 O MET C 415 ? O MET C 453 
U 1 2  N LYS D 3   ? N LYS D 41  O LEU D 231 ? O LEU D 269 
U 2 3  O ARG D 230 ? O ARG D 268 N VAL D 205 ? N VAL D 243 
U 3 4  O VAL D 204 ? O VAL D 242 N ALA D 170 ? N ALA D 208 
U 4 5  O LEU D 171 ? O LEU D 209 N LEU D 22  ? N LEU D 60  
U 5 6  N VAL D 23  ? N VAL D 61  O VAL D 50  ? O VAL D 88  
U 6 7  N ALA D 49  ? N ALA D 87  O VAL D 74  ? O VAL D 112 
U 7 8  N MET D 73  ? N MET D 111 O GLU D 96  ? O GLU D 134 
V 1 2  N THR D 119 ? N THR D 157 O ILE D 160 ? O ILE D 198 
V 2 3  O GLN D 157 ? O GLN D 195 N PHE D 154 ? N PHE D 192 
W 1 2  N ILE D 134 ? N ILE D 172 O ILE D 144 ? O ILE D 182 
X 1 2  O ILE D 184 ? O ILE D 222 N LYS D 176 ? N LYS D 214 
X 2 3  N ALA D 177 ? N ALA D 215 O VAL D 211 ? O VAL D 249 
Y 1 2  O THR D 334 ? O THR D 372 N GLY D 313 ? N GLY D 351 
Y 2 3  O VAL D 309 ? O VAL D 347 N SER D 305 ? N SER D 343 
Y 3 4  O GLN D 304 ? O GLN D 342 N ALA D 281 ? N ALA D 319 
Y 4 5  N ASN D 282 ? N ASN D 320 O MET D 360 ? O MET D 398 
Y 5 6  N THR D 359 ? N THR D 397 O LYS D 398 ? O LYS D 436 
Y 6 7  N VAL D 401 ? N VAL D 439 O ILE D 432 ? O ILE D 470 
Y 7 8  N ILE D 431 ? N ILE D 469 O PHE D 438 ? O PHE D 476 
Y 8 9  N ASP D 441 ? N ASP D 479 O GLY D 445 ? O GLY D 483 
Z 1 2  O ALA D 373 ? O ALA D 411 N GLN D 365 ? N GLN D 403 
Z 2 3  N VAL D 366 ? N VAL D 404 O MET D 415 ? O MET D 453 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL C 1' 
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 PRO C 120 ? PRO C 158 . ? 1_555 ? 
2  AC1 7 GLY C 122 ? GLY C 160 . ? 1_555 ? 
3  AC1 7 TYR C 123 ? TYR C 161 . ? 1_555 ? 
4  AC1 7 MET C 389 ? MET C 427 . ? 1_555 ? 
5  AC1 7 THR C 423 ? THR C 461 . ? 1_555 ? 
6  AC1 7 GLY C 424 ? GLY C 462 . ? 1_555 ? 
7  AC1 7 LYS C 425 ? LYS C 463 . ? 1_555 ? 
8  AC2 8 PRO A 120 ? PRO A 158 . ? 1_555 ? 
9  AC2 8 GLY A 122 ? GLY A 160 . ? 1_555 ? 
10 AC2 8 TYR A 123 ? TYR A 161 . ? 1_555 ? 
11 AC2 8 MET A 389 ? MET A 427 . ? 1_555 ? 
12 AC2 8 SER A 393 ? SER A 431 . ? 1_555 ? 
13 AC2 8 THR A 423 ? THR A 461 . ? 1_555 ? 
14 AC2 8 GLY A 424 ? GLY A 462 . ? 1_555 ? 
15 AC2 8 LYS A 425 ? LYS A 463 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3DLX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DLX 
_atom_sites.fract_transf_matrix[1][1]   0.016405 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004660 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005935 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010906 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . THR A 1 2   ? 31.274  57.193  -11.025 1.00 41.03 ? 40  THR A N   1 
ATOM   2     C CA  . THR A 1 2   ? 31.412  55.831  -11.588 1.00 40.10 ? 40  THR A CA  1 
ATOM   3     C C   . THR A 1 2   ? 32.401  55.831  -12.730 1.00 39.86 ? 40  THR A C   1 
ATOM   4     O O   . THR A 1 2   ? 32.229  56.571  -13.680 1.00 39.28 ? 40  THR A O   1 
ATOM   5     C CB  . THR A 1 2   ? 30.059  55.350  -12.062 1.00 40.26 ? 40  THR A CB  1 
ATOM   6     O OG1 . THR A 1 2   ? 29.123  55.509  -10.980 1.00 40.70 ? 40  THR A OG1 1 
ATOM   7     C CG2 . THR A 1 2   ? 30.126  53.885  -12.509 1.00 38.01 ? 40  THR A CG2 1 
ATOM   8     N N   . LYS A 1 3   ? 33.442  54.999  -12.646 1.00 39.73 ? 41  LYS A N   1 
ATOM   9     C CA  . LYS A 1 3   ? 34.313  54.803  -13.790 1.00 39.64 ? 41  LYS A CA  1 
ATOM   10    C C   . LYS A 1 3   ? 33.912  53.507  -14.533 1.00 39.42 ? 41  LYS A C   1 
ATOM   11    O O   . LYS A 1 3   ? 33.733  52.440  -13.924 1.00 37.45 ? 41  LYS A O   1 
ATOM   12    C CB  . LYS A 1 3   ? 35.813  54.832  -13.410 1.00 40.36 ? 41  LYS A CB  1 
ATOM   13    C CG  . LYS A 1 3   ? 36.690  54.353  -14.604 1.00 40.82 ? 41  LYS A CG  1 
ATOM   14    C CD  . LYS A 1 3   ? 38.185  54.767  -14.648 1.00 41.29 ? 41  LYS A CD  1 
ATOM   15    C CE  . LYS A 1 3   ? 38.721  54.415  -16.069 1.00 42.52 ? 41  LYS A CE  1 
ATOM   16    N NZ  . LYS A 1 3   ? 40.175  54.656  -16.323 1.00 46.22 ? 41  LYS A NZ  1 
ATOM   17    N N   . PHE A 1 4   ? 33.772  53.637  -15.856 1.00 39.39 ? 42  PHE A N   1 
ATOM   18    C CA  . PHE A 1 4   ? 33.429  52.537  -16.757 1.00 40.50 ? 42  PHE A CA  1 
ATOM   19    C C   . PHE A 1 4   ? 34.684  51.913  -17.374 1.00 39.87 ? 42  PHE A C   1 
ATOM   20    O O   . PHE A 1 4   ? 35.569  52.626  -17.802 1.00 38.61 ? 42  PHE A O   1 
ATOM   21    C CB  . PHE A 1 4   ? 32.529  53.038  -17.906 1.00 41.79 ? 42  PHE A CB  1 
ATOM   22    C CG  . PHE A 1 4   ? 31.118  53.390  -17.474 1.00 43.84 ? 42  PHE A CG  1 
ATOM   23    C CD1 . PHE A 1 4   ? 30.846  54.607  -16.826 1.00 45.52 ? 42  PHE A CD1 1 
ATOM   24    C CD2 . PHE A 1 4   ? 30.063  52.497  -17.696 1.00 46.63 ? 42  PHE A CD2 1 
ATOM   25    C CE1 . PHE A 1 4   ? 29.539  54.941  -16.420 1.00 45.73 ? 42  PHE A CE1 1 
ATOM   26    C CE2 . PHE A 1 4   ? 28.750  52.821  -17.304 1.00 46.71 ? 42  PHE A CE2 1 
ATOM   27    C CZ  . PHE A 1 4   ? 28.494  54.048  -16.649 1.00 45.81 ? 42  PHE A CZ  1 
ATOM   28    N N   . TYR A 1 5   ? 34.732  50.579  -17.399 1.00 39.43 ? 43  TYR A N   1 
ATOM   29    C CA  . TYR A 1 5   ? 35.843  49.806  -17.962 1.00 39.19 ? 43  TYR A CA  1 
ATOM   30    C C   . TYR A 1 5   ? 35.348  48.850  -19.031 1.00 39.41 ? 43  TYR A C   1 
ATOM   31    O O   . TYR A 1 5   ? 34.266  48.319  -18.923 1.00 40.35 ? 43  TYR A O   1 
ATOM   32    C CB  . TYR A 1 5   ? 36.488  48.946  -16.898 1.00 38.50 ? 43  TYR A CB  1 
ATOM   33    C CG  . TYR A 1 5   ? 37.123  49.696  -15.791 1.00 38.38 ? 43  TYR A CG  1 
ATOM   34    C CD1 . TYR A 1 5   ? 36.344  50.271  -14.794 1.00 39.17 ? 43  TYR A CD1 1 
ATOM   35    C CD2 . TYR A 1 5   ? 38.507  49.814  -15.700 1.00 39.00 ? 43  TYR A CD2 1 
ATOM   36    C CE1 . TYR A 1 5   ? 36.906  50.959  -13.757 1.00 38.65 ? 43  TYR A CE1 1 
ATOM   37    C CE2 . TYR A 1 5   ? 39.094  50.512  -14.637 1.00 39.05 ? 43  TYR A CE2 1 
ATOM   38    C CZ  . TYR A 1 5   ? 38.271  51.079  -13.674 1.00 38.00 ? 43  TYR A CZ  1 
ATOM   39    O OH  . TYR A 1 5   ? 38.804  51.766  -12.617 1.00 36.78 ? 43  TYR A OH  1 
ATOM   40    N N   . THR A 1 6   ? 36.148  48.652  -20.070 1.00 40.64 ? 44  THR A N   1 
ATOM   41    C CA  . THR A 1 6   ? 35.896  47.627  -21.081 1.00 40.71 ? 44  THR A CA  1 
ATOM   42    C C   . THR A 1 6   ? 36.703  46.336  -20.770 1.00 41.19 ? 44  THR A C   1 
ATOM   43    O O   . THR A 1 6   ? 36.295  45.233  -21.142 1.00 41.25 ? 44  THR A O   1 
ATOM   44    C CB  . THR A 1 6   ? 36.158  48.188  -22.504 1.00 41.22 ? 44  THR A CB  1 
ATOM   45    O OG1 . THR A 1 6   ? 37.191  49.177  -22.457 1.00 39.89 ? 44  THR A OG1 1 
ATOM   46    C CG2 . THR A 1 6   ? 34.866  48.845  -23.088 1.00 40.10 ? 44  THR A CG2 1 
ATOM   47    N N   . ASP A 1 7   ? 37.802  46.503  -20.029 1.00 41.01 ? 45  ASP A N   1 
ATOM   48    C CA  . ASP A 1 7   ? 38.721  45.437  -19.599 1.00 40.55 ? 45  ASP A CA  1 
ATOM   49    C C   . ASP A 1 7   ? 38.417  45.090  -18.119 1.00 39.95 ? 45  ASP A C   1 
ATOM   50    O O   . ASP A 1 7   ? 38.734  45.892  -17.254 1.00 40.33 ? 45  ASP A O   1 
ATOM   51    C CB  . ASP A 1 7   ? 40.155  46.021  -19.747 1.00 41.34 ? 45  ASP A CB  1 
ATOM   52    C CG  . ASP A 1 7   ? 41.274  45.014  -19.525 1.00 42.95 ? 45  ASP A CG  1 
ATOM   53    O OD1 . ASP A 1 7   ? 41.042  43.965  -18.905 1.00 48.26 ? 45  ASP A OD1 1 
ATOM   54    O OD2 . ASP A 1 7   ? 42.415  45.291  -19.988 1.00 46.26 ? 45  ASP A OD2 1 
ATOM   55    N N   . PRO A 1 8   ? 37.792  43.916  -17.822 1.00 38.98 ? 46  PRO A N   1 
ATOM   56    C CA  . PRO A 1 8   ? 37.556  43.467  -16.429 1.00 38.13 ? 46  PRO A CA  1 
ATOM   57    C C   . PRO A 1 8   ? 38.815  43.181  -15.623 1.00 37.05 ? 46  PRO A C   1 
ATOM   58    O O   . PRO A 1 8   ? 38.793  43.346  -14.424 1.00 35.69 ? 46  PRO A O   1 
ATOM   59    C CB  . PRO A 1 8   ? 36.735  42.177  -16.588 1.00 37.72 ? 46  PRO A CB  1 
ATOM   60    C CG  . PRO A 1 8   ? 37.014  41.696  -17.964 1.00 38.91 ? 46  PRO A CG  1 
ATOM   61    C CD  . PRO A 1 8   ? 37.225  42.948  -18.792 1.00 39.63 ? 46  PRO A CD  1 
ATOM   62    N N   . VAL A 1 9   ? 39.913  42.769  -16.274 1.00 36.64 ? 47  VAL A N   1 
ATOM   63    C CA  . VAL A 1 9   ? 41.177  42.644  -15.567 1.00 35.97 ? 47  VAL A CA  1 
ATOM   64    C C   . VAL A 1 9   ? 41.640  44.003  -15.046 1.00 36.19 ? 47  VAL A C   1 
ATOM   65    O O   . VAL A 1 9   ? 42.064  44.090  -13.902 1.00 36.83 ? 47  VAL A O   1 
ATOM   66    C CB  . VAL A 1 9   ? 42.234  41.884  -16.373 1.00 35.86 ? 47  VAL A CB  1 
ATOM   67    C CG1 . VAL A 1 9   ? 43.534  41.858  -15.633 1.00 35.91 ? 47  VAL A CG1 1 
ATOM   68    C CG2 . VAL A 1 9   ? 41.731  40.450  -16.633 1.00 34.54 ? 47  VAL A CG2 1 
ATOM   69    N N   . GLU A 1 10  ? 41.460  45.068  -15.818 1.00 35.83 ? 48  GLU A N   1 
ATOM   70    C CA  . GLU A 1 10  ? 41.806  46.432  -15.372 1.00 36.02 ? 48  GLU A CA  1 
ATOM   71    C C   . GLU A 1 10  ? 41.029  46.918  -14.150 1.00 35.58 ? 48  GLU A C   1 
ATOM   72    O O   . GLU A 1 10  ? 41.602  47.594  -13.290 1.00 35.32 ? 48  GLU A O   1 
ATOM   73    C CB  . GLU A 1 10  ? 41.567  47.424  -16.499 1.00 36.86 ? 48  GLU A CB  1 
ATOM   74    C CG  . GLU A 1 10  ? 41.948  48.878  -16.161 1.00 40.11 ? 48  GLU A CG  1 
ATOM   75    C CD  . GLU A 1 10  ? 43.468  49.176  -16.151 1.00 42.11 ? 48  GLU A CD  1 
ATOM   76    O OE1 . GLU A 1 10  ? 44.275  48.424  -16.754 1.00 39.36 ? 48  GLU A OE1 1 
ATOM   77    O OE2 . GLU A 1 10  ? 43.837  50.189  -15.508 1.00 46.59 ? 48  GLU A OE2 1 
ATOM   78    N N   . ALA A 1 11  ? 39.731  46.601  -14.109 1.00 34.28 ? 49  ALA A N   1 
ATOM   79    C CA  . ALA A 1 11  ? 38.861  46.950  -12.991 1.00 34.61 ? 49  ALA A CA  1 
ATOM   80    C C   . ALA A 1 11  ? 39.171  46.238  -11.664 1.00 33.82 ? 49  ALA A C   1 
ATOM   81    O O   . ALA A 1 11  ? 38.727  46.690  -10.655 1.00 34.00 ? 49  ALA A O   1 
ATOM   82    C CB  . ALA A 1 11  ? 37.359  46.739  -13.382 1.00 33.87 ? 49  ALA A CB  1 
ATOM   83    N N   . VAL A 1 12  ? 39.878  45.119  -11.681 1.00 33.93 ? 50  VAL A N   1 
ATOM   84    C CA  . VAL A 1 12  ? 40.252  44.360  -10.462 1.00 34.14 ? 50  VAL A CA  1 
ATOM   85    C C   . VAL A 1 12  ? 41.782  44.170  -10.281 1.00 34.99 ? 50  VAL A C   1 
ATOM   86    O O   . VAL A 1 12  ? 42.245  43.452  -9.389  1.00 34.96 ? 50  VAL A O   1 
ATOM   87    C CB  . VAL A 1 12  ? 39.611  42.955  -10.468 1.00 34.07 ? 50  VAL A CB  1 
ATOM   88    C CG1 . VAL A 1 12  ? 38.068  43.038  -10.637 1.00 34.80 ? 50  VAL A CG1 1 
ATOM   89    C CG2 . VAL A 1 12  ? 40.277  42.044  -11.519 1.00 31.12 ? 50  VAL A CG2 1 
ATOM   90    N N   . LYS A 1 13  ? 42.545  44.847  -11.120 1.00 35.80 ? 51  LYS A N   1 
ATOM   91    C CA  . LYS A 1 13  ? 43.980  44.676  -11.245 1.00 37.28 ? 51  LYS A CA  1 
ATOM   92    C C   . LYS A 1 13  ? 44.760  45.168  -10.019 1.00 37.54 ? 51  LYS A C   1 
ATOM   93    O O   . LYS A 1 13  ? 45.932  44.855  -9.853  1.00 36.93 ? 51  LYS A O   1 
ATOM   94    C CB  . LYS A 1 13  ? 44.461  45.480  -12.459 1.00 37.83 ? 51  LYS A CB  1 
ATOM   95    C CG  . LYS A 1 13  ? 45.931  45.418  -12.701 1.00 38.99 ? 51  LYS A CG  1 
ATOM   96    C CD  . LYS A 1 13  ? 46.275  45.702  -14.117 1.00 41.79 ? 51  LYS A CD  1 
ATOM   97    C CE  . LYS A 1 13  ? 46.255  47.181  -14.489 1.00 43.15 ? 51  LYS A CE  1 
ATOM   98    N NZ  . LYS A 1 13  ? 46.978  47.370  -15.818 1.00 39.40 ? 51  LYS A NZ  1 
ATOM   99    N N   . ASP A 1 14  ? 44.116  45.951  -9.177  1.00 37.48 ? 52  ASP A N   1 
ATOM   100   C CA  . ASP A 1 14  ? 44.808  46.516  -8.074  1.00 37.34 ? 52  ASP A CA  1 
ATOM   101   C C   . ASP A 1 14  ? 44.352  45.933  -6.757  1.00 36.24 ? 52  ASP A C   1 
ATOM   102   O O   . ASP A 1 14  ? 44.832  46.368  -5.709  1.00 36.84 ? 52  ASP A O   1 
ATOM   103   C CB  . ASP A 1 14  ? 44.708  48.042  -8.121  1.00 38.15 ? 52  ASP A CB  1 
ATOM   104   C CG  . ASP A 1 14  ? 43.284  48.555  -7.961  1.00 39.60 ? 52  ASP A CG  1 
ATOM   105   O OD1 . ASP A 1 14  ? 42.317  47.794  -8.104  1.00 45.01 ? 52  ASP A OD1 1 
ATOM   106   O OD2 . ASP A 1 14  ? 43.132  49.747  -7.695  1.00 42.53 ? 52  ASP A OD2 1 
ATOM   107   N N   . ILE A 1 15  ? 43.509  44.902  -6.784  1.00 35.46 ? 53  ILE A N   1 
ATOM   108   C CA  . ILE A 1 15  ? 43.239  44.150  -5.566  1.00 34.93 ? 53  ILE A CA  1 
ATOM   109   C C   . ILE A 1 15  ? 44.567  43.549  -5.038  1.00 35.82 ? 53  ILE A C   1 
ATOM   110   O O   . ILE A 1 15  ? 45.215  42.731  -5.718  1.00 36.70 ? 53  ILE A O   1 
ATOM   111   C CB  . ILE A 1 15  ? 42.195  42.993  -5.731  1.00 35.65 ? 53  ILE A CB  1 
ATOM   112   C CG1 . ILE A 1 15  ? 40.839  43.466  -6.315  1.00 35.10 ? 53  ILE A CG1 1 
ATOM   113   C CG2 . ILE A 1 15  ? 41.963  42.314  -4.358  1.00 34.29 ? 53  ILE A CG2 1 
ATOM   114   C CD1 . ILE A 1 15  ? 39.844  42.340  -6.633  1.00 33.23 ? 53  ILE A CD1 1 
ATOM   115   N N   . PRO A 1 16  ? 45.001  43.954  -3.834  1.00 35.04 ? 54  PRO A N   1 
ATOM   116   C CA  . PRO A 1 16  ? 46.230  43.388  -3.291  1.00 34.86 ? 54  PRO A CA  1 
ATOM   117   C C   . PRO A 1 16  ? 46.078  41.982  -2.671  1.00 34.80 ? 54  PRO A C   1 
ATOM   118   O O   . PRO A 1 16  ? 44.994  41.606  -2.205  1.00 35.46 ? 54  PRO A O   1 
ATOM   119   C CB  . PRO A 1 16  ? 46.585  44.383  -2.198  1.00 35.42 ? 54  PRO A CB  1 
ATOM   120   C CG  . PRO A 1 16  ? 45.259  44.805  -1.671  1.00 34.59 ? 54  PRO A CG  1 
ATOM   121   C CD  . PRO A 1 16  ? 44.389  44.914  -2.903  1.00 34.58 ? 54  PRO A CD  1 
ATOM   122   N N   . ASP A 1 17  ? 47.160  41.223  -2.663  1.00 34.24 ? 55  ASP A N   1 
ATOM   123   C CA  . ASP A 1 17  ? 47.228  39.969  -1.929  1.00 34.84 ? 55  ASP A CA  1 
ATOM   124   C C   . ASP A 1 17  ? 46.767  40.213  -0.491  1.00 34.65 ? 55  ASP A C   1 
ATOM   125   O O   . ASP A 1 17  ? 47.018  41.259  0.080   1.00 34.87 ? 55  ASP A O   1 
ATOM   126   C CB  . ASP A 1 17  ? 48.672  39.407  -1.956  1.00 34.70 ? 55  ASP A CB  1 
ATOM   127   C CG  . ASP A 1 17  ? 49.003  38.711  -3.272  1.00 35.58 ? 55  ASP A CG  1 
ATOM   128   O OD1 . ASP A 1 17  ? 48.240  38.843  -4.247  1.00 34.78 ? 55  ASP A OD1 1 
ATOM   129   O OD2 . ASP A 1 17  ? 50.031  38.016  -3.335  1.00 38.29 ? 55  ASP A OD2 1 
ATOM   130   N N   . GLY A 1 18  ? 46.050  39.266  0.089   1.00 34.63 ? 56  GLY A N   1 
ATOM   131   C CA  . GLY A 1 18  ? 45.549  39.462  1.436   1.00 34.02 ? 56  GLY A CA  1 
ATOM   132   C C   . GLY A 1 18  ? 44.232  40.222  1.542   1.00 33.53 ? 56  GLY A C   1 
ATOM   133   O O   . GLY A 1 18  ? 43.698  40.253  2.615   1.00 33.52 ? 56  GLY A O   1 
ATOM   134   N N   . ALA A 1 19  ? 43.687  40.780  0.442   1.00 32.65 ? 57  ALA A N   1 
ATOM   135   C CA  . ALA A 1 19  ? 42.517  41.674  0.492   1.00 32.00 ? 57  ALA A CA  1 
ATOM   136   C C   . ALA A 1 19  ? 41.350  40.965  1.092   1.00 32.07 ? 57  ALA A C   1 
ATOM   137   O O   . ALA A 1 19  ? 41.230  39.784  0.933   1.00 32.74 ? 57  ALA A O   1 
ATOM   138   C CB  . ALA A 1 19  ? 42.113  42.195  -0.923  1.00 30.88 ? 57  ALA A CB  1 
ATOM   139   N N   . THR A 1 20  ? 40.470  41.708  1.739   1.00 32.28 ? 58  THR A N   1 
ATOM   140   C CA  . THR A 1 20  ? 39.135  41.230  2.037   1.00 32.78 ? 58  THR A CA  1 
ATOM   141   C C   . THR A 1 20  ? 38.214  41.598  0.901   1.00 32.74 ? 58  THR A C   1 
ATOM   142   O O   . THR A 1 20  ? 38.025  42.778  0.616   1.00 32.65 ? 58  THR A O   1 
ATOM   143   C CB  . THR A 1 20  ? 38.641  41.837  3.348   1.00 33.45 ? 58  THR A CB  1 
ATOM   144   O OG1 . THR A 1 20  ? 39.585  41.457  4.366   1.00 33.63 ? 58  THR A OG1 1 
ATOM   145   C CG2 . THR A 1 20  ? 37.207  41.347  3.704   1.00 30.55 ? 58  THR A CG2 1 
ATOM   146   N N   . VAL A 1 21  ? 37.624  40.580  0.267   1.00 32.86 ? 59  VAL A N   1 
ATOM   147   C CA  . VAL A 1 21  ? 36.786  40.776  -0.940  1.00 31.84 ? 59  VAL A CA  1 
ATOM   148   C C   . VAL A 1 21  ? 35.351  40.289  -0.657  1.00 31.88 ? 59  VAL A C   1 
ATOM   149   O O   . VAL A 1 21  ? 35.139  39.188  -0.156  1.00 32.60 ? 59  VAL A O   1 
ATOM   150   C CB  . VAL A 1 21  ? 37.410  40.099  -2.207  1.00 31.79 ? 59  VAL A CB  1 
ATOM   151   C CG1 . VAL A 1 21  ? 36.542  40.370  -3.454  1.00 31.59 ? 59  VAL A CG1 1 
ATOM   152   C CG2 . VAL A 1 21  ? 38.874  40.610  -2.444  1.00 26.85 ? 59  VAL A CG2 1 
ATOM   153   N N   . LEU A 1 22  ? 34.390  41.161  -0.897  1.00 31.76 ? 60  LEU A N   1 
ATOM   154   C CA  . LEU A 1 22  ? 32.986  40.855  -0.739  1.00 31.59 ? 60  LEU A CA  1 
ATOM   155   C C   . LEU A 1 22  ? 32.503  40.329  -2.091  1.00 31.42 ? 60  LEU A C   1 
ATOM   156   O O   . LEU A 1 22  ? 32.755  40.983  -3.136  1.00 30.93 ? 60  LEU A O   1 
ATOM   157   C CB  . LEU A 1 22  ? 32.208  42.115  -0.373  1.00 31.27 ? 60  LEU A CB  1 
ATOM   158   C CG  . LEU A 1 22  ? 32.717  42.983  0.780   1.00 31.65 ? 60  LEU A CG  1 
ATOM   159   C CD1 . LEU A 1 22  ? 31.567  43.895  1.134   1.00 30.90 ? 60  LEU A CD1 1 
ATOM   160   C CD2 . LEU A 1 22  ? 33.218  42.159  2.006   1.00 24.23 ? 60  LEU A CD2 1 
ATOM   161   N N   . VAL A 1 23  ? 31.930  39.114  -2.111  1.00 32.34 ? 61  VAL A N   1 
ATOM   162   C CA  . VAL A 1 23  ? 31.533  38.503  -3.398  1.00 32.14 ? 61  VAL A CA  1 
ATOM   163   C C   . VAL A 1 23  ? 30.055  38.192  -3.357  1.00 33.01 ? 61  VAL A C   1 
ATOM   164   O O   . VAL A 1 23  ? 29.593  37.356  -2.559  1.00 35.35 ? 61  VAL A O   1 
ATOM   165   C CB  . VAL A 1 23  ? 32.316  37.240  -3.757  1.00 33.53 ? 61  VAL A CB  1 
ATOM   166   C CG1 . VAL A 1 23  ? 31.959  36.791  -5.240  1.00 30.48 ? 61  VAL A CG1 1 
ATOM   167   C CG2 . VAL A 1 23  ? 33.837  37.424  -3.564  1.00 29.28 ? 61  VAL A CG2 1 
ATOM   168   N N   . GLY A 1 24  ? 29.301  38.846  -4.231  1.00 32.93 ? 62  GLY A N   1 
ATOM   169   C CA  . GLY A 1 24  ? 27.854  38.655  -4.283  1.00 33.72 ? 62  GLY A CA  1 
ATOM   170   C C   . GLY A 1 24  ? 27.362  37.307  -4.771  1.00 33.49 ? 62  GLY A C   1 
ATOM   171   O O   . GLY A 1 24  ? 28.117  36.516  -5.346  1.00 34.58 ? 62  GLY A O   1 
ATOM   172   N N   . GLY A 1 25  ? 26.080  37.054  -4.547  1.00 33.88 ? 63  GLY A N   1 
ATOM   173   C CA  . GLY A 1 25  ? 25.413  35.840  -5.023  1.00 33.80 ? 63  GLY A CA  1 
ATOM   174   C C   . GLY A 1 25  ? 24.886  34.982  -3.873  1.00 33.93 ? 63  GLY A C   1 
ATOM   175   O O   . GLY A 1 25  ? 25.370  35.055  -2.749  1.00 36.37 ? 63  GLY A O   1 
ATOM   176   N N   . PHE A 1 26  ? 23.847  34.222  -4.172  1.00 33.84 ? 64  PHE A N   1 
ATOM   177   C CA  . PHE A 1 26  ? 23.177  33.313  -3.267  1.00 33.82 ? 64  PHE A CA  1 
ATOM   178   C C   . PHE A 1 26  ? 23.119  32.013  -4.083  1.00 35.06 ? 64  PHE A C   1 
ATOM   179   O O   . PHE A 1 26  ? 22.471  31.986  -5.127  1.00 35.96 ? 64  PHE A O   1 
ATOM   180   C CB  . PHE A 1 26  ? 21.750  33.808  -2.968  1.00 33.97 ? 64  PHE A CB  1 
ATOM   181   C CG  . PHE A 1 26  ? 20.964  32.875  -2.073  1.00 34.44 ? 64  PHE A CG  1 
ATOM   182   C CD1 . PHE A 1 26  ? 20.985  33.048  -0.688  1.00 34.51 ? 64  PHE A CD1 1 
ATOM   183   C CD2 . PHE A 1 26  ? 20.257  31.769  -2.614  1.00 36.50 ? 64  PHE A CD2 1 
ATOM   184   C CE1 . PHE A 1 26  ? 20.322  32.123  0.165   1.00 34.80 ? 64  PHE A CE1 1 
ATOM   185   C CE2 . PHE A 1 26  ? 19.583  30.867  -1.785  1.00 36.10 ? 64  PHE A CE2 1 
ATOM   186   C CZ  . PHE A 1 26  ? 19.615  31.054  -0.381  1.00 33.93 ? 64  PHE A CZ  1 
ATOM   187   N N   . GLY A 1 27  ? 23.765  30.933  -3.644  1.00 35.33 ? 65  GLY A N   1 
ATOM   188   C CA  . GLY A 1 27  ? 23.848  29.760  -4.525  1.00 35.17 ? 65  GLY A CA  1 
ATOM   189   C C   . GLY A 1 27  ? 24.611  30.165  -5.793  1.00 34.66 ? 65  GLY A C   1 
ATOM   190   O O   . GLY A 1 27  ? 25.675  30.822  -5.723  1.00 34.81 ? 65  GLY A O   1 
ATOM   191   N N   . LEU A 1 28  ? 24.106  29.780  -6.961  1.00 33.89 ? 66  LEU A N   1 
ATOM   192   C CA  . LEU A 1 28  ? 24.708  30.256  -8.224  1.00 33.59 ? 66  LEU A CA  1 
ATOM   193   C C   . LEU A 1 28  ? 23.944  31.478  -8.799  1.00 34.43 ? 66  LEU A C   1 
ATOM   194   O O   . LEU A 1 28  ? 24.232  31.918  -9.899  1.00 34.09 ? 66  LEU A O   1 
ATOM   195   C CB  . LEU A 1 28  ? 24.825  29.141  -9.253  1.00 33.07 ? 66  LEU A CB  1 
ATOM   196   C CG  . LEU A 1 28  ? 25.659  27.907  -8.864  1.00 31.82 ? 66  LEU A CG  1 
ATOM   197   C CD1 . LEU A 1 28  ? 25.786  27.016  -10.056 1.00 27.97 ? 66  LEU A CD1 1 
ATOM   198   C CD2 . LEU A 1 28  ? 27.033  28.291  -8.295  1.00 29.68 ? 66  LEU A CD2 1 
ATOM   199   N N   . CYS A 1 29  ? 23.054  32.065  -7.999  1.00 34.09 ? 67  CYS A N   1 
ATOM   200   C CA  . CYS A 1 29  ? 22.182  33.145  -8.428  1.00 34.52 ? 67  CYS A CA  1 
ATOM   201   C C   . CYS A 1 29  ? 22.766  34.532  -8.121  1.00 34.38 ? 67  CYS A C   1 
ATOM   202   O O   . CYS A 1 29  ? 23.006  34.869  -6.970  1.00 33.36 ? 67  CYS A O   1 
ATOM   203   C CB  . CYS A 1 29  ? 20.860  32.988  -7.676  1.00 35.12 ? 67  CYS A CB  1 
ATOM   204   S SG  . CYS A 1 29  ? 19.515  34.050  -8.172  1.00 36.35 ? 67  CYS A SG  1 
ATOM   205   N N   . GLY A 1 30  ? 22.942  35.330  -9.156  1.00 34.71 ? 68  GLY A N   1 
ATOM   206   C CA  . GLY A 1 30  ? 23.568  36.633  -9.069  1.00 36.32 ? 68  GLY A CA  1 
ATOM   207   C C   . GLY A 1 30  ? 25.029  36.606  -8.687  1.00 36.74 ? 68  GLY A C   1 
ATOM   208   O O   . GLY A 1 30  ? 25.473  37.377  -7.850  1.00 37.01 ? 68  GLY A O   1 
ATOM   209   N N   . ILE A 1 31  ? 25.755  35.697  -9.314  1.00 37.63 ? 69  ILE A N   1 
ATOM   210   C CA  . ILE A 1 31  ? 27.203  35.528  -9.155  1.00 38.22 ? 69  ILE A CA  1 
ATOM   211   C C   . ILE A 1 31  ? 27.935  36.423  -10.165 1.00 37.33 ? 69  ILE A C   1 
ATOM   212   O O   . ILE A 1 31  ? 27.554  36.419  -11.339 1.00 35.93 ? 69  ILE A O   1 
ATOM   213   C CB  . ILE A 1 31  ? 27.554  34.034  -9.406  1.00 39.01 ? 69  ILE A CB  1 
ATOM   214   C CG1 . ILE A 1 31  ? 26.999  33.206  -8.264  1.00 39.47 ? 69  ILE A CG1 1 
ATOM   215   C CG2 . ILE A 1 31  ? 29.051  33.807  -9.532  1.00 40.40 ? 69  ILE A CG2 1 
ATOM   216   C CD1 . ILE A 1 31  ? 27.736  33.386  -7.049  1.00 40.91 ? 69  ILE A CD1 1 
ATOM   217   N N   . PRO A 1 32  ? 28.952  37.221  -9.722  1.00 35.84 ? 70  PRO A N   1 
ATOM   218   C CA  . PRO A 1 32  ? 29.689  38.032  -10.686 1.00 35.45 ? 70  PRO A CA  1 
ATOM   219   C C   . PRO A 1 32  ? 30.712  37.222  -11.447 1.00 35.33 ? 70  PRO A C   1 
ATOM   220   O O   . PRO A 1 32  ? 31.913  37.294  -11.193 1.00 35.81 ? 70  PRO A O   1 
ATOM   221   C CB  . PRO A 1 32  ? 30.345  39.087  -9.821  1.00 34.66 ? 70  PRO A CB  1 
ATOM   222   C CG  . PRO A 1 32  ? 30.592  38.433  -8.599  1.00 34.79 ? 70  PRO A CG  1 
ATOM   223   C CD  . PRO A 1 32  ? 29.448  37.484  -8.367  1.00 36.14 ? 70  PRO A CD  1 
ATOM   224   N N   . GLU A 1 33  ? 30.229  36.474  -12.428 1.00 35.78 ? 71  GLU A N   1 
ATOM   225   C CA  . GLU A 1 33  ? 31.076  35.484  -13.065 1.00 34.97 ? 71  GLU A CA  1 
ATOM   226   C C   . GLU A 1 33  ? 32.267  36.039  -13.878 1.00 34.14 ? 71  GLU A C   1 
ATOM   227   O O   . GLU A 1 33  ? 33.338  35.363  -14.010 1.00 32.42 ? 71  GLU A O   1 
ATOM   228   C CB  . GLU A 1 33  ? 30.206  34.481  -13.838 1.00 34.91 ? 71  GLU A CB  1 
ATOM   229   C CG  . GLU A 1 33  ? 29.420  35.045  -14.967 1.00 37.33 ? 71  GLU A CG  1 
ATOM   230   C CD  . GLU A 1 33  ? 28.447  34.026  -15.600 1.00 37.63 ? 71  GLU A CD  1 
ATOM   231   O OE1 . GLU A 1 33  ? 28.881  33.303  -16.520 1.00 39.63 ? 71  GLU A OE1 1 
ATOM   232   O OE2 . GLU A 1 33  ? 27.261  33.978  -15.194 1.00 37.73 ? 71  GLU A OE2 1 
ATOM   233   N N   . ASN A 1 34  ? 32.116  37.238  -14.442 1.00 33.85 ? 72  ASN A N   1 
ATOM   234   C CA  . ASN A 1 34  ? 33.192  37.816  -15.287 1.00 33.67 ? 72  ASN A CA  1 
ATOM   235   C C   . ASN A 1 34  ? 34.298  38.419  -14.423 1.00 33.16 ? 72  ASN A C   1 
ATOM   236   O O   . ASN A 1 34  ? 35.464  38.434  -14.802 1.00 31.77 ? 72  ASN A O   1 
ATOM   237   C CB  . ASN A 1 34  ? 32.624  38.875  -16.270 1.00 34.62 ? 72  ASN A CB  1 
ATOM   238   C CG  . ASN A 1 34  ? 31.719  38.261  -17.349 1.00 33.50 ? 72  ASN A CG  1 
ATOM   239   O OD1 . ASN A 1 34  ? 32.200  37.868  -18.376 1.00 36.27 ? 72  ASN A OD1 1 
ATOM   240   N ND2 . ASN A 1 34  ? 30.404  38.204  -17.102 1.00 34.71 ? 72  ASN A ND2 1 
ATOM   241   N N   . LEU A 1 35  ? 33.914  38.897  -13.240 1.00 32.81 ? 73  LEU A N   1 
ATOM   242   C CA  . LEU A 1 35  ? 34.845  39.479  -12.295 1.00 33.36 ? 73  LEU A CA  1 
ATOM   243   C C   . LEU A 1 35  ? 35.631  38.369  -11.581 1.00 33.68 ? 73  LEU A C   1 
ATOM   244   O O   . LEU A 1 35  ? 36.809  38.534  -11.319 1.00 34.05 ? 73  LEU A O   1 
ATOM   245   C CB  . LEU A 1 35  ? 34.114  40.386  -11.300 1.00 33.53 ? 73  LEU A CB  1 
ATOM   246   C CG  . LEU A 1 35  ? 33.557  41.721  -11.837 1.00 32.04 ? 73  LEU A CG  1 
ATOM   247   C CD1 . LEU A 1 35  ? 32.729  42.434  -10.786 1.00 28.68 ? 73  LEU A CD1 1 
ATOM   248   C CD2 . LEU A 1 35  ? 34.683  42.639  -12.353 1.00 31.53 ? 73  LEU A CD2 1 
ATOM   249   N N   . ILE A 1 36  ? 34.994  37.239  -11.301 1.00 33.65 ? 74  ILE A N   1 
ATOM   250   C CA  . ILE A 1 36  ? 35.695  36.076  -10.739 1.00 33.62 ? 74  ILE A CA  1 
ATOM   251   C C   . ILE A 1 36  ? 36.763  35.528  -11.728 1.00 34.51 ? 74  ILE A C   1 
ATOM   252   O O   . ILE A 1 36  ? 37.886  35.183  -11.350 1.00 33.27 ? 74  ILE A O   1 
ATOM   253   C CB  . ILE A 1 36  ? 34.675  34.961  -10.314 1.00 34.09 ? 74  ILE A CB  1 
ATOM   254   C CG1 . ILE A 1 36  ? 33.925  35.361  -9.066  1.00 33.20 ? 74  ILE A CG1 1 
ATOM   255   C CG2 . ILE A 1 36  ? 35.343  33.539  -10.055 1.00 33.43 ? 74  ILE A CG2 1 
ATOM   256   C CD1 . ILE A 1 36  ? 32.622  34.560  -8.837  1.00 33.50 ? 74  ILE A CD1 1 
ATOM   257   N N   . ASP A 1 37  ? 36.396  35.479  -13.002 1.00 34.97 ? 75  ASP A N   1 
ATOM   258   C CA  . ASP A 1 37  ? 37.304  35.086  -14.071 1.00 35.89 ? 75  ASP A CA  1 
ATOM   259   C C   . ASP A 1 37  ? 38.512  36.048  -14.194 1.00 35.27 ? 75  ASP A C   1 
ATOM   260   O O   . ASP A 1 37  ? 39.635  35.616  -14.482 1.00 35.04 ? 75  ASP A O   1 
ATOM   261   C CB  . ASP A 1 37  ? 36.524  35.017  -15.392 1.00 36.18 ? 75  ASP A CB  1 
ATOM   262   C CG  . ASP A 1 37  ? 37.294  34.391  -16.481 1.00 41.62 ? 75  ASP A CG  1 
ATOM   263   O OD1 . ASP A 1 37  ? 37.413  33.140  -16.477 1.00 49.10 ? 75  ASP A OD1 1 
ATOM   264   O OD2 . ASP A 1 37  ? 37.782  35.131  -17.376 1.00 50.36 ? 75  ASP A OD2 1 
ATOM   265   N N   . ALA A 1 38  ? 38.276  37.337  -14.001 1.00 34.41 ? 76  ALA A N   1 
ATOM   266   C CA  . ALA A 1 38  ? 39.339  38.335  -13.990 1.00 34.36 ? 76  ALA A CA  1 
ATOM   267   C C   . ALA A 1 38  ? 40.322  38.126  -12.812 1.00 34.64 ? 76  ALA A C   1 
ATOM   268   O O   . ALA A 1 38  ? 41.533  38.332  -12.983 1.00 34.91 ? 76  ALA A O   1 
ATOM   269   C CB  . ALA A 1 38  ? 38.748  39.771  -13.990 1.00 33.33 ? 76  ALA A CB  1 
ATOM   270   N N   . LEU A 1 39  ? 39.832  37.701  -11.636 1.00 34.89 ? 77  LEU A N   1 
ATOM   271   C CA  . LEU A 1 39  ? 40.731  37.387  -10.508 1.00 34.61 ? 77  LEU A CA  1 
ATOM   272   C C   . LEU A 1 39  ? 41.546  36.113  -10.769 1.00 35.27 ? 77  LEU A C   1 
ATOM   273   O O   . LEU A 1 39  ? 42.675  35.993  -10.282 1.00 34.49 ? 77  LEU A O   1 
ATOM   274   C CB  . LEU A 1 39  ? 40.004  37.263  -9.180  1.00 35.63 ? 77  LEU A CB  1 
ATOM   275   C CG  . LEU A 1 39  ? 39.654  38.567  -8.449  1.00 35.95 ? 77  LEU A CG  1 
ATOM   276   C CD1 . LEU A 1 39  ? 38.714  39.345  -9.288  1.00 37.08 ? 77  LEU A CD1 1 
ATOM   277   C CD2 . LEU A 1 39  ? 39.011  38.261  -7.149  1.00 37.30 ? 77  LEU A CD2 1 
ATOM   278   N N   . LEU A 1 40  ? 40.984  35.165  -11.521 1.00 35.12 ? 78  LEU A N   1 
ATOM   279   C CA  . LEU A 1 40  ? 41.757  33.994  -11.938 1.00 34.90 ? 78  LEU A CA  1 
ATOM   280   C C   . LEU A 1 40  ? 42.919  34.392  -12.856 1.00 35.37 ? 78  LEU A C   1 
ATOM   281   O O   . LEU A 1 40  ? 44.016  33.805  -12.788 1.00 34.48 ? 78  LEU A O   1 
ATOM   282   C CB  . LEU A 1 40  ? 40.865  32.985  -12.674 1.00 34.80 ? 78  LEU A CB  1 
ATOM   283   C CG  . LEU A 1 40  ? 39.762  32.209  -11.946 1.00 33.06 ? 78  LEU A CG  1 
ATOM   284   C CD1 . LEU A 1 40  ? 38.920  31.450  -13.024 1.00 31.88 ? 78  LEU A CD1 1 
ATOM   285   C CD2 . LEU A 1 40  ? 40.320  31.242  -10.925 1.00 31.08 ? 78  LEU A CD2 1 
ATOM   286   N N   . LYS A 1 41  ? 42.670  35.379  -13.727 1.00 35.81 ? 79  LYS A N   1 
ATOM   287   C CA  . LYS A 1 41  ? 43.707  35.900  -14.623 1.00 36.28 ? 79  LYS A CA  1 
ATOM   288   C C   . LYS A 1 41  ? 44.802  36.650  -13.877 1.00 35.42 ? 79  LYS A C   1 
ATOM   289   O O   . LYS A 1 41  ? 45.943  36.572  -14.255 1.00 36.00 ? 79  LYS A O   1 
ATOM   290   C CB  . LYS A 1 41  ? 43.115  36.830  -15.702 1.00 37.19 ? 79  LYS A CB  1 
ATOM   291   C CG  . LYS A 1 41  ? 42.012  36.207  -16.594 1.00 39.05 ? 79  LYS A CG  1 
ATOM   292   C CD  . LYS A 1 41  ? 42.088  36.720  -18.021 1.00 41.78 ? 79  LYS A CD  1 
ATOM   293   C CE  . LYS A 1 41  ? 41.001  36.125  -18.943 1.00 42.41 ? 79  LYS A CE  1 
ATOM   294   N NZ  . LYS A 1 41  ? 41.001  34.634  -18.963 1.00 43.79 ? 79  LYS A NZ  1 
ATOM   295   N N   . THR A 1 42  ? 44.453  37.417  -12.851 1.00 35.38 ? 80  THR A N   1 
ATOM   296   C CA  . THR A 1 42  ? 45.456  38.174  -12.089 1.00 35.01 ? 80  THR A CA  1 
ATOM   297   C C   . THR A 1 42  ? 46.169  37.279  -11.076 1.00 35.55 ? 80  THR A C   1 
ATOM   298   O O   . THR A 1 42  ? 47.308  37.510  -10.736 1.00 35.84 ? 80  THR A O   1 
ATOM   299   C CB  . THR A 1 42  ? 44.861  39.393  -11.350 1.00 34.39 ? 80  THR A CB  1 
ATOM   300   O OG1 . THR A 1 42  ? 43.968  38.939  -10.343 1.00 34.13 ? 80  THR A OG1 1 
ATOM   301   C CG2 . THR A 1 42  ? 44.109  40.343  -12.315 1.00 33.45 ? 80  THR A CG2 1 
ATOM   302   N N   . GLY A 1 43  ? 45.497  36.250  -10.597 1.00 36.21 ? 81  GLY A N   1 
ATOM   303   C CA  . GLY A 1 43  ? 46.111  35.308  -9.676  1.00 36.57 ? 81  GLY A CA  1 
ATOM   304   C C   . GLY A 1 43  ? 46.337  35.851  -8.273  1.00 36.11 ? 81  GLY A C   1 
ATOM   305   O O   . GLY A 1 43  ? 47.097  35.279  -7.511  1.00 36.13 ? 81  GLY A O   1 
ATOM   306   N N   . VAL A 1 44  ? 45.676  36.951  -7.945  1.00 36.60 ? 82  VAL A N   1 
ATOM   307   C CA  . VAL A 1 44  ? 45.710  37.544  -6.598  1.00 36.21 ? 82  VAL A CA  1 
ATOM   308   C C   . VAL A 1 44  ? 45.356  36.471  -5.553  1.00 36.40 ? 82  VAL A C   1 
ATOM   309   O O   . VAL A 1 44  ? 44.370  35.745  -5.707  1.00 36.74 ? 82  VAL A O   1 
ATOM   310   C CB  . VAL A 1 44  ? 44.779  38.812  -6.522  1.00 36.03 ? 82  VAL A CB  1 
ATOM   311   C CG1 . VAL A 1 44  ? 43.271  38.427  -6.461  1.00 35.90 ? 82  VAL A CG1 1 
ATOM   312   C CG2 . VAL A 1 44  ? 45.131  39.680  -5.332  1.00 34.77 ? 82  VAL A CG2 1 
ATOM   313   N N   . LYS A 1 45  ? 46.167  36.356  -4.498  1.00 36.53 ? 83  LYS A N   1 
ATOM   314   C CA  . LYS A 1 45  ? 45.960  35.299  -3.483  1.00 36.18 ? 83  LYS A CA  1 
ATOM   315   C C   . LYS A 1 45  ? 45.871  35.830  -2.056  1.00 35.02 ? 83  LYS A C   1 
ATOM   316   O O   . LYS A 1 45  ? 45.906  37.036  -1.848  1.00 33.72 ? 83  LYS A O   1 
ATOM   317   C CB  . LYS A 1 45  ? 47.085  34.262  -3.586  1.00 36.46 ? 83  LYS A CB  1 
ATOM   318   C CG  . LYS A 1 45  ? 48.480  34.796  -3.241  1.00 38.43 ? 83  LYS A CG  1 
ATOM   319   C CD  . LYS A 1 45  ? 49.562  33.880  -3.770  1.00 39.43 ? 83  LYS A CD  1 
ATOM   320   C CE  . LYS A 1 45  ? 50.960  34.437  -3.508  1.00 42.14 ? 83  LYS A CE  1 
ATOM   321   N NZ  . LYS A 1 45  ? 51.350  35.544  -4.444  1.00 43.79 ? 83  LYS A NZ  1 
ATOM   322   N N   . GLY A 1 46  ? 45.776  34.919  -1.084  1.00 34.05 ? 84  GLY A N   1 
ATOM   323   C CA  . GLY A 1 46  ? 45.607  35.282  0.327   1.00 33.94 ? 84  GLY A CA  1 
ATOM   324   C C   . GLY A 1 46  ? 44.280  35.880  0.726   1.00 33.93 ? 84  GLY A C   1 
ATOM   325   O O   . GLY A 1 46  ? 44.111  36.314  1.872   1.00 35.60 ? 84  GLY A O   1 
ATOM   326   N N   . LEU A 1 47  ? 43.299  35.877  -0.181  1.00 33.57 ? 85  LEU A N   1 
ATOM   327   C CA  . LEU A 1 47  ? 42.044  36.619  0.036   1.00 32.28 ? 85  LEU A CA  1 
ATOM   328   C C   . LEU A 1 47  ? 41.267  36.079  1.190   1.00 32.77 ? 85  LEU A C   1 
ATOM   329   O O   . LEU A 1 47  ? 41.291  34.870  1.423   1.00 32.75 ? 85  LEU A O   1 
ATOM   330   C CB  . LEU A 1 47  ? 41.151  36.533  -1.199  1.00 31.93 ? 85  LEU A CB  1 
ATOM   331   C CG  . LEU A 1 47  ? 41.867  37.006  -2.481  1.00 29.96 ? 85  LEU A CG  1 
ATOM   332   C CD1 . LEU A 1 47  ? 40.986  36.744  -3.664  1.00 31.71 ? 85  LEU A CD1 1 
ATOM   333   C CD2 . LEU A 1 47  ? 42.201  38.459  -2.363  1.00 24.00 ? 85  LEU A CD2 1 
ATOM   334   N N   . THR A 1 48  ? 40.599  36.995  1.909   1.00 33.20 ? 86  THR A N   1 
ATOM   335   C CA  . THR A 1 48  ? 39.420  36.714  2.719   1.00 33.93 ? 86  THR A CA  1 
ATOM   336   C C   . THR A 1 48  ? 38.187  37.048  1.867   1.00 34.57 ? 86  THR A C   1 
ATOM   337   O O   . THR A 1 48  ? 37.961  38.189  1.542   1.00 36.40 ? 86  THR A O   1 
ATOM   338   C CB  . THR A 1 48  ? 39.367  37.554  4.024   1.00 33.17 ? 86  THR A CB  1 
ATOM   339   O OG1 . THR A 1 48  ? 40.585  37.395  4.718   1.00 33.20 ? 86  THR A OG1 1 
ATOM   340   C CG2 . THR A 1 48  ? 38.257  37.110  4.949   1.00 34.01 ? 86  THR A CG2 1 
ATOM   341   N N   . ALA A 1 49  ? 37.418  36.024  1.501   1.00 34.53 ? 87  ALA A N   1 
ATOM   342   C CA  . ALA A 1 49  ? 36.192  36.156  0.731   1.00 33.34 ? 87  ALA A CA  1 
ATOM   343   C C   . ALA A 1 49  ? 34.983  36.089  1.646   1.00 32.84 ? 87  ALA A C   1 
ATOM   344   O O   . ALA A 1 49  ? 34.746  35.080  2.306   1.00 32.54 ? 87  ALA A O   1 
ATOM   345   C CB  . ALA A 1 49  ? 36.111  35.040  -0.340  1.00 32.69 ? 87  ALA A CB  1 
ATOM   346   N N   . VAL A 1 50  ? 34.237  37.190  1.654   1.00 32.05 ? 88  VAL A N   1 
ATOM   347   C CA  . VAL A 1 50  ? 32.994  37.305  2.323   1.00 31.91 ? 88  VAL A CA  1 
ATOM   348   C C   . VAL A 1 50  ? 31.946  37.070  1.242   1.00 32.98 ? 88  VAL A C   1 
ATOM   349   O O   . VAL A 1 50  ? 31.711  37.887  0.330   1.00 32.89 ? 88  VAL A O   1 
ATOM   350   C CB  . VAL A 1 50  ? 32.854  38.659  2.984   1.00 31.17 ? 88  VAL A CB  1 
ATOM   351   C CG1 . VAL A 1 50  ? 31.489  38.769  3.572   1.00 29.82 ? 88  VAL A CG1 1 
ATOM   352   C CG2 . VAL A 1 50  ? 33.989  38.854  4.037   1.00 30.64 ? 88  VAL A CG2 1 
ATOM   353   N N   . SER A 1 51  ? 31.329  35.912  1.361   1.00 33.13 ? 89  SER A N   1 
ATOM   354   C CA  . SER A 1 51  ? 30.503  35.363  0.338   1.00 33.26 ? 89  SER A CA  1 
ATOM   355   C C   . SER A 1 51  ? 29.497  34.442  1.020   1.00 33.40 ? 89  SER A C   1 
ATOM   356   O O   . SER A 1 51  ? 29.916  33.541  1.764   1.00 33.84 ? 89  SER A O   1 
ATOM   357   C CB  . SER A 1 51  ? 31.367  34.531  -0.589  1.00 31.93 ? 89  SER A CB  1 
ATOM   358   O OG  . SER A 1 51  ? 30.584  33.942  -1.588  1.00 33.75 ? 89  SER A OG  1 
ATOM   359   N N   . ASN A 1 52  ? 28.210  34.574  0.712   1.00 33.00 ? 90  ASN A N   1 
ATOM   360   C CA  . ASN A 1 52  ? 27.236  33.710  1.385   1.00 33.45 ? 90  ASN A CA  1 
ATOM   361   C C   . ASN A 1 52  ? 27.457  32.212  1.297   1.00 34.18 ? 90  ASN A C   1 
ATOM   362   O O   . ASN A 1 52  ? 27.271  31.538  2.275   1.00 33.64 ? 90  ASN A O   1 
ATOM   363   C CB  . ASN A 1 52  ? 25.828  33.958  0.926   1.00 33.89 ? 90  ASN A CB  1 
ATOM   364   C CG  . ASN A 1 52  ? 24.804  33.305  1.861   1.00 34.73 ? 90  ASN A CG  1 
ATOM   365   O OD1 . ASN A 1 52  ? 24.885  33.426  3.093   1.00 36.37 ? 90  ASN A OD1 1 
ATOM   366   N ND2 . ASN A 1 52  ? 23.862  32.607  1.285   1.00 37.70 ? 90  ASN A ND2 1 
ATOM   367   N N   . ASN A 1 53  ? 27.782  31.698  0.099   1.00 34.87 ? 91  ASN A N   1 
ATOM   368   C CA  . ASN A 1 53  ? 28.046  30.294  -0.117  1.00 34.60 ? 91  ASN A CA  1 
ATOM   369   C C   . ASN A 1 53  ? 29.417  30.159  -0.822  1.00 35.74 ? 91  ASN A C   1 
ATOM   370   O O   . ASN A 1 53  ? 30.055  31.160  -1.106  1.00 35.73 ? 91  ASN A O   1 
ATOM   371   C CB  . ASN A 1 53  ? 26.931  29.664  -0.969  1.00 34.44 ? 91  ASN A CB  1 
ATOM   372   C CG  . ASN A 1 53  ? 25.517  29.995  -0.462  1.00 35.04 ? 91  ASN A CG  1 
ATOM   373   O OD1 . ASN A 1 53  ? 24.735  30.719  -1.120  1.00 35.04 ? 91  ASN A OD1 1 
ATOM   374   N ND2 . ASN A 1 53  ? 25.197  29.488  0.700   1.00 33.87 ? 91  ASN A ND2 1 
ATOM   375   N N   . ALA A 1 54  ? 29.834  28.930  -1.144  1.00 36.43 ? 92  ALA A N   1 
ATOM   376   C CA  . ALA A 1 54  ? 31.135  28.658  -1.794  1.00 36.55 ? 92  ALA A CA  1 
ATOM   377   C C   . ALA A 1 54  ? 30.986  28.246  -3.268  1.00 37.59 ? 92  ALA A C   1 
ATOM   378   O O   . ALA A 1 54  ? 31.791  27.490  -3.783  1.00 38.98 ? 92  ALA A O   1 
ATOM   379   C CB  . ALA A 1 54  ? 31.915  27.562  -0.988  1.00 35.99 ? 92  ALA A CB  1 
ATOM   380   N N   . GLY A 1 55  ? 29.953  28.739  -3.941  1.00 38.76 ? 93  GLY A N   1 
ATOM   381   C CA  . GLY A 1 55  ? 29.612  28.295  -5.286  1.00 38.81 ? 93  GLY A CA  1 
ATOM   382   C C   . GLY A 1 55  ? 29.416  26.785  -5.373  1.00 38.94 ? 93  GLY A C   1 
ATOM   383   O O   . GLY A 1 55  ? 28.909  26.171  -4.435  1.00 39.60 ? 93  GLY A O   1 
ATOM   384   N N   . VAL A 1 56  ? 29.799  26.207  -6.519  1.00 38.05 ? 94  VAL A N   1 
ATOM   385   C CA  . VAL A 1 56  ? 29.996  24.776  -6.665  1.00 37.46 ? 94  VAL A CA  1 
ATOM   386   C C   . VAL A 1 56  ? 31.444  24.581  -7.121  1.00 38.09 ? 94  VAL A C   1 
ATOM   387   O O   . VAL A 1 56  ? 32.180  25.538  -7.274  1.00 37.54 ? 94  VAL A O   1 
ATOM   388   C CB  . VAL A 1 56  ? 28.964  24.118  -7.658  1.00 37.76 ? 94  VAL A CB  1 
ATOM   389   C CG1 . VAL A 1 56  ? 27.550  24.277  -7.109  1.00 34.33 ? 94  VAL A CG1 1 
ATOM   390   C CG2 . VAL A 1 56  ? 29.084  24.712  -9.122  1.00 35.31 ? 94  VAL A CG2 1 
ATOM   391   N N   . ASP A 1 57  ? 31.855  23.346  -7.322  1.00 38.99 ? 95  ASP A N   1 
ATOM   392   C CA  . ASP A 1 57  ? 33.256  23.052  -7.682  1.00 40.21 ? 95  ASP A CA  1 
ATOM   393   C C   . ASP A 1 57  ? 33.759  23.806  -8.911  1.00 40.24 ? 95  ASP A C   1 
ATOM   394   O O   . ASP A 1 57  ? 34.892  24.277  -8.947  1.00 40.13 ? 95  ASP A O   1 
ATOM   395   C CB  . ASP A 1 57  ? 33.443  21.549  -7.915  1.00 40.79 ? 95  ASP A CB  1 
ATOM   396   C CG  . ASP A 1 57  ? 32.945  20.719  -6.753  1.00 42.22 ? 95  ASP A CG  1 
ATOM   397   O OD1 . ASP A 1 57  ? 33.805  20.105  -6.085  1.00 42.78 ? 95  ASP A OD1 1 
ATOM   398   O OD2 . ASP A 1 57  ? 31.695  20.709  -6.510  1.00 44.22 ? 95  ASP A OD2 1 
ATOM   399   N N   . ASN A 1 58  ? 32.906  23.926  -9.916  1.00 40.61 ? 96  ASN A N   1 
ATOM   400   C CA  . ASN A 1 58  ? 33.323  24.528  -11.183 1.00 40.69 ? 96  ASN A CA  1 
ATOM   401   C C   . ASN A 1 58  ? 32.692  25.890  -11.493 1.00 40.16 ? 96  ASN A C   1 
ATOM   402   O O   . ASN A 1 58  ? 32.584  26.263  -12.649 1.00 39.62 ? 96  ASN A O   1 
ATOM   403   C CB  . ASN A 1 58  ? 33.105  23.529  -12.339 1.00 41.16 ? 96  ASN A CB  1 
ATOM   404   C CG  . ASN A 1 58  ? 31.626  23.147  -12.566 1.00 42.71 ? 96  ASN A CG  1 
ATOM   405   O OD1 . ASN A 1 58  ? 30.711  23.587  -11.866 1.00 46.04 ? 96  ASN A OD1 1 
ATOM   406   N ND2 . ASN A 1 58  ? 31.404  22.321  -13.585 1.00 45.21 ? 96  ASN A ND2 1 
ATOM   407   N N   . PHE A 1 59  ? 32.288  26.644  -10.470 1.00 39.41 ? 97  PHE A N   1 
ATOM   408   C CA  . PHE A 1 59  ? 31.560  27.860  -10.724 1.00 39.20 ? 97  PHE A CA  1 
ATOM   409   C C   . PHE A 1 59  ? 31.497  28.742  -9.496  1.00 38.83 ? 97  PHE A C   1 
ATOM   410   O O   . PHE A 1 59  ? 31.484  28.259  -8.378  1.00 38.97 ? 97  PHE A O   1 
ATOM   411   C CB  . PHE A 1 59  ? 30.141  27.538  -11.264 1.00 39.97 ? 97  PHE A CB  1 
ATOM   412   C CG  . PHE A 1 59  ? 29.539  28.647  -12.100 1.00 40.15 ? 97  PHE A CG  1 
ATOM   413   C CD1 . PHE A 1 59  ? 30.004  28.903  -13.376 1.00 41.91 ? 97  PHE A CD1 1 
ATOM   414   C CD2 . PHE A 1 59  ? 28.518  29.436  -11.609 1.00 43.55 ? 97  PHE A CD2 1 
ATOM   415   C CE1 . PHE A 1 59  ? 29.459  29.942  -14.152 1.00 42.08 ? 97  PHE A CE1 1 
ATOM   416   C CE2 . PHE A 1 59  ? 27.968  30.478  -12.376 1.00 44.43 ? 97  PHE A CE2 1 
ATOM   417   C CZ  . PHE A 1 59  ? 28.452  30.719  -13.659 1.00 42.47 ? 97  PHE A CZ  1 
ATOM   418   N N   . GLY A 1 60  ? 31.451  30.046  -9.717  1.00 37.97 ? 98  GLY A N   1 
ATOM   419   C CA  . GLY A 1 60  ? 31.395  30.994  -8.632  1.00 37.51 ? 98  GLY A CA  1 
ATOM   420   C C   . GLY A 1 60  ? 32.696  30.993  -7.852  1.00 37.40 ? 98  GLY A C   1 
ATOM   421   O O   . GLY A 1 60  ? 33.765  30.838  -8.413  1.00 37.48 ? 98  GLY A O   1 
ATOM   422   N N   . LEU A 1 61  ? 32.594  31.133  -6.536  1.00 37.16 ? 99  LEU A N   1 
ATOM   423   C CA  . LEU A 1 61  ? 33.749  31.211  -5.666  1.00 36.78 ? 99  LEU A CA  1 
ATOM   424   C C   . LEU A 1 61  ? 34.499  29.900  -5.714  1.00 35.96 ? 99  LEU A C   1 
ATOM   425   O O   . LEU A 1 61  ? 35.697  29.835  -5.505  1.00 36.56 ? 99  LEU A O   1 
ATOM   426   C CB  . LEU A 1 61  ? 33.268  31.484  -4.241  1.00 37.46 ? 99  LEU A CB  1 
ATOM   427   C CG  . LEU A 1 61  ? 34.309  32.162  -3.386  1.00 39.23 ? 99  LEU A CG  1 
ATOM   428   C CD1 . LEU A 1 61  ? 34.201  33.681  -3.639  1.00 37.48 ? 99  LEU A CD1 1 
ATOM   429   C CD2 . LEU A 1 61  ? 34.123  31.784  -1.926  1.00 42.20 ? 99  LEU A CD2 1 
ATOM   430   N N   . GLY A 1 62  ? 33.798  28.823  -6.021  1.00 35.89 ? 100 GLY A N   1 
ATOM   431   C CA  . GLY A 1 62  ? 34.468  27.552  -6.217  1.00 35.65 ? 100 GLY A CA  1 
ATOM   432   C C   . GLY A 1 62  ? 35.680  27.572  -7.137  1.00 35.56 ? 100 GLY A C   1 
ATOM   433   O O   . GLY A 1 62  ? 36.604  26.756  -6.966  1.00 36.62 ? 100 GLY A O   1 
ATOM   434   N N   . LEU A 1 63  ? 35.690  28.456  -8.134  1.00 35.08 ? 101 LEU A N   1 
ATOM   435   C CA  . LEU A 1 63  ? 36.847  28.549  -9.054  1.00 34.61 ? 101 LEU A CA  1 
ATOM   436   C C   . LEU A 1 63  ? 38.112  29.100  -8.373  1.00 34.34 ? 101 LEU A C   1 
ATOM   437   O O   . LEU A 1 63  ? 39.230  28.686  -8.713  1.00 34.43 ? 101 LEU A O   1 
ATOM   438   C CB  . LEU A 1 63  ? 36.521  29.425  -10.277 1.00 34.79 ? 101 LEU A CB  1 
ATOM   439   C CG  . LEU A 1 63  ? 35.449  28.918  -11.248 1.00 34.06 ? 101 LEU A CG  1 
ATOM   440   C CD1 . LEU A 1 63  ? 34.992  30.094  -12.094 1.00 35.11 ? 101 LEU A CD1 1 
ATOM   441   C CD2 . LEU A 1 63  ? 35.927  27.737  -12.119 1.00 32.66 ? 101 LEU A CD2 1 
ATOM   442   N N   . LEU A 1 64  ? 37.930  30.036  -7.435  1.00 34.47 ? 102 LEU A N   1 
ATOM   443   C CA  . LEU A 1 64  ? 39.047  30.658  -6.717  1.00 34.43 ? 102 LEU A CA  1 
ATOM   444   C C   . LEU A 1 64  ? 39.557  29.790  -5.560  1.00 34.83 ? 102 LEU A C   1 
ATOM   445   O O   . LEU A 1 64  ? 40.670  29.972  -5.077  1.00 34.70 ? 102 LEU A O   1 
ATOM   446   C CB  . LEU A 1 64  ? 38.646  32.040  -6.203  1.00 34.15 ? 102 LEU A CB  1 
ATOM   447   C CG  . LEU A 1 64  ? 38.171  33.087  -7.216  1.00 32.67 ? 102 LEU A CG  1 
ATOM   448   C CD1 . LEU A 1 64  ? 37.664  34.321  -6.494  1.00 33.11 ? 102 LEU A CD1 1 
ATOM   449   C CD2 . LEU A 1 64  ? 39.253  33.471  -8.155  1.00 31.47 ? 102 LEU A CD2 1 
ATOM   450   N N   . LEU A 1 65  ? 38.711  28.868  -5.117  1.00 35.68 ? 103 LEU A N   1 
ATOM   451   C CA  . LEU A 1 65  ? 39.090  27.781  -4.217  1.00 35.60 ? 103 LEU A CA  1 
ATOM   452   C C   . LEU A 1 65  ? 39.953  26.805  -4.967  1.00 35.17 ? 103 LEU A C   1 
ATOM   453   O O   . LEU A 1 65  ? 41.013  26.417  -4.486  1.00 34.71 ? 103 LEU A O   1 
ATOM   454   C CB  . LEU A 1 65  ? 37.858  27.062  -3.627  1.00 35.63 ? 103 LEU A CB  1 
ATOM   455   C CG  . LEU A 1 65  ? 37.119  27.862  -2.567  1.00 36.09 ? 103 LEU A CG  1 
ATOM   456   C CD1 . LEU A 1 65  ? 35.858  27.133  -2.132  1.00 38.81 ? 103 LEU A CD1 1 
ATOM   457   C CD2 . LEU A 1 65  ? 38.036  28.162  -1.356  1.00 35.26 ? 103 LEU A CD2 1 
ATOM   458   N N   . ARG A 1 66  ? 39.524  26.445  -6.174  1.00 35.02 ? 104 ARG A N   1 
ATOM   459   C CA  . ARG A 1 66  ? 40.303  25.516  -7.027  1.00 33.59 ? 104 ARG A CA  1 
ATOM   460   C C   . ARG A 1 66  ? 41.730  26.050  -7.317  1.00 33.72 ? 104 ARG A C   1 
ATOM   461   O O   . ARG A 1 66  ? 42.709  25.282  -7.302  1.00 33.89 ? 104 ARG A O   1 
ATOM   462   C CB  . ARG A 1 66  ? 39.536  25.166  -8.323  1.00 32.43 ? 104 ARG A CB  1 
ATOM   463   N N   . SER A 1 67  ? 41.867  27.353  -7.562  1.00 33.43 ? 105 SER A N   1 
ATOM   464   C CA  . SER A 1 67  ? 43.201  27.948  -7.815  1.00 33.28 ? 105 SER A CA  1 
ATOM   465   C C   . SER A 1 67  ? 43.953  28.367  -6.538  1.00 32.88 ? 105 SER A C   1 
ATOM   466   O O   . SER A 1 67  ? 45.014  28.976  -6.619  1.00 31.99 ? 105 SER A O   1 
ATOM   467   C CB  . SER A 1 67  ? 43.052  29.174  -8.722  1.00 33.37 ? 105 SER A CB  1 
ATOM   468   O OG  . SER A 1 67  ? 42.184  30.096  -8.098  1.00 33.54 ? 105 SER A OG  1 
ATOM   469   N N   . LYS A 1 68  ? 43.390  28.075  -5.366  1.00 33.02 ? 106 LYS A N   1 
ATOM   470   C CA  . LYS A 1 68  ? 44.019  28.390  -4.066  1.00 32.95 ? 106 LYS A CA  1 
ATOM   471   C C   . LYS A 1 68  ? 44.259  29.881  -3.841  1.00 31.76 ? 106 LYS A C   1 
ATOM   472   O O   . LYS A 1 68  ? 45.248  30.266  -3.246  1.00 30.43 ? 106 LYS A O   1 
ATOM   473   C CB  . LYS A 1 68  ? 45.364  27.645  -3.916  1.00 33.69 ? 106 LYS A CB  1 
ATOM   474   C CG  . LYS A 1 68  ? 45.371  26.164  -4.308  1.00 36.75 ? 106 LYS A CG  1 
ATOM   475   C CD  . LYS A 1 68  ? 44.271  25.368  -3.614  1.00 41.02 ? 106 LYS A CD  1 
ATOM   476   C CE  . LYS A 1 68  ? 44.275  23.936  -4.162  1.00 42.97 ? 106 LYS A CE  1 
ATOM   477   N NZ  . LYS A 1 68  ? 45.304  23.141  -3.479  1.00 43.79 ? 106 LYS A NZ  1 
ATOM   478   N N   . GLN A 1 69  ? 43.368  30.721  -4.337  1.00 31.55 ? 107 GLN A N   1 
ATOM   479   C CA  . GLN A 1 69  ? 43.487  32.156  -4.128  1.00 31.78 ? 107 GLN A CA  1 
ATOM   480   C C   . GLN A 1 69  ? 42.761  32.652  -2.864  1.00 32.48 ? 107 GLN A C   1 
ATOM   481   O O   . GLN A 1 69  ? 42.886  33.816  -2.491  1.00 32.90 ? 107 GLN A O   1 
ATOM   482   C CB  . GLN A 1 69  ? 42.955  32.870  -5.349  1.00 31.62 ? 107 GLN A CB  1 
ATOM   483   C CG  . GLN A 1 69  ? 43.895  32.797  -6.551  1.00 32.24 ? 107 GLN A CG  1 
ATOM   484   C CD  . GLN A 1 69  ? 43.252  33.340  -7.791  1.00 31.64 ? 107 GLN A CD  1 
ATOM   485   O OE1 . GLN A 1 69  ? 42.889  32.578  -8.665  1.00 33.26 ? 107 GLN A OE1 1 
ATOM   486   N NE2 . GLN A 1 69  ? 43.040  34.656  -7.844  1.00 32.35 ? 107 GLN A NE2 1 
ATOM   487   N N   . ILE A 1 70  ? 41.970  31.790  -2.222  1.00 33.07 ? 108 ILE A N   1 
ATOM   488   C CA  . ILE A 1 70  ? 41.296  32.151  -0.956  1.00 32.41 ? 108 ILE A CA  1 
ATOM   489   C C   . ILE A 1 70  ? 41.945  31.456  0.229   1.00 33.44 ? 108 ILE A C   1 
ATOM   490   O O   . ILE A 1 70  ? 42.167  30.240  0.200   1.00 33.50 ? 108 ILE A O   1 
ATOM   491   C CB  . ILE A 1 70  ? 39.821  31.849  -1.002  1.00 33.06 ? 108 ILE A CB  1 
ATOM   492   C CG1 . ILE A 1 70  ? 39.174  32.726  -2.103  1.00 32.14 ? 108 ILE A CG1 1 
ATOM   493   C CG2 . ILE A 1 70  ? 39.134  32.144  0.411   1.00 30.23 ? 108 ILE A CG2 1 
ATOM   494   C CD1 . ILE A 1 70  ? 37.943  32.158  -2.665  1.00 33.05 ? 108 ILE A CD1 1 
ATOM   495   N N   . LYS A 1 71  ? 42.286  32.251  1.239   1.00 34.70 ? 109 LYS A N   1 
ATOM   496   C CA  . LYS A 1 71  ? 42.837  31.752  2.494   1.00 36.30 ? 109 LYS A CA  1 
ATOM   497   C C   . LYS A 1 71  ? 41.767  31.640  3.563   1.00 35.82 ? 109 LYS A C   1 
ATOM   498   O O   . LYS A 1 71  ? 41.817  30.728  4.391   1.00 34.91 ? 109 LYS A O   1 
ATOM   499   C CB  . LYS A 1 71  ? 44.000  32.633  2.968   1.00 36.72 ? 109 LYS A CB  1 
ATOM   500   C CG  . LYS A 1 71  ? 44.221  32.652  4.486   1.00 39.22 ? 109 LYS A CG  1 
ATOM   501   C CD  . LYS A 1 71  ? 45.285  33.681  4.880   1.00 40.46 ? 109 LYS A CD  1 
ATOM   502   C CE  . LYS A 1 71  ? 45.345  33.926  6.399   1.00 44.19 ? 109 LYS A CE  1 
ATOM   503   N NZ  . LYS A 1 71  ? 46.111  32.857  7.126   1.00 45.98 ? 109 LYS A NZ  1 
ATOM   504   N N   . ARG A 1 72  ? 40.791  32.548  3.539   1.00 36.01 ? 110 ARG A N   1 
ATOM   505   C CA  . ARG A 1 72  ? 39.705  32.508  4.497   1.00 36.86 ? 110 ARG A CA  1 
ATOM   506   C C   . ARG A 1 72  ? 38.338  32.844  3.874   1.00 37.60 ? 110 ARG A C   1 
ATOM   507   O O   . ARG A 1 72  ? 38.243  33.677  3.007   1.00 37.28 ? 110 ARG A O   1 
ATOM   508   C CB  . ARG A 1 72  ? 39.989  33.432  5.698   1.00 36.63 ? 110 ARG A CB  1 
ATOM   509   C CG  . ARG A 1 72  ? 38.774  33.482  6.681   1.00 37.53 ? 110 ARG A CG  1 
ATOM   510   C CD  . ARG A 1 72  ? 38.983  34.314  7.902   1.00 37.83 ? 110 ARG A CD  1 
ATOM   511   N NE  . ARG A 1 72  ? 39.936  33.644  8.757   1.00 38.95 ? 110 ARG A NE  1 
ATOM   512   C CZ  . ARG A 1 72  ? 39.987  33.709  10.088  1.00 40.33 ? 110 ARG A CZ  1 
ATOM   513   N NH1 . ARG A 1 72  ? 39.120  34.427  10.766  1.00 40.10 ? 110 ARG A NH1 1 
ATOM   514   N NH2 . ARG A 1 72  ? 40.925  33.029  10.754  1.00 40.95 ? 110 ARG A NH2 1 
ATOM   515   N N   . MET A 1 73  ? 37.296  32.181  4.366   1.00 38.56 ? 111 MET A N   1 
ATOM   516   C CA  . MET A 1 73  ? 35.922  32.434  3.977   1.00 40.29 ? 111 MET A CA  1 
ATOM   517   C C   . MET A 1 73  ? 35.051  32.781  5.150   1.00 39.33 ? 111 MET A C   1 
ATOM   518   O O   . MET A 1 73  ? 35.207  32.196  6.222   1.00 38.69 ? 111 MET A O   1 
ATOM   519   C CB  . MET A 1 73  ? 35.340  31.187  3.350   1.00 40.41 ? 111 MET A CB  1 
ATOM   520   C CG  . MET A 1 73  ? 35.904  30.917  2.002   1.00 42.65 ? 111 MET A CG  1 
ATOM   521   S SD  . MET A 1 73  ? 34.929  29.711  1.188   1.00 45.84 ? 111 MET A SD  1 
ATOM   522   C CE  . MET A 1 73  ? 33.451  30.626  0.683   1.00 44.39 ? 111 MET A CE  1 
ATOM   523   N N   . VAL A 1 74  ? 34.141  33.735  4.899   1.00 38.76 ? 112 VAL A N   1 
ATOM   524   C CA  . VAL A 1 74  ? 33.106  34.175  5.814   1.00 38.58 ? 112 VAL A CA  1 
ATOM   525   C C   . VAL A 1 74  ? 31.759  33.945  5.095   1.00 38.88 ? 112 VAL A C   1 
ATOM   526   O O   . VAL A 1 74  ? 31.356  34.692  4.202   1.00 37.07 ? 112 VAL A O   1 
ATOM   527   C CB  . VAL A 1 74  ? 33.283  35.676  6.210   1.00 39.11 ? 112 VAL A CB  1 
ATOM   528   C CG1 . VAL A 1 74  ? 32.273  36.038  7.262   1.00 38.55 ? 112 VAL A CG1 1 
ATOM   529   C CG2 . VAL A 1 74  ? 34.740  36.010  6.710   1.00 36.33 ? 112 VAL A CG2 1 
ATOM   530   N N   . SER A 1 75  ? 31.088  32.860  5.463   1.00 39.07 ? 113 SER A N   1 
ATOM   531   C CA  . SER A 1 75  ? 29.907  32.396  4.732   1.00 38.70 ? 113 SER A CA  1 
ATOM   532   C C   . SER A 1 75  ? 28.891  31.795  5.664   1.00 37.39 ? 113 SER A C   1 
ATOM   533   O O   . SER A 1 75  ? 29.228  31.464  6.806   1.00 35.69 ? 113 SER A O   1 
ATOM   534   C CB  . SER A 1 75  ? 30.320  31.331  3.716   1.00 39.07 ? 113 SER A CB  1 
ATOM   535   O OG  . SER A 1 75  ? 31.561  31.653  3.118   1.00 41.97 ? 113 SER A OG  1 
ATOM   536   N N   . SER A 1 76  ? 27.660  31.621  5.170   1.00 36.61 ? 114 SER A N   1 
ATOM   537   C CA  . SER A 1 76  ? 26.595  30.980  5.985   1.00 36.60 ? 114 SER A CA  1 
ATOM   538   C C   . SER A 1 76  ? 26.375  29.527  5.673   1.00 36.01 ? 114 SER A C   1 
ATOM   539   O O   . SER A 1 76  ? 25.837  28.822  6.515   1.00 37.42 ? 114 SER A O   1 
ATOM   540   C CB  . SER A 1 76  ? 25.265  31.724  5.888   1.00 36.05 ? 114 SER A CB  1 
ATOM   541   O OG  . SER A 1 76  ? 24.655  31.515  4.619   1.00 38.06 ? 114 SER A OG  1 
ATOM   542   N N   . TYR A 1 77  ? 26.756  29.076  4.471   1.00 35.67 ? 115 TYR A N   1 
ATOM   543   C CA  . TYR A 1 77  ? 26.447  27.722  4.021   1.00 35.28 ? 115 TYR A CA  1 
ATOM   544   C C   . TYR A 1 77  ? 27.364  27.324  2.877   1.00 35.22 ? 115 TYR A C   1 
ATOM   545   O O   . TYR A 1 77  ? 27.393  27.969  1.847   1.00 35.20 ? 115 TYR A O   1 
ATOM   546   C CB  . TYR A 1 77  ? 24.961  27.575  3.595   1.00 35.81 ? 115 TYR A CB  1 
ATOM   547   C CG  . TYR A 1 77  ? 24.669  26.193  3.026   1.00 35.97 ? 115 TYR A CG  1 
ATOM   548   C CD1 . TYR A 1 77  ? 24.467  25.116  3.870   1.00 36.21 ? 115 TYR A CD1 1 
ATOM   549   C CD2 . TYR A 1 77  ? 24.677  25.959  1.636   1.00 35.83 ? 115 TYR A CD2 1 
ATOM   550   C CE1 . TYR A 1 77  ? 24.243  23.855  3.362   1.00 38.58 ? 115 TYR A CE1 1 
ATOM   551   C CE2 . TYR A 1 77  ? 24.465  24.714  1.128   1.00 35.39 ? 115 TYR A CE2 1 
ATOM   552   C CZ  . TYR A 1 77  ? 24.246  23.658  1.995   1.00 37.09 ? 115 TYR A CZ  1 
ATOM   553   O OH  . TYR A 1 77  ? 24.028  22.385  1.515   1.00 37.34 ? 115 TYR A OH  1 
ATOM   554   N N   . VAL A 1 78  ? 28.107  26.248  3.068   1.00 35.24 ? 116 VAL A N   1 
ATOM   555   C CA  . VAL A 1 78  ? 29.246  25.937  2.220   1.00 35.37 ? 116 VAL A CA  1 
ATOM   556   C C   . VAL A 1 78  ? 29.186  24.557  1.591   1.00 35.83 ? 116 VAL A C   1 
ATOM   557   O O   . VAL A 1 78  ? 30.204  24.027  1.143   1.00 36.90 ? 116 VAL A O   1 
ATOM   558   C CB  . VAL A 1 78  ? 30.579  26.174  2.983   1.00 35.02 ? 116 VAL A CB  1 
ATOM   559   C CG1 . VAL A 1 78  ? 30.813  27.717  3.156   1.00 34.29 ? 116 VAL A CG1 1 
ATOM   560   C CG2 . VAL A 1 78  ? 30.624  25.415  4.338   1.00 33.22 ? 116 VAL A CG2 1 
ATOM   561   N N   . GLY A 1 79  ? 27.984  24.002  1.492   1.00 35.77 ? 117 GLY A N   1 
ATOM   562   C CA  . GLY A 1 79  ? 27.793  22.685  0.894   1.00 35.74 ? 117 GLY A CA  1 
ATOM   563   C C   . GLY A 1 79  ? 27.794  22.704  -0.622  1.00 35.71 ? 117 GLY A C   1 
ATOM   564   O O   . GLY A 1 79  ? 27.829  23.760  -1.238  1.00 36.97 ? 117 GLY A O   1 
ATOM   565   N N   . GLU A 1 80  ? 27.720  21.526  -1.209  1.00 34.99 ? 118 GLU A N   1 
ATOM   566   C CA  . GLU A 1 80  ? 27.702  21.334  -2.665  1.00 35.26 ? 118 GLU A CA  1 
ATOM   567   C C   . GLU A 1 80  ? 29.008  21.783  -3.382  1.00 34.14 ? 118 GLU A C   1 
ATOM   568   O O   . GLU A 1 80  ? 29.007  22.156  -4.553  1.00 33.86 ? 118 GLU A O   1 
ATOM   569   C CB  . GLU A 1 80  ? 26.405  21.924  -3.285  1.00 35.64 ? 118 GLU A CB  1 
ATOM   570   C CG  . GLU A 1 80  ? 25.088  21.122  -2.966  1.00 36.23 ? 118 GLU A CG  1 
ATOM   571   C CD  . GLU A 1 80  ? 24.615  21.209  -1.496  1.00 38.06 ? 118 GLU A CD  1 
ATOM   572   O OE1 . GLU A 1 80  ? 24.469  22.338  -0.967  1.00 37.97 ? 118 GLU A OE1 1 
ATOM   573   O OE2 . GLU A 1 80  ? 24.363  20.145  -0.862  1.00 39.04 ? 118 GLU A OE2 1 
ATOM   574   N N   . ASN A 1 81  ? 30.128  21.680  -2.679  1.00 32.79 ? 119 ASN A N   1 
ATOM   575   C CA  . ASN A 1 81  ? 31.453  22.005  -3.226  1.00 32.20 ? 119 ASN A CA  1 
ATOM   576   C C   . ASN A 1 81  ? 32.468  21.086  -2.547  1.00 32.50 ? 119 ASN A C   1 
ATOM   577   O O   . ASN A 1 81  ? 32.902  21.339  -1.438  1.00 31.67 ? 119 ASN A O   1 
ATOM   578   C CB  . ASN A 1 81  ? 31.782  23.497  -3.011  1.00 31.53 ? 119 ASN A CB  1 
ATOM   579   C CG  . ASN A 1 81  ? 33.042  23.951  -3.762  1.00 32.09 ? 119 ASN A CG  1 
ATOM   580   O OD1 . ASN A 1 81  ? 33.961  23.165  -4.018  1.00 34.63 ? 119 ASN A OD1 1 
ATOM   581   N ND2 . ASN A 1 81  ? 33.072  25.225  -4.135  1.00 30.03 ? 119 ASN A ND2 1 
ATOM   582   N N   . ALA A 1 82  ? 32.826  19.997  -3.228  1.00 33.98 ? 120 ALA A N   1 
ATOM   583   C CA  . ALA A 1 82  ? 33.717  18.973  -2.685  1.00 34.68 ? 120 ALA A CA  1 
ATOM   584   C C   . ALA A 1 82  ? 35.155  19.464  -2.501  1.00 35.67 ? 120 ALA A C   1 
ATOM   585   O O   . ALA A 1 82  ? 35.891  18.917  -1.677  1.00 36.07 ? 120 ALA A O   1 
ATOM   586   C CB  . ALA A 1 82  ? 33.678  17.684  -3.581  1.00 34.07 ? 120 ALA A CB  1 
ATOM   587   N N   . GLU A 1 83  ? 35.561  20.486  -3.254  1.00 36.78 ? 121 GLU A N   1 
ATOM   588   C CA  . GLU A 1 83  ? 36.929  21.020  -3.144  1.00 37.37 ? 121 GLU A CA  1 
ATOM   589   C C   . GLU A 1 83  ? 37.047  21.917  -1.914  1.00 37.83 ? 121 GLU A C   1 
ATOM   590   O O   . GLU A 1 83  ? 38.083  21.905  -1.225  1.00 38.92 ? 121 GLU A O   1 
ATOM   591   C CB  . GLU A 1 83  ? 37.343  21.773  -4.420  1.00 37.16 ? 121 GLU A CB  1 
ATOM   592   C CG  . GLU A 1 83  ? 38.714  22.503  -4.352  1.00 37.82 ? 121 GLU A CG  1 
ATOM   593   C CD  . GLU A 1 83  ? 39.958  21.603  -4.100  1.00 38.66 ? 121 GLU A CD  1 
ATOM   594   O OE1 . GLU A 1 83  ? 39.880  20.347  -4.175  1.00 40.26 ? 121 GLU A OE1 1 
ATOM   595   O OE2 . GLU A 1 83  ? 41.037  22.189  -3.840  1.00 39.04 ? 121 GLU A OE2 1 
ATOM   596   N N   . PHE A 1 84  ? 36.004  22.703  -1.665  1.00 37.64 ? 122 PHE A N   1 
ATOM   597   C CA  . PHE A 1 84  ? 35.854  23.445  -0.427  1.00 37.85 ? 122 PHE A CA  1 
ATOM   598   C C   . PHE A 1 84  ? 36.011  22.516  0.785   1.00 37.58 ? 122 PHE A C   1 
ATOM   599   O O   . PHE A 1 84  ? 36.734  22.833  1.717   1.00 36.55 ? 122 PHE A O   1 
ATOM   600   C CB  . PHE A 1 84  ? 34.474  24.136  -0.335  1.00 37.56 ? 122 PHE A CB  1 
ATOM   601   C CG  . PHE A 1 84  ? 34.211  24.695  1.028   1.00 38.74 ? 122 PHE A CG  1 
ATOM   602   C CD1 . PHE A 1 84  ? 33.624  23.901  2.023   1.00 38.55 ? 122 PHE A CD1 1 
ATOM   603   C CD2 . PHE A 1 84  ? 34.639  25.985  1.357   1.00 35.53 ? 122 PHE A CD2 1 
ATOM   604   C CE1 . PHE A 1 84  ? 33.464  24.399  3.314   1.00 37.86 ? 122 PHE A CE1 1 
ATOM   605   C CE2 . PHE A 1 84  ? 34.504  26.449  2.616   1.00 36.77 ? 122 PHE A CE2 1 
ATOM   606   C CZ  . PHE A 1 84  ? 33.902  25.667  3.603   1.00 36.34 ? 122 PHE A CZ  1 
ATOM   607   N N   . GLU A 1 85  ? 35.296  21.393  0.758   1.00 37.55 ? 123 GLU A N   1 
ATOM   608   C CA  . GLU A 1 85  ? 35.238  20.483  1.896   1.00 38.50 ? 123 GLU A CA  1 
ATOM   609   C C   . GLU A 1 85  ? 36.576  19.796  2.114   1.00 37.85 ? 123 GLU A C   1 
ATOM   610   O O   . GLU A 1 85  ? 36.989  19.596  3.257   1.00 37.12 ? 123 GLU A O   1 
ATOM   611   C CB  . GLU A 1 85  ? 34.094  19.479  1.727   1.00 38.65 ? 123 GLU A CB  1 
ATOM   612   C CG  . GLU A 1 85  ? 34.284  18.145  2.491   1.00 41.14 ? 123 GLU A CG  1 
ATOM   613   C CD  . GLU A 1 85  ? 33.242  17.095  2.115   1.00 41.25 ? 123 GLU A CD  1 
ATOM   614   O OE1 . GLU A 1 85  ? 32.055  17.465  2.061   1.00 46.97 ? 123 GLU A OE1 1 
ATOM   615   O OE2 . GLU A 1 85  ? 33.607  15.913  1.875   1.00 48.56 ? 123 GLU A OE2 1 
ATOM   616   N N   . ARG A 1 86  ? 37.252  19.434  1.020   1.00 37.86 ? 124 ARG A N   1 
ATOM   617   C CA  . ARG A 1 86  ? 38.631  18.944  1.094   1.00 37.79 ? 124 ARG A CA  1 
ATOM   618   C C   . ARG A 1 86  ? 39.586  20.000  1.678   1.00 37.00 ? 124 ARG A C   1 
ATOM   619   O O   . ARG A 1 86  ? 40.405  19.679  2.525   1.00 36.11 ? 124 ARG A O   1 
ATOM   620   C CB  . ARG A 1 86  ? 39.130  18.525  -0.287  1.00 38.34 ? 124 ARG A CB  1 
ATOM   621   C CG  . ARG A 1 86  ? 40.461  17.793  -0.257  1.00 41.30 ? 124 ARG A CG  1 
ATOM   622   C CD  . ARG A 1 86  ? 41.147  17.818  -1.613  1.00 44.65 ? 124 ARG A CD  1 
ATOM   623   N NE  . ARG A 1 86  ? 41.751  19.116  -1.946  1.00 46.18 ? 124 ARG A NE  1 
ATOM   624   C CZ  . ARG A 1 86  ? 42.852  19.609  -1.373  1.00 47.41 ? 124 ARG A CZ  1 
ATOM   625   N NH1 . ARG A 1 86  ? 43.326  20.795  -1.757  1.00 47.57 ? 124 ARG A NH1 1 
ATOM   626   N NH2 . ARG A 1 86  ? 43.480  18.935  -0.413  1.00 46.93 ? 124 ARG A NH2 1 
ATOM   627   N N   . GLN A 1 87  ? 39.494  21.255  1.229   1.00 36.14 ? 125 GLN A N   1 
ATOM   628   C CA  . GLN A 1 87  ? 40.405  22.275  1.741   1.00 35.97 ? 125 GLN A CA  1 
ATOM   629   C C   . GLN A 1 87  ? 40.148  22.589  3.240   1.00 36.77 ? 125 GLN A C   1 
ATOM   630   O O   . GLN A 1 87  ? 41.093  22.717  4.025   1.00 37.99 ? 125 GLN A O   1 
ATOM   631   C CB  . GLN A 1 87  ? 40.331  23.557  0.906   1.00 35.70 ? 125 GLN A CB  1 
ATOM   632   C CG  . GLN A 1 87  ? 40.927  23.445  -0.456  1.00 34.53 ? 125 GLN A CG  1 
ATOM   633   C CD  . GLN A 1 87  ? 41.021  24.758  -1.192  1.00 33.15 ? 125 GLN A CD  1 
ATOM   634   O OE1 . GLN A 1 87  ? 41.120  25.812  -0.589  1.00 33.27 ? 125 GLN A OE1 1 
ATOM   635   N NE2 . GLN A 1 87  ? 41.003  24.697  -2.518  1.00 33.36 ? 125 GLN A NE2 1 
ATOM   636   N N   . TYR A 1 88  ? 38.881  22.693  3.617   1.00 36.90 ? 126 TYR A N   1 
ATOM   637   C CA  . TYR A 1 88  ? 38.440  22.990  4.998   1.00 37.26 ? 126 TYR A CA  1 
ATOM   638   C C   . TYR A 1 88  ? 38.820  21.923  5.990   1.00 38.33 ? 126 TYR A C   1 
ATOM   639   O O   . TYR A 1 88  ? 39.411  22.221  7.035   1.00 37.64 ? 126 TYR A O   1 
ATOM   640   C CB  . TYR A 1 88  ? 36.922  23.089  5.013   1.00 37.22 ? 126 TYR A CB  1 
ATOM   641   C CG  . TYR A 1 88  ? 36.246  23.525  6.301   1.00 36.06 ? 126 TYR A CG  1 
ATOM   642   C CD1 . TYR A 1 88  ? 36.874  24.382  7.218   1.00 36.82 ? 126 TYR A CD1 1 
ATOM   643   C CD2 . TYR A 1 88  ? 34.941  23.119  6.565   1.00 36.68 ? 126 TYR A CD2 1 
ATOM   644   C CE1 . TYR A 1 88  ? 36.218  24.794  8.391   1.00 36.30 ? 126 TYR A CE1 1 
ATOM   645   C CE2 . TYR A 1 88  ? 34.261  23.525  7.715   1.00 37.67 ? 126 TYR A CE2 1 
ATOM   646   C CZ  . TYR A 1 88  ? 34.896  24.380  8.637   1.00 37.63 ? 126 TYR A CZ  1 
ATOM   647   O OH  . TYR A 1 88  ? 34.203  24.826  9.771   1.00 35.68 ? 126 TYR A OH  1 
ATOM   648   N N   . LEU A 1 89  ? 38.467  20.673  5.647   1.00 39.31 ? 127 LEU A N   1 
ATOM   649   C CA  . LEU A 1 89  ? 38.687  19.519  6.537   1.00 39.61 ? 127 LEU A CA  1 
ATOM   650   C C   . LEU A 1 89  ? 40.156  19.124  6.648   1.00 39.71 ? 127 LEU A C   1 
ATOM   651   O O   . LEU A 1 89  ? 40.566  18.566  7.659   1.00 40.15 ? 127 LEU A O   1 
ATOM   652   C CB  . LEU A 1 89  ? 37.869  18.304  6.092   1.00 39.67 ? 127 LEU A CB  1 
ATOM   653   C CG  . LEU A 1 89  ? 36.342  18.397  6.093   1.00 39.63 ? 127 LEU A CG  1 
ATOM   654   C CD1 . LEU A 1 89  ? 35.735  17.030  5.697   1.00 39.93 ? 127 LEU A CD1 1 
ATOM   655   C CD2 . LEU A 1 89  ? 35.812  18.837  7.451   1.00 41.13 ? 127 LEU A CD2 1 
ATOM   656   N N   . SER A 1 90  ? 40.948  19.436  5.629   1.00 40.05 ? 128 SER A N   1 
ATOM   657   C CA  . SER A 1 90  ? 42.395  19.117  5.614   1.00 39.66 ? 128 SER A CA  1 
ATOM   658   C C   . SER A 1 90  ? 43.264  20.157  6.335   1.00 39.22 ? 128 SER A C   1 
ATOM   659   O O   . SER A 1 90  ? 44.467  19.936  6.613   1.00 38.99 ? 128 SER A O   1 
ATOM   660   C CB  . SER A 1 90  ? 42.879  18.963  4.161   1.00 39.99 ? 128 SER A CB  1 
ATOM   661   O OG  . SER A 1 90  ? 42.848  20.204  3.466   1.00 40.45 ? 128 SER A OG  1 
ATOM   662   N N   . GLY A 1 91  ? 42.653  21.296  6.614   1.00 38.85 ? 129 GLY A N   1 
ATOM   663   C CA  . GLY A 1 91  ? 43.317  22.378  7.281   1.00 39.01 ? 129 GLY A CA  1 
ATOM   664   C C   . GLY A 1 91  ? 43.913  23.399  6.339   1.00 39.05 ? 129 GLY A C   1 
ATOM   665   O O   . GLY A 1 91  ? 44.730  24.196  6.771   1.00 39.86 ? 129 GLY A O   1 
ATOM   666   N N   . GLU A 1 92  ? 43.510  23.402  5.070   1.00 38.95 ? 130 GLU A N   1 
ATOM   667   C CA  . GLU A 1 92  ? 44.024  24.387  4.087   1.00 39.40 ? 130 GLU A CA  1 
ATOM   668   C C   . GLU A 1 92  ? 43.256  25.709  4.024   1.00 38.86 ? 130 GLU A C   1 
ATOM   669   O O   . GLU A 1 92  ? 43.793  26.711  3.583   1.00 40.62 ? 130 GLU A O   1 
ATOM   670   C CB  . GLU A 1 92  ? 43.981  23.787  2.677   1.00 39.19 ? 130 GLU A CB  1 
ATOM   671   C CG  . GLU A 1 92  ? 44.948  22.643  2.453   1.00 40.47 ? 130 GLU A CG  1 
ATOM   672   C CD  . GLU A 1 92  ? 44.755  21.985  1.090   1.00 40.87 ? 130 GLU A CD  1 
ATOM   673   O OE1 . GLU A 1 92  ? 44.364  22.672  0.110   1.00 41.33 ? 130 GLU A OE1 1 
ATOM   674   O OE2 . GLU A 1 92  ? 44.993  20.765  1.014   1.00 42.74 ? 130 GLU A OE2 1 
ATOM   675   N N   . LEU A 1 93  ? 41.990  25.681  4.402   1.00 37.41 ? 131 LEU A N   1 
ATOM   676   C CA  . LEU A 1 93  ? 41.091  26.836  4.322   1.00 37.04 ? 131 LEU A CA  1 
ATOM   677   C C   . LEU A 1 93  ? 40.585  27.169  5.718   1.00 36.35 ? 131 LEU A C   1 
ATOM   678   O O   . LEU A 1 93  ? 40.247  26.270  6.475   1.00 36.26 ? 131 LEU A O   1 
ATOM   679   C CB  . LEU A 1 93  ? 39.914  26.496  3.392   1.00 36.32 ? 131 LEU A CB  1 
ATOM   680   C CG  . LEU A 1 93  ? 38.861  27.500  2.958   1.00 37.75 ? 131 LEU A CG  1 
ATOM   681   C CD1 . LEU A 1 93  ? 39.515  28.697  2.335   1.00 37.17 ? 131 LEU A CD1 1 
ATOM   682   C CD2 . LEU A 1 93  ? 37.877  26.772  1.989   1.00 35.19 ? 131 LEU A CD2 1 
ATOM   683   N N   . GLU A 1 94  ? 40.564  28.454  6.062   1.00 36.35 ? 132 GLU A N   1 
ATOM   684   C CA  . GLU A 1 94  ? 39.877  28.914  7.264   1.00 36.43 ? 132 GLU A CA  1 
ATOM   685   C C   . GLU A 1 94  ? 38.443  29.325  6.886   1.00 36.14 ? 132 GLU A C   1 
ATOM   686   O O   . GLU A 1 94  ? 38.242  29.992  5.874   1.00 35.27 ? 132 GLU A O   1 
ATOM   687   C CB  . GLU A 1 94  ? 40.603  30.074  7.888   1.00 36.20 ? 132 GLU A CB  1 
ATOM   688   C CG  . GLU A 1 94  ? 42.012  29.746  8.331   1.00 38.29 ? 132 GLU A CG  1 
ATOM   689   C CD  . GLU A 1 94  ? 42.820  31.003  8.602   1.00 41.47 ? 132 GLU A CD  1 
ATOM   690   O OE1 . GLU A 1 94  ? 42.260  32.124  8.566   1.00 42.91 ? 132 GLU A OE1 1 
ATOM   691   O OE2 . GLU A 1 94  ? 44.019  30.895  8.854   1.00 42.59 ? 132 GLU A OE2 1 
ATOM   692   N N   . VAL A 1 95  ? 37.460  28.903  7.692   1.00 35.86 ? 133 VAL A N   1 
ATOM   693   C CA  . VAL A 1 95  ? 36.060  29.143  7.400   1.00 35.69 ? 133 VAL A CA  1 
ATOM   694   C C   . VAL A 1 95  ? 35.350  29.665  8.648   1.00 36.10 ? 133 VAL A C   1 
ATOM   695   O O   . VAL A 1 95  ? 35.299  28.975  9.658   1.00 36.54 ? 133 VAL A O   1 
ATOM   696   C CB  . VAL A 1 95  ? 35.363  27.888  6.831   1.00 36.16 ? 133 VAL A CB  1 
ATOM   697   C CG1 . VAL A 1 95  ? 33.887  28.164  6.535   1.00 35.52 ? 133 VAL A CG1 1 
ATOM   698   C CG2 . VAL A 1 95  ? 36.098  27.374  5.528   1.00 34.77 ? 133 VAL A CG2 1 
ATOM   699   N N   . GLU A 1 96  ? 34.871  30.912  8.578   1.00 36.22 ? 134 GLU A N   1 
ATOM   700   C CA  . GLU A 1 96  ? 33.966  31.484  9.574   1.00 37.23 ? 134 GLU A CA  1 
ATOM   701   C C   . GLU A 1 96  ? 32.508  31.287  9.192   1.00 36.34 ? 134 GLU A C   1 
ATOM   702   O O   . GLU A 1 96  ? 31.962  32.020  8.379   1.00 36.59 ? 134 GLU A O   1 
ATOM   703   C CB  . GLU A 1 96  ? 34.215  32.970  9.724   1.00 37.12 ? 134 GLU A CB  1 
ATOM   704   C CG  . GLU A 1 96  ? 35.603  33.323  10.204  1.00 39.51 ? 134 GLU A CG  1 
ATOM   705   C CD  . GLU A 1 96  ? 35.766  34.839  10.466  1.00 40.12 ? 134 GLU A CD  1 
ATOM   706   O OE1 . GLU A 1 96  ? 36.922  35.318  10.399  1.00 40.97 ? 134 GLU A OE1 1 
ATOM   707   O OE2 . GLU A 1 96  ? 34.736  35.539  10.680  1.00 43.50 ? 134 GLU A OE2 1 
ATOM   708   N N   . LEU A 1 97  ? 31.875  30.292  9.793   1.00 35.68 ? 135 LEU A N   1 
ATOM   709   C CA  . LEU A 1 97  ? 30.486  30.016  9.525   1.00 35.01 ? 135 LEU A CA  1 
ATOM   710   C C   . LEU A 1 97  ? 29.670  31.035  10.294  1.00 34.98 ? 135 LEU A C   1 
ATOM   711   O O   . LEU A 1 97  ? 29.734  31.071  11.491  1.00 35.56 ? 135 LEU A O   1 
ATOM   712   C CB  . LEU A 1 97  ? 30.147  28.606  9.944   1.00 34.28 ? 135 LEU A CB  1 
ATOM   713   C CG  . LEU A 1 97  ? 30.868  27.440  9.267   1.00 36.79 ? 135 LEU A CG  1 
ATOM   714   C CD1 . LEU A 1 97  ? 30.462  26.119  9.974   1.00 36.66 ? 135 LEU A CD1 1 
ATOM   715   C CD2 . LEU A 1 97  ? 30.562  27.386  7.753   1.00 36.13 ? 135 LEU A CD2 1 
ATOM   716   N N   . THR A 1 98  ? 28.904  31.853  9.580   1.00 34.86 ? 136 THR A N   1 
ATOM   717   C CA  . THR A 1 98  ? 28.223  33.019  10.117  1.00 34.92 ? 136 THR A CA  1 
ATOM   718   C C   . THR A 1 98  ? 26.745  32.948  9.770   1.00 34.47 ? 136 THR A C   1 
ATOM   719   O O   . THR A 1 98  ? 26.406  32.794  8.593   1.00 34.84 ? 136 THR A O   1 
ATOM   720   C CB  . THR A 1 98  ? 28.795  34.282  9.468   1.00 35.68 ? 136 THR A CB  1 
ATOM   721   O OG1 . THR A 1 98  ? 30.231  34.267  9.596   1.00 38.41 ? 136 THR A OG1 1 
ATOM   722   C CG2 . THR A 1 98  ? 28.207  35.575  10.113  1.00 34.84 ? 136 THR A CG2 1 
ATOM   723   N N   . PRO A 1 99  ? 25.854  33.108  10.762  1.00 33.95 ? 137 PRO A N   1 
ATOM   724   C CA  . PRO A 1 99  ? 24.426  33.039  10.381  1.00 32.96 ? 137 PRO A CA  1 
ATOM   725   C C   . PRO A 1 99  ? 24.097  34.028  9.269   1.00 33.70 ? 137 PRO A C   1 
ATOM   726   O O   . PRO A 1 99  ? 24.601  35.156  9.282   1.00 31.88 ? 137 PRO A O   1 
ATOM   727   C CB  . PRO A 1 99  ? 23.723  33.399  11.666  1.00 33.45 ? 137 PRO A CB  1 
ATOM   728   C CG  . PRO A 1 99  ? 24.716  32.977  12.766  1.00 31.85 ? 137 PRO A CG  1 
ATOM   729   C CD  . PRO A 1 99  ? 26.016  33.417  12.210  1.00 33.38 ? 137 PRO A CD  1 
ATOM   730   N N   . GLN A 1 100 ? 23.290  33.575  8.300   1.00 33.37 ? 138 GLN A N   1 
ATOM   731   C CA  . GLN A 1 100 ? 23.051  34.305  7.029   1.00 33.61 ? 138 GLN A CA  1 
ATOM   732   C C   . GLN A 1 100 ? 22.547  35.751  7.265   1.00 33.97 ? 138 GLN A C   1 
ATOM   733   O O   . GLN A 1 100 ? 23.031  36.704  6.651   1.00 33.83 ? 138 GLN A O   1 
ATOM   734   C CB  . GLN A 1 100 ? 22.071  33.531  6.147   1.00 32.41 ? 138 GLN A CB  1 
ATOM   735   C CG  . GLN A 1 100 ? 21.949  34.058  4.757   1.00 34.20 ? 138 GLN A CG  1 
ATOM   736   C CD  . GLN A 1 100 ? 21.135  33.174  3.825   1.00 35.47 ? 138 GLN A CD  1 
ATOM   737   O OE1 . GLN A 1 100 ? 20.279  33.672  3.095   1.00 38.27 ? 138 GLN A OE1 1 
ATOM   738   N NE2 . GLN A 1 100 ? 21.411  31.867  3.820   1.00 34.08 ? 138 GLN A NE2 1 
ATOM   739   N N   . GLY A 1 101 ? 21.604  35.889  8.180   1.00 34.19 ? 139 GLY A N   1 
ATOM   740   C CA  . GLY A 1 101 ? 21.039  37.189  8.507   1.00 34.47 ? 139 GLY A CA  1 
ATOM   741   C C   . GLY A 1 101 ? 21.975  38.081  9.267   1.00 33.84 ? 139 GLY A C   1 
ATOM   742   O O   . GLY A 1 101 ? 21.871  39.298  9.184   1.00 35.16 ? 139 GLY A O   1 
ATOM   743   N N   . THR A 1 102 ? 22.887  37.470  10.007  1.00 33.23 ? 140 THR A N   1 
ATOM   744   C CA  . THR A 1 102 ? 23.911  38.197  10.681  1.00 33.25 ? 140 THR A CA  1 
ATOM   745   C C   . THR A 1 102 ? 24.947  38.652  9.634   1.00 33.10 ? 140 THR A C   1 
ATOM   746   O O   . THR A 1 102 ? 25.335  39.781  9.660   1.00 33.97 ? 140 THR A O   1 
ATOM   747   C CB  . THR A 1 102 ? 24.536  37.338  11.806  1.00 33.52 ? 140 THR A CB  1 
ATOM   748   O OG1 . THR A 1 102 ? 23.562  37.178  12.813  1.00 32.07 ? 140 THR A OG1 1 
ATOM   749   C CG2 . THR A 1 102 ? 25.765  38.007  12.406  1.00 30.70 ? 140 THR A CG2 1 
ATOM   750   N N   . LEU A 1 103 ? 25.380  37.776  8.739   1.00 32.29 ? 141 LEU A N   1 
ATOM   751   C CA  . LEU A 1 103 ? 26.222  38.168  7.624   1.00 33.62 ? 141 LEU A CA  1 
ATOM   752   C C   . LEU A 1 103 ? 25.603  39.358  6.837   1.00 34.71 ? 141 LEU A C   1 
ATOM   753   O O   . LEU A 1 103 ? 26.255  40.381  6.633   1.00 36.39 ? 141 LEU A O   1 
ATOM   754   C CB  . LEU A 1 103 ? 26.477  36.939  6.718   1.00 33.36 ? 141 LEU A CB  1 
ATOM   755   C CG  . LEU A 1 103 ? 27.523  36.989  5.582   1.00 35.04 ? 141 LEU A CG  1 
ATOM   756   C CD1 . LEU A 1 103 ? 28.971  37.148  6.083   1.00 32.59 ? 141 LEU A CD1 1 
ATOM   757   C CD2 . LEU A 1 103 ? 27.411  35.725  4.784   1.00 34.99 ? 141 LEU A CD2 1 
ATOM   758   N N   . ALA A 1 104 ? 24.338  39.244  6.443   1.00 35.67 ? 142 ALA A N   1 
ATOM   759   C CA  . ALA A 1 104 ? 23.593  40.336  5.771   1.00 35.74 ? 142 ALA A CA  1 
ATOM   760   C C   . ALA A 1 104 ? 23.638  41.667  6.502   1.00 35.16 ? 142 ALA A C   1 
ATOM   761   O O   . ALA A 1 104 ? 23.999  42.668  5.905   1.00 33.99 ? 142 ALA A O   1 
ATOM   762   C CB  . ALA A 1 104 ? 22.143  39.918  5.506   1.00 35.89 ? 142 ALA A CB  1 
ATOM   763   N N   . GLU A 1 105 ? 23.314  41.656  7.801   1.00 35.02 ? 143 GLU A N   1 
ATOM   764   C CA  . GLU A 1 105 ? 23.235  42.853  8.614   1.00 34.91 ? 143 GLU A CA  1 
ATOM   765   C C   . GLU A 1 105 ? 24.596  43.468  8.985   1.00 34.46 ? 143 GLU A C   1 
ATOM   766   O O   . GLU A 1 105 ? 24.704  44.702  9.060   1.00 35.84 ? 143 GLU A O   1 
ATOM   767   C CB  . GLU A 1 105 ? 22.417  42.587  9.880   1.00 36.65 ? 143 GLU A CB  1 
ATOM   768   C CG  . GLU A 1 105 ? 22.057  43.831  10.666  1.00 38.85 ? 143 GLU A CG  1 
ATOM   769   C CD  . GLU A 1 105 ? 21.283  44.880  9.799   1.00 46.42 ? 143 GLU A CD  1 
ATOM   770   O OE1 . GLU A 1 105 ? 21.498  46.107  9.989   1.00 49.22 ? 143 GLU A OE1 1 
ATOM   771   O OE2 . GLU A 1 105 ? 20.463  44.479  8.924   1.00 49.01 ? 143 GLU A OE2 1 
ATOM   772   N N   . ARG A 1 106 ? 25.623  42.648  9.214   1.00 33.83 ? 144 ARG A N   1 
ATOM   773   C CA  . ARG A 1 106 ? 26.991  43.146  9.399   1.00 33.40 ? 144 ARG A CA  1 
ATOM   774   C C   . ARG A 1 106 ? 27.531  43.873  8.170   1.00 33.83 ? 144 ARG A C   1 
ATOM   775   O O   . ARG A 1 106 ? 28.257  44.893  8.293   1.00 33.73 ? 144 ARG A O   1 
ATOM   776   C CB  . ARG A 1 106 ? 27.934  42.000  9.779   1.00 33.74 ? 144 ARG A CB  1 
ATOM   777   C CG  . ARG A 1 106 ? 27.637  41.394  11.130  1.00 33.65 ? 144 ARG A CG  1 
ATOM   778   C CD  . ARG A 1 106 ? 28.441  40.144  11.419  1.00 33.74 ? 144 ARG A CD  1 
ATOM   779   N NE  . ARG A 1 106 ? 29.876  40.371  11.416  1.00 32.90 ? 144 ARG A NE  1 
ATOM   780   C CZ  . ARG A 1 106 ? 30.819  39.422  11.427  1.00 35.52 ? 144 ARG A CZ  1 
ATOM   781   N NH1 . ARG A 1 106 ? 30.509  38.123  11.409  1.00 36.96 ? 144 ARG A NH1 1 
ATOM   782   N NH2 . ARG A 1 106 ? 32.089  39.777  11.372  1.00 32.66 ? 144 ARG A NH2 1 
ATOM   783   N N   . ILE A 1 107 ? 27.216  43.324  6.997   1.00 33.40 ? 145 ILE A N   1 
ATOM   784   C CA  . ILE A 1 107 ? 27.634  43.918  5.748   1.00 33.84 ? 145 ILE A CA  1 
ATOM   785   C C   . ILE A 1 107 ? 26.923  45.244  5.597   1.00 32.87 ? 145 ILE A C   1 
ATOM   786   O O   . ILE A 1 107 ? 27.541  46.228  5.343   1.00 32.17 ? 145 ILE A O   1 
ATOM   787   C CB  . ILE A 1 107 ? 27.359  43.001  4.511   1.00 33.71 ? 145 ILE A CB  1 
ATOM   788   C CG1 . ILE A 1 107 ? 28.395  41.863  4.512   1.00 34.52 ? 145 ILE A CG1 1 
ATOM   789   C CG2 . ILE A 1 107 ? 27.397  43.825  3.136   1.00 33.61 ? 145 ILE A CG2 1 
ATOM   790   C CD1 . ILE A 1 107 ? 27.944  40.635  3.739   1.00 34.67 ? 145 ILE A CD1 1 
ATOM   791   N N   . ARG A 1 108 ? 25.619  45.250  5.776   1.00 33.72 ? 146 ARG A N   1 
ATOM   792   C CA  . ARG A 1 108 ? 24.847  46.489  5.749   1.00 34.46 ? 146 ARG A CA  1 
ATOM   793   C C   . ARG A 1 108 ? 25.317  47.553  6.782   1.00 33.78 ? 146 ARG A C   1 
ATOM   794   O O   . ARG A 1 108 ? 25.560  48.718  6.422   1.00 34.43 ? 146 ARG A O   1 
ATOM   795   C CB  . ARG A 1 108 ? 23.392  46.153  5.877   1.00 35.95 ? 146 ARG A CB  1 
ATOM   796   C CG  . ARG A 1 108 ? 22.525  47.348  5.581   1.00 41.34 ? 146 ARG A CG  1 
ATOM   797   C CD  . ARG A 1 108 ? 21.385  47.465  6.457   1.00 44.55 ? 146 ARG A CD  1 
ATOM   798   N NE  . ARG A 1 108 ? 20.740  48.798  6.411   1.00 46.43 ? 146 ARG A NE  1 
ATOM   799   C CZ  . ARG A 1 108 ? 20.783  49.690  7.406   1.00 48.62 ? 146 ARG A CZ  1 
ATOM   800   N NH1 . ARG A 1 108 ? 21.486  49.430  8.517   1.00 51.10 ? 146 ARG A NH1 1 
ATOM   801   N NH2 . ARG A 1 108 ? 20.132  50.847  7.305   1.00 46.96 ? 146 ARG A NH2 1 
ATOM   802   N N   . ALA A 1 109 ? 25.537  47.134  8.021   1.00 34.40 ? 147 ALA A N   1 
ATOM   803   C CA  . ALA A 1 109 ? 26.207  47.941  9.070   1.00 34.76 ? 147 ALA A CA  1 
ATOM   804   C C   . ALA A 1 109 ? 27.496  48.518  8.543   1.00 35.64 ? 147 ALA A C   1 
ATOM   805   O O   . ALA A 1 109 ? 27.731  49.727  8.629   1.00 36.44 ? 147 ALA A O   1 
ATOM   806   C CB  . ALA A 1 109 ? 26.470  47.088  10.387  1.00 33.75 ? 147 ALA A CB  1 
ATOM   807   N N   . GLY A 1 110 ? 28.308  47.671  7.929   1.00 36.38 ? 148 GLY A N   1 
ATOM   808   C CA  . GLY A 1 110 ? 29.551  48.119  7.287   1.00 36.18 ? 148 GLY A CA  1 
ATOM   809   C C   . GLY A 1 110 ? 29.348  49.237  6.286   1.00 36.11 ? 148 GLY A C   1 
ATOM   810   O O   . GLY A 1 110 ? 30.025  50.236  6.328   1.00 37.53 ? 148 GLY A O   1 
ATOM   811   N N   . GLY A 1 111 ? 28.370  49.107  5.416   1.00 35.54 ? 149 GLY A N   1 
ATOM   812   C CA  . GLY A 1 111 ? 28.016  50.209  4.513   1.00 35.03 ? 149 GLY A CA  1 
ATOM   813   C C   . GLY A 1 111 ? 27.357  51.410  5.186   1.00 34.72 ? 149 GLY A C   1 
ATOM   814   O O   . GLY A 1 111 ? 27.404  52.523  4.645   1.00 35.10 ? 149 GLY A O   1 
ATOM   815   N N   . ALA A 1 112 ? 26.767  51.212  6.365   1.00 34.13 ? 150 ALA A N   1 
ATOM   816   C CA  . ALA A 1 112 ? 25.897  52.248  6.955   1.00 33.16 ? 150 ALA A CA  1 
ATOM   817   C C   . ALA A 1 112 ? 26.610  53.074  8.012   1.00 32.68 ? 150 ALA A C   1 
ATOM   818   O O   . ALA A 1 112 ? 26.042  53.964  8.589   1.00 33.45 ? 150 ALA A O   1 
ATOM   819   C CB  . ALA A 1 112 ? 24.656  51.634  7.501   1.00 33.09 ? 150 ALA A CB  1 
ATOM   820   N N   . GLY A 1 113 ? 27.880  52.797  8.233   1.00 32.81 ? 151 GLY A N   1 
ATOM   821   C CA  . GLY A 1 113 ? 28.684  53.527  9.219   1.00 32.52 ? 151 GLY A CA  1 
ATOM   822   C C   . GLY A 1 113 ? 28.391  53.149  10.664  1.00 32.50 ? 151 GLY A C   1 
ATOM   823   O O   . GLY A 1 113 ? 28.752  53.914  11.548  1.00 32.07 ? 151 GLY A O   1 
ATOM   824   N N   . VAL A 1 114 ? 27.761  51.974  10.869  1.00 33.05 ? 152 VAL A N   1 
ATOM   825   C CA  . VAL A 1 114 ? 27.441  51.397  12.158  1.00 32.94 ? 152 VAL A CA  1 
ATOM   826   C C   . VAL A 1 114 ? 28.483  50.278  12.477  1.00 33.88 ? 152 VAL A C   1 
ATOM   827   O O   . VAL A 1 114 ? 28.566  49.279  11.763  1.00 35.35 ? 152 VAL A O   1 
ATOM   828   C CB  . VAL A 1 114 ? 25.935  50.871  12.180  1.00 33.67 ? 152 VAL A CB  1 
ATOM   829   C CG1 . VAL A 1 114 ? 25.624  50.011  13.478  1.00 31.40 ? 152 VAL A CG1 1 
ATOM   830   C CG2 . VAL A 1 114 ? 24.930  52.030  12.037  1.00 30.64 ? 152 VAL A CG2 1 
ATOM   831   N N   . PRO A 1 115 ? 29.341  50.493  13.486  1.00 33.73 ? 153 PRO A N   1 
ATOM   832   C CA  . PRO A 1 115 ? 30.454  49.573  13.716  1.00 33.50 ? 153 PRO A CA  1 
ATOM   833   C C   . PRO A 1 115 ? 30.085  48.258  14.377  1.00 33.68 ? 153 PRO A C   1 
ATOM   834   O O   . PRO A 1 115 ? 30.842  47.312  14.293  1.00 33.37 ? 153 PRO A O   1 
ATOM   835   C CB  . PRO A 1 115 ? 31.372  50.362  14.648  1.00 33.28 ? 153 PRO A CB  1 
ATOM   836   C CG  . PRO A 1 115 ? 30.385  51.237  15.443  1.00 33.62 ? 153 PRO A CG  1 
ATOM   837   C CD  . PRO A 1 115 ? 29.357  51.636  14.443  1.00 34.27 ? 153 PRO A CD  1 
ATOM   838   N N   . ALA A 1 116 ? 28.968  48.240  15.077  1.00 33.15 ? 154 ALA A N   1 
ATOM   839   C CA  . ALA A 1 116 ? 28.525  47.076  15.808  1.00 32.16 ? 154 ALA A CA  1 
ATOM   840   C C   . ALA A 1 116 ? 27.022  47.247  16.160  1.00 31.31 ? 154 ALA A C   1 
ATOM   841   O O   . ALA A 1 116 ? 26.566  48.369  16.287  1.00 29.65 ? 154 ALA A O   1 
ATOM   842   C CB  . ALA A 1 116 ? 29.379  46.886  17.066  1.00 30.44 ? 154 ALA A CB  1 
ATOM   843   N N   . PHE A 1 117 ? 26.299  46.123  16.268  1.00 31.08 ? 155 PHE A N   1 
ATOM   844   C CA  . PHE A 1 117 ? 24.881  46.084  16.624  1.00 33.35 ? 155 PHE A CA  1 
ATOM   845   C C   . PHE A 1 117 ? 24.556  44.800  17.387  1.00 33.25 ? 155 PHE A C   1 
ATOM   846   O O   . PHE A 1 117 ? 25.282  43.860  17.301  1.00 33.64 ? 155 PHE A O   1 
ATOM   847   C CB  . PHE A 1 117 ? 23.983  46.150  15.373  1.00 33.34 ? 155 PHE A CB  1 
ATOM   848   C CG  . PHE A 1 117 ? 24.181  45.005  14.443  1.00 34.56 ? 155 PHE A CG  1 
ATOM   849   C CD1 . PHE A 1 117 ? 23.442  43.837  14.588  1.00 34.76 ? 155 PHE A CD1 1 
ATOM   850   C CD2 . PHE A 1 117 ? 25.136  45.063  13.447  1.00 36.00 ? 155 PHE A CD2 1 
ATOM   851   C CE1 . PHE A 1 117 ? 23.633  42.755  13.780  1.00 34.79 ? 155 PHE A CE1 1 
ATOM   852   C CE2 . PHE A 1 117 ? 25.314  43.970  12.591  1.00 33.63 ? 155 PHE A CE2 1 
ATOM   853   C CZ  . PHE A 1 117 ? 24.573  42.812  12.776  1.00 36.10 ? 155 PHE A CZ  1 
ATOM   854   N N   . TYR A 1 118 ? 23.434  44.763  18.093  1.00 33.75 ? 156 TYR A N   1 
ATOM   855   C CA  . TYR A 1 118 ? 23.008  43.533  18.742  1.00 33.30 ? 156 TYR A CA  1 
ATOM   856   C C   . TYR A 1 118 ? 21.948  42.745  17.970  1.00 33.56 ? 156 TYR A C   1 
ATOM   857   O O   . TYR A 1 118 ? 21.009  43.305  17.424  1.00 32.55 ? 156 TYR A O   1 
ATOM   858   C CB  . TYR A 1 118 ? 22.514  43.842  20.121  1.00 32.80 ? 156 TYR A CB  1 
ATOM   859   C CG  . TYR A 1 118 ? 23.609  44.301  21.067  1.00 33.40 ? 156 TYR A CG  1 
ATOM   860   C CD1 . TYR A 1 118 ? 24.262  43.407  21.913  1.00 33.14 ? 156 TYR A CD1 1 
ATOM   861   C CD2 . TYR A 1 118 ? 23.955  45.646  21.148  1.00 33.77 ? 156 TYR A CD2 1 
ATOM   862   C CE1 . TYR A 1 118 ? 25.242  43.855  22.817  1.00 33.31 ? 156 TYR A CE1 1 
ATOM   863   C CE2 . TYR A 1 118 ? 24.930  46.095  21.987  1.00 34.59 ? 156 TYR A CE2 1 
ATOM   864   C CZ  . TYR A 1 118 ? 25.575  45.209  22.834  1.00 34.24 ? 156 TYR A CZ  1 
ATOM   865   O OH  . TYR A 1 118 ? 26.532  45.702  23.682  1.00 34.58 ? 156 TYR A OH  1 
ATOM   866   N N   . THR A 1 119 ? 22.100  41.425  17.966  1.00 32.92 ? 157 THR A N   1 
ATOM   867   C CA  . THR A 1 119 ? 21.141  40.541  17.324  1.00 33.51 ? 157 THR A CA  1 
ATOM   868   C C   . THR A 1 119 ? 20.842  39.363  18.232  1.00 33.29 ? 157 THR A C   1 
ATOM   869   O O   . THR A 1 119 ? 21.705  38.948  18.977  1.00 32.68 ? 157 THR A O   1 
ATOM   870   C CB  . THR A 1 119 ? 21.662  40.000  15.953  1.00 33.47 ? 157 THR A CB  1 
ATOM   871   O OG1 . THR A 1 119 ? 20.749  39.026  15.462  1.00 33.02 ? 157 THR A OG1 1 
ATOM   872   C CG2 . THR A 1 119 ? 23.086  39.371  16.058  1.00 32.09 ? 157 THR A CG2 1 
ATOM   873   N N   . PRO A 1 120 ? 19.611  38.835  18.173  1.00 34.13 ? 158 PRO A N   1 
ATOM   874   C CA  . PRO A 1 120 ? 19.230  37.658  18.957  1.00 34.52 ? 158 PRO A CA  1 
ATOM   875   C C   . PRO A 1 120 ? 19.700  36.337  18.339  1.00 35.31 ? 158 PRO A C   1 
ATOM   876   O O   . PRO A 1 120 ? 19.700  35.283  19.022  1.00 36.31 ? 158 PRO A O   1 
ATOM   877   C CB  . PRO A 1 120 ? 17.704  37.748  18.985  1.00 34.79 ? 158 PRO A CB  1 
ATOM   878   C CG  . PRO A 1 120 ? 17.360  38.414  17.604  1.00 34.67 ? 158 PRO A CG  1 
ATOM   879   C CD  . PRO A 1 120 ? 18.485  39.372  17.368  1.00 34.44 ? 158 PRO A CD  1 
ATOM   880   N N   . THR A 1 121 ? 20.087  36.383  17.064  1.00 35.14 ? 159 THR A N   1 
ATOM   881   C CA  . THR A 1 121 ? 20.504  35.222  16.293  1.00 34.47 ? 159 THR A CA  1 
ATOM   882   C C   . THR A 1 121 ? 21.858  34.698  16.785  1.00 33.92 ? 159 THR A C   1 
ATOM   883   O O   . THR A 1 121 ? 22.831  35.456  16.866  1.00 32.93 ? 159 THR A O   1 
ATOM   884   C CB  . THR A 1 121 ? 20.612  35.619  14.794  1.00 34.85 ? 159 THR A CB  1 
ATOM   885   O OG1 . THR A 1 121 ? 19.316  35.996  14.351  1.00 36.19 ? 159 THR A OG1 1 
ATOM   886   C CG2 . THR A 1 121 ? 21.137  34.517  13.925  1.00 33.35 ? 159 THR A CG2 1 
ATOM   887   N N   . GLY A 1 122 ? 21.912  33.416  17.134  1.00 33.22 ? 160 GLY A N   1 
ATOM   888   C CA  . GLY A 1 122 ? 23.148  32.824  17.633  1.00 33.70 ? 160 GLY A CA  1 
ATOM   889   C C   . GLY A 1 122 ? 23.189  32.674  19.130  1.00 34.27 ? 160 GLY A C   1 
ATOM   890   O O   . GLY A 1 122 ? 24.049  31.942  19.651  1.00 34.54 ? 160 GLY A O   1 
ATOM   891   N N   . TYR A 1 123 ? 22.298  33.378  19.840  1.00 34.32 ? 161 TYR A N   1 
ATOM   892   C CA  . TYR A 1 123 ? 22.214  33.221  21.283  1.00 34.85 ? 161 TYR A CA  1 
ATOM   893   C C   . TYR A 1 123 ? 21.921  31.747  21.613  1.00 34.22 ? 161 TYR A C   1 
ATOM   894   O O   . TYR A 1 123 ? 21.044  31.122  20.992  1.00 35.24 ? 161 TYR A O   1 
ATOM   895   C CB  . TYR A 1 123 ? 21.156  34.161  21.931  1.00 35.40 ? 161 TYR A CB  1 
ATOM   896   C CG  . TYR A 1 123 ? 20.979  33.837  23.386  1.00 36.23 ? 161 TYR A CG  1 
ATOM   897   C CD1 . TYR A 1 123 ? 21.959  34.181  24.328  1.00 37.06 ? 161 TYR A CD1 1 
ATOM   898   C CD2 . TYR A 1 123 ? 19.891  33.108  23.820  1.00 37.03 ? 161 TYR A CD2 1 
ATOM   899   C CE1 . TYR A 1 123 ? 21.830  33.804  25.662  1.00 37.51 ? 161 TYR A CE1 1 
ATOM   900   C CE2 . TYR A 1 123 ? 19.761  32.746  25.148  1.00 37.44 ? 161 TYR A CE2 1 
ATOM   901   C CZ  . TYR A 1 123 ? 20.728  33.085  26.070  1.00 36.42 ? 161 TYR A CZ  1 
ATOM   902   O OH  . TYR A 1 123 ? 20.553  32.702  27.403  1.00 34.54 ? 161 TYR A OH  1 
ATOM   903   N N   . GLY A 1 124 ? 22.649  31.200  22.579  1.00 32.16 ? 162 GLY A N   1 
ATOM   904   C CA  . GLY A 1 124 ? 22.418  29.841  23.002  1.00 32.10 ? 162 GLY A CA  1 
ATOM   905   C C   . GLY A 1 124 ? 23.095  28.797  22.152  1.00 31.67 ? 162 GLY A C   1 
ATOM   906   O O   . GLY A 1 124 ? 22.878  27.619  22.374  1.00 31.19 ? 162 GLY A O   1 
ATOM   907   N N   . THR A 1 125 ? 23.959  29.228  21.221  1.00 31.88 ? 163 THR A N   1 
ATOM   908   C CA  . THR A 1 125 ? 24.608  28.346  20.255  1.00 31.12 ? 163 THR A CA  1 
ATOM   909   C C   . THR A 1 125 ? 26.137  28.578  20.279  1.00 31.32 ? 163 THR A C   1 
ATOM   910   O O   . THR A 1 125 ? 26.645  29.398  21.056  1.00 29.30 ? 163 THR A O   1 
ATOM   911   C CB  . THR A 1 125 ? 24.050  28.512  18.772  1.00 31.48 ? 163 THR A CB  1 
ATOM   912   O OG1 . THR A 1 125 ? 24.617  29.676  18.145  1.00 32.16 ? 163 THR A OG1 1 
ATOM   913   C CG2 . THR A 1 125 ? 22.517  28.599  18.707  1.00 29.59 ? 163 THR A CG2 1 
ATOM   914   N N   . LEU A 1 126 ? 26.858  27.814  19.442  1.00 31.37 ? 164 LEU A N   1 
ATOM   915   C CA  . LEU A 1 126 ? 28.311  27.956  19.300  1.00 31.70 ? 164 LEU A CA  1 
ATOM   916   C C   . LEU A 1 126 ? 28.718  29.326  18.807  1.00 31.62 ? 164 LEU A C   1 
ATOM   917   O O   . LEU A 1 126 ? 29.831  29.765  19.068  1.00 31.20 ? 164 LEU A O   1 
ATOM   918   C CB  . LEU A 1 126 ? 28.885  26.916  18.333  1.00 32.46 ? 164 LEU A CB  1 
ATOM   919   C CG  . LEU A 1 126 ? 28.835  25.465  18.820  1.00 32.39 ? 164 LEU A CG  1 
ATOM   920   C CD1 . LEU A 1 126 ? 29.332  24.589  17.708  1.00 33.12 ? 164 LEU A CD1 1 
ATOM   921   C CD2 . LEU A 1 126 ? 29.620  25.211  20.087  1.00 31.64 ? 164 LEU A CD2 1 
ATOM   922   N N   . VAL A 1 127 ? 27.810  30.003  18.101  1.00 31.74 ? 165 VAL A N   1 
ATOM   923   C CA  . VAL A 1 127 ? 28.046  31.386  17.664  1.00 31.49 ? 165 VAL A CA  1 
ATOM   924   C C   . VAL A 1 127 ? 28.255  32.289  18.880  1.00 31.91 ? 165 VAL A C   1 
ATOM   925   O O   . VAL A 1 127 ? 29.258  32.992  18.975  1.00 31.22 ? 165 VAL A O   1 
ATOM   926   C CB  . VAL A 1 127 ? 26.933  31.861  16.711  1.00 31.36 ? 165 VAL A CB  1 
ATOM   927   C CG1 . VAL A 1 127 ? 27.146  33.318  16.263  1.00 29.68 ? 165 VAL A CG1 1 
ATOM   928   C CG2 . VAL A 1 127 ? 26.897  30.934  15.483  1.00 31.27 ? 165 VAL A CG2 1 
ATOM   929   N N   . GLN A 1 128 ? 27.350  32.204  19.857  1.00 32.70 ? 166 GLN A N   1 
ATOM   930   C CA  . GLN A 1 128 ? 27.476  32.983  21.089  1.00 31.48 ? 166 GLN A CA  1 
ATOM   931   C C   . GLN A 1 128 ? 28.504  32.449  22.052  1.00 32.50 ? 166 GLN A C   1 
ATOM   932   O O   . GLN A 1 128 ? 29.270  33.245  22.620  1.00 32.94 ? 166 GLN A O   1 
ATOM   933   C CB  . GLN A 1 128 ? 26.121  33.151  21.745  1.00 31.98 ? 166 GLN A CB  1 
ATOM   934   C CG  . GLN A 1 128 ? 26.126  33.845  23.095  1.00 29.83 ? 166 GLN A CG  1 
ATOM   935   C CD  . GLN A 1 128 ? 25.936  32.888  24.215  1.00 29.00 ? 166 GLN A CD  1 
ATOM   936   O OE1 . GLN A 1 128 ? 24.994  32.103  24.175  1.00 27.72 ? 166 GLN A OE1 1 
ATOM   937   N NE2 . GLN A 1 128 ? 26.837  32.925  25.241  1.00 26.19 ? 166 GLN A NE2 1 
ATOM   938   N N   . GLU A 1 129 ? 28.575  31.125  22.243  1.00 32.45 ? 167 GLU A N   1 
ATOM   939   C CA  . GLU A 1 129 ? 29.415  30.615  23.290  1.00 33.53 ? 167 GLU A CA  1 
ATOM   940   C C   . GLU A 1 129 ? 30.833  30.424  22.790  1.00 32.43 ? 167 GLU A C   1 
ATOM   941   O O   . GLU A 1 129 ? 31.738  30.297  23.578  1.00 31.56 ? 167 GLU A O   1 
ATOM   942   C CB  . GLU A 1 129 ? 28.847  29.341  23.941  1.00 33.10 ? 167 GLU A CB  1 
ATOM   943   C CG  . GLU A 1 129 ? 27.310  29.368  24.182  1.00 37.69 ? 167 GLU A CG  1 
ATOM   944   C CD  . GLU A 1 129 ? 26.795  28.402  25.276  1.00 38.62 ? 167 GLU A CD  1 
ATOM   945   O OE1 . GLU A 1 129 ? 27.632  27.713  25.928  1.00 42.99 ? 167 GLU A OE1 1 
ATOM   946   O OE2 . GLU A 1 129 ? 25.541  28.380  25.506  1.00 43.82 ? 167 GLU A OE2 1 
ATOM   947   N N   . GLY A 1 130 ? 31.005  30.451  21.476  1.00 32.77 ? 168 GLY A N   1 
ATOM   948   C CA  . GLY A 1 130 ? 32.269  30.189  20.848  1.00 33.09 ? 168 GLY A CA  1 
ATOM   949   C C   . GLY A 1 130 ? 32.410  28.682  20.650  1.00 33.35 ? 168 GLY A C   1 
ATOM   950   O O   . GLY A 1 130 ? 31.560  27.899  21.111  1.00 32.59 ? 168 GLY A O   1 
ATOM   951   N N   . GLY A 1 131 ? 33.484  28.280  19.985  1.00 33.25 ? 169 GLY A N   1 
ATOM   952   C CA  . GLY A 1 131 ? 33.694  26.867  19.653  1.00 34.23 ? 169 GLY A CA  1 
ATOM   953   C C   . GLY A 1 131 ? 33.356  26.425  18.230  1.00 34.45 ? 169 GLY A C   1 
ATOM   954   O O   . GLY A 1 131 ? 33.510  25.252  17.899  1.00 36.61 ? 169 GLY A O   1 
ATOM   955   N N   . SER A 1 132 ? 32.898  27.314  17.377  1.00 33.66 ? 170 SER A N   1 
ATOM   956   C CA  . SER A 1 132 ? 32.654  26.912  16.011  1.00 34.60 ? 170 SER A CA  1 
ATOM   957   C C   . SER A 1 132 ? 34.016  26.756  15.268  1.00 34.87 ? 170 SER A C   1 
ATOM   958   O O   . SER A 1 132 ? 34.903  27.595  15.385  1.00 33.84 ? 170 SER A O   1 
ATOM   959   C CB  . SER A 1 132 ? 31.718  27.892  15.291  1.00 34.93 ? 170 SER A CB  1 
ATOM   960   O OG  . SER A 1 132 ? 31.502  27.461  13.934  1.00 35.77 ? 170 SER A OG  1 
ATOM   961   N N   . PRO A 1 133 ? 34.188  25.657  14.503  1.00 35.93 ? 171 PRO A N   1 
ATOM   962   C CA  . PRO A 1 133 ? 35.509  25.385  13.942  1.00 35.65 ? 171 PRO A CA  1 
ATOM   963   C C   . PRO A 1 133 ? 35.806  26.281  12.733  1.00 34.75 ? 171 PRO A C   1 
ATOM   964   O O   . PRO A 1 133 ? 34.966  26.463  11.820  1.00 35.42 ? 171 PRO A O   1 
ATOM   965   C CB  . PRO A 1 133 ? 35.445  23.900  13.618  1.00 36.21 ? 171 PRO A CB  1 
ATOM   966   C CG  . PRO A 1 133 ? 34.021  23.681  13.246  1.00 37.13 ? 171 PRO A CG  1 
ATOM   967   C CD  . PRO A 1 133 ? 33.214  24.619  14.122  1.00 36.91 ? 171 PRO A CD  1 
ATOM   968   N N   . ILE A 1 134 ? 36.954  26.928  12.815  1.00 33.59 ? 172 ILE A N   1 
ATOM   969   C CA  . ILE A 1 134 ? 37.386  27.843  11.797  1.00 33.86 ? 172 ILE A CA  1 
ATOM   970   C C   . ILE A 1 134 ? 38.454  27.146  10.966  1.00 34.09 ? 172 ILE A C   1 
ATOM   971   O O   . ILE A 1 134 ? 38.485  27.291  9.753   1.00 33.90 ? 172 ILE A O   1 
ATOM   972   C CB  . ILE A 1 134 ? 37.860  29.246  12.409  1.00 34.00 ? 172 ILE A CB  1 
ATOM   973   C CG1 . ILE A 1 134 ? 36.653  30.011  12.943  1.00 33.00 ? 172 ILE A CG1 1 
ATOM   974   C CG2 . ILE A 1 134 ? 38.604  30.096  11.388  1.00 34.27 ? 172 ILE A CG2 1 
ATOM   975   C CD1 . ILE A 1 134 ? 36.965  31.267  13.775  1.00 31.51 ? 172 ILE A CD1 1 
ATOM   976   N N   . LYS A 1 135 ? 39.314  26.374  11.612  1.00 34.51 ? 173 LYS A N   1 
ATOM   977   C CA  . LYS A 1 135 ? 40.394  25.733  10.922  1.00 34.74 ? 173 LYS A CA  1 
ATOM   978   C C   . LYS A 1 135 ? 40.689  24.411  11.618  1.00 35.97 ? 173 LYS A C   1 
ATOM   979   O O   . LYS A 1 135 ? 40.685  24.329  12.839  1.00 34.64 ? 173 LYS A O   1 
ATOM   980   C CB  . LYS A 1 135 ? 41.605  26.653  10.908  1.00 35.21 ? 173 LYS A CB  1 
ATOM   981   C CG  . LYS A 1 135 ? 42.819  26.149  10.049  1.00 36.07 ? 173 LYS A CG  1 
ATOM   982   C CD  . LYS A 1 135 ? 44.121  26.763  10.542  1.00 37.50 ? 173 LYS A CD  1 
ATOM   983   C CE  . LYS A 1 135 ? 45.382  26.065  9.973   1.00 39.94 ? 173 LYS A CE  1 
ATOM   984   N NZ  . LYS A 1 135 ? 45.849  26.744  8.730   1.00 41.43 ? 173 LYS A NZ  1 
ATOM   985   N N   . TYR A 1 136 ? 40.915  23.373  10.807  1.00 37.29 ? 174 TYR A N   1 
ATOM   986   C CA  . TYR A 1 136 ? 41.211  22.045  11.275  1.00 38.15 ? 174 TYR A CA  1 
ATOM   987   C C   . TYR A 1 136 ? 42.703  21.813  11.203  1.00 39.58 ? 174 TYR A C   1 
ATOM   988   O O   . TYR A 1 136 ? 43.431  22.504  10.496  1.00 40.33 ? 174 TYR A O   1 
ATOM   989   C CB  . TYR A 1 136 ? 40.430  20.989  10.471  1.00 37.80 ? 174 TYR A CB  1 
ATOM   990   C CG  . TYR A 1 136 ? 38.945  20.949  10.819  1.00 36.94 ? 174 TYR A CG  1 
ATOM   991   C CD1 . TYR A 1 136 ? 38.500  20.312  11.974  1.00 36.98 ? 174 TYR A CD1 1 
ATOM   992   C CD2 . TYR A 1 136 ? 38.001  21.548  10.013  1.00 36.67 ? 174 TYR A CD2 1 
ATOM   993   C CE1 . TYR A 1 136 ? 37.159  20.279  12.311  1.00 36.03 ? 174 TYR A CE1 1 
ATOM   994   C CE2 . TYR A 1 136 ? 36.638  21.524  10.342  1.00 36.83 ? 174 TYR A CE2 1 
ATOM   995   C CZ  . TYR A 1 136 ? 36.233  20.875  11.487  1.00 36.78 ? 174 TYR A CZ  1 
ATOM   996   O OH  . TYR A 1 136 ? 34.904  20.835  11.824  1.00 38.57 ? 174 TYR A OH  1 
ATOM   997   N N   . ASN A 1 137 ? 43.152  20.869  12.005  1.00 41.23 ? 175 ASN A N   1 
ATOM   998   C CA  . ASN A 1 137 ? 44.498  20.343  11.930  1.00 42.28 ? 175 ASN A CA  1 
ATOM   999   C C   . ASN A 1 137 ? 44.491  19.210  10.910  1.00 43.80 ? 175 ASN A C   1 
ATOM   1000  O O   . ASN A 1 137 ? 43.428  18.625  10.629  1.00 44.08 ? 175 ASN A O   1 
ATOM   1001  C CB  . ASN A 1 137 ? 44.929  19.789  13.290  1.00 41.85 ? 175 ASN A CB  1 
ATOM   1002  C CG  . ASN A 1 137 ? 45.383  20.860  14.260  1.00 41.58 ? 175 ASN A CG  1 
ATOM   1003  O OD1 . ASN A 1 137 ? 46.141  21.767  13.907  1.00 41.16 ? 175 ASN A OD1 1 
ATOM   1004  N ND2 . ASN A 1 137 ? 44.961  20.729  15.520  1.00 42.73 ? 175 ASN A ND2 1 
ATOM   1005  N N   . LYS A 1 138 ? 45.677  18.908  10.366  1.00 45.55 ? 176 LYS A N   1 
ATOM   1006  C CA  . LYS A 1 138 ? 45.889  17.773  9.456   1.00 46.99 ? 176 LYS A CA  1 
ATOM   1007  C C   . LYS A 1 138 ? 45.147  16.525  9.935   1.00 48.22 ? 176 LYS A C   1 
ATOM   1008  O O   . LYS A 1 138 ? 44.438  15.881  9.157   1.00 49.13 ? 176 LYS A O   1 
ATOM   1009  C CB  . LYS A 1 138 ? 47.385  17.463  9.323   1.00 46.84 ? 176 LYS A CB  1 
ATOM   1010  N N   . ASP A 1 139 ? 45.288  16.232  11.233  1.00 49.18 ? 177 ASP A N   1 
ATOM   1011  C CA  . ASP A 1 139 ? 44.650  15.065  11.886  1.00 49.61 ? 177 ASP A CA  1 
ATOM   1012  C C   . ASP A 1 139 ? 43.148  15.224  12.244  1.00 49.07 ? 177 ASP A C   1 
ATOM   1013  O O   . ASP A 1 139 ? 42.582  14.377  12.940  1.00 49.90 ? 177 ASP A O   1 
ATOM   1014  C CB  . ASP A 1 139 ? 45.459  14.641  13.128  1.00 49.72 ? 177 ASP A CB  1 
ATOM   1015  C CG  . ASP A 1 139 ? 46.176  15.808  13.796  1.00 52.29 ? 177 ASP A CG  1 
ATOM   1016  O OD1 . ASP A 1 139 ? 46.146  15.892  15.050  1.00 54.52 ? 177 ASP A OD1 1 
ATOM   1017  O OD2 . ASP A 1 139 ? 46.768  16.645  13.061  1.00 55.19 ? 177 ASP A OD2 1 
ATOM   1018  N N   . GLY A 1 140 ? 42.510  16.292  11.773  1.00 48.32 ? 178 GLY A N   1 
ATOM   1019  C CA  . GLY A 1 140 ? 41.067  16.472  11.939  1.00 47.23 ? 178 GLY A CA  1 
ATOM   1020  C C   . GLY A 1 140 ? 40.611  17.021  13.282  1.00 46.14 ? 178 GLY A C   1 
ATOM   1021  O O   . GLY A 1 140 ? 39.407  17.112  13.530  1.00 46.07 ? 178 GLY A O   1 
ATOM   1022  N N   . SER A 1 141 ? 41.550  17.384  14.154  1.00 44.70 ? 179 SER A N   1 
ATOM   1023  C CA  . SER A 1 141 ? 41.216  18.155  15.339  1.00 43.92 ? 179 SER A CA  1 
ATOM   1024  C C   . SER A 1 141 ? 41.102  19.633  14.931  1.00 43.31 ? 179 SER A C   1 
ATOM   1025  O O   . SER A 1 141 ? 41.582  20.024  13.864  1.00 44.18 ? 179 SER A O   1 
ATOM   1026  C CB  . SER A 1 141 ? 42.268  17.960  16.434  1.00 43.44 ? 179 SER A CB  1 
ATOM   1027  O OG  . SER A 1 141 ? 43.537  18.409  16.011  1.00 43.33 ? 179 SER A OG  1 
ATOM   1028  N N   . VAL A 1 142 ? 40.467  20.455  15.761  1.00 41.86 ? 180 VAL A N   1 
ATOM   1029  C CA  . VAL A 1 142 ? 40.335  21.880  15.442  1.00 40.48 ? 180 VAL A CA  1 
ATOM   1030  C C   . VAL A 1 142 ? 41.582  22.664  15.865  1.00 39.27 ? 180 VAL A C   1 
ATOM   1031  O O   . VAL A 1 142 ? 42.042  22.554  16.985  1.00 38.61 ? 180 VAL A O   1 
ATOM   1032  C CB  . VAL A 1 142 ? 39.046  22.492  16.041  1.00 40.46 ? 180 VAL A CB  1 
ATOM   1033  C CG1 . VAL A 1 142 ? 38.925  23.976  15.672  1.00 39.44 ? 180 VAL A CG1 1 
ATOM   1034  C CG2 . VAL A 1 142 ? 37.818  21.691  15.543  1.00 40.44 ? 180 VAL A CG2 1 
ATOM   1035  N N   . ALA A 1 143 ? 42.117  23.445  14.935  1.00 38.23 ? 181 ALA A N   1 
ATOM   1036  C CA  . ALA A 1 143 ? 43.274  24.267  15.175  1.00 38.01 ? 181 ALA A CA  1 
ATOM   1037  C C   . ALA A 1 143 ? 42.808  25.631  15.644  1.00 38.13 ? 181 ALA A C   1 
ATOM   1038  O O   . ALA A 1 143 ? 43.379  26.180  16.577  1.00 38.84 ? 181 ALA A O   1 
ATOM   1039  C CB  . ALA A 1 143 ? 44.120  24.377  13.907  1.00 37.31 ? 181 ALA A CB  1 
ATOM   1040  N N   . ILE A 1 144 ? 41.762  26.169  15.002  1.00 38.36 ? 182 ILE A N   1 
ATOM   1041  C CA  . ILE A 1 144 ? 41.166  27.455  15.364  1.00 37.67 ? 182 ILE A CA  1 
ATOM   1042  C C   . ILE A 1 144 ? 39.658  27.341  15.514  1.00 37.52 ? 182 ILE A C   1 
ATOM   1043  O O   . ILE A 1 144 ? 38.951  26.906  14.604  1.00 37.06 ? 182 ILE A O   1 
ATOM   1044  C CB  . ILE A 1 144 ? 41.471  28.536  14.327  1.00 37.63 ? 182 ILE A CB  1 
ATOM   1045  C CG1 . ILE A 1 144 ? 42.969  28.589  14.027  1.00 38.19 ? 182 ILE A CG1 1 
ATOM   1046  C CG2 . ILE A 1 144 ? 40.983  29.881  14.835  1.00 38.00 ? 182 ILE A CG2 1 
ATOM   1047  C CD1 . ILE A 1 144 ? 43.327  29.748  13.152  1.00 39.52 ? 182 ILE A CD1 1 
ATOM   1048  N N   . ALA A 1 145 ? 39.171  27.724  16.689  1.00 38.07 ? 183 ALA A N   1 
ATOM   1049  C CA  . ALA A 1 145 ? 37.720  27.796  16.989  1.00 37.73 ? 183 ALA A CA  1 
ATOM   1050  C C   . ALA A 1 145 ? 37.297  29.248  17.232  1.00 37.75 ? 183 ALA A C   1 
ATOM   1051  O O   . ALA A 1 145 ? 38.109  30.107  17.616  1.00 37.07 ? 183 ALA A O   1 
ATOM   1052  C CB  . ALA A 1 145 ? 37.372  26.905  18.201  1.00 37.40 ? 183 ALA A CB  1 
ATOM   1053  N N   . SER A 1 146 ? 36.019  29.519  16.987  1.00 37.96 ? 184 SER A N   1 
ATOM   1054  C CA  . SER A 1 146 ? 35.464  30.828  17.209  1.00 37.77 ? 184 SER A CA  1 
ATOM   1055  C C   . SER A 1 146 ? 35.401  31.167  18.718  1.00 38.49 ? 184 SER A C   1 
ATOM   1056  O O   . SER A 1 146 ? 35.311  30.290  19.593  1.00 37.30 ? 184 SER A O   1 
ATOM   1057  C CB  . SER A 1 146 ? 34.075  30.952  16.553  1.00 37.83 ? 184 SER A CB  1 
ATOM   1058  O OG  . SER A 1 146 ? 33.029  30.391  17.344  1.00 36.66 ? 184 SER A OG  1 
ATOM   1059  N N   . LYS A 1 147 ? 35.412  32.474  18.983  1.00 39.00 ? 185 LYS A N   1 
ATOM   1060  C CA  . LYS A 1 147 ? 35.463  33.012  20.338  1.00 38.54 ? 185 LYS A CA  1 
ATOM   1061  C C   . LYS A 1 147 ? 34.070  33.325  20.884  1.00 36.74 ? 185 LYS A C   1 
ATOM   1062  O O   . LYS A 1 147 ? 33.159  33.564  20.124  1.00 35.68 ? 185 LYS A O   1 
ATOM   1063  C CB  . LYS A 1 147 ? 36.283  34.301  20.333  1.00 39.87 ? 185 LYS A CB  1 
ATOM   1064  C CG  . LYS A 1 147 ? 37.769  34.093  20.016  1.00 40.41 ? 185 LYS A CG  1 
ATOM   1065  C CD  . LYS A 1 147 ? 38.313  35.302  19.252  1.00 44.05 ? 185 LYS A CD  1 
ATOM   1066  N N   . PRO A 1 148 ? 33.930  33.354  22.224  1.00 35.60 ? 186 PRO A N   1 
ATOM   1067  C CA  . PRO A 1 148 ? 32.632  33.768  22.784  1.00 34.94 ? 186 PRO A CA  1 
ATOM   1068  C C   . PRO A 1 148 ? 32.274  35.189  22.330  1.00 34.91 ? 186 PRO A C   1 
ATOM   1069  O O   . PRO A 1 148 ? 33.159  36.016  22.191  1.00 34.54 ? 186 PRO A O   1 
ATOM   1070  C CB  . PRO A 1 148 ? 32.854  33.706  24.289  1.00 33.95 ? 186 PRO A CB  1 
ATOM   1071  C CG  . PRO A 1 148 ? 34.217  33.024  24.494  1.00 35.72 ? 186 PRO A CG  1 
ATOM   1072  C CD  . PRO A 1 148 ? 34.972  33.123  23.252  1.00 34.36 ? 186 PRO A CD  1 
ATOM   1073  N N   . ARG A 1 149 ? 30.993  35.450  22.078  1.00 36.03 ? 187 ARG A N   1 
ATOM   1074  C CA  . ARG A 1 149 ? 30.484  36.780  21.777  1.00 36.28 ? 187 ARG A CA  1 
ATOM   1075  C C   . ARG A 1 149 ? 30.060  37.449  23.043  1.00 35.56 ? 187 ARG A C   1 
ATOM   1076  O O   . ARG A 1 149 ? 29.605  36.787  23.993  1.00 34.27 ? 187 ARG A O   1 
ATOM   1077  C CB  . ARG A 1 149 ? 29.209  36.763  20.914  1.00 37.44 ? 187 ARG A CB  1 
ATOM   1078  C CG  . ARG A 1 149 ? 29.365  36.285  19.503  1.00 41.49 ? 187 ARG A CG  1 
ATOM   1079  C CD  . ARG A 1 149 ? 30.100  37.216  18.638  1.00 45.94 ? 187 ARG A CD  1 
ATOM   1080  N NE  . ARG A 1 149 ? 30.180  36.656  17.287  1.00 50.22 ? 187 ARG A NE  1 
ATOM   1081  C CZ  . ARG A 1 149 ? 31.262  36.082  16.741  1.00 53.00 ? 187 ARG A CZ  1 
ATOM   1082  N NH1 . ARG A 1 149 ? 32.434  35.949  17.393  1.00 53.30 ? 187 ARG A NH1 1 
ATOM   1083  N NH2 . ARG A 1 149 ? 31.169  35.635  15.499  1.00 55.58 ? 187 ARG A NH2 1 
ATOM   1084  N N   . GLU A 1 150 ? 30.122  38.783  23.005  1.00 34.95 ? 188 GLU A N   1 
ATOM   1085  C CA  . GLU A 1 150 ? 29.517  39.591  24.039  1.00 35.28 ? 188 GLU A CA  1 
ATOM   1086  C C   . GLU A 1 150 ? 27.995  39.388  24.035  1.00 34.49 ? 188 GLU A C   1 
ATOM   1087  O O   . GLU A 1 150 ? 27.332  39.441  22.988  1.00 34.25 ? 188 GLU A O   1 
ATOM   1088  C CB  . GLU A 1 150 ? 29.838  41.066  23.861  1.00 35.57 ? 188 GLU A CB  1 
ATOM   1089  C CG  . GLU A 1 150 ? 29.138  41.906  24.929  1.00 38.93 ? 188 GLU A CG  1 
ATOM   1090  C CD  . GLU A 1 150 ? 29.148  43.406  24.627  1.00 44.99 ? 188 GLU A CD  1 
ATOM   1091  O OE1 . GLU A 1 150 ? 30.135  43.868  23.945  1.00 44.84 ? 188 GLU A OE1 1 
ATOM   1092  O OE2 . GLU A 1 150 ? 28.163  44.076  25.089  1.00 43.58 ? 188 GLU A OE2 1 
ATOM   1093  N N   . VAL A 1 151 ? 27.479  39.111  25.216  1.00 34.08 ? 189 VAL A N   1 
ATOM   1094  C CA  . VAL A 1 151 ? 26.076  38.892  25.439  1.00 34.56 ? 189 VAL A CA  1 
ATOM   1095  C C   . VAL A 1 151 ? 25.511  40.018  26.319  1.00 34.10 ? 189 VAL A C   1 
ATOM   1096  O O   . VAL A 1 151 ? 26.106  40.407  27.319  1.00 32.72 ? 189 VAL A O   1 
ATOM   1097  C CB  . VAL A 1 151 ? 25.796  37.531  26.114  1.00 34.51 ? 189 VAL A CB  1 
ATOM   1098  C CG1 . VAL A 1 151 ? 24.368  37.495  26.584  1.00 35.06 ? 189 VAL A CG1 1 
ATOM   1099  C CG2 . VAL A 1 151 ? 26.044  36.398  25.135  1.00 34.28 ? 189 VAL A CG2 1 
ATOM   1100  N N   . ARG A 1 152 ? 24.334  40.487  25.931  1.00 34.29 ? 190 ARG A N   1 
ATOM   1101  C CA  . ARG A 1 152 ? 23.653  41.534  26.630  1.00 34.92 ? 190 ARG A CA  1 
ATOM   1102  C C   . ARG A 1 152 ? 22.114  41.414  26.601  1.00 34.41 ? 190 ARG A C   1 
ATOM   1103  O O   . ARG A 1 152 ? 21.518  41.104  25.594  1.00 33.52 ? 190 ARG A O   1 
ATOM   1104  C CB  . ARG A 1 152 ? 24.102  42.840  26.018  1.00 35.86 ? 190 ARG A CB  1 
ATOM   1105  C CG  . ARG A 1 152 ? 23.613  44.013  26.734  1.00 37.46 ? 190 ARG A CG  1 
ATOM   1106  C CD  . ARG A 1 152 ? 24.622  45.065  26.723  1.00 41.77 ? 190 ARG A CD  1 
ATOM   1107  N NE  . ARG A 1 152 ? 23.975  46.298  27.071  1.00 45.22 ? 190 ARG A NE  1 
ATOM   1108  C CZ  . ARG A 1 152 ? 24.568  47.481  27.114  1.00 48.00 ? 190 ARG A CZ  1 
ATOM   1109  N NH1 . ARG A 1 152 ? 25.854  47.609  26.815  1.00 48.44 ? 190 ARG A NH1 1 
ATOM   1110  N NH2 . ARG A 1 152 ? 23.840  48.535  27.478  1.00 48.35 ? 190 ARG A NH2 1 
ATOM   1111  N N   . GLU A 1 153 ? 21.490  41.666  27.737  1.00 34.67 ? 191 GLU A N   1 
ATOM   1112  C CA  . GLU A 1 153 ? 20.047  41.643  27.831  1.00 35.35 ? 191 GLU A CA  1 
ATOM   1113  C C   . GLU A 1 153 ? 19.420  43.010  27.525  1.00 35.72 ? 191 GLU A C   1 
ATOM   1114  O O   . GLU A 1 153 ? 19.895  44.054  28.006  1.00 35.30 ? 191 GLU A O   1 
ATOM   1115  C CB  . GLU A 1 153 ? 19.631  41.209  29.229  1.00 35.68 ? 191 GLU A CB  1 
ATOM   1116  C CG  . GLU A 1 153 ? 18.164  40.894  29.370  1.00 37.75 ? 191 GLU A CG  1 
ATOM   1117  C CD  . GLU A 1 153 ? 17.509  41.719  30.427  1.00 43.19 ? 191 GLU A CD  1 
ATOM   1118  O OE1 . GLU A 1 153 ? 17.582  42.976  30.349  1.00 47.97 ? 191 GLU A OE1 1 
ATOM   1119  O OE2 . GLU A 1 153 ? 16.918  41.110  31.350  1.00 48.12 ? 191 GLU A OE2 1 
ATOM   1120  N N   . PHE A 1 154 ? 18.344  42.966  26.727  1.00 36.23 ? 192 PHE A N   1 
ATOM   1121  C CA  . PHE A 1 154 ? 17.428  44.104  26.460  1.00 36.28 ? 192 PHE A CA  1 
ATOM   1122  C C   . PHE A 1 154 ? 16.008  43.599  26.559  1.00 37.52 ? 192 PHE A C   1 
ATOM   1123  O O   . PHE A 1 154 ? 15.675  42.619  25.905  1.00 36.52 ? 192 PHE A O   1 
ATOM   1124  C CB  . PHE A 1 154 ? 17.594  44.610  25.030  1.00 35.63 ? 192 PHE A CB  1 
ATOM   1125  C CG  . PHE A 1 154 ? 18.909  45.239  24.771  1.00 35.01 ? 192 PHE A CG  1 
ATOM   1126  C CD1 . PHE A 1 154 ? 19.119  46.577  25.074  1.00 35.51 ? 192 PHE A CD1 1 
ATOM   1127  C CD2 . PHE A 1 154 ? 19.951  44.505  24.238  1.00 32.39 ? 192 PHE A CD2 1 
ATOM   1128  C CE1 . PHE A 1 154 ? 20.357  47.160  24.839  1.00 36.32 ? 192 PHE A CE1 1 
ATOM   1129  C CE2 . PHE A 1 154 ? 21.166  45.079  24.026  1.00 31.07 ? 192 PHE A CE2 1 
ATOM   1130  C CZ  . PHE A 1 154 ? 21.364  46.412  24.309  1.00 32.67 ? 192 PHE A CZ  1 
ATOM   1131  N N   . ASN A 1 155 ? 15.176  44.265  27.363  1.00 39.73 ? 193 ASN A N   1 
ATOM   1132  C CA  . ASN A 1 155 ? 13.757  43.918  27.494  1.00 40.84 ? 193 ASN A CA  1 
ATOM   1133  C C   . ASN A 1 155 ? 13.523  42.447  27.803  1.00 40.40 ? 193 ASN A C   1 
ATOM   1134  O O   . ASN A 1 155 ? 12.675  41.810  27.188  1.00 39.90 ? 193 ASN A O   1 
ATOM   1135  C CB  . ASN A 1 155 ? 13.046  44.227  26.181  1.00 42.19 ? 193 ASN A CB  1 
ATOM   1136  C CG  . ASN A 1 155 ? 13.209  45.667  25.755  1.00 44.97 ? 193 ASN A CG  1 
ATOM   1137  O OD1 . ASN A 1 155 ? 13.743  45.962  24.668  1.00 49.32 ? 193 ASN A OD1 1 
ATOM   1138  N ND2 . ASN A 1 155 ? 12.770  46.575  26.615  1.00 47.50 ? 193 ASN A ND2 1 
ATOM   1139  N N   . GLY A 1 156 ? 14.314  41.888  28.703  1.00 40.09 ? 194 GLY A N   1 
ATOM   1140  C CA  . GLY A 1 156 ? 14.158  40.490  29.046  1.00 39.82 ? 194 GLY A CA  1 
ATOM   1141  C C   . GLY A 1 156 ? 14.563  39.469  28.001  1.00 39.58 ? 194 GLY A C   1 
ATOM   1142  O O   . GLY A 1 156 ? 14.324  38.276  28.201  1.00 40.83 ? 194 GLY A O   1 
ATOM   1143  N N   . GLN A 1 157 ? 15.193  39.893  26.904  1.00 38.56 ? 195 GLN A N   1 
ATOM   1144  C CA  . GLN A 1 157 ? 15.752  38.949  25.952  1.00 38.01 ? 195 GLN A CA  1 
ATOM   1145  C C   . GLN A 1 157 ? 17.284  39.123  25.846  1.00 36.54 ? 195 GLN A C   1 
ATOM   1146  O O   . GLN A 1 157 ? 17.823  40.219  26.027  1.00 35.12 ? 195 GLN A O   1 
ATOM   1147  C CB  . GLN A 1 157 ? 15.072  39.067  24.560  1.00 37.99 ? 195 GLN A CB  1 
ATOM   1148  C CG  . GLN A 1 157 ? 15.556  37.999  23.548  1.00 38.26 ? 195 GLN A CG  1 
ATOM   1149  C CD  . GLN A 1 157 ? 14.846  37.988  22.182  1.00 39.74 ? 195 GLN A CD  1 
ATOM   1150  O OE1 . GLN A 1 157 ? 13.841  38.638  21.993  1.00 45.02 ? 195 GLN A OE1 1 
ATOM   1151  N NE2 . GLN A 1 157 ? 15.364  37.204  21.248  1.00 41.62 ? 195 GLN A NE2 1 
ATOM   1152  N N   . HIS A 1 158 ? 17.969  38.023  25.542  1.00 35.25 ? 196 HIS A N   1 
ATOM   1153  C CA  . HIS A 1 158 ? 19.416  38.057  25.367  1.00 34.35 ? 196 HIS A CA  1 
ATOM   1154  C C   . HIS A 1 158 ? 19.827  38.147  23.902  1.00 33.42 ? 196 HIS A C   1 
ATOM   1155  O O   . HIS A 1 158 ? 19.242  37.502  23.032  1.00 33.09 ? 196 HIS A O   1 
ATOM   1156  C CB  . HIS A 1 158 ? 20.080  36.885  26.073  1.00 34.61 ? 196 HIS A CB  1 
ATOM   1157  C CG  . HIS A 1 158 ? 20.157  37.040  27.558  1.00 34.22 ? 196 HIS A CG  1 
ATOM   1158  N ND1 . HIS A 1 158 ? 19.060  36.906  28.381  1.00 38.88 ? 196 HIS A ND1 1 
ATOM   1159  C CD2 . HIS A 1 158 ? 21.200  37.324  28.370  1.00 35.35 ? 196 HIS A CD2 1 
ATOM   1160  C CE1 . HIS A 1 158 ? 19.426  37.097  29.634  1.00 35.37 ? 196 HIS A CE1 1 
ATOM   1161  N NE2 . HIS A 1 158 ? 20.724  37.336  29.654  1.00 35.29 ? 196 HIS A NE2 1 
ATOM   1162  N N   . PHE A 1 159 ? 20.827  38.995  23.657  1.00 32.78 ? 197 PHE A N   1 
ATOM   1163  C CA  . PHE A 1 159 ? 21.320  39.301  22.338  1.00 32.84 ? 197 PHE A CA  1 
ATOM   1164  C C   . PHE A 1 159 ? 22.838  39.224  22.347  1.00 33.35 ? 197 PHE A C   1 
ATOM   1165  O O   . PHE A 1 159 ? 23.478  39.298  23.385  1.00 32.43 ? 197 PHE A O   1 
ATOM   1166  C CB  . PHE A 1 159 ? 20.908  40.727  21.909  1.00 32.50 ? 197 PHE A CB  1 
ATOM   1167  C CG  . PHE A 1 159 ? 19.420  40.953  21.867  1.00 30.85 ? 197 PHE A CG  1 
ATOM   1168  C CD1 . PHE A 1 159 ? 18.737  40.929  20.663  1.00 29.73 ? 197 PHE A CD1 1 
ATOM   1169  C CD2 . PHE A 1 159 ? 18.703  41.170  23.039  1.00 29.49 ? 197 PHE A CD2 1 
ATOM   1170  C CE1 . PHE A 1 159 ? 17.335  41.102  20.619  1.00 29.03 ? 197 PHE A CE1 1 
ATOM   1171  C CE2 . PHE A 1 159 ? 17.315  41.371  23.009  1.00 29.03 ? 197 PHE A CE2 1 
ATOM   1172  C CZ  . PHE A 1 159 ? 16.629  41.311  21.804  1.00 30.06 ? 197 PHE A CZ  1 
ATOM   1173  N N   . ILE A 1 160 ? 23.404  39.089  21.161  1.00 34.07 ? 198 ILE A N   1 
ATOM   1174  C CA  . ILE A 1 160 ? 24.845  39.115  21.015  1.00 34.26 ? 198 ILE A CA  1 
ATOM   1175  C C   . ILE A 1 160 ? 25.283  40.273  20.151  1.00 33.64 ? 198 ILE A C   1 
ATOM   1176  O O   . ILE A 1 160 ? 24.582  40.687  19.213  1.00 32.67 ? 198 ILE A O   1 
ATOM   1177  C CB  . ILE A 1 160 ? 25.414  37.756  20.586  1.00 34.59 ? 198 ILE A CB  1 
ATOM   1178  C CG1 . ILE A 1 160 ? 24.999  37.383  19.169  1.00 34.75 ? 198 ILE A CG1 1 
ATOM   1179  C CG2 . ILE A 1 160 ? 24.938  36.690  21.593  1.00 35.62 ? 198 ILE A CG2 1 
ATOM   1180  C CD1 . ILE A 1 160 ? 25.466  35.982  18.735  1.00 33.71 ? 198 ILE A CD1 1 
ATOM   1181  N N   . LEU A 1 161 ? 26.442  40.816  20.518  1.00 33.68 ? 199 LEU A N   1 
ATOM   1182  C CA  . LEU A 1 161 ? 27.045  41.899  19.760  1.00 34.04 ? 199 LEU A CA  1 
ATOM   1183  C C   . LEU A 1 161 ? 27.797  41.392  18.507  1.00 34.08 ? 199 LEU A C   1 
ATOM   1184  O O   . LEU A 1 161 ? 28.655  40.535  18.620  1.00 34.61 ? 199 LEU A O   1 
ATOM   1185  C CB  . LEU A 1 161 ? 27.990  42.718  20.640  1.00 33.74 ? 199 LEU A CB  1 
ATOM   1186  C CG  . LEU A 1 161 ? 28.532  43.928  19.866  1.00 36.36 ? 199 LEU A CG  1 
ATOM   1187  C CD1 . LEU A 1 161 ? 27.514  45.093  20.003  1.00 35.99 ? 199 LEU A CD1 1 
ATOM   1188  C CD2 . LEU A 1 161 ? 29.882  44.318  20.331  1.00 36.66 ? 199 LEU A CD2 1 
ATOM   1189  N N   . GLU A 1 162 ? 27.462  41.948  17.329  1.00 34.67 ? 200 GLU A N   1 
ATOM   1190  C CA  . GLU A 1 162 ? 28.130  41.618  16.081  1.00 34.71 ? 200 GLU A CA  1 
ATOM   1191  C C   . GLU A 1 162 ? 28.748  42.887  15.512  1.00 35.50 ? 200 GLU A C   1 
ATOM   1192  O O   . GLU A 1 162 ? 28.192  43.941  15.645  1.00 34.50 ? 200 GLU A O   1 
ATOM   1193  C CB  . GLU A 1 162 ? 27.149  41.010  15.089  1.00 35.15 ? 200 GLU A CB  1 
ATOM   1194  C CG  . GLU A 1 162 ? 26.579  39.634  15.454  1.00 35.07 ? 200 GLU A CG  1 
ATOM   1195  C CD  . GLU A 1 162 ? 27.562  38.454  15.283  1.00 39.81 ? 200 GLU A CD  1 
ATOM   1196  O OE1 . GLU A 1 162 ? 28.704  38.639  14.742  1.00 43.09 ? 200 GLU A OE1 1 
ATOM   1197  O OE2 . GLU A 1 162 ? 27.160  37.313  15.666  1.00 42.89 ? 200 GLU A OE2 1 
ATOM   1198  N N   . GLU A 1 163 ? 29.919  42.770  14.904  1.00 36.80 ? 201 GLU A N   1 
ATOM   1199  C CA  . GLU A 1 163 ? 30.621  43.909  14.297  1.00 37.28 ? 201 GLU A CA  1 
ATOM   1200  C C   . GLU A 1 163 ? 30.406  43.998  12.795  1.00 36.55 ? 201 GLU A C   1 
ATOM   1201  O O   . GLU A 1 163 ? 30.203  42.989  12.125  1.00 36.02 ? 201 GLU A O   1 
ATOM   1202  C CB  . GLU A 1 163 ? 32.118  43.804  14.567  1.00 37.75 ? 201 GLU A CB  1 
ATOM   1203  C CG  . GLU A 1 163 ? 32.465  44.005  16.014  1.00 42.34 ? 201 GLU A CG  1 
ATOM   1204  C CD  . GLU A 1 163 ? 33.904  44.348  16.229  1.00 48.69 ? 201 GLU A CD  1 
ATOM   1205  O OE1 . GLU A 1 163 ? 34.323  45.516  15.988  1.00 53.66 ? 201 GLU A OE1 1 
ATOM   1206  O OE2 . GLU A 1 163 ? 34.625  43.438  16.630  1.00 52.84 ? 201 GLU A OE2 1 
ATOM   1207  N N   . ALA A 1 164 ? 30.474  45.216  12.277  1.00 34.96 ? 202 ALA A N   1 
ATOM   1208  C CA  . ALA A 1 164 ? 30.369  45.464  10.855  1.00 34.66 ? 202 ALA A CA  1 
ATOM   1209  C C   . ALA A 1 164 ? 31.441  44.678  10.067  1.00 34.66 ? 202 ALA A C   1 
ATOM   1210  O O   . ALA A 1 164 ? 32.550  44.398  10.555  1.00 33.46 ? 202 ALA A O   1 
ATOM   1211  C CB  . ALA A 1 164 ? 30.537  46.958  10.551  1.00 32.97 ? 202 ALA A CB  1 
ATOM   1212  N N   . ILE A 1 165 ? 31.080  44.378  8.826   1.00 34.02 ? 203 ILE A N   1 
ATOM   1213  C CA  . ILE A 1 165 ? 31.965  43.820  7.864   1.00 34.33 ? 203 ILE A CA  1 
ATOM   1214  C C   . ILE A 1 165 ? 32.062  44.860  6.771   1.00 35.03 ? 203 ILE A C   1 
ATOM   1215  O O   . ILE A 1 165 ? 31.052  45.307  6.253   1.00 33.23 ? 203 ILE A O   1 
ATOM   1216  C CB  . ILE A 1 165 ? 31.424  42.537  7.236   1.00 33.43 ? 203 ILE A CB  1 
ATOM   1217  C CG1 . ILE A 1 165 ? 31.538  41.379  8.226   1.00 33.06 ? 203 ILE A CG1 1 
ATOM   1218  C CG2 . ILE A 1 165 ? 32.183  42.264  5.930   1.00 34.38 ? 203 ILE A CG2 1 
ATOM   1219  C CD1 . ILE A 1 165 ? 30.980  40.007  7.678   1.00 33.02 ? 203 ILE A CD1 1 
ATOM   1220  N N   . THR A 1 166 ? 33.293  45.261  6.471   1.00 35.60 ? 204 THR A N   1 
ATOM   1221  C CA  . THR A 1 166 ? 33.571  46.048  5.284   1.00 36.35 ? 204 THR A CA  1 
ATOM   1222  C C   . THR A 1 166 ? 34.624  45.289  4.434   1.00 36.34 ? 204 THR A C   1 
ATOM   1223  O O   . THR A 1 166 ? 35.341  44.398  4.925   1.00 37.66 ? 204 THR A O   1 
ATOM   1224  C CB  . THR A 1 166 ? 34.061  47.457  5.656   1.00 36.66 ? 204 THR A CB  1 
ATOM   1225  O OG1 . THR A 1 166 ? 35.198  47.326  6.499   1.00 36.36 ? 204 THR A OG1 1 
ATOM   1226  C CG2 . THR A 1 166 ? 32.970  48.260  6.394   1.00 37.99 ? 204 THR A CG2 1 
ATOM   1227  N N   . GLY A 1 167 ? 34.675  45.571  3.147   1.00 35.59 ? 205 GLY A N   1 
ATOM   1228  C CA  . GLY A 1 167 ? 35.693  44.970  2.314   1.00 34.45 ? 205 GLY A CA  1 
ATOM   1229  C C   . GLY A 1 167 ? 36.682  45.986  1.818   1.00 34.29 ? 205 GLY A C   1 
ATOM   1230  O O   . GLY A 1 167 ? 36.424  47.178  1.809   1.00 32.49 ? 205 GLY A O   1 
ATOM   1231  N N   . ASP A 1 168 ? 37.806  45.492  1.332   1.00 34.34 ? 206 ASP A N   1 
ATOM   1232  C CA  . ASP A 1 168 ? 38.647  46.307  0.453   1.00 34.98 ? 206 ASP A CA  1 
ATOM   1233  C C   . ASP A 1 168 ? 37.957  46.492  -0.892  1.00 33.77 ? 206 ASP A C   1 
ATOM   1234  O O   . ASP A 1 168 ? 37.870  47.608  -1.411  1.00 33.24 ? 206 ASP A O   1 
ATOM   1235  C CB  . ASP A 1 168 ? 40.022  45.652  0.311   1.00 35.70 ? 206 ASP A CB  1 
ATOM   1236  C CG  . ASP A 1 168 ? 40.760  45.616  1.647   1.00 37.29 ? 206 ASP A CG  1 
ATOM   1237  O OD1 . ASP A 1 168 ? 40.828  46.679  2.294   1.00 41.49 ? 206 ASP A OD1 1 
ATOM   1238  O OD2 . ASP A 1 168 ? 41.242  44.558  2.060   1.00 37.85 ? 206 ASP A OD2 1 
ATOM   1239  N N   . PHE A 1 169 ? 37.368  45.407  -1.373  1.00 33.59 ? 207 PHE A N   1 
ATOM   1240  C CA  . PHE A 1 169 ? 36.666  45.356  -2.672  1.00 33.37 ? 207 PHE A CA  1 
ATOM   1241  C C   . PHE A 1 169 ? 35.361  44.614  -2.533  1.00 32.41 ? 207 PHE A C   1 
ATOM   1242  O O   . PHE A 1 169 ? 35.254  43.786  -1.690  1.00 31.71 ? 207 PHE A O   1 
ATOM   1243  C CB  . PHE A 1 169 ? 37.572  44.653  -3.726  1.00 33.70 ? 207 PHE A CB  1 
ATOM   1244  C CG  . PHE A 1 169 ? 38.721  45.511  -4.189  1.00 34.88 ? 207 PHE A CG  1 
ATOM   1245  C CD1 . PHE A 1 169 ? 39.883  45.604  -3.432  1.00 37.21 ? 207 PHE A CD1 1 
ATOM   1246  C CD2 . PHE A 1 169 ? 38.635  46.251  -5.361  1.00 35.66 ? 207 PHE A CD2 1 
ATOM   1247  C CE1 . PHE A 1 169 ? 40.921  46.394  -3.811  1.00 37.24 ? 207 PHE A CE1 1 
ATOM   1248  C CE2 . PHE A 1 169 ? 39.690  47.045  -5.759  1.00 37.93 ? 207 PHE A CE2 1 
ATOM   1249  C CZ  . PHE A 1 169 ? 40.839  47.124  -4.989  1.00 36.15 ? 207 PHE A CZ  1 
ATOM   1250  N N   . ALA A 1 170 ? 34.376  44.946  -3.358  1.00 32.77 ? 208 ALA A N   1 
ATOM   1251  C CA  . ALA A 1 170 ? 33.122  44.189  -3.516  1.00 33.64 ? 208 ALA A CA  1 
ATOM   1252  C C   . ALA A 1 170 ? 33.021  43.800  -4.995  1.00 33.60 ? 208 ALA A C   1 
ATOM   1253  O O   . ALA A 1 170 ? 33.284  44.651  -5.868  1.00 34.49 ? 208 ALA A O   1 
ATOM   1254  C CB  . ALA A 1 170 ? 31.891  45.027  -3.107  1.00 33.35 ? 208 ALA A CB  1 
ATOM   1255  N N   . LEU A 1 171 ? 32.720  42.532  -5.279  1.00 33.34 ? 209 LEU A N   1 
ATOM   1256  C CA  . LEU A 1 171 ? 32.523  42.092  -6.658  1.00 33.58 ? 209 LEU A CA  1 
ATOM   1257  C C   . LEU A 1 171 ? 31.044  41.791  -6.766  1.00 34.04 ? 209 LEU A C   1 
ATOM   1258  O O   . LEU A 1 171 ? 30.571  40.842  -6.154  1.00 34.28 ? 209 LEU A O   1 
ATOM   1259  C CB  . LEU A 1 171 ? 33.385  40.869  -7.024  1.00 33.95 ? 209 LEU A CB  1 
ATOM   1260  C CG  . LEU A 1 171 ? 34.901  40.944  -6.791  1.00 32.79 ? 209 LEU A CG  1 
ATOM   1261  C CD1 . LEU A 1 171 ? 35.464  39.640  -7.222  1.00 32.62 ? 209 LEU A CD1 1 
ATOM   1262  C CD2 . LEU A 1 171 ? 35.602  42.109  -7.518  1.00 31.72 ? 209 LEU A CD2 1 
ATOM   1263  N N   . VAL A 1 172 ? 30.343  42.641  -7.524  1.00 34.06 ? 210 VAL A N   1 
ATOM   1264  C CA  . VAL A 1 172 ? 28.869  42.728  -7.558  1.00 34.16 ? 210 VAL A CA  1 
ATOM   1265  C C   . VAL A 1 172 ? 28.320  42.450  -8.997  1.00 33.90 ? 210 VAL A C   1 
ATOM   1266  O O   . VAL A 1 172 ? 28.747  43.044  -9.959  1.00 32.89 ? 210 VAL A O   1 
ATOM   1267  C CB  . VAL A 1 172 ? 28.402  44.143  -6.997  1.00 33.81 ? 210 VAL A CB  1 
ATOM   1268  C CG1 . VAL A 1 172 ? 26.899  44.375  -7.184  1.00 35.26 ? 210 VAL A CG1 1 
ATOM   1269  C CG2 . VAL A 1 172 ? 28.845  44.309  -5.528  1.00 30.44 ? 210 VAL A CG2 1 
ATOM   1270  N N   . LYS A 1 173 ? 27.419  41.473  -9.109  1.00 35.03 ? 211 LYS A N   1 
ATOM   1271  C CA  . LYS A 1 173 ? 26.633  41.215  -10.327 1.00 34.90 ? 211 LYS A CA  1 
ATOM   1272  C C   . LYS A 1 173 ? 25.303  41.988  -10.215 1.00 34.43 ? 211 LYS A C   1 
ATOM   1273  O O   . LYS A 1 173 ? 24.603  41.910  -9.193  1.00 34.57 ? 211 LYS A O   1 
ATOM   1274  C CB  . LYS A 1 173 ? 26.342  39.718  -10.449 1.00 35.12 ? 211 LYS A CB  1 
ATOM   1275  C CG  . LYS A 1 173 ? 25.435  39.274  -11.621 1.00 34.95 ? 211 LYS A CG  1 
ATOM   1276  C CD  . LYS A 1 173 ? 25.889  39.801  -12.975 1.00 35.16 ? 211 LYS A CD  1 
ATOM   1277  C CE  . LYS A 1 173 ? 25.180  39.080  -14.127 1.00 35.01 ? 211 LYS A CE  1 
ATOM   1278  N NZ  . LYS A 1 173 ? 23.746  39.071  -14.001 1.00 38.49 ? 211 LYS A NZ  1 
ATOM   1279  N N   . ALA A 1 174 ? 24.965  42.736  -11.258 1.00 33.38 ? 212 ALA A N   1 
ATOM   1280  C CA  . ALA A 1 174 ? 23.650  43.366  -11.350 1.00 33.59 ? 212 ALA A CA  1 
ATOM   1281  C C   . ALA A 1 174 ? 23.087  43.097  -12.764 1.00 33.26 ? 212 ALA A C   1 
ATOM   1282  O O   . ALA A 1 174 ? 23.709  42.446  -13.587 1.00 33.16 ? 212 ALA A O   1 
ATOM   1283  C CB  . ALA A 1 174 ? 23.714  44.858  -10.994 1.00 32.71 ? 212 ALA A CB  1 
ATOM   1284  N N   . TRP A 1 175 ? 21.885  43.570  -13.006 1.00 32.81 ? 213 TRP A N   1 
ATOM   1285  C CA  . TRP A 1 175 ? 21.195  43.323  -14.214 1.00 32.32 ? 213 TRP A CA  1 
ATOM   1286  C C   . TRP A 1 175 ? 21.524  44.441  -15.223 1.00 32.27 ? 213 TRP A C   1 
ATOM   1287  O O   . TRP A 1 175 ? 22.025  44.197  -16.299 1.00 30.16 ? 213 TRP A O   1 
ATOM   1288  C CB  . TRP A 1 175 ? 19.689  43.278  -13.921 1.00 33.09 ? 213 TRP A CB  1 
ATOM   1289  C CG  . TRP A 1 175 ? 18.866  42.985  -15.121 1.00 33.04 ? 213 TRP A CG  1 
ATOM   1290  C CD1 . TRP A 1 175 ? 19.293  42.420  -16.282 1.00 34.18 ? 213 TRP A CD1 1 
ATOM   1291  C CD2 . TRP A 1 175 ? 17.467  43.200  -15.268 1.00 34.21 ? 213 TRP A CD2 1 
ATOM   1292  N NE1 . TRP A 1 175 ? 18.256  42.276  -17.149 1.00 34.57 ? 213 TRP A NE1 1 
ATOM   1293  C CE2 . TRP A 1 175 ? 17.115  42.761  -16.563 1.00 34.08 ? 213 TRP A CE2 1 
ATOM   1294  C CE3 . TRP A 1 175 ? 16.471  43.726  -14.434 1.00 35.34 ? 213 TRP A CE3 1 
ATOM   1295  C CZ2 . TRP A 1 175 ? 15.810  42.838  -17.057 1.00 35.18 ? 213 TRP A CZ2 1 
ATOM   1296  C CZ3 . TRP A 1 175 ? 15.132  43.789  -14.922 1.00 34.91 ? 213 TRP A CZ3 1 
ATOM   1297  C CH2 . TRP A 1 175 ? 14.825  43.349  -16.207 1.00 34.68 ? 213 TRP A CH2 1 
ATOM   1298  N N   . LYS A 1 176 ? 21.213  45.678  -14.852 1.00 31.73 ? 214 LYS A N   1 
ATOM   1299  C CA  . LYS A 1 176 ? 21.463  46.800  -15.721 1.00 31.58 ? 214 LYS A CA  1 
ATOM   1300  C C   . LYS A 1 176 ? 22.034  47.975  -14.965 1.00 31.12 ? 214 LYS A C   1 
ATOM   1301  O O   . LYS A 1 176 ? 21.764  48.116  -13.816 1.00 30.41 ? 214 LYS A O   1 
ATOM   1302  C CB  . LYS A 1 176 ? 20.156  47.226  -16.393 1.00 31.54 ? 214 LYS A CB  1 
ATOM   1303  C CG  . LYS A 1 176 ? 19.522  46.135  -17.143 1.00 30.80 ? 214 LYS A CG  1 
ATOM   1304  C CD  . LYS A 1 176 ? 18.619  46.662  -18.158 1.00 32.70 ? 214 LYS A CD  1 
ATOM   1305  C CE  . LYS A 1 176 ? 17.644  45.593  -18.640 1.00 31.71 ? 214 LYS A CE  1 
ATOM   1306  N NZ  . LYS A 1 176 ? 16.803  46.162  -19.743 1.00 31.51 ? 214 LYS A NZ  1 
ATOM   1307  N N   . ALA A 1 177 ? 22.759  48.835  -15.659 1.00 31.41 ? 215 ALA A N   1 
ATOM   1308  C CA  . ALA A 1 177 ? 23.204  50.088  -15.108 1.00 32.05 ? 215 ALA A CA  1 
ATOM   1309  C C   . ALA A 1 177 ? 22.898  51.131  -16.153 1.00 32.53 ? 215 ALA A C   1 
ATOM   1310  O O   . ALA A 1 177 ? 23.010  50.836  -17.340 1.00 31.93 ? 215 ALA A O   1 
ATOM   1311  C CB  . ALA A 1 177 ? 24.662  50.062  -14.834 1.00 31.33 ? 215 ALA A CB  1 
ATOM   1312  N N   . ASP A 1 178 ? 22.501  52.327  -15.723 1.00 33.46 ? 216 ASP A N   1 
ATOM   1313  C CA  . ASP A 1 178 ? 22.411  53.463  -16.636 1.00 34.96 ? 216 ASP A CA  1 
ATOM   1314  C C   . ASP A 1 178 ? 23.788  54.097  -16.758 1.00 36.09 ? 216 ASP A C   1 
ATOM   1315  O O   . ASP A 1 178 ? 24.725  53.720  -16.042 1.00 35.84 ? 216 ASP A O   1 
ATOM   1316  C CB  . ASP A 1 178 ? 21.287  54.475  -16.261 1.00 35.54 ? 216 ASP A CB  1 
ATOM   1317  C CG  . ASP A 1 178 ? 21.555  55.268  -14.959 1.00 36.70 ? 216 ASP A CG  1 
ATOM   1318  O OD1 . ASP A 1 178 ? 22.724  55.294  -14.505 1.00 35.33 ? 216 ASP A OD1 1 
ATOM   1319  O OD2 . ASP A 1 178 ? 20.579  55.884  -14.414 1.00 35.66 ? 216 ASP A OD2 1 
ATOM   1320  N N   . ARG A 1 179 ? 23.915  55.068  -17.666 1.00 37.07 ? 217 ARG A N   1 
ATOM   1321  C CA  . ARG A 1 179 ? 25.191  55.721  -17.886 1.00 37.81 ? 217 ARG A CA  1 
ATOM   1322  C C   . ARG A 1 179 ? 25.610  56.721  -16.773 1.00 37.87 ? 217 ARG A C   1 
ATOM   1323  O O   . ARG A 1 179 ? 26.700  57.311  -16.852 1.00 37.91 ? 217 ARG A O   1 
ATOM   1324  C CB  . ARG A 1 179 ? 25.228  56.357  -19.279 1.00 37.98 ? 217 ARG A CB  1 
ATOM   1325  C CG  . ARG A 1 179 ? 25.150  55.302  -20.366 1.00 40.82 ? 217 ARG A CG  1 
ATOM   1326  C CD  . ARG A 1 179 ? 25.307  55.831  -21.774 1.00 45.74 ? 217 ARG A CD  1 
ATOM   1327  N NE  . ARG A 1 179 ? 25.858  54.801  -22.683 1.00 48.26 ? 217 ARG A NE  1 
ATOM   1328  C CZ  . ARG A 1 179 ? 25.153  53.877  -23.347 1.00 49.46 ? 217 ARG A CZ  1 
ATOM   1329  N NH1 . ARG A 1 179 ? 23.815  53.812  -23.253 1.00 50.46 ? 217 ARG A NH1 1 
ATOM   1330  N NH2 . ARG A 1 179 ? 25.799  53.004  -24.124 1.00 48.96 ? 217 ARG A NH2 1 
ATOM   1331  N N   . ALA A 1 180 ? 24.774  56.915  -15.753 1.00 37.22 ? 218 ALA A N   1 
ATOM   1332  C CA  . ALA A 1 180 ? 25.221  57.639  -14.554 1.00 37.19 ? 218 ALA A CA  1 
ATOM   1333  C C   . ALA A 1 180 ? 25.852  56.650  -13.587 1.00 36.68 ? 218 ALA A C   1 
ATOM   1334  O O   . ALA A 1 180 ? 26.606  57.041  -12.675 1.00 37.77 ? 218 ALA A O   1 
ATOM   1335  C CB  . ALA A 1 180 ? 24.070  58.419  -13.899 1.00 36.83 ? 218 ALA A CB  1 
ATOM   1336  N N   . GLY A 1 181 ? 25.578  55.362  -13.782 1.00 35.90 ? 219 GLY A N   1 
ATOM   1337  C CA  . GLY A 1 181 ? 26.065  54.311  -12.861 1.00 34.73 ? 219 GLY A CA  1 
ATOM   1338  C C   . GLY A 1 181 ? 25.063  53.889  -11.797 1.00 34.38 ? 219 GLY A C   1 
ATOM   1339  O O   . GLY A 1 181 ? 25.420  53.201  -10.850 1.00 34.62 ? 219 GLY A O   1 
ATOM   1340  N N   . ASN A 1 182 ? 23.797  54.292  -11.945 1.00 34.85 ? 220 ASN A N   1 
ATOM   1341  C CA  . ASN A 1 182 ? 22.681  53.716  -11.173 1.00 34.22 ? 220 ASN A CA  1 
ATOM   1342  C C   . ASN A 1 182 ? 22.520  52.278  -11.594 1.00 34.47 ? 220 ASN A C   1 
ATOM   1343  O O   . ASN A 1 182 ? 22.837  51.945  -12.736 1.00 34.78 ? 220 ASN A O   1 
ATOM   1344  C CB  . ASN A 1 182 ? 21.382  54.454  -11.435 1.00 34.09 ? 220 ASN A CB  1 
ATOM   1345  C CG  . ASN A 1 182 ? 21.445  55.894  -11.017 1.00 34.01 ? 220 ASN A CG  1 
ATOM   1346  O OD1 . ASN A 1 182 ? 21.617  56.188  -9.836  1.00 33.87 ? 220 ASN A OD1 1 
ATOM   1347  N ND2 . ASN A 1 182 ? 21.322  56.804  -11.978 1.00 32.55 ? 220 ASN A ND2 1 
ATOM   1348  N N   . VAL A 1 183 ? 22.078  51.421  -10.684 1.00 34.10 ? 221 VAL A N   1 
ATOM   1349  C CA  . VAL A 1 183 ? 22.042  49.962  -10.946 1.00 34.75 ? 221 VAL A CA  1 
ATOM   1350  C C   . VAL A 1 183 ? 20.712  49.337  -10.473 1.00 34.39 ? 221 VAL A C   1 
ATOM   1351  O O   . VAL A 1 183 ? 20.154  49.756  -9.469  1.00 33.85 ? 221 VAL A O   1 
ATOM   1352  C CB  . VAL A 1 183 ? 23.274  49.272  -10.249 1.00 35.09 ? 221 VAL A CB  1 
ATOM   1353  C CG1 . VAL A 1 183 ? 23.090  47.781  -10.100 1.00 34.80 ? 221 VAL A CG1 1 
ATOM   1354  C CG2 . VAL A 1 183 ? 24.545  49.630  -11.032 1.00 35.01 ? 221 VAL A CG2 1 
ATOM   1355  N N   . ILE A 1 184 ? 20.227  48.354  -11.242 1.00 34.47 ? 222 ILE A N   1 
ATOM   1356  C CA  . ILE A 1 184 ? 19.082  47.523  -10.900 1.00 33.08 ? 222 ILE A CA  1 
ATOM   1357  C C   . ILE A 1 184 ? 19.436  46.017  -10.913 1.00 32.73 ? 222 ILE A C   1 
ATOM   1358  O O   . ILE A 1 184 ? 20.359  45.625  -11.544 1.00 32.91 ? 222 ILE A O   1 
ATOM   1359  C CB  . ILE A 1 184 ? 17.800  47.822  -11.820 1.00 33.59 ? 222 ILE A CB  1 
ATOM   1360  C CG1 . ILE A 1 184 ? 18.048  47.514  -13.303 1.00 32.36 ? 222 ILE A CG1 1 
ATOM   1361  C CG2 . ILE A 1 184 ? 17.262  49.244  -11.585 1.00 31.33 ? 222 ILE A CG2 1 
ATOM   1362  C CD1 . ILE A 1 184 ? 16.785  47.561  -14.123 1.00 32.45 ? 222 ILE A CD1 1 
ATOM   1363  N N   . PHE A 1 185 ? 18.682  45.220  -10.163 1.00 32.81 ? 223 PHE A N   1 
ATOM   1364  C CA  . PHE A 1 185 ? 18.850  43.796  -9.965  1.00 32.88 ? 223 PHE A CA  1 
ATOM   1365  C C   . PHE A 1 185 ? 17.579  43.078  -10.436 1.00 33.41 ? 223 PHE A C   1 
ATOM   1366  O O   . PHE A 1 185 ? 16.459  43.627  -10.377 1.00 33.69 ? 223 PHE A O   1 
ATOM   1367  C CB  . PHE A 1 185 ? 19.102  43.496  -8.468  1.00 33.60 ? 223 PHE A CB  1 
ATOM   1368  C CG  . PHE A 1 185 ? 20.333  44.165  -7.913  1.00 33.15 ? 223 PHE A CG  1 
ATOM   1369  C CD1 . PHE A 1 185 ? 21.554  43.573  -8.035  1.00 34.03 ? 223 PHE A CD1 1 
ATOM   1370  C CD2 . PHE A 1 185 ? 20.239  45.399  -7.280  1.00 33.58 ? 223 PHE A CD2 1 
ATOM   1371  C CE1 . PHE A 1 185 ? 22.694  44.213  -7.537  1.00 33.31 ? 223 PHE A CE1 1 
ATOM   1372  C CE2 . PHE A 1 185 ? 21.305  46.057  -6.845  1.00 32.43 ? 223 PHE A CE2 1 
ATOM   1373  C CZ  . PHE A 1 185 ? 22.569  45.442  -6.922  1.00 34.25 ? 223 PHE A CZ  1 
ATOM   1374  N N   . ARG A 1 186 ? 17.765  41.862  -10.950 1.00 34.55 ? 224 ARG A N   1 
ATOM   1375  C CA  . ARG A 1 186 ? 16.689  41.039  -11.511 1.00 34.06 ? 224 ARG A CA  1 
ATOM   1376  C C   . ARG A 1 186 ? 16.260  39.909  -10.598 1.00 34.33 ? 224 ARG A C   1 
ATOM   1377  O O   . ARG A 1 186 ? 17.067  39.057  -10.200 1.00 34.31 ? 224 ARG A O   1 
ATOM   1378  C CB  . ARG A 1 186 ? 17.143  40.439  -12.827 1.00 34.55 ? 224 ARG A CB  1 
ATOM   1379  C CG  . ARG A 1 186 ? 16.004  39.887  -13.697 1.00 34.25 ? 224 ARG A CG  1 
ATOM   1380  C CD  . ARG A 1 186 ? 16.518  39.639  -15.073 1.00 35.64 ? 224 ARG A CD  1 
ATOM   1381  N NE  . ARG A 1 186 ? 15.578  38.921  -15.923 1.00 36.78 ? 224 ARG A NE  1 
ATOM   1382  C CZ  . ARG A 1 186 ? 15.396  37.604  -15.908 1.00 33.99 ? 224 ARG A CZ  1 
ATOM   1383  N NH1 . ARG A 1 186 ? 14.537  37.048  -16.732 1.00 32.27 ? 224 ARG A NH1 1 
ATOM   1384  N NH2 . ARG A 1 186 ? 16.048  36.857  -15.046 1.00 32.14 ? 224 ARG A NH2 1 
ATOM   1385  N N   . LYS A 1 187 ? 14.982  39.892  -10.258 1.00 34.78 ? 225 LYS A N   1 
ATOM   1386  C CA  . LYS A 1 187 ? 14.417  38.780  -9.523  1.00 35.34 ? 225 LYS A CA  1 
ATOM   1387  C C   . LYS A 1 187 ? 15.187  38.558  -8.222  1.00 36.10 ? 225 LYS A C   1 
ATOM   1388  O O   . LYS A 1 187 ? 15.516  39.577  -7.562  1.00 36.47 ? 225 LYS A O   1 
ATOM   1389  C CB  . LYS A 1 187 ? 14.306  37.552  -10.426 1.00 35.37 ? 225 LYS A CB  1 
ATOM   1390  C CG  . LYS A 1 187 ? 13.199  37.742  -11.452 1.00 36.38 ? 225 LYS A CG  1 
ATOM   1391  C CD  . LYS A 1 187 ? 13.132  36.686  -12.507 1.00 37.08 ? 225 LYS A CD  1 
ATOM   1392  C CE  . LYS A 1 187 ? 12.157  37.116  -13.593 1.00 38.89 ? 225 LYS A CE  1 
ATOM   1393  N NZ  . LYS A 1 187 ? 11.701  35.947  -14.364 1.00 42.57 ? 225 LYS A NZ  1 
ATOM   1394  N N   . SER A 1 188 ? 15.427  37.288  -7.824  1.00 35.58 ? 226 SER A N   1 
ATOM   1395  C CA  . SER A 1 188 ? 16.163  36.960  -6.583  1.00 35.22 ? 226 SER A CA  1 
ATOM   1396  C C   . SER A 1 188 ? 17.705  37.054  -6.732  1.00 35.01 ? 226 SER A C   1 
ATOM   1397  O O   . SER A 1 188 ? 18.439  36.620  -5.848  1.00 35.66 ? 226 SER A O   1 
ATOM   1398  C CB  . SER A 1 188 ? 15.750  35.548  -6.072  1.00 35.43 ? 226 SER A CB  1 
ATOM   1399  O OG  . SER A 1 188 ? 16.321  34.467  -6.848  1.00 33.75 ? 226 SER A OG  1 
ATOM   1400  N N   . ALA A 1 189 ? 18.185  37.601  -7.846  1.00 34.61 ? 227 ALA A N   1 
ATOM   1401  C CA  . ALA A 1 189 ? 19.624  37.800  -8.090  1.00 34.11 ? 227 ALA A CA  1 
ATOM   1402  C C   . ALA A 1 189 ? 20.217  39.040  -7.351  1.00 34.75 ? 227 ALA A C   1 
ATOM   1403  O O   . ALA A 1 189 ? 21.451  39.280  -7.337  1.00 36.00 ? 227 ALA A O   1 
ATOM   1404  C CB  . ALA A 1 189 ? 19.875  37.868  -9.557  1.00 33.43 ? 227 ALA A CB  1 
ATOM   1405  N N   . ARG A 1 190 ? 19.339  39.796  -6.699  1.00 35.11 ? 228 ARG A N   1 
ATOM   1406  C CA  . ARG A 1 190 ? 19.682  40.885  -5.789  1.00 34.38 ? 228 ARG A CA  1 
ATOM   1407  C C   . ARG A 1 190 ? 20.422  40.415  -4.546  1.00 35.22 ? 228 ARG A C   1 
ATOM   1408  O O   . ARG A 1 190 ? 21.534  40.832  -4.326  1.00 37.70 ? 228 ARG A O   1 
ATOM   1409  C CB  . ARG A 1 190 ? 18.402  41.630  -5.406  1.00 33.67 ? 228 ARG A CB  1 
ATOM   1410  C CG  . ARG A 1 190 ? 18.656  42.899  -4.663  1.00 33.01 ? 228 ARG A CG  1 
ATOM   1411  C CD  . ARG A 1 190 ? 17.393  43.692  -4.283  1.00 34.13 ? 228 ARG A CD  1 
ATOM   1412  N NE  . ARG A 1 190 ? 16.397  43.787  -5.357  1.00 33.43 ? 228 ARG A NE  1 
ATOM   1413  C CZ  . ARG A 1 190 ? 15.324  44.565  -5.281  1.00 33.71 ? 228 ARG A CZ  1 
ATOM   1414  N NH1 . ARG A 1 190 ? 15.152  45.352  -4.232  1.00 32.12 ? 228 ARG A NH1 1 
ATOM   1415  N NH2 . ARG A 1 190 ? 14.435  44.571  -6.258  1.00 31.18 ? 228 ARG A NH2 1 
ATOM   1416  N N   . ASN A 1 191 ? 19.786  39.565  -3.735  1.00 35.55 ? 229 ASN A N   1 
ATOM   1417  C CA  . ASN A 1 191 ? 20.379  38.933  -2.552  1.00 35.47 ? 229 ASN A CA  1 
ATOM   1418  C C   . ASN A 1 191 ? 21.508  39.751  -1.839  1.00 35.34 ? 229 ASN A C   1 
ATOM   1419  O O   . ASN A 1 191 ? 21.233  40.843  -1.373  1.00 33.20 ? 229 ASN A O   1 
ATOM   1420  C CB  . ASN A 1 191 ? 20.756  37.443  -2.819  1.00 34.87 ? 229 ASN A CB  1 
ATOM   1421  C CG  . ASN A 1 191 ? 21.818  37.238  -3.911  1.00 36.27 ? 229 ASN A CG  1 
ATOM   1422  O OD1 . ASN A 1 191 ? 23.023  37.463  -3.689  1.00 31.67 ? 229 ASN A OD1 1 
ATOM   1423  N ND2 . ASN A 1 191 ? 21.384  36.718  -5.068  1.00 33.21 ? 229 ASN A ND2 1 
ATOM   1424  N N   . PHE A 1 192 ? 22.737  39.225  -1.765  1.00 34.96 ? 230 PHE A N   1 
ATOM   1425  C CA  . PHE A 1 192 ? 23.852  39.932  -1.090  1.00 34.65 ? 230 PHE A CA  1 
ATOM   1426  C C   . PHE A 1 192 ? 24.517  40.968  -1.959  1.00 34.60 ? 230 PHE A C   1 
ATOM   1427  O O   . PHE A 1 192 ? 25.192  41.830  -1.447  1.00 35.13 ? 230 PHE A O   1 
ATOM   1428  C CB  . PHE A 1 192 ? 24.881  38.929  -0.603  1.00 34.07 ? 230 PHE A CB  1 
ATOM   1429  C CG  . PHE A 1 192 ? 24.440  38.166  0.611   1.00 33.55 ? 230 PHE A CG  1 
ATOM   1430  C CD1 . PHE A 1 192 ? 23.682  37.027  0.485   1.00 34.93 ? 230 PHE A CD1 1 
ATOM   1431  C CD2 . PHE A 1 192 ? 24.795  38.589  1.882   1.00 34.30 ? 230 PHE A CD2 1 
ATOM   1432  C CE1 . PHE A 1 192 ? 23.276  36.318  1.588   1.00 36.08 ? 230 PHE A CE1 1 
ATOM   1433  C CE2 . PHE A 1 192 ? 24.392  37.889  2.980   1.00 34.33 ? 230 PHE A CE2 1 
ATOM   1434  C CZ  . PHE A 1 192 ? 23.603  36.760  2.832   1.00 34.73 ? 230 PHE A CZ  1 
ATOM   1435  N N   . ASN A 1 193 ? 24.328  40.897  -3.274  1.00 34.52 ? 231 ASN A N   1 
ATOM   1436  C CA  . ASN A 1 193 ? 24.873  41.926  -4.150  1.00 35.43 ? 231 ASN A CA  1 
ATOM   1437  C C   . ASN A 1 193 ? 24.551  43.364  -3.701  1.00 36.22 ? 231 ASN A C   1 
ATOM   1438  O O   . ASN A 1 193 ? 25.390  44.224  -3.663  1.00 35.54 ? 231 ASN A O   1 
ATOM   1439  C CB  . ASN A 1 193 ? 24.431  41.673  -5.609  1.00 35.11 ? 231 ASN A CB  1 
ATOM   1440  C CG  . ASN A 1 193 ? 25.133  40.523  -6.202  1.00 34.00 ? 231 ASN A CG  1 
ATOM   1441  O OD1 . ASN A 1 193 ? 26.335  40.573  -6.424  1.00 35.61 ? 231 ASN A OD1 1 
ATOM   1442  N ND2 . ASN A 1 193 ? 24.410  39.442  -6.450  1.00 36.63 ? 231 ASN A ND2 1 
ATOM   1443  N N   . LEU A 1 194 ? 23.314  43.603  -3.306  1.00 38.30 ? 232 LEU A N   1 
ATOM   1444  C CA  . LEU A 1 194 ? 22.897  44.941  -2.925  1.00 37.10 ? 232 LEU A CA  1 
ATOM   1445  C C   . LEU A 1 194 ? 23.622  45.514  -1.703  1.00 37.21 ? 232 LEU A C   1 
ATOM   1446  O O   . LEU A 1 194 ? 24.266  46.574  -1.817  1.00 38.14 ? 232 LEU A O   1 
ATOM   1447  C CB  . LEU A 1 194 ? 21.383  44.988  -2.799  1.00 37.29 ? 232 LEU A CB  1 
ATOM   1448  C CG  . LEU A 1 194 ? 20.761  46.364  -2.580  1.00 36.88 ? 232 LEU A CG  1 
ATOM   1449  C CD1 . LEU A 1 194 ? 19.354  46.474  -3.193  1.00 37.59 ? 232 LEU A CD1 1 
ATOM   1450  C CD2 . LEU A 1 194 ? 20.751  46.643  -1.117  1.00 38.61 ? 232 LEU A CD2 1 
ATOM   1451  N N   . PRO A 1 195 ? 23.538  44.858  -0.527  1.00 36.30 ? 233 PRO A N   1 
ATOM   1452  C CA  . PRO A 1 195 ? 24.307  45.430  0.563   1.00 35.73 ? 233 PRO A CA  1 
ATOM   1453  C C   . PRO A 1 195 ? 25.834  45.451  0.394   1.00 35.26 ? 233 PRO A C   1 
ATOM   1454  O O   . PRO A 1 195 ? 26.453  46.375  0.914   1.00 35.55 ? 233 PRO A O   1 
ATOM   1455  C CB  . PRO A 1 195 ? 23.870  44.597  1.802   1.00 35.50 ? 233 PRO A CB  1 
ATOM   1456  C CG  . PRO A 1 195 ? 23.398  43.338  1.250   1.00 35.55 ? 233 PRO A CG  1 
ATOM   1457  C CD  . PRO A 1 195 ? 22.742  43.699  -0.080  1.00 36.91 ? 233 PRO A CD  1 
ATOM   1458  N N   . MET A 1 196 ? 26.419  44.466  -0.293  1.00 34.33 ? 234 MET A N   1 
ATOM   1459  C CA  . MET A 1 196 ? 27.868  44.426  -0.531  1.00 34.65 ? 234 MET A CA  1 
ATOM   1460  C C   . MET A 1 196 ? 28.385  45.584  -1.378  1.00 35.55 ? 234 MET A C   1 
ATOM   1461  O O   . MET A 1 196 ? 29.544  45.979  -1.281  1.00 34.70 ? 234 MET A O   1 
ATOM   1462  C CB  . MET A 1 196 ? 28.295  43.108  -1.161  1.00 33.53 ? 234 MET A CB  1 
ATOM   1463  C CG  . MET A 1 196 ? 28.136  41.958  -0.273  1.00 33.34 ? 234 MET A CG  1 
ATOM   1464  S SD  . MET A 1 196 ? 28.603  40.495  -1.117  1.00 35.23 ? 234 MET A SD  1 
ATOM   1465  C CE  . MET A 1 196 ? 28.798  39.303  0.238   1.00 32.23 ? 234 MET A CE  1 
ATOM   1466  N N   . CYS A 1 197 ? 27.491  46.115  -2.199  1.00 36.26 ? 235 CYS A N   1 
ATOM   1467  C CA  . CYS A 1 197 ? 27.730  47.311  -2.962  1.00 38.21 ? 235 CYS A CA  1 
ATOM   1468  C C   . CYS A 1 197 ? 28.008  48.576  -2.158  1.00 36.88 ? 235 CYS A C   1 
ATOM   1469  O O   . CYS A 1 197 ? 28.635  49.519  -2.649  1.00 36.78 ? 235 CYS A O   1 
ATOM   1470  C CB  . CYS A 1 197 ? 26.469  47.556  -3.792  1.00 40.05 ? 235 CYS A CB  1 
ATOM   1471  S SG  . CYS A 1 197 ? 26.837  47.834  -5.428  1.00 45.79 ? 235 CYS A SG  1 
ATOM   1472  N N   . LYS A 1 198 ? 27.519  48.591  -0.930  1.00 36.77 ? 236 LYS A N   1 
ATOM   1473  C CA  . LYS A 1 198 ? 27.639  49.699  -0.001  1.00 36.46 ? 236 LYS A CA  1 
ATOM   1474  C C   . LYS A 1 198 ? 28.793  49.576  1.021   1.00 35.86 ? 236 LYS A C   1 
ATOM   1475  O O   . LYS A 1 198 ? 29.041  50.510  1.736   1.00 35.64 ? 236 LYS A O   1 
ATOM   1476  C CB  . LYS A 1 198 ? 26.318  49.787  0.783   1.00 37.34 ? 236 LYS A CB  1 
ATOM   1477  C CG  . LYS A 1 198 ? 25.061  49.821  -0.142  1.00 37.65 ? 236 LYS A CG  1 
ATOM   1478  C CD  . LYS A 1 198 ? 23.793  49.931  0.621   1.00 38.40 ? 236 LYS A CD  1 
ATOM   1479  C CE  . LYS A 1 198 ? 22.623  49.892  -0.354  1.00 40.81 ? 236 LYS A CE  1 
ATOM   1480  N NZ  . LYS A 1 198 ? 21.378  50.194  0.353   1.00 42.83 ? 236 LYS A NZ  1 
ATOM   1481  N N   . ALA A 1 199 ? 29.465  48.429  1.097   1.00 34.38 ? 237 ALA A N   1 
ATOM   1482  C CA  . ALA A 1 199 ? 30.281  48.052  2.236   1.00 34.87 ? 237 ALA A CA  1 
ATOM   1483  C C   . ALA A 1 199 ? 31.772  47.829  1.911   1.00 34.71 ? 237 ALA A C   1 
ATOM   1484  O O   . ALA A 1 199 ? 32.520  47.331  2.738   1.00 36.95 ? 237 ALA A O   1 
ATOM   1485  C CB  . ALA A 1 199 ? 29.675  46.793  2.981   1.00 33.63 ? 237 ALA A CB  1 
ATOM   1486  N N   . ALA A 1 200 ? 32.241  48.302  0.781   1.00 34.66 ? 238 ALA A N   1 
ATOM   1487  C CA  . ALA A 1 200 ? 33.634  48.090  0.363   1.00 34.12 ? 238 ALA A CA  1 
ATOM   1488  C C   . ALA A 1 200 ? 34.207  49.417  -0.035  1.00 34.41 ? 238 ALA A C   1 
ATOM   1489  O O   . ALA A 1 200 ? 33.464  50.322  -0.459  1.00 36.40 ? 238 ALA A O   1 
ATOM   1490  C CB  . ALA A 1 200 ? 33.678  47.137  -0.792  1.00 33.39 ? 238 ALA A CB  1 
ATOM   1491  N N   . GLU A 1 201 ? 35.512  49.551  0.107   1.00 34.50 ? 239 GLU A N   1 
ATOM   1492  C CA  . GLU A 1 201 ? 36.223  50.756  -0.300  1.00 35.39 ? 239 GLU A CA  1 
ATOM   1493  C C   . GLU A 1 201 ? 36.121  50.989  -1.809  1.00 35.44 ? 239 GLU A C   1 
ATOM   1494  O O   . GLU A 1 201 ? 36.001  52.121  -2.228  1.00 36.96 ? 239 GLU A O   1 
ATOM   1495  C CB  . GLU A 1 201 ? 37.700  50.754  0.164   1.00 34.54 ? 239 GLU A CB  1 
ATOM   1496  N N   . THR A 1 202 ? 36.168  49.918  -2.601  1.00 34.97 ? 240 THR A N   1 
ATOM   1497  C CA  . THR A 1 202 ? 36.007  49.975  -4.039  1.00 33.88 ? 240 THR A CA  1 
ATOM   1498  C C   . THR A 1 202 ? 35.052  48.865  -4.471  1.00 34.36 ? 240 THR A C   1 
ATOM   1499  O O   . THR A 1 202 ? 35.385  47.677  -4.391  1.00 33.32 ? 240 THR A O   1 
ATOM   1500  C CB  . THR A 1 202 ? 37.357  49.725  -4.747  1.00 33.90 ? 240 THR A CB  1 
ATOM   1501  O OG1 . THR A 1 202 ? 38.332  50.652  -4.250  1.00 34.93 ? 240 THR A OG1 1 
ATOM   1502  C CG2 . THR A 1 202 ? 37.217  49.833  -6.278  1.00 31.71 ? 240 THR A CG2 1 
ATOM   1503  N N   . THR A 1 203 ? 33.875  49.267  -4.936  1.00 34.56 ? 241 THR A N   1 
ATOM   1504  C CA  . THR A 1 203 ? 32.869  48.348  -5.434  1.00 34.56 ? 241 THR A CA  1 
ATOM   1505  C C   . THR A 1 203 ? 33.006  48.265  -6.967  1.00 34.80 ? 241 THR A C   1 
ATOM   1506  O O   . THR A 1 203 ? 33.184  49.278  -7.669  1.00 34.43 ? 241 THR A O   1 
ATOM   1507  C CB  . THR A 1 203 ? 31.453  48.798  -4.999  1.00 35.34 ? 241 THR A CB  1 
ATOM   1508  O OG1 . THR A 1 203 ? 31.265  50.122  -5.474  1.00 39.96 ? 241 THR A OG1 1 
ATOM   1509  C CG2 . THR A 1 203 ? 31.284  48.784  -3.484  1.00 32.11 ? 241 THR A CG2 1 
ATOM   1510  N N   . VAL A 1 204 ? 33.051  47.032  -7.474  1.00 34.49 ? 242 VAL A N   1 
ATOM   1511  C CA  . VAL A 1 204 ? 33.150  46.775  -8.912  1.00 33.43 ? 242 VAL A CA  1 
ATOM   1512  C C   . VAL A 1 204 ? 31.870  46.010  -9.247  1.00 32.82 ? 242 VAL A C   1 
ATOM   1513  O O   . VAL A 1 204 ? 31.651  44.954  -8.684  1.00 32.62 ? 242 VAL A O   1 
ATOM   1514  C CB  . VAL A 1 204 ? 34.456  45.957  -9.306  1.00 33.18 ? 242 VAL A CB  1 
ATOM   1515  C CG1 . VAL A 1 204 ? 34.663  45.963  -10.809 1.00 34.37 ? 242 VAL A CG1 1 
ATOM   1516  C CG2 . VAL A 1 204 ? 35.675  46.485  -8.602  1.00 30.47 ? 242 VAL A CG2 1 
ATOM   1517  N N   . VAL A 1 205 ? 31.031  46.585  -10.130 1.00 31.95 ? 243 VAL A N   1 
ATOM   1518  C CA  . VAL A 1 205 ? 29.791  45.974  -10.563 1.00 31.21 ? 243 VAL A CA  1 
ATOM   1519  C C   . VAL A 1 205 ? 29.894  45.530  -12.004 1.00 31.26 ? 243 VAL A C   1 
ATOM   1520  O O   . VAL A 1 205 ? 30.328  46.280  -12.856 1.00 31.78 ? 243 VAL A O   1 
ATOM   1521  C CB  . VAL A 1 205 ? 28.571  46.965  -10.414 1.00 31.44 ? 243 VAL A CB  1 
ATOM   1522  C CG1 . VAL A 1 205 ? 27.249  46.313  -10.804 1.00 32.21 ? 243 VAL A CG1 1 
ATOM   1523  C CG2 . VAL A 1 205 ? 28.477  47.503  -9.022  1.00 28.64 ? 243 VAL A CG2 1 
ATOM   1524  N N   . GLU A 1 206 ? 29.497  44.299  -12.276 1.00 30.70 ? 244 GLU A N   1 
ATOM   1525  C CA  . GLU A 1 206 ? 29.243  43.854  -13.640 1.00 31.09 ? 244 GLU A CA  1 
ATOM   1526  C C   . GLU A 1 206 ? 27.758  43.723  -13.923 1.00 31.24 ? 244 GLU A C   1 
ATOM   1527  O O   . GLU A 1 206 ? 26.991  43.229  -13.098 1.00 30.33 ? 244 GLU A O   1 
ATOM   1528  C CB  . GLU A 1 206 ? 29.923  42.515  -13.918 1.00 32.16 ? 244 GLU A CB  1 
ATOM   1529  C CG  . GLU A 1 206 ? 29.456  41.337  -13.096 1.00 31.91 ? 244 GLU A CG  1 
ATOM   1530  C CD  . GLU A 1 206 ? 30.186  40.097  -13.493 1.00 35.88 ? 244 GLU A CD  1 
ATOM   1531  O OE1 . GLU A 1 206 ? 31.207  39.834  -12.832 1.00 36.39 ? 244 GLU A OE1 1 
ATOM   1532  O OE2 . GLU A 1 206 ? 29.799  39.446  -14.503 1.00 36.44 ? 244 GLU A OE2 1 
ATOM   1533  N N   . VAL A 1 207 ? 27.358  44.212  -15.086 1.00 31.31 ? 245 VAL A N   1 
ATOM   1534  C CA  . VAL A 1 207 ? 25.962  44.262  -15.481 1.00 30.78 ? 245 VAL A CA  1 
ATOM   1535  C C   . VAL A 1 207 ? 25.859  43.565  -16.839 1.00 31.79 ? 245 VAL A C   1 
ATOM   1536  O O   . VAL A 1 207 ? 26.865  43.332  -17.505 1.00 31.87 ? 245 VAL A O   1 
ATOM   1537  C CB  . VAL A 1 207 ? 25.425  45.729  -15.560 1.00 30.51 ? 245 VAL A CB  1 
ATOM   1538  C CG1 . VAL A 1 207 ? 25.487  46.414  -14.169 1.00 28.79 ? 245 VAL A CG1 1 
ATOM   1539  C CG2 . VAL A 1 207 ? 26.178  46.539  -16.625 1.00 28.20 ? 245 VAL A CG2 1 
ATOM   1540  N N   . GLU A 1 208 ? 24.636  43.238  -17.246 1.00 32.88 ? 246 GLU A N   1 
ATOM   1541  C CA  . GLU A 1 208 ? 24.398  42.565  -18.511 1.00 33.92 ? 246 GLU A CA  1 
ATOM   1542  C C   . GLU A 1 208 ? 24.058  43.524  -19.633 1.00 33.65 ? 246 GLU A C   1 
ATOM   1543  O O   . GLU A 1 208 ? 24.173  43.169  -20.810 1.00 32.29 ? 246 GLU A O   1 
ATOM   1544  C CB  . GLU A 1 208 ? 23.266  41.579  -18.363 1.00 34.32 ? 246 GLU A CB  1 
ATOM   1545  C CG  . GLU A 1 208 ? 23.443  40.600  -17.228 1.00 36.96 ? 246 GLU A CG  1 
ATOM   1546  C CD  . GLU A 1 208 ? 22.210  39.785  -17.048 1.00 37.51 ? 246 GLU A CD  1 
ATOM   1547  O OE1 . GLU A 1 208 ? 21.387  39.826  -17.963 1.00 39.53 ? 246 GLU A OE1 1 
ATOM   1548  O OE2 . GLU A 1 208 ? 22.055  39.117  -15.999 1.00 42.79 ? 246 GLU A OE2 1 
ATOM   1549  N N   . GLU A 1 209 ? 23.613  44.717  -19.259 1.00 34.37 ? 247 GLU A N   1 
ATOM   1550  C CA  . GLU A 1 209 ? 23.282  45.760  -20.229 1.00 35.29 ? 247 GLU A CA  1 
ATOM   1551  C C   . GLU A 1 209 ? 23.511  47.129  -19.603 1.00 34.95 ? 247 GLU A C   1 
ATOM   1552  O O   . GLU A 1 209 ? 23.186  47.339  -18.429 1.00 34.59 ? 247 GLU A O   1 
ATOM   1553  C CB  . GLU A 1 209 ? 21.818  45.627  -20.678 1.00 35.09 ? 247 GLU A CB  1 
ATOM   1554  C CG  . GLU A 1 209 ? 21.512  46.444  -21.944 1.00 37.00 ? 247 GLU A CG  1 
ATOM   1555  C CD  . GLU A 1 209 ? 20.043  46.527  -22.302 1.00 38.81 ? 247 GLU A CD  1 
ATOM   1556  O OE1 . GLU A 1 209 ? 19.205  45.757  -21.746 1.00 42.73 ? 247 GLU A OE1 1 
ATOM   1557  O OE2 . GLU A 1 209 ? 19.729  47.401  -23.167 1.00 46.51 ? 247 GLU A OE2 1 
ATOM   1558  N N   . ILE A 1 210 ? 24.092  48.041  -20.364 1.00 34.54 ? 248 ILE A N   1 
ATOM   1559  C CA  . ILE A 1 210 ? 24.156  49.436  -19.970 1.00 35.23 ? 248 ILE A CA  1 
ATOM   1560  C C   . ILE A 1 210 ? 23.124  50.239  -20.753 1.00 35.34 ? 248 ILE A C   1 
ATOM   1561  O O   . ILE A 1 210 ? 23.082  50.178  -21.965 1.00 35.33 ? 248 ILE A O   1 
ATOM   1562  C CB  . ILE A 1 210 ? 25.559  50.026  -20.185 1.00 35.43 ? 248 ILE A CB  1 
ATOM   1563  C CG1 . ILE A 1 210 ? 26.523  49.489  -19.117 1.00 35.44 ? 248 ILE A CG1 1 
ATOM   1564  C CG2 . ILE A 1 210 ? 25.488  51.563  -20.149 1.00 35.13 ? 248 ILE A CG2 1 
ATOM   1565  C CD1 . ILE A 1 210 ? 27.924  49.380  -19.605 1.00 36.03 ? 248 ILE A CD1 1 
ATOM   1566  N N   . VAL A 1 211 ? 22.293  50.997  -20.051 1.00 36.03 ? 249 VAL A N   1 
ATOM   1567  C CA  . VAL A 1 211 ? 21.204  51.740  -20.686 1.00 35.37 ? 249 VAL A CA  1 
ATOM   1568  C C   . VAL A 1 211 ? 21.416  53.229  -20.456 1.00 36.26 ? 249 VAL A C   1 
ATOM   1569  O O   . VAL A 1 211 ? 22.361  53.625  -19.737 1.00 34.92 ? 249 VAL A O   1 
ATOM   1570  C CB  . VAL A 1 211 ? 19.817  51.265  -20.183 1.00 36.40 ? 249 VAL A CB  1 
ATOM   1571  C CG1 . VAL A 1 211 ? 19.631  49.786  -20.548 1.00 34.99 ? 249 VAL A CG1 1 
ATOM   1572  C CG2 . VAL A 1 211 ? 19.624  51.503  -18.638 1.00 32.91 ? 249 VAL A CG2 1 
ATOM   1573  N N   . ASP A 1 212 ? 20.592  54.039  -21.138 1.00 36.49 ? 250 ASP A N   1 
ATOM   1574  C CA  . ASP A 1 212 ? 20.649  55.503  -21.052 1.00 37.32 ? 250 ASP A CA  1 
ATOM   1575  C C   . ASP A 1 212 ? 20.201  56.040  -19.686 1.00 37.21 ? 250 ASP A C   1 
ATOM   1576  O O   . ASP A 1 212 ? 19.311  55.485  -19.058 1.00 37.14 ? 250 ASP A O   1 
ATOM   1577  C CB  . ASP A 1 212 ? 19.760  56.143  -22.109 1.00 37.36 ? 250 ASP A CB  1 
ATOM   1578  C CG  . ASP A 1 212 ? 20.275  55.948  -23.530 1.00 41.10 ? 250 ASP A CG  1 
ATOM   1579  O OD1 . ASP A 1 212 ? 21.501  55.710  -23.739 1.00 46.07 ? 250 ASP A OD1 1 
ATOM   1580  O OD2 . ASP A 1 212 ? 19.430  56.042  -24.455 1.00 42.95 ? 250 ASP A OD2 1 
ATOM   1581  N N   . ILE A 1 213 ? 20.824  57.129  -19.251 1.00 38.09 ? 251 ILE A N   1 
ATOM   1582  C CA  . ILE A 1 213 ? 20.296  57.949  -18.153 1.00 38.61 ? 251 ILE A CA  1 
ATOM   1583  C C   . ILE A 1 213 ? 18.832  58.284  -18.449 1.00 39.02 ? 251 ILE A C   1 
ATOM   1584  O O   . ILE A 1 213 ? 18.524  58.825  -19.509 1.00 39.17 ? 251 ILE A O   1 
ATOM   1585  C CB  . ILE A 1 213 ? 21.084  59.272  -17.975 1.00 38.55 ? 251 ILE A CB  1 
ATOM   1586  C CG1 . ILE A 1 213 ? 22.496  58.994  -17.450 1.00 39.51 ? 251 ILE A CG1 1 
ATOM   1587  C CG2 . ILE A 1 213 ? 20.379  60.204  -17.007 1.00 37.72 ? 251 ILE A CG2 1 
ATOM   1588  C CD1 . ILE A 1 213 ? 23.502  60.131  -17.725 1.00 37.72 ? 251 ILE A CD1 1 
ATOM   1589  N N   . GLY A 1 214 ? 17.942  57.974  -17.506 1.00 39.19 ? 252 GLY A N   1 
ATOM   1590  C CA  . GLY A 1 214 ? 16.507  58.133  -17.706 1.00 39.30 ? 252 GLY A CA  1 
ATOM   1591  C C   . GLY A 1 214 ? 15.729  56.857  -18.009 1.00 39.38 ? 252 GLY A C   1 
ATOM   1592  O O   . GLY A 1 214 ? 14.505  56.895  -18.029 1.00 40.15 ? 252 GLY A O   1 
ATOM   1593  N N   . ALA A 1 215 ? 16.411  55.732  -18.239 1.00 38.91 ? 253 ALA A N   1 
ATOM   1594  C CA  . ALA A 1 215 ? 15.736  54.426  -18.432 1.00 38.46 ? 253 ALA A CA  1 
ATOM   1595  C C   . ALA A 1 215 ? 15.197  53.828  -17.127 1.00 38.14 ? 253 ALA A C   1 
ATOM   1596  O O   . ALA A 1 215 ? 14.449  52.832  -17.154 1.00 39.24 ? 253 ALA A O   1 
ATOM   1597  C CB  . ALA A 1 215 ? 16.680  53.433  -19.084 1.00 37.84 ? 253 ALA A CB  1 
ATOM   1598  N N   . PHE A 1 216 ? 15.626  54.375  -15.987 1.00 36.89 ? 254 PHE A N   1 
ATOM   1599  C CA  . PHE A 1 216 ? 15.102  53.974  -14.689 1.00 35.70 ? 254 PHE A CA  1 
ATOM   1600  C C   . PHE A 1 216 ? 14.269  55.120  -14.081 1.00 35.08 ? 254 PHE A C   1 
ATOM   1601  O O   . PHE A 1 216 ? 14.725  56.261  -14.012 1.00 35.40 ? 254 PHE A O   1 
ATOM   1602  C CB  . PHE A 1 216 ? 16.224  53.655  -13.694 1.00 35.57 ? 254 PHE A CB  1 
ATOM   1603  C CG  . PHE A 1 216 ? 17.273  52.674  -14.183 1.00 35.78 ? 254 PHE A CG  1 
ATOM   1604  C CD1 . PHE A 1 216 ? 16.971  51.624  -15.028 1.00 37.15 ? 254 PHE A CD1 1 
ATOM   1605  C CD2 . PHE A 1 216 ? 18.579  52.774  -13.715 1.00 36.92 ? 254 PHE A CD2 1 
ATOM   1606  C CE1 . PHE A 1 216 ? 17.975  50.735  -15.425 1.00 36.80 ? 254 PHE A CE1 1 
ATOM   1607  C CE2 . PHE A 1 216 ? 19.567  51.878  -14.123 1.00 33.94 ? 254 PHE A CE2 1 
ATOM   1608  C CZ  . PHE A 1 216 ? 19.262  50.888  -14.967 1.00 34.06 ? 254 PHE A CZ  1 
ATOM   1609  N N   . ALA A 1 217 ? 13.064  54.806  -13.631 1.00 34.55 ? 255 ALA A N   1 
ATOM   1610  C CA  . ALA A 1 217 ? 12.289  55.728  -12.816 1.00 34.69 ? 255 ALA A CA  1 
ATOM   1611  C C   . ALA A 1 217 ? 13.143  56.000  -11.583 1.00 34.58 ? 255 ALA A C   1 
ATOM   1612  O O   . ALA A 1 217 ? 13.808  55.077  -11.059 1.00 33.03 ? 255 ALA A O   1 
ATOM   1613  C CB  . ALA A 1 217 ? 10.945  55.141  -12.411 1.00 34.39 ? 255 ALA A CB  1 
ATOM   1614  N N   . PRO A 1 218 ? 13.159  57.272  -11.139 1.00 33.64 ? 256 PRO A N   1 
ATOM   1615  C CA  . PRO A 1 218 ? 14.012  57.602  -10.000 1.00 33.53 ? 256 PRO A CA  1 
ATOM   1616  C C   . PRO A 1 218 ? 13.625  56.879  -8.713  1.00 32.81 ? 256 PRO A C   1 
ATOM   1617  O O   . PRO A 1 218 ? 14.469  56.669  -7.877  1.00 31.52 ? 256 PRO A O   1 
ATOM   1618  C CB  . PRO A 1 218 ? 13.874  59.127  -9.871  1.00 33.22 ? 256 PRO A CB  1 
ATOM   1619  C CG  . PRO A 1 218 ? 12.668  59.498  -10.569 1.00 33.70 ? 256 PRO A CG  1 
ATOM   1620  C CD  . PRO A 1 218 ? 12.431  58.446  -11.651 1.00 34.44 ? 256 PRO A CD  1 
ATOM   1621  N N   . GLU A 1 219 ? 12.361  56.498  -8.582  1.00 34.21 ? 257 GLU A N   1 
ATOM   1622  C CA  . GLU A 1 219 ? 11.882  55.699  -7.454  1.00 35.83 ? 257 GLU A CA  1 
ATOM   1623  C C   . GLU A 1 219 ? 12.356  54.234  -7.458  1.00 36.86 ? 257 GLU A C   1 
ATOM   1624  O O   . GLU A 1 219 ? 12.274  53.554  -6.441  1.00 37.20 ? 257 GLU A O   1 
ATOM   1625  C CB  . GLU A 1 219 ? 10.347  55.705  -7.433  1.00 35.61 ? 257 GLU A CB  1 
ATOM   1626  C CG  . GLU A 1 219 ? 9.736   57.000  -6.953  1.00 35.97 ? 257 GLU A CG  1 
ATOM   1627  C CD  . GLU A 1 219 ? 9.423   57.950  -8.082  1.00 37.32 ? 257 GLU A CD  1 
ATOM   1628  O OE1 . GLU A 1 219 ? 9.928   57.728  -9.227  1.00 35.61 ? 257 GLU A OE1 1 
ATOM   1629  O OE2 . GLU A 1 219 ? 8.673   58.909  -7.812  1.00 37.79 ? 257 GLU A OE2 1 
ATOM   1630  N N   . ASP A 1 220 ? 12.835  53.735  -8.597  1.00 37.94 ? 258 ASP A N   1 
ATOM   1631  C CA  . ASP A 1 220 ? 13.139  52.293  -8.750  1.00 38.07 ? 258 ASP A CA  1 
ATOM   1632  C C   . ASP A 1 220 ? 14.601  51.981  -9.068  1.00 37.64 ? 258 ASP A C   1 
ATOM   1633  O O   . ASP A 1 220 ? 14.906  51.009  -9.757  1.00 37.29 ? 258 ASP A O   1 
ATOM   1634  C CB  . ASP A 1 220 ? 12.231  51.736  -9.841  1.00 38.47 ? 258 ASP A CB  1 
ATOM   1635  C CG  . ASP A 1 220 ? 10.750  52.082  -9.594  1.00 40.34 ? 258 ASP A CG  1 
ATOM   1636  O OD1 . ASP A 1 220 ? 10.260  51.878  -8.440  1.00 41.78 ? 258 ASP A OD1 1 
ATOM   1637  O OD2 . ASP A 1 220 ? 10.108  52.566  -10.562 1.00 43.60 ? 258 ASP A OD2 1 
ATOM   1638  N N   . ILE A 1 221 ? 15.497  52.808  -8.557  1.00 37.09 ? 259 ILE A N   1 
ATOM   1639  C CA  . ILE A 1 221 ? 16.940  52.588  -8.679  1.00 36.81 ? 259 ILE A CA  1 
ATOM   1640  C C   . ILE A 1 221 ? 17.302  51.832  -7.393  1.00 38.23 ? 259 ILE A C   1 
ATOM   1641  O O   . ILE A 1 221 ? 17.055  52.339  -6.299  1.00 39.47 ? 259 ILE A O   1 
ATOM   1642  C CB  . ILE A 1 221 ? 17.668  53.939  -8.885  1.00 36.07 ? 259 ILE A CB  1 
ATOM   1643  C CG1 . ILE A 1 221 ? 17.405  54.445  -10.328 1.00 34.58 ? 259 ILE A CG1 1 
ATOM   1644  C CG2 . ILE A 1 221 ? 19.140  53.826  -8.677  1.00 34.41 ? 259 ILE A CG2 1 
ATOM   1645  C CD1 . ILE A 1 221 ? 17.658  55.902  -10.549 1.00 33.57 ? 259 ILE A CD1 1 
ATOM   1646  N N   . HIS A 1 222 ? 17.802  50.601  -7.540  1.00 38.07 ? 260 HIS A N   1 
ATOM   1647  C CA  . HIS A 1 222 ? 18.011  49.693  -6.415  1.00 37.65 ? 260 HIS A CA  1 
ATOM   1648  C C   . HIS A 1 222 ? 19.313  50.048  -5.727  1.00 37.18 ? 260 HIS A C   1 
ATOM   1649  O O   . HIS A 1 222 ? 19.389  50.076  -4.492  1.00 35.90 ? 260 HIS A O   1 
ATOM   1650  C CB  . HIS A 1 222 ? 18.035  48.235  -6.891  1.00 37.71 ? 260 HIS A CB  1 
ATOM   1651  C CG  . HIS A 1 222 ? 16.768  47.787  -7.575  1.00 37.52 ? 260 HIS A CG  1 
ATOM   1652  N ND1 . HIS A 1 222 ? 16.728  46.708  -8.425  1.00 38.82 ? 260 HIS A ND1 1 
ATOM   1653  C CD2 . HIS A 1 222 ? 15.508  48.265  -7.532  1.00 38.11 ? 260 HIS A CD2 1 
ATOM   1654  C CE1 . HIS A 1 222 ? 15.505  46.538  -8.878  1.00 38.98 ? 260 HIS A CE1 1 
ATOM   1655  N NE2 . HIS A 1 222 ? 14.742  47.474  -8.350  1.00 41.60 ? 260 HIS A NE2 1 
ATOM   1656  N N   . ILE A 1 223 ? 20.332  50.352  -6.545  1.00 36.88 ? 261 ILE A N   1 
ATOM   1657  C CA  . ILE A 1 223 ? 21.572  50.934  -6.065  1.00 35.98 ? 261 ILE A CA  1 
ATOM   1658  C C   . ILE A 1 223 ? 21.860  52.306  -6.685  1.00 35.42 ? 261 ILE A C   1 
ATOM   1659  O O   . ILE A 1 223 ? 22.176  52.411  -7.865  1.00 36.03 ? 261 ILE A O   1 
ATOM   1660  C CB  . ILE A 1 223 ? 22.773  49.949  -6.198  1.00 35.91 ? 261 ILE A CB  1 
ATOM   1661  C CG1 . ILE A 1 223 ? 22.726  48.931  -5.069  1.00 38.03 ? 261 ILE A CG1 1 
ATOM   1662  C CG2 . ILE A 1 223 ? 24.124  50.659  -6.033  1.00 35.21 ? 261 ILE A CG2 1 
ATOM   1663  C CD1 . ILE A 1 223 ? 22.936  49.548  -3.657  1.00 36.29 ? 261 ILE A CD1 1 
ATOM   1664  N N   . PRO A 1 224 ? 21.751  53.387  -5.885  1.00 34.54 ? 262 PRO A N   1 
ATOM   1665  C CA  . PRO A 1 224 ? 22.102  54.654  -6.492  1.00 34.39 ? 262 PRO A CA  1 
ATOM   1666  C C   . PRO A 1 224 ? 23.607  54.716  -6.840  1.00 34.10 ? 262 PRO A C   1 
ATOM   1667  O O   . PRO A 1 224 ? 24.423  54.037  -6.202  1.00 33.18 ? 262 PRO A O   1 
ATOM   1668  C CB  . PRO A 1 224 ? 21.690  55.670  -5.435  1.00 34.03 ? 262 PRO A CB  1 
ATOM   1669  C CG  . PRO A 1 224 ? 20.706  54.893  -4.567  1.00 35.16 ? 262 PRO A CG  1 
ATOM   1670  C CD  . PRO A 1 224 ? 21.287  53.575  -4.513  1.00 33.99 ? 262 PRO A CD  1 
ATOM   1671  N N   . GLN A 1 225 ? 23.927  55.479  -7.891  1.00 33.69 ? 263 GLN A N   1 
ATOM   1672  C CA  . GLN A 1 225 ? 25.284  55.614  -8.445  1.00 33.72 ? 263 GLN A CA  1 
ATOM   1673  C C   . GLN A 1 225 ? 26.380  55.965  -7.439  1.00 33.93 ? 263 GLN A C   1 
ATOM   1674  O O   . GLN A 1 225 ? 27.558  55.807  -7.735  1.00 33.70 ? 263 GLN A O   1 
ATOM   1675  C CB  . GLN A 1 225 ? 25.287  56.737  -9.467  1.00 33.67 ? 263 GLN A CB  1 
ATOM   1676  C CG  . GLN A 1 225 ? 24.890  58.092  -8.872  1.00 34.78 ? 263 GLN A CG  1 
ATOM   1677  C CD  . GLN A 1 225 ? 25.038  59.202  -9.873  1.00 38.27 ? 263 GLN A CD  1 
ATOM   1678  O OE1 . GLN A 1 225 ? 26.147  59.507  -10.290 1.00 39.11 ? 263 GLN A OE1 1 
ATOM   1679  N NE2 . GLN A 1 225 ? 23.920  59.806  -10.274 1.00 39.08 ? 263 GLN A NE2 1 
ATOM   1680  N N   . ILE A 1 226 ? 25.993  56.515  -6.283  1.00 34.27 ? 264 ILE A N   1 
ATOM   1681  C CA  . ILE A 1 226 ? 26.962  56.924  -5.248  1.00 33.97 ? 264 ILE A CA  1 
ATOM   1682  C C   . ILE A 1 226 ? 27.751  55.733  -4.730  1.00 33.88 ? 264 ILE A C   1 
ATOM   1683  O O   . ILE A 1 226 ? 28.853  55.893  -4.249  1.00 34.78 ? 264 ILE A O   1 
ATOM   1684  C CB  . ILE A 1 226 ? 26.246  57.709  -4.105  1.00 34.11 ? 264 ILE A CB  1 
ATOM   1685  C CG1 . ILE A 1 226 ? 27.257  58.354  -3.135  1.00 34.61 ? 264 ILE A CG1 1 
ATOM   1686  C CG2 . ILE A 1 226 ? 25.236  56.844  -3.440  1.00 33.22 ? 264 ILE A CG2 1 
ATOM   1687  C CD1 . ILE A 1 226 ? 26.645  59.448  -2.264  1.00 32.57 ? 264 ILE A CD1 1 
ATOM   1688  N N   . TYR A 1 227 ? 27.197  54.540  -4.888  1.00 33.59 ? 265 TYR A N   1 
ATOM   1689  C CA  . TYR A 1 227 ? 27.777  53.297  -4.373  1.00 33.10 ? 265 TYR A CA  1 
ATOM   1690  C C   . TYR A 1 227 ? 28.587  52.514  -5.407  1.00 33.74 ? 265 TYR A C   1 
ATOM   1691  O O   . TYR A 1 227 ? 29.297  51.579  -5.026  1.00 32.83 ? 265 TYR A O   1 
ATOM   1692  C CB  . TYR A 1 227 ? 26.654  52.349  -3.877  1.00 33.25 ? 265 TYR A CB  1 
ATOM   1693  C CG  . TYR A 1 227 ? 25.923  52.816  -2.637  1.00 31.11 ? 265 TYR A CG  1 
ATOM   1694  C CD1 . TYR A 1 227 ? 26.622  53.044  -1.455  1.00 31.06 ? 265 TYR A CD1 1 
ATOM   1695  C CD2 . TYR A 1 227 ? 24.542  52.993  -2.620  1.00 31.78 ? 265 TYR A CD2 1 
ATOM   1696  C CE1 . TYR A 1 227 ? 25.978  53.491  -0.305  1.00 32.49 ? 265 TYR A CE1 1 
ATOM   1697  C CE2 . TYR A 1 227 ? 23.867  53.457  -1.440  1.00 29.59 ? 265 TYR A CE2 1 
ATOM   1698  C CZ  . TYR A 1 227 ? 24.617  53.694  -0.300  1.00 30.60 ? 265 TYR A CZ  1 
ATOM   1699  O OH  . TYR A 1 227 ? 24.090  54.104  0.908   1.00 34.00 ? 265 TYR A OH  1 
ATOM   1700  N N   . VAL A 1 228 ? 28.480  52.895  -6.687  1.00 33.55 ? 266 VAL A N   1 
ATOM   1701  C CA  . VAL A 1 228 ? 29.129  52.184  -7.791  1.00 34.40 ? 266 VAL A CA  1 
ATOM   1702  C C   . VAL A 1 228 ? 30.385  52.925  -8.257  1.00 34.11 ? 266 VAL A C   1 
ATOM   1703  O O   . VAL A 1 228 ? 30.310  54.009  -8.830  1.00 35.52 ? 266 VAL A O   1 
ATOM   1704  C CB  . VAL A 1 228 ? 28.166  52.033  -8.947  1.00 34.70 ? 266 VAL A CB  1 
ATOM   1705  C CG1 . VAL A 1 228 ? 28.702  51.048  -9.933  1.00 34.61 ? 266 VAL A CG1 1 
ATOM   1706  C CG2 . VAL A 1 228 ? 26.765  51.640  -8.410  1.00 33.33 ? 266 VAL A CG2 1 
ATOM   1707  N N   . HIS A 1 229 ? 31.538  52.340  -7.990  1.00 34.04 ? 267 HIS A N   1 
ATOM   1708  C CA  . HIS A 1 229 ? 32.830  52.980  -8.249  1.00 33.52 ? 267 HIS A CA  1 
ATOM   1709  C C   . HIS A 1 229 ? 33.386  52.601  -9.602  1.00 33.18 ? 267 HIS A C   1 
ATOM   1710  O O   . HIS A 1 229 ? 33.907  53.430  -10.352 1.00 32.03 ? 267 HIS A O   1 
ATOM   1711  C CB  . HIS A 1 229 ? 33.811  52.624  -7.142  1.00 33.23 ? 267 HIS A CB  1 
ATOM   1712  C CG  . HIS A 1 229 ? 33.312  52.983  -5.775  1.00 35.03 ? 267 HIS A CG  1 
ATOM   1713  N ND1 . HIS A 1 229 ? 33.464  52.167  -4.682  1.00 35.83 ? 267 HIS A ND1 1 
ATOM   1714  C CD2 . HIS A 1 229 ? 32.594  54.044  -5.347  1.00 37.03 ? 267 HIS A CD2 1 
ATOM   1715  C CE1 . HIS A 1 229 ? 32.918  52.735  -3.627  1.00 36.53 ? 267 HIS A CE1 1 
ATOM   1716  N NE2 . HIS A 1 229 ? 32.363  53.867  -4.007  1.00 36.96 ? 267 HIS A NE2 1 
ATOM   1717  N N   . ARG A 1 230 ? 33.245  51.326  -9.908  1.00 33.74 ? 268 ARG A N   1 
ATOM   1718  C CA  . ARG A 1 230 ? 33.775  50.763  -11.126 1.00 32.84 ? 268 ARG A CA  1 
ATOM   1719  C C   . ARG A 1 230 ? 32.679  49.896  -11.719 1.00 33.36 ? 268 ARG A C   1 
ATOM   1720  O O   . ARG A 1 230 ? 32.031  49.123  -10.987 1.00 31.72 ? 268 ARG A O   1 
ATOM   1721  C CB  . ARG A 1 230 ? 34.992  49.932  -10.781 1.00 33.11 ? 268 ARG A CB  1 
ATOM   1722  C CG  . ARG A 1 230 ? 36.186  50.783  -10.279 1.00 33.84 ? 268 ARG A CG  1 
ATOM   1723  C CD  . ARG A 1 230 ? 37.424  49.949  -10.101 1.00 33.56 ? 268 ARG A CD  1 
ATOM   1724  N NE  . ARG A 1 230 ? 38.500  50.698  -9.443  1.00 34.79 ? 268 ARG A NE  1 
ATOM   1725  C CZ  . ARG A 1 230 ? 39.636  50.161  -9.002  1.00 34.44 ? 268 ARG A CZ  1 
ATOM   1726  N NH1 . ARG A 1 230 ? 39.885  48.864  -9.147  1.00 33.78 ? 268 ARG A NH1 1 
ATOM   1727  N NH2 . ARG A 1 230 ? 40.530  50.929  -8.391  1.00 35.54 ? 268 ARG A NH2 1 
ATOM   1728  N N   . LEU A 1 231 ? 32.445  50.070  -13.025 1.00 34.11 ? 269 LEU A N   1 
ATOM   1729  C CA  . LEU A 1 231 ? 31.357  49.379  -13.723 1.00 34.80 ? 269 LEU A CA  1 
ATOM   1730  C C   . LEU A 1 231 ? 31.886  48.762  -15.008 1.00 35.09 ? 269 LEU A C   1 
ATOM   1731  O O   . LEU A 1 231 ? 32.637  49.381  -15.728 1.00 34.83 ? 269 LEU A O   1 
ATOM   1732  C CB  . LEU A 1 231 ? 30.227  50.339  -14.037 1.00 34.87 ? 269 LEU A CB  1 
ATOM   1733  C CG  . LEU A 1 231 ? 28.880  49.725  -14.454 1.00 36.86 ? 269 LEU A CG  1 
ATOM   1734  C CD1 . LEU A 1 231 ? 28.041  49.386  -13.280 1.00 35.18 ? 269 LEU A CD1 1 
ATOM   1735  C CD2 . LEU A 1 231 ? 28.121  50.672  -15.370 1.00 36.82 ? 269 LEU A CD2 1 
ATOM   1736  N N   . ILE A 1 232 ? 31.521  47.504  -15.244 1.00 35.66 ? 270 ILE A N   1 
ATOM   1737  C CA  . ILE A 1 232 ? 31.797  46.818  -16.487 1.00 36.01 ? 270 ILE A CA  1 
ATOM   1738  C C   . ILE A 1 232 ? 30.509  46.189  -16.996 1.00 36.42 ? 270 ILE A C   1 
ATOM   1739  O O   . ILE A 1 232 ? 29.663  45.796  -16.217 1.00 35.91 ? 270 ILE A O   1 
ATOM   1740  C CB  . ILE A 1 232 ? 32.940  45.715  -16.342 1.00 36.65 ? 270 ILE A CB  1 
ATOM   1741  C CG1 . ILE A 1 232 ? 32.546  44.557  -15.427 1.00 34.85 ? 270 ILE A CG1 1 
ATOM   1742  C CG2 . ILE A 1 232 ? 34.194  46.310  -15.731 1.00 37.37 ? 270 ILE A CG2 1 
ATOM   1743  C CD1 . ILE A 1 232 ? 33.262  43.185  -15.807 1.00 35.50 ? 270 ILE A CD1 1 
ATOM   1744  N N   . LYS A 1 233 ? 30.368  46.095  -18.312 1.00 37.08 ? 271 LYS A N   1 
ATOM   1745  C CA  . LYS A 1 233 ? 29.369  45.223  -18.901 1.00 37.04 ? 271 LYS A CA  1 
ATOM   1746  C C   . LYS A 1 233 ? 30.052  43.897  -19.176 1.00 36.87 ? 271 LYS A C   1 
ATOM   1747  O O   . LYS A 1 233 ? 30.974  43.848  -19.977 1.00 35.96 ? 271 LYS A O   1 
ATOM   1748  C CB  . LYS A 1 233 ? 28.821  45.844  -20.190 1.00 37.46 ? 271 LYS A CB  1 
ATOM   1749  C CG  . LYS A 1 233 ? 27.746  44.993  -20.894 1.00 38.23 ? 271 LYS A CG  1 
ATOM   1750  C CD  . LYS A 1 233 ? 27.587  45.379  -22.322 1.00 40.92 ? 271 LYS A CD  1 
ATOM   1751  C CE  . LYS A 1 233 ? 26.857  44.267  -23.072 1.00 43.40 ? 271 LYS A CE  1 
ATOM   1752  N NZ  . LYS A 1 233 ? 26.392  44.746  -24.393 1.00 44.85 ? 271 LYS A NZ  1 
ATOM   1753  N N   . GLY A 1 234 ? 29.607  42.824  -18.525 1.00 37.55 ? 272 GLY A N   1 
ATOM   1754  C CA  . GLY A 1 234 ? 30.251  41.499  -18.685 1.00 38.54 ? 272 GLY A CA  1 
ATOM   1755  C C   . GLY A 1 234 ? 30.171  40.938  -20.096 1.00 39.32 ? 272 GLY A C   1 
ATOM   1756  O O   . GLY A 1 234 ? 29.133  41.022  -20.734 1.00 39.27 ? 272 GLY A O   1 
ATOM   1757  N N   . GLU A 1 235 ? 31.278  40.387  -20.594 1.00 40.95 ? 273 GLU A N   1 
ATOM   1758  C CA  . GLU A 1 235 ? 31.315  39.796  -21.941 1.00 42.07 ? 273 GLU A CA  1 
ATOM   1759  C C   . GLU A 1 235 ? 30.387  38.568  -22.068 1.00 42.89 ? 273 GLU A C   1 
ATOM   1760  O O   . GLU A 1 235 ? 29.698  38.449  -23.061 1.00 43.40 ? 273 GLU A O   1 
ATOM   1761  C CB  . GLU A 1 235 ? 32.753  39.407  -22.352 1.00 42.13 ? 273 GLU A CB  1 
ATOM   1762  C CG  . GLU A 1 235 ? 32.934  39.063  -23.854 1.00 42.16 ? 273 GLU A CG  1 
ATOM   1763  N N   . LYS A 1 236 ? 30.360  37.684  -21.062 1.00 43.72 ? 274 LYS A N   1 
ATOM   1764  C CA  . LYS A 1 236 ? 29.638  36.413  -21.165 1.00 44.17 ? 274 LYS A CA  1 
ATOM   1765  C C   . LYS A 1 236 ? 29.008  35.999  -19.850 1.00 43.16 ? 274 LYS A C   1 
ATOM   1766  O O   . LYS A 1 236 ? 29.628  36.114  -18.791 1.00 43.17 ? 274 LYS A O   1 
ATOM   1767  C CB  . LYS A 1 236 ? 30.554  35.261  -21.624 1.00 44.74 ? 274 LYS A CB  1 
ATOM   1768  C CG  . LYS A 1 236 ? 29.740  33.984  -21.951 1.00 46.09 ? 274 LYS A CG  1 
ATOM   1769  C CD  . LYS A 1 236 ? 30.556  32.687  -22.104 1.00 46.76 ? 274 LYS A CD  1 
ATOM   1770  C CE  . LYS A 1 236 ? 29.607  31.486  -22.371 1.00 47.95 ? 274 LYS A CE  1 
ATOM   1771  N NZ  . LYS A 1 236 ? 30.030  30.673  -23.565 1.00 49.09 ? 274 LYS A NZ  1 
ATOM   1772  N N   . TYR A 1 237 ? 27.789  35.465  -19.972 1.00 41.91 ? 275 TYR A N   1 
ATOM   1773  C CA  . TYR A 1 237 ? 26.960  35.011  -18.885 1.00 41.16 ? 275 TYR A CA  1 
ATOM   1774  C C   . TYR A 1 237 ? 26.441  33.599  -19.158 1.00 41.70 ? 275 TYR A C   1 
ATOM   1775  O O   . TYR A 1 237 ? 25.567  33.400  -20.009 1.00 41.59 ? 275 TYR A O   1 
ATOM   1776  C CB  . TYR A 1 237 ? 25.805  36.004  -18.669 1.00 40.43 ? 275 TYR A CB  1 
ATOM   1777  C CG  . TYR A 1 237 ? 26.325  37.284  -18.048 1.00 40.08 ? 275 TYR A CG  1 
ATOM   1778  C CD1 . TYR A 1 237 ? 26.664  37.313  -16.706 1.00 36.41 ? 275 TYR A CD1 1 
ATOM   1779  C CD2 . TYR A 1 237 ? 26.572  38.441  -18.831 1.00 39.17 ? 275 TYR A CD2 1 
ATOM   1780  C CE1 . TYR A 1 237 ? 27.218  38.446  -16.135 1.00 37.22 ? 275 TYR A CE1 1 
ATOM   1781  C CE2 . TYR A 1 237 ? 27.107  39.584  -18.252 1.00 37.24 ? 275 TYR A CE2 1 
ATOM   1782  C CZ  . TYR A 1 237 ? 27.410  39.582  -16.895 1.00 36.78 ? 275 TYR A CZ  1 
ATOM   1783  O OH  . TYR A 1 237 ? 27.967  40.675  -16.260 1.00 38.38 ? 275 TYR A OH  1 
ATOM   1784  N N   . GLU A 1 238 ? 26.994  32.617  -18.451 1.00 42.01 ? 276 GLU A N   1 
ATOM   1785  C CA  . GLU A 1 238 ? 26.500  31.251  -18.540 1.00 43.31 ? 276 GLU A CA  1 
ATOM   1786  C C   . GLU A 1 238 ? 25.149  31.129  -17.839 1.00 43.66 ? 276 GLU A C   1 
ATOM   1787  O O   . GLU A 1 238 ? 24.253  30.425  -18.278 1.00 43.81 ? 276 GLU A O   1 
ATOM   1788  C CB  . GLU A 1 238 ? 27.461  30.283  -17.872 1.00 43.51 ? 276 GLU A CB  1 
ATOM   1789  C CG  . GLU A 1 238 ? 28.866  30.351  -18.372 1.00 44.85 ? 276 GLU A CG  1 
ATOM   1790  C CD  . GLU A 1 238 ? 29.557  29.022  -18.284 1.00 45.49 ? 276 GLU A CD  1 
ATOM   1791  O OE1 . GLU A 1 238 ? 29.390  28.305  -17.281 1.00 45.78 ? 276 GLU A OE1 1 
ATOM   1792  O OE2 . GLU A 1 238 ? 30.261  28.688  -19.242 1.00 49.66 ? 276 GLU A OE2 1 
ATOM   1793  N N   . LYS A 1 239 ? 25.025  31.855  -16.750 1.00 44.92 ? 277 LYS A N   1 
ATOM   1794  C CA  . LYS A 1 239 ? 23.873  31.769  -15.844 1.00 45.90 ? 277 LYS A CA  1 
ATOM   1795  C C   . LYS A 1 239 ? 23.440  30.301  -15.663 1.00 44.77 ? 277 LYS A C   1 
ATOM   1796  O O   . LYS A 1 239 ? 22.432  29.822  -16.169 1.00 44.98 ? 277 LYS A O   1 
ATOM   1797  C CB  . LYS A 1 239 ? 22.790  32.788  -16.272 1.00 46.31 ? 277 LYS A CB  1 
ATOM   1798  C CG  . LYS A 1 239 ? 23.216  34.230  -15.775 1.00 47.31 ? 277 LYS A CG  1 
ATOM   1799  C CD  . LYS A 1 239 ? 22.389  35.390  -16.349 1.00 47.05 ? 277 LYS A CD  1 
ATOM   1800  C CE  . LYS A 1 239 ? 21.338  35.909  -15.368 1.00 46.65 ? 277 LYS A CE  1 
ATOM   1801  N NZ  . LYS A 1 239 ? 20.258  36.730  -16.037 1.00 49.13 ? 277 LYS A NZ  1 
ATOM   1802  N N   . ARG A 1 240 ? 24.322  29.586  -14.986 1.00 43.88 ? 278 ARG A N   1 
ATOM   1803  C CA  . ARG A 1 240 ? 24.096  28.211  -14.660 1.00 43.64 ? 278 ARG A CA  1 
ATOM   1804  C C   . ARG A 1 240 ? 23.017  28.107  -13.610 1.00 41.93 ? 278 ARG A C   1 
ATOM   1805  O O   . ARG A 1 240 ? 22.888  28.979  -12.750 1.00 41.61 ? 278 ARG A O   1 
ATOM   1806  C CB  . ARG A 1 240 ? 25.365  27.559  -14.141 1.00 43.77 ? 278 ARG A CB  1 
ATOM   1807  C CG  . ARG A 1 240 ? 26.421  27.498  -15.187 1.00 47.04 ? 278 ARG A CG  1 
ATOM   1808  C CD  . ARG A 1 240 ? 27.500  26.496  -14.822 1.00 49.85 ? 278 ARG A CD  1 
ATOM   1809  N NE  . ARG A 1 240 ? 28.538  26.452  -15.849 1.00 50.48 ? 278 ARG A NE  1 
ATOM   1810  C CZ  . ARG A 1 240 ? 29.738  25.916  -15.658 1.00 51.48 ? 278 ARG A CZ  1 
ATOM   1811  N NH1 . ARG A 1 240 ? 30.043  25.368  -14.482 1.00 53.18 ? 278 ARG A NH1 1 
ATOM   1812  N NH2 . ARG A 1 240 ? 30.636  25.915  -16.642 1.00 51.11 ? 278 ARG A NH2 1 
ATOM   1813  N N   . ILE A 1 241 ? 22.258  27.017  -13.724 1.00 40.94 ? 279 ILE A N   1 
ATOM   1814  C CA  . ILE A 1 241 ? 21.248  26.590  -12.760 1.00 39.32 ? 279 ILE A CA  1 
ATOM   1815  C C   . ILE A 1 241 ? 21.842  25.379  -12.029 1.00 39.27 ? 279 ILE A C   1 
ATOM   1816  O O   . ILE A 1 241 ? 22.234  24.404  -12.665 1.00 40.62 ? 279 ILE A O   1 
ATOM   1817  C CB  . ILE A 1 241 ? 19.917  26.264  -13.495 1.00 38.98 ? 279 ILE A CB  1 
ATOM   1818  C CG1 . ILE A 1 241 ? 19.423  27.538  -14.229 1.00 38.50 ? 279 ILE A CG1 1 
ATOM   1819  C CG2 . ILE A 1 241 ? 18.849  25.728  -12.521 1.00 36.94 ? 279 ILE A CG2 1 
ATOM   1820  C CD1 . ILE A 1 241 ? 18.168  27.388  -15.115 1.00 37.57 ? 279 ILE A CD1 1 
ATOM   1821  N N   . GLU A 1 242 ? 21.940  25.453  -10.710 1.00 38.76 ? 280 GLU A N   1 
ATOM   1822  C CA  . GLU A 1 242 ? 22.478  24.350  -9.891  1.00 38.53 ? 280 GLU A CA  1 
ATOM   1823  C C   . GLU A 1 242 ? 21.488  23.186  -9.815  1.00 37.55 ? 280 GLU A C   1 
ATOM   1824  O O   . GLU A 1 242 ? 21.885  22.030  -9.878  1.00 37.37 ? 280 GLU A O   1 
ATOM   1825  C CB  . GLU A 1 242 ? 22.822  24.861  -8.483  1.00 38.19 ? 280 GLU A CB  1 
ATOM   1826  C CG  . GLU A 1 242 ? 23.556  23.849  -7.577  1.00 40.01 ? 280 GLU A CG  1 
ATOM   1827  C CD  . GLU A 1 242 ? 23.965  24.428  -6.201  1.00 40.66 ? 280 GLU A CD  1 
ATOM   1828  O OE1 . GLU A 1 242 ? 24.142  25.661  -6.078  1.00 48.47 ? 280 GLU A OE1 1 
ATOM   1829  O OE2 . GLU A 1 242 ? 24.139  23.650  -5.238  1.00 46.07 ? 280 GLU A OE2 1 
ATOM   1830  N N   . ARG A 1 243 ? 20.199  23.517  -9.677  1.00 37.37 ? 281 ARG A N   1 
ATOM   1831  C CA  . ARG A 1 243 ? 19.089  22.564  -9.523  1.00 36.81 ? 281 ARG A CA  1 
ATOM   1832  C C   . ARG A 1 243 ? 17.904  22.972  -10.402 1.00 35.87 ? 281 ARG A C   1 
ATOM   1833  O O   . ARG A 1 243 ? 17.165  23.900  -10.087 1.00 35.36 ? 281 ARG A O   1 
ATOM   1834  C CB  . ARG A 1 243 ? 18.645  22.495  -8.052  1.00 37.21 ? 281 ARG A CB  1 
ATOM   1835  C CG  . ARG A 1 243 ? 19.658  21.771  -7.169  1.00 40.37 ? 281 ARG A CG  1 
ATOM   1836  C CD  . ARG A 1 243 ? 19.768  22.225  -5.717  1.00 43.39 ? 281 ARG A CD  1 
ATOM   1837  N NE  . ARG A 1 243 ? 20.573  21.240  -4.986  1.00 44.48 ? 281 ARG A NE  1 
ATOM   1838  C CZ  . ARG A 1 243 ? 20.861  21.264  -3.688  1.00 45.78 ? 281 ARG A CZ  1 
ATOM   1839  N NH1 . ARG A 1 243 ? 20.445  22.244  -2.886  1.00 46.84 ? 281 ARG A NH1 1 
ATOM   1840  N NH2 . ARG A 1 243 ? 21.589  20.279  -3.173  1.00 47.24 ? 281 ARG A NH2 1 
ATOM   1841  N N   . LEU A 1 244 ? 17.733  22.275  -11.505 1.00 35.39 ? 282 LEU A N   1 
ATOM   1842  C CA  . LEU A 1 244 ? 16.564  22.451  -12.360 1.00 35.60 ? 282 LEU A CA  1 
ATOM   1843  C C   . LEU A 1 244 ? 15.440  21.623  -11.758 1.00 35.76 ? 282 LEU A C   1 
ATOM   1844  O O   . LEU A 1 244 ? 15.397  20.409  -11.944 1.00 36.41 ? 282 LEU A O   1 
ATOM   1845  C CB  . LEU A 1 244 ? 16.861  21.990  -13.791 1.00 34.96 ? 282 LEU A CB  1 
ATOM   1846  C CG  . LEU A 1 244 ? 15.897  22.441  -14.880 1.00 35.52 ? 282 LEU A CG  1 
ATOM   1847  C CD1 . LEU A 1 244 ? 15.690  23.950  -14.820 1.00 34.42 ? 282 LEU A CD1 1 
ATOM   1848  C CD2 . LEU A 1 244 ? 16.415  22.041  -16.266 1.00 34.76 ? 282 LEU A CD2 1 
ATOM   1849  N N   . SER A 1 245 ? 14.554  22.298  -11.027 1.00 35.97 ? 283 SER A N   1 
ATOM   1850  C CA  . SER A 1 245 ? 13.432  21.686  -10.331 1.00 36.23 ? 283 SER A CA  1 
ATOM   1851  C C   . SER A 1 245 ? 12.161  22.027  -11.100 1.00 36.12 ? 283 SER A C   1 
ATOM   1852  O O   . SER A 1 245 ? 11.706  23.159  -11.038 1.00 36.39 ? 283 SER A O   1 
ATOM   1853  C CB  . SER A 1 245 ? 13.315  22.255  -8.911  1.00 35.77 ? 283 SER A CB  1 
ATOM   1854  O OG  . SER A 1 245 ? 14.583  22.334  -8.288  1.00 37.93 ? 283 SER A OG  1 
ATOM   1855  N N   . ILE A 1 246 ? 11.578  21.056  -11.786 1.00 36.60 ? 284 ILE A N   1 
ATOM   1856  C CA  . ILE A 1 246 ? 10.463  21.302  -12.720 1.00 37.03 ? 284 ILE A CA  1 
ATOM   1857  C C   . ILE A 1 246 ? 9.151   20.709  -12.186 1.00 37.72 ? 284 ILE A C   1 
ATOM   1858  O O   . ILE A 1 246 ? 9.140   19.644  -11.597 1.00 37.02 ? 284 ILE A O   1 
ATOM   1859  C CB  . ILE A 1 246 ? 10.793  20.727  -14.121 1.00 36.67 ? 284 ILE A CB  1 
ATOM   1860  C CG1 . ILE A 1 246 ? 12.046  21.407  -14.676 1.00 36.44 ? 284 ILE A CG1 1 
ATOM   1861  C CG2 . ILE A 1 246 ? 9.624   20.900  -15.111 1.00 36.37 ? 284 ILE A CG2 1 
ATOM   1862  C CD1 . ILE A 1 246 ? 11.898  22.876  -14.883 1.00 33.38 ? 284 ILE A CD1 1 
ATOM   1863  N N   . ARG A 1 247 ? 8.054   21.424  -12.404 1.00 38.91 ? 285 ARG A N   1 
ATOM   1864  C CA  . ARG A 1 247 ? 6.729   21.020  -11.921 1.00 39.79 ? 285 ARG A CA  1 
ATOM   1865  C C   . ARG A 1 247 ? 6.243   19.643  -12.427 1.00 40.86 ? 285 ARG A C   1 
ATOM   1866  O O   . ARG A 1 247 ? 6.306   19.374  -13.616 1.00 40.79 ? 285 ARG A O   1 
ATOM   1867  C CB  . ARG A 1 247 ? 5.710   22.075  -12.323 1.00 39.70 ? 285 ARG A CB  1 
ATOM   1868  C CG  . ARG A 1 247 ? 4.416   21.950  -11.587 1.00 39.11 ? 285 ARG A CG  1 
ATOM   1869  C CD  . ARG A 1 247 ? 3.648   23.226  -11.649 1.00 39.99 ? 285 ARG A CD  1 
ATOM   1870  N NE  . ARG A 1 247 ? 2.235   23.004  -11.394 1.00 40.36 ? 285 ARG A NE  1 
ATOM   1871  C CZ  . ARG A 1 247 ? 1.332   23.971  -11.354 1.00 41.23 ? 285 ARG A CZ  1 
ATOM   1872  N NH1 . ARG A 1 247 ? 0.067   23.667  -11.132 1.00 43.65 ? 285 ARG A NH1 1 
ATOM   1873  N NH2 . ARG A 1 247 ? 1.682   25.236  -11.560 1.00 42.53 ? 285 ARG A NH2 1 
ATOM   1874  N N   . LYS A 1 248 ? 5.764   18.797  -11.498 1.00 41.97 ? 286 LYS A N   1 
ATOM   1875  C CA  . LYS A 1 248 ? 5.240   17.461  -11.794 1.00 42.54 ? 286 LYS A CA  1 
ATOM   1876  C C   . LYS A 1 248 ? 3.798   17.575  -12.278 1.00 42.96 ? 286 LYS A C   1 
ATOM   1877  O O   . LYS A 1 248 ? 3.013   18.336  -11.695 1.00 43.65 ? 286 LYS A O   1 
ATOM   1878  C CB  . LYS A 1 248 ? 5.309   16.572  -10.538 1.00 42.38 ? 286 LYS A CB  1 
ATOM   1879  N N   . PRO A 1 259 ? 10.193  6.382   -1.798  1.00 51.34 ? 297 PRO A N   1 
ATOM   1880  C CA  . PRO A 1 259 ? 11.322  5.748   -1.132  1.00 51.35 ? 297 PRO A CA  1 
ATOM   1881  C C   . PRO A 1 259 ? 10.998  5.416   0.332   1.00 51.39 ? 297 PRO A C   1 
ATOM   1882  O O   . PRO A 1 259 ? 10.915  4.232   0.684   1.00 51.39 ? 297 PRO A O   1 
ATOM   1883  C CB  . PRO A 1 259 ? 12.443  6.803   -1.257  1.00 51.68 ? 297 PRO A CB  1 
ATOM   1884  C CG  . PRO A 1 259 ? 11.835  8.014   -2.040  1.00 51.38 ? 297 PRO A CG  1 
ATOM   1885  C CD  . PRO A 1 259 ? 10.627  7.453   -2.718  1.00 51.73 ? 297 PRO A CD  1 
ATOM   1886  N N   . GLY A 1 260 ? 10.839  6.461   1.156   1.00 51.18 ? 298 GLY A N   1 
ATOM   1887  C CA  . GLY A 1 260 ? 10.263  6.386   2.509   1.00 51.00 ? 298 GLY A CA  1 
ATOM   1888  C C   . GLY A 1 260 ? 9.209   7.489   2.663   1.00 51.00 ? 298 GLY A C   1 
ATOM   1889  O O   . GLY A 1 260 ? 9.259   8.305   3.597   1.00 51.08 ? 298 GLY A O   1 
ATOM   1890  N N   . ASP A 1 261 ? 8.263   7.511   1.718   1.00 50.73 ? 299 ASP A N   1 
ATOM   1891  C CA  . ASP A 1 261 ? 7.232   8.561   1.606   1.00 50.41 ? 299 ASP A CA  1 
ATOM   1892  C C   . ASP A 1 261 ? 5.967   8.239   2.411   1.00 50.23 ? 299 ASP A C   1 
ATOM   1893  O O   . ASP A 1 261 ? 5.105   9.109   2.601   1.00 49.62 ? 299 ASP A O   1 
ATOM   1894  C CB  . ASP A 1 261 ? 6.858   8.767   0.127   1.00 50.41 ? 299 ASP A CB  1 
ATOM   1895  C CG  . ASP A 1 261 ? 8.036   9.251   -0.725  1.00 50.18 ? 299 ASP A CG  1 
ATOM   1896  O OD1 . ASP A 1 261 ? 9.151   9.401   -0.186  1.00 50.18 ? 299 ASP A OD1 1 
ATOM   1897  O OD2 . ASP A 1 261 ? 7.851   9.488   -1.936  1.00 49.40 ? 299 ASP A OD2 1 
ATOM   1898  N N   . ASP A 1 262 ? 5.869   6.981   2.858   1.00 50.11 ? 300 ASP A N   1 
ATOM   1899  C CA  . ASP A 1 262 ? 4.758   6.485   3.679   1.00 49.96 ? 300 ASP A CA  1 
ATOM   1900  C C   . ASP A 1 262 ? 4.498   7.356   4.922   1.00 49.73 ? 300 ASP A C   1 
ATOM   1901  O O   . ASP A 1 262 ? 3.387   7.854   5.119   1.00 49.77 ? 300 ASP A O   1 
ATOM   1902  C CB  . ASP A 1 262 ? 5.029   5.030   4.104   1.00 49.82 ? 300 ASP A CB  1 
ATOM   1903  N N   . VAL A 1 263 ? 5.526   7.542   5.748   1.00 49.31 ? 301 VAL A N   1 
ATOM   1904  C CA  . VAL A 1 263 ? 5.392   8.282   7.012   1.00 48.72 ? 301 VAL A CA  1 
ATOM   1905  C C   . VAL A 1 263 ? 5.630   9.781   6.818   1.00 48.27 ? 301 VAL A C   1 
ATOM   1906  O O   . VAL A 1 263 ? 5.287   10.605  7.657   1.00 48.24 ? 301 VAL A O   1 
ATOM   1907  C CB  . VAL A 1 263 ? 6.381   7.752   8.086   1.00 48.77 ? 301 VAL A CB  1 
ATOM   1908  C CG1 . VAL A 1 263 ? 6.251   6.240   8.234   1.00 48.69 ? 301 VAL A CG1 1 
ATOM   1909  C CG2 . VAL A 1 263 ? 7.827   8.162   7.760   1.00 48.83 ? 301 VAL A CG2 1 
ATOM   1910  N N   . ARG A 1 264 ? 6.245   10.110  5.696   1.00 47.54 ? 302 ARG A N   1 
ATOM   1911  C CA  . ARG A 1 264 ? 6.564   11.470  5.322   1.00 46.68 ? 302 ARG A CA  1 
ATOM   1912  C C   . ARG A 1 264 ? 5.279   12.169  4.787   1.00 45.41 ? 302 ARG A C   1 
ATOM   1913  O O   . ARG A 1 264 ? 5.042   13.339  5.090   1.00 44.88 ? 302 ARG A O   1 
ATOM   1914  C CB  . ARG A 1 264 ? 7.675   11.383  4.273   1.00 47.10 ? 302 ARG A CB  1 
ATOM   1915  C CG  . ARG A 1 264 ? 8.485   12.599  3.984   1.00 48.21 ? 302 ARG A CG  1 
ATOM   1916  C CD  . ARG A 1 264 ? 9.250   12.320  2.696   1.00 51.51 ? 302 ARG A CD  1 
ATOM   1917  N NE  . ARG A 1 264 ? 10.154  13.399  2.319   1.00 53.84 ? 302 ARG A NE  1 
ATOM   1918  C CZ  . ARG A 1 264 ? 10.761  13.505  1.132   1.00 54.79 ? 302 ARG A CZ  1 
ATOM   1919  N NH1 . ARG A 1 264 ? 10.571  12.586  0.173   1.00 54.98 ? 302 ARG A NH1 1 
ATOM   1920  N NH2 . ARG A 1 264 ? 11.571  14.544  0.901   1.00 54.34 ? 302 ARG A NH2 1 
ATOM   1921  N N   . GLU A 1 265 ? 4.443   11.449  4.024   1.00 43.56 ? 303 GLU A N   1 
ATOM   1922  C CA  . GLU A 1 265 ? 3.140   11.982  3.596   1.00 42.24 ? 303 GLU A CA  1 
ATOM   1923  C C   . GLU A 1 265 ? 2.236   12.270  4.815   1.00 40.95 ? 303 GLU A C   1 
ATOM   1924  O O   . GLU A 1 265 ? 1.483   13.248  4.823   1.00 40.67 ? 303 GLU A O   1 
ATOM   1925  C CB  . GLU A 1 265 ? 2.449   11.035  2.600   1.00 42.14 ? 303 GLU A CB  1 
ATOM   1926  N N   . ARG A 1 266 ? 2.342   11.435  5.848   1.00 39.40 ? 304 ARG A N   1 
ATOM   1927  C CA  . ARG A 1 266 ? 1.676   11.674  7.149   1.00 38.17 ? 304 ARG A CA  1 
ATOM   1928  C C   . ARG A 1 266 ? 2.004   13.014  7.793   1.00 37.14 ? 304 ARG A C   1 
ATOM   1929  O O   . ARG A 1 266 ? 1.104   13.722  8.243   1.00 36.74 ? 304 ARG A O   1 
ATOM   1930  C CB  . ARG A 1 266 ? 2.044   10.570  8.146   1.00 38.30 ? 304 ARG A CB  1 
ATOM   1931  C CG  . ARG A 1 266 ? 0.945   9.554   8.390   1.00 37.51 ? 304 ARG A CG  1 
ATOM   1932  C CD  . ARG A 1 266 ? 1.423   8.129   8.264   1.00 37.46 ? 304 ARG A CD  1 
ATOM   1933  N NE  . ARG A 1 266 ? 2.121   7.668   9.461   1.00 38.31 ? 304 ARG A NE  1 
ATOM   1934  C CZ  . ARG A 1 266 ? 2.260   6.385   9.811   1.00 38.59 ? 304 ARG A CZ  1 
ATOM   1935  N NH1 . ARG A 1 266 ? 1.740   5.423   9.059   1.00 39.01 ? 304 ARG A NH1 1 
ATOM   1936  N NH2 . ARG A 1 266 ? 2.912   6.056   10.927  1.00 37.68 ? 304 ARG A NH2 1 
ATOM   1937  N N   . ILE A 1 267 ? 3.297   13.344  7.833   1.00 36.26 ? 305 ILE A N   1 
ATOM   1938  C CA  . ILE A 1 267 ? 3.798   14.549  8.493   1.00 35.25 ? 305 ILE A CA  1 
ATOM   1939  C C   . ILE A 1 267 ? 3.329   15.784  7.725   1.00 34.46 ? 305 ILE A C   1 
ATOM   1940  O O   . ILE A 1 267 ? 2.923   16.777  8.312   1.00 33.83 ? 305 ILE A O   1 
ATOM   1941  C CB  . ILE A 1 267 ? 5.360   14.572  8.556   1.00 35.80 ? 305 ILE A CB  1 
ATOM   1942  C CG1 . ILE A 1 267 ? 5.928   13.292  9.213   1.00 36.09 ? 305 ILE A CG1 1 
ATOM   1943  C CG2 . ILE A 1 267 ? 5.859   15.822  9.297   1.00 34.74 ? 305 ILE A CG2 1 
ATOM   1944  C CD1 . ILE A 1 267 ? 7.419   13.017  8.882   1.00 34.90 ? 305 ILE A CD1 1 
ATOM   1945  N N   . ILE A 1 268 ? 3.374   15.664  6.402   1.00 33.60 ? 306 ILE A N   1 
ATOM   1946  C CA  . ILE A 1 268 ? 3.049   16.722  5.463   1.00 33.47 ? 306 ILE A CA  1 
ATOM   1947  C C   . ILE A 1 268 ? 1.563   17.072  5.456   1.00 32.81 ? 306 ILE A C   1 
ATOM   1948  O O   . ILE A 1 268 ? 1.204   18.248  5.440   1.00 32.52 ? 306 ILE A O   1 
ATOM   1949  C CB  . ILE A 1 268 ? 3.438   16.287  4.039   1.00 33.83 ? 306 ILE A CB  1 
ATOM   1950  C CG1 . ILE A 1 268 ? 4.958   16.103  3.910   1.00 33.88 ? 306 ILE A CG1 1 
ATOM   1951  C CG2 . ILE A 1 268 ? 2.945   17.276  3.009   1.00 34.37 ? 306 ILE A CG2 1 
ATOM   1952  C CD1 . ILE A 1 268 ? 5.308   15.149  2.718   1.00 35.36 ? 306 ILE A CD1 1 
ATOM   1953  N N   . LYS A 1 269 ? 0.711   16.045  5.457   1.00 32.03 ? 307 LYS A N   1 
ATOM   1954  C CA  . LYS A 1 269 ? -0.730  16.224  5.573   1.00 31.31 ? 307 LYS A CA  1 
ATOM   1955  C C   . LYS A 1 269 ? -1.142  16.766  6.936   1.00 30.75 ? 307 LYS A C   1 
ATOM   1956  O O   . LYS A 1 269 ? -2.178  17.408  7.053   1.00 30.52 ? 307 LYS A O   1 
ATOM   1957  C CB  . LYS A 1 269 ? -1.465  14.907  5.327   1.00 31.21 ? 307 LYS A CB  1 
ATOM   1958  C CG  . LYS A 1 269 ? -1.488  14.419  3.881   1.00 31.32 ? 307 LYS A CG  1 
ATOM   1959  C CD  . LYS A 1 269 ? -2.128  13.040  3.817   1.00 30.80 ? 307 LYS A CD  1 
ATOM   1960  C CE  . LYS A 1 269 ? -2.842  12.789  2.523   1.00 31.59 ? 307 LYS A CE  1 
ATOM   1961  N NZ  . LYS A 1 269 ? -3.713  11.567  2.579   1.00 31.27 ? 307 LYS A NZ  1 
ATOM   1962  N N   . ARG A 1 270 ? -0.363  16.495  7.974   1.00 30.43 ? 308 ARG A N   1 
ATOM   1963  C CA  . ARG A 1 270 ? -0.631  17.132  9.261   1.00 30.46 ? 308 ARG A CA  1 
ATOM   1964  C C   . ARG A 1 270 ? -0.089  18.557  9.320   1.00 30.49 ? 308 ARG A C   1 
ATOM   1965  O O   . ARG A 1 270 ? -0.780  19.453  9.800   1.00 30.77 ? 308 ARG A O   1 
ATOM   1966  C CB  . ARG A 1 270 ? -0.075  16.328  10.437  1.00 30.47 ? 308 ARG A CB  1 
ATOM   1967  C CG  . ARG A 1 270 ? -0.311  16.997  11.787  1.00 30.10 ? 308 ARG A CG  1 
ATOM   1968  C CD  . ARG A 1 270 ? -1.785  17.377  12.018  1.00 30.80 ? 308 ARG A CD  1 
ATOM   1969  N NE  . ARG A 1 270 ? -1.966  18.020  13.306  1.00 31.05 ? 308 ARG A NE  1 
ATOM   1970  C CZ  . ARG A 1 270 ? -1.709  19.301  13.562  1.00 32.66 ? 308 ARG A CZ  1 
ATOM   1971  N NH1 . ARG A 1 270 ? -1.249  20.115  12.628  1.00 33.68 ? 308 ARG A NH1 1 
ATOM   1972  N NH2 . ARG A 1 270 ? -1.899  19.766  14.789  1.00 34.85 ? 308 ARG A NH2 1 
ATOM   1973  N N   . ALA A 1 271 ? 1.141   18.754  8.839   1.00 30.36 ? 309 ALA A N   1 
ATOM   1974  C CA  . ALA A 1 271 ? 1.792   20.064  8.779   1.00 29.93 ? 309 ALA A CA  1 
ATOM   1975  C C   . ALA A 1 271 ? 1.029   21.083  7.934   1.00 30.29 ? 309 ALA A C   1 
ATOM   1976  O O   . ALA A 1 271 ? 1.076   22.283  8.213   1.00 30.54 ? 309 ALA A O   1 
ATOM   1977  C CB  . ALA A 1 271 ? 3.205   19.901  8.242   1.00 29.26 ? 309 ALA A CB  1 
ATOM   1978  N N   . ALA A 1 272 ? 0.332   20.605  6.903   1.00 30.80 ? 310 ALA A N   1 
ATOM   1979  C CA  . ALA A 1 272 ? -0.492  21.442  6.012   1.00 30.94 ? 310 ALA A CA  1 
ATOM   1980  C C   . ALA A 1 272 ? -1.637  22.114  6.764   1.00 31.56 ? 310 ALA A C   1 
ATOM   1981  O O   . ALA A 1 272 ? -2.116  23.208  6.378   1.00 31.04 ? 310 ALA A O   1 
ATOM   1982  C CB  . ALA A 1 272 ? -1.053  20.606  4.854   1.00 30.67 ? 310 ALA A CB  1 
ATOM   1983  N N   . LEU A 1 273 ? -2.091  21.438  7.816   1.00 31.85 ? 311 LEU A N   1 
ATOM   1984  C CA  . LEU A 1 273 ? -3.124  21.986  8.697   1.00 32.79 ? 311 LEU A CA  1 
ATOM   1985  C C   . LEU A 1 273 ? -2.623  23.112  9.634   1.00 34.07 ? 311 LEU A C   1 
ATOM   1986  O O   . LEU A 1 273 ? -3.454  23.694  10.347  1.00 35.34 ? 311 LEU A O   1 
ATOM   1987  C CB  . LEU A 1 273 ? -3.782  20.884  9.526   1.00 32.00 ? 311 LEU A CB  1 
ATOM   1988  C CG  . LEU A 1 273 ? -4.674  19.895  8.764   1.00 31.30 ? 311 LEU A CG  1 
ATOM   1989  C CD1 . LEU A 1 273 ? -5.313  18.967  9.763   1.00 29.59 ? 311 LEU A CD1 1 
ATOM   1990  C CD2 . LEU A 1 273 ? -5.762  20.553  7.882   1.00 28.50 ? 311 LEU A CD2 1 
ATOM   1991  N N   . GLU A 1 274 ? -1.308  23.388  9.648   1.00 34.24 ? 312 GLU A N   1 
ATOM   1992  C CA  . GLU A 1 274 ? -0.728  24.524  10.389  1.00 34.97 ? 312 GLU A CA  1 
ATOM   1993  C C   . GLU A 1 274 ? -0.902  25.887  9.710   1.00 34.99 ? 312 GLU A C   1 
ATOM   1994  O O   . GLU A 1 274 ? -0.781  26.905  10.364  1.00 33.92 ? 312 GLU A O   1 
ATOM   1995  C CB  . GLU A 1 274 ? 0.750   24.284  10.669  1.00 34.99 ? 312 GLU A CB  1 
ATOM   1996  C CG  . GLU A 1 274 ? 0.992   23.126  11.632  1.00 36.48 ? 312 GLU A CG  1 
ATOM   1997  C CD  . GLU A 1 274 ? 0.460   23.418  13.016  1.00 38.48 ? 312 GLU A CD  1 
ATOM   1998  O OE1 . GLU A 1 274 ? 0.878   24.429  13.615  1.00 39.15 ? 312 GLU A OE1 1 
ATOM   1999  O OE2 . GLU A 1 274 ? -0.388  22.651  13.510  1.00 39.66 ? 312 GLU A OE2 1 
ATOM   2000  N N   . PHE A 1 275 ? -1.242  25.886  8.423   1.00 35.92 ? 313 PHE A N   1 
ATOM   2001  C CA  . PHE A 1 275 ? -1.470  27.095  7.665   1.00 36.81 ? 313 PHE A CA  1 
ATOM   2002  C C   . PHE A 1 275 ? -2.864  27.703  7.851   1.00 37.10 ? 313 PHE A C   1 
ATOM   2003  O O   . PHE A 1 275 ? -3.867  27.008  8.008   1.00 37.20 ? 313 PHE A O   1 
ATOM   2004  C CB  . PHE A 1 275 ? -1.228  26.826  6.172   1.00 38.03 ? 313 PHE A CB  1 
ATOM   2005  C CG  . PHE A 1 275 ? 0.188   26.380  5.855   1.00 38.54 ? 313 PHE A CG  1 
ATOM   2006  C CD1 . PHE A 1 275 ? 1.250   27.261  5.975   1.00 41.27 ? 313 PHE A CD1 1 
ATOM   2007  C CD2 . PHE A 1 275 ? 0.452   25.078  5.449   1.00 39.98 ? 313 PHE A CD2 1 
ATOM   2008  C CE1 . PHE A 1 275 ? 2.566   26.846  5.698   1.00 41.23 ? 313 PHE A CE1 1 
ATOM   2009  C CE2 . PHE A 1 275 ? 1.756   24.657  5.180   1.00 40.82 ? 313 PHE A CE2 1 
ATOM   2010  C CZ  . PHE A 1 275 ? 2.807   25.541  5.294   1.00 40.48 ? 313 PHE A CZ  1 
ATOM   2011  N N   . GLU A 1 276 ? -2.909  29.023  7.819   1.00 37.20 ? 314 GLU A N   1 
ATOM   2012  C CA  . GLU A 1 276 ? -4.143  29.765  7.960   1.00 37.36 ? 314 GLU A CA  1 
ATOM   2013  C C   . GLU A 1 276 ? -4.174  30.809  6.874   1.00 36.48 ? 314 GLU A C   1 
ATOM   2014  O O   . GLU A 1 276 ? -3.123  31.263  6.405   1.00 36.00 ? 314 GLU A O   1 
ATOM   2015  C CB  . GLU A 1 276 ? -4.192  30.472  9.316   1.00 37.98 ? 314 GLU A CB  1 
ATOM   2016  C CG  . GLU A 1 276 ? -3.996  29.558  10.493  1.00 41.02 ? 314 GLU A CG  1 
ATOM   2017  C CD  . GLU A 1 276 ? -3.841  30.306  11.807  1.00 46.52 ? 314 GLU A CD  1 
ATOM   2018  O OE1 . GLU A 1 276 ? -3.068  31.298  11.872  1.00 51.07 ? 314 GLU A OE1 1 
ATOM   2019  O OE2 . GLU A 1 276 ? -4.482  29.879  12.789  1.00 50.30 ? 314 GLU A OE2 1 
ATOM   2020  N N   . ASP A 1 277 ? -5.384  31.197  6.490   1.00 35.12 ? 315 ASP A N   1 
ATOM   2021  C CA  . ASP A 1 277 ? -5.599  32.285  5.546   1.00 34.67 ? 315 ASP A CA  1 
ATOM   2022  C C   . ASP A 1 277 ? -4.885  33.598  5.962   1.00 34.24 ? 315 ASP A C   1 
ATOM   2023  O O   . ASP A 1 277 ? -5.024  34.080  7.096   1.00 33.73 ? 315 ASP A O   1 
ATOM   2024  C CB  . ASP A 1 277 ? -7.100  32.510  5.395   1.00 34.66 ? 315 ASP A CB  1 
ATOM   2025  C CG  . ASP A 1 277 ? -7.466  33.355  4.187   1.00 34.94 ? 315 ASP A CG  1 
ATOM   2026  O OD1 . ASP A 1 277 ? -6.781  33.321  3.139   1.00 34.24 ? 315 ASP A OD1 1 
ATOM   2027  O OD2 . ASP A 1 277 ? -8.492  34.052  4.289   1.00 35.27 ? 315 ASP A OD2 1 
ATOM   2028  N N   . GLY A 1 278 ? -4.114  34.161  5.034   1.00 33.72 ? 316 GLY A N   1 
ATOM   2029  C CA  . GLY A 1 278 ? -3.452  35.451  5.242   1.00 33.56 ? 316 GLY A CA  1 
ATOM   2030  C C   . GLY A 1 278 ? -2.099  35.343  5.918   1.00 33.19 ? 316 GLY A C   1 
ATOM   2031  O O   . GLY A 1 278 ? -1.453  36.347  6.198   1.00 33.43 ? 316 GLY A O   1 
ATOM   2032  N N   . MET A 1 279 ? -1.670  34.118  6.160   1.00 32.96 ? 317 MET A N   1 
ATOM   2033  C CA  . MET A 1 279 ? -0.418  33.835  6.867   1.00 33.67 ? 317 MET A CA  1 
ATOM   2034  C C   . MET A 1 279 ? 0.790   34.060  6.011   1.00 32.95 ? 317 MET A C   1 
ATOM   2035  O O   . MET A 1 279 ? 0.786   33.675  4.845   1.00 32.87 ? 317 MET A O   1 
ATOM   2036  C CB  . MET A 1 279 ? -0.411  32.366  7.265   1.00 33.67 ? 317 MET A CB  1 
ATOM   2037  C CG  . MET A 1 279 ? 0.795   31.894  7.972   1.00 34.67 ? 317 MET A CG  1 
ATOM   2038  S SD  . MET A 1 279 ? 0.389   30.288  8.641   1.00 35.83 ? 317 MET A SD  1 
ATOM   2039  C CE  . MET A 1 279 ? -0.191  30.663  10.313  1.00 30.82 ? 317 MET A CE  1 
ATOM   2040  N N   . TYR A 1 280 ? 1.820   34.661  6.614   1.00 32.51 ? 318 TYR A N   1 
ATOM   2041  C CA  . TYR A 1 280 ? 3.158   34.736  6.055   1.00 31.60 ? 318 TYR A CA  1 
ATOM   2042  C C   . TYR A 1 280 ? 3.977   33.608  6.682   1.00 32.21 ? 318 TYR A C   1 
ATOM   2043  O O   . TYR A 1 280 ? 4.107   33.488  7.940   1.00 30.98 ? 318 TYR A O   1 
ATOM   2044  C CB  . TYR A 1 280 ? 3.773   36.118  6.311   1.00 31.41 ? 318 TYR A CB  1 
ATOM   2045  C CG  . TYR A 1 280 ? 2.903   37.211  5.708   1.00 30.19 ? 318 TYR A CG  1 
ATOM   2046  C CD1 . TYR A 1 280 ? 3.066   37.597  4.382   1.00 30.17 ? 318 TYR A CD1 1 
ATOM   2047  C CD2 . TYR A 1 280 ? 1.905   37.832  6.440   1.00 29.48 ? 318 TYR A CD2 1 
ATOM   2048  C CE1 . TYR A 1 280 ? 2.267   38.553  3.792   1.00 29.59 ? 318 TYR A CE1 1 
ATOM   2049  C CE2 . TYR A 1 280 ? 1.060   38.812  5.838   1.00 27.69 ? 318 TYR A CE2 1 
ATOM   2050  C CZ  . TYR A 1 280 ? 1.255   39.153  4.517   1.00 30.17 ? 318 TYR A CZ  1 
ATOM   2051  O OH  . TYR A 1 280 ? 0.481   40.110  3.893   1.00 29.62 ? 318 TYR A OH  1 
ATOM   2052  N N   . ALA A 1 281 ? 4.473   32.728  5.812   1.00 31.46 ? 319 ALA A N   1 
ATOM   2053  C CA  . ALA A 1 281 ? 5.217   31.570  6.283   1.00 31.39 ? 319 ALA A CA  1 
ATOM   2054  C C   . ALA A 1 281 ? 6.558   31.473  5.554   1.00 32.10 ? 319 ALA A C   1 
ATOM   2055  O O   . ALA A 1 281 ? 6.677   31.822  4.396   1.00 31.23 ? 319 ALA A O   1 
ATOM   2056  C CB  . ALA A 1 281 ? 4.408   30.287  6.122   1.00 29.53 ? 319 ALA A CB  1 
ATOM   2057  N N   . ASN A 1 282 ? 7.567   30.992  6.269   1.00 34.23 ? 320 ASN A N   1 
ATOM   2058  C CA  . ASN A 1 282 ? 8.808   30.609  5.663   1.00 35.51 ? 320 ASN A CA  1 
ATOM   2059  C C   . ASN A 1 282 ? 9.003   29.106  5.842   1.00 36.51 ? 320 ASN A C   1 
ATOM   2060  O O   . ASN A 1 282 ? 9.068   28.621  6.966   1.00 37.24 ? 320 ASN A O   1 
ATOM   2061  C CB  . ASN A 1 282 ? 9.971   31.389  6.281   1.00 35.54 ? 320 ASN A CB  1 
ATOM   2062  C CG  . ASN A 1 282 ? 11.271  30.993  5.683   1.00 36.29 ? 320 ASN A CG  1 
ATOM   2063  O OD1 . ASN A 1 282 ? 11.673  29.856  5.837   1.00 39.13 ? 320 ASN A OD1 1 
ATOM   2064  N ND2 . ASN A 1 282 ? 11.917  31.891  4.954   1.00 33.27 ? 320 ASN A ND2 1 
ATOM   2065  N N   . LEU A 1 283 ? 9.123   28.362  4.739   1.00 37.17 ? 321 LEU A N   1 
ATOM   2066  C CA  . LEU A 1 283 ? 9.239   26.915  4.801   1.00 37.41 ? 321 LEU A CA  1 
ATOM   2067  C C   . LEU A 1 283 ? 10.659  26.456  4.552   1.00 38.97 ? 321 LEU A C   1 
ATOM   2068  O O   . LEU A 1 283 ? 11.286  26.809  3.545   1.00 39.69 ? 321 LEU A O   1 
ATOM   2069  C CB  . LEU A 1 283 ? 8.313   26.259  3.795   1.00 37.03 ? 321 LEU A CB  1 
ATOM   2070  C CG  . LEU A 1 283 ? 6.828   26.567  3.954   1.00 35.77 ? 321 LEU A CG  1 
ATOM   2071  C CD1 . LEU A 1 283 ? 6.105   25.975  2.760   1.00 34.89 ? 321 LEU A CD1 1 
ATOM   2072  C CD2 . LEU A 1 283 ? 6.289   26.053  5.271   1.00 34.53 ? 321 LEU A CD2 1 
ATOM   2073  N N   . GLY A 1 284 ? 11.159  25.630  5.462   1.00 40.61 ? 322 GLY A N   1 
ATOM   2074  C CA  . GLY A 1 284 ? 12.526  25.161  5.399   1.00 41.96 ? 322 GLY A CA  1 
ATOM   2075  C C   . GLY A 1 284 ? 12.715  24.029  4.417   1.00 43.28 ? 322 GLY A C   1 
ATOM   2076  O O   . GLY A 1 284 ? 11.769  23.375  3.989   1.00 43.28 ? 322 GLY A O   1 
ATOM   2077  N N   . ILE A 1 285 ? 13.977  23.811  4.069   1.00 45.36 ? 323 ILE A N   1 
ATOM   2078  C CA  . ILE A 1 285 ? 14.370  22.735  3.156   1.00 46.68 ? 323 ILE A CA  1 
ATOM   2079  C C   . ILE A 1 285 ? 14.103  21.387  3.857   1.00 47.08 ? 323 ILE A C   1 
ATOM   2080  O O   . ILE A 1 285 ? 14.148  21.294  5.118   1.00 47.01 ? 323 ILE A O   1 
ATOM   2081  C CB  . ILE A 1 285 ? 15.879  22.860  2.731   1.00 47.18 ? 323 ILE A CB  1 
ATOM   2082  C CG1 . ILE A 1 285 ? 16.179  24.262  2.162   1.00 47.59 ? 323 ILE A CG1 1 
ATOM   2083  C CG2 . ILE A 1 285 ? 16.232  21.777  1.672   1.00 48.06 ? 323 ILE A CG2 1 
ATOM   2084  C CD1 . ILE A 1 285 ? 16.590  25.321  3.174   1.00 46.98 ? 323 ILE A CD1 1 
ATOM   2085  N N   . GLY A 1 286 ? 13.767  20.380  3.059   1.00 46.41 ? 324 GLY A N   1 
ATOM   2086  C CA  . GLY A 1 286 ? 13.379  19.107  3.589   1.00 46.34 ? 324 GLY A CA  1 
ATOM   2087  C C   . GLY A 1 286 ? 11.885  18.955  3.447   1.00 46.46 ? 324 GLY A C   1 
ATOM   2088  O O   . GLY A 1 286 ? 11.300  19.376  2.438   1.00 46.30 ? 324 GLY A O   1 
ATOM   2089  N N   . ILE A 1 287 ? 11.276  18.343  4.470   1.00 46.40 ? 325 ILE A N   1 
ATOM   2090  C CA  . ILE A 1 287 ? 9.832   18.063  4.507   1.00 46.03 ? 325 ILE A CA  1 
ATOM   2091  C C   . ILE A 1 287 ? 8.925   19.285  4.359   1.00 45.84 ? 325 ILE A C   1 
ATOM   2092  O O   . ILE A 1 287 ? 7.925   19.171  3.672   1.00 46.36 ? 325 ILE A O   1 
ATOM   2093  C CB  . ILE A 1 287 ? 9.402   17.351  5.834   1.00 46.25 ? 325 ILE A CB  1 
ATOM   2094  C CG1 . ILE A 1 287 ? 10.084  15.977  5.971   1.00 46.78 ? 325 ILE A CG1 1 
ATOM   2095  C CG2 . ILE A 1 287 ? 7.864   17.260  5.912   1.00 45.63 ? 325 ILE A CG2 1 
ATOM   2096  C CD1 . ILE A 1 287 ? 9.502   15.087  7.059   1.00 45.44 ? 325 ILE A CD1 1 
ATOM   2097  N N   . PRO A 1 288 ? 9.241   20.433  5.034   1.00 45.84 ? 326 PRO A N   1 
ATOM   2098  C CA  . PRO A 1 288 ? 8.350   21.632  5.043   1.00 45.52 ? 326 PRO A CA  1 
ATOM   2099  C C   . PRO A 1 288 ? 7.922   22.166  3.647   1.00 45.27 ? 326 PRO A C   1 
ATOM   2100  O O   . PRO A 1 288 ? 6.748   22.526  3.426   1.00 44.22 ? 326 PRO A O   1 
ATOM   2101  C CB  . PRO A 1 288 ? 9.199   22.695  5.744   1.00 45.67 ? 326 PRO A CB  1 
ATOM   2102  C CG  . PRO A 1 288 ? 10.276  21.966  6.465   1.00 45.90 ? 326 PRO A CG  1 
ATOM   2103  C CD  . PRO A 1 288 ? 10.483  20.668  5.810   1.00 45.87 ? 326 PRO A CD  1 
ATOM   2104  N N   . LEU A 1 289 ? 8.878   22.231  2.729   1.00 44.84 ? 327 LEU A N   1 
ATOM   2105  C CA  . LEU A 1 289 ? 8.566   22.511  1.320   1.00 45.09 ? 327 LEU A CA  1 
ATOM   2106  C C   . LEU A 1 289 ? 7.366   21.686  0.782   1.00 44.92 ? 327 LEU A C   1 
ATOM   2107  O O   . LEU A 1 289 ? 6.473   22.233  0.112   1.00 45.16 ? 327 LEU A O   1 
ATOM   2108  C CB  . LEU A 1 289 ? 9.816   22.290  0.455   1.00 44.89 ? 327 LEU A CB  1 
ATOM   2109  N N   . LEU A 1 290 ? 7.325   20.386  1.096   1.00 44.40 ? 328 LEU A N   1 
ATOM   2110  C CA  . LEU A 1 290 ? 6.330   19.473  0.503   1.00 43.59 ? 328 LEU A CA  1 
ATOM   2111  C C   . LEU A 1 290 ? 4.898   19.720  0.980   1.00 43.69 ? 328 LEU A C   1 
ATOM   2112  O O   . LEU A 1 290 ? 3.949   19.374  0.279   1.00 42.87 ? 328 LEU A O   1 
ATOM   2113  C CB  . LEU A 1 290 ? 6.699   18.016  0.785   1.00 43.38 ? 328 LEU A CB  1 
ATOM   2114  C CG  . LEU A 1 290 ? 8.051   17.541  0.249   1.00 42.63 ? 328 LEU A CG  1 
ATOM   2115  C CD1 . LEU A 1 290 ? 8.558   16.371  1.071   1.00 41.28 ? 328 LEU A CD1 1 
ATOM   2116  C CD2 . LEU A 1 290 ? 7.937   17.188  -1.229  1.00 41.24 ? 328 LEU A CD2 1 
ATOM   2117  N N   . ALA A 1 291 ? 4.738   20.296  2.176   1.00 44.11 ? 329 ALA A N   1 
ATOM   2118  C CA  . ALA A 1 291 ? 3.391   20.571  2.712   1.00 44.41 ? 329 ALA A CA  1 
ATOM   2119  C C   . ALA A 1 291 ? 2.757   21.813  2.062   1.00 44.39 ? 329 ALA A C   1 
ATOM   2120  O O   . ALA A 1 291 ? 1.551   22.026  2.207   1.00 44.48 ? 329 ALA A O   1 
ATOM   2121  C CB  . ALA A 1 291 ? 3.400   20.695  4.262   1.00 44.38 ? 329 ALA A CB  1 
ATOM   2122  N N   . SER A 1 292 ? 3.549   22.602  1.332   1.00 44.16 ? 330 SER A N   1 
ATOM   2123  C CA  . SER A 1 292 ? 3.020   23.771  0.636   1.00 44.21 ? 330 SER A CA  1 
ATOM   2124  C C   . SER A 1 292 ? 2.018   23.358  -0.440  1.00 44.58 ? 330 SER A C   1 
ATOM   2125  O O   . SER A 1 292 ? 0.991   24.025  -0.640  1.00 44.41 ? 330 SER A O   1 
ATOM   2126  C CB  . SER A 1 292 ? 4.139   24.584  0.008   1.00 44.14 ? 330 SER A CB  1 
ATOM   2127  O OG  . SER A 1 292 ? 4.712   23.890  -1.074  1.00 44.43 ? 330 SER A OG  1 
ATOM   2128  N N   . ASN A 1 293 ? 2.320   22.247  -1.121  1.00 44.57 ? 331 ASN A N   1 
ATOM   2129  C CA  . ASN A 1 293 ? 1.408   21.636  -2.081  1.00 43.69 ? 331 ASN A CA  1 
ATOM   2130  C C   . ASN A 1 293 ? 0.077   21.214  -1.491  1.00 43.39 ? 331 ASN A C   1 
ATOM   2131  O O   . ASN A 1 293 ? -0.893  21.017  -2.225  1.00 42.61 ? 331 ASN A O   1 
ATOM   2132  C CB  . ASN A 1 293 ? 2.045   20.412  -2.697  1.00 43.79 ? 331 ASN A CB  1 
ATOM   2133  C CG  . ASN A 1 293 ? 3.231   20.748  -3.534  1.00 44.46 ? 331 ASN A CG  1 
ATOM   2134  O OD1 . ASN A 1 293 ? 3.179   21.632  -4.396  1.00 45.75 ? 331 ASN A OD1 1 
ATOM   2135  N ND2 . ASN A 1 293 ? 4.325   20.046  -3.293  1.00 47.10 ? 331 ASN A ND2 1 
ATOM   2136  N N   . PHE A 1 294 ? 0.030   21.055  -0.177  1.00 43.24 ? 332 PHE A N   1 
ATOM   2137  C CA  . PHE A 1 294 ? -1.186  20.621  0.482   1.00 43.53 ? 332 PHE A CA  1 
ATOM   2138  C C   . PHE A 1 294 ? -1.942  21.773  1.127   1.00 43.82 ? 332 PHE A C   1 
ATOM   2139  O O   . PHE A 1 294 ? -3.010  21.557  1.708   1.00 43.65 ? 332 PHE A O   1 
ATOM   2140  C CB  . PHE A 1 294 ? -0.874  19.547  1.515   1.00 43.83 ? 332 PHE A CB  1 
ATOM   2141  C CG  . PHE A 1 294 ? -0.355  18.271  0.924   1.00 43.62 ? 332 PHE A CG  1 
ATOM   2142  C CD1 . PHE A 1 294 ? 0.962   18.185  0.492   1.00 44.29 ? 332 PHE A CD1 1 
ATOM   2143  C CD2 . PHE A 1 294 ? -1.169  17.165  0.811   1.00 43.64 ? 332 PHE A CD2 1 
ATOM   2144  C CE1 . PHE A 1 294 ? 1.457   17.020  -0.044  1.00 44.08 ? 332 PHE A CE1 1 
ATOM   2145  C CE2 . PHE A 1 294 ? -0.691  15.991  0.270   1.00 44.16 ? 332 PHE A CE2 1 
ATOM   2146  C CZ  . PHE A 1 294 ? 0.631   15.916  -0.153  1.00 44.53 ? 332 PHE A CZ  1 
ATOM   2147  N N   . ILE A 1 295 ? -1.396  22.987  1.023   1.00 43.91 ? 333 ILE A N   1 
ATOM   2148  C CA  . ILE A 1 295 ? -2.093  24.204  1.467   1.00 43.92 ? 333 ILE A CA  1 
ATOM   2149  C C   . ILE A 1 295 ? -3.428  24.272  0.774   1.00 43.73 ? 333 ILE A C   1 
ATOM   2150  O O   . ILE A 1 295 ? -3.454  24.216  -0.455  1.00 44.99 ? 333 ILE A O   1 
ATOM   2151  C CB  . ILE A 1 295 ? -1.309  25.474  1.083   1.00 43.97 ? 333 ILE A CB  1 
ATOM   2152  C CG1 . ILE A 1 295 ? -0.076  25.599  1.959   1.00 43.61 ? 333 ILE A CG1 1 
ATOM   2153  C CG2 . ILE A 1 295 ? -2.193  26.717  1.211   1.00 43.61 ? 333 ILE A CG2 1 
ATOM   2154  C CD1 . ILE A 1 295 ? 0.900   26.627  1.472   1.00 45.57 ? 333 ILE A CD1 1 
ATOM   2155  N N   . SER A 1 296 ? -4.531  24.395  1.525   1.00 43.18 ? 334 SER A N   1 
ATOM   2156  C CA  . SER A 1 296 ? -5.869  24.460  0.900   1.00 42.33 ? 334 SER A CA  1 
ATOM   2157  C C   . SER A 1 296 ? -5.895  25.539  -0.174  1.00 41.87 ? 334 SER A C   1 
ATOM   2158  O O   . SER A 1 296 ? -5.289  26.604  0.004   1.00 42.03 ? 334 SER A O   1 
ATOM   2159  C CB  . SER A 1 296 ? -6.981  24.738  1.931   1.00 42.53 ? 334 SER A CB  1 
ATOM   2160  O OG  . SER A 1 296 ? -8.286  24.683  1.340   1.00 41.31 ? 334 SER A OG  1 
ATOM   2161  N N   . PRO A 1 297 ? -6.575  25.270  -1.301  1.00 41.34 ? 335 PRO A N   1 
ATOM   2162  C CA  . PRO A 1 297 ? -6.775  26.318  -2.304  1.00 40.86 ? 335 PRO A CA  1 
ATOM   2163  C C   . PRO A 1 297 ? -7.939  27.237  -1.911  1.00 40.49 ? 335 PRO A C   1 
ATOM   2164  O O   . PRO A 1 297 ? -8.230  28.206  -2.615  1.00 40.12 ? 335 PRO A O   1 
ATOM   2165  C CB  . PRO A 1 297 ? -7.086  25.529  -3.581  1.00 40.96 ? 335 PRO A CB  1 
ATOM   2166  C CG  . PRO A 1 297 ? -7.763  24.284  -3.098  1.00 41.04 ? 335 PRO A CG  1 
ATOM   2167  C CD  . PRO A 1 297 ? -7.202  23.993  -1.706  1.00 41.53 ? 335 PRO A CD  1 
ATOM   2168  N N   . ASN A 1 298 ? -8.602  26.917  -0.798  1.00 39.97 ? 336 ASN A N   1 
ATOM   2169  C CA  . ASN A 1 298 ? -9.589  27.813  -0.213  1.00 39.61 ? 336 ASN A CA  1 
ATOM   2170  C C   . ASN A 1 298 ? -8.934  28.962  0.582   1.00 39.07 ? 336 ASN A C   1 
ATOM   2171  O O   . ASN A 1 298 ? -9.607  29.967  0.846   1.00 39.14 ? 336 ASN A O   1 
ATOM   2172  C CB  . ASN A 1 298 ? -10.612 27.029  0.644   1.00 39.90 ? 336 ASN A CB  1 
ATOM   2173  N N   . ILE A 1 299 ? -7.639  28.833  0.927   1.00 37.57 ? 337 ILE A N   1 
ATOM   2174  C CA  . ILE A 1 299 ? -6.890  29.901  1.593   1.00 36.71 ? 337 ILE A CA  1 
ATOM   2175  C C   . ILE A 1 299 ? -5.681  30.401  0.772   1.00 36.29 ? 337 ILE A C   1 
ATOM   2176  O O   . ILE A 1 299 ? -5.229  29.773  -0.183  1.00 35.05 ? 337 ILE A O   1 
ATOM   2177  C CB  . ILE A 1 299 ? -6.381  29.465  3.008   1.00 36.73 ? 337 ILE A CB  1 
ATOM   2178  C CG1 . ILE A 1 299 ? -5.078  28.643  2.911   1.00 36.37 ? 337 ILE A CG1 1 
ATOM   2179  C CG2 . ILE A 1 299 ? -7.468  28.683  3.747   1.00 37.62 ? 337 ILE A CG2 1 
ATOM   2180  C CD1 . ILE A 1 299 ? -4.539  28.124  4.230   1.00 36.29 ? 337 ILE A CD1 1 
ATOM   2181  N N   . THR A 1 300 ? -5.169  31.553  1.190   1.00 36.73 ? 338 THR A N   1 
ATOM   2182  C CA  . THR A 1 300 ? -3.931  32.133  0.672   1.00 36.92 ? 338 THR A CA  1 
ATOM   2183  C C   . THR A 1 300 ? -2.901  32.218  1.817   1.00 36.73 ? 338 THR A C   1 
ATOM   2184  O O   . THR A 1 300 ? -3.105  32.918  2.816   1.00 37.50 ? 338 THR A O   1 
ATOM   2185  C CB  . THR A 1 300 ? -4.177  33.494  -0.067  1.00 36.86 ? 338 THR A CB  1 
ATOM   2186  O OG1 . THR A 1 300 ? -2.928  34.140  -0.327  1.00 38.26 ? 338 THR A OG1 1 
ATOM   2187  C CG2 . THR A 1 300 ? -5.052  34.426  0.737   1.00 37.71 ? 338 THR A CG2 1 
ATOM   2188  N N   . VAL A 1 301 ? -1.849  31.408  1.686   1.00 35.72 ? 339 VAL A N   1 
ATOM   2189  C CA  . VAL A 1 301 ? -0.613  31.528  2.455   1.00 34.90 ? 339 VAL A CA  1 
ATOM   2190  C C   . VAL A 1 301 ? 0.417   32.297  1.597   1.00 33.82 ? 339 VAL A C   1 
ATOM   2191  O O   . VAL A 1 301 ? 0.537   32.034  0.412   1.00 33.22 ? 339 VAL A O   1 
ATOM   2192  C CB  . VAL A 1 301 ? -0.065  30.133  2.825   1.00 35.19 ? 339 VAL A CB  1 
ATOM   2193  C CG1 . VAL A 1 301 ? 1.157   30.246  3.706   1.00 34.91 ? 339 VAL A CG1 1 
ATOM   2194  C CG2 . VAL A 1 301 ? -1.147  29.290  3.535   1.00 34.23 ? 339 VAL A CG2 1 
ATOM   2195  N N   . HIS A 1 302 ? 1.125   33.261  2.196   1.00 32.54 ? 340 HIS A N   1 
ATOM   2196  C CA  . HIS A 1 302 ? 2.184   34.024  1.520   1.00 31.61 ? 340 HIS A CA  1 
ATOM   2197  C C   . HIS A 1 302 ? 3.522   33.467  1.920   1.00 31.00 ? 340 HIS A C   1 
ATOM   2198  O O   . HIS A 1 302 ? 3.873   33.530  3.051   1.00 31.68 ? 340 HIS A O   1 
ATOM   2199  C CB  . HIS A 1 302 ? 2.110   35.522  1.871   1.00 31.25 ? 340 HIS A CB  1 
ATOM   2200  C CG  . HIS A 1 302 ? 0.758   36.113  1.666   1.00 30.23 ? 340 HIS A CG  1 
ATOM   2201  N ND1 . HIS A 1 302 ? 0.181   36.252  0.420   1.00 30.24 ? 340 HIS A ND1 1 
ATOM   2202  C CD2 . HIS A 1 302 ? -0.171  36.520  2.555   1.00 30.67 ? 340 HIS A CD2 1 
ATOM   2203  C CE1 . HIS A 1 302 ? -1.022  36.772  0.551   1.00 27.89 ? 340 HIS A CE1 1 
ATOM   2204  N NE2 . HIS A 1 302 ? -1.257  36.945  1.840   1.00 28.68 ? 340 HIS A NE2 1 
ATOM   2205  N N   . LEU A 1 303 ? 4.271   32.927  0.976   1.00 31.42 ? 341 LEU A N   1 
ATOM   2206  C CA  . LEU A 1 303 ? 5.522   32.218  1.271   1.00 31.71 ? 341 LEU A CA  1 
ATOM   2207  C C   . LEU A 1 303 ? 6.784   33.083  1.000   1.00 31.75 ? 341 LEU A C   1 
ATOM   2208  O O   . LEU A 1 303 ? 6.962   33.676  -0.083  1.00 31.50 ? 341 LEU A O   1 
ATOM   2209  C CB  . LEU A 1 303 ? 5.587   30.917  0.469   1.00 31.80 ? 341 LEU A CB  1 
ATOM   2210  C CG  . LEU A 1 303 ? 4.593   29.817  0.787   1.00 31.63 ? 341 LEU A CG  1 
ATOM   2211  C CD1 . LEU A 1 303 ? 4.873   28.662  -0.162  1.00 33.67 ? 341 LEU A CD1 1 
ATOM   2212  C CD2 . LEU A 1 303 ? 4.721   29.391  2.222   1.00 31.25 ? 341 LEU A CD2 1 
ATOM   2213  N N   . GLN A 1 304 ? 7.637   33.144  2.013   1.00 32.64 ? 342 GLN A N   1 
ATOM   2214  C CA  . GLN A 1 304 ? 8.781   34.025  2.040   1.00 33.73 ? 342 GLN A CA  1 
ATOM   2215  C C   . GLN A 1 304 ? 10.045  33.181  1.858   1.00 34.66 ? 342 GLN A C   1 
ATOM   2216  O O   . GLN A 1 304 ? 10.149  32.083  2.391   1.00 33.97 ? 342 GLN A O   1 
ATOM   2217  C CB  . GLN A 1 304 ? 8.792   34.821  3.347   1.00 33.87 ? 342 GLN A CB  1 
ATOM   2218  C CG  . GLN A 1 304 ? 9.653   36.088  3.372   1.00 35.09 ? 342 GLN A CG  1 
ATOM   2219  C CD  . GLN A 1 304 ? 11.073  35.866  3.896   1.00 39.18 ? 342 GLN A CD  1 
ATOM   2220  O OE1 . GLN A 1 304 ? 11.483  34.719  4.151   1.00 39.34 ? 342 GLN A OE1 1 
ATOM   2221  N NE2 . GLN A 1 304 ? 11.845  36.977  4.062   1.00 37.44 ? 342 GLN A NE2 1 
ATOM   2222  N N   . SER A 1 305 ? 10.987  33.705  1.059   1.00 36.45 ? 343 SER A N   1 
ATOM   2223  C CA  . SER A 1 305 ? 12.283  33.059  0.819   1.00 36.56 ? 343 SER A CA  1 
ATOM   2224  C C   . SER A 1 305 ? 13.355  33.976  1.321   1.00 37.11 ? 343 SER A C   1 
ATOM   2225  O O   . SER A 1 305 ? 13.353  35.160  0.994   1.00 37.02 ? 343 SER A O   1 
ATOM   2226  C CB  . SER A 1 305 ? 12.462  32.843  -0.664  1.00 37.15 ? 343 SER A CB  1 
ATOM   2227  O OG  . SER A 1 305 ? 13.315  31.751  -0.912  1.00 40.28 ? 343 SER A OG  1 
ATOM   2228  N N   . GLU A 1 306 ? 14.278  33.440  2.115   1.00 37.46 ? 344 GLU A N   1 
ATOM   2229  C CA  . GLU A 1 306 ? 15.361  34.227  2.710   1.00 38.50 ? 344 GLU A CA  1 
ATOM   2230  C C   . GLU A 1 306 ? 16.319  34.912  1.731   1.00 37.81 ? 344 GLU A C   1 
ATOM   2231  O O   . GLU A 1 306 ? 17.026  35.869  2.076   1.00 37.94 ? 344 GLU A O   1 
ATOM   2232  C CB  . GLU A 1 306 ? 16.185  33.315  3.633   1.00 39.12 ? 344 GLU A CB  1 
ATOM   2233  C CG  . GLU A 1 306 ? 16.991  32.245  2.908   1.00 41.28 ? 344 GLU A CG  1 
ATOM   2234  C CD  . GLU A 1 306 ? 17.591  31.198  3.865   1.00 42.14 ? 344 GLU A CD  1 
ATOM   2235  O OE1 . GLU A 1 306 ? 16.910  30.884  4.880   1.00 43.45 ? 344 GLU A OE1 1 
ATOM   2236  O OE2 . GLU A 1 306 ? 18.718  30.688  3.562   1.00 41.72 ? 344 GLU A OE2 1 
ATOM   2237  N N   . ASN A 1 307 ? 16.388  34.379  0.522   1.00 37.49 ? 345 ASN A N   1 
ATOM   2238  C CA  . ASN A 1 307 ? 17.193  34.963  -0.530  1.00 37.15 ? 345 ASN A CA  1 
ATOM   2239  C C   . ASN A 1 307 ? 16.568  36.181  -1.178  1.00 37.08 ? 345 ASN A C   1 
ATOM   2240  O O   . ASN A 1 307 ? 17.144  36.745  -2.123  1.00 38.28 ? 345 ASN A O   1 
ATOM   2241  C CB  . ASN A 1 307 ? 17.532  33.923  -1.580  1.00 37.32 ? 345 ASN A CB  1 
ATOM   2242  C CG  . ASN A 1 307 ? 16.335  33.343  -2.199  1.00 36.42 ? 345 ASN A CG  1 
ATOM   2243  O OD1 . ASN A 1 307 ? 15.371  33.041  -1.503  1.00 36.26 ? 345 ASN A OD1 1 
ATOM   2244  N ND2 . ASN A 1 307 ? 16.363  33.186  -3.527  1.00 37.82 ? 345 ASN A ND2 1 
ATOM   2245  N N   . GLY A 1 308 ? 15.393  36.588  -0.676  1.00 36.08 ? 346 GLY A N   1 
ATOM   2246  C CA  . GLY A 1 308 ? 14.800  37.845  -1.025  1.00 34.26 ? 346 GLY A CA  1 
ATOM   2247  C C   . GLY A 1 308 ? 13.525  37.814  -1.824  1.00 34.17 ? 346 GLY A C   1 
ATOM   2248  O O   . GLY A 1 308 ? 13.323  38.678  -2.685  1.00 32.28 ? 346 GLY A O   1 
ATOM   2249  N N   . VAL A 1 309 ? 12.640  36.867  -1.511  1.00 33.36 ? 347 VAL A N   1 
ATOM   2250  C CA  . VAL A 1 309 ? 11.362  36.777  -2.184  1.00 33.06 ? 347 VAL A CA  1 
ATOM   2251  C C   . VAL A 1 309 ? 10.158  36.665  -1.242  1.00 32.77 ? 347 VAL A C   1 
ATOM   2252  O O   . VAL A 1 309 ? 10.243  36.090  -0.182  1.00 33.99 ? 347 VAL A O   1 
ATOM   2253  C CB  . VAL A 1 309 ? 11.271  35.584  -3.138  1.00 33.57 ? 347 VAL A CB  1 
ATOM   2254  C CG1 . VAL A 1 309 ? 10.056  35.816  -4.145  1.00 31.75 ? 347 VAL A CG1 1 
ATOM   2255  C CG2 . VAL A 1 309 ? 12.564  35.332  -3.863  1.00 30.80 ? 347 VAL A CG2 1 
ATOM   2256  N N   . LEU A 1 310 ? 9.054   37.275  -1.640  1.00 32.71 ? 348 LEU A N   1 
ATOM   2257  C CA  . LEU A 1 310 ? 7.773   37.104  -0.962  1.00 32.97 ? 348 LEU A CA  1 
ATOM   2258  C C   . LEU A 1 310 ? 6.701   36.844  -2.004  1.00 32.37 ? 348 LEU A C   1 
ATOM   2259  O O   . LEU A 1 310 ? 6.501   37.636  -2.902  1.00 33.74 ? 348 LEU A O   1 
ATOM   2260  C CB  . LEU A 1 310 ? 7.414   38.337  -0.141  1.00 33.11 ? 348 LEU A CB  1 
ATOM   2261  C CG  . LEU A 1 310 ? 6.103   38.271  0.630   1.00 34.87 ? 348 LEU A CG  1 
ATOM   2262  C CD1 . LEU A 1 310 ? 6.137   37.114  1.596   1.00 32.42 ? 348 LEU A CD1 1 
ATOM   2263  C CD2 . LEU A 1 310 ? 5.893   39.590  1.332   1.00 39.03 ? 348 LEU A CD2 1 
ATOM   2264  N N   . GLY A 1 311 ? 6.031   35.713  -1.873  1.00 32.70 ? 349 GLY A N   1 
ATOM   2265  C CA  . GLY A 1 311 ? 4.985   35.319  -2.751  1.00 32.44 ? 349 GLY A CA  1 
ATOM   2266  C C   . GLY A 1 311 ? 5.422   34.209  -3.657  1.00 32.79 ? 349 GLY A C   1 
ATOM   2267  O O   . GLY A 1 311 ? 5.056   34.208  -4.817  1.00 32.86 ? 349 GLY A O   1 
ATOM   2268  N N   . LEU A 1 312 ? 6.203   33.259  -3.136  1.00 33.47 ? 350 LEU A N   1 
ATOM   2269  C CA  . LEU A 1 312 ? 6.627   32.127  -3.927  1.00 33.59 ? 350 LEU A CA  1 
ATOM   2270  C C   . LEU A 1 312 ? 5.410   31.358  -4.447  1.00 33.47 ? 350 LEU A C   1 
ATOM   2271  O O   . LEU A 1 312 ? 4.428   31.125  -3.729  1.00 33.87 ? 350 LEU A O   1 
ATOM   2272  C CB  . LEU A 1 312 ? 7.578   31.196  -3.150  1.00 34.25 ? 350 LEU A CB  1 
ATOM   2273  C CG  . LEU A 1 312 ? 8.972   31.715  -2.861  1.00 35.41 ? 350 LEU A CG  1 
ATOM   2274  C CD1 . LEU A 1 312 ? 9.733   30.709  -2.003  1.00 38.64 ? 350 LEU A CD1 1 
ATOM   2275  C CD2 . LEU A 1 312 ? 9.703   31.976  -4.169  1.00 38.81 ? 350 LEU A CD2 1 
ATOM   2276  N N   . GLY A 1 313 ? 5.480   30.995  -5.729  1.00 33.57 ? 351 GLY A N   1 
ATOM   2277  C CA  . GLY A 1 313 ? 4.476   30.113  -6.375  1.00 32.99 ? 351 GLY A CA  1 
ATOM   2278  C C   . GLY A 1 313 ? 4.999   28.693  -6.476  1.00 32.49 ? 351 GLY A C   1 
ATOM   2279  O O   . GLY A 1 313 ? 5.967   28.355  -5.826  1.00 32.69 ? 351 GLY A O   1 
ATOM   2280  N N   . PRO A 1 314 ? 4.355   27.846  -7.289  1.00 32.67 ? 352 PRO A N   1 
ATOM   2281  C CA  . PRO A 1 314 ? 4.860   26.485  -7.556  1.00 32.29 ? 352 PRO A CA  1 
ATOM   2282  C C   . PRO A 1 314 ? 6.201   26.387  -8.293  1.00 31.54 ? 352 PRO A C   1 
ATOM   2283  O O   . PRO A 1 314 ? 6.729   27.388  -8.792  1.00 33.02 ? 352 PRO A O   1 
ATOM   2284  C CB  . PRO A 1 314 ? 3.743   25.830  -8.402  1.00 31.83 ? 352 PRO A CB  1 
ATOM   2285  C CG  . PRO A 1 314 ? 2.807   26.881  -8.775  1.00 32.68 ? 352 PRO A CG  1 
ATOM   2286  C CD  . PRO A 1 314 ? 3.056   28.109  -7.936  1.00 33.04 ? 352 PRO A CD  1 
ATOM   2287  N N   . TYR A 1 315 ? 6.728   25.177  -8.370  1.00 30.35 ? 353 TYR A N   1 
ATOM   2288  C CA  . TYR A 1 315 ? 7.875   24.906  -9.198  1.00 30.55 ? 353 TYR A CA  1 
ATOM   2289  C C   . TYR A 1 315 ? 7.498   25.241  -10.631 1.00 30.11 ? 353 TYR A C   1 
ATOM   2290  O O   . TYR A 1 315 ? 6.303   25.152  -11.001 1.00 29.91 ? 353 TYR A O   1 
ATOM   2291  C CB  . TYR A 1 315 ? 8.365   23.451  -9.052  1.00 31.36 ? 353 TYR A CB  1 
ATOM   2292  C CG  . TYR A 1 315 ? 8.965   23.199  -7.694  1.00 31.34 ? 353 TYR A CG  1 
ATOM   2293  C CD1 . TYR A 1 315 ? 10.167  23.771  -7.336  1.00 31.87 ? 353 TYR A CD1 1 
ATOM   2294  C CD2 . TYR A 1 315 ? 8.302   22.416  -6.753  1.00 33.68 ? 353 TYR A CD2 1 
ATOM   2295  C CE1 . TYR A 1 315 ? 10.707  23.578  -6.098  1.00 33.04 ? 353 TYR A CE1 1 
ATOM   2296  C CE2 . TYR A 1 315 ? 8.832   22.200  -5.507  1.00 33.55 ? 353 TYR A CE2 1 
ATOM   2297  C CZ  . TYR A 1 315 ? 10.034  22.784  -5.174  1.00 34.65 ? 353 TYR A CZ  1 
ATOM   2298  O OH  . TYR A 1 315 ? 10.547  22.577  -3.918  1.00 33.07 ? 353 TYR A OH  1 
ATOM   2299  N N   . PRO A 1 316 ? 8.488   25.696  -11.428 1.00 29.54 ? 354 PRO A N   1 
ATOM   2300  C CA  . PRO A 1 316 ? 8.191   26.121  -12.798 1.00 29.07 ? 354 PRO A CA  1 
ATOM   2301  C C   . PRO A 1 316 ? 8.070   25.008  -13.781 1.00 29.65 ? 354 PRO A C   1 
ATOM   2302  O O   . PRO A 1 316 ? 8.726   24.001  -13.634 1.00 29.99 ? 354 PRO A O   1 
ATOM   2303  C CB  . PRO A 1 316 ? 9.432   26.949  -13.183 1.00 28.78 ? 354 PRO A CB  1 
ATOM   2304  C CG  . PRO A 1 316 ? 10.559  26.312  -12.431 1.00 27.76 ? 354 PRO A CG  1 
ATOM   2305  C CD  . PRO A 1 316 ? 9.905   25.956  -11.081 1.00 29.45 ? 354 PRO A CD  1 
ATOM   2306  N N   . ARG A 1 317 ? 7.226   25.211  -14.800 1.00 29.95 ? 355 ARG A N   1 
ATOM   2307  C CA  A ARG A 1 317 ? 7.279   24.404  -16.003 0.50 29.58 ? 355 ARG A CA  1 
ATOM   2308  C CA  B ARG A 1 317 ? 7.279   24.407  -15.997 0.50 29.45 ? 355 ARG A CA  1 
ATOM   2309  C C   . ARG A 1 317 ? 8.631   24.685  -16.639 1.00 29.89 ? 355 ARG A C   1 
ATOM   2310  O O   . ARG A 1 317 ? 9.221   25.734  -16.423 1.00 28.42 ? 355 ARG A O   1 
ATOM   2311  C CB  A ARG A 1 317 ? 6.159   24.772  -16.986 0.50 29.64 ? 355 ARG A CB  1 
ATOM   2312  C CB  B ARG A 1 317 ? 6.132   24.770  -16.950 0.50 29.45 ? 355 ARG A CB  1 
ATOM   2313  C CG  A ARG A 1 317 ? 4.713   24.794  -16.412 0.50 29.21 ? 355 ARG A CG  1 
ATOM   2314  C CG  B ARG A 1 317 ? 4.715   24.326  -16.467 0.50 28.37 ? 355 ARG A CG  1 
ATOM   2315  C CD  A ARG A 1 317 ? 4.113   23.417  -16.129 0.50 27.71 ? 355 ARG A CD  1 
ATOM   2316  C CD  B ARG A 1 317 ? 4.013   25.371  -15.546 0.50 26.64 ? 355 ARG A CD  1 
ATOM   2317  N NE  A ARG A 1 317 ? 2.758   23.529  -15.567 0.50 26.47 ? 355 ARG A NE  1 
ATOM   2318  N NE  B ARG A 1 317 ? 2.586   25.076  -15.361 0.50 26.46 ? 355 ARG A NE  1 
ATOM   2319  C CZ  A ARG A 1 317 ? 1.976   22.508  -15.235 0.50 26.18 ? 355 ARG A CZ  1 
ATOM   2320  C CZ  B ARG A 1 317 ? 1.629   25.964  -15.082 0.50 24.16 ? 355 ARG A CZ  1 
ATOM   2321  N NH1 A ARG A 1 317 ? 2.391   21.254  -15.399 0.50 27.14 ? 355 ARG A NH1 1 
ATOM   2322  N NH1 B ARG A 1 317 ? 1.890   27.249  -14.940 0.50 23.39 ? 355 ARG A NH1 1 
ATOM   2323  N NH2 A ARG A 1 317 ? 0.768   22.744  -14.740 0.50 25.67 ? 355 ARG A NH2 1 
ATOM   2324  N NH2 B ARG A 1 317 ? 0.386   25.551  -14.941 0.50 25.11 ? 355 ARG A NH2 1 
ATOM   2325  N N   . GLN A 1 318 ? 9.126   23.740  -17.415 1.00 30.99 ? 356 GLN A N   1 
ATOM   2326  C CA  . GLN A 1 318 ? 10.406  23.887  -18.101 1.00 32.75 ? 356 GLN A CA  1 
ATOM   2327  C C   . GLN A 1 318 ? 10.651  25.302  -18.630 1.00 32.59 ? 356 GLN A C   1 
ATOM   2328  O O   . GLN A 1 318 ? 11.660  25.927  -18.318 1.00 32.77 ? 356 GLN A O   1 
ATOM   2329  C CB  . GLN A 1 318 ? 10.459  22.891  -19.272 1.00 33.90 ? 356 GLN A CB  1 
ATOM   2330  C CG  . GLN A 1 318 ? 11.811  22.826  -20.006 1.00 38.33 ? 356 GLN A CG  1 
ATOM   2331  C CD  . GLN A 1 318 ? 12.893  22.158  -19.166 1.00 44.41 ? 356 GLN A CD  1 
ATOM   2332  O OE1 . GLN A 1 318 ? 12.655  21.750  -18.016 1.00 49.40 ? 356 GLN A OE1 1 
ATOM   2333  N NE2 . GLN A 1 318 ? 14.088  22.029  -19.741 1.00 48.32 ? 356 GLN A NE2 1 
ATOM   2334  N N   . HIS A 1 319 ? 9.708   25.788  -19.434 1.00 32.68 ? 357 HIS A N   1 
ATOM   2335  C CA  . HIS A 1 319 ? 9.805   27.081  -20.090 1.00 32.53 ? 357 HIS A CA  1 
ATOM   2336  C C   . HIS A 1 319 ? 9.797   28.280  -19.151 1.00 32.96 ? 357 HIS A C   1 
ATOM   2337  O O   . HIS A 1 319 ? 10.231  29.342  -19.550 1.00 34.43 ? 357 HIS A O   1 
ATOM   2338  C CB  . HIS A 1 319 ? 8.695   27.226  -21.149 1.00 32.20 ? 357 HIS A CB  1 
ATOM   2339  C CG  . HIS A 1 319 ? 7.322   27.339  -20.575 1.00 30.68 ? 357 HIS A CG  1 
ATOM   2340  N ND1 . HIS A 1 319 ? 6.550   26.236  -20.270 1.00 28.57 ? 357 HIS A ND1 1 
ATOM   2341  C CD2 . HIS A 1 319 ? 6.581   28.422  -20.254 1.00 30.07 ? 357 HIS A CD2 1 
ATOM   2342  C CE1 . HIS A 1 319 ? 5.387   26.637  -19.792 1.00 30.11 ? 357 HIS A CE1 1 
ATOM   2343  N NE2 . HIS A 1 319 ? 5.383   27.959  -19.765 1.00 31.12 ? 357 HIS A NE2 1 
ATOM   2344  N N   . GLU A 1 320 ? 9.315   28.118  -17.924 1.00 33.48 ? 358 GLU A N   1 
ATOM   2345  C CA  . GLU A 1 320 ? 9.370   29.162  -16.898 1.00 33.90 ? 358 GLU A CA  1 
ATOM   2346  C C   . GLU A 1 320 ? 10.659  29.146  -16.034 1.00 33.96 ? 358 GLU A C   1 
ATOM   2347  O O   . GLU A 1 320 ? 10.917  30.101  -15.301 1.00 34.12 ? 358 GLU A O   1 
ATOM   2348  C CB  . GLU A 1 320 ? 8.188   29.016  -15.922 1.00 33.91 ? 358 GLU A CB  1 
ATOM   2349  C CG  . GLU A 1 320 ? 6.799   29.198  -16.522 1.00 33.36 ? 358 GLU A CG  1 
ATOM   2350  C CD  . GLU A 1 320 ? 5.713   28.582  -15.652 1.00 34.56 ? 358 GLU A CD  1 
ATOM   2351  O OE1 . GLU A 1 320 ? 6.060   27.850  -14.699 1.00 33.31 ? 358 GLU A OE1 1 
ATOM   2352  O OE2 . GLU A 1 320 ? 4.501   28.783  -15.946 1.00 37.78 ? 358 GLU A OE2 1 
ATOM   2353  N N   . ALA A 1 321 ? 11.441  28.076  -16.059 1.00 34.05 ? 359 ALA A N   1 
ATOM   2354  C CA  . ALA A 1 321 ? 12.636  28.011  -15.170 1.00 34.77 ? 359 ALA A CA  1 
ATOM   2355  C C   . ALA A 1 321 ? 13.623  29.148  -15.509 1.00 35.30 ? 359 ALA A C   1 
ATOM   2356  O O   . ALA A 1 321 ? 13.864  29.454  -16.679 1.00 35.40 ? 359 ALA A O   1 
ATOM   2357  C CB  . ALA A 1 321 ? 13.308  26.634  -15.207 1.00 33.76 ? 359 ALA A CB  1 
ATOM   2358  N N   . ASP A 1 322 ? 14.139  29.796  -14.461 1.00 36.31 ? 360 ASP A N   1 
ATOM   2359  C CA  . ASP A 1 322 ? 14.983  31.004  -14.573 1.00 36.71 ? 360 ASP A CA  1 
ATOM   2360  C C   . ASP A 1 322 ? 16.086  30.957  -13.520 1.00 35.56 ? 360 ASP A C   1 
ATOM   2361  O O   . ASP A 1 322 ? 15.798  30.846  -12.335 1.00 36.34 ? 360 ASP A O   1 
ATOM   2362  C CB  . ASP A 1 322 ? 14.128  32.248  -14.310 1.00 37.73 ? 360 ASP A CB  1 
ATOM   2363  C CG  . ASP A 1 322 ? 14.817  33.533  -14.688 1.00 39.40 ? 360 ASP A CG  1 
ATOM   2364  O OD1 . ASP A 1 322 ? 16.025  33.753  -14.377 1.00 41.41 ? 360 ASP A OD1 1 
ATOM   2365  O OD2 . ASP A 1 322 ? 14.124  34.333  -15.328 1.00 43.74 ? 360 ASP A OD2 1 
ATOM   2366  N N   . ALA A 1 323 ? 17.332  31.051  -13.969 1.00 34.52 ? 361 ALA A N   1 
ATOM   2367  C CA  . ALA A 1 323 ? 18.508  31.065  -13.097 1.00 34.11 ? 361 ALA A CA  1 
ATOM   2368  C C   . ALA A 1 323 ? 18.474  32.223  -12.064 1.00 33.52 ? 361 ALA A C   1 
ATOM   2369  O O   . ALA A 1 323 ? 19.083  32.104  -10.996 1.00 34.20 ? 361 ALA A O   1 
ATOM   2370  C CB  . ALA A 1 323 ? 19.783  31.141  -13.953 1.00 32.69 ? 361 ALA A CB  1 
ATOM   2371  N N   . ASP A 1 324 ? 17.769  33.314  -12.375 1.00 33.24 ? 362 ASP A N   1 
ATOM   2372  C CA  . ASP A 1 324 ? 17.666  34.458  -11.488 1.00 33.85 ? 362 ASP A CA  1 
ATOM   2373  C C   . ASP A 1 324 ? 16.578  34.298  -10.434 1.00 33.08 ? 362 ASP A C   1 
ATOM   2374  O O   . ASP A 1 324 ? 16.449  35.202  -9.589  1.00 32.80 ? 362 ASP A O   1 
ATOM   2375  C CB  . ASP A 1 324 ? 17.474  35.811  -12.256 1.00 34.71 ? 362 ASP A CB  1 
ATOM   2376  C CG  . ASP A 1 324 ? 18.719  36.256  -13.027 1.00 38.32 ? 362 ASP A CG  1 
ATOM   2377  O OD1 . ASP A 1 324 ? 19.849  35.824  -12.680 1.00 42.72 ? 362 ASP A OD1 1 
ATOM   2378  O OD2 . ASP A 1 324 ? 18.585  37.055  -13.995 1.00 42.30 ? 362 ASP A OD2 1 
ATOM   2379  N N   . LEU A 1 325 ? 15.846  33.163  -10.447 1.00 32.21 ? 363 LEU A N   1 
ATOM   2380  C CA  . LEU A 1 325 ? 14.739  32.877  -9.493  1.00 30.97 ? 363 LEU A CA  1 
ATOM   2381  C C   . LEU A 1 325 ? 14.836  31.487  -8.873  1.00 31.33 ? 363 LEU A C   1 
ATOM   2382  O O   . LEU A 1 325 ? 14.571  30.457  -9.515  1.00 31.20 ? 363 LEU A O   1 
ATOM   2383  C CB  . LEU A 1 325 ? 13.370  33.049  -10.153 1.00 31.19 ? 363 LEU A CB  1 
ATOM   2384  C CG  . LEU A 1 325 ? 12.059  33.085  -9.325  1.00 31.19 ? 363 LEU A CG  1 
ATOM   2385  C CD1 . LEU A 1 325 ? 12.174  33.892  -8.023  1.00 29.78 ? 363 LEU A CD1 1 
ATOM   2386  C CD2 . LEU A 1 325 ? 10.905  33.614  -10.162 1.00 27.56 ? 363 LEU A CD2 1 
ATOM   2387  N N   . ILE A 1 326 ? 15.254  31.474  -7.609  1.00 31.35 ? 364 ILE A N   1 
ATOM   2388  C CA  . ILE A 1 326 ? 15.433  30.256  -6.872  1.00 31.23 ? 364 ILE A CA  1 
ATOM   2389  C C   . ILE A 1 326 ? 14.887  30.430  -5.432  1.00 32.49 ? 364 ILE A C   1 
ATOM   2390  O O   . ILE A 1 326 ? 14.613  31.580  -4.961  1.00 32.74 ? 364 ILE A O   1 
ATOM   2391  C CB  . ILE A 1 326 ? 16.936  29.766  -6.895  1.00 31.86 ? 364 ILE A CB  1 
ATOM   2392  C CG1 . ILE A 1 326 ? 17.921  30.754  -6.254  1.00 31.38 ? 364 ILE A CG1 1 
ATOM   2393  C CG2 . ILE A 1 326 ? 17.442  29.470  -8.341  1.00 28.99 ? 364 ILE A CG2 1 
ATOM   2394  C CD1 . ILE A 1 326 ? 19.185  30.090  -5.801  1.00 30.08 ? 364 ILE A CD1 1 
ATOM   2395  N N   . ASN A 1 327 ? 14.717  29.301  -4.747  1.00 31.13 ? 365 ASN A N   1 
ATOM   2396  C CA  . ASN A 1 327 ? 14.418  29.342  -3.354  1.00 31.91 ? 365 ASN A CA  1 
ATOM   2397  C C   . ASN A 1 327 ? 15.721  29.141  -2.526  1.00 31.93 ? 365 ASN A C   1 
ATOM   2398  O O   . ASN A 1 327 ? 16.850  29.154  -3.063  1.00 31.59 ? 365 ASN A O   1 
ATOM   2399  C CB  . ASN A 1 327 ? 13.247  28.381  -2.984  1.00 31.52 ? 365 ASN A CB  1 
ATOM   2400  C CG  . ASN A 1 327 ? 13.557  26.915  -3.257  1.00 31.28 ? 365 ASN A CG  1 
ATOM   2401  O OD1 . ASN A 1 327 ? 14.692  26.565  -3.456  1.00 32.74 ? 365 ASN A OD1 1 
ATOM   2402  N ND2 . ASN A 1 327 ? 12.534  26.057  -3.253  1.00 26.84 ? 365 ASN A ND2 1 
ATOM   2403  N N   . ALA A 1 328 ? 15.546  29.023  -1.225  1.00 32.40 ? 366 ALA A N   1 
ATOM   2404  C CA  . ALA A 1 328 ? 16.640  28.856  -0.278  1.00 33.46 ? 366 ALA A CA  1 
ATOM   2405  C C   . ALA A 1 328 ? 17.230  27.446  -0.344  1.00 34.13 ? 366 ALA A C   1 
ATOM   2406  O O   . ALA A 1 328 ? 18.360  27.230  0.072   1.00 35.54 ? 366 ALA A O   1 
ATOM   2407  C CB  . ALA A 1 328 ? 16.145  29.146  1.096   1.00 33.48 ? 366 ALA A CB  1 
ATOM   2408  N N   . GLY A 1 329 ? 16.501  26.491  -0.909  1.00 33.46 ? 367 GLY A N   1 
ATOM   2409  C CA  . GLY A 1 329 ? 17.086  25.215  -1.280  1.00 33.58 ? 367 GLY A CA  1 
ATOM   2410  C C   . GLY A 1 329 ? 17.812  25.225  -2.616  1.00 33.48 ? 367 GLY A C   1 
ATOM   2411  O O   . GLY A 1 329 ? 18.126  24.180  -3.141  1.00 33.94 ? 367 GLY A O   1 
ATOM   2412  N N   . LYS A 1 330 ? 18.060  26.402  -3.179  1.00 33.75 ? 368 LYS A N   1 
ATOM   2413  C CA  . LYS A 1 330 ? 18.690  26.553  -4.505  1.00 33.79 ? 368 LYS A CA  1 
ATOM   2414  C C   . LYS A 1 330 ? 17.962  25.866  -5.680  1.00 33.46 ? 368 LYS A C   1 
ATOM   2415  O O   . LYS A 1 330 ? 18.588  25.497  -6.687  1.00 32.92 ? 368 LYS A O   1 
ATOM   2416  C CB  . LYS A 1 330 ? 20.161  26.141  -4.441  1.00 33.79 ? 368 LYS A CB  1 
ATOM   2417  C CG  . LYS A 1 330 ? 20.979  26.994  -3.436  1.00 34.61 ? 368 LYS A CG  1 
ATOM   2418  C CD  . LYS A 1 330 ? 22.413  26.518  -3.282  1.00 35.08 ? 368 LYS A CD  1 
ATOM   2419  C CE  . LYS A 1 330 ? 22.550  25.145  -2.572  1.00 37.97 ? 368 LYS A CE  1 
ATOM   2420  N NZ  . LYS A 1 330 ? 23.914  24.532  -2.802  1.00 37.72 ? 368 LYS A NZ  1 
ATOM   2421  N N   . GLU A 1 331 ? 16.649  25.701  -5.521  1.00 33.33 ? 369 GLU A N   1 
ATOM   2422  C CA  . GLU A 1 331 ? 15.760  25.152  -6.539  1.00 33.47 ? 369 GLU A CA  1 
ATOM   2423  C C   . GLU A 1 331 ? 15.152  26.284  -7.359  1.00 32.74 ? 369 GLU A C   1 
ATOM   2424  O O   . GLU A 1 331 ? 14.735  27.292  -6.817  1.00 32.30 ? 369 GLU A O   1 
ATOM   2425  C CB  . GLU A 1 331 ? 14.605  24.380  -5.873  1.00 34.15 ? 369 GLU A CB  1 
ATOM   2426  C CG  . GLU A 1 331 ? 15.013  23.121  -5.064  1.00 35.65 ? 369 GLU A CG  1 
ATOM   2427  C CD  . GLU A 1 331 ? 13.851  22.447  -4.353  1.00 35.13 ? 369 GLU A CD  1 
ATOM   2428  O OE1 . GLU A 1 331 ? 13.092  23.107  -3.647  1.00 34.62 ? 369 GLU A OE1 1 
ATOM   2429  O OE2 . GLU A 1 331 ? 13.694  21.225  -4.491  1.00 42.52 ? 369 GLU A OE2 1 
ATOM   2430  N N   . THR A 1 332 ? 15.052  26.100  -8.662  1.00 32.13 ? 370 THR A N   1 
ATOM   2431  C CA  . THR A 1 332 ? 14.253  27.005  -9.512  1.00 31.28 ? 370 THR A CA  1 
ATOM   2432  C C   . THR A 1 332 ? 12.751  27.005  -9.130  1.00 31.24 ? 370 THR A C   1 
ATOM   2433  O O   . THR A 1 332 ? 12.117  25.965  -8.970  1.00 31.18 ? 370 THR A O   1 
ATOM   2434  C CB  . THR A 1 332 ? 14.433  26.645  -10.988 1.00 31.57 ? 370 THR A CB  1 
ATOM   2435  O OG1 . THR A 1 332 ? 14.054  25.265  -11.192 1.00 31.88 ? 370 THR A OG1 1 
ATOM   2436  C CG2 . THR A 1 332 ? 15.895  26.868  -11.434 1.00 30.08 ? 370 THR A CG2 1 
ATOM   2437  N N   . VAL A 1 333 ? 12.205  28.203  -8.966  1.00 31.44 ? 371 VAL A N   1 
ATOM   2438  C CA  . VAL A 1 333 ? 10.845  28.408  -8.478  1.00 30.86 ? 371 VAL A CA  1 
ATOM   2439  C C   . VAL A 1 333 ? 10.126  29.419  -9.385  1.00 31.24 ? 371 VAL A C   1 
ATOM   2440  O O   . VAL A 1 333 ? 10.713  29.944  -10.346 1.00 31.36 ? 371 VAL A O   1 
ATOM   2441  C CB  . VAL A 1 333 ? 10.845  28.891  -6.981  1.00 31.03 ? 371 VAL A CB  1 
ATOM   2442  C CG1 . VAL A 1 333 ? 11.388  27.803  -6.118  1.00 30.20 ? 371 VAL A CG1 1 
ATOM   2443  C CG2 . VAL A 1 333 ? 11.651  30.206  -6.830  1.00 26.97 ? 371 VAL A CG2 1 
ATOM   2444  N N   . THR A 1 334 ? 8.862   29.681  -9.083  1.00 31.73 ? 372 THR A N   1 
ATOM   2445  C CA  . THR A 1 334 ? 8.132   30.786  -9.695  1.00 32.37 ? 372 THR A CA  1 
ATOM   2446  C C   . THR A 1 334 ? 7.623   31.792  -8.622  1.00 32.59 ? 372 THR A C   1 
ATOM   2447  O O   . THR A 1 334 ? 7.747   31.552  -7.417  1.00 32.57 ? 372 THR A O   1 
ATOM   2448  C CB  . THR A 1 334 ? 6.959   30.271  -10.580 1.00 32.98 ? 372 THR A CB  1 
ATOM   2449  O OG1 . THR A 1 334 ? 5.834   29.964  -9.747  1.00 33.62 ? 372 THR A OG1 1 
ATOM   2450  C CG2 . THR A 1 334 ? 7.358   29.054  -11.385 1.00 31.21 ? 372 THR A CG2 1 
ATOM   2451  N N   . ILE A 1 335 ? 7.083   32.933  -9.066  1.00 33.76 ? 373 ILE A N   1 
ATOM   2452  C CA  . ILE A 1 335 ? 6.338   33.857  -8.180  1.00 34.10 ? 373 ILE A CA  1 
ATOM   2453  C C   . ILE A 1 335 ? 4.870   34.005  -8.633  1.00 34.64 ? 373 ILE A C   1 
ATOM   2454  O O   . ILE A 1 335 ? 4.568   33.826  -9.792  1.00 34.33 ? 373 ILE A O   1 
ATOM   2455  C CB  . ILE A 1 335 ? 7.017   35.256  -8.025  1.00 33.76 ? 373 ILE A CB  1 
ATOM   2456  C CG1 . ILE A 1 335 ? 7.339   35.896  -9.383  1.00 34.10 ? 373 ILE A CG1 1 
ATOM   2457  C CG2 . ILE A 1 335 ? 8.293   35.154  -7.100  1.00 35.92 ? 373 ILE A CG2 1 
ATOM   2458  C CD1 . ILE A 1 335 ? 7.335   37.382  -9.367  1.00 33.53 ? 373 ILE A CD1 1 
ATOM   2459  N N   . LEU A 1 336 ? 3.977   34.321  -7.684  1.00 35.09 ? 374 LEU A N   1 
ATOM   2460  C CA  . LEU A 1 336 ? 2.570   34.583  -7.942  1.00 35.20 ? 374 LEU A CA  1 
ATOM   2461  C C   . LEU A 1 336 ? 2.372   36.091  -8.205  1.00 36.02 ? 374 LEU A C   1 
ATOM   2462  O O   . LEU A 1 336 ? 3.284   36.899  -7.908  1.00 36.79 ? 374 LEU A O   1 
ATOM   2463  C CB  . LEU A 1 336 ? 1.750   34.133  -6.736  1.00 35.77 ? 374 LEU A CB  1 
ATOM   2464  C CG  . LEU A 1 336 ? 1.848   32.656  -6.378  1.00 34.73 ? 374 LEU A CG  1 
ATOM   2465  C CD1 . LEU A 1 336 ? 1.031   32.378  -5.133  1.00 34.33 ? 374 LEU A CD1 1 
ATOM   2466  C CD2 . LEU A 1 336 ? 1.344   31.832  -7.602  1.00 34.82 ? 374 LEU A CD2 1 
ATOM   2467  N N   . PRO A 1 337 ? 1.225   36.483  -8.822  1.00 35.52 ? 375 PRO A N   1 
ATOM   2468  C CA  . PRO A 1 337 ? 0.929   37.933  -8.910  1.00 35.09 ? 375 PRO A CA  1 
ATOM   2469  C C   . PRO A 1 337 ? 0.867   38.574  -7.529  1.00 34.32 ? 375 PRO A C   1 
ATOM   2470  O O   . PRO A 1 337 ? 0.304   38.000  -6.627  1.00 34.43 ? 375 PRO A O   1 
ATOM   2471  C CB  . PRO A 1 337 ? -0.460  37.985  -9.588  1.00 35.14 ? 375 PRO A CB  1 
ATOM   2472  C CG  . PRO A 1 337 ? -0.589  36.667  -10.318 1.00 35.20 ? 375 PRO A CG  1 
ATOM   2473  C CD  . PRO A 1 337 ? 0.181   35.665  -9.483  1.00 35.63 ? 375 PRO A CD  1 
ATOM   2474  N N   . GLY A 1 338 ? 1.441   39.751  -7.358  1.00 33.95 ? 376 GLY A N   1 
ATOM   2475  C CA  . GLY A 1 338 ? 1.534   40.339  -6.022  1.00 33.96 ? 376 GLY A CA  1 
ATOM   2476  C C   . GLY A 1 338 ? 2.824   40.037  -5.261  1.00 34.09 ? 376 GLY A C   1 
ATOM   2477  O O   . GLY A 1 338 ? 3.045   40.618  -4.205  1.00 34.02 ? 376 GLY A O   1 
ATOM   2478  N N   . ALA A 1 339 ? 3.702   39.198  -5.844  1.00 34.38 ? 377 ALA A N   1 
ATOM   2479  C CA  . ALA A 1 339 ? 5.028   38.902  -5.299  1.00 34.67 ? 377 ALA A CA  1 
ATOM   2480  C C   . ALA A 1 339 ? 5.938   40.125  -5.254  1.00 34.65 ? 377 ALA A C   1 
ATOM   2481  O O   . ALA A 1 339 ? 5.728   41.084  -5.963  1.00 34.58 ? 377 ALA A O   1 
ATOM   2482  C CB  . ALA A 1 339 ? 5.683   37.785  -6.081  1.00 34.53 ? 377 ALA A CB  1 
ATOM   2483  N N   . SER A 1 340 ? 6.933   40.099  -4.373  1.00 35.05 ? 378 SER A N   1 
ATOM   2484  C CA  . SER A 1 340 ? 7.982   41.124  -4.368  1.00 34.76 ? 378 SER A CA  1 
ATOM   2485  C C   . SER A 1 340 ? 9.359   40.508  -4.230  1.00 34.50 ? 378 SER A C   1 
ATOM   2486  O O   . SER A 1 340 ? 9.511   39.363  -3.803  1.00 33.85 ? 378 SER A O   1 
ATOM   2487  C CB  . SER A 1 340 ? 7.752   42.114  -3.231  1.00 35.14 ? 378 SER A CB  1 
ATOM   2488  O OG  . SER A 1 340 ? 7.715   41.431  -1.976  1.00 37.94 ? 378 SER A OG  1 
ATOM   2489  N N   . PHE A 1 341 ? 10.362  41.310  -4.579  1.00 34.60 ? 379 PHE A N   1 
ATOM   2490  C CA  . PHE A 1 341 ? 11.798  40.953  -4.416  1.00 33.75 ? 379 PHE A CA  1 
ATOM   2491  C C   . PHE A 1 341 ? 12.446  42.050  -3.579  1.00 33.94 ? 379 PHE A C   1 
ATOM   2492  O O   . PHE A 1 341 ? 11.980  43.178  -3.604  1.00 33.60 ? 379 PHE A O   1 
ATOM   2493  C CB  . PHE A 1 341 ? 12.471  40.869  -5.770  1.00 32.73 ? 379 PHE A CB  1 
ATOM   2494  C CG  . PHE A 1 341 ? 11.970  39.758  -6.630  1.00 30.50 ? 379 PHE A CG  1 
ATOM   2495  C CD1 . PHE A 1 341 ? 12.244  38.452  -6.302  1.00 32.59 ? 379 PHE A CD1 1 
ATOM   2496  C CD2 . PHE A 1 341 ? 11.318  40.013  -7.813  1.00 32.03 ? 379 PHE A CD2 1 
ATOM   2497  C CE1 . PHE A 1 341 ? 11.805  37.376  -7.137  1.00 33.92 ? 379 PHE A CE1 1 
ATOM   2498  C CE2 . PHE A 1 341 ? 10.855  38.968  -8.642  1.00 33.35 ? 379 PHE A CE2 1 
ATOM   2499  C CZ  . PHE A 1 341 ? 11.118  37.641  -8.303  1.00 33.10 ? 379 PHE A CZ  1 
ATOM   2500  N N   . PHE A 1 342 ? 13.490  41.710  -2.833  1.00 34.37 ? 380 PHE A N   1 
ATOM   2501  C CA  . PHE A 1 342 ? 14.138  42.630  -1.893  1.00 34.49 ? 380 PHE A CA  1 
ATOM   2502  C C   . PHE A 1 342 ? 15.478  42.002  -1.532  1.00 35.18 ? 380 PHE A C   1 
ATOM   2503  O O   . PHE A 1 342 ? 15.736  40.845  -1.884  1.00 34.51 ? 380 PHE A O   1 
ATOM   2504  C CB  . PHE A 1 342 ? 13.260  42.881  -0.642  1.00 34.56 ? 380 PHE A CB  1 
ATOM   2505  C CG  . PHE A 1 342 ? 12.545  41.647  -0.134  1.00 34.01 ? 380 PHE A CG  1 
ATOM   2506  C CD1 . PHE A 1 342 ? 13.184  40.772  0.730   1.00 33.64 ? 380 PHE A CD1 1 
ATOM   2507  C CD2 . PHE A 1 342 ? 11.260  41.338  -0.576  1.00 34.56 ? 380 PHE A CD2 1 
ATOM   2508  C CE1 . PHE A 1 342 ? 12.532  39.615  1.181   1.00 36.02 ? 380 PHE A CE1 1 
ATOM   2509  C CE2 . PHE A 1 342 ? 10.586  40.188  -0.132  1.00 33.13 ? 380 PHE A CE2 1 
ATOM   2510  C CZ  . PHE A 1 342 ? 11.204  39.333  0.757   1.00 35.83 ? 380 PHE A CZ  1 
ATOM   2511  N N   . SER A 1 343 ? 16.375  42.771  -0.898  1.00 35.86 ? 381 SER A N   1 
ATOM   2512  C CA  . SER A 1 343 ? 17.727  42.257  -0.663  1.00 36.42 ? 381 SER A CA  1 
ATOM   2513  C C   . SER A 1 343 ? 17.761  41.324  0.540   1.00 36.45 ? 381 SER A C   1 
ATOM   2514  O O   . SER A 1 343 ? 16.801  41.217  1.302   1.00 35.94 ? 381 SER A O   1 
ATOM   2515  C CB  . SER A 1 343 ? 18.719  43.393  -0.442  1.00 37.23 ? 381 SER A CB  1 
ATOM   2516  O OG  . SER A 1 343 ? 18.393  44.117  0.734   1.00 38.05 ? 381 SER A OG  1 
ATOM   2517  N N   . SER A 1 344 ? 18.891  40.674  0.708   1.00 36.05 ? 382 SER A N   1 
ATOM   2518  C CA  . SER A 1 344 ? 19.099  39.738  1.807   1.00 36.54 ? 382 SER A CA  1 
ATOM   2519  C C   . SER A 1 344 ? 19.077  40.387  3.201   1.00 35.82 ? 382 SER A C   1 
ATOM   2520  O O   . SER A 1 344 ? 18.556  39.811  4.139   1.00 35.13 ? 382 SER A O   1 
ATOM   2521  C CB  . SER A 1 344 ? 20.412  38.972  1.589   1.00 36.71 ? 382 SER A CB  1 
ATOM   2522  O OG  . SER A 1 344 ? 20.256  38.023  0.527   1.00 38.90 ? 382 SER A OG  1 
ATOM   2523  N N   . ASP A 1 345 ? 19.609  41.592  3.345   1.00 36.21 ? 383 ASP A N   1 
ATOM   2524  C CA  . ASP A 1 345 ? 19.461  42.322  4.622   1.00 37.40 ? 383 ASP A CA  1 
ATOM   2525  C C   . ASP A 1 345 ? 17.990  42.623  4.969   1.00 37.54 ? 383 ASP A C   1 
ATOM   2526  O O   . ASP A 1 345 ? 17.603  42.556  6.132   1.00 36.89 ? 383 ASP A O   1 
ATOM   2527  C CB  . ASP A 1 345 ? 20.292  43.609  4.633   1.00 38.24 ? 383 ASP A CB  1 
ATOM   2528  C CG  . ASP A 1 345 ? 20.072  44.484  3.363   1.00 41.35 ? 383 ASP A CG  1 
ATOM   2529  O OD1 . ASP A 1 345 ? 20.318  43.964  2.252   1.00 43.99 ? 383 ASP A OD1 1 
ATOM   2530  O OD2 . ASP A 1 345 ? 19.686  45.677  3.479   1.00 44.71 ? 383 ASP A OD2 1 
ATOM   2531  N N   . GLU A 1 346 ? 17.172  42.929  3.950   1.00 37.23 ? 384 GLU A N   1 
ATOM   2532  C CA  . GLU A 1 346 ? 15.764  43.247  4.151   1.00 37.28 ? 384 GLU A CA  1 
ATOM   2533  C C   . GLU A 1 346 ? 14.977  41.959  4.421   1.00 36.43 ? 384 GLU A C   1 
ATOM   2534  O O   . GLU A 1 346 ? 14.057  41.918  5.216   1.00 34.82 ? 384 GLU A O   1 
ATOM   2535  C CB  . GLU A 1 346 ? 15.215  44.012  2.948   1.00 37.20 ? 384 GLU A CB  1 
ATOM   2536  C CG  . GLU A 1 346 ? 13.706  44.149  2.941   1.00 42.82 ? 384 GLU A CG  1 
ATOM   2537  C CD  . GLU A 1 346 ? 13.149  44.908  4.168   1.00 46.84 ? 384 GLU A CD  1 
ATOM   2538  O OE1 . GLU A 1 346 ? 13.868  45.786  4.705   1.00 50.26 ? 384 GLU A OE1 1 
ATOM   2539  O OE2 . GLU A 1 346 ? 12.008  44.618  4.582   1.00 50.07 ? 384 GLU A OE2 1 
ATOM   2540  N N   . SER A 1 347 ? 15.374  40.890  3.764   1.00 36.48 ? 385 SER A N   1 
ATOM   2541  C CA  . SER A 1 347 ? 14.800  39.588  4.015   1.00 36.21 ? 385 SER A CA  1 
ATOM   2542  C C   . SER A 1 347 ? 14.918  39.208  5.478   1.00 35.57 ? 385 SER A C   1 
ATOM   2543  O O   . SER A 1 347 ? 13.947  38.839  6.124   1.00 36.24 ? 385 SER A O   1 
ATOM   2544  C CB  . SER A 1 347 ? 15.534  38.582  3.163   1.00 36.88 ? 385 SER A CB  1 
ATOM   2545  O OG  . SER A 1 347 ? 14.958  37.331  3.282   1.00 39.71 ? 385 SER A OG  1 
ATOM   2546  N N   . PHE A 1 348 ? 16.114  39.307  6.015   1.00 35.15 ? 386 PHE A N   1 
ATOM   2547  C CA  . PHE A 1 348 ? 16.339  38.960  7.397   1.00 34.87 ? 386 PHE A CA  1 
ATOM   2548  C C   . PHE A 1 348 ? 15.838  39.925  8.446   1.00 34.61 ? 386 PHE A C   1 
ATOM   2549  O O   . PHE A 1 348 ? 15.655  39.512  9.594   1.00 34.97 ? 386 PHE A O   1 
ATOM   2550  C CB  . PHE A 1 348 ? 17.792  38.551  7.639   1.00 35.08 ? 386 PHE A CB  1 
ATOM   2551  C CG  . PHE A 1 348 ? 18.083  37.173  7.093   1.00 35.60 ? 386 PHE A CG  1 
ATOM   2552  C CD1 . PHE A 1 348 ? 17.712  36.054  7.810   1.00 33.61 ? 386 PHE A CD1 1 
ATOM   2553  C CD2 . PHE A 1 348 ? 18.635  37.013  5.831   1.00 34.46 ? 386 PHE A CD2 1 
ATOM   2554  C CE1 . PHE A 1 348 ? 17.892  34.795  7.285   1.00 35.54 ? 386 PHE A CE1 1 
ATOM   2555  C CE2 . PHE A 1 348 ? 18.802  35.763  5.286   1.00 34.31 ? 386 PHE A CE2 1 
ATOM   2556  C CZ  . PHE A 1 348 ? 18.451  34.650  6.017   1.00 36.04 ? 386 PHE A CZ  1 
ATOM   2557  N N   . ALA A 1 349 ? 15.662  41.187  8.073   1.00 33.63 ? 387 ALA A N   1 
ATOM   2558  C CA  . ALA A 1 349 ? 14.952  42.158  8.880   1.00 33.80 ? 387 ALA A CA  1 
ATOM   2559  C C   . ALA A 1 349 ? 13.498  41.736  9.044   1.00 33.74 ? 387 ALA A C   1 
ATOM   2560  O O   . ALA A 1 349 ? 12.922  41.857  10.148  1.00 34.02 ? 387 ALA A O   1 
ATOM   2561  C CB  . ALA A 1 349 ? 15.062  43.570  8.235   1.00 32.83 ? 387 ALA A CB  1 
ATOM   2562  N N   . MET A 1 350 ? 12.906  41.221  7.968   1.00 32.56 ? 388 MET A N   1 
ATOM   2563  C CA  . MET A 1 350 ? 11.529  40.655  8.017   1.00 34.43 ? 388 MET A CA  1 
ATOM   2564  C C   . MET A 1 350 ? 11.376  39.493  9.032   1.00 33.76 ? 388 MET A C   1 
ATOM   2565  O O   . MET A 1 350 ? 10.464  39.438  9.839   1.00 33.51 ? 388 MET A O   1 
ATOM   2566  C CB  . MET A 1 350 ? 11.170  40.151  6.616   1.00 34.17 ? 388 MET A CB  1 
ATOM   2567  C CG  . MET A 1 350 ? 9.881   40.511  6.035   1.00 35.40 ? 388 MET A CG  1 
ATOM   2568  S SD  . MET A 1 350 ? 9.959   40.072  4.238   1.00 36.73 ? 388 MET A SD  1 
ATOM   2569  C CE  . MET A 1 350 ? 9.903   41.691  3.410   1.00 30.41 ? 388 MET A CE  1 
ATOM   2570  N N   . ILE A 1 351 ? 12.291  38.560  8.912   1.00 34.74 ? 389 ILE A N   1 
ATOM   2571  C CA  . ILE A 1 351 ? 12.443  37.354  9.758   1.00 35.15 ? 389 ILE A CA  1 
ATOM   2572  C C   . ILE A 1 351 ? 12.877  37.732  11.185  1.00 35.62 ? 389 ILE A C   1 
ATOM   2573  O O   . ILE A 1 351 ? 12.187  37.465  12.152  1.00 36.15 ? 389 ILE A O   1 
ATOM   2574  C CB  . ILE A 1 351 ? 13.531  36.383  9.123   1.00 34.38 ? 389 ILE A CB  1 
ATOM   2575  C CG1 . ILE A 1 351 ? 13.071  35.847  7.736   1.00 35.68 ? 389 ILE A CG1 1 
ATOM   2576  C CG2 . ILE A 1 351 ? 13.799  35.194  10.034  1.00 35.21 ? 389 ILE A CG2 1 
ATOM   2577  C CD1 . ILE A 1 351 ? 14.194  35.236  6.837   1.00 32.74 ? 389 ILE A CD1 1 
ATOM   2578  N N   . ARG A 1 352 ? 14.029  38.387  11.310  1.00 36.33 ? 390 ARG A N   1 
ATOM   2579  C CA  . ARG A 1 352 ? 14.537  38.793  12.633  1.00 35.69 ? 390 ARG A CA  1 
ATOM   2580  C C   . ARG A 1 352 ? 13.530  39.689  13.326  1.00 35.37 ? 390 ARG A C   1 
ATOM   2581  O O   . ARG A 1 352 ? 13.360  39.578  14.509  1.00 36.52 ? 390 ARG A O   1 
ATOM   2582  C CB  . ARG A 1 352 ? 15.927  39.441  12.531  1.00 35.54 ? 390 ARG A CB  1 
ATOM   2583  C CG  . ARG A 1 352 ? 16.675  39.514  13.830  1.00 36.05 ? 390 ARG A CG  1 
ATOM   2584  C CD  . ARG A 1 352 ? 17.758  40.571  13.771  1.00 35.63 ? 390 ARG A CD  1 
ATOM   2585  N NE  . ARG A 1 352 ? 18.671  40.232  12.711  1.00 35.80 ? 390 ARG A NE  1 
ATOM   2586  C CZ  . ARG A 1 352 ? 18.791  40.834  11.524  1.00 35.55 ? 390 ARG A CZ  1 
ATOM   2587  N NH1 . ARG A 1 352 ? 18.137  41.944  11.156  1.00 33.84 ? 390 ARG A NH1 1 
ATOM   2588  N NH2 . ARG A 1 352 ? 19.616  40.295  10.691  1.00 35.42 ? 390 ARG A NH2 1 
ATOM   2589  N N   . GLY A 1 353 ? 12.787  40.510  12.599  1.00 34.57 ? 391 GLY A N   1 
ATOM   2590  C CA  . GLY A 1 353 ? 11.838  41.415  13.239  1.00 34.15 ? 391 GLY A CA  1 
ATOM   2591  C C   . GLY A 1 353 ? 10.479  40.823  13.613  1.00 34.34 ? 391 GLY A C   1 
ATOM   2592  O O   . GLY A 1 353 ? 9.633   41.543  14.108  1.00 33.99 ? 391 GLY A O   1 
ATOM   2593  N N   . GLY A 1 354 ? 10.267  39.527  13.377  1.00 33.25 ? 392 GLY A N   1 
ATOM   2594  C CA  . GLY A 1 354 ? 9.038   38.874  13.771  1.00 33.94 ? 392 GLY A CA  1 
ATOM   2595  C C   . GLY A 1 354 ? 7.842   39.073  12.842  1.00 33.31 ? 392 GLY A C   1 
ATOM   2596  O O   . GLY A 1 354 ? 6.742   38.866  13.241  1.00 34.83 ? 392 GLY A O   1 
ATOM   2597  N N   . HIS A 1 355 ? 8.073   39.466  11.605  1.00 33.86 ? 393 HIS A N   1 
ATOM   2598  C CA  . HIS A 1 355 ? 6.998   39.757  10.663  1.00 34.00 ? 393 HIS A CA  1 
ATOM   2599  C C   . HIS A 1 355 ? 6.450   38.504  9.965   1.00 34.54 ? 393 HIS A C   1 
ATOM   2600  O O   . HIS A 1 355 ? 5.368   38.538  9.405   1.00 35.11 ? 393 HIS A O   1 
ATOM   2601  C CB  . HIS A 1 355 ? 7.482   40.752  9.612   1.00 33.68 ? 393 HIS A CB  1 
ATOM   2602  C CG  . HIS A 1 355 ? 7.944   42.055  10.179  1.00 34.96 ? 393 HIS A CG  1 
ATOM   2603  N ND1 . HIS A 1 355 ? 7.072   43.077  10.494  1.00 33.50 ? 393 HIS A ND1 1 
ATOM   2604  C CD2 . HIS A 1 355 ? 9.178   42.493  10.522  1.00 34.41 ? 393 HIS A CD2 1 
ATOM   2605  C CE1 . HIS A 1 355 ? 7.756   44.102  10.971  1.00 33.82 ? 393 HIS A CE1 1 
ATOM   2606  N NE2 . HIS A 1 355 ? 9.041   43.784  10.964  1.00 35.25 ? 393 HIS A NE2 1 
ATOM   2607  N N   . VAL A 1 356 ? 7.206   37.414  9.971   1.00 35.05 ? 394 VAL A N   1 
ATOM   2608  C CA  . VAL A 1 356 ? 6.732   36.140  9.443   1.00 35.49 ? 394 VAL A CA  1 
ATOM   2609  C C   . VAL A 1 356 ? 5.930   35.445  10.531  1.00 35.78 ? 394 VAL A C   1 
ATOM   2610  O O   . VAL A 1 356 ? 6.353   35.423  11.665  1.00 36.55 ? 394 VAL A O   1 
ATOM   2611  C CB  . VAL A 1 356 ? 7.927   35.280  9.009   1.00 35.59 ? 394 VAL A CB  1 
ATOM   2612  C CG1 . VAL A 1 356 ? 7.474   33.818  8.657   1.00 34.24 ? 394 VAL A CG1 1 
ATOM   2613  C CG2 . VAL A 1 356 ? 8.662   35.986  7.850   1.00 36.41 ? 394 VAL A CG2 1 
ATOM   2614  N N   . ASP A 1 357 ? 4.761   34.908  10.199  1.00 36.53 ? 395 ASP A N   1 
ATOM   2615  C CA  . ASP A 1 357 ? 3.868   34.336  11.196  1.00 36.89 ? 395 ASP A CA  1 
ATOM   2616  C C   . ASP A 1 357 ? 4.335   32.954  11.617  1.00 37.11 ? 395 ASP A C   1 
ATOM   2617  O O   . ASP A 1 357 ? 4.255   32.589  12.804  1.00 36.75 ? 395 ASP A O   1 
ATOM   2618  C CB  . ASP A 1 357 ? 2.421   34.208  10.661  1.00 36.95 ? 395 ASP A CB  1 
ATOM   2619  C CG  . ASP A 1 357 ? 1.757   35.557  10.399  1.00 39.18 ? 395 ASP A CG  1 
ATOM   2620  O OD1 . ASP A 1 357 ? 1.880   36.460  11.258  1.00 42.06 ? 395 ASP A OD1 1 
ATOM   2621  O OD2 . ASP A 1 357 ? 1.100   35.716  9.336   1.00 39.76 ? 395 ASP A OD2 1 
ATOM   2622  N N   . LEU A 1 358 ? 4.740   32.166  10.629  1.00 37.12 ? 396 LEU A N   1 
ATOM   2623  C CA  . LEU A 1 358 ? 5.130   30.782  10.842  1.00 37.90 ? 396 LEU A CA  1 
ATOM   2624  C C   . LEU A 1 358 ? 6.439   30.460  10.124  1.00 38.21 ? 396 LEU A C   1 
ATOM   2625  O O   . LEU A 1 358 ? 6.614   30.791  8.951   1.00 38.36 ? 396 LEU A O   1 
ATOM   2626  C CB  . LEU A 1 358 ? 4.017   29.856  10.331  1.00 38.06 ? 396 LEU A CB  1 
ATOM   2627  C CG  . LEU A 1 358 ? 4.210   28.337  10.390  1.00 37.15 ? 396 LEU A CG  1 
ATOM   2628  C CD1 . LEU A 1 358 ? 4.409   27.946  11.818  1.00 37.01 ? 396 LEU A CD1 1 
ATOM   2629  C CD2 . LEU A 1 358 ? 3.005   27.619  9.802   1.00 38.47 ? 396 LEU A CD2 1 
ATOM   2630  N N   . THR A 1 359 ? 7.338   29.799  10.839  1.00 39.25 ? 397 THR A N   1 
ATOM   2631  C CA  . THR A 1 359 ? 8.500   29.111  10.265  1.00 40.10 ? 397 THR A CA  1 
ATOM   2632  C C   . THR A 1 359 ? 8.319   27.607  10.463  1.00 39.85 ? 397 THR A C   1 
ATOM   2633  O O   . THR A 1 359 ? 7.940   27.196  11.538  1.00 40.61 ? 397 THR A O   1 
ATOM   2634  C CB  . THR A 1 359 ? 9.781   29.553  10.954  1.00 40.56 ? 397 THR A CB  1 
ATOM   2635  O OG1 . THR A 1 359 ? 10.107  30.878  10.518  1.00 44.78 ? 397 THR A OG1 1 
ATOM   2636  C CG2 . THR A 1 359 ? 10.924  28.644  10.583  1.00 40.53 ? 397 THR A CG2 1 
ATOM   2637  N N   . MET A 1 360 ? 8.565   26.804  9.430   1.00 39.46 ? 398 MET A N   1 
ATOM   2638  C CA  . MET A 1 360 ? 8.434   25.347  9.486   1.00 39.70 ? 398 MET A CA  1 
ATOM   2639  C C   . MET A 1 360 ? 9.754   24.744  9.039   1.00 39.13 ? 398 MET A C   1 
ATOM   2640  O O   . MET A 1 360 ? 10.248  25.051  7.918   1.00 38.87 ? 398 MET A O   1 
ATOM   2641  C CB  . MET A 1 360 ? 7.289   24.884  8.589   1.00 39.58 ? 398 MET A CB  1 
ATOM   2642  C CG  . MET A 1 360 ? 6.822   23.445  8.806   1.00 40.89 ? 398 MET A CG  1 
ATOM   2643  S SD  . MET A 1 360 ? 5.135   23.154  8.172   1.00 45.35 ? 398 MET A SD  1 
ATOM   2644  C CE  . MET A 1 360 ? 4.185   23.919  9.501   1.00 44.05 ? 398 MET A CE  1 
ATOM   2645  N N   . LEU A 1 361 ? 10.333  23.914  9.914   1.00 37.98 ? 399 LEU A N   1 
ATOM   2646  C CA  . LEU A 1 361 ? 11.739  23.457  9.814   1.00 37.54 ? 399 LEU A CA  1 
ATOM   2647  C C   . LEU A 1 361 ? 11.893  21.953  10.047  1.00 35.95 ? 399 LEU A C   1 
ATOM   2648  O O   . LEU A 1 361 ? 11.139  21.351  10.775  1.00 36.45 ? 399 LEU A O   1 
ATOM   2649  C CB  . LEU A 1 361 ? 12.599  24.172  10.877  1.00 38.19 ? 399 LEU A CB  1 
ATOM   2650  C CG  . LEU A 1 361 ? 13.042  25.602  10.550  1.00 39.49 ? 399 LEU A CG  1 
ATOM   2651  C CD1 . LEU A 1 361 ? 13.855  26.247  11.694  1.00 38.48 ? 399 LEU A CD1 1 
ATOM   2652  C CD2 . LEU A 1 361 ? 13.813  25.578  9.267   1.00 41.53 ? 399 LEU A CD2 1 
ATOM   2653  N N   . GLY A 1 362 ? 12.891  21.363  9.427   1.00 34.61 ? 400 GLY A N   1 
ATOM   2654  C CA  . GLY A 1 362 ? 13.369  20.059  9.808   1.00 34.16 ? 400 GLY A CA  1 
ATOM   2655  C C   . GLY A 1 362 ? 14.239  20.122  11.051  1.00 33.49 ? 400 GLY A C   1 
ATOM   2656  O O   . GLY A 1 362 ? 14.675  21.199  11.497  1.00 32.27 ? 400 GLY A O   1 
ATOM   2657  N N   . ALA A 1 363 ? 14.483  18.953  11.623  1.00 33.42 ? 401 ALA A N   1 
ATOM   2658  C CA  . ALA A 1 363 ? 15.355  18.841  12.787  1.00 33.36 ? 401 ALA A CA  1 
ATOM   2659  C C   . ALA A 1 363 ? 16.032  17.474  12.838  1.00 33.47 ? 401 ALA A C   1 
ATOM   2660  O O   . ALA A 1 363 ? 15.468  16.467  12.424  1.00 33.40 ? 401 ALA A O   1 
ATOM   2661  C CB  . ALA A 1 363 ? 14.563  19.096  14.056  1.00 33.15 ? 401 ALA A CB  1 
ATOM   2662  N N   . MET A 1 364 ? 17.262  17.455  13.341  1.00 33.72 ? 402 MET A N   1 
ATOM   2663  C CA  . MET A 1 364 ? 17.915  16.224  13.774  1.00 33.60 ? 402 MET A CA  1 
ATOM   2664  C C   . MET A 1 364 ? 17.548  15.933  15.205  1.00 32.18 ? 402 MET A C   1 
ATOM   2665  O O   . MET A 1 364 ? 17.369  14.768  15.578  1.00 31.51 ? 402 MET A O   1 
ATOM   2666  C CB  . MET A 1 364 ? 19.433  16.336  13.650  1.00 33.69 ? 402 MET A CB  1 
ATOM   2667  C CG  . MET A 1 364 ? 19.889  16.437  12.221  1.00 34.58 ? 402 MET A CG  1 
ATOM   2668  S SD  . MET A 1 364 ? 21.678  16.697  12.133  1.00 37.48 ? 402 MET A SD  1 
ATOM   2669  C CE  . MET A 1 364 ? 21.807  18.331  12.835  1.00 31.61 ? 402 MET A CE  1 
ATOM   2670  N N   . GLN A 1 365 ? 17.463  16.974  16.032  1.00 31.18 ? 403 GLN A N   1 
ATOM   2671  C CA  . GLN A 1 365 ? 16.922  16.798  17.379  1.00 30.57 ? 403 GLN A CA  1 
ATOM   2672  C C   . GLN A 1 365 ? 16.133  18.007  17.824  1.00 30.98 ? 403 GLN A C   1 
ATOM   2673  O O   . GLN A 1 365 ? 16.381  19.146  17.371  1.00 31.19 ? 403 GLN A O   1 
ATOM   2674  C CB  . GLN A 1 365 ? 18.016  16.484  18.428  1.00 30.36 ? 403 GLN A CB  1 
ATOM   2675  C CG  . GLN A 1 365 ? 18.915  15.262  18.153  1.00 29.76 ? 403 GLN A CG  1 
ATOM   2676  C CD  . GLN A 1 365 ? 20.183  15.248  19.009  1.00 30.92 ? 403 GLN A CD  1 
ATOM   2677  O OE1 . GLN A 1 365 ? 20.603  16.285  19.517  1.00 29.01 ? 403 GLN A OE1 1 
ATOM   2678  N NE2 . GLN A 1 365 ? 20.821  14.079  19.132  1.00 31.64 ? 403 GLN A NE2 1 
ATOM   2679  N N   . VAL A 1 366 ? 15.168  17.724  18.706  1.00 31.40 ? 404 VAL A N   1 
ATOM   2680  C CA  . VAL A 1 366 ? 14.412  18.712  19.460  1.00 31.51 ? 404 VAL A CA  1 
ATOM   2681  C C   . VAL A 1 366 ? 14.410  18.275  20.931  1.00 32.17 ? 404 VAL A C   1 
ATOM   2682  O O   . VAL A 1 366 ? 14.248  17.099  21.250  1.00 31.58 ? 404 VAL A O   1 
ATOM   2683  C CB  . VAL A 1 366 ? 12.942  18.822  18.961  1.00 31.73 ? 404 VAL A CB  1 
ATOM   2684  C CG1 . VAL A 1 366 ? 12.195  19.917  19.729  1.00 30.84 ? 404 VAL A CG1 1 
ATOM   2685  C CG2 . VAL A 1 366 ? 12.914  19.092  17.467  1.00 28.33 ? 404 VAL A CG2 1 
ATOM   2686  N N   . SER A 1 367 ? 14.599  19.234  21.823  1.00 32.62 ? 405 SER A N   1 
ATOM   2687  C CA  . SER A 1 367 ? 14.636  18.968  23.252  1.00 32.45 ? 405 SER A CA  1 
ATOM   2688  C C   . SER A 1 367 ? 13.294  19.258  23.917  1.00 32.98 ? 405 SER A C   1 
ATOM   2689  O O   . SER A 1 367 ? 12.435  19.943  23.371  1.00 33.35 ? 405 SER A O   1 
ATOM   2690  C CB  . SER A 1 367 ? 15.774  19.750  23.921  1.00 32.55 ? 405 SER A CB  1 
ATOM   2691  O OG  . SER A 1 367 ? 15.358  20.995  24.460  1.00 32.09 ? 405 SER A OG  1 
ATOM   2692  N N   . LYS A 1 368 ? 13.143  18.688  25.098  1.00 33.77 ? 406 LYS A N   1 
ATOM   2693  C CA  . LYS A 1 368 ? 11.984  18.824  25.975  1.00 34.28 ? 406 LYS A CA  1 
ATOM   2694  C C   . LYS A 1 368 ? 11.419  20.232  26.105  1.00 34.17 ? 406 LYS A C   1 
ATOM   2695  O O   . LYS A 1 368 ? 10.197  20.412  26.227  1.00 34.60 ? 406 LYS A O   1 
ATOM   2696  C CB  . LYS A 1 368 ? 12.419  18.330  27.358  1.00 34.79 ? 406 LYS A CB  1 
ATOM   2697  C CG  . LYS A 1 368 ? 11.340  18.190  28.385  1.00 35.96 ? 406 LYS A CG  1 
ATOM   2698  C CD  . LYS A 1 368 ? 11.921  17.616  29.651  1.00 35.48 ? 406 LYS A CD  1 
ATOM   2699  C CE  . LYS A 1 368 ? 10.845  17.511  30.706  1.00 36.71 ? 406 LYS A CE  1 
ATOM   2700  N NZ  . LYS A 1 368 ? 11.234  16.629  31.856  1.00 37.96 ? 406 LYS A NZ  1 
ATOM   2701  N N   . TYR A 1 369 ? 12.313  21.222  26.096  1.00 34.08 ? 407 TYR A N   1 
ATOM   2702  C CA  . TYR A 1 369 ? 11.940  22.612  26.313  1.00 33.66 ? 407 TYR A CA  1 
ATOM   2703  C C   . TYR A 1 369 ? 11.989  23.442  25.041  1.00 32.80 ? 407 TYR A C   1 
ATOM   2704  O O   . TYR A 1 369 ? 11.745  24.634  25.087  1.00 32.28 ? 407 TYR A O   1 
ATOM   2705  C CB  . TYR A 1 369 ? 12.817  23.221  27.410  1.00 34.60 ? 407 TYR A CB  1 
ATOM   2706  C CG  . TYR A 1 369 ? 12.610  22.545  28.753  1.00 34.53 ? 407 TYR A CG  1 
ATOM   2707  C CD1 . TYR A 1 369 ? 11.409  22.684  29.454  1.00 35.85 ? 407 TYR A CD1 1 
ATOM   2708  C CD2 . TYR A 1 369 ? 13.594  21.741  29.306  1.00 36.27 ? 407 TYR A CD2 1 
ATOM   2709  C CE1 . TYR A 1 369 ? 11.210  22.062  30.667  1.00 35.68 ? 407 TYR A CE1 1 
ATOM   2710  C CE2 . TYR A 1 369 ? 13.409  21.110  30.545  1.00 36.26 ? 407 TYR A CE2 1 
ATOM   2711  C CZ  . TYR A 1 369 ? 12.212  21.271  31.210  1.00 35.66 ? 407 TYR A CZ  1 
ATOM   2712  O OH  . TYR A 1 369 ? 12.026  20.649  32.420  1.00 36.04 ? 407 TYR A OH  1 
ATOM   2713  N N   . GLY A 1 370 ? 12.260  22.802  23.916  1.00 32.11 ? 408 GLY A N   1 
ATOM   2714  C CA  . GLY A 1 370 ? 12.180  23.456  22.611  1.00 33.02 ? 408 GLY A CA  1 
ATOM   2715  C C   . GLY A 1 370 ? 13.484  23.853  21.966  1.00 32.54 ? 408 GLY A C   1 
ATOM   2716  O O   . GLY A 1 370 ? 13.494  24.590  20.995  1.00 33.27 ? 408 GLY A O   1 
ATOM   2717  N N   . ASP A 1 371 ? 14.599  23.377  22.484  1.00 32.58 ? 409 ASP A N   1 
ATOM   2718  C CA  . ASP A 1 371 ? 15.862  23.621  21.832  1.00 32.18 ? 409 ASP A CA  1 
ATOM   2719  C C   . ASP A 1 371 ? 15.808  22.842  20.526  1.00 32.73 ? 409 ASP A C   1 
ATOM   2720  O O   . ASP A 1 371 ? 15.201  21.767  20.453  1.00 33.02 ? 409 ASP A O   1 
ATOM   2721  C CB  . ASP A 1 371 ? 17.042  23.096  22.641  1.00 32.14 ? 409 ASP A CB  1 
ATOM   2722  C CG  . ASP A 1 371 ? 17.213  23.771  23.993  1.00 33.65 ? 409 ASP A CG  1 
ATOM   2723  O OD1 . ASP A 1 371 ? 16.550  24.785  24.353  1.00 31.66 ? 409 ASP A OD1 1 
ATOM   2724  O OD2 . ASP A 1 371 ? 18.056  23.227  24.739  1.00 38.07 ? 409 ASP A OD2 1 
ATOM   2725  N N   . LEU A 1 372 ? 16.488  23.362  19.516  1.00 32.74 ? 410 LEU A N   1 
ATOM   2726  C CA  . LEU A 1 372 ? 16.552  22.725  18.202  1.00 32.30 ? 410 LEU A CA  1 
ATOM   2727  C C   . LEU A 1 372 ? 18.012  22.475  17.811  1.00 31.12 ? 410 LEU A C   1 
ATOM   2728  O O   . LEU A 1 372 ? 18.862  23.346  17.944  1.00 31.08 ? 410 LEU A O   1 
ATOM   2729  C CB  . LEU A 1 372 ? 15.865  23.633  17.165  1.00 32.67 ? 410 LEU A CB  1 
ATOM   2730  C CG  . LEU A 1 372 ? 15.961  23.259  15.696  1.00 32.27 ? 410 LEU A CG  1 
ATOM   2731  C CD1 . LEU A 1 372 ? 15.259  21.935  15.527  1.00 35.21 ? 410 LEU A CD1 1 
ATOM   2732  C CD2 . LEU A 1 372 ? 15.328  24.296  14.848  1.00 32.07 ? 410 LEU A CD2 1 
ATOM   2733  N N   . ALA A 1 373 ? 18.289  21.283  17.291  1.00 30.91 ? 411 ALA A N   1 
ATOM   2734  C CA  . ALA A 1 373 ? 19.578  20.983  16.657  1.00 30.33 ? 411 ALA A CA  1 
ATOM   2735  C C   . ALA A 1 373 ? 19.363  20.547  15.218  1.00 31.08 ? 411 ALA A C   1 
ATOM   2736  O O   . ALA A 1 373 ? 18.865  19.445  14.961  1.00 30.46 ? 411 ALA A O   1 
ATOM   2737  C CB  . ALA A 1 373 ? 20.300  19.886  17.428  1.00 30.34 ? 411 ALA A CB  1 
ATOM   2738  N N   . ASN A 1 374 ? 19.732  21.390  14.263  1.00 31.93 ? 412 ASN A N   1 
ATOM   2739  C CA  . ASN A 1 374 ? 19.582  21.012  12.872  1.00 33.44 ? 412 ASN A CA  1 
ATOM   2740  C C   . ASN A 1 374 ? 20.670  21.435  11.893  1.00 33.36 ? 412 ASN A C   1 
ATOM   2741  O O   . ASN A 1 374 ? 20.395  21.443  10.701  1.00 33.50 ? 412 ASN A O   1 
ATOM   2742  C CB  . ASN A 1 374 ? 18.164  21.354  12.347  1.00 33.47 ? 412 ASN A CB  1 
ATOM   2743  C CG  . ASN A 1 374 ? 17.971  22.832  11.929  1.00 37.70 ? 412 ASN A CG  1 
ATOM   2744  O OD1 . ASN A 1 374 ? 18.811  23.721  12.167  1.00 42.30 ? 412 ASN A OD1 1 
ATOM   2745  N ND2 . ASN A 1 374 ? 16.833  23.085  11.284  1.00 37.05 ? 412 ASN A ND2 1 
ATOM   2746  N N   . TRP A 1 375 ? 21.895  21.740  12.354  1.00 33.55 ? 413 TRP A N   1 
ATOM   2747  C CA  . TRP A 1 375 ? 22.920  22.361  11.439  1.00 32.87 ? 413 TRP A CA  1 
ATOM   2748  C C   . TRP A 1 375 ? 24.316  21.782  11.514  1.00 33.54 ? 413 TRP A C   1 
ATOM   2749  O O   . TRP A 1 375 ? 25.152  22.044  10.636  1.00 33.92 ? 413 TRP A O   1 
ATOM   2750  C CB  . TRP A 1 375 ? 23.007  23.883  11.653  1.00 32.71 ? 413 TRP A CB  1 
ATOM   2751  C CG  . TRP A 1 375 ? 23.823  24.337  12.864  1.00 30.98 ? 413 TRP A CG  1 
ATOM   2752  C CD1 . TRP A 1 375 ? 23.395  24.396  14.137  1.00 30.58 ? 413 TRP A CD1 1 
ATOM   2753  C CD2 . TRP A 1 375 ? 25.187  24.789  12.880  1.00 29.55 ? 413 TRP A CD2 1 
ATOM   2754  N NE1 . TRP A 1 375 ? 24.387  24.825  14.946  1.00 30.06 ? 413 TRP A NE1 1 
ATOM   2755  C CE2 . TRP A 1 375 ? 25.500  25.089  14.202  1.00 29.11 ? 413 TRP A CE2 1 
ATOM   2756  C CE3 . TRP A 1 375 ? 26.162  24.976  11.900  1.00 30.70 ? 413 TRP A CE3 1 
ATOM   2757  C CZ2 . TRP A 1 375 ? 26.744  25.569  14.586  1.00 30.09 ? 413 TRP A CZ2 1 
ATOM   2758  C CZ3 . TRP A 1 375 ? 27.400  25.421  12.265  1.00 29.78 ? 413 TRP A CZ3 1 
ATOM   2759  C CH2 . TRP A 1 375 ? 27.685  25.727  13.607  1.00 31.51 ? 413 TRP A CH2 1 
ATOM   2760  N N   . MET A 1 376 ? 24.594  20.995  12.544  1.00 34.19 ? 414 MET A N   1 
ATOM   2761  C CA  . MET A 1 376 ? 25.920  20.447  12.696  1.00 34.55 ? 414 MET A CA  1 
ATOM   2762  C C   . MET A 1 376 ? 25.904  19.032  13.270  1.00 34.02 ? 414 MET A C   1 
ATOM   2763  O O   . MET A 1 376 ? 25.229  18.767  14.231  1.00 31.91 ? 414 MET A O   1 
ATOM   2764  C CB  . MET A 1 376 ? 26.756  21.367  13.585  1.00 34.77 ? 414 MET A CB  1 
ATOM   2765  C CG  . MET A 1 376 ? 28.300  21.274  13.299  1.00 36.76 ? 414 MET A CG  1 
ATOM   2766  S SD  . MET A 1 376 ? 29.426  22.249  14.373  1.00 37.94 ? 414 MET A SD  1 
ATOM   2767  C CE  . MET A 1 376 ? 30.827  21.098  14.445  1.00 35.70 ? 414 MET A CE  1 
ATOM   2768  N N   . ILE A 1 377 ? 26.677  18.140  12.654  1.00 35.35 ? 415 ILE A N   1 
ATOM   2769  C CA  . ILE A 1 377 ? 27.018  16.841  13.234  1.00 36.68 ? 415 ILE A CA  1 
ATOM   2770  C C   . ILE A 1 377 ? 28.545  16.852  13.361  1.00 38.70 ? 415 ILE A C   1 
ATOM   2771  O O   . ILE A 1 377 ? 29.259  16.724  12.351  1.00 38.46 ? 415 ILE A O   1 
ATOM   2772  C CB  . ILE A 1 377 ? 26.528  15.675  12.367  1.00 36.57 ? 415 ILE A CB  1 
ATOM   2773  C CG1 . ILE A 1 377 ? 25.039  15.822  12.065  1.00 35.71 ? 415 ILE A CG1 1 
ATOM   2774  C CG2 . ILE A 1 377 ? 26.775  14.357  13.058  1.00 35.90 ? 415 ILE A CG2 1 
ATOM   2775  C CD1 . ILE A 1 377 ? 24.453  14.610  11.338  1.00 35.74 ? 415 ILE A CD1 1 
ATOM   2776  N N   . PRO A 1 378 ? 29.065  17.072  14.595  1.00 40.84 ? 416 PRO A N   1 
ATOM   2777  C CA  . PRO A 1 378 ? 30.521  17.235  14.705  1.00 41.77 ? 416 PRO A CA  1 
ATOM   2778  C C   . PRO A 1 378 ? 31.220  16.001  14.161  1.00 42.37 ? 416 PRO A C   1 
ATOM   2779  O O   . PRO A 1 378 ? 30.800  14.878  14.458  1.00 42.91 ? 416 PRO A O   1 
ATOM   2780  C CB  . PRO A 1 378 ? 30.771  17.402  16.215  1.00 41.65 ? 416 PRO A CB  1 
ATOM   2781  C CG  . PRO A 1 378 ? 29.459  17.745  16.804  1.00 41.95 ? 416 PRO A CG  1 
ATOM   2782  C CD  . PRO A 1 378 ? 28.397  17.164  15.906  1.00 41.07 ? 416 PRO A CD  1 
ATOM   2783  N N   . GLY A 1 379 ? 32.224  16.228  13.313  1.00 43.15 ? 417 GLY A N   1 
ATOM   2784  C CA  . GLY A 1 379 ? 33.011  15.157  12.699  1.00 43.39 ? 417 GLY A CA  1 
ATOM   2785  C C   . GLY A 1 379 ? 32.371  14.518  11.476  1.00 43.51 ? 417 GLY A C   1 
ATOM   2786  O O   . GLY A 1 379 ? 32.892  13.553  10.956  1.00 43.19 ? 417 GLY A O   1 
ATOM   2787  N N   . LYS A 1 380 ? 31.245  15.042  11.005  1.00 43.59 ? 418 LYS A N   1 
ATOM   2788  C CA  . LYS A 1 380 ? 30.590  14.445  9.839   1.00 43.94 ? 418 LYS A CA  1 
ATOM   2789  C C   . LYS A 1 380 ? 30.038  15.494  8.878   1.00 43.89 ? 418 LYS A C   1 
ATOM   2790  O O   . LYS A 1 380 ? 30.297  15.452  7.685   1.00 43.95 ? 418 LYS A O   1 
ATOM   2791  C CB  . LYS A 1 380 ? 29.502  13.446  10.271  1.00 43.71 ? 418 LYS A CB  1 
ATOM   2792  N N   . MET A 1 381 ? 29.301  16.453  9.403   1.00 44.62 ? 419 MET A N   1 
ATOM   2793  C CA  . MET A 1 381 ? 28.552  17.382  8.566   1.00 44.81 ? 419 MET A CA  1 
ATOM   2794  C C   . MET A 1 381 ? 28.738  18.790  9.132   1.00 43.44 ? 419 MET A C   1 
ATOM   2795  O O   . MET A 1 381 ? 28.112  19.140  10.143  1.00 43.31 ? 419 MET A O   1 
ATOM   2796  C CB  . MET A 1 381 ? 27.066  16.932  8.534   1.00 45.66 ? 419 MET A CB  1 
ATOM   2797  C CG  . MET A 1 381 ? 26.178  17.611  7.519   1.00 48.14 ? 419 MET A CG  1 
ATOM   2798  S SD  . MET A 1 381 ? 25.134  18.842  8.320   1.00 57.90 ? 419 MET A SD  1 
ATOM   2799  C CE  . MET A 1 381 ? 23.659  17.887  8.775   1.00 54.38 ? 419 MET A CE  1 
ATOM   2800  N N   . VAL A 1 382 ? 29.623  19.575  8.508   1.00 41.24 ? 420 VAL A N   1 
ATOM   2801  C CA  . VAL A 1 382 ? 29.840  20.951  8.949   1.00 39.86 ? 420 VAL A CA  1 
ATOM   2802  C C   . VAL A 1 382 ? 29.728  21.884  7.749   1.00 38.03 ? 420 VAL A C   1 
ATOM   2803  O O   . VAL A 1 382 ? 30.729  22.286  7.163   1.00 37.77 ? 420 VAL A O   1 
ATOM   2804  C CB  . VAL A 1 382 ? 31.199  21.139  9.670   1.00 40.19 ? 420 VAL A CB  1 
ATOM   2805  C CG1 . VAL A 1 382 ? 31.263  22.545  10.289  1.00 40.19 ? 420 VAL A CG1 1 
ATOM   2806  C CG2 . VAL A 1 382 ? 31.416  20.079  10.751  1.00 40.40 ? 420 VAL A CG2 1 
ATOM   2807  N N   . LYS A 1 383 ? 28.496  22.224  7.406   1.00 35.73 ? 421 LYS A N   1 
ATOM   2808  C CA  . LYS A 1 383 ? 28.191  22.947  6.175   1.00 35.09 ? 421 LYS A CA  1 
ATOM   2809  C C   . LYS A 1 383 ? 27.615  24.349  6.375   1.00 34.09 ? 421 LYS A C   1 
ATOM   2810  O O   . LYS A 1 383 ? 27.497  25.110  5.432   1.00 33.14 ? 421 LYS A O   1 
ATOM   2811  C CB  . LYS A 1 383 ? 27.253  22.094  5.299   1.00 34.52 ? 421 LYS A CB  1 
ATOM   2812  C CG  . LYS A 1 383 ? 27.942  21.553  4.056   1.00 36.47 ? 421 LYS A CG  1 
ATOM   2813  C CD  . LYS A 1 383 ? 29.199  20.685  4.339   1.00 36.57 ? 421 LYS A CD  1 
ATOM   2814  C CE  . LYS A 1 383 ? 30.267  20.711  3.224   1.00 35.46 ? 421 LYS A CE  1 
ATOM   2815  N NZ  . LYS A 1 383 ? 30.385  19.403  2.448   1.00 36.21 ? 421 LYS A NZ  1 
ATOM   2816  N N   . GLY A 1 384 ? 27.224  24.649  7.606   1.00 33.33 ? 422 GLY A N   1 
ATOM   2817  C CA  . GLY A 1 384 ? 26.815  25.964  8.014   1.00 32.96 ? 422 GLY A CA  1 
ATOM   2818  C C   . GLY A 1 384 ? 25.387  25.902  8.430   1.00 32.30 ? 422 GLY A C   1 
ATOM   2819  O O   . GLY A 1 384 ? 24.673  24.934  8.108   1.00 31.91 ? 422 GLY A O   1 
ATOM   2820  N N   . MET A 1 385 ? 24.964  26.959  9.112   1.00 31.85 ? 423 MET A N   1 
ATOM   2821  C CA  . MET A 1 385 ? 23.595  27.067  9.625   1.00 32.17 ? 423 MET A CA  1 
ATOM   2822  C C   . MET A 1 385 ? 22.657  27.743  8.641   1.00 30.97 ? 423 MET A C   1 
ATOM   2823  O O   . MET A 1 385 ? 21.451  27.707  8.832   1.00 31.93 ? 423 MET A O   1 
ATOM   2824  C CB  . MET A 1 385 ? 23.575  27.836  10.962  1.00 32.67 ? 423 MET A CB  1 
ATOM   2825  C CG  . MET A 1 385 ? 24.049  29.284  10.904  1.00 31.98 ? 423 MET A CG  1 
ATOM   2826  S SD  . MET A 1 385 ? 25.820  29.473  10.769  1.00 35.98 ? 423 MET A SD  1 
ATOM   2827  C CE  . MET A 1 385 ? 26.426  28.929  12.394  1.00 35.34 ? 423 MET A CE  1 
ATOM   2828  N N   . GLY A 1 386 ? 23.212  28.371  7.613   1.00 31.01 ? 424 GLY A N   1 
ATOM   2829  C CA  . GLY A 1 386 ? 22.433  29.214  6.683   1.00 30.24 ? 424 GLY A CA  1 
ATOM   2830  C C   . GLY A 1 386 ? 21.589  30.224  7.418   1.00 29.73 ? 424 GLY A C   1 
ATOM   2831  O O   . GLY A 1 386 ? 22.049  30.862  8.346   1.00 29.32 ? 424 GLY A O   1 
ATOM   2832  N N   . GLY A 1 387 ? 20.332  30.346  7.025   1.00 29.41 ? 425 GLY A N   1 
ATOM   2833  C CA  . GLY A 1 387 ? 19.391  31.178  7.724   1.00 30.07 ? 425 GLY A CA  1 
ATOM   2834  C C   . GLY A 1 387 ? 18.611  30.537  8.860   1.00 31.13 ? 425 GLY A C   1 
ATOM   2835  O O   . GLY A 1 387 ? 17.712  31.180  9.401   1.00 31.66 ? 425 GLY A O   1 
ATOM   2836  N N   . ALA A 1 388 ? 18.957  29.312  9.263   1.00 31.07 ? 426 ALA A N   1 
ATOM   2837  C CA  . ALA A 1 388 ? 18.215  28.579  10.292  1.00 32.71 ? 426 ALA A CA  1 
ATOM   2838  C C   . ALA A 1 388 ? 18.189  29.225  11.691  1.00 33.90 ? 426 ALA A C   1 
ATOM   2839  O O   . ALA A 1 388 ? 17.117  29.273  12.339  1.00 33.69 ? 426 ALA A O   1 
ATOM   2840  C CB  . ALA A 1 388 ? 18.709  27.115  10.405  1.00 31.85 ? 426 ALA A CB  1 
ATOM   2841  N N   . MET A 1 389 ? 19.336  29.735  12.150  1.00 34.23 ? 427 MET A N   1 
ATOM   2842  C CA  . MET A 1 389 ? 19.386  30.418  13.436  1.00 34.32 ? 427 MET A CA  1 
ATOM   2843  C C   . MET A 1 389 ? 18.536  31.677  13.491  1.00 34.97 ? 427 MET A C   1 
ATOM   2844  O O   . MET A 1 389 ? 17.853  31.928  14.489  1.00 35.39 ? 427 MET A O   1 
ATOM   2845  C CB  . MET A 1 389 ? 20.825  30.711  13.824  1.00 33.94 ? 427 MET A CB  1 
ATOM   2846  C CG  . MET A 1 389 ? 21.630  29.471  14.057  1.00 34.72 ? 427 MET A CG  1 
ATOM   2847  S SD  . MET A 1 389 ? 23.231  29.831  14.710  1.00 32.81 ? 427 MET A SD  1 
ATOM   2848  C CE  . MET A 1 389 ? 23.834  28.184  15.030  1.00 31.05 ? 427 MET A CE  1 
ATOM   2849  N N   . ASP A 1 390 ? 18.555  32.453  12.411  1.00 35.09 ? 428 ASP A N   1 
ATOM   2850  C CA  . ASP A 1 390 ? 17.654  33.614  12.258  1.00 34.62 ? 428 ASP A CA  1 
ATOM   2851  C C   . ASP A 1 390 ? 16.193  33.267  12.247  1.00 34.44 ? 428 ASP A C   1 
ATOM   2852  O O   . ASP A 1 390 ? 15.376  34.015  12.832  1.00 33.86 ? 428 ASP A O   1 
ATOM   2853  C CB  . ASP A 1 390 ? 17.961  34.400  10.972  1.00 34.79 ? 428 ASP A CB  1 
ATOM   2854  C CG  . ASP A 1 390 ? 19.348  34.992  10.963  1.00 35.61 ? 428 ASP A CG  1 
ATOM   2855  O OD1 . ASP A 1 390 ? 19.522  36.072  11.566  1.00 38.50 ? 428 ASP A OD1 1 
ATOM   2856  O OD2 . ASP A 1 390 ? 20.255  34.376  10.343  1.00 36.34 ? 428 ASP A OD2 1 
ATOM   2857  N N   . LEU A 1 391 ? 15.842  32.163  11.589  1.00 33.44 ? 429 LEU A N   1 
ATOM   2858  C CA  . LEU A 1 391 ? 14.429  31.766  11.476  1.00 33.71 ? 429 LEU A CA  1 
ATOM   2859  C C   . LEU A 1 391 ? 13.771  31.438  12.802  1.00 34.71 ? 429 LEU A C   1 
ATOM   2860  O O   . LEU A 1 391 ? 12.554  31.582  12.945  1.00 35.81 ? 429 LEU A O   1 
ATOM   2861  C CB  . LEU A 1 391 ? 14.248  30.599  10.510  1.00 32.95 ? 429 LEU A CB  1 
ATOM   2862  C CG  . LEU A 1 391 ? 14.329  31.106  9.076   1.00 33.18 ? 429 LEU A CG  1 
ATOM   2863  C CD1 . LEU A 1 391 ? 14.679  30.012  8.085   1.00 32.45 ? 429 LEU A CD1 1 
ATOM   2864  C CD2 . LEU A 1 391 ? 13.013  31.769  8.692   1.00 32.80 ? 429 LEU A CD2 1 
ATOM   2865  N N   . VAL A 1 392 ? 14.571  31.028  13.778  1.00 34.56 ? 430 VAL A N   1 
ATOM   2866  C CA  . VAL A 1 392 ? 14.085  30.678  15.082  1.00 33.95 ? 430 VAL A CA  1 
ATOM   2867  C C   . VAL A 1 392 ? 14.438  31.717  16.134  1.00 34.36 ? 430 VAL A C   1 
ATOM   2868  O O   . VAL A 1 392 ? 14.350  31.449  17.321  1.00 36.22 ? 430 VAL A O   1 
ATOM   2869  C CB  . VAL A 1 392 ? 14.663  29.298  15.491  1.00 34.57 ? 430 VAL A CB  1 
ATOM   2870  C CG1 . VAL A 1 392 ? 14.383  28.248  14.396  1.00 32.46 ? 430 VAL A CG1 1 
ATOM   2871  C CG2 . VAL A 1 392 ? 16.175  29.411  15.847  1.00 32.26 ? 430 VAL A CG2 1 
ATOM   2872  N N   . SER A 1 393 ? 14.849  32.895  15.711  1.00 34.68 ? 431 SER A N   1 
ATOM   2873  C CA  . SER A 1 393 ? 15.291  33.940  16.607  1.00 35.66 ? 431 SER A CA  1 
ATOM   2874  C C   . SER A 1 393 ? 14.143  34.764  17.207  1.00 36.33 ? 431 SER A C   1 
ATOM   2875  O O   . SER A 1 393 ? 14.337  35.363  18.237  1.00 37.78 ? 431 SER A O   1 
ATOM   2876  C CB  . SER A 1 393 ? 16.272  34.896  15.893  1.00 35.31 ? 431 SER A CB  1 
ATOM   2877  O OG  . SER A 1 393 ? 15.568  35.673  14.941  1.00 36.39 ? 431 SER A OG  1 
ATOM   2878  N N   . SER A 1 394 ? 12.959  34.807  16.596  1.00 37.44 ? 432 SER A N   1 
ATOM   2879  C CA  . SER A 1 394 ? 11.916  35.746  17.024  1.00 37.63 ? 432 SER A CA  1 
ATOM   2880  C C   . SER A 1 394 ? 10.851  35.081  17.884  1.00 38.33 ? 432 SER A C   1 
ATOM   2881  O O   . SER A 1 394 ? 10.292  34.032  17.509  1.00 38.86 ? 432 SER A O   1 
ATOM   2882  C CB  . SER A 1 394 ? 11.233  36.361  15.791  1.00 37.68 ? 432 SER A CB  1 
ATOM   2883  O OG  . SER A 1 394 ? 10.453  37.501  16.144  1.00 36.54 ? 432 SER A OG  1 
ATOM   2884  N N   . ALA A 1 395 ? 10.545  35.726  19.006  1.00 39.32 ? 433 ALA A N   1 
ATOM   2885  C CA  . ALA A 1 395 ? 9.435   35.360  19.907  1.00 39.45 ? 433 ALA A CA  1 
ATOM   2886  C C   . ALA A 1 395 ? 8.049   35.597  19.280  1.00 39.38 ? 433 ALA A C   1 
ATOM   2887  O O   . ALA A 1 395 ? 7.060   35.012  19.714  1.00 39.89 ? 433 ALA A O   1 
ATOM   2888  C CB  . ALA A 1 395 ? 9.550   36.152  21.205  1.00 39.52 ? 433 ALA A CB  1 
ATOM   2889  N N   . LYS A 1 396 ? 7.985   36.446  18.253  1.00 39.44 ? 434 LYS A N   1 
ATOM   2890  C CA  . LYS A 1 396 ? 6.720   36.768  17.563  1.00 38.34 ? 434 LYS A CA  1 
ATOM   2891  C C   . LYS A 1 396 ? 6.370   35.823  16.426  1.00 37.61 ? 434 LYS A C   1 
ATOM   2892  O O   . LYS A 1 396 ? 5.430   36.091  15.708  1.00 39.25 ? 434 LYS A O   1 
ATOM   2893  C CB  . LYS A 1 396 ? 6.767   38.210  17.013  1.00 38.02 ? 434 LYS A CB  1 
ATOM   2894  C CG  . LYS A 1 396 ? 6.838   39.261  18.101  1.00 38.62 ? 434 LYS A CG  1 
ATOM   2895  C CD  . LYS A 1 396 ? 6.629   40.710  17.628  1.00 38.89 ? 434 LYS A CD  1 
ATOM   2896  C CE  . LYS A 1 396 ? 6.176   41.602  18.864  1.00 40.95 ? 434 LYS A CE  1 
ATOM   2897  N NZ  . LYS A 1 396 ? 5.815   43.036  18.599  1.00 39.95 ? 434 LYS A NZ  1 
ATOM   2898  N N   . THR A 1 397 ? 7.114   34.736  16.237  1.00 36.46 ? 435 THR A N   1 
ATOM   2899  C CA  . THR A 1 397 ? 6.935   33.842  15.089  1.00 35.33 ? 435 THR A CA  1 
ATOM   2900  C C   . THR A 1 397 ? 6.763   32.420  15.590  1.00 35.08 ? 435 THR A C   1 
ATOM   2901  O O   . THR A 1 397 ? 7.477   32.003  16.455  1.00 35.18 ? 435 THR A O   1 
ATOM   2902  C CB  . THR A 1 397 ? 8.204   33.868  14.164  1.00 35.64 ? 435 THR A CB  1 
ATOM   2903  O OG1 . THR A 1 397 ? 8.368   35.171  13.592  1.00 35.14 ? 435 THR A OG1 1 
ATOM   2904  C CG2 . THR A 1 397 ? 8.131   32.812  13.042  1.00 34.54 ? 435 THR A CG2 1 
ATOM   2905  N N   . LYS A 1 398 ? 5.841   31.662  15.028  1.00 35.17 ? 436 LYS A N   1 
ATOM   2906  C CA  . LYS A 1 398 ? 5.585   30.301  15.486  1.00 35.15 ? 436 LYS A CA  1 
ATOM   2907  C C   . LYS A 1 398 ? 6.581   29.382  14.815  1.00 35.26 ? 436 LYS A C   1 
ATOM   2908  O O   . LYS A 1 398 ? 6.807   29.484  13.602  1.00 35.28 ? 436 LYS A O   1 
ATOM   2909  C CB  . LYS A 1 398 ? 4.161   29.898  15.127  1.00 35.48 ? 436 LYS A CB  1 
ATOM   2910  C CG  . LYS A 1 398 ? 3.792   28.499  15.561  1.00 37.58 ? 436 LYS A CG  1 
ATOM   2911  C CD  . LYS A 1 398 ? 2.306   28.264  15.539  1.00 37.83 ? 436 LYS A CD  1 
ATOM   2912  C CE  . LYS A 1 398 ? 2.039   26.758  15.594  1.00 40.39 ? 436 LYS A CE  1 
ATOM   2913  N NZ  . LYS A 1 398 ? 0.603   26.401  15.414  1.00 40.46 ? 436 LYS A NZ  1 
ATOM   2914  N N   . VAL A 1 399 ? 7.228   28.503  15.577  1.00 34.37 ? 437 VAL A N   1 
ATOM   2915  C CA  . VAL A 1 399 ? 8.198   27.602  14.963  1.00 33.16 ? 437 VAL A CA  1 
ATOM   2916  C C   . VAL A 1 399 ? 7.694   26.187  15.099  1.00 32.78 ? 437 VAL A C   1 
ATOM   2917  O O   . VAL A 1 399 ? 7.524   25.672  16.208  1.00 33.10 ? 437 VAL A O   1 
ATOM   2918  C CB  . VAL A 1 399 ? 9.646   27.770  15.524  1.00 33.76 ? 437 VAL A CB  1 
ATOM   2919  C CG1 . VAL A 1 399 ? 10.596  26.660  14.974  1.00 30.39 ? 437 VAL A CG1 1 
ATOM   2920  C CG2 . VAL A 1 399 ? 10.184  29.167  15.201  1.00 31.84 ? 437 VAL A CG2 1 
ATOM   2921  N N   . VAL A 1 400 ? 7.422   25.563  13.961  1.00 31.66 ? 438 VAL A N   1 
ATOM   2922  C CA  . VAL A 1 400 ? 6.972   24.171  13.952  1.00 31.24 ? 438 VAL A CA  1 
ATOM   2923  C C   . VAL A 1 400 ? 8.072   23.319  13.333  1.00 30.68 ? 438 VAL A C   1 
ATOM   2924  O O   . VAL A 1 400 ? 8.515   23.630  12.250  1.00 29.86 ? 438 VAL A O   1 
ATOM   2925  C CB  . VAL A 1 400 ? 5.662   24.005  13.125  1.00 31.15 ? 438 VAL A CB  1 
ATOM   2926  C CG1 . VAL A 1 400 ? 5.071   22.572  13.270  1.00 30.31 ? 438 VAL A CG1 1 
ATOM   2927  C CG2 . VAL A 1 400 ? 4.659   25.069  13.515  1.00 28.93 ? 438 VAL A CG2 1 
ATOM   2928  N N   . VAL A 1 401 ? 8.488   22.259  14.026  1.00 30.45 ? 439 VAL A N   1 
ATOM   2929  C CA  . VAL A 1 401 ? 9.385   21.244  13.477  1.00 31.00 ? 439 VAL A CA  1 
ATOM   2930  C C   . VAL A 1 401 ? 8.619   20.050  12.898  1.00 31.95 ? 439 VAL A C   1 
ATOM   2931  O O   . VAL A 1 401 ? 7.765   19.452  13.547  1.00 32.35 ? 439 VAL A O   1 
ATOM   2932  C CB  . VAL A 1 401 ? 10.438  20.771  14.531  1.00 30.98 ? 439 VAL A CB  1 
ATOM   2933  C CG1 . VAL A 1 401 ? 11.034  19.387  14.175  1.00 28.46 ? 439 VAL A CG1 1 
ATOM   2934  C CG2 . VAL A 1 401 ? 11.538  21.829  14.682  1.00 31.62 ? 439 VAL A CG2 1 
ATOM   2935  N N   . THR A 1 402 ? 8.954   19.713  11.662  1.00 32.53 ? 440 THR A N   1 
ATOM   2936  C CA  . THR A 1 402 ? 8.426   18.555  10.987  1.00 32.86 ? 440 THR A CA  1 
ATOM   2937  C C   . THR A 1 402 ? 9.572   17.549  10.801  1.00 34.04 ? 440 THR A C   1 
ATOM   2938  O O   . THR A 1 402 ? 10.592  17.859  10.152  1.00 34.44 ? 440 THR A O   1 
ATOM   2939  C CB  . THR A 1 402 ? 7.836   18.934  9.614   1.00 32.63 ? 440 THR A CB  1 
ATOM   2940  O OG1 . THR A 1 402 ? 8.837   19.575  8.821   1.00 30.52 ? 440 THR A OG1 1 
ATOM   2941  C CG2 . THR A 1 402 ? 6.607   19.872  9.762   1.00 32.46 ? 440 THR A CG2 1 
ATOM   2942  N N   . MET A 1 403 ? 9.399   16.350  11.365  1.00 34.83 ? 441 MET A N   1 
ATOM   2943  C CA  . MET A 1 403 ? 10.450  15.334  11.333  1.00 35.98 ? 441 MET A CA  1 
ATOM   2944  C C   . MET A 1 403 ? 9.935   13.954  11.611  1.00 36.22 ? 441 MET A C   1 
ATOM   2945  O O   . MET A 1 403 ? 8.903   13.803  12.252  1.00 36.00 ? 441 MET A O   1 
ATOM   2946  C CB  . MET A 1 403 ? 11.529  15.646  12.375  1.00 36.17 ? 441 MET A CB  1 
ATOM   2947  C CG  . MET A 1 403 ? 11.089  15.539  13.841  1.00 35.67 ? 441 MET A CG  1 
ATOM   2948  S SD  . MET A 1 403 ? 12.521  15.736  14.921  1.00 37.64 ? 441 MET A SD  1 
ATOM   2949  C CE  . MET A 1 403 ? 11.856  15.301  16.507  1.00 37.40 ? 441 MET A CE  1 
ATOM   2950  N N   . GLU A 1 404 ? 10.679  12.951  11.146  1.00 36.56 ? 442 GLU A N   1 
ATOM   2951  C CA  . GLU A 1 404 ? 10.442  11.579  11.571  1.00 37.31 ? 442 GLU A CA  1 
ATOM   2952  C C   . GLU A 1 404 ? 10.760  11.487  13.065  1.00 36.07 ? 442 GLU A C   1 
ATOM   2953  O O   . GLU A 1 404 ? 11.748  12.067  13.541  1.00 35.96 ? 442 GLU A O   1 
ATOM   2954  C CB  . GLU A 1 404 ? 11.276  10.591  10.751  1.00 37.48 ? 442 GLU A CB  1 
ATOM   2955  C CG  . GLU A 1 404 ? 10.905  10.595  9.251   1.00 39.64 ? 442 GLU A CG  1 
ATOM   2956  C CD  . GLU A 1 404 ? 11.757  9.636   8.417   1.00 40.71 ? 442 GLU A CD  1 
ATOM   2957  O OE1 . GLU A 1 404 ? 11.580  8.392   8.569   1.00 44.53 ? 442 GLU A OE1 1 
ATOM   2958  O OE2 . GLU A 1 404 ? 12.600  10.137  7.617   1.00 44.33 ? 442 GLU A OE2 1 
ATOM   2959  N N   . HIS A 1 405 ? 9.895   10.799  13.797  1.00 34.97 ? 443 HIS A N   1 
ATOM   2960  C CA  . HIS A 1 405 ? 9.924   10.783  15.258  1.00 34.44 ? 443 HIS A CA  1 
ATOM   2961  C C   . HIS A 1 405 ? 11.274  10.301  15.853  1.00 34.43 ? 443 HIS A C   1 
ATOM   2962  O O   . HIS A 1 405 ? 11.787  10.892  16.815  1.00 33.87 ? 443 HIS A O   1 
ATOM   2963  C CB  . HIS A 1 405 ? 8.774   9.899   15.765  1.00 34.34 ? 443 HIS A CB  1 
ATOM   2964  C CG  . HIS A 1 405 ? 8.430   10.124  17.200  1.00 33.65 ? 443 HIS A CG  1 
ATOM   2965  N ND1 . HIS A 1 405 ? 7.408   10.955  17.595  1.00 33.03 ? 443 HIS A ND1 1 
ATOM   2966  C CD2 . HIS A 1 405 ? 8.981   9.640   18.336  1.00 33.67 ? 443 HIS A CD2 1 
ATOM   2967  C CE1 . HIS A 1 405 ? 7.340   10.970  18.914  1.00 32.74 ? 443 HIS A CE1 1 
ATOM   2968  N NE2 . HIS A 1 405 ? 8.280   10.176  19.387  1.00 33.51 ? 443 HIS A NE2 1 
ATOM   2969  N N   . SER A 1 406 ? 11.833  9.246   15.260  1.00 34.19 ? 444 SER A N   1 
ATOM   2970  C CA  . SER A 1 406 ? 13.095  8.630   15.709  1.00 34.73 ? 444 SER A CA  1 
ATOM   2971  C C   . SER A 1 406 ? 14.087  8.459   14.563  1.00 34.73 ? 444 SER A C   1 
ATOM   2972  O O   . SER A 1 406 ? 13.701  8.426   13.393  1.00 34.50 ? 444 SER A O   1 
ATOM   2973  C CB  . SER A 1 406 ? 12.836  7.262   16.335  1.00 34.61 ? 444 SER A CB  1 
ATOM   2974  O OG  . SER A 1 406 ? 11.809  7.321   17.317  1.00 36.21 ? 444 SER A OG  1 
ATOM   2975  N N   . ALA A 1 407 ? 15.367  8.356   14.920  1.00 35.41 ? 445 ALA A N   1 
ATOM   2976  C CA  . ALA A 1 407 ? 16.485  8.263   13.968  1.00 35.92 ? 445 ALA A CA  1 
ATOM   2977  C C   . ALA A 1 407 ? 16.714  6.796   13.661  1.00 36.40 ? 445 ALA A C   1 
ATOM   2978  O O   . ALA A 1 407 ? 15.925  5.959   14.109  1.00 36.22 ? 445 ALA A O   1 
ATOM   2979  C CB  . ALA A 1 407 ? 17.751  8.903   14.571  1.00 36.07 ? 445 ALA A CB  1 
ATOM   2980  N N   . LYS A 1 408 ? 17.772  6.465   12.910  1.00 37.25 ? 446 LYS A N   1 
ATOM   2981  C CA  . LYS A 1 408 ? 18.097  5.037   12.632  1.00 37.57 ? 446 LYS A CA  1 
ATOM   2982  C C   . LYS A 1 408 ? 18.338  4.256   13.932  1.00 37.75 ? 446 LYS A C   1 
ATOM   2983  O O   . LYS A 1 408 ? 18.865  4.795   14.904  1.00 38.48 ? 446 LYS A O   1 
ATOM   2984  C CB  . LYS A 1 408 ? 19.318  4.904   11.713  1.00 37.76 ? 446 LYS A CB  1 
ATOM   2985  N N   . GLY A 1 409 ? 17.929  2.996   13.954  1.00 37.73 ? 447 GLY A N   1 
ATOM   2986  C CA  . GLY A 1 409 ? 18.046  2.170   15.150  1.00 37.86 ? 447 GLY A CA  1 
ATOM   2987  C C   . GLY A 1 409 ? 17.088  2.541   16.270  1.00 37.80 ? 447 GLY A C   1 
ATOM   2988  O O   . GLY A 1 409 ? 17.298  2.156   17.426  1.00 38.06 ? 447 GLY A O   1 
ATOM   2989  N N   . ASN A 1 410 ? 16.024  3.264   15.921  1.00 37.44 ? 448 ASN A N   1 
ATOM   2990  C CA  . ASN A 1 410 ? 15.086  3.845   16.898  1.00 37.25 ? 448 ASN A CA  1 
ATOM   2991  C C   . ASN A 1 410 ? 15.784  4.787   17.914  1.00 36.50 ? 448 ASN A C   1 
ATOM   2992  O O   . ASN A 1 410 ? 15.302  4.993   19.035  1.00 35.96 ? 448 ASN A O   1 
ATOM   2993  C CB  . ASN A 1 410 ? 14.268  2.739   17.592  1.00 37.36 ? 448 ASN A CB  1 
ATOM   2994  C CG  . ASN A 1 410 ? 12.943  3.250   18.186  1.00 38.27 ? 448 ASN A CG  1 
ATOM   2995  O OD1 . ASN A 1 410 ? 12.295  4.149   17.641  1.00 39.16 ? 448 ASN A OD1 1 
ATOM   2996  N ND2 . ASN A 1 410 ? 12.545  2.668   19.315  1.00 38.59 ? 448 ASN A ND2 1 
ATOM   2997  N N   . ALA A 1 411 ? 16.909  5.363   17.480  1.00 35.72 ? 449 ALA A N   1 
ATOM   2998  C CA  . ALA A 1 411 ? 17.629  6.374   18.228  1.00 35.44 ? 449 ALA A CA  1 
ATOM   2999  C C   . ALA A 1 411 ? 16.728  7.609   18.397  1.00 35.12 ? 449 ALA A C   1 
ATOM   3000  O O   . ALA A 1 411 ? 16.206  8.123   17.426  1.00 34.35 ? 449 ALA A O   1 
ATOM   3001  C CB  . ALA A 1 411 ? 18.938  6.742   17.493  1.00 35.29 ? 449 ALA A CB  1 
ATOM   3002  N N   . HIS A 1 412 ? 16.549  8.061   19.643  1.00 35.08 ? 450 HIS A N   1 
ATOM   3003  C CA  . HIS A 1 412 ? 15.684  9.216   19.973  1.00 34.31 ? 450 HIS A CA  1 
ATOM   3004  C C   . HIS A 1 412 ? 16.097  10.469  19.235  1.00 33.37 ? 450 HIS A C   1 
ATOM   3005  O O   . HIS A 1 412 ? 17.273  10.740  19.078  1.00 32.93 ? 450 HIS A O   1 
ATOM   3006  C CB  . HIS A 1 412 ? 15.702  9.514   21.486  1.00 34.35 ? 450 HIS A CB  1 
ATOM   3007  C CG  . HIS A 1 412 ? 15.107  8.425   22.322  1.00 33.69 ? 450 HIS A CG  1 
ATOM   3008  N ND1 . HIS A 1 412 ? 13.852  7.904   22.077  1.00 34.21 ? 450 HIS A ND1 1 
ATOM   3009  C CD2 . HIS A 1 412 ? 15.593  7.754   23.393  1.00 33.05 ? 450 HIS A CD2 1 
ATOM   3010  C CE1 . HIS A 1 412 ? 13.599  6.947   22.956  1.00 34.08 ? 450 HIS A CE1 1 
ATOM   3011  N NE2 . HIS A 1 412 ? 14.639  6.831   23.762  1.00 32.37 ? 450 HIS A NE2 1 
ATOM   3012  N N   . LYS A 1 413 ? 15.116  11.223  18.766  1.00 32.88 ? 451 LYS A N   1 
ATOM   3013  C CA  . LYS A 1 413 ? 15.374  12.559  18.234  1.00 32.86 ? 451 LYS A CA  1 
ATOM   3014  C C   . LYS A 1 413 ? 14.736  13.656  19.103  1.00 32.67 ? 451 LYS A C   1 
ATOM   3015  O O   . LYS A 1 413 ? 15.171  14.799  19.077  1.00 33.05 ? 451 LYS A O   1 
ATOM   3016  C CB  . LYS A 1 413 ? 14.865  12.646  16.797  1.00 32.73 ? 451 LYS A CB  1 
ATOM   3017  C CG  . LYS A 1 413 ? 15.747  11.942  15.819  1.00 32.04 ? 451 LYS A CG  1 
ATOM   3018  C CD  . LYS A 1 413 ? 15.029  11.651  14.510  1.00 32.85 ? 451 LYS A CD  1 
ATOM   3019  C CE  . LYS A 1 413 ? 14.993  12.801  13.566  1.00 32.94 ? 451 LYS A CE  1 
ATOM   3020  N NZ  . LYS A 1 413 ? 14.525  12.273  12.241  1.00 35.82 ? 451 LYS A NZ  1 
ATOM   3021  N N   . ILE A 1 414 ? 13.683  13.286  19.826  1.00 32.60 ? 452 ILE A N   1 
ATOM   3022  C CA  . ILE A 1 414 ? 13.001  14.113  20.810  1.00 32.61 ? 452 ILE A CA  1 
ATOM   3023  C C   . ILE A 1 414 ? 13.514  13.636  22.160  1.00 33.53 ? 452 ILE A C   1 
ATOM   3024  O O   . ILE A 1 414 ? 13.357  12.454  22.511  1.00 32.92 ? 452 ILE A O   1 
ATOM   3025  C CB  . ILE A 1 414 ? 11.469  13.896  20.757  1.00 32.80 ? 452 ILE A CB  1 
ATOM   3026  C CG1 . ILE A 1 414 ? 10.899  14.345  19.387  1.00 32.68 ? 452 ILE A CG1 1 
ATOM   3027  C CG2 . ILE A 1 414 ? 10.801  14.605  21.934  1.00 33.82 ? 452 ILE A CG2 1 
ATOM   3028  C CD1 . ILE A 1 414 ? 9.481   13.809  19.044  1.00 31.63 ? 452 ILE A CD1 1 
ATOM   3029  N N   . MET A 1 415 ? 14.143  14.535  22.905  1.00 33.97 ? 453 MET A N   1 
ATOM   3030  C CA  . MET A 1 415 ? 14.920  14.137  24.062  1.00 35.55 ? 453 MET A CA  1 
ATOM   3031  C C   . MET A 1 415 ? 15.005  15.251  25.100  1.00 35.35 ? 453 MET A C   1 
ATOM   3032  O O   . MET A 1 415 ? 14.507  16.366  24.894  1.00 35.43 ? 453 MET A O   1 
ATOM   3033  C CB  . MET A 1 415 ? 16.314  13.664  23.609  1.00 35.31 ? 453 MET A CB  1 
ATOM   3034  C CG  . MET A 1 415 ? 17.073  14.661  22.720  1.00 37.68 ? 453 MET A CG  1 
ATOM   3035  S SD  . MET A 1 415 ? 18.530  13.944  21.967  1.00 38.60 ? 453 MET A SD  1 
ATOM   3036  C CE  . MET A 1 415 ? 17.759  12.677  20.983  1.00 38.41 ? 453 MET A CE  1 
ATOM   3037  N N   . GLU A 1 416 ? 15.626  14.945  26.223  1.00 35.82 ? 454 GLU A N   1 
ATOM   3038  C CA  . GLU A 1 416 ? 15.632  15.858  27.354  1.00 36.50 ? 454 GLU A CA  1 
ATOM   3039  C C   . GLU A 1 416 ? 16.560  17.028  27.132  1.00 36.11 ? 454 GLU A C   1 
ATOM   3040  O O   . GLU A 1 416 ? 16.187  18.154  27.422  1.00 36.05 ? 454 GLU A O   1 
ATOM   3041  C CB  . GLU A 1 416 ? 16.012  15.120  28.623  1.00 37.31 ? 454 GLU A CB  1 
ATOM   3042  C CG  . GLU A 1 416 ? 16.115  16.026  29.819  1.00 40.14 ? 454 GLU A CG  1 
ATOM   3043  C CD  . GLU A 1 416 ? 15.621  15.360  31.079  1.00 45.14 ? 454 GLU A CD  1 
ATOM   3044  O OE1 . GLU A 1 416 ? 16.031  14.199  31.362  1.00 48.49 ? 454 GLU A OE1 1 
ATOM   3045  O OE2 . GLU A 1 416 ? 14.812  16.010  31.783  1.00 48.03 ? 454 GLU A OE2 1 
ATOM   3046  N N   . LYS A 1 417 ? 17.758  16.749  26.618  1.00 35.76 ? 455 LYS A N   1 
ATOM   3047  C CA  . LYS A 1 417 ? 18.673  17.769  26.141  1.00 35.70 ? 455 LYS A CA  1 
ATOM   3048  C C   . LYS A 1 417 ? 19.259  17.273  24.830  1.00 35.48 ? 455 LYS A C   1 
ATOM   3049  O O   . LYS A 1 417 ? 19.498  16.080  24.677  1.00 35.82 ? 455 LYS A O   1 
ATOM   3050  C CB  . LYS A 1 417 ? 19.784  18.003  27.182  1.00 35.86 ? 455 LYS A CB  1 
ATOM   3051  N N   . CYS A 1 418 ? 19.469  18.167  23.870  1.00 35.67 ? 456 CYS A N   1 
ATOM   3052  C CA  . CYS A 1 418 ? 20.183  17.810  22.627  1.00 35.39 ? 456 CYS A CA  1 
ATOM   3053  C C   . CYS A 1 418 ? 21.654  17.463  22.879  1.00 35.14 ? 456 CYS A C   1 
ATOM   3054  O O   . CYS A 1 418 ? 22.276  17.990  23.787  1.00 34.60 ? 456 CYS A O   1 
ATOM   3055  C CB  . CYS A 1 418 ? 20.126  18.928  21.593  1.00 35.19 ? 456 CYS A CB  1 
ATOM   3056  S SG  . CYS A 1 418 ? 18.482  19.475  21.051  1.00 36.14 ? 456 CYS A SG  1 
ATOM   3057  N N   . THR A 1 419 ? 22.188  16.558  22.061  1.00 34.85 ? 457 THR A N   1 
ATOM   3058  C CA  . THR A 1 419 ? 23.602  16.209  22.074  1.00 34.66 ? 457 THR A CA  1 
ATOM   3059  C C   . THR A 1 419 ? 24.327  16.779  20.853  1.00 34.69 ? 457 THR A C   1 
ATOM   3060  O O   . THR A 1 419 ? 25.545  16.819  20.824  1.00 34.97 ? 457 THR A O   1 
ATOM   3061  C CB  . THR A 1 419 ? 23.772  14.682  22.189  1.00 34.53 ? 457 THR A CB  1 
ATOM   3062  O OG1 . THR A 1 419 ? 23.234  14.036  21.025  1.00 34.91 ? 457 THR A OG1 1 
ATOM   3063  C CG2 . THR A 1 419 ? 23.013  14.189  23.417  1.00 34.17 ? 457 THR A CG2 1 
ATOM   3064  N N   . LEU A 1 420 ? 23.570  17.249  19.859  1.00 34.46 ? 458 LEU A N   1 
ATOM   3065  C CA  . LEU A 1 420 ? 24.129  17.920  18.692  1.00 33.93 ? 458 LEU A CA  1 
ATOM   3066  C C   . LEU A 1 420 ? 24.129  19.447  18.941  1.00 33.46 ? 458 LEU A C   1 
ATOM   3067  O O   . LEU A 1 420 ? 23.271  19.956  19.678  1.00 33.18 ? 458 LEU A O   1 
ATOM   3068  C CB  . LEU A 1 420 ? 23.335  17.532  17.409  1.00 33.67 ? 458 LEU A CB  1 
ATOM   3069  C CG  . LEU A 1 420 ? 23.444  16.072  16.927  1.00 33.82 ? 458 LEU A CG  1 
ATOM   3070  C CD1 . LEU A 1 420 ? 22.574  15.822  15.733  1.00 32.08 ? 458 LEU A CD1 1 
ATOM   3071  C CD2 . LEU A 1 420 ? 24.894  15.662  16.598  1.00 33.03 ? 458 LEU A CD2 1 
ATOM   3072  N N   . PRO A 1 421 ? 25.090  20.188  18.333  1.00 32.91 ? 459 PRO A N   1 
ATOM   3073  C CA  . PRO A 1 421 ? 25.095  21.652  18.456  1.00 33.38 ? 459 PRO A CA  1 
ATOM   3074  C C   . PRO A 1 421 ? 23.748  22.276  18.147  1.00 33.12 ? 459 PRO A C   1 
ATOM   3075  O O   . PRO A 1 421 ? 23.052  21.839  17.238  1.00 34.21 ? 459 PRO A O   1 
ATOM   3076  C CB  . PRO A 1 421 ? 26.155  22.072  17.433  1.00 33.12 ? 459 PRO A CB  1 
ATOM   3077  C CG  . PRO A 1 421 ? 27.078  20.981  17.440  1.00 32.77 ? 459 PRO A CG  1 
ATOM   3078  C CD  . PRO A 1 421 ? 26.228  19.744  17.516  1.00 32.91 ? 459 PRO A CD  1 
ATOM   3079  N N   . LEU A 1 422 ? 23.370  23.272  18.931  1.00 34.02 ? 460 LEU A N   1 
ATOM   3080  C CA  . LEU A 1 422 ? 22.033  23.864  18.842  1.00 33.54 ? 460 LEU A CA  1 
ATOM   3081  C C   . LEU A 1 422 ? 22.023  24.870  17.749  1.00 33.24 ? 460 LEU A C   1 
ATOM   3082  O O   . LEU A 1 422 ? 23.024  25.568  17.521  1.00 34.02 ? 460 LEU A O   1 
ATOM   3083  C CB  . LEU A 1 422 ? 21.616  24.588  20.143  1.00 33.94 ? 460 LEU A CB  1 
ATOM   3084  C CG  . LEU A 1 422 ? 21.461  23.842  21.452  1.00 32.39 ? 460 LEU A CG  1 
ATOM   3085  C CD1 . LEU A 1 422 ? 20.838  24.807  22.405  1.00 30.73 ? 460 LEU A CD1 1 
ATOM   3086  C CD2 . LEU A 1 422 ? 20.610  22.577  21.297  1.00 32.59 ? 460 LEU A CD2 1 
ATOM   3087  N N   . THR A 1 423 ? 20.880  24.905  17.075  1.00 33.28 ? 461 THR A N   1 
ATOM   3088  C CA  . THR A 1 423 ? 20.446  25.949  16.137  1.00 32.59 ? 461 THR A CA  1 
ATOM   3089  C C   . THR A 1 423 ? 19.709  27.055  16.907  1.00 33.25 ? 461 THR A C   1 
ATOM   3090  O O   . THR A 1 423 ? 19.789  28.228  16.574  1.00 33.19 ? 461 THR A O   1 
ATOM   3091  C CB  . THR A 1 423 ? 19.465  25.337  15.100  1.00 32.64 ? 461 THR A CB  1 
ATOM   3092  O OG1 . THR A 1 423 ? 20.154  24.336  14.360  1.00 31.92 ? 461 THR A OG1 1 
ATOM   3093  C CG2 . THR A 1 423 ? 18.856  26.379  14.140  1.00 30.02 ? 461 THR A CG2 1 
ATOM   3094  N N   . GLY A 1 424 ? 18.995  26.651  17.951  1.00 34.31 ? 462 GLY A N   1 
ATOM   3095  C CA  . GLY A 1 424 ? 18.283  27.579  18.806  1.00 34.13 ? 462 GLY A CA  1 
ATOM   3096  C C   . GLY A 1 424 ? 17.979  26.930  20.138  1.00 34.46 ? 462 GLY A C   1 
ATOM   3097  O O   . GLY A 1 424 ? 17.809  25.729  20.249  1.00 34.06 ? 462 GLY A O   1 
ATOM   3098  N N   . LYS A 1 425 ? 17.916  27.773  21.141  1.00 35.12 ? 463 LYS A N   1 
ATOM   3099  C CA  . LYS A 1 425 ? 17.537  27.437  22.477  1.00 36.15 ? 463 LYS A CA  1 
ATOM   3100  C C   . LYS A 1 425 ? 16.070  27.835  22.705  1.00 35.93 ? 463 LYS A C   1 
ATOM   3101  O O   . LYS A 1 425 ? 15.709  28.987  22.468  1.00 36.59 ? 463 LYS A O   1 
ATOM   3102  C CB  . LYS A 1 425 ? 18.442  28.245  23.412  1.00 35.90 ? 463 LYS A CB  1 
ATOM   3103  C CG  . LYS A 1 425 ? 18.335  27.882  24.856  1.00 37.60 ? 463 LYS A CG  1 
ATOM   3104  C CD  . LYS A 1 425 ? 19.172  28.842  25.731  1.00 38.64 ? 463 LYS A CD  1 
ATOM   3105  C CE  . LYS A 1 425 ? 18.712  28.774  27.181  1.00 41.07 ? 463 LYS A CE  1 
ATOM   3106  N NZ  . LYS A 1 425 ? 18.440  27.349  27.622  1.00 43.50 ? 463 LYS A NZ  1 
ATOM   3107  N N   . GLN A 1 426 ? 15.253  26.899  23.190  1.00 35.74 ? 464 GLN A N   1 
ATOM   3108  C CA  . GLN A 1 426 ? 13.877  27.157  23.642  1.00 36.52 ? 464 GLN A CA  1 
ATOM   3109  C C   . GLN A 1 426 ? 13.073  27.918  22.604  1.00 36.06 ? 464 GLN A C   1 
ATOM   3110  O O   . GLN A 1 426 ? 12.482  28.924  22.908  1.00 36.88 ? 464 GLN A O   1 
ATOM   3111  C CB  . GLN A 1 426 ? 13.852  27.895  25.018  1.00 35.99 ? 464 GLN A CB  1 
ATOM   3112  C CG  . GLN A 1 426 ? 14.325  27.017  26.182  1.00 36.57 ? 464 GLN A CG  1 
ATOM   3113  C CD  . GLN A 1 426 ? 14.370  27.726  27.536  1.00 37.49 ? 464 GLN A CD  1 
ATOM   3114  O OE1 . GLN A 1 426 ? 14.804  28.863  27.653  1.00 38.01 ? 464 GLN A OE1 1 
ATOM   3115  N NE2 . GLN A 1 426 ? 13.900  27.040  28.569  1.00 40.82 ? 464 GLN A NE2 1 
ATOM   3116  N N   . CYS A 1 427 ? 13.017  27.393  21.384  1.00 36.86 ? 465 CYS A N   1 
ATOM   3117  C CA  . CYS A 1 427 ? 12.444  28.117  20.241  1.00 37.23 ? 465 CYS A CA  1 
ATOM   3118  C C   . CYS A 1 427 ? 11.338  27.386  19.454  1.00 36.65 ? 465 CYS A C   1 
ATOM   3119  O O   . CYS A 1 427 ? 10.528  28.016  18.766  1.00 37.82 ? 465 CYS A O   1 
ATOM   3120  C CB  . CYS A 1 427 ? 13.584  28.582  19.319  1.00 36.99 ? 465 CYS A CB  1 
ATOM   3121  S SG  . CYS A 1 427 ? 14.582  27.271  18.637  1.00 40.41 ? 465 CYS A SG  1 
ATOM   3122  N N   . VAL A 1 428 ? 11.261  26.075  19.609  1.00 35.93 ? 466 VAL A N   1 
ATOM   3123  C CA  . VAL A 1 428 ? 10.249  25.260  18.944  1.00 35.07 ? 466 VAL A CA  1 
ATOM   3124  C C   . VAL A 1 428 ? 8.944   25.325  19.699  1.00 34.81 ? 466 VAL A C   1 
ATOM   3125  O O   . VAL A 1 428 ? 8.927   25.059  20.889  1.00 35.61 ? 466 VAL A O   1 
ATOM   3126  C CB  . VAL A 1 428 ? 10.720  23.796  18.843  1.00 34.82 ? 466 VAL A CB  1 
ATOM   3127  C CG1 . VAL A 1 428 ? 9.686   22.955  18.148  1.00 34.85 ? 466 VAL A CG1 1 
ATOM   3128  C CG2 . VAL A 1 428 ? 12.055  23.749  18.087  1.00 33.89 ? 466 VAL A CG2 1 
ATOM   3129  N N   . ASN A 1 429 ? 7.849   25.676  19.012  1.00 34.35 ? 467 ASN A N   1 
ATOM   3130  C CA  . ASN A 1 429 ? 6.522   25.730  19.611  1.00 33.41 ? 467 ASN A CA  1 
ATOM   3131  C C   . ASN A 1 429 ? 5.768   24.408  19.460  1.00 32.60 ? 467 ASN A C   1 
ATOM   3132  O O   . ASN A 1 429 ? 5.019   24.033  20.345  1.00 32.69 ? 467 ASN A O   1 
ATOM   3133  C CB  . ASN A 1 429 ? 5.688   26.858  18.991  1.00 33.64 ? 467 ASN A CB  1 
ATOM   3134  C CG  . ASN A 1 429 ? 6.207   28.233  19.339  1.00 32.40 ? 467 ASN A CG  1 
ATOM   3135  O OD1 . ASN A 1 429 ? 6.865   28.866  18.535  1.00 34.75 ? 467 ASN A OD1 1 
ATOM   3136  N ND2 . ASN A 1 429 ? 5.910   28.697  20.536  1.00 24.30 ? 467 ASN A ND2 1 
ATOM   3137  N N   . ARG A 1 430 ? 5.964   23.718  18.341  1.00 31.95 ? 468 ARG A N   1 
ATOM   3138  C CA  . ARG A 1 430 ? 5.243   22.474  18.043  1.00 31.93 ? 468 ARG A CA  1 
ATOM   3139  C C   . ARG A 1 430 ? 6.134   21.476  17.276  1.00 31.36 ? 468 ARG A C   1 
ATOM   3140  O O   . ARG A 1 430 ? 7.003   21.868  16.477  1.00 31.11 ? 468 ARG A O   1 
ATOM   3141  C CB  . ARG A 1 430 ? 3.952   22.795  17.266  1.00 32.23 ? 468 ARG A CB  1 
ATOM   3142  C CG  . ARG A 1 430 ? 3.170   21.587  16.750  1.00 32.41 ? 468 ARG A CG  1 
ATOM   3143  C CD  . ARG A 1 430 ? 1.779   22.003  16.320  1.00 33.05 ? 468 ARG A CD  1 
ATOM   3144  N NE  . ARG A 1 430 ? 0.983   22.405  17.482  1.00 33.79 ? 468 ARG A NE  1 
ATOM   3145  C CZ  . ARG A 1 430 ? -0.313  22.672  17.449  1.00 32.65 ? 468 ARG A CZ  1 
ATOM   3146  N NH1 . ARG A 1 430 ? -0.935  23.040  18.544  1.00 34.36 ? 468 ARG A NH1 1 
ATOM   3147  N NH2 . ARG A 1 430 ? -0.994  22.579  16.324  1.00 33.34 ? 468 ARG A NH2 1 
ATOM   3148  N N   . ILE A 1 431 ? 5.954   20.197  17.573  1.00 30.49 ? 469 ILE A N   1 
ATOM   3149  C CA  . ILE A 1 431 ? 6.670   19.118  16.881  1.00 30.75 ? 469 ILE A CA  1 
ATOM   3150  C C   . ILE A 1 431 ? 5.639   18.211  16.236  1.00 31.15 ? 469 ILE A C   1 
ATOM   3151  O O   . ILE A 1 431 ? 4.831   17.609  16.945  1.00 31.13 ? 469 ILE A O   1 
ATOM   3152  C CB  . ILE A 1 431 ? 7.505   18.227  17.847  1.00 30.46 ? 469 ILE A CB  1 
ATOM   3153  C CG1 . ILE A 1 431 ? 8.347   19.072  18.814  1.00 30.57 ? 469 ILE A CG1 1 
ATOM   3154  C CG2 . ILE A 1 431 ? 8.373   17.264  17.041  1.00 30.47 ? 469 ILE A CG2 1 
ATOM   3155  C CD1 . ILE A 1 431 ? 8.980   18.243  19.963  1.00 30.31 ? 469 ILE A CD1 1 
ATOM   3156  N N   . ILE A 1 432 ? 5.665   18.120  14.910  1.00 31.70 ? 470 ILE A N   1 
ATOM   3157  C CA  . ILE A 1 432 ? 4.840   17.168  14.158  1.00 31.32 ? 470 ILE A CA  1 
ATOM   3158  C C   . ILE A 1 432 ? 5.748   16.032  13.726  1.00 31.52 ? 470 ILE A C   1 
ATOM   3159  O O   . ILE A 1 432 ? 6.772   16.255  13.096  1.00 31.89 ? 470 ILE A O   1 
ATOM   3160  C CB  . ILE A 1 432 ? 4.173   17.821  12.882  1.00 31.14 ? 470 ILE A CB  1 
ATOM   3161  C CG1 . ILE A 1 432 ? 3.183   18.930  13.285  1.00 31.63 ? 470 ILE A CG1 1 
ATOM   3162  C CG2 . ILE A 1 432 ? 3.473   16.752  12.060  1.00 29.03 ? 470 ILE A CG2 1 
ATOM   3163  C CD1 . ILE A 1 432 ? 2.842   19.953  12.203  1.00 31.18 ? 470 ILE A CD1 1 
ATOM   3164  N N   . THR A 1 433 ? 5.381   14.812  14.095  1.00 31.95 ? 471 THR A N   1 
ATOM   3165  C CA  . THR A 1 433 ? 6.060   13.613  13.619  1.00 31.88 ? 471 THR A CA  1 
ATOM   3166  C C   . THR A 1 433 ? 5.013   12.776  12.901  1.00 32.14 ? 471 THR A C   1 
ATOM   3167  O O   . THR A 1 433 ? 3.934   13.274  12.627  1.00 32.24 ? 471 THR A O   1 
ATOM   3168  C CB  . THR A 1 433 ? 6.702   12.818  14.783  1.00 31.90 ? 471 THR A CB  1 
ATOM   3169  O OG1 . THR A 1 433 ? 5.714   11.992  15.421  1.00 31.23 ? 471 THR A OG1 1 
ATOM   3170  C CG2 . THR A 1 433 ? 7.309   13.769  15.801  1.00 31.39 ? 471 THR A CG2 1 
ATOM   3171  N N   . GLU A 1 434 ? 5.345   11.525  12.586  1.00 32.84 ? 472 GLU A N   1 
ATOM   3172  C CA  . GLU A 1 434 ? 4.410   10.571  11.971  1.00 33.20 ? 472 GLU A CA  1 
ATOM   3173  C C   . GLU A 1 434 ? 3.601   9.792   13.011  1.00 33.23 ? 472 GLU A C   1 
ATOM   3174  O O   . GLU A 1 434 ? 2.664   9.083   12.666  1.00 32.87 ? 472 GLU A O   1 
ATOM   3175  C CB  . GLU A 1 434 ? 5.169   9.599   11.047  1.00 33.46 ? 472 GLU A CB  1 
ATOM   3176  C CG  . GLU A 1 434 ? 5.898   8.431   11.748  1.00 34.63 ? 472 GLU A CG  1 
ATOM   3177  C CD  . GLU A 1 434 ? 7.236   8.814   12.365  1.00 36.04 ? 472 GLU A CD  1 
ATOM   3178  O OE1 . GLU A 1 434 ? 7.572   10.023  12.381  1.00 37.83 ? 472 GLU A OE1 1 
ATOM   3179  O OE2 . GLU A 1 434 ? 7.962   7.904   12.838  1.00 35.66 ? 472 GLU A OE2 1 
ATOM   3180  N N   . LYS A 1 435 ? 4.004   9.915   14.277  1.00 33.58 ? 473 LYS A N   1 
ATOM   3181  C CA  . LYS A 1 435 ? 3.328   9.300   15.420  1.00 33.37 ? 473 LYS A CA  1 
ATOM   3182  C C   . LYS A 1 435 ? 2.601   10.341  16.289  1.00 33.17 ? 473 LYS A C   1 
ATOM   3183  O O   . LYS A 1 435 ? 1.495   10.093  16.744  1.00 33.05 ? 473 LYS A O   1 
ATOM   3184  C CB  . LYS A 1 435 ? 4.342   8.540   16.288  1.00 33.69 ? 473 LYS A CB  1 
ATOM   3185  C CG  . LYS A 1 435 ? 5.435   7.822   15.498  1.00 34.08 ? 473 LYS A CG  1 
ATOM   3186  C CD  . LYS A 1 435 ? 6.210   6.828   16.354  1.00 33.81 ? 473 LYS A CD  1 
ATOM   3187  C CE  . LYS A 1 435 ? 7.328   6.177   15.551  1.00 34.38 ? 473 LYS A CE  1 
ATOM   3188  N NZ  . LYS A 1 435 ? 7.389   4.695   15.737  1.00 34.84 ? 473 LYS A NZ  1 
ATOM   3189  N N   . ALA A 1 436 ? 3.227   11.496  16.538  1.00 33.08 ? 474 ALA A N   1 
ATOM   3190  C CA  . ALA A 1 436 ? 2.683   12.455  17.500  1.00 32.89 ? 474 ALA A CA  1 
ATOM   3191  C C   . ALA A 1 436 ? 2.703   13.903  17.020  1.00 32.42 ? 474 ALA A C   1 
ATOM   3192  O O   . ALA A 1 436 ? 3.395   14.257  16.080  1.00 32.86 ? 474 ALA A O   1 
ATOM   3193  C CB  . ALA A 1 436 ? 3.438   12.336  18.834  1.00 32.78 ? 474 ALA A CB  1 
ATOM   3194  N N   . VAL A 1 437 ? 1.876   14.718  17.661  1.00 31.91 ? 475 VAL A N   1 
ATOM   3195  C CA  . VAL A 1 437 ? 1.997   16.160  17.626  1.00 31.04 ? 475 VAL A CA  1 
ATOM   3196  C C   . VAL A 1 437 ? 2.191   16.556  19.086  1.00 31.09 ? 475 VAL A C   1 
ATOM   3197  O O   . VAL A 1 437 ? 1.381   16.191  19.957  1.00 30.61 ? 475 VAL A O   1 
ATOM   3198  C CB  . VAL A 1 437 ? 0.748   16.866  17.030  1.00 30.89 ? 475 VAL A CB  1 
ATOM   3199  C CG1 . VAL A 1 437 ? 0.929   18.391  17.046  1.00 31.05 ? 475 VAL A CG1 1 
ATOM   3200  C CG2 . VAL A 1 437 ? 0.498   16.416  15.612  1.00 29.67 ? 475 VAL A CG2 1 
ATOM   3201  N N   . PHE A 1 438 ? 3.283   17.260  19.359  1.00 31.08 ? 476 PHE A N   1 
ATOM   3202  C CA  . PHE A 1 438 ? 3.529   17.829  20.676  1.00 31.60 ? 476 PHE A CA  1 
ATOM   3203  C C   . PHE A 1 438 ? 3.429   19.347  20.637  1.00 31.91 ? 476 PHE A C   1 
ATOM   3204  O O   . PHE A 1 438 ? 3.896   19.979  19.704  1.00 31.45 ? 476 PHE A O   1 
ATOM   3205  C CB  . PHE A 1 438 ? 4.926   17.489  21.191  1.00 31.52 ? 476 PHE A CB  1 
ATOM   3206  C CG  . PHE A 1 438 ? 5.169   16.050  21.442  1.00 31.55 ? 476 PHE A CG  1 
ATOM   3207  C CD1 . PHE A 1 438 ? 4.640   15.422  22.561  1.00 31.21 ? 476 PHE A CD1 1 
ATOM   3208  C CD2 . PHE A 1 438 ? 6.001   15.328  20.608  1.00 32.09 ? 476 PHE A CD2 1 
ATOM   3209  C CE1 . PHE A 1 438 ? 4.915   14.091  22.818  1.00 32.75 ? 476 PHE A CE1 1 
ATOM   3210  C CE2 . PHE A 1 438 ? 6.271   13.978  20.850  1.00 33.20 ? 476 PHE A CE2 1 
ATOM   3211  C CZ  . PHE A 1 438 ? 5.732   13.360  21.951  1.00 32.84 ? 476 PHE A CZ  1 
ATOM   3212  N N   . ASP A 1 439 ? 2.831   19.926  21.670  1.00 33.25 ? 477 ASP A N   1 
ATOM   3213  C CA  . ASP A 1 439 ? 3.039   21.332  21.965  1.00 34.31 ? 477 ASP A CA  1 
ATOM   3214  C C   . ASP A 1 439 ? 4.232   21.398  22.894  1.00 34.98 ? 477 ASP A C   1 
ATOM   3215  O O   . ASP A 1 439 ? 4.461   20.471  23.654  1.00 34.89 ? 477 ASP A O   1 
ATOM   3216  C CB  . ASP A 1 439 ? 1.819   21.958  22.603  1.00 34.54 ? 477 ASP A CB  1 
ATOM   3217  C CG  . ASP A 1 439 ? 0.736   22.210  21.601  1.00 36.48 ? 477 ASP A CG  1 
ATOM   3218  O OD1 . ASP A 1 439 ? 1.088   22.714  20.512  1.00 36.57 ? 477 ASP A OD1 1 
ATOM   3219  O OD2 . ASP A 1 439 ? -0.439  21.876  21.878  1.00 37.27 ? 477 ASP A OD2 1 
ATOM   3220  N N   . VAL A 1 440 ? 4.994   22.483  22.792  1.00 35.85 ? 478 VAL A N   1 
ATOM   3221  C CA  . VAL A 1 440 ? 6.270   22.621  23.470  1.00 36.64 ? 478 VAL A CA  1 
ATOM   3222  C C   . VAL A 1 440 ? 6.265   23.934  24.264  1.00 37.45 ? 478 VAL A C   1 
ATOM   3223  O O   . VAL A 1 440 ? 6.134   25.016  23.699  1.00 37.52 ? 478 VAL A O   1 
ATOM   3224  C CB  . VAL A 1 440 ? 7.449   22.640  22.459  1.00 36.80 ? 478 VAL A CB  1 
ATOM   3225  C CG1 . VAL A 1 440 ? 8.787   22.532  23.203  1.00 36.26 ? 478 VAL A CG1 1 
ATOM   3226  C CG2 . VAL A 1 440 ? 7.308   21.539  21.391  1.00 35.14 ? 478 VAL A CG2 1 
ATOM   3227  N N   . ASP A 1 441 ? 6.409   23.827  25.576  1.00 38.72 ? 479 ASP A N   1 
ATOM   3228  C CA  . ASP A 1 441 ? 6.538   24.999  26.430  1.00 39.78 ? 479 ASP A CA  1 
ATOM   3229  C C   . ASP A 1 441 ? 7.934   25.039  27.029  1.00 40.20 ? 479 ASP A C   1 
ATOM   3230  O O   . ASP A 1 441 ? 8.472   24.005  27.453  1.00 40.81 ? 479 ASP A O   1 
ATOM   3231  C CB  . ASP A 1 441 ? 5.494   24.980  27.541  1.00 39.80 ? 479 ASP A CB  1 
ATOM   3232  C CG  . ASP A 1 441 ? 5.254   26.363  28.142  1.00 41.63 ? 479 ASP A CG  1 
ATOM   3233  O OD1 . ASP A 1 441 ? 4.774   27.248  27.399  1.00 46.08 ? 479 ASP A OD1 1 
ATOM   3234  O OD2 . ASP A 1 441 ? 5.549   26.575  29.343  1.00 43.30 ? 479 ASP A OD2 1 
ATOM   3235  N N   . LYS A 1 442 ? 8.495   26.245  27.065  1.00 40.46 ? 480 LYS A N   1 
ATOM   3236  C CA  . LYS A 1 442 ? 9.845   26.478  27.522  1.00 40.95 ? 480 LYS A CA  1 
ATOM   3237  C C   . LYS A 1 442 ? 9.983   26.287  29.032  1.00 40.99 ? 480 LYS A C   1 
ATOM   3238  O O   . LYS A 1 442 ? 11.072  25.987  29.473  1.00 41.54 ? 480 LYS A O   1 
ATOM   3239  C CB  . LYS A 1 442 ? 10.358  27.863  27.035  1.00 41.16 ? 480 LYS A CB  1 
ATOM   3240  C CG  . LYS A 1 442 ? 9.717   29.099  27.729  1.00 41.74 ? 480 LYS A CG  1 
ATOM   3241  C CD  . LYS A 1 442 ? 9.942   30.405  26.940  1.00 41.26 ? 480 LYS A CD  1 
ATOM   3242  N N   . LYS A 1 443 ? 8.895   26.408  29.813  1.00 41.04 ? 481 LYS A N   1 
ATOM   3243  C CA  . LYS A 1 443 ? 8.908   26.074  31.255  1.00 41.19 ? 481 LYS A CA  1 
ATOM   3244  C C   . LYS A 1 443 ? 8.172   24.759  31.625  1.00 41.29 ? 481 LYS A C   1 
ATOM   3245  O O   . LYS A 1 443 ? 8.540   24.097  32.596  1.00 41.21 ? 481 LYS A O   1 
ATOM   3246  C CB  . LYS A 1 443 ? 8.304   27.219  32.104  1.00 41.16 ? 481 LYS A CB  1 
ATOM   3247  C CG  . LYS A 1 443 ? 9.026   28.563  32.025  1.00 41.60 ? 481 LYS A CG  1 
ATOM   3248  N N   . LYS A 1 444 ? 7.115   24.407  30.891  1.00 41.10 ? 482 LYS A N   1 
ATOM   3249  C CA  . LYS A 1 444 ? 6.334   23.200  31.200  1.00 41.24 ? 482 LYS A CA  1 
ATOM   3250  C C   . LYS A 1 444 ? 6.963   21.944  30.598  1.00 40.52 ? 482 LYS A C   1 
ATOM   3251  O O   . LYS A 1 444 ? 6.931   20.882  31.213  1.00 41.45 ? 482 LYS A O   1 
ATOM   3252  C CB  . LYS A 1 444 ? 4.869   23.310  30.707  1.00 41.57 ? 482 LYS A CB  1 
ATOM   3253  C CG  . LYS A 1 444 ? 3.876   24.091  31.595  1.00 41.74 ? 482 LYS A CG  1 
ATOM   3254  C CD  . LYS A 1 444 ? 2.527   24.245  30.870  1.00 41.37 ? 482 LYS A CD  1 
ATOM   3255  N N   . GLY A 1 445 ? 7.491   22.052  29.387  1.00 39.49 ? 483 GLY A N   1 
ATOM   3256  C CA  . GLY A 1 445 ? 7.914   20.877  28.618  1.00 38.57 ? 483 GLY A CA  1 
ATOM   3257  C C   . GLY A 1 445 ? 6.942   20.514  27.492  1.00 37.44 ? 483 GLY A C   1 
ATOM   3258  O O   . GLY A 1 445 ? 6.310   21.384  26.889  1.00 37.57 ? 483 GLY A O   1 
ATOM   3259  N N   . LEU A 1 446 ? 6.843   19.220  27.202  1.00 35.91 ? 484 LEU A N   1 
ATOM   3260  C CA  . LEU A 1 446 ? 6.037   18.711  26.094  1.00 35.01 ? 484 LEU A CA  1 
ATOM   3261  C C   . LEU A 1 446 ? 4.606   18.341  26.546  1.00 34.44 ? 484 LEU A C   1 
ATOM   3262  O O   . LEU A 1 446 ? 4.398   17.872  27.685  1.00 34.29 ? 484 LEU A O   1 
ATOM   3263  C CB  . LEU A 1 446 ? 6.701   17.465  25.486  1.00 34.36 ? 484 LEU A CB  1 
ATOM   3264  C CG  . LEU A 1 446 ? 8.109   17.603  24.913  1.00 34.98 ? 484 LEU A CG  1 
ATOM   3265  C CD1 . LEU A 1 446 ? 8.683   16.232  24.525  1.00 34.63 ? 484 LEU A CD1 1 
ATOM   3266  C CD2 . LEU A 1 446 ? 8.092   18.554  23.718  1.00 32.67 ? 484 LEU A CD2 1 
ATOM   3267  N N   . THR A 1 447 ? 3.636   18.558  25.653  1.00 33.09 ? 485 THR A N   1 
ATOM   3268  C CA  . THR A 1 447 ? 2.333   17.909  25.764  1.00 32.59 ? 485 THR A CA  1 
ATOM   3269  C C   . THR A 1 447 ? 1.986   17.178  24.473  1.00 31.86 ? 485 THR A C   1 
ATOM   3270  O O   . THR A 1 447 ? 2.005   17.775  23.386  1.00 31.05 ? 485 THR A O   1 
ATOM   3271  C CB  . THR A 1 447 ? 1.200   18.897  26.067  1.00 32.75 ? 485 THR A CB  1 
ATOM   3272  O OG1 . THR A 1 447 ? 1.521   19.650  27.238  1.00 33.72 ? 485 THR A OG1 1 
ATOM   3273  C CG2 . THR A 1 447 ? -0.115  18.146  26.291  1.00 31.85 ? 485 THR A CG2 1 
ATOM   3274  N N   . LEU A 1 448 ? 1.665   15.891  24.593  1.00 31.24 ? 486 LEU A N   1 
ATOM   3275  C CA  . LEU A 1 448 ? 1.218   15.100  23.450  1.00 31.19 ? 486 LEU A CA  1 
ATOM   3276  C C   . LEU A 1 448 ? -0.247  15.416  23.193  1.00 31.22 ? 486 LEU A C   1 
ATOM   3277  O O   . LEU A 1 448 ? -1.117  14.931  23.929  1.00 31.69 ? 486 LEU A O   1 
ATOM   3278  C CB  . LEU A 1 448 ? 1.397   13.611  23.731  1.00 31.64 ? 486 LEU A CB  1 
ATOM   3279  C CG  . LEU A 1 448 ? 0.945   12.653  22.619  1.00 32.31 ? 486 LEU A CG  1 
ATOM   3280  C CD1 . LEU A 1 448 ? 1.877   12.808  21.416  1.00 29.37 ? 486 LEU A CD1 1 
ATOM   3281  C CD2 . LEU A 1 448 ? 0.889   11.195  23.107  1.00 29.38 ? 486 LEU A CD2 1 
ATOM   3282  N N   . ILE A 1 449 ? -0.512  16.239  22.178  1.00 31.27 ? 487 ILE A N   1 
ATOM   3283  C CA  . ILE A 1 449 ? -1.874  16.725  21.871  1.00 31.57 ? 487 ILE A CA  1 
ATOM   3284  C C   . ILE A 1 449 ? -2.579  15.886  20.782  1.00 31.73 ? 487 ILE A C   1 
ATOM   3285  O O   . ILE A 1 449 ? -3.808  15.810  20.740  1.00 31.45 ? 487 ILE A O   1 
ATOM   3286  C CB  . ILE A 1 449 ? -1.886  18.255  21.491  1.00 31.38 ? 487 ILE A CB  1 
ATOM   3287  C CG1 . ILE A 1 449 ? -1.321  18.501  20.089  1.00 31.77 ? 487 ILE A CG1 1 
ATOM   3288  C CG2 . ILE A 1 449 ? -1.137  19.078  22.555  1.00 30.89 ? 487 ILE A CG2 1 
ATOM   3289  C CD1 . ILE A 1 449 ? -1.378  19.917  19.639  1.00 31.29 ? 487 ILE A CD1 1 
ATOM   3290  N N   . GLU A 1 450 ? -1.786  15.276  19.905  1.00 32.17 ? 488 GLU A N   1 
ATOM   3291  C CA  . GLU A 1 450 ? -2.305  14.371  18.892  1.00 32.88 ? 488 GLU A CA  1 
ATOM   3292  C C   . GLU A 1 450 ? -1.433  13.123  18.757  1.00 32.88 ? 488 GLU A C   1 
ATOM   3293  O O   . GLU A 1 450 ? -0.235  13.138  19.040  1.00 32.65 ? 488 GLU A O   1 
ATOM   3294  C CB  . GLU A 1 450 ? -2.455  15.101  17.555  1.00 32.81 ? 488 GLU A CB  1 
ATOM   3295  C CG  . GLU A 1 450 ? -3.670  16.047  17.520  1.00 33.79 ? 488 GLU A CG  1 
ATOM   3296  C CD  . GLU A 1 450 ? -3.666  16.985  16.327  1.00 34.95 ? 488 GLU A CD  1 
ATOM   3297  O OE1 . GLU A 1 450 ? -3.312  16.502  15.226  1.00 38.11 ? 488 GLU A OE1 1 
ATOM   3298  O OE2 . GLU A 1 450 ? -4.011  18.194  16.493  1.00 36.07 ? 488 GLU A OE2 1 
ATOM   3299  N N   . LEU A 1 451 ? -2.060  12.037  18.336  1.00 33.33 ? 489 LEU A N   1 
ATOM   3300  C CA  . LEU A 1 451 ? -1.423  10.730  18.281  1.00 33.72 ? 489 LEU A CA  1 
ATOM   3301  C C   . LEU A 1 451 ? -1.962  9.965   17.061  1.00 34.24 ? 489 LEU A C   1 
ATOM   3302  O O   . LEU A 1 451 ? -3.177  9.904   16.858  1.00 33.95 ? 489 LEU A O   1 
ATOM   3303  C CB  . LEU A 1 451 ? -1.716  9.991   19.590  1.00 33.69 ? 489 LEU A CB  1 
ATOM   3304  C CG  . LEU A 1 451 ? -1.421  8.496   19.743  1.00 33.47 ? 489 LEU A CG  1 
ATOM   3305  C CD1 . LEU A 1 451 ? 0.073   8.231   19.916  1.00 32.82 ? 489 LEU A CD1 1 
ATOM   3306  C CD2 . LEU A 1 451 ? -2.186  7.982   20.916  1.00 32.41 ? 489 LEU A CD2 1 
ATOM   3307  N N   . TRP A 1 452 ? -1.070  9.402   16.242  1.00 34.77 ? 490 TRP A N   1 
ATOM   3308  C CA  . TRP A 1 452 ? -1.499  8.659   15.059  1.00 35.38 ? 490 TRP A CA  1 
ATOM   3309  C C   . TRP A 1 452 ? -2.348  7.487   15.488  1.00 35.98 ? 490 TRP A C   1 
ATOM   3310  O O   . TRP A 1 452 ? -1.859  6.563   16.133  1.00 36.30 ? 490 TRP A O   1 
ATOM   3311  C CB  . TRP A 1 452 ? -0.331  8.131   14.223  1.00 35.23 ? 490 TRP A CB  1 
ATOM   3312  C CG  . TRP A 1 452 ? -0.832  7.412   12.987  1.00 35.27 ? 490 TRP A CG  1 
ATOM   3313  C CD1 . TRP A 1 452 ? -0.947  6.067   12.813  1.00 34.93 ? 490 TRP A CD1 1 
ATOM   3314  C CD2 . TRP A 1 452 ? -1.312  8.016   11.775  1.00 34.68 ? 490 TRP A CD2 1 
ATOM   3315  N NE1 . TRP A 1 452 ? -1.462  5.792   11.564  1.00 35.00 ? 490 TRP A NE1 1 
ATOM   3316  C CE2 . TRP A 1 452 ? -1.700  6.970   10.911  1.00 34.89 ? 490 TRP A CE2 1 
ATOM   3317  C CE3 . TRP A 1 452 ? -1.448  9.342   11.339  1.00 34.75 ? 490 TRP A CE3 1 
ATOM   3318  C CZ2 . TRP A 1 452 ? -2.212  7.203   9.634   1.00 35.57 ? 490 TRP A CZ2 1 
ATOM   3319  C CZ3 . TRP A 1 452 ? -1.949  9.581   10.072  1.00 34.66 ? 490 TRP A CZ3 1 
ATOM   3320  C CH2 . TRP A 1 452 ? -2.325  8.519   9.229   1.00 35.78 ? 490 TRP A CH2 1 
ATOM   3321  N N   . GLU A 1 453 ? -3.622  7.526   15.128  1.00 36.92 ? 491 GLU A N   1 
ATOM   3322  C CA  . GLU A 1 453 ? -4.561  6.478   15.524  1.00 37.68 ? 491 GLU A CA  1 
ATOM   3323  C C   . GLU A 1 453 ? -3.982  5.075   15.267  1.00 37.75 ? 491 GLU A C   1 
ATOM   3324  O O   . GLU A 1 453 ? -3.302  4.830   14.269  1.00 37.55 ? 491 GLU A O   1 
ATOM   3325  C CB  . GLU A 1 453 ? -5.897  6.674   14.797  1.00 38.16 ? 491 GLU A CB  1 
ATOM   3326  C CG  . GLU A 1 453 ? -5.822  6.548   13.264  1.00 39.09 ? 491 GLU A CG  1 
ATOM   3327  C CD  . GLU A 1 453 ? -6.304  5.192   12.771  1.00 40.42 ? 491 GLU A CD  1 
ATOM   3328  O OE1 . GLU A 1 453 ? -5.624  4.582   11.918  1.00 42.26 ? 491 GLU A OE1 1 
ATOM   3329  O OE2 . GLU A 1 453 ? -7.364  4.736   13.243  1.00 41.21 ? 491 GLU A OE2 1 
ATOM   3330  N N   . GLY A 1 454 ? -4.224  4.158   16.190  1.00 37.96 ? 492 GLY A N   1 
ATOM   3331  C CA  . GLY A 1 454 ? -3.648  2.822   16.078  1.00 38.27 ? 492 GLY A CA  1 
ATOM   3332  C C   . GLY A 1 454 ? -2.402  2.661   16.919  1.00 38.42 ? 492 GLY A C   1 
ATOM   3333  O O   . GLY A 1 454 ? -2.081  1.539   17.331  1.00 38.60 ? 492 GLY A O   1 
ATOM   3334  N N   . LEU A 1 455 ? -1.692  3.769   17.151  1.00 38.66 ? 493 LEU A N   1 
ATOM   3335  C CA  . LEU A 1 455 ? -0.672  3.838   18.196  1.00 38.70 ? 493 LEU A CA  1 
ATOM   3336  C C   . LEU A 1 455 ? -1.329  4.256   19.503  1.00 38.74 ? 493 LEU A C   1 
ATOM   3337  O O   . LEU A 1 455 ? -2.261  5.067   19.500  1.00 38.95 ? 493 LEU A O   1 
ATOM   3338  C CB  . LEU A 1 455 ? 0.415   4.863   17.854  1.00 38.88 ? 493 LEU A CB  1 
ATOM   3339  C CG  . LEU A 1 455 ? 1.460   4.544   16.786  1.00 38.79 ? 493 LEU A CG  1 
ATOM   3340  C CD1 . LEU A 1 455 ? 2.318   5.749   16.584  1.00 38.27 ? 493 LEU A CD1 1 
ATOM   3341  C CD2 . LEU A 1 455 ? 2.311   3.352   17.184  1.00 39.04 ? 493 LEU A CD2 1 
ATOM   3342  N N   . THR A 1 456 ? -0.836  3.706   20.612  1.00 38.68 ? 494 THR A N   1 
ATOM   3343  C CA  . THR A 1 456 ? -1.180  4.198   21.949  1.00 38.72 ? 494 THR A CA  1 
ATOM   3344  C C   . THR A 1 456 ? -0.095  5.183   22.458  1.00 38.56 ? 494 THR A C   1 
ATOM   3345  O O   . THR A 1 456 ? 0.850   5.511   21.738  1.00 37.89 ? 494 THR A O   1 
ATOM   3346  C CB  . THR A 1 456 ? -1.429  3.017   22.953  1.00 39.14 ? 494 THR A CB  1 
ATOM   3347  O OG1 . THR A 1 456 ? -0.214  2.286   23.195  1.00 40.11 ? 494 THR A OG1 1 
ATOM   3348  C CG2 . THR A 1 456 ? -2.513  2.060   22.418  1.00 37.88 ? 494 THR A CG2 1 
ATOM   3349  N N   . VAL A 1 457 ? -0.257  5.663   23.689  1.00 38.56 ? 495 VAL A N   1 
ATOM   3350  C CA  . VAL A 1 457 ? 0.691   6.591   24.311  1.00 38.61 ? 495 VAL A CA  1 
ATOM   3351  C C   . VAL A 1 457 ? 2.025   5.918   24.692  1.00 38.64 ? 495 VAL A C   1 
ATOM   3352  O O   . VAL A 1 457 ? 3.060   6.570   24.732  1.00 38.95 ? 495 VAL A O   1 
ATOM   3353  C CB  . VAL A 1 457 ? 0.053   7.264   25.567  1.00 38.62 ? 495 VAL A CB  1 
ATOM   3354  C CG1 . VAL A 1 457 ? 1.036   8.225   26.260  1.00 39.46 ? 495 VAL A CG1 1 
ATOM   3355  C CG2 . VAL A 1 457 ? -1.242  7.997   25.185  1.00 38.31 ? 495 VAL A CG2 1 
ATOM   3356  N N   . ASP A 1 458 ? 2.007   4.625   24.980  1.00 39.07 ? 496 ASP A N   1 
ATOM   3357  C CA  . ASP A 1 458 ? 3.244   3.885   25.283  1.00 39.34 ? 496 ASP A CA  1 
ATOM   3358  C C   . ASP A 1 458 ? 4.122   3.654   24.049  1.00 39.42 ? 496 ASP A C   1 
ATOM   3359  O O   . ASP A 1 458 ? 5.329   3.413   24.174  1.00 39.60 ? 496 ASP A O   1 
ATOM   3360  C CB  . ASP A 1 458 ? 2.938   2.540   25.956  1.00 39.41 ? 496 ASP A CB  1 
ATOM   3361  C CG  . ASP A 1 458 ? 3.397   2.492   27.409  1.00 40.11 ? 496 ASP A CG  1 
ATOM   3362  O OD1 . ASP A 1 458 ? 4.491   3.017   27.730  1.00 40.31 ? 496 ASP A OD1 1 
ATOM   3363  O OD2 . ASP A 1 458 ? 2.667   1.910   28.233  1.00 40.73 ? 496 ASP A OD2 1 
ATOM   3364  N N   . ASP A 1 459 ? 3.510   3.718   22.868  1.00 39.30 ? 497 ASP A N   1 
ATOM   3365  C CA  . ASP A 1 459 ? 4.237   3.584   21.606  1.00 38.89 ? 497 ASP A CA  1 
ATOM   3366  C C   . ASP A 1 459 ? 5.070   4.831   21.368  1.00 38.82 ? 497 ASP A C   1 
ATOM   3367  O O   . ASP A 1 459 ? 6.243   4.739   20.995  1.00 38.66 ? 497 ASP A O   1 
ATOM   3368  C CB  . ASP A 1 459 ? 3.266   3.346   20.443  1.00 38.72 ? 497 ASP A CB  1 
ATOM   3369  C CG  . ASP A 1 459 ? 2.516   2.020   20.565  1.00 38.20 ? 497 ASP A CG  1 
ATOM   3370  O OD1 . ASP A 1 459 ? 3.149   1.011   20.960  1.00 36.14 ? 497 ASP A OD1 1 
ATOM   3371  O OD2 . ASP A 1 459 ? 1.302   1.990   20.259  1.00 36.80 ? 497 ASP A OD2 1 
ATOM   3372  N N   . VAL A 1 460 ? 4.449   5.987   21.608  1.00 38.89 ? 498 VAL A N   1 
ATOM   3373  C CA  . VAL A 1 460 ? 5.132   7.276   21.568  1.00 38.81 ? 498 VAL A CA  1 
ATOM   3374  C C   . VAL A 1 460 ? 6.216   7.401   22.668  1.00 38.70 ? 498 VAL A C   1 
ATOM   3375  O O   . VAL A 1 460 ? 7.313   7.879   22.381  1.00 39.12 ? 498 VAL A O   1 
ATOM   3376  C CB  . VAL A 1 460 ? 4.121   8.464   21.648  1.00 38.94 ? 498 VAL A CB  1 
ATOM   3377  C CG1 . VAL A 1 460 ? 4.860   9.823   21.706  1.00 37.63 ? 498 VAL A CG1 1 
ATOM   3378  C CG2 . VAL A 1 460 ? 3.191   8.430   20.468  1.00 38.52 ? 498 VAL A CG2 1 
ATOM   3379  N N   . GLN A 1 461 ? 5.921   6.971   23.899  1.00 38.40 ? 499 GLN A N   1 
ATOM   3380  C CA  . GLN A 1 461 ? 6.894   7.061   25.013  1.00 38.06 ? 499 GLN A CA  1 
ATOM   3381  C C   . GLN A 1 461 ? 8.140   6.202   24.780  1.00 38.02 ? 499 GLN A C   1 
ATOM   3382  O O   . GLN A 1 461 ? 9.255   6.658   25.040  1.00 37.79 ? 499 GLN A O   1 
ATOM   3383  C CB  . GLN A 1 461 ? 6.260   6.694   26.359  1.00 38.10 ? 499 GLN A CB  1 
ATOM   3384  C CG  . GLN A 1 461 ? 7.121   7.052   27.567  1.00 37.47 ? 499 GLN A CG  1 
ATOM   3385  N N   . LYS A 1 462 ? 7.948   4.980   24.274  1.00 37.88 ? 500 LYS A N   1 
ATOM   3386  C CA  . LYS A 1 462 ? 9.069   4.097   23.895  1.00 37.82 ? 500 LYS A CA  1 
ATOM   3387  C C   . LYS A 1 462 ? 9.865   4.575   22.663  1.00 37.73 ? 500 LYS A C   1 
ATOM   3388  O O   . LYS A 1 462 ? 10.879  3.981   22.307  1.00 37.95 ? 500 LYS A O   1 
ATOM   3389  C CB  . LYS A 1 462 ? 8.572   2.657   23.669  1.00 37.80 ? 500 LYS A CB  1 
ATOM   3390  N N   . SER A 1 463 ? 9.408   5.637   22.010  1.00 37.91 ? 501 SER A N   1 
ATOM   3391  C CA  . SER A 1 463 ? 10.120  6.229   20.875  1.00 37.76 ? 501 SER A CA  1 
ATOM   3392  C C   . SER A 1 463 ? 10.655  7.643   21.155  1.00 37.75 ? 501 SER A C   1 
ATOM   3393  O O   . SER A 1 463 ? 11.375  8.211   20.324  1.00 37.05 ? 501 SER A O   1 
ATOM   3394  C CB  . SER A 1 463 ? 9.197   6.270   19.658  1.00 37.90 ? 501 SER A CB  1 
ATOM   3395  O OG  . SER A 1 463 ? 9.126   4.999   19.061  1.00 37.74 ? 501 SER A OG  1 
ATOM   3396  N N   . THR A 1 464 ? 10.301  8.184   22.323  1.00 37.58 ? 502 THR A N   1 
ATOM   3397  C CA  . THR A 1 464 ? 10.611  9.556   22.715  1.00 37.56 ? 502 THR A CA  1 
ATOM   3398  C C   . THR A 1 464 ? 11.530  9.478   23.921  1.00 37.43 ? 502 THR A C   1 
ATOM   3399  O O   . THR A 1 464 ? 11.225  8.768   24.856  1.00 36.96 ? 502 THR A O   1 
ATOM   3400  C CB  . THR A 1 464 ? 9.322   10.313  23.133  1.00 37.65 ? 502 THR A CB  1 
ATOM   3401  O OG1 . THR A 1 464 ? 8.380   10.334  22.047  1.00 38.44 ? 502 THR A OG1 1 
ATOM   3402  C CG2 . THR A 1 464 ? 9.631   11.727  23.557  1.00 36.46 ? 502 THR A CG2 1 
ATOM   3403  N N   . GLY A 1 465 ? 12.625  10.237  23.914  1.00 37.51 ? 503 GLY A N   1 
ATOM   3404  C CA  . GLY A 1 465 ? 13.649  10.167  24.967  1.00 37.53 ? 503 GLY A CA  1 
ATOM   3405  C C   . GLY A 1 465 ? 13.446  11.003  26.226  1.00 37.66 ? 503 GLY A C   1 
ATOM   3406  O O   . GLY A 1 465 ? 14.401  11.257  26.940  1.00 38.25 ? 503 GLY A O   1 
ATOM   3407  N N   . CYS A 1 466 ? 12.217  11.429  26.502  1.00 37.80 ? 504 CYS A N   1 
ATOM   3408  C CA  . CYS A 1 466 ? 11.871  12.191  27.713  1.00 38.00 ? 504 CYS A CA  1 
ATOM   3409  C C   . CYS A 1 466 ? 10.385  11.991  28.024  1.00 38.09 ? 504 CYS A C   1 
ATOM   3410  O O   . CYS A 1 466 ? 9.653   11.437  27.204  1.00 38.06 ? 504 CYS A O   1 
ATOM   3411  C CB  . CYS A 1 466 ? 12.132  13.685  27.519  1.00 37.93 ? 504 CYS A CB  1 
ATOM   3412  S SG  . CYS A 1 466 ? 11.186  14.403  26.134  1.00 39.08 ? 504 CYS A SG  1 
ATOM   3413  N N   . ASP A 1 467 ? 9.939   12.456  29.192  1.00 38.01 ? 505 ASP A N   1 
ATOM   3414  C CA  . ASP A 1 467 ? 8.513   12.401  29.538  1.00 38.20 ? 505 ASP A CA  1 
ATOM   3415  C C   . ASP A 1 467 ? 7.777   13.619  28.970  1.00 37.63 ? 505 ASP A C   1 
ATOM   3416  O O   . ASP A 1 467 ? 8.392   14.560  28.435  1.00 38.02 ? 505 ASP A O   1 
ATOM   3417  C CB  . ASP A 1 467 ? 8.280   12.220  31.062  1.00 38.54 ? 505 ASP A CB  1 
ATOM   3418  C CG  . ASP A 1 467 ? 8.828   13.377  31.903  1.00 39.98 ? 505 ASP A CG  1 
ATOM   3419  O OD1 . ASP A 1 467 ? 8.945   14.514  31.388  1.00 43.75 ? 505 ASP A OD1 1 
ATOM   3420  O OD2 . ASP A 1 467 ? 9.140   13.147  33.090  1.00 41.07 ? 505 ASP A OD2 1 
ATOM   3421  N N   . PHE A 1 468 ? 6.455   13.566  29.060  1.00 36.88 ? 506 PHE A N   1 
ATOM   3422  C CA  . PHE A 1 468 ? 5.582   14.558  28.441  1.00 36.30 ? 506 PHE A CA  1 
ATOM   3423  C C   . PHE A 1 468 ? 4.164   14.472  29.029  1.00 36.12 ? 506 PHE A C   1 
ATOM   3424  O O   . PHE A 1 468 ? 3.715   13.401  29.453  1.00 35.47 ? 506 PHE A O   1 
ATOM   3425  C CB  . PHE A 1 468 ? 5.539   14.341  26.923  1.00 36.10 ? 506 PHE A CB  1 
ATOM   3426  C CG  . PHE A 1 468 ? 5.211   12.919  26.505  1.00 35.69 ? 506 PHE A CG  1 
ATOM   3427  C CD1 . PHE A 1 468 ? 3.892   12.472  26.456  1.00 34.81 ? 506 PHE A CD1 1 
ATOM   3428  C CD2 . PHE A 1 468 ? 6.227   12.044  26.131  1.00 34.31 ? 506 PHE A CD2 1 
ATOM   3429  C CE1 . PHE A 1 468 ? 3.589   11.170  26.055  1.00 34.48 ? 506 PHE A CE1 1 
ATOM   3430  C CE2 . PHE A 1 468 ? 5.949   10.760  25.728  1.00 34.80 ? 506 PHE A CE2 1 
ATOM   3431  C CZ  . PHE A 1 468 ? 4.614   10.309  25.688  1.00 34.86 ? 506 PHE A CZ  1 
ATOM   3432  N N   . ALA A 1 469 ? 3.463   15.599  29.080  1.00 35.87 ? 507 ALA A N   1 
ATOM   3433  C CA  . ALA A 1 469 ? 2.069   15.570  29.509  1.00 35.49 ? 507 ALA A CA  1 
ATOM   3434  C C   . ALA A 1 469 ? 1.238   15.003  28.360  1.00 35.53 ? 507 ALA A C   1 
ATOM   3435  O O   . ALA A 1 469 ? 1.659   15.033  27.199  1.00 34.89 ? 507 ALA A O   1 
ATOM   3436  C CB  . ALA A 1 469 ? 1.584   16.966  29.908  1.00 35.37 ? 507 ALA A CB  1 
ATOM   3437  N N   . VAL A 1 470 ? 0.078   14.445  28.694  1.00 35.87 ? 508 VAL A N   1 
ATOM   3438  C CA  . VAL A 1 470 ? -0.895  14.001  27.689  1.00 36.11 ? 508 VAL A CA  1 
ATOM   3439  C C   . VAL A 1 470 ? -2.146  14.864  27.814  1.00 35.92 ? 508 VAL A C   1 
ATOM   3440  O O   . VAL A 1 470 ? -2.815  14.829  28.850  1.00 35.44 ? 508 VAL A O   1 
ATOM   3441  C CB  . VAL A 1 470 ? -1.309  12.510  27.875  1.00 36.28 ? 508 VAL A CB  1 
ATOM   3442  C CG1 . VAL A 1 470 ? -1.804  11.944  26.540  1.00 36.74 ? 508 VAL A CG1 1 
ATOM   3443  C CG2 . VAL A 1 470 ? -0.153  11.677  28.427  1.00 36.00 ? 508 VAL A CG2 1 
ATOM   3444  N N   . SER A 1 471 ? -2.457  15.628  26.768  1.00 35.70 ? 509 SER A N   1 
ATOM   3445  C CA  . SER A 1 471 ? -3.635  16.495  26.765  1.00 35.92 ? 509 SER A CA  1 
ATOM   3446  C C   . SER A 1 471 ? -4.925  15.727  27.126  1.00 36.10 ? 509 SER A C   1 
ATOM   3447  O O   . SER A 1 471 ? -5.149  14.620  26.625  1.00 35.75 ? 509 SER A O   1 
ATOM   3448  C CB  . SER A 1 471 ? -3.804  17.142  25.394  1.00 36.16 ? 509 SER A CB  1 
ATOM   3449  O OG  . SER A 1 471 ? -4.852  18.093  25.398  1.00 36.23 ? 509 SER A OG  1 
ATOM   3450  N N   . PRO A 1 472 ? -5.775  16.305  28.001  1.00 36.31 ? 510 PRO A N   1 
ATOM   3451  C CA  . PRO A 1 472 ? -7.067  15.653  28.244  1.00 36.69 ? 510 PRO A CA  1 
ATOM   3452  C C   . PRO A 1 472 ? -7.926  15.613  26.972  1.00 37.12 ? 510 PRO A C   1 
ATOM   3453  O O   . PRO A 1 472 ? -8.656  14.652  26.747  1.00 37.19 ? 510 PRO A O   1 
ATOM   3454  C CB  . PRO A 1 472 ? -7.704  16.521  29.332  1.00 36.69 ? 510 PRO A CB  1 
ATOM   3455  C CG  . PRO A 1 472 ? -7.041  17.838  29.222  1.00 36.21 ? 510 PRO A CG  1 
ATOM   3456  C CD  . PRO A 1 472 ? -5.633  17.547  28.783  1.00 36.30 ? 510 PRO A CD  1 
ATOM   3457  N N   . LYS A 1 473 ? -7.786  16.626  26.120  1.00 38.03 ? 511 LYS A N   1 
ATOM   3458  C CA  . LYS A 1 473 ? -8.426  16.628  24.803  1.00 38.09 ? 511 LYS A CA  1 
ATOM   3459  C C   . LYS A 1 473 ? -7.530  16.007  23.717  1.00 38.08 ? 511 LYS A C   1 
ATOM   3460  O O   . LYS A 1 473 ? -7.585  16.428  22.560  1.00 38.59 ? 511 LYS A O   1 
ATOM   3461  C CB  . LYS A 1 473 ? -8.875  18.049  24.443  1.00 37.99 ? 511 LYS A CB  1 
ATOM   3462  C CG  . LYS A 1 473 ? -10.040 18.535  25.319  1.00 38.05 ? 511 LYS A CG  1 
ATOM   3463  N N   . LEU A 1 474 ? -6.730  15.000  24.094  1.00 38.14 ? 512 LEU A N   1 
ATOM   3464  C CA  . LEU A 1 474 ? -5.922  14.211  23.151  1.00 38.46 ? 512 LEU A CA  1 
ATOM   3465  C C   . LEU A 1 474 ? -6.822  13.624  22.085  1.00 39.10 ? 512 LEU A C   1 
ATOM   3466  O O   . LEU A 1 474 ? -7.873  13.084  22.403  1.00 39.69 ? 512 LEU A O   1 
ATOM   3467  C CB  . LEU A 1 474 ? -5.192  13.067  23.870  1.00 38.36 ? 512 LEU A CB  1 
ATOM   3468  C CG  . LEU A 1 474 ? -4.359  12.088  23.028  1.00 38.23 ? 512 LEU A CG  1 
ATOM   3469  C CD1 . LEU A 1 474 ? -3.030  12.692  22.607  1.00 36.42 ? 512 LEU A CD1 1 
ATOM   3470  C CD2 . LEU A 1 474 ? -4.138  10.794  23.801  1.00 37.89 ? 512 LEU A CD2 1 
ATOM   3471  N N   . MET A 1 475 ? -6.420  13.739  20.824  1.00 39.68 ? 513 MET A N   1 
ATOM   3472  C CA  . MET A 1 475 ? -7.228  13.250  19.708  1.00 40.37 ? 513 MET A CA  1 
ATOM   3473  C C   . MET A 1 475 ? -6.334  12.489  18.733  1.00 40.30 ? 513 MET A C   1 
ATOM   3474  O O   . MET A 1 475 ? -5.110  12.545  18.838  1.00 39.89 ? 513 MET A O   1 
ATOM   3475  C CB  . MET A 1 475 ? -7.974  14.410  19.006  1.00 40.27 ? 513 MET A CB  1 
ATOM   3476  C CG  . MET A 1 475 ? -7.158  15.694  18.789  1.00 40.96 ? 513 MET A CG  1 
ATOM   3477  S SD  . MET A 1 475 ? -7.998  17.008  17.813  1.00 42.09 ? 513 MET A SD  1 
ATOM   3478  C CE  . MET A 1 475 ? -6.753  18.310  17.773  1.00 40.37 ? 513 MET A CE  1 
ATOM   3479  N N   . PRO A 1 476 ? -6.940  11.720  17.812  1.00 40.52 ? 514 PRO A N   1 
ATOM   3480  C CA  . PRO A 1 476 ? -6.121  11.156  16.737  1.00 40.38 ? 514 PRO A CA  1 
ATOM   3481  C C   . PRO A 1 476 ? -5.531  12.253  15.840  1.00 40.15 ? 514 PRO A C   1 
ATOM   3482  O O   . PRO A 1 476 ? -6.152  13.301  15.646  1.00 39.88 ? 514 PRO A O   1 
ATOM   3483  C CB  . PRO A 1 476 ? -7.103  10.247  15.980  1.00 40.52 ? 514 PRO A CB  1 
ATOM   3484  C CG  . PRO A 1 476 ? -8.448  10.772  16.315  1.00 40.40 ? 514 PRO A CG  1 
ATOM   3485  C CD  . PRO A 1 476 ? -8.348  11.295  17.713  1.00 40.42 ? 514 PRO A CD  1 
ATOM   3486  N N   . MET A 1 477 ? -4.322  12.013  15.339  1.00 39.97 ? 515 MET A N   1 
ATOM   3487  C CA  . MET A 1 477 ? -3.580  12.989  14.541  1.00 39.79 ? 515 MET A CA  1 
ATOM   3488  C C   . MET A 1 477 ? -4.309  13.347  13.252  1.00 39.42 ? 515 MET A C   1 
ATOM   3489  O O   . MET A 1 477 ? -4.688  12.478  12.480  1.00 39.38 ? 515 MET A O   1 
ATOM   3490  C CB  . MET A 1 477 ? -2.196  12.443  14.209  1.00 39.54 ? 515 MET A CB  1 
ATOM   3491  C CG  . MET A 1 477 ? -1.301  13.393  13.456  1.00 40.44 ? 515 MET A CG  1 
ATOM   3492  S SD  . MET A 1 477 ? 0.329   12.678  13.228  1.00 40.46 ? 515 MET A SD  1 
ATOM   3493  C CE  . MET A 1 477 ? 0.584   12.996  11.495  1.00 39.37 ? 515 MET A CE  1 
ATOM   3494  N N   . GLN A 1 478 ? -4.460  14.645  13.023  1.00 39.45 ? 516 GLN A N   1 
ATOM   3495  C CA  . GLN A 1 478 ? -5.216  15.180  11.886  1.00 39.22 ? 516 GLN A CA  1 
ATOM   3496  C C   . GLN A 1 478 ? -4.472  15.062  10.548  1.00 38.80 ? 516 GLN A C   1 
ATOM   3497  O O   . GLN A 1 478 ? -3.251  15.067  10.504  1.00 38.99 ? 516 GLN A O   1 
ATOM   3498  C CB  . GLN A 1 478 ? -5.558  16.652  12.144  1.00 39.25 ? 516 GLN A CB  1 
ATOM   3499  C CG  . GLN A 1 478 ? -6.291  16.934  13.459  1.00 38.88 ? 516 GLN A CG  1 
ATOM   3500  C CD  . GLN A 1 478 ? -6.741  18.385  13.545  1.00 39.23 ? 516 GLN A CD  1 
ATOM   3501  O OE1 . GLN A 1 478 ? -7.869  18.707  13.163  1.00 39.06 ? 516 GLN A OE1 1 
ATOM   3502  N NE2 . GLN A 1 478 ? -5.851  19.273  14.010  1.00 36.01 ? 516 GLN A NE2 1 
ATOM   3503  N N   . GLN A 1 479 ? -5.235  14.947  9.466   1.00 38.64 ? 517 GLN A N   1 
ATOM   3504  C CA  . GLN A 1 479 ? -4.700  14.826  8.106   1.00 38.39 ? 517 GLN A CA  1 
ATOM   3505  C C   . GLN A 1 479 ? -5.558  15.668  7.180   1.00 38.39 ? 517 GLN A C   1 
ATOM   3506  O O   . GLN A 1 479 ? -6.776  15.516  7.160   1.00 37.70 ? 517 GLN A O   1 
ATOM   3507  C CB  . GLN A 1 479 ? -4.746  13.371  7.629   1.00 38.22 ? 517 GLN A CB  1 
ATOM   3508  C CG  . GLN A 1 479 ? -3.901  12.392  8.448   1.00 37.90 ? 517 GLN A CG  1 
ATOM   3509  C CD  . GLN A 1 479 ? -2.443  12.411  8.053   1.00 37.37 ? 517 GLN A CD  1 
ATOM   3510  O OE1 . GLN A 1 479 ? -2.082  11.967  6.964   1.00 36.28 ? 517 GLN A OE1 1 
ATOM   3511  N NE2 . GLN A 1 479 ? -1.594  12.920  8.935   1.00 37.49 ? 517 GLN A NE2 1 
ATOM   3512  N N   . ILE A 1 480 ? -4.928  16.573  6.435   1.00 38.60 ? 518 ILE A N   1 
ATOM   3513  C CA  . ILE A 1 480 ? -5.655  17.457  5.533   1.00 38.98 ? 518 ILE A CA  1 
ATOM   3514  C C   . ILE A 1 480 ? -6.312  16.631  4.428   1.00 39.65 ? 518 ILE A C   1 
ATOM   3515  O O   . ILE A 1 480 ? -5.638  15.876  3.725   1.00 40.14 ? 518 ILE A O   1 
ATOM   3516  C CB  . ILE A 1 480 ? -4.740  18.553  4.929   1.00 38.97 ? 518 ILE A CB  1 
ATOM   3517  C CG1 . ILE A 1 480 ? -5.573  19.577  4.161   1.00 38.35 ? 518 ILE A CG1 1 
ATOM   3518  C CG2 . ILE A 1 480 ? -3.662  17.944  4.036   1.00 39.20 ? 518 ILE A CG2 1 
ATOM   3519  C CD1 . ILE A 1 480 ? -4.874  20.898  3.960   1.00 37.49 ? 518 ILE A CD1 1 
ATOM   3520  N N   . ALA A 1 481 ? -7.634  16.744  4.307   1.00 39.78 ? 519 ALA A N   1 
ATOM   3521  C CA  . ALA A 1 481 ? -8.347  16.052  3.253   1.00 40.10 ? 519 ALA A CA  1 
ATOM   3522  C C   . ALA A 1 481 ? -8.253  16.877  1.988   1.00 40.08 ? 519 ALA A C   1 
ATOM   3523  O O   . ALA A 1 481 ? -8.882  16.525  0.995   1.00 41.22 ? 519 ALA A O   1 
ATOM   3524  C CB  . ALA A 1 481 ? -9.817  15.799  3.638   1.00 39.77 ? 519 ALA A CB  1 
ATOM   3525  N N   . THR B 1 2   ? -3.748  42.264  4.952   1.00 44.42 ? 40  THR B N   1 
ATOM   3526  C CA  . THR B 1 2   ? -4.062  43.671  4.587   1.00 43.90 ? 40  THR B CA  1 
ATOM   3527  C C   . THR B 1 2   ? -5.567  43.857  4.566   1.00 43.33 ? 40  THR B C   1 
ATOM   3528  O O   . THR B 1 2   ? -6.258  43.410  3.648   1.00 43.69 ? 40  THR B O   1 
ATOM   3529  C CB  . THR B 1 2   ? -3.475  44.062  3.219   1.00 43.96 ? 40  THR B CB  1 
ATOM   3530  O OG1 . THR B 1 2   ? -2.048  43.876  3.226   1.00 44.47 ? 40  THR B OG1 1 
ATOM   3531  C CG2 . THR B 1 2   ? -3.807  45.524  2.892   1.00 43.84 ? 40  THR B CG2 1 
ATOM   3532  N N   . LYS B 1 3   ? -6.067  44.521  5.594   1.00 42.50 ? 41  LYS B N   1 
ATOM   3533  C CA  . LYS B 1 3   ? -7.461  44.896  5.678   1.00 41.44 ? 41  LYS B CA  1 
ATOM   3534  C C   . LYS B 1 3   ? -7.620  46.267  5.035   1.00 40.79 ? 41  LYS B C   1 
ATOM   3535  O O   . LYS B 1 3   ? -6.852  47.203  5.322   1.00 40.16 ? 41  LYS B O   1 
ATOM   3536  C CB  . LYS B 1 3   ? -7.919  44.938  7.139   1.00 41.58 ? 41  LYS B CB  1 
ATOM   3537  N N   . PHE B 1 4   ? -8.609  46.365  4.151   1.00 40.12 ? 42  PHE B N   1 
ATOM   3538  C CA  . PHE B 1 4   ? -8.957  47.599  3.477   1.00 39.76 ? 42  PHE B CA  1 
ATOM   3539  C C   . PHE B 1 4   ? -10.154 48.209  4.196   1.00 39.20 ? 42  PHE B C   1 
ATOM   3540  O O   . PHE B 1 4   ? -11.114 47.503  4.516   1.00 38.28 ? 42  PHE B O   1 
ATOM   3541  C CB  . PHE B 1 4   ? -9.312  47.326  2.009   1.00 40.30 ? 42  PHE B CB  1 
ATOM   3542  C CG  . PHE B 1 4   ? -8.134  46.988  1.167   1.00 41.42 ? 42  PHE B CG  1 
ATOM   3543  C CD1 . PHE B 1 4   ? -7.563  45.721  1.238   1.00 42.20 ? 42  PHE B CD1 1 
ATOM   3544  C CD2 . PHE B 1 4   ? -7.568  47.944  0.318   1.00 42.62 ? 42  PHE B CD2 1 
ATOM   3545  C CE1 . PHE B 1 4   ? -6.440  45.399  0.479   1.00 42.30 ? 42  PHE B CE1 1 
ATOM   3546  C CE2 . PHE B 1 4   ? -6.433  47.638  -0.462  1.00 43.12 ? 42  PHE B CE2 1 
ATOM   3547  C CZ  . PHE B 1 4   ? -5.868  46.358  -0.377  1.00 42.44 ? 42  PHE B CZ  1 
ATOM   3548  N N   . TYR B 1 5   ? -10.091 49.521  4.423   1.00 38.78 ? 43  TYR B N   1 
ATOM   3549  C CA  . TYR B 1 5   ? -11.131 50.278  5.138   1.00 38.48 ? 43  TYR B CA  1 
ATOM   3550  C C   . TYR B 1 5   ? -11.636 51.426  4.265   1.00 38.47 ? 43  TYR B C   1 
ATOM   3551  O O   . TYR B 1 5   ? -10.850 52.052  3.567   1.00 37.67 ? 43  TYR B O   1 
ATOM   3552  C CB  . TYR B 1 5   ? -10.550 50.869  6.430   1.00 37.94 ? 43  TYR B CB  1 
ATOM   3553  C CG  . TYR B 1 5   ? -10.200 49.867  7.504   1.00 37.29 ? 43  TYR B CG  1 
ATOM   3554  C CD1 . TYR B 1 5   ? -8.981  49.201  7.485   1.00 36.56 ? 43  TYR B CD1 1 
ATOM   3555  C CD2 . TYR B 1 5   ? -11.085 49.607  8.560   1.00 37.69 ? 43  TYR B CD2 1 
ATOM   3556  C CE1 . TYR B 1 5   ? -8.658  48.295  8.472   1.00 37.20 ? 43  TYR B CE1 1 
ATOM   3557  C CE2 . TYR B 1 5   ? -10.776 48.697  9.549   1.00 37.59 ? 43  TYR B CE2 1 
ATOM   3558  C CZ  . TYR B 1 5   ? -9.552  48.053  9.504   1.00 37.67 ? 43  TYR B CZ  1 
ATOM   3559  O OH  . TYR B 1 5   ? -9.241  47.149  10.474  1.00 37.27 ? 43  TYR B OH  1 
ATOM   3560  N N   . THR B 1 6   ? -12.941 51.713  4.309   1.00 39.07 ? 44  THR B N   1 
ATOM   3561  C CA  . THR B 1 6   ? -13.453 52.921  3.654   1.00 39.38 ? 44  THR B CA  1 
ATOM   3562  C C   . THR B 1 6   ? -13.658 54.096  4.631   1.00 39.60 ? 44  THR B C   1 
ATOM   3563  O O   . THR B 1 6   ? -13.879 55.216  4.181   1.00 39.91 ? 44  THR B O   1 
ATOM   3564  C CB  . THR B 1 6   ? -14.740 52.664  2.829   1.00 39.54 ? 44  THR B CB  1 
ATOM   3565  O OG1 . THR B 1 6   ? -15.407 51.486  3.302   1.00 40.10 ? 44  THR B OG1 1 
ATOM   3566  C CG2 . THR B 1 6   ? -14.408 52.506  1.342   1.00 39.42 ? 44  THR B CG2 1 
ATOM   3567  N N   . ASP B 1 7   ? -13.580 53.855  5.943   1.00 39.66 ? 45  ASP B N   1 
ATOM   3568  C CA  . ASP B 1 7   ? -13.629 54.938  6.935   1.00 39.63 ? 45  ASP B CA  1 
ATOM   3569  C C   . ASP B 1 7   ? -12.256 55.058  7.592   1.00 39.33 ? 45  ASP B C   1 
ATOM   3570  O O   . ASP B 1 7   ? -11.805 54.088  8.207   1.00 39.22 ? 45  ASP B O   1 
ATOM   3571  C CB  . ASP B 1 7   ? -14.685 54.637  8.002   1.00 40.01 ? 45  ASP B CB  1 
ATOM   3572  C CG  . ASP B 1 7   ? -15.120 55.884  8.800   1.00 40.66 ? 45  ASP B CG  1 
ATOM   3573  O OD1 . ASP B 1 7   ? -14.335 56.861  8.942   1.00 41.86 ? 45  ASP B OD1 1 
ATOM   3574  O OD2 . ASP B 1 7   ? -16.262 55.869  9.309   1.00 39.09 ? 45  ASP B OD2 1 
ATOM   3575  N N   . PRO B 1 8   ? -11.579 56.227  7.432   1.00 39.08 ? 46  PRO B N   1 
ATOM   3576  C CA  . PRO B 1 8   ? -10.329 56.610  8.137   1.00 38.98 ? 46  PRO B CA  1 
ATOM   3577  C C   . PRO B 1 8   ? -10.435 56.600  9.655   1.00 38.66 ? 46  PRO B C   1 
ATOM   3578  O O   . PRO B 1 8   ? -9.438  56.430  10.336  1.00 38.41 ? 46  PRO B O   1 
ATOM   3579  C CB  . PRO B 1 8   ? -10.059 58.042  7.647   1.00 38.92 ? 46  PRO B CB  1 
ATOM   3580  C CG  . PRO B 1 8   ? -10.748 58.134  6.350   1.00 38.97 ? 46  PRO B CG  1 
ATOM   3581  C CD  . PRO B 1 8   ? -11.966 57.258  6.449   1.00 39.17 ? 46  PRO B CD  1 
ATOM   3582  N N   . VAL B 1 9   ? -11.639 56.809  10.175  1.00 38.41 ? 47  VAL B N   1 
ATOM   3583  C CA  . VAL B 1 9   ? -11.873 56.671  11.604  1.00 38.00 ? 47  VAL B CA  1 
ATOM   3584  C C   . VAL B 1 9   ? -11.900 55.173  11.993  1.00 37.72 ? 47  VAL B C   1 
ATOM   3585  O O   . VAL B 1 9   ? -11.367 54.810  13.043  1.00 37.44 ? 47  VAL B O   1 
ATOM   3586  C CB  . VAL B 1 9   ? -13.167 57.403  12.046  1.00 37.81 ? 47  VAL B CB  1 
ATOM   3587  C CG1 . VAL B 1 9   ? -13.266 57.442  13.559  1.00 38.15 ? 47  VAL B CG1 1 
ATOM   3588  C CG2 . VAL B 1 9   ? -13.205 58.827  11.489  1.00 37.27 ? 47  VAL B CG2 1 
ATOM   3589  N N   . GLU B 1 10  ? -12.504 54.312  11.158  1.00 37.13 ? 48  GLU B N   1 
ATOM   3590  C CA  . GLU B 1 10  ? -12.505 52.858  11.419  1.00 36.71 ? 48  GLU B CA  1 
ATOM   3591  C C   . GLU B 1 10  ? -11.094 52.249  11.344  1.00 36.73 ? 48  GLU B C   1 
ATOM   3592  O O   . GLU B 1 10  ? -10.786 51.279  12.058  1.00 36.33 ? 48  GLU B O   1 
ATOM   3593  C CB  . GLU B 1 10  ? -13.415 52.117  10.445  1.00 36.66 ? 48  GLU B CB  1 
ATOM   3594  C CG  . GLU B 1 10  ? -13.736 50.686  10.879  1.00 36.76 ? 48  GLU B CG  1 
ATOM   3595  N N   . ALA B 1 11  ? -10.254 52.805  10.465  1.00 36.58 ? 49  ALA B N   1 
ATOM   3596  C CA  . ALA B 1 11  ? -8.841  52.411  10.389  1.00 36.60 ? 49  ALA B CA  1 
ATOM   3597  C C   . ALA B 1 11  ? -8.108  52.639  11.719  1.00 36.54 ? 49  ALA B C   1 
ATOM   3598  O O   . ALA B 1 11  ? -7.288  51.820  12.083  1.00 37.14 ? 49  ALA B O   1 
ATOM   3599  C CB  . ALA B 1 11  ? -8.129  53.132  9.228   1.00 36.26 ? 49  ALA B CB  1 
ATOM   3600  N N   . VAL B 1 12  ? -8.439  53.717  12.447  1.00 37.28 ? 50  VAL B N   1 
ATOM   3601  C CA  . VAL B 1 12  ? -7.752  54.109  13.705  1.00 37.30 ? 50  VAL B CA  1 
ATOM   3602  C C   . VAL B 1 12  ? -8.603  54.135  14.998  1.00 38.07 ? 50  VAL B C   1 
ATOM   3603  O O   . VAL B 1 12  ? -8.191  54.733  16.006  1.00 38.22 ? 50  VAL B O   1 
ATOM   3604  C CB  . VAL B 1 12  ? -7.106  55.522  13.571  1.00 37.46 ? 50  VAL B CB  1 
ATOM   3605  C CG1 . VAL B 1 12  ? -5.942  55.516  12.546  1.00 36.04 ? 50  VAL B CG1 1 
ATOM   3606  C CG2 . VAL B 1 12  ? -8.165  56.552  13.213  1.00 36.02 ? 50  VAL B CG2 1 
ATOM   3607  N N   . LYS B 1 13  ? -9.760  53.485  15.018  1.00 38.79 ? 51  LYS B N   1 
ATOM   3608  C CA  . LYS B 1 13  ? -10.651 53.586  16.200  1.00 39.20 ? 51  LYS B CA  1 
ATOM   3609  C C   . LYS B 1 13  ? -9.959  53.057  17.490  1.00 39.80 ? 51  LYS B C   1 
ATOM   3610  O O   . LYS B 1 13  ? -10.135 53.609  18.585  1.00 39.70 ? 51  LYS B O   1 
ATOM   3611  C CB  . LYS B 1 13  ? -11.987 52.867  15.941  1.00 38.79 ? 51  LYS B CB  1 
ATOM   3612  N N   . ASP B 1 14  ? -9.127  52.027  17.338  1.00 40.17 ? 52  ASP B N   1 
ATOM   3613  C CA  . ASP B 1 14  ? -8.603  51.257  18.492  1.00 40.67 ? 52  ASP B CA  1 
ATOM   3614  C C   . ASP B 1 14  ? -7.252  51.716  19.083  1.00 40.51 ? 52  ASP B C   1 
ATOM   3615  O O   . ASP B 1 14  ? -6.708  51.048  19.972  1.00 40.54 ? 52  ASP B O   1 
ATOM   3616  C CB  . ASP B 1 14  ? -8.521  49.772  18.127  1.00 40.55 ? 52  ASP B CB  1 
ATOM   3617  C CG  . ASP B 1 14  ? -7.841  49.540  16.804  1.00 42.49 ? 52  ASP B CG  1 
ATOM   3618  O OD1 . ASP B 1 14  ? -7.816  50.481  15.959  1.00 43.95 ? 52  ASP B OD1 1 
ATOM   3619  O OD2 . ASP B 1 14  ? -7.336  48.413  16.601  1.00 44.83 ? 52  ASP B OD2 1 
ATOM   3620  N N   . ILE B 1 15  ? -6.721  52.845  18.606  1.00 40.21 ? 53  ILE B N   1 
ATOM   3621  C CA  . ILE B 1 15  ? -5.550  53.448  19.240  1.00 40.05 ? 53  ILE B CA  1 
ATOM   3622  C C   . ILE B 1 15  ? -5.918  53.876  20.700  1.00 40.24 ? 53  ILE B C   1 
ATOM   3623  O O   . ILE B 1 15  ? -6.719  54.822  20.907  1.00 40.04 ? 53  ILE B O   1 
ATOM   3624  C CB  . ILE B 1 15  ? -4.973  54.646  18.421  1.00 39.79 ? 53  ILE B CB  1 
ATOM   3625  C CG1 . ILE B 1 15  ? -4.552  54.208  17.019  1.00 39.08 ? 53  ILE B CG1 1 
ATOM   3626  C CG2 . ILE B 1 15  ? -3.783  55.255  19.132  1.00 39.53 ? 53  ILE B CG2 1 
ATOM   3627  C CD1 . ILE B 1 15  ? -3.850  55.290  16.213  1.00 38.81 ? 53  ILE B CD1 1 
ATOM   3628  N N   . PRO B 1 16  ? -5.305  53.208  21.716  1.00 40.35 ? 54  PRO B N   1 
ATOM   3629  C CA  . PRO B 1 16  ? -5.644  53.496  23.093  1.00 40.59 ? 54  PRO B CA  1 
ATOM   3630  C C   . PRO B 1 16  ? -4.911  54.764  23.487  1.00 40.69 ? 54  PRO B C   1 
ATOM   3631  O O   . PRO B 1 16  ? -3.848  55.055  22.909  1.00 41.36 ? 54  PRO B O   1 
ATOM   3632  C CB  . PRO B 1 16  ? -5.069  52.297  23.838  1.00 40.33 ? 54  PRO B CB  1 
ATOM   3633  C CG  . PRO B 1 16  ? -3.843  51.991  23.105  1.00 40.77 ? 54  PRO B CG  1 
ATOM   3634  C CD  . PRO B 1 16  ? -4.182  52.250  21.646  1.00 40.73 ? 54  PRO B CD  1 
ATOM   3635  N N   . ASP B 1 17  ? -5.441  55.519  24.445  1.00 40.21 ? 55  ASP B N   1 
ATOM   3636  C CA  . ASP B 1 17  ? -4.739  56.707  24.898  1.00 39.61 ? 55  ASP B CA  1 
ATOM   3637  C C   . ASP B 1 17  ? -3.342  56.270  25.359  1.00 39.77 ? 55  ASP B C   1 
ATOM   3638  O O   . ASP B 1 17  ? -3.153  55.146  25.858  1.00 39.75 ? 55  ASP B O   1 
ATOM   3639  C CB  . ASP B 1 17  ? -5.514  57.443  26.006  1.00 40.65 ? 55  ASP B CB  1 
ATOM   3640  C CG  . ASP B 1 17  ? -6.704  58.274  25.463  1.00 39.34 ? 55  ASP B CG  1 
ATOM   3641  O OD1 . ASP B 1 17  ? -6.940  58.301  24.241  1.00 37.95 ? 55  ASP B OD1 1 
ATOM   3642  O OD2 . ASP B 1 17  ? -7.389  58.923  26.257  1.00 41.08 ? 55  ASP B OD2 1 
ATOM   3643  N N   . GLY B 1 18  ? -2.354  57.125  25.091  1.00 38.60 ? 56  GLY B N   1 
ATOM   3644  C CA  . GLY B 1 18  ? -1.001  56.909  25.546  1.00 37.33 ? 56  GLY B CA  1 
ATOM   3645  C C   . GLY B 1 18  ? -0.173  56.088  24.599  1.00 36.24 ? 56  GLY B C   1 
ATOM   3646  O O   . GLY B 1 18  ? 0.988   55.885  24.854  1.00 35.88 ? 56  GLY B O   1 
ATOM   3647  N N   . ALA B 1 19  ? -0.769  55.636  23.501  1.00 35.53 ? 57  ALA B N   1 
ATOM   3648  C CA  . ALA B 1 19  ? -0.074  54.830  22.521  1.00 35.20 ? 57  ALA B CA  1 
ATOM   3649  C C   . ALA B 1 19  ? 1.144   55.594  22.073  1.00 34.72 ? 57  ALA B C   1 
ATOM   3650  O O   . ALA B 1 19  ? 1.180   56.825  22.180  1.00 34.70 ? 57  ALA B O   1 
ATOM   3651  C CB  . ALA B 1 19  ? -0.978  54.525  21.328  1.00 34.66 ? 57  ALA B CB  1 
ATOM   3652  N N   . THR B 1 20  ? 2.151   54.848  21.638  1.00 34.53 ? 58  THR B N   1 
ATOM   3653  C CA  . THR B 1 20  ? 3.199   55.373  20.748  1.00 34.47 ? 58  THR B CA  1 
ATOM   3654  C C   . THR B 1 20  ? 2.768   55.208  19.270  1.00 33.84 ? 58  THR B C   1 
ATOM   3655  O O   . THR B 1 20  ? 2.465   54.104  18.805  1.00 33.75 ? 58  THR B O   1 
ATOM   3656  C CB  . THR B 1 20  ? 4.546   54.667  20.991  1.00 34.69 ? 58  THR B CB  1 
ATOM   3657  O OG1 . THR B 1 20  ? 4.873   54.717  22.390  1.00 34.81 ? 58  THR B OG1 1 
ATOM   3658  C CG2 . THR B 1 20  ? 5.644   55.307  20.181  1.00 33.57 ? 58  THR B CG2 1 
ATOM   3659  N N   . VAL B 1 21  ? 2.697   56.323  18.548  1.00 33.83 ? 59  VAL B N   1 
ATOM   3660  C CA  . VAL B 1 21  ? 2.335   56.290  17.133  1.00 33.02 ? 59  VAL B CA  1 
ATOM   3661  C C   . VAL B 1 21  ? 3.485   56.833  16.306  1.00 34.03 ? 59  VAL B C   1 
ATOM   3662  O O   . VAL B 1 21  ? 3.977   57.938  16.559  1.00 34.69 ? 59  VAL B O   1 
ATOM   3663  C CB  . VAL B 1 21  ? 1.034   57.088  16.882  1.00 33.40 ? 59  VAL B CB  1 
ATOM   3664  C CG1 . VAL B 1 21  ? 0.523   56.872  15.480  1.00 30.02 ? 59  VAL B CG1 1 
ATOM   3665  C CG2 . VAL B 1 21  ? -0.015  56.672  17.923  1.00 29.65 ? 59  VAL B CG2 1 
ATOM   3666  N N   . LEU B 1 22  ? 3.933   56.053  15.327  1.00 33.66 ? 60  LEU B N   1 
ATOM   3667  C CA  . LEU B 1 22  ? 4.942   56.542  14.387  1.00 33.71 ? 60  LEU B CA  1 
ATOM   3668  C C   . LEU B 1 22  ? 4.224   57.295  13.283  1.00 33.64 ? 60  LEU B C   1 
ATOM   3669  O O   . LEU B 1 22  ? 3.338   56.740  12.654  1.00 34.16 ? 60  LEU B O   1 
ATOM   3670  C CB  . LEU B 1 22  ? 5.761   55.373  13.796  1.00 33.10 ? 60  LEU B CB  1 
ATOM   3671  C CG  . LEU B 1 22  ? 6.340   54.379  14.794  1.00 32.82 ? 60  LEU B CG  1 
ATOM   3672  C CD1 . LEU B 1 22  ? 7.229   53.395  14.102  1.00 32.24 ? 60  LEU B CD1 1 
ATOM   3673  C CD2 . LEU B 1 22  ? 7.083   55.098  15.912  1.00 31.36 ? 60  LEU B CD2 1 
ATOM   3674  N N   . VAL B 1 23  ? 4.610   58.549  13.044  1.00 34.13 ? 61  VAL B N   1 
ATOM   3675  C CA  . VAL B 1 23  ? 3.981   59.387  11.992  1.00 34.42 ? 61  VAL B CA  1 
ATOM   3676  C C   . VAL B 1 23  ? 4.969   59.721  10.882  1.00 34.51 ? 61  VAL B C   1 
ATOM   3677  O O   . VAL B 1 23  ? 6.003   60.380  11.115  1.00 35.12 ? 61  VAL B O   1 
ATOM   3678  C CB  . VAL B 1 23  ? 3.365   60.685  12.549  1.00 34.16 ? 61  VAL B CB  1 
ATOM   3679  C CG1 . VAL B 1 23  ? 2.423   61.356  11.502  1.00 32.44 ? 61  VAL B CG1 1 
ATOM   3680  C CG2 . VAL B 1 23  ? 2.615   60.391  13.848  1.00 33.97 ? 61  VAL B CG2 1 
ATOM   3681  N N   . GLY B 1 24  ? 4.669   59.217  9.683   1.00 34.26 ? 62  GLY B N   1 
ATOM   3682  C CA  . GLY B 1 24  ? 5.473   59.504  8.494   1.00 33.61 ? 62  GLY B CA  1 
ATOM   3683  C C   . GLY B 1 24  ? 5.460   60.983  8.103   1.00 33.97 ? 62  GLY B C   1 
ATOM   3684  O O   . GLY B 1 24  ? 4.582   61.773  8.517   1.00 34.01 ? 62  GLY B O   1 
ATOM   3685  N N   . GLY B 1 25  ? 6.453   61.360  7.313   1.00 33.88 ? 63  GLY B N   1 
ATOM   3686  C CA  . GLY B 1 25  ? 6.533   62.690  6.787   1.00 34.45 ? 63  GLY B CA  1 
ATOM   3687  C C   . GLY B 1 25  ? 7.820   63.402  7.131   1.00 34.95 ? 63  GLY B C   1 
ATOM   3688  O O   . GLY B 1 25  ? 8.387   63.222  8.222   1.00 34.67 ? 63  GLY B O   1 
ATOM   3689  N N   . PHE B 1 26  ? 8.243   64.238  6.188   1.00 35.09 ? 64  PHE B N   1 
ATOM   3690  C CA  . PHE B 1 26  ? 9.403   65.099  6.337   1.00 35.86 ? 64  PHE B CA  1 
ATOM   3691  C C   . PHE B 1 26  ? 8.894   66.503  5.999   1.00 36.05 ? 64  PHE B C   1 
ATOM   3692  O O   . PHE B 1 26  ? 8.476   66.759  4.859   1.00 35.51 ? 64  PHE B O   1 
ATOM   3693  C CB  . PHE B 1 26  ? 10.538  64.646  5.396   1.00 35.89 ? 64  PHE B CB  1 
ATOM   3694  C CG  . PHE B 1 26  ? 11.776  65.505  5.460   1.00 36.19 ? 64  PHE B CG  1 
ATOM   3695  C CD1 . PHE B 1 26  ? 12.848  65.140  6.268   1.00 37.89 ? 64  PHE B CD1 1 
ATOM   3696  C CD2 . PHE B 1 26  ? 11.866  66.683  4.715   1.00 35.91 ? 64  PHE B CD2 1 
ATOM   3697  C CE1 . PHE B 1 26  ? 14.014  65.943  6.339   1.00 37.48 ? 64  PHE B CE1 1 
ATOM   3698  C CE2 . PHE B 1 26  ? 13.001  67.474  4.777   1.00 37.25 ? 64  PHE B CE2 1 
ATOM   3699  C CZ  . PHE B 1 26  ? 14.089  67.096  5.600   1.00 36.12 ? 64  PHE B CZ  1 
ATOM   3700  N N   . GLY B 1 27  ? 8.894   67.404  6.990   1.00 36.23 ? 65  GLY B N   1 
ATOM   3701  C CA  . GLY B 1 27  ? 8.253   68.688  6.817   1.00 36.30 ? 65  GLY B CA  1 
ATOM   3702  C C   . GLY B 1 27  ? 6.776   68.392  6.582   1.00 36.81 ? 65  GLY B C   1 
ATOM   3703  O O   . GLY B 1 27  ? 6.182   67.560  7.282   1.00 37.78 ? 65  GLY B O   1 
ATOM   3704  N N   . LEU B 1 28  ? 6.184   69.037  5.581   1.00 36.36 ? 66  LEU B N   1 
ATOM   3705  C CA  . LEU B 1 28  ? 4.818   68.711  5.181   1.00 35.87 ? 66  LEU B CA  1 
ATOM   3706  C C   . LEU B 1 28  ? 4.803   67.700  3.999   1.00 35.83 ? 66  LEU B C   1 
ATOM   3707  O O   . LEU B 1 28  ? 3.751   67.416  3.448   1.00 36.38 ? 66  LEU B O   1 
ATOM   3708  C CB  . LEU B 1 28  ? 4.041   69.995  4.861   1.00 35.27 ? 66  LEU B CB  1 
ATOM   3709  C CG  . LEU B 1 28  ? 4.062   71.056  5.981   1.00 34.06 ? 66  LEU B CG  1 
ATOM   3710  C CD1 . LEU B 1 28  ? 3.155   72.218  5.603   1.00 30.53 ? 66  LEU B CD1 1 
ATOM   3711  C CD2 . LEU B 1 28  ? 3.662   70.476  7.379   1.00 30.31 ? 66  LEU B CD2 1 
ATOM   3712  N N   . CYS B 1 29  ? 5.963   67.131  3.658   1.00 35.17 ? 67  CYS B N   1 
ATOM   3713  C CA  . CYS B 1 29  ? 6.120   66.229  2.505   1.00 34.71 ? 67  CYS B CA  1 
ATOM   3714  C C   . CYS B 1 29  ? 5.924   64.740  2.900   1.00 34.25 ? 67  CYS B C   1 
ATOM   3715  O O   . CYS B 1 29  ? 6.722   64.182  3.662   1.00 34.42 ? 67  CYS B O   1 
ATOM   3716  C CB  . CYS B 1 29  ? 7.505   66.460  1.865   1.00 34.69 ? 67  CYS B CB  1 
ATOM   3717  S SG  . CYS B 1 29  ? 7.876   65.424  0.421   1.00 34.64 ? 67  CYS B SG  1 
ATOM   3718  N N   . GLY B 1 30  ? 4.855   64.118  2.408   1.00 33.41 ? 68  GLY B N   1 
ATOM   3719  C CA  . GLY B 1 30  ? 4.467   62.757  2.814   1.00 33.85 ? 68  GLY B CA  1 
ATOM   3720  C C   . GLY B 1 30  ? 3.807   62.616  4.183   1.00 33.32 ? 68  GLY B C   1 
ATOM   3721  O O   . GLY B 1 30  ? 4.103   61.731  4.976   1.00 34.05 ? 68  GLY B O   1 
ATOM   3722  N N   . ILE B 1 31  ? 2.870   63.481  4.422   1.00 33.16 ? 69  ILE B N   1 
ATOM   3723  C CA  . ILE B 1 31  ? 2.126   63.593  5.675   1.00 33.22 ? 69  ILE B CA  1 
ATOM   3724  C C   . ILE B 1 31  ? 0.849   62.748  5.476   1.00 33.24 ? 69  ILE B C   1 
ATOM   3725  O O   . ILE B 1 31  ? 0.195   62.854  4.421   1.00 33.52 ? 69  ILE B O   1 
ATOM   3726  C CB  . ILE B 1 31  ? 1.889   65.124  5.924   1.00 33.01 ? 69  ILE B CB  1 
ATOM   3727  C CG1 . ILE B 1 31  ? 3.233   65.753  6.351   1.00 32.45 ? 69  ILE B CG1 1 
ATOM   3728  C CG2 . ILE B 1 31  ? 0.709   65.460  6.872   1.00 33.28 ? 69  ILE B CG2 1 
ATOM   3729  C CD1 . ILE B 1 31  ? 3.683   65.420  7.643   1.00 28.04 ? 69  ILE B CD1 1 
ATOM   3730  N N   . PRO B 1 32  ? 0.520   61.867  6.442   1.00 32.63 ? 70  PRO B N   1 
ATOM   3731  C CA  . PRO B 1 32  ? -0.755  61.149  6.385   1.00 32.19 ? 70  PRO B CA  1 
ATOM   3732  C C   . PRO B 1 32  ? -1.885  62.018  6.938   1.00 32.27 ? 70  PRO B C   1 
ATOM   3733  O O   . PRO B 1 32  ? -2.362  61.820  8.058   1.00 32.04 ? 70  PRO B O   1 
ATOM   3734  C CB  . PRO B 1 32  ? -0.493  59.919  7.252   1.00 32.13 ? 70  PRO B CB  1 
ATOM   3735  C CG  . PRO B 1 32  ? 0.465   60.397  8.277   1.00 32.23 ? 70  PRO B CG  1 
ATOM   3736  C CD  . PRO B 1 32  ? 1.330   61.444  7.598   1.00 33.16 ? 70  PRO B CD  1 
ATOM   3737  N N   . GLU B 1 33  ? -2.320  62.964  6.114   1.00 32.51 ? 71  GLU B N   1 
ATOM   3738  C CA  . GLU B 1 33  ? -3.236  64.030  6.543   1.00 32.83 ? 71  GLU B CA  1 
ATOM   3739  C C   . GLU B 1 33  ? -4.661  63.551  6.775   1.00 32.67 ? 71  GLU B C   1 
ATOM   3740  O O   . GLU B 1 33  ? -5.416  64.201  7.517   1.00 34.12 ? 71  GLU B O   1 
ATOM   3741  C CB  . GLU B 1 33  ? -3.203  65.215  5.559   1.00 32.19 ? 71  GLU B CB  1 
ATOM   3742  C CG  . GLU B 1 33  ? -3.198  64.808  4.111   1.00 34.38 ? 71  GLU B CG  1 
ATOM   3743  C CD  . GLU B 1 33  ? -3.342  65.963  3.144   1.00 33.90 ? 71  GLU B CD  1 
ATOM   3744  O OE1 . GLU B 1 33  ? -4.460  66.494  3.027   1.00 37.72 ? 71  GLU B OE1 1 
ATOM   3745  O OE2 . GLU B 1 33  ? -2.337  66.293  2.473   1.00 37.33 ? 71  GLU B OE2 1 
ATOM   3746  N N   . ASN B 1 34  ? -5.033  62.439  6.143   1.00 32.61 ? 72  ASN B N   1 
ATOM   3747  C CA  . ASN B 1 34  ? -6.343  61.824  6.347   1.00 32.48 ? 72  ASN B CA  1 
ATOM   3748  C C   . ASN B 1 34  ? -6.400  60.992  7.621   1.00 32.56 ? 72  ASN B C   1 
ATOM   3749  O O   . ASN B 1 34  ? -7.390  61.026  8.346   1.00 32.28 ? 72  ASN B O   1 
ATOM   3750  C CB  . ASN B 1 34  ? -6.764  60.990  5.133   1.00 32.36 ? 72  ASN B CB  1 
ATOM   3751  C CG  . ASN B 1 34  ? -7.127  61.848  3.951   1.00 32.18 ? 72  ASN B CG  1 
ATOM   3752  O OD1 . ASN B 1 34  ? -8.177  62.466  3.928   1.00 34.85 ? 72  ASN B OD1 1 
ATOM   3753  N ND2 . ASN B 1 34  ? -6.263  61.898  2.970   1.00 32.61 ? 72  ASN B ND2 1 
ATOM   3754  N N   . LEU B 1 35  ? -5.329  60.263  7.914   1.00 33.45 ? 73  LEU B N   1 
ATOM   3755  C CA  . LEU B 1 35  ? -5.276  59.502  9.165   1.00 33.17 ? 73  LEU B CA  1 
ATOM   3756  C C   . LEU B 1 35  ? -5.125  60.420  10.385  1.00 33.52 ? 73  LEU B C   1 
ATOM   3757  O O   . LEU B 1 35  ? -5.792  60.209  11.411  1.00 32.39 ? 73  LEU B O   1 
ATOM   3758  C CB  . LEU B 1 35  ? -4.188  58.445  9.102   1.00 32.75 ? 73  LEU B CB  1 
ATOM   3759  C CG  . LEU B 1 35  ? -4.443  57.298  8.113   1.00 31.93 ? 73  LEU B CG  1 
ATOM   3760  C CD1 . LEU B 1 35  ? -3.123  56.495  7.898   1.00 26.19 ? 73  LEU B CD1 1 
ATOM   3761  C CD2 . LEU B 1 35  ? -5.632  56.402  8.578   1.00 29.13 ? 73  LEU B CD2 1 
ATOM   3762  N N   . ILE B 1 36  ? -4.283  61.452  10.245  1.00 34.06 ? 74  ILE B N   1 
ATOM   3763  C CA  . ILE B 1 36  ? -4.124  62.489  11.284  1.00 34.61 ? 74  ILE B CA  1 
ATOM   3764  C C   . ILE B 1 36  ? -5.413  63.249  11.534  1.00 34.47 ? 74  ILE B C   1 
ATOM   3765  O O   . ILE B 1 36  ? -5.591  63.806  12.605  1.00 34.38 ? 74  ILE B O   1 
ATOM   3766  C CB  . ILE B 1 36  ? -3.024  63.532  10.914  1.00 34.72 ? 74  ILE B CB  1 
ATOM   3767  C CG1 . ILE B 1 36  ? -1.635  62.898  10.997  1.00 34.76 ? 74  ILE B CG1 1 
ATOM   3768  C CG2 . ILE B 1 36  ? -3.114  64.768  11.819  1.00 33.85 ? 74  ILE B CG2 1 
ATOM   3769  C CD1 . ILE B 1 36  ? -0.553  63.670  10.227  1.00 35.72 ? 74  ILE B CD1 1 
ATOM   3770  N N   . ASP B 1 37  ? -6.302  63.287  10.539  1.00 35.38 ? 75  ASP B N   1 
ATOM   3771  C CA  . ASP B 1 37  ? -7.639  63.920  10.676  1.00 35.39 ? 75  ASP B CA  1 
ATOM   3772  C C   . ASP B 1 37  ? -8.610  62.997  11.419  1.00 34.94 ? 75  ASP B C   1 
ATOM   3773  O O   . ASP B 1 37  ? -9.437  63.456  12.218  1.00 34.88 ? 75  ASP B O   1 
ATOM   3774  C CB  . ASP B 1 37  ? -8.198  64.227  9.293   1.00 36.12 ? 75  ASP B CB  1 
ATOM   3775  C CG  . ASP B 1 37  ? -9.167  65.368  9.299   1.00 37.99 ? 75  ASP B CG  1 
ATOM   3776  O OD1 . ASP B 1 37  ? -8.720  66.514  9.541   1.00 42.82 ? 75  ASP B OD1 1 
ATOM   3777  O OD2 . ASP B 1 37  ? -10.370 65.139  9.043   1.00 41.24 ? 75  ASP B OD2 1 
ATOM   3778  N N   . ALA B 1 38  ? -8.513  61.696  11.138  1.00 34.70 ? 76  ALA B N   1 
ATOM   3779  C CA  . ALA B 1 38  ? -9.241  60.665  11.885  1.00 34.60 ? 76  ALA B CA  1 
ATOM   3780  C C   . ALA B 1 38  ? -8.903  60.688  13.385  1.00 34.56 ? 76  ALA B C   1 
ATOM   3781  O O   . ALA B 1 38  ? -9.777  60.418  14.215  1.00 33.97 ? 76  ALA B O   1 
ATOM   3782  C CB  . ALA B 1 38  ? -8.961  59.282  11.306  1.00 34.36 ? 76  ALA B CB  1 
ATOM   3783  N N   . LEU B 1 39  ? -7.648  61.015  13.720  1.00 33.93 ? 77  LEU B N   1 
ATOM   3784  C CA  . LEU B 1 39  ? -7.222  61.128  15.119  1.00 33.93 ? 77  LEU B CA  1 
ATOM   3785  C C   . LEU B 1 39  ? -7.822  62.346  15.821  1.00 33.89 ? 77  LEU B C   1 
ATOM   3786  O O   . LEU B 1 39  ? -8.127  62.269  17.010  1.00 33.77 ? 77  LEU B O   1 
ATOM   3787  C CB  . LEU B 1 39  ? -5.704  61.190  15.259  1.00 33.68 ? 77  LEU B CB  1 
ATOM   3788  C CG  . LEU B 1 39  ? -4.984  59.893  15.633  1.00 33.90 ? 77  LEU B CG  1 
ATOM   3789  C CD1 . LEU B 1 39  ? -5.069  58.859  14.523  1.00 33.00 ? 77  LEU B CD1 1 
ATOM   3790  C CD2 . LEU B 1 39  ? -3.530  60.204  16.000  1.00 32.20 ? 77  LEU B CD2 1 
ATOM   3791  N N   . LEU B 1 40  ? -7.943  63.468  15.105  1.00 34.16 ? 78  LEU B N   1 
ATOM   3792  C CA  . LEU B 1 40  ? -8.685  64.644  15.598  1.00 34.49 ? 78  LEU B CA  1 
ATOM   3793  C C   . LEU B 1 40  ? -10.129 64.271  15.847  1.00 34.31 ? 78  LEU B C   1 
ATOM   3794  O O   . LEU B 1 40  ? -10.767 64.798  16.761  1.00 34.35 ? 78  LEU B O   1 
ATOM   3795  C CB  . LEU B 1 40  ? -8.659  65.794  14.585  1.00 34.75 ? 78  LEU B CB  1 
ATOM   3796  C CG  . LEU B 1 40  ? -7.300  66.311  14.110  1.00 35.52 ? 78  LEU B CG  1 
ATOM   3797  C CD1 . LEU B 1 40  ? -7.522  67.362  13.020  1.00 36.71 ? 78  LEU B CD1 1 
ATOM   3798  C CD2 . LEU B 1 40  ? -6.486  66.866  15.299  1.00 36.61 ? 78  LEU B CD2 1 
ATOM   3799  N N   . LYS B 1 41  ? -10.636 63.370  15.005  1.00 34.31 ? 79  LYS B N   1 
ATOM   3800  C CA  . LYS B 1 41  ? -12.027 62.941  15.043  1.00 34.56 ? 79  LYS B CA  1 
ATOM   3801  C C   . LYS B 1 41  ? -12.298 61.850  16.079  1.00 34.76 ? 79  LYS B C   1 
ATOM   3802  O O   . LYS B 1 41  ? -13.369 61.803  16.645  1.00 35.24 ? 79  LYS B O   1 
ATOM   3803  C CB  . LYS B 1 41  ? -12.481 62.503  13.652  1.00 34.44 ? 79  LYS B CB  1 
ATOM   3804  C CG  . LYS B 1 41  ? -12.689 63.678  12.697  1.00 34.47 ? 79  LYS B CG  1 
ATOM   3805  C CD  . LYS B 1 41  ? -12.841 63.209  11.262  1.00 34.95 ? 79  LYS B CD  1 
ATOM   3806  C CE  . LYS B 1 41  ? -13.401 64.296  10.370  1.00 36.44 ? 79  LYS B CE  1 
ATOM   3807  N NZ  . LYS B 1 41  ? -13.038 64.072  8.928   1.00 37.46 ? 79  LYS B NZ  1 
ATOM   3808  N N   . THR B 1 42  ? -11.340 60.984  16.341  1.00 35.17 ? 80  THR B N   1 
ATOM   3809  C CA  . THR B 1 42  ? -11.439 60.071  17.478  1.00 35.70 ? 80  THR B CA  1 
ATOM   3810  C C   . THR B 1 42  ? -11.157 60.843  18.770  1.00 35.89 ? 80  THR B C   1 
ATOM   3811  O O   . THR B 1 42  ? -11.689 60.508  19.819  1.00 34.90 ? 80  THR B O   1 
ATOM   3812  C CB  . THR B 1 42  ? -10.388 58.965  17.420  1.00 35.59 ? 80  THR B CB  1 
ATOM   3813  O OG1 . THR B 1 42  ? -9.094  59.565  17.536  1.00 36.10 ? 80  THR B OG1 1 
ATOM   3814  C CG2 . THR B 1 42  ? -10.482 58.164  16.111  1.00 36.88 ? 80  THR B CG2 1 
ATOM   3815  N N   . GLY B 1 43  ? -10.275 61.842  18.676  1.00 36.49 ? 81  GLY B N   1 
ATOM   3816  C CA  . GLY B 1 43  ? -9.831  62.627  19.826  1.00 36.99 ? 81  GLY B CA  1 
ATOM   3817  C C   . GLY B 1 43  ? -8.896  61.913  20.791  1.00 37.19 ? 81  GLY B C   1 
ATOM   3818  O O   . GLY B 1 43  ? -8.723  62.355  21.914  1.00 38.05 ? 81  GLY B O   1 
ATOM   3819  N N   . VAL B 1 44  ? -8.284  60.822  20.356  1.00 37.76 ? 82  VAL B N   1 
ATOM   3820  C CA  . VAL B 1 44  ? -7.382  60.024  21.212  1.00 37.85 ? 82  VAL B CA  1 
ATOM   3821  C C   . VAL B 1 44  ? -6.204  60.867  21.731  1.00 37.88 ? 82  VAL B C   1 
ATOM   3822  O O   . VAL B 1 44  ? -5.718  61.763  21.046  1.00 37.63 ? 82  VAL B O   1 
ATOM   3823  C CB  . VAL B 1 44  ? -6.914  58.743  20.481  1.00 37.30 ? 82  VAL B CB  1 
ATOM   3824  C CG1 . VAL B 1 44  ? -6.103  59.088  19.234  1.00 38.46 ? 82  VAL B CG1 1 
ATOM   3825  C CG2 . VAL B 1 44  ? -6.154  57.837  21.417  1.00 37.62 ? 82  VAL B CG2 1 
ATOM   3826  N N   . LYS B 1 45  ? -5.788  60.585  22.965  1.00 38.11 ? 83  LYS B N   1 
ATOM   3827  C CA  . LYS B 1 45  ? -4.933  61.485  23.747  1.00 37.81 ? 83  LYS B CA  1 
ATOM   3828  C C   . LYS B 1 45  ? -3.807  60.736  24.472  1.00 37.41 ? 83  LYS B C   1 
ATOM   3829  O O   . LYS B 1 45  ? -3.739  59.509  24.470  1.00 36.34 ? 83  LYS B O   1 
ATOM   3830  C CB  . LYS B 1 45  ? -5.783  62.263  24.775  1.00 37.86 ? 83  LYS B CB  1 
ATOM   3831  N N   . GLY B 1 46  ? -2.940  61.508  25.114  1.00 37.35 ? 84  GLY B N   1 
ATOM   3832  C CA  . GLY B 1 46  ? -1.770  60.974  25.790  1.00 36.90 ? 84  GLY B CA  1 
ATOM   3833  C C   . GLY B 1 46  ? -0.627  60.612  24.879  1.00 36.59 ? 84  GLY B C   1 
ATOM   3834  O O   . GLY B 1 46  ? 0.454   60.297  25.361  1.00 36.87 ? 84  GLY B O   1 
ATOM   3835  N N   . LEU B 1 47  ? -0.854  60.672  23.566  1.00 36.01 ? 85  LEU B N   1 
ATOM   3836  C CA  . LEU B 1 47  ? 0.009   60.011  22.581  1.00 34.68 ? 85  LEU B CA  1 
ATOM   3837  C C   . LEU B 1 47  ? 1.476   60.419  22.690  1.00 34.32 ? 85  LEU B C   1 
ATOM   3838  O O   . LEU B 1 47  ? 1.761   61.566  23.040  1.00 32.97 ? 85  LEU B O   1 
ATOM   3839  C CB  . LEU B 1 47  ? -0.475  60.300  21.151  1.00 34.73 ? 85  LEU B CB  1 
ATOM   3840  C CG  . LEU B 1 47  ? -1.861  59.812  20.693  1.00 34.67 ? 85  LEU B CG  1 
ATOM   3841  C CD1 . LEU B 1 47  ? -2.073  60.195  19.231  1.00 34.47 ? 85  LEU B CD1 1 
ATOM   3842  C CD2 . LEU B 1 47  ? -2.050  58.304  20.883  1.00 35.11 ? 85  LEU B CD2 1 
ATOM   3843  N N   . THR B 1 48  ? 2.387   59.461  22.407  1.00 33.27 ? 86  THR B N   1 
ATOM   3844  C CA  . THR B 1 48  ? 3.801   59.734  22.150  1.00 32.70 ? 86  THR B CA  1 
ATOM   3845  C C   . THR B 1 48  ? 3.984   59.614  20.654  1.00 32.70 ? 86  THR B C   1 
ATOM   3846  O O   . THR B 1 48  ? 3.907   58.508  20.101  1.00 31.99 ? 86  THR B O   1 
ATOM   3847  C CB  . THR B 1 48  ? 4.755   58.728  22.827  1.00 33.06 ? 86  THR B CB  1 
ATOM   3848  O OG1 . THR B 1 48  ? 4.797   58.974  24.233  1.00 33.69 ? 86  THR B OG1 1 
ATOM   3849  C CG2 . THR B 1 48  ? 6.191   58.852  22.262  1.00 31.01 ? 86  THR B CG2 1 
ATOM   3850  N N   . ALA B 1 49  ? 4.183   60.755  20.001  1.00 31.99 ? 87  ALA B N   1 
ATOM   3851  C CA  . ALA B 1 49  ? 4.246   60.832  18.549  1.00 31.14 ? 87  ALA B CA  1 
ATOM   3852  C C   . ALA B 1 49  ? 5.696   60.763  18.160  1.00 30.50 ? 87  ALA B C   1 
ATOM   3853  O O   . ALA B 1 49  ? 6.492   61.595  18.595  1.00 29.82 ? 87  ALA B O   1 
ATOM   3854  C CB  . ALA B 1 49  ? 3.630   62.151  18.061  1.00 30.96 ? 87  ALA B CB  1 
ATOM   3855  N N   . VAL B 1 50  ? 6.053   59.734  17.394  1.00 31.03 ? 88  VAL B N   1 
ATOM   3856  C CA  . VAL B 1 50  ? 7.384   59.629  16.817  1.00 31.05 ? 88  VAL B CA  1 
ATOM   3857  C C   . VAL B 1 50  ? 7.261   60.140  15.355  1.00 32.04 ? 88  VAL B C   1 
ATOM   3858  O O   . VAL B 1 50  ? 6.601   59.545  14.507  1.00 29.54 ? 88  VAL B O   1 
ATOM   3859  C CB  . VAL B 1 50  ? 7.912   58.196  16.910  1.00 31.92 ? 88  VAL B CB  1 
ATOM   3860  C CG1 . VAL B 1 50  ? 9.344   58.112  16.347  1.00 30.42 ? 88  VAL B CG1 1 
ATOM   3861  C CG2 . VAL B 1 50  ? 7.813   57.685  18.357  1.00 30.45 ? 88  VAL B CG2 1 
ATOM   3862  N N   . SER B 1 51  ? 7.843   61.314  15.131  1.00 32.91 ? 89  SER B N   1 
ATOM   3863  C CA  . SER B 1 51  ? 7.642   62.075  13.923  1.00 33.76 ? 89  SER B CA  1 
ATOM   3864  C C   . SER B 1 51  ? 8.867   62.939  13.752  1.00 33.77 ? 89  SER B C   1 
ATOM   3865  O O   . SER B 1 51  ? 9.323   63.555  14.700  1.00 33.05 ? 89  SER B O   1 
ATOM   3866  C CB  . SER B 1 51  ? 6.383   62.953  14.063  1.00 34.44 ? 89  SER B CB  1 
ATOM   3867  O OG  . SER B 1 51  ? 6.284   63.941  13.041  1.00 35.84 ? 89  SER B OG  1 
ATOM   3868  N N   . ASN B 1 52  ? 9.383   62.989  12.536  1.00 34.34 ? 90  ASN B N   1 
ATOM   3869  C CA  . ASN B 1 52  ? 10.632  63.668  12.304  1.00 35.04 ? 90  ASN B CA  1 
ATOM   3870  C C   . ASN B 1 52  ? 10.519  65.126  12.701  1.00 35.69 ? 90  ASN B C   1 
ATOM   3871  O O   . ASN B 1 52  ? 11.382  65.674  13.399  1.00 36.37 ? 90  ASN B O   1 
ATOM   3872  C CB  . ASN B 1 52  ? 11.052  63.553  10.835  1.00 34.90 ? 90  ASN B CB  1 
ATOM   3873  C CG  . ASN B 1 52  ? 12.396  64.171  10.594  1.00 35.33 ? 90  ASN B CG  1 
ATOM   3874  O OD1 . ASN B 1 52  ? 13.364  63.829  11.283  1.00 35.74 ? 90  ASN B OD1 1 
ATOM   3875  N ND2 . ASN B 1 52  ? 12.455  65.155  9.705   1.00 32.88 ? 90  ASN B ND2 1 
ATOM   3876  N N   . ASN B 1 53  ? 9.421   65.748  12.276  1.00 35.91 ? 91  ASN B N   1 
ATOM   3877  C CA  . ASN B 1 53  ? 9.203   67.155  12.503  1.00 35.73 ? 91  ASN B CA  1 
ATOM   3878  C C   . ASN B 1 53  ? 7.889   67.390  13.250  1.00 35.81 ? 91  ASN B C   1 
ATOM   3879  O O   . ASN B 1 53  ? 7.126   66.453  13.512  1.00 35.65 ? 91  ASN B O   1 
ATOM   3880  C CB  . ASN B 1 53  ? 9.242   67.886  11.165  1.00 35.28 ? 91  ASN B CB  1 
ATOM   3881  C CG  . ASN B 1 53  ? 10.456  67.536  10.349  1.00 35.80 ? 91  ASN B CG  1 
ATOM   3882  O OD1 . ASN B 1 53  ? 10.358  66.932  9.262   1.00 34.58 ? 91  ASN B OD1 1 
ATOM   3883  N ND2 . ASN B 1 53  ? 11.622  67.885  10.866  1.00 36.16 ? 91  ASN B ND2 1 
ATOM   3884  N N   . ALA B 1 54  ? 7.648   68.649  13.601  1.00 36.25 ? 92  ALA B N   1 
ATOM   3885  C CA  . ALA B 1 54  ? 6.431   69.068  14.290  1.00 36.27 ? 92  ALA B CA  1 
ATOM   3886  C C   . ALA B 1 54  ? 5.394   69.670  13.315  1.00 36.79 ? 92  ALA B C   1 
ATOM   3887  O O   . ALA B 1 54  ? 4.525   70.462  13.737  1.00 37.66 ? 92  ALA B O   1 
ATOM   3888  C CB  . ALA B 1 54  ? 6.796   70.082  15.395  1.00 35.68 ? 92  ALA B CB  1 
ATOM   3889  N N   . GLY B 1 55  ? 5.458   69.322  12.027  1.00 37.16 ? 93  GLY B N   1 
ATOM   3890  C CA  . GLY B 1 55  ? 4.538   69.902  11.023  1.00 37.55 ? 93  GLY B CA  1 
ATOM   3891  C C   . GLY B 1 55  ? 4.617   71.425  11.006  1.00 38.20 ? 93  GLY B C   1 
ATOM   3892  O O   . GLY B 1 55  ? 5.693   72.002  11.151  1.00 38.75 ? 93  GLY B O   1 
ATOM   3893  N N   . VAL B 1 56  ? 3.489   72.093  10.796  1.00 38.82 ? 94  VAL B N   1 
ATOM   3894  C CA  . VAL B 1 56  ? 3.395   73.532  11.041  1.00 38.88 ? 94  VAL B CA  1 
ATOM   3895  C C   . VAL B 1 56  ? 2.145   73.686  11.883  1.00 38.97 ? 94  VAL B C   1 
ATOM   3896  O O   . VAL B 1 56  ? 1.498   72.681  12.172  1.00 37.92 ? 94  VAL B O   1 
ATOM   3897  C CB  . VAL B 1 56  ? 3.366   74.389  9.731   1.00 39.31 ? 94  VAL B CB  1 
ATOM   3898  C CG1 . VAL B 1 56  ? 4.611   74.135  8.896   1.00 38.39 ? 94  VAL B CG1 1 
ATOM   3899  C CG2 . VAL B 1 56  ? 2.113   74.120  8.907   1.00 39.52 ? 94  VAL B CG2 1 
ATOM   3900  N N   . ASP B 1 57  ? 1.807   74.914  12.294  1.00 39.89 ? 95  ASP B N   1 
ATOM   3901  C CA  . ASP B 1 57  ? 0.704   75.113  13.246  1.00 40.31 ? 95  ASP B CA  1 
ATOM   3902  C C   . ASP B 1 57  ? -0.593  74.543  12.705  1.00 40.70 ? 95  ASP B C   1 
ATOM   3903  O O   . ASP B 1 57  ? -1.258  73.723  13.347  1.00 40.56 ? 95  ASP B O   1 
ATOM   3904  C CB  . ASP B 1 57  ? 0.504   76.596  13.581  1.00 40.79 ? 95  ASP B CB  1 
ATOM   3905  C CG  . ASP B 1 57  ? 1.450   77.083  14.647  1.00 41.07 ? 95  ASP B CG  1 
ATOM   3906  O OD1 . ASP B 1 57  ? 1.003   77.200  15.827  1.00 42.32 ? 95  ASP B OD1 1 
ATOM   3907  O OD2 . ASP B 1 57  ? 2.643   77.341  14.306  1.00 42.62 ? 95  ASP B OD2 1 
ATOM   3908  N N   . ASN B 1 58  ? -0.931  74.977  11.501  1.00 41.14 ? 96  ASN B N   1 
ATOM   3909  C CA  . ASN B 1 58  ? -2.206  74.637  10.892  1.00 41.90 ? 96  ASN B CA  1 
ATOM   3910  C C   . ASN B 1 58  ? -2.203  73.309  10.125  1.00 42.02 ? 96  ASN B C   1 
ATOM   3911  O O   . ASN B 1 58  ? -3.164  73.030  9.406   1.00 42.50 ? 96  ASN B O   1 
ATOM   3912  C CB  . ASN B 1 58  ? -2.686  75.797  9.985   1.00 42.04 ? 96  ASN B CB  1 
ATOM   3913  C CG  . ASN B 1 58  ? -1.595  76.313  9.042   1.00 43.46 ? 96  ASN B CG  1 
ATOM   3914  O OD1 . ASN B 1 58  ? -0.393  76.246  9.340   1.00 44.31 ? 96  ASN B OD1 1 
ATOM   3915  N ND2 . ASN B 1 58  ? -2.015  76.834  7.898   1.00 45.69 ? 96  ASN B ND2 1 
ATOM   3916  N N   . PHE B 1 59  ? -1.149  72.489  10.265  1.00 41.95 ? 97  PHE B N   1 
ATOM   3917  C CA  . PHE B 1 59  ? -1.061  71.276  9.495   1.00 41.54 ? 97  PHE B CA  1 
ATOM   3918  C C   . PHE B 1 59  ? -0.079  70.211  9.974   1.00 41.37 ? 97  PHE B C   1 
ATOM   3919  O O   . PHE B 1 59  ? 0.944   70.504  10.582  1.00 41.38 ? 97  PHE B O   1 
ATOM   3920  C CB  . PHE B 1 59  ? -0.702  71.613  8.065   1.00 42.00 ? 97  PHE B CB  1 
ATOM   3921  C CG  . PHE B 1 59  ? -1.423  70.769  7.065   1.00 42.96 ? 97  PHE B CG  1 
ATOM   3922  C CD1 . PHE B 1 59  ? -2.815  70.867  6.935   1.00 44.30 ? 97  PHE B CD1 1 
ATOM   3923  C CD2 . PHE B 1 59  ? -0.745  69.894  6.264   1.00 42.91 ? 97  PHE B CD2 1 
ATOM   3924  C CE1 . PHE B 1 59  ? -3.493  70.096  6.022   1.00 43.72 ? 97  PHE B CE1 1 
ATOM   3925  C CE2 . PHE B 1 59  ? -1.429  69.129  5.342   1.00 43.70 ? 97  PHE B CE2 1 
ATOM   3926  C CZ  . PHE B 1 59  ? -2.801  69.233  5.225   1.00 42.20 ? 97  PHE B CZ  1 
ATOM   3927  N N   . GLY B 1 60  ? -0.401  68.969  9.630   1.00 40.50 ? 98  GLY B N   1 
ATOM   3928  C CA  . GLY B 1 60  ? 0.389   67.831  10.025  1.00 41.00 ? 98  GLY B CA  1 
ATOM   3929  C C   . GLY B 1 60  ? 0.213   67.605  11.502  1.00 40.78 ? 98  GLY B C   1 
ATOM   3930  O O   . GLY B 1 60  ? -0.882  67.769  12.021  1.00 39.99 ? 98  GLY B O   1 
ATOM   3931  N N   . LEU B 1 61  ? 1.309   67.256  12.172  1.00 41.09 ? 99  LEU B N   1 
ATOM   3932  C CA  . LEU B 1 61  ? 1.268   66.918  13.593  1.00 41.03 ? 99  LEU B CA  1 
ATOM   3933  C C   . LEU B 1 61  ? 0.965   68.145  14.428  1.00 40.57 ? 99  LEU B C   1 
ATOM   3934  O O   . LEU B 1 61  ? 0.452   68.026  15.539  1.00 40.62 ? 99  LEU B O   1 
ATOM   3935  C CB  . LEU B 1 61  ? 2.582   66.282  14.019  1.00 41.64 ? 99  LEU B CB  1 
ATOM   3936  C CG  . LEU B 1 61  ? 2.530   64.892  14.665  1.00 42.59 ? 99  LEU B CG  1 
ATOM   3937  C CD1 . LEU B 1 61  ? 1.531   63.942  14.028  1.00 42.83 ? 99  LEU B CD1 1 
ATOM   3938  C CD2 . LEU B 1 61  ? 3.897   64.310  14.560  1.00 43.57 ? 99  LEU B CD2 1 
ATOM   3939  N N   . GLY B 1 62  ? 1.245   69.327  13.874  1.00 39.94 ? 100 GLY B N   1 
ATOM   3940  C CA  . GLY B 1 62  ? 0.804   70.595  14.464  1.00 39.17 ? 100 GLY B CA  1 
ATOM   3941  C C   . GLY B 1 62  ? -0.683  70.674  14.817  1.00 38.93 ? 100 GLY B C   1 
ATOM   3942  O O   . GLY B 1 62  ? -1.070  71.433  15.719  1.00 37.87 ? 100 GLY B O   1 
ATOM   3943  N N   . LEU B 1 63  ? -1.503  69.875  14.120  1.00 38.54 ? 101 LEU B N   1 
ATOM   3944  C CA  . LEU B 1 63  ? -2.938  69.778  14.386  1.00 38.46 ? 101 LEU B CA  1 
ATOM   3945  C C   . LEU B 1 63  ? -3.250  68.991  15.663  1.00 38.18 ? 101 LEU B C   1 
ATOM   3946  O O   . LEU B 1 63  ? -4.054  69.427  16.459  1.00 38.61 ? 101 LEU B O   1 
ATOM   3947  C CB  . LEU B 1 63  ? -3.679  69.158  13.191  1.00 38.36 ? 101 LEU B CB  1 
ATOM   3948  C CG  . LEU B 1 63  ? -3.581  69.902  11.838  1.00 38.61 ? 101 LEU B CG  1 
ATOM   3949  C CD1 . LEU B 1 63  ? -4.088  69.015  10.687  1.00 38.12 ? 101 LEU B CD1 1 
ATOM   3950  C CD2 . LEU B 1 63  ? -4.300  71.261  11.852  1.00 34.05 ? 101 LEU B CD2 1 
ATOM   3951  N N   . LEU B 1 64  ? -2.644  67.829  15.851  1.00 38.37 ? 102 LEU B N   1 
ATOM   3952  C CA  . LEU B 1 64  ? -2.803  67.091  17.117  1.00 38.42 ? 102 LEU B CA  1 
ATOM   3953  C C   . LEU B 1 64  ? -2.160  67.792  18.325  1.00 38.53 ? 102 LEU B C   1 
ATOM   3954  O O   . LEU B 1 64  ? -2.581  67.577  19.480  1.00 38.05 ? 102 LEU B O   1 
ATOM   3955  C CB  . LEU B 1 64  ? -2.228  65.688  16.997  1.00 38.32 ? 102 LEU B CB  1 
ATOM   3956  C CG  . LEU B 1 64  ? -2.964  64.760  16.036  1.00 38.31 ? 102 LEU B CG  1 
ATOM   3957  C CD1 . LEU B 1 64  ? -2.157  63.459  15.916  1.00 37.46 ? 102 LEU B CD1 1 
ATOM   3958  C CD2 . LEU B 1 64  ? -4.375  64.495  16.495  1.00 37.07 ? 102 LEU B CD2 1 
ATOM   3959  N N   . LEU B 1 65  ? -1.162  68.636  18.057  1.00 38.92 ? 103 LEU B N   1 
ATOM   3960  C CA  . LEU B 1 65  ? -0.546  69.462  19.091  1.00 39.03 ? 103 LEU B CA  1 
ATOM   3961  C C   . LEU B 1 65  ? -1.490  70.558  19.564  1.00 38.97 ? 103 LEU B C   1 
ATOM   3962  O O   . LEU B 1 65  ? -1.748  70.664  20.766  1.00 39.87 ? 103 LEU B O   1 
ATOM   3963  C CB  . LEU B 1 65  ? 0.773   70.076  18.605  1.00 38.97 ? 103 LEU B CB  1 
ATOM   3964  C CG  . LEU B 1 65  ? 1.927   69.103  18.430  1.00 38.42 ? 103 LEU B CG  1 
ATOM   3965  C CD1 . LEU B 1 65  ? 2.917   69.643  17.396  1.00 38.78 ? 103 LEU B CD1 1 
ATOM   3966  C CD2 . LEU B 1 65  ? 2.612   68.798  19.772  1.00 37.48 ? 103 LEU B CD2 1 
ATOM   3967  N N   . ARG B 1 66  ? -2.019  71.371  18.645  1.00 38.91 ? 104 ARG B N   1 
ATOM   3968  C CA  . ARG B 1 66  ? -2.979  72.427  19.037  1.00 38.38 ? 104 ARG B CA  1 
ATOM   3969  C C   . ARG B 1 66  ? -4.212  71.814  19.704  1.00 38.18 ? 104 ARG B C   1 
ATOM   3970  O O   . ARG B 1 66  ? -4.804  72.433  20.586  1.00 37.89 ? 104 ARG B O   1 
ATOM   3971  C CB  . ARG B 1 66  ? -3.394  73.323  17.855  1.00 38.24 ? 104 ARG B CB  1 
ATOM   3972  N N   . SER B 1 67  ? -4.597  70.595  19.313  1.00 37.94 ? 105 SER B N   1 
ATOM   3973  C CA  . SER B 1 67  ? -5.727  69.933  19.983  1.00 38.00 ? 105 SER B CA  1 
ATOM   3974  C C   . SER B 1 67  ? -5.321  69.108  21.216  1.00 37.85 ? 105 SER B C   1 
ATOM   3975  O O   . SER B 1 67  ? -6.107  68.283  21.685  1.00 37.80 ? 105 SER B O   1 
ATOM   3976  C CB  . SER B 1 67  ? -6.487  69.047  19.015  1.00 37.59 ? 105 SER B CB  1 
ATOM   3977  O OG  . SER B 1 67  ? -5.817  67.827  18.884  1.00 38.68 ? 105 SER B OG  1 
ATOM   3978  N N   . LYS B 1 68  ? -4.090  69.309  21.708  1.00 38.13 ? 106 LYS B N   1 
ATOM   3979  C CA  . LYS B 1 68  ? -3.599  68.714  22.977  1.00 38.36 ? 106 LYS B CA  1 
ATOM   3980  C C   . LYS B 1 68  ? -3.605  67.164  23.066  1.00 38.24 ? 106 LYS B C   1 
ATOM   3981  O O   . LYS B 1 68  ? -3.695  66.601  24.158  1.00 38.51 ? 106 LYS B O   1 
ATOM   3982  C CB  . LYS B 1 68  ? -4.350  69.319  24.181  1.00 38.57 ? 106 LYS B CB  1 
ATOM   3983  C CG  . LYS B 1 68  ? -4.073  70.801  24.424  1.00 39.18 ? 106 LYS B CG  1 
ATOM   3984  C CD  . LYS B 1 68  ? -2.713  70.991  25.061  1.00 41.03 ? 106 LYS B CD  1 
ATOM   3985  N N   . GLN B 1 69  ? -3.463  66.471  21.946  1.00 37.79 ? 107 GLN B N   1 
ATOM   3986  C CA  . GLN B 1 69  ? -3.553  64.999  21.954  1.00 37.73 ? 107 GLN B CA  1 
ATOM   3987  C C   . GLN B 1 69  ? -2.223  64.226  22.155  1.00 36.89 ? 107 GLN B C   1 
ATOM   3988  O O   . GLN B 1 69  ? -2.208  62.990  22.187  1.00 35.86 ? 107 GLN B O   1 
ATOM   3989  C CB  . GLN B 1 69  ? -4.232  64.535  20.654  1.00 38.18 ? 107 GLN B CB  1 
ATOM   3990  C CG  . GLN B 1 69  ? -5.680  64.926  20.591  1.00 38.46 ? 107 GLN B CG  1 
ATOM   3991  C CD  . GLN B 1 69  ? -6.344  64.574  19.280  1.00 39.92 ? 107 GLN B CD  1 
ATOM   3992  O OE1 . GLN B 1 69  ? -6.761  65.481  18.542  1.00 42.48 ? 107 GLN B OE1 1 
ATOM   3993  N NE2 . GLN B 1 69  ? -6.464  63.249  18.987  1.00 38.91 ? 107 GLN B NE2 1 
ATOM   3994  N N   . ILE B 1 70  ? -1.119  64.957  22.290  1.00 36.37 ? 108 ILE B N   1 
ATOM   3995  C CA  . ILE B 1 70  ? 0.212   64.363  22.354  1.00 35.70 ? 108 ILE B CA  1 
ATOM   3996  C C   . ILE B 1 70  ? 0.887   64.759  23.674  1.00 35.68 ? 108 ILE B C   1 
ATOM   3997  O O   . ILE B 1 70  ? 0.790   65.918  24.094  1.00 36.31 ? 108 ILE B O   1 
ATOM   3998  C CB  . ILE B 1 70  ? 1.050   64.770  21.091  1.00 35.83 ? 108 ILE B CB  1 
ATOM   3999  C CG1 . ILE B 1 70  ? 0.401   64.218  19.823  1.00 33.96 ? 108 ILE B CG1 1 
ATOM   4000  C CG2 . ILE B 1 70  ? 2.480   64.240  21.148  1.00 34.97 ? 108 ILE B CG2 1 
ATOM   4001  C CD1 . ILE B 1 70  ? 0.908   64.871  18.603  1.00 33.16 ? 108 ILE B CD1 1 
ATOM   4002  N N   . LYS B 1 71  ? 1.478   63.779  24.365  1.00 35.39 ? 109 LYS B N   1 
ATOM   4003  C CA  . LYS B 1 71  ? 2.179   63.981  25.639  1.00 35.01 ? 109 LYS B CA  1 
ATOM   4004  C C   . LYS B 1 71  ? 3.632   64.241  25.362  1.00 35.16 ? 109 LYS B C   1 
ATOM   4005  O O   . LYS B 1 71  ? 4.250   65.068  26.018  1.00 35.02 ? 109 LYS B O   1 
ATOM   4006  C CB  . LYS B 1 71  ? 2.069   62.748  26.547  1.00 34.71 ? 109 LYS B CB  1 
ATOM   4007  N N   . ARG B 1 72  ? 4.158   63.517  24.373  1.00 35.80 ? 110 ARG B N   1 
ATOM   4008  C CA  . ARG B 1 72  ? 5.564   63.509  24.021  1.00 36.18 ? 110 ARG B CA  1 
ATOM   4009  C C   . ARG B 1 72  ? 5.758   63.450  22.508  1.00 36.40 ? 110 ARG B C   1 
ATOM   4010  O O   . ARG B 1 72  ? 5.126   62.653  21.827  1.00 37.14 ? 110 ARG B O   1 
ATOM   4011  C CB  . ARG B 1 72  ? 6.280   62.295  24.638  1.00 36.14 ? 110 ARG B CB  1 
ATOM   4012  C CG  . ARG B 1 72  ? 7.782   62.322  24.401  1.00 36.69 ? 110 ARG B CG  1 
ATOM   4013  C CD  . ARG B 1 72  ? 8.473   61.162  25.023  1.00 37.85 ? 110 ARG B CD  1 
ATOM   4014  N NE  . ARG B 1 72  ? 8.399   61.236  26.482  1.00 39.30 ? 110 ARG B NE  1 
ATOM   4015  C CZ  . ARG B 1 72  ? 9.410   60.992  27.312  1.00 38.73 ? 110 ARG B CZ  1 
ATOM   4016  N NH1 . ARG B 1 72  ? 9.219   61.111  28.610  1.00 36.87 ? 110 ARG B NH1 1 
ATOM   4017  N NH2 . ARG B 1 72  ? 10.615  60.649  26.856  1.00 40.50 ? 110 ARG B NH2 1 
ATOM   4018  N N   . MET B 1 73  ? 6.644   64.304  22.006  1.00 35.95 ? 111 MET B N   1 
ATOM   4019  C CA  . MET B 1 73  ? 7.061   64.282  20.628  1.00 36.69 ? 111 MET B CA  1 
ATOM   4020  C C   . MET B 1 73  ? 8.464   63.720  20.669  1.00 35.98 ? 111 MET B C   1 
ATOM   4021  O O   . MET B 1 73  ? 9.269   64.163  21.487  1.00 35.50 ? 111 MET B O   1 
ATOM   4022  C CB  . MET B 1 73  ? 7.100   65.698  20.046  1.00 37.40 ? 111 MET B CB  1 
ATOM   4023  C CG  . MET B 1 73  ? 5.777   66.254  19.622  1.00 38.84 ? 111 MET B CG  1 
ATOM   4024  S SD  . MET B 1 73  ? 5.207   65.529  18.087  1.00 45.95 ? 111 MET B SD  1 
ATOM   4025  C CE  . MET B 1 73  ? 6.390   66.246  16.922  1.00 43.43 ? 111 MET B CE  1 
ATOM   4026  N N   . VAL B 1 74  ? 8.728   62.715  19.841  1.00 35.55 ? 112 VAL B N   1 
ATOM   4027  C CA  . VAL B 1 74  ? 10.100  62.274  19.545  1.00 35.52 ? 112 VAL B CA  1 
ATOM   4028  C C   . VAL B 1 74  ? 10.422  62.680  18.105  1.00 35.88 ? 112 VAL B C   1 
ATOM   4029  O O   . VAL B 1 74  ? 9.902   62.111  17.162  1.00 34.64 ? 112 VAL B O   1 
ATOM   4030  C CB  . VAL B 1 74  ? 10.279  60.731  19.736  1.00 35.13 ? 112 VAL B CB  1 
ATOM   4031  C CG1 . VAL B 1 74  ? 11.755  60.280  19.457  1.00 35.20 ? 112 VAL B CG1 1 
ATOM   4032  C CG2 . VAL B 1 74  ? 9.886   60.326  21.126  1.00 34.59 ? 112 VAL B CG2 1 
ATOM   4033  N N   . SER B 1 75  ? 11.303  63.673  17.965  1.00 37.14 ? 113 SER B N   1 
ATOM   4034  C CA  . SER B 1 75  ? 11.601  64.326  16.693  1.00 36.88 ? 113 SER B CA  1 
ATOM   4035  C C   . SER B 1 75  ? 13.064  64.715  16.555  1.00 37.16 ? 113 SER B C   1 
ATOM   4036  O O   . SER B 1 75  ? 13.848  64.572  17.507  1.00 36.86 ? 113 SER B O   1 
ATOM   4037  C CB  . SER B 1 75  ? 10.767  65.585  16.599  1.00 36.58 ? 113 SER B CB  1 
ATOM   4038  O OG  . SER B 1 75  ? 9.425   65.227  16.758  1.00 37.16 ? 113 SER B OG  1 
ATOM   4039  N N   . SER B 1 76  ? 13.425  65.193  15.357  1.00 36.67 ? 114 SER B N   1 
ATOM   4040  C CA  . SER B 1 76  ? 14.752  65.734  15.111  1.00 36.63 ? 114 SER B CA  1 
ATOM   4041  C C   . SER B 1 76  ? 14.750  67.244  14.874  1.00 36.96 ? 114 SER B C   1 
ATOM   4042  O O   . SER B 1 76  ? 15.718  67.928  15.157  1.00 37.39 ? 114 SER B O   1 
ATOM   4043  C CB  . SER B 1 76  ? 15.425  65.017  13.936  1.00 36.27 ? 114 SER B CB  1 
ATOM   4044  O OG  . SER B 1 76  ? 15.138  65.588  12.687  1.00 33.90 ? 114 SER B OG  1 
ATOM   4045  N N   . TYR B 1 77  ? 13.693  67.763  14.310  1.00 37.69 ? 115 TYR B N   1 
ATOM   4046  C CA  . TYR B 1 77  ? 13.658  69.183  14.035  1.00 39.22 ? 115 TYR B CA  1 
ATOM   4047  C C   . TYR B 1 77  ? 12.215  69.649  14.152  1.00 40.03 ? 115 TYR B C   1 
ATOM   4048  O O   . TYR B 1 77  ? 11.335  69.168  13.439  1.00 39.70 ? 115 TYR B O   1 
ATOM   4049  C CB  . TYR B 1 77  ? 14.274  69.516  12.670  1.00 39.72 ? 115 TYR B CB  1 
ATOM   4050  C CG  . TYR B 1 77  ? 14.242  70.999  12.395  1.00 40.32 ? 115 TYR B CG  1 
ATOM   4051  C CD1 . TYR B 1 77  ? 15.247  71.838  12.864  1.00 40.99 ? 115 TYR B CD1 1 
ATOM   4052  C CD2 . TYR B 1 77  ? 13.182  71.564  11.705  1.00 40.46 ? 115 TYR B CD2 1 
ATOM   4053  C CE1 . TYR B 1 77  ? 15.201  73.206  12.638  1.00 41.34 ? 115 TYR B CE1 1 
ATOM   4054  C CE2 . TYR B 1 77  ? 13.119  72.922  11.495  1.00 40.74 ? 115 TYR B CE2 1 
ATOM   4055  C CZ  . TYR B 1 77  ? 14.129  73.745  11.957  1.00 40.40 ? 115 TYR B CZ  1 
ATOM   4056  O OH  . TYR B 1 77  ? 14.052  75.110  11.713  1.00 42.45 ? 115 TYR B OH  1 
ATOM   4057  N N   . VAL B 1 78  ? 12.006  70.596  15.067  1.00 41.06 ? 116 VAL B N   1 
ATOM   4058  C CA  . VAL B 1 78  ? 10.690  70.972  15.551  1.00 41.47 ? 116 VAL B CA  1 
ATOM   4059  C C   . VAL B 1 78  ? 10.445  72.479  15.364  1.00 42.73 ? 116 VAL B C   1 
ATOM   4060  O O   . VAL B 1 78  ? 9.599   73.067  16.038  1.00 42.51 ? 116 VAL B O   1 
ATOM   4061  C CB  . VAL B 1 78  ? 10.543  70.556  17.049  1.00 41.47 ? 116 VAL B CB  1 
ATOM   4062  C CG1 . VAL B 1 78  ? 10.515  69.057  17.178  1.00 41.35 ? 116 VAL B CG1 1 
ATOM   4063  C CG2 . VAL B 1 78  ? 11.685  71.148  17.924  1.00 40.27 ? 116 VAL B CG2 1 
ATOM   4064  N N   . GLY B 1 79  ? 11.173  73.084  14.425  1.00 43.83 ? 117 GLY B N   1 
ATOM   4065  C CA  . GLY B 1 79  ? 11.045  74.499  14.122  1.00 44.89 ? 117 GLY B CA  1 
ATOM   4066  C C   . GLY B 1 79  ? 9.847   74.757  13.237  1.00 46.18 ? 117 GLY B C   1 
ATOM   4067  O O   . GLY B 1 79  ? 9.228   73.817  12.732  1.00 46.74 ? 117 GLY B O   1 
ATOM   4068  N N   . GLU B 1 80  ? 9.515   76.036  13.054  1.00 47.05 ? 118 GLU B N   1 
ATOM   4069  C CA  . GLU B 1 80  ? 8.369   76.456  12.238  1.00 47.87 ? 118 GLU B CA  1 
ATOM   4070  C C   . GLU B 1 80  ? 7.030   75.926  12.797  1.00 47.92 ? 118 GLU B C   1 
ATOM   4071  O O   . GLU B 1 80  ? 6.100   75.607  12.045  1.00 47.98 ? 118 GLU B O   1 
ATOM   4072  C CB  . GLU B 1 80  ? 8.576   76.086  10.758  1.00 48.09 ? 118 GLU B CB  1 
ATOM   4073  C CG  . GLU B 1 80  ? 9.602   76.977  10.028  1.00 50.09 ? 118 GLU B CG  1 
ATOM   4074  C CD  . GLU B 1 80  ? 11.057  76.502  10.162  1.00 52.63 ? 118 GLU B CD  1 
ATOM   4075  O OE1 . GLU B 1 80  ? 11.353  75.340  9.794   1.00 53.70 ? 118 GLU B OE1 1 
ATOM   4076  O OE2 . GLU B 1 80  ? 11.912  77.306  10.607  1.00 53.43 ? 118 GLU B OE2 1 
ATOM   4077  N N   . ASN B 1 81  ? 6.968   75.829  14.128  1.00 47.77 ? 119 ASN B N   1 
ATOM   4078  C CA  . ASN B 1 81  ? 5.734   75.565  14.870  1.00 47.59 ? 119 ASN B CA  1 
ATOM   4079  C C   . ASN B 1 81  ? 5.806   76.300  16.224  1.00 47.60 ? 119 ASN B C   1 
ATOM   4080  O O   . ASN B 1 81  ? 6.340   75.777  17.199  1.00 47.62 ? 119 ASN B O   1 
ATOM   4081  C CB  . ASN B 1 81  ? 5.500   74.056  15.057  1.00 47.20 ? 119 ASN B CB  1 
ATOM   4082  C CG  . ASN B 1 81  ? 4.073   73.733  15.497  1.00 47.02 ? 119 ASN B CG  1 
ATOM   4083  O OD1 . ASN B 1 81  ? 3.477   74.452  16.290  1.00 47.71 ? 119 ASN B OD1 1 
ATOM   4084  N ND2 . ASN B 1 81  ? 3.522   72.654  14.973  1.00 46.12 ? 119 ASN B ND2 1 
ATOM   4085  N N   . ALA B 1 82  ? 5.287   77.525  16.255  1.00 47.58 ? 120 ALA B N   1 
ATOM   4086  C CA  . ALA B 1 82  ? 5.308   78.366  17.458  1.00 47.78 ? 120 ALA B CA  1 
ATOM   4087  C C   . ALA B 1 82  ? 4.497   77.775  18.608  1.00 47.83 ? 120 ALA B C   1 
ATOM   4088  O O   . ALA B 1 82  ? 4.820   78.027  19.763  1.00 48.51 ? 120 ALA B O   1 
ATOM   4089  C CB  . ALA B 1 82  ? 4.802   79.792  17.138  1.00 47.29 ? 120 ALA B CB  1 
ATOM   4090  N N   . GLU B 1 83  ? 3.441   77.018  18.299  1.00 47.89 ? 121 GLU B N   1 
ATOM   4091  C CA  . GLU B 1 83  ? 2.593   76.400  19.330  1.00 48.21 ? 121 GLU B CA  1 
ATOM   4092  C C   . GLU B 1 83  ? 3.289   75.226  20.045  1.00 48.55 ? 121 GLU B C   1 
ATOM   4093  O O   . GLU B 1 83  ? 3.002   74.948  21.209  1.00 48.98 ? 121 GLU B O   1 
ATOM   4094  C CB  . GLU B 1 83  ? 1.264   75.954  18.720  1.00 48.14 ? 121 GLU B CB  1 
ATOM   4095  C CG  . GLU B 1 83  ? 0.392   75.068  19.606  1.00 48.97 ? 121 GLU B CG  1 
ATOM   4096  C CD  . GLU B 1 83  ? -0.034  75.720  20.917  1.00 49.55 ? 121 GLU B CD  1 
ATOM   4097  O OE1 . GLU B 1 83  ? 0.021   76.962  21.054  1.00 52.09 ? 121 GLU B OE1 1 
ATOM   4098  O OE2 . GLU B 1 83  ? -0.463  74.973  21.815  1.00 49.93 ? 121 GLU B OE2 1 
ATOM   4099  N N   . PHE B 1 84  ? 4.197   74.542  19.353  1.00 48.86 ? 122 PHE B N   1 
ATOM   4100  C CA  . PHE B 1 84  ? 5.007   73.489  19.966  1.00 48.93 ? 122 PHE B CA  1 
ATOM   4101  C C   . PHE B 1 84  ? 6.046   74.085  20.923  1.00 48.68 ? 122 PHE B C   1 
ATOM   4102  O O   . PHE B 1 84  ? 6.405   73.473  21.927  1.00 48.29 ? 122 PHE B O   1 
ATOM   4103  C CB  . PHE B 1 84  ? 5.697   72.691  18.869  1.00 49.55 ? 122 PHE B CB  1 
ATOM   4104  C CG  . PHE B 1 84  ? 6.725   71.723  19.364  1.00 49.86 ? 122 PHE B CG  1 
ATOM   4105  C CD1 . PHE B 1 84  ? 8.014   72.157  19.664  1.00 50.62 ? 122 PHE B CD1 1 
ATOM   4106  C CD2 . PHE B 1 84  ? 6.423   70.374  19.494  1.00 50.39 ? 122 PHE B CD2 1 
ATOM   4107  C CE1 . PHE B 1 84  ? 8.979   71.271  20.104  1.00 51.09 ? 122 PHE B CE1 1 
ATOM   4108  C CE2 . PHE B 1 84  ? 7.383   69.478  19.939  1.00 50.97 ? 122 PHE B CE2 1 
ATOM   4109  C CZ  . PHE B 1 84  ? 8.669   69.927  20.236  1.00 51.03 ? 122 PHE B CZ  1 
ATOM   4110  N N   . GLU B 1 85  ? 6.543   75.275  20.596  1.00 48.38 ? 123 GLU B N   1 
ATOM   4111  C CA  . GLU B 1 85  ? 7.469   75.980  21.479  1.00 48.03 ? 123 GLU B CA  1 
ATOM   4112  C C   . GLU B 1 85  ? 6.746   76.369  22.764  1.00 47.25 ? 123 GLU B C   1 
ATOM   4113  O O   . GLU B 1 85  ? 7.279   76.252  23.872  1.00 46.68 ? 123 GLU B O   1 
ATOM   4114  C CB  . GLU B 1 85  ? 8.027   77.223  20.781  1.00 48.21 ? 123 GLU B CB  1 
ATOM   4115  C CG  . GLU B 1 85  ? 9.052   77.994  21.620  1.00 48.82 ? 123 GLU B CG  1 
ATOM   4116  C CD  . GLU B 1 85  ? 10.164  78.601  20.779  1.00 49.65 ? 123 GLU B CD  1 
ATOM   4117  O OE1 . GLU B 1 85  ? 11.017  77.809  20.262  1.00 49.17 ? 123 GLU B OE1 1 
ATOM   4118  O OE2 . GLU B 1 85  ? 10.184  79.859  20.659  1.00 47.58 ? 123 GLU B OE2 1 
ATOM   4119  N N   . ARG B 1 86  ? 5.510   76.807  22.576  1.00 46.47 ? 124 ARG B N   1 
ATOM   4120  C CA  . ARG B 1 86  ? 4.650   77.243  23.646  1.00 46.21 ? 124 ARG B CA  1 
ATOM   4121  C C   . ARG B 1 86  ? 4.365   76.108  24.634  1.00 45.34 ? 124 ARG B C   1 
ATOM   4122  O O   . ARG B 1 86  ? 4.383   76.326  25.843  1.00 45.39 ? 124 ARG B O   1 
ATOM   4123  C CB  . ARG B 1 86  ? 3.339   77.773  23.054  1.00 46.43 ? 124 ARG B CB  1 
ATOM   4124  C CG  . ARG B 1 86  ? 2.504   78.611  24.003  1.00 47.11 ? 124 ARG B CG  1 
ATOM   4125  C CD  . ARG B 1 86  ? 1.010   78.288  23.879  1.00 48.68 ? 124 ARG B CD  1 
ATOM   4126  N NE  . ARG B 1 86  ? 0.699   76.976  24.458  1.00 48.82 ? 124 ARG B NE  1 
ATOM   4127  C CZ  . ARG B 1 86  ? 0.532   76.731  25.762  1.00 49.44 ? 124 ARG B CZ  1 
ATOM   4128  N NH1 . ARG B 1 86  ? 0.269   75.484  26.163  1.00 49.08 ? 124 ARG B NH1 1 
ATOM   4129  N NH2 . ARG B 1 86  ? 0.627   77.711  26.669  1.00 49.40 ? 124 ARG B NH2 1 
ATOM   4130  N N   . GLN B 1 87  ? 4.091   74.909  24.124  1.00 44.21 ? 125 GLN B N   1 
ATOM   4131  C CA  . GLN B 1 87  ? 3.722   73.783  24.993  1.00 43.16 ? 125 GLN B CA  1 
ATOM   4132  C C   . GLN B 1 87  ? 4.930   73.171  25.695  1.00 42.12 ? 125 GLN B C   1 
ATOM   4133  O O   . GLN B 1 87  ? 4.816   72.621  26.789  1.00 41.35 ? 125 GLN B O   1 
ATOM   4134  C CB  . GLN B 1 87  ? 3.000   72.701  24.196  1.00 43.09 ? 125 GLN B CB  1 
ATOM   4135  C CG  . GLN B 1 87  ? 1.531   72.994  23.976  1.00 42.46 ? 125 GLN B CG  1 
ATOM   4136  C CD  . GLN B 1 87  ? 0.863   71.925  23.137  1.00 42.20 ? 125 GLN B CD  1 
ATOM   4137  O OE1 . GLN B 1 87  ? 1.115   70.727  23.324  1.00 40.06 ? 125 GLN B OE1 1 
ATOM   4138  N NE2 . GLN B 1 87  ? 0.010   72.350  22.204  1.00 39.71 ? 125 GLN B NE2 1 
ATOM   4139  N N   . TYR B 1 88  ? 6.084   73.252  25.043  1.00 41.13 ? 126 TYR B N   1 
ATOM   4140  C CA  . TYR B 1 88  ? 7.318   72.725  25.603  1.00 40.32 ? 126 TYR B CA  1 
ATOM   4141  C C   . TYR B 1 88  ? 7.821   73.550  26.790  1.00 39.69 ? 126 TYR B C   1 
ATOM   4142  O O   . TYR B 1 88  ? 8.081   73.004  27.866  1.00 38.71 ? 126 TYR B O   1 
ATOM   4143  C CB  . TYR B 1 88  ? 8.389   72.663  24.527  1.00 40.29 ? 126 TYR B CB  1 
ATOM   4144  C CG  . TYR B 1 88  ? 9.724   72.228  25.060  1.00 39.98 ? 126 TYR B CG  1 
ATOM   4145  C CD1 . TYR B 1 88  ? 9.881   70.973  25.661  1.00 39.64 ? 126 TYR B CD1 1 
ATOM   4146  C CD2 . TYR B 1 88  ? 10.835  73.072  24.979  1.00 40.30 ? 126 TYR B CD2 1 
ATOM   4147  C CE1 . TYR B 1 88  ? 11.100  70.570  26.162  1.00 39.76 ? 126 TYR B CE1 1 
ATOM   4148  C CE2 . TYR B 1 88  ? 12.069  72.676  25.487  1.00 41.02 ? 126 TYR B CE2 1 
ATOM   4149  C CZ  . TYR B 1 88  ? 12.198  71.422  26.070  1.00 40.60 ? 126 TYR B CZ  1 
ATOM   4150  O OH  . TYR B 1 88  ? 13.430  71.034  26.559  1.00 40.14 ? 126 TYR B OH  1 
ATOM   4151  N N   . LEU B 1 89  ? 7.948   74.859  26.570  1.00 39.45 ? 127 LEU B N   1 
ATOM   4152  C CA  . LEU B 1 89  ? 8.456   75.790  27.586  1.00 39.45 ? 127 LEU B CA  1 
ATOM   4153  C C   . LEU B 1 89  ? 7.486   75.942  28.763  1.00 38.85 ? 127 LEU B C   1 
ATOM   4154  O O   . LEU B 1 89  ? 7.932   76.150  29.896  1.00 39.18 ? 127 LEU B O   1 
ATOM   4155  C CB  . LEU B 1 89  ? 8.827   77.147  26.955  1.00 39.37 ? 127 LEU B CB  1 
ATOM   4156  C CG  . LEU B 1 89  ? 9.936   77.026  25.884  1.00 40.81 ? 127 LEU B CG  1 
ATOM   4157  C CD1 . LEU B 1 89  ? 9.907   78.175  24.868  1.00 42.00 ? 127 LEU B CD1 1 
ATOM   4158  C CD2 . LEU B 1 89  ? 11.316  76.920  26.522  1.00 40.94 ? 127 LEU B CD2 1 
ATOM   4159  N N   . SER B 1 90  ? 6.181   75.787  28.509  1.00 38.25 ? 128 SER B N   1 
ATOM   4160  C CA  . SER B 1 90  ? 5.178   75.836  29.574  1.00 37.74 ? 128 SER B CA  1 
ATOM   4161  C C   . SER B 1 90  ? 5.101   74.556  30.415  1.00 37.87 ? 128 SER B C   1 
ATOM   4162  O O   . SER B 1 90  ? 4.602   74.585  31.536  1.00 37.80 ? 128 SER B O   1 
ATOM   4163  C CB  . SER B 1 90  ? 3.784   76.276  29.043  1.00 37.59 ? 128 SER B CB  1 
ATOM   4164  O OG  . SER B 1 90  ? 3.029   75.262  28.396  1.00 36.23 ? 128 SER B OG  1 
ATOM   4165  N N   . GLY B 1 91  ? 5.618   73.446  29.903  1.00 38.11 ? 129 GLY B N   1 
ATOM   4166  C CA  . GLY B 1 91  ? 5.590   72.167  30.626  1.00 38.45 ? 129 GLY B CA  1 
ATOM   4167  C C   . GLY B 1 91  ? 4.345   71.333  30.368  1.00 38.89 ? 129 GLY B C   1 
ATOM   4168  O O   . GLY B 1 91  ? 3.948   70.523  31.202  1.00 38.57 ? 129 GLY B O   1 
ATOM   4169  N N   . GLU B 1 92  ? 3.732   71.547  29.201  1.00 39.72 ? 130 GLU B N   1 
ATOM   4170  C CA  . GLU B 1 92  ? 2.551   70.809  28.740  1.00 39.76 ? 130 GLU B CA  1 
ATOM   4171  C C   . GLU B 1 92  ? 2.977   69.689  27.816  1.00 39.78 ? 130 GLU B C   1 
ATOM   4172  O O   . GLU B 1 92  ? 2.301   68.663  27.747  1.00 40.57 ? 130 GLU B O   1 
ATOM   4173  C CB  . GLU B 1 92  ? 1.592   71.741  27.981  1.00 40.03 ? 130 GLU B CB  1 
ATOM   4174  N N   . LEU B 1 93  ? 4.099   69.886  27.116  1.00 39.44 ? 131 LEU B N   1 
ATOM   4175  C CA  . LEU B 1 93  ? 4.642   68.900  26.167  1.00 38.78 ? 131 LEU B CA  1 
ATOM   4176  C C   . LEU B 1 93  ? 6.003   68.358  26.597  1.00 38.74 ? 131 LEU B C   1 
ATOM   4177  O O   . LEU B 1 93  ? 6.885   69.130  26.964  1.00 39.47 ? 131 LEU B O   1 
ATOM   4178  C CB  . LEU B 1 93  ? 4.774   69.548  24.777  1.00 38.39 ? 131 LEU B CB  1 
ATOM   4179  C CG  . LEU B 1 93  ? 4.952   68.653  23.550  1.00 39.08 ? 131 LEU B CG  1 
ATOM   4180  C CD1 . LEU B 1 93  ? 3.811   67.647  23.405  1.00 37.57 ? 131 LEU B CD1 1 
ATOM   4181  C CD2 . LEU B 1 93  ? 5.071   69.538  22.327  1.00 38.69 ? 131 LEU B CD2 1 
ATOM   4182  N N   . GLU B 1 94  ? 6.165   67.030  26.530  1.00 38.02 ? 132 GLU B N   1 
ATOM   4183  C CA  . GLU B 1 94  ? 7.458   66.371  26.650  1.00 37.24 ? 132 GLU B CA  1 
ATOM   4184  C C   . GLU B 1 94  ? 8.117   66.288  25.253  1.00 36.98 ? 132 GLU B C   1 
ATOM   4185  O O   . GLU B 1 94  ? 7.458   65.956  24.280  1.00 35.90 ? 132 GLU B O   1 
ATOM   4186  C CB  . GLU B 1 94  ? 7.281   64.954  27.233  1.00 37.29 ? 132 GLU B CB  1 
ATOM   4187  C CG  . GLU B 1 94  ? 6.494   64.893  28.556  1.00 37.41 ? 132 GLU B CG  1 
ATOM   4188  C CD  . GLU B 1 94  ? 6.114   63.472  29.029  1.00 37.15 ? 132 GLU B CD  1 
ATOM   4189  O OE1 . GLU B 1 94  ? 6.473   62.461  28.389  1.00 40.55 ? 132 GLU B OE1 1 
ATOM   4190  O OE2 . GLU B 1 94  ? 5.446   63.364  30.075  1.00 40.19 ? 132 GLU B OE2 1 
ATOM   4191  N N   . VAL B 1 95  ? 9.412   66.581  25.158  1.00 36.68 ? 133 VAL B N   1 
ATOM   4192  C CA  . VAL B 1 95  ? 10.123  66.578  23.877  1.00 36.99 ? 133 VAL B CA  1 
ATOM   4193  C C   . VAL B 1 95  ? 11.495  65.905  23.965  1.00 37.24 ? 133 VAL B C   1 
ATOM   4194  O O   . VAL B 1 95  ? 12.376  66.401  24.683  1.00 36.61 ? 133 VAL B O   1 
ATOM   4195  C CB  . VAL B 1 95  ? 10.361  68.017  23.356  1.00 37.36 ? 133 VAL B CB  1 
ATOM   4196  C CG1 . VAL B 1 95  ? 11.170  67.984  22.058  1.00 35.34 ? 133 VAL B CG1 1 
ATOM   4197  C CG2 . VAL B 1 95  ? 9.036   68.774  23.209  1.00 36.07 ? 133 VAL B CG2 1 
ATOM   4198  N N   . GLU B 1 96  ? 11.646  64.802  23.220  1.00 37.71 ? 134 GLU B N   1 
ATOM   4199  C CA  . GLU B 1 96  ? 12.917  64.104  22.985  1.00 38.68 ? 134 GLU B CA  1 
ATOM   4200  C C   . GLU B 1 96  ? 13.488  64.424  21.581  1.00 38.77 ? 134 GLU B C   1 
ATOM   4201  O O   . GLU B 1 96  ? 13.001  63.908  20.585  1.00 38.28 ? 134 GLU B O   1 
ATOM   4202  C CB  . GLU B 1 96  ? 12.706  62.589  22.970  1.00 39.05 ? 134 GLU B CB  1 
ATOM   4203  C CG  . GLU B 1 96  ? 12.636  61.826  24.253  1.00 40.05 ? 134 GLU B CG  1 
ATOM   4204  C CD  . GLU B 1 96  ? 12.495  60.310  23.977  1.00 40.86 ? 134 GLU B CD  1 
ATOM   4205  O OE1 . GLU B 1 96  ? 11.520  59.672  24.474  1.00 44.73 ? 134 GLU B OE1 1 
ATOM   4206  O OE2 . GLU B 1 96  ? 13.359  59.749  23.254  1.00 46.83 ? 134 GLU B OE2 1 
ATOM   4207  N N   . LEU B 1 97  ? 14.526  65.251  21.513  1.00 38.71 ? 135 LEU B N   1 
ATOM   4208  C CA  . LEU B 1 97  ? 15.181  65.573  20.261  1.00 38.99 ? 135 LEU B CA  1 
ATOM   4209  C C   . LEU B 1 97  ? 16.241  64.511  20.043  1.00 38.45 ? 135 LEU B C   1 
ATOM   4210  O O   . LEU B 1 97  ? 16.968  64.186  20.978  1.00 39.03 ? 135 LEU B O   1 
ATOM   4211  C CB  . LEU B 1 97  ? 15.827  66.965  20.309  1.00 39.28 ? 135 LEU B CB  1 
ATOM   4212  C CG  . LEU B 1 97  ? 14.876  68.138  20.189  1.00 40.70 ? 135 LEU B CG  1 
ATOM   4213  C CD1 . LEU B 1 97  ? 15.527  69.450  20.635  1.00 41.43 ? 135 LEU B CD1 1 
ATOM   4214  C CD2 . LEU B 1 97  ? 14.349  68.192  18.737  1.00 43.63 ? 135 LEU B CD2 1 
ATOM   4215  N N   . THR B 1 98  ? 16.294  63.948  18.838  1.00 37.26 ? 136 THR B N   1 
ATOM   4216  C CA  . THR B 1 98  ? 17.227  62.878  18.509  1.00 36.58 ? 136 THR B CA  1 
ATOM   4217  C C   . THR B 1 98  ? 17.774  63.138  17.107  1.00 35.05 ? 136 THR B C   1 
ATOM   4218  O O   . THR B 1 98  ? 17.021  63.610  16.267  1.00 33.87 ? 136 THR B O   1 
ATOM   4219  C CB  . THR B 1 98  ? 16.514  61.491  18.594  1.00 37.78 ? 136 THR B CB  1 
ATOM   4220  O OG1 . THR B 1 98  ? 17.464  60.419  18.354  1.00 39.07 ? 136 THR B OG1 1 
ATOM   4221  C CG2 . THR B 1 98  ? 15.386  61.383  17.628  1.00 36.46 ? 136 THR B CG2 1 
ATOM   4222  N N   . PRO B 1 99  ? 19.105  62.924  16.852  1.00 33.59 ? 137 PRO B N   1 
ATOM   4223  C CA  . PRO B 1 99  ? 19.543  63.203  15.481  1.00 33.24 ? 137 PRO B CA  1 
ATOM   4224  C C   . PRO B 1 99  ? 18.678  62.488  14.454  1.00 33.08 ? 137 PRO B C   1 
ATOM   4225  O O   . PRO B 1 99  ? 18.169  61.409  14.719  1.00 31.82 ? 137 PRO B O   1 
ATOM   4226  C CB  . PRO B 1 99  ? 20.992  62.732  15.474  1.00 33.98 ? 137 PRO B CB  1 
ATOM   4227  C CG  . PRO B 1 99  ? 21.412  62.920  16.901  1.00 32.80 ? 137 PRO B CG  1 
ATOM   4228  C CD  . PRO B 1 99  ? 20.239  62.576  17.715  1.00 32.91 ? 137 PRO B CD  1 
ATOM   4229  N N   . GLN B 1 100 ? 18.466  63.133  13.313  1.00 33.92 ? 138 GLN B N   1 
ATOM   4230  C CA  . GLN B 1 100 ? 17.586  62.608  12.261  1.00 33.95 ? 138 GLN B CA  1 
ATOM   4231  C C   . GLN B 1 100 ? 17.973  61.204  11.783  1.00 33.69 ? 138 GLN B C   1 
ATOM   4232  O O   . GLN B 1 100 ? 17.103  60.338  11.622  1.00 33.05 ? 138 GLN B O   1 
ATOM   4233  C CB  . GLN B 1 100 ? 17.546  63.548  11.044  1.00 34.34 ? 138 GLN B CB  1 
ATOM   4234  C CG  . GLN B 1 100 ? 16.413  63.191  10.088  1.00 34.54 ? 138 GLN B CG  1 
ATOM   4235  C CD  . GLN B 1 100 ? 16.284  64.130  8.910   1.00 35.37 ? 138 GLN B CD  1 
ATOM   4236  O OE1 . GLN B 1 100 ? 16.023  63.680  7.815   1.00 41.00 ? 138 GLN B OE1 1 
ATOM   4237  N NE2 . GLN B 1 100 ? 16.511  65.407  9.115   1.00 36.56 ? 138 GLN B NE2 1 
ATOM   4238  N N   . GLY B 1 101 ? 19.266  61.006  11.556  1.00 33.07 ? 139 GLY B N   1 
ATOM   4239  C CA  . GLY B 1 101 ? 19.789  59.709  11.110  1.00 34.14 ? 139 GLY B CA  1 
ATOM   4240  C C   . GLY B 1 101 ? 19.743  58.647  12.191  1.00 33.28 ? 139 GLY B C   1 
ATOM   4241  O O   . GLY B 1 101 ? 19.562  57.499  11.914  1.00 34.33 ? 139 GLY B O   1 
ATOM   4242  N N   . THR B 1 102 ? 19.884  59.068  13.437  1.00 33.36 ? 140 THR B N   1 
ATOM   4243  C CA  . THR B 1 102 ? 19.629  58.221  14.591  1.00 32.28 ? 140 THR B CA  1 
ATOM   4244  C C   . THR B 1 102 ? 18.146  57.874  14.699  1.00 32.72 ? 140 THR B C   1 
ATOM   4245  O O   . THR B 1 102 ? 17.757  56.715  14.931  1.00 33.48 ? 140 THR B O   1 
ATOM   4246  C CB  . THR B 1 102 ? 20.190  58.901  15.835  1.00 32.78 ? 140 THR B CB  1 
ATOM   4247  O OG1 . THR B 1 102 ? 21.602  58.856  15.700  1.00 27.76 ? 140 THR B OG1 1 
ATOM   4248  C CG2 . THR B 1 102 ? 19.753  58.194  17.181  1.00 31.74 ? 140 THR B CG2 1 
ATOM   4249  N N   . LEU B 1 103 ? 17.303  58.853  14.458  1.00 32.87 ? 141 LEU B N   1 
ATOM   4250  C CA  . LEU B 1 103 ? 15.877  58.600  14.415  1.00 32.64 ? 141 LEU B CA  1 
ATOM   4251  C C   . LEU B 1 103 ? 15.527  57.535  13.390  1.00 32.41 ? 141 LEU B C   1 
ATOM   4252  O O   . LEU B 1 103 ? 14.895  56.540  13.736  1.00 33.11 ? 141 LEU B O   1 
ATOM   4253  C CB  . LEU B 1 103 ? 15.105  59.900  14.180  1.00 32.88 ? 141 LEU B CB  1 
ATOM   4254  C CG  . LEU B 1 103 ? 13.585  59.840  14.370  1.00 34.55 ? 141 LEU B CG  1 
ATOM   4255  C CD1 . LEU B 1 103 ? 13.236  59.395  15.764  1.00 33.71 ? 141 LEU B CD1 1 
ATOM   4256  C CD2 . LEU B 1 103 ? 13.009  61.237  14.058  1.00 32.66 ? 141 LEU B CD2 1 
ATOM   4257  N N   . ALA B 1 104 ? 15.947  57.724  12.138  1.00 32.79 ? 142 ALA B N   1 
ATOM   4258  C CA  . ALA B 1 104 ? 15.758  56.721  11.046  1.00 32.42 ? 142 ALA B CA  1 
ATOM   4259  C C   . ALA B 1 104 ? 16.314  55.326  11.355  1.00 32.83 ? 142 ALA B C   1 
ATOM   4260  O O   . ALA B 1 104 ? 15.664  54.320  11.104  1.00 32.14 ? 142 ALA B O   1 
ATOM   4261  C CB  . ALA B 1 104 ? 16.393  57.251  9.721   1.00 31.39 ? 142 ALA B CB  1 
ATOM   4262  N N   . GLU B 1 105 ? 17.556  55.258  11.841  1.00 33.89 ? 143 GLU B N   1 
ATOM   4263  C CA  . GLU B 1 105 ? 18.143  53.960  12.170  1.00 34.26 ? 143 GLU B CA  1 
ATOM   4264  C C   . GLU B 1 105 ? 17.501  53.261  13.347  1.00 34.58 ? 143 GLU B C   1 
ATOM   4265  O O   . GLU B 1 105 ? 17.412  52.019  13.331  1.00 35.17 ? 143 GLU B O   1 
ATOM   4266  C CB  . GLU B 1 105 ? 19.671  54.052  12.370  1.00 35.65 ? 143 GLU B CB  1 
ATOM   4267  C CG  . GLU B 1 105 ? 20.400  52.666  12.307  1.00 37.39 ? 143 GLU B CG  1 
ATOM   4268  C CD  . GLU B 1 105 ? 19.957  51.820  11.071  1.00 44.39 ? 143 GLU B CD  1 
ATOM   4269  O OE1 . GLU B 1 105 ? 19.729  50.575  11.199  1.00 43.71 ? 143 GLU B OE1 1 
ATOM   4270  O OE2 . GLU B 1 105 ? 19.740  52.430  9.983   1.00 46.94 ? 143 GLU B OE2 1 
ATOM   4271  N N   . ARG B 1 106 ? 17.049  54.015  14.356  1.00 33.82 ? 144 ARG B N   1 
ATOM   4272  C CA  . ARG B 1 106 ? 16.362  53.419  15.489  1.00 34.52 ? 144 ARG B CA  1 
ATOM   4273  C C   . ARG B 1 106 ? 15.059  52.752  15.134  1.00 34.39 ? 144 ARG B C   1 
ATOM   4274  O O   . ARG B 1 106 ? 14.762  51.659  15.634  1.00 34.63 ? 144 ARG B O   1 
ATOM   4275  C CB  . ARG B 1 106 ? 16.150  54.440  16.601  1.00 33.54 ? 144 ARG B CB  1 
ATOM   4276  C CG  . ARG B 1 106 ? 17.470  54.778  17.327  1.00 35.86 ? 144 ARG B CG  1 
ATOM   4277  C CD  . ARG B 1 106 ? 17.353  55.950  18.278  1.00 34.18 ? 144 ARG B CD  1 
ATOM   4278  N NE  . ARG B 1 106 ? 16.475  55.622  19.381  1.00 35.96 ? 144 ARG B NE  1 
ATOM   4279  C CZ  . ARG B 1 106 ? 16.037  56.492  20.293  1.00 35.15 ? 144 ARG B CZ  1 
ATOM   4280  N NH1 . ARG B 1 106 ? 16.397  57.756  20.256  1.00 35.23 ? 144 ARG B NH1 1 
ATOM   4281  N NH2 . ARG B 1 106 ? 15.234  56.073  21.244  1.00 31.78 ? 144 ARG B NH2 1 
ATOM   4282  N N   . ILE B 1 107 ? 14.277  53.431  14.312  1.00 34.59 ? 145 ILE B N   1 
ATOM   4283  C CA  . ILE B 1 107 ? 13.000  52.922  13.780  1.00 34.67 ? 145 ILE B CA  1 
ATOM   4284  C C   . ILE B 1 107 ? 13.217  51.678  12.899  1.00 34.66 ? 145 ILE B C   1 
ATOM   4285  O O   . ILE B 1 107 ? 12.481  50.671  12.968  1.00 35.20 ? 145 ILE B O   1 
ATOM   4286  C CB  . ILE B 1 107 ? 12.302  54.036  12.922  1.00 35.11 ? 145 ILE B CB  1 
ATOM   4287  C CG1 . ILE B 1 107 ? 11.862  55.211  13.792  1.00 33.81 ? 145 ILE B CG1 1 
ATOM   4288  C CG2 . ILE B 1 107 ? 11.086  53.493  12.107  1.00 33.52 ? 145 ILE B CG2 1 
ATOM   4289  C CD1 . ILE B 1 107 ? 11.432  56.404  12.958  1.00 31.64 ? 145 ILE B CD1 1 
ATOM   4290  N N   . ARG B 1 108 ? 14.215  51.766  12.041  1.00 34.55 ? 146 ARG B N   1 
ATOM   4291  C CA  . ARG B 1 108 ? 14.610  50.617  11.224  1.00 34.66 ? 146 ARG B CA  1 
ATOM   4292  C C   . ARG B 1 108 ? 15.050  49.421  12.050  1.00 33.11 ? 146 ARG B C   1 
ATOM   4293  O O   . ARG B 1 108 ? 14.661  48.285  11.743  1.00 32.40 ? 146 ARG B O   1 
ATOM   4294  C CB  . ARG B 1 108 ? 15.743  50.994  10.279  1.00 35.15 ? 146 ARG B CB  1 
ATOM   4295  C CG  . ARG B 1 108 ? 15.908  49.980  9.170   1.00 38.85 ? 146 ARG B CG  1 
ATOM   4296  C CD  . ARG B 1 108 ? 17.310  49.683  8.908   1.00 42.84 ? 146 ARG B CD  1 
ATOM   4297  N NE  . ARG B 1 108 ? 17.467  48.410  8.220   1.00 48.10 ? 146 ARG B NE  1 
ATOM   4298  C CZ  . ARG B 1 108 ? 18.277  47.404  8.586   1.00 47.10 ? 146 ARG B CZ  1 
ATOM   4299  N NH1 . ARG B 1 108 ? 19.023  47.468  9.678   1.00 48.71 ? 146 ARG B NH1 1 
ATOM   4300  N NH2 . ARG B 1 108 ? 18.334  46.312  7.840   1.00 46.12 ? 146 ARG B NH2 1 
ATOM   4301  N N   . ALA B 1 109 ? 15.891  49.677  13.059  1.00 31.74 ? 147 ALA B N   1 
ATOM   4302  C CA  . ALA B 1 109 ? 16.342  48.652  13.979  1.00 31.52 ? 147 ALA B CA  1 
ATOM   4303  C C   . ALA B 1 109 ? 15.176  47.991  14.629  1.00 32.01 ? 147 ALA B C   1 
ATOM   4304  O O   . ALA B 1 109 ? 15.165  46.773  14.775  1.00 32.01 ? 147 ALA B O   1 
ATOM   4305  C CB  . ALA B 1 109 ? 17.290  49.231  15.053  1.00 31.14 ? 147 ALA B CB  1 
ATOM   4306  N N   . GLY B 1 110 ? 14.204  48.786  15.073  1.00 33.40 ? 148 GLY B N   1 
ATOM   4307  C CA  . GLY B 1 110 ? 13.018  48.256  15.745  1.00 34.10 ? 148 GLY B CA  1 
ATOM   4308  C C   . GLY B 1 110 ? 12.198  47.368  14.844  1.00 34.86 ? 148 GLY B C   1 
ATOM   4309  O O   . GLY B 1 110 ? 11.707  46.328  15.257  1.00 35.74 ? 148 GLY B O   1 
ATOM   4310  N N   . GLY B 1 111 ? 12.093  47.744  13.577  1.00 35.74 ? 149 GLY B N   1 
ATOM   4311  C CA  . GLY B 1 111 ? 11.491  46.846  12.593  1.00 36.37 ? 149 GLY B CA  1 
ATOM   4312  C C   . GLY B 1 111 ? 12.263  45.584  12.244  1.00 35.59 ? 149 GLY B C   1 
ATOM   4313  O O   . GLY B 1 111 ? 11.670  44.578  11.870  1.00 35.95 ? 149 GLY B O   1 
ATOM   4314  N N   . ALA B 1 112 ? 13.586  45.644  12.360  1.00 36.05 ? 150 ALA B N   1 
ATOM   4315  C CA  . ALA B 1 112 ? 14.487  44.556  11.985  1.00 34.47 ? 150 ALA B CA  1 
ATOM   4316  C C   . ALA B 1 112 ? 14.944  43.628  13.110  1.00 34.25 ? 150 ALA B C   1 
ATOM   4317  O O   . ALA B 1 112 ? 15.691  42.678  12.861  1.00 34.12 ? 150 ALA B O   1 
ATOM   4318  C CB  . ALA B 1 112 ? 15.677  45.108  11.257  1.00 34.50 ? 150 ALA B CB  1 
ATOM   4319  N N   . GLY B 1 113 ? 14.492  43.869  14.324  1.00 33.16 ? 151 GLY B N   1 
ATOM   4320  C CA  . GLY B 1 113 ? 14.713  42.970  15.447  1.00 32.27 ? 151 GLY B CA  1 
ATOM   4321  C C   . GLY B 1 113 ? 16.053  43.206  16.128  1.00 31.80 ? 151 GLY B C   1 
ATOM   4322  O O   . GLY B 1 113 ? 16.611  42.297  16.723  1.00 31.86 ? 151 GLY B O   1 
ATOM   4323  N N   . VAL B 1 114 ? 16.590  44.413  15.994  1.00 31.36 ? 152 VAL B N   1 
ATOM   4324  C CA  . VAL B 1 114 ? 17.936  44.744  16.464  1.00 31.57 ? 152 VAL B CA  1 
ATOM   4325  C C   . VAL B 1 114 ? 17.636  45.735  17.556  1.00 31.72 ? 152 VAL B C   1 
ATOM   4326  O O   . VAL B 1 114 ? 17.085  46.781  17.264  1.00 31.36 ? 152 VAL B O   1 
ATOM   4327  C CB  . VAL B 1 114 ? 18.831  45.411  15.363  1.00 31.64 ? 152 VAL B CB  1 
ATOM   4328  C CG1 . VAL B 1 114 ? 20.080  46.052  15.982  1.00 30.08 ? 152 VAL B CG1 1 
ATOM   4329  C CG2 . VAL B 1 114 ? 19.176  44.448  14.256  1.00 31.09 ? 152 VAL B CG2 1 
ATOM   4330  N N   . PRO B 1 115 ? 17.897  45.359  18.826  1.00 31.39 ? 153 PRO B N   1 
ATOM   4331  C CA  . PRO B 1 115 ? 17.472  46.168  19.932  1.00 30.98 ? 153 PRO B CA  1 
ATOM   4332  C C   . PRO B 1 115 ? 18.348  47.384  20.170  1.00 31.74 ? 153 PRO B C   1 
ATOM   4333  O O   . PRO B 1 115 ? 17.925  48.306  20.872  1.00 31.13 ? 153 PRO B O   1 
ATOM   4334  C CB  . PRO B 1 115 ? 17.559  45.203  21.112  1.00 30.94 ? 153 PRO B CB  1 
ATOM   4335  C CG  . PRO B 1 115 ? 18.659  44.275  20.720  1.00 31.73 ? 153 PRO B CG  1 
ATOM   4336  C CD  . PRO B 1 115 ? 18.483  44.085  19.269  1.00 30.54 ? 153 PRO B CD  1 
ATOM   4337  N N   . ALA B 1 116 ? 19.555  47.394  19.598  1.00 32.09 ? 154 ALA B N   1 
ATOM   4338  C CA  . ALA B 1 116 ? 20.491  48.508  19.826  1.00 31.45 ? 154 ALA B CA  1 
ATOM   4339  C C   . ALA B 1 116 ? 21.698  48.446  18.848  1.00 31.03 ? 154 ALA B C   1 
ATOM   4340  O O   . ALA B 1 116 ? 22.049  47.404  18.414  1.00 30.04 ? 154 ALA B O   1 
ATOM   4341  C CB  . ALA B 1 116 ? 20.930  48.550  21.276  1.00 28.41 ? 154 ALA B CB  1 
ATOM   4342  N N   . PHE B 1 117 ? 22.314  49.591  18.566  1.00 31.35 ? 155 PHE B N   1 
ATOM   4343  C CA  . PHE B 1 117 ? 23.391  49.698  17.598  1.00 32.02 ? 155 PHE B CA  1 
ATOM   4344  C C   . PHE B 1 117 ? 24.252  50.911  17.965  1.00 32.41 ? 155 PHE B C   1 
ATOM   4345  O O   . PHE B 1 117 ? 23.822  51.777  18.696  1.00 31.82 ? 155 PHE B O   1 
ATOM   4346  C CB  . PHE B 1 117 ? 22.832  49.828  16.160  1.00 31.79 ? 155 PHE B CB  1 
ATOM   4347  C CG  . PHE B 1 117 ? 22.074  51.097  15.938  1.00 31.16 ? 155 PHE B CG  1 
ATOM   4348  C CD1 . PHE B 1 117 ? 22.732  52.263  15.557  1.00 32.05 ? 155 PHE B CD1 1 
ATOM   4349  C CD2 . PHE B 1 117 ? 20.727  51.163  16.200  1.00 32.05 ? 155 PHE B CD2 1 
ATOM   4350  C CE1 . PHE B 1 117 ? 22.056  53.447  15.434  1.00 31.92 ? 155 PHE B CE1 1 
ATOM   4351  C CE2 . PHE B 1 117 ? 20.056  52.357  16.098  1.00 32.35 ? 155 PHE B CE2 1 
ATOM   4352  C CZ  . PHE B 1 117 ? 20.718  53.490  15.682  1.00 33.12 ? 155 PHE B CZ  1 
ATOM   4353  N N   . TYR B 1 118 ? 25.478  50.951  17.445  1.00 33.55 ? 156 TYR B N   1 
ATOM   4354  C CA  . TYR B 1 118 ? 26.388  52.046  17.734  1.00 33.59 ? 156 TYR B CA  1 
ATOM   4355  C C   . TYR B 1 118 ? 26.383  53.003  16.521  1.00 33.57 ? 156 TYR B C   1 
ATOM   4356  O O   . TYR B 1 118 ? 26.260  52.560  15.392  1.00 34.64 ? 156 TYR B O   1 
ATOM   4357  C CB  . TYR B 1 118 ? 27.777  51.518  18.096  1.00 34.17 ? 156 TYR B CB  1 
ATOM   4358  C CG  . TYR B 1 118 ? 27.873  50.948  19.514  1.00 35.88 ? 156 TYR B CG  1 
ATOM   4359  C CD1 . TYR B 1 118 ? 28.182  51.777  20.613  1.00 34.92 ? 156 TYR B CD1 1 
ATOM   4360  C CD2 . TYR B 1 118 ? 27.641  49.580  19.771  1.00 34.98 ? 156 TYR B CD2 1 
ATOM   4361  C CE1 . TYR B 1 118 ? 28.282  51.247  21.914  1.00 35.08 ? 156 TYR B CE1 1 
ATOM   4362  C CE2 . TYR B 1 118 ? 27.735  49.058  21.087  1.00 35.18 ? 156 TYR B CE2 1 
ATOM   4363  C CZ  . TYR B 1 118 ? 28.056  49.905  22.125  1.00 34.45 ? 156 TYR B CZ  1 
ATOM   4364  O OH  . TYR B 1 118 ? 28.128  49.431  23.382  1.00 38.35 ? 156 TYR B OH  1 
ATOM   4365  N N   . THR B 1 119 ? 26.377  54.315  16.794  1.00 33.95 ? 157 THR B N   1 
ATOM   4366  C CA  . THR B 1 119 ? 26.460  55.354  15.794  1.00 33.31 ? 157 THR B CA  1 
ATOM   4367  C C   . THR B 1 119 ? 27.462  56.373  16.265  1.00 33.83 ? 157 THR B C   1 
ATOM   4368  O O   . THR B 1 119 ? 27.537  56.640  17.461  1.00 33.16 ? 157 THR B O   1 
ATOM   4369  C CB  . THR B 1 119 ? 25.099  56.040  15.509  1.00 34.08 ? 157 THR B CB  1 
ATOM   4370  O OG1 . THR B 1 119 ? 25.299  57.095  14.552  1.00 33.11 ? 157 THR B OG1 1 
ATOM   4371  C CG2 . THR B 1 119 ? 24.450  56.618  16.771  1.00 32.89 ? 157 THR B CG2 1 
ATOM   4372  N N   . PRO B 1 120 ? 28.259  56.944  15.331  1.00 34.01 ? 158 PRO B N   1 
ATOM   4373  C CA  . PRO B 1 120 ? 29.190  58.023  15.703  1.00 33.68 ? 158 PRO B CA  1 
ATOM   4374  C C   . PRO B 1 120 ? 28.508  59.347  15.963  1.00 33.84 ? 158 PRO B C   1 
ATOM   4375  O O   . PRO B 1 120 ? 29.112  60.292  16.492  1.00 32.96 ? 158 PRO B O   1 
ATOM   4376  C CB  . PRO B 1 120 ? 30.105  58.127  14.488  1.00 33.52 ? 158 PRO B CB  1 
ATOM   4377  C CG  . PRO B 1 120 ? 29.247  57.635  13.332  1.00 34.46 ? 158 PRO B CG  1 
ATOM   4378  C CD  . PRO B 1 120 ? 28.353  56.597  13.898  1.00 34.26 ? 158 PRO B CD  1 
ATOM   4379  N N   . THR B 1 121 ? 27.241  59.398  15.581  1.00 34.61 ? 159 THR B N   1 
ATOM   4380  C CA  . THR B 1 121 ? 26.446  60.588  15.621  1.00 34.21 ? 159 THR B CA  1 
ATOM   4381  C C   . THR B 1 121 ? 25.992  60.953  17.033  1.00 34.91 ? 159 THR B C   1 
ATOM   4382  O O   . THR B 1 121 ? 25.271  60.173  17.694  1.00 35.38 ? 159 THR B O   1 
ATOM   4383  C CB  . THR B 1 121 ? 25.213  60.406  14.705  1.00 34.43 ? 159 THR B CB  1 
ATOM   4384  O OG1 . THR B 1 121 ? 25.662  60.101  13.375  1.00 33.12 ? 159 THR B OG1 1 
ATOM   4385  C CG2 . THR B 1 121 ? 24.379  61.696  14.655  1.00 33.12 ? 159 THR B CG2 1 
ATOM   4386  N N   . GLY B 1 122 ? 26.353  62.172  17.455  1.00 34.93 ? 160 GLY B N   1 
ATOM   4387  C CA  . GLY B 1 122 ? 26.043  62.648  18.781  1.00 34.30 ? 160 GLY B CA  1 
ATOM   4388  C C   . GLY B 1 122 ? 27.163  62.498  19.781  1.00 34.45 ? 160 GLY B C   1 
ATOM   4389  O O   . GLY B 1 122 ? 27.051  62.981  20.901  1.00 34.05 ? 160 GLY B O   1 
ATOM   4390  N N   . TYR B 1 123 ? 28.241  61.814  19.395  1.00 34.40 ? 161 TYR B N   1 
ATOM   4391  C CA  . TYR B 1 123 ? 29.389  61.651  20.290  1.00 34.55 ? 161 TYR B CA  1 
ATOM   4392  C C   . TYR B 1 123 ? 30.019  63.031  20.540  1.00 34.28 ? 161 TYR B C   1 
ATOM   4393  O O   . TYR B 1 123 ? 30.189  63.813  19.613  1.00 34.95 ? 161 TYR B O   1 
ATOM   4394  C CB  . TYR B 1 123 ? 30.427  60.655  19.728  1.00 34.10 ? 161 TYR B CB  1 
ATOM   4395  C CG  . TYR B 1 123 ? 31.742  60.802  20.443  1.00 34.82 ? 161 TYR B CG  1 
ATOM   4396  C CD1 . TYR B 1 123 ? 31.909  60.313  21.740  1.00 34.54 ? 161 TYR B CD1 1 
ATOM   4397  C CD2 . TYR B 1 123 ? 32.811  61.481  19.852  1.00 35.03 ? 161 TYR B CD2 1 
ATOM   4398  C CE1 . TYR B 1 123 ? 33.098  60.484  22.429  1.00 34.72 ? 161 TYR B CE1 1 
ATOM   4399  C CE2 . TYR B 1 123 ? 34.012  61.662  20.548  1.00 35.05 ? 161 TYR B CE2 1 
ATOM   4400  C CZ  . TYR B 1 123 ? 34.146  61.157  21.823  1.00 34.34 ? 161 TYR B CZ  1 
ATOM   4401  O OH  . TYR B 1 123 ? 35.327  61.344  22.506  1.00 36.34 ? 161 TYR B OH  1 
ATOM   4402  N N   . GLY B 1 124 ? 30.364  63.319  21.791  1.00 34.08 ? 162 GLY B N   1 
ATOM   4403  C CA  . GLY B 1 124 ? 30.966  64.604  22.176  1.00 33.71 ? 162 GLY B CA  1 
ATOM   4404  C C   . GLY B 1 124 ? 29.963  65.764  22.221  1.00 33.60 ? 162 GLY B C   1 
ATOM   4405  O O   . GLY B 1 124 ? 30.350  66.903  22.402  1.00 33.06 ? 162 GLY B O   1 
ATOM   4406  N N   . THR B 1 125 ? 28.681  65.451  22.023  1.00 33.52 ? 163 THR B N   1 
ATOM   4407  C CA  . THR B 1 125 ? 27.599  66.396  22.081  1.00 32.96 ? 163 THR B CA  1 
ATOM   4408  C C   . THR B 1 125 ? 26.652  66.045  23.261  1.00 33.81 ? 163 THR B C   1 
ATOM   4409  O O   . THR B 1 125 ? 26.870  65.087  24.010  1.00 34.29 ? 163 THR B O   1 
ATOM   4410  C CB  . THR B 1 125 ? 26.805  66.429  20.771  1.00 32.54 ? 163 THR B CB  1 
ATOM   4411  O OG1 . THR B 1 125 ? 25.824  65.397  20.780  1.00 30.96 ? 163 THR B OG1 1 
ATOM   4412  C CG2 . THR B 1 125 ? 27.734  66.301  19.536  1.00 31.32 ? 163 THR B CG2 1 
ATOM   4413  N N   . LEU B 1 126 ? 25.618  66.862  23.432  1.00 33.78 ? 164 LEU B N   1 
ATOM   4414  C CA  . LEU B 1 126 ? 24.627  66.659  24.474  1.00 34.05 ? 164 LEU B CA  1 
ATOM   4415  C C   . LEU B 1 126 ? 23.781  65.411  24.295  1.00 33.11 ? 164 LEU B C   1 
ATOM   4416  O O   . LEU B 1 126 ? 23.098  64.994  25.227  1.00 32.54 ? 164 LEU B O   1 
ATOM   4417  C CB  . LEU B 1 126 ? 23.716  67.896  24.582  1.00 34.04 ? 164 LEU B CB  1 
ATOM   4418  C CG  . LEU B 1 126 ? 24.325  69.125  25.259  1.00 35.00 ? 164 LEU B CG  1 
ATOM   4419  C CD1 . LEU B 1 126 ? 23.529  70.387  24.873  1.00 36.70 ? 164 LEU B CD1 1 
ATOM   4420  C CD2 . LEU B 1 126 ? 24.369  68.957  26.771  1.00 36.29 ? 164 LEU B CD2 1 
ATOM   4421  N N   . VAL B 1 127 ? 23.797  64.834  23.100  1.00 33.11 ? 165 VAL B N   1 
ATOM   4422  C CA  . VAL B 1 127 ? 23.108  63.561  22.858  1.00 33.23 ? 165 VAL B CA  1 
ATOM   4423  C C   . VAL B 1 127 ? 23.802  62.470  23.686  1.00 33.61 ? 165 VAL B C   1 
ATOM   4424  O O   . VAL B 1 127 ? 23.155  61.672  24.337  1.00 34.55 ? 165 VAL B O   1 
ATOM   4425  C CB  . VAL B 1 127 ? 23.051  63.191  21.357  1.00 33.42 ? 165 VAL B CB  1 
ATOM   4426  C CG1 . VAL B 1 127 ? 22.381  61.813  21.136  1.00 32.09 ? 165 VAL B CG1 1 
ATOM   4427  C CG2 . VAL B 1 127 ? 22.347  64.322  20.556  1.00 34.01 ? 165 VAL B CG2 1 
ATOM   4428  N N   . GLN B 1 128 ? 25.119  62.455  23.687  1.00 33.74 ? 166 GLN B N   1 
ATOM   4429  C CA  . GLN B 1 128 ? 25.835  61.521  24.513  1.00 34.03 ? 166 GLN B CA  1 
ATOM   4430  C C   . GLN B 1 128 ? 25.716  61.881  25.978  1.00 33.82 ? 166 GLN B C   1 
ATOM   4431  O O   . GLN B 1 128 ? 25.446  61.018  26.806  1.00 34.14 ? 166 GLN B O   1 
ATOM   4432  C CB  . GLN B 1 128 ? 27.285  61.542  24.154  1.00 34.22 ? 166 GLN B CB  1 
ATOM   4433  C CG  . GLN B 1 128 ? 28.112  60.612  25.031  1.00 36.74 ? 166 GLN B CG  1 
ATOM   4434  C CD  . GLN B 1 128 ? 29.533  61.032  25.125  1.00 39.54 ? 166 GLN B CD  1 
ATOM   4435  O OE1 . GLN B 1 128 ? 30.017  61.810  24.307  1.00 41.52 ? 166 GLN B OE1 1 
ATOM   4436  N NE2 . GLN B 1 128 ? 30.246  60.480  26.107  1.00 43.50 ? 166 GLN B NE2 1 
ATOM   4437  N N   . GLU B 1 129 ? 25.941  63.165  26.279  1.00 34.37 ? 167 GLU B N   1 
ATOM   4438  C CA  . GLU B 1 129 ? 25.976  63.675  27.646  1.00 33.77 ? 167 GLU B CA  1 
ATOM   4439  C C   . GLU B 1 129 ? 24.656  63.576  28.389  1.00 34.12 ? 167 GLU B C   1 
ATOM   4440  O O   . GLU B 1 129 ? 24.662  63.461  29.610  1.00 35.42 ? 167 GLU B O   1 
ATOM   4441  C CB  . GLU B 1 129 ? 26.492  65.130  27.688  1.00 33.34 ? 167 GLU B CB  1 
ATOM   4442  N N   . GLY B 1 130 ? 23.528  63.632  27.692  1.00 34.28 ? 168 GLY B N   1 
ATOM   4443  C CA  . GLY B 1 130 ? 22.210  63.641  28.345  1.00 34.36 ? 168 GLY B CA  1 
ATOM   4444  C C   . GLY B 1 130 ? 22.035  64.886  29.185  1.00 35.55 ? 168 GLY B C   1 
ATOM   4445  O O   . GLY B 1 130 ? 22.870  65.783  29.110  1.00 35.48 ? 168 GLY B O   1 
ATOM   4446  N N   . GLY B 1 131 ? 20.965  64.936  29.986  1.00 36.25 ? 169 GLY B N   1 
ATOM   4447  C CA  . GLY B 1 131 ? 20.700  66.052  30.947  1.00 37.50 ? 169 GLY B CA  1 
ATOM   4448  C C   . GLY B 1 131 ? 19.825  67.205  30.450  1.00 37.99 ? 169 GLY B C   1 
ATOM   4449  O O   . GLY B 1 131 ? 19.545  68.166  31.181  1.00 38.84 ? 169 GLY B O   1 
ATOM   4450  N N   . SER B 1 132 ? 19.402  67.144  29.195  1.00 38.41 ? 170 SER B N   1 
ATOM   4451  C CA  . SER B 1 132 ? 18.645  68.251  28.626  1.00 38.52 ? 170 SER B CA  1 
ATOM   4452  C C   . SER B 1 132 ? 17.153  68.093  28.983  1.00 37.72 ? 170 SER B C   1 
ATOM   4453  O O   . SER B 1 132 ? 16.660  66.972  29.077  1.00 37.40 ? 170 SER B O   1 
ATOM   4454  C CB  . SER B 1 132 ? 18.866  68.278  27.117  1.00 39.06 ? 170 SER B CB  1 
ATOM   4455  O OG  . SER B 1 132 ? 20.248  68.070  26.805  1.00 40.85 ? 170 SER B OG  1 
ATOM   4456  N N   . PRO B 1 133 ? 16.420  69.216  29.190  1.00 36.89 ? 171 PRO B N   1 
ATOM   4457  C CA  . PRO B 1 133 ? 15.006  69.055  29.595  1.00 35.73 ? 171 PRO B CA  1 
ATOM   4458  C C   . PRO B 1 133 ? 14.111  68.382  28.542  1.00 34.56 ? 171 PRO B C   1 
ATOM   4459  O O   . PRO B 1 133 ? 13.977  68.903  27.453  1.00 34.36 ? 171 PRO B O   1 
ATOM   4460  C CB  . PRO B 1 133 ? 14.554  70.481  29.867  1.00 36.15 ? 171 PRO B CB  1 
ATOM   4461  C CG  . PRO B 1 133 ? 15.830  71.291  29.950  1.00 37.10 ? 171 PRO B CG  1 
ATOM   4462  C CD  . PRO B 1 133 ? 16.817  70.629  29.102  1.00 36.45 ? 171 PRO B CD  1 
ATOM   4463  N N   . ILE B 1 134 ? 13.563  67.206  28.866  1.00 33.02 ? 172 ILE B N   1 
ATOM   4464  C CA  . ILE B 1 134 ? 12.487  66.576  28.097  1.00 32.48 ? 172 ILE B CA  1 
ATOM   4465  C C   . ILE B 1 134 ? 11.164  67.207  28.540  1.00 32.52 ? 172 ILE B C   1 
ATOM   4466  O O   . ILE B 1 134 ? 10.293  67.514  27.732  1.00 32.68 ? 172 ILE B O   1 
ATOM   4467  C CB  . ILE B 1 134 ? 12.436  65.011  28.314  1.00 32.36 ? 172 ILE B CB  1 
ATOM   4468  C CG1 . ILE B 1 134 ? 13.626  64.323  27.614  1.00 32.10 ? 172 ILE B CG1 1 
ATOM   4469  C CG2 . ILE B 1 134 ? 11.109  64.437  27.844  1.00 31.11 ? 172 ILE B CG2 1 
ATOM   4470  C CD1 . ILE B 1 134 ? 13.622  62.778  27.664  1.00 33.31 ? 172 ILE B CD1 1 
ATOM   4471  N N   . LYS B 1 135 ? 11.035  67.440  29.838  1.00 32.04 ? 173 LYS B N   1 
ATOM   4472  C CA  . LYS B 1 135 ? 9.853   68.066  30.367  1.00 31.92 ? 173 LYS B CA  1 
ATOM   4473  C C   . LYS B 1 135 ? 10.223  69.017  31.489  1.00 31.80 ? 173 LYS B C   1 
ATOM   4474  O O   . LYS B 1 135 ? 10.988  68.657  32.396  1.00 30.38 ? 173 LYS B O   1 
ATOM   4475  C CB  . LYS B 1 135 ? 8.911   66.997  30.898  1.00 32.19 ? 173 LYS B CB  1 
ATOM   4476  C CG  . LYS B 1 135 ? 7.522   67.485  31.097  1.00 32.27 ? 173 LYS B CG  1 
ATOM   4477  C CD  . LYS B 1 135 ? 6.676   66.483  31.812  1.00 32.50 ? 173 LYS B CD  1 
ATOM   4478  C CE  . LYS B 1 135 ? 5.231   66.922  31.756  1.00 33.11 ? 173 LYS B CE  1 
ATOM   4479  N NZ  . LYS B 1 135 ? 4.523   66.614  33.011  1.00 32.20 ? 173 LYS B NZ  1 
ATOM   4480  N N   . TYR B 1 136 ? 9.666   70.232  31.404  1.00 32.27 ? 174 TYR B N   1 
ATOM   4481  C CA  . TYR B 1 136 ? 9.668   71.196  32.492  1.00 31.97 ? 174 TYR B CA  1 
ATOM   4482  C C   . TYR B 1 136 ? 8.439   71.043  33.364  1.00 32.70 ? 174 TYR B C   1 
ATOM   4483  O O   . TYR B 1 136 ? 7.402   70.533  32.917  1.00 32.92 ? 174 TYR B O   1 
ATOM   4484  C CB  . TYR B 1 136 ? 9.654   72.609  31.946  1.00 31.64 ? 174 TYR B CB  1 
ATOM   4485  C CG  . TYR B 1 136 ? 10.906  73.014  31.253  1.00 31.59 ? 174 TYR B CG  1 
ATOM   4486  C CD1 . TYR B 1 136 ? 12.045  73.366  31.972  1.00 31.23 ? 174 TYR B CD1 1 
ATOM   4487  C CD2 . TYR B 1 136 ? 10.965  73.039  29.869  1.00 32.42 ? 174 TYR B CD2 1 
ATOM   4488  C CE1 . TYR B 1 136 ? 13.217  73.724  31.317  1.00 30.32 ? 174 TYR B CE1 1 
ATOM   4489  C CE2 . TYR B 1 136 ? 12.109  73.404  29.215  1.00 31.55 ? 174 TYR B CE2 1 
ATOM   4490  C CZ  . TYR B 1 136 ? 13.228  73.758  29.941  1.00 31.56 ? 174 TYR B CZ  1 
ATOM   4491  O OH  . TYR B 1 136 ? 14.347  74.132  29.249  1.00 32.01 ? 174 TYR B OH  1 
ATOM   4492  N N   . ASN B 1 137 ? 8.575   71.494  34.612  1.00 32.97 ? 175 ASN B N   1 
ATOM   4493  C CA  . ASN B 1 137 ? 7.447   71.779  35.460  1.00 33.51 ? 175 ASN B CA  1 
ATOM   4494  C C   . ASN B 1 137 ? 7.005   73.245  35.250  1.00 33.85 ? 175 ASN B C   1 
ATOM   4495  O O   . ASN B 1 137 ? 7.631   74.004  34.496  1.00 32.84 ? 175 ASN B O   1 
ATOM   4496  C CB  . ASN B 1 137 ? 7.809   71.535  36.936  1.00 33.96 ? 175 ASN B CB  1 
ATOM   4497  C CG  . ASN B 1 137 ? 8.258   70.098  37.201  1.00 32.52 ? 175 ASN B CG  1 
ATOM   4498  O OD1 . ASN B 1 137 ? 7.467   69.162  37.003  1.00 30.04 ? 175 ASN B OD1 1 
ATOM   4499  N ND2 . ASN B 1 137 ? 9.526   69.932  37.667  1.00 34.38 ? 175 ASN B ND2 1 
ATOM   4500  N N   . LYS B 1 138 ? 5.925   73.631  35.925  1.00 34.79 ? 176 LYS B N   1 
ATOM   4501  C CA  . LYS B 1 138 ? 5.386   74.993  35.831  1.00 35.60 ? 176 LYS B CA  1 
ATOM   4502  C C   . LYS B 1 138 ? 6.348   76.019  36.471  1.00 36.53 ? 176 LYS B C   1 
ATOM   4503  O O   . LYS B 1 138 ? 6.273   77.218  36.164  1.00 37.06 ? 176 LYS B O   1 
ATOM   4504  C CB  . LYS B 1 138 ? 3.996   75.044  36.462  1.00 35.47 ? 176 LYS B CB  1 
ATOM   4505  N N   . ASP B 1 139 ? 7.231   75.524  37.352  1.00 37.69 ? 177 ASP B N   1 
ATOM   4506  C CA  . ASP B 1 139 ? 8.423   76.230  37.904  1.00 38.36 ? 177 ASP B CA  1 
ATOM   4507  C C   . ASP B 1 139 ? 9.463   76.783  36.928  1.00 38.32 ? 177 ASP B C   1 
ATOM   4508  O O   . ASP B 1 139 ? 10.133  77.773  37.231  1.00 38.40 ? 177 ASP B O   1 
ATOM   4509  C CB  . ASP B 1 139 ? 9.262   75.232  38.706  1.00 38.64 ? 177 ASP B CB  1 
ATOM   4510  C CG  . ASP B 1 139 ? 8.724   74.969  40.025  1.00 40.13 ? 177 ASP B CG  1 
ATOM   4511  O OD1 . ASP B 1 139 ? 7.525   75.249  40.215  1.00 44.58 ? 177 ASP B OD1 1 
ATOM   4512  O OD2 . ASP B 1 139 ? 9.514   74.483  40.867  1.00 42.79 ? 177 ASP B OD2 1 
ATOM   4513  N N   . GLY B 1 140 ? 9.680   76.069  35.830  1.00 38.04 ? 178 GLY B N   1 
ATOM   4514  C CA  . GLY B 1 140 ? 10.913  76.214  35.049  1.00 38.04 ? 178 GLY B CA  1 
ATOM   4515  C C   . GLY B 1 140 ? 11.986  75.218  35.469  1.00 37.68 ? 178 GLY B C   1 
ATOM   4516  O O   . GLY B 1 140 ? 13.035  75.117  34.814  1.00 37.93 ? 178 GLY B O   1 
ATOM   4517  N N   . SER B 1 141 ? 11.731  74.491  36.563  1.00 37.27 ? 179 SER B N   1 
ATOM   4518  C CA  . SER B 1 141 ? 12.529  73.327  36.939  1.00 37.07 ? 179 SER B CA  1 
ATOM   4519  C C   . SER B 1 141 ? 12.169  72.170  36.012  1.00 36.54 ? 179 SER B C   1 
ATOM   4520  O O   . SER B 1 141 ? 11.117  72.190  35.369  1.00 36.59 ? 179 SER B O   1 
ATOM   4521  C CB  . SER B 1 141 ? 12.360  72.980  38.447  1.00 36.81 ? 179 SER B CB  1 
ATOM   4522  O OG  . SER B 1 141 ? 10.993  72.427  38.838  1.00 38.15 ? 179 SER B OG  1 
ATOM   4523  N N   . VAL B 1 142 ? 13.077  71.202  35.914  1.00 36.28 ? 180 VAL B N   1 
ATOM   4524  C CA  . VAL B 1 142 ? 13.006  70.139  34.916  1.00 35.80 ? 180 VAL B CA  1 
ATOM   4525  C C   . VAL B 1 142 ? 12.381  68.881  35.548  1.00 35.44 ? 180 VAL B C   1 
ATOM   4526  O O   . VAL B 1 142 ? 12.884  68.376  36.545  1.00 34.70 ? 180 VAL B O   1 
ATOM   4527  C CB  . VAL B 1 142 ? 14.431  69.848  34.358  1.00 36.08 ? 180 VAL B CB  1 
ATOM   4528  C CG1 . VAL B 1 142 ? 14.381  68.939  33.157  1.00 36.14 ? 180 VAL B CG1 1 
ATOM   4529  C CG2 . VAL B 1 142 ? 15.128  71.164  33.983  1.00 35.41 ? 180 VAL B CG2 1 
ATOM   4530  N N   . ALA B 1 143 ? 11.266  68.402  34.990  1.00 35.40 ? 181 ALA B N   1 
ATOM   4531  C CA  . ALA B 1 143 ? 10.621  67.176  35.486  1.00 35.03 ? 181 ALA B CA  1 
ATOM   4532  C C   . ALA B 1 143 ? 11.265  65.898  34.851  1.00 34.89 ? 181 ALA B C   1 
ATOM   4533  O O   . ALA B 1 143 ? 11.311  64.843  35.487  1.00 34.62 ? 181 ALA B O   1 
ATOM   4534  C CB  . ALA B 1 143 ? 9.114   67.237  35.227  1.00 34.75 ? 181 ALA B CB  1 
ATOM   4535  N N   . ILE B 1 144 ? 11.770  66.013  33.622  1.00 34.19 ? 182 ILE B N   1 
ATOM   4536  C CA  . ILE B 1 144 ? 12.433  64.906  32.932  1.00 34.39 ? 182 ILE B CA  1 
ATOM   4537  C C   . ILE B 1 144 ? 13.682  65.397  32.165  1.00 35.36 ? 182 ILE B C   1 
ATOM   4538  O O   . ILE B 1 144 ? 13.650  66.433  31.470  1.00 34.87 ? 182 ILE B O   1 
ATOM   4539  C CB  . ILE B 1 144 ? 11.479  64.174  31.946  1.00 34.28 ? 182 ILE B CB  1 
ATOM   4540  C CG1 . ILE B 1 144 ? 10.121  63.915  32.597  1.00 33.63 ? 182 ILE B CG1 1 
ATOM   4541  C CG2 . ILE B 1 144 ? 12.100  62.851  31.471  1.00 32.14 ? 182 ILE B CG2 1 
ATOM   4542  C CD1 . ILE B 1 144 ? 9.085   63.356  31.660  1.00 33.95 ? 182 ILE B CD1 1 
ATOM   4543  N N   . ALA B 1 145 ? 14.779  64.646  32.308  1.00 35.96 ? 183 ALA B N   1 
ATOM   4544  C CA  . ALA B 1 145 ? 16.047  64.961  31.655  1.00 35.98 ? 183 ALA B CA  1 
ATOM   4545  C C   . ALA B 1 145 ? 16.372  63.841  30.710  1.00 36.33 ? 183 ALA B C   1 
ATOM   4546  O O   . ALA B 1 145 ? 15.992  62.705  30.967  1.00 35.70 ? 183 ALA B O   1 
ATOM   4547  C CB  . ALA B 1 145 ? 17.145  65.107  32.693  1.00 36.41 ? 183 ALA B CB  1 
ATOM   4548  N N   . SER B 1 146 ? 17.054  64.153  29.609  1.00 36.68 ? 184 SER B N   1 
ATOM   4549  C CA  . SER B 1 146 ? 17.458  63.099  28.674  1.00 37.57 ? 184 SER B CA  1 
ATOM   4550  C C   . SER B 1 146 ? 18.574  62.270  29.321  1.00 37.79 ? 184 SER B C   1 
ATOM   4551  O O   . SER B 1 146 ? 19.492  62.830  29.937  1.00 37.78 ? 184 SER B O   1 
ATOM   4552  C CB  . SER B 1 146 ? 17.909  63.670  27.337  1.00 37.22 ? 184 SER B CB  1 
ATOM   4553  O OG  . SER B 1 146 ? 18.907  64.647  27.526  1.00 38.74 ? 184 SER B OG  1 
ATOM   4554  N N   . LYS B 1 147 ? 18.422  60.944  29.236  1.00 38.08 ? 185 LYS B N   1 
ATOM   4555  C CA  . LYS B 1 147 ? 19.429  59.959  29.674  1.00 38.42 ? 185 LYS B CA  1 
ATOM   4556  C C   . LYS B 1 147 ? 20.718  60.068  28.842  1.00 37.02 ? 185 LYS B C   1 
ATOM   4557  O O   . LYS B 1 147 ? 20.646  60.263  27.653  1.00 36.01 ? 185 LYS B O   1 
ATOM   4558  C CB  . LYS B 1 147 ? 18.892  58.535  29.475  1.00 38.80 ? 185 LYS B CB  1 
ATOM   4559  C CG  . LYS B 1 147 ? 17.541  58.171  30.135  1.00 39.53 ? 185 LYS B CG  1 
ATOM   4560  C CD  . LYS B 1 147 ? 17.199  56.659  29.835  1.00 40.51 ? 185 LYS B CD  1 
ATOM   4561  N N   . PRO B 1 148 ? 21.899  59.911  29.466  1.00 37.06 ? 186 PRO B N   1 
ATOM   4562  C CA  . PRO B 1 148 ? 23.143  59.765  28.689  1.00 36.81 ? 186 PRO B CA  1 
ATOM   4563  C C   . PRO B 1 148 ? 23.147  58.520  27.799  1.00 37.26 ? 186 PRO B C   1 
ATOM   4564  O O   . PRO B 1 148 ? 22.327  57.626  28.020  1.00 37.74 ? 186 PRO B O   1 
ATOM   4565  C CB  . PRO B 1 148 ? 24.217  59.627  29.771  1.00 36.83 ? 186 PRO B CB  1 
ATOM   4566  C CG  . PRO B 1 148 ? 23.614  60.274  31.017  1.00 36.63 ? 186 PRO B CG  1 
ATOM   4567  C CD  . PRO B 1 148 ? 22.160  59.919  30.922  1.00 36.45 ? 186 PRO B CD  1 
ATOM   4568  N N   . ARG B 1 149 ? 24.020  58.490  26.774  1.00 37.10 ? 187 ARG B N   1 
ATOM   4569  C CA  . ARG B 1 149 ? 24.225  57.301  25.927  1.00 36.56 ? 187 ARG B CA  1 
ATOM   4570  C C   . ARG B 1 149 ? 25.597  56.712  26.275  1.00 36.77 ? 187 ARG B C   1 
ATOM   4571  O O   . ARG B 1 149 ? 26.551  57.432  26.575  1.00 37.80 ? 187 ARG B O   1 
ATOM   4572  C CB  . ARG B 1 149 ? 24.168  57.611  24.400  1.00 36.70 ? 187 ARG B CB  1 
ATOM   4573  C CG  . ARG B 1 149 ? 22.934  58.374  23.905  1.00 37.79 ? 187 ARG B CG  1 
ATOM   4574  C CD  . ARG B 1 149 ? 21.677  57.690  24.331  1.00 39.04 ? 187 ARG B CD  1 
ATOM   4575  N NE  . ARG B 1 149 ? 20.532  58.078  23.518  1.00 41.64 ? 187 ARG B NE  1 
ATOM   4576  C CZ  . ARG B 1 149 ? 19.437  58.707  23.944  1.00 41.01 ? 187 ARG B CZ  1 
ATOM   4577  N NH1 . ARG B 1 149 ? 18.464  58.917  23.097  1.00 44.14 ? 187 ARG B NH1 1 
ATOM   4578  N NH2 . ARG B 1 149 ? 19.285  59.100  25.190  1.00 43.74 ? 187 ARG B NH2 1 
ATOM   4579  N N   . GLU B 1 150 ? 25.680  55.391  26.259  1.00 36.79 ? 188 GLU B N   1 
ATOM   4580  C CA  . GLU B 1 150 ? 26.942  54.701  26.423  1.00 36.40 ? 188 GLU B CA  1 
ATOM   4581  C C   . GLU B 1 150 ? 27.877  55.003  25.264  1.00 35.43 ? 188 GLU B C   1 
ATOM   4582  O O   . GLU B 1 150 ? 27.458  54.963  24.128  1.00 35.20 ? 188 GLU B O   1 
ATOM   4583  C CB  . GLU B 1 150 ? 26.695  53.212  26.442  1.00 36.89 ? 188 GLU B CB  1 
ATOM   4584  C CG  . GLU B 1 150 ? 25.925  52.799  27.662  1.00 39.41 ? 188 GLU B CG  1 
ATOM   4585  C CD  . GLU B 1 150 ? 25.587  51.324  27.673  1.00 41.67 ? 188 GLU B CD  1 
ATOM   4586  O OE1 . GLU B 1 150 ? 26.346  50.510  27.053  1.00 38.89 ? 188 GLU B OE1 1 
ATOM   4587  O OE2 . GLU B 1 150 ? 24.561  51.023  28.337  1.00 43.69 ? 188 GLU B OE2 1 
ATOM   4588  N N   . VAL B 1 151 ? 29.134  55.286  25.591  1.00 34.74 ? 189 VAL B N   1 
ATOM   4589  C CA  . VAL B 1 151 ? 30.186  55.574  24.636  1.00 34.86 ? 189 VAL B CA  1 
ATOM   4590  C C   . VAL B 1 151 ? 31.047  54.330  24.565  1.00 34.91 ? 189 VAL B C   1 
ATOM   4591  O O   . VAL B 1 151 ? 31.275  53.659  25.554  1.00 34.68 ? 189 VAL B O   1 
ATOM   4592  C CB  . VAL B 1 151 ? 30.996  56.808  25.023  1.00 33.72 ? 189 VAL B CB  1 
ATOM   4593  C CG1 . VAL B 1 151 ? 31.827  56.538  26.181  1.00 36.20 ? 189 VAL B CG1 1 
ATOM   4594  C CG2 . VAL B 1 151 ? 31.860  57.263  23.891  1.00 36.24 ? 189 VAL B CG2 1 
ATOM   4595  N N   . ARG B 1 152 ? 31.445  53.984  23.359  1.00 34.98 ? 190 ARG B N   1 
ATOM   4596  C CA  . ARG B 1 152 ? 32.369  52.890  23.142  1.00 35.04 ? 190 ARG B CA  1 
ATOM   4597  C C   . ARG B 1 152 ? 33.268  53.162  21.959  1.00 34.43 ? 190 ARG B C   1 
ATOM   4598  O O   . ARG B 1 152 ? 32.870  53.782  20.993  1.00 33.17 ? 190 ARG B O   1 
ATOM   4599  C CB  . ARG B 1 152 ? 31.599  51.626  22.877  1.00 35.35 ? 190 ARG B CB  1 
ATOM   4600  C CG  . ARG B 1 152 ? 32.480  50.442  22.703  1.00 36.16 ? 190 ARG B CG  1 
ATOM   4601  C CD  . ARG B 1 152 ? 31.675  49.223  22.939  1.00 38.79 ? 190 ARG B CD  1 
ATOM   4602  N NE  . ARG B 1 152 ? 32.482  48.056  22.660  1.00 40.13 ? 190 ARG B NE  1 
ATOM   4603  C CZ  . ARG B 1 152 ? 32.059  46.812  22.802  1.00 41.41 ? 190 ARG B CZ  1 
ATOM   4604  N NH1 . ARG B 1 152 ? 30.837  46.558  23.222  1.00 45.11 ? 190 ARG B NH1 1 
ATOM   4605  N NH2 . ARG B 1 152 ? 32.866  45.822  22.512  1.00 43.72 ? 190 ARG B NH2 1 
ATOM   4606  N N   . GLU B 1 153 ? 34.472  52.633  22.016  1.00 35.61 ? 191 GLU B N   1 
ATOM   4607  C CA  . GLU B 1 153 ? 35.400  52.771  20.906  1.00 36.50 ? 191 GLU B CA  1 
ATOM   4608  C C   . GLU B 1 153 ? 35.581  51.502  20.046  1.00 36.32 ? 191 GLU B C   1 
ATOM   4609  O O   . GLU B 1 153 ? 35.709  50.412  20.570  1.00 35.73 ? 191 GLU B O   1 
ATOM   4610  C CB  . GLU B 1 153 ? 36.732  53.187  21.474  1.00 37.57 ? 191 GLU B CB  1 
ATOM   4611  C CG  . GLU B 1 153 ? 37.757  53.569  20.432  1.00 40.39 ? 191 GLU B CG  1 
ATOM   4612  C CD  . GLU B 1 153 ? 39.016  52.810  20.656  1.00 45.54 ? 191 GLU B CD  1 
ATOM   4613  O OE1 . GLU B 1 153 ? 39.073  51.631  20.160  1.00 48.87 ? 191 GLU B OE1 1 
ATOM   4614  O OE2 . GLU B 1 153 ? 39.903  53.379  21.363  1.00 45.28 ? 191 GLU B OE2 1 
ATOM   4615  N N   . PHE B 1 154 ? 35.603  51.700  18.724  1.00 36.11 ? 192 PHE B N   1 
ATOM   4616  C CA  . PHE B 1 154 ? 35.870  50.671  17.722  1.00 36.35 ? 192 PHE B CA  1 
ATOM   4617  C C   . PHE B 1 154 ? 36.841  51.267  16.678  1.00 38.14 ? 192 PHE B C   1 
ATOM   4618  O O   . PHE B 1 154 ? 36.563  52.318  16.104  1.00 37.82 ? 192 PHE B O   1 
ATOM   4619  C CB  . PHE B 1 154 ? 34.602  50.259  16.965  1.00 34.65 ? 192 PHE B CB  1 
ATOM   4620  C CG  . PHE B 1 154 ? 33.527  49.634  17.813  1.00 33.47 ? 192 PHE B CG  1 
ATOM   4621  C CD1 . PHE B 1 154 ? 33.504  48.266  18.040  1.00 31.92 ? 192 PHE B CD1 1 
ATOM   4622  C CD2 . PHE B 1 154 ? 32.524  50.407  18.373  1.00 31.58 ? 192 PHE B CD2 1 
ATOM   4623  C CE1 . PHE B 1 154 ? 32.510  47.704  18.825  1.00 27.71 ? 192 PHE B CE1 1 
ATOM   4624  C CE2 . PHE B 1 154 ? 31.543  49.853  19.162  1.00 29.31 ? 192 PHE B CE2 1 
ATOM   4625  C CZ  . PHE B 1 154 ? 31.510  48.505  19.350  1.00 30.44 ? 192 PHE B CZ  1 
ATOM   4626  N N   . ASN B 1 155 ? 37.966  50.599  16.427  1.00 40.70 ? 193 ASN B N   1 
ATOM   4627  C CA  . ASN B 1 155 ? 38.871  50.991  15.323  1.00 42.27 ? 193 ASN B CA  1 
ATOM   4628  C C   . ASN B 1 155 ? 39.146  52.501  15.328  1.00 42.82 ? 193 ASN B C   1 
ATOM   4629  O O   . ASN B 1 155 ? 38.849  53.202  14.343  1.00 44.08 ? 193 ASN B O   1 
ATOM   4630  C CB  . ASN B 1 155 ? 38.273  50.605  13.963  1.00 42.81 ? 193 ASN B CB  1 
ATOM   4631  C CG  . ASN B 1 155 ? 37.946  49.117  13.848  1.00 46.40 ? 193 ASN B CG  1 
ATOM   4632  O OD1 . ASN B 1 155 ? 36.770  48.736  13.725  1.00 50.92 ? 193 ASN B OD1 1 
ATOM   4633  N ND2 . ASN B 1 155 ? 38.986  48.269  13.855  1.00 50.66 ? 193 ASN B ND2 1 
ATOM   4634  N N   . GLY B 1 156 ? 39.633  53.017  16.447  1.00 42.86 ? 194 GLY B N   1 
ATOM   4635  C CA  . GLY B 1 156 ? 39.995  54.438  16.535  1.00 43.17 ? 194 GLY B CA  1 
ATOM   4636  C C   . GLY B 1 156 ? 38.911  55.436  16.927  1.00 42.86 ? 194 GLY B C   1 
ATOM   4637  O O   . GLY B 1 156 ? 39.171  56.342  17.709  1.00 44.61 ? 194 GLY B O   1 
ATOM   4638  N N   . GLN B 1 157 ? 37.711  55.287  16.392  1.00 42.23 ? 195 GLN B N   1 
ATOM   4639  C CA  . GLN B 1 157 ? 36.652  56.296  16.538  1.00 42.19 ? 195 GLN B CA  1 
ATOM   4640  C C   . GLN B 1 157 ? 35.754  55.941  17.744  1.00 40.84 ? 195 GLN B C   1 
ATOM   4641  O O   . GLN B 1 157 ? 35.758  54.797  18.265  1.00 40.35 ? 195 GLN B O   1 
ATOM   4642  C CB  . GLN B 1 157 ? 35.853  56.443  15.209  1.00 41.97 ? 195 GLN B CB  1 
ATOM   4643  C CG  . GLN B 1 157 ? 34.900  57.664  15.126  1.00 43.85 ? 195 GLN B CG  1 
ATOM   4644  C CD  . GLN B 1 157 ? 34.259  57.959  13.737  1.00 44.91 ? 195 GLN B CD  1 
ATOM   4645  O OE1 . GLN B 1 157 ? 34.796  57.602  12.674  1.00 50.60 ? 195 GLN B OE1 1 
ATOM   4646  N NE2 . GLN B 1 157 ? 33.107  58.650  13.757  1.00 45.28 ? 195 GLN B NE2 1 
ATOM   4647  N N   . HIS B 1 158 ? 35.019  56.943  18.213  1.00 39.53 ? 196 HIS B N   1 
ATOM   4648  C CA  . HIS B 1 158 ? 34.131  56.767  19.348  1.00 38.13 ? 196 HIS B CA  1 
ATOM   4649  C C   . HIS B 1 158 ? 32.730  56.846  18.852  1.00 36.26 ? 196 HIS B C   1 
ATOM   4650  O O   . HIS B 1 158 ? 32.409  57.598  17.917  1.00 37.05 ? 196 HIS B O   1 
ATOM   4651  C CB  . HIS B 1 158 ? 34.351  57.792  20.426  1.00 38.44 ? 196 HIS B CB  1 
ATOM   4652  C CG  . HIS B 1 158 ? 35.539  57.523  21.265  1.00 39.07 ? 196 HIS B CG  1 
ATOM   4653  N ND1 . HIS B 1 158 ? 36.766  58.090  21.003  1.00 40.32 ? 196 HIS B ND1 1 
ATOM   4654  C CD2 . HIS B 1 158 ? 35.701  56.750  22.362  1.00 41.58 ? 196 HIS B CD2 1 
ATOM   4655  C CE1 . HIS B 1 158 ? 37.639  57.671  21.902  1.00 42.78 ? 196 HIS B CE1 1 
ATOM   4656  N NE2 . HIS B 1 158 ? 37.019  56.859  22.739  1.00 43.36 ? 196 HIS B NE2 1 
ATOM   4657  N N   . PHE B 1 159 ? 31.910  56.008  19.468  1.00 34.72 ? 197 PHE B N   1 
ATOM   4658  C CA  . PHE B 1 159 ? 30.536  55.773  19.048  1.00 33.42 ? 197 PHE B CA  1 
ATOM   4659  C C   . PHE B 1 159 ? 29.685  55.721  20.297  1.00 32.44 ? 197 PHE B C   1 
ATOM   4660  O O   . PHE B 1 159 ? 30.220  55.476  21.375  1.00 32.10 ? 197 PHE B O   1 
ATOM   4661  C CB  . PHE B 1 159 ? 30.437  54.441  18.315  1.00 32.81 ? 197 PHE B CB  1 
ATOM   4662  C CG  . PHE B 1 159 ? 31.305  54.354  17.097  1.00 31.48 ? 197 PHE B CG  1 
ATOM   4663  C CD1 . PHE B 1 159 ? 30.820  54.729  15.857  1.00 32.29 ? 197 PHE B CD1 1 
ATOM   4664  C CD2 . PHE B 1 159 ? 32.600  53.907  17.192  1.00 31.70 ? 197 PHE B CD2 1 
ATOM   4665  C CE1 . PHE B 1 159 ? 31.628  54.641  14.715  1.00 32.10 ? 197 PHE B CE1 1 
ATOM   4666  C CE2 . PHE B 1 159 ? 33.409  53.828  16.072  1.00 31.70 ? 197 PHE B CE2 1 
ATOM   4667  C CZ  . PHE B 1 159 ? 32.925  54.201  14.843  1.00 31.49 ? 197 PHE B CZ  1 
ATOM   4668  N N   . ILE B 1 160 ? 28.374  55.914  20.118  1.00 31.84 ? 198 ILE B N   1 
ATOM   4669  C CA  . ILE B 1 160 ? 27.396  55.824  21.163  1.00 31.73 ? 198 ILE B CA  1 
ATOM   4670  C C   . ILE B 1 160 ? 26.274  54.801  20.833  1.00 32.73 ? 198 ILE B C   1 
ATOM   4671  O O   . ILE B 1 160 ? 25.936  54.556  19.669  1.00 33.28 ? 198 ILE B O   1 
ATOM   4672  C CB  . ILE B 1 160 ? 26.783  57.244  21.573  1.00 31.85 ? 198 ILE B CB  1 
ATOM   4673  C CG1 . ILE B 1 160 ? 25.890  57.845  20.498  1.00 33.55 ? 198 ILE B CG1 1 
ATOM   4674  C CG2 . ILE B 1 160 ? 27.834  58.242  21.904  1.00 30.49 ? 198 ILE B CG2 1 
ATOM   4675  C CD1 . ILE B 1 160 ? 25.529  59.255  20.797  1.00 30.76 ? 198 ILE B CD1 1 
ATOM   4676  N N   . LEU B 1 161 ? 25.716  54.219  21.894  1.00 33.04 ? 199 LEU B N   1 
ATOM   4677  C CA  . LEU B 1 161 ? 24.703  53.199  21.826  1.00 33.49 ? 199 LEU B CA  1 
ATOM   4678  C C   . LEU B 1 161 ? 23.305  53.814  21.804  1.00 33.58 ? 199 LEU B C   1 
ATOM   4679  O O   . LEU B 1 161 ? 22.942  54.505  22.721  1.00 34.00 ? 199 LEU B O   1 
ATOM   4680  C CB  . LEU B 1 161 ? 24.827  52.277  23.051  1.00 33.33 ? 199 LEU B CB  1 
ATOM   4681  C CG  . LEU B 1 161 ? 23.962  51.004  23.024  1.00 34.22 ? 199 LEU B CG  1 
ATOM   4682  C CD1 . LEU B 1 161 ? 24.145  50.231  21.724  1.00 30.74 ? 199 LEU B CD1 1 
ATOM   4683  C CD2 . LEU B 1 161 ? 24.308  50.160  24.219  1.00 34.91 ? 199 LEU B CD2 1 
ATOM   4684  N N   . GLU B 1 162 ? 22.559  53.547  20.737  1.00 34.00 ? 200 GLU B N   1 
ATOM   4685  C CA  . GLU B 1 162 ? 21.170  53.922  20.579  1.00 34.46 ? 200 GLU B CA  1 
ATOM   4686  C C   . GLU B 1 162 ? 20.275  52.685  20.500  1.00 33.89 ? 200 GLU B C   1 
ATOM   4687  O O   . GLU B 1 162 ? 20.677  51.641  19.990  1.00 34.96 ? 200 GLU B O   1 
ATOM   4688  C CB  . GLU B 1 162 ? 21.000  54.778  19.313  1.00 34.63 ? 200 GLU B CB  1 
ATOM   4689  C CG  . GLU B 1 162 ? 21.736  56.097  19.373  1.00 35.62 ? 200 GLU B CG  1 
ATOM   4690  C CD  . GLU B 1 162 ? 21.008  57.169  20.201  1.00 36.10 ? 200 GLU B CD  1 
ATOM   4691  O OE1 . GLU B 1 162 ? 20.004  56.841  20.874  1.00 37.75 ? 200 GLU B OE1 1 
ATOM   4692  O OE2 . GLU B 1 162 ? 21.427  58.354  20.154  1.00 37.19 ? 200 GLU B OE2 1 
ATOM   4693  N N   . GLU B 1 163 ? 19.076  52.808  21.049  1.00 34.34 ? 201 GLU B N   1 
ATOM   4694  C CA  . GLU B 1 163 ? 18.134  51.698  21.191  1.00 34.68 ? 201 GLU B CA  1 
ATOM   4695  C C   . GLU B 1 163 ? 17.055  51.857  20.173  1.00 33.76 ? 201 GLU B C   1 
ATOM   4696  O O   . GLU B 1 163 ? 16.771  52.953  19.746  1.00 33.88 ? 201 GLU B O   1 
ATOM   4697  C CB  . GLU B 1 163 ? 17.512  51.658  22.587  1.00 35.15 ? 201 GLU B CB  1 
ATOM   4698  C CG  . GLU B 1 163 ? 18.522  51.520  23.695  1.00 38.91 ? 201 GLU B CG  1 
ATOM   4699  C CD  . GLU B 1 163 ? 17.945  50.948  24.987  1.00 45.32 ? 201 GLU B CD  1 
ATOM   4700  O OE1 . GLU B 1 163 ? 17.239  49.902  24.971  1.00 51.20 ? 201 GLU B OE1 1 
ATOM   4701  O OE2 . GLU B 1 163 ? 18.208  51.546  26.041  1.00 50.20 ? 201 GLU B OE2 1 
ATOM   4702  N N   . ALA B 1 164 ? 16.488  50.743  19.761  1.00 33.54 ? 202 ALA B N   1 
ATOM   4703  C CA  . ALA B 1 164 ? 15.437  50.699  18.785  1.00 32.87 ? 202 ALA B CA  1 
ATOM   4704  C C   . ALA B 1 164 ? 14.173  51.478  19.224  1.00 33.08 ? 202 ALA B C   1 
ATOM   4705  O O   . ALA B 1 164 ? 13.858  51.623  20.440  1.00 33.31 ? 202 ALA B O   1 
ATOM   4706  C CB  . ALA B 1 164 ? 15.095  49.230  18.512  1.00 32.44 ? 202 ALA B CB  1 
ATOM   4707  N N   . ILE B 1 165 ? 13.443  51.956  18.224  1.00 33.34 ? 203 ILE B N   1 
ATOM   4708  C CA  . ILE B 1 165 ? 12.121  52.512  18.375  1.00 34.00 ? 203 ILE B CA  1 
ATOM   4709  C C   . ILE B 1 165 ? 11.138  51.597  17.661  1.00 34.26 ? 203 ILE B C   1 
ATOM   4710  O O   . ILE B 1 165 ? 11.291  51.268  16.478  1.00 34.64 ? 203 ILE B O   1 
ATOM   4711  C CB  . ILE B 1 165 ? 11.984  53.950  17.786  1.00 34.08 ? 203 ILE B CB  1 
ATOM   4712  C CG1 . ILE B 1 165 ? 12.928  54.912  18.484  1.00 35.20 ? 203 ILE B CG1 1 
ATOM   4713  C CG2 . ILE B 1 165 ? 10.496  54.456  17.936  1.00 33.11 ? 203 ILE B CG2 1 
ATOM   4714  C CD1 . ILE B 1 165 ? 13.011  56.305  17.832  1.00 34.50 ? 203 ILE B CD1 1 
ATOM   4715  N N   . THR B 1 166 ? 10.147  51.146  18.408  1.00 34.87 ? 204 THR B N   1 
ATOM   4716  C CA  . THR B 1 166 ? 8.957   50.530  17.858  1.00 35.38 ? 204 THR B CA  1 
ATOM   4717  C C   . THR B 1 166 ? 7.775   51.411  18.280  1.00 35.92 ? 204 THR B C   1 
ATOM   4718  O O   . THR B 1 166 ? 7.877   52.256  19.166  1.00 35.65 ? 204 THR B O   1 
ATOM   4719  C CB  . THR B 1 166 ? 8.714   49.079  18.360  1.00 35.42 ? 204 THR B CB  1 
ATOM   4720  O OG1 . THR B 1 166 ? 8.724   49.059  19.787  1.00 37.15 ? 204 THR B OG1 1 
ATOM   4721  C CG2 . THR B 1 166 ? 9.792   48.089  17.849  1.00 36.01 ? 204 THR B CG2 1 
ATOM   4722  N N   . GLY B 1 167 ? 6.645   51.199  17.624  1.00 36.12 ? 205 GLY B N   1 
ATOM   4723  C CA  . GLY B 1 167 ? 5.427   51.856  17.975  1.00 34.89 ? 205 GLY B CA  1 
ATOM   4724  C C   . GLY B 1 167 ? 4.366   50.802  18.108  1.00 34.75 ? 205 GLY B C   1 
ATOM   4725  O O   . GLY B 1 167 ? 4.557   49.668  17.689  1.00 34.24 ? 205 GLY B O   1 
ATOM   4726  N N   . ASP B 1 168 ? 3.258   51.201  18.720  1.00 34.52 ? 206 ASP B N   1 
ATOM   4727  C CA  . ASP B 1 168 ? 2.018   50.434  18.721  1.00 35.39 ? 206 ASP B CA  1 
ATOM   4728  C C   . ASP B 1 168 ? 1.307   50.534  17.369  1.00 34.35 ? 206 ASP B C   1 
ATOM   4729  O O   . ASP B 1 168 ? 0.754   49.536  16.863  1.00 33.82 ? 206 ASP B O   1 
ATOM   4730  C CB  . ASP B 1 168 ? 1.080   50.971  19.801  1.00 35.14 ? 206 ASP B CB  1 
ATOM   4731  C CG  . ASP B 1 168 ? 1.693   50.922  21.194  1.00 37.14 ? 206 ASP B CG  1 
ATOM   4732  O OD1 . ASP B 1 168 ? 1.930   49.804  21.685  1.00 39.42 ? 206 ASP B OD1 1 
ATOM   4733  O OD2 . ASP B 1 168 ? 1.918   51.999  21.802  1.00 39.03 ? 206 ASP B OD2 1 
ATOM   4734  N N   . PHE B 1 169 ? 1.318   51.753  16.822  1.00 34.07 ? 207 PHE B N   1 
ATOM   4735  C CA  . PHE B 1 169 ? 0.789   52.045  15.497  1.00 34.07 ? 207 PHE B CA  1 
ATOM   4736  C C   . PHE B 1 169 ? 1.761   52.875  14.668  1.00 33.57 ? 207 PHE B C   1 
ATOM   4737  O O   . PHE B 1 169 ? 2.559   53.596  15.218  1.00 33.89 ? 207 PHE B O   1 
ATOM   4738  C CB  . PHE B 1 169 ? -0.527  52.827  15.616  1.00 34.63 ? 207 PHE B CB  1 
ATOM   4739  C CG  . PHE B 1 169 ? -1.633  52.045  16.236  1.00 35.41 ? 207 PHE B CG  1 
ATOM   4740  C CD1 . PHE B 1 169 ? -1.664  51.848  17.618  1.00 34.13 ? 207 PHE B CD1 1 
ATOM   4741  C CD2 . PHE B 1 169 ? -2.629  51.469  15.437  1.00 35.33 ? 207 PHE B CD2 1 
ATOM   4742  C CE1 . PHE B 1 169 ? -2.662  51.086  18.197  1.00 34.58 ? 207 PHE B CE1 1 
ATOM   4743  C CE2 . PHE B 1 169 ? -3.642  50.729  16.010  1.00 35.80 ? 207 PHE B CE2 1 
ATOM   4744  C CZ  . PHE B 1 169 ? -3.659  50.530  17.395  1.00 34.51 ? 207 PHE B CZ  1 
ATOM   4745  N N   . ALA B 1 170 ? 1.673   52.751  13.344  1.00 33.68 ? 208 ALA B N   1 
ATOM   4746  C CA  . ALA B 1 170 ? 2.329   53.653  12.382  1.00 33.51 ? 208 ALA B CA  1 
ATOM   4747  C C   . ALA B 1 170 ? 1.249   54.278  11.494  1.00 33.51 ? 208 ALA B C   1 
ATOM   4748  O O   . ALA B 1 170 ? 0.386   53.577  10.939  1.00 33.22 ? 208 ALA B O   1 
ATOM   4749  C CB  . ALA B 1 170 ? 3.361   52.913  11.521  1.00 33.48 ? 208 ALA B CB  1 
ATOM   4750  N N   . LEU B 1 171 ? 1.271   55.605  11.398  1.00 33.38 ? 209 LEU B N   1 
ATOM   4751  C CA  . LEU B 1 171 ? 0.414   56.325  10.453  1.00 32.83 ? 209 LEU B CA  1 
ATOM   4752  C C   . LEU B 1 171 ? 1.264   56.693  9.251   1.00 32.30 ? 209 LEU B C   1 
ATOM   4753  O O   . LEU B 1 171 ? 2.161   57.527  9.323   1.00 32.93 ? 209 LEU B O   1 
ATOM   4754  C CB  . LEU B 1 171 ? -0.210  57.563  11.082  1.00 32.16 ? 209 LEU B CB  1 
ATOM   4755  C CG  . LEU B 1 171 ? -1.089  57.353  12.329  1.00 31.53 ? 209 LEU B CG  1 
ATOM   4756  C CD1 . LEU B 1 171 ? -1.704  58.707  12.749  1.00 29.39 ? 209 LEU B CD1 1 
ATOM   4757  C CD2 . LEU B 1 171 ? -2.176  56.267  12.144  1.00 29.08 ? 209 LEU B CD2 1 
ATOM   4758  N N   . VAL B 1 172 ? 0.991   56.046  8.139   1.00 32.28 ? 210 VAL B N   1 
ATOM   4759  C CA  . VAL B 1 172 ? 1.874   56.150  6.975   1.00 32.32 ? 210 VAL B CA  1 
ATOM   4760  C C   . VAL B 1 172 ? 1.119   56.640  5.755   1.00 32.19 ? 210 VAL B C   1 
ATOM   4761  O O   . VAL B 1 172 ? 0.039   56.169  5.451   1.00 33.01 ? 210 VAL B O   1 
ATOM   4762  C CB  . VAL B 1 172 ? 2.585   54.772  6.704   1.00 32.04 ? 210 VAL B CB  1 
ATOM   4763  C CG1 . VAL B 1 172 ? 3.455   54.880  5.486   1.00 32.49 ? 210 VAL B CG1 1 
ATOM   4764  C CG2 . VAL B 1 172 ? 3.411   54.345  7.941   1.00 31.14 ? 210 VAL B CG2 1 
ATOM   4765  N N   . LYS B 1 173 ? 1.666   57.639  5.084   1.00 33.19 ? 211 LYS B N   1 
ATOM   4766  C CA  . LYS B 1 173 ? 1.153   58.068  3.772   1.00 33.52 ? 211 LYS B CA  1 
ATOM   4767  C C   . LYS B 1 173 ? 1.982   57.433  2.667   1.00 33.28 ? 211 LYS B C   1 
ATOM   4768  O O   . LYS B 1 173 ? 3.186   57.508  2.711   1.00 33.32 ? 211 LYS B O   1 
ATOM   4769  C CB  . LYS B 1 173 ? 1.241   59.594  3.646   1.00 33.95 ? 211 LYS B CB  1 
ATOM   4770  C CG  . LYS B 1 173 ? 1.126   60.176  2.197   1.00 34.26 ? 211 LYS B CG  1 
ATOM   4771  C CD  . LYS B 1 173 ? -0.286  60.239  1.693   1.00 35.11 ? 211 LYS B CD  1 
ATOM   4772  C CE  . LYS B 1 173 ? -0.370  60.402  0.135   1.00 35.87 ? 211 LYS B CE  1 
ATOM   4773  N NZ  . LYS B 1 173 ? 0.107   61.721  -0.335  1.00 37.27 ? 211 LYS B NZ  1 
ATOM   4774  N N   . ALA B 1 174 ? 1.338   56.837  1.668   1.00 34.32 ? 212 ALA B N   1 
ATOM   4775  C CA  . ALA B 1 174 ? 2.016   56.401  0.423   1.00 34.66 ? 212 ALA B CA  1 
ATOM   4776  C C   . ALA B 1 174 ? 1.279   56.862  -0.825  1.00 35.01 ? 212 ALA B C   1 
ATOM   4777  O O   . ALA B 1 174 ? 0.208   57.446  -0.752  1.00 35.14 ? 212 ALA B O   1 
ATOM   4778  C CB  . ALA B 1 174 ? 2.191   54.865  0.391   1.00 34.56 ? 212 ALA B CB  1 
ATOM   4779  N N   . TRP B 1 175 ? 1.864   56.571  -1.986  1.00 35.61 ? 213 TRP B N   1 
ATOM   4780  C CA  . TRP B 1 175 ? 1.303   56.933  -3.291  1.00 35.53 ? 213 TRP B CA  1 
ATOM   4781  C C   . TRP B 1 175 ? 0.196   55.971  -3.764  1.00 35.07 ? 213 TRP B C   1 
ATOM   4782  O O   . TRP B 1 175 ? -0.906  56.377  -3.993  1.00 35.32 ? 213 TRP B O   1 
ATOM   4783  C CB  . TRP B 1 175 ? 2.453   57.018  -4.321  1.00 35.69 ? 213 TRP B CB  1 
ATOM   4784  C CG  . TRP B 1 175 ? 2.088   57.504  -5.695  1.00 36.83 ? 213 TRP B CG  1 
ATOM   4785  C CD1 . TRP B 1 175 ? 0.964   58.169  -6.069  1.00 36.69 ? 213 TRP B CD1 1 
ATOM   4786  C CD2 . TRP B 1 175 ? 2.901   57.400  -6.876  1.00 37.55 ? 213 TRP B CD2 1 
ATOM   4787  N NE1 . TRP B 1 175 ? 1.014   58.463  -7.406  1.00 36.17 ? 213 TRP B NE1 1 
ATOM   4788  C CE2 . TRP B 1 175 ? 2.191   58.000  -7.923  1.00 36.55 ? 213 TRP B CE2 1 
ATOM   4789  C CE3 . TRP B 1 175 ? 4.153   56.834  -7.143  1.00 37.25 ? 213 TRP B CE3 1 
ATOM   4790  C CZ2 . TRP B 1 175 ? 2.688   58.056  -9.228  1.00 37.14 ? 213 TRP B CZ2 1 
ATOM   4791  C CZ3 . TRP B 1 175 ? 4.655   56.906  -8.428  1.00 37.02 ? 213 TRP B CZ3 1 
ATOM   4792  C CH2 . TRP B 1 175 ? 3.921   57.505  -9.457  1.00 36.65 ? 213 TRP B CH2 1 
ATOM   4793  N N   . LYS B 1 176 ? 0.503   54.695  -3.932  1.00 35.82 ? 214 LYS B N   1 
ATOM   4794  C CA  . LYS B 1 176 ? -0.482  53.710  -4.425  1.00 35.17 ? 214 LYS B CA  1 
ATOM   4795  C C   . LYS B 1 176 ? -0.268  52.416  -3.668  1.00 34.62 ? 214 LYS B C   1 
ATOM   4796  O O   . LYS B 1 176 ? 0.820   52.166  -3.199  1.00 33.52 ? 214 LYS B O   1 
ATOM   4797  C CB  . LYS B 1 176 ? -0.306  53.409  -5.928  1.00 34.96 ? 214 LYS B CB  1 
ATOM   4798  C CG  . LYS B 1 176 ? -0.125  54.605  -6.805  1.00 34.59 ? 214 LYS B CG  1 
ATOM   4799  C CD  . LYS B 1 176 ? -0.045  54.192  -8.273  1.00 36.01 ? 214 LYS B CD  1 
ATOM   4800  C CE  . LYS B 1 176 ? 0.113   55.417  -9.178  1.00 37.51 ? 214 LYS B CE  1 
ATOM   4801  N NZ  . LYS B 1 176 ? -0.412  55.243  -10.560 1.00 39.35 ? 214 LYS B NZ  1 
ATOM   4802  N N   . ALA B 1 177 ? -1.328  51.629  -3.531  1.00 34.61 ? 215 ALA B N   1 
ATOM   4803  C CA  . ALA B 1 177 ? -1.237  50.264  -3.058  1.00 34.50 ? 215 ALA B CA  1 
ATOM   4804  C C   . ALA B 1 177 ? -1.848  49.376  -4.135  1.00 34.63 ? 215 ALA B C   1 
ATOM   4805  O O   . ALA B 1 177 ? -2.699  49.835  -4.901  1.00 34.19 ? 215 ALA B O   1 
ATOM   4806  C CB  . ALA B 1 177 ? -1.976  50.119  -1.776  1.00 34.54 ? 215 ALA B CB  1 
ATOM   4807  N N   . ASP B 1 178 ? -1.399  48.130  -4.248  1.00 35.07 ? 216 ASP B N   1 
ATOM   4808  C CA  . ASP B 1 178 ? -2.135  47.180  -5.060  1.00 35.80 ? 216 ASP B CA  1 
ATOM   4809  C C   . ASP B 1 178 ? -3.112  46.480  -4.127  1.00 36.55 ? 216 ASP B C   1 
ATOM   4810  O O   . ASP B 1 178 ? -3.127  46.741  -2.906  1.00 35.46 ? 216 ASP B O   1 
ATOM   4811  C CB  . ASP B 1 178 ? -1.249  46.257  -5.922  1.00 35.78 ? 216 ASP B CB  1 
ATOM   4812  C CG  . ASP B 1 178 ? -0.560  45.156  -5.139  1.00 38.39 ? 216 ASP B CG  1 
ATOM   4813  O OD1 . ASP B 1 178 ? -1.052  44.820  -4.046  1.00 37.86 ? 216 ASP B OD1 1 
ATOM   4814  O OD2 . ASP B 1 178 ? 0.500   44.640  -5.627  1.00 39.33 ? 216 ASP B OD2 1 
ATOM   4815  N N   . ARG B 1 179 ? -3.962  45.624  -4.687  1.00 37.60 ? 217 ARG B N   1 
ATOM   4816  C CA  . ARG B 1 179 ? -5.010  45.026  -3.878  1.00 38.55 ? 217 ARG B CA  1 
ATOM   4817  C C   . ARG B 1 179 ? -4.507  43.902  -2.955  1.00 38.77 ? 217 ARG B C   1 
ATOM   4818  O O   . ARG B 1 179 ? -5.282  43.388  -2.130  1.00 39.06 ? 217 ARG B O   1 
ATOM   4819  C CB  . ARG B 1 179 ? -6.198  44.623  -4.748  1.00 38.80 ? 217 ARG B CB  1 
ATOM   4820  C CG  . ARG B 1 179 ? -6.923  45.854  -5.274  1.00 40.37 ? 217 ARG B CG  1 
ATOM   4821  C CD  . ARG B 1 179 ? -8.426  45.640  -5.528  1.00 42.89 ? 217 ARG B CD  1 
ATOM   4822  N NE  . ARG B 1 179 ? -9.093  46.887  -5.949  1.00 42.72 ? 217 ARG B NE  1 
ATOM   4823  C CZ  . ARG B 1 179 ? -9.008  47.417  -7.175  1.00 43.95 ? 217 ARG B CZ  1 
ATOM   4824  N NH1 . ARG B 1 179 ? -8.308  46.824  -8.131  1.00 43.38 ? 217 ARG B NH1 1 
ATOM   4825  N NH2 . ARG B 1 179 ? -9.640  48.548  -7.462  1.00 44.88 ? 217 ARG B NH2 1 
ATOM   4826  N N   . ALA B 1 180 ? -3.224  43.548  -3.074  1.00 38.12 ? 218 ALA B N   1 
ATOM   4827  C CA  . ALA B 1 180 ? -2.566  42.618  -2.144  1.00 38.26 ? 218 ALA B CA  1 
ATOM   4828  C C   . ALA B 1 180 ? -2.022  43.328  -0.927  1.00 38.17 ? 218 ALA B C   1 
ATOM   4829  O O   . ALA B 1 180 ? -1.715  42.667  0.050   1.00 39.55 ? 218 ALA B O   1 
ATOM   4830  C CB  . ALA B 1 180 ? -1.436  41.882  -2.830  1.00 37.70 ? 218 ALA B CB  1 
ATOM   4831  N N   . GLY B 1 181 ? -1.906  44.659  -0.984  1.00 37.40 ? 219 GLY B N   1 
ATOM   4832  C CA  . GLY B 1 181 ? -1.297  45.462  0.090   1.00 36.79 ? 219 GLY B CA  1 
ATOM   4833  C C   . GLY B 1 181 ? 0.141   45.928  -0.152  1.00 35.91 ? 219 GLY B C   1 
ATOM   4834  O O   . GLY B 1 181 ? 0.728   46.590  0.691   1.00 35.87 ? 219 GLY B O   1 
ATOM   4835  N N   . ASN B 1 182 ? 0.712   45.625  -1.307  1.00 35.31 ? 220 ASN B N   1 
ATOM   4836  C CA  . ASN B 1 182 ? 2.025   46.176  -1.664  1.00 35.08 ? 220 ASN B CA  1 
ATOM   4837  C C   . ASN B 1 182 ? 1.862   47.661  -1.892  1.00 34.75 ? 220 ASN B C   1 
ATOM   4838  O O   . ASN B 1 182 ? 0.824   48.074  -2.345  1.00 34.72 ? 220 ASN B O   1 
ATOM   4839  C CB  . ASN B 1 182 ? 2.595   45.521  -2.914  1.00 34.68 ? 220 ASN B CB  1 
ATOM   4840  C CG  . ASN B 1 182 ? 2.681   44.015  -2.797  1.00 33.80 ? 220 ASN B CG  1 
ATOM   4841  O OD1 . ASN B 1 182 ? 3.345   43.505  -1.923  1.00 34.52 ? 220 ASN B OD1 1 
ATOM   4842  N ND2 . ASN B 1 182 ? 2.015   43.306  -3.693  1.00 30.08 ? 220 ASN B ND2 1 
ATOM   4843  N N   . VAL B 1 183 ? 2.892   48.446  -1.583  1.00 35.03 ? 221 VAL B N   1 
ATOM   4844  C CA  . VAL B 1 183 ? 2.808   49.911  -1.535  1.00 35.06 ? 221 VAL B CA  1 
ATOM   4845  C C   . VAL B 1 183 ? 4.071   50.522  -2.175  1.00 35.35 ? 221 VAL B C   1 
ATOM   4846  O O   . VAL B 1 183 ? 5.169   50.027  -1.959  1.00 34.59 ? 221 VAL B O   1 
ATOM   4847  C CB  . VAL B 1 183 ? 2.695   50.380  -0.046  1.00 35.16 ? 221 VAL B CB  1 
ATOM   4848  C CG1 . VAL B 1 183 ? 3.276   51.791  0.185   1.00 35.14 ? 221 VAL B CG1 1 
ATOM   4849  C CG2 . VAL B 1 183 ? 1.295   50.308  0.412   1.00 34.19 ? 221 VAL B CG2 1 
ATOM   4850  N N   . ILE B 1 184 ? 3.889   51.607  -2.934  1.00 35.17 ? 222 ILE B N   1 
ATOM   4851  C CA  . ILE B 1 184 ? 4.976   52.409  -3.449  1.00 34.01 ? 222 ILE B CA  1 
ATOM   4852  C C   . ILE B 1 184 ? 4.775   53.856  -2.989  1.00 34.36 ? 222 ILE B C   1 
ATOM   4853  O O   . ILE B 1 184 ? 3.661   54.250  -2.687  1.00 34.14 ? 222 ILE B O   1 
ATOM   4854  C CB  . ILE B 1 184 ? 5.056   52.311  -5.007  1.00 34.73 ? 222 ILE B CB  1 
ATOM   4855  C CG1 . ILE B 1 184 ? 3.846   52.975  -5.689  1.00 32.16 ? 222 ILE B CG1 1 
ATOM   4856  C CG2 . ILE B 1 184 ? 5.211   50.824  -5.434  1.00 33.48 ? 222 ILE B CG2 1 
ATOM   4857  C CD1 . ILE B 1 184 ? 3.984   53.213  -7.203  1.00 32.98 ? 222 ILE B CD1 1 
ATOM   4858  N N   . PHE B 1 185 ? 5.867   54.619  -2.934  1.00 34.35 ? 223 PHE B N   1 
ATOM   4859  C CA  . PHE B 1 185 ? 5.897   56.031  -2.539  1.00 34.80 ? 223 PHE B CA  1 
ATOM   4860  C C   . PHE B 1 185 ? 6.352   56.873  -3.723  1.00 34.77 ? 223 PHE B C   1 
ATOM   4861  O O   . PHE B 1 185 ? 7.158   56.416  -4.548  1.00 35.52 ? 223 PHE B O   1 
ATOM   4862  C CB  . PHE B 1 185 ? 6.868   56.236  -1.361  1.00 35.17 ? 223 PHE B CB  1 
ATOM   4863  C CG  . PHE B 1 185 ? 6.596   55.326  -0.199  1.00 35.81 ? 223 PHE B CG  1 
ATOM   4864  C CD1 . PHE B 1 185 ? 5.849   55.761  0.872   1.00 38.55 ? 223 PHE B CD1 1 
ATOM   4865  C CD2 . PHE B 1 185 ? 7.062   54.016  -0.200  1.00 37.72 ? 223 PHE B CD2 1 
ATOM   4866  C CE1 . PHE B 1 185 ? 5.569   54.898  1.919   1.00 38.39 ? 223 PHE B CE1 1 
ATOM   4867  C CE2 . PHE B 1 185 ? 6.776   53.153  0.811   1.00 37.93 ? 223 PHE B CE2 1 
ATOM   4868  C CZ  . PHE B 1 185 ? 6.049   53.584  1.887   1.00 37.57 ? 223 PHE B CZ  1 
ATOM   4869  N N   . ARG B 1 186 ? 5.850   58.104  -3.793  1.00 34.26 ? 224 ARG B N   1 
ATOM   4870  C CA  . ARG B 1 186 ? 6.196   59.039  -4.846  1.00 34.00 ? 224 ARG B CA  1 
ATOM   4871  C C   . ARG B 1 186 ? 7.303   60.011  -4.451  1.00 34.70 ? 224 ARG B C   1 
ATOM   4872  O O   . ARG B 1 186 ? 7.233   60.631  -3.399  1.00 36.09 ? 224 ARG B O   1 
ATOM   4873  C CB  . ARG B 1 186 ? 4.962   59.852  -5.196  1.00 34.12 ? 224 ARG B CB  1 
ATOM   4874  C CG  . ARG B 1 186 ? 5.009   60.499  -6.543  1.00 32.59 ? 224 ARG B CG  1 
ATOM   4875  C CD  . ARG B 1 186 ? 3.634   61.005  -6.901  1.00 32.01 ? 224 ARG B CD  1 
ATOM   4876  N NE  . ARG B 1 186 ? 3.673   61.886  -8.057  1.00 30.94 ? 224 ARG B NE  1 
ATOM   4877  C CZ  . ARG B 1 186 ? 3.777   63.210  -7.999  1.00 32.98 ? 224 ARG B CZ  1 
ATOM   4878  N NH1 . ARG B 1 186 ? 3.815   63.909  -9.121  1.00 32.48 ? 224 ARG B NH1 1 
ATOM   4879  N NH2 . ARG B 1 186 ? 3.849   63.842  -6.829  1.00 34.51 ? 224 ARG B NH2 1 
ATOM   4880  N N   . LYS B 1 187 ? 8.316   60.150  -5.287  1.00 34.39 ? 225 LYS B N   1 
ATOM   4881  C CA  . LYS B 1 187 ? 9.399   61.102  -5.049  1.00 34.93 ? 225 LYS B CA  1 
ATOM   4882  C C   . LYS B 1 187 ? 9.978   61.118  -3.603  1.00 35.14 ? 225 LYS B C   1 
ATOM   4883  O O   . LYS B 1 187 ? 10.233  60.051  -3.040  1.00 35.09 ? 225 LYS B O   1 
ATOM   4884  C CB  . LYS B 1 187 ? 8.988   62.486  -5.559  1.00 34.27 ? 225 LYS B CB  1 
ATOM   4885  C CG  . LYS B 1 187 ? 8.429   62.409  -6.985  1.00 34.90 ? 225 LYS B CG  1 
ATOM   4886  C CD  . LYS B 1 187 ? 8.238   63.748  -7.619  1.00 36.11 ? 225 LYS B CD  1 
ATOM   4887  C CE  . LYS B 1 187 ? 7.611   63.599  -8.996  1.00 37.10 ? 225 LYS B CE  1 
ATOM   4888  N NZ  . LYS B 1 187 ? 8.361   64.386  -9.971  1.00 39.19 ? 225 LYS B NZ  1 
ATOM   4889  N N   . SER B 1 188 ? 10.178  62.315  -3.031  1.00 35.44 ? 226 SER B N   1 
ATOM   4890  C CA  . SER B 1 188 ? 10.842  62.491  -1.738  1.00 35.47 ? 226 SER B CA  1 
ATOM   4891  C C   . SER B 1 188 ? 9.844   62.323  -0.607  1.00 35.63 ? 226 SER B C   1 
ATOM   4892  O O   . SER B 1 188 ? 10.179  62.590  0.541   1.00 35.73 ? 226 SER B O   1 
ATOM   4893  C CB  . SER B 1 188 ? 11.540  63.872  -1.648  1.00 35.51 ? 226 SER B CB  1 
ATOM   4894  O OG  . SER B 1 188 ? 10.628  64.967  -1.513  1.00 34.97 ? 226 SER B OG  1 
ATOM   4895  N N   . ALA B 1 189 ? 8.626   61.873  -0.941  1.00 35.47 ? 227 ALA B N   1 
ATOM   4896  C CA  . ALA B 1 189 ? 7.546   61.754  0.015   1.00 35.39 ? 227 ALA B CA  1 
ATOM   4897  C C   . ALA B 1 189 ? 7.686   60.472  0.806   1.00 35.61 ? 227 ALA B C   1 
ATOM   4898  O O   . ALA B 1 189 ? 6.942   60.257  1.769   1.00 36.52 ? 227 ALA B O   1 
ATOM   4899  C CB  . ALA B 1 189 ? 6.179   61.804  -0.697  1.00 34.62 ? 227 ALA B CB  1 
ATOM   4900  N N   . ARG B 1 190 ? 8.628   59.621  0.387   1.00 35.49 ? 228 ARG B N   1 
ATOM   4901  C CA  . ARG B 1 190 ? 8.961   58.341  1.047   1.00 35.46 ? 228 ARG B CA  1 
ATOM   4902  C C   . ARG B 1 190 ? 9.600   58.510  2.437   1.00 35.88 ? 228 ARG B C   1 
ATOM   4903  O O   . ARG B 1 190 ? 9.214   57.860  3.388   1.00 37.85 ? 228 ARG B O   1 
ATOM   4904  C CB  . ARG B 1 190 ? 9.944   57.559  0.143   1.00 35.66 ? 228 ARG B CB  1 
ATOM   4905  C CG  . ARG B 1 190 ? 10.157  56.100  0.521   1.00 35.91 ? 228 ARG B CG  1 
ATOM   4906  C CD  . ARG B 1 190 ? 11.244  55.401  -0.335  1.00 35.73 ? 228 ARG B CD  1 
ATOM   4907  N NE  . ARG B 1 190 ? 11.044  55.476  -1.776  1.00 35.12 ? 228 ARG B NE  1 
ATOM   4908  C CZ  . ARG B 1 190 ? 11.754  54.805  -2.694  1.00 35.71 ? 228 ARG B CZ  1 
ATOM   4909  N NH1 . ARG B 1 190 ? 12.678  53.930  -2.369  1.00 38.19 ? 228 ARG B NH1 1 
ATOM   4910  N NH2 . ARG B 1 190 ? 11.504  54.965  -3.956  1.00 37.15 ? 228 ARG B NH2 1 
ATOM   4911  N N   . ASN B 1 191 ? 10.608  59.356  2.532   1.00 35.51 ? 229 ASN B N   1 
ATOM   4912  C CA  . ASN B 1 191 ? 11.310  59.641  3.776   1.00 34.82 ? 229 ASN B CA  1 
ATOM   4913  C C   . ASN B 1 191 ? 11.166  58.609  4.943   1.00 35.11 ? 229 ASN B C   1 
ATOM   4914  O O   . ASN B 1 191 ? 11.693  57.486  4.852   1.00 34.58 ? 229 ASN B O   1 
ATOM   4915  C CB  . ASN B 1 191 ? 11.046  61.114  4.214   1.00 34.58 ? 229 ASN B CB  1 
ATOM   4916  C CG  . ASN B 1 191 ? 9.570   61.476  4.322   1.00 33.56 ? 229 ASN B CG  1 
ATOM   4917  O OD1 . ASN B 1 191 ? 8.904   61.115  5.278   1.00 29.53 ? 229 ASN B OD1 1 
ATOM   4918  N ND2 . ASN B 1 191 ? 9.081   62.251  3.377   1.00 29.98 ? 229 ASN B ND2 1 
ATOM   4919  N N   . PHE B 1 192 ? 10.491  59.015  6.020   1.00 34.41 ? 230 PHE B N   1 
ATOM   4920  C CA  . PHE B 1 192 ? 10.282  58.189  7.200   1.00 34.12 ? 230 PHE B CA  1 
ATOM   4921  C C   . PHE B 1 192 ? 9.108   57.233  7.068   1.00 34.37 ? 230 PHE B C   1 
ATOM   4922  O O   . PHE B 1 192 ? 8.995   56.311  7.860   1.00 35.15 ? 230 PHE B O   1 
ATOM   4923  C CB  . PHE B 1 192 ? 10.121  59.063  8.450   1.00 32.68 ? 230 PHE B CB  1 
ATOM   4924  C CG  . PHE B 1 192 ? 11.418  59.639  8.943   1.00 32.07 ? 230 PHE B CG  1 
ATOM   4925  C CD1 . PHE B 1 192 ? 11.926  60.800  8.413   1.00 31.58 ? 230 PHE B CD1 1 
ATOM   4926  C CD2 . PHE B 1 192 ? 12.152  58.995  9.937   1.00 34.66 ? 230 PHE B CD2 1 
ATOM   4927  C CE1 . PHE B 1 192 ? 13.147  61.321  8.874   1.00 33.92 ? 230 PHE B CE1 1 
ATOM   4928  C CE2 . PHE B 1 192 ? 13.390  59.507  10.400  1.00 32.60 ? 230 PHE B CE2 1 
ATOM   4929  C CZ  . PHE B 1 192 ? 13.876  60.657  9.880   1.00 31.60 ? 230 PHE B CZ  1 
ATOM   4930  N N   . ASN B 1 193 ? 8.242   57.437  6.079   1.00 35.08 ? 231 ASN B N   1 
ATOM   4931  C CA  . ASN B 1 193 ? 7.104   56.526  5.860   1.00 34.97 ? 231 ASN B CA  1 
ATOM   4932  C C   . ASN B 1 193 ? 7.528   55.083  5.665   1.00 35.39 ? 231 ASN B C   1 
ATOM   4933  O O   . ASN B 1 193 ? 6.923   54.228  6.240   1.00 36.95 ? 231 ASN B O   1 
ATOM   4934  C CB  . ASN B 1 193 ? 6.246   56.947  4.657   1.00 34.85 ? 231 ASN B CB  1 
ATOM   4935  C CG  . ASN B 1 193 ? 5.449   58.189  4.913   1.00 33.22 ? 231 ASN B CG  1 
ATOM   4936  O OD1 . ASN B 1 193 ? 4.529   58.202  5.718   1.00 34.73 ? 231 ASN B OD1 1 
ATOM   4937  N ND2 . ASN B 1 193 ? 5.797   59.242  4.236   1.00 36.33 ? 231 ASN B ND2 1 
ATOM   4938  N N   . LEU B 1 194 ? 8.539   54.808  4.827   1.00 36.18 ? 232 LEU B N   1 
ATOM   4939  C CA  . LEU B 1 194 ? 9.020   53.430  4.569   1.00 35.59 ? 232 LEU B CA  1 
ATOM   4940  C C   . LEU B 1 194 ? 9.546   52.687  5.801   1.00 35.27 ? 232 LEU B C   1 
ATOM   4941  O O   . LEU B 1 194 ? 9.075   51.602  6.104   1.00 36.22 ? 232 LEU B O   1 
ATOM   4942  C CB  . LEU B 1 194 ? 10.068  53.418  3.443   1.00 35.83 ? 232 LEU B CB  1 
ATOM   4943  C CG  . LEU B 1 194 ? 10.583  52.084  2.894   1.00 35.32 ? 232 LEU B CG  1 
ATOM   4944  C CD1 . LEU B 1 194 ? 10.836  52.109  1.343   1.00 31.86 ? 232 LEU B CD1 1 
ATOM   4945  C CD2 . LEU B 1 194 ? 11.830  51.662  3.661   1.00 34.86 ? 232 LEU B CD2 1 
ATOM   4946  N N   . PRO B 1 195 ? 10.544  53.228  6.511   1.00 34.67 ? 233 PRO B N   1 
ATOM   4947  C CA  . PRO B 1 195 ? 10.932  52.494  7.708   1.00 34.53 ? 233 PRO B CA  1 
ATOM   4948  C C   . PRO B 1 195 ? 9.863   52.407  8.796   1.00 35.66 ? 233 PRO B C   1 
ATOM   4949  O O   . PRO B 1 195 ? 9.825   51.427  9.532   1.00 36.45 ? 233 PRO B O   1 
ATOM   4950  C CB  . PRO B 1 195 ? 12.125  53.284  8.226   1.00 34.73 ? 233 PRO B CB  1 
ATOM   4951  C CG  . PRO B 1 195 ? 11.983  54.636  7.665   1.00 34.52 ? 233 PRO B CG  1 
ATOM   4952  C CD  . PRO B 1 195 ? 11.385  54.418  6.308   1.00 34.48 ? 233 PRO B CD  1 
ATOM   4953  N N   . MET B 1 196 ? 9.021   53.434  8.930   1.00 36.51 ? 234 MET B N   1 
ATOM   4954  C CA  . MET B 1 196 ? 7.965   53.414  9.941   1.00 35.92 ? 234 MET B CA  1 
ATOM   4955  C C   . MET B 1 196 ? 6.916   52.368  9.694   1.00 35.61 ? 234 MET B C   1 
ATOM   4956  O O   . MET B 1 196 ? 6.335   51.866  10.647  1.00 36.50 ? 234 MET B O   1 
ATOM   4957  C CB  . MET B 1 196 ? 7.310   54.761  10.038  1.00 36.02 ? 234 MET B CB  1 
ATOM   4958  C CG  . MET B 1 196 ? 8.137   55.729  10.792  1.00 35.24 ? 234 MET B CG  1 
ATOM   4959  S SD  . MET B 1 196 ? 7.250   57.262  10.840  1.00 35.16 ? 234 MET B SD  1 
ATOM   4960  C CE  . MET B 1 196 ? 8.304   58.162  12.021  1.00 30.22 ? 234 MET B CE  1 
ATOM   4961  N N   . CYS B 1 197 ? 6.705   51.998  8.441   1.00 35.14 ? 235 CYS B N   1 
ATOM   4962  C CA  . CYS B 1 197 ? 5.915   50.806  8.119   1.00 35.28 ? 235 CYS B CA  1 
ATOM   4963  C C   . CYS B 1 197 ? 6.363   49.509  8.742   1.00 34.91 ? 235 CYS B C   1 
ATOM   4964  O O   . CYS B 1 197 ? 5.604   48.535  8.790   1.00 34.68 ? 235 CYS B O   1 
ATOM   4965  C CB  . CYS B 1 197 ? 5.995   50.512  6.630   1.00 35.58 ? 235 CYS B CB  1 
ATOM   4966  S SG  . CYS B 1 197 ? 4.900   51.398  5.707   1.00 38.28 ? 235 CYS B SG  1 
ATOM   4967  N N   . LYS B 1 198 ? 7.636   49.426  9.092   1.00 34.93 ? 236 LYS B N   1 
ATOM   4968  C CA  . LYS B 1 198 ? 8.179   48.159  9.535   1.00 35.04 ? 236 LYS B CA  1 
ATOM   4969  C C   . LYS B 1 198 ? 8.242   48.003  11.059  1.00 34.32 ? 236 LYS B C   1 
ATOM   4970  O O   . LYS B 1 198 ? 8.482   46.918  11.548  1.00 33.77 ? 236 LYS B O   1 
ATOM   4971  C CB  . LYS B 1 198 ? 9.561   47.974  8.934   1.00 34.70 ? 236 LYS B CB  1 
ATOM   4972  C CG  . LYS B 1 198 ? 9.609   48.079  7.387   1.00 35.49 ? 236 LYS B CG  1 
ATOM   4973  C CD  . LYS B 1 198 ? 11.029  48.094  6.891   1.00 32.91 ? 236 LYS B CD  1 
ATOM   4974  C CE  . LYS B 1 198 ? 11.081  48.399  5.430   1.00 33.81 ? 236 LYS B CE  1 
ATOM   4975  N NZ  . LYS B 1 198 ? 12.439  48.261  5.004   1.00 36.36 ? 236 LYS B NZ  1 
ATOM   4976  N N   . ALA B 1 199 ? 8.051   49.097  11.780  1.00 34.74 ? 237 ALA B N   1 
ATOM   4977  C CA  . ALA B 1 199 ? 8.465   49.212  13.179  1.00 35.10 ? 237 ALA B CA  1 
ATOM   4978  C C   . ALA B 1 199 ? 7.292   49.342  14.175  1.00 35.94 ? 237 ALA B C   1 
ATOM   4979  O O   . ALA B 1 199 ? 7.503   49.603  15.363  1.00 36.42 ? 237 ALA B O   1 
ATOM   4980  C CB  . ALA B 1 199 ? 9.393   50.362  13.328  1.00 34.32 ? 237 ALA B CB  1 
ATOM   4981  N N   . ALA B 1 200 ? 6.062   49.136  13.704  1.00 36.24 ? 238 ALA B N   1 
ATOM   4982  C CA  . ALA B 1 200 ? 4.871   49.263  14.558  1.00 36.31 ? 238 ALA B CA  1 
ATOM   4983  C C   . ALA B 1 200 ? 4.100   47.950  14.549  1.00 35.78 ? 238 ALA B C   1 
ATOM   4984  O O   . ALA B 1 200 ? 4.189   47.187  13.596  1.00 36.47 ? 238 ALA B O   1 
ATOM   4985  C CB  . ALA B 1 200 ? 4.002   50.425  14.089  1.00 36.08 ? 238 ALA B CB  1 
ATOM   4986  N N   . GLU B 1 201 ? 3.400   47.659  15.636  1.00 34.66 ? 239 GLU B N   1 
ATOM   4987  C CA  . GLU B 1 201 ? 2.595   46.454  15.707  1.00 34.72 ? 239 GLU B CA  1 
ATOM   4988  C C   . GLU B 1 201 ? 1.460   46.515  14.665  1.00 34.90 ? 239 GLU B C   1 
ATOM   4989  O O   . GLU B 1 201 ? 1.099   45.498  14.075  1.00 35.97 ? 239 GLU B O   1 
ATOM   4990  C CB  . GLU B 1 201 ? 2.053   46.252  17.138  1.00 34.40 ? 239 GLU B CB  1 
ATOM   4991  N N   . THR B 1 202 ? 0.889   47.700  14.432  1.00 35.22 ? 240 THR B N   1 
ATOM   4992  C CA  . THR B 1 202 ? -0.093  47.867  13.371  1.00 34.82 ? 240 THR B CA  1 
ATOM   4993  C C   . THR B 1 202 ? 0.234   49.082  12.537  1.00 34.75 ? 240 THR B C   1 
ATOM   4994  O O   . THR B 1 202 ? 0.220   50.207  13.029  1.00 34.51 ? 240 THR B O   1 
ATOM   4995  C CB  . THR B 1 202 ? -1.524  48.013  13.950  1.00 35.21 ? 240 THR B CB  1 
ATOM   4996  O OG1 . THR B 1 202 ? -1.830  46.874  14.768  1.00 34.76 ? 240 THR B OG1 1 
ATOM   4997  C CG2 . THR B 1 202 ? -2.559  48.156  12.846  1.00 34.81 ? 240 THR B CG2 1 
ATOM   4998  N N   . THR B 1 203 ? 0.536   48.855  11.263  1.00 34.31 ? 241 THR B N   1 
ATOM   4999  C CA  . THR B 1 203 ? 0.731   49.949  10.354  1.00 34.58 ? 241 THR B CA  1 
ATOM   5000  C C   . THR B 1 203 ? -0.588  50.265  9.601   1.00 34.47 ? 241 THR B C   1 
ATOM   5001  O O   . THR B 1 203 ? -1.284  49.357  9.091   1.00 34.32 ? 241 THR B O   1 
ATOM   5002  C CB  . THR B 1 203 ? 1.906   49.664  9.425   1.00 36.04 ? 241 THR B CB  1 
ATOM   5003  O OG1 . THR B 1 203 ? 1.451   48.903  8.298   1.00 40.91 ? 241 THR B OG1 1 
ATOM   5004  C CG2 . THR B 1 203 ? 3.002   48.905  10.174  1.00 32.16 ? 241 THR B CG2 1 
ATOM   5005  N N   . VAL B 1 204 ? -0.969  51.550  9.619   1.00 33.50 ? 242 VAL B N   1 
ATOM   5006  C CA  . VAL B 1 204 ? -2.072  52.057  8.833   1.00 32.68 ? 242 VAL B CA  1 
ATOM   5007  C C   . VAL B 1 204 ? -1.481  52.950  7.738   1.00 33.42 ? 242 VAL B C   1 
ATOM   5008  O O   . VAL B 1 204 ? -0.755  53.915  8.014   1.00 33.75 ? 242 VAL B O   1 
ATOM   5009  C CB  . VAL B 1 204 ? -3.121  52.800  9.714   1.00 32.86 ? 242 VAL B CB  1 
ATOM   5010  C CG1 . VAL B 1 204 ? -4.397  53.114  8.898   1.00 31.45 ? 242 VAL B CG1 1 
ATOM   5011  C CG2 . VAL B 1 204 ? -3.449  51.951  10.952  1.00 30.34 ? 242 VAL B CG2 1 
ATOM   5012  N N   . VAL B 1 205 ? -1.746  52.580  6.489   1.00 33.85 ? 243 VAL B N   1 
ATOM   5013  C CA  . VAL B 1 205 ? -1.236  53.304  5.327   1.00 33.84 ? 243 VAL B CA  1 
ATOM   5014  C C   . VAL B 1 205 ? -2.429  53.949  4.609   1.00 34.09 ? 243 VAL B C   1 
ATOM   5015  O O   . VAL B 1 205 ? -3.441  53.297  4.368   1.00 33.20 ? 243 VAL B O   1 
ATOM   5016  C CB  . VAL B 1 205 ? -0.477  52.355  4.360   1.00 34.58 ? 243 VAL B CB  1 
ATOM   5017  C CG1 . VAL B 1 205 ? 0.081   53.143  3.118   1.00 33.89 ? 243 VAL B CG1 1 
ATOM   5018  C CG2 . VAL B 1 205 ? 0.645   51.536  5.098   1.00 31.96 ? 243 VAL B CG2 1 
ATOM   5019  N N   . GLU B 1 206 ? -2.331  55.240  4.307   1.00 34.59 ? 244 GLU B N   1 
ATOM   5020  C CA  . GLU B 1 206 ? -3.266  55.865  3.364   1.00 34.93 ? 244 GLU B CA  1 
ATOM   5021  C C   . GLU B 1 206 ? -2.567  56.116  2.028   1.00 35.08 ? 244 GLU B C   1 
ATOM   5022  O O   . GLU B 1 206 ? -1.471  56.631  2.006   1.00 34.33 ? 244 GLU B O   1 
ATOM   5023  C CB  . GLU B 1 206 ? -3.834  57.173  3.916   1.00 35.33 ? 244 GLU B CB  1 
ATOM   5024  C CG  . GLU B 1 206 ? -2.780  58.247  4.142   1.00 35.83 ? 244 GLU B CG  1 
ATOM   5025  C CD  . GLU B 1 206 ? -3.356  59.490  4.713   1.00 36.98 ? 244 GLU B CD  1 
ATOM   5026  O OE1 . GLU B 1 206 ? -3.216  59.661  5.948   1.00 39.70 ? 244 GLU B OE1 1 
ATOM   5027  O OE2 . GLU B 1 206 ? -3.961  60.274  3.938   1.00 32.90 ? 244 GLU B OE2 1 
ATOM   5028  N N   . VAL B 1 207 ? -3.232  55.776  0.921   1.00 36.11 ? 245 VAL B N   1 
ATOM   5029  C CA  . VAL B 1 207 ? -2.699  55.975  -0.424  1.00 36.32 ? 245 VAL B CA  1 
ATOM   5030  C C   . VAL B 1 207 ? -3.593  56.924  -1.248  1.00 37.13 ? 245 VAL B C   1 
ATOM   5031  O O   . VAL B 1 207 ? -4.718  57.188  -0.882  1.00 36.90 ? 245 VAL B O   1 
ATOM   5032  C CB  . VAL B 1 207 ? -2.579  54.619  -1.184  1.00 36.53 ? 245 VAL B CB  1 
ATOM   5033  C CG1 . VAL B 1 207 ? -1.457  53.734  -0.569  1.00 35.28 ? 245 VAL B CG1 1 
ATOM   5034  C CG2 . VAL B 1 207 ? -3.961  53.887  -1.232  1.00 36.05 ? 245 VAL B CG2 1 
ATOM   5035  N N   . GLU B 1 208 ? -3.066  57.412  -2.367  1.00 37.63 ? 246 GLU B N   1 
ATOM   5036  C CA  . GLU B 1 208 ? -3.800  58.263  -3.279  1.00 38.07 ? 246 GLU B CA  1 
ATOM   5037  C C   . GLU B 1 208 ? -4.661  57.454  -4.235  1.00 37.88 ? 246 GLU B C   1 
ATOM   5038  O O   . GLU B 1 208 ? -5.648  57.966  -4.743  1.00 39.09 ? 246 GLU B O   1 
ATOM   5039  C CB  . GLU B 1 208 ? -2.822  59.157  -4.040  1.00 38.21 ? 246 GLU B CB  1 
ATOM   5040  C CG  . GLU B 1 208 ? -2.150  60.174  -3.118  1.00 38.99 ? 246 GLU B CG  1 
ATOM   5041  C CD  . GLU B 1 208 ? -1.099  61.045  -3.790  1.00 39.08 ? 246 GLU B CD  1 
ATOM   5042  O OE1 . GLU B 1 208 ? -1.242  61.454  -4.961  1.00 41.34 ? 246 GLU B OE1 1 
ATOM   5043  O OE2 . GLU B 1 208 ? -0.118  61.345  -3.107  1.00 43.44 ? 246 GLU B OE2 1 
ATOM   5044  N N   . GLU B 1 209 ? -4.324  56.181  -4.433  1.00 37.94 ? 247 GLU B N   1 
ATOM   5045  C CA  . GLU B 1 209 ? -4.946  55.344  -5.455  1.00 38.26 ? 247 GLU B CA  1 
ATOM   5046  C C   . GLU B 1 209 ? -4.721  53.857  -5.154  1.00 37.24 ? 247 GLU B C   1 
ATOM   5047  O O   . GLU B 1 209 ? -3.656  53.489  -4.683  1.00 36.78 ? 247 GLU B O   1 
ATOM   5048  C CB  . GLU B 1 209 ? -4.300  55.694  -6.798  1.00 38.37 ? 247 GLU B CB  1 
ATOM   5049  C CG  . GLU B 1 209 ? -4.961  55.131  -8.034  1.00 40.55 ? 247 GLU B CG  1 
ATOM   5050  C CD  . GLU B 1 209 ? -4.079  55.304  -9.274  1.00 41.72 ? 247 GLU B CD  1 
ATOM   5051  O OE1 . GLU B 1 209 ? -3.007  55.957  -9.159  1.00 47.28 ? 247 GLU B OE1 1 
ATOM   5052  O OE2 . GLU B 1 209 ? -4.441  54.780  -10.351 1.00 44.35 ? 247 GLU B OE2 1 
ATOM   5053  N N   . ILE B 1 210 ? -5.722  53.011  -5.409  1.00 36.71 ? 248 ILE B N   1 
ATOM   5054  C CA  . ILE B 1 210 ? -5.563  51.548  -5.335  1.00 36.29 ? 248 ILE B CA  1 
ATOM   5055  C C   . ILE B 1 210 ? -5.595  50.962  -6.725  1.00 36.06 ? 248 ILE B C   1 
ATOM   5056  O O   . ILE B 1 210 ? -6.482  51.288  -7.503  1.00 35.95 ? 248 ILE B O   1 
ATOM   5057  C CB  . ILE B 1 210 ? -6.668  50.852  -4.525  1.00 36.43 ? 248 ILE B CB  1 
ATOM   5058  C CG1 . ILE B 1 210 ? -6.585  51.263  -3.051  1.00 37.02 ? 248 ILE B CG1 1 
ATOM   5059  C CG2 . ILE B 1 210 ? -6.537  49.329  -4.647  1.00 34.94 ? 248 ILE B CG2 1 
ATOM   5060  C CD1 . ILE B 1 210 ? -7.430  50.409  -2.162  1.00 36.37 ? 248 ILE B CD1 1 
ATOM   5061  N N   . VAL B 1 211 ? -4.625  50.099  -7.027  1.00 36.25 ? 249 VAL B N   1 
ATOM   5062  C CA  . VAL B 1 211 ? -4.468  49.470  -8.357  1.00 35.83 ? 249 VAL B CA  1 
ATOM   5063  C C   . VAL B 1 211 ? -4.597  47.953  -8.209  1.00 36.38 ? 249 VAL B C   1 
ATOM   5064  O O   . VAL B 1 211 ? -4.673  47.437  -7.098  1.00 36.03 ? 249 VAL B O   1 
ATOM   5065  C CB  . VAL B 1 211 ? -3.101  49.822  -9.021  1.00 35.41 ? 249 VAL B CB  1 
ATOM   5066  C CG1 . VAL B 1 211 ? -3.016  51.292  -9.396  1.00 33.37 ? 249 VAL B CG1 1 
ATOM   5067  C CG2 . VAL B 1 211 ? -1.930  49.438  -8.111  1.00 34.56 ? 249 VAL B CG2 1 
ATOM   5068  N N   . ASP B 1 212 ? -4.625  47.245  -9.331  1.00 37.46 ? 250 ASP B N   1 
ATOM   5069  C CA  . ASP B 1 212 ? -4.785  45.798  -9.330  1.00 38.78 ? 250 ASP B CA  1 
ATOM   5070  C C   . ASP B 1 212 ? -3.509  45.091  -8.892  1.00 39.38 ? 250 ASP B C   1 
ATOM   5071  O O   . ASP B 1 212 ? -2.395  45.614  -9.044  1.00 39.28 ? 250 ASP B O   1 
ATOM   5072  C CB  . ASP B 1 212 ? -5.127  45.291  -10.738 1.00 39.19 ? 250 ASP B CB  1 
ATOM   5073  C CG  . ASP B 1 212 ? -6.522  45.660  -11.187 1.00 41.17 ? 250 ASP B CG  1 
ATOM   5074  O OD1 . ASP B 1 212 ? -7.434  45.802  -10.342 1.00 43.22 ? 250 ASP B OD1 1 
ATOM   5075  O OD2 . ASP B 1 212 ? -6.725  45.778  -12.414 1.00 44.59 ? 250 ASP B OD2 1 
ATOM   5076  N N   . ILE B 1 213 ? -3.676  43.880  -8.371  1.00 40.34 ? 251 ILE B N   1 
ATOM   5077  C CA  . ILE B 1 213 ? -2.546  42.970  -8.159  1.00 41.11 ? 251 ILE B CA  1 
ATOM   5078  C C   . ILE B 1 213 ? -1.891  42.784  -9.523  1.00 40.88 ? 251 ILE B C   1 
ATOM   5079  O O   . ILE B 1 213 ? -2.589  42.603  -10.520 1.00 40.91 ? 251 ILE B O   1 
ATOM   5080  C CB  . ILE B 1 213 ? -3.009  41.613  -7.548  1.00 41.07 ? 251 ILE B CB  1 
ATOM   5081  C CG1 . ILE B 1 213 ? -3.610  41.837  -6.164  1.00 41.59 ? 251 ILE B CG1 1 
ATOM   5082  C CG2 . ILE B 1 213 ? -1.857  40.673  -7.379  1.00 42.02 ? 251 ILE B CG2 1 
ATOM   5083  C CD1 . ILE B 1 213 ? -3.888  40.555  -5.401  1.00 41.77 ? 251 ILE B CD1 1 
ATOM   5084  N N   . GLY B 1 214 ? -0.563  42.908  -9.584  1.00 41.31 ? 252 GLY B N   1 
ATOM   5085  C CA  . GLY B 1 214 ? 0.170   42.826  -10.872 1.00 40.63 ? 252 GLY B CA  1 
ATOM   5086  C C   . GLY B 1 214 ? 0.522   44.146  -11.545 1.00 40.36 ? 252 GLY B C   1 
ATOM   5087  O O   . GLY B 1 214 ? 1.206   44.148  -12.575 1.00 40.88 ? 252 GLY B O   1 
ATOM   5088  N N   . ALA B 1 215 ? 0.054   45.269  -10.991 1.00 39.47 ? 253 ALA B N   1 
ATOM   5089  C CA  . ALA B 1 215 ? 0.366   46.603  -11.539 1.00 38.75 ? 253 ALA B CA  1 
ATOM   5090  C C   . ALA B 1 215 ? 1.815   47.012  -11.257 1.00 38.25 ? 253 ALA B C   1 
ATOM   5091  O O   . ALA B 1 215 ? 2.397   47.784  -12.017 1.00 37.37 ? 253 ALA B O   1 
ATOM   5092  C CB  . ALA B 1 215 ? -0.595  47.663  -10.973 1.00 38.45 ? 253 ALA B CB  1 
ATOM   5093  N N   . PHE B 1 216 ? 2.390   46.506  -10.158 1.00 37.53 ? 254 PHE B N   1 
ATOM   5094  C CA  . PHE B 1 216 ? 3.769   46.837  -9.783  1.00 37.15 ? 254 PHE B CA  1 
ATOM   5095  C C   . PHE B 1 216 ? 4.718   45.723  -10.205 1.00 36.77 ? 254 PHE B C   1 
ATOM   5096  O O   . PHE B 1 216 ? 4.449   44.559  -9.931  1.00 38.40 ? 254 PHE B O   1 
ATOM   5097  C CB  . PHE B 1 216 ? 3.924   46.989  -8.270  1.00 36.84 ? 254 PHE B CB  1 
ATOM   5098  C CG  . PHE B 1 216 ? 3.006   47.996  -7.624  1.00 36.63 ? 254 PHE B CG  1 
ATOM   5099  C CD1 . PHE B 1 216 ? 2.641   49.171  -8.271  1.00 36.41 ? 254 PHE B CD1 1 
ATOM   5100  C CD2 . PHE B 1 216 ? 2.559   47.784  -6.319  1.00 36.69 ? 254 PHE B CD2 1 
ATOM   5101  C CE1 . PHE B 1 216 ? 1.826   50.098  -7.648  1.00 36.55 ? 254 PHE B CE1 1 
ATOM   5102  C CE2 . PHE B 1 216 ? 1.750   48.706  -5.689  1.00 36.50 ? 254 PHE B CE2 1 
ATOM   5103  C CZ  . PHE B 1 216 ? 1.384   49.872  -6.356  1.00 36.41 ? 254 PHE B CZ  1 
ATOM   5104  N N   . ALA B 1 217 ? 5.843   46.071  -10.820 1.00 35.52 ? 255 ALA B N   1 
ATOM   5105  C CA  . ALA B 1 217 ? 6.891   45.095  -11.093 1.00 34.65 ? 255 ALA B CA  1 
ATOM   5106  C C   . ALA B 1 217 ? 7.346   44.544  -9.756  1.00 34.18 ? 255 ALA B C   1 
ATOM   5107  O O   . ALA B 1 217 ? 7.527   45.298  -8.799  1.00 34.54 ? 255 ALA B O   1 
ATOM   5108  C CB  . ALA B 1 217 ? 8.056   45.723  -11.839 1.00 34.38 ? 255 ALA B CB  1 
ATOM   5109  N N   . PRO B 1 218 ? 7.514   43.218  -9.658  1.00 33.00 ? 256 PRO B N   1 
ATOM   5110  C CA  . PRO B 1 218 ? 7.898   42.677  -8.353  1.00 32.42 ? 256 PRO B CA  1 
ATOM   5111  C C   . PRO B 1 218 ? 9.214   43.231  -7.731  1.00 32.37 ? 256 PRO B C   1 
ATOM   5112  O O   . PRO B 1 218 ? 9.326   43.361  -6.515  1.00 31.51 ? 256 PRO B O   1 
ATOM   5113  C CB  . PRO B 1 218 ? 7.961   41.178  -8.606  1.00 32.81 ? 256 PRO B CB  1 
ATOM   5114  C CG  . PRO B 1 218 ? 7.905   40.988  -10.075 1.00 32.92 ? 256 PRO B CG  1 
ATOM   5115  C CD  . PRO B 1 218 ? 7.327   42.189  -10.698 1.00 32.28 ? 256 PRO B CD  1 
ATOM   5116  N N   . GLU B 1 219 ? 10.184  43.577  -8.563  1.00 32.90 ? 257 GLU B N   1 
ATOM   5117  C CA  . GLU B 1 219 ? 11.418  44.227  -8.114  1.00 33.14 ? 257 GLU B CA  1 
ATOM   5118  C C   . GLU B 1 219 ? 11.223  45.650  -7.615  1.00 33.79 ? 257 GLU B C   1 
ATOM   5119  O O   . GLU B 1 219 ? 12.106  46.189  -6.938  1.00 33.62 ? 257 GLU B O   1 
ATOM   5120  C CB  . GLU B 1 219 ? 12.427  44.308  -9.272  1.00 32.89 ? 257 GLU B CB  1 
ATOM   5121  C CG  . GLU B 1 219 ? 13.028  43.000  -9.673  1.00 33.36 ? 257 GLU B CG  1 
ATOM   5122  C CD  . GLU B 1 219 ? 12.269  42.335  -10.772 1.00 34.78 ? 257 GLU B CD  1 
ATOM   5123  O OE1 . GLU B 1 219 ? 11.119  42.730  -10.991 1.00 37.29 ? 257 GLU B OE1 1 
ATOM   5124  O OE2 . GLU B 1 219 ? 12.810  41.399  -11.391 1.00 37.33 ? 257 GLU B OE2 1 
ATOM   5125  N N   . ASP B 1 220 ? 10.095  46.279  -7.963  1.00 34.69 ? 258 ASP B N   1 
ATOM   5126  C CA  . ASP B 1 220 ? 9.897   47.719  -7.696  1.00 35.54 ? 258 ASP B CA  1 
ATOM   5127  C C   . ASP B 1 220 ? 8.885   48.005  -6.593  1.00 35.60 ? 258 ASP B C   1 
ATOM   5128  O O   . ASP B 1 220 ? 8.399   49.115  -6.454  1.00 36.33 ? 258 ASP B O   1 
ATOM   5129  C CB  . ASP B 1 220 ? 9.565   48.453  -9.006  1.00 35.49 ? 258 ASP B CB  1 
ATOM   5130  C CG  . ASP B 1 220 ? 10.704  48.279  -10.090 1.00 39.62 ? 258 ASP B CG  1 
ATOM   5131  O OD1 . ASP B 1 220 ? 11.914  48.201  -9.704  1.00 40.83 ? 258 ASP B OD1 1 
ATOM   5132  O OD2 . ASP B 1 220 ? 10.373  48.211  -11.303 1.00 42.69 ? 258 ASP B OD2 1 
ATOM   5133  N N   . ILE B 1 221 ? 8.610   47.026  -5.740  1.00 35.89 ? 259 ILE B N   1 
ATOM   5134  C CA  . ILE B 1 221 ? 7.681   47.244  -4.639  1.00 34.82 ? 259 ILE B CA  1 
ATOM   5135  C C   . ILE B 1 221 ? 8.491   47.858  -3.500  1.00 34.94 ? 259 ILE B C   1 
ATOM   5136  O O   . ILE B 1 221 ? 9.519   47.323  -3.149  1.00 36.01 ? 259 ILE B O   1 
ATOM   5137  C CB  . ILE B 1 221 ? 6.979   45.943  -4.282  1.00 34.75 ? 259 ILE B CB  1 
ATOM   5138  C CG1 . ILE B 1 221 ? 5.969   45.595  -5.386  1.00 35.67 ? 259 ILE B CG1 1 
ATOM   5139  C CG2 . ILE B 1 221 ? 6.292   46.035  -2.902  1.00 34.38 ? 259 ILE B CG2 1 
ATOM   5140  C CD1 . ILE B 1 221 ? 5.648   44.121  -5.472  1.00 35.36 ? 259 ILE B CD1 1 
ATOM   5141  N N   . HIS B 1 222 ? 8.070   49.009  -2.971  1.00 34.61 ? 260 HIS B N   1 
ATOM   5142  C CA  . HIS B 1 222 ? 8.836   49.702  -1.923  1.00 33.96 ? 260 HIS B CA  1 
ATOM   5143  C C   . HIS B 1 222 ? 8.579   49.144  -0.529  1.00 34.00 ? 260 HIS B C   1 
ATOM   5144  O O   . HIS B 1 222 ? 9.494   49.000  0.249   1.00 34.54 ? 260 HIS B O   1 
ATOM   5145  C CB  . HIS B 1 222 ? 8.520   51.198  -1.912  1.00 34.37 ? 260 HIS B CB  1 
ATOM   5146  C CG  . HIS B 1 222 ? 8.821   51.882  -3.203  1.00 33.65 ? 260 HIS B CG  1 
ATOM   5147  N ND1 . HIS B 1 222 ? 8.280   53.094  -3.532  1.00 33.49 ? 260 HIS B ND1 1 
ATOM   5148  C CD2 . HIS B 1 222 ? 9.596   51.517  -4.254  1.00 35.07 ? 260 HIS B CD2 1 
ATOM   5149  C CE1 . HIS B 1 222 ? 8.693   53.452  -4.736  1.00 35.85 ? 260 HIS B CE1 1 
ATOM   5150  N NE2 . HIS B 1 222 ? 9.481   52.506  -5.204  1.00 36.94 ? 260 HIS B NE2 1 
ATOM   5151  N N   . ILE B 1 223 ? 7.323   48.866  -0.208  1.00 33.94 ? 261 ILE B N   1 
ATOM   5152  C CA  . ILE B 1 223 ? 6.959   48.165  1.023   1.00 33.93 ? 261 ILE B CA  1 
ATOM   5153  C C   . ILE B 1 223 ? 6.148   46.935  0.656   1.00 33.44 ? 261 ILE B C   1 
ATOM   5154  O O   . ILE B 1 223 ? 5.028   47.062  0.174   1.00 34.06 ? 261 ILE B O   1 
ATOM   5155  C CB  . ILE B 1 223 ? 6.161   49.050  2.003   1.00 33.79 ? 261 ILE B CB  1 
ATOM   5156  C CG1 . ILE B 1 223 ? 7.119   49.900  2.821   1.00 36.38 ? 261 ILE B CG1 1 
ATOM   5157  C CG2 . ILE B 1 223 ? 5.342   48.206  2.980   1.00 33.39 ? 261 ILE B CG2 1 
ATOM   5158  C CD1 . ILE B 1 223 ? 8.055   49.129  3.798   1.00 35.13 ? 261 ILE B CD1 1 
ATOM   5159  N N   . PRO B 1 224 ? 6.726   45.740  0.837   1.00 33.55 ? 262 PRO B N   1 
ATOM   5160  C CA  . PRO B 1 224 ? 5.974   44.529  0.615   1.00 33.79 ? 262 PRO B CA  1 
ATOM   5161  C C   . PRO B 1 224 ? 4.815   44.436  1.576   1.00 33.94 ? 262 PRO B C   1 
ATOM   5162  O O   . PRO B 1 224 ? 4.856   44.974  2.684   1.00 34.21 ? 262 PRO B O   1 
ATOM   5163  C CB  . PRO B 1 224 ? 7.006   43.411  0.819   1.00 33.93 ? 262 PRO B CB  1 
ATOM   5164  C CG  . PRO B 1 224 ? 8.311   44.088  0.479   1.00 35.39 ? 262 PRO B CG  1 
ATOM   5165  C CD  . PRO B 1 224 ? 8.134   45.440  1.135   1.00 34.65 ? 262 PRO B CD  1 
ATOM   5166  N N   . GLN B 1 225 ? 3.763   43.797  1.098   1.00 33.85 ? 263 GLN B N   1 
ATOM   5167  C CA  . GLN B 1 225 ? 2.488   43.689  1.799   1.00 33.44 ? 263 GLN B CA  1 
ATOM   5168  C C   . GLN B 1 225 ? 2.583   43.214  3.230   1.00 34.08 ? 263 GLN B C   1 
ATOM   5169  O O   . GLN B 1 225 ? 1.671   43.476  4.015   1.00 34.46 ? 263 GLN B O   1 
ATOM   5170  C CB  . GLN B 1 225 ? 1.584   42.736  1.012   1.00 33.80 ? 263 GLN B CB  1 
ATOM   5171  C CG  . GLN B 1 225 ? 2.249   41.449  0.604   1.00 33.88 ? 263 GLN B CG  1 
ATOM   5172  C CD  . GLN B 1 225 ? 1.305   40.417  0.151   1.00 33.63 ? 263 GLN B CD  1 
ATOM   5173  O OE1 . GLN B 1 225 ? 0.567   39.873  0.935   1.00 38.93 ? 263 GLN B OE1 1 
ATOM   5174  N NE2 . GLN B 1 225 ? 1.316   40.126  -1.126  1.00 39.30 ? 263 GLN B NE2 1 
ATOM   5175  N N   . ILE B 1 226 ? 3.662   42.497  3.571   1.00 34.38 ? 264 ILE B N   1 
ATOM   5176  C CA  . ILE B 1 226 ? 3.812   41.856  4.895   1.00 34.21 ? 264 ILE B CA  1 
ATOM   5177  C C   . ILE B 1 226 ? 3.800   42.894  5.998   1.00 35.09 ? 264 ILE B C   1 
ATOM   5178  O O   . ILE B 1 226 ? 3.489   42.576  7.170   1.00 35.61 ? 264 ILE B O   1 
ATOM   5179  C CB  . ILE B 1 226 ? 5.127   40.926  4.952   1.00 34.37 ? 264 ILE B CB  1 
ATOM   5180  C CG1 . ILE B 1 226 ? 5.192   40.090  6.245   1.00 34.81 ? 264 ILE B CG1 1 
ATOM   5181  C CG2 . ILE B 1 226 ? 6.387   41.725  4.799   1.00 33.50 ? 264 ILE B CG2 1 
ATOM   5182  C CD1 . ILE B 1 226 ? 6.408   39.153  6.305   1.00 34.11 ? 264 ILE B CD1 1 
ATOM   5183  N N   . TYR B 1 227 ? 4.143   44.139  5.635   1.00 34.75 ? 265 TYR B N   1 
ATOM   5184  C CA  . TYR B 1 227 ? 4.251   45.230  6.595   1.00 34.49 ? 265 TYR B CA  1 
ATOM   5185  C C   . TYR B 1 227 ? 2.949   46.055  6.731   1.00 34.99 ? 265 TYR B C   1 
ATOM   5186  O O   . TYR B 1 227 ? 2.796   46.882  7.636   1.00 34.56 ? 265 TYR B O   1 
ATOM   5187  C CB  . TYR B 1 227 ? 5.385   46.155  6.162   1.00 34.05 ? 265 TYR B CB  1 
ATOM   5188  C CG  . TYR B 1 227 ? 6.755   45.595  6.249   1.00 32.47 ? 265 TYR B CG  1 
ATOM   5189  C CD1 . TYR B 1 227 ? 7.286   45.225  7.452   1.00 33.85 ? 265 TYR B CD1 1 
ATOM   5190  C CD2 . TYR B 1 227 ? 7.562   45.485  5.122   1.00 34.20 ? 265 TYR B CD2 1 
ATOM   5191  C CE1 . TYR B 1 227 ? 8.587   44.710  7.540   1.00 35.61 ? 265 TYR B CE1 1 
ATOM   5192  C CE2 . TYR B 1 227 ? 8.871   45.012  5.190   1.00 31.40 ? 265 TYR B CE2 1 
ATOM   5193  C CZ  . TYR B 1 227 ? 9.389   44.628  6.395   1.00 34.35 ? 265 TYR B CZ  1 
ATOM   5194  O OH  . TYR B 1 227 ? 10.689  44.136  6.511   1.00 34.36 ? 265 TYR B OH  1 
ATOM   5195  N N   . VAL B 1 228 ? 2.023   45.849  5.806   1.00 35.67 ? 266 VAL B N   1 
ATOM   5196  C CA  . VAL B 1 228 ? 0.848   46.706  5.689   1.00 35.51 ? 266 VAL B CA  1 
ATOM   5197  C C   . VAL B 1 228 ? -0.335  45.933  6.247   1.00 36.02 ? 266 VAL B C   1 
ATOM   5198  O O   . VAL B 1 228 ? -0.719  44.879  5.716   1.00 36.00 ? 266 VAL B O   1 
ATOM   5199  C CB  . VAL B 1 228 ? 0.621   47.143  4.225   1.00 35.44 ? 266 VAL B CB  1 
ATOM   5200  C CG1 . VAL B 1 228 ? -0.501  48.207  4.132   1.00 34.75 ? 266 VAL B CG1 1 
ATOM   5201  C CG2 . VAL B 1 228 ? 1.924   47.672  3.636   1.00 34.57 ? 266 VAL B CG2 1 
ATOM   5202  N N   . HIS B 1 229 ? -0.873  46.445  7.351   1.00 36.39 ? 267 HIS B N   1 
ATOM   5203  C CA  . HIS B 1 229 ? -1.975  45.804  8.064   1.00 36.27 ? 267 HIS B CA  1 
ATOM   5204  C C   . HIS B 1 229 ? -3.294  46.438  7.709   1.00 36.36 ? 267 HIS B C   1 
ATOM   5205  O O   . HIS B 1 229 ? -4.264  45.736  7.437   1.00 36.09 ? 267 HIS B O   1 
ATOM   5206  C CB  . HIS B 1 229 ? -1.689  45.850  9.548   1.00 36.72 ? 267 HIS B CB  1 
ATOM   5207  C CG  . HIS B 1 229 ? -0.332  45.304  9.878   1.00 38.01 ? 267 HIS B CG  1 
ATOM   5208  N ND1 . HIS B 1 229 ? 0.674   46.082  10.399  1.00 38.68 ? 267 HIS B ND1 1 
ATOM   5209  C CD2 . HIS B 1 229 ? 0.211   44.080  9.654   1.00 37.52 ? 267 HIS B CD2 1 
ATOM   5210  C CE1 . HIS B 1 229 ? 1.771   45.350  10.523  1.00 39.40 ? 267 HIS B CE1 1 
ATOM   5211  N NE2 . HIS B 1 229 ? 1.515   44.130  10.080  1.00 38.34 ? 267 HIS B NE2 1 
ATOM   5212  N N   . ARG B 1 230 ? -3.317  47.769  7.673   1.00 36.48 ? 268 ARG B N   1 
ATOM   5213  C CA  . ARG B 1 230 ? -4.529  48.516  7.317   1.00 36.38 ? 268 ARG B CA  1 
ATOM   5214  C C   . ARG B 1 230 ? -4.221  49.509  6.221   1.00 36.13 ? 268 ARG B C   1 
ATOM   5215  O O   . ARG B 1 230 ? -3.186  50.193  6.244   1.00 35.68 ? 268 ARG B O   1 
ATOM   5216  C CB  . ARG B 1 230 ? -5.105  49.228  8.538   1.00 36.06 ? 268 ARG B CB  1 
ATOM   5217  C CG  . ARG B 1 230 ? -5.102  48.344  9.752   1.00 36.65 ? 268 ARG B CG  1 
ATOM   5218  C CD  . ARG B 1 230 ? -5.960  48.865  10.898  1.00 37.30 ? 268 ARG B CD  1 
ATOM   5219  N NE  . ARG B 1 230 ? -6.031  47.853  11.957  1.00 37.35 ? 268 ARG B NE  1 
ATOM   5220  C CZ  . ARG B 1 230 ? -6.347  48.095  13.226  1.00 36.15 ? 268 ARG B CZ  1 
ATOM   5221  N NH1 . ARG B 1 230 ? -6.624  49.331  13.642  1.00 33.25 ? 268 ARG B NH1 1 
ATOM   5222  N NH2 . ARG B 1 230 ? -6.379  47.074  14.085  1.00 36.46 ? 268 ARG B NH2 1 
ATOM   5223  N N   . LEU B 1 231 ? -5.139  49.586  5.269   1.00 36.68 ? 269 LEU B N   1 
ATOM   5224  C CA  . LEU B 1 231 ? -4.963  50.392  4.081   1.00 36.47 ? 269 LEU B CA  1 
ATOM   5225  C C   . LEU B 1 231 ? -6.291  51.073  3.772   1.00 36.97 ? 269 LEU B C   1 
ATOM   5226  O O   . LEU B 1 231 ? -7.342  50.447  3.813   1.00 36.28 ? 269 LEU B O   1 
ATOM   5227  C CB  . LEU B 1 231 ? -4.509  49.485  2.934   1.00 36.57 ? 269 LEU B CB  1 
ATOM   5228  C CG  . LEU B 1 231 ? -3.857  50.004  1.642   1.00 36.58 ? 269 LEU B CG  1 
ATOM   5229  C CD1 . LEU B 1 231 ? -2.882  51.170  1.820   1.00 36.44 ? 269 LEU B CD1 1 
ATOM   5230  C CD2 . LEU B 1 231 ? -3.144  48.833  1.002   1.00 37.30 ? 269 LEU B CD2 1 
ATOM   5231  N N   . ILE B 1 232 ? -6.218  52.378  3.520   1.00 37.27 ? 270 ILE B N   1 
ATOM   5232  C CA  . ILE B 1 232 ? -7.297  53.157  2.958   1.00 36.98 ? 270 ILE B CA  1 
ATOM   5233  C C   . ILE B 1 232 ? -6.724  53.973  1.809   1.00 36.98 ? 270 ILE B C   1 
ATOM   5234  O O   . ILE B 1 232 ? -5.548  54.303  1.814   1.00 36.54 ? 270 ILE B O   1 
ATOM   5235  C CB  . ILE B 1 232 ? -7.942  54.178  3.955   1.00 37.31 ? 270 ILE B CB  1 
ATOM   5236  C CG1 . ILE B 1 232 ? -6.896  55.012  4.710   1.00 37.04 ? 270 ILE B CG1 1 
ATOM   5237  C CG2 . ILE B 1 232 ? -8.917  53.507  4.932   1.00 38.77 ? 270 ILE B CG2 1 
ATOM   5238  C CD1 . ILE B 1 232 ? -7.184  56.539  4.616   1.00 37.89 ? 270 ILE B CD1 1 
ATOM   5239  N N   . LYS B 1 233 ? -7.568  54.278  0.825   1.00 37.35 ? 271 LYS B N   1 
ATOM   5240  C CA  . LYS B 1 233 ? -7.337  55.366  -0.128  1.00 37.47 ? 271 LYS B CA  1 
ATOM   5241  C C   . LYS B 1 233 ? -7.955  56.660  0.447   1.00 38.17 ? 271 LYS B C   1 
ATOM   5242  O O   . LYS B 1 233 ? -9.171  56.750  0.621   1.00 37.67 ? 271 LYS B O   1 
ATOM   5243  C CB  . LYS B 1 233 ? -7.935  55.014  -1.494  1.00 37.37 ? 271 LYS B CB  1 
ATOM   5244  C CG  . LYS B 1 233 ? -7.951  56.160  -2.503  1.00 37.31 ? 271 LYS B CG  1 
ATOM   5245  C CD  . LYS B 1 233 ? -8.755  55.783  -3.727  1.00 37.21 ? 271 LYS B CD  1 
ATOM   5246  C CE  . LYS B 1 233 ? -9.274  56.996  -4.454  1.00 37.40 ? 271 LYS B CE  1 
ATOM   5247  N NZ  . LYS B 1 233 ? -10.362 56.601  -5.371  1.00 37.46 ? 271 LYS B NZ  1 
ATOM   5248  N N   . GLY B 1 234 ? -7.116  57.650  0.770   1.00 38.96 ? 272 GLY B N   1 
ATOM   5249  C CA  . GLY B 1 234 ? -7.605  58.881  1.409   1.00 39.34 ? 272 GLY B CA  1 
ATOM   5250  C C   . GLY B 1 234 ? -8.588  59.593  0.501   1.00 39.80 ? 272 GLY B C   1 
ATOM   5251  O O   . GLY B 1 234 ? -8.491  59.478  -0.732  1.00 39.23 ? 272 GLY B O   1 
ATOM   5252  N N   . GLU B 1 235 ? -9.530  60.320  1.114   1.00 40.45 ? 273 GLU B N   1 
ATOM   5253  C CA  . GLU B 1 235 ? -10.620 60.964  0.381   1.00 41.13 ? 273 GLU B CA  1 
ATOM   5254  C C   . GLU B 1 235 ? -10.200 62.310  -0.169  1.00 41.73 ? 273 GLU B C   1 
ATOM   5255  O O   . GLU B 1 235 ? -10.745 62.765  -1.164  1.00 41.47 ? 273 GLU B O   1 
ATOM   5256  C CB  . GLU B 1 235 ? -11.848 61.169  1.284   1.00 41.10 ? 273 GLU B CB  1 
ATOM   5257  N N   . LYS B 1 236 ? -9.243  62.951  0.496   1.00 42.45 ? 274 LYS B N   1 
ATOM   5258  C CA  . LYS B 1 236 ? -8.875  64.325  0.169   1.00 42.92 ? 274 LYS B CA  1 
ATOM   5259  C C   . LYS B 1 236 ? -7.402  64.547  0.451   1.00 43.34 ? 274 LYS B C   1 
ATOM   5260  O O   . LYS B 1 236 ? -6.852  64.001  1.420   1.00 43.60 ? 274 LYS B O   1 
ATOM   5261  C CB  . LYS B 1 236 ? -9.711  65.308  0.990   1.00 43.14 ? 274 LYS B CB  1 
ATOM   5262  N N   . TYR B 1 237 ? -6.761  65.349  -0.392  1.00 43.60 ? 275 TYR B N   1 
ATOM   5263  C CA  . TYR B 1 237 ? -5.358  65.655  -0.215  1.00 44.22 ? 275 TYR B CA  1 
ATOM   5264  C C   . TYR B 1 237 ? -5.082  67.115  -0.532  1.00 44.71 ? 275 TYR B C   1 
ATOM   5265  O O   . TYR B 1 237 ? -5.123  67.519  -1.687  1.00 44.90 ? 275 TYR B O   1 
ATOM   5266  C CB  . TYR B 1 237 ? -4.506  64.683  -1.054  1.00 44.35 ? 275 TYR B CB  1 
ATOM   5267  C CG  . TYR B 1 237 ? -4.492  63.274  -0.461  1.00 44.36 ? 275 TYR B CG  1 
ATOM   5268  C CD1 . TYR B 1 237 ? -3.980  63.052  0.818   1.00 44.24 ? 275 TYR B CD1 1 
ATOM   5269  C CD2 . TYR B 1 237 ? -5.027  62.180  -1.152  1.00 44.01 ? 275 TYR B CD2 1 
ATOM   5270  C CE1 . TYR B 1 237 ? -3.974  61.795  1.381   1.00 44.31 ? 275 TYR B CE1 1 
ATOM   5271  C CE2 . TYR B 1 237 ? -5.026  60.901  -0.582  1.00 43.18 ? 275 TYR B CE2 1 
ATOM   5272  C CZ  . TYR B 1 237 ? -4.500  60.721  0.683   1.00 43.94 ? 275 TYR B CZ  1 
ATOM   5273  O OH  . TYR B 1 237 ? -4.479  59.475  1.270   1.00 43.56 ? 275 TYR B OH  1 
ATOM   5274  N N   . GLU B 1 238 ? -4.851  67.915  0.513   1.00 45.38 ? 276 GLU B N   1 
ATOM   5275  C CA  . GLU B 1 238 ? -4.433  69.312  0.342   1.00 45.81 ? 276 GLU B CA  1 
ATOM   5276  C C   . GLU B 1 238 ? -3.018  69.311  -0.230  1.00 45.78 ? 276 GLU B C   1 
ATOM   5277  O O   . GLU B 1 238 ? -2.746  70.011  -1.194  1.00 46.00 ? 276 GLU B O   1 
ATOM   5278  C CB  . GLU B 1 238 ? -4.450  70.112  1.664   1.00 45.70 ? 276 GLU B CB  1 
ATOM   5279  C CG  . GLU B 1 238 ? -5.793  70.180  2.397   1.00 46.10 ? 276 GLU B CG  1 
ATOM   5280  C CD  . GLU B 1 238 ? -5.845  71.236  3.522   1.00 46.65 ? 276 GLU B CD  1 
ATOM   5281  O OE1 . GLU B 1 238 ? -4.796  71.785  3.934   1.00 48.63 ? 276 GLU B OE1 1 
ATOM   5282  O OE2 . GLU B 1 238 ? -6.962  71.527  3.998   1.00 48.80 ? 276 GLU B OE2 1 
ATOM   5283  N N   . LYS B 1 239 ? -2.130  68.512  0.371   1.00 45.94 ? 277 LYS B N   1 
ATOM   5284  C CA  . LYS B 1 239 ? -0.716  68.452  -0.025  1.00 45.87 ? 277 LYS B CA  1 
ATOM   5285  C C   . LYS B 1 239 ? -0.132  69.858  -0.103  1.00 45.61 ? 277 LYS B C   1 
ATOM   5286  O O   . LYS B 1 239 ? 0.050   70.408  -1.201  1.00 45.51 ? 277 LYS B O   1 
ATOM   5287  C CB  . LYS B 1 239 ? -0.559  67.748  -1.377  1.00 46.15 ? 277 LYS B CB  1 
ATOM   5288  C CG  . LYS B 1 239 ? -0.924  66.284  -1.350  1.00 46.14 ? 277 LYS B CG  1 
ATOM   5289  C CD  . LYS B 1 239 ? -0.619  65.636  -2.681  1.00 45.08 ? 277 LYS B CD  1 
ATOM   5290  C CE  . LYS B 1 239 ? 0.191   64.384  -2.497  1.00 44.56 ? 277 LYS B CE  1 
ATOM   5291  N NZ  . LYS B 1 239 ? 1.415   64.445  -3.332  1.00 42.80 ? 277 LYS B NZ  1 
ATOM   5292  N N   . ARG B 1 240 ? 0.153   70.439  1.057   1.00 45.00 ? 278 ARG B N   1 
ATOM   5293  C CA  . ARG B 1 240 ? 0.374   71.877  1.122   1.00 44.92 ? 278 ARG B CA  1 
ATOM   5294  C C   . ARG B 1 240 ? 1.862   72.206  1.134   1.00 43.92 ? 278 ARG B C   1 
ATOM   5295  O O   . ARG B 1 240 ? 2.527   72.002  2.136   1.00 45.26 ? 278 ARG B O   1 
ATOM   5296  C CB  . ARG B 1 240 ? -0.333  72.459  2.351   1.00 44.92 ? 278 ARG B CB  1 
ATOM   5297  C CG  . ARG B 1 240 ? -1.078  73.794  2.065   1.00 46.35 ? 278 ARG B CG  1 
ATOM   5298  C CD  . ARG B 1 240 ? -1.859  74.242  3.279   1.00 45.99 ? 278 ARG B CD  1 
ATOM   5299  N NE  . ARG B 1 240 ? -0.977  74.352  4.442   1.00 46.55 ? 278 ARG B NE  1 
ATOM   5300  C CZ  . ARG B 1 240 ? -1.387  74.478  5.703   1.00 47.15 ? 278 ARG B CZ  1 
ATOM   5301  N NH1 . ARG B 1 240 ? -2.691  74.515  6.010   1.00 47.25 ? 278 ARG B NH1 1 
ATOM   5302  N NH2 . ARG B 1 240 ? -0.475  74.582  6.661   1.00 46.73 ? 278 ARG B NH2 1 
ATOM   5303  N N   . ILE B 1 241 ? 2.382   72.709  0.021   1.00 42.45 ? 279 ILE B N   1 
ATOM   5304  C CA  . ILE B 1 241 ? 3.769   73.173  -0.045  1.00 41.22 ? 279 ILE B CA  1 
ATOM   5305  C C   . ILE B 1 241 ? 4.030   74.151  1.110   1.00 40.72 ? 279 ILE B C   1 
ATOM   5306  O O   . ILE B 1 241 ? 3.242   75.060  1.342   1.00 40.37 ? 279 ILE B O   1 
ATOM   5307  C CB  . ILE B 1 241 ? 4.076   73.868  -1.403  1.00 40.96 ? 279 ILE B CB  1 
ATOM   5308  C CG1 . ILE B 1 241 ? 3.975   72.861  -2.563  1.00 40.96 ? 279 ILE B CG1 1 
ATOM   5309  C CG2 . ILE B 1 241 ? 5.464   74.519  -1.372  1.00 40.02 ? 279 ILE B CG2 1 
ATOM   5310  C CD1 . ILE B 1 241 ? 3.765   73.480  -3.952  1.00 40.70 ? 279 ILE B CD1 1 
ATOM   5311  N N   . GLU B 1 242 ? 5.122   73.952  1.845   1.00 39.96 ? 280 GLU B N   1 
ATOM   5312  C CA  . GLU B 1 242 ? 5.466   74.848  2.947   1.00 39.52 ? 280 GLU B CA  1 
ATOM   5313  C C   . GLU B 1 242 ? 6.229   76.089  2.454   1.00 39.48 ? 280 GLU B C   1 
ATOM   5314  O O   . GLU B 1 242 ? 5.917   77.211  2.848   1.00 39.30 ? 280 GLU B O   1 
ATOM   5315  C CB  . GLU B 1 242 ? 6.263   74.112  4.026   1.00 39.10 ? 280 GLU B CB  1 
ATOM   5316  C CG  . GLU B 1 242 ? 6.929   75.042  5.016   1.00 38.65 ? 280 GLU B CG  1 
ATOM   5317  C CD  . GLU B 1 242 ? 7.525   74.344  6.209   1.00 38.99 ? 280 GLU B CD  1 
ATOM   5318  O OE1 . GLU B 1 242 ? 7.715   73.097  6.156   1.00 35.21 ? 280 GLU B OE1 1 
ATOM   5319  O OE2 . GLU B 1 242 ? 7.789   75.066  7.204   1.00 37.24 ? 280 GLU B OE2 1 
ATOM   5320  N N   . ARG B 1 243 ? 7.232   75.872  1.615   1.00 39.49 ? 281 ARG B N   1 
ATOM   5321  C CA  . ARG B 1 243 ? 8.034   76.938  1.039   1.00 40.12 ? 281 ARG B CA  1 
ATOM   5322  C C   . ARG B 1 243 ? 7.999   76.803  -0.484  1.00 39.85 ? 281 ARG B C   1 
ATOM   5323  O O   . ARG B 1 243 ? 8.783   76.027  -1.063  1.00 39.86 ? 281 ARG B O   1 
ATOM   5324  C CB  . ARG B 1 243 ? 9.496   76.830  1.517   1.00 40.24 ? 281 ARG B CB  1 
ATOM   5325  C CG  . ARG B 1 243 ? 9.756   77.111  2.997   1.00 41.16 ? 281 ARG B CG  1 
ATOM   5326  C CD  . ARG B 1 243 ? 11.259  77.335  3.278   1.00 42.37 ? 281 ARG B CD  1 
ATOM   5327  N NE  . ARG B 1 243 ? 11.475  77.958  4.586   1.00 44.65 ? 281 ARG B NE  1 
ATOM   5328  C CZ  . ARG B 1 243 ? 11.745  77.306  5.725   1.00 46.19 ? 281 ARG B CZ  1 
ATOM   5329  N NH1 . ARG B 1 243 ? 11.864  75.992  5.757   1.00 47.21 ? 281 ARG B NH1 1 
ATOM   5330  N NH2 . ARG B 1 243 ? 11.912  77.983  6.858   1.00 46.24 ? 281 ARG B NH2 1 
ATOM   5331  N N   . LEU B 1 244 ? 7.100   77.544  -1.128  1.00 39.58 ? 282 LEU B N   1 
ATOM   5332  C CA  . LEU B 1 244 ? 6.967   77.516  -2.587  1.00 39.60 ? 282 LEU B CA  1 
ATOM   5333  C C   . LEU B 1 244 ? 8.122   78.297  -3.208  1.00 39.74 ? 282 LEU B C   1 
ATOM   5334  O O   . LEU B 1 244 ? 8.051   79.505  -3.350  1.00 39.91 ? 282 LEU B O   1 
ATOM   5335  C CB  . LEU B 1 244 ? 5.620   78.088  -3.024  1.00 39.44 ? 282 LEU B CB  1 
ATOM   5336  C CG  . LEU B 1 244 ? 5.222   77.918  -4.493  1.00 39.49 ? 282 LEU B CG  1 
ATOM   5337  C CD1 . LEU B 1 244 ? 5.372   76.479  -4.958  1.00 39.65 ? 282 LEU B CD1 1 
ATOM   5338  C CD2 . LEU B 1 244 ? 3.788   78.382  -4.686  1.00 38.92 ? 282 LEU B CD2 1 
ATOM   5339  N N   . SER B 1 245 ? 9.191   77.579  -3.548  1.00 40.06 ? 283 SER B N   1 
ATOM   5340  C CA  . SER B 1 245 ? 10.456  78.168  -3.965  1.00 40.18 ? 283 SER B CA  1 
ATOM   5341  C C   . SER B 1 245 ? 10.554  78.016  -5.468  1.00 40.48 ? 283 SER B C   1 
ATOM   5342  O O   . SER B 1 245 ? 10.827  76.922  -5.971  1.00 40.80 ? 283 SER B O   1 
ATOM   5343  C CB  . SER B 1 245 ? 11.638  77.438  -3.292  1.00 40.34 ? 283 SER B CB  1 
ATOM   5344  O OG  . SER B 1 245 ? 11.599  77.524  -1.872  1.00 39.89 ? 283 SER B OG  1 
ATOM   5345  N N   . ILE B 1 246 ? 10.332  79.117  -6.175  1.00 40.89 ? 284 ILE B N   1 
ATOM   5346  C CA  . ILE B 1 246 ? 10.223  79.123  -7.629  1.00 41.05 ? 284 ILE B CA  1 
ATOM   5347  C C   . ILE B 1 246 ? 11.458  79.779  -8.234  1.00 41.56 ? 284 ILE B C   1 
ATOM   5348  O O   . ILE B 1 246 ? 12.042  80.687  -7.652  1.00 41.87 ? 284 ILE B O   1 
ATOM   5349  C CB  . ILE B 1 246 ? 8.928   79.847  -8.053  1.00 40.90 ? 284 ILE B CB  1 
ATOM   5350  C CG1 . ILE B 1 246 ? 7.710   78.963  -7.733  1.00 40.22 ? 284 ILE B CG1 1 
ATOM   5351  C CG2 . ILE B 1 246 ? 8.965   80.300  -9.533  1.00 41.51 ? 284 ILE B CG2 1 
ATOM   5352  C CD1 . ILE B 1 246 ? 7.717   77.595  -8.344  1.00 39.22 ? 284 ILE B CD1 1 
ATOM   5353  N N   . ARG B 1 247 ? 11.856  79.295  -9.402  1.00 42.28 ? 285 ARG B N   1 
ATOM   5354  C CA  . ARG B 1 247 ? 13.043  79.792  -10.100 1.00 42.85 ? 285 ARG B CA  1 
ATOM   5355  C C   . ARG B 1 247 ? 12.946  81.279  -10.485 1.00 42.65 ? 285 ARG B C   1 
ATOM   5356  O O   . ARG B 1 247 ? 11.970  81.722  -11.099 1.00 42.65 ? 285 ARG B O   1 
ATOM   5357  C CB  . ARG B 1 247 ? 13.270  78.940  -11.346 1.00 43.10 ? 285 ARG B CB  1 
ATOM   5358  C CG  . ARG B 1 247 ? 14.674  78.975  -11.876 1.00 44.96 ? 285 ARG B CG  1 
ATOM   5359  C CD  . ARG B 1 247 ? 15.042  77.636  -12.497 1.00 47.74 ? 285 ARG B CD  1 
ATOM   5360  N NE  . ARG B 1 247 ? 16.138  77.757  -13.447 1.00 48.90 ? 285 ARG B NE  1 
ATOM   5361  C CZ  . ARG B 1 247 ? 16.643  76.746  -14.144 1.00 50.44 ? 285 ARG B CZ  1 
ATOM   5362  N NH1 . ARG B 1 247 ? 17.639  76.971  -14.991 1.00 50.72 ? 285 ARG B NH1 1 
ATOM   5363  N NH2 . ARG B 1 247 ? 16.163  75.510  -14.001 1.00 51.72 ? 285 ARG B NH2 1 
ATOM   5364  N N   . ASP B 1 261 ? 25.594  90.875  0.081   1.00 48.20 ? 299 ASP B N   1 
ATOM   5365  C CA  . ASP B 1 261 ? 26.622  91.803  0.552   1.00 48.18 ? 299 ASP B CA  1 
ATOM   5366  C C   . ASP B 1 261 ? 28.038  91.379  0.154   1.00 47.77 ? 299 ASP B C   1 
ATOM   5367  O O   . ASP B 1 261 ? 28.297  90.215  -0.149  1.00 46.89 ? 299 ASP B O   1 
ATOM   5368  C CB  . ASP B 1 261 ? 26.564  91.952  2.078   1.00 48.46 ? 299 ASP B CB  1 
ATOM   5369  C CG  . ASP B 1 261 ? 26.870  90.654  2.799   1.00 49.21 ? 299 ASP B CG  1 
ATOM   5370  O OD1 . ASP B 1 261 ? 25.960  89.802  2.902   1.00 51.54 ? 299 ASP B OD1 1 
ATOM   5371  O OD2 . ASP B 1 261 ? 28.021  90.481  3.255   1.00 49.84 ? 299 ASP B OD2 1 
ATOM   5372  N N   . ASP B 1 262 ? 28.935  92.363  0.171   1.00 47.50 ? 300 ASP B N   1 
ATOM   5373  C CA  . ASP B 1 262 ? 30.368  92.201  -0.144  1.00 47.24 ? 300 ASP B CA  1 
ATOM   5374  C C   . ASP B 1 262 ? 31.039  90.910  0.382   1.00 46.87 ? 300 ASP B C   1 
ATOM   5375  O O   . ASP B 1 262 ? 31.607  90.142  -0.395  1.00 46.69 ? 300 ASP B O   1 
ATOM   5376  C CB  . ASP B 1 262 ? 31.136  93.441  0.346   1.00 47.16 ? 300 ASP B CB  1 
ATOM   5377  C CG  . ASP B 1 262 ? 30.527  94.051  1.619   1.00 47.43 ? 300 ASP B CG  1 
ATOM   5378  O OD1 . ASP B 1 262 ? 29.936  95.153  1.543   1.00 46.19 ? 300 ASP B OD1 1 
ATOM   5379  O OD2 . ASP B 1 262 ? 30.616  93.408  2.690   1.00 48.33 ? 300 ASP B OD2 1 
ATOM   5380  N N   . VAL B 1 263 ? 30.964  90.670  1.689   1.00 46.52 ? 301 VAL B N   1 
ATOM   5381  C CA  . VAL B 1 263 ? 31.704  89.569  2.317   1.00 45.89 ? 301 VAL B CA  1 
ATOM   5382  C C   . VAL B 1 263 ? 31.031  88.200  2.120   1.00 45.64 ? 301 VAL B C   1 
ATOM   5383  O O   . VAL B 1 263 ? 31.692  87.164  2.146   1.00 45.18 ? 301 VAL B O   1 
ATOM   5384  C CB  . VAL B 1 263 ? 31.932  89.829  3.837   1.00 46.28 ? 301 VAL B CB  1 
ATOM   5385  C CG1 . VAL B 1 263 ? 32.459  91.267  4.075   1.00 44.65 ? 301 VAL B CG1 1 
ATOM   5386  C CG2 . VAL B 1 263 ? 30.661  89.535  4.653   1.00 46.21 ? 301 VAL B CG2 1 
ATOM   5387  N N   . ARG B 1 264 ? 29.718  88.209  1.918   1.00 44.89 ? 302 ARG B N   1 
ATOM   5388  C CA  . ARG B 1 264 ? 28.962  86.995  1.719   1.00 44.51 ? 302 ARG B CA  1 
ATOM   5389  C C   . ARG B 1 264 ? 29.259  86.415  0.327   1.00 43.07 ? 302 ARG B C   1 
ATOM   5390  O O   . ARG B 1 264 ? 29.567  85.224  0.206   1.00 42.66 ? 302 ARG B O   1 
ATOM   5391  C CB  . ARG B 1 264 ? 27.472  87.281  1.917   1.00 44.58 ? 302 ARG B CB  1 
ATOM   5392  C CG  . ARG B 1 264 ? 26.645  86.043  2.163   1.00 46.34 ? 302 ARG B CG  1 
ATOM   5393  C CD  . ARG B 1 264 ? 25.125  86.317  2.182   1.00 47.19 ? 302 ARG B CD  1 
ATOM   5394  N NE  . ARG B 1 264 ? 24.394  85.056  2.394   1.00 50.10 ? 302 ARG B NE  1 
ATOM   5395  C CZ  . ARG B 1 264 ? 23.087  84.858  2.188   1.00 50.39 ? 302 ARG B CZ  1 
ATOM   5396  N NH1 . ARG B 1 264 ? 22.295  85.848  1.756   1.00 49.56 ? 302 ARG B NH1 1 
ATOM   5397  N NH2 . ARG B 1 264 ? 22.573  83.642  2.413   1.00 49.87 ? 302 ARG B NH2 1 
ATOM   5398  N N   . GLU B 1 265 ? 29.205  87.254  -0.709  1.00 41.50 ? 303 GLU B N   1 
ATOM   5399  C CA  . GLU B 1 265 ? 29.601  86.839  -2.064  1.00 40.87 ? 303 GLU B CA  1 
ATOM   5400  C C   . GLU B 1 265 ? 31.049  86.324  -2.098  1.00 39.74 ? 303 GLU B C   1 
ATOM   5401  O O   . GLU B 1 265 ? 31.376  85.395  -2.852  1.00 39.60 ? 303 GLU B O   1 
ATOM   5402  C CB  . GLU B 1 265 ? 29.406  87.965  -3.114  1.00 40.56 ? 303 GLU B CB  1 
ATOM   5403  C CG  . GLU B 1 265 ? 30.343  89.171  -2.967  1.00 41.60 ? 303 GLU B CG  1 
ATOM   5404  C CD  . GLU B 1 265 ? 30.658  89.906  -4.279  1.00 41.73 ? 303 GLU B CD  1 
ATOM   5405  O OE1 . GLU B 1 265 ? 31.219  89.291  -5.218  1.00 42.74 ? 303 GLU B OE1 1 
ATOM   5406  O OE2 . GLU B 1 265 ? 30.373  91.121  -4.355  1.00 42.41 ? 303 GLU B OE2 1 
ATOM   5407  N N   . ARG B 1 266 ? 31.905  86.917  -1.273  1.00 38.50 ? 304 ARG B N   1 
ATOM   5408  C CA  . ARG B 1 266 ? 33.313  86.530  -1.210  1.00 37.76 ? 304 ARG B CA  1 
ATOM   5409  C C   . ARG B 1 266 ? 33.450  85.077  -0.737  1.00 37.34 ? 304 ARG B C   1 
ATOM   5410  O O   . ARG B 1 266 ? 34.103  84.266  -1.400  1.00 37.31 ? 304 ARG B O   1 
ATOM   5411  C CB  . ARG B 1 266 ? 34.089  87.480  -0.285  1.00 37.66 ? 304 ARG B CB  1 
ATOM   5412  C CG  . ARG B 1 266 ? 35.587  87.529  -0.549  1.00 37.35 ? 304 ARG B CG  1 
ATOM   5413  C CD  . ARG B 1 266 ? 36.130  88.927  -0.312  1.00 36.97 ? 304 ARG B CD  1 
ATOM   5414  N NE  . ARG B 1 266 ? 36.214  89.219  1.117   1.00 37.45 ? 304 ARG B NE  1 
ATOM   5415  C CZ  . ARG B 1 266 ? 36.296  90.432  1.652   1.00 36.37 ? 304 ARG B CZ  1 
ATOM   5416  N NH1 . ARG B 1 266 ? 36.297  91.515  0.888   1.00 36.92 ? 304 ARG B NH1 1 
ATOM   5417  N NH2 . ARG B 1 266 ? 36.368  90.556  2.970   1.00 36.15 ? 304 ARG B NH2 1 
ATOM   5418  N N   . ILE B 1 267 ? 32.808  84.761  0.390   1.00 36.57 ? 305 ILE B N   1 
ATOM   5419  C CA  . ILE B 1 267 ? 32.808  83.409  0.960   1.00 36.02 ? 305 ILE B CA  1 
ATOM   5420  C C   . ILE B 1 267 ? 32.261  82.449  -0.077  1.00 35.62 ? 305 ILE B C   1 
ATOM   5421  O O   . ILE B 1 267 ? 32.841  81.415  -0.283  1.00 35.52 ? 305 ILE B O   1 
ATOM   5422  C CB  . ILE B 1 267 ? 31.977  83.305  2.293   1.00 35.95 ? 305 ILE B CB  1 
ATOM   5423  C CG1 . ILE B 1 267 ? 32.565  84.216  3.388   1.00 35.45 ? 305 ILE B CG1 1 
ATOM   5424  C CG2 . ILE B 1 267 ? 31.915  81.841  2.804   1.00 35.08 ? 305 ILE B CG2 1 
ATOM   5425  C CD1 . ILE B 1 267 ? 31.599  84.575  4.476   1.00 33.90 ? 305 ILE B CD1 1 
ATOM   5426  N N   . ILE B 1 268 ? 31.173  82.836  -0.745  1.00 35.80 ? 306 ILE B N   1 
ATOM   5427  C CA  . ILE B 1 268 ? 30.514  82.016  -1.777  1.00 36.28 ? 306 ILE B CA  1 
ATOM   5428  C C   . ILE B 1 268 ? 31.400  81.713  -2.997  1.00 36.18 ? 306 ILE B C   1 
ATOM   5429  O O   . ILE B 1 268 ? 31.492  80.568  -3.434  1.00 36.10 ? 306 ILE B O   1 
ATOM   5430  C CB  . ILE B 1 268 ? 29.194  82.688  -2.297  1.00 36.66 ? 306 ILE B CB  1 
ATOM   5431  C CG1 . ILE B 1 268 ? 28.089  82.630  -1.228  1.00 36.66 ? 306 ILE B CG1 1 
ATOM   5432  C CG2 . ILE B 1 268 ? 28.717  82.019  -3.604  1.00 35.83 ? 306 ILE B CG2 1 
ATOM   5433  C CD1 . ILE B 1 268 ? 26.704  82.942  -1.755  1.00 36.55 ? 306 ILE B CD1 1 
ATOM   5434  N N   . LYS B 1 269 ? 32.023  82.746  -3.546  1.00 36.32 ? 307 LYS B N   1 
ATOM   5435  C CA  . LYS B 1 269 ? 32.924  82.607  -4.689  1.00 36.40 ? 307 LYS B CA  1 
ATOM   5436  C C   . LYS B 1 269 ? 34.166  81.761  -4.361  1.00 36.23 ? 307 LYS B C   1 
ATOM   5437  O O   . LYS B 1 269 ? 34.755  81.145  -5.256  1.00 36.34 ? 307 LYS B O   1 
ATOM   5438  C CB  . LYS B 1 269 ? 33.328  83.991  -5.211  1.00 36.44 ? 307 LYS B CB  1 
ATOM   5439  C CG  . LYS B 1 269 ? 32.249  84.675  -6.063  1.00 36.72 ? 307 LYS B CG  1 
ATOM   5440  C CD  . LYS B 1 269 ? 32.734  86.031  -6.598  1.00 36.86 ? 307 LYS B CD  1 
ATOM   5441  C CE  . LYS B 1 269 ? 31.687  86.709  -7.498  1.00 37.46 ? 307 LYS B CE  1 
ATOM   5442  N NZ  . LYS B 1 269 ? 32.186  87.977  -8.153  1.00 36.61 ? 307 LYS B NZ  1 
ATOM   5443  N N   . ARG B 1 270 ? 34.555  81.738  -3.084  1.00 35.81 ? 308 ARG B N   1 
ATOM   5444  C CA  . ARG B 1 270 ? 35.554  80.789  -2.578  1.00 35.61 ? 308 ARG B CA  1 
ATOM   5445  C C   . ARG B 1 270 ? 34.988  79.376  -2.284  1.00 35.39 ? 308 ARG B C   1 
ATOM   5446  O O   . ARG B 1 270 ? 35.662  78.377  -2.523  1.00 35.23 ? 308 ARG B O   1 
ATOM   5447  C CB  . ARG B 1 270 ? 36.239  81.343  -1.315  1.00 35.38 ? 308 ARG B CB  1 
ATOM   5448  C CG  . ARG B 1 270 ? 37.410  80.487  -0.791  1.00 35.48 ? 308 ARG B CG  1 
ATOM   5449  C CD  . ARG B 1 270 ? 38.405  80.118  -1.912  1.00 36.66 ? 308 ARG B CD  1 
ATOM   5450  N NE  . ARG B 1 270 ? 39.468  79.209  -1.493  1.00 36.57 ? 308 ARG B NE  1 
ATOM   5451  C CZ  . ARG B 1 270 ? 39.312  77.903  -1.269  1.00 37.62 ? 308 ARG B CZ  1 
ATOM   5452  N NH1 . ARG B 1 270 ? 38.126  77.292  -1.415  1.00 37.55 ? 308 ARG B NH1 1 
ATOM   5453  N NH2 . ARG B 1 270 ? 40.363  77.198  -0.885  1.00 37.60 ? 308 ARG B NH2 1 
ATOM   5454  N N   . ALA B 1 271 ? 33.775  79.301  -1.732  1.00 35.06 ? 309 ALA B N   1 
ATOM   5455  C CA  . ALA B 1 271 ? 33.122  78.012  -1.454  1.00 34.66 ? 309 ALA B CA  1 
ATOM   5456  C C   . ALA B 1 271 ? 32.993  77.216  -2.748  1.00 34.15 ? 309 ALA B C   1 
ATOM   5457  O O   . ALA B 1 271 ? 33.298  76.011  -2.801  1.00 34.05 ? 309 ALA B O   1 
ATOM   5458  C CB  . ALA B 1 271 ? 31.740  78.251  -0.838  1.00 34.73 ? 309 ALA B CB  1 
ATOM   5459  N N   . ALA B 1 272 ? 32.554  77.918  -3.793  1.00 33.72 ? 310 ALA B N   1 
ATOM   5460  C CA  . ALA B 1 272 ? 32.379  77.357  -5.137  1.00 33.79 ? 310 ALA B CA  1 
ATOM   5461  C C   . ALA B 1 272 ? 33.612  76.642  -5.673  1.00 33.67 ? 310 ALA B C   1 
ATOM   5462  O O   . ALA B 1 272 ? 33.463  75.727  -6.453  1.00 34.07 ? 310 ALA B O   1 
ATOM   5463  C CB  . ALA B 1 272 ? 31.921  78.440  -6.137  1.00 33.74 ? 310 ALA B CB  1 
ATOM   5464  N N   . LEU B 1 273 ? 34.814  77.023  -5.235  1.00 33.56 ? 311 LEU B N   1 
ATOM   5465  C CA  . LEU B 1 273 ? 36.039  76.330  -5.673  1.00 33.57 ? 311 LEU B CA  1 
ATOM   5466  C C   . LEU B 1 273 ? 36.283  74.973  -4.968  1.00 33.71 ? 311 LEU B C   1 
ATOM   5467  O O   . LEU B 1 273 ? 37.259  74.296  -5.264  1.00 33.60 ? 311 LEU B O   1 
ATOM   5468  C CB  . LEU B 1 273 ? 37.268  77.250  -5.534  1.00 33.37 ? 311 LEU B CB  1 
ATOM   5469  C CG  . LEU B 1 273 ? 37.348  78.464  -6.475  1.00 32.86 ? 311 LEU B CG  1 
ATOM   5470  C CD1 . LEU B 1 273 ? 38.259  79.514  -5.873  1.00 32.54 ? 311 LEU B CD1 1 
ATOM   5471  C CD2 . LEU B 1 273 ? 37.817  78.123  -7.916  1.00 31.88 ? 311 LEU B CD2 1 
ATOM   5472  N N   . GLU B 1 274 ? 35.397  74.575  -4.049  1.00 34.19 ? 312 GLU B N   1 
ATOM   5473  C CA  . GLU B 1 274 ? 35.547  73.311  -3.318  1.00 34.30 ? 312 GLU B CA  1 
ATOM   5474  C C   . GLU B 1 274 ? 35.007  72.119  -4.077  1.00 34.66 ? 312 GLU B C   1 
ATOM   5475  O O   . GLU B 1 274 ? 35.337  70.975  -3.751  1.00 34.44 ? 312 GLU B O   1 
ATOM   5476  C CB  . GLU B 1 274 ? 34.851  73.401  -1.969  1.00 34.40 ? 312 GLU B CB  1 
ATOM   5477  C CG  . GLU B 1 274 ? 35.544  74.348  -1.011  1.00 34.97 ? 312 GLU B CG  1 
ATOM   5478  C CD  . GLU B 1 274 ? 36.909  73.836  -0.570  1.00 37.82 ? 312 GLU B CD  1 
ATOM   5479  O OE1 . GLU B 1 274 ? 37.005  72.700  -0.050  1.00 39.84 ? 312 GLU B OE1 1 
ATOM   5480  O OE2 . GLU B 1 274 ? 37.901  74.569  -0.742  1.00 39.87 ? 312 GLU B OE2 1 
ATOM   5481  N N   . PHE B 1 275 ? 34.185  72.399  -5.086  1.00 34.91 ? 313 PHE B N   1 
ATOM   5482  C CA  . PHE B 1 275 ? 33.492  71.373  -5.842  1.00 35.02 ? 313 PHE B CA  1 
ATOM   5483  C C   . PHE B 1 275 ? 34.416  70.841  -6.902  1.00 35.21 ? 313 PHE B C   1 
ATOM   5484  O O   . PHE B 1 275 ? 35.142  71.608  -7.542  1.00 35.04 ? 313 PHE B O   1 
ATOM   5485  C CB  . PHE B 1 275 ? 32.241  71.948  -6.503  1.00 35.40 ? 313 PHE B CB  1 
ATOM   5486  C CG  . PHE B 1 275 ? 31.243  72.528  -5.530  1.00 35.70 ? 313 PHE B CG  1 
ATOM   5487  C CD1 . PHE B 1 275 ? 30.397  71.696  -4.808  1.00 37.92 ? 313 PHE B CD1 1 
ATOM   5488  C CD2 . PHE B 1 275 ? 31.114  73.888  -5.375  1.00 36.32 ? 313 PHE B CD2 1 
ATOM   5489  C CE1 . PHE B 1 275 ? 29.472  72.227  -3.909  1.00 37.61 ? 313 PHE B CE1 1 
ATOM   5490  C CE2 . PHE B 1 275 ? 30.179  74.425  -4.498  1.00 37.98 ? 313 PHE B CE2 1 
ATOM   5491  C CZ  . PHE B 1 275 ? 29.363  73.589  -3.759  1.00 37.53 ? 313 PHE B CZ  1 
ATOM   5492  N N   . GLU B 1 276 ? 34.409  69.525  -7.082  1.00 35.16 ? 314 GLU B N   1 
ATOM   5493  C CA  . GLU B 1 276 ? 35.195  68.906  -8.125  1.00 35.74 ? 314 GLU B CA  1 
ATOM   5494  C C   . GLU B 1 276 ? 34.307  67.982  -8.917  1.00 35.35 ? 314 GLU B C   1 
ATOM   5495  O O   . GLU B 1 276 ? 33.272  67.552  -8.437  1.00 35.05 ? 314 GLU B O   1 
ATOM   5496  C CB  . GLU B 1 276 ? 36.342  68.080  -7.572  1.00 36.25 ? 314 GLU B CB  1 
ATOM   5497  C CG  . GLU B 1 276 ? 37.225  68.710  -6.509  1.00 38.93 ? 314 GLU B CG  1 
ATOM   5498  C CD  . GLU B 1 276 ? 37.753  67.615  -5.573  1.00 43.24 ? 314 GLU B CD  1 
ATOM   5499  O OE1 . GLU B 1 276 ? 38.120  66.522  -6.097  1.00 44.54 ? 314 GLU B OE1 1 
ATOM   5500  O OE2 . GLU B 1 276 ? 37.751  67.820  -4.332  1.00 45.16 ? 314 GLU B OE2 1 
ATOM   5501  N N   . ASP B 1 277 ? 34.753  67.668  -10.127 1.00 35.45 ? 315 ASP B N   1 
ATOM   5502  C CA  . ASP B 1 277 ? 34.011  66.822  -11.042 1.00 35.56 ? 315 ASP B CA  1 
ATOM   5503  C C   . ASP B 1 277 ? 33.881  65.402  -10.470 1.00 35.68 ? 315 ASP B C   1 
ATOM   5504  O O   . ASP B 1 277 ? 34.863  64.803  -10.028 1.00 35.11 ? 315 ASP B O   1 
ATOM   5505  C CB  . ASP B 1 277 ? 34.726  66.796  -12.386 1.00 35.79 ? 315 ASP B CB  1 
ATOM   5506  C CG  . ASP B 1 277 ? 33.839  66.340  -13.505 1.00 36.38 ? 315 ASP B CG  1 
ATOM   5507  O OD1 . ASP B 1 277 ? 32.620  66.247  -13.291 1.00 38.08 ? 315 ASP B OD1 1 
ATOM   5508  O OD2 . ASP B 1 277 ? 34.354  66.098  -14.613 1.00 40.27 ? 315 ASP B OD2 1 
ATOM   5509  N N   . GLY B 1 278 ? 32.651  64.886  -10.461 1.00 36.05 ? 316 GLY B N   1 
ATOM   5510  C CA  . GLY B 1 278 ? 32.351  63.545  -9.973  1.00 35.43 ? 316 GLY B CA  1 
ATOM   5511  C C   . GLY B 1 278 ? 31.966  63.537  -8.513  1.00 35.74 ? 316 GLY B C   1 
ATOM   5512  O O   . GLY B 1 278 ? 31.768  62.475  -7.938  1.00 36.55 ? 316 GLY B O   1 
ATOM   5513  N N   . MET B 1 279 ? 31.845  64.715  -7.903  1.00 35.50 ? 317 MET B N   1 
ATOM   5514  C CA  . MET B 1 279 ? 31.730  64.818  -6.458  1.00 34.95 ? 317 MET B CA  1 
ATOM   5515  C C   . MET B 1 279 ? 30.274  64.658  -6.040  1.00 34.32 ? 317 MET B C   1 
ATOM   5516  O O   . MET B 1 279 ? 29.375  65.087  -6.744  1.00 34.21 ? 317 MET B O   1 
ATOM   5517  C CB  . MET B 1 279 ? 32.315  66.156  -5.989  1.00 35.16 ? 317 MET B CB  1 
ATOM   5518  C CG  . MET B 1 279 ? 32.250  66.443  -4.530  1.00 34.87 ? 317 MET B CG  1 
ATOM   5519  S SD  . MET B 1 279 ? 32.953  68.064  -4.049  1.00 36.71 ? 317 MET B SD  1 
ATOM   5520  C CE  . MET B 1 279 ? 34.607  67.559  -3.547  1.00 33.37 ? 317 MET B CE  1 
ATOM   5521  N N   . TYR B 1 280 ? 30.076  63.969  -4.912  1.00 33.97 ? 318 TYR B N   1 
ATOM   5522  C CA  . TYR B 1 280 ? 28.795  63.829  -4.213  1.00 33.43 ? 318 TYR B CA  1 
ATOM   5523  C C   . TYR B 1 280 ? 28.878  64.774  -3.056  1.00 33.98 ? 318 TYR B C   1 
ATOM   5524  O O   . TYR B 1 280 ? 29.795  64.676  -2.253  1.00 34.82 ? 318 TYR B O   1 
ATOM   5525  C CB  . TYR B 1 280 ? 28.578  62.384  -3.720  1.00 32.65 ? 318 TYR B CB  1 
ATOM   5526  C CG  . TYR B 1 280 ? 28.508  61.427  -4.903  1.00 31.01 ? 318 TYR B CG  1 
ATOM   5527  C CD1 . TYR B 1 280 ? 27.329  61.284  -5.619  1.00 27.68 ? 318 TYR B CD1 1 
ATOM   5528  C CD2 . TYR B 1 280 ? 29.636  60.737  -5.336  1.00 29.19 ? 318 TYR B CD2 1 
ATOM   5529  C CE1 . TYR B 1 280 ? 27.258  60.481  -6.731  1.00 29.16 ? 318 TYR B CE1 1 
ATOM   5530  C CE2 . TYR B 1 280 ? 29.568  59.892  -6.425  1.00 28.31 ? 318 TYR B CE2 1 
ATOM   5531  C CZ  . TYR B 1 280 ? 28.380  59.777  -7.132  1.00 29.52 ? 318 TYR B CZ  1 
ATOM   5532  O OH  . TYR B 1 280 ? 28.290  58.945  -8.234  1.00 32.38 ? 318 TYR B OH  1 
ATOM   5533  N N   . ALA B 1 281 ? 27.954  65.726  -3.005  1.00 34.29 ? 319 ALA B N   1 
ATOM   5534  C CA  . ALA B 1 281 ? 27.996  66.775  -2.019  1.00 34.00 ? 319 ALA B CA  1 
ATOM   5535  C C   . ALA B 1 281 ? 26.623  66.915  -1.351  1.00 34.02 ? 319 ALA B C   1 
ATOM   5536  O O   . ALA B 1 281 ? 25.606  66.729  -1.993  1.00 32.73 ? 319 ALA B O   1 
ATOM   5537  C CB  . ALA B 1 281 ? 28.430  68.087  -2.675  1.00 33.60 ? 319 ALA B CB  1 
ATOM   5538  N N   . ASN B 1 282 ? 26.630  67.234  -0.056  1.00 33.88 ? 320 ASN B N   1 
ATOM   5539  C CA  . ASN B 1 282 ? 25.456  67.685  0.665   1.00 34.67 ? 320 ASN B CA  1 
ATOM   5540  C C   . ASN B 1 282 ? 25.705  69.138  1.132   1.00 36.05 ? 320 ASN B C   1 
ATOM   5541  O O   . ASN B 1 282 ? 26.691  69.420  1.818   1.00 37.08 ? 320 ASN B O   1 
ATOM   5542  C CB  . ASN B 1 282 ? 25.145  66.736  1.837   1.00 34.28 ? 320 ASN B CB  1 
ATOM   5543  C CG  . ASN B 1 282 ? 23.908  67.133  2.585   1.00 33.84 ? 320 ASN B CG  1 
ATOM   5544  O OD1 . ASN B 1 282 ? 23.878  68.184  3.197   1.00 36.81 ? 320 ASN B OD1 1 
ATOM   5545  N ND2 . ASN B 1 282 ? 22.885  66.296  2.554   1.00 28.41 ? 320 ASN B ND2 1 
ATOM   5546  N N   . LEU B 1 283 ? 24.824  70.052  0.729   1.00 36.15 ? 321 LEU B N   1 
ATOM   5547  C CA  . LEU B 1 283 ? 24.985  71.477  0.999   1.00 36.02 ? 321 LEU B CA  1 
ATOM   5548  C C   . LEU B 1 283 ? 23.879  71.986  1.963   1.00 36.95 ? 321 LEU B C   1 
ATOM   5549  O O   . LEU B 1 283 ? 22.666  71.757  1.744   1.00 36.56 ? 321 LEU B O   1 
ATOM   5550  C CB  . LEU B 1 283 ? 24.997  72.253  -0.325  1.00 35.79 ? 321 LEU B CB  1 
ATOM   5551  C CG  . LEU B 1 283 ? 26.020  71.745  -1.365  1.00 34.11 ? 321 LEU B CG  1 
ATOM   5552  C CD1 . LEU B 1 283 ? 25.946  72.542  -2.665  1.00 33.05 ? 321 LEU B CD1 1 
ATOM   5553  C CD2 . LEU B 1 283 ? 27.458  71.721  -0.823  1.00 30.88 ? 321 LEU B CD2 1 
ATOM   5554  N N   . GLY B 1 284 ? 24.304  72.609  3.062   1.00 37.27 ? 322 GLY B N   1 
ATOM   5555  C CA  . GLY B 1 284 ? 23.380  73.310  3.924   1.00 38.32 ? 322 GLY B CA  1 
ATOM   5556  C C   . GLY B 1 284 ? 22.744  74.493  3.198   1.00 39.47 ? 322 GLY B C   1 
ATOM   5557  O O   . GLY B 1 284 ? 23.246  74.973  2.156   1.00 39.15 ? 322 GLY B O   1 
ATOM   5558  N N   . ILE B 1 285 ? 21.602  74.923  3.738   1.00 40.85 ? 323 ILE B N   1 
ATOM   5559  C CA  . ILE B 1 285 ? 20.902  76.157  3.342   1.00 41.87 ? 323 ILE B CA  1 
ATOM   5560  C C   . ILE B 1 285 ? 21.848  77.371  3.406   1.00 41.60 ? 323 ILE B C   1 
ATOM   5561  O O   . ILE B 1 285 ? 22.847  77.338  4.136   1.00 41.92 ? 323 ILE B O   1 
ATOM   5562  C CB  . ILE B 1 285 ? 19.681  76.405  4.292   1.00 42.34 ? 323 ILE B CB  1 
ATOM   5563  C CG1 . ILE B 1 285 ? 20.162  76.621  5.757   1.00 43.92 ? 323 ILE B CG1 1 
ATOM   5564  C CG2 . ILE B 1 285 ? 18.684  75.221  4.196   1.00 42.24 ? 323 ILE B CG2 1 
ATOM   5565  C CD1 . ILE B 1 285 ? 19.157  76.150  6.909   1.00 43.25 ? 323 ILE B CD1 1 
ATOM   5566  N N   . GLY B 1 286 ? 21.548  78.430  2.657   1.00 40.92 ? 324 GLY B N   1 
ATOM   5567  C CA  . GLY B 1 286 ? 22.379  79.637  2.689   1.00 40.59 ? 324 GLY B CA  1 
ATOM   5568  C C   . GLY B 1 286 ? 23.631  79.542  1.827   1.00 40.21 ? 324 GLY B C   1 
ATOM   5569  O O   . GLY B 1 286 ? 23.589  78.978  0.724   1.00 39.86 ? 324 GLY B O   1 
ATOM   5570  N N   . ILE B 1 287 ? 24.745  80.077  2.331   1.00 39.60 ? 325 ILE B N   1 
ATOM   5571  C CA  . ILE B 1 287 ? 26.005  80.129  1.567   1.00 39.46 ? 325 ILE B CA  1 
ATOM   5572  C C   . ILE B 1 287 ? 26.340  78.838  0.756   1.00 39.94 ? 325 ILE B C   1 
ATOM   5573  O O   . ILE B 1 287 ? 26.572  78.918  -0.463  1.00 39.83 ? 325 ILE B O   1 
ATOM   5574  C CB  . ILE B 1 287 ? 27.203  80.534  2.474   1.00 39.54 ? 325 ILE B CB  1 
ATOM   5575  C CG1 . ILE B 1 287 ? 27.112  82.036  2.832   1.00 40.04 ? 325 ILE B CG1 1 
ATOM   5576  C CG2 . ILE B 1 287 ? 28.543  80.235  1.782   1.00 38.17 ? 325 ILE B CG2 1 
ATOM   5577  C CD1 . ILE B 1 287 ? 28.002  82.504  3.991   1.00 39.38 ? 325 ILE B CD1 1 
ATOM   5578  N N   . PRO B 1 288 ? 26.352  77.649  1.413   1.00 39.80 ? 326 PRO B N   1 
ATOM   5579  C CA  . PRO B 1 288 ? 26.788  76.469  0.661   1.00 39.87 ? 326 PRO B CA  1 
ATOM   5580  C C   . PRO B 1 288 ? 25.921  76.197  -0.581  1.00 40.28 ? 326 PRO B C   1 
ATOM   5581  O O   . PRO B 1 288 ? 26.447  75.999  -1.684  1.00 40.12 ? 326 PRO B O   1 
ATOM   5582  C CB  . PRO B 1 288 ? 26.680  75.350  1.705   1.00 40.00 ? 326 PRO B CB  1 
ATOM   5583  C CG  . PRO B 1 288 ? 26.766  76.039  3.020   1.00 38.94 ? 326 PRO B CG  1 
ATOM   5584  C CD  . PRO B 1 288 ? 25.976  77.282  2.789   1.00 39.32 ? 326 PRO B CD  1 
ATOM   5585  N N   . LEU B 1 289 ? 24.603  76.235  -0.404  1.00 40.67 ? 327 LEU B N   1 
ATOM   5586  C CA  . LEU B 1 289 ? 23.665  76.024  -1.501  1.00 40.87 ? 327 LEU B CA  1 
ATOM   5587  C C   . LEU B 1 289 ? 23.836  77.090  -2.607  1.00 41.25 ? 327 LEU B C   1 
ATOM   5588  O O   . LEU B 1 289 ? 23.974  76.732  -3.795  1.00 41.56 ? 327 LEU B O   1 
ATOM   5589  C CB  . LEU B 1 289 ? 22.227  75.986  -0.955  1.00 41.15 ? 327 LEU B CB  1 
ATOM   5590  C CG  . LEU B 1 289 ? 21.103  75.295  -1.740  1.00 41.65 ? 327 LEU B CG  1 
ATOM   5591  C CD1 . LEU B 1 289 ? 21.491  73.866  -2.149  1.00 40.44 ? 327 LEU B CD1 1 
ATOM   5592  C CD2 . LEU B 1 289 ? 19.818  75.300  -0.900  1.00 40.81 ? 327 LEU B CD2 1 
ATOM   5593  N N   . LEU B 1 290 ? 23.853  78.378  -2.234  1.00 40.80 ? 328 LEU B N   1 
ATOM   5594  C CA  . LEU B 1 290 ? 24.139  79.446  -3.188  1.00 41.00 ? 328 LEU B CA  1 
ATOM   5595  C C   . LEU B 1 290 ? 25.473  79.256  -3.919  1.00 40.81 ? 328 LEU B C   1 
ATOM   5596  O O   . LEU B 1 290 ? 25.590  79.661  -5.068  1.00 40.89 ? 328 LEU B O   1 
ATOM   5597  C CB  . LEU B 1 290 ? 24.146  80.842  -2.513  1.00 41.48 ? 328 LEU B CB  1 
ATOM   5598  C CG  . LEU B 1 290 ? 22.810  81.480  -2.119  1.00 41.45 ? 328 LEU B CG  1 
ATOM   5599  C CD1 . LEU B 1 290 ? 23.004  82.621  -1.111  1.00 40.56 ? 328 LEU B CD1 1 
ATOM   5600  C CD2 . LEU B 1 290 ? 22.084  81.965  -3.367  1.00 41.58 ? 328 LEU B CD2 1 
ATOM   5601  N N   . ALA B 1 291 ? 26.481  78.678  -3.261  1.00 40.53 ? 329 ALA B N   1 
ATOM   5602  C CA  . ALA B 1 291 ? 27.773  78.412  -3.925  1.00 40.61 ? 329 ALA B CA  1 
ATOM   5603  C C   . ALA B 1 291 ? 27.622  77.473  -5.115  1.00 40.83 ? 329 ALA B C   1 
ATOM   5604  O O   . ALA B 1 291 ? 28.406  77.560  -6.067  1.00 41.34 ? 329 ALA B O   1 
ATOM   5605  C CB  . ALA B 1 291 ? 28.806  77.841  -2.953  1.00 40.49 ? 329 ALA B CB  1 
ATOM   5606  N N   . SER B 1 292 ? 26.629  76.583  -5.067  1.00 40.77 ? 330 SER B N   1 
ATOM   5607  C CA  . SER B 1 292 ? 26.417  75.615  -6.157  1.00 40.85 ? 330 SER B CA  1 
ATOM   5608  C C   . SER B 1 292 ? 26.022  76.279  -7.506  1.00 41.01 ? 330 SER B C   1 
ATOM   5609  O O   . SER B 1 292 ? 26.253  75.699  -8.578  1.00 41.01 ? 330 SER B O   1 
ATOM   5610  C CB  . SER B 1 292 ? 25.419  74.510  -5.751  1.00 40.56 ? 330 SER B CB  1 
ATOM   5611  O OG  . SER B 1 292 ? 24.093  74.986  -5.634  1.00 38.99 ? 330 SER B OG  1 
ATOM   5612  N N   . ASN B 1 293 ? 25.455  77.488  -7.446  1.00 40.87 ? 331 ASN B N   1 
ATOM   5613  C CA  . ASN B 1 293 ? 25.134  78.261  -8.653  1.00 40.69 ? 331 ASN B CA  1 
ATOM   5614  C C   . ASN B 1 293 ? 26.374  78.618  -9.467  1.00 40.47 ? 331 ASN B C   1 
ATOM   5615  O O   . ASN B 1 293 ? 26.281  78.823  -10.673 1.00 40.20 ? 331 ASN B O   1 
ATOM   5616  C CB  . ASN B 1 293 ? 24.363  79.529  -8.294  1.00 40.78 ? 331 ASN B CB  1 
ATOM   5617  C CG  . ASN B 1 293 ? 23.084  79.235  -7.531  1.00 41.61 ? 331 ASN B CG  1 
ATOM   5618  O OD1 . ASN B 1 293 ? 22.099  78.783  -8.096  1.00 43.00 ? 331 ASN B OD1 1 
ATOM   5619  N ND2 . ASN B 1 293 ? 23.103  79.480  -6.234  1.00 43.90 ? 331 ASN B ND2 1 
ATOM   5620  N N   . PHE B 1 294 ? 27.535  78.652  -8.817  1.00 40.74 ? 332 PHE B N   1 
ATOM   5621  C CA  . PHE B 1 294 ? 28.798  78.967  -9.491  1.00 41.17 ? 332 PHE B CA  1 
ATOM   5622  C C   . PHE B 1 294 ? 29.564  77.719  -9.966  1.00 41.31 ? 332 PHE B C   1 
ATOM   5623  O O   . PHE B 1 294 ? 30.692  77.836  -10.433 1.00 41.41 ? 332 PHE B O   1 
ATOM   5624  C CB  . PHE B 1 294 ? 29.690  79.840  -8.579  1.00 41.29 ? 332 PHE B CB  1 
ATOM   5625  C CG  . PHE B 1 294 ? 29.083  81.179  -8.224  1.00 41.25 ? 332 PHE B CG  1 
ATOM   5626  C CD1 . PHE B 1 294 ? 28.121  81.283  -7.222  1.00 42.27 ? 332 PHE B CD1 1 
ATOM   5627  C CD2 . PHE B 1 294 ? 29.473  82.336  -8.887  1.00 42.26 ? 332 PHE B CD2 1 
ATOM   5628  C CE1 . PHE B 1 294 ? 27.551  82.518  -6.895  1.00 41.90 ? 332 PHE B CE1 1 
ATOM   5629  C CE2 . PHE B 1 294 ? 28.905  83.573  -8.565  1.00 41.88 ? 332 PHE B CE2 1 
ATOM   5630  C CZ  . PHE B 1 294 ? 27.945  83.657  -7.564  1.00 41.26 ? 332 PHE B CZ  1 
ATOM   5631  N N   . ILE B 1 295 ? 28.955  76.534  -9.869  1.00 41.81 ? 333 ILE B N   1 
ATOM   5632  C CA  . ILE B 1 295 ? 29.565  75.283  -10.382 1.00 41.82 ? 333 ILE B CA  1 
ATOM   5633  C C   . ILE B 1 295 ? 29.671  75.332  -11.920 1.00 42.05 ? 333 ILE B C   1 
ATOM   5634  O O   . ILE B 1 295 ? 28.660  75.463  -12.607 1.00 42.35 ? 333 ILE B O   1 
ATOM   5635  C CB  . ILE B 1 295 ? 28.745  74.002  -9.939  1.00 41.85 ? 333 ILE B CB  1 
ATOM   5636  C CG1 . ILE B 1 295 ? 28.781  73.824  -8.423  1.00 41.22 ? 333 ILE B CG1 1 
ATOM   5637  C CG2 . ILE B 1 295 ? 29.292  72.717  -10.571 1.00 41.76 ? 333 ILE B CG2 1 
ATOM   5638  C CD1 . ILE B 1 295 ? 27.750  72.898  -7.901  1.00 40.51 ? 333 ILE B CD1 1 
ATOM   5639  N N   . SER B 1 296 ? 30.886  75.245  -12.459 1.00 42.09 ? 334 SER B N   1 
ATOM   5640  C CA  . SER B 1 296 ? 31.074  75.165  -13.921 1.00 41.97 ? 334 SER B CA  1 
ATOM   5641  C C   . SER B 1 296 ? 30.222  74.038  -14.557 1.00 41.89 ? 334 SER B C   1 
ATOM   5642  O O   . SER B 1 296 ? 30.147  72.943  -13.997 1.00 41.81 ? 334 SER B O   1 
ATOM   5643  C CB  . SER B 1 296 ? 32.559  74.937  -14.253 1.00 42.09 ? 334 SER B CB  1 
ATOM   5644  O OG  . SER B 1 296 ? 32.769  74.740  -15.646 1.00 41.49 ? 334 SER B OG  1 
ATOM   5645  N N   . PRO B 1 297 ? 29.575  74.314  -15.717 1.00 41.78 ? 335 PRO B N   1 
ATOM   5646  C CA  . PRO B 1 297 ? 28.850  73.280  -16.462 1.00 41.66 ? 335 PRO B CA  1 
ATOM   5647  C C   . PRO B 1 297 ? 29.785  72.277  -17.137 1.00 41.56 ? 335 PRO B C   1 
ATOM   5648  O O   . PRO B 1 297 ? 29.322  71.249  -17.653 1.00 41.86 ? 335 PRO B O   1 
ATOM   5649  C CB  . PRO B 1 297 ? 28.080  74.078  -17.530 1.00 41.62 ? 335 PRO B CB  1 
ATOM   5650  C CG  . PRO B 1 297 ? 28.867  75.297  -17.731 1.00 41.57 ? 335 PRO B CG  1 
ATOM   5651  C CD  . PRO B 1 297 ? 29.492  75.624  -16.400 1.00 42.01 ? 335 PRO B CD  1 
ATOM   5652  N N   . ASN B 1 298 ? 31.088  72.564  -17.135 1.00 41.11 ? 336 ASN B N   1 
ATOM   5653  C CA  . ASN B 1 298 ? 32.086  71.604  -17.620 1.00 40.77 ? 336 ASN B CA  1 
ATOM   5654  C C   . ASN B 1 298 ? 32.458  70.523  -16.602 1.00 39.99 ? 336 ASN B C   1 
ATOM   5655  O O   . ASN B 1 298 ? 33.278  69.651  -16.900 1.00 40.13 ? 336 ASN B O   1 
ATOM   5656  C CB  . ASN B 1 298 ? 33.335  72.339  -18.104 1.00 40.81 ? 336 ASN B CB  1 
ATOM   5657  C CG  . ASN B 1 298 ? 33.060  73.174  -19.325 1.00 40.58 ? 336 ASN B CG  1 
ATOM   5658  O OD1 . ASN B 1 298 ? 32.299  72.765  -20.204 1.00 39.10 ? 336 ASN B OD1 1 
ATOM   5659  N ND2 . ASN B 1 298 ? 33.665  74.358  -19.385 1.00 40.54 ? 336 ASN B ND2 1 
ATOM   5660  N N   . ILE B 1 299 ? 31.850  70.595  -15.413 1.00 38.99 ? 337 ILE B N   1 
ATOM   5661  C CA  . ILE B 1 299 ? 31.921  69.538  -14.410 1.00 37.65 ? 337 ILE B CA  1 
ATOM   5662  C C   . ILE B 1 299 ? 30.512  69.154  -13.919 1.00 36.89 ? 337 ILE B C   1 
ATOM   5663  O O   . ILE B 1 299 ? 29.538  69.908  -14.089 1.00 36.60 ? 337 ILE B O   1 
ATOM   5664  C CB  . ILE B 1 299 ? 32.837  69.912  -13.199 1.00 37.53 ? 337 ILE B CB  1 
ATOM   5665  C CG1 . ILE B 1 299 ? 32.212  70.992  -12.313 1.00 37.05 ? 337 ILE B CG1 1 
ATOM   5666  C CG2 . ILE B 1 299 ? 34.226  70.365  -13.680 1.00 37.36 ? 337 ILE B CG2 1 
ATOM   5667  C CD1 . ILE B 1 299 ? 32.663  70.908  -10.872 1.00 34.61 ? 337 ILE B CD1 1 
ATOM   5668  N N   . THR B 1 300 ? 30.440  67.958  -13.332 1.00 35.24 ? 338 THR B N   1 
ATOM   5669  C CA  . THR B 1 300 ? 29.236  67.428  -12.738 1.00 34.46 ? 338 THR B CA  1 
ATOM   5670  C C   . THR B 1 300 ? 29.467  67.214  -11.246 1.00 32.62 ? 338 THR B C   1 
ATOM   5671  O O   . THR B 1 300 ? 30.426  66.571  -10.855 1.00 32.19 ? 338 THR B O   1 
ATOM   5672  C CB  . THR B 1 300 ? 28.822  66.079  -13.376 1.00 34.28 ? 338 THR B CB  1 
ATOM   5673  O OG1 . THR B 1 300 ? 28.934  66.172  -14.798 1.00 35.44 ? 338 THR B OG1 1 
ATOM   5674  C CG2 . THR B 1 300 ? 27.396  65.742  -13.015 1.00 32.89 ? 338 THR B CG2 1 
ATOM   5675  N N   . VAL B 1 301 ? 28.598  67.820  -10.448 1.00 31.74 ? 339 VAL B N   1 
ATOM   5676  C CA  . VAL B 1 301 ? 28.485  67.604  -9.004  1.00 31.61 ? 339 VAL B CA  1 
ATOM   5677  C C   . VAL B 1 301 ? 27.117  66.945  -8.803  1.00 31.78 ? 339 VAL B C   1 
ATOM   5678  O O   . VAL B 1 301 ? 26.162  67.285  -9.511  1.00 32.57 ? 339 VAL B O   1 
ATOM   5679  C CB  . VAL B 1 301 ? 28.590  68.927  -8.179  1.00 31.27 ? 339 VAL B CB  1 
ATOM   5680  C CG1 . VAL B 1 301 ? 28.491  68.662  -6.679  1.00 28.80 ? 339 VAL B CG1 1 
ATOM   5681  C CG2 . VAL B 1 301 ? 29.889  69.633  -8.474  1.00 31.23 ? 339 VAL B CG2 1 
ATOM   5682  N N   . HIS B 1 302 ? 27.040  65.983  -7.883  1.00 31.08 ? 340 HIS B N   1 
ATOM   5683  C CA  . HIS B 1 302 ? 25.810  65.275  -7.586  1.00 30.79 ? 340 HIS B CA  1 
ATOM   5684  C C   . HIS B 1 302 ? 25.366  65.711  -6.219  1.00 30.88 ? 340 HIS B C   1 
ATOM   5685  O O   . HIS B 1 302 ? 26.064  65.483  -5.254  1.00 30.04 ? 340 HIS B O   1 
ATOM   5686  C CB  . HIS B 1 302 ? 26.064  63.768  -7.608  1.00 31.05 ? 340 HIS B CB  1 
ATOM   5687  C CG  . HIS B 1 302 ? 26.698  63.291  -8.885  1.00 32.10 ? 340 HIS B CG  1 
ATOM   5688  N ND1 . HIS B 1 302 ? 26.049  63.337  -10.104 1.00 32.99 ? 340 HIS B ND1 1 
ATOM   5689  C CD2 . HIS B 1 302 ? 27.943  62.820  -9.141  1.00 31.05 ? 340 HIS B CD2 1 
ATOM   5690  C CE1 . HIS B 1 302 ? 26.861  62.900  -11.049 1.00 31.47 ? 340 HIS B CE1 1 
ATOM   5691  N NE2 . HIS B 1 302 ? 28.012  62.573  -10.487 1.00 31.03 ? 340 HIS B NE2 1 
ATOM   5692  N N   . LEU B 1 303 ? 24.210  66.366  -6.130  1.00 31.45 ? 341 LEU B N   1 
ATOM   5693  C CA  . LEU B 1 303 ? 23.757  66.933  -4.854  1.00 31.50 ? 341 LEU B CA  1 
ATOM   5694  C C   . LEU B 1 303 ? 22.750  65.993  -4.190  1.00 31.29 ? 341 LEU B C   1 
ATOM   5695  O O   . LEU B 1 303 ? 21.740  65.594  -4.799  1.00 30.52 ? 341 LEU B O   1 
ATOM   5696  C CB  . LEU B 1 303 ? 23.193  68.352  -5.029  1.00 31.30 ? 341 LEU B CB  1 
ATOM   5697  C CG  . LEU B 1 303 ? 24.177  69.432  -5.519  1.00 31.86 ? 341 LEU B CG  1 
ATOM   5698  C CD1 . LEU B 1 303 ? 23.516  70.809  -5.537  1.00 32.56 ? 341 LEU B CD1 1 
ATOM   5699  C CD2 . LEU B 1 303 ? 25.413  69.488  -4.686  1.00 28.96 ? 341 LEU B CD2 1 
ATOM   5700  N N   . GLN B 1 304 ? 23.096  65.641  -2.957  1.00 31.70 ? 342 GLN B N   1 
ATOM   5701  C CA  . GLN B 1 304 ? 22.343  64.774  -2.065  1.00 32.88 ? 342 GLN B CA  1 
ATOM   5702  C C   . GLN B 1 304 ? 21.548  65.576  -1.040  1.00 34.06 ? 342 GLN B C   1 
ATOM   5703  O O   . GLN B 1 304 ? 22.029  66.586  -0.499  1.00 33.62 ? 342 GLN B O   1 
ATOM   5704  C CB  . GLN B 1 304 ? 23.320  63.879  -1.308  1.00 33.20 ? 342 GLN B CB  1 
ATOM   5705  C CG  . GLN B 1 304 ? 22.743  62.593  -0.725  1.00 33.60 ? 342 GLN B CG  1 
ATOM   5706  C CD  . GLN B 1 304 ? 22.261  62.718  0.708   1.00 35.39 ? 342 GLN B CD  1 
ATOM   5707  O OE1 . GLN B 1 304 ? 22.334  63.791  1.315   1.00 38.91 ? 342 GLN B OE1 1 
ATOM   5708  N NE2 . GLN B 1 304 ? 21.713  61.619  1.250   1.00 31.83 ? 342 GLN B NE2 1 
ATOM   5709  N N   . SER B 1 305 ? 20.361  65.076  -0.733  1.00 35.29 ? 343 SER B N   1 
ATOM   5710  C CA  . SER B 1 305 ? 19.441  65.709  0.203   1.00 35.95 ? 343 SER B CA  1 
ATOM   5711  C C   . SER B 1 305 ? 19.062  64.634  1.221   1.00 36.40 ? 343 SER B C   1 
ATOM   5712  O O   . SER B 1 305 ? 18.830  63.488  0.855   1.00 36.82 ? 343 SER B O   1 
ATOM   5713  C CB  . SER B 1 305 ? 18.217  66.229  -0.548  1.00 36.11 ? 343 SER B CB  1 
ATOM   5714  O OG  . SER B 1 305 ? 17.178  66.630  0.328   1.00 37.48 ? 343 SER B OG  1 
ATOM   5715  N N   . GLU B 1 306 ? 18.981  65.011  2.492   1.00 36.53 ? 344 GLU B N   1 
ATOM   5716  C CA  . GLU B 1 306 ? 18.847  64.035  3.592   1.00 37.15 ? 344 GLU B CA  1 
ATOM   5717  C C   . GLU B 1 306 ? 17.491  63.352  3.676   1.00 35.41 ? 344 GLU B C   1 
ATOM   5718  O O   . GLU B 1 306 ? 17.385  62.253  4.231   1.00 34.57 ? 344 GLU B O   1 
ATOM   5719  C CB  . GLU B 1 306 ? 19.228  64.686  4.945   1.00 37.09 ? 344 GLU B CB  1 
ATOM   5720  C CG  . GLU B 1 306 ? 18.264  65.759  5.449   1.00 40.31 ? 344 GLU B CG  1 
ATOM   5721  C CD  . GLU B 1 306 ? 18.936  66.768  6.386   1.00 42.28 ? 344 GLU B CD  1 
ATOM   5722  O OE1 . GLU B 1 306 ? 20.118  67.105  6.125   1.00 49.61 ? 344 GLU B OE1 1 
ATOM   5723  O OE2 . GLU B 1 306 ? 18.276  67.233  7.359   1.00 48.78 ? 344 GLU B OE2 1 
ATOM   5724  N N   . ASN B 1 307 ? 16.452  64.005  3.150   1.00 34.90 ? 345 ASN B N   1 
ATOM   5725  C CA  . ASN B 1 307 ? 15.128  63.387  3.034   1.00 34.08 ? 345 ASN B CA  1 
ATOM   5726  C C   . ASN B 1 307 ? 15.027  62.269  1.956   1.00 34.41 ? 345 ASN B C   1 
ATOM   5727  O O   . ASN B 1 307 ? 13.958  61.678  1.778   1.00 35.24 ? 345 ASN B O   1 
ATOM   5728  C CB  . ASN B 1 307 ? 14.018  64.452  2.845   1.00 34.61 ? 345 ASN B CB  1 
ATOM   5729  C CG  . ASN B 1 307 ? 14.272  65.401  1.685   1.00 33.24 ? 345 ASN B CG  1 
ATOM   5730  O OD1 . ASN B 1 307 ? 15.373  65.875  1.483   1.00 34.69 ? 345 ASN B OD1 1 
ATOM   5731  N ND2 . ASN B 1 307 ? 13.243  65.655  0.911   1.00 33.78 ? 345 ASN B ND2 1 
ATOM   5732  N N   . GLY B 1 308 ? 16.110  62.007  1.223   1.00 33.19 ? 346 GLY B N   1 
ATOM   5733  C CA  . GLY B 1 308 ? 16.176  60.838  0.361   1.00 32.72 ? 346 GLY B CA  1 
ATOM   5734  C C   . GLY B 1 308 ? 16.229  61.135  -1.123  1.00 32.18 ? 346 GLY B C   1 
ATOM   5735  O O   . GLY B 1 308 ? 15.494  60.538  -1.878  1.00 31.79 ? 346 GLY B O   1 
ATOM   5736  N N   . VAL B 1 309 ? 17.101  62.053  -1.536  1.00 31.67 ? 347 VAL B N   1 
ATOM   5737  C CA  . VAL B 1 309 ? 17.241  62.416  -2.942  1.00 31.84 ? 347 VAL B CA  1 
ATOM   5738  C C   . VAL B 1 309 ? 18.734  62.479  -3.256  1.00 32.17 ? 347 VAL B C   1 
ATOM   5739  O O   . VAL B 1 309 ? 19.497  63.019  -2.472  1.00 32.03 ? 347 VAL B O   1 
ATOM   5740  C CB  . VAL B 1 309 ? 16.549  63.811  -3.330  1.00 31.33 ? 347 VAL B CB  1 
ATOM   5741  C CG1 . VAL B 1 309 ? 16.318  63.902  -4.834  1.00 30.55 ? 347 VAL B CG1 1 
ATOM   5742  C CG2 . VAL B 1 309 ? 15.207  64.004  -2.632  1.00 31.19 ? 347 VAL B CG2 1 
ATOM   5743  N N   . LEU B 1 310 ? 19.131  61.889  -4.384  1.00 32.61 ? 348 LEU B N   1 
ATOM   5744  C CA  . LEU B 1 310 ? 20.448  62.087  -4.975  1.00 33.36 ? 348 LEU B CA  1 
ATOM   5745  C C   . LEU B 1 310 ? 20.215  62.601  -6.359  1.00 33.28 ? 348 LEU B C   1 
ATOM   5746  O O   . LEU B 1 310 ? 19.528  61.971  -7.142  1.00 33.16 ? 348 LEU B O   1 
ATOM   5747  C CB  . LEU B 1 310 ? 21.237  60.777  -5.042  1.00 33.92 ? 348 LEU B CB  1 
ATOM   5748  C CG  . LEU B 1 310 ? 22.642  60.832  -5.639  1.00 35.38 ? 348 LEU B CG  1 
ATOM   5749  C CD1 . LEU B 1 310 ? 23.504  61.870  -4.865  1.00 33.83 ? 348 LEU B CD1 1 
ATOM   5750  C CD2 . LEU B 1 310 ? 23.239  59.382  -5.649  1.00 35.03 ? 348 LEU B CD2 1 
ATOM   5751  N N   . GLY B 1 311 ? 20.753  63.773  -6.662  1.00 33.60 ? 349 GLY B N   1 
ATOM   5752  C CA  . GLY B 1 311 ? 20.599  64.328  -7.993  1.00 34.39 ? 349 GLY B CA  1 
ATOM   5753  C C   . GLY B 1 311 ? 19.660  65.511  -8.083  1.00 34.47 ? 349 GLY B C   1 
ATOM   5754  O O   . GLY B 1 311 ? 18.984  65.678  -9.093  1.00 34.10 ? 349 GLY B O   1 
ATOM   5755  N N   . LEU B 1 312 ? 19.645  66.325  -7.029  1.00 34.75 ? 350 LEU B N   1 
ATOM   5756  C CA  . LEU B 1 312 ? 18.851  67.550  -6.971  1.00 35.11 ? 350 LEU B CA  1 
ATOM   5757  C C   . LEU B 1 312 ? 19.230  68.494  -8.126  1.00 35.11 ? 350 LEU B C   1 
ATOM   5758  O O   . LEU B 1 312 ? 20.405  68.629  -8.481  1.00 34.32 ? 350 LEU B O   1 
ATOM   5759  C CB  . LEU B 1 312 ? 19.031  68.282  -5.623  1.00 34.88 ? 350 LEU B CB  1 
ATOM   5760  C CG  . LEU B 1 312 ? 18.390  67.734  -4.338  1.00 35.92 ? 350 LEU B CG  1 
ATOM   5761  C CD1 . LEU B 1 312 ? 18.669  68.710  -3.252  1.00 35.68 ? 350 LEU B CD1 1 
ATOM   5762  C CD2 . LEU B 1 312 ? 16.875  67.521  -4.441  1.00 35.36 ? 350 LEU B CD2 1 
ATOM   5763  N N   . GLY B 1 313 ? 18.208  69.098  -8.717  1.00 35.25 ? 351 GLY B N   1 
ATOM   5764  C CA  . GLY B 1 313 ? 18.378  70.126  -9.722  1.00 36.28 ? 351 GLY B CA  1 
ATOM   5765  C C   . GLY B 1 313 ? 18.011  71.510  -9.206  1.00 37.08 ? 351 GLY B C   1 
ATOM   5766  O O   . GLY B 1 313 ? 17.863  71.738  -7.997  1.00 36.32 ? 351 GLY B O   1 
ATOM   5767  N N   . PRO B 1 314 ? 17.861  72.458  -10.131 1.00 38.09 ? 352 PRO B N   1 
ATOM   5768  C CA  . PRO B 1 314 ? 17.526  73.817  -9.746  1.00 38.70 ? 352 PRO B CA  1 
ATOM   5769  C C   . PRO B 1 314 ? 16.104  73.934  -9.214  1.00 38.95 ? 352 PRO B C   1 
ATOM   5770  O O   . PRO B 1 314 ? 15.338  72.965  -9.242  1.00 39.33 ? 352 PRO B O   1 
ATOM   5771  C CB  . PRO B 1 314 ? 17.700  74.603  -11.047 1.00 38.85 ? 352 PRO B CB  1 
ATOM   5772  C CG  . PRO B 1 314 ? 17.559  73.604  -12.111 1.00 38.69 ? 352 PRO B CG  1 
ATOM   5773  C CD  . PRO B 1 314 ? 18.039  72.313  -11.584 1.00 38.23 ? 352 PRO B CD  1 
ATOM   5774  N N   . TYR B 1 315 ? 15.761  75.119  -8.725  1.00 38.89 ? 353 TYR B N   1 
ATOM   5775  C CA  . TYR B 1 315 ? 14.399  75.376  -8.254  1.00 38.57 ? 353 TYR B CA  1 
ATOM   5776  C C   . TYR B 1 315 ? 13.393  75.237  -9.408  1.00 38.40 ? 353 TYR B C   1 
ATOM   5777  O O   . TYR B 1 315 ? 13.737  75.489  -10.566 1.00 37.75 ? 353 TYR B O   1 
ATOM   5778  C CB  . TYR B 1 315 ? 14.325  76.751  -7.604  1.00 38.43 ? 353 TYR B CB  1 
ATOM   5779  C CG  . TYR B 1 315 ? 15.119  76.823  -6.320  1.00 38.45 ? 353 TYR B CG  1 
ATOM   5780  C CD1 . TYR B 1 315 ? 14.694  76.146  -5.190  1.00 37.95 ? 353 TYR B CD1 1 
ATOM   5781  C CD2 . TYR B 1 315 ? 16.300  77.563  -6.235  1.00 39.70 ? 353 TYR B CD2 1 
ATOM   5782  C CE1 . TYR B 1 315 ? 15.402  76.211  -4.002  1.00 38.09 ? 353 TYR B CE1 1 
ATOM   5783  C CE2 . TYR B 1 315 ? 17.031  77.622  -5.028  1.00 39.54 ? 353 TYR B CE2 1 
ATOM   5784  C CZ  . TYR B 1 315 ? 16.563  76.939  -3.922  1.00 37.50 ? 353 TYR B CZ  1 
ATOM   5785  O OH  . TYR B 1 315 ? 17.237  76.975  -2.729  1.00 38.34 ? 353 TYR B OH  1 
ATOM   5786  N N   . PRO B 1 316 ? 12.159  74.804  -9.100  1.00 38.38 ? 354 PRO B N   1 
ATOM   5787  C CA  . PRO B 1 316 ? 11.135  74.586  -10.134 1.00 38.72 ? 354 PRO B CA  1 
ATOM   5788  C C   . PRO B 1 316 ? 10.521  75.877  -10.664 1.00 39.41 ? 354 PRO B C   1 
ATOM   5789  O O   . PRO B 1 316 ? 10.392  76.832  -9.908  1.00 39.38 ? 354 PRO B O   1 
ATOM   5790  C CB  . PRO B 1 316 ? 10.070  73.779  -9.394  1.00 38.62 ? 354 PRO B CB  1 
ATOM   5791  C CG  . PRO B 1 316 ? 10.211  74.211  -7.956  1.00 38.46 ? 354 PRO B CG  1 
ATOM   5792  C CD  . PRO B 1 316 ? 11.662  74.494  -7.749  1.00 37.94 ? 354 PRO B CD  1 
ATOM   5793  N N   . ARG B 1 317 ? 10.145  75.891  -11.945 1.00 40.23 ? 355 ARG B N   1 
ATOM   5794  C CA  . ARG B 1 317 ? 9.284   76.938  -12.502 1.00 41.24 ? 355 ARG B CA  1 
ATOM   5795  C C   . ARG B 1 317 ? 7.910   76.761  -11.855 1.00 42.15 ? 355 ARG B C   1 
ATOM   5796  O O   . ARG B 1 317 ? 7.622   75.690  -11.329 1.00 42.13 ? 355 ARG B O   1 
ATOM   5797  C CB  . ARG B 1 317 ? 9.122   76.808  -14.026 1.00 41.07 ? 355 ARG B CB  1 
ATOM   5798  C CG  . ARG B 1 317 ? 10.409  76.700  -14.853 1.00 41.49 ? 355 ARG B CG  1 
ATOM   5799  C CD  . ARG B 1 317 ? 10.174  75.891  -16.129 1.00 40.49 ? 355 ARG B CD  1 
ATOM   5800  N N   . GLN B 1 318 ? 7.062   77.790  -11.917 1.00 43.28 ? 356 GLN B N   1 
ATOM   5801  C CA  . GLN B 1 318 ? 5.719   77.751  -11.310 1.00 44.11 ? 356 GLN B CA  1 
ATOM   5802  C C   . GLN B 1 318 ? 5.050   76.402  -11.525 1.00 44.95 ? 356 GLN B C   1 
ATOM   5803  O O   . GLN B 1 318 ? 4.673   75.717  -10.561 1.00 45.68 ? 356 GLN B O   1 
ATOM   5804  C CB  . GLN B 1 318 ? 4.832   78.860  -11.885 1.00 43.95 ? 356 GLN B CB  1 
ATOM   5805  N N   . HIS B 1 319 ? 4.964   76.012  -12.792 1.00 45.75 ? 357 HIS B N   1 
ATOM   5806  C CA  . HIS B 1 319 ? 4.296   74.776  -13.217 1.00 46.57 ? 357 HIS B CA  1 
ATOM   5807  C C   . HIS B 1 319 ? 5.012   73.481  -12.814 1.00 46.48 ? 357 HIS B C   1 
ATOM   5808  O O   . HIS B 1 319 ? 4.402   72.406  -12.852 1.00 47.41 ? 357 HIS B O   1 
ATOM   5809  C CB  . HIS B 1 319 ? 4.078   74.785  -14.752 1.00 47.22 ? 357 HIS B CB  1 
ATOM   5810  C CG  . HIS B 1 319 ? 5.333   74.573  -15.557 1.00 48.70 ? 357 HIS B CG  1 
ATOM   5811  N ND1 . HIS B 1 319 ? 5.944   75.589  -16.264 1.00 51.08 ? 357 HIS B ND1 1 
ATOM   5812  C CD2 . HIS B 1 319 ? 6.083   73.464  -15.773 1.00 49.77 ? 357 HIS B CD2 1 
ATOM   5813  C CE1 . HIS B 1 319 ? 7.022   75.118  -16.869 1.00 51.01 ? 357 HIS B CE1 1 
ATOM   5814  N NE2 . HIS B 1 319 ? 7.128   73.831  -16.590 1.00 50.20 ? 357 HIS B NE2 1 
ATOM   5815  N N   . GLU B 1 320 ? 6.299   73.575  -12.463 1.00 45.65 ? 358 GLU B N   1 
ATOM   5816  C CA  . GLU B 1 320 ? 7.082   72.418  -12.050 1.00 44.80 ? 358 GLU B CA  1 
ATOM   5817  C C   . GLU B 1 320 ? 7.043   72.193  -10.528 1.00 43.18 ? 358 GLU B C   1 
ATOM   5818  O O   . GLU B 1 320 ? 7.704   71.284  -10.042 1.00 42.76 ? 358 GLU B O   1 
ATOM   5819  C CB  . GLU B 1 320 ? 8.566   72.581  -12.447 1.00 45.10 ? 358 GLU B CB  1 
ATOM   5820  C CG  . GLU B 1 320 ? 8.920   72.771  -13.935 1.00 45.88 ? 358 GLU B CG  1 
ATOM   5821  C CD  . GLU B 1 320 ? 10.447  72.649  -14.159 1.00 46.53 ? 358 GLU B CD  1 
ATOM   5822  O OE1 . GLU B 1 320 ? 11.204  73.480  -13.613 1.00 47.87 ? 358 GLU B OE1 1 
ATOM   5823  O OE2 . GLU B 1 320 ? 10.898  71.710  -14.857 1.00 49.39 ? 358 GLU B OE2 1 
ATOM   5824  N N   . ALA B 1 321 ? 6.325   73.014  -9.755  1.00 41.24 ? 359 ALA B N   1 
ATOM   5825  C CA  . ALA B 1 321 ? 6.385   72.842  -8.285  1.00 39.39 ? 359 ALA B CA  1 
ATOM   5826  C C   . ALA B 1 321 ? 5.516   71.671  -7.840  1.00 37.93 ? 359 ALA B C   1 
ATOM   5827  O O   . ALA B 1 321 ? 4.348   71.549  -8.205  1.00 36.75 ? 359 ALA B O   1 
ATOM   5828  C CB  . ALA B 1 321 ? 6.030   74.116  -7.519  1.00 39.01 ? 359 ALA B CB  1 
ATOM   5829  N N   . ASP B 1 322 ? 6.138   70.797  -7.056  1.00 36.80 ? 360 ASP B N   1 
ATOM   5830  C CA  . ASP B 1 322 ? 5.538   69.576  -6.608  1.00 35.75 ? 360 ASP B CA  1 
ATOM   5831  C C   . ASP B 1 322 ? 5.818   69.436  -5.120  1.00 35.06 ? 360 ASP B C   1 
ATOM   5832  O O   . ASP B 1 322 ? 6.969   69.491  -4.691  1.00 34.03 ? 360 ASP B O   1 
ATOM   5833  C CB  . ASP B 1 322 ? 6.123   68.398  -7.376  1.00 35.79 ? 360 ASP B CB  1 
ATOM   5834  C CG  . ASP B 1 322 ? 5.360   67.132  -7.142  1.00 36.02 ? 360 ASP B CG  1 
ATOM   5835  O OD1 . ASP B 1 322 ? 5.168   66.743  -5.983  1.00 39.35 ? 360 ASP B OD1 1 
ATOM   5836  O OD2 . ASP B 1 322 ? 4.919   66.530  -8.110  1.00 38.57 ? 360 ASP B OD2 1 
ATOM   5837  N N   . ALA B 1 323 ? 4.733   69.253  -4.367  1.00 34.85 ? 361 ALA B N   1 
ATOM   5838  C CA  . ALA B 1 323 ? 4.745   69.109  -2.923  1.00 35.07 ? 361 ALA B CA  1 
ATOM   5839  C C   . ALA B 1 323 ? 5.449   67.848  -2.480  1.00 35.02 ? 361 ALA B C   1 
ATOM   5840  O O   . ALA B 1 323 ? 5.836   67.778  -1.325  1.00 36.02 ? 361 ALA B O   1 
ATOM   5841  C CB  . ALA B 1 323 ? 3.305   69.125  -2.363  1.00 34.58 ? 361 ALA B CB  1 
ATOM   5842  N N   . ASP B 1 324 ? 5.599   66.855  -3.373  1.00 35.14 ? 362 ASP B N   1 
ATOM   5843  C CA  . ASP B 1 324 ? 6.327   65.601  -3.051  1.00 35.44 ? 362 ASP B CA  1 
ATOM   5844  C C   . ASP B 1 324 ? 7.816   65.679  -3.313  1.00 34.52 ? 362 ASP B C   1 
ATOM   5845  O O   . ASP B 1 324 ? 8.505   64.703  -3.130  1.00 33.33 ? 362 ASP B O   1 
ATOM   5846  C CB  . ASP B 1 324 ? 5.773   64.401  -3.833  1.00 36.14 ? 362 ASP B CB  1 
ATOM   5847  C CG  . ASP B 1 324 ? 4.415   63.997  -3.363  1.00 37.94 ? 362 ASP B CG  1 
ATOM   5848  O OD1 . ASP B 1 324 ? 3.889   64.726  -2.505  1.00 43.75 ? 362 ASP B OD1 1 
ATOM   5849  O OD2 . ASP B 1 324 ? 3.868   62.967  -3.821  1.00 39.90 ? 362 ASP B OD2 1 
ATOM   5850  N N   . LEU B 1 325 ? 8.299   66.831  -3.772  1.00 34.12 ? 363 LEU B N   1 
ATOM   5851  C CA  . LEU B 1 325 ? 9.708   66.986  -4.039  1.00 33.40 ? 363 LEU B CA  1 
ATOM   5852  C C   . LEU B 1 325 ? 10.205  68.270  -3.380  1.00 33.14 ? 363 LEU B C   1 
ATOM   5853  O O   . LEU B 1 325 ? 9.897   69.407  -3.834  1.00 32.47 ? 363 LEU B O   1 
ATOM   5854  C CB  . LEU B 1 325 ? 9.985   66.926  -5.545  1.00 33.50 ? 363 LEU B CB  1 
ATOM   5855  C CG  . LEU B 1 325 ? 11.441  66.924  -6.039  1.00 32.89 ? 363 LEU B CG  1 
ATOM   5856  C CD1 . LEU B 1 325 ? 12.280  65.954  -5.276  1.00 30.61 ? 363 LEU B CD1 1 
ATOM   5857  C CD2 . LEU B 1 325 ? 11.470  66.654  -7.565  1.00 32.23 ? 363 LEU B CD2 1 
ATOM   5858  N N   . ILE B 1 326 ? 10.944  68.069  -2.278  1.00 32.66 ? 364 ILE B N   1 
ATOM   5859  C CA  . ILE B 1 326 ? 11.525  69.165  -1.515  1.00 32.64 ? 364 ILE B CA  1 
ATOM   5860  C C   . ILE B 1 326 ? 12.926  68.857  -1.077  1.00 33.49 ? 364 ILE B C   1 
ATOM   5861  O O   . ILE B 1 326 ? 13.350  67.701  -1.098  1.00 34.66 ? 364 ILE B O   1 
ATOM   5862  C CB  . ILE B 1 326 ? 10.665  69.563  -0.281  1.00 32.00 ? 364 ILE B CB  1 
ATOM   5863  C CG1 . ILE B 1 326 ? 10.404  68.395  0.657   1.00 30.44 ? 364 ILE B CG1 1 
ATOM   5864  C CG2 . ILE B 1 326 ? 9.335   70.153  -0.721  1.00 31.80 ? 364 ILE B CG2 1 
ATOM   5865  C CD1 . ILE B 1 326 ? 10.062  68.849  2.073   1.00 27.20 ? 364 ILE B CD1 1 
ATOM   5866  N N   . ASN B 1 327 ? 13.670  69.885  -0.695  1.00 34.49 ? 365 ASN B N   1 
ATOM   5867  C CA  . ASN B 1 327 ? 15.010  69.660  -0.144  1.00 35.07 ? 365 ASN B CA  1 
ATOM   5868  C C   . ASN B 1 327 ? 14.951  69.663  1.392   1.00 36.24 ? 365 ASN B C   1 
ATOM   5869  O O   . ASN B 1 327 ? 13.867  69.671  1.965   1.00 37.29 ? 365 ASN B O   1 
ATOM   5870  C CB  . ASN B 1 327 ? 16.049  70.636  -0.740  1.00 34.79 ? 365 ASN B CB  1 
ATOM   5871  C CG  . ASN B 1 327 ? 15.770  72.111  -0.417  1.00 34.31 ? 365 ASN B CG  1 
ATOM   5872  O OD1 . ASN B 1 327 ? 15.082  72.440  0.543   1.00 35.10 ? 365 ASN B OD1 1 
ATOM   5873  N ND2 . ASN B 1 327 ? 16.334  73.000  -1.220  1.00 34.35 ? 365 ASN B ND2 1 
ATOM   5874  N N   . ALA B 1 328 ? 16.108  69.613  2.049   1.00 37.42 ? 366 ALA B N   1 
ATOM   5875  C CA  . ALA B 1 328 ? 16.184  69.566  3.509   1.00 37.71 ? 366 ALA B CA  1 
ATOM   5876  C C   . ALA B 1 328 ? 15.824  70.931  4.098   1.00 38.13 ? 366 ALA B C   1 
ATOM   5877  O O   . ALA B 1 328 ? 15.320  71.017  5.216   1.00 39.00 ? 366 ALA B O   1 
ATOM   5878  C CB  . ALA B 1 328 ? 17.559  69.123  3.937   1.00 37.90 ? 366 ALA B CB  1 
ATOM   5879  N N   . GLY B 1 329 ? 16.054  71.986  3.322   1.00 37.88 ? 367 GLY B N   1 
ATOM   5880  C CA  . GLY B 1 329 ? 15.513  73.306  3.606   1.00 37.83 ? 367 GLY B CA  1 
ATOM   5881  C C   . GLY B 1 329 ? 13.983  73.412  3.556   1.00 37.43 ? 367 GLY B C   1 
ATOM   5882  O O   . GLY B 1 329 ? 13.461  74.448  3.901   1.00 36.65 ? 367 GLY B O   1 
ATOM   5883  N N   . LYS B 1 330 ? 13.289  72.343  3.146   1.00 37.28 ? 368 LYS B N   1 
ATOM   5884  C CA  . LYS B 1 330 ? 11.817  72.302  2.950   1.00 37.45 ? 368 LYS B CA  1 
ATOM   5885  C C   . LYS B 1 330 ? 11.287  73.079  1.711   1.00 37.23 ? 368 LYS B C   1 
ATOM   5886  O O   . LYS B 1 330 ? 10.087  73.269  1.525   1.00 38.28 ? 368 LYS B O   1 
ATOM   5887  C CB  . LYS B 1 330 ? 11.074  72.631  4.254   1.00 37.15 ? 368 LYS B CB  1 
ATOM   5888  C CG  . LYS B 1 330 ? 11.435  71.641  5.377   1.00 37.90 ? 368 LYS B CG  1 
ATOM   5889  C CD  . LYS B 1 330 ? 10.631  71.811  6.663   1.00 38.35 ? 368 LYS B CD  1 
ATOM   5890  C CE  . LYS B 1 330 ? 11.082  73.031  7.509   1.00 39.93 ? 368 LYS B CE  1 
ATOM   5891  N NZ  . LYS B 1 330 ? 10.309  73.153  8.792   1.00 40.13 ? 368 LYS B NZ  1 
ATOM   5892  N N   . GLU B 1 331 ? 12.205  73.455  0.834   1.00 37.18 ? 369 GLU B N   1 
ATOM   5893  C CA  . GLU B 1 331 ? 11.913  74.189  -0.381  1.00 37.23 ? 369 GLU B CA  1 
ATOM   5894  C C   . GLU B 1 331 ? 11.501  73.231  -1.503  1.00 36.61 ? 369 GLU B C   1 
ATOM   5895  O O   . GLU B 1 331 ? 12.082  72.164  -1.643  1.00 36.77 ? 369 GLU B O   1 
ATOM   5896  C CB  . GLU B 1 331 ? 13.180  74.910  -0.836  1.00 37.15 ? 369 GLU B CB  1 
ATOM   5897  C CG  . GLU B 1 331 ? 13.757  75.885  0.154   1.00 38.30 ? 369 GLU B CG  1 
ATOM   5898  C CD  . GLU B 1 331 ? 15.147  76.397  -0.236  1.00 39.10 ? 369 GLU B CD  1 
ATOM   5899  O OE1 . GLU B 1 331 ? 16.017  75.621  -0.708  1.00 40.10 ? 369 GLU B OE1 1 
ATOM   5900  O OE2 . GLU B 1 331 ? 15.375  77.607  -0.037  1.00 44.06 ? 369 GLU B OE2 1 
ATOM   5901  N N   . THR B 1 332 ? 10.526  73.619  -2.317  1.00 35.91 ? 370 THR B N   1 
ATOM   5902  C CA  . THR B 1 332 ? 10.231  72.889  -3.567  1.00 35.14 ? 370 THR B CA  1 
ATOM   5903  C C   . THR B 1 332 ? 11.497  72.867  -4.436  1.00 34.54 ? 370 THR B C   1 
ATOM   5904  O O   . THR B 1 332 ? 12.108  73.920  -4.665  1.00 34.94 ? 370 THR B O   1 
ATOM   5905  C CB  . THR B 1 332 ? 9.089   73.573  -4.362  1.00 34.93 ? 370 THR B CB  1 
ATOM   5906  O OG1 . THR B 1 332 ? 9.468   74.914  -4.686  1.00 33.68 ? 370 THR B OG1 1 
ATOM   5907  C CG2 . THR B 1 332 ? 7.816   73.610  -3.549  1.00 34.53 ? 370 THR B CG2 1 
ATOM   5908  N N   . VAL B 1 333 ? 11.908  71.680  -4.887  1.00 33.96 ? 371 VAL B N   1 
ATOM   5909  C CA  . VAL B 1 333 ? 13.065  71.547  -5.784  1.00 33.31 ? 371 VAL B CA  1 
ATOM   5910  C C   . VAL B 1 333 ? 12.669  70.746  -7.034  1.00 33.65 ? 371 VAL B C   1 
ATOM   5911  O O   . VAL B 1 333 ? 11.500  70.346  -7.182  1.00 31.87 ? 371 VAL B O   1 
ATOM   5912  C CB  . VAL B 1 333 ? 14.324  70.920  -5.057  1.00 33.65 ? 371 VAL B CB  1 
ATOM   5913  C CG1 . VAL B 1 333 ? 14.987  71.954  -4.099  1.00 31.63 ? 371 VAL B CG1 1 
ATOM   5914  C CG2 . VAL B 1 333 ? 13.980  69.613  -4.325  1.00 32.10 ? 371 VAL B CG2 1 
ATOM   5915  N N   . THR B 1 334 ? 13.635  70.579  -7.945  1.00 33.86 ? 372 THR B N   1 
ATOM   5916  C CA  . THR B 1 334 ? 13.555  69.609  -9.044  1.00 34.00 ? 372 THR B CA  1 
ATOM   5917  C C   . THR B 1 334 ? 14.679  68.573  -8.932  1.00 33.81 ? 372 THR B C   1 
ATOM   5918  O O   . THR B 1 334 ? 15.547  68.669  -8.061  1.00 34.01 ? 372 THR B O   1 
ATOM   5919  C CB  . THR B 1 334 ? 13.687  70.281  -10.437 1.00 34.02 ? 372 THR B CB  1 
ATOM   5920  O OG1 . THR B 1 334 ? 14.990  70.880  -10.553 1.00 35.27 ? 372 THR B OG1 1 
ATOM   5921  C CG2 . THR B 1 334 ? 12.579  71.330  -10.675 1.00 32.78 ? 372 THR B CG2 1 
ATOM   5922  N N   . ILE B 1 335 ? 14.642  67.571  -9.816  1.00 33.69 ? 373 ILE B N   1 
ATOM   5923  C CA  . ILE B 1 335 ? 15.719  66.594  -9.962  1.00 32.67 ? 373 ILE B CA  1 
ATOM   5924  C C   . ILE B 1 335 ? 16.191  66.531  -11.389 1.00 32.05 ? 373 ILE B C   1 
ATOM   5925  O O   . ILE B 1 335 ? 15.444  66.773  -12.309 1.00 32.40 ? 373 ILE B O   1 
ATOM   5926  C CB  . ILE B 1 335 ? 15.346  65.165  -9.542  1.00 32.84 ? 373 ILE B CB  1 
ATOM   5927  C CG1 . ILE B 1 335 ? 13.990  64.746  -10.107 1.00 32.35 ? 373 ILE B CG1 1 
ATOM   5928  C CG2 . ILE B 1 335 ? 15.454  64.991  -8.021  1.00 31.71 ? 373 ILE B CG2 1 
ATOM   5929  C CD1 . ILE B 1 335 ? 13.932  63.235  -10.300 1.00 31.52 ? 373 ILE B CD1 1 
ATOM   5930  N N   . LEU B 1 336 ? 17.453  66.200  -11.567 1.00 31.73 ? 374 LEU B N   1 
ATOM   5931  C CA  . LEU B 1 336 ? 18.007  66.069  -12.892 1.00 32.13 ? 374 LEU B CA  1 
ATOM   5932  C C   . LEU B 1 336 ? 17.796  64.624  -13.394 1.00 31.96 ? 374 LEU B C   1 
ATOM   5933  O O   . LEU B 1 336 ? 17.463  63.742  -12.595 1.00 31.29 ? 374 LEU B O   1 
ATOM   5934  C CB  . LEU B 1 336 ? 19.484  66.453  -12.843 1.00 32.32 ? 374 LEU B CB  1 
ATOM   5935  C CG  . LEU B 1 336 ? 19.770  67.852  -12.280 1.00 32.22 ? 374 LEU B CG  1 
ATOM   5936  C CD1 . LEU B 1 336 ? 21.209  67.924  -11.836 1.00 32.94 ? 374 LEU B CD1 1 
ATOM   5937  C CD2 . LEU B 1 336 ? 19.428  68.935  -13.312 1.00 31.14 ? 374 LEU B CD2 1 
ATOM   5938  N N   . PRO B 1 337 ? 17.966  64.381  -14.717 1.00 32.10 ? 375 PRO B N   1 
ATOM   5939  C CA  . PRO B 1 337 ? 17.914  62.994  -15.199 1.00 32.36 ? 375 PRO B CA  1 
ATOM   5940  C C   . PRO B 1 337 ? 19.055  62.198  -14.559 1.00 32.19 ? 375 PRO B C   1 
ATOM   5941  O O   . PRO B 1 337 ? 20.125  62.750  -14.352 1.00 32.59 ? 375 PRO B O   1 
ATOM   5942  C CB  . PRO B 1 337 ? 18.101  63.137  -16.724 1.00 32.65 ? 375 PRO B CB  1 
ATOM   5943  C CG  . PRO B 1 337 ? 17.757  64.552  -17.032 1.00 32.28 ? 375 PRO B CG  1 
ATOM   5944  C CD  . PRO B 1 337 ? 18.217  65.328  -15.818 1.00 32.37 ? 375 PRO B CD  1 
ATOM   5945  N N   . GLY B 1 338 ? 18.825  60.938  -14.225 1.00 32.08 ? 376 GLY B N   1 
ATOM   5946  C CA  . GLY B 1 338 ? 19.777  60.155  -13.417 1.00 32.40 ? 376 GLY B CA  1 
ATOM   5947  C C   . GLY B 1 338 ? 19.581  60.218  -11.901 1.00 32.86 ? 376 GLY B C   1 
ATOM   5948  O O   . GLY B 1 338 ? 20.355  59.605  -11.135 1.00 33.64 ? 376 GLY B O   1 
ATOM   5949  N N   . ALA B 1 339 ? 18.557  60.941  -11.436 1.00 32.79 ? 377 ALA B N   1 
ATOM   5950  C CA  . ALA B 1 339 ? 18.354  61.127  -9.993  1.00 32.12 ? 377 ALA B CA  1 
ATOM   5951  C C   . ALA B 1 339 ? 17.719  59.863  -9.423  1.00 32.19 ? 377 ALA B C   1 
ATOM   5952  O O   . ALA B 1 339 ? 17.252  59.021  -10.170 1.00 32.06 ? 377 ALA B O   1 
ATOM   5953  C CB  . ALA B 1 339 ? 17.505  62.338  -9.713  1.00 31.74 ? 377 ALA B CB  1 
ATOM   5954  N N   . SER B 1 340 ? 17.796  59.688  -8.101  1.00 32.30 ? 378 SER B N   1 
ATOM   5955  C CA  . SER B 1 340 ? 17.163  58.562  -7.429  1.00 32.12 ? 378 SER B CA  1 
ATOM   5956  C C   . SER B 1 340 ? 16.569  59.055  -6.126  1.00 32.28 ? 378 SER B C   1 
ATOM   5957  O O   . SER B 1 340 ? 16.978  60.094  -5.593  1.00 31.67 ? 378 SER B O   1 
ATOM   5958  C CB  . SER B 1 340 ? 18.171  57.438  -7.158  1.00 32.53 ? 378 SER B CB  1 
ATOM   5959  O OG  . SER B 1 340 ? 19.363  57.949  -6.565  1.00 33.98 ? 378 SER B OG  1 
ATOM   5960  N N   . PHE B 1 341 ? 15.588  58.297  -5.650  1.00 32.57 ? 379 PHE B N   1 
ATOM   5961  C CA  . PHE B 1 341 ? 14.883  58.555  -4.404  1.00 32.62 ? 379 PHE B CA  1 
ATOM   5962  C C   . PHE B 1 341 ? 15.047  57.332  -3.539  1.00 32.77 ? 379 PHE B C   1 
ATOM   5963  O O   . PHE B 1 341 ? 15.254  56.229  -4.029  1.00 32.15 ? 379 PHE B O   1 
ATOM   5964  C CB  . PHE B 1 341 ? 13.397  58.832  -4.626  1.00 32.00 ? 379 PHE B CB  1 
ATOM   5965  C CG  . PHE B 1 341 ? 13.137  60.056  -5.420  1.00 32.77 ? 379 PHE B CG  1 
ATOM   5966  C CD1 . PHE B 1 341 ? 13.521  61.294  -4.938  1.00 34.27 ? 379 PHE B CD1 1 
ATOM   5967  C CD2 . PHE B 1 341 ? 12.513  59.991  -6.640  1.00 31.84 ? 379 PHE B CD2 1 
ATOM   5968  C CE1 . PHE B 1 341 ? 13.301  62.419  -5.658  1.00 31.20 ? 379 PHE B CE1 1 
ATOM   5969  C CE2 . PHE B 1 341 ? 12.273  61.125  -7.350  1.00 30.73 ? 379 PHE B CE2 1 
ATOM   5970  C CZ  . PHE B 1 341 ? 12.676  62.328  -6.871  1.00 31.97 ? 379 PHE B CZ  1 
ATOM   5971  N N   . PHE B 1 342 ? 14.977  57.560  -2.240  1.00 32.78 ? 380 PHE B N   1 
ATOM   5972  C CA  . PHE B 1 342 ? 15.207  56.517  -1.283  1.00 33.36 ? 380 PHE B CA  1 
ATOM   5973  C C   . PHE B 1 342 ? 14.669  57.012  0.071   1.00 33.34 ? 380 PHE B C   1 
ATOM   5974  O O   . PHE B 1 342 ? 14.358  58.180  0.249   1.00 32.14 ? 380 PHE B O   1 
ATOM   5975  C CB  . PHE B 1 342 ? 16.718  56.046  -1.253  1.00 33.63 ? 380 PHE B CB  1 
ATOM   5976  C CG  . PHE B 1 342 ? 17.734  57.160  -1.417  1.00 33.47 ? 380 PHE B CG  1 
ATOM   5977  C CD1 . PHE B 1 342 ? 18.121  57.943  -0.326  1.00 33.87 ? 380 PHE B CD1 1 
ATOM   5978  C CD2 . PHE B 1 342 ? 18.293  57.435  -2.661  1.00 33.88 ? 380 PHE B CD2 1 
ATOM   5979  C CE1 . PHE B 1 342 ? 19.019  59.003  -0.472  1.00 33.77 ? 380 PHE B CE1 1 
ATOM   5980  C CE2 . PHE B 1 342 ? 19.194  58.472  -2.830  1.00 33.17 ? 380 PHE B CE2 1 
ATOM   5981  C CZ  . PHE B 1 342 ? 19.569  59.267  -1.722  1.00 35.80 ? 380 PHE B CZ  1 
ATOM   5982  N N   . SER B 1 343 ? 14.526  56.084  0.994   1.00 34.41 ? 381 SER B N   1 
ATOM   5983  C CA  . SER B 1 343 ? 14.027  56.348  2.330   1.00 35.14 ? 381 SER B CA  1 
ATOM   5984  C C   . SER B 1 343 ? 15.066  57.086  3.216   1.00 35.28 ? 381 SER B C   1 
ATOM   5985  O O   . SER B 1 343 ? 16.274  57.128  2.926   1.00 35.76 ? 381 SER B O   1 
ATOM   5986  C CB  . SER B 1 343 ? 13.628  55.008  2.983   1.00 35.19 ? 381 SER B CB  1 
ATOM   5987  O OG  . SER B 1 343 ? 14.779  54.203  3.262   1.00 36.60 ? 381 SER B OG  1 
ATOM   5988  N N   . SER B 1 344 ? 14.564  57.631  4.311   1.00 35.62 ? 382 SER B N   1 
ATOM   5989  C CA  . SER B 1 344 ? 15.376  58.326  5.306   1.00 35.86 ? 382 SER B CA  1 
ATOM   5990  C C   . SER B 1 344 ? 16.435  57.431  5.979   1.00 35.82 ? 382 SER B C   1 
ATOM   5991  O O   . SER B 1 344 ? 17.513  57.895  6.264   1.00 35.41 ? 382 SER B O   1 
ATOM   5992  C CB  . SER B 1 344 ? 14.466  58.943  6.363   1.00 35.92 ? 382 SER B CB  1 
ATOM   5993  O OG  . SER B 1 344 ? 13.695  59.958  5.763   1.00 37.54 ? 382 SER B OG  1 
ATOM   5994  N N   . ASP B 1 345 ? 16.152  56.153  6.210   1.00 36.48 ? 383 ASP B N   1 
ATOM   5995  C CA  . ASP B 1 345 ? 17.180  55.253  6.760   1.00 37.24 ? 383 ASP B CA  1 
ATOM   5996  C C   . ASP B 1 345 ? 18.305  54.957  5.778   1.00 37.26 ? 383 ASP B C   1 
ATOM   5997  O O   . ASP B 1 345 ? 19.479  54.975  6.159   1.00 37.26 ? 383 ASP B O   1 
ATOM   5998  C CB  . ASP B 1 345 ? 16.573  53.954  7.283   1.00 38.01 ? 383 ASP B CB  1 
ATOM   5999  C CG  . ASP B 1 345 ? 15.690  53.283  6.282   1.00 40.80 ? 383 ASP B CG  1 
ATOM   6000  O OD1 . ASP B 1 345 ? 14.875  54.023  5.642   1.00 42.00 ? 383 ASP B OD1 1 
ATOM   6001  O OD2 . ASP B 1 345 ? 15.818  52.019  6.139   1.00 45.34 ? 383 ASP B OD2 1 
ATOM   6002  N N   . GLU B 1 346 ? 17.961  54.729  4.503   1.00 37.58 ? 384 GLU B N   1 
ATOM   6003  C CA  . GLU B 1 346 ? 18.983  54.632  3.429   1.00 36.92 ? 384 GLU B CA  1 
ATOM   6004  C C   . GLU B 1 346 ? 19.785  55.927  3.205   1.00 35.92 ? 384 GLU B C   1 
ATOM   6005  O O   . GLU B 1 346 ? 20.973  55.896  2.983   1.00 36.92 ? 384 GLU B O   1 
ATOM   6006  C CB  . GLU B 1 346 ? 18.339  54.192  2.122   1.00 36.97 ? 384 GLU B CB  1 
ATOM   6007  C CG  . GLU B 1 346 ? 19.374  54.042  0.994   1.00 40.39 ? 384 GLU B CG  1 
ATOM   6008  C CD  . GLU B 1 346 ? 20.504  53.023  1.320   1.00 42.98 ? 384 GLU B CD  1 
ATOM   6009  O OE1 . GLU B 1 346 ? 20.216  52.016  2.017   1.00 44.84 ? 384 GLU B OE1 1 
ATOM   6010  O OE2 . GLU B 1 346 ? 21.670  53.231  0.889   1.00 45.08 ? 384 GLU B OE2 1 
ATOM   6011  N N   . SER B 1 347 ? 19.130  57.070  3.269   1.00 35.05 ? 385 SER B N   1 
ATOM   6012  C CA  . SER B 1 347 ? 19.801  58.351  3.141   1.00 34.48 ? 385 SER B CA  1 
ATOM   6013  C C   . SER B 1 347 ? 20.895  58.551  4.212   1.00 33.66 ? 385 SER B C   1 
ATOM   6014  O O   . SER B 1 347 ? 22.041  58.936  3.900   1.00 34.00 ? 385 SER B O   1 
ATOM   6015  C CB  . SER B 1 347 ? 18.758  59.477  3.248   1.00 34.81 ? 385 SER B CB  1 
ATOM   6016  O OG  . SER B 1 347 ? 19.433  60.714  3.320   1.00 36.58 ? 385 SER B OG  1 
ATOM   6017  N N   . PHE B 1 348 ? 20.566  58.258  5.459   1.00 32.73 ? 386 PHE B N   1 
ATOM   6018  C CA  . PHE B 1 348 ? 21.562  58.359  6.558   1.00 32.70 ? 386 PHE B CA  1 
ATOM   6019  C C   . PHE B 1 348 ? 22.618  57.261  6.644   1.00 33.56 ? 386 PHE B C   1 
ATOM   6020  O O   . PHE B 1 348 ? 23.697  57.506  7.174   1.00 33.78 ? 386 PHE B O   1 
ATOM   6021  C CB  . PHE B 1 348 ? 20.872  58.661  7.884   1.00 32.47 ? 386 PHE B CB  1 
ATOM   6022  C CG  . PHE B 1 348 ? 20.391  60.062  7.960   1.00 30.02 ? 386 PHE B CG  1 
ATOM   6023  C CD1 . PHE B 1 348 ? 21.293  61.106  8.163   1.00 33.33 ? 386 PHE B CD1 1 
ATOM   6024  C CD2 . PHE B 1 348 ? 19.067  60.368  7.719   1.00 31.40 ? 386 PHE B CD2 1 
ATOM   6025  C CE1 . PHE B 1 348 ? 20.834  62.448  8.210   1.00 33.98 ? 386 PHE B CE1 1 
ATOM   6026  C CE2 . PHE B 1 348 ? 18.599  61.675  7.766   1.00 32.16 ? 386 PHE B CE2 1 
ATOM   6027  C CZ  . PHE B 1 348 ? 19.474  62.717  7.982   1.00 33.77 ? 386 PHE B CZ  1 
ATOM   6028  N N   . ALA B 1 349 ? 22.345  56.088  6.047   1.00 34.58 ? 387 ALA B N   1 
ATOM   6029  C CA  . ALA B 1 349 ? 23.369  55.071  5.803   1.00 34.16 ? 387 ALA B CA  1 
ATOM   6030  C C   . ALA B 1 349 ? 24.470  55.575  4.822   1.00 34.10 ? 387 ALA B C   1 
ATOM   6031  O O   . ALA B 1 349 ? 25.667  55.344  5.023   1.00 35.16 ? 387 ALA B O   1 
ATOM   6032  C CB  . ALA B 1 349 ? 22.715  53.779  5.307   1.00 33.18 ? 387 ALA B CB  1 
ATOM   6033  N N   . MET B 1 350 ? 24.060  56.274  3.776   1.00 34.71 ? 388 MET B N   1 
ATOM   6034  C CA  . MET B 1 350 ? 24.943  56.926  2.791   1.00 35.52 ? 388 MET B CA  1 
ATOM   6035  C C   . MET B 1 350 ? 25.834  57.998  3.451   1.00 35.13 ? 388 MET B C   1 
ATOM   6036  O O   . MET B 1 350 ? 27.056  58.084  3.205   1.00 35.82 ? 388 MET B O   1 
ATOM   6037  C CB  . MET B 1 350 ? 24.026  57.584  1.754   1.00 36.06 ? 388 MET B CB  1 
ATOM   6038  C CG  . MET B 1 350 ? 24.521  57.900  0.380   1.00 37.49 ? 388 MET B CG  1 
ATOM   6039  S SD  . MET B 1 350 ? 23.068  58.432  -0.672  1.00 39.70 ? 388 MET B SD  1 
ATOM   6040  C CE  . MET B 1 350 ? 22.051  56.945  -0.861  1.00 37.27 ? 388 MET B CE  1 
ATOM   6041  N N   . ILE B 1 351 ? 25.200  58.808  4.286   1.00 34.33 ? 389 ILE B N   1 
ATOM   6042  C CA  . ILE B 1 351 ? 25.844  59.877  5.076   1.00 33.62 ? 389 ILE B CA  1 
ATOM   6043  C C   . ILE B 1 351 ? 26.745  59.315  6.214   1.00 33.45 ? 389 ILE B C   1 
ATOM   6044  O O   . ILE B 1 351 ? 27.937  59.585  6.252   1.00 32.14 ? 389 ILE B O   1 
ATOM   6045  C CB  . ILE B 1 351 ? 24.735  60.871  5.654   1.00 33.45 ? 389 ILE B CB  1 
ATOM   6046  C CG1 . ILE B 1 351 ? 24.038  61.595  4.490   1.00 33.70 ? 389 ILE B CG1 1 
ATOM   6047  C CG2 . ILE B 1 351 ? 25.323  61.875  6.675   1.00 31.63 ? 389 ILE B CG2 1 
ATOM   6048  C CD1 . ILE B 1 351 ? 22.787  62.400  4.858   1.00 31.79 ? 389 ILE B CD1 1 
ATOM   6049  N N   . ARG B 1 352 ? 26.168  58.504  7.108   1.00 33.15 ? 390 ARG B N   1 
ATOM   6050  C CA  . ARG B 1 352 ? 26.895  57.983  8.252   1.00 33.22 ? 390 ARG B CA  1 
ATOM   6051  C C   . ARG B 1 352 ? 28.024  57.079  7.748   1.00 33.23 ? 390 ARG B C   1 
ATOM   6052  O O   . ARG B 1 352 ? 29.145  57.089  8.262   1.00 33.29 ? 390 ARG B O   1 
ATOM   6053  C CB  . ARG B 1 352 ? 25.905  57.290  9.218   1.00 33.55 ? 390 ARG B CB  1 
ATOM   6054  C CG  . ARG B 1 352 ? 26.510  56.777  10.550  1.00 35.26 ? 390 ARG B CG  1 
ATOM   6055  C CD  . ARG B 1 352 ? 25.615  55.728  11.224  1.00 35.11 ? 390 ARG B CD  1 
ATOM   6056  N NE  . ARG B 1 352 ? 24.268  56.204  11.375  1.00 34.51 ? 390 ARG B NE  1 
ATOM   6057  C CZ  . ARG B 1 352 ? 23.233  55.871  10.613  1.00 38.47 ? 390 ARG B CZ  1 
ATOM   6058  N NH1 . ARG B 1 352 ? 23.334  55.019  9.594   1.00 38.51 ? 390 ARG B NH1 1 
ATOM   6059  N NH2 . ARG B 1 352 ? 22.072  56.429  10.874  1.00 39.44 ? 390 ARG B NH2 1 
ATOM   6060  N N   . GLY B 1 353 ? 27.762  56.379  6.651   1.00 33.58 ? 391 GLY B N   1 
ATOM   6061  C CA  . GLY B 1 353 ? 28.753  55.515  6.038   1.00 33.47 ? 391 GLY B CA  1 
ATOM   6062  C C   . GLY B 1 353 ? 29.905  56.144  5.311   1.00 33.32 ? 391 GLY B C   1 
ATOM   6063  O O   . GLY B 1 353 ? 30.819  55.433  4.888   1.00 34.82 ? 391 GLY B O   1 
ATOM   6064  N N   . GLY B 1 354 ? 29.885  57.455  5.136   1.00 33.08 ? 392 GLY B N   1 
ATOM   6065  C CA  . GLY B 1 354 ? 31.000  58.169  4.493   1.00 31.79 ? 392 GLY B CA  1 
ATOM   6066  C C   . GLY B 1 354 ? 30.971  58.221  2.981   1.00 31.37 ? 392 GLY B C   1 
ATOM   6067  O O   . GLY B 1 354 ? 32.001  58.450  2.369   1.00 32.91 ? 392 GLY B O   1 
ATOM   6068  N N   . HIS B 1 355 ? 29.821  58.004  2.353   1.00 31.09 ? 393 HIS B N   1 
ATOM   6069  C CA  . HIS B 1 355 ? 29.773  57.915  0.895   1.00 30.82 ? 393 HIS B CA  1 
ATOM   6070  C C   . HIS B 1 355 ? 29.683  59.259  0.244   1.00 31.36 ? 393 HIS B C   1 
ATOM   6071  O O   . HIS B 1 355 ? 30.040  59.390  -0.927  1.00 31.01 ? 393 HIS B O   1 
ATOM   6072  C CB  . HIS B 1 355 ? 28.612  57.034  0.417   1.00 30.60 ? 393 HIS B CB  1 
ATOM   6073  C CG  . HIS B 1 355 ? 28.678  55.641  0.936   1.00 30.13 ? 393 HIS B CG  1 
ATOM   6074  N ND1 . HIS B 1 355 ? 29.239  54.608  0.219   1.00 33.70 ? 393 HIS B ND1 1 
ATOM   6075  C CD2 . HIS B 1 355 ? 28.319  55.117  2.130   1.00 32.82 ? 393 HIS B CD2 1 
ATOM   6076  C CE1 . HIS B 1 355 ? 29.178  53.498  0.932   1.00 31.40 ? 393 HIS B CE1 1 
ATOM   6077  N NE2 . HIS B 1 355 ? 28.633  53.780  2.100   1.00 30.63 ? 393 HIS B NE2 1 
ATOM   6078  N N   . VAL B 1 356 ? 29.220  60.258  0.986   1.00 31.74 ? 394 VAL B N   1 
ATOM   6079  C CA  . VAL B 1 356 ? 29.250  61.653  0.520   1.00 33.67 ? 394 VAL B CA  1 
ATOM   6080  C C   . VAL B 1 356 ? 30.700  62.173  0.581   1.00 34.19 ? 394 VAL B C   1 
ATOM   6081  O O   . VAL B 1 356 ? 31.420  61.858  1.527   1.00 35.14 ? 394 VAL B O   1 
ATOM   6082  C CB  . VAL B 1 356 ? 28.257  62.527  1.350   1.00 33.96 ? 394 VAL B CB  1 
ATOM   6083  C CG1 . VAL B 1 356 ? 28.280  64.003  0.927   1.00 33.75 ? 394 VAL B CG1 1 
ATOM   6084  C CG2 . VAL B 1 356 ? 26.846  61.932  1.214   1.00 34.72 ? 394 VAL B CG2 1 
ATOM   6085  N N   . ASP B 1 357 ? 31.147  62.897  -0.453  1.00 33.95 ? 395 ASP B N   1 
ATOM   6086  C CA  . ASP B 1 357 ? 32.518  63.405  -0.501  1.00 33.67 ? 395 ASP B CA  1 
ATOM   6087  C C   . ASP B 1 357 ? 32.711  64.695  0.298   1.00 34.10 ? 395 ASP B C   1 
ATOM   6088  O O   . ASP B 1 357 ? 33.734  64.872  0.931   1.00 33.54 ? 395 ASP B O   1 
ATOM   6089  C CB  . ASP B 1 357 ? 32.941  63.682  -1.931  1.00 33.63 ? 395 ASP B CB  1 
ATOM   6090  C CG  . ASP B 1 357 ? 33.022  62.430  -2.779  1.00 34.71 ? 395 ASP B CG  1 
ATOM   6091  O OD1 . ASP B 1 357 ? 33.700  61.478  -2.365  1.00 33.82 ? 395 ASP B OD1 1 
ATOM   6092  O OD2 . ASP B 1 357 ? 32.449  62.407  -3.892  1.00 34.30 ? 395 ASP B OD2 1 
ATOM   6093  N N   . LEU B 1 358 ? 31.713  65.582  0.244   1.00 34.56 ? 396 LEU B N   1 
ATOM   6094  C CA  . LEU B 1 358 ? 31.798  66.957  0.735   1.00 33.95 ? 396 LEU B CA  1 
ATOM   6095  C C   . LEU B 1 358 ? 30.472  67.319  1.376   1.00 34.33 ? 396 LEU B C   1 
ATOM   6096  O O   . LEU B 1 358 ? 29.431  67.236  0.728   1.00 33.91 ? 396 LEU B O   1 
ATOM   6097  C CB  . LEU B 1 358 ? 32.062  67.948  -0.403  1.00 33.95 ? 396 LEU B CB  1 
ATOM   6098  C CG  . LEU B 1 358 ? 32.146  69.460  -0.050  1.00 34.11 ? 396 LEU B CG  1 
ATOM   6099  C CD1 . LEU B 1 358 ? 33.401  69.736  0.753   1.00 35.05 ? 396 LEU B CD1 1 
ATOM   6100  C CD2 . LEU B 1 358 ? 32.098  70.403  -1.266  1.00 34.48 ? 396 LEU B CD2 1 
ATOM   6101  N N   . THR B 1 359 ? 30.535  67.729  2.640   1.00 34.53 ? 397 THR B N   1 
ATOM   6102  C CA  . THR B 1 359 ? 29.434  68.368  3.372   1.00 35.51 ? 397 THR B CA  1 
ATOM   6103  C C   . THR B 1 359 ? 29.853  69.833  3.609   1.00 35.26 ? 397 THR B C   1 
ATOM   6104  O O   . THR B 1 359 ? 30.882  70.085  4.183   1.00 34.46 ? 397 THR B O   1 
ATOM   6105  C CB  . THR B 1 359 ? 29.206  67.627  4.719   1.00 35.92 ? 397 THR B CB  1 
ATOM   6106  O OG1 . THR B 1 359 ? 28.771  66.283  4.448   1.00 38.46 ? 397 THR B OG1 1 
ATOM   6107  C CG2 . THR B 1 359 ? 28.220  68.338  5.645   1.00 34.96 ? 397 THR B CG2 1 
ATOM   6108  N N   . MET B 1 360 ? 29.085  70.778  3.089   1.00 35.91 ? 398 MET B N   1 
ATOM   6109  C CA  . MET B 1 360 ? 29.364  72.185  3.275   1.00 36.13 ? 398 MET B CA  1 
ATOM   6110  C C   . MET B 1 360 ? 28.204  72.779  4.070   1.00 35.85 ? 398 MET B C   1 
ATOM   6111  O O   . MET B 1 360 ? 27.025  72.608  3.719   1.00 34.72 ? 398 MET B O   1 
ATOM   6112  C CB  . MET B 1 360 ? 29.566  72.875  1.940   1.00 36.72 ? 398 MET B CB  1 
ATOM   6113  C CG  . MET B 1 360 ? 30.210  74.263  1.988   1.00 35.79 ? 398 MET B CG  1 
ATOM   6114  S SD  . MET B 1 360 ? 30.921  74.697  0.370   1.00 39.23 ? 398 MET B SD  1 
ATOM   6115  C CE  . MET B 1 360 ? 32.650  74.348  0.681   1.00 35.29 ? 398 MET B CE  1 
ATOM   6116  N N   . LEU B 1 361 ? 28.589  73.449  5.163   1.00 35.70 ? 399 LEU B N   1 
ATOM   6117  C CA  . LEU B 1 361 ? 27.727  73.796  6.294   1.00 35.85 ? 399 LEU B CA  1 
ATOM   6118  C C   . LEU B 1 361 ? 28.030  75.210  6.767   1.00 35.21 ? 399 LEU B C   1 
ATOM   6119  O O   . LEU B 1 361 ? 29.172  75.630  6.703   1.00 33.93 ? 399 LEU B O   1 
ATOM   6120  C CB  . LEU B 1 361 ? 28.077  72.901  7.500   1.00 36.71 ? 399 LEU B CB  1 
ATOM   6121  C CG  . LEU B 1 361 ? 27.383  71.595  7.803   1.00 38.15 ? 399 LEU B CG  1 
ATOM   6122  C CD1 . LEU B 1 361 ? 27.684  71.207  9.209   1.00 40.47 ? 399 LEU B CD1 1 
ATOM   6123  C CD2 . LEU B 1 361 ? 25.876  71.754  7.622   1.00 43.03 ? 399 LEU B CD2 1 
ATOM   6124  N N   . GLY B 1 362 ? 27.030  75.896  7.318   1.00 35.06 ? 400 GLY B N   1 
ATOM   6125  C CA  . GLY B 1 362 ? 27.276  77.071  8.130   1.00 34.85 ? 400 GLY B CA  1 
ATOM   6126  C C   . GLY B 1 362 ? 27.720  76.731  9.553   1.00 34.72 ? 400 GLY B C   1 
ATOM   6127  O O   . GLY B 1 362 ? 27.602  75.588  9.992   1.00 35.38 ? 400 GLY B O   1 
ATOM   6128  N N   . ALA B 1 363 ? 28.227  77.715  10.280  1.00 33.84 ? 401 ALA B N   1 
ATOM   6129  C CA  . ALA B 1 363 ? 28.618  77.515  11.683  1.00 34.10 ? 401 ALA B CA  1 
ATOM   6130  C C   . ALA B 1 363 ? 28.524  78.795  12.512  1.00 34.49 ? 401 ALA B C   1 
ATOM   6131  O O   . ALA B 1 363 ? 28.797  79.905  12.011  1.00 33.31 ? 401 ALA B O   1 
ATOM   6132  C CB  . ALA B 1 363 ? 30.023  76.982  11.767  1.00 33.78 ? 401 ALA B CB  1 
ATOM   6133  N N   . MET B 1 364 ? 28.184  78.628  13.790  1.00 34.94 ? 402 MET B N   1 
ATOM   6134  C CA  . MET B 1 364 ? 28.260  79.729  14.737  1.00 36.34 ? 402 MET B CA  1 
ATOM   6135  C C   . MET B 1 364 ? 29.655  79.783  15.339  1.00 35.71 ? 402 MET B C   1 
ATOM   6136  O O   . MET B 1 364 ? 30.217  80.857  15.556  1.00 36.35 ? 402 MET B O   1 
ATOM   6137  C CB  . MET B 1 364 ? 27.189  79.599  15.817  1.00 36.21 ? 402 MET B CB  1 
ATOM   6138  C CG  . MET B 1 364 ? 25.811  79.319  15.229  1.00 37.21 ? 402 MET B CG  1 
ATOM   6139  S SD  . MET B 1 364 ? 24.501  79.507  16.439  1.00 39.88 ? 402 MET B SD  1 
ATOM   6140  C CE  . MET B 1 364 ? 24.140  77.805  16.883  1.00 35.73 ? 402 MET B CE  1 
ATOM   6141  N N   . GLN B 1 365 ? 30.217  78.625  15.627  1.00 35.23 ? 403 GLN B N   1 
ATOM   6142  C CA  . GLN B 1 365 ? 31.550  78.584  16.180  1.00 34.55 ? 403 GLN B CA  1 
ATOM   6143  C C   . GLN B 1 365 ? 32.271  77.376  15.644  1.00 34.18 ? 403 GLN B C   1 
ATOM   6144  O O   . GLN B 1 365 ? 31.643  76.364  15.376  1.00 33.06 ? 403 GLN B O   1 
ATOM   6145  C CB  . GLN B 1 365 ? 31.487  78.492  17.688  1.00 34.54 ? 403 GLN B CB  1 
ATOM   6146  C CG  . GLN B 1 365 ? 30.901  79.698  18.383  1.00 34.48 ? 403 GLN B CG  1 
ATOM   6147  C CD  . GLN B 1 365 ? 30.806  79.472  19.863  1.00 33.46 ? 403 GLN B CD  1 
ATOM   6148  O OE1 . GLN B 1 365 ? 30.848  78.318  20.320  1.00 33.87 ? 403 GLN B OE1 1 
ATOM   6149  N NE2 . GLN B 1 365 ? 30.677  80.545  20.626  1.00 25.69 ? 403 GLN B NE2 1 
ATOM   6150  N N   . VAL B 1 366 ? 33.580  77.524  15.450  1.00 34.16 ? 404 VAL B N   1 
ATOM   6151  C CA  . VAL B 1 366 ? 34.469  76.413  15.133  1.00 34.15 ? 404 VAL B CA  1 
ATOM   6152  C C   . VAL B 1 366 ? 35.650  76.511  16.084  1.00 33.92 ? 404 VAL B C   1 
ATOM   6153  O O   . VAL B 1 366 ? 36.176  77.607  16.329  1.00 34.43 ? 404 VAL B O   1 
ATOM   6154  C CB  . VAL B 1 366 ? 34.941  76.416  13.634  1.00 34.38 ? 404 VAL B CB  1 
ATOM   6155  C CG1 . VAL B 1 366 ? 35.816  75.151  13.317  1.00 34.01 ? 404 VAL B CG1 1 
ATOM   6156  C CG2 . VAL B 1 366 ? 33.745  76.461  12.672  1.00 34.10 ? 404 VAL B CG2 1 
ATOM   6157  N N   . SER B 1 367 ? 36.051  75.385  16.661  1.00 33.80 ? 405 SER B N   1 
ATOM   6158  C CA  . SER B 1 367 ? 37.200  75.372  17.564  1.00 33.69 ? 405 SER B CA  1 
ATOM   6159  C C   . SER B 1 367 ? 38.512  75.114  16.816  1.00 33.81 ? 405 SER B C   1 
ATOM   6160  O O   . SER B 1 367 ? 38.514  74.851  15.638  1.00 34.71 ? 405 SER B O   1 
ATOM   6161  C CB  . SER B 1 367 ? 37.009  74.348  18.675  1.00 33.21 ? 405 SER B CB  1 
ATOM   6162  O OG  . SER B 1 367 ? 37.422  73.052  18.257  1.00 34.44 ? 405 SER B OG  1 
ATOM   6163  N N   . LYS B 1 368 ? 39.619  75.187  17.541  1.00 34.80 ? 406 LYS B N   1 
ATOM   6164  C CA  . LYS B 1 368 ? 40.983  74.999  17.018  1.00 34.93 ? 406 LYS B CA  1 
ATOM   6165  C C   . LYS B 1 368 ? 41.145  73.639  16.353  1.00 34.81 ? 406 LYS B C   1 
ATOM   6166  O O   . LYS B 1 368 ? 41.683  73.546  15.245  1.00 34.79 ? 406 LYS B O   1 
ATOM   6167  C CB  . LYS B 1 368 ? 41.991  75.145  18.182  1.00 35.25 ? 406 LYS B CB  1 
ATOM   6168  C CG  . LYS B 1 368 ? 43.493  75.043  17.841  1.00 35.47 ? 406 LYS B CG  1 
ATOM   6169  C CD  . LYS B 1 368 ? 44.375  75.504  19.012  1.00 35.21 ? 406 LYS B CD  1 
ATOM   6170  C CE  . LYS B 1 368 ? 45.903  75.352  18.727  1.00 36.39 ? 406 LYS B CE  1 
ATOM   6171  N NZ  . LYS B 1 368 ? 46.269  75.197  17.248  1.00 38.03 ? 406 LYS B NZ  1 
ATOM   6172  N N   . TYR B 1 369 ? 40.675  72.596  17.037  1.00 34.54 ? 407 TYR B N   1 
ATOM   6173  C CA  . TYR B 1 369 ? 40.836  71.220  16.573  1.00 34.47 ? 407 TYR B CA  1 
ATOM   6174  C C   . TYR B 1 369 ? 39.622  70.693  15.825  1.00 34.62 ? 407 TYR B C   1 
ATOM   6175  O O   . TYR B 1 369 ? 39.585  69.526  15.483  1.00 34.10 ? 407 TYR B O   1 
ATOM   6176  C CB  . TYR B 1 369 ? 41.197  70.324  17.749  1.00 34.64 ? 407 TYR B CB  1 
ATOM   6177  C CG  . TYR B 1 369 ? 42.497  70.779  18.406  1.00 35.23 ? 407 TYR B CG  1 
ATOM   6178  C CD1 . TYR B 1 369 ? 43.699  70.712  17.702  1.00 35.49 ? 407 TYR B CD1 1 
ATOM   6179  C CD2 . TYR B 1 369 ? 42.521  71.306  19.701  1.00 34.15 ? 407 TYR B CD2 1 
ATOM   6180  C CE1 . TYR B 1 369 ? 44.883  71.126  18.260  1.00 35.92 ? 407 TYR B CE1 1 
ATOM   6181  C CE2 . TYR B 1 369 ? 43.718  71.708  20.281  1.00 34.84 ? 407 TYR B CE2 1 
ATOM   6182  C CZ  . TYR B 1 369 ? 44.895  71.623  19.544  1.00 35.15 ? 407 TYR B CZ  1 
ATOM   6183  O OH  . TYR B 1 369 ? 46.104  72.022  20.061  1.00 34.90 ? 407 TYR B OH  1 
ATOM   6184  N N   . GLY B 1 370 ? 38.648  71.569  15.558  1.00 34.98 ? 408 GLY B N   1 
ATOM   6185  C CA  . GLY B 1 370 ? 37.581  71.295  14.576  1.00 34.95 ? 408 GLY B CA  1 
ATOM   6186  C C   . GLY B 1 370 ? 36.213  70.984  15.147  1.00 35.23 ? 408 GLY B C   1 
ATOM   6187  O O   . GLY B 1 370 ? 35.379  70.407  14.452  1.00 35.87 ? 408 GLY B O   1 
ATOM   6188  N N   . ASP B 1 371 ? 35.959  71.363  16.406  1.00 35.67 ? 409 ASP B N   1 
ATOM   6189  C CA  . ASP B 1 371 ? 34.621  71.232  16.965  1.00 35.39 ? 409 ASP B CA  1 
ATOM   6190  C C   . ASP B 1 371 ? 33.704  72.220  16.244  1.00 35.32 ? 409 ASP B C   1 
ATOM   6191  O O   . ASP B 1 371 ? 34.136  73.294  15.846  1.00 35.35 ? 409 ASP B O   1 
ATOM   6192  C CB  . ASP B 1 371 ? 34.593  71.494  18.461  1.00 35.30 ? 409 ASP B CB  1 
ATOM   6193  C CG  . ASP B 1 371 ? 35.466  70.532  19.258  1.00 36.10 ? 409 ASP B CG  1 
ATOM   6194  O OD1 . ASP B 1 371 ? 35.975  69.523  18.713  1.00 36.13 ? 409 ASP B OD1 1 
ATOM   6195  O OD2 . ASP B 1 371 ? 35.632  70.794  20.464  1.00 36.11 ? 409 ASP B OD2 1 
ATOM   6196  N N   . LEU B 1 372 ? 32.447  71.844  16.079  1.00 34.87 ? 410 LEU B N   1 
ATOM   6197  C CA  . LEU B 1 372 ? 31.492  72.641  15.331  1.00 34.83 ? 410 LEU B CA  1 
ATOM   6198  C C   . LEU B 1 372 ? 30.293  72.856  16.207  1.00 34.03 ? 410 LEU B C   1 
ATOM   6199  O O   . LEU B 1 372 ? 29.732  71.880  16.705  1.00 33.94 ? 410 LEU B O   1 
ATOM   6200  C CB  . LEU B 1 372 ? 31.056  71.901  14.041  1.00 35.27 ? 410 LEU B CB  1 
ATOM   6201  C CG  . LEU B 1 372 ? 29.982  72.594  13.197  1.00 34.38 ? 410 LEU B CG  1 
ATOM   6202  C CD1 . LEU B 1 372 ? 30.538  73.851  12.629  1.00 35.44 ? 410 LEU B CD1 1 
ATOM   6203  C CD2 . LEU B 1 372 ? 29.502  71.716  12.111  1.00 35.43 ? 410 LEU B CD2 1 
ATOM   6204  N N   . ALA B 1 373 ? 29.897  74.116  16.390  1.00 32.53 ? 411 ALA B N   1 
ATOM   6205  C CA  . ALA B 1 373 ? 28.650  74.441  17.080  1.00 32.45 ? 411 ALA B CA  1 
ATOM   6206  C C   . ALA B 1 373 ? 27.742  75.150  16.094  1.00 32.64 ? 411 ALA B C   1 
ATOM   6207  O O   . ALA B 1 373 ? 28.060  76.285  15.675  1.00 32.48 ? 411 ALA B O   1 
ATOM   6208  C CB  . ALA B 1 373 ? 28.913  75.356  18.340  1.00 31.65 ? 411 ALA B CB  1 
ATOM   6209  N N   . ASN B 1 374 ? 26.601  74.541  15.757  1.00 33.03 ? 412 ASN B N   1 
ATOM   6210  C CA  . ASN B 1 374 ? 25.701  75.157  14.756  1.00 34.01 ? 412 ASN B CA  1 
ATOM   6211  C C   . ASN B 1 374 ? 24.186  74.910  14.860  1.00 34.04 ? 412 ASN B C   1 
ATOM   6212  O O   . ASN B 1 374 ? 23.448  75.281  13.933  1.00 35.01 ? 412 ASN B O   1 
ATOM   6213  C CB  . ASN B 1 374 ? 26.209  74.878  13.301  1.00 34.53 ? 412 ASN B CB  1 
ATOM   6214  C CG  . ASN B 1 374 ? 25.816  73.483  12.752  1.00 36.62 ? 412 ASN B CG  1 
ATOM   6215  O OD1 . ASN B 1 374 ? 25.492  72.558  13.503  1.00 41.74 ? 412 ASN B OD1 1 
ATOM   6216  N ND2 . ASN B 1 374 ? 25.873  73.336  11.422  1.00 34.36 ? 412 ASN B ND2 1 
ATOM   6217  N N   . TRP B 1 375 ? 23.714  74.332  15.961  1.00 33.70 ? 413 TRP B N   1 
ATOM   6218  C CA  . TRP B 1 375 ? 22.327  73.870  16.039  1.00 34.06 ? 413 TRP B CA  1 
ATOM   6219  C C   . TRP B 1 375 ? 21.514  74.416  17.223  1.00 35.55 ? 413 TRP B C   1 
ATOM   6220  O O   . TRP B 1 375 ? 20.282  74.297  17.233  1.00 36.29 ? 413 TRP B O   1 
ATOM   6221  C CB  . TRP B 1 375 ? 22.302  72.340  16.060  1.00 33.71 ? 413 TRP B CB  1 
ATOM   6222  C CG  . TRP B 1 375 ? 22.732  71.715  17.375  1.00 33.69 ? 413 TRP B CG  1 
ATOM   6223  C CD1 . TRP B 1 375 ? 24.006  71.483  17.801  1.00 32.41 ? 413 TRP B CD1 1 
ATOM   6224  C CD2 . TRP B 1 375 ? 21.870  71.239  18.416  1.00 32.22 ? 413 TRP B CD2 1 
ATOM   6225  N NE1 . TRP B 1 375 ? 23.986  70.904  19.043  1.00 32.87 ? 413 TRP B NE1 1 
ATOM   6226  C CE2 . TRP B 1 375 ? 22.690  70.737  19.439  1.00 31.65 ? 413 TRP B CE2 1 
ATOM   6227  C CE3 . TRP B 1 375 ? 20.485  71.195  18.580  1.00 33.06 ? 413 TRP B CE3 1 
ATOM   6228  C CZ2 . TRP B 1 375 ? 22.176  70.195  20.612  1.00 32.23 ? 413 TRP B CZ2 1 
ATOM   6229  C CZ3 . TRP B 1 375 ? 19.969  70.640  19.741  1.00 32.86 ? 413 TRP B CZ3 1 
ATOM   6230  C CH2 . TRP B 1 375 ? 20.813  70.154  20.745  1.00 32.93 ? 413 TRP B CH2 1 
ATOM   6231  N N   . MET B 1 376 ? 22.185  75.003  18.211  1.00 36.29 ? 414 MET B N   1 
ATOM   6232  C CA  . MET B 1 376 ? 21.526  75.415  19.432  1.00 37.72 ? 414 MET B CA  1 
ATOM   6233  C C   . MET B 1 376 ? 22.219  76.627  20.025  1.00 37.57 ? 414 MET B C   1 
ATOM   6234  O O   . MET B 1 376 ? 23.437  76.677  20.064  1.00 37.81 ? 414 MET B O   1 
ATOM   6235  C CB  . MET B 1 376 ? 21.564  74.272  20.439  1.00 37.38 ? 414 MET B CB  1 
ATOM   6236  C CG  . MET B 1 376 ? 20.630  74.461  21.588  1.00 39.35 ? 414 MET B CG  1 
ATOM   6237  S SD  . MET B 1 376 ? 20.959  73.397  23.010  1.00 41.03 ? 414 MET B SD  1 
ATOM   6238  C CE  . MET B 1 376 ? 21.004  74.662  24.276  1.00 38.28 ? 414 MET B CE  1 
ATOM   6239  N N   . ILE B 1 377 ? 21.428  77.603  20.462  1.00 38.62 ? 415 ILE B N   1 
ATOM   6240  C CA  . ILE B 1 377 ? 21.882  78.707  21.312  1.00 39.07 ? 415 ILE B CA  1 
ATOM   6241  C C   . ILE B 1 377 ? 21.101  78.579  22.628  1.00 39.94 ? 415 ILE B C   1 
ATOM   6242  O O   . ILE B 1 377 ? 19.862  78.660  22.625  1.00 39.74 ? 415 ILE B O   1 
ATOM   6243  C CB  . ILE B 1 377 ? 21.601  80.094  20.665  1.00 39.39 ? 415 ILE B CB  1 
ATOM   6244  C CG1 . ILE B 1 377 ? 22.395  80.265  19.373  1.00 39.80 ? 415 ILE B CG1 1 
ATOM   6245  C CG2 . ILE B 1 377 ? 21.961  81.264  21.609  1.00 38.50 ? 415 ILE B CG2 1 
ATOM   6246  C CD1 . ILE B 1 377 ? 22.426  81.720  18.888  1.00 38.94 ? 415 ILE B CD1 1 
ATOM   6247  N N   . PRO B 1 378 ? 21.807  78.318  23.751  1.00 40.95 ? 416 PRO B N   1 
ATOM   6248  C CA  . PRO B 1 378 ? 21.166  78.329  25.083  1.00 41.37 ? 416 PRO B CA  1 
ATOM   6249  C C   . PRO B 1 378 ? 20.357  79.606  25.368  1.00 41.80 ? 416 PRO B C   1 
ATOM   6250  O O   . PRO B 1 378 ? 20.901  80.717  25.336  1.00 41.41 ? 416 PRO B O   1 
ATOM   6251  C CB  . PRO B 1 378 ? 22.354  78.180  26.042  1.00 41.31 ? 416 PRO B CB  1 
ATOM   6252  C CG  . PRO B 1 378 ? 23.361  77.362  25.226  1.00 41.24 ? 416 PRO B CG  1 
ATOM   6253  C CD  . PRO B 1 378 ? 23.229  77.918  23.831  1.00 41.02 ? 416 PRO B CD  1 
ATOM   6254  N N   . GLY B 1 379 ? 19.058  79.426  25.610  1.00 42.38 ? 417 GLY B N   1 
ATOM   6255  C CA  . GLY B 1 379 ? 18.137  80.533  25.846  1.00 43.15 ? 417 GLY B CA  1 
ATOM   6256  C C   . GLY B 1 379 ? 17.686  81.271  24.590  1.00 43.62 ? 417 GLY B C   1 
ATOM   6257  O O   . GLY B 1 379 ? 17.406  82.475  24.649  1.00 43.74 ? 417 GLY B O   1 
ATOM   6258  N N   . LYS B 1 380 ? 17.611  80.565  23.459  1.00 43.80 ? 418 LYS B N   1 
ATOM   6259  C CA  . LYS B 1 380 ? 17.109  81.155  22.207  1.00 44.08 ? 418 LYS B CA  1 
ATOM   6260  C C   . LYS B 1 380 ? 16.447  80.080  21.339  1.00 44.20 ? 418 LYS B C   1 
ATOM   6261  O O   . LYS B 1 380 ? 15.342  79.621  21.648  1.00 44.10 ? 418 LYS B O   1 
ATOM   6262  C CB  . LYS B 1 380 ? 18.240  81.853  21.435  1.00 43.93 ? 418 LYS B CB  1 
ATOM   6263  N N   . VAL B 1 382 ? 14.840  76.996  20.142  1.00 41.12 ? 420 VAL B N   1 
ATOM   6264  C CA  . VAL B 1 382 ? 14.876  75.596  20.589  1.00 41.41 ? 420 VAL B CA  1 
ATOM   6265  C C   . VAL B 1 382 ? 14.413  74.575  19.495  1.00 41.19 ? 420 VAL B C   1 
ATOM   6266  O O   . VAL B 1 382 ? 13.489  73.785  19.730  1.00 42.09 ? 420 VAL B O   1 
ATOM   6267  C CB  . VAL B 1 382 ? 14.014  75.422  21.861  1.00 41.07 ? 420 VAL B CB  1 
ATOM   6268  N N   . LYS B 1 383 ? 15.086  74.559  18.336  1.00 40.26 ? 421 LYS B N   1 
ATOM   6269  C CA  . LYS B 1 383 ? 14.583  73.867  17.124  1.00 39.32 ? 421 LYS B CA  1 
ATOM   6270  C C   . LYS B 1 383 ? 15.026  72.386  16.896  1.00 38.35 ? 421 LYS B C   1 
ATOM   6271  O O   . LYS B 1 383 ? 14.377  71.651  16.155  1.00 37.84 ? 421 LYS B O   1 
ATOM   6272  C CB  . LYS B 1 383 ? 14.934  74.706  15.880  1.00 39.13 ? 421 LYS B CB  1 
ATOM   6273  C CG  . LYS B 1 383 ? 14.247  76.084  15.809  1.00 40.50 ? 421 LYS B CG  1 
ATOM   6274  C CD  . LYS B 1 383 ? 14.199  76.641  14.367  1.00 40.01 ? 421 LYS B CD  1 
ATOM   6275  N N   . GLY B 1 384 ? 16.131  71.961  17.502  1.00 37.12 ? 422 GLY B N   1 
ATOM   6276  C CA  . GLY B 1 384 ? 16.652  70.591  17.325  1.00 36.40 ? 422 GLY B CA  1 
ATOM   6277  C C   . GLY B 1 384 ? 17.765  70.547  16.304  1.00 35.22 ? 422 GLY B C   1 
ATOM   6278  O O   . GLY B 1 384 ? 18.003  71.535  15.638  1.00 35.17 ? 422 GLY B O   1 
ATOM   6279  N N   . MET B 1 385 ? 18.451  69.406  16.179  1.00 33.78 ? 423 MET B N   1 
ATOM   6280  C CA  . MET B 1 385 ? 19.662  69.327  15.343  1.00 32.74 ? 423 MET B CA  1 
ATOM   6281  C C   . MET B 1 385 ? 19.448  68.932  13.891  1.00 32.12 ? 423 MET B C   1 
ATOM   6282  O O   . MET B 1 385 ? 20.356  69.141  13.077  1.00 31.62 ? 423 MET B O   1 
ATOM   6283  C CB  . MET B 1 385 ? 20.759  68.430  15.960  1.00 32.68 ? 423 MET B CB  1 
ATOM   6284  C CG  . MET B 1 385 ? 20.430  66.975  16.116  1.00 31.06 ? 423 MET B CG  1 
ATOM   6285  S SD  . MET B 1 385 ? 19.185  66.647  17.342  1.00 30.81 ? 423 MET B SD  1 
ATOM   6286  C CE  . MET B 1 385 ? 19.967  66.880  18.941  1.00 27.02 ? 423 MET B CE  1 
ATOM   6287  N N   . GLY B 1 386 ? 18.287  68.373  13.549  1.00 31.08 ? 424 GLY B N   1 
ATOM   6288  C CA  . GLY B 1 386 ? 18.098  67.829  12.204  1.00 31.07 ? 424 GLY B CA  1 
ATOM   6289  C C   . GLY B 1 386 ? 19.090  66.718  11.878  1.00 31.56 ? 424 GLY B C   1 
ATOM   6290  O O   . GLY B 1 386 ? 19.320  65.841  12.712  1.00 31.85 ? 424 GLY B O   1 
ATOM   6291  N N   . GLY B 1 387 ? 19.647  66.748  10.661  1.00 31.74 ? 425 GLY B N   1 
ATOM   6292  C CA  . GLY B 1 387 ? 20.654  65.815  10.185  1.00 32.45 ? 425 GLY B CA  1 
ATOM   6293  C C   . GLY B 1 387 ? 22.067  66.354  10.313  1.00 33.63 ? 425 GLY B C   1 
ATOM   6294  O O   . GLY B 1 387 ? 23.020  65.776  9.767   1.00 35.50 ? 425 GLY B O   1 
ATOM   6295  N N   . ALA B 1 388 ? 22.203  67.459  11.043  1.00 34.46 ? 426 ALA B N   1 
ATOM   6296  C CA  . ALA B 1 388 ? 23.451  68.230  11.180  1.00 34.35 ? 426 ALA B CA  1 
ATOM   6297  C C   . ALA B 1 388 ? 24.540  67.409  11.883  1.00 35.01 ? 426 ALA B C   1 
ATOM   6298  O O   . ALA B 1 388 ? 25.710  67.415  11.469  1.00 36.11 ? 426 ALA B O   1 
ATOM   6299  C CB  . ALA B 1 388 ? 23.158  69.490  11.943  1.00 33.53 ? 426 ALA B CB  1 
ATOM   6300  N N   . MET B 1 389 ? 24.154  66.684  12.930  1.00 34.46 ? 427 MET B N   1 
ATOM   6301  C CA  . MET B 1 389 ? 25.096  65.822  13.603  1.00 34.16 ? 427 MET B CA  1 
ATOM   6302  C C   . MET B 1 389 ? 25.532  64.623  12.735  1.00 34.45 ? 427 MET B C   1 
ATOM   6303  O O   . MET B 1 389 ? 26.710  64.243  12.761  1.00 34.42 ? 427 MET B O   1 
ATOM   6304  C CB  . MET B 1 389 ? 24.523  65.339  14.942  1.00 34.03 ? 427 MET B CB  1 
ATOM   6305  C CG  . MET B 1 389 ? 24.317  66.437  15.912  1.00 33.02 ? 427 MET B CG  1 
ATOM   6306  S SD  . MET B 1 389 ? 23.858  65.863  17.528  1.00 33.83 ? 427 MET B SD  1 
ATOM   6307  C CE  . MET B 1 389 ? 23.661  67.387  18.444  1.00 28.95 ? 427 MET B CE  1 
ATOM   6308  N N   . ASP B 1 390 ? 24.584  64.034  11.994  1.00 34.15 ? 428 ASP B N   1 
ATOM   6309  C CA  . ASP B 1 390 ? 24.873  62.939  11.069  1.00 34.82 ? 428 ASP B CA  1 
ATOM   6310  C C   . ASP B 1 390 ? 25.798  63.348  9.921   1.00 34.56 ? 428 ASP B C   1 
ATOM   6311  O O   . ASP B 1 390 ? 26.656  62.580  9.538   1.00 33.74 ? 428 ASP B O   1 
ATOM   6312  C CB  . ASP B 1 390 ? 23.596  62.369  10.439  1.00 34.55 ? 428 ASP B CB  1 
ATOM   6313  C CG  . ASP B 1 390 ? 22.747  61.596  11.436  1.00 36.46 ? 428 ASP B CG  1 
ATOM   6314  O OD1 . ASP B 1 390 ? 22.945  60.356  11.605  1.00 38.09 ? 428 ASP B OD1 1 
ATOM   6315  O OD2 . ASP B 1 390 ? 21.848  62.224  12.010  1.00 36.51 ? 428 ASP B OD2 1 
ATOM   6316  N N   . LEU B 1 391 ? 25.587  64.542  9.373   1.00 34.87 ? 429 LEU B N   1 
ATOM   6317  C CA  . LEU B 1 391 ? 26.405  65.035  8.268   1.00 35.66 ? 429 LEU B CA  1 
ATOM   6318  C C   . LEU B 1 391 ? 27.871  65.319  8.636   1.00 35.77 ? 429 LEU B C   1 
ATOM   6319  O O   . LEU B 1 391 ? 28.708  65.368  7.761   1.00 36.98 ? 429 LEU B O   1 
ATOM   6320  C CB  . LEU B 1 391 ? 25.791  66.307  7.693   1.00 35.61 ? 429 LEU B CB  1 
ATOM   6321  C CG  . LEU B 1 391 ? 24.514  66.063  6.908   1.00 37.58 ? 429 LEU B CG  1 
ATOM   6322  C CD1 . LEU B 1 391 ? 23.725  67.370  6.818   1.00 38.82 ? 429 LEU B CD1 1 
ATOM   6323  C CD2 . LEU B 1 391 ? 24.847  65.512  5.532   1.00 35.78 ? 429 LEU B CD2 1 
ATOM   6324  N N   . VAL B 1 392 ? 28.181  65.525  9.914   1.00 35.72 ? 430 VAL B N   1 
ATOM   6325  C CA  . VAL B 1 392 ? 29.567  65.747  10.317  1.00 36.17 ? 430 VAL B CA  1 
ATOM   6326  C C   . VAL B 1 392 ? 30.248  64.529  10.956  1.00 36.32 ? 430 VAL B C   1 
ATOM   6327  O O   . VAL B 1 392 ? 31.417  64.597  11.306  1.00 36.26 ? 430 VAL B O   1 
ATOM   6328  C CB  . VAL B 1 392 ? 29.687  66.972  11.249  1.00 36.02 ? 430 VAL B CB  1 
ATOM   6329  C CG1 . VAL B 1 392 ? 29.094  68.184  10.557  1.00 36.03 ? 430 VAL B CG1 1 
ATOM   6330  C CG2 . VAL B 1 392 ? 29.009  66.712  12.636  1.00 36.92 ? 430 VAL B CG2 1 
ATOM   6331  N N   . SER B 1 393 ? 29.552  63.400  11.031  1.00 36.92 ? 431 SER B N   1 
ATOM   6332  C CA  . SER B 1 393 ? 29.993  62.276  11.869  1.00 37.77 ? 431 SER B CA  1 
ATOM   6333  C C   . SER B 1 393 ? 30.990  61.307  11.192  1.00 37.88 ? 431 SER B C   1 
ATOM   6334  O O   . SER B 1 393 ? 31.687  60.544  11.870  1.00 38.50 ? 431 SER B O   1 
ATOM   6335  C CB  . SER B 1 393 ? 28.771  61.513  12.407  1.00 37.69 ? 431 SER B CB  1 
ATOM   6336  O OG  . SER B 1 393 ? 28.165  60.773  11.369  1.00 38.32 ? 431 SER B OG  1 
ATOM   6337  N N   . SER B 1 394 ? 31.091  61.353  9.876   1.00 37.82 ? 432 SER B N   1 
ATOM   6338  C CA  . SER B 1 394 ? 31.990  60.477  9.169   1.00 37.76 ? 432 SER B CA  1 
ATOM   6339  C C   . SER B 1 394 ? 33.336  61.129  8.865   1.00 37.60 ? 432 SER B C   1 
ATOM   6340  O O   . SER B 1 394 ? 33.429  62.160  8.204   1.00 38.59 ? 432 SER B O   1 
ATOM   6341  C CB  . SER B 1 394 ? 31.363  60.002  7.875   1.00 38.19 ? 432 SER B CB  1 
ATOM   6342  O OG  . SER B 1 394 ? 32.172  58.986  7.342   1.00 38.30 ? 432 SER B OG  1 
ATOM   6343  N N   . ALA B 1 395 ? 34.373  60.483  9.359   1.00 37.67 ? 433 ALA B N   1 
ATOM   6344  C CA  . ALA B 1 395 ? 35.761  60.721  8.997   1.00 38.07 ? 433 ALA B CA  1 
ATOM   6345  C C   . ALA B 1 395 ? 36.067  60.673  7.490   1.00 37.68 ? 433 ALA B C   1 
ATOM   6346  O O   . ALA B 1 395 ? 37.005  61.325  7.049   1.00 38.32 ? 433 ALA B O   1 
ATOM   6347  C CB  . ALA B 1 395 ? 36.626  59.696  9.724   1.00 38.13 ? 433 ALA B CB  1 
ATOM   6348  N N   . LYS B 1 396 ? 35.270  59.947  6.708   1.00 37.25 ? 434 LYS B N   1 
ATOM   6349  C CA  . LYS B 1 396 ? 35.519  59.769  5.265   1.00 37.69 ? 434 LYS B CA  1 
ATOM   6350  C C   . LYS B 1 396 ? 34.989  60.882  4.400   1.00 38.05 ? 434 LYS B C   1 
ATOM   6351  O O   . LYS B 1 396 ? 35.224  60.869  3.200   1.00 39.65 ? 434 LYS B O   1 
ATOM   6352  C CB  . LYS B 1 396 ? 34.906  58.448  4.764   1.00 37.59 ? 434 LYS B CB  1 
ATOM   6353  C CG  . LYS B 1 396 ? 35.417  57.266  5.531   1.00 37.59 ? 434 LYS B CG  1 
ATOM   6354  C CD  . LYS B 1 396 ? 35.207  55.934  4.877   1.00 40.59 ? 434 LYS B CD  1 
ATOM   6355  C CE  . LYS B 1 396 ? 36.217  54.924  5.493   1.00 43.11 ? 434 LYS B CE  1 
ATOM   6356  N NZ  . LYS B 1 396 ? 35.949  53.468  5.213   1.00 45.50 ? 434 LYS B NZ  1 
ATOM   6357  N N   . THR B 1 397 ? 34.253  61.811  4.999   1.00 37.63 ? 435 THR B N   1 
ATOM   6358  C CA  . THR B 1 397 ? 33.645  62.928  4.314   1.00 37.24 ? 435 THR B CA  1 
ATOM   6359  C C   . THR B 1 397 ? 34.335  64.220  4.782   1.00 36.97 ? 435 THR B C   1 
ATOM   6360  O O   . THR B 1 397 ? 34.406  64.473  5.975   1.00 37.42 ? 435 THR B O   1 
ATOM   6361  C CB  . THR B 1 397 ? 32.116  63.011  4.673   1.00 37.27 ? 435 THR B CB  1 
ATOM   6362  O OG1 . THR B 1 397 ? 31.434  61.862  4.132   1.00 35.33 ? 435 THR B OG1 1 
ATOM   6363  C CG2 . THR B 1 397 ? 31.478  64.313  4.151   1.00 35.29 ? 435 THR B CG2 1 
ATOM   6364  N N   . LYS B 1 398 ? 34.868  64.988  3.829   1.00 36.46 ? 436 LYS B N   1 
ATOM   6365  C CA  . LYS B 1 398 ? 35.399  66.321  4.061   1.00 36.39 ? 436 LYS B CA  1 
ATOM   6366  C C   . LYS B 1 398 ? 34.290  67.254  4.492   1.00 35.13 ? 436 LYS B C   1 
ATOM   6367  O O   . LYS B 1 398 ? 33.289  67.379  3.791   1.00 34.83 ? 436 LYS B O   1 
ATOM   6368  C CB  . LYS B 1 398 ? 36.047  66.851  2.770   1.00 36.60 ? 436 LYS B CB  1 
ATOM   6369  C CG  . LYS B 1 398 ? 36.727  68.203  2.906   1.00 37.85 ? 436 LYS B CG  1 
ATOM   6370  C CD  . LYS B 1 398 ? 37.475  68.636  1.618   1.00 38.12 ? 436 LYS B CD  1 
ATOM   6371  C CE  . LYS B 1 398 ? 38.064  70.071  1.777   1.00 39.49 ? 436 LYS B CE  1 
ATOM   6372  N NZ  . LYS B 1 398 ? 38.956  70.486  0.649   1.00 39.51 ? 436 LYS B NZ  1 
ATOM   6373  N N   . VAL B 1 399 ? 34.452  67.877  5.664   1.00 34.38 ? 437 VAL B N   1 
ATOM   6374  C CA  . VAL B 1 399 ? 33.497  68.870  6.202   1.00 33.12 ? 437 VAL B CA  1 
ATOM   6375  C C   . VAL B 1 399 ? 34.080  70.276  6.084   1.00 33.67 ? 437 VAL B C   1 
ATOM   6376  O O   . VAL B 1 399 ? 35.119  70.581  6.703   1.00 33.56 ? 437 VAL B O   1 
ATOM   6377  C CB  . VAL B 1 399 ? 33.176  68.618  7.700   1.00 33.03 ? 437 VAL B CB  1 
ATOM   6378  C CG1 . VAL B 1 399 ? 32.316  69.761  8.286   1.00 31.81 ? 437 VAL B CG1 1 
ATOM   6379  C CG2 . VAL B 1 399 ? 32.499  67.247  7.907   1.00 30.72 ? 437 VAL B CG2 1 
ATOM   6380  N N   . VAL B 1 400 ? 33.384  71.131  5.319   1.00 33.15 ? 438 VAL B N   1 
ATOM   6381  C CA  . VAL B 1 400 ? 33.801  72.503  5.066   1.00 32.76 ? 438 VAL B CA  1 
ATOM   6382  C C   . VAL B 1 400 ? 32.769  73.487  5.616   1.00 32.96 ? 438 VAL B C   1 
ATOM   6383  O O   . VAL B 1 400 ? 31.588  73.466  5.235   1.00 32.98 ? 438 VAL B O   1 
ATOM   6384  C CB  . VAL B 1 400 ? 34.005  72.767  3.567   1.00 32.28 ? 438 VAL B CB  1 
ATOM   6385  C CG1 . VAL B 1 400 ? 34.316  74.240  3.340   1.00 30.66 ? 438 VAL B CG1 1 
ATOM   6386  C CG2 . VAL B 1 400 ? 35.112  71.871  3.019   1.00 31.94 ? 438 VAL B CG2 1 
ATOM   6387  N N   . VAL B 1 401 ? 33.213  74.337  6.529   1.00 33.22 ? 439 VAL B N   1 
ATOM   6388  C CA  . VAL B 1 401 ? 32.363  75.362  7.071   1.00 33.18 ? 439 VAL B CA  1 
ATOM   6389  C C   . VAL B 1 401 ? 32.546  76.651  6.287   1.00 34.40 ? 439 VAL B C   1 
ATOM   6390  O O   . VAL B 1 401 ? 33.672  77.051  5.955   1.00 35.01 ? 439 VAL B O   1 
ATOM   6391  C CB  . VAL B 1 401 ? 32.625  75.616  8.577   1.00 33.63 ? 439 VAL B CB  1 
ATOM   6392  C CG1 . VAL B 1 401 ? 31.904  76.900  9.033   1.00 30.28 ? 439 VAL B CG1 1 
ATOM   6393  C CG2 . VAL B 1 401 ? 32.220  74.381  9.379   1.00 30.90 ? 439 VAL B CG2 1 
ATOM   6394  N N   . THR B 1 402 ? 31.421  77.287  5.995   1.00 34.61 ? 440 THR B N   1 
ATOM   6395  C CA  . THR B 1 402 ? 31.402  78.555  5.343   1.00 35.55 ? 440 THR B CA  1 
ATOM   6396  C C   . THR B 1 402 ? 30.751  79.515  6.326   1.00 35.91 ? 440 THR B C   1 
ATOM   6397  O O   . THR B 1 402 ? 29.572  79.344  6.638   1.00 36.39 ? 440 THR B O   1 
ATOM   6398  C CB  . THR B 1 402 ? 30.539  78.480  4.073   1.00 35.65 ? 440 THR B CB  1 
ATOM   6399  O OG1 . THR B 1 402 ? 29.194  78.142  4.452   1.00 36.29 ? 440 THR B OG1 1 
ATOM   6400  C CG2 . THR B 1 402 ? 31.087  77.443  3.092   1.00 34.98 ? 440 THR B CG2 1 
ATOM   6401  N N   . MET B 1 403 ? 31.500  80.506  6.818   1.00 36.14 ? 441 MET B N   1 
ATOM   6402  C CA  . MET B 1 403 ? 30.941  81.472  7.762   1.00 36.59 ? 441 MET B CA  1 
ATOM   6403  C C   . MET B 1 403 ? 31.643  82.838  7.761   1.00 37.07 ? 441 MET B C   1 
ATOM   6404  O O   . MET B 1 403 ? 32.855  82.925  7.549   1.00 37.06 ? 441 MET B O   1 
ATOM   6405  C CB  . MET B 1 403 ? 30.963  80.896  9.183   1.00 36.40 ? 441 MET B CB  1 
ATOM   6406  C CG  . MET B 1 403 ? 32.344  80.563  9.732   1.00 36.38 ? 441 MET B CG  1 
ATOM   6407  S SD  . MET B 1 403 ? 32.346  80.214  11.512  1.00 37.60 ? 441 MET B SD  1 
ATOM   6408  C CE  . MET B 1 403 ? 34.113  80.094  11.828  1.00 37.65 ? 441 MET B CE  1 
ATOM   6409  N N   . GLU B 1 404 ? 30.873  83.900  8.022   1.00 37.56 ? 442 GLU B N   1 
ATOM   6410  C CA  . GLU B 1 404 ? 31.457  85.197  8.318   1.00 38.16 ? 442 GLU B CA  1 
ATOM   6411  C C   . GLU B 1 404 ? 32.429  85.016  9.485   1.00 37.42 ? 442 GLU B C   1 
ATOM   6412  O O   . GLU B 1 404 ? 32.175  84.245  10.413  1.00 36.70 ? 442 GLU B O   1 
ATOM   6413  C CB  . GLU B 1 404 ? 30.380  86.265  8.600   1.00 38.74 ? 442 GLU B CB  1 
ATOM   6414  C CG  . GLU B 1 404 ? 29.567  86.644  7.310   1.00 40.21 ? 442 GLU B CG  1 
ATOM   6415  C CD  . GLU B 1 404 ? 28.409  87.645  7.524   1.00 40.00 ? 442 GLU B CD  1 
ATOM   6416  O OE1 . GLU B 1 404 ? 28.620  88.748  8.097   1.00 41.78 ? 442 GLU B OE1 1 
ATOM   6417  O OE2 . GLU B 1 404 ? 27.280  87.328  7.076   1.00 42.08 ? 442 GLU B OE2 1 
ATOM   6418  N N   . HIS B 1 405 ? 33.569  85.695  9.392   1.00 37.01 ? 443 HIS B N   1 
ATOM   6419  C CA  . HIS B 1 405 ? 34.707  85.428  10.266  1.00 36.72 ? 443 HIS B CA  1 
ATOM   6420  C C   . HIS B 1 405 ? 34.426  85.704  11.743  1.00 37.21 ? 443 HIS B C   1 
ATOM   6421  O O   . HIS B 1 405 ? 34.906  84.960  12.594  1.00 36.99 ? 443 HIS B O   1 
ATOM   6422  C CB  . HIS B 1 405 ? 35.930  86.228  9.792   1.00 36.48 ? 443 HIS B CB  1 
ATOM   6423  C CG  . HIS B 1 405 ? 37.224  85.730  10.349  1.00 35.85 ? 443 HIS B CG  1 
ATOM   6424  N ND1 . HIS B 1 405 ? 38.067  84.898  9.642   1.00 36.66 ? 443 HIS B ND1 1 
ATOM   6425  C CD2 . HIS B 1 405 ? 37.805  85.916  11.555  1.00 33.85 ? 443 HIS B CD2 1 
ATOM   6426  C CE1 . HIS B 1 405 ? 39.122  84.611  10.385  1.00 35.56 ? 443 HIS B CE1 1 
ATOM   6427  N NE2 . HIS B 1 405 ? 38.983  85.211  11.552  1.00 33.40 ? 443 HIS B NE2 1 
ATOM   6428  N N   . SER B 1 406 ? 33.658  86.766  12.029  1.00 38.05 ? 444 SER B N   1 
ATOM   6429  C CA  . SER B 1 406 ? 33.401  87.270  13.401  1.00 38.68 ? 444 SER B CA  1 
ATOM   6430  C C   . SER B 1 406 ? 31.906  87.612  13.598  1.00 39.26 ? 444 SER B C   1 
ATOM   6431  O O   . SER B 1 406 ? 31.173  87.833  12.628  1.00 39.60 ? 444 SER B O   1 
ATOM   6432  C CB  . SER B 1 406 ? 34.252  88.522  13.690  1.00 38.92 ? 444 SER B CB  1 
ATOM   6433  O OG  . SER B 1 406 ? 35.561  88.218  14.159  1.00 39.03 ? 444 SER B OG  1 
ATOM   6434  N N   . ALA B 1 407 ? 31.447  87.618  14.846  1.00 39.79 ? 445 ALA B N   1 
ATOM   6435  C CA  . ALA B 1 407 ? 30.069  88.002  15.164  1.00 40.28 ? 445 ALA B CA  1 
ATOM   6436  C C   . ALA B 1 407 ? 30.071  89.486  15.510  1.00 41.08 ? 445 ALA B C   1 
ATOM   6437  O O   . ALA B 1 407 ? 31.117  90.151  15.385  1.00 41.22 ? 445 ALA B O   1 
ATOM   6438  C CB  . ALA B 1 407 ? 29.547  87.185  16.318  1.00 40.19 ? 445 ALA B CB  1 
ATOM   6439  N N   . LYS B 1 408 ? 28.922  90.016  15.950  1.00 41.66 ? 446 LYS B N   1 
ATOM   6440  C CA  . LYS B 1 408 ? 28.838  91.425  16.338  1.00 41.92 ? 446 LYS B CA  1 
ATOM   6441  C C   . LYS B 1 408 ? 29.880  91.750  17.408  1.00 42.05 ? 446 LYS B C   1 
ATOM   6442  O O   . LYS B 1 408 ? 30.196  90.910  18.269  1.00 42.50 ? 446 LYS B O   1 
ATOM   6443  C CB  . LYS B 1 408 ? 27.439  91.797  16.847  1.00 42.30 ? 446 LYS B CB  1 
ATOM   6444  N N   . GLY B 1 409 ? 30.411  92.966  17.328  1.00 41.61 ? 447 GLY B N   1 
ATOM   6445  C CA  . GLY B 1 409 ? 31.472  93.424  18.215  1.00 41.45 ? 447 GLY B CA  1 
ATOM   6446  C C   . GLY B 1 409 ? 32.819  92.775  17.960  1.00 41.02 ? 447 GLY B C   1 
ATOM   6447  O O   . GLY B 1 409 ? 33.665  92.728  18.851  1.00 40.86 ? 447 GLY B O   1 
ATOM   6448  N N   . ASN B 1 410 ? 33.030  92.281  16.743  1.00 40.68 ? 448 ASN B N   1 
ATOM   6449  C CA  . ASN B 1 410 ? 34.184  91.426  16.455  1.00 40.48 ? 448 ASN B CA  1 
ATOM   6450  C C   . ASN B 1 410 ? 34.304  90.268  17.469  1.00 39.80 ? 448 ASN B C   1 
ATOM   6451  O O   . ASN B 1 410 ? 35.406  89.800  17.743  1.00 40.09 ? 448 ASN B O   1 
ATOM   6452  C CB  . ASN B 1 410 ? 35.485  92.264  16.418  1.00 40.55 ? 448 ASN B CB  1 
ATOM   6453  C CG  . ASN B 1 410 ? 36.685  91.509  15.794  1.00 41.20 ? 448 ASN B CG  1 
ATOM   6454  O OD1 . ASN B 1 410 ? 36.553  90.815  14.785  1.00 42.30 ? 448 ASN B OD1 1 
ATOM   6455  N ND2 . ASN B 1 410 ? 37.862  91.667  16.400  1.00 41.63 ? 448 ASN B ND2 1 
ATOM   6456  N N   . ALA B 1 411 ? 33.185  89.812  18.036  1.00 39.02 ? 449 ALA B N   1 
ATOM   6457  C CA  . ALA B 1 411 ? 33.224  88.661  18.949  1.00 38.57 ? 449 ALA B CA  1 
ATOM   6458  C C   . ALA B 1 411 ? 33.653  87.467  18.106  1.00 37.99 ? 449 ALA B C   1 
ATOM   6459  O O   . ALA B 1 411 ? 33.142  87.293  17.005  1.00 37.79 ? 449 ALA B O   1 
ATOM   6460  C CB  . ALA B 1 411 ? 31.858  88.414  19.598  1.00 38.48 ? 449 ALA B CB  1 
ATOM   6461  N N   . HIS B 1 412 ? 34.604  86.676  18.606  1.00 37.52 ? 450 HIS B N   1 
ATOM   6462  C CA  . HIS B 1 412 ? 35.185  85.572  17.828  1.00 37.33 ? 450 HIS B CA  1 
ATOM   6463  C C   . HIS B 1 412 ? 34.185  84.463  17.504  1.00 36.95 ? 450 HIS B C   1 
ATOM   6464  O O   . HIS B 1 412 ? 33.218  84.243  18.231  1.00 36.89 ? 450 HIS B O   1 
ATOM   6465  C CB  . HIS B 1 412 ? 36.403  84.952  18.541  1.00 37.32 ? 450 HIS B CB  1 
ATOM   6466  C CG  . HIS B 1 412 ? 37.571  85.878  18.650  1.00 37.20 ? 450 HIS B CG  1 
ATOM   6467  N ND1 . HIS B 1 412 ? 37.974  86.691  17.613  1.00 37.59 ? 450 HIS B ND1 1 
ATOM   6468  C CD2 . HIS B 1 412 ? 38.412  86.133  19.679  1.00 37.65 ? 450 HIS B CD2 1 
ATOM   6469  C CE1 . HIS B 1 412 ? 39.009  87.414  18.003  1.00 37.89 ? 450 HIS B CE1 1 
ATOM   6470  N NE2 . HIS B 1 412 ? 39.299  87.092  19.250  1.00 37.58 ? 450 HIS B NE2 1 
ATOM   6471  N N   . LYS B 1 413 ? 34.433  83.784  16.387  1.00 36.48 ? 451 LYS B N   1 
ATOM   6472  C CA  . LYS B 1 413 ? 33.720  82.551  16.041  1.00 36.25 ? 451 LYS B CA  1 
ATOM   6473  C C   . LYS B 1 413 ? 34.692  81.380  15.853  1.00 36.12 ? 451 LYS B C   1 
ATOM   6474  O O   . LYS B 1 413 ? 34.289  80.251  15.991  1.00 36.36 ? 451 LYS B O   1 
ATOM   6475  C CB  . LYS B 1 413 ? 32.869  82.750  14.791  1.00 36.01 ? 451 LYS B CB  1 
ATOM   6476  C CG  . LYS B 1 413 ? 31.822  83.857  14.918  1.00 35.29 ? 451 LYS B CG  1 
ATOM   6477  C CD  . LYS B 1 413 ? 31.233  84.217  13.566  1.00 34.25 ? 451 LYS B CD  1 
ATOM   6478  C CE  . LYS B 1 413 ? 30.155  83.256  13.186  1.00 33.53 ? 451 LYS B CE  1 
ATOM   6479  N NZ  . LYS B 1 413 ? 29.674  83.492  11.827  1.00 34.72 ? 451 LYS B NZ  1 
ATOM   6480  N N   . ILE B 1 414 ? 35.960  81.654  15.528  1.00 36.25 ? 452 ILE B N   1 
ATOM   6481  C CA  . ILE B 1 414 ? 37.033  80.639  15.560  1.00 36.14 ? 452 ILE B CA  1 
ATOM   6482  C C   . ILE B 1 414 ? 37.789  80.775  16.888  1.00 36.44 ? 452 ILE B C   1 
ATOM   6483  O O   . ILE B 1 414 ? 38.367  81.840  17.180  1.00 35.96 ? 452 ILE B O   1 
ATOM   6484  C CB  . ILE B 1 414 ? 38.028  80.765  14.370  1.00 35.98 ? 452 ILE B CB  1 
ATOM   6485  C CG1 . ILE B 1 414 ? 37.279  80.772  13.026  1.00 36.62 ? 452 ILE B CG1 1 
ATOM   6486  C CG2 . ILE B 1 414 ? 39.026  79.619  14.400  1.00 34.48 ? 452 ILE B CG2 1 
ATOM   6487  C CD1 . ILE B 1 414 ? 37.974  81.549  11.912  1.00 35.66 ? 452 ILE B CD1 1 
ATOM   6488  N N   . MET B 1 415 ? 37.780  79.699  17.681  1.00 36.61 ? 453 MET B N   1 
ATOM   6489  C CA  . MET B 1 415 ? 38.285  79.743  19.050  1.00 37.17 ? 453 MET B CA  1 
ATOM   6490  C C   . MET B 1 415 ? 38.950  78.454  19.535  1.00 37.21 ? 453 MET B C   1 
ATOM   6491  O O   . MET B 1 415 ? 39.019  77.466  18.804  1.00 36.65 ? 453 MET B O   1 
ATOM   6492  C CB  . MET B 1 415 ? 37.155  80.160  20.001  1.00 37.35 ? 453 MET B CB  1 
ATOM   6493  C CG  . MET B 1 415 ? 35.828  79.433  19.820  1.00 37.52 ? 453 MET B CG  1 
ATOM   6494  S SD  . MET B 1 415 ? 34.495  80.529  20.362  1.00 37.90 ? 453 MET B SD  1 
ATOM   6495  C CE  . MET B 1 415 ? 34.157  81.367  18.828  1.00 38.20 ? 453 MET B CE  1 
ATOM   6496  N N   . GLU B 1 416 ? 39.479  78.494  20.763  1.00 37.36 ? 454 GLU B N   1 
ATOM   6497  C CA  . GLU B 1 416 ? 40.076  77.317  21.403  1.00 37.70 ? 454 GLU B CA  1 
ATOM   6498  C C   . GLU B 1 416 ? 39.016  76.252  21.671  1.00 37.46 ? 454 GLU B C   1 
ATOM   6499  O O   . GLU B 1 416 ? 39.171  75.090  21.305  1.00 37.93 ? 454 GLU B O   1 
ATOM   6500  C CB  . GLU B 1 416 ? 40.740  77.708  22.734  1.00 37.95 ? 454 GLU B CB  1 
ATOM   6501  C CG  . GLU B 1 416 ? 41.944  78.629  22.587  1.00 40.42 ? 454 GLU B CG  1 
ATOM   6502  C CD  . GLU B 1 416 ? 43.204  77.915  22.119  1.00 44.02 ? 454 GLU B CD  1 
ATOM   6503  O OE1 . GLU B 1 416 ? 43.242  76.665  22.224  1.00 47.57 ? 454 GLU B OE1 1 
ATOM   6504  O OE2 . GLU B 1 416 ? 44.157  78.597  21.652  1.00 45.63 ? 454 GLU B OE2 1 
ATOM   6505  N N   . LYS B 1 417 ? 37.937  76.683  22.312  1.00 37.18 ? 455 LYS B N   1 
ATOM   6506  C CA  . LYS B 1 417 ? 36.892  75.815  22.821  1.00 36.84 ? 455 LYS B CA  1 
ATOM   6507  C C   . LYS B 1 417 ? 35.610  76.481  22.421  1.00 36.39 ? 455 LYS B C   1 
ATOM   6508  O O   . LYS B 1 417 ? 35.446  77.651  22.659  1.00 36.20 ? 455 LYS B O   1 
ATOM   6509  C CB  . LYS B 1 417 ? 36.968  75.732  24.359  1.00 36.66 ? 455 LYS B CB  1 
ATOM   6510  N N   . CYS B 1 418 ? 34.688  75.762  21.807  1.00 36.02 ? 456 CYS B N   1 
ATOM   6511  C CA  . CYS B 1 418 ? 33.374  76.347  21.605  1.00 35.74 ? 456 CYS B CA  1 
ATOM   6512  C C   . CYS B 1 418 ? 32.713  76.585  22.961  1.00 34.92 ? 456 CYS B C   1 
ATOM   6513  O O   . CYS B 1 418 ? 33.051  75.942  23.954  1.00 35.06 ? 456 CYS B O   1 
ATOM   6514  C CB  . CYS B 1 418 ? 32.515  75.441  20.733  1.00 35.90 ? 456 CYS B CB  1 
ATOM   6515  S SG  . CYS B 1 418 ? 33.193  75.197  19.089  1.00 36.59 ? 456 CYS B SG  1 
ATOM   6516  N N   . THR B 1 419 ? 31.788  77.532  23.005  1.00 34.12 ? 457 THR B N   1 
ATOM   6517  C CA  . THR B 1 419 ? 31.014  77.791  24.209  1.00 33.21 ? 457 THR B CA  1 
ATOM   6518  C C   . THR B 1 419 ? 29.517  77.550  23.948  1.00 32.85 ? 457 THR B C   1 
ATOM   6519  O O   . THR B 1 419 ? 28.702  77.567  24.872  1.00 33.64 ? 457 THR B O   1 
ATOM   6520  C CB  . THR B 1 419 ? 31.234  79.234  24.698  1.00 33.17 ? 457 THR B CB  1 
ATOM   6521  O OG1 . THR B 1 419 ? 30.787  80.134  23.682  1.00 33.09 ? 457 THR B OG1 1 
ATOM   6522  C CG2 . THR B 1 419 ? 32.710  79.513  25.010  1.00 32.43 ? 457 THR B CG2 1 
ATOM   6523  N N   . LEU B 1 420 ? 29.132  77.372  22.697  1.00 32.01 ? 458 LEU B N   1 
ATOM   6524  C CA  . LEU B 1 420 ? 27.787  76.919  22.398  1.00 31.91 ? 458 LEU B CA  1 
ATOM   6525  C C   . LEU B 1 420 ? 27.772  75.365  22.227  1.00 31.90 ? 458 LEU B C   1 
ATOM   6526  O O   . LEU B 1 420 ? 28.828  74.737  21.974  1.00 31.36 ? 458 LEU B O   1 
ATOM   6527  C CB  . LEU B 1 420 ? 27.288  77.616  21.142  1.00 32.13 ? 458 LEU B CB  1 
ATOM   6528  C CG  . LEU B 1 420 ? 27.194  79.133  21.133  1.00 31.64 ? 458 LEU B CG  1 
ATOM   6529  C CD1 . LEU B 1 420 ? 26.965  79.575  19.706  1.00 33.66 ? 458 LEU B CD1 1 
ATOM   6530  C CD2 . LEU B 1 420 ? 26.087  79.586  22.012  1.00 31.16 ? 458 LEU B CD2 1 
ATOM   6531  N N   . PRO B 1 421 ? 26.589  74.730  22.393  1.00 31.52 ? 459 PRO B N   1 
ATOM   6532  C CA  . PRO B 1 421 ? 26.510  73.268  22.254  1.00 31.83 ? 459 PRO B CA  1 
ATOM   6533  C C   . PRO B 1 421 ? 27.023  72.712  20.913  1.00 32.41 ? 459 PRO B C   1 
ATOM   6534  O O   . PRO B 1 421 ? 26.664  73.208  19.834  1.00 32.24 ? 459 PRO B O   1 
ATOM   6535  C CB  . PRO B 1 421 ? 25.008  72.969  22.473  1.00 31.51 ? 459 PRO B CB  1 
ATOM   6536  C CG  . PRO B 1 421 ? 24.511  74.120  23.249  1.00 30.99 ? 459 PRO B CG  1 
ATOM   6537  C CD  . PRO B 1 421 ? 25.295  75.303  22.783  1.00 31.36 ? 459 PRO B CD  1 
ATOM   6538  N N   . LEU B 1 422 ? 27.842  71.659  20.999  1.00 33.09 ? 460 LEU B N   1 
ATOM   6539  C CA  . LEU B 1 422 ? 28.481  71.096  19.840  1.00 33.07 ? 460 LEU B CA  1 
ATOM   6540  C C   . LEU B 1 422 ? 27.504  70.299  18.983  1.00 32.88 ? 460 LEU B C   1 
ATOM   6541  O O   . LEU B 1 422 ? 26.600  69.649  19.481  1.00 31.99 ? 460 LEU B O   1 
ATOM   6542  C CB  . LEU B 1 422 ? 29.687  70.206  20.218  1.00 33.26 ? 460 LEU B CB  1 
ATOM   6543  C CG  . LEU B 1 422 ? 30.831  70.910  20.973  1.00 34.85 ? 460 LEU B CG  1 
ATOM   6544  C CD1 . LEU B 1 422 ? 32.036  69.975  21.069  1.00 34.36 ? 460 LEU B CD1 1 
ATOM   6545  C CD2 . LEU B 1 422 ? 31.234  72.225  20.344  1.00 34.29 ? 460 LEU B CD2 1 
ATOM   6546  N N   . THR B 1 423 ? 27.715  70.408  17.672  1.00 32.94 ? 461 THR B N   1 
ATOM   6547  C CA  . THR B 1 423 ? 27.101  69.573  16.668  1.00 32.54 ? 461 THR B CA  1 
ATOM   6548  C C   . THR B 1 423 ? 27.992  68.370  16.487  1.00 33.12 ? 461 THR B C   1 
ATOM   6549  O O   . THR B 1 423 ? 27.531  67.254  16.238  1.00 33.34 ? 461 THR B O   1 
ATOM   6550  C CB  . THR B 1 423 ? 27.063  70.320  15.337  1.00 32.62 ? 461 THR B CB  1 
ATOM   6551  O OG1 . THR B 1 423 ? 26.326  71.538  15.495  1.00 32.34 ? 461 THR B OG1 1 
ATOM   6552  C CG2 . THR B 1 423 ? 26.453  69.482  14.260  1.00 32.76 ? 461 THR B CG2 1 
ATOM   6553  N N   . GLY B 1 424 ? 29.289  68.616  16.549  1.00 33.45 ? 462 GLY B N   1 
ATOM   6554  C CA  . GLY B 1 424 ? 30.254  67.565  16.428  1.00 33.96 ? 462 GLY B CA  1 
ATOM   6555  C C   . GLY B 1 424 ? 31.602  67.883  17.026  1.00 34.33 ? 462 GLY B C   1 
ATOM   6556  O O   . GLY B 1 424 ? 31.984  69.050  17.214  1.00 34.22 ? 462 GLY B O   1 
ATOM   6557  N N   . LYS B 1 425 ? 32.330  66.811  17.295  1.00 34.52 ? 463 LYS B N   1 
ATOM   6558  C CA  . LYS B 1 425 ? 33.613  66.893  17.941  1.00 34.85 ? 463 LYS B CA  1 
ATOM   6559  C C   . LYS B 1 425 ? 34.685  66.596  16.894  1.00 34.51 ? 463 LYS B C   1 
ATOM   6560  O O   . LYS B 1 425 ? 34.620  65.577  16.188  1.00 34.84 ? 463 LYS B O   1 
ATOM   6561  C CB  . LYS B 1 425 ? 33.653  65.928  19.144  1.00 34.81 ? 463 LYS B CB  1 
ATOM   6562  C CG  . LYS B 1 425 ? 34.736  66.206  20.117  1.00 36.03 ? 463 LYS B CG  1 
ATOM   6563  C CD  . LYS B 1 425 ? 34.483  65.545  21.445  1.00 37.80 ? 463 LYS B CD  1 
ATOM   6564  C CE  . LYS B 1 425 ? 35.748  65.531  22.291  1.00 39.31 ? 463 LYS B CE  1 
ATOM   6565  N NZ  . LYS B 1 425 ? 36.510  64.235  22.145  1.00 40.59 ? 463 LYS B NZ  1 
ATOM   6566  N N   . GLN B 1 426 ? 35.612  67.535  16.746  1.00 34.07 ? 464 GLN B N   1 
ATOM   6567  C CA  . GLN B 1 426 ? 36.768  67.401  15.879  1.00 34.23 ? 464 GLN B CA  1 
ATOM   6568  C C   . GLN B 1 426 ? 36.345  66.917  14.516  1.00 34.64 ? 464 GLN B C   1 
ATOM   6569  O O   . GLN B 1 426 ? 36.904  65.971  13.975  1.00 34.93 ? 464 GLN B O   1 
ATOM   6570  C CB  . GLN B 1 426 ? 37.801  66.492  16.530  1.00 33.93 ? 464 GLN B CB  1 
ATOM   6571  C CG  . GLN B 1 426 ? 38.255  67.044  17.896  1.00 34.90 ? 464 GLN B CG  1 
ATOM   6572  C CD  . GLN B 1 426 ? 39.085  66.096  18.733  1.00 34.57 ? 464 GLN B CD  1 
ATOM   6573  O OE1 . GLN B 1 426 ? 39.522  65.065  18.276  1.00 36.69 ? 464 GLN B OE1 1 
ATOM   6574  N NE2 . GLN B 1 426 ? 39.311  66.468  19.981  1.00 38.58 ? 464 GLN B NE2 1 
ATOM   6575  N N   . CYS B 1 427 ? 35.338  67.574  13.960  1.00 35.22 ? 465 CYS B N   1 
ATOM   6576  C CA  . CYS B 1 427 ? 34.751  67.110  12.699  1.00 36.05 ? 465 CYS B CA  1 
ATOM   6577  C C   . CYS B 1 427 ? 35.076  67.997  11.501  1.00 35.09 ? 465 CYS B C   1 
ATOM   6578  O O   . CYS B 1 427 ? 35.122  67.492  10.419  1.00 35.71 ? 465 CYS B O   1 
ATOM   6579  C CB  . CYS B 1 427 ? 33.239  66.879  12.850  1.00 35.65 ? 465 CYS B CB  1 
ATOM   6580  S SG  . CYS B 1 427 ? 32.321  68.227  13.493  1.00 38.95 ? 465 CYS B SG  1 
ATOM   6581  N N   . VAL B 1 428 ? 35.332  69.292  11.706  1.00 34.90 ? 466 VAL B N   1 
ATOM   6582  C CA  . VAL B 1 428 ? 35.645  70.220  10.611  1.00 33.96 ? 466 VAL B CA  1 
ATOM   6583  C C   . VAL B 1 428 ? 37.064  70.015  10.022  1.00 33.97 ? 466 VAL B C   1 
ATOM   6584  O O   . VAL B 1 428 ? 38.074  69.938  10.759  1.00 33.81 ? 466 VAL B O   1 
ATOM   6585  C CB  . VAL B 1 428 ? 35.422  71.725  11.028  1.00 34.07 ? 466 VAL B CB  1 
ATOM   6586  C CG1 . VAL B 1 428 ? 35.740  72.689  9.865   1.00 33.07 ? 466 VAL B CG1 1 
ATOM   6587  C CG2 . VAL B 1 428 ? 33.974  71.950  11.512  1.00 32.46 ? 466 VAL B CG2 1 
ATOM   6588  N N   . ASN B 1 429 ? 37.113  69.957  8.681   1.00 33.63 ? 467 ASN B N   1 
ATOM   6589  C CA  . ASN B 1 429 ? 38.352  69.827  7.899   1.00 33.19 ? 467 ASN B CA  1 
ATOM   6590  C C   . ASN B 1 429 ? 38.855  71.156  7.320   1.00 33.04 ? 467 ASN B C   1 
ATOM   6591  O O   . ASN B 1 429 ? 40.048  71.317  7.085   1.00 32.65 ? 467 ASN B O   1 
ATOM   6592  C CB  . ASN B 1 429 ? 38.133  68.844  6.748   1.00 33.72 ? 467 ASN B CB  1 
ATOM   6593  C CG  . ASN B 1 429 ? 37.782  67.447  7.228   1.00 32.75 ? 467 ASN B CG  1 
ATOM   6594  O OD1 . ASN B 1 429 ? 36.630  67.097  7.280   1.00 35.40 ? 467 ASN B OD1 1 
ATOM   6595  N ND2 . ASN B 1 429 ? 38.785  66.648  7.572   1.00 32.08 ? 467 ASN B ND2 1 
ATOM   6596  N N   . ARG B 1 430 ? 37.957  72.110  7.101   1.00 32.50 ? 468 ARG B N   1 
ATOM   6597  C CA  . ARG B 1 430 ? 38.359  73.418  6.570   1.00 32.77 ? 468 ARG B CA  1 
ATOM   6598  C C   . ARG B 1 430 ? 37.293  74.468  6.859   1.00 32.15 ? 468 ARG B C   1 
ATOM   6599  O O   . ARG B 1 430 ? 36.108  74.155  6.886   1.00 32.01 ? 468 ARG B O   1 
ATOM   6600  C CB  . ARG B 1 430 ? 38.614  73.314  5.053   1.00 33.14 ? 468 ARG B CB  1 
ATOM   6601  C CG  . ARG B 1 430 ? 38.707  74.659  4.307   1.00 33.47 ? 468 ARG B CG  1 
ATOM   6602  C CD  . ARG B 1 430 ? 39.110  74.493  2.836   1.00 34.36 ? 468 ARG B CD  1 
ATOM   6603  N NE  . ARG B 1 430 ? 40.374  73.778  2.692   1.00 36.33 ? 468 ARG B NE  1 
ATOM   6604  C CZ  . ARG B 1 430 ? 40.972  73.530  1.533   1.00 38.12 ? 468 ARG B CZ  1 
ATOM   6605  N NH1 . ARG B 1 430 ? 42.115  72.861  1.506   1.00 38.74 ? 468 ARG B NH1 1 
ATOM   6606  N NH2 . ARG B 1 430 ? 40.435  73.937  0.390   1.00 40.22 ? 468 ARG B NH2 1 
ATOM   6607  N N   . ILE B 1 431 ? 37.741  75.703  7.069   1.00 32.42 ? 469 ILE B N   1 
ATOM   6608  C CA  . ILE B 1 431 ? 36.880  76.840  7.340   1.00 32.62 ? 469 ILE B CA  1 
ATOM   6609  C C   . ILE B 1 431 ? 37.158  77.936  6.328   1.00 32.69 ? 469 ILE B C   1 
ATOM   6610  O O   . ILE B 1 431 ? 38.286  78.417  6.233   1.00 33.18 ? 469 ILE B O   1 
ATOM   6611  C CB  . ILE B 1 431 ? 37.136  77.493  8.726   1.00 32.72 ? 469 ILE B CB  1 
ATOM   6612  C CG1 . ILE B 1 431 ? 37.273  76.461  9.861   1.00 32.73 ? 469 ILE B CG1 1 
ATOM   6613  C CG2 . ILE B 1 431 ? 36.040  78.513  9.012   1.00 32.26 ? 469 ILE B CG2 1 
ATOM   6614  C CD1 . ILE B 1 431 ? 38.092  77.004  11.101  1.00 31.82 ? 469 ILE B CD1 1 
ATOM   6615  N N   . ILE B 1 432 ? 36.123  78.346  5.603   1.00 32.51 ? 470 ILE B N   1 
ATOM   6616  C CA  . ILE B 1 432 ? 36.236  79.443  4.667   1.00 32.46 ? 470 ILE B CA  1 
ATOM   6617  C C   . ILE B 1 432 ? 35.407  80.592  5.232   1.00 32.92 ? 470 ILE B C   1 
ATOM   6618  O O   . ILE B 1 432 ? 34.189  80.464  5.459   1.00 33.36 ? 470 ILE B O   1 
ATOM   6619  C CB  . ILE B 1 432 ? 35.754  79.110  3.222   1.00 32.49 ? 470 ILE B CB  1 
ATOM   6620  C CG1 . ILE B 1 432 ? 36.462  77.850  2.655   1.00 32.82 ? 470 ILE B CG1 1 
ATOM   6621  C CG2 . ILE B 1 432 ? 36.005  80.335  2.319   1.00 31.47 ? 470 ILE B CG2 1 
ATOM   6622  C CD1 . ILE B 1 432 ? 35.844  77.236  1.384   1.00 30.92 ? 470 ILE B CD1 1 
ATOM   6623  N N   . THR B 1 433 ? 36.091  81.704  5.482   1.00 32.68 ? 471 THR B N   1 
ATOM   6624  C CA  . THR B 1 433 ? 35.463  82.947  5.864   1.00 32.36 ? 471 THR B CA  1 
ATOM   6625  C C   . THR B 1 433 ? 35.832  83.987  4.801   1.00 32.49 ? 471 THR B C   1 
ATOM   6626  O O   . THR B 1 433 ? 36.561  83.696  3.851   1.00 31.93 ? 471 THR B O   1 
ATOM   6627  C CB  . THR B 1 433 ? 35.939  83.403  7.288   1.00 32.25 ? 471 THR B CB  1 
ATOM   6628  O OG1 . THR B 1 433 ? 37.310  83.822  7.235   1.00 32.32 ? 471 THR B OG1 1 
ATOM   6629  C CG2 . THR B 1 433 ? 35.800  82.279  8.317   1.00 31.46 ? 471 THR B CG2 1 
ATOM   6630  N N   . GLU B 1 434 ? 35.336  85.204  4.977   1.00 32.72 ? 472 GLU B N   1 
ATOM   6631  C CA  . GLU B 1 434 ? 35.688  86.312  4.094   1.00 32.98 ? 472 GLU B CA  1 
ATOM   6632  C C   . GLU B 1 434 ? 37.153  86.779  4.250   1.00 32.93 ? 472 GLU B C   1 
ATOM   6633  O O   . GLU B 1 434 ? 37.651  87.543  3.413   1.00 32.98 ? 472 GLU B O   1 
ATOM   6634  C CB  . GLU B 1 434 ? 34.731  87.494  4.317   1.00 32.66 ? 472 GLU B CB  1 
ATOM   6635  C CG  . GLU B 1 434 ? 35.081  88.431  5.494   1.00 33.25 ? 472 GLU B CG  1 
ATOM   6636  C CD  . GLU B 1 434 ? 34.563  87.965  6.849   1.00 31.89 ? 472 GLU B CD  1 
ATOM   6637  O OE1 . GLU B 1 434 ? 33.891  86.901  6.939   1.00 30.82 ? 472 GLU B OE1 1 
ATOM   6638  O OE2 . GLU B 1 434 ? 34.837  88.686  7.826   1.00 29.30 ? 472 GLU B OE2 1 
ATOM   6639  N N   . LYS B 1 435 ? 37.831  86.347  5.321   1.00 32.86 ? 473 LYS B N   1 
ATOM   6640  C CA  . LYS B 1 435 ? 39.205  86.810  5.589   1.00 32.63 ? 473 LYS B CA  1 
ATOM   6641  C C   . LYS B 1 435 ? 40.284  85.765  5.317   1.00 32.46 ? 473 LYS B C   1 
ATOM   6642  O O   . LYS B 1 435 ? 41.427  86.134  5.014   1.00 31.52 ? 473 LYS B O   1 
ATOM   6643  C CB  . LYS B 1 435 ? 39.333  87.290  7.032   1.00 32.65 ? 473 LYS B CB  1 
ATOM   6644  C CG  . LYS B 1 435 ? 38.544  88.536  7.330   1.00 32.03 ? 473 LYS B CG  1 
ATOM   6645  C CD  . LYS B 1 435 ? 38.791  89.010  8.755   1.00 31.81 ? 473 LYS B CD  1 
ATOM   6646  C CE  . LYS B 1 435 ? 37.740  90.026  9.153   1.00 32.08 ? 473 LYS B CE  1 
ATOM   6647  N NZ  . LYS B 1 435 ? 38.165  90.848  10.304  1.00 30.63 ? 473 LYS B NZ  1 
ATOM   6648  N N   . ALA B 1 436 ? 39.918  84.477  5.416   1.00 32.56 ? 474 ALA B N   1 
ATOM   6649  C CA  . ALA B 1 436 ? 40.892  83.401  5.366   1.00 32.42 ? 474 ALA B CA  1 
ATOM   6650  C C   . ALA B 1 436 ? 40.289  82.017  5.050   1.00 33.11 ? 474 ALA B C   1 
ATOM   6651  O O   . ALA B 1 436 ? 39.083  81.788  5.161   1.00 32.58 ? 474 ALA B O   1 
ATOM   6652  C CB  . ALA B 1 436 ? 41.643  83.353  6.685   1.00 31.97 ? 474 ALA B CB  1 
ATOM   6653  N N   . VAL B 1 437 ? 41.167  81.104  4.651   1.00 33.39 ? 475 VAL B N   1 
ATOM   6654  C CA  . VAL B 1 437 ? 40.850  79.703  4.573   1.00 33.66 ? 475 VAL B CA  1 
ATOM   6655  C C   . VAL B 1 437 ? 41.823  79.004  5.512   1.00 34.37 ? 475 VAL B C   1 
ATOM   6656  O O   . VAL B 1 437 ? 43.024  79.221  5.408   1.00 35.10 ? 475 VAL B O   1 
ATOM   6657  C CB  . VAL B 1 437 ? 40.979  79.165  3.116   1.00 33.68 ? 475 VAL B CB  1 
ATOM   6658  C CG1 . VAL B 1 437 ? 40.712  77.655  3.056   1.00 32.64 ? 475 VAL B CG1 1 
ATOM   6659  C CG2 . VAL B 1 437 ? 40.038  79.932  2.175   1.00 32.15 ? 475 VAL B CG2 1 
ATOM   6660  N N   . PHE B 1 438 ? 41.303  78.214  6.459   1.00 34.85 ? 476 PHE B N   1 
ATOM   6661  C CA  . PHE B 1 438 ? 42.136  77.337  7.292   1.00 34.70 ? 476 PHE B CA  1 
ATOM   6662  C C   . PHE B 1 438 ? 41.884  75.864  6.990   1.00 34.80 ? 476 PHE B C   1 
ATOM   6663  O O   . PHE B 1 438 ? 40.747  75.450  6.900   1.00 34.36 ? 476 PHE B O   1 
ATOM   6664  C CB  . PHE B 1 438 ? 41.838  77.501  8.784   1.00 34.93 ? 476 PHE B CB  1 
ATOM   6665  C CG  . PHE B 1 438 ? 41.878  78.914  9.289   1.00 35.01 ? 476 PHE B CG  1 
ATOM   6666  C CD1 . PHE B 1 438 ? 43.056  79.457  9.783   1.00 34.49 ? 476 PHE B CD1 1 
ATOM   6667  C CD2 . PHE B 1 438 ? 40.720  79.672  9.339   1.00 34.76 ? 476 PHE B CD2 1 
ATOM   6668  C CE1 . PHE B 1 438 ? 43.078  80.741  10.297  1.00 35.12 ? 476 PHE B CE1 1 
ATOM   6669  C CE2 . PHE B 1 438 ? 40.739  80.961  9.839   1.00 34.97 ? 476 PHE B CE2 1 
ATOM   6670  C CZ  . PHE B 1 438 ? 41.917  81.498  10.315  1.00 34.75 ? 476 PHE B CZ  1 
ATOM   6671  N N   . ASP B 1 439 ? 42.958  75.086  6.842   1.00 35.04 ? 477 ASP B N   1 
ATOM   6672  C CA  . ASP B 1 439 ? 42.910  73.651  7.051   1.00 35.10 ? 477 ASP B CA  1 
ATOM   6673  C C   . ASP B 1 439 ? 42.866  73.469  8.569   1.00 35.26 ? 477 ASP B C   1 
ATOM   6674  O O   . ASP B 1 439 ? 43.457  74.261  9.321   1.00 34.65 ? 477 ASP B O   1 
ATOM   6675  C CB  . ASP B 1 439 ? 44.155  72.941  6.479   1.00 35.05 ? 477 ASP B CB  1 
ATOM   6676  C CG  . ASP B 1 439 ? 44.255  73.038  4.958   1.00 35.26 ? 477 ASP B CG  1 
ATOM   6677  O OD1 . ASP B 1 439 ? 43.266  72.724  4.271   1.00 31.35 ? 477 ASP B OD1 1 
ATOM   6678  O OD2 . ASP B 1 439 ? 45.337  73.421  4.451   1.00 36.33 ? 477 ASP B OD2 1 
ATOM   6679  N N   . VAL B 1 440 ? 42.169  72.416  8.996   1.00 35.70 ? 478 VAL B N   1 
ATOM   6680  C CA  . VAL B 1 440 ? 41.927  72.118  10.400  1.00 35.83 ? 478 VAL B CA  1 
ATOM   6681  C C   . VAL B 1 440 ? 42.242  70.636  10.687  1.00 36.54 ? 478 VAL B C   1 
ATOM   6682  O O   . VAL B 1 440 ? 41.740  69.758  9.988   1.00 36.79 ? 478 VAL B O   1 
ATOM   6683  C CB  . VAL B 1 440 ? 40.458  72.360  10.753  1.00 35.61 ? 478 VAL B CB  1 
ATOM   6684  C CG1 . VAL B 1 440 ? 40.288  72.346  12.235  1.00 35.46 ? 478 VAL B CG1 1 
ATOM   6685  C CG2 . VAL B 1 440 ? 39.947  73.673  10.136  1.00 35.13 ? 478 VAL B CG2 1 
ATOM   6686  N N   . ASP B 1 441 ? 43.050  70.371  11.721  1.00 37.13 ? 479 ASP B N   1 
ATOM   6687  C CA  . ASP B 1 441 ? 43.417  69.011  12.128  1.00 37.25 ? 479 ASP B CA  1 
ATOM   6688  C C   . ASP B 1 441 ? 43.113  68.763  13.612  1.00 37.43 ? 479 ASP B C   1 
ATOM   6689  O O   . ASP B 1 441 ? 43.379  69.630  14.445  1.00 37.05 ? 479 ASP B O   1 
ATOM   6690  C CB  . ASP B 1 441 ? 44.904  68.758  11.846  1.00 37.65 ? 479 ASP B CB  1 
ATOM   6691  C CG  . ASP B 1 441 ? 45.330  67.325  12.154  1.00 39.06 ? 479 ASP B CG  1 
ATOM   6692  O OD1 . ASP B 1 441 ? 45.135  66.434  11.298  1.00 42.71 ? 479 ASP B OD1 1 
ATOM   6693  O OD2 . ASP B 1 441 ? 45.860  67.079  13.255  1.00 40.00 ? 479 ASP B OD2 1 
ATOM   6694  N N   . LYS B 1 442 ? 42.535  67.579  13.897  1.00 38.02 ? 480 LYS B N   1 
ATOM   6695  C CA  . LYS B 1 442 ? 42.233  67.044  15.254  1.00 38.65 ? 480 LYS B CA  1 
ATOM   6696  C C   . LYS B 1 442 ? 43.306  67.319  16.307  1.00 38.42 ? 480 LYS B C   1 
ATOM   6697  O O   . LYS B 1 442 ? 42.994  67.623  17.455  1.00 38.80 ? 480 LYS B O   1 
ATOM   6698  C CB  . LYS B 1 442 ? 42.131  65.505  15.198  1.00 38.70 ? 480 LYS B CB  1 
ATOM   6699  C CG  . LYS B 1 442 ? 40.867  64.903  14.697  1.00 40.06 ? 480 LYS B CG  1 
ATOM   6700  C CD  . LYS B 1 442 ? 41.051  63.401  14.484  1.00 39.49 ? 480 LYS B CD  1 
ATOM   6701  N N   . LYS B 1 443 ? 44.560  67.128  15.897  1.00 38.48 ? 481 LYS B N   1 
ATOM   6702  C CA  . LYS B 1 443 ? 45.739  67.077  16.779  1.00 38.95 ? 481 LYS B CA  1 
ATOM   6703  C C   . LYS B 1 443 ? 46.698  68.257  16.573  1.00 38.55 ? 481 LYS B C   1 
ATOM   6704  O O   . LYS B 1 443 ? 47.379  68.668  17.517  1.00 38.24 ? 481 LYS B O   1 
ATOM   6705  C CB  . LYS B 1 443 ? 46.506  65.747  16.556  1.00 39.23 ? 481 LYS B CB  1 
ATOM   6706  C CG  . LYS B 1 443 ? 46.396  64.730  17.702  1.00 40.55 ? 481 LYS B CG  1 
ATOM   6707  C CD  . LYS B 1 443 ? 47.179  65.206  18.931  1.00 42.20 ? 481 LYS B CD  1 
ATOM   6708  C CE  . LYS B 1 443 ? 47.500  64.073  19.905  1.00 44.61 ? 481 LYS B CE  1 
ATOM   6709  N NZ  . LYS B 1 443 ? 46.361  63.118  20.105  1.00 46.40 ? 481 LYS B NZ  1 
ATOM   6710  N N   . LYS B 1 444 ? 46.749  68.787  15.346  1.00 38.27 ? 482 LYS B N   1 
ATOM   6711  C CA  . LYS B 1 444 ? 47.631  69.914  14.993  1.00 37.96 ? 482 LYS B CA  1 
ATOM   6712  C C   . LYS B 1 444 ? 46.988  71.313  15.029  1.00 37.75 ? 482 LYS B C   1 
ATOM   6713  O O   . LYS B 1 444 ? 47.703  72.321  15.067  1.00 37.58 ? 482 LYS B O   1 
ATOM   6714  C CB  . LYS B 1 444 ? 48.224  69.682  13.601  1.00 37.95 ? 482 LYS B CB  1 
ATOM   6715  C CG  . LYS B 1 444 ? 49.197  68.540  13.515  1.00 37.73 ? 482 LYS B CG  1 
ATOM   6716  C CD  . LYS B 1 444 ? 49.765  68.420  12.118  1.00 38.43 ? 482 LYS B CD  1 
ATOM   6717  C CE  . LYS B 1 444 ? 48.729  67.929  11.131  1.00 39.32 ? 482 LYS B CE  1 
ATOM   6718  N NZ  . LYS B 1 444 ? 49.348  67.553  9.826   1.00 41.49 ? 482 LYS B NZ  1 
ATOM   6719  N N   . GLY B 1 445 ? 45.659  71.388  14.983  1.00 37.54 ? 483 GLY B N   1 
ATOM   6720  C CA  . GLY B 1 445 ? 44.970  72.675  14.949  1.00 37.28 ? 483 GLY B CA  1 
ATOM   6721  C C   . GLY B 1 445 ? 44.868  73.270  13.549  1.00 37.60 ? 483 GLY B C   1 
ATOM   6722  O O   . GLY B 1 445 ? 44.754  72.536  12.554  1.00 37.81 ? 483 GLY B O   1 
ATOM   6723  N N   . LEU B 1 446 ? 44.897  74.605  13.482  1.00 37.55 ? 484 LEU B N   1 
ATOM   6724  C CA  . LEU B 1 446 ? 44.686  75.363  12.243  1.00 37.45 ? 484 LEU B CA  1 
ATOM   6725  C C   . LEU B 1 446 ? 45.978  75.640  11.473  1.00 37.47 ? 484 LEU B C   1 
ATOM   6726  O O   . LEU B 1 446 ? 47.004  75.984  12.088  1.00 37.38 ? 484 LEU B O   1 
ATOM   6727  C CB  . LEU B 1 446 ? 44.056  76.725  12.557  1.00 37.43 ? 484 LEU B CB  1 
ATOM   6728  C CG  . LEU B 1 446 ? 42.666  76.789  13.190  1.00 37.77 ? 484 LEU B CG  1 
ATOM   6729  C CD1 . LEU B 1 446 ? 42.365  78.242  13.538  1.00 38.78 ? 484 LEU B CD1 1 
ATOM   6730  C CD2 . LEU B 1 446 ? 41.589  76.205  12.273  1.00 38.80 ? 484 LEU B CD2 1 
ATOM   6731  N N   . THR B 1 447 ? 45.924  75.484  10.141  1.00 36.62 ? 485 THR B N   1 
ATOM   6732  C CA  . THR B 1 447 ? 46.896  76.118  9.240   1.00 36.22 ? 485 THR B CA  1 
ATOM   6733  C C   . THR B 1 447 ? 46.156  77.136  8.375   1.00 35.69 ? 485 THR B C   1 
ATOM   6734  O O   . THR B 1 447 ? 45.130  76.823  7.797   1.00 35.55 ? 485 THR B O   1 
ATOM   6735  C CB  . THR B 1 447 ? 47.626  75.097  8.314   1.00 36.28 ? 485 THR B CB  1 
ATOM   6736  O OG1 . THR B 1 447 ? 48.200  74.052  9.103   1.00 36.63 ? 485 THR B OG1 1 
ATOM   6737  C CG2 . THR B 1 447 ? 48.744  75.781  7.501   1.00 35.61 ? 485 THR B CG2 1 
ATOM   6738  N N   . LEU B 1 448 ? 46.663  78.359  8.305   1.00 35.42 ? 486 LEU B N   1 
ATOM   6739  C CA  . LEU B 1 448 ? 46.094  79.375  7.428   1.00 35.30 ? 486 LEU B CA  1 
ATOM   6740  C C   . LEU B 1 448 ? 46.723  79.142  6.070   1.00 35.56 ? 486 LEU B C   1 
ATOM   6741  O O   . LEU B 1 448 ? 47.939  79.313  5.892   1.00 35.43 ? 486 LEU B O   1 
ATOM   6742  C CB  . LEU B 1 448 ? 46.415  80.782  7.943   1.00 35.42 ? 486 LEU B CB  1 
ATOM   6743  C CG  . LEU B 1 448 ? 45.791  81.977  7.211   1.00 35.63 ? 486 LEU B CG  1 
ATOM   6744  C CD1 . LEU B 1 448 ? 44.300  82.063  7.512   1.00 34.64 ? 486 LEU B CD1 1 
ATOM   6745  C CD2 . LEU B 1 448 ? 46.499  83.288  7.585   1.00 34.61 ? 486 LEU B CD2 1 
ATOM   6746  N N   . ILE B 1 449 ? 45.914  78.707  5.117   1.00 35.98 ? 487 ILE B N   1 
ATOM   6747  C CA  . ILE B 1 449 ? 46.443  78.360  3.801   1.00 36.35 ? 487 ILE B CA  1 
ATOM   6748  C C   . ILE B 1 449 ? 46.189  79.478  2.780   1.00 36.76 ? 487 ILE B C   1 
ATOM   6749  O O   . ILE B 1 449 ? 46.873  79.547  1.764   1.00 36.65 ? 487 ILE B O   1 
ATOM   6750  C CB  . ILE B 1 449 ? 45.948  76.969  3.304   1.00 35.93 ? 487 ILE B CB  1 
ATOM   6751  C CG1 . ILE B 1 449 ? 44.427  76.907  3.154   1.00 36.16 ? 487 ILE B CG1 1 
ATOM   6752  C CG2 . ILE B 1 449 ? 46.401  75.881  4.263   1.00 35.73 ? 487 ILE B CG2 1 
ATOM   6753  C CD1 . ILE B 1 449 ? 43.974  75.845  2.167   1.00 34.73 ? 487 ILE B CD1 1 
ATOM   6754  N N   . GLU B 1 450 ? 45.219  80.348  3.062   1.00 37.26 ? 488 GLU B N   1 
ATOM   6755  C CA  . GLU B 1 450 ? 44.890  81.454  2.174   1.00 37.69 ? 488 GLU B CA  1 
ATOM   6756  C C   . GLU B 1 450 ? 44.396  82.614  2.984   1.00 37.92 ? 488 GLU B C   1 
ATOM   6757  O O   . GLU B 1 450 ? 43.703  82.437  3.974   1.00 38.28 ? 488 GLU B O   1 
ATOM   6758  C CB  . GLU B 1 450 ? 43.783  81.088  1.189   1.00 37.84 ? 488 GLU B CB  1 
ATOM   6759  C CG  . GLU B 1 450 ? 44.097  79.964  0.237   1.00 37.92 ? 488 GLU B CG  1 
ATOM   6760  C CD  . GLU B 1 450 ? 43.030  79.799  -0.836  1.00 39.16 ? 488 GLU B CD  1 
ATOM   6761  O OE1 . GLU B 1 450 ? 42.044  80.579  -0.856  1.00 41.41 ? 488 GLU B OE1 1 
ATOM   6762  O OE2 . GLU B 1 450 ? 43.181  78.882  -1.668  1.00 40.87 ? 488 GLU B OE2 1 
ATOM   6763  N N   . LEU B 1 451 ? 44.726  83.802  2.510   1.00 38.23 ? 489 LEU B N   1 
ATOM   6764  C CA  . LEU B 1 451 ? 44.380  85.045  3.159   1.00 38.50 ? 489 LEU B CA  1 
ATOM   6765  C C   . LEU B 1 451 ? 43.833  85.998  2.081   1.00 38.46 ? 489 LEU B C   1 
ATOM   6766  O O   . LEU B 1 451 ? 44.367  86.080  0.964   1.00 38.04 ? 489 LEU B O   1 
ATOM   6767  C CB  . LEU B 1 451 ? 45.641  85.632  3.831   1.00 38.40 ? 489 LEU B CB  1 
ATOM   6768  C CG  . LEU B 1 451 ? 45.607  86.949  4.600   1.00 38.39 ? 489 LEU B CG  1 
ATOM   6769  C CD1 . LEU B 1 451 ? 44.916  86.801  5.947   1.00 39.02 ? 489 LEU B CD1 1 
ATOM   6770  C CD2 . LEU B 1 451 ? 47.040  87.471  4.783   1.00 38.28 ? 489 LEU B CD2 1 
ATOM   6771  N N   . TRP B 1 452 ? 42.763  86.705  2.422   1.00 38.36 ? 490 TRP B N   1 
ATOM   6772  C CA  . TRP B 1 452 ? 42.204  87.696  1.535   1.00 38.03 ? 490 TRP B CA  1 
ATOM   6773  C C   . TRP B 1 452 ? 43.259  88.790  1.281   1.00 38.09 ? 490 TRP B C   1 
ATOM   6774  O O   . TRP B 1 452 ? 43.897  89.281  2.218   1.00 38.67 ? 490 TRP B O   1 
ATOM   6775  C CB  . TRP B 1 452 ? 40.913  88.268  2.127   1.00 37.76 ? 490 TRP B CB  1 
ATOM   6776  C CG  . TRP B 1 452 ? 40.348  89.369  1.291   1.00 37.88 ? 490 TRP B CG  1 
ATOM   6777  C CD1 . TRP B 1 452 ? 40.245  90.690  1.628   1.00 36.83 ? 490 TRP B CD1 1 
ATOM   6778  C CD2 . TRP B 1 452 ? 39.844  89.249  -0.045  1.00 37.71 ? 490 TRP B CD2 1 
ATOM   6779  N NE1 . TRP B 1 452 ? 39.696  91.400  0.585   1.00 37.23 ? 490 TRP B NE1 1 
ATOM   6780  C CE2 . TRP B 1 452 ? 39.438  90.540  -0.454  1.00 37.92 ? 490 TRP B CE2 1 
ATOM   6781  C CE3 . TRP B 1 452 ? 39.693  88.172  -0.939  1.00 37.20 ? 490 TRP B CE3 1 
ATOM   6782  C CZ2 . TRP B 1 452 ? 38.884  90.786  -1.726  1.00 37.88 ? 490 TRP B CZ2 1 
ATOM   6783  C CZ3 . TRP B 1 452 ? 39.145  88.415  -2.198  1.00 37.08 ? 490 TRP B CZ3 1 
ATOM   6784  C CH2 . TRP B 1 452 ? 38.748  89.715  -2.581  1.00 37.54 ? 490 TRP B CH2 1 
ATOM   6785  N N   . GLU B 1 453 ? 43.450  89.141  0.011   1.00 37.70 ? 491 GLU B N   1 
ATOM   6786  C CA  . GLU B 1 453 ? 44.415  90.160  -0.396  1.00 37.95 ? 491 GLU B CA  1 
ATOM   6787  C C   . GLU B 1 453 ? 44.172  91.497  0.304   1.00 37.55 ? 491 GLU B C   1 
ATOM   6788  O O   . GLU B 1 453 ? 43.031  91.886  0.562   1.00 37.47 ? 491 GLU B O   1 
ATOM   6789  C CB  . GLU B 1 453 ? 44.357  90.359  -1.915  1.00 37.98 ? 491 GLU B CB  1 
ATOM   6790  C CG  . GLU B 1 453 ? 43.069  91.026  -2.392  1.00 38.26 ? 491 GLU B CG  1 
ATOM   6791  C CD  . GLU B 1 453 ? 42.711  90.674  -3.813  1.00 37.97 ? 491 GLU B CD  1 
ATOM   6792  O OE1 . GLU B 1 453 ? 42.471  91.604  -4.609  1.00 39.02 ? 491 GLU B OE1 1 
ATOM   6793  O OE2 . GLU B 1 453 ? 42.674  89.472  -4.138  1.00 38.71 ? 491 GLU B OE2 1 
ATOM   6794  N N   . GLY B 1 454 ? 45.254  92.194  0.613   1.00 37.58 ? 492 GLY B N   1 
ATOM   6795  C CA  . GLY B 1 454 ? 45.175  93.455  1.360   1.00 37.52 ? 492 GLY B CA  1 
ATOM   6796  C C   . GLY B 1 454 ? 45.295  93.272  2.870   1.00 37.39 ? 492 GLY B C   1 
ATOM   6797  O O   . GLY B 1 454 ? 46.056  94.017  3.528   1.00 37.39 ? 492 GLY B O   1 
ATOM   6798  N N   . LEU B 1 455 ? 44.539  92.307  3.412   1.00 36.69 ? 493 LEU B N   1 
ATOM   6799  C CA  . LEU B 1 455 ? 44.687  91.870  4.807   1.00 36.56 ? 493 LEU B CA  1 
ATOM   6800  C C   . LEU B 1 455 ? 46.051  91.219  5.052   1.00 36.50 ? 493 LEU B C   1 
ATOM   6801  O O   . LEU B 1 455 ? 46.620  90.614  4.142   1.00 36.63 ? 493 LEU B O   1 
ATOM   6802  C CB  . LEU B 1 455 ? 43.591  90.853  5.190   1.00 36.40 ? 493 LEU B CB  1 
ATOM   6803  C CG  . LEU B 1 455 ? 42.172  91.384  5.418   1.00 36.22 ? 493 LEU B CG  1 
ATOM   6804  C CD1 . LEU B 1 455 ? 41.199  90.246  5.634   1.00 33.97 ? 493 LEU B CD1 1 
ATOM   6805  C CD2 . LEU B 1 455 ? 42.138  92.369  6.599   1.00 35.60 ? 493 LEU B CD2 1 
ATOM   6806  N N   . THR B 1 456 ? 46.547  91.336  6.287   1.00 36.50 ? 494 THR B N   1 
ATOM   6807  C CA  . THR B 1 456 ? 47.774  90.661  6.745   1.00 36.53 ? 494 THR B CA  1 
ATOM   6808  C C   . THR B 1 456 ? 47.411  89.505  7.685   1.00 36.92 ? 494 THR B C   1 
ATOM   6809  O O   . THR B 1 456 ? 46.255  89.365  8.108   1.00 36.66 ? 494 THR B O   1 
ATOM   6810  C CB  . THR B 1 456 ? 48.741  91.633  7.502   1.00 36.76 ? 494 THR B CB  1 
ATOM   6811  O OG1 . THR B 1 456 ? 48.107  92.153  8.680   1.00 36.31 ? 494 THR B OG1 1 
ATOM   6812  C CG2 . THR B 1 456 ? 49.168  92.795  6.609   1.00 36.09 ? 494 THR B CG2 1 
ATOM   6813  N N   . VAL B 1 457 ? 48.401  88.678  8.015   1.00 37.12 ? 495 VAL B N   1 
ATOM   6814  C CA  . VAL B 1 457 ? 48.207  87.611  8.997   1.00 37.45 ? 495 VAL B CA  1 
ATOM   6815  C C   . VAL B 1 457 ? 47.765  88.165  10.358  1.00 37.66 ? 495 VAL B C   1 
ATOM   6816  O O   . VAL B 1 457 ? 47.008  87.512  11.064  1.00 36.95 ? 495 VAL B O   1 
ATOM   6817  C CB  . VAL B 1 457 ? 49.476  86.699  9.141   1.00 37.60 ? 495 VAL B CB  1 
ATOM   6818  C CG1 . VAL B 1 457 ? 49.521  86.005  10.500  1.00 38.05 ? 495 VAL B CG1 1 
ATOM   6819  C CG2 . VAL B 1 457 ? 49.518  85.647  8.021   1.00 37.33 ? 495 VAL B CG2 1 
ATOM   6820  N N   . ASP B 1 458 ? 48.224  89.375  10.706  1.00 38.52 ? 496 ASP B N   1 
ATOM   6821  C CA  . ASP B 1 458 ? 47.881  90.003  11.989  1.00 38.87 ? 496 ASP B CA  1 
ATOM   6822  C C   . ASP B 1 458 ? 46.451  90.569  12.026  1.00 39.02 ? 496 ASP B C   1 
ATOM   6823  O O   . ASP B 1 458 ? 45.816  90.599  13.078  1.00 39.34 ? 496 ASP B O   1 
ATOM   6824  C CB  . ASP B 1 458 ? 48.911  91.071  12.346  1.00 39.39 ? 496 ASP B CB  1 
ATOM   6825  C CG  . ASP B 1 458 ? 50.325  90.511  12.398  1.00 40.27 ? 496 ASP B CG  1 
ATOM   6826  O OD1 . ASP B 1 458 ? 51.120  90.972  13.249  1.00 39.36 ? 496 ASP B OD1 1 
ATOM   6827  O OD2 . ASP B 1 458 ? 50.625  89.595  11.583  1.00 41.66 ? 496 ASP B OD2 1 
ATOM   6828  N N   . ASP B 1 459 ? 45.937  91.003  10.880  1.00 39.09 ? 497 ASP B N   1 
ATOM   6829  C CA  . ASP B 1 459 ? 44.496  91.267  10.740  1.00 38.97 ? 497 ASP B CA  1 
ATOM   6830  C C   . ASP B 1 459 ? 43.667  89.985  10.962  1.00 38.88 ? 497 ASP B C   1 
ATOM   6831  O O   . ASP B 1 459 ? 42.587  90.022  11.556  1.00 39.43 ? 497 ASP B O   1 
ATOM   6832  C CB  . ASP B 1 459 ? 44.207  91.872  9.362   1.00 38.93 ? 497 ASP B CB  1 
ATOM   6833  C CG  . ASP B 1 459 ? 44.891  93.216  9.169   1.00 38.76 ? 497 ASP B CG  1 
ATOM   6834  O OD1 . ASP B 1 459 ? 44.759  94.066  10.066  1.00 39.25 ? 497 ASP B OD1 1 
ATOM   6835  O OD2 . ASP B 1 459 ? 45.562  93.428  8.138   1.00 38.21 ? 497 ASP B OD2 1 
ATOM   6836  N N   . VAL B 1 460 ? 44.183  88.849  10.498  1.00 38.27 ? 498 VAL B N   1 
ATOM   6837  C CA  . VAL B 1 460 ? 43.542  87.558  10.745  1.00 37.74 ? 498 VAL B CA  1 
ATOM   6838  C C   . VAL B 1 460 ? 43.686  87.142  12.226  1.00 37.07 ? 498 VAL B C   1 
ATOM   6839  O O   . VAL B 1 460 ? 42.706  86.737  12.859  1.00 36.40 ? 498 VAL B O   1 
ATOM   6840  C CB  . VAL B 1 460 ? 44.110  86.459  9.809   1.00 37.78 ? 498 VAL B CB  1 
ATOM   6841  N N   . GLN B 1 461 ? 44.899  87.278  12.771  1.00 36.71 ? 499 GLN B N   1 
ATOM   6842  C CA  . GLN B 1 461 ? 45.206  86.882  14.157  1.00 36.13 ? 499 GLN B CA  1 
ATOM   6843  C C   . GLN B 1 461 ? 44.331  87.613  15.152  1.00 35.83 ? 499 GLN B C   1 
ATOM   6844  O O   . GLN B 1 461 ? 43.895  87.026  16.136  1.00 36.09 ? 499 GLN B O   1 
ATOM   6845  C CB  . GLN B 1 461 ? 46.681  87.130  14.491  1.00 35.73 ? 499 GLN B CB  1 
ATOM   6846  N N   . LYS B 1 462 ? 44.058  88.885  14.873  1.00 35.57 ? 500 LYS B N   1 
ATOM   6847  C CA  . LYS B 1 462 ? 43.326  89.757  15.800  1.00 35.35 ? 500 LYS B CA  1 
ATOM   6848  C C   . LYS B 1 462 ? 41.828  89.464  15.795  1.00 35.03 ? 500 LYS B C   1 
ATOM   6849  O O   . LYS B 1 462 ? 41.150  89.695  16.779  1.00 34.26 ? 500 LYS B O   1 
ATOM   6850  C CB  . LYS B 1 462 ? 43.603  91.243  15.482  1.00 35.17 ? 500 LYS B CB  1 
ATOM   6851  N N   . SER B 1 463 ? 41.321  88.939  14.686  1.00 35.46 ? 501 SER B N   1 
ATOM   6852  C CA  . SER B 1 463 ? 39.925  88.495  14.605  1.00 35.88 ? 501 SER B CA  1 
ATOM   6853  C C   . SER B 1 463 ? 39.744  86.963  14.795  1.00 36.18 ? 501 SER B C   1 
ATOM   6854  O O   . SER B 1 463 ? 38.645  86.442  14.613  1.00 37.08 ? 501 SER B O   1 
ATOM   6855  C CB  . SER B 1 463 ? 39.329  88.972  13.281  1.00 35.92 ? 501 SER B CB  1 
ATOM   6856  O OG  . SER B 1 463 ? 40.352  89.122  12.308  1.00 36.83 ? 501 SER B OG  1 
ATOM   6857  N N   . THR B 1 464 ? 40.817  86.253  15.173  1.00 36.08 ? 502 THR B N   1 
ATOM   6858  C CA  . THR B 1 464 ? 40.781  84.797  15.459  1.00 35.22 ? 502 THR B CA  1 
ATOM   6859  C C   . THR B 1 464 ? 41.177  84.577  16.935  1.00 35.19 ? 502 THR B C   1 
ATOM   6860  O O   . THR B 1 464 ? 42.002  85.322  17.482  1.00 35.38 ? 502 THR B O   1 
ATOM   6861  C CB  . THR B 1 464 ? 41.738  83.997  14.522  1.00 35.07 ? 502 THR B CB  1 
ATOM   6862  O OG1 . THR B 1 464 ? 41.534  84.387  13.163  1.00 33.84 ? 502 THR B OG1 1 
ATOM   6863  C CG2 . THR B 1 464 ? 41.521  82.502  14.643  1.00 34.18 ? 502 THR B CG2 1 
ATOM   6864  N N   . GLY B 1 465 ? 40.588  83.561  17.567  1.00 34.77 ? 503 GLY B N   1 
ATOM   6865  C CA  . GLY B 1 465 ? 40.677  83.364  19.010  1.00 34.34 ? 503 GLY B CA  1 
ATOM   6866  C C   . GLY B 1 465 ? 41.640  82.286  19.446  1.00 34.42 ? 503 GLY B C   1 
ATOM   6867  O O   . GLY B 1 465 ? 41.561  81.802  20.569  1.00 34.38 ? 503 GLY B O   1 
ATOM   6868  N N   . CYS B 1 466 ? 42.552  81.901  18.560  1.00 34.65 ? 504 CYS B N   1 
ATOM   6869  C CA  . CYS B 1 466 ? 43.546  80.885  18.883  1.00 34.94 ? 504 CYS B CA  1 
ATOM   6870  C C   . CYS B 1 466 ? 44.793  81.048  18.015  1.00 34.98 ? 504 CYS B C   1 
ATOM   6871  O O   . CYS B 1 466 ? 44.833  81.907  17.123  1.00 35.21 ? 504 CYS B O   1 
ATOM   6872  C CB  . CYS B 1 466 ? 42.944  79.469  18.769  1.00 34.81 ? 504 CYS B CB  1 
ATOM   6873  S SG  . CYS B 1 466 ? 42.351  78.951  17.123  1.00 36.04 ? 504 CYS B SG  1 
ATOM   6874  N N   . ASP B 1 467 ? 45.821  80.255  18.313  1.00 34.86 ? 505 ASP B N   1 
ATOM   6875  C CA  . ASP B 1 467 ? 47.024  80.229  17.490  1.00 34.94 ? 505 ASP B CA  1 
ATOM   6876  C C   . ASP B 1 467 ? 46.709  79.483  16.203  1.00 34.61 ? 505 ASP B C   1 
ATOM   6877  O O   . ASP B 1 467 ? 45.730  78.736  16.134  1.00 34.89 ? 505 ASP B O   1 
ATOM   6878  C CB  . ASP B 1 467 ? 48.183  79.540  18.216  1.00 34.94 ? 505 ASP B CB  1 
ATOM   6879  N N   . PHE B 1 468 ? 47.525  79.717  15.181  1.00 34.52 ? 506 PHE B N   1 
ATOM   6880  C CA  . PHE B 1 468 ? 47.480  78.942  13.936  1.00 34.59 ? 506 PHE B CA  1 
ATOM   6881  C C   . PHE B 1 468 ? 48.817  78.966  13.205  1.00 34.65 ? 506 PHE B C   1 
ATOM   6882  O O   . PHE B 1 468 ? 49.564  79.936  13.280  1.00 34.23 ? 506 PHE B O   1 
ATOM   6883  C CB  . PHE B 1 468 ? 46.350  79.407  12.995  1.00 34.20 ? 506 PHE B CB  1 
ATOM   6884  C CG  . PHE B 1 468 ? 46.385  80.874  12.641  1.00 33.57 ? 506 PHE B CG  1 
ATOM   6885  C CD1 . PHE B 1 468 ? 47.180  81.337  11.603  1.00 33.54 ? 506 PHE B CD1 1 
ATOM   6886  C CD2 . PHE B 1 468 ? 45.569  81.780  13.310  1.00 32.52 ? 506 PHE B CD2 1 
ATOM   6887  C CE1 . PHE B 1 468 ? 47.200  82.688  11.261  1.00 33.59 ? 506 PHE B CE1 1 
ATOM   6888  C CE2 . PHE B 1 468 ? 45.571  83.122  12.972  1.00 33.41 ? 506 PHE B CE2 1 
ATOM   6889  C CZ  . PHE B 1 468 ? 46.392  83.584  11.947  1.00 33.49 ? 506 PHE B CZ  1 
ATOM   6890  N N   . ALA B 1 469 ? 49.107  77.877  12.504  1.00 34.83 ? 507 ALA B N   1 
ATOM   6891  C CA  . ALA B 1 469 ? 50.234  77.832  11.587  1.00 35.04 ? 507 ALA B CA  1 
ATOM   6892  C C   . ALA B 1 469 ? 49.902  78.641  10.328  1.00 35.25 ? 507 ALA B C   1 
ATOM   6893  O O   . ALA B 1 469 ? 48.730  78.832  9.989   1.00 34.94 ? 507 ALA B O   1 
ATOM   6894  C CB  . ALA B 1 469 ? 50.567  76.376  11.230  1.00 34.77 ? 507 ALA B CB  1 
ATOM   6895  N N   . VAL B 1 470 ? 50.937  79.166  9.673   1.00 35.99 ? 508 VAL B N   1 
ATOM   6896  C CA  . VAL B 1 470 ? 50.799  79.757  8.337   1.00 36.05 ? 508 VAL B CA  1 
ATOM   6897  C C   . VAL B 1 470 ? 51.468  78.830  7.326   1.00 36.43 ? 508 VAL B C   1 
ATOM   6898  O O   . VAL B 1 470 ? 52.611  78.388  7.524   1.00 36.00 ? 508 VAL B O   1 
ATOM   6899  C CB  . VAL B 1 470 ? 51.441  81.145  8.228   1.00 35.80 ? 508 VAL B CB  1 
ATOM   6900  C CG1 . VAL B 1 470 ? 51.185  81.717  6.840   1.00 35.30 ? 508 VAL B CG1 1 
ATOM   6901  C CG2 . VAL B 1 470 ? 50.893  82.069  9.304   1.00 35.76 ? 508 VAL B CG2 1 
ATOM   6902  N N   . SER B 1 471 ? 50.750  78.530  6.249   1.00 36.94 ? 509 SER B N   1 
ATOM   6903  C CA  . SER B 1 471 ? 51.305  77.724  5.177   1.00 37.29 ? 509 SER B CA  1 
ATOM   6904  C C   . SER B 1 471 ? 52.547  78.421  4.615   1.00 37.63 ? 509 SER B C   1 
ATOM   6905  O O   . SER B 1 471 ? 52.590  79.653  4.565   1.00 37.41 ? 509 SER B O   1 
ATOM   6906  C CB  . SER B 1 471 ? 50.279  77.532  4.074   1.00 37.17 ? 509 SER B CB  1 
ATOM   6907  O OG  . SER B 1 471 ? 50.744  76.573  3.145   1.00 38.10 ? 509 SER B OG  1 
ATOM   6908  N N   . PRO B 1 472 ? 53.575  77.638  4.228   1.00 38.05 ? 510 PRO B N   1 
ATOM   6909  C CA  . PRO B 1 472 ? 54.730  78.215  3.529   1.00 38.14 ? 510 PRO B CA  1 
ATOM   6910  C C   . PRO B 1 472 ? 54.474  78.340  2.016   1.00 38.29 ? 510 PRO B C   1 
ATOM   6911  O O   . PRO B 1 472 ? 55.274  78.947  1.315   1.00 38.28 ? 510 PRO B O   1 
ATOM   6912  C CB  . PRO B 1 472 ? 55.842  77.213  3.821   1.00 38.03 ? 510 PRO B CB  1 
ATOM   6913  C CG  . PRO B 1 472 ? 55.115  75.888  3.879   1.00 38.69 ? 510 PRO B CG  1 
ATOM   6914  C CD  . PRO B 1 472 ? 53.722  76.180  4.418   1.00 37.96 ? 510 PRO B CD  1 
ATOM   6915  N N   . LYS B 1 473 ? 53.373  77.755  1.527   1.00 38.48 ? 511 LYS B N   1 
ATOM   6916  C CA  . LYS B 1 473 ? 52.848  78.024  0.177   1.00 38.58 ? 511 LYS B CA  1 
ATOM   6917  C C   . LYS B 1 473 ? 51.602  78.935  0.232   1.00 38.57 ? 511 LYS B C   1 
ATOM   6918  O O   . LYS B 1 473 ? 50.797  78.931  -0.708  1.00 39.09 ? 511 LYS B O   1 
ATOM   6919  C CB  . LYS B 1 473 ? 52.503  76.709  -0.537  1.00 38.31 ? 511 LYS B CB  1 
ATOM   6920  N N   . LEU B 1 474 ? 51.476  79.710  1.321   1.00 38.25 ? 512 LEU B N   1 
ATOM   6921  C CA  . LEU B 1 474 ? 50.328  80.595  1.605   1.00 38.20 ? 512 LEU B CA  1 
ATOM   6922  C C   . LEU B 1 474 ? 50.027  81.593  0.484   1.00 38.39 ? 512 LEU B C   1 
ATOM   6923  O O   . LEU B 1 474 ? 50.692  82.617  0.359   1.00 38.52 ? 512 LEU B O   1 
ATOM   6924  C CB  . LEU B 1 474 ? 50.589  81.358  2.911   1.00 37.98 ? 512 LEU B CB  1 
ATOM   6925  C CG  . LEU B 1 474 ? 49.697  82.523  3.364   1.00 37.67 ? 512 LEU B CG  1 
ATOM   6926  C CD1 . LEU B 1 474 ? 48.499  82.046  4.161   1.00 35.56 ? 512 LEU B CD1 1 
ATOM   6927  C CD2 . LEU B 1 474 ? 50.522  83.461  4.197   1.00 35.17 ? 512 LEU B CD2 1 
ATOM   6928  N N   . MET B 1 475 ? 49.007  81.285  -0.314  1.00 38.66 ? 513 MET B N   1 
ATOM   6929  C CA  . MET B 1 475 ? 48.581  82.123  -1.437  1.00 38.59 ? 513 MET B CA  1 
ATOM   6930  C C   . MET B 1 475 ? 47.530  83.118  -0.937  1.00 38.58 ? 513 MET B C   1 
ATOM   6931  O O   . MET B 1 475 ? 47.079  83.014  0.207   1.00 37.92 ? 513 MET B O   1 
ATOM   6932  C CB  . MET B 1 475 ? 48.000  81.241  -2.557  1.00 38.65 ? 513 MET B CB  1 
ATOM   6933  N N   . PRO B 1 476 ? 47.135  84.087  -1.788  1.00 38.86 ? 514 PRO B N   1 
ATOM   6934  C CA  . PRO B 1 476 ? 45.988  84.918  -1.435  1.00 39.12 ? 514 PRO B CA  1 
ATOM   6935  C C   . PRO B 1 476 ? 44.701  84.127  -1.672  1.00 39.39 ? 514 PRO B C   1 
ATOM   6936  O O   . PRO B 1 476 ? 44.755  83.027  -2.222  1.00 39.74 ? 514 PRO B O   1 
ATOM   6937  C CB  . PRO B 1 476 ? 46.099  86.128  -2.378  1.00 39.00 ? 514 PRO B CB  1 
ATOM   6938  C CG  . PRO B 1 476 ? 47.115  85.783  -3.409  1.00 38.69 ? 514 PRO B CG  1 
ATOM   6939  C CD  . PRO B 1 476 ? 47.695  84.435  -3.108  1.00 39.06 ? 514 PRO B CD  1 
ATOM   6940  N N   . MET B 1 477 ? 43.559  84.663  -1.252  1.00 39.85 ? 515 MET B N   1 
ATOM   6941  C CA  . MET B 1 477 ? 42.297  83.915  -1.314  1.00 40.14 ? 515 MET B CA  1 
ATOM   6942  C C   . MET B 1 477 ? 41.739  83.834  -2.745  1.00 40.04 ? 515 MET B C   1 
ATOM   6943  O O   . MET B 1 477 ? 41.599  84.851  -3.413  1.00 40.09 ? 515 MET B O   1 
ATOM   6944  C CB  . MET B 1 477 ? 41.259  84.523  -0.364  1.00 40.12 ? 515 MET B CB  1 
ATOM   6945  C CG  . MET B 1 477 ? 39.869  83.887  -0.448  1.00 40.23 ? 515 MET B CG  1 
ATOM   6946  S SD  . MET B 1 477 ? 38.904  84.140  1.049   1.00 40.92 ? 515 MET B SD  1 
ATOM   6947  C CE  . MET B 1 477 ? 37.230  84.108  0.401   1.00 40.07 ? 515 MET B CE  1 
ATOM   6948  N N   . GLN B 1 478 ? 41.416  82.617  -3.192  1.00 40.02 ? 516 GLN B N   1 
ATOM   6949  C CA  . GLN B 1 478 ? 40.888  82.396  -4.536  1.00 39.76 ? 516 GLN B CA  1 
ATOM   6950  C C   . GLN B 1 478 ? 39.449  82.873  -4.644  1.00 39.43 ? 516 GLN B C   1 
ATOM   6951  O O   . GLN B 1 478 ? 38.722  82.940  -3.658  1.00 39.07 ? 516 GLN B O   1 
ATOM   6952  C CB  . GLN B 1 478 ? 40.907  80.915  -4.898  1.00 39.77 ? 516 GLN B CB  1 
ATOM   6953  C CG  . GLN B 1 478 ? 42.253  80.212  -4.892  1.00 40.31 ? 516 GLN B CG  1 
ATOM   6954  C CD  . GLN B 1 478 ? 42.088  78.689  -4.893  1.00 40.62 ? 516 GLN B CD  1 
ATOM   6955  O OE1 . GLN B 1 478 ? 41.610  78.101  -3.920  1.00 41.35 ? 516 GLN B OE1 1 
ATOM   6956  N NE2 . GLN B 1 478 ? 42.471  78.050  -5.993  1.00 42.56 ? 516 GLN B NE2 1 
ATOM   6957  N N   . GLN B 1 479 ? 39.043  83.180  -5.870  1.00 39.52 ? 517 GLN B N   1 
ATOM   6958  C CA  . GLN B 1 479 ? 37.678  83.618  -6.171  1.00 39.54 ? 517 GLN B CA  1 
ATOM   6959  C C   . GLN B 1 479 ? 37.237  83.033  -7.517  1.00 39.45 ? 517 GLN B C   1 
ATOM   6960  O O   . GLN B 1 479 ? 37.910  83.250  -8.529  1.00 39.51 ? 517 GLN B O   1 
ATOM   6961  C CB  . GLN B 1 479 ? 37.615  85.156  -6.234  1.00 39.63 ? 517 GLN B CB  1 
ATOM   6962  C CG  . GLN B 1 479 ? 37.653  85.856  -4.889  1.00 39.15 ? 517 GLN B CG  1 
ATOM   6963  C CD  . GLN B 1 479 ? 36.413  85.592  -4.068  1.00 38.29 ? 517 GLN B CD  1 
ATOM   6964  O OE1 . GLN B 1 479 ? 35.446  86.357  -4.136  1.00 38.11 ? 517 GLN B OE1 1 
ATOM   6965  N NE2 . GLN B 1 479 ? 36.428  84.507  -3.288  1.00 35.91 ? 517 GLN B NE2 1 
ATOM   6966  N N   . ILE B 1 480 ? 36.124  82.299  -7.533  1.00 39.09 ? 518 ILE B N   1 
ATOM   6967  C CA  . ILE B 1 480 ? 35.599  81.764  -8.791  1.00 38.80 ? 518 ILE B CA  1 
ATOM   6968  C C   . ILE B 1 480 ? 35.188  82.892  -9.750  1.00 38.85 ? 518 ILE B C   1 
ATOM   6969  O O   . ILE B 1 480 ? 35.559  82.881  -10.931 1.00 38.98 ? 518 ILE B O   1 
ATOM   6970  C CB  . ILE B 1 480 ? 34.409  80.794  -8.558  1.00 38.56 ? 518 ILE B CB  1 
ATOM   6971  C CG1 . ILE B 1 480 ? 34.302  79.792  -9.720  1.00 38.74 ? 518 ILE B CG1 1 
ATOM   6972  C CG2 . ILE B 1 480 ? 33.107  81.567  -8.342  1.00 37.54 ? 518 ILE B CG2 1 
ATOM   6973  C CD1 . ILE B 1 480 ? 33.941  78.343  -9.284  1.00 37.05 ? 518 ILE B CD1 1 
ATOM   6974  N N   . THR C 1 2   ? 58.892  16.832  50.974  1.00 41.20 ? 40  THR C N   1 
ATOM   6975  C CA  . THR C 1 2   ? 59.143  18.264  51.273  1.00 40.62 ? 40  THR C CA  1 
ATOM   6976  C C   . THR C 1 2   ? 60.649  18.419  51.415  1.00 40.24 ? 40  THR C C   1 
ATOM   6977  O O   . THR C 1 2   ? 61.291  17.641  52.125  1.00 39.48 ? 40  THR C O   1 
ATOM   6978  C CB  . THR C 1 2   ? 58.415  18.704  52.551  1.00 40.65 ? 40  THR C CB  1 
ATOM   6979  O OG1 . THR C 1 2   ? 57.043  18.318  52.451  1.00 40.89 ? 40  THR C OG1 1 
ATOM   6980  C CG2 . THR C 1 2   ? 58.486  20.209  52.744  1.00 39.95 ? 40  THR C CG2 1 
ATOM   6981  N N   . LYS C 1 3   ? 61.225  19.378  50.687  1.00 39.36 ? 41  LYS C N   1 
ATOM   6982  C CA  . LYS C 1 3   ? 62.635  19.692  50.866  1.00 38.78 ? 41  LYS C CA  1 
ATOM   6983  C C   . LYS C 1 3   ? 62.755  20.965  51.711  1.00 38.36 ? 41  LYS C C   1 
ATOM   6984  O O   . LYS C 1 3   ? 62.127  21.978  51.421  1.00 37.24 ? 41  LYS C O   1 
ATOM   6985  C CB  . LYS C 1 3   ? 63.359  19.854  49.524  1.00 38.86 ? 41  LYS C CB  1 
ATOM   6986  C CG  . LYS C 1 3   ? 64.862  20.190  49.745  1.00 38.53 ? 41  LYS C CG  1 
ATOM   6987  C CD  . LYS C 1 3   ? 65.740  20.027  48.519  1.00 38.75 ? 41  LYS C CD  1 
ATOM   6988  C CE  . LYS C 1 3   ? 67.207  20.261  48.875  1.00 39.46 ? 41  LYS C CE  1 
ATOM   6989  N NZ  . LYS C 1 3   ? 67.575  19.565  50.175  1.00 38.51 ? 41  LYS C NZ  1 
ATOM   6990  N N   . PHE C 1 4   ? 63.564  20.898  52.759  1.00 38.09 ? 42  PHE C N   1 
ATOM   6991  C CA  . PHE C 1 4   ? 63.779  22.035  53.643  1.00 38.98 ? 42  PHE C CA  1 
ATOM   6992  C C   . PHE C 1 4   ? 65.000  22.837  53.207  1.00 38.47 ? 42  PHE C C   1 
ATOM   6993  O O   . PHE C 1 4   ? 66.033  22.282  52.821  1.00 38.19 ? 42  PHE C O   1 
ATOM   6994  C CB  . PHE C 1 4   ? 63.948  21.582  55.101  1.00 40.67 ? 42  PHE C CB  1 
ATOM   6995  C CG  . PHE C 1 4   ? 62.683  21.041  55.727  1.00 42.51 ? 42  PHE C CG  1 
ATOM   6996  C CD1 . PHE C 1 4   ? 62.138  19.826  55.311  1.00 46.34 ? 42  PHE C CD1 1 
ATOM   6997  C CD2 . PHE C 1 4   ? 62.043  21.729  56.742  1.00 45.37 ? 42  PHE C CD2 1 
ATOM   6998  C CE1 . PHE C 1 4   ? 60.956  19.318  55.897  1.00 46.19 ? 42  PHE C CE1 1 
ATOM   6999  C CE2 . PHE C 1 4   ? 60.859  21.227  57.324  1.00 45.96 ? 42  PHE C CE2 1 
ATOM   7000  C CZ  . PHE C 1 4   ? 60.326  20.020  56.898  1.00 44.66 ? 42  PHE C CZ  1 
ATOM   7001  N N   . TYR C 1 5   ? 64.868  24.155  53.269  1.00 38.00 ? 43  TYR C N   1 
ATOM   7002  C CA  . TYR C 1 5   ? 65.940  25.066  52.936  1.00 37.21 ? 43  TYR C CA  1 
ATOM   7003  C C   . TYR C 1 5   ? 66.163  26.000  54.105  1.00 37.75 ? 43  TYR C C   1 
ATOM   7004  O O   . TYR C 1 5   ? 65.212  26.395  54.800  1.00 37.77 ? 43  TYR C O   1 
ATOM   7005  C CB  . TYR C 1 5   ? 65.556  25.884  51.716  1.00 36.69 ? 43  TYR C CB  1 
ATOM   7006  C CG  . TYR C 1 5   ? 65.359  25.075  50.467  1.00 35.66 ? 43  TYR C CG  1 
ATOM   7007  C CD1 . TYR C 1 5   ? 64.214  24.352  50.273  1.00 35.59 ? 43  TYR C CD1 1 
ATOM   7008  C CD2 . TYR C 1 5   ? 66.327  25.035  49.469  1.00 36.63 ? 43  TYR C CD2 1 
ATOM   7009  C CE1 . TYR C 1 5   ? 64.011  23.614  49.127  1.00 35.52 ? 43  TYR C CE1 1 
ATOM   7010  C CE2 . TYR C 1 5   ? 66.129  24.285  48.300  1.00 36.03 ? 43  TYR C CE2 1 
ATOM   7011  C CZ  . TYR C 1 5   ? 64.963  23.583  48.147  1.00 35.57 ? 43  TYR C CZ  1 
ATOM   7012  O OH  . TYR C 1 5   ? 64.712  22.841  47.028  1.00 36.16 ? 43  TYR C OH  1 
ATOM   7013  N N   . THR C 1 6   ? 67.423  26.353  54.326  1.00 38.21 ? 44  THR C N   1 
ATOM   7014  C CA  . THR C 1 6   ? 67.784  27.348  55.324  1.00 38.63 ? 44  THR C CA  1 
ATOM   7015  C C   . THR C 1 6   ? 68.024  28.724  54.657  1.00 38.88 ? 44  THR C C   1 
ATOM   7016  O O   . THR C 1 6   ? 67.992  29.769  55.327  1.00 38.98 ? 44  THR C O   1 
ATOM   7017  C CB  . THR C 1 6   ? 69.025  26.895  56.141  1.00 38.52 ? 44  THR C CB  1 
ATOM   7018  O OG1 . THR C 1 6   ? 70.202  26.927  55.324  1.00 38.23 ? 44  THR C OG1 1 
ATOM   7019  C CG2 . THR C 1 6   ? 68.835  25.484  56.660  1.00 38.91 ? 44  THR C CG2 1 
ATOM   7020  N N   . ASP C 1 7   ? 68.250  28.710  53.343  1.00 38.86 ? 45  ASP C N   1 
ATOM   7021  C CA  . ASP C 1 7   ? 68.526  29.914  52.579  1.00 38.98 ? 45  ASP C CA  1 
ATOM   7022  C C   . ASP C 1 7   ? 67.339  30.154  51.639  1.00 39.18 ? 45  ASP C C   1 
ATOM   7023  O O   . ASP C 1 7   ? 67.045  29.324  50.766  1.00 39.55 ? 45  ASP C O   1 
ATOM   7024  C CB  . ASP C 1 7   ? 69.856  29.750  51.834  1.00 39.20 ? 45  ASP C CB  1 
ATOM   7025  C CG  . ASP C 1 7   ? 70.321  31.025  51.120  1.00 39.55 ? 45  ASP C CG  1 
ATOM   7026  O OD1 . ASP C 1 7   ? 69.569  32.017  51.030  1.00 38.68 ? 45  ASP C OD1 1 
ATOM   7027  O OD2 . ASP C 1 7   ? 71.459  31.017  50.613  1.00 39.81 ? 45  ASP C OD2 1 
ATOM   7028  N N   . PRO C 1 8   ? 66.641  31.297  51.824  1.00 38.73 ? 46  PRO C N   1 
ATOM   7029  C CA  . PRO C 1 8   ? 65.449  31.572  51.013  1.00 38.25 ? 46  PRO C CA  1 
ATOM   7030  C C   . PRO C 1 8   ? 65.693  31.691  49.505  1.00 37.59 ? 46  PRO C C   1 
ATOM   7031  O O   . PRO C 1 8   ? 64.857  31.258  48.715  1.00 37.80 ? 46  PRO C O   1 
ATOM   7032  C CB  . PRO C 1 8   ? 64.884  32.879  51.603  1.00 37.88 ? 46  PRO C CB  1 
ATOM   7033  C CG  . PRO C 1 8   ? 65.959  33.456  52.495  1.00 38.82 ? 46  PRO C CG  1 
ATOM   7034  C CD  . PRO C 1 8   ? 66.955  32.380  52.794  1.00 38.51 ? 46  PRO C CD  1 
ATOM   7035  N N   . VAL C 1 9   ? 66.811  32.300  49.126  1.00 37.44 ? 47  VAL C N   1 
ATOM   7036  C CA  . VAL C 1 9   ? 67.223  32.410  47.728  1.00 37.12 ? 47  VAL C CA  1 
ATOM   7037  C C   . VAL C 1 9   ? 67.499  31.051  47.068  1.00 36.76 ? 47  VAL C C   1 
ATOM   7038  O O   . VAL C 1 9   ? 67.231  30.875  45.887  1.00 35.94 ? 47  VAL C O   1 
ATOM   7039  C CB  . VAL C 1 9   ? 68.468  33.314  47.586  1.00 37.14 ? 47  VAL C CB  1 
ATOM   7040  C CG1 . VAL C 1 9   ? 69.022  33.216  46.197  1.00 36.34 ? 47  VAL C CG1 1 
ATOM   7041  C CG2 . VAL C 1 9   ? 68.094  34.755  47.907  1.00 36.82 ? 47  VAL C CG2 1 
ATOM   7042  N N   . GLU C 1 10  ? 68.038  30.109  47.833  1.00 36.45 ? 48  GLU C N   1 
ATOM   7043  C CA  . GLU C 1 10  ? 68.167  28.725  47.378  1.00 36.72 ? 48  GLU C CA  1 
ATOM   7044  C C   . GLU C 1 10  ? 66.814  28.089  47.050  1.00 36.39 ? 48  GLU C C   1 
ATOM   7045  O O   . GLU C 1 10  ? 66.693  27.318  46.108  1.00 36.89 ? 48  GLU C O   1 
ATOM   7046  C CB  . GLU C 1 10  ? 68.845  27.895  48.466  1.00 36.81 ? 48  GLU C CB  1 
ATOM   7047  C CG  . GLU C 1 10  ? 69.601  26.708  47.929  1.00 38.78 ? 48  GLU C CG  1 
ATOM   7048  C CD  . GLU C 1 10  ? 70.906  27.080  47.236  1.00 39.21 ? 48  GLU C CD  1 
ATOM   7049  O OE1 . GLU C 1 10  ? 71.147  28.279  46.959  1.00 37.93 ? 48  GLU C OE1 1 
ATOM   7050  O OE2 . GLU C 1 10  ? 71.704  26.149  46.980  1.00 43.61 ? 48  GLU C OE2 1 
ATOM   7051  N N   . ALA C 1 11  ? 65.815  28.410  47.864  1.00 36.03 ? 49  ALA C N   1 
ATOM   7052  C CA  . ALA C 1 11  ? 64.419  27.954  47.669  1.00 36.32 ? 49  ALA C CA  1 
ATOM   7053  C C   . ALA C 1 11  ? 63.680  28.526  46.427  1.00 35.86 ? 49  ALA C C   1 
ATOM   7054  O O   . ALA C 1 11  ? 62.736  27.911  45.957  1.00 35.55 ? 49  ALA C O   1 
ATOM   7055  C CB  . ALA C 1 11  ? 63.601  28.213  48.955  1.00 35.59 ? 49  ALA C CB  1 
ATOM   7056  N N   . VAL C 1 12  ? 64.116  29.689  45.923  1.00 35.82 ? 50  VAL C N   1 
ATOM   7057  C CA  . VAL C 1 12  ? 63.502  30.391  44.771  1.00 35.34 ? 50  VAL C CA  1 
ATOM   7058  C C   . VAL C 1 12  ? 64.454  30.699  43.597  1.00 36.35 ? 50  VAL C C   1 
ATOM   7059  O O   . VAL C 1 12  ? 64.049  31.327  42.613  1.00 37.05 ? 50  VAL C O   1 
ATOM   7060  C CB  . VAL C 1 12  ? 62.895  31.735  45.216  1.00 35.30 ? 50  VAL C CB  1 
ATOM   7061  C CG1 . VAL C 1 12  ? 61.710  31.471  46.167  1.00 33.28 ? 50  VAL C CG1 1 
ATOM   7062  C CG2 . VAL C 1 12  ? 63.984  32.674  45.826  1.00 32.45 ? 50  VAL C CG2 1 
ATOM   7063  N N   . LYS C 1 13  ? 65.693  30.214  43.686  1.00 36.28 ? 51  LYS C N   1 
ATOM   7064  C CA  . LYS C 1 13  ? 66.785  30.585  42.769  1.00 37.38 ? 51  LYS C CA  1 
ATOM   7065  C C   . LYS C 1 13  ? 66.529  30.191  41.303  1.00 36.92 ? 51  LYS C C   1 
ATOM   7066  O O   . LYS C 1 13  ? 67.164  30.723  40.404  1.00 37.29 ? 51  LYS C O   1 
ATOM   7067  C CB  . LYS C 1 13  ? 68.109  29.993  43.292  1.00 36.70 ? 51  LYS C CB  1 
ATOM   7068  C CG  . LYS C 1 13  ? 69.006  29.349  42.264  1.00 39.34 ? 51  LYS C CG  1 
ATOM   7069  C CD  . LYS C 1 13  ? 70.108  28.480  42.906  1.00 39.17 ? 51  LYS C CD  1 
ATOM   7070  C CE  . LYS C 1 13  ? 69.543  27.097  43.321  1.00 42.45 ? 51  LYS C CE  1 
ATOM   7071  N NZ  . LYS C 1 13  ? 70.353  26.431  44.391  1.00 42.60 ? 51  LYS C NZ  1 
ATOM   7072  N N   . ASP C 1 14  ? 65.596  29.271  41.079  1.00 36.51 ? 52  ASP C N   1 
ATOM   7073  C CA  . ASP C 1 14  ? 65.348  28.687  39.756  1.00 36.07 ? 52  ASP C CA  1 
ATOM   7074  C C   . ASP C 1 14  ? 63.965  29.071  39.173  1.00 35.56 ? 52  ASP C C   1 
ATOM   7075  O O   . ASP C 1 14  ? 63.537  28.492  38.167  1.00 35.40 ? 52  ASP C O   1 
ATOM   7076  C CB  . ASP C 1 14  ? 65.448  27.164  39.863  1.00 36.24 ? 52  ASP C CB  1 
ATOM   7077  C CG  . ASP C 1 14  ? 64.340  26.571  40.704  1.00 38.34 ? 52  ASP C CG  1 
ATOM   7078  O OD1 . ASP C 1 14  ? 63.752  27.314  41.534  1.00 44.11 ? 52  ASP C OD1 1 
ATOM   7079  O OD2 . ASP C 1 14  ? 64.009  25.386  40.500  1.00 39.75 ? 52  ASP C OD2 1 
ATOM   7080  N N   . ILE C 1 15  ? 63.282  30.047  39.785  1.00 34.18 ? 53  ILE C N   1 
ATOM   7081  C CA  . ILE C 1 15  ? 62.196  30.710  39.094  1.00 33.79 ? 53  ILE C CA  1 
ATOM   7082  C C   . ILE C 1 15  ? 62.763  31.425  37.858  1.00 33.88 ? 53  ILE C C   1 
ATOM   7083  O O   . ILE C 1 15  ? 63.636  32.282  37.978  1.00 34.32 ? 53  ILE C O   1 
ATOM   7084  C CB  . ILE C 1 15  ? 61.396  31.715  39.970  1.00 33.84 ? 53  ILE C CB  1 
ATOM   7085  C CG1 . ILE C 1 15  ? 60.981  31.112  41.300  1.00 33.58 ? 53  ILE C CG1 1 
ATOM   7086  C CG2 . ILE C 1 15  ? 60.108  32.130  39.263  1.00 33.25 ? 53  ILE C CG2 1 
ATOM   7087  C CD1 . ILE C 1 15  ? 60.019  32.002  42.095  1.00 33.47 ? 53  ILE C CD1 1 
ATOM   7088  N N   . PRO C 1 16  ? 62.265  31.067  36.659  1.00 33.75 ? 54  PRO C N   1 
ATOM   7089  C CA  . PRO C 1 16  ? 62.739  31.595  35.414  1.00 33.40 ? 54  PRO C CA  1 
ATOM   7090  C C   . PRO C 1 16  ? 62.039  32.927  35.095  1.00 34.17 ? 54  PRO C C   1 
ATOM   7091  O O   . PRO C 1 16  ? 60.934  33.180  35.607  1.00 32.80 ? 54  PRO C O   1 
ATOM   7092  C CB  . PRO C 1 16  ? 62.299  30.523  34.445  1.00 33.25 ? 54  PRO C CB  1 
ATOM   7093  C CG  . PRO C 1 16  ? 60.964  30.168  34.929  1.00 33.43 ? 54  PRO C CG  1 
ATOM   7094  C CD  . PRO C 1 16  ? 61.116  30.169  36.431  1.00 33.80 ? 54  PRO C CD  1 
ATOM   7095  N N   . ASP C 1 17  ? 62.673  33.774  34.282  1.00 34.62 ? 55  ASP C N   1 
ATOM   7096  C CA  . ASP C 1 17  ? 62.046  35.029  33.868  1.00 35.91 ? 55  ASP C CA  1 
ATOM   7097  C C   . ASP C 1 17  ? 60.729  34.677  33.168  1.00 36.15 ? 55  ASP C C   1 
ATOM   7098  O O   . ASP C 1 17  ? 60.647  33.662  32.495  1.00 37.40 ? 55  ASP C O   1 
ATOM   7099  C CB  . ASP C 1 17  ? 62.986  35.832  32.944  1.00 35.81 ? 55  ASP C CB  1 
ATOM   7100  C CG  . ASP C 1 17  ? 64.156  36.488  33.703  1.00 36.87 ? 55  ASP C CG  1 
ATOM   7101  O OD1 . ASP C 1 17  ? 64.026  36.727  34.927  1.00 38.02 ? 55  ASP C OD1 1 
ATOM   7102  O OD2 . ASP C 1 17  ? 65.206  36.780  33.079  1.00 33.81 ? 55  ASP C OD2 1 
ATOM   7103  N N   . GLY C 1 18  ? 59.683  35.451  33.382  1.00 36.17 ? 56  GLY C N   1 
ATOM   7104  C CA  . GLY C 1 18  ? 58.399  35.143  32.770  1.00 36.19 ? 56  GLY C CA  1 
ATOM   7105  C C   . GLY C 1 18  ? 57.493  34.121  33.456  1.00 36.64 ? 56  GLY C C   1 
ATOM   7106  O O   . GLY C 1 18  ? 56.449  33.761  32.907  1.00 37.34 ? 56  GLY C O   1 
ATOM   7107  N N   . ALA C 1 19  ? 57.843  33.670  34.665  1.00 36.47 ? 57  ALA C N   1 
ATOM   7108  C CA  . ALA C 1 19  ? 57.039  32.672  35.386  1.00 35.52 ? 57  ALA C CA  1 
ATOM   7109  C C   . ALA C 1 19  ? 55.730  33.302  35.854  1.00 35.51 ? 57  ALA C C   1 
ATOM   7110  O O   . ALA C 1 19  ? 55.659  34.503  36.095  1.00 34.60 ? 57  ALA C O   1 
ATOM   7111  C CB  . ALA C 1 19  ? 57.807  32.111  36.601  1.00 34.59 ? 57  ALA C CB  1 
ATOM   7112  N N   . THR C 1 20  ? 54.710  32.458  35.976  1.00 35.08 ? 58  THR C N   1 
ATOM   7113  C CA  . THR C 1 20  ? 53.491  32.775  36.678  1.00 35.31 ? 58  THR C CA  1 
ATOM   7114  C C   . THR C 1 20  ? 53.653  32.354  38.115  1.00 34.93 ? 58  THR C C   1 
ATOM   7115  O O   . THR C 1 20  ? 53.925  31.228  38.393  1.00 35.66 ? 58  THR C O   1 
ATOM   7116  C CB  . THR C 1 20  ? 52.302  32.048  36.051  1.00 35.90 ? 58  THR C CB  1 
ATOM   7117  O OG1 . THR C 1 20  ? 52.228  32.429  34.667  1.00 36.64 ? 58  THR C OG1 1 
ATOM   7118  C CG2 . THR C 1 20  ? 51.003  32.375  36.800  1.00 31.91 ? 58  THR C CG2 1 
ATOM   7119  N N   . VAL C 1 21  ? 53.519  33.291  39.031  1.00 35.26 ? 59  VAL C N   1 
ATOM   7120  C CA  . VAL C 1 21  ? 53.795  33.018  40.423  1.00 33.90 ? 59  VAL C CA  1 
ATOM   7121  C C   . VAL C 1 21  ? 52.555  33.436  41.204  1.00 33.94 ? 59  VAL C C   1 
ATOM   7122  O O   . VAL C 1 21  ? 52.102  34.583  41.098  1.00 34.47 ? 59  VAL C O   1 
ATOM   7123  C CB  . VAL C 1 21  ? 55.104  33.747  40.903  1.00 34.08 ? 59  VAL C CB  1 
ATOM   7124  C CG1 . VAL C 1 21  ? 55.425  33.386  42.324  1.00 30.88 ? 59  VAL C CG1 1 
ATOM   7125  C CG2 . VAL C 1 21  ? 56.281  33.388  39.997  1.00 30.04 ? 59  VAL C CG2 1 
ATOM   7126  N N   . LEU C 1 22  ? 51.997  32.486  41.963  1.00 33.79 ? 60  LEU C N   1 
ATOM   7127  C CA  . LEU C 1 22  ? 50.893  32.725  42.867  1.00 32.67 ? 60  LEU C CA  1 
ATOM   7128  C C   . LEU C 1 22  ? 51.486  33.238  44.167  1.00 32.93 ? 60  LEU C C   1 
ATOM   7129  O O   . LEU C 1 22  ? 52.369  32.609  44.721  1.00 34.68 ? 60  LEU C O   1 
ATOM   7130  C CB  . LEU C 1 22  ? 50.152  31.418  43.133  1.00 33.04 ? 60  LEU C CB  1 
ATOM   7131  C CG  . LEU C 1 22  ? 49.886  30.460  41.954  1.00 33.95 ? 60  LEU C CG  1 
ATOM   7132  C CD1 . LEU C 1 22  ? 49.092  29.260  42.437  1.00 32.71 ? 60  LEU C CD1 1 
ATOM   7133  C CD2 . LEU C 1 22  ? 49.196  31.181  40.794  1.00 30.74 ? 60  LEU C CD2 1 
ATOM   7134  N N   . VAL C 1 23  ? 51.031  34.375  44.668  1.00 33.58 ? 61  VAL C N   1 
ATOM   7135  C CA  . VAL C 1 23  ? 51.594  34.937  45.898  1.00 34.11 ? 61  VAL C CA  1 
ATOM   7136  C C   . VAL C 1 23  ? 50.519  35.124  46.939  1.00 33.96 ? 61  VAL C C   1 
ATOM   7137  O O   . VAL C 1 23  ? 49.545  35.825  46.706  1.00 34.84 ? 61  VAL C O   1 
ATOM   7138  C CB  . VAL C 1 23  ? 52.289  36.271  45.641  1.00 34.76 ? 61  VAL C CB  1 
ATOM   7139  C CG1 . VAL C 1 23  ? 52.925  36.802  46.936  1.00 34.57 ? 61  VAL C CG1 1 
ATOM   7140  C CG2 . VAL C 1 23  ? 53.312  36.105  44.550  1.00 32.34 ? 61  VAL C CG2 1 
ATOM   7141  N N   . GLY C 1 24  ? 50.665  34.455  48.074  1.00 33.39 ? 62  GLY C N   1 
ATOM   7142  C CA  . GLY C 1 24  ? 49.634  34.465  49.091  1.00 32.78 ? 62  GLY C CA  1 
ATOM   7143  C C   . GLY C 1 24  ? 49.502  35.824  49.745  1.00 32.58 ? 62  GLY C C   1 
ATOM   7144  O O   . GLY C 1 24  ? 50.380  36.652  49.618  1.00 32.33 ? 62  GLY C O   1 
ATOM   7145  N N   . GLY C 1 25  ? 48.384  36.041  50.448  1.00 32.22 ? 63  GLY C N   1 
ATOM   7146  C CA  . GLY C 1 25  ? 48.134  37.248  51.209  1.00 31.95 ? 63  GLY C CA  1 
ATOM   7147  C C   . GLY C 1 25  ? 46.814  37.957  50.860  1.00 32.23 ? 63  GLY C C   1 
ATOM   7148  O O   . GLY C 1 25  ? 46.297  37.909  49.720  1.00 30.31 ? 63  GLY C O   1 
ATOM   7149  N N   . PHE C 1 26  ? 46.299  38.644  51.869  1.00 32.93 ? 64  PHE C N   1 
ATOM   7150  C CA  . PHE C 1 26  ? 45.137  39.514  51.748  1.00 33.25 ? 64  PHE C CA  1 
ATOM   7151  C C   . PHE C 1 26  ? 45.591  40.767  52.439  1.00 33.14 ? 64  PHE C C   1 
ATOM   7152  O O   . PHE C 1 26  ? 45.891  40.747  53.622  1.00 32.50 ? 64  PHE C O   1 
ATOM   7153  C CB  . PHE C 1 26  ? 43.954  38.879  52.427  1.00 34.29 ? 64  PHE C CB  1 
ATOM   7154  C CG  . PHE C 1 26  ? 42.708  39.713  52.406  1.00 35.32 ? 64  PHE C CG  1 
ATOM   7155  C CD1 . PHE C 1 26  ? 41.789  39.580  51.364  1.00 36.75 ? 64  PHE C CD1 1 
ATOM   7156  C CD2 . PHE C 1 26  ? 42.459  40.622  53.417  1.00 34.90 ? 64  PHE C CD2 1 
ATOM   7157  C CE1 . PHE C 1 26  ? 40.664  40.367  51.321  1.00 34.84 ? 64  PHE C CE1 1 
ATOM   7158  C CE2 . PHE C 1 26  ? 41.333  41.424  53.384  1.00 35.49 ? 64  PHE C CE2 1 
ATOM   7159  C CZ  . PHE C 1 26  ? 40.425  41.277  52.325  1.00 34.59 ? 64  PHE C CZ  1 
ATOM   7160  N N   . GLY C 1 27  ? 45.710  41.840  51.678  1.00 33.55 ? 65  GLY C N   1 
ATOM   7161  C CA  . GLY C 1 27  ? 46.287  43.052  52.172  1.00 34.61 ? 65  GLY C CA  1 
ATOM   7162  C C   . GLY C 1 27  ? 47.711  42.711  52.564  1.00 35.34 ? 65  GLY C C   1 
ATOM   7163  O O   . GLY C 1 27  ? 48.421  42.138  51.759  1.00 35.22 ? 65  GLY C O   1 
ATOM   7164  N N   . LEU C 1 28  ? 48.102  43.071  53.804  1.00 36.27 ? 66  LEU C N   1 
ATOM   7165  C CA  . LEU C 1 28  ? 49.425  42.736  54.369  1.00 35.57 ? 66  LEU C CA  1 
ATOM   7166  C C   . LEU C 1 28  ? 49.345  41.501  55.250  1.00 35.87 ? 66  LEU C C   1 
ATOM   7167  O O   . LEU C 1 28  ? 50.339  41.085  55.835  1.00 35.56 ? 66  LEU C O   1 
ATOM   7168  C CB  . LEU C 1 28  ? 50.024  43.938  55.136  1.00 35.66 ? 66  LEU C CB  1 
ATOM   7169  C CG  . LEU C 1 28  ? 50.273  45.229  54.315  1.00 35.57 ? 66  LEU C CG  1 
ATOM   7170  C CD1 . LEU C 1 28  ? 51.001  46.283  55.141  1.00 33.20 ? 66  LEU C CD1 1 
ATOM   7171  C CD2 . LEU C 1 28  ? 51.069  44.962  52.997  1.00 32.68 ? 66  LEU C CD2 1 
ATOM   7172  N N   . CYS C 1 29  ? 48.181  40.852  55.279  1.00 36.44 ? 67  CYS C N   1 
ATOM   7173  C CA  . CYS C 1 29  ? 47.939  39.734  56.162  1.00 36.15 ? 67  CYS C CA  1 
ATOM   7174  C C   . CYS C 1 29  ? 48.211  38.386  55.460  1.00 36.03 ? 67  CYS C C   1 
ATOM   7175  O O   . CYS C 1 29  ? 47.538  38.046  54.499  1.00 36.68 ? 67  CYS C O   1 
ATOM   7176  C CB  . CYS C 1 29  ? 46.488  39.829  56.692  1.00 36.07 ? 67  CYS C CB  1 
ATOM   7177  S SG  . CYS C 1 29  ? 46.026  38.497  57.791  1.00 36.83 ? 67  CYS C SG  1 
ATOM   7178  N N   . GLY C 1 30  ? 49.207  37.635  55.935  1.00 35.53 ? 68  GLY C N   1 
ATOM   7179  C CA  . GLY C 1 30  ? 49.629  36.365  55.339  1.00 35.34 ? 68  GLY C CA  1 
ATOM   7180  C C   . GLY C 1 30  ? 50.614  36.476  54.174  1.00 35.38 ? 68  GLY C C   1 
ATOM   7181  O O   . GLY C 1 30  ? 50.557  35.702  53.244  1.00 35.55 ? 68  GLY C O   1 
ATOM   7182  N N   . ILE C 1 31  ? 51.512  37.445  54.244  1.00 34.72 ? 69  ILE C N   1 
ATOM   7183  C CA  . ILE C 1 31  ? 52.412  37.838  53.164  1.00 35.13 ? 69  ILE C CA  1 
ATOM   7184  C C   . ILE C 1 31  ? 53.706  37.007  53.281  1.00 34.44 ? 69  ILE C C   1 
ATOM   7185  O O   . ILE C 1 31  ? 54.305  36.992  54.346  1.00 35.30 ? 69  ILE C O   1 
ATOM   7186  C CB  . ILE C 1 31  ? 52.699  39.391  53.336  1.00 34.41 ? 69  ILE C CB  1 
ATOM   7187  C CG1 . ILE C 1 31  ? 51.450  40.187  52.948  1.00 35.26 ? 69  ILE C CG1 1 
ATOM   7188  C CG2 . ILE C 1 31  ? 53.923  39.910  52.612  1.00 36.50 ? 69  ILE C CG2 1 
ATOM   7189  C CD1 . ILE C 1 31  ? 50.856  39.877  51.617  1.00 31.36 ? 69  ILE C CD1 1 
ATOM   7190  N N   . PRO C 1 32  ? 54.111  36.278  52.221  1.00 33.07 ? 70  PRO C N   1 
ATOM   7191  C CA  . PRO C 1 32  ? 55.434  35.589  52.254  1.00 33.05 ? 70  PRO C CA  1 
ATOM   7192  C C   . PRO C 1 32  ? 56.618  36.569  52.141  1.00 32.98 ? 70  PRO C C   1 
ATOM   7193  O O   . PRO C 1 32  ? 57.239  36.657  51.103  1.00 32.72 ? 70  PRO C O   1 
ATOM   7194  C CB  . PRO C 1 32  ? 55.376  34.668  51.020  1.00 33.07 ? 70  PRO C CB  1 
ATOM   7195  C CG  . PRO C 1 32  ? 54.421  35.348  50.074  1.00 31.98 ? 70  PRO C CG  1 
ATOM   7196  C CD  . PRO C 1 32  ? 53.400  36.039  50.951  1.00 32.94 ? 70  PRO C CD  1 
ATOM   7197  N N   . GLU C 1 33  ? 56.921  37.283  53.217  1.00 33.48 ? 71  GLU C N   1 
ATOM   7198  C CA  . GLU C 1 33  ? 57.802  38.421  53.147  1.00 33.74 ? 71  GLU C CA  1 
ATOM   7199  C C   . GLU C 1 33  ? 59.281  38.075  52.917  1.00 33.49 ? 71  GLU C C   1 
ATOM   7200  O O   . GLU C 1 33  ? 59.981  38.804  52.220  1.00 32.38 ? 71  GLU C O   1 
ATOM   7201  C CB  . GLU C 1 33  ? 57.600  39.362  54.352  1.00 34.27 ? 71  GLU C CB  1 
ATOM   7202  C CG  . GLU C 1 33  ? 57.769  38.758  55.712  1.00 35.48 ? 71  GLU C CG  1 
ATOM   7203  C CD  . GLU C 1 33  ? 57.604  39.801  56.809  1.00 36.30 ? 71  GLU C CD  1 
ATOM   7204  O OE1 . GLU C 1 33  ? 58.602  40.524  57.110  1.00 39.41 ? 71  GLU C OE1 1 
ATOM   7205  O OE2 . GLU C 1 33  ? 56.478  39.882  57.364  1.00 36.52 ? 71  GLU C OE2 1 
ATOM   7206  N N   . ASN C 1 34  ? 59.724  36.952  53.479  1.00 33.31 ? 72  ASN C N   1 
ATOM   7207  C CA  . ASN C 1 34  ? 61.095  36.473  53.307  1.00 32.92 ? 72  ASN C CA  1 
ATOM   7208  C C   . ASN C 1 34  ? 61.318  35.963  51.868  1.00 32.54 ? 72  ASN C C   1 
ATOM   7209  O O   . ASN C 1 34  ? 62.378  36.174  51.296  1.00 31.80 ? 72  ASN C O   1 
ATOM   7210  C CB  . ASN C 1 34  ? 61.407  35.356  54.327  1.00 33.10 ? 72  ASN C CB  1 
ATOM   7211  C CG  . ASN C 1 34  ? 61.540  35.877  55.781  1.00 34.38 ? 72  ASN C CG  1 
ATOM   7212  O OD1 . ASN C 1 34  ? 62.595  36.393  56.174  1.00 36.45 ? 72  ASN C OD1 1 
ATOM   7213  N ND2 . ASN C 1 34  ? 60.491  35.703  56.579  1.00 33.28 ? 72  ASN C ND2 1 
ATOM   7214  N N   . LEU C 1 35  ? 60.310  35.304  51.294  1.00 32.30 ? 73  LEU C N   1 
ATOM   7215  C CA  . LEU C 1 35  ? 60.369  34.808  49.909  1.00 32.73 ? 73  LEU C CA  1 
ATOM   7216  C C   . LEU C 1 35  ? 60.279  35.927  48.876  1.00 33.45 ? 73  LEU C C   1 
ATOM   7217  O O   . LEU C 1 35  ? 60.912  35.840  47.816  1.00 34.11 ? 73  LEU C O   1 
ATOM   7218  C CB  . LEU C 1 35  ? 59.276  33.774  49.637  1.00 32.32 ? 73  LEU C CB  1 
ATOM   7219  C CG  . LEU C 1 35  ? 59.341  32.464  50.443  1.00 32.25 ? 73  LEU C CG  1 
ATOM   7220  C CD1 . LEU C 1 35  ? 58.180  31.634  50.050  1.00 30.17 ? 73  LEU C CD1 1 
ATOM   7221  C CD2 . LEU C 1 35  ? 60.729  31.719  50.239  1.00 32.17 ? 73  LEU C CD2 1 
ATOM   7222  N N   . ILE C 1 36  ? 59.509  36.973  49.174  1.00 34.52 ? 74  ILE C N   1 
ATOM   7223  C CA  . ILE C 1 36  ? 59.454  38.158  48.296  1.00 34.51 ? 74  ILE C CA  1 
ATOM   7224  C C   . ILE C 1 36  ? 60.825  38.843  48.287  1.00 34.33 ? 74  ILE C C   1 
ATOM   7225  O O   . ILE C 1 36  ? 61.293  39.339  47.254  1.00 34.15 ? 74  ILE C O   1 
ATOM   7226  C CB  . ILE C 1 36  ? 58.293  39.158  48.687  1.00 35.23 ? 74  ILE C CB  1 
ATOM   7227  C CG1 . ILE C 1 36  ? 56.934  38.577  48.301  1.00 35.33 ? 74  ILE C CG1 1 
ATOM   7228  C CG2 . ILE C 1 36  ? 58.552  40.558  48.031  1.00 33.57 ? 74  ILE C CG2 1 
ATOM   7229  C CD1 . ILE C 1 36  ? 55.678  39.078  49.110  1.00 35.19 ? 74  ILE C CD1 1 
ATOM   7230  N N   . ASP C 1 37  ? 61.479  38.843  49.445  1.00 34.44 ? 75  ASP C N   1 
ATOM   7231  C CA  . ASP C 1 37  ? 62.782  39.443  49.598  1.00 34.13 ? 75  ASP C CA  1 
ATOM   7232  C C   . ASP C 1 37  ? 63.837  38.663  48.793  1.00 33.53 ? 75  ASP C C   1 
ATOM   7233  O O   . ASP C 1 37  ? 64.736  39.259  48.184  1.00 32.62 ? 75  ASP C O   1 
ATOM   7234  C CB  . ASP C 1 37  ? 63.166  39.478  51.076  1.00 35.20 ? 75  ASP C CB  1 
ATOM   7235  C CG  . ASP C 1 37  ? 64.361  40.364  51.341  1.00 39.29 ? 75  ASP C CG  1 
ATOM   7236  O OD1 . ASP C 1 37  ? 64.125  41.584  51.445  1.00 45.75 ? 75  ASP C OD1 1 
ATOM   7237  O OD2 . ASP C 1 37  ? 65.543  39.876  51.416  1.00 48.13 ? 75  ASP C OD2 1 
ATOM   7238  N N   . ALA C 1 38  ? 63.713  37.336  48.786  1.00 32.62 ? 76  ALA C N   1 
ATOM   7239  C CA  . ALA C 1 38  ? 64.588  36.495  47.995  1.00 31.92 ? 76  ALA C CA  1 
ATOM   7240  C C   . ALA C 1 38  ? 64.430  36.851  46.519  1.00 31.48 ? 76  ALA C C   1 
ATOM   7241  O O   . ALA C 1 38  ? 65.426  37.036  45.825  1.00 31.08 ? 76  ALA C O   1 
ATOM   7242  C CB  . ALA C 1 38  ? 64.296  35.029  48.254  1.00 31.67 ? 76  ALA C CB  1 
ATOM   7243  N N   . LEU C 1 39  ? 63.201  36.996  46.031  1.00 31.30 ? 77  LEU C N   1 
ATOM   7244  C CA  . LEU C 1 39  ? 63.018  37.379  44.619  1.00 31.32 ? 77  LEU C CA  1 
ATOM   7245  C C   . LEU C 1 39  ? 63.690  38.708  44.254  1.00 32.52 ? 77  LEU C C   1 
ATOM   7246  O O   . LEU C 1 39  ? 64.210  38.863  43.143  1.00 31.62 ? 77  LEU C O   1 
ATOM   7247  C CB  . LEU C 1 39  ? 61.541  37.437  44.239  1.00 31.57 ? 77  LEU C CB  1 
ATOM   7248  C CG  . LEU C 1 39  ? 60.861  36.206  43.662  1.00 29.09 ? 77  LEU C CG  1 
ATOM   7249  C CD1 . LEU C 1 39  ? 61.281  35.026  44.450  1.00 30.74 ? 77  LEU C CD1 1 
ATOM   7250  C CD2 . LEU C 1 39  ? 59.369  36.407  43.748  1.00 31.58 ? 77  LEU C CD2 1 
ATOM   7251  N N   . LEU C 1 40  ? 63.627  39.680  45.166  1.00 33.85 ? 78  LEU C N   1 
ATOM   7252  C CA  . LEU C 1 40  ? 64.358  40.948  45.014  1.00 34.69 ? 78  LEU C CA  1 
ATOM   7253  C C   . LEU C 1 40  ? 65.871  40.717  44.762  1.00 35.53 ? 78  LEU C C   1 
ATOM   7254  O O   . LEU C 1 40  ? 66.489  41.394  43.927  1.00 35.47 ? 78  LEU C O   1 
ATOM   7255  C CB  . LEU C 1 40  ? 64.177  41.837  46.258  1.00 35.00 ? 78  LEU C CB  1 
ATOM   7256  C CG  . LEU C 1 40  ? 62.791  42.385  46.620  1.00 33.75 ? 78  LEU C CG  1 
ATOM   7257  C CD1 . LEU C 1 40  ? 62.955  43.195  47.905  1.00 33.33 ? 78  LEU C CD1 1 
ATOM   7258  C CD2 . LEU C 1 40  ? 62.288  43.248  45.496  1.00 33.44 ? 78  LEU C CD2 1 
ATOM   7259  N N   . LYS C 1 41  ? 66.457  39.763  45.490  1.00 36.10 ? 79  LYS C N   1 
ATOM   7260  C CA  . LYS C 1 41  ? 67.861  39.367  45.295  1.00 36.59 ? 79  LYS C CA  1 
ATOM   7261  C C   . LYS C 1 41  ? 68.182  38.581  44.019  1.00 36.17 ? 79  LYS C C   1 
ATOM   7262  O O   . LYS C 1 41  ? 69.226  38.781  43.437  1.00 36.39 ? 79  LYS C O   1 
ATOM   7263  C CB  . LYS C 1 41  ? 68.350  38.569  46.499  1.00 37.18 ? 79  LYS C CB  1 
ATOM   7264  C CG  . LYS C 1 41  ? 68.679  39.465  47.657  1.00 39.63 ? 79  LYS C CG  1 
ATOM   7265  C CD  . LYS C 1 41  ? 68.235  38.897  48.980  1.00 41.61 ? 79  LYS C CD  1 
ATOM   7266  C CE  . LYS C 1 41  ? 68.590  39.858  50.090  1.00 42.37 ? 79  LYS C CE  1 
ATOM   7267  N NZ  . LYS C 1 41  ? 68.937  39.098  51.305  1.00 44.42 ? 79  LYS C NZ  1 
ATOM   7268  N N   . THR C 1 42  ? 67.323  37.668  43.601  1.00 36.35 ? 80  THR C N   1 
ATOM   7269  C CA  . THR C 1 42  ? 67.605  36.903  42.398  1.00 36.15 ? 80  THR C CA  1 
ATOM   7270  C C   . THR C 1 42  ? 67.284  37.763  41.200  1.00 36.05 ? 80  THR C C   1 
ATOM   7271  O O   . THR C 1 42  ? 67.816  37.528  40.120  1.00 34.75 ? 80  THR C O   1 
ATOM   7272  C CB  . THR C 1 42  ? 66.767  35.633  42.307  1.00 35.99 ? 80  THR C CB  1 
ATOM   7273  O OG1 . THR C 1 42  ? 65.397  36.007  42.191  1.00 37.20 ? 80  THR C OG1 1 
ATOM   7274  C CG2 . THR C 1 42  ? 66.989  34.743  43.531  1.00 35.51 ? 80  THR C CG2 1 
ATOM   7275  N N   . GLY C 1 43  ? 66.377  38.731  41.380  1.00 35.82 ? 81  GLY C N   1 
ATOM   7276  C CA  . GLY C 1 43  ? 66.112  39.721  40.337  1.00 36.19 ? 81  GLY C CA  1 
ATOM   7277  C C   . GLY C 1 43  ? 65.235  39.232  39.189  1.00 36.32 ? 81  GLY C C   1 
ATOM   7278  O O   . GLY C 1 43  ? 65.063  39.938  38.200  1.00 37.38 ? 81  GLY C O   1 
ATOM   7279  N N   . VAL C 1 44  ? 64.663  38.042  39.318  1.00 35.98 ? 82  VAL C N   1 
ATOM   7280  C CA  . VAL C 1 44  ? 63.784  37.491  38.293  1.00 35.63 ? 82  VAL C CA  1 
ATOM   7281  C C   . VAL C 1 44  ? 62.640  38.454  37.883  1.00 35.70 ? 82  VAL C C   1 
ATOM   7282  O O   . VAL C 1 44  ? 61.857  38.952  38.734  1.00 36.34 ? 82  VAL C O   1 
ATOM   7283  C CB  . VAL C 1 44  ? 63.239  36.114  38.720  1.00 34.87 ? 82  VAL C CB  1 
ATOM   7284  C CG1 . VAL C 1 44  ? 62.189  36.257  39.795  1.00 36.03 ? 82  VAL C CG1 1 
ATOM   7285  C CG2 . VAL C 1 44  ? 62.724  35.376  37.524  1.00 34.41 ? 82  VAL C CG2 1 
ATOM   7286  N N   . LYS C 1 45  ? 62.570  38.685  36.567  1.00 35.54 ? 83  LYS C N   1 
ATOM   7287  C CA  . LYS C 1 45  ? 61.688  39.657  35.913  1.00 35.13 ? 83  LYS C CA  1 
ATOM   7288  C C   . LYS C 1 45  ? 60.654  39.024  34.965  1.00 35.42 ? 83  LYS C C   1 
ATOM   7289  O O   . LYS C 1 45  ? 60.628  37.784  34.780  1.00 34.69 ? 83  LYS C O   1 
ATOM   7290  C CB  . LYS C 1 45  ? 62.504  40.714  35.161  1.00 35.34 ? 83  LYS C CB  1 
ATOM   7291  C CG  . LYS C 1 45  ? 63.693  40.226  34.294  1.00 34.32 ? 83  LYS C CG  1 
ATOM   7292  N N   . GLY C 1 46  ? 59.755  39.881  34.440  1.00 35.26 ? 84  GLY C N   1 
ATOM   7293  C CA  . GLY C 1 46  ? 58.719  39.458  33.487  1.00 34.90 ? 84  GLY C CA  1 
ATOM   7294  C C   . GLY C 1 46  ? 57.565  38.651  34.072  1.00 34.40 ? 84  GLY C C   1 
ATOM   7295  O O   . GLY C 1 46  ? 56.735  38.106  33.324  1.00 34.99 ? 84  GLY C O   1 
ATOM   7296  N N   . LEU C 1 47  ? 57.467  38.611  35.398  1.00 34.17 ? 85  LEU C N   1 
ATOM   7297  C CA  . LEU C 1 47  ? 56.538  37.700  36.108  1.00 33.51 ? 85  LEU C CA  1 
ATOM   7298  C C   . LEU C 1 47  ? 55.075  38.060  35.924  1.00 33.46 ? 85  LEU C C   1 
ATOM   7299  O O   . LEU C 1 47  ? 54.746  39.250  35.853  1.00 33.28 ? 85  LEU C O   1 
ATOM   7300  C CB  . LEU C 1 47  ? 56.832  37.712  37.613  1.00 34.00 ? 85  LEU C CB  1 
ATOM   7301  C CG  . LEU C 1 47  ? 58.230  37.331  38.111  1.00 34.36 ? 85  LEU C CG  1 
ATOM   7302  C CD1 . LEU C 1 47  ? 58.243  37.481  39.635  1.00 36.12 ? 85  LEU C CD1 1 
ATOM   7303  C CD2 . LEU C 1 47  ? 58.620  35.902  37.688  1.00 32.41 ? 85  LEU C CD2 1 
ATOM   7304  N N   . THR C 1 48  ? 54.211  37.036  35.828  1.00 33.22 ? 86  THR C N   1 
ATOM   7305  C CA  . THR C 1 48  ? 52.761  37.208  35.967  1.00 34.48 ? 86  THR C CA  1 
ATOM   7306  C C   . THR C 1 48  ? 52.411  36.844  37.412  1.00 34.70 ? 86  THR C C   1 
ATOM   7307  O O   . THR C 1 48  ? 52.366  35.648  37.761  1.00 35.68 ? 86  THR C O   1 
ATOM   7308  C CB  . THR C 1 48  ? 51.888  36.278  35.025  1.00 34.48 ? 86  THR C CB  1 
ATOM   7309  O OG1 . THR C 1 48  ? 52.076  36.620  33.639  1.00 34.17 ? 86  THR C OG1 1 
ATOM   7310  C CG2 . THR C 1 48  ? 50.426  36.424  35.343  1.00 32.58 ? 86  THR C CG2 1 
ATOM   7311  N N   . ALA C 1 49  ? 52.184  37.851  38.244  1.00 33.88 ? 87  ALA C N   1 
ATOM   7312  C CA  . ALA C 1 49  ? 51.870  37.646  39.657  1.00 33.90 ? 87  ALA C CA  1 
ATOM   7313  C C   . ALA C 1 49  ? 50.365  37.443  39.889  1.00 33.88 ? 87  ALA C C   1 
ATOM   7314  O O   . ALA C 1 49  ? 49.574  38.350  39.675  1.00 35.35 ? 87  ALA C O   1 
ATOM   7315  C CB  . ALA C 1 49  ? 52.362  38.851  40.469  1.00 32.71 ? 87  ALA C CB  1 
ATOM   7316  N N   . VAL C 1 50  ? 49.961  36.263  40.349  1.00 34.61 ? 88  VAL C N   1 
ATOM   7317  C CA  . VAL C 1 50  ? 48.583  36.067  40.846  1.00 33.56 ? 88  VAL C CA  1 
ATOM   7318  C C   . VAL C 1 50  ? 48.518  36.337  42.352  1.00 33.46 ? 88  VAL C C   1 
ATOM   7319  O O   . VAL C 1 50  ? 49.013  35.583  43.152  1.00 32.90 ? 88  VAL C O   1 
ATOM   7320  C CB  . VAL C 1 50  ? 48.018  34.668  40.479  1.00 33.27 ? 88  VAL C CB  1 
ATOM   7321  C CG1 . VAL C 1 50  ? 46.502  34.610  40.853  1.00 30.63 ? 88  VAL C CG1 1 
ATOM   7322  C CG2 . VAL C 1 50  ? 48.247  34.437  39.008  1.00 31.10 ? 88  VAL C CG2 1 
ATOM   7323  N N   . SER C 1 51  ? 47.928  37.470  42.705  1.00 33.74 ? 89  SER C N   1 
ATOM   7324  C CA  . SER C 1 51  ? 47.975  37.975  44.047  1.00 33.84 ? 89  SER C CA  1 
ATOM   7325  C C   . SER C 1 51  ? 46.705  38.721  44.237  1.00 33.80 ? 89  SER C C   1 
ATOM   7326  O O   . SER C 1 51  ? 46.396  39.601  43.456  1.00 35.21 ? 89  SER C O   1 
ATOM   7327  C CB  . SER C 1 51  ? 49.183  38.921  44.228  1.00 34.58 ? 89  SER C CB  1 
ATOM   7328  O OG  . SER C 1 51  ? 49.415  39.300  45.591  1.00 35.66 ? 89  SER C OG  1 
ATOM   7329  N N   . ASN C 1 52  ? 45.945  38.405  45.264  1.00 34.09 ? 90  ASN C N   1 
ATOM   7330  C CA  . ASN C 1 52  ? 44.700  39.125  45.487  1.00 33.63 ? 90  ASN C CA  1 
ATOM   7331  C C   . ASN C 1 52  ? 44.835  40.622  45.478  1.00 34.01 ? 90  ASN C C   1 
ATOM   7332  O O   . ASN C 1 52  ? 44.037  41.333  44.885  1.00 33.92 ? 90  ASN C O   1 
ATOM   7333  C CB  . ASN C 1 52  ? 44.078  38.737  46.807  1.00 34.28 ? 90  ASN C CB  1 
ATOM   7334  C CG  . ASN C 1 52  ? 42.678  39.282  46.931  1.00 34.21 ? 90  ASN C CG  1 
ATOM   7335  O OD1 . ASN C 1 52  ? 41.868  39.115  46.003  1.00 36.22 ? 90  ASN C OD1 1 
ATOM   7336  N ND2 . ASN C 1 52  ? 42.407  39.995  48.005  1.00 32.68 ? 90  ASN C ND2 1 
ATOM   7337  N N   . ASN C 1 53  ? 45.859  41.102  46.160  1.00 34.96 ? 91  ASN C N   1 
ATOM   7338  C CA  . ASN C 1 53  ? 46.143  42.520  46.264  1.00 34.86 ? 91  ASN C CA  1 
ATOM   7339  C C   . ASN C 1 53  ? 47.571  42.791  45.781  1.00 35.97 ? 91  ASN C C   1 
ATOM   7340  O O   . ASN C 1 53  ? 48.292  41.862  45.416  1.00 36.08 ? 91  ASN C O   1 
ATOM   7341  C CB  . ASN C 1 53  ? 45.965  42.939  47.716  1.00 35.03 ? 91  ASN C CB  1 
ATOM   7342  C CG  . ASN C 1 53  ? 44.586  42.618  48.239  1.00 34.99 ? 91  ASN C CG  1 
ATOM   7343  O OD1 . ASN C 1 53  ? 44.402  41.749  49.124  1.00 33.91 ? 91  ASN C OD1 1 
ATOM   7344  N ND2 . ASN C 1 53  ? 43.596  43.225  47.619  1.00 31.17 ? 91  ASN C ND2 1 
ATOM   7345  N N   . ALA C 1 54  ? 47.944  44.066  45.767  1.00 37.57 ? 92  ALA C N   1 
ATOM   7346  C CA  . ALA C 1 54  ? 49.259  44.545  45.296  1.00 38.20 ? 92  ALA C CA  1 
ATOM   7347  C C   . ALA C 1 54  ? 50.110  45.063  46.472  1.00 38.47 ? 92  ALA C C   1 
ATOM   7348  O O   . ALA C 1 54  ? 50.942  45.924  46.288  1.00 38.56 ? 92  ALA C O   1 
ATOM   7349  C CB  . ALA C 1 54  ? 49.074  45.662  44.258  1.00 37.15 ? 92  ALA C CB  1 
ATOM   7350  N N   . GLY C 1 55  ? 49.881  44.521  47.669  1.00 39.40 ? 93  GLY C N   1 
ATOM   7351  C CA  . GLY C 1 55  ? 50.515  44.989  48.902  1.00 39.04 ? 93  GLY C CA  1 
ATOM   7352  C C   . GLY C 1 55  ? 50.251  46.446  49.186  1.00 39.02 ? 93  GLY C C   1 
ATOM   7353  O O   . GLY C 1 55  ? 49.133  46.946  48.917  1.00 39.20 ? 93  GLY C O   1 
ATOM   7354  N N   . VAL C 1 56  ? 51.254  47.101  49.782  1.00 37.70 ? 94  VAL C N   1 
ATOM   7355  C CA  . VAL C 1 56  ? 51.353  48.541  49.800  1.00 38.27 ? 94  VAL C CA  1 
ATOM   7356  C C   . VAL C 1 56  ? 52.674  48.900  49.135  1.00 38.97 ? 94  VAL C C   1 
ATOM   7357  O O   . VAL C 1 56  ? 53.430  48.031  48.709  1.00 38.53 ? 94  VAL C O   1 
ATOM   7358  C CB  . VAL C 1 56  ? 51.288  49.208  51.213  1.00 37.43 ? 94  VAL C CB  1 
ATOM   7359  C CG1 . VAL C 1 56  ? 49.913  49.121  51.790  1.00 38.03 ? 94  VAL C CG1 1 
ATOM   7360  C CG2 . VAL C 1 56  ? 52.350  48.650  52.148  1.00 37.75 ? 94  VAL C CG2 1 
ATOM   7361  N N   . ASP C 1 57  ? 52.924  50.189  49.003  1.00 40.48 ? 95  ASP C N   1 
ATOM   7362  C CA  . ASP C 1 57  ? 54.196  50.666  48.437  1.00 41.99 ? 95  ASP C CA  1 
ATOM   7363  C C   . ASP C 1 57  ? 55.481  49.997  48.947  1.00 42.33 ? 95  ASP C C   1 
ATOM   7364  O O   . ASP C 1 57  ? 56.233  49.420  48.149  1.00 42.82 ? 95  ASP C O   1 
ATOM   7365  C CB  . ASP C 1 57  ? 54.310  52.167  48.626  1.00 42.52 ? 95  ASP C CB  1 
ATOM   7366  C CG  . ASP C 1 57  ? 53.760  52.940  47.433  1.00 44.31 ? 95  ASP C CG  1 
ATOM   7367  O OD1 . ASP C 1 57  ? 54.560  53.210  46.489  1.00 43.62 ? 95  ASP C OD1 1 
ATOM   7368  O OD2 . ASP C 1 57  ? 52.527  53.230  47.458  1.00 45.57 ? 95  ASP C OD2 1 
ATOM   7369  N N   . ASN C 1 58  ? 55.727  50.073  50.258  1.00 42.25 ? 96  ASN C N   1 
ATOM   7370  C CA  . ASN C 1 58  ? 56.964  49.517  50.830  1.00 42.41 ? 96  ASN C CA  1 
ATOM   7371  C C   . ASN C 1 58  ? 56.901  48.079  51.331  1.00 41.56 ? 96  ASN C C   1 
ATOM   7372  O O   . ASN C 1 58  ? 57.823  47.649  52.009  1.00 42.13 ? 96  ASN C O   1 
ATOM   7373  C CB  . ASN C 1 58  ? 57.559  50.433  51.947  1.00 42.71 ? 96  ASN C CB  1 
ATOM   7374  C CG  . ASN C 1 58  ? 56.540  50.829  53.059  1.00 45.25 ? 96  ASN C CG  1 
ATOM   7375  O OD1 . ASN C 1 58  ? 55.541  50.117  53.348  1.00 45.96 ? 96  ASN C OD1 1 
ATOM   7376  N ND2 . ASN C 1 58  ? 56.816  51.985  53.699  1.00 45.21 ? 96  ASN C ND2 1 
ATOM   7377  N N   . PHE C 1 59  ? 55.867  47.308  51.004  1.00 40.41 ? 97  PHE C N   1 
ATOM   7378  C CA  . PHE C 1 59  ? 55.734  45.997  51.616  1.00 39.26 ? 97  PHE C CA  1 
ATOM   7379  C C   . PHE C 1 59  ? 54.878  45.066  50.768  1.00 38.16 ? 97  PHE C C   1 
ATOM   7380  O O   . PHE C 1 59  ? 54.034  45.517  49.987  1.00 37.87 ? 97  PHE C O   1 
ATOM   7381  C CB  . PHE C 1 59  ? 55.154  46.182  53.013  1.00 40.32 ? 97  PHE C CB  1 
ATOM   7382  C CG  . PHE C 1 59  ? 55.420  45.042  53.966  1.00 41.47 ? 97  PHE C CG  1 
ATOM   7383  C CD1 . PHE C 1 59  ? 56.665  44.875  54.558  1.00 43.40 ? 97  PHE C CD1 1 
ATOM   7384  C CD2 . PHE C 1 59  ? 54.402  44.168  54.315  1.00 43.99 ? 97  PHE C CD2 1 
ATOM   7385  C CE1 . PHE C 1 59  ? 56.887  43.831  55.455  1.00 42.27 ? 97  PHE C CE1 1 
ATOM   7386  C CE2 . PHE C 1 59  ? 54.627  43.112  55.203  1.00 44.18 ? 97  PHE C CE2 1 
ATOM   7387  C CZ  . PHE C 1 59  ? 55.868  42.959  55.772  1.00 41.97 ? 97  PHE C CZ  1 
ATOM   7388  N N   . GLY C 1 60  ? 55.134  43.760  50.877  1.00 36.67 ? 98  GLY C N   1 
ATOM   7389  C CA  . GLY C 1 60  ? 54.442  42.770  50.065  1.00 35.69 ? 98  GLY C CA  1 
ATOM   7390  C C   . GLY C 1 60  ? 54.811  42.855  48.606  1.00 35.64 ? 98  GLY C C   1 
ATOM   7391  O O   . GLY C 1 60  ? 55.934  43.212  48.273  1.00 36.22 ? 98  GLY C O   1 
ATOM   7392  N N   . LEU C 1 61  ? 53.886  42.530  47.707  1.00 34.82 ? 99  LEU C N   1 
ATOM   7393  C CA  . LEU C 1 61  ? 54.165  42.618  46.268  1.00 34.75 ? 99  LEU C CA  1 
ATOM   7394  C C   . LEU C 1 61  ? 54.588  44.009  45.812  1.00 34.00 ? 99  LEU C C   1 
ATOM   7395  O O   . LEU C 1 61  ? 55.150  44.145  44.730  1.00 33.74 ? 99  LEU C O   1 
ATOM   7396  C CB  . LEU C 1 61  ? 52.940  42.264  45.450  1.00 35.88 ? 99  LEU C CB  1 
ATOM   7397  C CG  . LEU C 1 61  ? 53.023  41.190  44.380  1.00 37.89 ? 99  LEU C CG  1 
ATOM   7398  C CD1 . LEU C 1 61  ? 52.863  39.794  44.966  1.00 38.84 ? 99  LEU C CD1 1 
ATOM   7399  C CD2 . LEU C 1 61  ? 51.877  41.511  43.435  1.00 39.51 ? 99  LEU C CD2 1 
ATOM   7400  N N   . GLY C 1 62  ? 54.300  45.042  46.602  1.00 32.68 ? 100 GLY C N   1 
ATOM   7401  C CA  . GLY C 1 62  ? 54.726  46.385  46.262  1.00 32.11 ? 100 GLY C CA  1 
ATOM   7402  C C   . GLY C 1 62  ? 56.241  46.487  46.071  1.00 31.74 ? 100 GLY C C   1 
ATOM   7403  O O   . GLY C 1 62  ? 56.740  47.320  45.307  1.00 30.99 ? 100 GLY C O   1 
ATOM   7404  N N   . LEU C 1 63  ? 56.981  45.665  46.790  1.00 31.54 ? 101 LEU C N   1 
ATOM   7405  C CA  . LEU C 1 63  ? 58.423  45.636  46.625  1.00 32.88 ? 101 LEU C CA  1 
ATOM   7406  C C   . LEU C 1 63  ? 58.838  45.081  45.240  1.00 32.61 ? 101 LEU C C   1 
ATOM   7407  O O   . LEU C 1 63  ? 59.810  45.519  44.681  1.00 33.12 ? 101 LEU C O   1 
ATOM   7408  C CB  . LEU C 1 63  ? 59.058  44.832  47.757  1.00 33.51 ? 101 LEU C CB  1 
ATOM   7409  C CG  . LEU C 1 63  ? 58.958  45.410  49.175  1.00 33.31 ? 101 LEU C CG  1 
ATOM   7410  C CD1 . LEU C 1 63  ? 59.267  44.318  50.203  1.00 32.00 ? 101 LEU C CD1 1 
ATOM   7411  C CD2 . LEU C 1 63  ? 59.903  46.593  49.286  1.00 33.16 ? 101 LEU C CD2 1 
ATOM   7412  N N   . LEU C 1 64  ? 58.091  44.155  44.670  1.00 32.99 ? 102 LEU C N   1 
ATOM   7413  C CA  . LEU C 1 64  ? 58.433  43.635  43.331  1.00 33.93 ? 102 LEU C CA  1 
ATOM   7414  C C   . LEU C 1 64  ? 57.968  44.554  42.186  1.00 34.91 ? 102 LEU C C   1 
ATOM   7415  O O   . LEU C 1 64  ? 58.557  44.547  41.101  1.00 34.02 ? 102 LEU C O   1 
ATOM   7416  C CB  . LEU C 1 64  ? 57.934  42.215  43.134  1.00 32.66 ? 102 LEU C CB  1 
ATOM   7417  C CG  . LEU C 1 64  ? 58.528  41.287  44.193  1.00 32.98 ? 102 LEU C CG  1 
ATOM   7418  C CD1 . LEU C 1 64  ? 57.668  40.031  44.449  1.00 36.25 ? 102 LEU C CD1 1 
ATOM   7419  C CD2 . LEU C 1 64  ? 59.901  40.889  43.848  1.00 32.03 ? 102 LEU C CD2 1 
ATOM   7420  N N   . LEU C 1 65  ? 56.929  45.340  42.442  1.00 35.39 ? 103 LEU C N   1 
ATOM   7421  C CA  . LEU C 1 65  ? 56.504  46.376  41.489  1.00 36.19 ? 103 LEU C CA  1 
ATOM   7422  C C   . LEU C 1 65  ? 57.496  47.541  41.464  1.00 36.41 ? 103 LEU C C   1 
ATOM   7423  O O   . LEU C 1 65  ? 57.773  48.089  40.390  1.00 36.76 ? 103 LEU C O   1 
ATOM   7424  C CB  . LEU C 1 65  ? 55.057  46.860  41.799  1.00 35.74 ? 103 LEU C CB  1 
ATOM   7425  C CG  . LEU C 1 65  ? 53.907  45.831  41.664  1.00 35.03 ? 103 LEU C CG  1 
ATOM   7426  C CD1 . LEU C 1 65  ? 52.622  46.354  42.339  1.00 31.96 ? 103 LEU C CD1 1 
ATOM   7427  C CD2 . LEU C 1 65  ? 53.635  45.473  40.191  1.00 31.65 ? 103 LEU C CD2 1 
ATOM   7428  N N   . ARG C 1 66  ? 58.075  47.900  42.620  1.00 36.92 ? 104 ARG C N   1 
ATOM   7429  C CA  . ARG C 1 66  ? 59.074  48.991  42.668  1.00 36.91 ? 104 ARG C CA  1 
ATOM   7430  C C   . ARG C 1 66  ? 60.323  48.597  41.916  1.00 36.84 ? 104 ARG C C   1 
ATOM   7431  O O   . ARG C 1 66  ? 61.034  49.465  41.381  1.00 35.83 ? 104 ARG C O   1 
ATOM   7432  C CB  . ARG C 1 66  ? 59.532  49.369  44.096  1.00 37.55 ? 104 ARG C CB  1 
ATOM   7433  C CG  . ARG C 1 66  ? 58.431  49.712  45.113  1.00 39.99 ? 104 ARG C CG  1 
ATOM   7434  C CD  . ARG C 1 66  ? 58.103  51.197  45.219  1.00 43.87 ? 104 ARG C CD  1 
ATOM   7435  N NE  . ARG C 1 66  ? 59.257  52.046  45.510  1.00 43.86 ? 104 ARG C NE  1 
ATOM   7436  C CZ  . ARG C 1 66  ? 59.165  53.337  45.839  1.00 47.78 ? 104 ARG C CZ  1 
ATOM   7437  N NH1 . ARG C 1 66  ? 57.946  53.912  45.939  1.00 49.88 ? 104 ARG C NH1 1 
ATOM   7438  N NH2 . ARG C 1 66  ? 60.285  54.062  46.087  1.00 44.79 ? 104 ARG C NH2 1 
ATOM   7439  N N   . SER C 1 67  ? 60.637  47.301  41.916  1.00 36.37 ? 105 SER C N   1 
ATOM   7440  C CA  . SER C 1 67  ? 61.847  46.838  41.227  1.00 36.44 ? 105 SER C CA  1 
ATOM   7441  C C   . SER C 1 67  ? 61.529  46.398  39.802  1.00 35.68 ? 105 SER C C   1 
ATOM   7442  O O   . SER C 1 67  ? 62.396  45.900  39.108  1.00 36.54 ? 105 SER C O   1 
ATOM   7443  C CB  . SER C 1 67  ? 62.585  45.739  42.017  1.00 36.08 ? 105 SER C CB  1 
ATOM   7444  O OG  . SER C 1 67  ? 61.807  44.578  42.155  1.00 36.82 ? 105 SER C OG  1 
ATOM   7445  N N   . LYS C 1 68  ? 60.289  46.605  39.367  1.00 34.84 ? 106 LYS C N   1 
ATOM   7446  C CA  . LYS C 1 68  ? 59.912  46.405  37.965  1.00 33.71 ? 106 LYS C CA  1 
ATOM   7447  C C   . LYS C 1 68  ? 60.083  44.923  37.535  1.00 33.24 ? 106 LYS C C   1 
ATOM   7448  O O   . LYS C 1 68  ? 60.435  44.626  36.387  1.00 31.91 ? 106 LYS C O   1 
ATOM   7449  C CB  . LYS C 1 68  ? 60.683  47.369  37.083  1.00 33.13 ? 106 LYS C CB  1 
ATOM   7450  C CG  . LYS C 1 68  ? 60.933  48.724  37.753  1.00 33.23 ? 106 LYS C CG  1 
ATOM   7451  N N   . GLN C 1 69  ? 59.774  44.013  38.472  1.00 31.74 ? 107 GLN C N   1 
ATOM   7452  C CA  . GLN C 1 69  ? 59.928  42.582  38.252  1.00 31.73 ? 107 GLN C CA  1 
ATOM   7453  C C   . GLN C 1 69  ? 58.650  41.931  37.842  1.00 31.72 ? 107 GLN C C   1 
ATOM   7454  O O   . GLN C 1 69  ? 58.655  40.778  37.492  1.00 31.91 ? 107 GLN C O   1 
ATOM   7455  C CB  . GLN C 1 69  ? 60.505  41.892  39.504  1.00 31.74 ? 107 GLN C CB  1 
ATOM   7456  C CG  . GLN C 1 69  ? 61.994  42.133  39.623  1.00 31.38 ? 107 GLN C CG  1 
ATOM   7457  C CD  . GLN C 1 69  ? 62.607  41.690  40.937  1.00 33.78 ? 107 GLN C CD  1 
ATOM   7458  O OE1 . GLN C 1 69  ? 63.034  42.537  41.734  1.00 34.60 ? 107 GLN C OE1 1 
ATOM   7459  N NE2 . GLN C 1 69  ? 62.697  40.370  41.159  1.00 30.76 ? 107 GLN C NE2 1 
ATOM   7460  N N   . ILE C 1 70  ? 57.546  42.669  37.905  1.00 33.05 ? 108 ILE C N   1 
ATOM   7461  C CA  . ILE C 1 70  ? 56.225  42.158  37.535  1.00 33.01 ? 108 ILE C CA  1 
ATOM   7462  C C   . ILE C 1 70  ? 55.779  42.866  36.278  1.00 33.63 ? 108 ILE C C   1 
ATOM   7463  O O   . ILE C 1 70  ? 55.962  44.094  36.139  1.00 32.46 ? 108 ILE C O   1 
ATOM   7464  C CB  . ILE C 1 70  ? 55.189  42.352  38.658  1.00 33.54 ? 108 ILE C CB  1 
ATOM   7465  C CG1 . ILE C 1 70  ? 55.595  41.517  39.885  1.00 33.43 ? 108 ILE C CG1 1 
ATOM   7466  C CG2 . ILE C 1 70  ? 53.791  41.914  38.205  1.00 31.55 ? 108 ILE C CG2 1 
ATOM   7467  C CD1 . ILE C 1 70  ? 54.801  41.892  41.084  1.00 35.98 ? 108 ILE C CD1 1 
ATOM   7468  N N   . LYS C 1 71  ? 55.243  42.063  35.363  1.00 33.92 ? 109 LYS C N   1 
ATOM   7469  C CA  . LYS C 1 71  ? 54.716  42.536  34.088  1.00 35.58 ? 109 LYS C CA  1 
ATOM   7470  C C   . LYS C 1 71  ? 53.185  42.486  34.050  1.00 35.03 ? 109 LYS C C   1 
ATOM   7471  O O   . LYS C 1 71  ? 52.567  43.377  33.491  1.00 35.59 ? 109 LYS C O   1 
ATOM   7472  C CB  . LYS C 1 71  ? 55.306  41.714  32.928  1.00 35.83 ? 109 LYS C CB  1 
ATOM   7473  C CG  . LYS C 1 71  ? 54.406  41.646  31.672  1.00 37.41 ? 109 LYS C CG  1 
ATOM   7474  C CD  . LYS C 1 71  ? 55.094  40.879  30.545  1.00 37.52 ? 109 LYS C CD  1 
ATOM   7475  C CE  . LYS C 1 71  ? 54.157  40.549  29.364  1.00 39.18 ? 109 LYS C CE  1 
ATOM   7476  N NZ  . LYS C 1 71  ? 54.911  40.680  28.055  1.00 37.48 ? 109 LYS C NZ  1 
ATOM   7477  N N   . ARG C 1 72  ? 52.587  41.450  34.642  1.00 34.61 ? 110 ARG C N   1 
ATOM   7478  C CA  . ARG C 1 72  ? 51.149  41.351  34.776  1.00 34.69 ? 110 ARG C CA  1 
ATOM   7479  C C   . ARG C 1 72  ? 50.732  40.888  36.182  1.00 34.96 ? 110 ARG C C   1 
ATOM   7480  O O   . ARG C 1 72  ? 51.325  39.974  36.735  1.00 34.70 ? 110 ARG C O   1 
ATOM   7481  C CB  . ARG C 1 72  ? 50.555  40.398  33.771  1.00 34.17 ? 110 ARG C CB  1 
ATOM   7482  C CG  . ARG C 1 72  ? 49.023  40.395  33.877  1.00 35.09 ? 110 ARG C CG  1 
ATOM   7483  C CD  . ARG C 1 72  ? 48.423  39.484  32.847  1.00 36.63 ? 110 ARG C CD  1 
ATOM   7484  N NE  . ARG C 1 72  ? 48.574  40.114  31.547  1.00 39.01 ? 110 ARG C NE  1 
ATOM   7485  C CZ  . ARG C 1 72  ? 47.820  39.879  30.472  1.00 39.37 ? 110 ARG C CZ  1 
ATOM   7486  N NH1 . ARG C 1 72  ? 46.846  38.990  30.491  1.00 40.23 ? 110 ARG C NH1 1 
ATOM   7487  N NH2 . ARG C 1 72  ? 48.055  40.555  29.363  1.00 38.74 ? 110 ARG C NH2 1 
ATOM   7488  N N   . MET C 1 73  ? 49.726  41.558  36.729  1.00 34.99 ? 111 MET C N   1 
ATOM   7489  C CA  . MET C 1 73  ? 49.104  41.203  37.993  1.00 36.73 ? 111 MET C CA  1 
ATOM   7490  C C   . MET C 1 73  ? 47.740  40.616  37.677  1.00 35.82 ? 111 MET C C   1 
ATOM   7491  O O   . MET C 1 73  ? 47.041  41.119  36.806  1.00 35.81 ? 111 MET C O   1 
ATOM   7492  C CB  . MET C 1 73  ? 48.920  42.448  38.872  1.00 37.53 ? 111 MET C CB  1 
ATOM   7493  C CG  . MET C 1 73  ? 50.222  43.053  39.426  1.00 40.18 ? 111 MET C CG  1 
ATOM   7494  S SD  . MET C 1 73  ? 50.719  42.121  40.886  1.00 52.63 ? 111 MET C SD  1 
ATOM   7495  C CE  . MET C 1 73  ? 49.372  42.546  41.996  1.00 52.60 ? 111 MET C CE  1 
ATOM   7496  N N   . VAL C 1 74  ? 47.363  39.562  38.383  1.00 35.59 ? 112 VAL C N   1 
ATOM   7497  C CA  . VAL C 1 74  ? 46.005  39.067  38.353  1.00 35.10 ? 112 VAL C CA  1 
ATOM   7498  C C   . VAL C 1 74  ? 45.500  39.175  39.801  1.00 36.04 ? 112 VAL C C   1 
ATOM   7499  O O   . VAL C 1 74  ? 45.948  38.449  40.681  1.00 35.94 ? 112 VAL C O   1 
ATOM   7500  C CB  . VAL C 1 74  ? 45.933  37.631  37.817  1.00 34.96 ? 112 VAL C CB  1 
ATOM   7501  C CG1 . VAL C 1 74  ? 44.480  37.067  37.919  1.00 35.62 ? 112 VAL C CG1 1 
ATOM   7502  C CG2 . VAL C 1 74  ? 46.525  37.542  36.364  1.00 35.72 ? 112 VAL C CG2 1 
ATOM   7503  N N   . SER C 1 75  ? 44.580  40.110  40.023  1.00 36.09 ? 113 SER C N   1 
ATOM   7504  C CA  . SER C 1 75  ? 44.228  40.608  41.349  1.00 35.93 ? 113 SER C CA  1 
ATOM   7505  C C   . SER C 1 75  ? 42.757  41.070  41.390  1.00 34.88 ? 113 SER C C   1 
ATOM   7506  O O   . SER C 1 75  ? 42.181  41.414  40.352  1.00 33.19 ? 113 SER C O   1 
ATOM   7507  C CB  . SER C 1 75  ? 45.132  41.795  41.689  1.00 36.47 ? 113 SER C CB  1 
ATOM   7508  O OG  . SER C 1 75  ? 46.495  41.553  41.383  1.00 36.47 ? 113 SER C OG  1 
ATOM   7509  N N   . SER C 1 76  ? 42.161  41.066  42.576  1.00 33.71 ? 114 SER C N   1 
ATOM   7510  C CA  . SER C 1 76  ? 40.820  41.600  42.755  1.00 33.98 ? 114 SER C CA  1 
ATOM   7511  C C   . SER C 1 76  ? 40.780  43.069  43.227  1.00 34.50 ? 114 SER C C   1 
ATOM   7512  O O   . SER C 1 76  ? 39.843  43.819  42.924  1.00 34.67 ? 114 SER C O   1 
ATOM   7513  C CB  . SER C 1 76  ? 40.071  40.713  43.707  1.00 33.67 ? 114 SER C CB  1 
ATOM   7514  O OG  . SER C 1 76  ? 40.439  40.980  45.041  1.00 34.21 ? 114 SER C OG  1 
ATOM   7515  N N   . TYR C 1 77  ? 41.792  43.507  43.958  1.00 34.65 ? 115 TYR C N   1 
ATOM   7516  C CA  . TYR C 1 77  ? 41.736  44.848  44.512  1.00 35.17 ? 115 TYR C CA  1 
ATOM   7517  C C   . TYR C 1 77  ? 43.141  45.395  44.685  1.00 34.06 ? 115 TYR C C   1 
ATOM   7518  O O   . TYR C 1 77  ? 43.972  44.786  45.351  1.00 33.55 ? 115 TYR C O   1 
ATOM   7519  C CB  . TYR C 1 77  ? 40.977  44.851  45.858  1.00 35.87 ? 115 TYR C CB  1 
ATOM   7520  C CG  . TYR C 1 77  ? 40.977  46.209  46.480  1.00 38.32 ? 115 TYR C CG  1 
ATOM   7521  C CD1 . TYR C 1 77  ? 40.092  47.196  46.053  1.00 39.20 ? 115 TYR C CD1 1 
ATOM   7522  C CD2 . TYR C 1 77  ? 41.895  46.532  47.484  1.00 38.82 ? 115 TYR C CD2 1 
ATOM   7523  C CE1 . TYR C 1 77  ? 40.121  48.465  46.615  1.00 41.33 ? 115 TYR C CE1 1 
ATOM   7524  C CE2 . TYR C 1 77  ? 41.925  47.810  48.042  1.00 38.81 ? 115 TYR C CE2 1 
ATOM   7525  C CZ  . TYR C 1 77  ? 41.050  48.760  47.615  1.00 39.67 ? 115 TYR C CZ  1 
ATOM   7526  O OH  . TYR C 1 77  ? 41.112  50.031  48.171  1.00 41.08 ? 115 TYR C OH  1 
ATOM   7527  N N   . VAL C 1 78  ? 43.396  46.568  44.136  1.00 33.34 ? 116 VAL C N   1 
ATOM   7528  C CA  . VAL C 1 78  ? 44.792  46.987  43.933  1.00 33.83 ? 116 VAL C CA  1 
ATOM   7529  C C   . VAL C 1 78  ? 44.994  48.406  44.468  1.00 34.88 ? 116 VAL C C   1 
ATOM   7530  O O   . VAL C 1 78  ? 45.944  49.077  44.104  1.00 34.62 ? 116 VAL C O   1 
ATOM   7531  C CB  . VAL C 1 78  ? 45.218  46.828  42.432  1.00 33.21 ? 116 VAL C CB  1 
ATOM   7532  C CG1 . VAL C 1 78  ? 45.117  45.320  41.966  1.00 32.81 ? 116 VAL C CG1 1 
ATOM   7533  C CG2 . VAL C 1 78  ? 44.404  47.771  41.482  1.00 32.04 ? 116 VAL C CG2 1 
ATOM   7534  N N   . GLY C 1 79  ? 44.097  48.839  45.348  1.00 35.37 ? 117 GLY C N   1 
ATOM   7535  C CA  . GLY C 1 79  ? 44.213  50.161  45.995  1.00 36.11 ? 117 GLY C CA  1 
ATOM   7536  C C   . GLY C 1 79  ? 45.317  50.189  47.046  1.00 36.64 ? 117 GLY C C   1 
ATOM   7537  O O   . GLY C 1 79  ? 45.972  49.141  47.310  1.00 38.16 ? 117 GLY C O   1 
ATOM   7538  N N   . GLU C 1 80  ? 45.550  51.388  47.571  1.00 36.46 ? 118 GLU C N   1 
ATOM   7539  C CA  . GLU C 1 80  ? 46.551  51.717  48.612  1.00 37.74 ? 118 GLU C CA  1 
ATOM   7540  C C   . GLU C 1 80  ? 48.004  51.422  48.207  1.00 38.09 ? 118 GLU C C   1 
ATOM   7541  O O   . GLU C 1 80  ? 48.811  50.991  49.045  1.00 39.77 ? 118 GLU C O   1 
ATOM   7542  C CB  . GLU C 1 80  ? 46.210  51.070  49.965  1.00 38.39 ? 118 GLU C CB  1 
ATOM   7543  C CG  . GLU C 1 80  ? 45.009  51.679  50.681  1.00 39.55 ? 118 GLU C CG  1 
ATOM   7544  C CD  . GLU C 1 80  ? 43.678  51.531  49.915  1.00 42.85 ? 118 GLU C CD  1 
ATOM   7545  O OE1 . GLU C 1 80  ? 43.255  50.386  49.607  1.00 43.98 ? 118 GLU C OE1 1 
ATOM   7546  O OE2 . GLU C 1 80  ? 43.040  52.559  49.625  1.00 41.84 ? 118 GLU C OE2 1 
ATOM   7547  N N   . ASN C 1 81  ? 48.329  51.634  46.931  1.00 37.65 ? 119 ASN C N   1 
ATOM   7548  C CA  . ASN C 1 81  ? 49.720  51.458  46.425  1.00 37.97 ? 119 ASN C CA  1 
ATOM   7549  C C   . ASN C 1 81  ? 49.952  52.452  45.295  1.00 37.91 ? 119 ASN C C   1 
ATOM   7550  O O   . ASN C 1 81  ? 49.587  52.189  44.149  1.00 38.65 ? 119 ASN C O   1 
ATOM   7551  C CB  . ASN C 1 81  ? 49.935  50.005  45.967  1.00 37.12 ? 119 ASN C CB  1 
ATOM   7552  C CG  . ASN C 1 81  ? 51.378  49.689  45.624  1.00 37.13 ? 119 ASN C CG  1 
ATOM   7553  O OD1 . ASN C 1 81  ? 52.091  50.501  45.063  1.00 37.72 ? 119 ASN C OD1 1 
ATOM   7554  N ND2 . ASN C 1 81  ? 51.797  48.484  45.930  1.00 38.85 ? 119 ASN C ND2 1 
ATOM   7555  N N   . ALA C 1 82  ? 50.523  53.603  45.623  1.00 37.44 ? 120 ALA C N   1 
ATOM   7556  C CA  . ALA C 1 82  ? 50.716  54.665  44.649  1.00 37.19 ? 120 ALA C CA  1 
ATOM   7557  C C   . ALA C 1 82  ? 51.551  54.229  43.470  1.00 37.41 ? 120 ALA C C   1 
ATOM   7558  O O   . ALA C 1 82  ? 51.370  54.736  42.368  1.00 36.74 ? 120 ALA C O   1 
ATOM   7559  C CB  . ALA C 1 82  ? 51.371  55.869  45.290  1.00 37.67 ? 120 ALA C CB  1 
ATOM   7560  N N   . GLU C 1 83  ? 52.489  53.318  43.711  1.00 37.88 ? 121 GLU C N   1 
ATOM   7561  C CA  . GLU C 1 83  ? 53.456  52.930  42.683  1.00 38.56 ? 121 GLU C CA  1 
ATOM   7562  C C   . GLU C 1 83  ? 52.810  52.001  41.670  1.00 39.15 ? 121 GLU C C   1 
ATOM   7563  O O   . GLU C 1 83  ? 53.142  52.054  40.481  1.00 40.92 ? 121 GLU C O   1 
ATOM   7564  C CB  . GLU C 1 83  ? 54.696  52.294  43.300  1.00 38.22 ? 121 GLU C CB  1 
ATOM   7565  C CG  . GLU C 1 83  ? 55.706  51.749  42.270  1.00 40.08 ? 121 GLU C CG  1 
ATOM   7566  C CD  . GLU C 1 83  ? 56.252  52.800  41.297  1.00 40.86 ? 121 GLU C CD  1 
ATOM   7567  O OE1 . GLU C 1 83  ? 56.007  54.050  41.471  1.00 41.83 ? 121 GLU C OE1 1 
ATOM   7568  O OE2 . GLU C 1 83  ? 56.948  52.353  40.350  1.00 40.44 ? 121 GLU C OE2 1 
ATOM   7569  N N   . PHE C 1 84  ? 51.918  51.147  42.155  1.00 39.17 ? 122 PHE C N   1 
ATOM   7570  C CA  . PHE C 1 84  ? 51.066  50.343  41.310  1.00 39.61 ? 122 PHE C CA  1 
ATOM   7571  C C   . PHE C 1 84  ? 50.148  51.195  40.388  1.00 40.73 ? 122 PHE C C   1 
ATOM   7572  O O   . PHE C 1 84  ? 50.063  50.953  39.170  1.00 40.73 ? 122 PHE C O   1 
ATOM   7573  C CB  . PHE C 1 84  ? 50.180  49.428  42.144  1.00 37.82 ? 122 PHE C CB  1 
ATOM   7574  C CG  . PHE C 1 84  ? 49.147  48.763  41.318  1.00 38.58 ? 122 PHE C CG  1 
ATOM   7575  C CD1 . PHE C 1 84  ? 47.980  49.472  40.912  1.00 40.00 ? 122 PHE C CD1 1 
ATOM   7576  C CD2 . PHE C 1 84  ? 49.339  47.474  40.856  1.00 33.82 ? 122 PHE C CD2 1 
ATOM   7577  C CE1 . PHE C 1 84  ? 47.043  48.879  40.049  1.00 36.91 ? 122 PHE C CE1 1 
ATOM   7578  C CE2 . PHE C 1 84  ? 48.425  46.889  40.008  1.00 34.49 ? 122 PHE C CE2 1 
ATOM   7579  C CZ  . PHE C 1 84  ? 47.277  47.573  39.614  1.00 36.62 ? 122 PHE C CZ  1 
ATOM   7580  N N   . GLU C 1 85  ? 49.425  52.140  40.997  1.00 41.55 ? 123 GLU C N   1 
ATOM   7581  C CA  . GLU C 1 85  ? 48.569  53.080  40.272  1.00 42.41 ? 123 GLU C CA  1 
ATOM   7582  C C   . GLU C 1 85  ? 49.343  53.735  39.149  1.00 42.38 ? 123 GLU C C   1 
ATOM   7583  O O   . GLU C 1 85  ? 48.882  53.808  37.994  1.00 43.39 ? 123 GLU C O   1 
ATOM   7584  C CB  . GLU C 1 85  ? 47.992  54.139  41.244  1.00 42.76 ? 123 GLU C CB  1 
ATOM   7585  C CG  . GLU C 1 85  ? 47.506  55.445  40.600  1.00 43.47 ? 123 GLU C CG  1 
ATOM   7586  C CD  . GLU C 1 85  ? 46.827  56.404  41.595  1.00 44.10 ? 123 GLU C CD  1 
ATOM   7587  O OE1 . GLU C 1 85  ? 46.012  55.950  42.432  1.00 48.23 ? 123 GLU C OE1 1 
ATOM   7588  O OE2 . GLU C 1 85  ? 47.100  57.621  41.541  1.00 46.04 ? 123 GLU C OE2 1 
ATOM   7589  N N   . ARG C 1 86  ? 50.539  54.202  39.475  1.00 41.99 ? 124 ARG C N   1 
ATOM   7590  C CA  . ARG C 1 86  ? 51.363  54.899  38.519  1.00 41.50 ? 124 ARG C CA  1 
ATOM   7591  C C   . ARG C 1 86  ? 51.828  54.023  37.337  1.00 40.76 ? 124 ARG C C   1 
ATOM   7592  O O   . ARG C 1 86  ? 51.961  54.520  36.210  1.00 40.69 ? 124 ARG C O   1 
ATOM   7593  C CB  . ARG C 1 86  ? 52.575  55.469  39.242  1.00 41.89 ? 124 ARG C CB  1 
ATOM   7594  C CG  . ARG C 1 86  ? 53.344  56.490  38.463  1.00 43.69 ? 124 ARG C CG  1 
ATOM   7595  C CD  . ARG C 1 86  ? 54.820  56.541  38.893  1.00 46.40 ? 124 ARG C CD  1 
ATOM   7596  N NE  . ARG C 1 86  ? 55.500  55.251  38.709  1.00 47.32 ? 124 ARG C NE  1 
ATOM   7597  C CZ  . ARG C 1 86  ? 56.057  54.832  37.573  1.00 47.16 ? 124 ARG C CZ  1 
ATOM   7598  N NH1 . ARG C 1 86  ? 56.642  53.639  37.540  1.00 46.63 ? 124 ARG C NH1 1 
ATOM   7599  N NH2 . ARG C 1 86  ? 56.029  55.586  36.479  1.00 45.35 ? 124 ARG C NH2 1 
ATOM   7600  N N   . GLN C 1 87  ? 52.121  52.750  37.599  1.00 39.21 ? 125 GLN C N   1 
ATOM   7601  C CA  . GLN C 1 87  ? 52.542  51.818  36.543  1.00 38.37 ? 125 GLN C CA  1 
ATOM   7602  C C   . GLN C 1 87  ? 51.362  51.336  35.672  1.00 38.11 ? 125 GLN C C   1 
ATOM   7603  O O   . GLN C 1 87  ? 51.511  51.140  34.444  1.00 38.29 ? 125 GLN C O   1 
ATOM   7604  C CB  . GLN C 1 87  ? 53.230  50.577  37.150  1.00 38.35 ? 125 GLN C CB  1 
ATOM   7605  C CG  . GLN C 1 87  ? 54.643  50.809  37.725  1.00 37.87 ? 125 GLN C CG  1 
ATOM   7606  C CD  . GLN C 1 87  ? 55.332  49.518  38.134  1.00 37.12 ? 125 GLN C CD  1 
ATOM   7607  O OE1 . GLN C 1 87  ? 55.040  48.442  37.610  1.00 38.34 ? 125 GLN C OE1 1 
ATOM   7608  N NE2 . GLN C 1 87  ? 56.257  49.620  39.068  1.00 32.97 ? 125 GLN C NE2 1 
ATOM   7609  N N   . TYR C 1 88  ? 50.237  51.072  36.335  1.00 36.75 ? 126 TYR C N   1 
ATOM   7610  C CA  . TYR C 1 88  ? 49.001  50.650  35.692  1.00 36.67 ? 126 TYR C CA  1 
ATOM   7611  C C   . TYR C 1 88  ? 48.416  51.727  34.778  1.00 36.72 ? 126 TYR C C   1 
ATOM   7612  O O   . TYR C 1 88  ? 48.103  51.442  33.633  1.00 36.12 ? 126 TYR C O   1 
ATOM   7613  C CB  . TYR C 1 88  ? 47.980  50.275  36.769  1.00 36.17 ? 126 TYR C CB  1 
ATOM   7614  C CG  . TYR C 1 88  ? 46.626  49.748  36.301  1.00 35.82 ? 126 TYR C CG  1 
ATOM   7615  C CD1 . TYR C 1 88  ? 46.497  48.970  35.160  1.00 36.21 ? 126 TYR C CD1 1 
ATOM   7616  C CD2 . TYR C 1 88  ? 45.483  49.965  37.068  1.00 35.96 ? 126 TYR C CD2 1 
ATOM   7617  C CE1 . TYR C 1 88  ? 45.277  48.478  34.755  1.00 35.43 ? 126 TYR C CE1 1 
ATOM   7618  C CE2 . TYR C 1 88  ? 44.269  49.466  36.681  1.00 37.29 ? 126 TYR C CE2 1 
ATOM   7619  C CZ  . TYR C 1 88  ? 44.162  48.731  35.499  1.00 37.44 ? 126 TYR C CZ  1 
ATOM   7620  O OH  . TYR C 1 88  ? 42.938  48.210  35.104  1.00 36.42 ? 126 TYR C OH  1 
ATOM   7621  N N   . LEU C 1 89  ? 48.270  52.950  35.299  1.00 37.58 ? 127 LEU C N   1 
ATOM   7622  C CA  . LEU C 1 89  ? 47.660  54.063  34.553  1.00 38.35 ? 127 LEU C CA  1 
ATOM   7623  C C   . LEU C 1 89  ? 48.515  54.594  33.434  1.00 38.33 ? 127 LEU C C   1 
ATOM   7624  O O   . LEU C 1 89  ? 47.987  55.192  32.490  1.00 37.64 ? 127 LEU C O   1 
ATOM   7625  C CB  . LEU C 1 89  ? 47.294  55.225  35.469  1.00 38.14 ? 127 LEU C CB  1 
ATOM   7626  C CG  . LEU C 1 89  ? 46.081  54.962  36.343  1.00 39.49 ? 127 LEU C CG  1 
ATOM   7627  C CD1 . LEU C 1 89  ? 45.806  56.284  37.073  1.00 40.42 ? 127 LEU C CD1 1 
ATOM   7628  C CD2 . LEU C 1 89  ? 44.875  54.468  35.508  1.00 38.81 ? 127 LEU C CD2 1 
ATOM   7629  N N   . SER C 1 90  ? 49.823  54.357  33.533  1.00 38.98 ? 128 SER C N   1 
ATOM   7630  C CA  . SER C 1 90  ? 50.770  54.818  32.528  1.00 39.84 ? 128 SER C CA  1 
ATOM   7631  C C   . SER C 1 90  ? 51.136  53.757  31.506  1.00 39.77 ? 128 SER C C   1 
ATOM   7632  O O   . SER C 1 90  ? 51.961  54.011  30.652  1.00 39.90 ? 128 SER C O   1 
ATOM   7633  C CB  . SER C 1 90  ? 52.054  55.324  33.201  1.00 39.92 ? 128 SER C CB  1 
ATOM   7634  O OG  . SER C 1 90  ? 52.758  54.249  33.794  1.00 42.61 ? 128 SER C OG  1 
ATOM   7635  N N   . GLY C 1 91  ? 50.555  52.566  31.610  1.00 40.33 ? 129 GLY C N   1 
ATOM   7636  C CA  . GLY C 1 91  ? 50.817  51.487  30.647  1.00 39.98 ? 129 GLY C CA  1 
ATOM   7637  C C   . GLY C 1 91  ? 52.025  50.605  30.920  1.00 39.96 ? 129 GLY C C   1 
ATOM   7638  O O   . GLY C 1 91  ? 52.365  49.791  30.086  1.00 39.81 ? 129 GLY C O   1 
ATOM   7639  N N   . GLU C 1 92  ? 52.662  50.741  32.080  1.00 39.93 ? 130 GLU C N   1 
ATOM   7640  C CA  . GLU C 1 92  ? 53.836  49.933  32.411  1.00 40.06 ? 130 GLU C CA  1 
ATOM   7641  C C   . GLU C 1 92  ? 53.547  48.555  32.975  1.00 39.84 ? 130 GLU C C   1 
ATOM   7642  O O   . GLU C 1 92  ? 54.447  47.720  33.053  1.00 41.71 ? 130 GLU C O   1 
ATOM   7643  C CB  . GLU C 1 92  ? 54.677  50.646  33.445  1.00 40.35 ? 130 GLU C CB  1 
ATOM   7644  C CG  . GLU C 1 92  ? 55.321  51.882  32.930  1.00 42.11 ? 130 GLU C CG  1 
ATOM   7645  C CD  . GLU C 1 92  ? 56.192  52.503  33.974  1.00 45.67 ? 130 GLU C CD  1 
ATOM   7646  O OE1 . GLU C 1 92  ? 57.048  51.771  34.527  1.00 47.87 ? 130 GLU C OE1 1 
ATOM   7647  O OE2 . GLU C 1 92  ? 56.012  53.710  34.258  1.00 49.29 ? 130 GLU C OE2 1 
ATOM   7648  N N   . LEU C 1 93  ? 52.314  48.332  33.412  1.00 38.13 ? 131 LEU C N   1 
ATOM   7649  C CA  . LEU C 1 93  ? 51.922  47.106  34.105  1.00 36.72 ? 131 LEU C CA  1 
ATOM   7650  C C   . LEU C 1 93  ? 50.580  46.711  33.544  1.00 35.94 ? 131 LEU C C   1 
ATOM   7651  O O   . LEU C 1 93  ? 49.692  47.554  33.398  1.00 36.96 ? 131 LEU C O   1 
ATOM   7652  C CB  . LEU C 1 93  ? 51.824  47.368  35.608  1.00 36.29 ? 131 LEU C CB  1 
ATOM   7653  C CG  . LEU C 1 93  ? 51.341  46.303  36.581  1.00 36.60 ? 131 LEU C CG  1 
ATOM   7654  C CD1 . LEU C 1 93  ? 52.336  45.195  36.645  1.00 36.18 ? 131 LEU C CD1 1 
ATOM   7655  C CD2 . LEU C 1 93  ? 51.133  46.902  37.933  1.00 35.59 ? 131 LEU C CD2 1 
ATOM   7656  N N   . GLU C 1 94  ? 50.442  45.450  33.174  1.00 36.06 ? 132 GLU C N   1 
ATOM   7657  C CA  . GLU C 1 94  ? 49.115  44.892  32.840  1.00 36.18 ? 132 GLU C CA  1 
ATOM   7658  C C   . GLU C 1 94  ? 48.413  44.335  34.074  1.00 35.55 ? 132 GLU C C   1 
ATOM   7659  O O   . GLU C 1 94  ? 49.070  43.816  34.954  1.00 34.95 ? 132 GLU C O   1 
ATOM   7660  C CB  . GLU C 1 94  ? 49.270  43.820  31.777  1.00 35.88 ? 132 GLU C CB  1 
ATOM   7661  C CG  . GLU C 1 94  ? 49.959  44.349  30.538  1.00 36.22 ? 132 GLU C CG  1 
ATOM   7662  C CD  . GLU C 1 94  ? 50.632  43.271  29.732  1.00 38.11 ? 132 GLU C CD  1 
ATOM   7663  O OE1 . GLU C 1 94  ? 50.567  42.088  30.125  1.00 41.45 ? 132 GLU C OE1 1 
ATOM   7664  O OE2 . GLU C 1 94  ? 51.249  43.604  28.703  1.00 40.77 ? 132 GLU C OE2 1 
ATOM   7665  N N   . VAL C 1 95  ? 47.083  44.472  34.153  1.00 35.65 ? 133 VAL C N   1 
ATOM   7666  C CA  . VAL C 1 95  ? 46.356  44.015  35.306  1.00 35.17 ? 133 VAL C CA  1 
ATOM   7667  C C   . VAL C 1 95  ? 45.036  43.418  34.927  1.00 35.17 ? 133 VAL C C   1 
ATOM   7668  O O   . VAL C 1 95  ? 44.182  44.104  34.399  1.00 34.19 ? 133 VAL C O   1 
ATOM   7669  C CB  . VAL C 1 95  ? 46.045  45.126  36.322  1.00 35.87 ? 133 VAL C CB  1 
ATOM   7670  C CG1 . VAL C 1 95  ? 45.411  44.488  37.606  1.00 34.45 ? 133 VAL C CG1 1 
ATOM   7671  C CG2 . VAL C 1 95  ? 47.282  45.926  36.653  1.00 35.06 ? 133 VAL C CG2 1 
ATOM   7672  N N   . GLU C 1 96  ? 44.867  42.130  35.203  1.00 34.85 ? 134 GLU C N   1 
ATOM   7673  C CA  . GLU C 1 96  ? 43.543  41.516  35.112  1.00 35.40 ? 134 GLU C CA  1 
ATOM   7674  C C   . GLU C 1 96  ? 42.789  41.633  36.425  1.00 34.33 ? 134 GLU C C   1 
ATOM   7675  O O   . GLU C 1 96  ? 43.025  40.875  37.362  1.00 33.19 ? 134 GLU C O   1 
ATOM   7676  C CB  . GLU C 1 96  ? 43.632  40.049  34.794  1.00 36.42 ? 134 GLU C CB  1 
ATOM   7677  C CG  . GLU C 1 96  ? 44.354  39.730  33.555  1.00 39.28 ? 134 GLU C CG  1 
ATOM   7678  C CD  . GLU C 1 96  ? 44.256  38.254  33.272  1.00 42.50 ? 134 GLU C CD  1 
ATOM   7679  O OE1 . GLU C 1 96  ? 45.148  37.708  32.601  1.00 47.83 ? 134 GLU C OE1 1 
ATOM   7680  O OE2 . GLU C 1 96  ? 43.283  37.631  33.753  1.00 49.91 ? 134 GLU C OE2 1 
ATOM   7681  N N   . LEU C 1 97  ? 41.848  42.560  36.454  1.00 34.42 ? 135 LEU C N   1 
ATOM   7682  C CA  . LEU C 1 97  ? 41.000  42.770  37.600  1.00 34.21 ? 135 LEU C CA  1 
ATOM   7683  C C   . LEU C 1 97  ? 39.966  41.635  37.583  1.00 34.36 ? 135 LEU C C   1 
ATOM   7684  O O   . LEU C 1 97  ? 39.223  41.474  36.613  1.00 35.19 ? 135 LEU C O   1 
ATOM   7685  C CB  . LEU C 1 97  ? 40.391  44.165  37.544  1.00 33.82 ? 135 LEU C CB  1 
ATOM   7686  C CG  . LEU C 1 97  ? 41.370  45.346  37.789  1.00 33.65 ? 135 LEU C CG  1 
ATOM   7687  C CD1 . LEU C 1 97  ? 40.741  46.687  37.424  1.00 29.17 ? 135 LEU C CD1 1 
ATOM   7688  C CD2 . LEU C 1 97  ? 41.948  45.347  39.209  1.00 33.33 ? 135 LEU C CD2 1 
ATOM   7689  N N   . THR C 1 98  ? 39.983  40.813  38.628  1.00 34.33 ? 136 THR C N   1 
ATOM   7690  C CA  . THR C 1 98  ? 39.272  39.527  38.683  1.00 33.67 ? 136 THR C CA  1 
ATOM   7691  C C   . THR C 1 98  ? 38.495  39.515  39.991  1.00 34.49 ? 136 THR C C   1 
ATOM   7692  O O   . THR C 1 98  ? 39.080  39.737  41.045  1.00 34.45 ? 136 THR C O   1 
ATOM   7693  C CB  . THR C 1 98  ? 40.293  38.362  38.690  1.00 34.82 ? 136 THR C CB  1 
ATOM   7694  O OG1 . THR C 1 98  ? 41.190  38.521  37.568  1.00 36.87 ? 136 THR C OG1 1 
ATOM   7695  C CG2 . THR C 1 98  ? 39.623  36.953  38.640  1.00 31.78 ? 136 THR C CG2 1 
ATOM   7696  N N   . PRO C 1 99  ? 37.167  39.257  39.943  1.00 34.57 ? 137 PRO C N   1 
ATOM   7697  C CA  . PRO C 1 99  ? 36.444  39.191  41.182  1.00 34.66 ? 137 PRO C CA  1 
ATOM   7698  C C   . PRO C 1 99  ? 37.120  38.219  42.157  1.00 35.08 ? 137 PRO C C   1 
ATOM   7699  O O   . PRO C 1 99  ? 37.515  37.127  41.781  1.00 35.69 ? 137 PRO C O   1 
ATOM   7700  C CB  . PRO C 1 99  ? 35.054  38.702  40.735  1.00 35.31 ? 137 PRO C CB  1 
ATOM   7701  C CG  . PRO C 1 99  ? 34.942  39.124  39.347  1.00 34.29 ? 137 PRO C CG  1 
ATOM   7702  C CD  . PRO C 1 99  ? 36.297  39.011  38.784  1.00 34.25 ? 137 PRO C CD  1 
ATOM   7703  N N   . GLN C 1 100 ? 37.233  38.623  43.413  1.00 35.63 ? 138 GLN C N   1 
ATOM   7704  C CA  . GLN C 1 100 ? 37.981  37.902  44.461  1.00 34.55 ? 138 GLN C CA  1 
ATOM   7705  C C   . GLN C 1 100 ? 37.566  36.429  44.631  1.00 34.91 ? 138 GLN C C   1 
ATOM   7706  O O   . GLN C 1 100 ? 38.425  35.569  44.880  1.00 37.01 ? 138 GLN C O   1 
ATOM   7707  C CB  . GLN C 1 100 ? 37.797  38.624  45.808  1.00 34.53 ? 138 GLN C CB  1 
ATOM   7708  C CG  . GLN C 1 100 ? 38.780  38.174  46.862  1.00 33.43 ? 138 GLN C CG  1 
ATOM   7709  C CD  . GLN C 1 100 ? 38.719  38.935  48.168  1.00 36.16 ? 138 GLN C CD  1 
ATOM   7710  O OE1 . GLN C 1 100 ? 38.708  38.328  49.241  1.00 38.60 ? 138 GLN C OE1 1 
ATOM   7711  N NE2 . GLN C 1 100 ? 38.734  40.253  48.100  1.00 38.36 ? 138 GLN C NE2 1 
ATOM   7712  N N   . GLY C 1 101 ? 36.275  36.152  44.506  1.00 32.94 ? 139 GLY C N   1 
ATOM   7713  C CA  . GLY C 1 101 ? 35.750  34.800  44.629  1.00 33.55 ? 139 GLY C CA  1 
ATOM   7714  C C   . GLY C 1 101 ? 36.012  33.930  43.413  1.00 32.79 ? 139 GLY C C   1 
ATOM   7715  O O   . GLY C 1 101 ? 36.230  32.733  43.519  1.00 32.92 ? 139 GLY C O   1 
ATOM   7716  N N   . THR C 1 102 ? 36.009  34.546  42.246  1.00 34.20 ? 140 THR C N   1 
ATOM   7717  C CA  . THR C 1 102 ? 36.416  33.880  41.020  1.00 33.85 ? 140 THR C CA  1 
ATOM   7718  C C   . THR C 1 102 ? 37.920  33.615  41.047  1.00 35.08 ? 140 THR C C   1 
ATOM   7719  O O   . THR C 1 102 ? 38.378  32.545  40.609  1.00 35.81 ? 140 THR C O   1 
ATOM   7720  C CB  . THR C 1 102 ? 35.995  34.738  39.863  1.00 34.43 ? 140 THR C CB  1 
ATOM   7721  O OG1 . THR C 1 102 ? 34.575  34.735  39.845  1.00 34.90 ? 140 THR C OG1 1 
ATOM   7722  C CG2 . THR C 1 102 ? 36.539  34.288  38.583  1.00 30.24 ? 140 THR C CG2 1 
ATOM   7723  N N   . LEU C 1 103 ? 38.678  34.557  41.596  1.00 34.88 ? 141 LEU C N   1 
ATOM   7724  C CA  . LEU C 1 103 ? 40.114  34.362  41.786  1.00 34.97 ? 141 LEU C CA  1 
ATOM   7725  C C   . LEU C 1 103 ? 40.365  33.143  42.665  1.00 34.85 ? 141 LEU C C   1 
ATOM   7726  O O   . LEU C 1 103 ? 41.160  32.286  42.300  1.00 34.84 ? 141 LEU C O   1 
ATOM   7727  C CB  . LEU C 1 103 ? 40.763  35.656  42.329  1.00 34.88 ? 141 LEU C CB  1 
ATOM   7728  C CG  . LEU C 1 103 ? 42.279  35.736  42.452  1.00 36.58 ? 141 LEU C CG  1 
ATOM   7729  C CD1 . LEU C 1 103 ? 42.975  35.475  41.134  1.00 32.63 ? 141 LEU C CD1 1 
ATOM   7730  C CD2 . LEU C 1 103 ? 42.590  37.083  42.977  1.00 37.58 ? 141 LEU C CD2 1 
ATOM   7731  N N   . ALA C 1 104 ? 39.659  33.049  43.798  1.00 34.60 ? 142 ALA C N   1 
ATOM   7732  C CA  . ALA C 1 104 ? 39.820  31.975  44.762  1.00 35.31 ? 142 ALA C CA  1 
ATOM   7733  C C   . ALA C 1 104 ? 39.364  30.623  44.222  1.00 35.87 ? 142 ALA C C   1 
ATOM   7734  O O   . ALA C 1 104 ? 39.979  29.563  44.509  1.00 36.40 ? 142 ALA C O   1 
ATOM   7735  C CB  . ALA C 1 104 ? 39.040  32.282  46.090  1.00 36.28 ? 142 ALA C CB  1 
ATOM   7736  N N   . GLU C 1 105 ? 38.275  30.646  43.469  1.00 35.76 ? 143 GLU C N   1 
ATOM   7737  C CA  . GLU C 1 105 ? 37.738  29.433  42.932  1.00 35.94 ? 143 GLU C CA  1 
ATOM   7738  C C   . GLU C 1 105 ? 38.502  28.981  41.710  1.00 34.56 ? 143 GLU C C   1 
ATOM   7739  O O   . GLU C 1 105 ? 38.652  27.790  41.517  1.00 34.03 ? 143 GLU C O   1 
ATOM   7740  C CB  . GLU C 1 105 ? 36.253  29.564  42.627  1.00 36.93 ? 143 GLU C CB  1 
ATOM   7741  C CG  . GLU C 1 105 ? 35.615  28.230  42.267  1.00 39.37 ? 143 GLU C CG  1 
ATOM   7742  C CD  . GLU C 1 105 ? 35.636  27.210  43.405  1.00 47.88 ? 143 GLU C CD  1 
ATOM   7743  O OE1 . GLU C 1 105 ? 35.687  25.988  43.085  1.00 53.02 ? 143 GLU C OE1 1 
ATOM   7744  O OE2 . GLU C 1 105 ? 35.575  27.606  44.602  1.00 50.17 ? 143 GLU C OE2 1 
ATOM   7745  N N   . ARG C 1 106 ? 39.039  29.902  40.917  1.00 33.77 ? 144 ARG C N   1 
ATOM   7746  C CA  . ARG C 1 106 ? 39.856  29.496  39.772  1.00 33.44 ? 144 ARG C CA  1 
ATOM   7747  C C   . ARG C 1 106 ? 41.171  28.847  40.192  1.00 34.32 ? 144 ARG C C   1 
ATOM   7748  O O   . ARG C 1 106 ? 41.633  27.935  39.529  1.00 34.22 ? 144 ARG C O   1 
ATOM   7749  C CB  . ARG C 1 106 ? 40.150  30.684  38.877  1.00 33.66 ? 144 ARG C CB  1 
ATOM   7750  C CG  . ARG C 1 106 ? 38.957  31.102  37.994  1.00 34.42 ? 144 ARG C CG  1 
ATOM   7751  C CD  . ARG C 1 106 ? 39.245  32.395  37.300  1.00 35.89 ? 144 ARG C CD  1 
ATOM   7752  N NE  . ARG C 1 106 ? 40.341  32.275  36.339  1.00 35.15 ? 144 ARG C NE  1 
ATOM   7753  C CZ  . ARG C 1 106 ? 40.861  33.277  35.642  1.00 36.00 ? 144 ARG C CZ  1 
ATOM   7754  N NH1 . ARG C 1 106 ? 40.409  34.520  35.777  1.00 34.08 ? 144 ARG C NH1 1 
ATOM   7755  N NH2 . ARG C 1 106 ? 41.885  33.025  34.842  1.00 34.00 ? 144 ARG C NH2 1 
ATOM   7756  N N   . ILE C 1 107 ? 41.786  29.378  41.260  1.00 34.59 ? 145 ILE C N   1 
ATOM   7757  C CA  . ILE C 1 107 ? 42.967  28.802  41.853  1.00 34.19 ? 145 ILE C CA  1 
ATOM   7758  C C   . ILE C 1 107 ? 42.646  27.450  42.434  1.00 34.21 ? 145 ILE C C   1 
ATOM   7759  O O   . ILE C 1 107 ? 43.398  26.505  42.235  1.00 32.01 ? 145 ILE C O   1 
ATOM   7760  C CB  . ILE C 1 107 ? 43.596  29.669  42.983  1.00 34.43 ? 145 ILE C CB  1 
ATOM   7761  C CG1 . ILE C 1 107 ? 44.047  31.015  42.422  1.00 35.09 ? 145 ILE C CG1 1 
ATOM   7762  C CG2 . ILE C 1 107 ? 44.781  28.906  43.665  1.00 35.41 ? 145 ILE C CG2 1 
ATOM   7763  C CD1 . ILE C 1 107 ? 44.290  32.113  43.437  1.00 32.78 ? 145 ILE C CD1 1 
ATOM   7764  N N   . ARG C 1 108 ? 41.538  27.350  43.175  1.00 35.31 ? 146 ARG C N   1 
ATOM   7765  C CA  . ARG C 1 108 ? 41.160  26.080  43.769  1.00 35.25 ? 146 ARG C CA  1 
ATOM   7766  C C   . ARG C 1 108 ? 40.936  25.044  42.667  1.00 34.81 ? 146 ARG C C   1 
ATOM   7767  O O   . ARG C 1 108 ? 41.357  23.910  42.787  1.00 35.71 ? 146 ARG C O   1 
ATOM   7768  C CB  . ARG C 1 108 ? 39.896  26.258  44.606  1.00 36.64 ? 146 ARG C CB  1 
ATOM   7769  C CG  . ARG C 1 108 ? 39.523  25.018  45.426  1.00 40.14 ? 146 ARG C CG  1 
ATOM   7770  C CD  . ARG C 1 108 ? 38.077  24.637  45.295  1.00 46.97 ? 146 ARG C CD  1 
ATOM   7771  N NE  . ARG C 1 108 ? 37.772  23.307  45.856  1.00 48.79 ? 146 ARG C NE  1 
ATOM   7772  C CZ  . ARG C 1 108 ? 37.295  22.250  45.172  1.00 51.16 ? 146 ARG C CZ  1 
ATOM   7773  N NH1 . ARG C 1 108 ? 37.058  22.301  43.853  1.00 50.14 ? 146 ARG C NH1 1 
ATOM   7774  N NH2 . ARG C 1 108 ? 37.038  21.113  45.827  1.00 47.78 ? 146 ARG C NH2 1 
ATOM   7775  N N   . ALA C 1 109 ? 40.235  25.431  41.602  1.00 34.76 ? 147 ALA C N   1 
ATOM   7776  C CA  . ALA C 1 109 ? 40.009  24.562  40.446  1.00 34.19 ? 147 ALA C CA  1 
ATOM   7777  C C   . ALA C 1 109 ? 41.327  24.075  39.858  1.00 34.90 ? 147 ALA C C   1 
ATOM   7778  O O   . ALA C 1 109 ? 41.459  22.879  39.516  1.00 35.24 ? 147 ALA C O   1 
ATOM   7779  C CB  . ALA C 1 109 ? 39.167  25.266  39.384  1.00 33.41 ? 147 ALA C CB  1 
ATOM   7780  N N   . GLY C 1 110 ? 42.302  24.981  39.747  1.00 34.89 ? 148 GLY C N   1 
ATOM   7781  C CA  . GLY C 1 110 ? 43.656  24.650  39.300  1.00 34.58 ? 148 GLY C CA  1 
ATOM   7782  C C   . GLY C 1 110 ? 44.361  23.586  40.112  1.00 35.53 ? 148 GLY C C   1 
ATOM   7783  O O   . GLY C 1 110 ? 45.044  22.722  39.563  1.00 36.11 ? 148 GLY C O   1 
ATOM   7784  N N   . GLY C 1 111 ? 44.190  23.599  41.426  1.00 35.56 ? 149 GLY C N   1 
ATOM   7785  C CA  . GLY C 1 111 ? 44.687  22.503  42.236  1.00 35.71 ? 149 GLY C CA  1 
ATOM   7786  C C   . GLY C 1 111 ? 43.924  21.196  42.234  1.00 35.54 ? 149 GLY C C   1 
ATOM   7787  O O   . GLY C 1 111 ? 44.468  20.160  42.623  1.00 36.70 ? 149 GLY C O   1 
ATOM   7788  N N   . ALA C 1 112 ? 42.676  21.246  41.806  1.00 35.79 ? 150 ALA C N   1 
ATOM   7789  C CA  . ALA C 1 112 ? 41.709  20.149  41.952  1.00 35.08 ? 150 ALA C CA  1 
ATOM   7790  C C   . ALA C 1 112 ? 41.427  19.427  40.667  1.00 34.38 ? 150 ALA C C   1 
ATOM   7791  O O   . ALA C 1 112 ? 40.573  18.547  40.662  1.00 35.10 ? 150 ALA C O   1 
ATOM   7792  C CB  . ALA C 1 112 ? 40.387  20.667  42.525  1.00 34.13 ? 150 ALA C CB  1 
ATOM   7793  N N   . GLY C 1 113 ? 42.135  19.770  39.594  1.00 33.70 ? 151 GLY C N   1 
ATOM   7794  C CA  . GLY C 1 113 ? 41.956  19.150  38.282  1.00 33.29 ? 151 GLY C CA  1 
ATOM   7795  C C   . GLY C 1 113 ? 40.680  19.490  37.539  1.00 33.40 ? 151 GLY C C   1 
ATOM   7796  O O   . GLY C 1 113 ? 40.243  18.735  36.654  1.00 34.73 ? 151 GLY C O   1 
ATOM   7797  N N   . VAL C 1 114 ? 40.088  20.631  37.874  1.00 33.53 ? 152 VAL C N   1 
ATOM   7798  C CA  . VAL C 1 114 ? 38.903  21.166  37.212  1.00 33.58 ? 152 VAL C CA  1 
ATOM   7799  C C   . VAL C 1 114 ? 39.348  22.321  36.276  1.00 34.02 ? 152 VAL C C   1 
ATOM   7800  O O   . VAL C 1 114 ? 39.834  23.323  36.740  1.00 34.29 ? 152 VAL C O   1 
ATOM   7801  C CB  . VAL C 1 114 ? 37.891  21.657  38.267  1.00 34.35 ? 152 VAL C CB  1 
ATOM   7802  C CG1 . VAL C 1 114 ? 36.708  22.461  37.594  1.00 32.47 ? 152 VAL C CG1 1 
ATOM   7803  C CG2 . VAL C 1 114 ? 37.389  20.458  39.112  1.00 31.33 ? 152 VAL C CG2 1 
ATOM   7804  N N   . PRO C 1 115 ? 39.298  22.115  34.955  1.00 34.27 ? 153 PRO C N   1 
ATOM   7805  C CA  . PRO C 1 115 ? 39.836  23.129  34.048  1.00 34.33 ? 153 PRO C CA  1 
ATOM   7806  C C   . PRO C 1 115 ? 38.960  24.342  33.865  1.00 35.01 ? 153 PRO C C   1 
ATOM   7807  O O   . PRO C 1 115 ? 39.452  25.361  33.437  1.00 35.40 ? 153 PRO C O   1 
ATOM   7808  C CB  . PRO C 1 115 ? 39.944  22.362  32.734  1.00 33.68 ? 153 PRO C CB  1 
ATOM   7809  C CG  . PRO C 1 115 ? 38.773  21.386  32.839  1.00 33.95 ? 153 PRO C CG  1 
ATOM   7810  C CD  . PRO C 1 115 ? 38.831  20.923  34.223  1.00 32.97 ? 153 PRO C CD  1 
ATOM   7811  N N   . ALA C 1 116 ? 37.667  24.197  34.123  1.00 35.02 ? 154 ALA C N   1 
ATOM   7812  C CA  . ALA C 1 116 ? 36.733  25.292  33.981  1.00 35.75 ? 154 ALA C CA  1 
ATOM   7813  C C   . ALA C 1 116 ? 35.493  25.028  34.846  1.00 34.87 ? 154 ALA C C   1 
ATOM   7814  O O   . ALA C 1 116 ? 35.185  23.884  35.136  1.00 35.78 ? 154 ALA C O   1 
ATOM   7815  C CB  . ALA C 1 116 ? 36.360  25.483  32.513  1.00 34.88 ? 154 ALA C CB  1 
ATOM   7816  N N   . PHE C 1 117 ? 34.808  26.093  35.258  1.00 34.83 ? 155 PHE C N   1 
ATOM   7817  C CA  . PHE C 1 117 ? 33.530  25.974  35.958  1.00 33.78 ? 155 PHE C CA  1 
ATOM   7818  C C   . PHE C 1 117 ? 32.625  27.147  35.673  1.00 33.17 ? 155 PHE C C   1 
ATOM   7819  O O   . PHE C 1 117 ? 33.083  28.201  35.252  1.00 33.07 ? 155 PHE C O   1 
ATOM   7820  C CB  . PHE C 1 117 ? 33.779  25.867  37.482  1.00 34.31 ? 155 PHE C CB  1 
ATOM   7821  C CG  . PHE C 1 117 ? 34.456  27.065  38.074  1.00 33.56 ? 155 PHE C CG  1 
ATOM   7822  C CD1 . PHE C 1 117 ? 33.713  28.095  38.664  1.00 34.00 ? 155 PHE C CD1 1 
ATOM   7823  C CD2 . PHE C 1 117 ? 35.830  27.173  38.065  1.00 35.28 ? 155 PHE C CD2 1 
ATOM   7824  C CE1 . PHE C 1 117 ? 34.308  29.205  39.213  1.00 32.82 ? 155 PHE C CE1 1 
ATOM   7825  C CE2 . PHE C 1 117 ? 36.454  28.327  38.607  1.00 36.06 ? 155 PHE C CE2 1 
ATOM   7826  C CZ  . PHE C 1 117 ? 35.670  29.341  39.175  1.00 35.63 ? 155 PHE C CZ  1 
ATOM   7827  N N   . TYR C 1 118 ? 31.334  27.023  35.965  1.00 32.54 ? 156 TYR C N   1 
ATOM   7828  C CA  . TYR C 1 118 ? 30.467  28.198  35.811  1.00 32.69 ? 156 TYR C CA  1 
ATOM   7829  C C   . TYR C 1 118 ? 30.236  28.938  37.124  1.00 33.60 ? 156 TYR C C   1 
ATOM   7830  O O   . TYR C 1 118 ? 29.989  28.308  38.156  1.00 33.13 ? 156 TYR C O   1 
ATOM   7831  C CB  . TYR C 1 118 ? 29.147  27.805  35.193  1.00 32.27 ? 156 TYR C CB  1 
ATOM   7832  C CG  . TYR C 1 118 ? 29.286  27.425  33.729  1.00 33.15 ? 156 TYR C CG  1 
ATOM   7833  C CD1 . TYR C 1 118 ? 29.209  28.373  32.716  1.00 30.13 ? 156 TYR C CD1 1 
ATOM   7834  C CD2 . TYR C 1 118 ? 29.502  26.123  33.369  1.00 30.87 ? 156 TYR C CD2 1 
ATOM   7835  C CE1 . TYR C 1 118 ? 29.297  28.005  31.401  1.00 30.08 ? 156 TYR C CE1 1 
ATOM   7836  C CE2 . TYR C 1 118 ? 29.598  25.743  32.044  1.00 33.84 ? 156 TYR C CE2 1 
ATOM   7837  C CZ  . TYR C 1 118 ? 29.497  26.663  31.076  1.00 33.52 ? 156 TYR C CZ  1 
ATOM   7838  O OH  . TYR C 1 118 ? 29.659  26.226  29.789  1.00 33.59 ? 156 TYR C OH  1 
ATOM   7839  N N   . THR C 1 119 ? 30.244  30.269  37.075  1.00 34.20 ? 157 THR C N   1 
ATOM   7840  C CA  . THR C 1 119 ? 29.880  31.103  38.256  1.00 34.50 ? 157 THR C CA  1 
ATOM   7841  C C   . THR C 1 119 ? 28.893  32.225  37.892  1.00 35.19 ? 157 THR C C   1 
ATOM   7842  O O   . THR C 1 119 ? 28.952  32.757  36.767  1.00 35.08 ? 157 THR C O   1 
ATOM   7843  C CB  . THR C 1 119 ? 31.162  31.751  38.884  1.00 35.60 ? 157 THR C CB  1 
ATOM   7844  O OG1 . THR C 1 119 ? 30.821  32.528  40.051  1.00 33.72 ? 157 THR C OG1 1 
ATOM   7845  C CG2 . THR C 1 119 ? 31.891  32.573  37.866  1.00 31.05 ? 157 THR C CG2 1 
ATOM   7846  N N   . PRO C 1 120 ? 27.986  32.606  38.838  1.00 35.29 ? 158 PRO C N   1 
ATOM   7847  C CA  . PRO C 1 120 ? 27.091  33.751  38.613  1.00 35.66 ? 158 PRO C CA  1 
ATOM   7848  C C   . PRO C 1 120 ? 27.819  35.081  38.634  1.00 35.89 ? 158 PRO C C   1 
ATOM   7849  O O   . PRO C 1 120 ? 27.266  36.079  38.147  1.00 37.02 ? 158 PRO C O   1 
ATOM   7850  C CB  . PRO C 1 120 ? 26.149  33.694  39.831  1.00 35.56 ? 158 PRO C CB  1 
ATOM   7851  C CG  . PRO C 1 120 ? 27.009  33.119  40.872  1.00 34.28 ? 158 PRO C CG  1 
ATOM   7852  C CD  . PRO C 1 120 ? 27.735  32.028  40.170  1.00 34.69 ? 158 PRO C CD  1 
ATOM   7853  N N   . THR C 1 121 ? 29.040  35.094  39.191  1.00 35.42 ? 159 THR C N   1 
ATOM   7854  C CA  . THR C 1 121 ? 29.748  36.331  39.504  1.00 34.57 ? 159 THR C CA  1 
ATOM   7855  C C   . THR C 1 121 ? 30.264  37.042  38.251  1.00 34.65 ? 159 THR C C   1 
ATOM   7856  O O   . THR C 1 121 ? 31.013  36.461  37.459  1.00 36.21 ? 159 THR C O   1 
ATOM   7857  C CB  . THR C 1 121 ? 30.915  36.048  40.475  1.00 35.12 ? 159 THR C CB  1 
ATOM   7858  O OG1 . THR C 1 121 ? 30.396  35.464  41.679  1.00 34.98 ? 159 THR C OG1 1 
ATOM   7859  C CG2 . THR C 1 121 ? 31.677  37.298  40.816  1.00 31.76 ? 159 THR C CG2 1 
ATOM   7860  N N   . GLY C 1 122 ? 29.919  38.325  38.126  1.00 33.41 ? 160 GLY C N   1 
ATOM   7861  C CA  . GLY C 1 122 ? 30.341  39.142  37.032  1.00 32.49 ? 160 GLY C CA  1 
ATOM   7862  C C   . GLY C 1 122 ? 29.426  39.156  35.829  1.00 31.99 ? 160 GLY C C   1 
ATOM   7863  O O   . GLY C 1 122 ? 29.647  39.937  34.909  1.00 30.67 ? 160 GLY C O   1 
ATOM   7864  N N   . TYR C 1 123 ? 28.436  38.255  35.805  1.00 31.88 ? 161 TYR C N   1 
ATOM   7865  C CA  . TYR C 1 123 ? 27.378  38.290  34.823  1.00 32.22 ? 161 TYR C CA  1 
ATOM   7866  C C   . TYR C 1 123 ? 26.807  39.743  34.846  1.00 32.43 ? 161 TYR C C   1 
ATOM   7867  O O   . TYR C 1 123 ? 26.596  40.299  35.914  1.00 32.54 ? 161 TYR C O   1 
ATOM   7868  C CB  . TYR C 1 123 ? 26.275  37.238  35.092  1.00 33.30 ? 161 TYR C CB  1 
ATOM   7869  C CG  . TYR C 1 123 ? 25.098  37.525  34.206  1.00 33.61 ? 161 TYR C CG  1 
ATOM   7870  C CD1 . TYR C 1 123 ? 25.201  37.340  32.813  1.00 35.71 ? 161 TYR C CD1 1 
ATOM   7871  C CD2 . TYR C 1 123 ? 23.950  38.123  34.704  1.00 33.24 ? 161 TYR C CD2 1 
ATOM   7872  C CE1 . TYR C 1 123 ? 24.165  37.693  31.938  1.00 33.04 ? 161 TYR C CE1 1 
ATOM   7873  C CE2 . TYR C 1 123 ? 22.918  38.500  33.838  1.00 34.96 ? 161 TYR C CE2 1 
ATOM   7874  C CZ  . TYR C 1 123 ? 23.020  38.255  32.457  1.00 33.54 ? 161 TYR C CZ  1 
ATOM   7875  O OH  . TYR C 1 123 ? 21.989  38.599  31.595  1.00 33.73 ? 161 TYR C OH  1 
ATOM   7876  N N   . GLY C 1 124 ? 26.633  40.374  33.676  1.00 31.89 ? 162 GLY C N   1 
ATOM   7877  C CA  . GLY C 1 124 ? 26.053  41.735  33.611  1.00 31.74 ? 162 GLY C CA  1 
ATOM   7878  C C   . GLY C 1 124 ? 27.020  42.903  33.737  1.00 30.90 ? 162 GLY C C   1 
ATOM   7879  O O   . GLY C 1 124 ? 26.627  44.081  33.742  1.00 30.93 ? 162 GLY C O   1 
ATOM   7880  N N   . THR C 1 125 ? 28.282  42.553  33.809  1.00 31.05 ? 163 THR C N   1 
ATOM   7881  C CA  . THR C 1 125 ? 29.368  43.451  34.047  1.00 31.19 ? 163 THR C CA  1 
ATOM   7882  C C   . THR C 1 125 ? 30.459  43.239  32.973  1.00 32.08 ? 163 THR C C   1 
ATOM   7883  O O   . THR C 1 125 ? 30.331  42.345  32.127  1.00 31.29 ? 163 THR C O   1 
ATOM   7884  C CB  . THR C 1 125 ? 29.983  43.209  35.457  1.00 31.51 ? 163 THR C CB  1 
ATOM   7885  O OG1 . THR C 1 125 ? 30.977  42.203  35.367  1.00 32.26 ? 163 THR C OG1 1 
ATOM   7886  C CG2 . THR C 1 125 ? 28.919  42.820  36.539  1.00 28.96 ? 163 THR C CG2 1 
ATOM   7887  N N   . LEU C 1 126 ? 31.494  44.094  33.015  1.00 31.58 ? 164 LEU C N   1 
ATOM   7888  C CA  . LEU C 1 126 ? 32.665  44.033  32.129  1.00 32.10 ? 164 LEU C CA  1 
ATOM   7889  C C   . LEU C 1 126 ? 33.435  42.730  32.169  1.00 32.43 ? 164 LEU C C   1 
ATOM   7890  O O   . LEU C 1 126 ? 34.077  42.342  31.172  1.00 35.56 ? 164 LEU C O   1 
ATOM   7891  C CB  . LEU C 1 126 ? 33.638  45.209  32.412  1.00 31.06 ? 164 LEU C CB  1 
ATOM   7892  C CG  . LEU C 1 126 ? 33.195  46.655  32.157  1.00 30.12 ? 164 LEU C CG  1 
ATOM   7893  C CD1 . LEU C 1 126 ? 34.325  47.633  32.489  1.00 25.68 ? 164 LEU C CD1 1 
ATOM   7894  C CD2 . LEU C 1 126 ? 32.745  46.906  30.702  1.00 31.69 ? 164 LEU C CD2 1 
ATOM   7895  N N   . VAL C 1 127 ? 33.453  42.085  33.320  1.00 33.42 ? 165 VAL C N   1 
ATOM   7896  C CA  . VAL C 1 127 ? 33.981  40.720  33.439  1.00 33.37 ? 165 VAL C CA  1 
ATOM   7897  C C   . VAL C 1 127 ? 33.330  39.809  32.397  1.00 33.35 ? 165 VAL C C   1 
ATOM   7898  O O   . VAL C 1 127 ? 34.025  39.197  31.581  1.00 33.78 ? 165 VAL C O   1 
ATOM   7899  C CB  . VAL C 1 127 ? 33.845  40.174  34.887  1.00 34.01 ? 165 VAL C CB  1 
ATOM   7900  C CG1 . VAL C 1 127 ? 34.488  38.807  35.035  1.00 34.61 ? 165 VAL C CG1 1 
ATOM   7901  C CG2 . VAL C 1 127 ? 34.462  41.124  35.862  1.00 34.88 ? 165 VAL C CG2 1 
ATOM   7902  N N   . GLN C 1 128 ? 32.002  39.800  32.347  1.00 32.71 ? 166 GLN C N   1 
ATOM   7903  C CA  . GLN C 1 128 ? 31.257  38.999  31.381  1.00 31.40 ? 166 GLN C CA  1 
ATOM   7904  C C   . GLN C 1 128 ? 31.303  39.534  29.950  1.00 31.45 ? 166 GLN C C   1 
ATOM   7905  O O   . GLN C 1 128 ? 31.612  38.811  29.006  1.00 29.77 ? 166 GLN C O   1 
ATOM   7906  C CB  . GLN C 1 128 ? 29.820  38.849  31.865  1.00 31.38 ? 166 GLN C CB  1 
ATOM   7907  C CG  . GLN C 1 128 ? 28.911  38.089  30.916  1.00 32.16 ? 166 GLN C CG  1 
ATOM   7908  C CD  . GLN C 1 128 ? 27.925  38.977  30.217  1.00 29.63 ? 166 GLN C CD  1 
ATOM   7909  O OE1 . GLN C 1 128 ? 27.116  39.598  30.875  1.00 29.42 ? 166 GLN C OE1 1 
ATOM   7910  N NE2 . GLN C 1 128 ? 27.984  39.040  28.890  1.00 27.04 ? 166 GLN C NE2 1 
ATOM   7911  N N   . GLU C 1 129 ? 31.004  40.815  29.776  1.00 31.58 ? 167 GLU C N   1 
ATOM   7912  C CA  . GLU C 1 129 ? 30.909  41.372  28.431  1.00 31.57 ? 167 GLU C CA  1 
ATOM   7913  C C   . GLU C 1 129 ? 32.261  41.660  27.819  1.00 30.66 ? 167 GLU C C   1 
ATOM   7914  O O   . GLU C 1 129 ? 32.346  41.861  26.630  1.00 31.12 ? 167 GLU C O   1 
ATOM   7915  C CB  . GLU C 1 129 ? 30.098  42.640  28.463  1.00 31.35 ? 167 GLU C CB  1 
ATOM   7916  C CG  . GLU C 1 129 ? 28.748  42.460  29.088  1.00 35.13 ? 167 GLU C CG  1 
ATOM   7917  C CD  . GLU C 1 129 ? 27.806  43.617  28.756  1.00 41.49 ? 167 GLU C CD  1 
ATOM   7918  O OE1 . GLU C 1 129 ? 28.099  44.318  27.768  1.00 47.01 ? 167 GLU C OE1 1 
ATOM   7919  O OE2 . GLU C 1 129 ? 26.775  43.809  29.450  1.00 46.25 ? 167 GLU C OE2 1 
ATOM   7920  N N   . GLY C 1 130 ? 33.315  41.690  28.629  1.00 30.63 ? 168 GLY C N   1 
ATOM   7921  C CA  . GLY C 1 130 ? 34.619  42.125  28.156  1.00 31.62 ? 168 GLY C CA  1 
ATOM   7922  C C   . GLY C 1 130 ? 34.742  43.626  28.227  1.00 31.87 ? 168 GLY C C   1 
ATOM   7923  O O   . GLY C 1 130 ? 33.781  44.300  28.495  1.00 31.74 ? 168 GLY C O   1 
ATOM   7924  N N   . GLY C 1 131 ? 35.950  44.144  28.026  1.00 33.01 ? 169 GLY C N   1 
ATOM   7925  C CA  . GLY C 1 131 ? 36.201  45.570  28.097  1.00 33.37 ? 169 GLY C CA  1 
ATOM   7926  C C   . GLY C 1 131 ? 36.776  46.054  29.419  1.00 33.54 ? 169 GLY C C   1 
ATOM   7927  O O   . GLY C 1 131 ? 36.902  47.268  29.630  1.00 33.26 ? 169 GLY C O   1 
ATOM   7928  N N   . SER C 1 132 ? 37.110  45.139  30.323  1.00 33.76 ? 170 SER C N   1 
ATOM   7929  C CA  . SER C 1 132 ? 37.833  45.550  31.511  1.00 34.87 ? 170 SER C CA  1 
ATOM   7930  C C   . SER C 1 132 ? 39.249  45.965  31.107  1.00 35.05 ? 170 SER C C   1 
ATOM   7931  O O   . SER C 1 132 ? 39.901  45.258  30.344  1.00 34.40 ? 170 SER C O   1 
ATOM   7932  C CB  . SER C 1 132 ? 37.853  44.470  32.592  1.00 35.82 ? 170 SER C CB  1 
ATOM   7933  O OG  . SER C 1 132 ? 38.410  45.004  33.798  1.00 37.82 ? 170 SER C OG  1 
ATOM   7934  N N   . PRO C 1 133 ? 39.734  47.126  31.613  1.00 35.99 ? 171 PRO C N   1 
ATOM   7935  C CA  . PRO C 1 133 ? 41.045  47.605  31.149  1.00 35.91 ? 171 PRO C CA  1 
ATOM   7936  C C   . PRO C 1 133 ? 42.161  46.720  31.726  1.00 35.82 ? 171 PRO C C   1 
ATOM   7937  O O   . PRO C 1 133 ? 42.164  46.473  32.948  1.00 36.35 ? 171 PRO C O   1 
ATOM   7938  C CB  . PRO C 1 133 ? 41.120  49.034  31.715  1.00 36.36 ? 171 PRO C CB  1 
ATOM   7939  C CG  . PRO C 1 133 ? 39.819  49.292  32.416  1.00 37.71 ? 171 PRO C CG  1 
ATOM   7940  C CD  . PRO C 1 133 ? 39.203  47.975  32.699  1.00 35.83 ? 171 PRO C CD  1 
ATOM   7941  N N   . ILE C 1 134 ? 43.025  46.184  30.854  1.00 35.59 ? 172 ILE C N   1 
ATOM   7942  C CA  . ILE C 1 134 ? 44.196  45.384  31.252  1.00 35.21 ? 172 ILE C CA  1 
ATOM   7943  C C   . ILE C 1 134 ? 45.461  46.223  31.091  1.00 35.51 ? 172 ILE C C   1 
ATOM   7944  O O   . ILE C 1 134 ? 46.391  46.150  31.885  1.00 34.70 ? 172 ILE C O   1 
ATOM   7945  C CB  . ILE C 1 134 ? 44.305  44.022  30.461  1.00 35.69 ? 172 ILE C CB  1 
ATOM   7946  C CG1 . ILE C 1 134 ? 43.112  43.099  30.795  1.00 35.25 ? 172 ILE C CG1 1 
ATOM   7947  C CG2 . ILE C 1 134 ? 45.647  43.289  30.751  1.00 35.47 ? 172 ILE C CG2 1 
ATOM   7948  C CD1 . ILE C 1 134 ? 42.957  41.946  29.870  1.00 34.25 ? 172 ILE C CD1 1 
ATOM   7949  N N   . LYS C 1 135 ? 45.489  47.031  30.052  1.00 36.46 ? 173 LYS C N   1 
ATOM   7950  C CA  . LYS C 1 135 ? 46.636  47.891  29.788  1.00 36.78 ? 173 LYS C CA  1 
ATOM   7951  C C   . LYS C 1 135 ? 46.081  49.213  29.325  1.00 36.32 ? 173 LYS C C   1 
ATOM   7952  O O   . LYS C 1 135 ? 45.143  49.262  28.532  1.00 35.43 ? 173 LYS C O   1 
ATOM   7953  C CB  . LYS C 1 135 ? 47.555  47.275  28.749  1.00 36.78 ? 173 LYS C CB  1 
ATOM   7954  C CG  . LYS C 1 135 ? 48.932  47.949  28.643  1.00 37.48 ? 173 LYS C CG  1 
ATOM   7955  C CD  . LYS C 1 135 ? 49.768  47.380  27.521  1.00 37.56 ? 173 LYS C CD  1 
ATOM   7956  C CE  . LYS C 1 135 ? 51.232  47.781  27.719  1.00 40.07 ? 173 LYS C CE  1 
ATOM   7957  N NZ  . LYS C 1 135 ? 52.043  47.833  26.495  1.00 38.11 ? 173 LYS C NZ  1 
ATOM   7958  N N   . TYR C 1 136 ? 46.632  50.274  29.896  1.00 36.88 ? 174 TYR C N   1 
ATOM   7959  C CA  . TYR C 1 136 ? 46.259  51.644  29.563  1.00 36.46 ? 174 TYR C CA  1 
ATOM   7960  C C   . TYR C 1 136 ? 47.307  52.231  28.677  1.00 37.57 ? 174 TYR C C   1 
ATOM   7961  O O   . TYR C 1 136 ? 48.461  51.815  28.715  1.00 37.20 ? 174 TYR C O   1 
ATOM   7962  C CB  . TYR C 1 136 ? 46.148  52.512  30.826  1.00 36.15 ? 174 TYR C CB  1 
ATOM   7963  C CG  . TYR C 1 136 ? 44.807  52.434  31.503  1.00 34.01 ? 174 TYR C CG  1 
ATOM   7964  C CD1 . TYR C 1 136 ? 43.704  53.003  30.919  1.00 33.79 ? 174 TYR C CD1 1 
ATOM   7965  C CD2 . TYR C 1 136 ? 44.650  51.780  32.714  1.00 35.46 ? 174 TYR C CD2 1 
ATOM   7966  C CE1 . TYR C 1 136 ? 42.470  52.931  31.508  1.00 35.42 ? 174 TYR C CE1 1 
ATOM   7967  C CE2 . TYR C 1 136 ? 43.406  51.675  33.321  1.00 33.02 ? 174 TYR C CE2 1 
ATOM   7968  C CZ  . TYR C 1 136 ? 42.326  52.255  32.711  1.00 35.26 ? 174 TYR C CZ  1 
ATOM   7969  O OH  . TYR C 1 136 ? 41.091  52.231  33.286  1.00 35.78 ? 174 TYR C OH  1 
ATOM   7970  N N   . ASN C 1 137 ? 46.862  53.179  27.854  1.00 38.92 ? 175 ASN C N   1 
ATOM   7971  C CA  . ASN C 1 137 ? 47.700  54.198  27.265  1.00 39.49 ? 175 ASN C CA  1 
ATOM   7972  C C   . ASN C 1 137 ? 47.701  55.422  28.181  1.00 40.81 ? 175 ASN C C   1 
ATOM   7973  O O   . ASN C 1 137 ? 46.787  55.614  28.987  1.00 40.89 ? 175 ASN C O   1 
ATOM   7974  C CB  . ASN C 1 137 ? 47.140  54.628  25.913  1.00 39.32 ? 175 ASN C CB  1 
ATOM   7975  C CG  . ASN C 1 137 ? 47.187  53.546  24.891  1.00 38.30 ? 175 ASN C CG  1 
ATOM   7976  O OD1 . ASN C 1 137 ? 48.154  52.814  24.812  1.00 41.30 ? 175 ASN C OD1 1 
ATOM   7977  N ND2 . ASN C 1 137 ? 46.149  53.447  24.074  1.00 37.03 ? 175 ASN C ND2 1 
ATOM   7978  N N   . LYS C 1 138 ? 48.714  56.269  28.040  1.00 42.43 ? 176 LYS C N   1 
ATOM   7979  C CA  . LYS C 1 138 ? 48.794  57.495  28.841  1.00 43.51 ? 176 LYS C CA  1 
ATOM   7980  C C   . LYS C 1 138 ? 47.613  58.440  28.608  1.00 43.92 ? 176 LYS C C   1 
ATOM   7981  O O   . LYS C 1 138 ? 47.167  59.104  29.546  1.00 43.86 ? 176 LYS C O   1 
ATOM   7982  C CB  . LYS C 1 138 ? 50.127  58.217  28.618  1.00 43.80 ? 176 LYS C CB  1 
ATOM   7983  C CG  . LYS C 1 138 ? 51.339  57.368  29.055  1.00 45.46 ? 176 LYS C CG  1 
ATOM   7984  C CD  . LYS C 1 138 ? 52.543  58.219  29.469  1.00 46.42 ? 176 LYS C CD  1 
ATOM   7985  C CE  . LYS C 1 138 ? 53.664  57.373  30.075  1.00 46.56 ? 176 LYS C CE  1 
ATOM   7986  N NZ  . LYS C 1 138 ? 54.780  57.102  29.126  1.00 47.79 ? 176 LYS C NZ  1 
ATOM   7987  N N   . ASP C 1 139 ? 47.088  58.507  27.387  1.00 44.50 ? 177 ASP C N   1 
ATOM   7988  C CA  . ASP C 1 139 ? 45.922  59.381  27.134  1.00 45.15 ? 177 ASP C CA  1 
ATOM   7989  C C   . ASP C 1 139 ? 44.685  58.907  27.905  1.00 45.14 ? 177 ASP C C   1 
ATOM   7990  O O   . ASP C 1 139 ? 43.707  59.652  28.031  1.00 46.12 ? 177 ASP C O   1 
ATOM   7991  C CB  . ASP C 1 139 ? 45.619  59.573  25.621  1.00 45.41 ? 177 ASP C CB  1 
ATOM   7992  C CG  . ASP C 1 139 ? 45.744  58.282  24.807  1.00 46.43 ? 177 ASP C CG  1 
ATOM   7993  O OD1 . ASP C 1 139 ? 46.370  58.327  23.726  1.00 44.70 ? 177 ASP C OD1 1 
ATOM   7994  O OD2 . ASP C 1 139 ? 45.241  57.224  25.265  1.00 47.29 ? 177 ASP C OD2 1 
ATOM   7995  N N   . GLY C 1 140 ? 44.736  57.679  28.438  1.00 45.01 ? 178 GLY C N   1 
ATOM   7996  C CA  . GLY C 1 140 ? 43.676  57.145  29.299  1.00 44.10 ? 178 GLY C CA  1 
ATOM   7997  C C   . GLY C 1 140 ? 42.767  56.242  28.509  1.00 43.60 ? 178 GLY C C   1 
ATOM   7998  O O   . GLY C 1 140 ? 41.778  55.729  29.043  1.00 44.38 ? 178 GLY C O   1 
ATOM   7999  N N   . SER C 1 141 ? 43.089  56.071  27.227  1.00 42.74 ? 179 SER C N   1 
ATOM   8000  C CA  . SER C 1 141 ? 42.476  55.046  26.389  1.00 41.93 ? 179 SER C CA  1 
ATOM   8001  C C   . SER C 1 141 ? 43.070  53.683  26.773  1.00 41.72 ? 179 SER C C   1 
ATOM   8002  O O   . SER C 1 141 ? 44.116  53.624  27.416  1.00 41.98 ? 179 SER C O   1 
ATOM   8003  C CB  . SER C 1 141 ? 42.721  55.355  24.903  1.00 41.66 ? 179 SER C CB  1 
ATOM   8004  O OG  . SER C 1 141 ? 44.105  55.394  24.580  1.00 39.49 ? 179 SER C OG  1 
ATOM   8005  N N   . VAL C 1 142 ? 42.402  52.602  26.362  1.00 41.25 ? 180 VAL C N   1 
ATOM   8006  C CA  . VAL C 1 142 ? 42.759  51.240  26.730  1.00 40.43 ? 180 VAL C CA  1 
ATOM   8007  C C   . VAL C 1 142 ? 43.570  50.550  25.601  1.00 40.34 ? 180 VAL C C   1 
ATOM   8008  O O   . VAL C 1 142 ? 43.113  50.485  24.452  1.00 40.73 ? 180 VAL C O   1 
ATOM   8009  C CB  . VAL C 1 142 ? 41.453  50.452  27.059  1.00 40.70 ? 180 VAL C CB  1 
ATOM   8010  C CG1 . VAL C 1 142 ? 41.731  48.957  27.297  1.00 40.28 ? 180 VAL C CG1 1 
ATOM   8011  C CG2 . VAL C 1 142 ? 40.721  51.093  28.282  1.00 41.60 ? 180 VAL C CG2 1 
ATOM   8012  N N   . ALA C 1 143 ? 44.774  50.058  25.901  1.00 39.31 ? 181 ALA C N   1 
ATOM   8013  C CA  . ALA C 1 143 ? 45.598  49.387  24.877  1.00 38.27 ? 181 ALA C CA  1 
ATOM   8014  C C   . ALA C 1 143 ? 45.209  47.907  24.826  1.00 37.93 ? 181 ALA C C   1 
ATOM   8015  O O   . ALA C 1 143 ? 45.196  47.302  23.756  1.00 37.48 ? 181 ALA C O   1 
ATOM   8016  C CB  . ALA C 1 143 ? 47.103  49.570  25.141  1.00 37.25 ? 181 ALA C CB  1 
ATOM   8017  N N   . ILE C 1 144 ? 44.860  47.333  25.985  1.00 37.17 ? 182 ILE C N   1 
ATOM   8018  C CA  . ILE C 1 144 ? 44.432  45.935  26.069  1.00 36.17 ? 182 ILE C CA  1 
ATOM   8019  C C   . ILE C 1 144 ? 43.217  45.850  26.973  1.00 36.06 ? 182 ILE C C   1 
ATOM   8020  O O   . ILE C 1 144 ? 43.262  46.289  28.129  1.00 36.54 ? 182 ILE C O   1 
ATOM   8021  C CB  . ILE C 1 144 ? 45.560  45.001  26.609  1.00 36.49 ? 182 ILE C CB  1 
ATOM   8022  C CG1 . ILE C 1 144 ? 46.855  45.198  25.828  1.00 35.71 ? 182 ILE C CG1 1 
ATOM   8023  C CG2 . ILE C 1 144 ? 45.124  43.505  26.567  1.00 35.83 ? 182 ILE C CG2 1 
ATOM   8024  C CD1 . ILE C 1 144 ? 47.938  44.181  26.178  1.00 36.54 ? 182 ILE C CD1 1 
ATOM   8025  N N   . ALA C 1 145 ? 42.120  45.325  26.436  1.00 35.85 ? 183 ALA C N   1 
ATOM   8026  C CA  . ALA C 1 145 ? 40.869  45.127  27.191  1.00 36.06 ? 183 ALA C CA  1 
ATOM   8027  C C   . ALA C 1 145 ? 40.584  43.615  27.329  1.00 35.86 ? 183 ALA C C   1 
ATOM   8028  O O   . ALA C 1 145 ? 40.971  42.840  26.483  1.00 35.38 ? 183 ALA C O   1 
ATOM   8029  C CB  . ALA C 1 145 ? 39.719  45.826  26.480  1.00 35.56 ? 183 ALA C CB  1 
ATOM   8030  N N   . SER C 1 146 ? 39.913  43.227  28.412  1.00 35.92 ? 184 SER C N   1 
ATOM   8031  C CA  . SER C 1 146 ? 39.506  41.870  28.628  1.00 35.81 ? 184 SER C CA  1 
ATOM   8032  C C   . SER C 1 146 ? 38.473  41.420  27.595  1.00 35.48 ? 184 SER C C   1 
ATOM   8033  O O   . SER C 1 146 ? 37.752  42.219  26.995  1.00 36.18 ? 184 SER C O   1 
ATOM   8034  C CB  . SER C 1 146 ? 38.942  41.702  30.038  1.00 36.14 ? 184 SER C CB  1 
ATOM   8035  O OG  . SER C 1 146 ? 37.622  42.184  30.139  1.00 35.77 ? 184 SER C OG  1 
ATOM   8036  N N   . LYS C 1 147 ? 38.393  40.117  27.425  1.00 35.47 ? 185 LYS C N   1 
ATOM   8037  C CA  . LYS C 1 147 ? 37.616  39.534  26.343  1.00 35.34 ? 185 LYS C CA  1 
ATOM   8038  C C   . LYS C 1 147 ? 36.304  39.031  26.916  1.00 33.88 ? 185 LYS C C   1 
ATOM   8039  O O   . LYS C 1 147 ? 36.249  38.685  28.095  1.00 34.18 ? 185 LYS C O   1 
ATOM   8040  C CB  . LYS C 1 147 ? 38.375  38.369  25.720  1.00 35.45 ? 185 LYS C CB  1 
ATOM   8041  C CG  . LYS C 1 147 ? 39.529  38.747  24.836  1.00 38.66 ? 185 LYS C CG  1 
ATOM   8042  C CD  . LYS C 1 147 ? 40.484  37.518  24.694  1.00 41.69 ? 185 LYS C CD  1 
ATOM   8043  N N   . PRO C 1 148 ? 35.250  38.995  26.081  1.00 33.20 ? 186 PRO C N   1 
ATOM   8044  C CA  . PRO C 1 148 ? 33.964  38.481  26.507  1.00 33.03 ? 186 PRO C CA  1 
ATOM   8045  C C   . PRO C 1 148 ? 34.110  37.049  27.018  1.00 33.79 ? 186 PRO C C   1 
ATOM   8046  O O   . PRO C 1 148 ? 34.871  36.269  26.440  1.00 33.65 ? 186 PRO C O   1 
ATOM   8047  C CB  . PRO C 1 148 ? 33.126  38.504  25.239  1.00 32.36 ? 186 PRO C CB  1 
ATOM   8048  C CG  . PRO C 1 148 ? 33.772  39.516  24.368  1.00 33.38 ? 186 PRO C CG  1 
ATOM   8049  C CD  . PRO C 1 148 ? 35.233  39.399  24.657  1.00 32.96 ? 186 PRO C CD  1 
ATOM   8050  N N   . ARG C 1 149 ? 33.409  36.744  28.110  1.00 34.08 ? 187 ARG C N   1 
ATOM   8051  C CA  . ARG C 1 149 ? 33.346  35.407  28.660  1.00 34.57 ? 187 ARG C CA  1 
ATOM   8052  C C   . ARG C 1 149 ? 32.151  34.629  28.053  1.00 34.69 ? 187 ARG C C   1 
ATOM   8053  O O   . ARG C 1 149 ? 31.153  35.197  27.642  1.00 34.24 ? 187 ARG C O   1 
ATOM   8054  C CB  . ARG C 1 149 ? 33.191  35.464  30.189  1.00 34.92 ? 187 ARG C CB  1 
ATOM   8055  C CG  . ARG C 1 149 ? 34.361  36.055  30.933  1.00 36.20 ? 187 ARG C CG  1 
ATOM   8056  C CD  . ARG C 1 149 ? 35.367  35.028  31.433  1.00 40.99 ? 187 ARG C CD  1 
ATOM   8057  N NE  . ARG C 1 149 ? 36.290  35.685  32.363  1.00 46.28 ? 187 ARG C NE  1 
ATOM   8058  C CZ  . ARG C 1 149 ? 37.401  36.360  32.006  1.00 48.54 ? 187 ARG C CZ  1 
ATOM   8059  N NH1 . ARG C 1 149 ? 37.776  36.482  30.732  1.00 49.06 ? 187 ARG C NH1 1 
ATOM   8060  N NH2 . ARG C 1 149 ? 38.156  36.934  32.941  1.00 49.36 ? 187 ARG C NH2 1 
ATOM   8061  N N   . GLU C 1 150 ? 32.252  33.311  28.070  1.00 34.98 ? 188 GLU C N   1 
ATOM   8062  C CA  . GLU C 1 150 ? 31.155  32.472  27.634  1.00 35.57 ? 188 GLU C CA  1 
ATOM   8063  C C   . GLU C 1 150 ? 30.063  32.529  28.658  1.00 34.80 ? 188 GLU C C   1 
ATOM   8064  O O   . GLU C 1 150 ? 30.344  32.380  29.851  1.00 34.39 ? 188 GLU C O   1 
ATOM   8065  C CB  . GLU C 1 150 ? 31.566  31.029  27.580  1.00 36.31 ? 188 GLU C CB  1 
ATOM   8066  C CG  . GLU C 1 150 ? 32.704  30.745  26.682  1.00 40.00 ? 188 GLU C CG  1 
ATOM   8067  C CD  . GLU C 1 150 ? 33.081  29.283  26.762  1.00 45.42 ? 188 GLU C CD  1 
ATOM   8068  O OE1 . GLU C 1 150 ? 32.150  28.473  27.078  1.00 47.32 ? 188 GLU C OE1 1 
ATOM   8069  O OE2 . GLU C 1 150 ? 34.290  28.992  26.530  1.00 44.33 ? 188 GLU C OE2 1 
ATOM   8070  N N   . VAL C 1 151 ? 28.834  32.711  28.175  1.00 33.89 ? 189 VAL C N   1 
ATOM   8071  C CA  . VAL C 1 151 ? 27.656  32.841  29.031  1.00 33.41 ? 189 VAL C CA  1 
ATOM   8072  C C   . VAL C 1 151 ? 26.786  31.647  28.742  1.00 33.40 ? 189 VAL C C   1 
ATOM   8073  O O   . VAL C 1 151 ? 26.559  31.330  27.589  1.00 33.33 ? 189 VAL C O   1 
ATOM   8074  C CB  . VAL C 1 151 ? 26.913  34.195  28.777  1.00 33.31 ? 189 VAL C CB  1 
ATOM   8075  C CG1 . VAL C 1 151 ? 25.517  34.268  29.468  1.00 28.89 ? 189 VAL C CG1 1 
ATOM   8076  C CG2 . VAL C 1 151 ? 27.786  35.323  29.249  1.00 32.57 ? 189 VAL C CG2 1 
ATOM   8077  N N   . ARG C 1 152 ? 26.350  30.971  29.800  1.00 34.11 ? 190 ARG C N   1 
ATOM   8078  C CA  . ARG C 1 152 ? 25.395  29.907  29.690  1.00 34.77 ? 190 ARG C CA  1 
ATOM   8079  C C   . ARG C 1 152 ? 24.327  29.950  30.799  1.00 35.22 ? 190 ARG C C   1 
ATOM   8080  O O   . ARG C 1 152 ? 24.624  30.174  31.940  1.00 34.49 ? 190 ARG C O   1 
ATOM   8081  C CB  . ARG C 1 152 ? 26.092  28.551  29.688  1.00 35.00 ? 190 ARG C CB  1 
ATOM   8082  C CG  . ARG C 1 152 ? 25.112  27.478  29.332  1.00 37.58 ? 190 ARG C CG  1 
ATOM   8083  C CD  . ARG C 1 152 ? 25.692  26.112  29.371  1.00 41.93 ? 190 ARG C CD  1 
ATOM   8084  N NE  . ARG C 1 152 ? 26.437  25.827  28.163  1.00 44.76 ? 190 ARG C NE  1 
ATOM   8085  C CZ  . ARG C 1 152 ? 26.951  24.640  27.888  1.00 43.62 ? 190 ARG C CZ  1 
ATOM   8086  N NH1 . ARG C 1 152 ? 27.626  24.478  26.758  1.00 42.11 ? 190 ARG C NH1 1 
ATOM   8087  N NH2 . ARG C 1 152 ? 26.783  23.637  28.740  1.00 41.57 ? 190 ARG C NH2 1 
ATOM   8088  N N   . GLU C 1 153 ? 23.083  29.672  30.431  1.00 36.67 ? 191 GLU C N   1 
ATOM   8089  C CA  . GLU C 1 153 ? 21.982  29.624  31.379  1.00 38.01 ? 191 GLU C CA  1 
ATOM   8090  C C   . GLU C 1 153 ? 21.825  28.228  32.023  1.00 37.89 ? 191 GLU C C   1 
ATOM   8091  O O   . GLU C 1 153 ? 21.873  27.208  31.350  1.00 38.64 ? 191 GLU C O   1 
ATOM   8092  C CB  . GLU C 1 153 ? 20.692  30.015  30.655  1.00 38.63 ? 191 GLU C CB  1 
ATOM   8093  C CG  . GLU C 1 153 ? 19.494  30.279  31.573  1.00 41.31 ? 191 GLU C CG  1 
ATOM   8094  C CD  . GLU C 1 153 ? 18.350  29.317  31.354  1.00 46.92 ? 191 GLU C CD  1 
ATOM   8095  O OE1 . GLU C 1 153 ? 18.514  28.097  31.638  1.00 48.28 ? 191 GLU C OE1 1 
ATOM   8096  O OE2 . GLU C 1 153 ? 17.274  29.790  30.883  1.00 52.15 ? 191 GLU C OE2 1 
ATOM   8097  N N   . PHE C 1 154 ? 21.666  28.201  33.334  1.00 38.30 ? 192 PHE C N   1 
ATOM   8098  C CA  . PHE C 1 154 ? 21.348  26.982  34.094  1.00 38.97 ? 192 PHE C CA  1 
ATOM   8099  C C   . PHE C 1 154 ? 20.187  27.360  34.990  1.00 39.30 ? 192 PHE C C   1 
ATOM   8100  O O   . PHE C 1 154 ? 20.280  28.323  35.705  1.00 39.41 ? 192 PHE C O   1 
ATOM   8101  C CB  . PHE C 1 154 ? 22.518  26.529  34.990  1.00 39.14 ? 192 PHE C CB  1 
ATOM   8102  C CG  . PHE C 1 154 ? 23.671  25.944  34.246  1.00 38.16 ? 192 PHE C CG  1 
ATOM   8103  C CD1 . PHE C 1 154 ? 23.720  24.584  33.993  1.00 38.80 ? 192 PHE C CD1 1 
ATOM   8104  C CD2 . PHE C 1 154 ? 24.700  26.751  33.809  1.00 37.01 ? 192 PHE C CD2 1 
ATOM   8105  C CE1 . PHE C 1 154 ? 24.756  24.042  33.289  1.00 38.29 ? 192 PHE C CE1 1 
ATOM   8106  C CE2 . PHE C 1 154 ? 25.747  26.230  33.102  1.00 37.08 ? 192 PHE C CE2 1 
ATOM   8107  C CZ  . PHE C 1 154 ? 25.792  24.867  32.845  1.00 39.16 ? 192 PHE C CZ  1 
ATOM   8108  N N   . ASN C 1 155 ? 19.079  26.641  34.876  1.00 40.79 ? 193 ASN C N   1 
ATOM   8109  C CA  . ASN C 1 155 ? 17.934  26.789  35.754  1.00 41.98 ? 193 ASN C CA  1 
ATOM   8110  C C   . ASN C 1 155 ? 17.335  28.190  35.825  1.00 42.00 ? 193 ASN C C   1 
ATOM   8111  O O   . ASN C 1 155 ? 16.929  28.666  36.884  1.00 43.10 ? 193 ASN C O   1 
ATOM   8112  C CB  . ASN C 1 155 ? 18.347  26.267  37.128  1.00 42.25 ? 193 ASN C CB  1 
ATOM   8113  C CG  . ASN C 1 155 ? 18.377  24.743  37.156  1.00 44.39 ? 193 ASN C CG  1 
ATOM   8114  O OD1 . ASN C 1 155 ? 17.504  24.088  36.552  1.00 48.40 ? 193 ASN C OD1 1 
ATOM   8115  N ND2 . ASN C 1 155 ? 19.358  24.172  37.836  1.00 46.02 ? 193 ASN C ND2 1 
ATOM   8116  N N   . GLY C 1 156 ? 17.301  28.852  34.684  1.00 41.52 ? 194 GLY C N   1 
ATOM   8117  C CA  . GLY C 1 156 ? 16.763  30.188  34.591  1.00 40.79 ? 194 GLY C CA  1 
ATOM   8118  C C   . GLY C 1 156 ? 17.664  31.285  35.082  1.00 39.96 ? 194 GLY C C   1 
ATOM   8119  O O   . GLY C 1 156 ? 17.208  32.383  35.310  1.00 40.51 ? 194 GLY C O   1 
ATOM   8120  N N   . GLN C 1 157 ? 18.945  31.004  35.255  1.00 39.51 ? 195 GLN C N   1 
ATOM   8121  C CA  . GLN C 1 157 ? 19.894  32.023  35.639  1.00 38.57 ? 195 GLN C CA  1 
ATOM   8122  C C   . GLN C 1 157 ? 21.115  31.920  34.714  1.00 37.62 ? 195 GLN C C   1 
ATOM   8123  O O   . GLN C 1 157 ? 21.429  30.841  34.177  1.00 36.41 ? 195 GLN C O   1 
ATOM   8124  C CB  . GLN C 1 157 ? 20.257  31.873  37.123  1.00 38.96 ? 195 GLN C CB  1 
ATOM   8125  C CG  . GLN C 1 157 ? 21.286  32.918  37.658  1.00 40.56 ? 195 GLN C CG  1 
ATOM   8126  C CD  . GLN C 1 157 ? 21.538  32.774  39.173  1.00 41.03 ? 195 GLN C CD  1 
ATOM   8127  O OE1 . GLN C 1 157 ? 20.941  31.912  39.809  1.00 44.39 ? 195 GLN C OE1 1 
ATOM   8128  N NE2 . GLN C 1 157 ? 22.420  33.606  39.737  1.00 38.15 ? 195 GLN C NE2 1 
ATOM   8129  N N   . HIS C 1 158 ? 21.780  33.056  34.516  1.00 36.44 ? 196 HIS C N   1 
ATOM   8130  C CA  . HIS C 1 158 ? 22.943  33.150  33.657  1.00 35.92 ? 196 HIS C CA  1 
ATOM   8131  C C   . HIS C 1 158 ? 24.236  33.165  34.458  1.00 34.91 ? 196 HIS C C   1 
ATOM   8132  O O   . HIS C 1 158 ? 24.324  33.783  35.513  1.00 33.56 ? 196 HIS C O   1 
ATOM   8133  C CB  . HIS C 1 158 ? 22.859  34.400  32.790  1.00 36.57 ? 196 HIS C CB  1 
ATOM   8134  C CG  . HIS C 1 158 ? 21.959  34.248  31.610  1.00 38.64 ? 196 HIS C CG  1 
ATOM   8135  N ND1 . HIS C 1 158 ? 20.598  34.102  31.732  1.00 40.58 ? 196 HIS C ND1 1 
ATOM   8136  C CD2 . HIS C 1 158 ? 22.225  34.232  30.281  1.00 40.03 ? 196 HIS C CD2 1 
ATOM   8137  C CE1 . HIS C 1 158 ? 20.066  33.976  30.530  1.00 42.52 ? 196 HIS C CE1 1 
ATOM   8138  N NE2 . HIS C 1 158 ? 21.032  34.059  29.633  1.00 41.94 ? 196 HIS C NE2 1 
ATOM   8139  N N   . PHE C 1 159 ? 25.230  32.459  33.918  1.00 33.97 ? 197 PHE C N   1 
ATOM   8140  C CA  . PHE C 1 159 ? 26.520  32.225  34.556  1.00 33.34 ? 197 PHE C CA  1 
ATOM   8141  C C   . PHE C 1 159 ? 27.593  32.401  33.479  1.00 32.88 ? 197 PHE C C   1 
ATOM   8142  O O   . PHE C 1 159 ? 27.334  32.322  32.276  1.00 33.08 ? 197 PHE C O   1 
ATOM   8143  C CB  . PHE C 1 159 ? 26.590  30.776  35.161  1.00 32.22 ? 197 PHE C CB  1 
ATOM   8144  C CG  . PHE C 1 159 ? 25.533  30.495  36.207  1.00 31.00 ? 197 PHE C CG  1 
ATOM   8145  C CD1 . PHE C 1 159 ? 25.801  30.617  37.536  1.00 30.65 ? 197 PHE C CD1 1 
ATOM   8146  C CD2 . PHE C 1 159 ? 24.265  30.107  35.846  1.00 32.81 ? 197 PHE C CD2 1 
ATOM   8147  C CE1 . PHE C 1 159 ? 24.857  30.372  38.464  1.00 32.23 ? 197 PHE C CE1 1 
ATOM   8148  C CE2 . PHE C 1 159 ? 23.338  29.843  36.772  1.00 28.34 ? 197 PHE C CE2 1 
ATOM   8149  C CZ  . PHE C 1 159 ? 23.625  29.965  38.081  1.00 30.20 ? 197 PHE C CZ  1 
ATOM   8150  N N   . ILE C 1 160 ? 28.808  32.616  33.911  1.00 32.92 ? 198 ILE C N   1 
ATOM   8151  C CA  . ILE C 1 160 ? 29.922  32.731  32.965  1.00 33.07 ? 198 ILE C CA  1 
ATOM   8152  C C   . ILE C 1 160 ? 30.941  31.626  33.242  1.00 33.39 ? 198 ILE C C   1 
ATOM   8153  O O   . ILE C 1 160 ? 31.133  31.237  34.396  1.00 33.04 ? 198 ILE C O   1 
ATOM   8154  C CB  . ILE C 1 160 ? 30.564  34.119  32.983  1.00 32.54 ? 198 ILE C CB  1 
ATOM   8155  C CG1 . ILE C 1 160 ? 31.258  34.393  34.302  1.00 32.40 ? 198 ILE C CG1 1 
ATOM   8156  C CG2 . ILE C 1 160 ? 29.523  35.216  32.634  1.00 34.81 ? 198 ILE C CG2 1 
ATOM   8157  C CD1 . ILE C 1 160 ? 31.873  35.806  34.391  1.00 29.05 ? 198 ILE C CD1 1 
ATOM   8158  N N   . LEU C 1 161 ? 31.588  31.137  32.189  1.00 34.17 ? 199 LEU C N   1 
ATOM   8159  C CA  . LEU C 1 161 ? 32.627  30.146  32.335  1.00 34.36 ? 199 LEU C CA  1 
ATOM   8160  C C   . LEU C 1 161 ? 33.940  30.808  32.735  1.00 35.12 ? 199 LEU C C   1 
ATOM   8161  O O   . LEU C 1 161 ? 34.311  31.811  32.154  1.00 37.20 ? 199 LEU C O   1 
ATOM   8162  C CB  . LEU C 1 161 ? 32.801  29.357  31.056  1.00 34.97 ? 199 LEU C CB  1 
ATOM   8163  C CG  . LEU C 1 161 ? 33.657  28.092  31.081  1.00 34.21 ? 199 LEU C CG  1 
ATOM   8164  C CD1 . LEU C 1 161 ? 32.936  26.931  31.705  1.00 37.02 ? 199 LEU C CD1 1 
ATOM   8165  C CD2 . LEU C 1 161 ? 33.998  27.749  29.710  1.00 36.87 ? 199 LEU C CD2 1 
ATOM   8166  N N   . GLU C 1 162 ? 34.630  30.225  33.724  1.00 35.62 ? 200 GLU C N   1 
ATOM   8167  C CA  . GLU C 1 162 ? 35.888  30.717  34.251  1.00 36.08 ? 200 GLU C CA  1 
ATOM   8168  C C   . GLU C 1 162 ? 36.879  29.542  34.218  1.00 36.10 ? 200 GLU C C   1 
ATOM   8169  O O   . GLU C 1 162 ? 36.540  28.446  34.535  1.00 35.99 ? 200 GLU C O   1 
ATOM   8170  C CB  . GLU C 1 162 ? 35.716  31.278  35.689  1.00 35.14 ? 200 GLU C CB  1 
ATOM   8171  C CG  . GLU C 1 162 ? 34.984  32.582  35.806  1.00 35.52 ? 200 GLU C CG  1 
ATOM   8172  C CD  . GLU C 1 162 ? 35.723  33.785  35.222  1.00 42.23 ? 200 GLU C CD  1 
ATOM   8173  O OE1 . GLU C 1 162 ? 36.892  33.620  34.737  1.00 44.66 ? 200 GLU C OE1 1 
ATOM   8174  O OE2 . GLU C 1 162 ? 35.135  34.921  35.236  1.00 41.89 ? 200 GLU C OE2 1 
ATOM   8175  N N   . GLU C 1 163 ? 38.116  29.803  33.843  1.00 37.32 ? 201 GLU C N   1 
ATOM   8176  C CA  . GLU C 1 163 ? 39.096  28.769  33.689  1.00 37.46 ? 201 GLU C CA  1 
ATOM   8177  C C   . GLU C 1 163 ? 39.989  28.661  34.905  1.00 36.49 ? 201 GLU C C   1 
ATOM   8178  O O   . GLU C 1 163 ? 40.251  29.655  35.574  1.00 36.50 ? 201 GLU C O   1 
ATOM   8179  C CB  . GLU C 1 163 ? 39.904  29.022  32.440  1.00 38.39 ? 201 GLU C CB  1 
ATOM   8180  C CG  . GLU C 1 163 ? 39.234  28.466  31.195  1.00 41.66 ? 201 GLU C CG  1 
ATOM   8181  C CD  . GLU C 1 163 ? 40.178  28.452  30.021  1.00 45.89 ? 201 GLU C CD  1 
ATOM   8182  O OE1 . GLU C 1 163 ? 40.679  27.341  29.674  1.00 48.82 ? 201 GLU C OE1 1 
ATOM   8183  O OE2 . GLU C 1 163 ? 40.451  29.549  29.487  1.00 43.92 ? 201 GLU C OE2 1 
ATOM   8184  N N   . ALA C 1 164 ? 40.479  27.459  35.168  1.00 34.83 ? 202 ALA C N   1 
ATOM   8185  C CA  . ALA C 1 164 ? 41.496  27.207  36.235  1.00 34.56 ? 202 ALA C CA  1 
ATOM   8186  C C   . ALA C 1 164 ? 42.712  28.162  36.147  1.00 34.79 ? 202 ALA C C   1 
ATOM   8187  O O   . ALA C 1 164 ? 43.112  28.557  35.079  1.00 35.37 ? 202 ALA C O   1 
ATOM   8188  C CB  . ALA C 1 164 ? 41.950  25.721  36.199  1.00 31.76 ? 202 ALA C CB  1 
ATOM   8189  N N   . ILE C 1 165 ? 43.261  28.550  37.296  1.00 35.89 ? 203 ILE C N   1 
ATOM   8190  C CA  . ILE C 1 165 ? 44.553  29.207  37.405  1.00 35.36 ? 203 ILE C CA  1 
ATOM   8191  C C   . ILE C 1 165 ? 45.523  28.232  38.081  1.00 35.94 ? 203 ILE C C   1 
ATOM   8192  O O   . ILE C 1 165 ? 45.277  27.767  39.164  1.00 35.84 ? 203 ILE C O   1 
ATOM   8193  C CB  . ILE C 1 165 ? 44.486  30.515  38.265  1.00 35.34 ? 203 ILE C CB  1 
ATOM   8194  C CG1 . ILE C 1 165 ? 43.666  31.569  37.530  1.00 34.35 ? 203 ILE C CG1 1 
ATOM   8195  C CG2 . ILE C 1 165 ? 45.914  30.972  38.630  1.00 35.69 ? 203 ILE C CG2 1 
ATOM   8196  C CD1 . ILE C 1 165 ? 43.403  32.857  38.276  1.00 34.30 ? 203 ILE C CD1 1 
ATOM   8197  N N   . THR C 1 166 ? 46.618  27.918  37.411  1.00 36.60 ? 204 THR C N   1 
ATOM   8198  C CA  . THR C 1 166 ? 47.719  27.227  38.020  1.00 37.67 ? 204 THR C CA  1 
ATOM   8199  C C   . THR C 1 166 ? 48.958  28.100  37.849  1.00 36.93 ? 204 THR C C   1 
ATOM   8200  O O   . THR C 1 166 ? 49.032  28.912  36.960  1.00 36.46 ? 204 THR C O   1 
ATOM   8201  C CB  . THR C 1 166 ? 48.009  25.894  37.298  1.00 37.62 ? 204 THR C CB  1 
ATOM   8202  O OG1 . THR C 1 166 ? 48.237  26.195  35.918  1.00 40.13 ? 204 THR C OG1 1 
ATOM   8203  C CG2 . THR C 1 166 ? 46.844  24.917  37.441  1.00 38.18 ? 204 THR C CG2 1 
ATOM   8204  N N   . GLY C 1 167 ? 49.934  27.903  38.707  1.00 37.31 ? 205 GLY C N   1 
ATOM   8205  C CA  . GLY C 1 167 ? 51.206  28.593  38.588  1.00 37.35 ? 205 GLY C CA  1 
ATOM   8206  C C   . GLY C 1 167 ? 52.376  27.686  38.385  1.00 36.29 ? 205 GLY C C   1 
ATOM   8207  O O   . GLY C 1 167 ? 52.349  26.493  38.674  1.00 36.87 ? 205 GLY C O   1 
ATOM   8208  N N   . ASP C 1 168 ? 53.436  28.271  37.888  1.00 35.89 ? 206 ASP C N   1 
ATOM   8209  C CA  . ASP C 1 168 ? 54.697  27.605  37.918  1.00 35.33 ? 206 ASP C CA  1 
ATOM   8210  C C   . ASP C 1 168 ? 55.140  27.473  39.375  1.00 34.86 ? 206 ASP C C   1 
ATOM   8211  O O   . ASP C 1 168 ? 55.608  26.416  39.759  1.00 36.51 ? 206 ASP C O   1 
ATOM   8212  C CB  . ASP C 1 168 ? 55.729  28.377  37.090  1.00 35.40 ? 206 ASP C CB  1 
ATOM   8213  C CG  . ASP C 1 168 ? 55.312  28.524  35.626  1.00 36.69 ? 206 ASP C CG  1 
ATOM   8214  O OD1 . ASP C 1 168 ? 54.949  27.509  34.991  1.00 41.09 ? 206 ASP C OD1 1 
ATOM   8215  O OD2 . ASP C 1 168 ? 55.355  29.640  35.093  1.00 35.40 ? 206 ASP C OD2 1 
ATOM   8216  N N   . PHE C 1 169 ? 55.044  28.552  40.157  1.00 33.60 ? 207 PHE C N   1 
ATOM   8217  C CA  . PHE C 1 169 ? 55.433  28.564  41.574  1.00 33.14 ? 207 PHE C CA  1 
ATOM   8218  C C   . PHE C 1 169 ? 54.323  29.201  42.407  1.00 32.37 ? 207 PHE C C   1 
ATOM   8219  O O   . PHE C 1 169 ? 53.592  30.033  41.905  1.00 33.44 ? 207 PHE C O   1 
ATOM   8220  C CB  . PHE C 1 169 ? 56.714  29.383  41.797  1.00 33.33 ? 207 PHE C CB  1 
ATOM   8221  C CG  . PHE C 1 169 ? 57.961  28.719  41.254  1.00 33.81 ? 207 PHE C CG  1 
ATOM   8222  C CD1 . PHE C 1 169 ? 58.210  28.703  39.884  1.00 33.90 ? 207 PHE C CD1 1 
ATOM   8223  C CD2 . PHE C 1 169 ? 58.872  28.111  42.113  1.00 33.15 ? 207 PHE C CD2 1 
ATOM   8224  C CE1 . PHE C 1 169 ? 59.353  28.102  39.362  1.00 32.22 ? 207 PHE C CE1 1 
ATOM   8225  C CE2 . PHE C 1 169 ? 60.003  27.494  41.608  1.00 34.09 ? 207 PHE C CE2 1 
ATOM   8226  C CZ  . PHE C 1 169 ? 60.228  27.473  40.223  1.00 33.39 ? 207 PHE C CZ  1 
ATOM   8227  N N   . ALA C 1 170 ? 54.212  28.789  43.659  1.00 31.71 ? 208 ALA C N   1 
ATOM   8228  C CA  . ALA C 1 170 ? 53.395  29.466  44.671  1.00 32.76 ? 208 ALA C CA  1 
ATOM   8229  C C   . ALA C 1 170 ? 54.355  29.887  45.761  1.00 32.79 ? 208 ALA C C   1 
ATOM   8230  O O   . ALA C 1 170 ? 55.193  29.103  46.192  1.00 32.79 ? 208 ALA C O   1 
ATOM   8231  C CB  . ALA C 1 170 ? 52.286  28.544  45.248  1.00 31.52 ? 208 ALA C CB  1 
ATOM   8232  N N   . LEU C 1 171 ? 54.224  31.142  46.177  1.00 33.74 ? 209 LEU C N   1 
ATOM   8233  C CA  . LEU C 1 171 ? 54.965  31.692  47.309  1.00 34.08 ? 209 LEU C CA  1 
ATOM   8234  C C   . LEU C 1 171 ? 53.974  31.904  48.431  1.00 33.67 ? 209 LEU C C   1 
ATOM   8235  O O   . LEU C 1 171 ? 53.099  32.759  48.336  1.00 34.48 ? 209 LEU C O   1 
ATOM   8236  C CB  . LEU C 1 171 ? 55.643  33.008  46.929  1.00 34.17 ? 209 LEU C CB  1 
ATOM   8237  C CG  . LEU C 1 171 ? 56.662  32.977  45.780  1.00 34.30 ? 209 LEU C CG  1 
ATOM   8238  C CD1 . LEU C 1 171 ? 57.253  34.347  45.670  1.00 35.35 ? 209 LEU C CD1 1 
ATOM   8239  C CD2 . LEU C 1 171 ? 57.772  31.941  45.929  1.00 30.68 ? 209 LEU C CD2 1 
ATOM   8240  N N   . VAL C 1 172 ? 54.107  31.098  49.474  1.00 33.54 ? 210 VAL C N   1 
ATOM   8241  C CA  . VAL C 1 172 ? 53.065  30.896  50.478  1.00 33.26 ? 210 VAL C CA  1 
ATOM   8242  C C   . VAL C 1 172 ? 53.632  31.190  51.893  1.00 32.72 ? 210 VAL C C   1 
ATOM   8243  O O   . VAL C 1 172 ? 54.694  30.799  52.233  1.00 32.18 ? 210 VAL C O   1 
ATOM   8244  C CB  . VAL C 1 172 ? 52.484  29.424  50.405  1.00 33.75 ? 210 VAL C CB  1 
ATOM   8245  C CG1 . VAL C 1 172 ? 51.626  29.139  51.622  1.00 33.56 ? 210 VAL C CG1 1 
ATOM   8246  C CG2 . VAL C 1 172 ? 51.703  29.130  49.092  1.00 32.81 ? 210 VAL C CG2 1 
ATOM   8247  N N   . LYS C 1 173 ? 52.875  31.909  52.700  1.00 33.86 ? 211 LYS C N   1 
ATOM   8248  C CA  . LYS C 1 173 ? 53.176  32.142  54.102  1.00 33.29 ? 211 LYS C CA  1 
ATOM   8249  C C   . LYS C 1 173 ? 52.190  31.349  54.949  1.00 32.19 ? 211 LYS C C   1 
ATOM   8250  O O   . LYS C 1 173 ? 50.982  31.357  54.702  1.00 32.92 ? 211 LYS C O   1 
ATOM   8251  C CB  . LYS C 1 173 ? 53.084  33.632  54.421  1.00 33.51 ? 211 LYS C CB  1 
ATOM   8252  C CG  . LYS C 1 173 ? 53.055  34.044  55.885  1.00 35.09 ? 211 LYS C CG  1 
ATOM   8253  C CD  . LYS C 1 173 ? 54.347  33.868  56.599  1.00 37.68 ? 211 LYS C CD  1 
ATOM   8254  C CE  . LYS C 1 173 ? 54.313  34.550  57.980  1.00 38.47 ? 211 LYS C CE  1 
ATOM   8255  N NZ  . LYS C 1 173 ? 53.368  33.908  58.910  1.00 40.54 ? 211 LYS C NZ  1 
ATOM   8256  N N   . ALA C 1 174 ? 52.731  30.691  55.966  1.00 30.90 ? 212 ALA C N   1 
ATOM   8257  C CA  . ALA C 1 174 ? 51.978  29.968  56.938  1.00 30.53 ? 212 ALA C CA  1 
ATOM   8258  C C   . ALA C 1 174 ? 52.580  30.191  58.311  1.00 31.01 ? 212 ALA C C   1 
ATOM   8259  O O   . ALA C 1 174 ? 53.598  30.870  58.492  1.00 30.57 ? 212 ALA C O   1 
ATOM   8260  C CB  . ALA C 1 174 ? 51.955  28.499  56.586  1.00 30.37 ? 212 ALA C CB  1 
ATOM   8261  N N   . TRP C 1 175 ? 51.946  29.597  59.301  1.00 32.17 ? 213 TRP C N   1 
ATOM   8262  C CA  . TRP C 1 175 ? 52.306  29.827  60.695  1.00 32.40 ? 213 TRP C CA  1 
ATOM   8263  C C   . TRP C 1 175 ? 53.337  28.798  61.222  1.00 32.29 ? 213 TRP C C   1 
ATOM   8264  O O   . TRP C 1 175 ? 54.430  29.171  61.662  1.00 31.50 ? 213 TRP C O   1 
ATOM   8265  C CB  . TRP C 1 175 ? 51.029  29.814  61.512  1.00 32.28 ? 213 TRP C CB  1 
ATOM   8266  C CG  . TRP C 1 175 ? 51.209  29.947  62.979  1.00 33.03 ? 213 TRP C CG  1 
ATOM   8267  C CD1 . TRP C 1 175 ? 52.256  30.520  63.652  1.00 33.13 ? 213 TRP C CD1 1 
ATOM   8268  C CD2 . TRP C 1 175 ? 50.266  29.532  63.961  1.00 31.16 ? 213 TRP C CD2 1 
ATOM   8269  N NE1 . TRP C 1 175 ? 52.003  30.481  65.009  1.00 33.72 ? 213 TRP C NE1 1 
ATOM   8270  C CE2 . TRP C 1 175 ? 50.776  29.889  65.211  1.00 33.49 ? 213 TRP C CE2 1 
ATOM   8271  C CE3 . TRP C 1 175 ? 48.994  28.923  63.889  1.00 35.44 ? 213 TRP C CE3 1 
ATOM   8272  C CZ2 . TRP C 1 175 ? 50.091  29.619  66.394  1.00 33.69 ? 213 TRP C CZ2 1 
ATOM   8273  C CZ3 . TRP C 1 175 ? 48.303  28.693  65.050  1.00 34.85 ? 213 TRP C CZ3 1 
ATOM   8274  C CH2 . TRP C 1 175 ? 48.875  29.008  66.301  1.00 33.08 ? 213 TRP C CH2 1 
ATOM   8275  N N   . LYS C 1 176 ? 52.970  27.507  61.180  1.00 32.04 ? 214 LYS C N   1 
ATOM   8276  C CA  . LYS C 1 176 ? 53.870  26.453  61.597  1.00 31.36 ? 214 LYS C CA  1 
ATOM   8277  C C   . LYS C 1 176 ? 53.895  25.354  60.594  1.00 31.27 ? 214 LYS C C   1 
ATOM   8278  O O   . LYS C 1 176 ? 52.940  25.194  59.892  1.00 31.17 ? 214 LYS C O   1 
ATOM   8279  C CB  . LYS C 1 176 ? 53.434  25.867  62.921  1.00 31.05 ? 214 LYS C CB  1 
ATOM   8280  C CG  . LYS C 1 176 ? 53.283  26.872  63.991  1.00 30.62 ? 214 LYS C CG  1 
ATOM   8281  C CD  . LYS C 1 176 ? 53.225  26.204  65.349  1.00 31.43 ? 214 LYS C CD  1 
ATOM   8282  C CE  . LYS C 1 176 ? 52.794  27.213  66.378  1.00 31.47 ? 214 LYS C CE  1 
ATOM   8283  N NZ  . LYS C 1 176 ? 52.877  26.654  67.691  1.00 32.42 ? 214 LYS C NZ  1 
ATOM   8284  N N   . ALA C 1 177 ? 54.995  24.593  60.554  1.00 31.39 ? 215 ALA C N   1 
ATOM   8285  C CA  . ALA C 1 177 ? 55.115  23.376  59.728  1.00 32.18 ? 215 ALA C CA  1 
ATOM   8286  C C   . ALA C 1 177 ? 55.694  22.309  60.606  1.00 32.72 ? 215 ALA C C   1 
ATOM   8287  O O   . ALA C 1 177 ? 56.510  22.616  61.489  1.00 32.29 ? 215 ALA C O   1 
ATOM   8288  C CB  . ALA C 1 177 ? 56.014  23.589  58.528  1.00 32.39 ? 215 ALA C CB  1 
ATOM   8289  N N   . ASP C 1 178 ? 55.236  21.075  60.439  1.00 33.57 ? 216 ASP C N   1 
ATOM   8290  C CA  . ASP C 1 178 ? 55.908  19.980  61.108  1.00 35.58 ? 216 ASP C CA  1 
ATOM   8291  C C   . ASP C 1 178 ? 57.049  19.528  60.198  1.00 36.05 ? 216 ASP C C   1 
ATOM   8292  O O   . ASP C 1 178 ? 57.234  20.057  59.080  1.00 35.22 ? 216 ASP C O   1 
ATOM   8293  C CB  . ASP C 1 178 ? 54.959  18.861  61.627  1.00 36.05 ? 216 ASP C CB  1 
ATOM   8294  C CG  . ASP C 1 178 ? 54.283  18.015  60.527  1.00 38.70 ? 216 ASP C CG  1 
ATOM   8295  O OD1 . ASP C 1 178 ? 54.773  17.919  59.377  1.00 39.41 ? 216 ASP C OD1 1 
ATOM   8296  O OD2 . ASP C 1 178 ? 53.221  17.409  60.857  1.00 42.12 ? 216 ASP C OD2 1 
ATOM   8297  N N   . ARG C 1 179 ? 57.857  18.613  60.705  1.00 37.84 ? 217 ARG C N   1 
ATOM   8298  C CA  . ARG C 1 179 ? 59.037  18.169  59.989  1.00 38.82 ? 217 ARG C CA  1 
ATOM   8299  C C   . ARG C 1 179 ? 58.738  17.184  58.850  1.00 39.20 ? 217 ARG C C   1 
ATOM   8300  O O   . ARG C 1 179 ? 59.681  16.715  58.202  1.00 39.56 ? 217 ARG C O   1 
ATOM   8301  C CB  . ARG C 1 179 ? 60.072  17.589  60.974  1.00 39.63 ? 217 ARG C CB  1 
ATOM   8302  C CG  . ARG C 1 179 ? 60.708  18.675  61.794  1.00 41.91 ? 217 ARG C CG  1 
ATOM   8303  C CD  . ARG C 1 179 ? 61.953  18.251  62.524  1.00 47.31 ? 217 ARG C CD  1 
ATOM   8304  N NE  . ARG C 1 179 ? 62.734  19.445  62.865  1.00 50.28 ? 217 ARG C NE  1 
ATOM   8305  C CZ  . ARG C 1 179 ? 62.539  20.229  63.935  1.00 51.95 ? 217 ARG C CZ  1 
ATOM   8306  N NH1 . ARG C 1 179 ? 63.331  21.294  64.114  1.00 52.24 ? 217 ARG C NH1 1 
ATOM   8307  N NH2 . ARG C 1 179 ? 61.587  19.965  64.843  1.00 50.62 ? 217 ARG C NH2 1 
ATOM   8308  N N   . ALA C 1 180 ? 57.457  16.848  58.630  1.00 38.52 ? 218 ALA C N   1 
ATOM   8309  C CA  . ALA C 1 180 ? 57.020  16.095  57.452  1.00 37.99 ? 218 ALA C CA  1 
ATOM   8310  C C   . ALA C 1 180 ? 56.552  17.037  56.367  1.00 37.61 ? 218 ALA C C   1 
ATOM   8311  O O   . ALA C 1 180 ? 56.336  16.618  55.227  1.00 38.77 ? 218 ALA C O   1 
ATOM   8312  C CB  . ALA C 1 180 ? 55.885  15.141  57.815  1.00 38.20 ? 218 ALA C CB  1 
ATOM   8313  N N   . GLY C 1 181 ? 56.382  18.314  56.698  1.00 36.52 ? 219 GLY C N   1 
ATOM   8314  C CA  . GLY C 1 181 ? 55.917  19.278  55.723  1.00 35.60 ? 219 GLY C CA  1 
ATOM   8315  C C   . GLY C 1 181 ? 54.438  19.630  55.787  1.00 34.59 ? 219 GLY C C   1 
ATOM   8316  O O   . GLY C 1 181 ? 53.975  20.322  54.929  1.00 34.47 ? 219 GLY C O   1 
ATOM   8317  N N   . ASN C 1 182 ? 53.701  19.170  56.798  1.00 34.27 ? 220 ASN C N   1 
ATOM   8318  C CA  . ASN C 1 182 ? 52.315  19.613  57.030  1.00 33.42 ? 220 ASN C CA  1 
ATOM   8319  C C   . ASN C 1 182 ? 52.313  21.013  57.581  1.00 33.88 ? 220 ASN C C   1 
ATOM   8320  O O   . ASN C 1 182 ? 53.217  21.357  58.344  1.00 33.56 ? 220 ASN C O   1 
ATOM   8321  C CB  . ASN C 1 182 ? 51.577  18.748  58.051  1.00 33.02 ? 220 ASN C CB  1 
ATOM   8322  C CG  . ASN C 1 182 ? 51.499  17.318  57.652  1.00 32.94 ? 220 ASN C CG  1 
ATOM   8323  O OD1 . ASN C 1 182 ? 50.982  16.999  56.572  1.00 33.10 ? 220 ASN C OD1 1 
ATOM   8324  N ND2 . ASN C 1 182 ? 52.026  16.420  58.516  1.00 30.28 ? 220 ASN C ND2 1 
ATOM   8325  N N   . VAL C 1 183 ? 51.250  21.771  57.280  1.00 33.97 ? 221 VAL C N   1 
ATOM   8326  C CA  . VAL C 1 183 ? 51.220  23.219  57.479  1.00 34.79 ? 221 VAL C CA  1 
ATOM   8327  C C   . VAL C 1 183 ? 49.885  23.728  58.068  1.00 34.60 ? 221 VAL C C   1 
ATOM   8328  O O   . VAL C 1 183 ? 48.801  23.239  57.689  1.00 34.42 ? 221 VAL C O   1 
ATOM   8329  C CB  . VAL C 1 183 ? 51.507  23.928  56.112  1.00 35.55 ? 221 VAL C CB  1 
ATOM   8330  C CG1 . VAL C 1 183 ? 50.983  25.384  56.084  1.00 36.82 ? 221 VAL C CG1 1 
ATOM   8331  C CG2 . VAL C 1 183 ? 52.979  23.869  55.803  1.00 34.93 ? 221 VAL C CG2 1 
ATOM   8332  N N   . ILE C 1 184 ? 49.990  24.686  59.005  1.00 33.75 ? 222 ILE C N   1 
ATOM   8333  C CA  . ILE C 1 184 ? 48.846  25.351  59.626  1.00 32.73 ? 222 ILE C CA  1 
ATOM   8334  C C   . ILE C 1 184 ? 49.016  26.877  59.500  1.00 33.59 ? 222 ILE C C   1 
ATOM   8335  O O   . ILE C 1 184 ? 50.139  27.382  59.387  1.00 33.02 ? 222 ILE C O   1 
ATOM   8336  C CB  . ILE C 1 184 ? 48.608  24.877  61.125  1.00 33.18 ? 222 ILE C CB  1 
ATOM   8337  C CG1 . ILE C 1 184 ? 49.752  25.314  62.066  1.00 32.78 ? 222 ILE C CG1 1 
ATOM   8338  C CG2 . ILE C 1 184 ? 48.391  23.325  61.176  1.00 30.22 ? 222 ILE C CG2 1 
ATOM   8339  C CD1 . ILE C 1 184 ? 49.390  25.264  63.563  1.00 31.14 ? 222 ILE C CD1 1 
ATOM   8340  N N   . PHE C 1 185 ? 47.890  27.595  59.480  1.00 34.26 ? 223 PHE C N   1 
ATOM   8341  C CA  . PHE C 1 185 ? 47.831  29.024  59.217  1.00 33.82 ? 223 PHE C CA  1 
ATOM   8342  C C   . PHE C 1 185 ? 47.186  29.643  60.437  1.00 35.49 ? 223 PHE C C   1 
ATOM   8343  O O   . PHE C 1 185 ? 46.296  29.024  61.050  1.00 36.43 ? 223 PHE C O   1 
ATOM   8344  C CB  . PHE C 1 185 ? 46.952  29.325  57.983  1.00 33.03 ? 223 PHE C CB  1 
ATOM   8345  C CG  . PHE C 1 185 ? 47.405  28.627  56.716  1.00 32.10 ? 223 PHE C CG  1 
ATOM   8346  C CD1 . PHE C 1 185 ? 48.329  29.196  55.878  1.00 31.95 ? 223 PHE C CD1 1 
ATOM   8347  C CD2 . PHE C 1 185 ? 46.918  27.358  56.391  1.00 34.29 ? 223 PHE C CD2 1 
ATOM   8348  C CE1 . PHE C 1 185 ? 48.758  28.509  54.710  1.00 31.76 ? 223 PHE C CE1 1 
ATOM   8349  C CE2 . PHE C 1 185 ? 47.343  26.676  55.270  1.00 32.38 ? 223 PHE C CE2 1 
ATOM   8350  C CZ  . PHE C 1 185 ? 48.281  27.262  54.433  1.00 31.82 ? 223 PHE C CZ  1 
ATOM   8351  N N   . ARG C 1 186 ? 47.586  30.879  60.755  1.00 35.05 ? 224 ARG C N   1 
ATOM   8352  C CA  . ARG C 1 186 ? 47.075  31.580  61.914  1.00 34.17 ? 224 ARG C CA  1 
ATOM   8353  C C   . ARG C 1 186 ? 46.023  32.603  61.512  1.00 33.85 ? 224 ARG C C   1 
ATOM   8354  O O   . ARG C 1 186 ? 46.218  33.379  60.570  1.00 34.63 ? 224 ARG C O   1 
ATOM   8355  C CB  . ARG C 1 186 ? 48.224  32.299  62.576  1.00 34.48 ? 224 ARG C CB  1 
ATOM   8356  C CG  . ARG C 1 186 ? 48.007  32.684  63.980  1.00 34.23 ? 224 ARG C CG  1 
ATOM   8357  C CD  . ARG C 1 186 ? 49.309  33.153  64.556  1.00 33.35 ? 224 ARG C CD  1 
ATOM   8358  N NE  . ARG C 1 186 ? 49.106  33.656  65.879  1.00 33.07 ? 224 ARG C NE  1 
ATOM   8359  C CZ  . ARG C 1 186 ? 48.846  34.924  66.166  1.00 35.80 ? 224 ARG C CZ  1 
ATOM   8360  N NH1 . ARG C 1 186 ? 48.645  35.275  67.428  1.00 33.91 ? 224 ARG C NH1 1 
ATOM   8361  N NH2 . ARG C 1 186 ? 48.760  35.831  65.194  1.00 34.24 ? 224 ARG C NH2 1 
ATOM   8362  N N   . LYS C 1 187 ? 44.908  32.577  62.222  1.00 32.93 ? 225 LYS C N   1 
ATOM   8363  C CA  . LYS C 1 187 ? 43.810  33.505  62.063  1.00 32.49 ? 225 LYS C CA  1 
ATOM   8364  C C   . LYS C 1 187 ? 43.373  33.707  60.599  1.00 32.96 ? 225 LYS C C   1 
ATOM   8365  O O   . LYS C 1 187 ? 43.198  32.722  59.878  1.00 31.34 ? 225 LYS C O   1 
ATOM   8366  C CB  . LYS C 1 187 ? 44.115  34.780  62.856  1.00 31.74 ? 225 LYS C CB  1 
ATOM   8367  C CG  . LYS C 1 187 ? 44.383  34.400  64.315  1.00 30.25 ? 225 LYS C CG  1 
ATOM   8368  C CD  . LYS C 1 187 ? 44.695  35.573  65.224  1.00 31.39 ? 225 LYS C CD  1 
ATOM   8369  C CE  . LYS C 1 187 ? 44.931  35.066  66.659  1.00 32.28 ? 225 LYS C CE  1 
ATOM   8370  N NZ  . LYS C 1 187 ? 45.244  36.177  67.493  1.00 38.41 ? 225 LYS C NZ  1 
ATOM   8371  N N   . SER C 1 188 ? 43.147  34.960  60.202  1.00 33.68 ? 226 SER C N   1 
ATOM   8372  C CA  . SER C 1 188 ? 42.814  35.313  58.821  1.00 34.33 ? 226 SER C CA  1 
ATOM   8373  C C   . SER C 1 188 ? 44.039  35.413  57.900  1.00 35.08 ? 226 SER C C   1 
ATOM   8374  O O   . SER C 1 188 ? 43.904  35.867  56.747  1.00 35.29 ? 226 SER C O   1 
ATOM   8375  C CB  . SER C 1 188 ? 42.027  36.643  58.797  1.00 34.39 ? 226 SER C CB  1 
ATOM   8376  O OG  . SER C 1 188 ? 42.846  37.764  59.194  1.00 33.40 ? 226 SER C OG  1 
ATOM   8377  N N   . ALA C 1 189 ? 45.229  35.024  58.393  1.00 34.92 ? 227 ALA C N   1 
ATOM   8378  C CA  . ALA C 1 189 ? 46.425  34.998  57.567  1.00 34.94 ? 227 ALA C CA  1 
ATOM   8379  C C   . ALA C 1 189 ? 46.388  33.800  56.562  1.00 36.18 ? 227 ALA C C   1 
ATOM   8380  O O   . ALA C 1 189 ? 47.210  33.723  55.637  1.00 37.68 ? 227 ALA C O   1 
ATOM   8381  C CB  . ALA C 1 189 ? 47.650  34.975  58.410  1.00 33.97 ? 227 ALA C CB  1 
ATOM   8382  N N   . ARG C 1 190 ? 45.398  32.911  56.706  1.00 35.97 ? 228 ARG C N   1 
ATOM   8383  C CA  . ARG C 1 190 ? 45.185  31.786  55.778  1.00 35.81 ? 228 ARG C CA  1 
ATOM   8384  C C   . ARG C 1 190 ? 44.808  32.208  54.338  1.00 35.25 ? 228 ARG C C   1 
ATOM   8385  O O   . ARG C 1 190 ? 45.485  31.874  53.387  1.00 36.16 ? 228 ARG C O   1 
ATOM   8386  C CB  . ARG C 1 190 ? 44.098  30.871  56.365  1.00 35.47 ? 228 ARG C CB  1 
ATOM   8387  C CG  . ARG C 1 190 ? 43.753  29.694  55.504  1.00 34.92 ? 228 ARG C CG  1 
ATOM   8388  C CD  . ARG C 1 190 ? 42.639  28.815  56.032  1.00 35.59 ? 228 ARG C CD  1 
ATOM   8389  N NE  . ARG C 1 190 ? 42.603  28.739  57.488  1.00 34.68 ? 228 ARG C NE  1 
ATOM   8390  C CZ  . ARG C 1 190 ? 42.064  27.770  58.179  1.00 33.27 ? 228 ARG C CZ  1 
ATOM   8391  N NH1 . ARG C 1 190 ? 41.467  26.769  57.572  1.00 35.58 ? 228 ARG C NH1 1 
ATOM   8392  N NH2 . ARG C 1 190 ? 42.108  27.820  59.495  1.00 38.15 ? 228 ARG C NH2 1 
ATOM   8393  N N   . ASN C 1 191 ? 43.686  32.887  54.212  1.00 34.68 ? 229 ASN C N   1 
ATOM   8394  C CA  . ASN C 1 191 ? 43.171  33.483  52.984  1.00 34.41 ? 229 ASN C CA  1 
ATOM   8395  C C   . ASN C 1 191 ? 43.458  32.736  51.678  1.00 34.07 ? 229 ASN C C   1 
ATOM   8396  O O   . ASN C 1 191 ? 42.920  31.693  51.482  1.00 32.82 ? 229 ASN C O   1 
ATOM   8397  C CB  . ASN C 1 191 ? 43.464  35.023  52.905  1.00 34.27 ? 229 ASN C CB  1 
ATOM   8398  C CG  . ASN C 1 191 ? 44.935  35.410  53.063  1.00 34.70 ? 229 ASN C CG  1 
ATOM   8399  O OD1 . ASN C 1 191 ? 45.719  35.347  52.109  1.00 35.79 ? 229 ASN C OD1 1 
ATOM   8400  N ND2 . ASN C 1 191 ? 45.273  35.958  54.209  1.00 28.71 ? 229 ASN C ND2 1 
ATOM   8401  N N   . PHE C 1 192 ? 44.279  33.305  50.793  1.00 34.73 ? 230 PHE C N   1 
ATOM   8402  C CA  . PHE C 1 192 ? 44.631  32.682  49.495  1.00 34.05 ? 230 PHE C CA  1 
ATOM   8403  C C   . PHE C 1 192 ? 45.806  31.744  49.625  1.00 35.26 ? 230 PHE C C   1 
ATOM   8404  O O   . PHE C 1 192 ? 46.069  30.946  48.720  1.00 36.10 ? 230 PHE C O   1 
ATOM   8405  C CB  . PHE C 1 192 ? 44.936  33.764  48.456  1.00 33.80 ? 230 PHE C CB  1 
ATOM   8406  C CG  . PHE C 1 192 ? 43.716  34.442  47.905  1.00 33.37 ? 230 PHE C CG  1 
ATOM   8407  C CD1 . PHE C 1 192 ? 43.193  35.573  48.514  1.00 34.91 ? 230 PHE C CD1 1 
ATOM   8408  C CD2 . PHE C 1 192 ? 43.113  33.981  46.743  1.00 36.18 ? 230 PHE C CD2 1 
ATOM   8409  C CE1 . PHE C 1 192 ? 42.077  36.192  48.012  1.00 36.12 ? 230 PHE C CE1 1 
ATOM   8410  C CE2 . PHE C 1 192 ? 41.948  34.614  46.234  1.00 34.54 ? 230 PHE C CE2 1 
ATOM   8411  C CZ  . PHE C 1 192 ? 41.431  35.710  46.896  1.00 34.68 ? 230 PHE C CZ  1 
ATOM   8412  N N   . ASN C 1 193 ? 46.515  31.824  50.747  1.00 35.65 ? 231 ASN C N   1 
ATOM   8413  C CA  . ASN C 1 193 ? 47.655  30.948  51.009  1.00 34.60 ? 231 ASN C CA  1 
ATOM   8414  C C   . ASN C 1 193 ? 47.286  29.482  50.879  1.00 35.44 ? 231 ASN C C   1 
ATOM   8415  O O   . ASN C 1 193 ? 48.029  28.695  50.235  1.00 35.26 ? 231 ASN C O   1 
ATOM   8416  C CB  . ASN C 1 193 ? 48.279  31.250  52.387  1.00 34.56 ? 231 ASN C CB  1 
ATOM   8417  C CG  . ASN C 1 193 ? 49.094  32.549  52.402  1.00 31.87 ? 231 ASN C CG  1 
ATOM   8418  O OD1 . ASN C 1 193 ? 50.034  32.679  51.679  1.00 34.87 ? 231 ASN C OD1 1 
ATOM   8419  N ND2 . ASN C 1 193 ? 48.743  33.486  53.271  1.00 31.94 ? 231 ASN C ND2 1 
ATOM   8420  N N   . LEU C 1 194 ? 46.133  29.090  51.431  1.00 34.92 ? 232 LEU C N   1 
ATOM   8421  C CA  . LEU C 1 194 ? 45.737  27.696  51.404  1.00 34.45 ? 232 LEU C CA  1 
ATOM   8422  C C   . LEU C 1 194 ? 45.407  27.185  49.985  1.00 34.89 ? 232 LEU C C   1 
ATOM   8423  O O   . LEU C 1 194 ? 46.040  26.205  49.554  1.00 36.30 ? 232 LEU C O   1 
ATOM   8424  C CB  . LEU C 1 194 ? 44.622  27.421  52.430  1.00 35.66 ? 232 LEU C CB  1 
ATOM   8425  C CG  . LEU C 1 194 ? 44.098  25.977  52.543  1.00 36.17 ? 232 LEU C CG  1 
ATOM   8426  C CD1 . LEU C 1 194 ? 43.637  25.668  53.988  1.00 33.35 ? 232 LEU C CD1 1 
ATOM   8427  C CD2 . LEU C 1 194 ? 42.992  25.672  51.470  1.00 33.74 ? 232 LEU C CD2 1 
ATOM   8428  N N   . PRO C 1 195 ? 44.465  27.834  49.231  1.00 34.42 ? 233 PRO C N   1 
ATOM   8429  C CA  . PRO C 1 195 ? 44.277  27.360  47.849  1.00 34.07 ? 233 PRO C CA  1 
ATOM   8430  C C   . PRO C 1 195 ? 45.526  27.472  46.943  1.00 34.53 ? 233 PRO C C   1 
ATOM   8431  O O   . PRO C 1 195 ? 45.732  26.642  46.060  1.00 33.96 ? 233 PRO C O   1 
ATOM   8432  C CB  . PRO C 1 195 ? 43.148  28.262  47.286  1.00 34.57 ? 233 PRO C CB  1 
ATOM   8433  C CG  . PRO C 1 195 ? 43.048  29.453  48.181  1.00 33.16 ? 233 PRO C CG  1 
ATOM   8434  C CD  . PRO C 1 195 ? 43.570  28.968  49.554  1.00 34.36 ? 233 PRO C CD  1 
ATOM   8435  N N   . MET C 1 196 ? 46.337  28.516  47.113  1.00 34.50 ? 234 MET C N   1 
ATOM   8436  C CA  . MET C 1 196 ? 47.550  28.644  46.293  1.00 34.25 ? 234 MET C CA  1 
ATOM   8437  C C   . MET C 1 196 ? 48.558  27.459  46.420  1.00 34.85 ? 234 MET C C   1 
ATOM   8438  O O   . MET C 1 196 ? 49.231  27.120  45.439  1.00 33.76 ? 234 MET C O   1 
ATOM   8439  C CB  . MET C 1 196 ? 48.240  29.987  46.490  1.00 34.35 ? 234 MET C CB  1 
ATOM   8440  C CG  . MET C 1 196 ? 47.492  31.112  45.843  1.00 32.76 ? 234 MET C CG  1 
ATOM   8441  S SD  . MET C 1 196 ? 48.192  32.658  46.291  1.00 35.40 ? 234 MET C SD  1 
ATOM   8442  C CE  . MET C 1 196 ? 47.157  33.835  45.344  1.00 32.47 ? 234 MET C CE  1 
ATOM   8443  N N   . CYS C 1 197 ? 48.601  26.807  47.579  1.00 34.55 ? 235 CYS C N   1 
ATOM   8444  C CA  . CYS C 1 197 ? 49.469  25.670  47.800  1.00 35.73 ? 235 CYS C CA  1 
ATOM   8445  C C   . CYS C 1 197 ? 49.249  24.493  46.894  1.00 35.46 ? 235 CYS C C   1 
ATOM   8446  O O   . CYS C 1 197 ? 50.174  23.695  46.701  1.00 37.27 ? 235 CYS C O   1 
ATOM   8447  C CB  . CYS C 1 197 ? 49.302  25.096  49.209  1.00 36.27 ? 235 CYS C CB  1 
ATOM   8448  S SG  . CYS C 1 197 ? 50.147  25.959  50.433  1.00 41.86 ? 235 CYS C SG  1 
ATOM   8449  N N   . LYS C 1 198 ? 48.028  24.361  46.411  1.00 35.72 ? 236 LYS C N   1 
ATOM   8450  C CA  . LYS C 1 198 ? 47.562  23.232  45.654  1.00 36.24 ? 236 LYS C CA  1 
ATOM   8451  C C   . LYS C 1 198 ? 47.571  23.466  44.141  1.00 36.59 ? 236 LYS C C   1 
ATOM   8452  O O   . LYS C 1 198 ? 47.357  22.530  43.366  1.00 37.43 ? 236 LYS C O   1 
ATOM   8453  C CB  . LYS C 1 198 ? 46.137  22.915  46.115  1.00 36.91 ? 236 LYS C CB  1 
ATOM   8454  C CG  . LYS C 1 198 ? 45.943  22.878  47.626  1.00 35.18 ? 236 LYS C CG  1 
ATOM   8455  C CD  . LYS C 1 198 ? 44.531  22.642  47.951  1.00 32.12 ? 236 LYS C CD  1 
ATOM   8456  C CE  . LYS C 1 198 ? 44.300  22.608  49.464  1.00 34.33 ? 236 LYS C CE  1 
ATOM   8457  N NZ  . LYS C 1 198 ? 42.849  22.268  49.764  1.00 39.06 ? 236 LYS C NZ  1 
ATOM   8458  N N   . ALA C 1 199 ? 47.890  24.680  43.713  1.00 36.72 ? 237 ALA C N   1 
ATOM   8459  C CA  . ALA C 1 199 ? 47.692  25.116  42.329  1.00 37.06 ? 237 ALA C CA  1 
ATOM   8460  C C   . ALA C 1 199 ? 48.983  25.458  41.569  1.00 37.34 ? 237 ALA C C   1 
ATOM   8461  O O   . ALA C 1 199 ? 48.914  25.879  40.429  1.00 38.23 ? 237 ALA C O   1 
ATOM   8462  C CB  . ALA C 1 199 ? 46.714  26.288  42.297  1.00 36.37 ? 237 ALA C CB  1 
ATOM   8463  N N   . ALA C 1 200 ? 50.162  25.221  42.149  1.00 37.80 ? 238 ALA C N   1 
ATOM   8464  C CA  . ALA C 1 200 ? 51.445  25.495  41.459  1.00 36.77 ? 238 ALA C CA  1 
ATOM   8465  C C   . ALA C 1 200 ? 52.282  24.245  41.309  1.00 36.47 ? 238 ALA C C   1 
ATOM   8466  O O   . ALA C 1 200 ? 52.245  23.361  42.152  1.00 37.63 ? 238 ALA C O   1 
ATOM   8467  C CB  . ALA C 1 200 ? 52.251  26.618  42.176  1.00 36.62 ? 238 ALA C CB  1 
ATOM   8468  N N   . GLU C 1 201 ? 53.023  24.161  40.203  1.00 35.67 ? 239 GLU C N   1 
ATOM   8469  C CA  . GLU C 1 201 ? 53.968  23.095  39.995  1.00 34.86 ? 239 GLU C CA  1 
ATOM   8470  C C   . GLU C 1 201 ? 54.969  23.009  41.159  1.00 34.27 ? 239 GLU C C   1 
ATOM   8471  O O   . GLU C 1 201 ? 55.284  21.918  41.619  1.00 34.16 ? 239 GLU C O   1 
ATOM   8472  C CB  . GLU C 1 201 ? 54.691  23.260  38.648  1.00 34.70 ? 239 GLU C CB  1 
ATOM   8473  N N   . THR C 1 202 ? 55.458  24.128  41.665  1.00 33.75 ? 240 THR C N   1 
ATOM   8474  C CA  . THR C 1 202 ? 56.344  24.097  42.854  1.00 33.54 ? 240 THR C CA  1 
ATOM   8475  C C   . THR C 1 202 ? 55.844  25.067  43.931  1.00 33.96 ? 240 THR C C   1 
ATOM   8476  O O   . THR C 1 202 ? 55.772  26.273  43.709  1.00 34.53 ? 240 THR C O   1 
ATOM   8477  C CB  . THR C 1 202 ? 57.788  24.424  42.506  1.00 33.53 ? 240 THR C CB  1 
ATOM   8478  O OG1 . THR C 1 202 ? 58.270  23.487  41.525  1.00 30.22 ? 240 THR C OG1 1 
ATOM   8479  C CG2 . THR C 1 202 ? 58.701  24.370  43.779  1.00 34.16 ? 240 THR C CG2 1 
ATOM   8480  N N   . THR C 1 203 ? 55.461  24.556  45.087  1.00 33.23 ? 241 THR C N   1 
ATOM   8481  C CA  . THR C 1 203 ? 55.031  25.450  46.101  1.00 34.54 ? 241 THR C CA  1 
ATOM   8482  C C   . THR C 1 203 ? 56.169  25.635  47.116  1.00 34.75 ? 241 THR C C   1 
ATOM   8483  O O   . THR C 1 203 ? 56.813  24.660  47.574  1.00 35.48 ? 241 THR C O   1 
ATOM   8484  C CB  . THR C 1 203 ? 53.680  25.021  46.764  1.00 34.03 ? 241 THR C CB  1 
ATOM   8485  O OG1 . THR C 1 203 ? 53.954  24.143  47.823  1.00 39.22 ? 241 THR C OG1 1 
ATOM   8486  C CG2 . THR C 1 203 ? 52.726  24.388  45.809  1.00 32.79 ? 241 THR C CG2 1 
ATOM   8487  N N   . VAL C 1 204 ? 56.439  26.898  47.428  1.00 34.59 ? 242 VAL C N   1 
ATOM   8488  C CA  . VAL C 1 204 ? 57.498  27.267  48.350  1.00 33.40 ? 242 VAL C CA  1 
ATOM   8489  C C   . VAL C 1 204 ? 56.748  27.953  49.513  1.00 33.79 ? 242 VAL C C   1 
ATOM   8490  O O   . VAL C 1 204 ? 56.023  28.937  49.290  1.00 32.25 ? 242 VAL C O   1 
ATOM   8491  C CB  . VAL C 1 204 ? 58.530  28.214  47.660  1.00 34.18 ? 242 VAL C CB  1 
ATOM   8492  C CG1 . VAL C 1 204 ? 59.787  28.393  48.517  1.00 30.38 ? 242 VAL C CG1 1 
ATOM   8493  C CG2 . VAL C 1 204 ? 58.861  27.714  46.224  1.00 30.76 ? 242 VAL C CG2 1 
ATOM   8494  N N   . VAL C 1 205 ? 56.899  27.400  50.730  1.00 33.44 ? 243 VAL C N   1 
ATOM   8495  C CA  . VAL C 1 205 ? 56.219  27.889  51.942  1.00 33.10 ? 243 VAL C CA  1 
ATOM   8496  C C   . VAL C 1 205 ? 57.222  28.387  52.978  1.00 33.25 ? 243 VAL C C   1 
ATOM   8497  O O   . VAL C 1 205 ? 58.186  27.693  53.321  1.00 33.57 ? 243 VAL C O   1 
ATOM   8498  C CB  . VAL C 1 205 ? 55.312  26.782  52.561  1.00 33.54 ? 243 VAL C CB  1 
ATOM   8499  C CG1 . VAL C 1 205 ? 54.573  27.284  53.783  1.00 30.90 ? 243 VAL C CG1 1 
ATOM   8500  C CG2 . VAL C 1 205 ? 54.267  26.277  51.503  1.00 34.07 ? 243 VAL C CG2 1 
ATOM   8501  N N   . GLU C 1 206 ? 57.007  29.601  53.470  1.00 32.66 ? 244 GLU C N   1 
ATOM   8502  C CA  . GLU C 1 206 ? 57.742  30.087  54.597  1.00 31.67 ? 244 GLU C CA  1 
ATOM   8503  C C   . GLU C 1 206 ? 56.886  30.070  55.838  1.00 31.40 ? 244 GLU C C   1 
ATOM   8504  O O   . GLU C 1 206 ? 55.759  30.510  55.808  1.00 32.37 ? 244 GLU C O   1 
ATOM   8505  C CB  . GLU C 1 206 ? 58.292  31.478  54.323  1.00 32.14 ? 244 GLU C CB  1 
ATOM   8506  C CG  . GLU C 1 206 ? 57.280  32.574  54.018  1.00 32.22 ? 244 GLU C CG  1 
ATOM   8507  C CD  . GLU C 1 206 ? 57.961  33.893  53.947  1.00 34.43 ? 244 GLU C CD  1 
ATOM   8508  O OE1 . GLU C 1 206 ? 58.190  34.364  52.826  1.00 36.77 ? 244 GLU C OE1 1 
ATOM   8509  O OE2 . GLU C 1 206 ? 58.346  34.438  55.008  1.00 36.17 ? 244 GLU C OE2 1 
ATOM   8510  N N   . VAL C 1 207 ? 57.432  29.548  56.932  1.00 31.44 ? 245 VAL C N   1 
ATOM   8511  C CA  . VAL C 1 207 ? 56.718  29.404  58.205  1.00 30.97 ? 245 VAL C CA  1 
ATOM   8512  C C   . VAL C 1 207 ? 57.490  30.097  59.292  1.00 31.92 ? 245 VAL C C   1 
ATOM   8513  O O   . VAL C 1 207 ? 58.683  30.342  59.144  1.00 32.83 ? 245 VAL C O   1 
ATOM   8514  C CB  . VAL C 1 207 ? 56.505  27.904  58.619  1.00 29.87 ? 245 VAL C CB  1 
ATOM   8515  C CG1 . VAL C 1 207 ? 55.627  27.192  57.617  1.00 26.94 ? 245 VAL C CG1 1 
ATOM   8516  C CG2 . VAL C 1 207 ? 57.836  27.167  58.856  1.00 29.09 ? 245 VAL C CG2 1 
ATOM   8517  N N   . GLU C 1 208 ? 56.836  30.397  60.397  1.00 32.95 ? 246 GLU C N   1 
ATOM   8518  C CA  . GLU C 1 208 ? 57.511  31.147  61.472  1.00 34.59 ? 246 GLU C CA  1 
ATOM   8519  C C   . GLU C 1 208 ? 58.146  30.202  62.491  1.00 34.07 ? 246 GLU C C   1 
ATOM   8520  O O   . GLU C 1 208 ? 59.070  30.589  63.189  1.00 33.40 ? 246 GLU C O   1 
ATOM   8521  C CB  . GLU C 1 208 ? 56.532  32.080  62.192  1.00 34.16 ? 246 GLU C CB  1 
ATOM   8522  C CG  . GLU C 1 208 ? 55.780  33.063  61.285  1.00 37.44 ? 246 GLU C CG  1 
ATOM   8523  C CD  . GLU C 1 208 ? 54.631  33.750  62.006  1.00 37.67 ? 246 GLU C CD  1 
ATOM   8524  O OE1 . GLU C 1 208 ? 54.534  33.611  63.249  1.00 43.68 ? 246 GLU C OE1 1 
ATOM   8525  O OE2 . GLU C 1 208 ? 53.833  34.418  61.348  1.00 42.13 ? 246 GLU C OE2 1 
ATOM   8526  N N   . GLU C 1 209 ? 57.616  28.980  62.572  1.00 34.32 ? 247 GLU C N   1 
ATOM   8527  C CA  . GLU C 1 209 ? 58.093  27.937  63.480  1.00 35.15 ? 247 GLU C CA  1 
ATOM   8528  C C   . GLU C 1 209 ? 58.013  26.563  62.796  1.00 34.39 ? 247 GLU C C   1 
ATOM   8529  O O   . GLU C 1 209 ? 57.054  26.248  62.086  1.00 32.82 ? 247 GLU C O   1 
ATOM   8530  C CB  . GLU C 1 209 ? 57.250  27.951  64.762  1.00 35.56 ? 247 GLU C CB  1 
ATOM   8531  C CG  . GLU C 1 209 ? 57.531  26.830  65.761  1.00 37.63 ? 247 GLU C CG  1 
ATOM   8532  C CD  . GLU C 1 209 ? 56.721  26.976  67.074  1.00 39.13 ? 247 GLU C CD  1 
ATOM   8533  O OE1 . GLU C 1 209 ? 55.532  27.392  67.025  1.00 48.04 ? 247 GLU C OE1 1 
ATOM   8534  O OE2 . GLU C 1 209 ? 57.252  26.676  68.161  1.00 42.38 ? 247 GLU C OE2 1 
ATOM   8535  N N   . ILE C 1 210 ? 59.053  25.765  62.984  1.00 34.49 ? 248 ILE C N   1 
ATOM   8536  C CA  . ILE C 1 210 ? 59.029  24.357  62.594  1.00 34.81 ? 248 ILE C CA  1 
ATOM   8537  C C   . ILE C 1 210 ? 59.013  23.504  63.863  1.00 35.13 ? 248 ILE C C   1 
ATOM   8538  O O   . ILE C 1 210 ? 59.838  23.688  64.769  1.00 35.53 ? 248 ILE C O   1 
ATOM   8539  C CB  . ILE C 1 210 ? 60.204  23.981  61.692  1.00 34.67 ? 248 ILE C CB  1 
ATOM   8540  C CG1 . ILE C 1 210 ? 60.053  24.643  60.313  1.00 34.80 ? 248 ILE C CG1 1 
ATOM   8541  C CG2 . ILE C 1 210 ? 60.288  22.474  61.526  1.00 34.24 ? 248 ILE C CG2 1 
ATOM   8542  C CD1 . ILE C 1 210 ? 61.408  24.630  59.508  1.00 35.65 ? 248 ILE C CD1 1 
ATOM   8543  N N   . VAL C 1 211 ? 58.058  22.582  63.906  1.00 35.43 ? 249 VAL C N   1 
ATOM   8544  C CA  . VAL C 1 211 ? 57.728  21.785  65.077  1.00 35.29 ? 249 VAL C CA  1 
ATOM   8545  C C   . VAL C 1 211 ? 57.828  20.291  64.713  1.00 36.11 ? 249 VAL C C   1 
ATOM   8546  O O   . VAL C 1 211 ? 57.877  19.908  63.545  1.00 36.01 ? 249 VAL C O   1 
ATOM   8547  C CB  . VAL C 1 211 ? 56.296  22.128  65.591  1.00 35.74 ? 249 VAL C CB  1 
ATOM   8548  C CG1 . VAL C 1 211 ? 56.144  23.634  65.854  1.00 36.21 ? 249 VAL C CG1 1 
ATOM   8549  C CG2 . VAL C 1 211 ? 55.224  21.686  64.583  1.00 33.67 ? 249 VAL C CG2 1 
ATOM   8550  N N   . ASP C 1 212 ? 57.866  19.443  65.721  1.00 36.93 ? 250 ASP C N   1 
ATOM   8551  C CA  . ASP C 1 212 ? 58.067  18.014  65.481  1.00 38.06 ? 250 ASP C CA  1 
ATOM   8552  C C   . ASP C 1 212 ? 56.897  17.345  64.816  1.00 37.74 ? 250 ASP C C   1 
ATOM   8553  O O   . ASP C 1 212 ? 55.769  17.726  65.054  1.00 37.82 ? 250 ASP C O   1 
ATOM   8554  C CB  . ASP C 1 212 ? 58.338  17.301  66.795  1.00 37.88 ? 250 ASP C CB  1 
ATOM   8555  C CG  . ASP C 1 212 ? 59.718  17.560  67.296  1.00 39.86 ? 250 ASP C CG  1 
ATOM   8556  O OD1 . ASP C 1 212 ? 60.666  17.504  66.470  1.00 39.18 ? 250 ASP C OD1 1 
ATOM   8557  O OD2 . ASP C 1 212 ? 59.855  17.812  68.521  1.00 43.62 ? 250 ASP C OD2 1 
ATOM   8558  N N   . ILE C 1 213 ? 57.185  16.320  64.017  1.00 38.14 ? 251 ILE C N   1 
ATOM   8559  C CA  . ILE C 1 213 ? 56.150  15.454  63.437  1.00 38.49 ? 251 ILE C CA  1 
ATOM   8560  C C   . ILE C 1 213 ? 55.275  14.923  64.566  1.00 38.95 ? 251 ILE C C   1 
ATOM   8561  O O   . ILE C 1 213 ? 55.791  14.403  65.534  1.00 38.91 ? 251 ILE C O   1 
ATOM   8562  C CB  . ILE C 1 213 ? 56.782  14.236  62.733  1.00 38.30 ? 251 ILE C CB  1 
ATOM   8563  C CG1 . ILE C 1 213 ? 57.486  14.641  61.443  1.00 38.55 ? 251 ILE C CG1 1 
ATOM   8564  C CG2 . ILE C 1 213 ? 55.739  13.212  62.411  1.00 38.75 ? 251 ILE C CG2 1 
ATOM   8565  C CD1 . ILE C 1 213 ? 58.602  13.668  61.037  1.00 36.11 ? 251 ILE C CD1 1 
ATOM   8566  N N   . GLY C 1 214 ? 53.959  15.046  64.454  1.00 40.06 ? 252 GLY C N   1 
ATOM   8567  C CA  . GLY C 1 214 ? 53.062  14.610  65.538  1.00 40.23 ? 252 GLY C CA  1 
ATOM   8568  C C   . GLY C 1 214 ? 52.606  15.708  66.485  1.00 40.37 ? 252 GLY C C   1 
ATOM   8569  O O   . GLY C 1 214 ? 51.848  15.455  67.413  1.00 40.62 ? 252 GLY C O   1 
ATOM   8570  N N   . ALA C 1 215 ? 53.057  16.936  66.247  1.00 40.34 ? 253 ALA C N   1 
ATOM   8571  C CA  . ALA C 1 215 ? 52.629  18.084  67.042  1.00 39.83 ? 253 ALA C CA  1 
ATOM   8572  C C   . ALA C 1 215 ? 51.226  18.590  66.624  1.00 39.18 ? 253 ALA C C   1 
ATOM   8573  O O   . ALA C 1 215 ? 50.514  19.155  67.444  1.00 39.77 ? 253 ALA C O   1 
ATOM   8574  C CB  . ALA C 1 215 ? 53.695  19.213  66.988  1.00 39.87 ? 253 ALA C CB  1 
ATOM   8575  N N   . PHE C 1 216 ? 50.808  18.356  65.381  1.00 37.68 ? 254 PHE C N   1 
ATOM   8576  C CA  . PHE C 1 216 ? 49.457  18.695  64.973  1.00 37.13 ? 254 PHE C CA  1 
ATOM   8577  C C   . PHE C 1 216 ? 48.492  17.523  65.141  1.00 36.57 ? 254 PHE C C   1 
ATOM   8578  O O   . PHE C 1 216 ? 48.835  16.409  64.752  1.00 36.90 ? 254 PHE C O   1 
ATOM   8579  C CB  . PHE C 1 216 ? 49.413  19.117  63.493  1.00 36.91 ? 254 PHE C CB  1 
ATOM   8580  C CG  . PHE C 1 216 ? 50.398  20.198  63.110  1.00 36.31 ? 254 PHE C CG  1 
ATOM   8581  C CD1 . PHE C 1 216 ? 50.655  21.274  63.952  1.00 37.44 ? 254 PHE C CD1 1 
ATOM   8582  C CD2 . PHE C 1 216 ? 51.030  20.151  61.873  1.00 36.12 ? 254 PHE C CD2 1 
ATOM   8583  C CE1 . PHE C 1 216 ? 51.538  22.251  63.577  1.00 37.28 ? 254 PHE C CE1 1 
ATOM   8584  C CE2 . PHE C 1 216 ? 51.896  21.128  61.474  1.00 34.75 ? 254 PHE C CE2 1 
ATOM   8585  C CZ  . PHE C 1 216 ? 52.170  22.173  62.333  1.00 38.16 ? 254 PHE C CZ  1 
ATOM   8586  N N   . ALA C 1 217 ? 47.281  17.774  65.665  1.00 35.87 ? 255 ALA C N   1 
ATOM   8587  C CA  . ALA C 1 217 ? 46.174  16.810  65.523  1.00 35.53 ? 255 ALA C CA  1 
ATOM   8588  C C   . ALA C 1 217 ? 45.934  16.597  64.033  1.00 35.30 ? 255 ALA C C   1 
ATOM   8589  O O   . ALA C 1 217 ? 45.865  17.579  63.264  1.00 35.39 ? 255 ALA C O   1 
ATOM   8590  C CB  . ALA C 1 217 ? 44.899  17.277  66.206  1.00 35.03 ? 255 ALA C CB  1 
ATOM   8591  N N   . PRO C 1 218 ? 45.875  15.325  63.597  1.00 34.48 ? 256 PRO C N   1 
ATOM   8592  C CA  . PRO C 1 218 ? 45.728  15.058  62.150  1.00 34.74 ? 256 PRO C CA  1 
ATOM   8593  C C   . PRO C 1 218 ? 44.474  15.690  61.480  1.00 34.99 ? 256 PRO C C   1 
ATOM   8594  O O   . PRO C 1 218 ? 44.524  16.100  60.315  1.00 34.96 ? 256 PRO C O   1 
ATOM   8595  C CB  . PRO C 1 218 ? 45.774  13.509  62.071  1.00 34.24 ? 256 PRO C CB  1 
ATOM   8596  C CG  . PRO C 1 218 ? 45.457  13.036  63.407  1.00 34.17 ? 256 PRO C CG  1 
ATOM   8597  C CD  . PRO C 1 218 ? 45.983  14.068  64.370  1.00 34.79 ? 256 PRO C CD  1 
ATOM   8598  N N   . GLU C 1 219 ? 43.400  15.835  62.249  1.00 35.12 ? 257 GLU C N   1 
ATOM   8599  C CA  . GLU C 1 219 ? 42.190  16.461  61.789  1.00 35.65 ? 257 GLU C CA  1 
ATOM   8600  C C   . GLU C 1 219 ? 42.378  17.941  61.523  1.00 36.22 ? 257 GLU C C   1 
ATOM   8601  O O   . GLU C 1 219 ? 41.602  18.534  60.792  1.00 35.82 ? 257 GLU C O   1 
ATOM   8602  C CB  . GLU C 1 219 ? 41.086  16.306  62.835  1.00 36.02 ? 257 GLU C CB  1 
ATOM   8603  C CG  . GLU C 1 219 ? 40.573  14.884  63.013  1.00 35.13 ? 257 GLU C CG  1 
ATOM   8604  C CD  . GLU C 1 219 ? 41.269  14.170  64.127  1.00 36.43 ? 257 GLU C CD  1 
ATOM   8605  O OE1 . GLU C 1 219 ? 42.206  14.775  64.711  1.00 39.51 ? 257 GLU C OE1 1 
ATOM   8606  O OE2 . GLU C 1 219 ? 40.903  13.009  64.413  1.00 36.13 ? 257 GLU C OE2 1 
ATOM   8607  N N   . ASP C 1 220 ? 43.408  18.525  62.130  1.00 36.74 ? 258 ASP C N   1 
ATOM   8608  C CA  . ASP C 1 220 ? 43.593  19.968  62.160  1.00 37.45 ? 258 ASP C CA  1 
ATOM   8609  C C   . ASP C 1 220 ? 44.780  20.442  61.308  1.00 37.58 ? 258 ASP C C   1 
ATOM   8610  O O   . ASP C 1 220 ? 45.261  21.545  61.491  1.00 38.24 ? 258 ASP C O   1 
ATOM   8611  C CB  . ASP C 1 220 ? 43.785  20.440  63.600  1.00 37.51 ? 258 ASP C CB  1 
ATOM   8612  C CG  . ASP C 1 220 ? 42.631  20.048  64.530  1.00 39.00 ? 258 ASP C CG  1 
ATOM   8613  O OD1 . ASP C 1 220 ? 41.451  19.991  64.134  1.00 42.21 ? 258 ASP C OD1 1 
ATOM   8614  O OD2 . ASP C 1 220 ? 42.927  19.847  65.722  1.00 45.06 ? 258 ASP C OD2 1 
ATOM   8615  N N   . ILE C 1 221 ? 45.214  19.638  60.335  1.00 37.66 ? 259 ILE C N   1 
ATOM   8616  C CA  . ILE C 1 221 ? 46.258  20.062  59.402  1.00 37.02 ? 259 ILE C CA  1 
ATOM   8617  C C   . ILE C 1 221 ? 45.586  20.747  58.233  1.00 37.19 ? 259 ILE C C   1 
ATOM   8618  O O   . ILE C 1 221 ? 44.853  20.111  57.484  1.00 38.20 ? 259 ILE C O   1 
ATOM   8619  C CB  . ILE C 1 221 ? 47.105  18.859  58.906  1.00 36.68 ? 259 ILE C CB  1 
ATOM   8620  C CG1 . ILE C 1 221 ? 47.972  18.326  60.060  1.00 36.70 ? 259 ILE C CG1 1 
ATOM   8621  C CG2 . ILE C 1 221 ? 47.936  19.261  57.726  1.00 33.56 ? 259 ILE C CG2 1 
ATOM   8622  C CD1 . ILE C 1 221 ? 48.634  16.972  59.799  1.00 37.71 ? 259 ILE C CD1 1 
ATOM   8623  N N   . HIS C 1 222 ? 45.892  22.030  58.047  1.00 37.03 ? 260 HIS C N   1 
ATOM   8624  C CA  . HIS C 1 222 ? 45.304  22.856  57.009  1.00 36.35 ? 260 HIS C CA  1 
ATOM   8625  C C   . HIS C 1 222 ? 45.805  22.563  55.612  1.00 35.92 ? 260 HIS C C   1 
ATOM   8626  O O   . HIS C 1 222 ? 45.035  22.560  54.697  1.00 36.96 ? 260 HIS C O   1 
ATOM   8627  C CB  . HIS C 1 222 ? 45.538  24.345  57.321  1.00 36.90 ? 260 HIS C CB  1 
ATOM   8628  C CG  . HIS C 1 222 ? 45.018  24.765  58.658  1.00 37.82 ? 260 HIS C CG  1 
ATOM   8629  N ND1 . HIS C 1 222 ? 45.451  25.900  59.302  1.00 37.92 ? 260 HIS C ND1 1 
ATOM   8630  C CD2 . HIS C 1 222 ? 44.126  24.183  59.489  1.00 39.77 ? 260 HIS C CD2 1 
ATOM   8631  C CE1 . HIS C 1 222 ? 44.852  26.002  60.472  1.00 36.53 ? 260 HIS C CE1 1 
ATOM   8632  N NE2 . HIS C 1 222 ? 44.046  24.971  60.613  1.00 40.55 ? 260 HIS C NE2 1 
ATOM   8633  N N   . ILE C 1 223 ? 47.108  22.382  55.441  1.00 36.51 ? 261 ILE C N   1 
ATOM   8634  C CA  . ILE C 1 223 ? 47.700  21.907  54.193  1.00 35.41 ? 261 ILE C CA  1 
ATOM   8635  C C   . ILE C 1 223 ? 48.591  20.700  54.481  1.00 35.92 ? 261 ILE C C   1 
ATOM   8636  O O   . ILE C 1 223 ? 49.670  20.832  55.098  1.00 35.02 ? 261 ILE C O   1 
ATOM   8637  C CB  . ILE C 1 223 ? 48.519  22.960  53.509  1.00 35.48 ? 261 ILE C CB  1 
ATOM   8638  C CG1 . ILE C 1 223 ? 47.611  23.884  52.706  1.00 36.31 ? 261 ILE C CG1 1 
ATOM   8639  C CG2 . ILE C 1 223 ? 49.539  22.317  52.562  1.00 34.86 ? 261 ILE C CG2 1 
ATOM   8640  C CD1 . ILE C 1 223 ? 46.793  23.205  51.539  1.00 33.33 ? 261 ILE C CD1 1 
ATOM   8641  N N   . PRO C 1 224 ? 48.135  19.509  54.049  1.00 35.46 ? 262 PRO C N   1 
ATOM   8642  C CA  . PRO C 1 224 ? 48.920  18.294  54.099  1.00 35.84 ? 262 PRO C CA  1 
ATOM   8643  C C   . PRO C 1 224 ? 50.230  18.386  53.312  1.00 36.04 ? 262 PRO C C   1 
ATOM   8644  O O   . PRO C 1 224 ? 50.340  19.125  52.340  1.00 36.48 ? 262 PRO C O   1 
ATOM   8645  C CB  . PRO C 1 224 ? 47.982  17.253  53.492  1.00 36.62 ? 262 PRO C CB  1 
ATOM   8646  C CG  . PRO C 1 224 ? 46.636  17.870  53.483  1.00 36.25 ? 262 PRO C CG  1 
ATOM   8647  C CD  . PRO C 1 224 ? 46.791  19.295  53.493  1.00 35.59 ? 262 PRO C CD  1 
ATOM   8648  N N   . GLN C 1 225 ? 51.225  17.638  53.759  1.00 36.31 ? 263 GLN C N   1 
ATOM   8649  C CA  . GLN C 1 225 ? 52.542  17.629  53.178  1.00 36.39 ? 263 GLN C CA  1 
ATOM   8650  C C   . GLN C 1 225 ? 52.579  17.382  51.665  1.00 35.49 ? 263 GLN C C   1 
ATOM   8651  O O   . GLN C 1 225 ? 53.542  17.771  51.018  1.00 34.89 ? 263 GLN C O   1 
ATOM   8652  C CB  . GLN C 1 225 ? 53.375  16.521  53.883  1.00 36.82 ? 263 GLN C CB  1 
ATOM   8653  C CG  . GLN C 1 225 ? 52.905  15.085  53.524  1.00 38.32 ? 263 GLN C CG  1 
ATOM   8654  C CD  . GLN C 1 225 ? 53.131  14.042  54.594  1.00 39.04 ? 263 GLN C CD  1 
ATOM   8655  O OE1 . GLN C 1 225 ? 52.189  13.324  54.984  1.00 45.16 ? 263 GLN C OE1 1 
ATOM   8656  N NE2 . GLN C 1 225 ? 54.370  13.924  55.067  1.00 39.60 ? 263 GLN C NE2 1 
ATOM   8657  N N   . ILE C 1 226 ? 51.582  16.677  51.116  1.00 35.60 ? 264 ILE C N   1 
ATOM   8658  C CA  . ILE C 1 226 ? 51.547  16.329  49.669  1.00 34.99 ? 264 ILE C CA  1 
ATOM   8659  C C   . ILE C 1 226 ? 51.639  17.578  48.772  1.00 35.70 ? 264 ILE C C   1 
ATOM   8660  O O   . ILE C 1 226 ? 52.125  17.520  47.644  1.00 36.27 ? 264 ILE C O   1 
ATOM   8661  C CB  . ILE C 1 226 ? 50.267  15.504  49.298  1.00 35.09 ? 264 ILE C CB  1 
ATOM   8662  C CG1 . ILE C 1 226 ? 50.348  14.954  47.856  1.00 35.31 ? 264 ILE C CG1 1 
ATOM   8663  C CG2 . ILE C 1 226 ? 49.005  16.304  49.448  1.00 31.60 ? 264 ILE C CG2 1 
ATOM   8664  C CD1 . ILE C 1 226 ? 49.279  13.844  47.540  1.00 34.78 ? 264 ILE C CD1 1 
ATOM   8665  N N   . TYR C 1 227 ? 51.154  18.691  49.300  1.00 35.35 ? 265 TYR C N   1 
ATOM   8666  C CA  . TYR C 1 227 ? 51.123  19.967  48.613  1.00 35.72 ? 265 TYR C CA  1 
ATOM   8667  C C   . TYR C 1 227 ? 52.312  20.879  48.873  1.00 36.01 ? 265 TYR C C   1 
ATOM   8668  O O   . TYR C 1 227 ? 52.402  21.935  48.248  1.00 36.20 ? 265 TYR C O   1 
ATOM   8669  C CB  . TYR C 1 227 ? 49.880  20.729  49.060  1.00 35.94 ? 265 TYR C CB  1 
ATOM   8670  C CG  . TYR C 1 227 ? 48.548  20.125  48.675  1.00 35.58 ? 265 TYR C CG  1 
ATOM   8671  C CD1 . TYR C 1 227 ? 48.240  19.845  47.342  1.00 34.91 ? 265 TYR C CD1 1 
ATOM   8672  C CD2 . TYR C 1 227 ? 47.549  19.931  49.629  1.00 37.55 ? 265 TYR C CD2 1 
ATOM   8673  C CE1 . TYR C 1 227 ? 46.989  19.333  46.969  1.00 33.66 ? 265 TYR C CE1 1 
ATOM   8674  C CE2 . TYR C 1 227 ? 46.295  19.431  49.260  1.00 36.11 ? 265 TYR C CE2 1 
ATOM   8675  C CZ  . TYR C 1 227 ? 46.038  19.151  47.918  1.00 36.32 ? 265 TYR C CZ  1 
ATOM   8676  O OH  . TYR C 1 227 ? 44.798  18.698  47.537  1.00 39.81 ? 265 TYR C OH  1 
ATOM   8677  N N   . VAL C 1 228 ? 53.211  20.509  49.795  1.00 34.65 ? 266 VAL C N   1 
ATOM   8678  C CA  . VAL C 1 228 ? 54.269  21.430  50.192  1.00 33.99 ? 266 VAL C CA  1 
ATOM   8679  C C   . VAL C 1 228 ? 55.583  20.852  49.671  1.00 33.91 ? 266 VAL C C   1 
ATOM   8680  O O   . VAL C 1 228 ? 55.979  19.790  50.093  1.00 34.06 ? 266 VAL C O   1 
ATOM   8681  C CB  . VAL C 1 228 ? 54.287  21.569  51.715  1.00 33.93 ? 266 VAL C CB  1 
ATOM   8682  C CG1 . VAL C 1 228 ? 55.437  22.427  52.152  1.00 30.72 ? 266 VAL C CG1 1 
ATOM   8683  C CG2 . VAL C 1 228 ? 52.913  22.055  52.226  1.00 31.36 ? 266 VAL C CG2 1 
ATOM   8684  N N   . HIS C 1 229 ? 56.227  21.523  48.723  1.00 34.02 ? 267 HIS C N   1 
ATOM   8685  C CA  . HIS C 1 229 ? 57.444  20.984  48.073  1.00 34.33 ? 267 HIS C CA  1 
ATOM   8686  C C   . HIS C 1 229 ? 58.720  21.587  48.619  1.00 33.79 ? 267 HIS C C   1 
ATOM   8687  O O   . HIS C 1 229 ? 59.781  20.944  48.644  1.00 34.06 ? 267 HIS C O   1 
ATOM   8688  C CB  . HIS C 1 229 ? 57.394  21.256  46.558  1.00 34.78 ? 267 HIS C CB  1 
ATOM   8689  C CG  . HIS C 1 229 ? 56.115  20.827  45.920  1.00 35.04 ? 267 HIS C CG  1 
ATOM   8690  N ND1 . HIS C 1 229 ? 55.423  21.611  45.030  1.00 33.11 ? 267 HIS C ND1 1 
ATOM   8691  C CD2 . HIS C 1 229 ? 55.397  19.689  46.058  1.00 38.17 ? 267 HIS C CD2 1 
ATOM   8692  C CE1 . HIS C 1 229 ? 54.335  20.978  44.636  1.00 38.31 ? 267 HIS C CE1 1 
ATOM   8693  N NE2 . HIS C 1 229 ? 54.300  19.797  45.234  1.00 39.62 ? 267 HIS C NE2 1 
ATOM   8694  N N   . ARG C 1 230 ? 58.652  22.862  48.970  1.00 33.51 ? 268 ARG C N   1 
ATOM   8695  C CA  . ARG C 1 230 ? 59.807  23.529  49.536  1.00 33.89 ? 268 ARG C CA  1 
ATOM   8696  C C   . ARG C 1 230 ? 59.348  24.292  50.749  1.00 33.99 ? 268 ARG C C   1 
ATOM   8697  O O   . ARG C 1 230 ? 58.298  24.916  50.738  1.00 33.34 ? 268 ARG C O   1 
ATOM   8698  C CB  . ARG C 1 230 ? 60.449  24.441  48.512  1.00 33.45 ? 268 ARG C CB  1 
ATOM   8699  C CG  . ARG C 1 230 ? 60.818  23.726  47.234  1.00 33.60 ? 268 ARG C CG  1 
ATOM   8700  C CD  . ARG C 1 230 ? 61.657  24.615  46.378  1.00 33.94 ? 268 ARG C CD  1 
ATOM   8701  N NE  . ARG C 1 230 ? 61.924  24.014  45.092  1.00 34.25 ? 268 ARG C NE  1 
ATOM   8702  C CZ  . ARG C 1 230 ? 62.405  24.658  44.033  1.00 33.37 ? 268 ARG C CZ  1 
ATOM   8703  N NH1 . ARG C 1 230 ? 62.681  25.944  44.080  1.00 34.46 ? 268 ARG C NH1 1 
ATOM   8704  N NH2 . ARG C 1 230 ? 62.583  24.006  42.906  1.00 32.83 ? 268 ARG C NH2 1 
ATOM   8705  N N   . LEU C 1 231 ? 60.118  24.173  51.812  1.00 34.99 ? 269 LEU C N   1 
ATOM   8706  C CA  . LEU C 1 231 ? 59.726  24.678  53.105  1.00 35.78 ? 269 LEU C CA  1 
ATOM   8707  C C   . LEU C 1 231 ? 60.936  25.393  53.665  1.00 35.12 ? 269 LEU C C   1 
ATOM   8708  O O   . LEU C 1 231 ? 62.045  24.882  53.627  1.00 34.29 ? 269 LEU C O   1 
ATOM   8709  C CB  . LEU C 1 231 ? 59.312  23.518  54.004  1.00 35.87 ? 269 LEU C CB  1 
ATOM   8710  C CG  . LEU C 1 231 ? 58.482  23.729  55.296  1.00 37.85 ? 269 LEU C CG  1 
ATOM   8711  C CD1 . LEU C 1 231 ? 57.472  24.865  55.283  1.00 32.65 ? 269 LEU C CD1 1 
ATOM   8712  C CD2 . LEU C 1 231 ? 57.743  22.390  55.650  1.00 37.38 ? 269 LEU C CD2 1 
ATOM   8713  N N   . ILE C 1 232 ? 60.713  26.594  54.164  1.00 35.79 ? 270 ILE C N   1 
ATOM   8714  C CA  . ILE C 1 232 ? 61.747  27.360  54.850  1.00 35.65 ? 270 ILE C CA  1 
ATOM   8715  C C   . ILE C 1 232 ? 61.113  28.023  56.078  1.00 35.87 ? 270 ILE C C   1 
ATOM   8716  O O   . ILE C 1 232 ? 59.963  28.416  56.032  1.00 34.83 ? 270 ILE C O   1 
ATOM   8717  C CB  . ILE C 1 232 ? 62.395  28.404  53.905  1.00 35.62 ? 270 ILE C CB  1 
ATOM   8718  C CG1 . ILE C 1 232 ? 63.531  29.121  54.632  1.00 36.20 ? 270 ILE C CG1 1 
ATOM   8719  C CG2 . ILE C 1 232 ? 61.334  29.398  53.376  1.00 36.91 ? 270 ILE C CG2 1 
ATOM   8720  C CD1 . ILE C 1 232 ? 64.565  29.662  53.758  1.00 37.63 ? 270 ILE C CD1 1 
ATOM   8721  N N   . LYS C 1 233 ? 61.849  28.060  57.188  1.00 36.78 ? 271 LYS C N   1 
ATOM   8722  C CA  . LYS C 1 233 ? 61.508  28.924  58.307  1.00 37.26 ? 271 LYS C CA  1 
ATOM   8723  C C   . LYS C 1 233 ? 62.036  30.333  58.052  1.00 37.53 ? 271 LYS C C   1 
ATOM   8724  O O   . LYS C 1 233 ? 63.233  30.547  57.962  1.00 36.70 ? 271 LYS C O   1 
ATOM   8725  C CB  . LYS C 1 233 ? 62.048  28.388  59.623  1.00 37.19 ? 271 LYS C CB  1 
ATOM   8726  C CG  . LYS C 1 233 ? 61.863  29.361  60.774  1.00 38.73 ? 271 LYS C CG  1 
ATOM   8727  C CD  . LYS C 1 233 ? 62.021  28.665  62.112  1.00 43.69 ? 271 LYS C CD  1 
ATOM   8728  C CE  . LYS C 1 233 ? 62.907  29.441  63.073  1.00 45.32 ? 271 LYS C CE  1 
ATOM   8729  N NZ  . LYS C 1 233 ? 62.389  29.325  64.463  1.00 48.19 ? 271 LYS C NZ  1 
ATOM   8730  N N   . GLY C 1 234 ? 61.128  31.292  57.917  1.00 38.14 ? 272 GLY C N   1 
ATOM   8731  C CA  . GLY C 1 234 ? 61.521  32.661  57.701  1.00 38.79 ? 272 GLY C CA  1 
ATOM   8732  C C   . GLY C 1 234 ? 62.375  33.178  58.835  1.00 39.93 ? 272 GLY C C   1 
ATOM   8733  O O   . GLY C 1 234 ? 62.252  32.770  59.998  1.00 38.99 ? 272 GLY C O   1 
ATOM   8734  N N   . GLU C 1 235 ? 63.242  34.100  58.459  1.00 41.85 ? 273 GLU C N   1 
ATOM   8735  C CA  . GLU C 1 235 ? 64.254  34.654  59.339  1.00 43.63 ? 273 GLU C CA  1 
ATOM   8736  C C   . GLU C 1 235 ? 63.676  35.814  60.156  1.00 43.73 ? 273 GLU C C   1 
ATOM   8737  O O   . GLU C 1 235 ? 63.886  35.910  61.364  1.00 44.36 ? 273 GLU C O   1 
ATOM   8738  C CB  . GLU C 1 235 ? 65.432  35.195  58.511  1.00 43.83 ? 273 GLU C CB  1 
ATOM   8739  C CG  . GLU C 1 235 ? 65.866  34.366  57.276  1.00 45.77 ? 273 GLU C CG  1 
ATOM   8740  C CD  . GLU C 1 235 ? 67.300  34.731  56.844  1.00 45.48 ? 273 GLU C CD  1 
ATOM   8741  O OE1 . GLU C 1 235 ? 67.646  35.924  56.989  1.00 48.23 ? 273 GLU C OE1 1 
ATOM   8742  O OE2 . GLU C 1 235 ? 68.079  33.840  56.396  1.00 48.47 ? 273 GLU C OE2 1 
ATOM   8743  N N   . LYS C 1 236 ? 62.979  36.711  59.470  1.00 43.37 ? 274 LYS C N   1 
ATOM   8744  C CA  . LYS C 1 236 ? 62.540  37.946  60.074  1.00 43.57 ? 274 LYS C CA  1 
ATOM   8745  C C   . LYS C 1 236 ? 61.126  38.131  59.616  1.00 43.55 ? 274 LYS C C   1 
ATOM   8746  O O   . LYS C 1 236 ? 60.769  37.807  58.471  1.00 43.67 ? 274 LYS C O   1 
ATOM   8747  C CB  . LYS C 1 236 ? 63.451  39.131  59.668  1.00 43.54 ? 274 LYS C CB  1 
ATOM   8748  N N   . TYR C 1 237 ? 60.293  38.570  60.547  1.00 43.75 ? 275 TYR C N   1 
ATOM   8749  C CA  . TYR C 1 237 ? 58.891  38.829  60.272  1.00 43.87 ? 275 TYR C CA  1 
ATOM   8750  C C   . TYR C 1 237 ? 58.530  40.211  60.841  1.00 44.78 ? 275 TYR C C   1 
ATOM   8751  O O   . TYR C 1 237 ? 58.496  40.425  62.062  1.00 45.18 ? 275 TYR C O   1 
ATOM   8752  C CB  . TYR C 1 237 ? 58.042  37.678  60.821  1.00 42.87 ? 275 TYR C CB  1 
ATOM   8753  C CG  . TYR C 1 237 ? 58.114  36.453  59.929  1.00 41.90 ? 275 TYR C CG  1 
ATOM   8754  C CD1 . TYR C 1 237 ? 57.646  36.502  58.619  1.00 40.75 ? 275 TYR C CD1 1 
ATOM   8755  C CD2 . TYR C 1 237 ? 58.674  35.253  60.380  1.00 41.73 ? 275 TYR C CD2 1 
ATOM   8756  C CE1 . TYR C 1 237 ? 57.723  35.407  57.787  1.00 39.12 ? 275 TYR C CE1 1 
ATOM   8757  C CE2 . TYR C 1 237 ? 58.752  34.139  59.544  1.00 40.20 ? 275 TYR C CE2 1 
ATOM   8758  C CZ  . TYR C 1 237 ? 58.273  34.229  58.261  1.00 40.11 ? 275 TYR C CZ  1 
ATOM   8759  O OH  . TYR C 1 237 ? 58.359  33.153  57.448  1.00 39.14 ? 275 TYR C OH  1 
ATOM   8760  N N   . GLU C 1 238 ? 58.352  41.172  59.944  1.00 45.70 ? 276 GLU C N   1 
ATOM   8761  C CA  . GLU C 1 238 ? 57.965  42.522  60.340  1.00 46.70 ? 276 GLU C CA  1 
ATOM   8762  C C   . GLU C 1 238 ? 56.499  42.438  60.744  1.00 46.29 ? 276 GLU C C   1 
ATOM   8763  O O   . GLU C 1 238 ? 56.078  42.968  61.764  1.00 45.80 ? 276 GLU C O   1 
ATOM   8764  C CB  . GLU C 1 238 ? 58.164  43.502  59.174  1.00 46.69 ? 276 GLU C CB  1 
ATOM   8765  C CG  . GLU C 1 238 ? 59.581  43.462  58.583  1.00 49.10 ? 276 GLU C CG  1 
ATOM   8766  C CD  . GLU C 1 238 ? 59.910  44.627  57.636  1.00 49.72 ? 276 GLU C CD  1 
ATOM   8767  O OE1 . GLU C 1 238 ? 58.984  45.201  57.004  1.00 53.84 ? 276 GLU C OE1 1 
ATOM   8768  O OE2 . GLU C 1 238 ? 61.122  44.958  57.526  1.00 52.83 ? 276 GLU C OE2 1 
ATOM   8769  N N   . LYS C 1 239 ? 55.746  41.703  59.936  1.00 46.87 ? 277 LYS C N   1 
ATOM   8770  C CA  . LYS C 1 239 ? 54.302  41.535  60.092  1.00 46.80 ? 277 LYS C CA  1 
ATOM   8771  C C   . LYS C 1 239 ? 53.658  42.903  60.384  1.00 45.99 ? 277 LYS C C   1 
ATOM   8772  O O   . LYS C 1 239 ? 53.124  43.204  61.455  1.00 45.85 ? 277 LYS C O   1 
ATOM   8773  C CB  . LYS C 1 239 ? 54.021  40.429  61.093  1.00 47.48 ? 277 LYS C CB  1 
ATOM   8774  C CG  . LYS C 1 239 ? 54.477  39.066  60.510  1.00 48.33 ? 277 LYS C CG  1 
ATOM   8775  C CD  . LYS C 1 239 ? 54.200  37.902  61.459  1.00 49.32 ? 277 LYS C CD  1 
ATOM   8776  C CE  . LYS C 1 239 ? 52.687  37.594  61.513  1.00 49.09 ? 277 LYS C CE  1 
ATOM   8777  N NZ  . LYS C 1 239 ? 52.405  36.619  62.584  1.00 47.65 ? 277 LYS C NZ  1 
ATOM   8778  N N   . ARG C 1 240 ? 53.826  43.726  59.356  1.00 44.82 ? 278 ARG C N   1 
ATOM   8779  C CA  . ARG C 1 240 ? 53.373  45.083  59.280  1.00 43.61 ? 278 ARG C CA  1 
ATOM   8780  C C   . ARG C 1 240 ? 51.842  45.061  59.367  1.00 41.60 ? 278 ARG C C   1 
ATOM   8781  O O   . ARG C 1 240 ? 51.191  44.119  58.890  1.00 41.02 ? 278 ARG C O   1 
ATOM   8782  C CB  . ARG C 1 240 ? 53.846  45.650  57.927  1.00 44.30 ? 278 ARG C CB  1 
ATOM   8783  C CG  . ARG C 1 240 ? 54.419  47.044  57.953  1.00 46.47 ? 278 ARG C CG  1 
ATOM   8784  C CD  . ARG C 1 240 ? 54.016  47.802  56.694  1.00 50.08 ? 278 ARG C CD  1 
ATOM   8785  N NE  . ARG C 1 240 ? 54.437  49.198  56.764  1.00 52.57 ? 278 ARG C NE  1 
ATOM   8786  C CZ  . ARG C 1 240 ? 53.779  50.240  56.246  1.00 52.37 ? 278 ARG C CZ  1 
ATOM   8787  N NH1 . ARG C 1 240 ? 52.635  50.076  55.581  1.00 50.17 ? 278 ARG C NH1 1 
ATOM   8788  N NH2 . ARG C 1 240 ? 54.278  51.480  56.421  1.00 52.56 ? 278 ARG C NH2 1 
ATOM   8789  N N   . ILE C 1 241 ? 51.283  46.068  60.022  1.00 38.96 ? 279 ILE C N   1 
ATOM   8790  C CA  . ILE C 1 241 ? 49.838  46.258  60.130  1.00 37.69 ? 279 ILE C CA  1 
ATOM   8791  C C   . ILE C 1 241 ? 49.544  47.500  59.272  1.00 36.76 ? 279 ILE C C   1 
ATOM   8792  O O   . ILE C 1 241 ? 50.060  48.566  59.530  1.00 35.10 ? 279 ILE C O   1 
ATOM   8793  C CB  . ILE C 1 241 ? 49.400  46.527  61.625  1.00 37.67 ? 279 ILE C CB  1 
ATOM   8794  C CG1 . ILE C 1 241 ? 49.546  45.288  62.517  1.00 36.12 ? 279 ILE C CG1 1 
ATOM   8795  C CG2 . ILE C 1 241 ? 47.964  47.075  61.698  1.00 37.08 ? 279 ILE C CG2 1 
ATOM   8796  C CD1 . ILE C 1 241 ? 49.207  45.558  63.995  1.00 36.35 ? 279 ILE C CD1 1 
ATOM   8797  N N   . GLU C 1 242 ? 48.711  47.361  58.255  1.00 36.56 ? 280 GLU C N   1 
ATOM   8798  C CA  . GLU C 1 242 ? 48.415  48.466  57.357  1.00 35.62 ? 280 GLU C CA  1 
ATOM   8799  C C   . GLU C 1 242 ? 47.569  49.562  58.011  1.00 36.16 ? 280 GLU C C   1 
ATOM   8800  O O   . GLU C 1 242 ? 47.840  50.743  57.835  1.00 35.53 ? 280 GLU C O   1 
ATOM   8801  C CB  . GLU C 1 242 ? 47.736  47.913  56.124  1.00 35.48 ? 280 GLU C CB  1 
ATOM   8802  C CG  . GLU C 1 242 ? 47.420  48.939  55.055  1.00 34.87 ? 280 GLU C CG  1 
ATOM   8803  C CD  . GLU C 1 242 ? 46.851  48.304  53.811  1.00 34.88 ? 280 GLU C CD  1 
ATOM   8804  O OE1 . GLU C 1 242 ? 47.013  47.055  53.590  1.00 35.95 ? 280 GLU C OE1 1 
ATOM   8805  O OE2 . GLU C 1 242 ? 46.217  49.051  53.041  1.00 31.94 ? 280 GLU C OE2 1 
ATOM   8806  N N   . ARG C 1 243 ? 46.524  49.161  58.736  1.00 37.42 ? 281 ARG C N   1 
ATOM   8807  C CA  . ARG C 1 243 ? 45.628  50.082  59.459  1.00 37.81 ? 281 ARG C CA  1 
ATOM   8808  C C   . ARG C 1 243 ? 45.492  49.573  60.882  1.00 36.88 ? 281 ARG C C   1 
ATOM   8809  O O   . ARG C 1 243 ? 44.950  48.500  61.137  1.00 37.05 ? 281 ARG C O   1 
ATOM   8810  C CB  . ARG C 1 243 ? 44.244  50.133  58.804  1.00 37.48 ? 281 ARG C CB  1 
ATOM   8811  C CG  . ARG C 1 243 ? 44.078  51.125  57.672  1.00 39.79 ? 281 ARG C CG  1 
ATOM   8812  C CD  . ARG C 1 243 ? 42.915  50.786  56.728  1.00 42.95 ? 281 ARG C CD  1 
ATOM   8813  N NE  . ARG C 1 243 ? 43.161  51.389  55.410  1.00 49.18 ? 281 ARG C NE  1 
ATOM   8814  C CZ  . ARG C 1 243 ? 42.599  51.023  54.248  1.00 51.56 ? 281 ARG C CZ  1 
ATOM   8815  N NH1 . ARG C 1 243 ? 41.697  50.060  54.177  1.00 52.02 ? 281 ARG C NH1 1 
ATOM   8816  N NH2 . ARG C 1 243 ? 42.939  51.655  53.130  1.00 52.60 ? 281 ARG C NH2 1 
ATOM   8817  N N   . LEU C 1 244 ? 45.979  50.350  61.828  1.00 36.13 ? 282 LEU C N   1 
ATOM   8818  C CA  . LEU C 1 244 ? 45.798  50.020  63.209  1.00 35.24 ? 282 LEU C CA  1 
ATOM   8819  C C   . LEU C 1 244 ? 44.461  50.621  63.669  1.00 35.64 ? 282 LEU C C   1 
ATOM   8820  O O   . LEU C 1 244 ? 44.373  51.821  63.886  1.00 35.68 ? 282 LEU C O   1 
ATOM   8821  C CB  . LEU C 1 244 ? 46.946  50.595  63.989  1.00 34.65 ? 282 LEU C CB  1 
ATOM   8822  C CG  . LEU C 1 244 ? 46.943  50.277  65.479  1.00 33.97 ? 282 LEU C CG  1 
ATOM   8823  C CD1 . LEU C 1 244 ? 47.060  48.739  65.732  1.00 27.18 ? 282 LEU C CD1 1 
ATOM   8824  C CD2 . LEU C 1 244 ? 48.080  51.071  66.072  1.00 26.92 ? 282 LEU C CD2 1 
ATOM   8825  N N   . SER C 1 245 ? 43.427  49.801  63.820  1.00 35.82 ? 283 SER C N   1 
ATOM   8826  C CA  . SER C 1 245 ? 42.093  50.306  64.175  1.00 36.53 ? 283 SER C CA  1 
ATOM   8827  C C   . SER C 1 245 ? 41.726  49.873  65.584  1.00 36.95 ? 283 SER C C   1 
ATOM   8828  O O   . SER C 1 245 ? 41.489  48.704  65.827  1.00 37.32 ? 283 SER C O   1 
ATOM   8829  C CB  . SER C 1 245 ? 41.070  49.788  63.190  1.00 36.28 ? 283 SER C CB  1 
ATOM   8830  O OG  . SER C 1 245 ? 41.634  49.799  61.922  1.00 36.93 ? 283 SER C OG  1 
ATOM   8831  N N   . ILE C 1 246 ? 41.683  50.828  66.490  1.00 38.10 ? 284 ILE C N   1 
ATOM   8832  C CA  . ILE C 1 246 ? 41.579  50.590  67.929  1.00 39.23 ? 284 ILE C CA  1 
ATOM   8833  C C   . ILE C 1 246 ? 40.259  51.114  68.433  1.00 40.06 ? 284 ILE C C   1 
ATOM   8834  O O   . ILE C 1 246 ? 39.871  52.209  68.050  1.00 40.04 ? 284 ILE C O   1 
ATOM   8835  C CB  . ILE C 1 246 ? 42.722  51.344  68.660  1.00 38.95 ? 284 ILE C CB  1 
ATOM   8836  C CG1 . ILE C 1 246 ? 44.070  50.800  68.195  1.00 38.73 ? 284 ILE C CG1 1 
ATOM   8837  C CG2 . ILE C 1 246 ? 42.594  51.256  70.184  1.00 39.29 ? 284 ILE C CG2 1 
ATOM   8838  C CD1 . ILE C 1 246 ? 44.128  49.300  68.103  1.00 39.44 ? 284 ILE C CD1 1 
ATOM   8839  N N   . ARG C 1 247 ? 39.569  50.355  69.294  1.00 41.48 ? 285 ARG C N   1 
ATOM   8840  C CA  . ARG C 1 247 ? 38.301  50.846  69.888  1.00 42.62 ? 285 ARG C CA  1 
ATOM   8841  C C   . ARG C 1 247 ? 38.642  51.963  70.878  1.00 42.49 ? 285 ARG C C   1 
ATOM   8842  O O   . ARG C 1 247 ? 39.612  51.858  71.628  1.00 42.89 ? 285 ARG C O   1 
ATOM   8843  C CB  . ARG C 1 247 ? 37.472  49.728  70.577  1.00 42.37 ? 285 ARG C CB  1 
ATOM   8844  C CG  . ARG C 1 247 ? 37.781  49.520  72.058  1.00 43.60 ? 285 ARG C CG  1 
ATOM   8845  C CD  . ARG C 1 247 ? 36.909  48.463  72.750  1.00 45.03 ? 285 ARG C CD  1 
ATOM   8846  N NE  . ARG C 1 247 ? 37.074  47.143  72.154  1.00 47.02 ? 285 ARG C NE  1 
ATOM   8847  C CZ  . ARG C 1 247 ? 37.165  45.987  72.818  1.00 47.86 ? 285 ARG C CZ  1 
ATOM   8848  N NH1 . ARG C 1 247 ? 37.338  44.852  72.130  1.00 47.56 ? 285 ARG C NH1 1 
ATOM   8849  N NH2 . ARG C 1 247 ? 37.091  45.939  74.141  1.00 49.15 ? 285 ARG C NH2 1 
ATOM   8850  N N   . ASP C 1 261 ? 29.246  62.041  60.765  1.00 50.37 ? 299 ASP C N   1 
ATOM   8851  C CA  . ASP C 1 261 ? 28.498  63.260  60.474  1.00 50.36 ? 299 ASP C CA  1 
ATOM   8852  C C   . ASP C 1 261 ? 26.994  63.003  60.486  1.00 49.66 ? 299 ASP C C   1 
ATOM   8853  O O   . ASP C 1 261 ? 26.560  61.857  60.536  1.00 49.30 ? 299 ASP C O   1 
ATOM   8854  C CB  . ASP C 1 261 ? 28.915  63.822  59.116  1.00 50.78 ? 299 ASP C CB  1 
ATOM   8855  C CG  . ASP C 1 261 ? 28.449  62.954  57.963  1.00 52.43 ? 299 ASP C CG  1 
ATOM   8856  O OD1 . ASP C 1 261 ? 29.305  62.354  57.266  1.00 54.45 ? 299 ASP C OD1 1 
ATOM   8857  O OD2 . ASP C 1 261 ? 27.217  62.859  57.764  1.00 54.68 ? 299 ASP C OD2 1 
ATOM   8858  N N   . ASP C 1 262 ? 26.214  64.082  60.416  1.00 49.21 ? 300 ASP C N   1 
ATOM   8859  C CA  . ASP C 1 262 ? 24.752  64.015  60.519  1.00 48.61 ? 300 ASP C CA  1 
ATOM   8860  C C   . ASP C 1 262 ? 24.123  63.105  59.457  1.00 48.13 ? 300 ASP C C   1 
ATOM   8861  O O   . ASP C 1 262 ? 23.329  62.236  59.800  1.00 48.65 ? 300 ASP C O   1 
ATOM   8862  C CB  . ASP C 1 262 ? 24.142  65.424  60.457  1.00 48.52 ? 300 ASP C CB  1 
ATOM   8863  N N   . VAL C 1 263 ? 24.492  63.273  58.183  1.00 47.51 ? 301 VAL C N   1 
ATOM   8864  C CA  . VAL C 1 263 ? 23.892  62.472  57.082  1.00 46.66 ? 301 VAL C CA  1 
ATOM   8865  C C   . VAL C 1 263 ? 24.214  60.965  57.178  1.00 45.73 ? 301 VAL C C   1 
ATOM   8866  O O   . VAL C 1 263 ? 23.366  60.101  56.932  1.00 44.81 ? 301 VAL C O   1 
ATOM   8867  C CB  . VAL C 1 263 ? 24.259  63.022  55.657  1.00 47.00 ? 301 VAL C CB  1 
ATOM   8868  C CG1 . VAL C 1 263 ? 23.939  64.502  55.563  1.00 45.87 ? 301 VAL C CG1 1 
ATOM   8869  C CG2 . VAL C 1 263 ? 25.708  62.759  55.286  1.00 47.58 ? 301 VAL C CG2 1 
ATOM   8870  N N   . ARG C 1 264 ? 25.442  60.677  57.579  1.00 44.56 ? 302 ARG C N   1 
ATOM   8871  C CA  . ARG C 1 264 ? 25.915  59.325  57.737  1.00 43.98 ? 302 ARG C CA  1 
ATOM   8872  C C   . ARG C 1 264 ? 25.419  58.628  59.012  1.00 42.43 ? 302 ARG C C   1 
ATOM   8873  O O   . ARG C 1 264 ? 25.365  57.409  59.048  1.00 41.71 ? 302 ARG C O   1 
ATOM   8874  C CB  . ARG C 1 264 ? 27.434  59.366  57.675  1.00 45.00 ? 302 ARG C CB  1 
ATOM   8875  C CG  . ARG C 1 264 ? 28.152  58.159  58.217  1.00 49.00 ? 302 ARG C CG  1 
ATOM   8876  C CD  . ARG C 1 264 ? 29.647  58.394  58.121  1.00 53.38 ? 302 ARG C CD  1 
ATOM   8877  N NE  . ARG C 1 264 ? 30.071  58.586  56.731  1.00 54.61 ? 302 ARG C NE  1 
ATOM   8878  C CZ  . ARG C 1 264 ? 30.808  59.611  56.287  1.00 56.25 ? 302 ARG C CZ  1 
ATOM   8879  N NH1 . ARG C 1 264 ? 31.242  60.579  57.106  1.00 55.60 ? 302 ARG C NH1 1 
ATOM   8880  N NH2 . ARG C 1 264 ? 31.122  59.664  54.994  1.00 57.10 ? 302 ARG C NH2 1 
ATOM   8881  N N   . GLU C 1 265 ? 25.065  59.392  60.049  1.00 40.72 ? 303 GLU C N   1 
ATOM   8882  C CA  . GLU C 1 265 ? 24.416  58.830  61.235  1.00 39.93 ? 303 GLU C CA  1 
ATOM   8883  C C   . GLU C 1 265 ? 22.955  58.477  60.943  1.00 38.68 ? 303 GLU C C   1 
ATOM   8884  O O   . GLU C 1 265 ? 22.483  57.472  61.420  1.00 38.02 ? 303 GLU C O   1 
ATOM   8885  C CB  . GLU C 1 265 ? 24.513  59.780  62.470  1.00 39.42 ? 303 GLU C CB  1 
ATOM   8886  N N   . ARG C 1 266 ? 22.248  59.297  60.163  1.00 37.75 ? 304 ARG C N   1 
ATOM   8887  C CA  . ARG C 1 266 ? 20.859  58.995  59.780  1.00 37.30 ? 304 ARG C CA  1 
ATOM   8888  C C   . ARG C 1 266 ? 20.735  57.717  58.965  1.00 36.21 ? 304 ARG C C   1 
ATOM   8889  O O   . ARG C 1 266 ? 19.807  56.927  59.189  1.00 36.26 ? 304 ARG C O   1 
ATOM   8890  C CB  . ARG C 1 266 ? 20.261  60.129  58.966  1.00 37.54 ? 304 ARG C CB  1 
ATOM   8891  C CG  . ARG C 1 266 ? 20.072  61.394  59.765  1.00 40.29 ? 304 ARG C CG  1 
ATOM   8892  C CD  . ARG C 1 266 ? 20.269  62.637  58.925  1.00 43.41 ? 304 ARG C CD  1 
ATOM   8893  N NE  . ARG C 1 266 ? 19.211  62.846  57.941  1.00 45.93 ? 304 ARG C NE  1 
ATOM   8894  C CZ  . ARG C 1 266 ? 19.207  63.839  57.047  1.00 47.83 ? 304 ARG C CZ  1 
ATOM   8895  N NH1 . ARG C 1 266 ? 20.206  64.719  57.020  1.00 49.92 ? 304 ARG C NH1 1 
ATOM   8896  N NH2 . ARG C 1 266 ? 18.212  63.959  56.169  1.00 46.65 ? 304 ARG C NH2 1 
ATOM   8897  N N   . ILE C 1 267 ? 21.665  57.541  58.023  1.00 34.80 ? 305 ILE C N   1 
ATOM   8898  C CA  . ILE C 1 267 ? 21.775  56.338  57.195  1.00 33.77 ? 305 ILE C CA  1 
ATOM   8899  C C   . ILE C 1 267 ? 22.095  55.121  58.044  1.00 33.42 ? 305 ILE C C   1 
ATOM   8900  O O   . ILE C 1 267 ? 21.412  54.116  57.935  1.00 31.72 ? 305 ILE C O   1 
ATOM   8901  C CB  . ILE C 1 267 ? 22.904  56.438  56.108  1.00 34.04 ? 305 ILE C CB  1 
ATOM   8902  C CG1 . ILE C 1 267 ? 22.598  57.507  55.060  1.00 33.47 ? 305 ILE C CG1 1 
ATOM   8903  C CG2 . ILE C 1 267 ? 23.084  55.049  55.389  1.00 31.65 ? 305 ILE C CG2 1 
ATOM   8904  C CD1 . ILE C 1 267 ? 23.809  58.052  54.346  1.00 33.71 ? 305 ILE C CD1 1 
ATOM   8905  N N   . ILE C 1 268 ? 23.151  55.239  58.862  1.00 34.08 ? 306 ILE C N   1 
ATOM   8906  C CA  . ILE C 1 268 ? 23.637  54.178  59.778  1.00 34.60 ? 306 ILE C CA  1 
ATOM   8907  C C   . ILE C 1 268 ? 22.605  53.773  60.837  1.00 34.16 ? 306 ILE C C   1 
ATOM   8908  O O   . ILE C 1 268 ? 22.424  52.594  61.121  1.00 34.11 ? 306 ILE C O   1 
ATOM   8909  C CB  . ILE C 1 268 ? 24.874  54.650  60.563  1.00 35.28 ? 306 ILE C CB  1 
ATOM   8910  C CG1 . ILE C 1 268 ? 26.116  54.635  59.691  1.00 35.81 ? 306 ILE C CG1 1 
ATOM   8911  C CG2 . ILE C 1 268 ? 25.132  53.761  61.818  1.00 35.61 ? 306 ILE C CG2 1 
ATOM   8912  C CD1 . ILE C 1 268 ? 27.212  55.540  60.277  1.00 37.28 ? 306 ILE C CD1 1 
ATOM   8913  N N   . LYS C 1 269 ? 21.951  54.760  61.431  1.00 34.10 ? 307 LYS C N   1 
ATOM   8914  C CA  . LYS C 1 269 ? 20.887  54.490  62.402  1.00 34.17 ? 307 LYS C CA  1 
ATOM   8915  C C   . LYS C 1 269 ? 19.654  53.846  61.772  1.00 33.89 ? 307 LYS C C   1 
ATOM   8916  O O   . LYS C 1 269 ? 18.833  53.261  62.481  1.00 33.82 ? 307 LYS C O   1 
ATOM   8917  C CB  . LYS C 1 269 ? 20.470  55.750  63.130  1.00 34.13 ? 307 LYS C CB  1 
ATOM   8918  C CG  . LYS C 1 269 ? 21.474  56.276  64.167  1.00 35.05 ? 307 LYS C CG  1 
ATOM   8919  C CD  . LYS C 1 269 ? 20.772  57.278  65.079  1.00 37.25 ? 307 LYS C CD  1 
ATOM   8920  C CE  . LYS C 1 269 ? 21.739  58.059  65.974  1.00 38.17 ? 307 LYS C CE  1 
ATOM   8921  N NZ  . LYS C 1 269 ? 21.017  58.857  67.013  1.00 39.20 ? 307 LYS C NZ  1 
ATOM   8922  N N   . ARG C 1 270 ? 19.511  53.957  60.453  1.00 33.35 ? 308 ARG C N   1 
ATOM   8923  C CA  . ARG C 1 270 ? 18.442  53.258  59.755  1.00 33.04 ? 308 ARG C CA  1 
ATOM   8924  C C   . ARG C 1 270 ? 18.920  51.912  59.248  1.00 33.01 ? 308 ARG C C   1 
ATOM   8925  O O   . ARG C 1 270 ? 18.190  50.939  59.306  1.00 34.44 ? 308 ARG C O   1 
ATOM   8926  C CB  . ARG C 1 270 ? 17.825  54.106  58.642  1.00 32.74 ? 308 ARG C CB  1 
ATOM   8927  C CG  . ARG C 1 270 ? 16.751  53.396  57.814  1.00 32.83 ? 308 ARG C CG  1 
ATOM   8928  C CD  . ARG C 1 270 ? 15.675  52.790  58.702  1.00 34.22 ? 308 ARG C CD  1 
ATOM   8929  N NE  . ARG C 1 270 ? 14.627  52.035  58.012  1.00 35.18 ? 308 ARG C NE  1 
ATOM   8930  C CZ  . ARG C 1 270 ? 14.769  50.792  57.552  1.00 39.01 ? 308 ARG C CZ  1 
ATOM   8931  N NH1 . ARG C 1 270 ? 15.928  50.153  57.665  1.00 40.98 ? 308 ARG C NH1 1 
ATOM   8932  N NH2 . ARG C 1 270 ? 13.750  50.180  56.948  1.00 38.02 ? 308 ARG C NH2 1 
ATOM   8933  N N   . ALA C 1 271 ? 20.152  51.832  58.773  1.00 33.60 ? 309 ALA C N   1 
ATOM   8934  C CA  . ALA C 1 271 ? 20.720  50.559  58.353  1.00 33.01 ? 309 ALA C CA  1 
ATOM   8935  C C   . ALA C 1 271 ? 20.756  49.555  59.513  1.00 33.16 ? 309 ALA C C   1 
ATOM   8936  O O   . ALA C 1 271 ? 20.544  48.345  59.301  1.00 32.25 ? 309 ALA C O   1 
ATOM   8937  C CB  . ALA C 1 271 ? 22.125  50.762  57.785  1.00 33.56 ? 309 ALA C CB  1 
ATOM   8938  N N   . ALA C 1 272 ? 21.064  50.061  60.711  1.00 32.43 ? 310 ALA C N   1 
ATOM   8939  C CA  . ALA C 1 272 ? 21.098  49.238  61.942  1.00 33.33 ? 310 ALA C CA  1 
ATOM   8940  C C   . ALA C 1 272 ? 19.836  48.399  62.167  1.00 33.83 ? 310 ALA C C   1 
ATOM   8941  O O   . ALA C 1 272 ? 19.914  47.317  62.775  1.00 34.40 ? 310 ALA C O   1 
ATOM   8942  C CB  . ALA C 1 272 ? 21.329  50.137  63.183  1.00 32.34 ? 310 ALA C CB  1 
ATOM   8943  N N   . LEU C 1 273 ? 18.681  48.909  61.707  1.00 34.69 ? 311 LEU C N   1 
ATOM   8944  C CA  . LEU C 1 273 ? 17.386  48.224  61.829  1.00 34.62 ? 311 LEU C CA  1 
ATOM   8945  C C   . LEU C 1 273 ? 17.180  47.134  60.771  1.00 35.29 ? 311 LEU C C   1 
ATOM   8946  O O   . LEU C 1 273 ? 16.188  46.417  60.827  1.00 35.83 ? 311 LEU C O   1 
ATOM   8947  C CB  . LEU C 1 273 ? 16.211  49.227  61.804  1.00 35.01 ? 311 LEU C CB  1 
ATOM   8948  C CG  . LEU C 1 273 ? 16.221  50.353  62.849  1.00 34.49 ? 311 LEU C CG  1 
ATOM   8949  C CD1 . LEU C 1 273 ? 15.114  51.351  62.578  1.00 33.30 ? 311 LEU C CD1 1 
ATOM   8950  C CD2 . LEU C 1 273 ? 16.137  49.820  64.307  1.00 34.30 ? 311 LEU C CD2 1 
ATOM   8951  N N   . GLU C 1 274 ? 18.131  46.963  59.846  1.00 35.64 ? 312 GLU C N   1 
ATOM   8952  C CA  . GLU C 1 274 ? 18.060  45.876  58.894  1.00 35.73 ? 312 GLU C CA  1 
ATOM   8953  C C   . GLU C 1 274 ? 18.497  44.567  59.529  1.00 35.79 ? 312 GLU C C   1 
ATOM   8954  O O   . GLU C 1 274 ? 18.260  43.523  58.948  1.00 36.04 ? 312 GLU C O   1 
ATOM   8955  C CB  . GLU C 1 274 ? 18.911  46.157  57.640  1.00 35.96 ? 312 GLU C CB  1 
ATOM   8956  C CG  . GLU C 1 274 ? 18.338  47.212  56.686  1.00 37.33 ? 312 GLU C CG  1 
ATOM   8957  C CD  . GLU C 1 274 ? 16.906  46.898  56.213  1.00 40.74 ? 312 GLU C CD  1 
ATOM   8958  O OE1 . GLU C 1 274 ? 16.622  45.809  55.674  1.00 45.66 ? 312 GLU C OE1 1 
ATOM   8959  O OE2 . GLU C 1 274 ? 16.036  47.761  56.363  1.00 41.59 ? 312 GLU C OE2 1 
ATOM   8960  N N   . PHE C 1 275 ? 19.143  44.605  60.698  1.00 36.31 ? 313 PHE C N   1 
ATOM   8961  C CA  . PHE C 1 275 ? 19.738  43.393  61.277  1.00 36.17 ? 313 PHE C CA  1 
ATOM   8962  C C   . PHE C 1 275 ? 18.764  42.702  62.185  1.00 36.61 ? 313 PHE C C   1 
ATOM   8963  O O   . PHE C 1 275 ? 18.004  43.341  62.874  1.00 34.78 ? 313 PHE C O   1 
ATOM   8964  C CB  . PHE C 1 275 ? 21.001  43.688  62.082  1.00 36.24 ? 313 PHE C CB  1 
ATOM   8965  C CG  . PHE C 1 275 ? 22.092  44.188  61.259  1.00 36.63 ? 313 PHE C CG  1 
ATOM   8966  C CD1 . PHE C 1 275 ? 22.820  43.329  60.493  1.00 37.18 ? 313 PHE C CD1 1 
ATOM   8967  C CD2 . PHE C 1 275 ? 22.355  45.552  61.189  1.00 39.10 ? 313 PHE C CD2 1 
ATOM   8968  C CE1 . PHE C 1 275 ? 23.793  43.803  59.676  1.00 40.08 ? 313 PHE C CE1 1 
ATOM   8969  C CE2 . PHE C 1 275 ? 23.332  46.050  60.369  1.00 37.16 ? 313 PHE C CE2 1 
ATOM   8970  C CZ  . PHE C 1 275 ? 24.053  45.200  59.606  1.00 38.06 ? 313 PHE C CZ  1 
ATOM   8971  N N   . GLU C 1 276 ? 18.862  41.374  62.190  1.00 37.45 ? 314 GLU C N   1 
ATOM   8972  C CA  . GLU C 1 276 ? 18.023  40.524  62.972  1.00 38.22 ? 314 GLU C CA  1 
ATOM   8973  C C   . GLU C 1 276 ? 18.887  39.533  63.691  1.00 37.40 ? 314 GLU C C   1 
ATOM   8974  O O   . GLU C 1 276 ? 20.021  39.263  63.286  1.00 37.23 ? 314 GLU C O   1 
ATOM   8975  C CB  . GLU C 1 276 ? 17.052  39.813  62.042  1.00 39.19 ? 314 GLU C CB  1 
ATOM   8976  C CG  . GLU C 1 276 ? 16.097  40.802  61.372  1.00 43.67 ? 314 GLU C CG  1 
ATOM   8977  C CD  . GLU C 1 276 ? 15.175  40.154  60.361  1.00 49.20 ? 314 GLU C CD  1 
ATOM   8978  O OE1 . GLU C 1 276 ? 15.434  38.984  59.975  1.00 52.01 ? 314 GLU C OE1 1 
ATOM   8979  O OE2 . GLU C 1 276 ? 14.187  40.826  59.963  1.00 52.42 ? 314 GLU C OE2 1 
ATOM   8980  N N   . ASP C 1 277 ? 18.326  39.008  64.768  1.00 37.00 ? 315 ASP C N   1 
ATOM   8981  C CA  . ASP C 1 277 ? 18.969  38.048  65.647  1.00 36.28 ? 315 ASP C CA  1 
ATOM   8982  C C   . ASP C 1 277 ? 19.132  36.748  64.873  1.00 35.46 ? 315 ASP C C   1 
ATOM   8983  O O   . ASP C 1 277 ? 18.200  36.305  64.217  1.00 34.75 ? 315 ASP C O   1 
ATOM   8984  C CB  . ASP C 1 277 ? 18.099  37.857  66.905  1.00 36.02 ? 315 ASP C CB  1 
ATOM   8985  C CG  . ASP C 1 277 ? 18.813  37.135  68.039  1.00 37.57 ? 315 ASP C CG  1 
ATOM   8986  O OD1 . ASP C 1 277 ? 20.060  37.128  68.129  1.00 39.72 ? 315 ASP C OD1 1 
ATOM   8987  O OD2 . ASP C 1 277 ? 18.110  36.556  68.903  1.00 44.14 ? 315 ASP C OD2 1 
ATOM   8988  N N   . GLY C 1 278 ? 20.335  36.175  64.925  1.00 35.17 ? 316 GLY C N   1 
ATOM   8989  C CA  . GLY C 1 278 ? 20.663  34.945  64.218  1.00 35.29 ? 316 GLY C CA  1 
ATOM   8990  C C   . GLY C 1 278 ? 21.043  35.131  62.757  1.00 35.86 ? 316 GLY C C   1 
ATOM   8991  O O   . GLY C 1 278 ? 21.337  34.170  62.059  1.00 34.96 ? 316 GLY C O   1 
ATOM   8992  N N   . MET C 1 279 ? 21.056  36.383  62.303  1.00 36.29 ? 317 MET C N   1 
ATOM   8993  C CA  . MET C 1 279 ? 21.415  36.715  60.939  1.00 36.53 ? 317 MET C CA  1 
ATOM   8994  C C   . MET C 1 279 ? 22.902  36.565  60.688  1.00 36.03 ? 317 MET C C   1 
ATOM   8995  O O   . MET C 1 279 ? 23.691  36.913  61.555  1.00 36.36 ? 317 MET C O   1 
ATOM   8996  C CB  . MET C 1 279 ? 21.029  38.180  60.687  1.00 36.91 ? 317 MET C CB  1 
ATOM   8997  C CG  . MET C 1 279 ? 21.102  38.582  59.298  1.00 36.32 ? 317 MET C CG  1 
ATOM   8998  S SD  . MET C 1 279 ? 20.599  40.279  59.033  1.00 40.20 ? 317 MET C SD  1 
ATOM   8999  C CE  . MET C 1 279 ? 19.027  39.962  58.274  1.00 30.90 ? 317 MET C CE  1 
ATOM   9000  N N   . TYR C 1 280 ? 23.254  36.020  59.509  1.00 34.79 ? 318 TYR C N   1 
ATOM   9001  C CA  . TYR C 1 280 ? 24.588  36.021  58.960  1.00 33.95 ? 318 TYR C CA  1 
ATOM   9002  C C   . TYR C 1 280 ? 24.644  37.183  57.967  1.00 33.62 ? 318 TYR C C   1 
ATOM   9003  O O   . TYR C 1 280 ? 23.848  37.195  57.014  1.00 33.61 ? 318 TYR C O   1 
ATOM   9004  C CB  . TYR C 1 280 ? 24.912  34.668  58.286  1.00 33.84 ? 318 TYR C CB  1 
ATOM   9005  C CG  . TYR C 1 280 ? 24.892  33.570  59.310  1.00 32.94 ? 318 TYR C CG  1 
ATOM   9006  C CD1 . TYR C 1 280 ? 23.715  32.915  59.616  1.00 32.58 ? 318 TYR C CD1 1 
ATOM   9007  C CD2 . TYR C 1 280 ? 26.025  33.278  60.061  1.00 32.56 ? 318 TYR C CD2 1 
ATOM   9008  C CE1 . TYR C 1 280 ? 23.657  31.960  60.636  1.00 30.80 ? 318 TYR C CE1 1 
ATOM   9009  C CE2 . TYR C 1 280 ? 25.996  32.321  61.068  1.00 30.84 ? 318 TYR C CE2 1 
ATOM   9010  C CZ  . TYR C 1 280 ? 24.804  31.673  61.352  1.00 33.05 ? 318 TYR C CZ  1 
ATOM   9011  O OH  . TYR C 1 280 ? 24.769  30.698  62.331  1.00 33.75 ? 318 TYR C OH  1 
ATOM   9012  N N   . ALA C 1 281 ? 25.500  38.180  58.259  1.00 31.81 ? 319 ALA C N   1 
ATOM   9013  C CA  . ALA C 1 281 ? 25.660  39.376  57.451  1.00 31.65 ? 319 ALA C CA  1 
ATOM   9014  C C   . ALA C 1 281 ? 27.102  39.616  57.024  1.00 32.39 ? 319 ALA C C   1 
ATOM   9015  O O   . ALA C 1 281 ? 28.056  39.298  57.739  1.00 31.98 ? 319 ALA C O   1 
ATOM   9016  C CB  . ALA C 1 281 ? 25.069  40.632  58.105  1.00 31.22 ? 319 ALA C CB  1 
ATOM   9017  N N   . ASN C 1 282 ? 27.246  40.119  55.807  1.00 33.59 ? 320 ASN C N   1 
ATOM   9018  C CA  . ASN C 1 282 ? 28.520  40.692  55.335  1.00 35.17 ? 320 ASN C CA  1 
ATOM   9019  C C   . ASN C 1 282 ? 28.450  42.204  55.151  1.00 35.42 ? 320 ASN C C   1 
ATOM   9020  O O   . ASN C 1 282 ? 27.588  42.686  54.447  1.00 36.25 ? 320 ASN C O   1 
ATOM   9021  C CB  . ASN C 1 282 ? 28.948  40.086  54.012  1.00 34.76 ? 320 ASN C CB  1 
ATOM   9022  C CG  . ASN C 1 282 ? 30.345  40.586  53.585  1.00 37.06 ? 320 ASN C CG  1 
ATOM   9023  O OD1 . ASN C 1 282 ? 30.483  41.731  53.195  1.00 37.44 ? 320 ASN C OD1 1 
ATOM   9024  N ND2 . ASN C 1 282 ? 31.363  39.728  53.669  1.00 36.47 ? 320 ASN C ND2 1 
ATOM   9025  N N   . LEU C 1 283 ? 29.354  42.949  55.785  1.00 36.28 ? 321 LEU C N   1 
ATOM   9026  C CA  . LEU C 1 283 ? 29.365  44.440  55.743  1.00 36.54 ? 321 LEU C CA  1 
ATOM   9027  C C   . LEU C 1 283 ? 30.515  45.000  54.904  1.00 38.08 ? 321 LEU C C   1 
ATOM   9028  O O   . LEU C 1 283 ? 31.708  44.817  55.211  1.00 38.05 ? 321 LEU C O   1 
ATOM   9029  C CB  . LEU C 1 283 ? 29.454  44.989  57.160  1.00 36.78 ? 321 LEU C CB  1 
ATOM   9030  C CG  . LEU C 1 283 ? 28.206  44.617  58.008  1.00 34.07 ? 321 LEU C CG  1 
ATOM   9031  C CD1 . LEU C 1 283 ? 28.263  45.348  59.257  1.00 32.10 ? 321 LEU C CD1 1 
ATOM   9032  C CD2 . LEU C 1 283 ? 26.911  44.868  57.294  1.00 31.02 ? 321 LEU C CD2 1 
ATOM   9033  N N   . GLY C 1 284 ? 30.174  45.673  53.827  1.00 39.12 ? 322 GLY C N   1 
ATOM   9034  C CA  . GLY C 1 284 ? 31.197  46.107  52.908  1.00 40.34 ? 322 GLY C CA  1 
ATOM   9035  C C   . GLY C 1 284 ? 31.984  47.278  53.435  1.00 41.27 ? 322 GLY C C   1 
ATOM   9036  O O   . GLY C 1 284 ? 31.597  47.942  54.402  1.00 40.31 ? 322 GLY C O   1 
ATOM   9037  N N   . ILE C 1 285 ? 33.112  47.512  52.774  1.00 43.95 ? 323 ILE C N   1 
ATOM   9038  C CA  . ILE C 1 285 ? 33.978  48.648  53.073  1.00 45.25 ? 323 ILE C CA  1 
ATOM   9039  C C   . ILE C 1 285 ? 33.202  49.943  52.812  1.00 45.55 ? 323 ILE C C   1 
ATOM   9040  O O   . ILE C 1 285 ? 32.333  49.980  51.937  1.00 45.22 ? 323 ILE C O   1 
ATOM   9041  C CB  . ILE C 1 285 ? 35.300  48.616  52.262  1.00 45.81 ? 323 ILE C CB  1 
ATOM   9042  C CG1 . ILE C 1 285 ? 35.063  48.787  50.751  1.00 46.80 ? 323 ILE C CG1 1 
ATOM   9043  C CG2 . ILE C 1 285 ? 36.091  47.291  52.521  1.00 46.56 ? 323 ILE C CG2 1 
ATOM   9044  C CD1 . ILE C 1 285 ? 36.391  48.830  49.949  1.00 45.78 ? 323 ILE C CD1 1 
ATOM   9045  N N   . GLY C 1 286 ? 33.503  50.972  53.604  1.00 45.71 ? 324 GLY C N   1 
ATOM   9046  C CA  . GLY C 1 286 ? 32.783  52.220  53.573  1.00 45.52 ? 324 GLY C CA  1 
ATOM   9047  C C   . GLY C 1 286 ? 31.797  52.286  54.720  1.00 45.70 ? 324 GLY C C   1 
ATOM   9048  O O   . GLY C 1 286 ? 32.095  51.827  55.825  1.00 45.06 ? 324 GLY C O   1 
ATOM   9049  N N   . ILE C 1 287 ? 30.616  52.851  54.430  1.00 46.05 ? 325 ILE C N   1 
ATOM   9050  C CA  . ILE C 1 287 ? 29.556  53.156  55.415  1.00 45.98 ? 325 ILE C CA  1 
ATOM   9051  C C   . ILE C 1 287 ? 28.969  51.953  56.173  1.00 45.31 ? 325 ILE C C   1 
ATOM   9052  O O   . ILE C 1 287 ? 28.607  52.098  57.358  1.00 44.58 ? 325 ILE C O   1 
ATOM   9053  C CB  . ILE C 1 287 ? 28.387  54.011  54.734  1.00 46.71 ? 325 ILE C CB  1 
ATOM   9054  C CG1 . ILE C 1 287 ? 28.932  55.369  54.241  1.00 47.67 ? 325 ILE C CG1 1 
ATOM   9055  C CG2 . ILE C 1 287 ? 27.176  54.234  55.690  1.00 45.35 ? 325 ILE C CG2 1 
ATOM   9056  C CD1 . ILE C 1 287 ? 27.841  56.369  53.804  1.00 46.98 ? 325 ILE C CD1 1 
ATOM   9057  N N   . PRO C 1 288 ? 28.824  50.772  55.499  1.00 44.61 ? 326 PRO C N   1 
ATOM   9058  C CA  . PRO C 1 288 ? 28.358  49.567  56.199  1.00 44.00 ? 326 PRO C CA  1 
ATOM   9059  C C   . PRO C 1 288 ? 29.246  49.080  57.360  1.00 44.00 ? 326 PRO C C   1 
ATOM   9060  O O   . PRO C 1 288 ? 28.697  48.575  58.349  1.00 44.35 ? 326 PRO C O   1 
ATOM   9061  C CB  . PRO C 1 288 ? 28.294  48.525  55.081  1.00 44.00 ? 326 PRO C CB  1 
ATOM   9062  C CG  . PRO C 1 288 ? 28.167  49.309  53.850  1.00 43.20 ? 326 PRO C CG  1 
ATOM   9063  C CD  . PRO C 1 288 ? 29.016  50.487  54.069  1.00 44.30 ? 326 PRO C CD  1 
ATOM   9064  N N   . LEU C 1 289 ? 30.572  49.234  57.275  1.00 43.65 ? 327 LEU C N   1 
ATOM   9065  C CA  . LEU C 1 289 ? 31.461  48.957  58.443  1.00 43.82 ? 327 LEU C CA  1 
ATOM   9066  C C   . LEU C 1 289 ? 31.036  49.780  59.669  1.00 44.23 ? 327 LEU C C   1 
ATOM   9067  O O   . LEU C 1 289 ? 30.844  49.225  60.748  1.00 45.79 ? 327 LEU C O   1 
ATOM   9068  C CB  . LEU C 1 289 ? 32.944  49.228  58.127  1.00 43.36 ? 327 LEU C CB  1 
ATOM   9069  C CG  . LEU C 1 289 ? 33.608  48.324  57.061  1.00 44.63 ? 327 LEU C CG  1 
ATOM   9070  C CD1 . LEU C 1 289 ? 35.065  48.744  56.712  1.00 42.59 ? 327 LEU C CD1 1 
ATOM   9071  C CD2 . LEU C 1 289 ? 33.531  46.853  57.488  1.00 43.34 ? 327 LEU C CD2 1 
ATOM   9072  N N   . LEU C 1 290 ? 30.866  51.092  59.488  1.00 43.75 ? 328 LEU C N   1 
ATOM   9073  C CA  . LEU C 1 290 ? 30.340  52.005  60.519  1.00 43.12 ? 328 LEU C CA  1 
ATOM   9074  C C   . LEU C 1 290 ? 29.024  51.564  61.198  1.00 42.88 ? 328 LEU C C   1 
ATOM   9075  O O   . LEU C 1 290 ? 28.791  51.898  62.344  1.00 42.46 ? 328 LEU C O   1 
ATOM   9076  C CB  . LEU C 1 290 ? 30.117  53.400  59.918  1.00 43.20 ? 328 LEU C CB  1 
ATOM   9077  C CG  . LEU C 1 290 ? 31.144  53.995  58.934  1.00 43.69 ? 328 LEU C CG  1 
ATOM   9078  C CD1 . LEU C 1 290 ? 30.625  55.301  58.356  1.00 43.78 ? 328 LEU C CD1 1 
ATOM   9079  C CD2 . LEU C 1 290 ? 32.520  54.202  59.589  1.00 44.65 ? 328 LEU C CD2 1 
ATOM   9080  N N   . ALA C 1 291 ? 28.166  50.827  60.498  1.00 43.05 ? 329 ALA C N   1 
ATOM   9081  C CA  . ALA C 1 291 ? 26.834  50.467  61.037  1.00 43.43 ? 329 ALA C CA  1 
ATOM   9082  C C   . ALA C 1 291 ? 26.867  49.323  62.078  1.00 43.59 ? 329 ALA C C   1 
ATOM   9083  O O   . ALA C 1 291 ? 25.908  49.158  62.872  1.00 43.14 ? 329 ALA C O   1 
ATOM   9084  C CB  . ALA C 1 291 ? 25.868  50.129  59.909  1.00 43.91 ? 329 ALA C CB  1 
ATOM   9085  N N   . SER C 1 292 ? 27.969  48.567  62.102  1.00 42.99 ? 330 SER C N   1 
ATOM   9086  C CA  . SER C 1 292 ? 28.123  47.482  63.075  1.00 43.17 ? 330 SER C CA  1 
ATOM   9087  C C   . SER C 1 292 ? 28.328  47.966  64.509  1.00 42.81 ? 330 SER C C   1 
ATOM   9088  O O   . SER C 1 292 ? 28.029  47.232  65.459  1.00 42.91 ? 330 SER C O   1 
ATOM   9089  C CB  . SER C 1 292 ? 29.296  46.595  62.690  1.00 43.35 ? 330 SER C CB  1 
ATOM   9090  O OG  . SER C 1 292 ? 30.506  47.288  62.930  1.00 45.33 ? 330 SER C OG  1 
ATOM   9091  N N   . ASN C 1 293 ? 28.850  49.191  64.669  1.00 42.15 ? 331 ASN C N   1 
ATOM   9092  C CA  . ASN C 1 293 ? 28.998  49.810  65.978  1.00 41.50 ? 331 ASN C CA  1 
ATOM   9093  C C   . ASN C 1 293 ? 27.647  50.194  66.552  1.00 40.46 ? 331 ASN C C   1 
ATOM   9094  O O   . ASN C 1 293 ? 27.510  50.442  67.733  1.00 40.23 ? 331 ASN C O   1 
ATOM   9095  C CB  . ASN C 1 293 ? 29.928  51.016  65.876  1.00 41.91 ? 331 ASN C CB  1 
ATOM   9096  C CG  . ASN C 1 293 ? 31.386  50.604  65.604  1.00 44.17 ? 331 ASN C CG  1 
ATOM   9097  O OD1 . ASN C 1 293 ? 32.095  50.169  66.523  1.00 45.84 ? 331 ASN C OD1 1 
ATOM   9098  N ND2 . ASN C 1 293 ? 31.826  50.714  64.329  1.00 45.34 ? 331 ASN C ND2 1 
ATOM   9099  N N   . PHE C 1 294 ? 26.646  50.219  65.688  1.00 40.09 ? 332 PHE C N   1 
ATOM   9100  C CA  . PHE C 1 294 ? 25.274  50.542  66.040  1.00 39.52 ? 332 PHE C CA  1 
ATOM   9101  C C   . PHE C 1 294 ? 24.355  49.317  66.092  1.00 38.90 ? 332 PHE C C   1 
ATOM   9102  O O   . PHE C 1 294 ? 23.195  49.451  66.450  1.00 38.08 ? 332 PHE C O   1 
ATOM   9103  C CB  . PHE C 1 294 ? 24.739  51.579  65.035  1.00 39.57 ? 332 PHE C CB  1 
ATOM   9104  C CG  . PHE C 1 294 ? 25.204  52.969  65.322  1.00 39.42 ? 332 PHE C CG  1 
ATOM   9105  C CD1 . PHE C 1 294 ? 26.402  53.447  64.790  1.00 40.17 ? 332 PHE C CD1 1 
ATOM   9106  C CD2 . PHE C 1 294 ? 24.480  53.779  66.171  1.00 40.33 ? 332 PHE C CD2 1 
ATOM   9107  C CE1 . PHE C 1 294 ? 26.846  54.718  65.070  1.00 37.93 ? 332 PHE C CE1 1 
ATOM   9108  C CE2 . PHE C 1 294 ? 24.918  55.048  66.460  1.00 40.28 ? 332 PHE C CE2 1 
ATOM   9109  C CZ  . PHE C 1 294 ? 26.108  55.517  65.898  1.00 40.14 ? 332 PHE C CZ  1 
ATOM   9110  N N   . ILE C 1 295 ? 24.866  48.138  65.718  1.00 39.20 ? 333 ILE C N   1 
ATOM   9111  C CA  . ILE C 1 295 ? 24.122  46.872  65.850  1.00 39.38 ? 333 ILE C CA  1 
ATOM   9112  C C   . ILE C 1 295 ? 23.704  46.682  67.310  1.00 38.80 ? 333 ILE C C   1 
ATOM   9113  O O   . ILE C 1 295 ? 24.556  46.574  68.206  1.00 40.04 ? 333 ILE C O   1 
ATOM   9114  C CB  . ILE C 1 295 ? 24.943  45.632  65.401  1.00 39.48 ? 333 ILE C CB  1 
ATOM   9115  C CG1 . ILE C 1 295 ? 24.984  45.512  63.874  1.00 40.52 ? 333 ILE C CG1 1 
ATOM   9116  C CG2 . ILE C 1 295 ? 24.345  44.346  65.969  1.00 40.54 ? 333 ILE C CG2 1 
ATOM   9117  C CD1 . ILE C 1 295 ? 26.015  44.520  63.338  1.00 38.42 ? 333 ILE C CD1 1 
ATOM   9118  N N   . SER C 1 296 ? 22.396  46.641  67.559  1.00 37.89 ? 334 SER C N   1 
ATOM   9119  C CA  . SER C 1 296 ? 21.870  46.462  68.935  1.00 36.79 ? 334 SER C CA  1 
ATOM   9120  C C   . SER C 1 296 ? 22.584  45.353  69.713  1.00 35.92 ? 334 SER C C   1 
ATOM   9121  O O   . SER C 1 296 ? 22.813  44.266  69.166  1.00 35.78 ? 334 SER C O   1 
ATOM   9122  C CB  . SER C 1 296 ? 20.387  46.125  68.885  1.00 37.01 ? 334 SER C CB  1 
ATOM   9123  O OG  . SER C 1 296 ? 20.017  45.368  70.012  1.00 36.55 ? 334 SER C OG  1 
ATOM   9124  N N   . PRO C 1 297 ? 22.968  45.624  70.977  1.00 34.97 ? 335 PRO C N   1 
ATOM   9125  C CA  . PRO C 1 297 ? 23.576  44.592  71.807  1.00 34.71 ? 335 PRO C CA  1 
ATOM   9126  C C   . PRO C 1 297 ? 22.630  43.470  72.271  1.00 35.16 ? 335 PRO C C   1 
ATOM   9127  O O   . PRO C 1 297 ? 23.078  42.447  72.827  1.00 34.46 ? 335 PRO C O   1 
ATOM   9128  C CB  . PRO C 1 297 ? 24.081  45.392  73.020  1.00 34.73 ? 335 PRO C CB  1 
ATOM   9129  C CG  . PRO C 1 297 ? 23.237  46.601  73.056  1.00 34.81 ? 335 PRO C CG  1 
ATOM   9130  C CD  . PRO C 1 297 ? 22.957  46.934  71.658  1.00 34.48 ? 335 PRO C CD  1 
ATOM   9131  N N   . ASN C 1 298 ? 21.331  43.685  72.068  1.00 35.54 ? 336 ASN C N   1 
ATOM   9132  C CA  . ASN C 1 298 ? 20.291  42.793  72.569  1.00 35.34 ? 336 ASN C CA  1 
ATOM   9133  C C   . ASN C 1 298 ? 20.061  41.613  71.606  1.00 34.97 ? 336 ASN C C   1 
ATOM   9134  O O   . ASN C 1 298 ? 19.287  40.708  71.912  1.00 34.66 ? 336 ASN C O   1 
ATOM   9135  C CB  . ASN C 1 298 ? 19.007  43.591  72.765  1.00 34.98 ? 336 ASN C CB  1 
ATOM   9136  C CG  . ASN C 1 298 ? 19.133  44.635  73.879  1.00 36.56 ? 336 ASN C CG  1 
ATOM   9137  O OD1 . ASN C 1 298 ? 19.835  44.435  74.913  1.00 36.29 ? 336 ASN C OD1 1 
ATOM   9138  N ND2 . ASN C 1 298 ? 18.398  45.728  73.721  1.00 38.08 ? 336 ASN C ND2 1 
ATOM   9139  N N   . ILE C 1 299 ? 20.736  41.645  70.452  1.00 34.56 ? 337 ILE C N   1 
ATOM   9140  C CA  . ILE C 1 299 ? 20.659  40.570  69.446  1.00 34.32 ? 337 ILE C CA  1 
ATOM   9141  C C   . ILE C 1 299 ? 22.049  40.091  69.097  1.00 34.89 ? 337 ILE C C   1 
ATOM   9142  O O   . ILE C 1 299 ? 23.029  40.748  69.434  1.00 34.81 ? 337 ILE C O   1 
ATOM   9143  C CB  . ILE C 1 299 ? 19.922  40.993  68.124  1.00 33.96 ? 337 ILE C CB  1 
ATOM   9144  C CG1 . ILE C 1 299 ? 20.660  42.096  67.351  1.00 33.96 ? 337 ILE C CG1 1 
ATOM   9145  C CG2 . ILE C 1 299 ? 18.501  41.420  68.406  1.00 34.86 ? 337 ILE C CG2 1 
ATOM   9146  C CD1 . ILE C 1 299 ? 20.208  42.194  65.866  1.00 32.16 ? 337 ILE C CD1 1 
ATOM   9147  N N   . THR C 1 300 ? 22.109  38.955  68.395  1.00 36.03 ? 338 THR C N   1 
ATOM   9148  C CA  . THR C 1 300 ? 23.351  38.387  67.838  1.00 35.81 ? 338 THR C CA  1 
ATOM   9149  C C   . THR C 1 300 ? 23.328  38.427  66.327  1.00 36.27 ? 338 THR C C   1 
ATOM   9150  O O   . THR C 1 300 ? 22.442  37.851  65.694  1.00 37.48 ? 338 THR C O   1 
ATOM   9151  C CB  . THR C 1 300 ? 23.569  36.899  68.238  1.00 35.74 ? 338 THR C CB  1 
ATOM   9152  O OG1 . THR C 1 300 ? 23.342  36.722  69.632  1.00 35.87 ? 338 THR C OG1 1 
ATOM   9153  C CG2 . THR C 1 300 ? 25.013  36.446  67.920  1.00 35.83 ? 338 THR C CG2 1 
ATOM   9154  N N   . VAL C 1 301 ? 24.321  39.094  65.758  1.00 35.24 ? 339 VAL C N   1 
ATOM   9155  C CA  . VAL C 1 301 ? 24.547  39.141  64.334  1.00 34.63 ? 339 VAL C CA  1 
ATOM   9156  C C   . VAL C 1 301 ? 25.934  38.528  64.112  1.00 33.44 ? 339 VAL C C   1 
ATOM   9157  O O   . VAL C 1 301 ? 26.904  38.942  64.771  1.00 33.78 ? 339 VAL C O   1 
ATOM   9158  C CB  . VAL C 1 301 ? 24.529  40.602  63.823  1.00 34.87 ? 339 VAL C CB  1 
ATOM   9159  C CG1 . VAL C 1 301 ? 24.825  40.652  62.315  1.00 33.55 ? 339 VAL C CG1 1 
ATOM   9160  C CG2 . VAL C 1 301 ? 23.172  41.265  64.165  1.00 35.53 ? 339 VAL C CG2 1 
ATOM   9161  N N   . HIS C 1 302 ? 25.998  37.501  63.264  1.00 31.41 ? 340 HIS C N   1 
ATOM   9162  C CA  . HIS C 1 302 ? 27.256  36.845  62.903  1.00 30.77 ? 340 HIS C CA  1 
ATOM   9163  C C   . HIS C 1 302 ? 27.801  37.541  61.702  1.00 30.54 ? 340 HIS C C   1 
ATOM   9164  O O   . HIS C 1 302 ? 27.250  37.461  60.606  1.00 32.01 ? 340 HIS C O   1 
ATOM   9165  C CB  . HIS C 1 302 ? 27.052  35.365  62.597  1.00 29.96 ? 340 HIS C CB  1 
ATOM   9166  C CG  . HIS C 1 302 ? 26.177  34.691  63.591  1.00 29.71 ? 340 HIS C CG  1 
ATOM   9167  N ND1 . HIS C 1 302 ? 26.590  34.409  64.872  1.00 28.66 ? 340 HIS C ND1 1 
ATOM   9168  C CD2 . HIS C 1 302 ? 24.886  34.305  63.518  1.00 28.21 ? 340 HIS C CD2 1 
ATOM   9169  C CE1 . HIS C 1 302 ? 25.599  33.841  65.532  1.00 27.35 ? 340 HIS C CE1 1 
ATOM   9170  N NE2 . HIS C 1 302 ? 24.557  33.751  64.725  1.00 26.18 ? 340 HIS C NE2 1 
ATOM   9171  N N   . LEU C 1 303 ? 28.885  38.256  61.908  1.00 30.47 ? 341 LEU C N   1 
ATOM   9172  C CA  . LEU C 1 303 ? 29.484  39.027  60.853  1.00 29.61 ? 341 LEU C CA  1 
ATOM   9173  C C   . LEU C 1 303 ? 30.521  38.156  60.139  1.00 30.31 ? 341 LEU C C   1 
ATOM   9174  O O   . LEU C 1 303 ? 31.389  37.570  60.788  1.00 30.94 ? 341 LEU C O   1 
ATOM   9175  C CB  . LEU C 1 303 ? 30.063  40.330  61.446  1.00 29.50 ? 341 LEU C CB  1 
ATOM   9176  C CG  . LEU C 1 303 ? 29.006  41.327  61.934  1.00 26.58 ? 341 LEU C CG  1 
ATOM   9177  C CD1 . LEU C 1 303 ? 29.627  42.545  62.629  1.00 23.23 ? 341 LEU C CD1 1 
ATOM   9178  C CD2 . LEU C 1 303 ? 28.075  41.752  60.785  1.00 23.31 ? 341 LEU C CD2 1 
ATOM   9179  N N   . GLN C 1 304 ? 30.376  38.060  58.817  1.00 30.88 ? 342 GLN C N   1 
ATOM   9180  C CA  . GLN C 1 304 ? 31.253  37.331  57.940  1.00 32.41 ? 342 GLN C CA  1 
ATOM   9181  C C   . GLN C 1 304 ? 32.145  38.333  57.247  1.00 33.27 ? 342 GLN C C   1 
ATOM   9182  O O   . GLN C 1 304 ? 31.724  39.418  56.938  1.00 31.92 ? 342 GLN C O   1 
ATOM   9183  C CB  . GLN C 1 304 ? 30.464  36.567  56.889  1.00 32.75 ? 342 GLN C CB  1 
ATOM   9184  C CG  . GLN C 1 304 ? 31.157  35.373  56.289  1.00 36.35 ? 342 GLN C CG  1 
ATOM   9185  C CD  . GLN C 1 304 ? 31.777  35.624  54.925  1.00 40.78 ? 342 GLN C CD  1 
ATOM   9186  O OE1 . GLN C 1 304 ? 31.825  36.768  54.437  1.00 46.36 ? 342 GLN C OE1 1 
ATOM   9187  N NE2 . GLN C 1 304 ? 32.275  34.566  54.311  1.00 36.56 ? 342 GLN C NE2 1 
ATOM   9188  N N   . SER C 1 305 ? 33.401  37.946  57.051  1.00 34.79 ? 343 SER C N   1 
ATOM   9189  C CA  . SER C 1 305 ? 34.393  38.727  56.323  1.00 35.44 ? 343 SER C CA  1 
ATOM   9190  C C   . SER C 1 305 ? 34.926  37.840  55.217  1.00 36.11 ? 343 SER C C   1 
ATOM   9191  O O   . SER C 1 305 ? 35.331  36.721  55.519  1.00 33.82 ? 343 SER C O   1 
ATOM   9192  C CB  . SER C 1 305 ? 35.543  39.083  57.268  1.00 36.75 ? 343 SER C CB  1 
ATOM   9193  O OG  . SER C 1 305 ? 36.187  40.254  56.855  1.00 40.62 ? 343 SER C OG  1 
ATOM   9194  N N   . GLU C 1 306 ? 35.031  38.384  53.986  1.00 36.65 ? 344 GLU C N   1 
ATOM   9195  C CA  . GLU C 1 306 ? 35.397  37.620  52.785  1.00 37.92 ? 344 GLU C CA  1 
ATOM   9196  C C   . GLU C 1 306 ? 36.817  36.993  52.800  1.00 37.32 ? 344 GLU C C   1 
ATOM   9197  O O   . GLU C 1 306 ? 37.065  35.973  52.122  1.00 36.71 ? 344 GLU C O   1 
ATOM   9198  C CB  . GLU C 1 306 ? 35.252  38.529  51.543  1.00 38.66 ? 344 GLU C CB  1 
ATOM   9199  C CG  . GLU C 1 306 ? 36.413  39.545  51.422  1.00 40.45 ? 344 GLU C CG  1 
ATOM   9200  C CD  . GLU C 1 306 ? 36.062  40.836  50.621  1.00 42.44 ? 344 GLU C CD  1 
ATOM   9201  O OE1 . GLU C 1 306 ? 34.846  41.207  50.635  1.00 42.79 ? 344 GLU C OE1 1 
ATOM   9202  O OE2 . GLU C 1 306 ? 37.033  41.486  50.070  1.00 42.65 ? 344 GLU C OE2 1 
ATOM   9203  N N   . ASN C 1 307 ? 37.719  37.608  53.587  1.00 37.24 ? 345 ASN C N   1 
ATOM   9204  C CA  . ASN C 1 307 ? 39.110  37.128  53.827  1.00 36.03 ? 345 ASN C CA  1 
ATOM   9205  C C   . ASN C 1 307 ? 39.210  35.863  54.717  1.00 36.11 ? 345 ASN C C   1 
ATOM   9206  O O   . ASN C 1 307 ? 40.304  35.358  54.961  1.00 36.54 ? 345 ASN C O   1 
ATOM   9207  C CB  . ASN C 1 307 ? 39.956  38.265  54.406  1.00 36.40 ? 345 ASN C CB  1 
ATOM   9208  C CG  . ASN C 1 307 ? 39.453  38.777  55.764  1.00 36.85 ? 345 ASN C CG  1 
ATOM   9209  O OD1 . ASN C 1 307 ? 38.276  39.196  55.916  1.00 34.71 ? 345 ASN C OD1 1 
ATOM   9210  N ND2 . ASN C 1 307 ? 40.342  38.733  56.765  1.00 33.03 ? 345 ASN C ND2 1 
ATOM   9211  N N   . GLY C 1 308 ? 38.068  35.365  55.210  1.00 34.40 ? 346 GLY C N   1 
ATOM   9212  C CA  . GLY C 1 308 ? 38.016  34.052  55.810  1.00 32.83 ? 346 GLY C CA  1 
ATOM   9213  C C   . GLY C 1 308 ? 37.704  34.079  57.283  1.00 32.02 ? 346 GLY C C   1 
ATOM   9214  O O   . GLY C 1 308 ? 38.325  33.359  58.063  1.00 30.94 ? 346 GLY C O   1 
ATOM   9215  N N   . VAL C 1 309 ? 36.728  34.880  57.675  1.00 32.02 ? 347 VAL C N   1 
ATOM   9216  C CA  . VAL C 1 309 ? 36.327  34.958  59.107  1.00 31.13 ? 347 VAL C CA  1 
ATOM   9217  C C   . VAL C 1 309 ? 34.826  34.859  59.238  1.00 32.15 ? 347 VAL C C   1 
ATOM   9218  O O   . VAL C 1 309 ? 34.112  35.413  58.433  1.00 32.95 ? 347 VAL C O   1 
ATOM   9219  C CB  . VAL C 1 309 ? 36.836  36.277  59.802  1.00 31.75 ? 347 VAL C CB  1 
ATOM   9220  C CG1 . VAL C 1 309 ? 36.605  36.211  61.324  1.00 27.39 ? 347 VAL C CG1 1 
ATOM   9221  C CG2 . VAL C 1 309 ? 38.329  36.544  59.501  1.00 25.26 ? 347 VAL C CG2 1 
ATOM   9222  N N   . LEU C 1 310 ? 34.343  34.139  60.241  1.00 32.84 ? 348 LEU C N   1 
ATOM   9223  C CA  . LEU C 1 310 ? 32.947  34.258  60.639  1.00 33.40 ? 348 LEU C CA  1 
ATOM   9224  C C   . LEU C 1 310 ? 32.864  34.506  62.118  1.00 33.36 ? 348 LEU C C   1 
ATOM   9225  O O   . LEU C 1 310 ? 33.366  33.738  62.897  1.00 32.80 ? 348 LEU C O   1 
ATOM   9226  C CB  . LEU C 1 310 ? 32.178  32.987  60.304  1.00 33.13 ? 348 LEU C CB  1 
ATOM   9227  C CG  . LEU C 1 310 ? 30.703  32.972  60.668  1.00 34.60 ? 348 LEU C CG  1 
ATOM   9228  C CD1 . LEU C 1 310 ? 29.920  34.078  59.953  1.00 30.62 ? 348 LEU C CD1 1 
ATOM   9229  C CD2 . LEU C 1 310 ? 30.189  31.543  60.375  1.00 35.23 ? 348 LEU C CD2 1 
ATOM   9230  N N   . GLY C 1 311 ? 32.224  35.596  62.522  1.00 34.73 ? 349 GLY C N   1 
ATOM   9231  C CA  . GLY C 1 311 ? 32.180  35.901  63.960  1.00 35.39 ? 349 GLY C CA  1 
ATOM   9232  C C   . GLY C 1 311 ? 33.048  37.060  64.371  1.00 35.37 ? 349 GLY C C   1 
ATOM   9233  O O   . GLY C 1 311 ? 33.663  37.033  65.434  1.00 34.96 ? 349 GLY C O   1 
ATOM   9234  N N   . LEU C 1 312 ? 33.042  38.103  63.544  1.00 35.96 ? 350 LEU C N   1 
ATOM   9235  C CA  . LEU C 1 312 ? 33.751  39.352  63.846  1.00 35.72 ? 350 LEU C CA  1 
ATOM   9236  C C   . LEU C 1 312 ? 33.231  40.045  65.072  1.00 34.48 ? 350 LEU C C   1 
ATOM   9237  O O   . LEU C 1 312 ? 32.027  40.161  65.271  1.00 34.20 ? 350 LEU C O   1 
ATOM   9238  C CB  . LEU C 1 312 ? 33.628  40.339  62.681  1.00 36.40 ? 350 LEU C CB  1 
ATOM   9239  C CG  . LEU C 1 312 ? 34.361  39.983  61.408  1.00 37.55 ? 350 LEU C CG  1 
ATOM   9240  C CD1 . LEU C 1 312 ? 34.009  41.010  60.372  1.00 38.91 ? 350 LEU C CD1 1 
ATOM   9241  C CD2 . LEU C 1 312 ? 35.842  39.938  61.677  1.00 39.19 ? 350 LEU C CD2 1 
ATOM   9242  N N   . GLY C 1 313 ? 34.158  40.528  65.884  1.00 34.32 ? 351 GLY C N   1 
ATOM   9243  C CA  . GLY C 1 313 ? 33.842  41.280  67.101  1.00 33.77 ? 351 GLY C CA  1 
ATOM   9244  C C   . GLY C 1 313 ? 34.225  42.749  66.903  1.00 33.94 ? 351 GLY C C   1 
ATOM   9245  O O   . GLY C 1 313 ? 34.521  43.181  65.778  1.00 34.40 ? 351 GLY C O   1 
ATOM   9246  N N   . PRO C 1 314 ? 34.264  43.519  67.989  1.00 33.36 ? 352 PRO C N   1 
ATOM   9247  C CA  . PRO C 1 314 ? 34.605  44.933  67.892  1.00 33.25 ? 352 PRO C CA  1 
ATOM   9248  C C   . PRO C 1 314 ? 36.070  45.142  67.531  1.00 33.26 ? 352 PRO C C   1 
ATOM   9249  O O   . PRO C 1 314 ? 36.844  44.186  67.473  1.00 32.60 ? 352 PRO C O   1 
ATOM   9250  C CB  . PRO C 1 314 ? 34.314  45.472  69.312  1.00 33.11 ? 352 PRO C CB  1 
ATOM   9251  C CG  . PRO C 1 314 ? 34.303  44.308  70.202  1.00 32.83 ? 352 PRO C CG  1 
ATOM   9252  C CD  . PRO C 1 314 ? 34.008  43.087  69.380  1.00 33.41 ? 352 PRO C CD  1 
ATOM   9253  N N   . TYR C 1 315 ? 36.429  46.395  67.294  1.00 33.29 ? 353 TYR C N   1 
ATOM   9254  C CA  . TYR C 1 315 ? 37.824  46.782  67.093  1.00 33.43 ? 353 TYR C CA  1 
ATOM   9255  C C   . TYR C 1 315 ? 38.593  46.511  68.380  1.00 32.79 ? 353 TYR C C   1 
ATOM   9256  O O   . TYR C 1 315 ? 38.037  46.670  69.463  1.00 31.09 ? 353 TYR C O   1 
ATOM   9257  C CB  . TYR C 1 315 ? 37.918  48.254  66.718  1.00 34.19 ? 353 TYR C CB  1 
ATOM   9258  C CG  . TYR C 1 315 ? 37.321  48.507  65.355  1.00 34.46 ? 353 TYR C CG  1 
ATOM   9259  C CD1 . TYR C 1 315 ? 37.997  48.125  64.214  1.00 35.47 ? 353 TYR C CD1 1 
ATOM   9260  C CD2 . TYR C 1 315 ? 36.086  49.100  65.212  1.00 35.69 ? 353 TYR C CD2 1 
ATOM   9261  C CE1 . TYR C 1 315 ? 37.466  48.338  62.947  1.00 37.55 ? 353 TYR C CE1 1 
ATOM   9262  C CE2 . TYR C 1 315 ? 35.522  49.349  63.927  1.00 36.82 ? 353 TYR C CE2 1 
ATOM   9263  C CZ  . TYR C 1 315 ? 36.219  48.953  62.797  1.00 37.97 ? 353 TYR C CZ  1 
ATOM   9264  O OH  . TYR C 1 315 ? 35.706  49.163  61.517  1.00 37.91 ? 353 TYR C OH  1 
ATOM   9265  N N   . PRO C 1 316 ? 39.856  46.048  68.258  1.00 31.97 ? 354 PRO C N   1 
ATOM   9266  C CA  . PRO C 1 316 ? 40.676  45.703  69.429  1.00 32.18 ? 354 PRO C CA  1 
ATOM   9267  C C   . PRO C 1 316 ? 41.009  46.894  70.317  1.00 33.28 ? 354 PRO C C   1 
ATOM   9268  O O   . PRO C 1 316 ? 40.975  48.029  69.857  1.00 33.71 ? 354 PRO C O   1 
ATOM   9269  C CB  . PRO C 1 316 ? 41.956  45.094  68.789  1.00 31.70 ? 354 PRO C CB  1 
ATOM   9270  C CG  . PRO C 1 316 ? 42.029  45.668  67.434  1.00 29.43 ? 354 PRO C CG  1 
ATOM   9271  C CD  . PRO C 1 316 ? 40.606  45.853  66.998  1.00 31.04 ? 354 PRO C CD  1 
ATOM   9272  N N   . ARG C 1 317 ? 41.249  46.646  71.607  1.00 34.92 ? 355 ARG C N   1 
ATOM   9273  C CA  . ARG C 1 317 ? 42.022  47.561  72.430  1.00 36.20 ? 355 ARG C CA  1 
ATOM   9274  C C   . ARG C 1 317 ? 43.458  47.608  71.895  1.00 36.40 ? 355 ARG C C   1 
ATOM   9275  O O   . ARG C 1 317 ? 43.954  46.636  71.322  1.00 35.85 ? 355 ARG C O   1 
ATOM   9276  C CB  . ARG C 1 317 ? 42.019  47.148  73.909  1.00 36.32 ? 355 ARG C CB  1 
ATOM   9277  C CG  . ARG C 1 317 ? 40.767  47.554  74.663  1.00 38.03 ? 355 ARG C CG  1 
ATOM   9278  C CD  . ARG C 1 317 ? 40.906  47.272  76.192  1.00 39.37 ? 355 ARG C CD  1 
ATOM   9279  N NE  . ARG C 1 317 ? 40.702  45.847  76.483  1.00 41.55 ? 355 ARG C NE  1 
ATOM   9280  C CZ  . ARG C 1 317 ? 39.681  45.314  77.166  1.00 41.25 ? 355 ARG C CZ  1 
ATOM   9281  N NH1 . ARG C 1 317 ? 38.722  46.064  77.703  1.00 39.19 ? 355 ARG C NH1 1 
ATOM   9282  N NH2 . ARG C 1 317 ? 39.635  43.989  77.317  1.00 42.60 ? 355 ARG C NH2 1 
ATOM   9283  N N   . GLN C 1 318 ? 44.106  48.749  72.100  1.00 37.49 ? 356 GLN C N   1 
ATOM   9284  C CA  . GLN C 1 318 ? 45.444  49.082  71.562  1.00 38.63 ? 356 GLN C CA  1 
ATOM   9285  C C   . GLN C 1 318 ? 46.462  47.934  71.485  1.00 38.14 ? 356 GLN C C   1 
ATOM   9286  O O   . GLN C 1 318 ? 46.980  47.588  70.392  1.00 39.41 ? 356 GLN C O   1 
ATOM   9287  C CB  . GLN C 1 318 ? 46.042  50.211  72.394  1.00 39.48 ? 356 GLN C CB  1 
ATOM   9288  C CG  . GLN C 1 318 ? 47.372  50.723  71.846  1.00 43.06 ? 356 GLN C CG  1 
ATOM   9289  C CD  . GLN C 1 318 ? 47.264  52.087  71.189  1.00 46.37 ? 356 GLN C CD  1 
ATOM   9290  O OE1 . GLN C 1 318 ? 47.758  52.292  70.078  1.00 47.77 ? 356 GLN C OE1 1 
ATOM   9291  N NE2 . GLN C 1 318 ? 46.633  53.034  71.886  1.00 48.08 ? 356 GLN C NE2 1 
ATOM   9292  N N   . HIS C 1 319 ? 46.724  47.296  72.606  1.00 36.64 ? 357 HIS C N   1 
ATOM   9293  C CA  . HIS C 1 319 ? 47.682  46.181  72.583  1.00 35.94 ? 357 HIS C CA  1 
ATOM   9294  C C   . HIS C 1 319 ? 47.103  44.786  72.308  1.00 36.19 ? 357 HIS C C   1 
ATOM   9295  O O   . HIS C 1 319 ? 47.855  43.822  72.373  1.00 36.57 ? 357 HIS C O   1 
ATOM   9296  C CB  . HIS C 1 319 ? 48.523  46.223  73.849  1.00 36.08 ? 357 HIS C CB  1 
ATOM   9297  C CG  . HIS C 1 319 ? 49.029  47.588  74.137  1.00 33.79 ? 357 HIS C CG  1 
ATOM   9298  N ND1 . HIS C 1 319 ? 49.806  48.279  73.237  1.00 32.73 ? 357 HIS C ND1 1 
ATOM   9299  C CD2 . HIS C 1 319 ? 48.768  48.442  75.146  1.00 36.15 ? 357 HIS C CD2 1 
ATOM   9300  C CE1 . HIS C 1 319 ? 50.048  49.488  73.706  1.00 34.49 ? 357 HIS C CE1 1 
ATOM   9301  N NE2 . HIS C 1 319 ? 49.443  49.608  74.873  1.00 37.08 ? 357 HIS C NE2 1 
ATOM   9302  N N   . GLU C 1 320 ? 45.811  44.665  71.970  1.00 35.96 ? 358 GLU C N   1 
ATOM   9303  C CA  . GLU C 1 320 ? 45.291  43.383  71.455  1.00 37.53 ? 358 GLU C CA  1 
ATOM   9304  C C   . GLU C 1 320 ? 45.159  43.286  69.931  1.00 35.69 ? 358 GLU C C   1 
ATOM   9305  O O   . GLU C 1 320 ? 44.771  42.246  69.426  1.00 35.75 ? 358 GLU C O   1 
ATOM   9306  C CB  . GLU C 1 320 ? 43.982  42.884  72.138  1.00 38.06 ? 358 GLU C CB  1 
ATOM   9307  C CG  . GLU C 1 320 ? 42.869  43.881  72.470  1.00 40.64 ? 358 GLU C CG  1 
ATOM   9308  C CD  . GLU C 1 320 ? 41.458  43.225  72.468  1.00 40.69 ? 358 GLU C CD  1 
ATOM   9309  O OE1 . GLU C 1 320 ? 41.357  41.982  72.350  1.00 46.30 ? 358 GLU C OE1 1 
ATOM   9310  O OE2 . GLU C 1 320 ? 40.445  43.943  72.561  1.00 42.93 ? 358 GLU C OE2 1 
ATOM   9311  N N   . ALA C 1 321 ? 45.517  44.337  69.201  1.00 34.92 ? 359 ALA C N   1 
ATOM   9312  C CA  . ALA C 1 321 ? 45.517  44.288  67.741  1.00 34.81 ? 359 ALA C CA  1 
ATOM   9313  C C   . ALA C 1 321 ? 46.507  43.225  67.283  1.00 34.80 ? 359 ALA C C   1 
ATOM   9314  O O   . ALA C 1 321 ? 47.579  43.070  67.869  1.00 34.27 ? 359 ALA C O   1 
ATOM   9315  C CB  . ALA C 1 321 ? 45.857  45.657  67.125  1.00 34.88 ? 359 ALA C CB  1 
ATOM   9316  N N   . ASP C 1 322 ? 46.122  42.482  66.257  1.00 35.42 ? 360 ASP C N   1 
ATOM   9317  C CA  . ASP C 1 322 ? 46.941  41.403  65.696  1.00 35.91 ? 360 ASP C CA  1 
ATOM   9318  C C   . ASP C 1 322 ? 46.952  41.531  64.164  1.00 35.28 ? 360 ASP C C   1 
ATOM   9319  O O   . ASP C 1 322 ? 45.896  41.629  63.529  1.00 35.39 ? 360 ASP C O   1 
ATOM   9320  C CB  . ASP C 1 322 ? 46.362  40.033  66.093  1.00 36.83 ? 360 ASP C CB  1 
ATOM   9321  C CG  . ASP C 1 322 ? 47.376  38.902  65.972  1.00 40.08 ? 360 ASP C CG  1 
ATOM   9322  O OD1 . ASP C 1 322 ? 48.021  38.742  64.898  1.00 41.34 ? 360 ASP C OD1 1 
ATOM   9323  O OD2 . ASP C 1 322 ? 47.569  38.190  66.981  1.00 46.00 ? 360 ASP C OD2 1 
ATOM   9324  N N   . ALA C 1 323 ? 48.158  41.492  63.613  1.00 34.82 ? 361 ALA C N   1 
ATOM   9325  C CA  . ALA C 1 323 ? 48.459  41.606  62.187  1.00 34.64 ? 361 ALA C CA  1 
ATOM   9326  C C   . ALA C 1 323 ? 47.846  40.478  61.324  1.00 34.46 ? 361 ALA C C   1 
ATOM   9327  O O   . ALA C 1 323 ? 47.507  40.706  60.135  1.00 34.94 ? 361 ALA C O   1 
ATOM   9328  C CB  . ALA C 1 323 ? 50.027  41.695  62.016  1.00 34.14 ? 361 ALA C CB  1 
ATOM   9329  N N   . ASP C 1 324 ? 47.674  39.295  61.936  1.00 33.93 ? 362 ASP C N   1 
ATOM   9330  C CA  . ASP C 1 324 ? 47.003  38.127  61.340  1.00 33.80 ? 362 ASP C CA  1 
ATOM   9331  C C   . ASP C 1 324 ? 45.462  38.125  61.495  1.00 33.04 ? 362 ASP C C   1 
ATOM   9332  O O   . ASP C 1 324 ? 44.823  37.186  61.078  1.00 30.98 ? 362 ASP C O   1 
ATOM   9333  C CB  . ASP C 1 324 ? 47.532  36.821  61.960  1.00 34.93 ? 362 ASP C CB  1 
ATOM   9334  C CG  . ASP C 1 324 ? 48.977  36.526  61.606  1.00 37.05 ? 362 ASP C CG  1 
ATOM   9335  O OD1 . ASP C 1 324 ? 49.551  37.058  60.635  1.00 44.11 ? 362 ASP C OD1 1 
ATOM   9336  O OD2 . ASP C 1 324 ? 49.563  35.715  62.308  1.00 41.42 ? 362 ASP C OD2 1 
ATOM   9337  N N   . LEU C 1 325 ? 44.868  39.189  62.049  1.00 32.81 ? 363 LEU C N   1 
ATOM   9338  C CA  . LEU C 1 325 ? 43.413  39.309  62.120  1.00 32.24 ? 363 LEU C CA  1 
ATOM   9339  C C   . LEU C 1 325 ? 42.897  40.686  61.633  1.00 32.79 ? 363 LEU C C   1 
ATOM   9340  O O   . LEU C 1 325 ? 42.940  41.685  62.344  1.00 31.70 ? 363 LEU C O   1 
ATOM   9341  C CB  . LEU C 1 325 ? 42.953  39.000  63.540  1.00 32.95 ? 363 LEU C CB  1 
ATOM   9342  C CG  . LEU C 1 325 ? 41.452  39.031  63.851  1.00 30.59 ? 363 LEU C CG  1 
ATOM   9343  C CD1 . LEU C 1 325 ? 40.705  38.266  62.796  1.00 30.23 ? 363 LEU C CD1 1 
ATOM   9344  C CD2 . LEU C 1 325 ? 41.250  38.486  65.301  1.00 31.46 ? 363 LEU C CD2 1 
ATOM   9345  N N   . ILE C 1 326 ? 42.405  40.716  60.399  1.00 32.79 ? 364 ILE C N   1 
ATOM   9346  C CA  . ILE C 1 326 ? 41.932  41.945  59.820  1.00 33.22 ? 364 ILE C CA  1 
ATOM   9347  C C   . ILE C 1 326 ? 40.566  41.683  59.141  1.00 34.14 ? 364 ILE C C   1 
ATOM   9348  O O   . ILE C 1 326 ? 40.167  40.522  58.950  1.00 33.18 ? 364 ILE C O   1 
ATOM   9349  C CB  . ILE C 1 326 ? 42.997  42.585  58.862  1.00 33.40 ? 364 ILE C CB  1 
ATOM   9350  C CG1 . ILE C 1 326 ? 43.343  41.665  57.709  1.00 32.03 ? 364 ILE C CG1 1 
ATOM   9351  C CG2 . ILE C 1 326 ? 44.306  42.956  59.622  1.00 30.87 ? 364 ILE C CG2 1 
ATOM   9352  C CD1 . ILE C 1 326 ? 43.913  42.380  56.552  1.00 30.66 ? 364 ILE C CD1 1 
ATOM   9353  N N   . ASN C 1 327 ? 39.842  42.757  58.831  1.00 33.76 ? 365 ASN C N   1 
ATOM   9354  C CA  . ASN C 1 327 ? 38.601  42.648  58.062  1.00 33.69 ? 365 ASN C CA  1 
ATOM   9355  C C   . ASN C 1 327 ? 38.889  42.987  56.578  1.00 34.88 ? 365 ASN C C   1 
ATOM   9356  O O   . ASN C 1 327 ? 40.021  43.160  56.203  1.00 35.43 ? 365 ASN C O   1 
ATOM   9357  C CB  . ASN C 1 327 ? 37.470  43.472  58.706  1.00 32.49 ? 365 ASN C CB  1 
ATOM   9358  C CG  . ASN C 1 327 ? 37.713  44.962  58.684  1.00 31.59 ? 365 ASN C CG  1 
ATOM   9359  O OD1 . ASN C 1 327 ? 38.501  45.456  57.922  1.00 34.85 ? 365 ASN C OD1 1 
ATOM   9360  N ND2 . ASN C 1 327 ? 37.019  45.676  59.528  1.00 31.40 ? 365 ASN C ND2 1 
ATOM   9361  N N   . ALA C 1 328 ? 37.869  43.077  55.732  1.00 36.79 ? 366 ALA C N   1 
ATOM   9362  C CA  . ALA C 1 328 ? 38.067  43.262  54.299  1.00 36.73 ? 366 ALA C CA  1 
ATOM   9363  C C   . ALA C 1 328 ? 38.457  44.678  53.961  1.00 37.57 ? 366 ALA C C   1 
ATOM   9364  O O   . ALA C 1 328 ? 39.064  44.927  52.892  1.00 37.44 ? 366 ALA C O   1 
ATOM   9365  C CB  . ALA C 1 328 ? 36.796  42.875  53.539  1.00 38.08 ? 366 ALA C CB  1 
ATOM   9366  N N   . GLY C 1 329 ? 38.130  45.610  54.855  1.00 36.31 ? 367 GLY C N   1 
ATOM   9367  C CA  . GLY C 1 329 ? 38.688  46.954  54.792  1.00 35.64 ? 367 GLY C CA  1 
ATOM   9368  C C   . GLY C 1 329 ? 40.120  47.059  55.310  1.00 35.29 ? 367 GLY C C   1 
ATOM   9369  O O   . GLY C 1 329 ? 40.633  48.143  55.438  1.00 33.33 ? 367 GLY C O   1 
ATOM   9370  N N   . LYS C 1 330 ? 40.759  45.925  55.620  1.00 35.31 ? 368 LYS C N   1 
ATOM   9371  C CA  . LYS C 1 330 ? 42.145  45.879  56.112  1.00 35.17 ? 368 LYS C CA  1 
ATOM   9372  C C   . LYS C 1 330 ? 42.372  46.554  57.470  1.00 34.10 ? 368 LYS C C   1 
ATOM   9373  O O   . LYS C 1 330 ? 43.466  47.030  57.752  1.00 33.61 ? 368 LYS C O   1 
ATOM   9374  C CB  . LYS C 1 330 ? 43.096  46.423  55.044  1.00 35.71 ? 368 LYS C CB  1 
ATOM   9375  C CG  . LYS C 1 330 ? 42.983  45.641  53.691  1.00 37.18 ? 368 LYS C CG  1 
ATOM   9376  C CD  . LYS C 1 330 ? 43.846  46.266  52.604  1.00 37.68 ? 368 LYS C CD  1 
ATOM   9377  C CE  . LYS C 1 330 ? 43.177  47.487  51.866  1.00 41.26 ? 368 LYS C CE  1 
ATOM   9378  N NZ  . LYS C 1 330 ? 44.163  48.287  51.069  1.00 42.19 ? 368 LYS C NZ  1 
ATOM   9379  N N   . GLU C 1 331 ? 41.323  46.588  58.295  1.00 33.40 ? 369 GLU C N   1 
ATOM   9380  C CA  . GLU C 1 331 ? 41.358  47.130  59.655  1.00 32.35 ? 369 GLU C CA  1 
ATOM   9381  C C   . GLU C 1 331 ? 41.625  45.914  60.539  1.00 31.01 ? 369 GLU C C   1 
ATOM   9382  O O   . GLU C 1 331 ? 41.101  44.829  60.276  1.00 30.18 ? 369 GLU C O   1 
ATOM   9383  C CB  . GLU C 1 331 ? 40.020  47.769  60.040  1.00 32.12 ? 369 GLU C CB  1 
ATOM   9384  C CG  . GLU C 1 331 ? 39.495  48.926  59.137  1.00 34.40 ? 369 GLU C CG  1 
ATOM   9385  C CD  . GLU C 1 331 ? 38.139  49.489  59.624  1.00 36.01 ? 369 GLU C CD  1 
ATOM   9386  O OE1 . GLU C 1 331 ? 37.122  48.746  59.704  1.00 41.12 ? 369 GLU C OE1 1 
ATOM   9387  O OE2 . GLU C 1 331 ? 38.071  50.694  59.953  1.00 43.57 ? 369 GLU C OE2 1 
ATOM   9388  N N   . THR C 1 332 ? 42.472  46.098  61.547  1.00 30.75 ? 370 THR C N   1 
ATOM   9389  C CA  . THR C 1 332 ? 42.620  45.156  62.676  1.00 31.04 ? 370 THR C CA  1 
ATOM   9390  C C   . THR C 1 332 ? 41.312  45.051  63.449  1.00 30.68 ? 370 THR C C   1 
ATOM   9391  O O   . THR C 1 332 ? 40.667  46.039  63.769  1.00 29.01 ? 370 THR C O   1 
ATOM   9392  C CB  . THR C 1 332 ? 43.734  45.589  63.690  1.00 31.24 ? 370 THR C CB  1 
ATOM   9393  O OG1 . THR C 1 332 ? 43.487  46.916  64.147  1.00 29.96 ? 370 THR C OG1 1 
ATOM   9394  C CG2 . THR C 1 332 ? 45.150  45.517  63.066  1.00 31.42 ? 370 THR C CG2 1 
ATOM   9395  N N   . VAL C 1 333 ? 40.912  43.820  63.722  1.00 31.59 ? 371 VAL C N   1 
ATOM   9396  C CA  . VAL C 1 333 ? 39.621  43.552  64.325  1.00 31.53 ? 371 VAL C CA  1 
ATOM   9397  C C   . VAL C 1 333 ? 39.817  42.494  65.432  1.00 33.11 ? 371 VAL C C   1 
ATOM   9398  O O   . VAL C 1 333 ? 40.948  42.046  65.711  1.00 33.37 ? 371 VAL C O   1 
ATOM   9399  C CB  . VAL C 1 333 ? 38.557  43.090  63.239  1.00 31.98 ? 371 VAL C CB  1 
ATOM   9400  C CG1 . VAL C 1 333 ? 38.346  44.183  62.178  1.00 29.86 ? 371 VAL C CG1 1 
ATOM   9401  C CG2 . VAL C 1 333 ? 38.976  41.742  62.551  1.00 28.03 ? 371 VAL C CG2 1 
ATOM   9402  N N   . THR C 1 334 ? 38.714  42.158  66.100  1.00 33.17 ? 372 THR C N   1 
ATOM   9403  C CA  . THR C 1 334 ? 38.685  41.006  66.996  1.00 33.62 ? 372 THR C CA  1 
ATOM   9404  C C   . THR C 1 334 ? 37.659  39.955  66.483  1.00 32.63 ? 372 THR C C   1 
ATOM   9405  O O   . THR C 1 334 ? 36.932  40.193  65.501  1.00 31.85 ? 372 THR C O   1 
ATOM   9406  C CB  . THR C 1 334 ? 38.343  41.426  68.451  1.00 33.33 ? 372 THR C CB  1 
ATOM   9407  O OG1 . THR C 1 334 ? 36.990  41.842  68.505  1.00 35.10 ? 372 THR C OG1 1 
ATOM   9408  C CG2 . THR C 1 334 ? 39.240  42.555  68.965  1.00 32.28 ? 372 THR C CG2 1 
ATOM   9409  N N   . ILE C 1 335 ? 37.629  38.810  67.159  1.00 32.47 ? 373 ILE C N   1 
ATOM   9410  C CA  . ILE C 1 335 ? 36.638  37.762  66.936  1.00 31.99 ? 373 ILE C CA  1 
ATOM   9411  C C   . ILE C 1 335 ? 35.942  37.456  68.234  1.00 33.04 ? 373 ILE C C   1 
ATOM   9412  O O   . ILE C 1 335 ? 36.520  37.588  69.302  1.00 33.20 ? 373 ILE C O   1 
ATOM   9413  C CB  . ILE C 1 335 ? 37.218  36.452  66.354  1.00 31.71 ? 373 ILE C CB  1 
ATOM   9414  C CG1 . ILE C 1 335 ? 38.468  36.002  67.142  1.00 32.80 ? 373 ILE C CG1 1 
ATOM   9415  C CG2 . ILE C 1 335 ? 37.418  36.630  64.844  1.00 30.77 ? 373 ILE C CG2 1 
ATOM   9416  C CD1 . ILE C 1 335 ? 38.982  34.527  66.923  1.00 30.32 ? 373 ILE C CD1 1 
ATOM   9417  N N   . LEU C 1 336 ? 34.679  37.054  68.119  1.00 33.83 ? 374 LEU C N   1 
ATOM   9418  C CA  . LEU C 1 336 ? 33.852  36.712  69.245  1.00 34.49 ? 374 LEU C CA  1 
ATOM   9419  C C   . LEU C 1 336 ? 33.998  35.213  69.570  1.00 35.27 ? 374 LEU C C   1 
ATOM   9420  O O   . LEU C 1 336 ? 34.351  34.430  68.701  1.00 35.54 ? 374 LEU C O   1 
ATOM   9421  C CB  . LEU C 1 336 ? 32.391  37.040  68.934  1.00 34.05 ? 374 LEU C CB  1 
ATOM   9422  C CG  . LEU C 1 336 ? 32.105  38.525  68.769  1.00 35.23 ? 374 LEU C CG  1 
ATOM   9423  C CD1 . LEU C 1 336 ? 30.663  38.775  68.389  1.00 33.57 ? 374 LEU C CD1 1 
ATOM   9424  C CD2 . LEU C 1 336 ? 32.456  39.264  70.065  1.00 36.03 ? 374 LEU C CD2 1 
ATOM   9425  N N   . PRO C 1 337 ? 33.700  34.816  70.826  1.00 36.09 ? 375 PRO C N   1 
ATOM   9426  C CA  . PRO C 1 337 ? 33.640  33.389  71.169  1.00 36.31 ? 375 PRO C CA  1 
ATOM   9427  C C   . PRO C 1 337 ? 32.794  32.627  70.133  1.00 36.35 ? 375 PRO C C   1 
ATOM   9428  O O   . PRO C 1 337 ? 31.741  33.112  69.727  1.00 35.97 ? 375 PRO C O   1 
ATOM   9429  C CB  . PRO C 1 337 ? 32.957  33.395  72.562  1.00 36.94 ? 375 PRO C CB  1 
ATOM   9430  C CG  . PRO C 1 337 ? 33.441  34.729  73.185  1.00 36.42 ? 375 PRO C CG  1 
ATOM   9431  C CD  . PRO C 1 337 ? 33.372  35.686  71.979  1.00 36.22 ? 375 PRO C CD  1 
ATOM   9432  N N   . GLY C 1 338 ? 33.270  31.483  69.660  1.00 36.52 ? 376 GLY C N   1 
ATOM   9433  C CA  . GLY C 1 338 ? 32.534  30.755  68.611  1.00 36.25 ? 376 GLY C CA  1 
ATOM   9434  C C   . GLY C 1 338 ? 32.777  31.154  67.148  1.00 35.58 ? 376 GLY C C   1 
ATOM   9435  O O   . GLY C 1 338 ? 32.143  30.575  66.241  1.00 36.72 ? 376 GLY C O   1 
ATOM   9436  N N   . ALA C 1 339 ? 33.672  32.123  66.920  1.00 34.40 ? 377 ALA C N   1 
ATOM   9437  C CA  . ALA C 1 339 ? 34.188  32.482  65.593  1.00 33.53 ? 377 ALA C CA  1 
ATOM   9438  C C   . ALA C 1 339 ? 35.031  31.371  64.957  1.00 32.83 ? 377 ALA C C   1 
ATOM   9439  O O   . ALA C 1 339 ? 35.597  30.549  65.636  1.00 31.78 ? 377 ALA C O   1 
ATOM   9440  C CB  . ALA C 1 339 ? 35.012  33.758  65.677  1.00 33.75 ? 377 ALA C CB  1 
ATOM   9441  N N   . SER C 1 340 ? 35.101  31.368  63.627  1.00 32.72 ? 378 SER C N   1 
ATOM   9442  C CA  . SER C 1 340 ? 35.928  30.443  62.881  1.00 32.12 ? 378 SER C CA  1 
ATOM   9443  C C   . SER C 1 340 ? 36.693  31.175  61.793  1.00 33.16 ? 378 SER C C   1 
ATOM   9444  O O   . SER C 1 340 ? 36.286  32.257  61.358  1.00 32.68 ? 378 SER C O   1 
ATOM   9445  C CB  . SER C 1 340 ? 35.030  29.377  62.264  1.00 32.66 ? 378 SER C CB  1 
ATOM   9446  O OG  . SER C 1 340 ? 33.912  29.976  61.623  1.00 30.09 ? 378 SER C OG  1 
ATOM   9447  N N   . PHE C 1 341 ? 37.807  30.570  61.366  1.00 33.82 ? 379 PHE C N   1 
ATOM   9448  C CA  . PHE C 1 341 ? 38.601  31.043  60.254  1.00 33.92 ? 379 PHE C CA  1 
ATOM   9449  C C   . PHE C 1 341 ? 38.530  29.992  59.190  1.00 34.25 ? 379 PHE C C   1 
ATOM   9450  O O   . PHE C 1 341 ? 38.298  28.861  59.498  1.00 34.18 ? 379 PHE C O   1 
ATOM   9451  C CB  . PHE C 1 341 ? 40.043  31.294  60.666  1.00 34.00 ? 379 PHE C CB  1 
ATOM   9452  C CG  . PHE C 1 341 ? 40.187  32.369  61.754  1.00 33.80 ? 379 PHE C CG  1 
ATOM   9453  C CD1 . PHE C 1 341 ? 40.062  33.714  61.451  1.00 33.39 ? 379 PHE C CD1 1 
ATOM   9454  C CD2 . PHE C 1 341 ? 40.466  32.021  63.053  1.00 33.79 ? 379 PHE C CD2 1 
ATOM   9455  C CE1 . PHE C 1 341 ? 40.189  34.686  62.459  1.00 32.42 ? 379 PHE C CE1 1 
ATOM   9456  C CE2 . PHE C 1 341 ? 40.585  32.999  64.079  1.00 33.45 ? 379 PHE C CE2 1 
ATOM   9457  C CZ  . PHE C 1 341 ? 40.460  34.326  63.757  1.00 32.37 ? 379 PHE C CZ  1 
ATOM   9458  N N   . PHE C 1 342 ? 38.625  30.412  57.931  1.00 34.80 ? 380 PHE C N   1 
ATOM   9459  C CA  . PHE C 1 342 ? 38.587  29.522  56.768  1.00 34.55 ? 380 PHE C CA  1 
ATOM   9460  C C   . PHE C 1 342 ? 39.279  30.226  55.611  1.00 35.17 ? 380 PHE C C   1 
ATOM   9461  O O   . PHE C 1 342 ? 39.618  31.414  55.681  1.00 34.32 ? 380 PHE C O   1 
ATOM   9462  C CB  . PHE C 1 342 ? 37.155  29.095  56.419  1.00 34.34 ? 380 PHE C CB  1 
ATOM   9463  C CG  . PHE C 1 342 ? 36.138  30.132  56.689  1.00 33.93 ? 380 PHE C CG  1 
ATOM   9464  C CD1 . PHE C 1 342 ? 35.829  31.096  55.718  1.00 34.14 ? 380 PHE C CD1 1 
ATOM   9465  C CD2 . PHE C 1 342 ? 35.511  30.188  57.913  1.00 33.19 ? 380 PHE C CD2 1 
ATOM   9466  C CE1 . PHE C 1 342 ? 34.908  32.058  55.987  1.00 33.78 ? 380 PHE C CE1 1 
ATOM   9467  C CE2 . PHE C 1 342 ? 34.583  31.171  58.202  1.00 33.22 ? 380 PHE C CE2 1 
ATOM   9468  C CZ  . PHE C 1 342 ? 34.277  32.092  57.265  1.00 34.72 ? 380 PHE C CZ  1 
ATOM   9469  N N   . SER C 1 343 ? 39.525  29.491  54.535  1.00 36.27 ? 381 SER C N   1 
ATOM   9470  C CA  . SER C 1 343 ? 40.247  30.041  53.423  1.00 36.13 ? 381 SER C CA  1 
ATOM   9471  C C   . SER C 1 343 ? 39.342  30.933  52.578  1.00 36.64 ? 381 SER C C   1 
ATOM   9472  O O   . SER C 1 343 ? 38.159  30.950  52.716  1.00 36.69 ? 381 SER C O   1 
ATOM   9473  C CB  . SER C 1 343 ? 40.783  28.883  52.592  1.00 37.26 ? 381 SER C CB  1 
ATOM   9474  O OG  . SER C 1 343 ? 39.703  28.100  52.047  1.00 36.20 ? 381 SER C OG  1 
ATOM   9475  N N   . SER C 1 344 ? 39.934  31.642  51.658  1.00 36.91 ? 382 SER C N   1 
ATOM   9476  C CA  . SER C 1 344 ? 39.202  32.442  50.700  1.00 37.38 ? 382 SER C CA  1 
ATOM   9477  C C   . SER C 1 344 ? 38.336  31.679  49.708  1.00 36.52 ? 382 SER C C   1 
ATOM   9478  O O   . SER C 1 344 ? 37.271  32.154  49.365  1.00 37.07 ? 382 SER C O   1 
ATOM   9479  C CB  . SER C 1 344 ? 40.172  33.332  49.930  1.00 37.23 ? 382 SER C CB  1 
ATOM   9480  O OG  . SER C 1 344 ? 40.856  34.172  50.823  1.00 40.77 ? 382 SER C OG  1 
ATOM   9481  N N   . ASP C 1 345 ? 38.747  30.499  49.250  1.00 37.29 ? 383 ASP C N   1 
ATOM   9482  C CA  . ASP C 1 345 ? 37.834  29.695  48.419  1.00 37.26 ? 383 ASP C CA  1 
ATOM   9483  C C   . ASP C 1 345 ? 36.557  29.316  49.186  1.00 36.53 ? 383 ASP C C   1 
ATOM   9484  O O   . ASP C 1 345 ? 35.487  29.245  48.612  1.00 37.46 ? 383 ASP C O   1 
ATOM   9485  C CB  . ASP C 1 345 ? 38.513  28.465  47.772  1.00 37.30 ? 383 ASP C CB  1 
ATOM   9486  C CG  . ASP C 1 345 ? 39.360  27.644  48.745  1.00 41.23 ? 383 ASP C CG  1 
ATOM   9487  O OD1 . ASP C 1 345 ? 40.246  28.196  49.453  1.00 43.76 ? 383 ASP C OD1 1 
ATOM   9488  O OD2 . ASP C 1 345 ? 39.173  26.410  48.766  1.00 44.99 ? 383 ASP C OD2 1 
ATOM   9489  N N   . GLU C 1 346 ? 36.685  29.046  50.476  1.00 36.00 ? 384 GLU C N   1 
ATOM   9490  C CA  . GLU C 1 346 ? 35.583  28.604  51.314  1.00 35.29 ? 384 GLU C CA  1 
ATOM   9491  C C   . GLU C 1 346 ? 34.719  29.799  51.682  1.00 34.39 ? 384 GLU C C   1 
ATOM   9492  O O   . GLU C 1 346 ? 33.502  29.723  51.751  1.00 34.83 ? 384 GLU C O   1 
ATOM   9493  C CB  . GLU C 1 346 ? 36.129  27.897  52.573  1.00 35.57 ? 384 GLU C CB  1 
ATOM   9494  C CG  . GLU C 1 346 ? 35.074  27.431  53.556  1.00 40.19 ? 384 GLU C CG  1 
ATOM   9495  C CD  . GLU C 1 346 ? 33.997  26.536  52.904  1.00 48.22 ? 384 GLU C CD  1 
ATOM   9496  O OE1 . GLU C 1 346 ? 34.375  25.771  51.972  1.00 51.97 ? 384 GLU C OE1 1 
ATOM   9497  O OE2 . GLU C 1 346 ? 32.794  26.645  53.272  1.00 50.72 ? 384 GLU C OE2 1 
ATOM   9498  N N   . SER C 1 347 ? 35.346  30.912  51.945  1.00 33.74 ? 385 SER C N   1 
ATOM   9499  C CA  . SER C 1 347 ? 34.605  32.114  52.188  1.00 33.94 ? 385 SER C CA  1 
ATOM   9500  C C   . SER C 1 347 ? 33.625  32.458  51.035  1.00 32.78 ? 385 SER C C   1 
ATOM   9501  O O   . SER C 1 347 ? 32.459  32.725  51.233  1.00 33.04 ? 385 SER C O   1 
ATOM   9502  C CB  . SER C 1 347 ? 35.596  33.257  52.368  1.00 33.45 ? 385 SER C CB  1 
ATOM   9503  O OG  . SER C 1 347 ? 34.859  34.434  52.507  1.00 36.31 ? 385 SER C OG  1 
ATOM   9504  N N   . PHE C 1 348 ? 34.106  32.400  49.831  1.00 32.34 ? 386 PHE C N   1 
ATOM   9505  C CA  . PHE C 1 348 ? 33.283  32.693  48.681  1.00 33.59 ? 386 PHE C CA  1 
ATOM   9506  C C   . PHE C 1 348 ? 32.301  31.629  48.245  1.00 33.46 ? 386 PHE C C   1 
ATOM   9507  O O   . PHE C 1 348 ? 31.314  31.969  47.647  1.00 35.51 ? 386 PHE C O   1 
ATOM   9508  C CB  . PHE C 1 348 ? 34.165  33.195  47.560  1.00 33.41 ? 386 PHE C CB  1 
ATOM   9509  C CG  . PHE C 1 348 ? 34.593  34.619  47.790  1.00 34.37 ? 386 PHE C CG  1 
ATOM   9510  C CD1 . PHE C 1 348 ? 33.694  35.651  47.572  1.00 33.28 ? 386 PHE C CD1 1 
ATOM   9511  C CD2 . PHE C 1 348 ? 35.862  34.915  48.305  1.00 32.39 ? 386 PHE C CD2 1 
ATOM   9512  C CE1 . PHE C 1 348 ? 34.073  36.980  47.798  1.00 35.74 ? 386 PHE C CE1 1 
ATOM   9513  C CE2 . PHE C 1 348 ? 36.235  36.229  48.534  1.00 31.68 ? 386 PHE C CE2 1 
ATOM   9514  C CZ  . PHE C 1 348 ? 35.351  37.266  48.272  1.00 33.52 ? 386 PHE C CZ  1 
ATOM   9515  N N   . ALA C 1 349 ? 32.549  30.363  48.565  1.00 33.74 ? 387 ALA C N   1 
ATOM   9516  C CA  . ALA C 1 349 ? 31.534  29.321  48.514  1.00 33.03 ? 387 ALA C CA  1 
ATOM   9517  C C   . ALA C 1 349 ? 30.356  29.691  49.397  1.00 33.95 ? 387 ALA C C   1 
ATOM   9518  O O   . ALA C 1 349 ? 29.177  29.542  49.046  1.00 33.23 ? 387 ALA C O   1 
ATOM   9519  C CB  . ALA C 1 349 ? 32.182  27.957  48.978  1.00 32.73 ? 387 ALA C CB  1 
ATOM   9520  N N   . MET C 1 350 ? 30.673  30.178  50.588  1.00 34.38 ? 388 MET C N   1 
ATOM   9521  C CA  . MET C 1 350 ? 29.673  30.605  51.531  1.00 34.68 ? 388 MET C CA  1 
ATOM   9522  C C   . MET C 1 350 ? 28.833  31.745  50.977  1.00 33.57 ? 388 MET C C   1 
ATOM   9523  O O   . MET C 1 350 ? 27.609  31.735  51.085  1.00 33.39 ? 388 MET C O   1 
ATOM   9524  C CB  . MET C 1 350 ? 30.432  31.040  52.783  1.00 35.74 ? 388 MET C CB  1 
ATOM   9525  C CG  . MET C 1 350 ? 29.737  31.005  54.061  1.00 37.09 ? 388 MET C CG  1 
ATOM   9526  S SD  . MET C 1 350 ? 30.990  31.454  55.356  1.00 38.52 ? 388 MET C SD  1 
ATOM   9527  C CE  . MET C 1 350 ? 31.786  29.884  55.779  1.00 34.58 ? 388 MET C CE  1 
ATOM   9528  N N   . ILE C 1 351 ? 29.503  32.735  50.383  1.00 33.43 ? 389 ILE C N   1 
ATOM   9529  C CA  . ILE C 1 351 ? 28.845  33.917  49.779  1.00 33.17 ? 389 ILE C CA  1 
ATOM   9530  C C   . ILE C 1 351 ? 28.085  33.565  48.469  1.00 32.87 ? 389 ILE C C   1 
ATOM   9531  O O   . ILE C 1 351 ? 26.920  33.790  48.335  1.00 33.43 ? 389 ILE C O   1 
ATOM   9532  C CB  . ILE C 1 351 ? 29.893  35.023  49.515  1.00 32.32 ? 389 ILE C CB  1 
ATOM   9533  C CG1 . ILE C 1 351 ? 30.470  35.511  50.859  1.00 30.77 ? 389 ILE C CG1 1 
ATOM   9534  C CG2 . ILE C 1 351 ? 29.314  36.134  48.619  1.00 33.13 ? 389 ILE C CG2 1 
ATOM   9535  C CD1 . ILE C 1 351 ? 31.811  36.209  50.714  1.00 27.51 ? 389 ILE C CD1 1 
ATOM   9536  N N   . ARG C 1 352 ? 28.778  32.983  47.519  1.00 33.55 ? 390 ARG C N   1 
ATOM   9537  C CA  . ARG C 1 352 ? 28.192  32.582  46.223  1.00 33.43 ? 390 ARG C CA  1 
ATOM   9538  C C   . ARG C 1 352 ? 27.070  31.527  46.400  1.00 32.50 ? 390 ARG C C   1 
ATOM   9539  O O   . ARG C 1 352 ? 26.112  31.495  45.645  1.00 33.81 ? 390 ARG C O   1 
ATOM   9540  C CB  . ARG C 1 352 ? 29.383  32.138  45.329  1.00 33.83 ? 390 ARG C CB  1 
ATOM   9541  C CG  . ARG C 1 352 ? 29.201  32.111  43.828  1.00 34.82 ? 390 ARG C CG  1 
ATOM   9542  C CD  . ARG C 1 352 ? 30.058  31.017  43.212  1.00 36.98 ? 390 ARG C CD  1 
ATOM   9543  N NE  . ARG C 1 352 ? 31.457  31.416  43.295  1.00 37.39 ? 390 ARG C NE  1 
ATOM   9544  C CZ  . ARG C 1 352 ? 32.393  30.880  44.068  1.00 37.35 ? 390 ARG C CZ  1 
ATOM   9545  N NH1 . ARG C 1 352 ? 32.178  29.827  44.810  1.00 36.82 ? 390 ARG C NH1 1 
ATOM   9546  N NH2 . ARG C 1 352 ? 33.587  31.439  44.062  1.00 41.73 ? 390 ARG C NH2 1 
ATOM   9547  N N   . GLY C 1 353 ? 27.142  30.699  47.439  1.00 31.71 ? 391 GLY C N   1 
ATOM   9548  C CA  . GLY C 1 353 ? 26.156  29.662  47.674  1.00 32.18 ? 391 GLY C CA  1 
ATOM   9549  C C   . GLY C 1 353 ? 24.904  30.159  48.382  1.00 32.10 ? 391 GLY C C   1 
ATOM   9550  O O   . GLY C 1 353 ? 23.988  29.415  48.605  1.00 32.58 ? 391 GLY C O   1 
ATOM   9551  N N   . GLY C 1 354 ? 24.862  31.429  48.749  1.00 31.73 ? 392 GLY C N   1 
ATOM   9552  C CA  . GLY C 1 354 ? 23.644  32.041  49.289  1.00 31.99 ? 392 GLY C CA  1 
ATOM   9553  C C   . GLY C 1 354 ? 23.442  31.816  50.754  1.00 31.04 ? 392 GLY C C   1 
ATOM   9554  O O   . GLY C 1 354 ? 22.302  31.835  51.251  1.00 32.15 ? 392 GLY C O   1 
ATOM   9555  N N   . HIS C 1 355 ? 24.544  31.619  51.461  1.00 31.08 ? 393 HIS C N   1 
ATOM   9556  C CA  . HIS C 1 355 ? 24.489  31.270  52.882  1.00 30.64 ? 393 HIS C CA  1 
ATOM   9557  C C   . HIS C 1 355 ? 24.415  32.429  53.797  1.00 30.17 ? 393 HIS C C   1 
ATOM   9558  O O   . HIS C 1 355 ? 23.991  32.291  54.909  1.00 32.02 ? 393 HIS C O   1 
ATOM   9559  C CB  . HIS C 1 355 ? 25.677  30.412  53.261  1.00 29.67 ? 393 HIS C CB  1 
ATOM   9560  C CG  . HIS C 1 355 ? 25.689  29.091  52.570  1.00 29.57 ? 393 HIS C CG  1 
ATOM   9561  N ND1 . HIS C 1 355 ? 25.017  27.993  53.051  1.00 30.38 ? 393 HIS C ND1 1 
ATOM   9562  C CD2 . HIS C 1 355 ? 26.260  28.700  51.410  1.00 32.28 ? 393 HIS C CD2 1 
ATOM   9563  C CE1 . HIS C 1 355 ? 25.177  26.981  52.222  1.00 29.81 ? 393 HIS C CE1 1 
ATOM   9564  N NE2 . HIS C 1 355 ? 25.938  27.380  51.224  1.00 31.11 ? 393 HIS C NE2 1 
ATOM   9565  N N   . VAL C 1 356 ? 24.898  33.562  53.333  1.00 32.32 ? 394 VAL C N   1 
ATOM   9566  C CA  . VAL C 1 356 ? 24.841  34.829  54.043  1.00 32.66 ? 394 VAL C CA  1 
ATOM   9567  C C   . VAL C 1 356 ? 23.488  35.405  53.752  1.00 32.62 ? 394 VAL C C   1 
ATOM   9568  O O   . VAL C 1 356 ? 23.076  35.446  52.597  1.00 33.57 ? 394 VAL C O   1 
ATOM   9569  C CB  . VAL C 1 356 ? 25.942  35.748  53.526  1.00 33.17 ? 394 VAL C CB  1 
ATOM   9570  C CG1 . VAL C 1 356 ? 25.782  37.174  54.007  1.00 34.30 ? 394 VAL C CG1 1 
ATOM   9571  C CG2 . VAL C 1 356 ? 27.312  35.158  53.855  1.00 30.55 ? 394 VAL C CG2 1 
ATOM   9572  N N   . ASP C 1 357 ? 22.806  35.835  54.806  1.00 32.44 ? 395 ASP C N   1 
ATOM   9573  C CA  . ASP C 1 357 ? 21.470  36.399  54.742  1.00 32.78 ? 395 ASP C CA  1 
ATOM   9574  C C   . ASP C 1 357 ? 21.361  37.836  54.173  1.00 32.52 ? 395 ASP C C   1 
ATOM   9575  O O   . ASP C 1 357 ? 20.394  38.162  53.494  1.00 33.06 ? 395 ASP C O   1 
ATOM   9576  C CB  . ASP C 1 357 ? 20.864  36.390  56.155  1.00 32.91 ? 395 ASP C CB  1 
ATOM   9577  C CG  . ASP C 1 357 ? 20.799  35.005  56.755  1.00 35.39 ? 395 ASP C CG  1 
ATOM   9578  O OD1 . ASP C 1 357 ? 20.315  34.084  56.063  1.00 41.34 ? 395 ASP C OD1 1 
ATOM   9579  O OD2 . ASP C 1 357 ? 21.211  34.821  57.917  1.00 34.62 ? 395 ASP C OD2 1 
ATOM   9580  N N   . LEU C 1 358 ? 22.325  38.690  54.480  1.00 33.62 ? 396 LEU C N   1 
ATOM   9581  C CA  . LEU C 1 358 ? 22.309  40.115  54.084  1.00 33.59 ? 396 LEU C CA  1 
ATOM   9582  C C   . LEU C 1 358 ? 23.722  40.568  53.775  1.00 34.33 ? 396 LEU C C   1 
ATOM   9583  O O   . LEU C 1 358 ? 24.656  40.242  54.516  1.00 34.20 ? 396 LEU C O   1 
ATOM   9584  C CB  . LEU C 1 358 ? 21.767  40.996  55.198  1.00 34.58 ? 396 LEU C CB  1 
ATOM   9585  C CG  . LEU C 1 358 ? 21.659  42.541  55.186  1.00 35.44 ? 396 LEU C CG  1 
ATOM   9586  C CD1 . LEU C 1 358 ? 20.241  43.030  54.859  1.00 42.61 ? 396 LEU C CD1 1 
ATOM   9587  C CD2 . LEU C 1 358 ? 21.963  43.074  56.566  1.00 39.62 ? 396 LEU C CD2 1 
ATOM   9588  N N   . THR C 1 359 ? 23.863  41.240  52.637  1.00 34.68 ? 397 THR C N   1 
ATOM   9589  C CA  . THR C 1 359 ? 25.023  42.049  52.312  1.00 36.98 ? 397 THR C CA  1 
ATOM   9590  C C   . THR C 1 359 ? 24.600  43.500  52.308  1.00 36.22 ? 397 THR C C   1 
ATOM   9591  O O   . THR C 1 359 ? 23.574  43.837  51.715  1.00 35.22 ? 397 THR C O   1 
ATOM   9592  C CB  . THR C 1 359 ? 25.576  41.780  50.891  1.00 37.14 ? 397 THR C CB  1 
ATOM   9593  O OG1 . THR C 1 359 ? 25.751  40.381  50.748  1.00 42.13 ? 397 THR C OG1 1 
ATOM   9594  C CG2 . THR C 1 359 ? 26.932  42.449  50.766  1.00 39.77 ? 397 THR C CG2 1 
ATOM   9595  N N   . MET C 1 360 ? 25.408  44.320  52.977  1.00 35.56 ? 398 MET C N   1 
ATOM   9596  C CA  . MET C 1 360 ? 25.235  45.755  53.057  1.00 36.78 ? 398 MET C CA  1 
ATOM   9597  C C   . MET C 1 360 ? 26.454  46.393  52.372  1.00 35.46 ? 398 MET C C   1 
ATOM   9598  O O   . MET C 1 360 ? 27.599  46.091  52.712  1.00 34.29 ? 398 MET C O   1 
ATOM   9599  C CB  . MET C 1 360 ? 25.107  46.189  54.505  1.00 36.70 ? 398 MET C CB  1 
ATOM   9600  C CG  . MET C 1 360 ? 24.585  47.637  54.711  1.00 38.04 ? 398 MET C CG  1 
ATOM   9601  S SD  . MET C 1 360 ? 24.057  47.842  56.446  1.00 43.18 ? 398 MET C SD  1 
ATOM   9602  C CE  . MET C 1 360 ? 22.320  47.273  56.374  1.00 35.51 ? 398 MET C CE  1 
ATOM   9603  N N   . LEU C 1 361 ? 26.187  47.217  51.364  1.00 34.87 ? 399 LEU C N   1 
ATOM   9604  C CA  . LEU C 1 361 ? 27.211  47.732  50.456  1.00 35.24 ? 399 LEU C CA  1 
ATOM   9605  C C   . LEU C 1 361 ? 27.009  49.220  50.261  1.00 34.37 ? 399 LEU C C   1 
ATOM   9606  O O   . LEU C 1 361 ? 25.886  49.686  50.331  1.00 32.59 ? 399 LEU C O   1 
ATOM   9607  C CB  . LEU C 1 361 ? 27.135  47.046  49.086  1.00 36.31 ? 399 LEU C CB  1 
ATOM   9608  C CG  . LEU C 1 361 ? 27.656  45.625  48.983  1.00 40.23 ? 399 LEU C CG  1 
ATOM   9609  C CD1 . LEU C 1 361 ? 28.060  45.335  47.533  1.00 46.17 ? 399 LEU C CD1 1 
ATOM   9610  C CD2 . LEU C 1 361 ? 28.833  45.366  49.931  1.00 41.04 ? 399 LEU C CD2 1 
ATOM   9611  N N   . GLY C 1 362 ? 28.107  49.949  50.037  1.00 33.59 ? 400 GLY C N   1 
ATOM   9612  C CA  . GLY C 1 362 ? 28.025  51.326  49.526  1.00 33.22 ? 400 GLY C CA  1 
ATOM   9613  C C   . GLY C 1 362 ? 27.823  51.324  48.019  1.00 32.10 ? 400 GLY C C   1 
ATOM   9614  O O   . GLY C 1 362 ? 27.982  50.299  47.348  1.00 31.36 ? 400 GLY C O   1 
ATOM   9615  N N   . ALA C 1 363 ? 27.451  52.475  47.473  1.00 32.31 ? 401 ALA C N   1 
ATOM   9616  C CA  . ALA C 1 363 ? 27.336  52.610  46.015  1.00 32.81 ? 401 ALA C CA  1 
ATOM   9617  C C   . ALA C 1 363 ? 27.660  54.007  45.533  1.00 32.77 ? 401 ALA C C   1 
ATOM   9618  O O   . ALA C 1 363 ? 27.550  54.994  46.264  1.00 32.41 ? 401 ALA C O   1 
ATOM   9619  C CB  . ALA C 1 363 ? 25.912  52.190  45.540  1.00 31.81 ? 401 ALA C CB  1 
ATOM   9620  N N   . MET C 1 364 ? 27.981  54.089  44.258  1.00 33.36 ? 402 MET C N   1 
ATOM   9621  C CA  . MET C 1 364 ? 28.035  55.366  43.572  1.00 34.67 ? 402 MET C CA  1 
ATOM   9622  C C   . MET C 1 364 ? 26.740  55.608  42.812  1.00 33.57 ? 402 MET C C   1 
ATOM   9623  O O   . MET C 1 364 ? 26.259  56.733  42.705  1.00 34.02 ? 402 MET C O   1 
ATOM   9624  C CB  . MET C 1 364 ? 29.207  55.357  42.631  1.00 35.27 ? 402 MET C CB  1 
ATOM   9625  C CG  . MET C 1 364 ? 30.517  55.351  43.387  1.00 37.23 ? 402 MET C CG  1 
ATOM   9626  S SD  . MET C 1 364 ? 31.873  55.173  42.278  1.00 40.42 ? 402 MET C SD  1 
ATOM   9627  C CE  . MET C 1 364 ? 31.710  53.527  41.666  1.00 34.76 ? 402 MET C CE  1 
ATOM   9628  N N   . GLN C 1 365 ? 26.154  54.534  42.298  1.00 32.40 ? 403 GLN C N   1 
ATOM   9629  C CA  . GLN C 1 365 ? 24.895  54.640  41.597  1.00 31.31 ? 403 GLN C CA  1 
ATOM   9630  C C   . GLN C 1 365 ? 24.127  53.377  41.830  1.00 31.58 ? 403 GLN C C   1 
ATOM   9631  O O   . GLN C 1 365 ? 24.703  52.304  41.994  1.00 30.80 ? 403 GLN C O   1 
ATOM   9632  C CB  . GLN C 1 365 ? 25.108  54.841  40.091  1.00 30.16 ? 403 GLN C CB  1 
ATOM   9633  C CG  . GLN C 1 365 ? 25.951  56.032  39.703  1.00 29.61 ? 403 GLN C CG  1 
ATOM   9634  C CD  . GLN C 1 365 ? 26.121  56.123  38.216  1.00 26.50 ? 403 GLN C CD  1 
ATOM   9635  O OE1 . GLN C 1 365 ? 25.975  55.128  37.499  1.00 27.78 ? 403 GLN C OE1 1 
ATOM   9636  N NE2 . GLN C 1 365 ? 26.410  57.299  37.732  1.00 26.81 ? 403 GLN C NE2 1 
ATOM   9637  N N   . VAL C 1 366 ? 22.809  53.523  41.911  1.00 32.49 ? 404 VAL C N   1 
ATOM   9638  C CA  . VAL C 1 366 ? 21.904  52.395  41.891  1.00 32.73 ? 404 VAL C CA  1 
ATOM   9639  C C   . VAL C 1 366 ? 20.843  52.696  40.824  1.00 32.91 ? 404 VAL C C   1 
ATOM   9640  O O   . VAL C 1 366 ? 20.416  53.832  40.692  1.00 33.41 ? 404 VAL C O   1 
ATOM   9641  C CB  . VAL C 1 366 ? 21.225  52.154  43.272  1.00 33.12 ? 404 VAL C CB  1 
ATOM   9642  C CG1 . VAL C 1 366 ? 20.368  50.917  43.189  1.00 35.27 ? 404 VAL C CG1 1 
ATOM   9643  C CG2 . VAL C 1 366 ? 22.245  51.961  44.391  1.00 32.87 ? 404 VAL C CG2 1 
ATOM   9644  N N   . SER C 1 367 ? 20.426  51.708  40.037  1.00 33.24 ? 405 SER C N   1 
ATOM   9645  C CA  . SER C 1 367 ? 19.302  51.962  39.136  1.00 33.07 ? 405 SER C CA  1 
ATOM   9646  C C   . SER C 1 367 ? 17.924  51.517  39.648  1.00 33.70 ? 405 SER C C   1 
ATOM   9647  O O   . SER C 1 367 ? 17.787  50.773  40.640  1.00 33.82 ? 405 SER C O   1 
ATOM   9648  C CB  . SER C 1 367 ? 19.540  51.380  37.770  1.00 33.05 ? 405 SER C CB  1 
ATOM   9649  O OG  . SER C 1 367 ? 19.134  50.044  37.761  1.00 33.26 ? 405 SER C OG  1 
ATOM   9650  N N   . LYS C 1 368 ? 16.909  52.028  38.938  1.00 34.03 ? 406 LYS C N   1 
ATOM   9651  C CA  . LYS C 1 368 ? 15.479  51.778  39.160  1.00 34.02 ? 406 LYS C CA  1 
ATOM   9652  C C   . LYS C 1 368 ? 15.123  50.280  39.353  1.00 33.96 ? 406 LYS C C   1 
ATOM   9653  O O   . LYS C 1 368 ? 14.243  49.927  40.141  1.00 33.20 ? 406 LYS C O   1 
ATOM   9654  C CB  . LYS C 1 368 ? 14.762  52.342  37.929  1.00 34.63 ? 406 LYS C CB  1 
ATOM   9655  C CG  . LYS C 1 368 ? 13.296  52.315  37.920  1.00 36.34 ? 406 LYS C CG  1 
ATOM   9656  C CD  . LYS C 1 368 ? 12.812  52.819  36.582  1.00 38.30 ? 406 LYS C CD  1 
ATOM   9657  C CE  . LYS C 1 368 ? 11.308  52.862  36.538  1.00 39.50 ? 406 LYS C CE  1 
ATOM   9658  N NZ  . LYS C 1 368 ? 10.812  53.304  35.187  1.00 40.89 ? 406 LYS C NZ  1 
ATOM   9659  N N   . TYR C 1 369 ? 15.831  49.413  38.634  1.00 33.72 ? 407 TYR C N   1 
ATOM   9660  C CA  . TYR C 1 369 ? 15.574  47.983  38.630  1.00 34.22 ? 407 TYR C CA  1 
ATOM   9661  C C   . TYR C 1 369 ? 16.663  47.194  39.391  1.00 34.89 ? 407 TYR C C   1 
ATOM   9662  O O   . TYR C 1 369 ? 16.745  45.997  39.273  1.00 36.08 ? 407 TYR C O   1 
ATOM   9663  C CB  . TYR C 1 369 ? 15.476  47.523  37.159  1.00 34.17 ? 407 TYR C CB  1 
ATOM   9664  C CG  . TYR C 1 369 ? 14.300  48.147  36.406  1.00 35.31 ? 407 TYR C CG  1 
ATOM   9665  C CD1 . TYR C 1 369 ? 13.004  47.864  36.776  1.00 34.72 ? 407 TYR C CD1 1 
ATOM   9666  C CD2 . TYR C 1 369 ? 14.495  49.038  35.335  1.00 35.01 ? 407 TYR C CD2 1 
ATOM   9667  C CE1 . TYR C 1 369 ? 11.914  48.452  36.125  1.00 36.06 ? 407 TYR C CE1 1 
ATOM   9668  C CE2 . TYR C 1 369 ? 13.412  49.626  34.670  1.00 35.32 ? 407 TYR C CE2 1 
ATOM   9669  C CZ  . TYR C 1 369 ? 12.118  49.315  35.060  1.00 35.07 ? 407 TYR C CZ  1 
ATOM   9670  O OH  . TYR C 1 369 ? 11.016  49.863  34.426  1.00 36.39 ? 407 TYR C OH  1 
ATOM   9671  N N   . GLY C 1 370 ? 17.558  47.884  40.089  1.00 35.27 ? 408 GLY C N   1 
ATOM   9672  C CA  . GLY C 1 370 ? 18.404  47.267  41.072  1.00 35.15 ? 408 GLY C CA  1 
ATOM   9673  C C   . GLY C 1 370 ? 19.834  47.053  40.666  1.00 35.34 ? 408 GLY C C   1 
ATOM   9674  O O   . GLY C 1 370 ? 20.509  46.328  41.346  1.00 36.58 ? 408 GLY C O   1 
ATOM   9675  N N   . ASP C 1 371 ? 20.281  47.649  39.557  1.00 34.92 ? 409 ASP C N   1 
ATOM   9676  C CA  . ASP C 1 371 ? 21.664  47.581  39.129  1.00 35.30 ? 409 ASP C CA  1 
ATOM   9677  C C   . ASP C 1 371 ? 22.518  48.407  40.079  1.00 34.51 ? 409 ASP C C   1 
ATOM   9678  O O   . ASP C 1 371 ? 22.055  49.427  40.574  1.00 34.27 ? 409 ASP C O   1 
ATOM   9679  C CB  . ASP C 1 371 ? 21.870  48.134  37.712  1.00 35.76 ? 409 ASP C CB  1 
ATOM   9680  C CG  . ASP C 1 371 ? 21.045  47.404  36.634  1.00 39.04 ? 409 ASP C CG  1 
ATOM   9681  O OD1 . ASP C 1 371 ? 20.382  46.403  36.939  1.00 42.18 ? 409 ASP C OD1 1 
ATOM   9682  O OD2 . ASP C 1 371 ? 21.066  47.861  35.456  1.00 43.79 ? 409 ASP C OD2 1 
ATOM   9683  N N   . LEU C 1 372 ? 23.771  47.992  40.281  1.00 32.75 ? 410 LEU C N   1 
ATOM   9684  C CA  . LEU C 1 372 ? 24.646  48.621  41.248  1.00 32.46 ? 410 LEU C CA  1 
ATOM   9685  C C   . LEU C 1 372 ? 25.928  49.001  40.573  1.00 31.56 ? 410 LEU C C   1 
ATOM   9686  O O   . LEU C 1 372 ? 26.507  48.187  39.862  1.00 31.17 ? 410 LEU C O   1 
ATOM   9687  C CB  . LEU C 1 372 ? 24.936  47.638  42.397  1.00 32.56 ? 410 LEU C CB  1 
ATOM   9688  C CG  . LEU C 1 372 ? 25.949  48.011  43.461  1.00 31.20 ? 410 LEU C CG  1 
ATOM   9689  C CD1 . LEU C 1 372 ? 25.522  49.223  44.142  1.00 32.23 ? 410 LEU C CD1 1 
ATOM   9690  C CD2 . LEU C 1 372 ? 26.114  46.888  44.433  1.00 33.31 ? 410 LEU C CD2 1 
ATOM   9691  N N   . ALA C 1 373 ? 26.360  50.245  40.767  1.00 31.40 ? 411 ALA C N   1 
ATOM   9692  C CA  . ALA C 1 373 ? 27.676  50.676  40.302  1.00 32.39 ? 411 ALA C CA  1 
ATOM   9693  C C   . ALA C 1 373 ? 28.494  51.102  41.525  1.00 32.82 ? 411 ALA C C   1 
ATOM   9694  O O   . ALA C 1 373 ? 28.161  52.063  42.179  1.00 33.36 ? 411 ALA C O   1 
ATOM   9695  C CB  . ALA C 1 373 ? 27.533  51.805  39.286  1.00 31.95 ? 411 ALA C CB  1 
ATOM   9696  N N   . ASN C 1 374 ? 29.554  50.381  41.857  1.00 33.64 ? 412 ASN C N   1 
ATOM   9697  C CA  . ASN C 1 374 ? 30.337  50.755  43.030  1.00 33.89 ? 412 ASN C CA  1 
ATOM   9698  C C   . ASN C 1 374 ? 31.813  50.388  42.987  1.00 33.34 ? 412 ASN C C   1 
ATOM   9699  O O   . ASN C 1 374 ? 32.444  50.417  44.015  1.00 34.29 ? 412 ASN C O   1 
ATOM   9700  C CB  . ASN C 1 374 ? 29.642  50.215  44.313  1.00 34.10 ? 412 ASN C CB  1 
ATOM   9701  C CG  . ASN C 1 374 ? 30.127  48.816  44.784  1.00 37.42 ? 412 ASN C CG  1 
ATOM   9702  O OD1 . ASN C 1 374 ? 30.705  48.008  44.031  1.00 39.79 ? 412 ASN C OD1 1 
ATOM   9703  N ND2 . ASN C 1 374 ? 29.860  48.533  46.064  1.00 37.32 ? 412 ASN C ND2 1 
ATOM   9704  N N   . TRP C 1 375 ? 32.360  50.056  41.816  1.00 32.61 ? 413 TRP C N   1 
ATOM   9705  C CA  . TRP C 1 375 ? 33.738  49.551  41.713  1.00 32.08 ? 413 TRP C CA  1 
ATOM   9706  C C   . TRP C 1 375 ? 34.653  50.339  40.766  1.00 32.30 ? 413 TRP C C   1 
ATOM   9707  O O   . TRP C 1 375 ? 35.835  50.270  40.927  1.00 31.76 ? 413 TRP C O   1 
ATOM   9708  C CB  . TRP C 1 375 ? 33.788  48.037  41.356  1.00 31.16 ? 413 TRP C CB  1 
ATOM   9709  C CG  . TRP C 1 375 ? 33.545  47.659  39.928  1.00 28.49 ? 413 TRP C CG  1 
ATOM   9710  C CD1 . TRP C 1 375 ? 32.328  47.523  39.331  1.00 30.81 ? 413 TRP C CD1 1 
ATOM   9711  C CD2 . TRP C 1 375 ? 34.505  47.319  38.943  1.00 27.88 ? 413 TRP C CD2 1 
ATOM   9712  N NE1 . TRP C 1 375 ? 32.474  47.158  38.011  1.00 30.15 ? 413 TRP C NE1 1 
ATOM   9713  C CE2 . TRP C 1 375 ? 33.800  47.000  37.756  1.00 27.97 ? 413 TRP C CE2 1 
ATOM   9714  C CE3 . TRP C 1 375 ? 35.906  47.283  38.917  1.00 26.05 ? 413 TRP C CE3 1 
ATOM   9715  C CZ2 . TRP C 1 375 ? 34.442  46.681  36.567  1.00 29.66 ? 413 TRP C CZ2 1 
ATOM   9716  C CZ3 . TRP C 1 375 ? 36.511  46.926  37.775  1.00 29.55 ? 413 TRP C CZ3 1 
ATOM   9717  C CH2 . TRP C 1 375 ? 35.787  46.633  36.592  1.00 28.63 ? 413 TRP C CH2 1 
ATOM   9718  N N   . MET C 1 376 ? 34.116  51.104  39.814  1.00 32.96 ? 414 MET C N   1 
ATOM   9719  C CA  . MET C 1 376 ? 34.962  51.776  38.843  1.00 34.48 ? 414 MET C CA  1 
ATOM   9720  C C   . MET C 1 376 ? 34.405  53.112  38.393  1.00 35.04 ? 414 MET C C   1 
ATOM   9721  O O   . MET C 1 376 ? 33.236  53.211  38.080  1.00 35.81 ? 414 MET C O   1 
ATOM   9722  C CB  . MET C 1 376 ? 35.150  50.882  37.633  1.00 34.00 ? 414 MET C CB  1 
ATOM   9723  C CG  . MET C 1 376 ? 36.216  51.330  36.673  1.00 35.03 ? 414 MET C CG  1 
ATOM   9724  S SD  . MET C 1 376 ? 36.251  50.258  35.213  1.00 36.85 ? 414 MET C SD  1 
ATOM   9725  C CE  . MET C 1 376 ? 37.052  51.258  33.952  1.00 32.39 ? 414 MET C CE  1 
ATOM   9726  N N   . ILE C 1 377 ? 35.267  54.124  38.360  1.00 36.63 ? 415 ILE C N   1 
ATOM   9727  C CA  . ILE C 1 377 ? 35.011  55.323  37.582  1.00 38.30 ? 415 ILE C CA  1 
ATOM   9728  C C   . ILE C 1 377 ? 36.048  55.428  36.524  1.00 38.80 ? 415 ILE C C   1 
ATOM   9729  O O   . ILE C 1 377 ? 37.183  55.787  36.817  1.00 38.64 ? 415 ILE C O   1 
ATOM   9730  C CB  . ILE C 1 377 ? 35.106  56.598  38.379  1.00 38.48 ? 415 ILE C CB  1 
ATOM   9731  C CG1 . ILE C 1 377 ? 34.251  56.503  39.632  1.00 38.91 ? 415 ILE C CG1 1 
ATOM   9732  C CG2 . ILE C 1 377 ? 34.723  57.808  37.464  1.00 40.47 ? 415 ILE C CG2 1 
ATOM   9733  C CD1 . ILE C 1 377 ? 34.830  57.287  40.788  1.00 40.36 ? 415 ILE C CD1 1 
ATOM   9734  N N   . PRO C 1 378 ? 35.667  55.165  35.264  1.00 40.72 ? 416 PRO C N   1 
ATOM   9735  C CA  . PRO C 1 378 ? 36.638  55.380  34.178  1.00 41.43 ? 416 PRO C CA  1 
ATOM   9736  C C   . PRO C 1 378 ? 37.235  56.793  34.220  1.00 42.27 ? 416 PRO C C   1 
ATOM   9737  O O   . PRO C 1 378 ? 36.499  57.786  34.358  1.00 42.74 ? 416 PRO C O   1 
ATOM   9738  C CB  . PRO C 1 378 ? 35.775  55.208  32.922  1.00 41.23 ? 416 PRO C CB  1 
ATOM   9739  C CG  . PRO C 1 378 ? 34.772  54.245  33.325  1.00 41.08 ? 416 PRO C CG  1 
ATOM   9740  C CD  . PRO C 1 378 ? 34.377  54.727  34.714  1.00 40.68 ? 416 PRO C CD  1 
ATOM   9741  N N   . GLY C 1 379 ? 38.556  56.874  34.120  1.00 43.34 ? 417 GLY C N   1 
ATOM   9742  C CA  . GLY C 1 379 ? 39.254  58.120  34.337  1.00 43.79 ? 417 GLY C CA  1 
ATOM   9743  C C   . GLY C 1 379 ? 40.049  58.147  35.633  1.00 43.99 ? 417 GLY C C   1 
ATOM   9744  O O   . GLY C 1 379 ? 41.265  58.372  35.587  1.00 44.80 ? 417 GLY C O   1 
ATOM   9745  N N   . LYS C 1 380 ? 39.373  57.898  36.763  1.00 43.23 ? 418 LYS C N   1 
ATOM   9746  C CA  . LYS C 1 380 ? 39.859  58.273  38.092  1.00 42.74 ? 418 LYS C CA  1 
ATOM   9747  C C   . LYS C 1 380 ? 40.183  57.081  38.979  1.00 42.60 ? 418 LYS C C   1 
ATOM   9748  O O   . LYS C 1 380 ? 41.334  56.763  39.213  1.00 42.64 ? 418 LYS C O   1 
ATOM   9749  C CB  . LYS C 1 380 ? 38.810  59.148  38.788  1.00 42.64 ? 418 LYS C CB  1 
ATOM   9750  N N   . MET C 1 381 ? 39.141  56.383  39.410  1.00 43.04 ? 419 MET C N   1 
ATOM   9751  C CA  . MET C 1 381 ? 39.250  55.324  40.379  1.00 42.86 ? 419 MET C CA  1 
ATOM   9752  C C   . MET C 1 381 ? 39.112  53.956  39.684  1.00 41.19 ? 419 MET C C   1 
ATOM   9753  O O   . MET C 1 381 ? 37.988  53.536  39.329  1.00 37.61 ? 419 MET C O   1 
ATOM   9754  C CB  . MET C 1 381 ? 38.168  55.549  41.452  1.00 44.24 ? 419 MET C CB  1 
ATOM   9755  C CG  . MET C 1 381 ? 38.346  54.732  42.731  1.00 48.30 ? 419 MET C CG  1 
ATOM   9756  S SD  . MET C 1 381 ? 37.555  53.124  42.599  1.00 56.60 ? 419 MET C SD  1 
ATOM   9757  C CE  . MET C 1 381 ? 35.818  53.503  42.995  1.00 53.65 ? 419 MET C CE  1 
ATOM   9758  N N   . VAL C 1 382 ? 40.263  53.293  39.467  1.00 39.73 ? 420 VAL C N   1 
ATOM   9759  C CA  . VAL C 1 382 ? 40.274  51.910  38.942  1.00 39.69 ? 420 VAL C CA  1 
ATOM   9760  C C   . VAL C 1 382 ? 41.053  50.919  39.862  1.00 38.20 ? 420 VAL C C   1 
ATOM   9761  O O   . VAL C 1 382 ? 42.147  50.476  39.539  1.00 37.67 ? 420 VAL C O   1 
ATOM   9762  C CB  . VAL C 1 382 ? 40.825  51.861  37.482  1.00 40.62 ? 420 VAL C CB  1 
ATOM   9763  C CG1 . VAL C 1 382 ? 40.513  50.461  36.862  1.00 42.35 ? 420 VAL C CG1 1 
ATOM   9764  C CG2 . VAL C 1 382 ? 40.217  52.979  36.609  1.00 39.28 ? 420 VAL C CG2 1 
ATOM   9765  N N   . LYS C 1 383 ? 40.467  50.598  41.005  1.00 36.85 ? 421 LYS C N   1 
ATOM   9766  C CA  . LYS C 1 383 ? 41.108  49.814  42.064  1.00 37.05 ? 421 LYS C CA  1 
ATOM   9767  C C   . LYS C 1 383 ? 40.626  48.353  42.138  1.00 36.50 ? 421 LYS C C   1 
ATOM   9768  O O   . LYS C 1 383 ? 41.185  47.542  42.871  1.00 36.68 ? 421 LYS C O   1 
ATOM   9769  C CB  . LYS C 1 383 ? 40.845  50.474  43.421  1.00 36.63 ? 421 LYS C CB  1 
ATOM   9770  C CG  . LYS C 1 383 ? 41.098  51.974  43.410  1.00 39.33 ? 421 LYS C CG  1 
ATOM   9771  C CD  . LYS C 1 383 ? 41.621  52.528  44.741  1.00 41.47 ? 421 LYS C CD  1 
ATOM   9772  C CE  . LYS C 1 383 ? 40.619  52.342  45.874  1.00 42.77 ? 421 LYS C CE  1 
ATOM   9773  N NZ  . LYS C 1 383 ? 41.003  53.112  47.110  1.00 44.11 ? 421 LYS C NZ  1 
ATOM   9774  N N   . GLY C 1 384 ? 39.556  48.040  41.421  1.00 35.98 ? 422 GLY C N   1 
ATOM   9775  C CA  . GLY C 1 384 ? 39.089  46.679  41.287  1.00 35.21 ? 422 GLY C CA  1 
ATOM   9776  C C   . GLY C 1 384 ? 37.878  46.503  42.147  1.00 34.99 ? 422 GLY C C   1 
ATOM   9777  O O   . GLY C 1 384 ? 37.538  47.362  42.964  1.00 34.31 ? 422 GLY C O   1 
ATOM   9778  N N   . MET C 1 385 ? 37.255  45.347  41.966  1.00 34.37 ? 423 MET C N   1 
ATOM   9779  C CA  . MET C 1 385 ? 35.930  45.084  42.475  1.00 33.62 ? 423 MET C CA  1 
ATOM   9780  C C   . MET C 1 385 ? 35.964  44.304  43.774  1.00 32.44 ? 423 MET C C   1 
ATOM   9781  O O   . MET C 1 385 ? 34.960  44.187  44.411  1.00 32.19 ? 423 MET C O   1 
ATOM   9782  C CB  . MET C 1 385 ? 35.077  44.342  41.414  1.00 33.99 ? 423 MET C CB  1 
ATOM   9783  C CG  . MET C 1 385 ? 35.464  42.901  41.147  1.00 31.95 ? 423 MET C CG  1 
ATOM   9784  S SD  . MET C 1 385 ? 36.906  42.797  40.102  1.00 32.68 ? 423 MET C SD  1 
ATOM   9785  C CE  . MET C 1 385 ? 36.265  43.274  38.498  1.00 33.44 ? 423 MET C CE  1 
ATOM   9786  N N   . GLY C 1 386 ? 37.129  43.820  44.185  1.00 32.14 ? 424 GLY C N   1 
ATOM   9787  C CA  . GLY C 1 386 ? 37.211  43.057  45.398  1.00 31.85 ? 424 GLY C CA  1 
ATOM   9788  C C   . GLY C 1 386 ? 36.259  41.882  45.299  1.00 31.92 ? 424 GLY C C   1 
ATOM   9789  O O   . GLY C 1 386 ? 36.187  41.204  44.242  1.00 32.03 ? 424 GLY C O   1 
ATOM   9790  N N   . GLY C 1 387 ? 35.520  41.677  46.399  1.00 31.51 ? 425 GLY C N   1 
ATOM   9791  C CA  . GLY C 1 387 ? 34.470  40.694  46.544  1.00 31.34 ? 425 GLY C CA  1 
ATOM   9792  C C   . GLY C 1 387 ? 33.069  41.188  46.274  1.00 31.74 ? 425 GLY C C   1 
ATOM   9793  O O   . GLY C 1 387 ? 32.124  40.417  46.432  1.00 32.00 ? 425 GLY C O   1 
ATOM   9794  N N   . ALA C 1 388 ? 32.930  42.416  45.794  1.00 32.26 ? 426 ALA C N   1 
ATOM   9795  C CA  . ALA C 1 388 ? 31.617  43.094  45.630  1.00 32.66 ? 426 ALA C CA  1 
ATOM   9796  C C   . ALA C 1 388 ? 30.722  42.379  44.613  1.00 33.69 ? 426 ALA C C   1 
ATOM   9797  O O   . ALA C 1 388 ? 29.517  42.225  44.864  1.00 34.07 ? 426 ALA C O   1 
ATOM   9798  C CB  . ALA C 1 388 ? 31.814  44.562  45.248  1.00 31.38 ? 426 ALA C CB  1 
ATOM   9799  N N   . MET C 1 389 ? 31.304  41.900  43.499  1.00 33.81 ? 427 MET C N   1 
ATOM   9800  C CA  . MET C 1 389 ? 30.492  41.199  42.503  1.00 33.14 ? 427 MET C CA  1 
ATOM   9801  C C   . MET C 1 389 ? 30.006  39.849  43.021  1.00 33.11 ? 427 MET C C   1 
ATOM   9802  O O   . MET C 1 389 ? 28.886  39.445  42.688  1.00 32.44 ? 427 MET C O   1 
ATOM   9803  C CB  . MET C 1 389 ? 31.212  41.023  41.175  1.00 33.16 ? 427 MET C CB  1 
ATOM   9804  C CG  . MET C 1 389 ? 31.680  42.301  40.534  1.00 33.03 ? 427 MET C CG  1 
ATOM   9805  S SD  . MET C 1 389 ? 32.375  42.018  38.910  1.00 33.27 ? 427 MET C SD  1 
ATOM   9806  C CE  . MET C 1 389 ? 32.377  43.697  38.278  1.00 26.51 ? 427 MET C CE  1 
ATOM   9807  N N   . ASP C 1 390 ? 30.807  39.167  43.854  1.00 33.11 ? 428 ASP C N   1 
ATOM   9808  C CA  . ASP C 1 390 ? 30.343  37.914  44.476  1.00 33.14 ? 428 ASP C CA  1 
ATOM   9809  C C   . ASP C 1 390 ? 29.260  38.130  45.489  1.00 32.76 ? 428 ASP C C   1 
ATOM   9810  O O   . ASP C 1 390 ? 28.324  37.307  45.598  1.00 32.47 ? 428 ASP C O   1 
ATOM   9811  C CB  . ASP C 1 390 ? 31.470  37.124  45.154  1.00 33.47 ? 428 ASP C CB  1 
ATOM   9812  C CG  . ASP C 1 390 ? 32.424  36.460  44.156  1.00 35.54 ? 428 ASP C CG  1 
ATOM   9813  O OD1 . ASP C 1 390 ? 32.169  35.276  43.691  1.00 34.61 ? 428 ASP C OD1 1 
ATOM   9814  O OD2 . ASP C 1 390 ? 33.466  37.109  43.926  1.00 34.11 ? 428 ASP C OD2 1 
ATOM   9815  N N   . LEU C 1 391 ? 29.376  39.215  46.260  1.00 33.02 ? 429 LEU C N   1 
ATOM   9816  C CA  . LEU C 1 391 ? 28.445  39.507  47.328  1.00 32.74 ? 429 LEU C CA  1 
ATOM   9817  C C   . LEU C 1 391 ? 27.026  39.815  46.843  1.00 34.33 ? 429 LEU C C   1 
ATOM   9818  O O   . LEU C 1 391 ? 26.049  39.601  47.598  1.00 36.08 ? 429 LEU C O   1 
ATOM   9819  C CB  . LEU C 1 391 ? 28.962  40.659  48.196  1.00 33.19 ? 429 LEU C CB  1 
ATOM   9820  C CG  . LEU C 1 391 ? 30.126  40.336  49.142  1.00 33.08 ? 429 LEU C CG  1 
ATOM   9821  C CD1 . LEU C 1 391 ? 30.837  41.605  49.616  1.00 29.01 ? 429 LEU C CD1 1 
ATOM   9822  C CD2 . LEU C 1 391 ? 29.603  39.531  50.321  1.00 31.63 ? 429 LEU C CD2 1 
ATOM   9823  N N   . VAL C 1 392 ? 26.892  40.266  45.588  1.00 34.48 ? 430 VAL C N   1 
ATOM   9824  C CA  . VAL C 1 392 ? 25.580  40.573  44.979  1.00 34.62 ? 430 VAL C CA  1 
ATOM   9825  C C   . VAL C 1 392 ? 25.134  39.494  43.983  1.00 35.58 ? 430 VAL C C   1 
ATOM   9826  O O   . VAL C 1 392 ? 24.186  39.687  43.265  1.00 36.48 ? 430 VAL C O   1 
ATOM   9827  C CB  . VAL C 1 392 ? 25.577  41.978  44.273  1.00 35.02 ? 430 VAL C CB  1 
ATOM   9828  C CG1 . VAL C 1 392 ? 26.103  43.029  45.206  1.00 31.82 ? 430 VAL C CG1 1 
ATOM   9829  C CG2 . VAL C 1 392 ? 26.399  41.967  43.027  1.00 33.84 ? 430 VAL C CG2 1 
ATOM   9830  N N   . SER C 1 393 ? 25.763  38.326  44.007  1.00 35.66 ? 431 SER C N   1 
ATOM   9831  C CA  . SER C 1 393 ? 25.529  37.311  42.990  1.00 36.52 ? 431 SER C CA  1 
ATOM   9832  C C   . SER C 1 393 ? 24.402  36.348  43.327  1.00 36.39 ? 431 SER C C   1 
ATOM   9833  O O   . SER C 1 393 ? 23.914  35.682  42.444  1.00 38.25 ? 431 SER C O   1 
ATOM   9834  C CB  . SER C 1 393 ? 26.818  36.520  42.729  1.00 36.45 ? 431 SER C CB  1 
ATOM   9835  O OG  . SER C 1 393 ? 27.102  35.630  43.823  1.00 38.94 ? 431 SER C OG  1 
ATOM   9836  N N   . SER C 1 394 ? 24.013  36.213  44.586  1.00 35.87 ? 432 SER C N   1 
ATOM   9837  C CA  . SER C 1 394 ? 22.978  35.234  44.958  1.00 36.19 ? 432 SER C CA  1 
ATOM   9838  C C   . SER C 1 394 ? 21.623  35.842  45.176  1.00 36.06 ? 432 SER C C   1 
ATOM   9839  O O   . SER C 1 394 ? 21.489  36.783  45.969  1.00 36.39 ? 432 SER C O   1 
ATOM   9840  C CB  . SER C 1 394 ? 23.352  34.523  46.268  1.00 36.10 ? 432 SER C CB  1 
ATOM   9841  O OG  . SER C 1 394 ? 22.517  33.412  46.453  1.00 35.67 ? 432 SER C OG  1 
ATOM   9842  N N   . ALA C 1 395 ? 20.612  35.243  44.550  1.00 36.47 ? 433 ALA C N   1 
ATOM   9843  C CA  . ALA C 1 395 ? 19.209  35.556  44.832  1.00 36.64 ? 433 ALA C CA  1 
ATOM   9844  C C   . ALA C 1 395 ? 18.779  35.184  46.240  1.00 37.43 ? 433 ALA C C   1 
ATOM   9845  O O   . ALA C 1 395 ? 17.711  35.610  46.663  1.00 38.49 ? 433 ALA C O   1 
ATOM   9846  C CB  . ALA C 1 395 ? 18.291  34.878  43.825  1.00 36.34 ? 433 ALA C CB  1 
ATOM   9847  N N   . LYS C 1 396 ? 19.560  34.369  46.967  1.00 37.74 ? 434 LYS C N   1 
ATOM   9848  C CA  . LYS C 1 396 ? 19.202  34.018  48.334  1.00 37.57 ? 434 LYS C CA  1 
ATOM   9849  C C   . LYS C 1 396 ? 19.694  35.018  49.372  1.00 36.48 ? 434 LYS C C   1 
ATOM   9850  O O   . LYS C 1 396 ? 19.441  34.843  50.557  1.00 38.01 ? 434 LYS C O   1 
ATOM   9851  C CB  . LYS C 1 396 ? 19.701  32.608  48.716  1.00 37.35 ? 434 LYS C CB  1 
ATOM   9852  C CG  . LYS C 1 396 ? 19.330  31.506  47.757  1.00 38.40 ? 434 LYS C CG  1 
ATOM   9853  C CD  . LYS C 1 396 ? 19.495  30.123  48.349  1.00 40.14 ? 434 LYS C CD  1 
ATOM   9854  C CE  . LYS C 1 396 ? 19.184  29.065  47.287  1.00 45.02 ? 434 LYS C CE  1 
ATOM   9855  N NZ  . LYS C 1 396 ? 18.989  27.708  47.876  1.00 46.48 ? 434 LYS C NZ  1 
ATOM   9856  N N   . THR C 1 397 ? 20.375  36.062  48.948  1.00 35.15 ? 435 THR C N   1 
ATOM   9857  C CA  . THR C 1 397 ? 20.953  37.049  49.856  1.00 34.83 ? 435 THR C CA  1 
ATOM   9858  C C   . THR C 1 397 ? 20.316  38.429  49.600  1.00 35.06 ? 435 THR C C   1 
ATOM   9859  O O   . THR C 1 397 ? 20.271  38.864  48.447  1.00 36.20 ? 435 THR C O   1 
ATOM   9860  C CB  . THR C 1 397 ? 22.490  37.046  49.710  1.00 34.90 ? 435 THR C CB  1 
ATOM   9861  O OG1 . THR C 1 397 ? 22.981  35.766  50.120  1.00 33.50 ? 435 THR C OG1 1 
ATOM   9862  C CG2 . THR C 1 397 ? 23.217  38.137  50.555  1.00 32.18 ? 435 THR C CG2 1 
ATOM   9863  N N   . LYS C 1 398 ? 19.773  39.069  50.642  1.00 33.81 ? 436 LYS C N   1 
ATOM   9864  C CA  . LYS C 1 398 ? 19.284  40.452  50.556  1.00 34.01 ? 436 LYS C CA  1 
ATOM   9865  C C   . LYS C 1 398 ? 20.465  41.386  50.388  1.00 33.26 ? 436 LYS C C   1 
ATOM   9866  O O   . LYS C 1 398 ? 21.434  41.264  51.109  1.00 32.62 ? 436 LYS C O   1 
ATOM   9867  C CB  . LYS C 1 398 ? 18.541  40.824  51.850  1.00 35.21 ? 436 LYS C CB  1 
ATOM   9868  C CG  . LYS C 1 398 ? 17.930  42.251  51.895  1.00 36.24 ? 436 LYS C CG  1 
ATOM   9869  C CD  . LYS C 1 398 ? 16.970  42.377  53.084  1.00 37.54 ? 436 LYS C CD  1 
ATOM   9870  C CE  . LYS C 1 398 ? 16.121  43.676  53.040  1.00 40.56 ? 436 LYS C CE  1 
ATOM   9871  N NZ  . LYS C 1 398 ? 15.348  43.944  54.339  1.00 38.99 ? 436 LYS C NZ  1 
ATOM   9872  N N   . VAL C 1 399 ? 20.430  42.248  49.383  1.00 33.33 ? 437 VAL C N   1 
ATOM   9873  C CA  . VAL C 1 399 ? 21.440  43.313  49.214  1.00 32.43 ? 437 VAL C CA  1 
ATOM   9874  C C   . VAL C 1 399 ? 20.817  44.684  49.545  1.00 32.64 ? 437 VAL C C   1 
ATOM   9875  O O   . VAL C 1 399 ? 19.854  45.130  48.901  1.00 34.24 ? 437 VAL C O   1 
ATOM   9876  C CB  . VAL C 1 399 ? 21.979  43.327  47.776  1.00 31.58 ? 437 VAL C CB  1 
ATOM   9877  C CG1 . VAL C 1 399 ? 23.082  44.502  47.597  1.00 32.08 ? 437 VAL C CG1 1 
ATOM   9878  C CG2 . VAL C 1 399 ? 22.492  41.925  47.438  1.00 28.25 ? 437 VAL C CG2 1 
ATOM   9879  N N   . VAL C 1 400 ? 21.371  45.348  50.539  1.00 32.58 ? 438 VAL C N   1 
ATOM   9880  C CA  . VAL C 1 400 ? 20.928  46.642  50.952  1.00 32.25 ? 438 VAL C CA  1 
ATOM   9881  C C   . VAL C 1 400 ? 22.110  47.576  50.664  1.00 33.47 ? 438 VAL C C   1 
ATOM   9882  O O   . VAL C 1 400 ? 23.270  47.260  51.015  1.00 32.77 ? 438 VAL C O   1 
ATOM   9883  C CB  . VAL C 1 400 ? 20.593  46.646  52.467  1.00 33.03 ? 438 VAL C CB  1 
ATOM   9884  C CG1 . VAL C 1 400 ? 20.127  48.059  52.943  1.00 30.73 ? 438 VAL C CG1 1 
ATOM   9885  C CG2 . VAL C 1 400 ? 19.557  45.549  52.787  1.00 31.39 ? 438 VAL C CG2 1 
ATOM   9886  N N   . VAL C 1 401 ? 21.808  48.677  49.972  1.00 32.33 ? 439 VAL C N   1 
ATOM   9887  C CA  . VAL C 1 401 ? 22.797  49.677  49.659  1.00 33.15 ? 439 VAL C CA  1 
ATOM   9888  C C   . VAL C 1 401 ? 22.538  50.825  50.613  1.00 32.92 ? 439 VAL C C   1 
ATOM   9889  O O   . VAL C 1 401 ? 21.390  51.229  50.801  1.00 30.90 ? 439 VAL C O   1 
ATOM   9890  C CB  . VAL C 1 401 ? 22.700  50.157  48.175  1.00 32.97 ? 439 VAL C CB  1 
ATOM   9891  C CG1 . VAL C 1 401 ? 23.370  51.531  48.021  1.00 33.97 ? 439 VAL C CG1 1 
ATOM   9892  C CG2 . VAL C 1 401 ? 23.302  49.126  47.252  1.00 31.08 ? 439 VAL C CG2 1 
ATOM   9893  N N   . THR C 1 402 ? 23.606  51.281  51.249  1.00 33.07 ? 440 THR C N   1 
ATOM   9894  C CA  . THR C 1 402 ? 23.575  52.409  52.146  1.00 34.41 ? 440 THR C CA  1 
ATOM   9895  C C   . THR C 1 402 ? 24.463  53.523  51.563  1.00 34.69 ? 440 THR C C   1 
ATOM   9896  O O   . THR C 1 402 ? 25.681  53.366  51.477  1.00 35.67 ? 440 THR C O   1 
ATOM   9897  C CB  . THR C 1 402 ? 24.097  52.021  53.573  1.00 34.70 ? 440 THR C CB  1 
ATOM   9898  O OG1 . THR C 1 402 ? 25.399  51.412  53.481  1.00 34.09 ? 440 THR C OG1 1 
ATOM   9899  C CG2 . THR C 1 402 ? 23.130  51.088  54.264  1.00 34.35 ? 440 THR C CG2 1 
ATOM   9900  N N   . MET C 1 403 ? 23.857  54.634  51.169  1.00 34.74 ? 441 MET C N   1 
ATOM   9901  C CA  . MET C 1 403 ? 24.566  55.687  50.468  1.00 35.21 ? 441 MET C CA  1 
ATOM   9902  C C   . MET C 1 403 ? 23.928  57.047  50.657  1.00 35.21 ? 441 MET C C   1 
ATOM   9903  O O   . MET C 1 403 ? 22.723  57.165  50.853  1.00 35.57 ? 441 MET C O   1 
ATOM   9904  C CB  . MET C 1 403 ? 24.643  55.347  48.969  1.00 35.66 ? 441 MET C CB  1 
ATOM   9905  C CG  . MET C 1 403 ? 23.336  55.484  48.187  1.00 35.08 ? 441 MET C CG  1 
ATOM   9906  S SD  . MET C 1 403 ? 23.560  55.298  46.419  1.00 36.63 ? 441 MET C SD  1 
ATOM   9907  C CE  . MET C 1 403 ? 21.882  55.571  45.865  1.00 38.74 ? 441 MET C CE  1 
ATOM   9908  N N   . GLU C 1 404 ? 24.742  58.087  50.612  1.00 35.35 ? 442 GLU C N   1 
ATOM   9909  C CA  . GLU C 1 404 ? 24.206  59.455  50.446  1.00 35.53 ? 442 GLU C CA  1 
ATOM   9910  C C   . GLU C 1 404 ? 23.262  59.535  49.232  1.00 34.34 ? 442 GLU C C   1 
ATOM   9911  O O   . GLU C 1 404 ? 23.556  58.954  48.171  1.00 34.08 ? 442 GLU C O   1 
ATOM   9912  C CB  . GLU C 1 404 ? 25.323  60.452  50.228  1.00 35.53 ? 442 GLU C CB  1 
ATOM   9913  C CG  . GLU C 1 404 ? 25.915  61.024  51.449  1.00 39.56 ? 442 GLU C CG  1 
ATOM   9914  C CD  . GLU C 1 404 ? 26.590  62.350  51.126  1.00 44.07 ? 442 GLU C CD  1 
ATOM   9915  O OE1 . GLU C 1 404 ? 26.123  63.418  51.606  1.00 47.13 ? 442 GLU C OE1 1 
ATOM   9916  O OE2 . GLU C 1 404 ? 27.567  62.320  50.336  1.00 47.99 ? 442 GLU C OE2 1 
ATOM   9917  N N   . HIS C 1 405 ? 22.169  60.283  49.370  1.00 32.83 ? 443 HIS C N   1 
ATOM   9918  C CA  . HIS C 1 405 ? 21.135  60.308  48.333  1.00 32.46 ? 443 HIS C CA  1 
ATOM   9919  C C   . HIS C 1 405 ? 21.662  60.771  46.969  1.00 31.76 ? 443 HIS C C   1 
ATOM   9920  O O   . HIS C 1 405 ? 21.477  60.075  45.989  1.00 31.02 ? 443 HIS C O   1 
ATOM   9921  C CB  . HIS C 1 405 ? 19.903  61.124  48.767  1.00 32.66 ? 443 HIS C CB  1 
ATOM   9922  C CG  . HIS C 1 405 ? 18.653  60.773  48.012  1.00 33.73 ? 443 HIS C CG  1 
ATOM   9923  N ND1 . HIS C 1 405 ? 17.705  59.900  48.497  1.00 35.84 ? 443 HIS C ND1 1 
ATOM   9924  C CD2 . HIS C 1 405 ? 18.237  61.120  46.770  1.00 34.95 ? 443 HIS C CD2 1 
ATOM   9925  C CE1 . HIS C 1 405 ? 16.742  59.756  47.601  1.00 35.51 ? 443 HIS C CE1 1 
ATOM   9926  N NE2 . HIS C 1 405 ? 17.041  60.488  46.542  1.00 33.53 ? 443 HIS C NE2 1 
ATOM   9927  N N   . SER C 1 406 ? 22.321  61.935  46.932  1.00 31.87 ? 444 SER C N   1 
ATOM   9928  C CA  . SER C 1 406 ? 22.907  62.508  45.710  1.00 32.41 ? 444 SER C CA  1 
ATOM   9929  C C   . SER C 1 406 ? 24.407  62.772  45.906  1.00 32.98 ? 444 SER C C   1 
ATOM   9930  O O   . SER C 1 406 ? 24.922  62.667  47.010  1.00 32.83 ? 444 SER C O   1 
ATOM   9931  C CB  . SER C 1 406 ? 22.207  63.817  45.321  1.00 32.61 ? 444 SER C CB  1 
ATOM   9932  O OG  . SER C 1 406 ? 20.794  63.760  45.452  1.00 31.06 ? 444 SER C OG  1 
ATOM   9933  N N   . ALA C 1 407 ? 25.111  63.084  44.818  1.00 33.80 ? 445 ALA C N   1 
ATOM   9934  C CA  . ALA C 1 407 ? 26.527  63.386  44.871  1.00 34.13 ? 445 ALA C CA  1 
ATOM   9935  C C   . ALA C 1 407 ? 26.678  64.916  44.892  1.00 35.32 ? 445 ALA C C   1 
ATOM   9936  O O   . ALA C 1 407 ? 25.668  65.649  44.969  1.00 34.58 ? 445 ALA C O   1 
ATOM   9937  C CB  . ALA C 1 407 ? 27.234  62.771  43.682  1.00 34.46 ? 445 ALA C CB  1 
ATOM   9938  N N   . LYS C 1 408 ? 27.909  65.417  44.824  1.00 36.47 ? 446 LYS C N   1 
ATOM   9939  C CA  . LYS C 1 408 ? 28.121  66.880  44.817  1.00 38.21 ? 446 LYS C CA  1 
ATOM   9940  C C   . LYS C 1 408 ? 27.396  67.486  43.608  1.00 39.18 ? 446 LYS C C   1 
ATOM   9941  O O   . LYS C 1 408 ? 27.350  66.878  42.527  1.00 40.29 ? 446 LYS C O   1 
ATOM   9942  C CB  . LYS C 1 408 ? 29.612  67.245  44.807  1.00 37.79 ? 446 LYS C CB  1 
ATOM   9943  N N   . GLY C 1 409 ? 26.800  68.652  43.818  1.00 39.81 ? 447 GLY C N   1 
ATOM   9944  C CA  . GLY C 1 409 ? 25.975  69.319  42.805  1.00 40.26 ? 447 GLY C CA  1 
ATOM   9945  C C   . GLY C 1 409 ? 24.486  68.976  42.850  1.00 40.19 ? 447 GLY C C   1 
ATOM   9946  O O   . GLY C 1 409 ? 23.691  69.572  42.126  1.00 40.07 ? 447 GLY C O   1 
ATOM   9947  N N   . ASN C 1 410 ? 24.109  68.051  43.733  1.00 39.99 ? 448 ASN C N   1 
ATOM   9948  C CA  . ASN C 1 410 ? 22.810  67.357  43.679  1.00 39.52 ? 448 ASN C CA  1 
ATOM   9949  C C   . ASN C 1 410 ? 22.724  66.487  42.410  1.00 38.55 ? 448 ASN C C   1 
ATOM   9950  O O   . ASN C 1 410 ? 21.639  66.291  41.886  1.00 38.20 ? 448 ASN C O   1 
ATOM   9951  C CB  . ASN C 1 410 ? 21.617  68.350  43.785  1.00 40.28 ? 448 ASN C CB  1 
ATOM   9952  C CG  . ASN C 1 410 ? 20.264  67.647  44.001  1.00 41.91 ? 448 ASN C CG  1 
ATOM   9953  O OD1 . ASN C 1 410 ? 20.115  66.829  44.909  1.00 43.96 ? 448 ASN C OD1 1 
ATOM   9954  N ND2 . ASN C 1 410 ? 19.281  67.970  43.159  1.00 42.63 ? 448 ASN C ND2 1 
ATOM   9955  N N   . ALA C 1 411 ? 23.870  65.977  41.924  1.00 37.61 ? 449 ALA C N   1 
ATOM   9956  C CA  . ALA C 1 411 ? 23.889  64.992  40.832  1.00 36.82 ? 449 ALA C CA  1 
ATOM   9957  C C   . ALA C 1 411 ? 23.280  63.701  41.340  1.00 35.93 ? 449 ALA C C   1 
ATOM   9958  O O   . ALA C 1 411 ? 23.671  63.213  42.400  1.00 35.40 ? 449 ALA C O   1 
ATOM   9959  C CB  . ALA C 1 411 ? 25.316  64.714  40.345  1.00 36.86 ? 449 ALA C CB  1 
ATOM   9960  N N   . HIS C 1 412 ? 22.349  63.135  40.567  1.00 35.12 ? 450 HIS C N   1 
ATOM   9961  C CA  . HIS C 1 412 ? 21.608  61.949  40.995  1.00 33.76 ? 450 HIS C CA  1 
ATOM   9962  C C   . HIS C 1 412 ? 22.528  60.756  41.144  1.00 33.79 ? 450 HIS C C   1 
ATOM   9963  O O   . HIS C 1 412 ? 23.410  60.545  40.307  1.00 33.89 ? 450 HIS C O   1 
ATOM   9964  C CB  . HIS C 1 412 ? 20.543  61.566  39.966  1.00 33.47 ? 450 HIS C CB  1 
ATOM   9965  C CG  . HIS C 1 412 ? 19.489  62.608  39.754  1.00 32.20 ? 450 HIS C CG  1 
ATOM   9966  N ND1 . HIS C 1 412 ? 18.824  63.224  40.792  1.00 31.04 ? 450 HIS C ND1 1 
ATOM   9967  C CD2 . HIS C 1 412 ? 18.962  63.109  38.615  1.00 28.41 ? 450 HIS C CD2 1 
ATOM   9968  C CE1 . HIS C 1 412 ? 17.950  64.084  40.295  1.00 31.11 ? 450 HIS C CE1 1 
ATOM   9969  N NE2 . HIS C 1 412 ? 18.020  64.032  38.975  1.00 29.76 ? 450 HIS C NE2 1 
ATOM   9970  N N   . LYS C 1 413 ? 22.291  59.959  42.181  1.00 32.64 ? 451 LYS C N   1 
ATOM   9971  C CA  . LYS C 1 413 ? 22.933  58.661  42.328  1.00 32.62 ? 451 LYS C CA  1 
ATOM   9972  C C   . LYS C 1 413 ? 21.924  57.525  42.132  1.00 32.37 ? 451 LYS C C   1 
ATOM   9973  O O   . LYS C 1 413 ? 22.294  56.403  41.876  1.00 32.22 ? 451 LYS C O   1 
ATOM   9974  C CB  . LYS C 1 413 ? 23.595  58.557  43.705  1.00 32.28 ? 451 LYS C CB  1 
ATOM   9975  C CG  . LYS C 1 413 ? 24.763  59.547  43.899  1.00 33.24 ? 451 LYS C CG  1 
ATOM   9976  C CD  . LYS C 1 413 ? 25.305  59.535  45.338  1.00 32.93 ? 451 LYS C CD  1 
ATOM   9977  C CE  . LYS C 1 413 ? 25.874  58.183  45.716  1.00 32.95 ? 451 LYS C CE  1 
ATOM   9978  N NZ  . LYS C 1 413 ? 26.650  58.164  46.962  1.00 34.39 ? 451 LYS C NZ  1 
ATOM   9979  N N   . ILE C 1 414 ? 20.636  57.833  42.257  1.00 32.93 ? 452 ILE C N   1 
ATOM   9980  C CA  . ILE C 1 414 ? 19.566  56.890  41.943  1.00 32.65 ? 452 ILE C CA  1 
ATOM   9981  C C   . ILE C 1 414 ? 18.937  57.318  40.623  1.00 32.96 ? 452 ILE C C   1 
ATOM   9982  O O   . ILE C 1 414 ? 18.414  58.441  40.489  1.00 32.50 ? 452 ILE C O   1 
ATOM   9983  C CB  . ILE C 1 414 ? 18.485  56.838  43.023  1.00 32.19 ? 452 ILE C CB  1 
ATOM   9984  C CG1 . ILE C 1 414 ? 19.105  56.498  44.380  1.00 31.66 ? 452 ILE C CG1 1 
ATOM   9985  C CG2 . ILE C 1 414 ? 17.410  55.804  42.633  1.00 30.88 ? 452 ILE C CG2 1 
ATOM   9986  C CD1 . ILE C 1 414 ? 18.180  56.860  45.570  1.00 28.39 ? 452 ILE C CD1 1 
ATOM   9987  N N   . MET C 1 415 ? 18.956  56.391  39.677  1.00 32.79 ? 453 MET C N   1 
ATOM   9988  C CA  . MET C 1 415 ? 18.656  56.702  38.317  1.00 33.77 ? 453 MET C CA  1 
ATOM   9989  C C   . MET C 1 415 ? 17.997  55.583  37.531  1.00 32.96 ? 453 MET C C   1 
ATOM   9990  O O   . MET C 1 415 ? 17.882  54.442  38.005  1.00 32.36 ? 453 MET C O   1 
ATOM   9991  C CB  . MET C 1 415 ? 19.944  57.128  37.641  1.00 33.37 ? 453 MET C CB  1 
ATOM   9992  C CG  . MET C 1 415 ? 21.157  56.209  37.826  1.00 36.06 ? 453 MET C CG  1 
ATOM   9993  S SD  . MET C 1 415 ? 22.664  57.102  37.335  1.00 38.95 ? 453 MET C SD  1 
ATOM   9994  C CE  . MET C 1 415 ? 22.557  58.352  38.631  1.00 32.72 ? 453 MET C CE  1 
ATOM   9995  N N   . GLU C 1 416 ? 17.566  55.946  36.327  1.00 32.81 ? 454 GLU C N   1 
ATOM   9996  C CA  . GLU C 1 416 ? 16.902  55.045  35.383  1.00 33.26 ? 454 GLU C CA  1 
ATOM   9997  C C   . GLU C 1 416 ? 17.880  53.940  34.993  1.00 33.52 ? 454 GLU C C   1 
ATOM   9998  O O   . GLU C 1 416 ? 17.526  52.748  35.036  1.00 33.62 ? 454 GLU C O   1 
ATOM   9999  C CB  . GLU C 1 416 ? 16.391  55.827  34.144  1.00 33.01 ? 454 GLU C CB  1 
ATOM   10000 N N   . LYS C 1 417 ? 19.106  54.349  34.641  1.00 33.13 ? 455 LYS C N   1 
ATOM   10001 C CA  . LYS C 1 417 ? 20.186  53.451  34.225  1.00 33.27 ? 455 LYS C CA  1 
ATOM   10002 C C   . LYS C 1 417 ? 21.479  54.032  34.785  1.00 33.67 ? 455 LYS C C   1 
ATOM   10003 O O   . LYS C 1 417 ? 21.663  55.252  34.757  1.00 32.88 ? 455 LYS C O   1 
ATOM   10004 C CB  . LYS C 1 417 ? 20.267  53.368  32.679  1.00 33.44 ? 455 LYS C CB  1 
ATOM   10005 N N   . CYS C 1 418 ? 22.356  53.175  35.322  1.00 33.91 ? 456 CYS C N   1 
ATOM   10006 C CA  . CYS C 1 418 ? 23.681  53.620  35.751  1.00 34.61 ? 456 CYS C CA  1 
ATOM   10007 C C   . CYS C 1 418 ? 24.481  54.043  34.551  1.00 34.59 ? 456 CYS C C   1 
ATOM   10008 O O   . CYS C 1 418 ? 24.238  53.574  33.439  1.00 34.69 ? 456 CYS C O   1 
ATOM   10009 C CB  . CYS C 1 418 ? 24.446  52.548  36.532  1.00 34.09 ? 456 CYS C CB  1 
ATOM   10010 S SG  . CYS C 1 418 ? 23.609  51.938  37.997  1.00 35.94 ? 456 CYS C SG  1 
ATOM   10011 N N   . THR C 1 419 ? 25.388  54.985  34.790  1.00 34.60 ? 457 THR C N   1 
ATOM   10012 C CA  . THR C 1 419 ? 26.306  55.465  33.806  1.00 34.32 ? 457 THR C CA  1 
ATOM   10013 C C   . THR C 1 419 ? 27.742  54.961  34.113  1.00 34.67 ? 457 THR C C   1 
ATOM   10014 O O   . THR C 1 419 ? 28.635  55.126  33.283  1.00 34.65 ? 457 THR C O   1 
ATOM   10015 C CB  . THR C 1 419 ? 26.340  57.021  33.757  1.00 34.28 ? 457 THR C CB  1 
ATOM   10016 O OG1 . THR C 1 419 ? 26.785  57.517  35.018  1.00 34.18 ? 457 THR C OG1 1 
ATOM   10017 C CG2 . THR C 1 419 ? 24.929  57.675  33.352  1.00 33.09 ? 457 THR C CG2 1 
ATOM   10018 N N   . LEU C 1 420 ? 27.968  54.354  35.280  1.00 34.23 ? 458 LEU C N   1 
ATOM   10019 C CA  . LEU C 1 420 ? 29.293  53.778  35.615  1.00 33.88 ? 458 LEU C CA  1 
ATOM   10020 C C   . LEU C 1 420 ? 29.189  52.286  35.496  1.00 33.41 ? 458 LEU C C   1 
ATOM   10021 O O   . LEU C 1 420 ? 28.097  51.749  35.595  1.00 34.93 ? 458 LEU C O   1 
ATOM   10022 C CB  . LEU C 1 420 ? 29.759  54.180  37.045  1.00 34.03 ? 458 LEU C CB  1 
ATOM   10023 C CG  . LEU C 1 420 ? 29.913  55.691  37.291  1.00 34.46 ? 458 LEU C CG  1 
ATOM   10024 C CD1 . LEU C 1 420 ? 30.023  55.995  38.786  1.00 32.82 ? 458 LEU C CD1 1 
ATOM   10025 C CD2 . LEU C 1 420 ? 31.099  56.223  36.497  1.00 32.44 ? 458 LEU C CD2 1 
ATOM   10026 N N   . PRO C 1 421 ? 30.329  51.588  35.262  1.00 33.79 ? 459 PRO C N   1 
ATOM   10027 C CA  . PRO C 1 421 ? 30.293  50.134  35.215  1.00 33.80 ? 459 PRO C CA  1 
ATOM   10028 C C   . PRO C 1 421 ? 29.607  49.473  36.385  1.00 33.77 ? 459 PRO C C   1 
ATOM   10029 O O   . PRO C 1 421 ? 29.841  49.855  37.543  1.00 34.29 ? 459 PRO C O   1 
ATOM   10030 C CB  . PRO C 1 421 ? 31.773  49.769  35.181  1.00 33.11 ? 459 PRO C CB  1 
ATOM   10031 C CG  . PRO C 1 421 ? 32.344  50.854  34.415  1.00 33.44 ? 459 PRO C CG  1 
ATOM   10032 C CD  . PRO C 1 421 ? 31.691  52.066  34.976  1.00 32.27 ? 459 PRO C CD  1 
ATOM   10033 N N   . LEU C 1 422 ? 28.791  48.464  36.051  1.00 34.18 ? 460 LEU C N   1 
ATOM   10034 C CA  . LEU C 1 422 ? 28.013  47.695  37.002  1.00 33.14 ? 460 LEU C CA  1 
ATOM   10035 C C   . LEU C 1 422 ? 28.891  46.734  37.746  1.00 33.11 ? 460 LEU C C   1 
ATOM   10036 O O   . LEU C 1 422 ? 29.842  46.161  37.191  1.00 32.38 ? 460 LEU C O   1 
ATOM   10037 C CB  . LEU C 1 422 ? 26.903  46.921  36.293  1.00 33.00 ? 460 LEU C CB  1 
ATOM   10038 C CG  . LEU C 1 422 ? 25.876  47.726  35.510  1.00 32.67 ? 460 LEU C CG  1 
ATOM   10039 C CD1 . LEU C 1 422 ? 24.747  46.828  35.055  1.00 32.12 ? 460 LEU C CD1 1 
ATOM   10040 C CD2 . LEU C 1 422 ? 25.347  48.963  36.260  1.00 27.44 ? 460 LEU C CD2 1 
ATOM   10041 N N   . THR C 1 423 ? 28.608  46.662  39.043  1.00 33.61 ? 461 THR C N   1 
ATOM   10042 C CA  . THR C 1 423 ? 29.060  45.643  39.963  1.00 33.26 ? 461 THR C CA  1 
ATOM   10043 C C   . THR C 1 423 ? 28.122  44.445  39.866  1.00 34.40 ? 461 THR C C   1 
ATOM   10044 O O   . THR C 1 423 ? 28.519  43.305  39.995  1.00 35.43 ? 461 THR C O   1 
ATOM   10045 C CB  . THR C 1 423 ? 28.995  46.183  41.395  1.00 34.50 ? 461 THR C CB  1 
ATOM   10046 O OG1 . THR C 1 423 ? 29.832  47.349  41.492  1.00 32.64 ? 461 THR C OG1 1 
ATOM   10047 C CG2 . THR C 1 423 ? 29.391  45.088  42.426  1.00 32.37 ? 461 THR C CG2 1 
ATOM   10048 N N   . GLY C 1 424 ? 26.851  44.727  39.662  1.00 35.46 ? 462 GLY C N   1 
ATOM   10049 C CA  . GLY C 1 424 ? 25.910  43.723  39.254  1.00 35.21 ? 462 GLY C CA  1 
ATOM   10050 C C   . GLY C 1 424 ? 24.631  44.325  38.714  1.00 35.18 ? 462 GLY C C   1 
ATOM   10051 O O   . GLY C 1 424 ? 24.347  45.496  38.845  1.00 33.27 ? 462 GLY C O   1 
ATOM   10052 N N   . LYS C 1 425 ? 23.846  43.445  38.144  1.00 35.79 ? 463 LYS C N   1 
ATOM   10053 C CA  . LYS C 1 425 ? 22.644  43.767  37.433  1.00 36.94 ? 463 LYS C CA  1 
ATOM   10054 C C   . LYS C 1 425 ? 21.444  43.264  38.249  1.00 36.47 ? 463 LYS C C   1 
ATOM   10055 O O   . LYS C 1 425 ? 21.446  42.130  38.727  1.00 35.45 ? 463 LYS C O   1 
ATOM   10056 C CB  . LYS C 1 425 ? 22.756  43.080  36.080  1.00 37.06 ? 463 LYS C CB  1 
ATOM   10057 C CG  . LYS C 1 425 ? 21.653  43.312  35.130  1.00 39.22 ? 463 LYS C CG  1 
ATOM   10058 C CD  . LYS C 1 425 ? 21.853  42.464  33.912  1.00 41.93 ? 463 LYS C CD  1 
ATOM   10059 C CE  . LYS C 1 425 ? 21.188  43.082  32.714  1.00 45.53 ? 463 LYS C CE  1 
ATOM   10060 N NZ  . LYS C 1 425 ? 19.870  43.657  33.061  1.00 48.02 ? 463 LYS C NZ  1 
ATOM   10061 N N   . GLN C 1 426 ? 20.451  44.131  38.428  1.00 37.28 ? 464 GLN C N   1 
ATOM   10062 C CA  . GLN C 1 426 ? 19.175  43.780  39.091  1.00 37.60 ? 464 GLN C CA  1 
ATOM   10063 C C   . GLN C 1 426 ? 19.395  42.962  40.332  1.00 37.05 ? 464 GLN C C   1 
ATOM   10064 O O   . GLN C 1 426 ? 18.834  41.886  40.492  1.00 36.61 ? 464 GLN C O   1 
ATOM   10065 C CB  . GLN C 1 426 ? 18.266  43.042  38.121  1.00 38.19 ? 464 GLN C CB  1 
ATOM   10066 C CG  . GLN C 1 426 ? 17.880  43.927  36.960  1.00 39.81 ? 464 GLN C CG  1 
ATOM   10067 C CD  . GLN C 1 426 ? 17.147  43.183  35.893  1.00 41.55 ? 464 GLN C CD  1 
ATOM   10068 O OE1 . GLN C 1 426 ? 17.511  42.082  35.541  1.00 44.73 ? 464 GLN C OE1 1 
ATOM   10069 N NE2 . GLN C 1 426 ? 16.114  43.786  35.365  1.00 46.77 ? 464 GLN C NE2 1 
ATOM   10070 N N   . CYS C 1 427 ? 20.203  43.511  41.228  1.00 36.80 ? 465 CYS C N   1 
ATOM   10071 C CA  . CYS C 1 427 ? 20.692  42.770  42.395  1.00 37.34 ? 465 CYS C CA  1 
ATOM   10072 C C   . CYS C 1 427 ? 20.376  43.433  43.733  1.00 36.62 ? 465 CYS C C   1 
ATOM   10073 O O   . CYS C 1 427 ? 20.443  42.770  44.747  1.00 36.62 ? 465 CYS C O   1 
ATOM   10074 C CB  . CYS C 1 427 ? 22.226  42.564  42.271  1.00 36.80 ? 465 CYS C CB  1 
ATOM   10075 S SG  . CYS C 1 427 ? 23.185  44.108  42.155  1.00 39.28 ? 465 CYS C SG  1 
ATOM   10076 N N   . VAL C 1 428 ? 20.030  44.726  43.738  1.00 36.79 ? 466 VAL C N   1 
ATOM   10077 C CA  . VAL C 1 428 ? 19.815  45.471  44.995  1.00 35.60 ? 466 VAL C CA  1 
ATOM   10078 C C   . VAL C 1 428 ? 18.374  45.280  45.380  1.00 36.50 ? 466 VAL C C   1 
ATOM   10079 O O   . VAL C 1 428 ? 17.491  45.382  44.524  1.00 37.84 ? 466 VAL C O   1 
ATOM   10080 C CB  . VAL C 1 428 ? 20.206  46.994  44.850  1.00 35.82 ? 466 VAL C CB  1 
ATOM   10081 C CG1 . VAL C 1 428 ? 19.876  47.791  46.135  1.00 33.33 ? 466 VAL C CG1 1 
ATOM   10082 C CG2 . VAL C 1 428 ? 21.703  47.156  44.469  1.00 32.81 ? 466 VAL C CG2 1 
ATOM   10083 N N   . ASN C 1 429 ? 18.118  44.974  46.656  1.00 35.70 ? 467 ASN C N   1 
ATOM   10084 C CA  . ASN C 1 429 ? 16.775  44.826  47.186  1.00 34.12 ? 467 ASN C CA  1 
ATOM   10085 C C   . ASN C 1 429 ? 16.194  46.073  47.876  1.00 34.03 ? 467 ASN C C   1 
ATOM   10086 O O   . ASN C 1 429 ? 14.997  46.316  47.831  1.00 32.19 ? 467 ASN C O   1 
ATOM   10087 C CB  . ASN C 1 429 ? 16.777  43.699  48.213  1.00 34.63 ? 467 ASN C CB  1 
ATOM   10088 C CG  . ASN C 1 429 ? 17.075  42.370  47.592  1.00 34.32 ? 467 ASN C CG  1 
ATOM   10089 O OD1 . ASN C 1 429 ? 18.159  41.838  47.755  1.00 36.26 ? 467 ASN C OD1 1 
ATOM   10090 N ND2 . ASN C 1 429 ? 16.124  41.841  46.841  1.00 30.87 ? 467 ASN C ND2 1 
ATOM   10091 N N   . ARG C 1 430 ? 17.056  46.845  48.518  1.00 33.12 ? 468 ARG C N   1 
ATOM   10092 C CA  . ARG C 1 430 ? 16.624  47.996  49.256  1.00 32.62 ? 468 ARG C CA  1 
ATOM   10093 C C   . ARG C 1 430 ? 17.703  49.072  49.243  1.00 31.88 ? 468 ARG C C   1 
ATOM   10094 O O   . ARG C 1 430 ? 18.880  48.754  49.251  1.00 30.00 ? 468 ARG C O   1 
ATOM   10095 C CB  . ARG C 1 430 ? 16.381  47.575  50.679  1.00 32.86 ? 468 ARG C CB  1 
ATOM   10096 C CG  . ARG C 1 430 ? 16.059  48.744  51.583  1.00 34.33 ? 468 ARG C CG  1 
ATOM   10097 C CD  . ARG C 1 430 ? 15.543  48.286  52.883  1.00 31.73 ? 468 ARG C CD  1 
ATOM   10098 N NE  . ARG C 1 430 ? 14.201  47.806  52.710  1.00 30.61 ? 468 ARG C NE  1 
ATOM   10099 C CZ  . ARG C 1 430 ? 13.471  47.297  53.688  1.00 29.14 ? 468 ARG C CZ  1 
ATOM   10100 N NH1 . ARG C 1 430 ? 12.245  46.896  53.453  1.00 30.15 ? 468 ARG C NH1 1 
ATOM   10101 N NH2 . ARG C 1 430 ? 13.973  47.190  54.896  1.00 27.35 ? 468 ARG C NH2 1 
ATOM   10102 N N   . ILE C 1 431 ? 17.280  50.340  49.214  1.00 31.54 ? 469 ILE C N   1 
ATOM   10103 C CA  . ILE C 1 431 ? 18.208  51.481  49.260  1.00 31.05 ? 469 ILE C CA  1 
ATOM   10104 C C   . ILE C 1 431 ? 17.883  52.282  50.505  1.00 31.53 ? 469 ILE C C   1 
ATOM   10105 O O   . ILE C 1 431 ? 16.743  52.740  50.697  1.00 30.98 ? 469 ILE C O   1 
ATOM   10106 C CB  . ILE C 1 431 ? 18.096  52.420  48.014  1.00 30.65 ? 469 ILE C CB  1 
ATOM   10107 C CG1 . ILE C 1 431 ? 18.098  51.622  46.717  1.00 30.89 ? 469 ILE C CG1 1 
ATOM   10108 C CG2 . ILE C 1 431 ? 19.251  53.428  47.976  1.00 29.70 ? 469 ILE C CG2 1 
ATOM   10109 C CD1 . ILE C 1 431 ? 17.593  52.368  45.472  1.00 30.48 ? 469 ILE C CD1 1 
ATOM   10110 N N   . ILE C 1 432 ? 18.881  52.459  51.355  1.00 32.20 ? 470 ILE C N   1 
ATOM   10111 C CA  . ILE C 1 432 ? 18.776  53.402  52.463  1.00 32.24 ? 470 ILE C CA  1 
ATOM   10112 C C   . ILE C 1 432 ? 19.699  54.599  52.197  1.00 31.95 ? 470 ILE C C   1 
ATOM   10113 O O   . ILE C 1 432 ? 20.900  54.434  51.994  1.00 31.69 ? 470 ILE C O   1 
ATOM   10114 C CB  . ILE C 1 432 ? 19.170  52.791  53.825  1.00 32.47 ? 470 ILE C CB  1 
ATOM   10115 C CG1 . ILE C 1 432 ? 18.370  51.499  54.119  1.00 33.08 ? 470 ILE C CG1 1 
ATOM   10116 C CG2 . ILE C 1 432 ? 18.949  53.869  54.920  1.00 32.21 ? 470 ILE C CG2 1 
ATOM   10117 C CD1 . ILE C 1 432 ? 18.926  50.655  55.259  1.00 31.05 ? 470 ILE C CD1 1 
ATOM   10118 N N   . THR C 1 433 ? 19.107  55.782  52.203  1.00 31.46 ? 471 THR C N   1 
ATOM   10119 C CA  . THR C 1 433 ? 19.817  57.041  52.166  1.00 32.14 ? 471 THR C CA  1 
ATOM   10120 C C   . THR C 1 433 ? 19.463  57.865  53.427  1.00 32.43 ? 471 THR C C   1 
ATOM   10121 O O   . THR C 1 433 ? 18.828  57.368  54.346  1.00 32.38 ? 471 THR C O   1 
ATOM   10122 C CB  . THR C 1 433 ? 19.484  57.837  50.853  1.00 32.08 ? 471 THR C CB  1 
ATOM   10123 O OG1 . THR C 1 433 ? 18.251  58.543  51.000  1.00 32.80 ? 471 THR C OG1 1 
ATOM   10124 C CG2 . THR C 1 433 ? 19.371  56.930  49.654  1.00 30.30 ? 471 THR C CG2 1 
ATOM   10125 N N   . GLU C 1 434 ? 19.903  59.119  53.475  1.00 33.37 ? 472 GLU C N   1 
ATOM   10126 C CA  . GLU C 1 434 ? 19.564  60.027  54.586  1.00 33.39 ? 472 GLU C CA  1 
ATOM   10127 C C   . GLU C 1 434 ? 18.167  60.625  54.431  1.00 33.29 ? 472 GLU C C   1 
ATOM   10128 O O   . GLU C 1 434 ? 17.603  61.160  55.401  1.00 33.65 ? 472 GLU C O   1 
ATOM   10129 C CB  . GLU C 1 434 ? 20.644  61.121  54.773  1.00 33.30 ? 472 GLU C CB  1 
ATOM   10130 C CG  . GLU C 1 434 ? 20.557  62.303  53.829  1.00 33.94 ? 472 GLU C CG  1 
ATOM   10131 C CD  . GLU C 1 434 ? 21.146  62.026  52.470  1.00 33.38 ? 472 GLU C CD  1 
ATOM   10132 O OE1 . GLU C 1 434 ? 21.467  60.862  52.200  1.00 32.63 ? 472 GLU C OE1 1 
ATOM   10133 O OE2 . GLU C 1 434 ? 21.276  62.969  51.666  1.00 31.93 ? 472 GLU C OE2 1 
ATOM   10134 N N   . LYS C 1 435 ? 17.590  60.500  53.236  1.00 32.77 ? 473 LYS C N   1 
ATOM   10135 C CA  . LYS C 1 435 ? 16.255  61.036  52.952  1.00 33.14 ? 473 LYS C CA  1 
ATOM   10136 C C   . LYS C 1 435 ? 15.155  59.998  52.712  1.00 32.06 ? 473 LYS C C   1 
ATOM   10137 O O   . LYS C 1 435 ? 13.979  60.334  52.796  1.00 31.91 ? 473 LYS C O   1 
ATOM   10138 C CB  . LYS C 1 435 ? 16.285  61.929  51.699  1.00 33.20 ? 473 LYS C CB  1 
ATOM   10139 C CG  . LYS C 1 435 ? 17.504  62.815  51.540  1.00 34.28 ? 473 LYS C CG  1 
ATOM   10140 C CD  . LYS C 1 435 ? 17.387  63.683  50.277  1.00 34.60 ? 473 LYS C CD  1 
ATOM   10141 C CE  . LYS C 1 435 ? 18.069  65.043  50.454  1.00 34.29 ? 473 LYS C CE  1 
ATOM   10142 N NZ  . LYS C 1 435 ? 17.950  65.854  49.215  1.00 34.46 ? 473 LYS C NZ  1 
ATOM   10143 N N   . ALA C 1 436 ? 15.507  58.766  52.377  1.00 31.23 ? 474 ALA C N   1 
ATOM   10144 C CA  . ALA C 1 436 ? 14.535  57.878  51.750  1.00 31.05 ? 474 ALA C CA  1 
ATOM   10145 C C   . ALA C 1 436 ? 14.893  56.451  51.966  1.00 31.24 ? 474 ALA C C   1 
ATOM   10146 O O   . ALA C 1 436 ? 16.056  56.139  52.032  1.00 32.20 ? 474 ALA C O   1 
ATOM   10147 C CB  . ALA C 1 436 ? 14.475  58.147  50.255  1.00 30.37 ? 474 ALA C CB  1 
ATOM   10148 N N   . VAL C 1 437 ? 13.909  55.566  52.051  1.00 31.23 ? 475 VAL C N   1 
ATOM   10149 C CA  . VAL C 1 437 ? 14.204  54.148  51.921  1.00 31.37 ? 475 VAL C CA  1 
ATOM   10150 C C   . VAL C 1 437 ? 13.302  53.620  50.800  1.00 31.51 ? 475 VAL C C   1 
ATOM   10151 O O   . VAL C 1 437 ? 12.112  53.900  50.787  1.00 32.75 ? 475 VAL C O   1 
ATOM   10152 C CB  . VAL C 1 437 ? 14.040  53.392  53.263  1.00 31.44 ? 475 VAL C CB  1 
ATOM   10153 C CG1 . VAL C 1 437 ? 14.359  51.938  53.107  1.00 29.45 ? 475 VAL C CG1 1 
ATOM   10154 C CG2 . VAL C 1 437 ? 14.915  54.006  54.345  1.00 30.35 ? 475 VAL C CG2 1 
ATOM   10155 N N   . PHE C 1 438 ? 13.896  52.944  49.818  1.00 32.06 ? 476 PHE C N   1 
ATOM   10156 C CA  . PHE C 1 438 ? 13.179  52.396  48.666  1.00 31.30 ? 476 PHE C CA  1 
ATOM   10157 C C   . PHE C 1 438 ? 13.279  50.894  48.721  1.00 31.68 ? 476 PHE C C   1 
ATOM   10158 O O   . PHE C 1 438 ? 14.342  50.388  49.009  1.00 31.05 ? 476 PHE C O   1 
ATOM   10159 C CB  . PHE C 1 438 ? 13.815  52.825  47.339  1.00 30.56 ? 476 PHE C CB  1 
ATOM   10160 C CG  . PHE C 1 438 ? 13.746  54.302  47.057  1.00 29.47 ? 476 PHE C CG  1 
ATOM   10161 C CD1 . PHE C 1 438 ? 12.661  54.850  46.383  1.00 29.85 ? 476 PHE C CD1 1 
ATOM   10162 C CD2 . PHE C 1 438 ? 14.806  55.134  47.404  1.00 30.28 ? 476 PHE C CD2 1 
ATOM   10163 C CE1 . PHE C 1 438 ? 12.611  56.214  46.119  1.00 30.77 ? 476 PHE C CE1 1 
ATOM   10164 C CE2 . PHE C 1 438 ? 14.781  56.489  47.122  1.00 28.32 ? 476 PHE C CE2 1 
ATOM   10165 C CZ  . PHE C 1 438 ? 13.684  57.029  46.477  1.00 30.47 ? 476 PHE C CZ  1 
ATOM   10166 N N   . ASP C 1 439 ? 12.173  50.198  48.460  1.00 32.39 ? 477 ASP C N   1 
ATOM   10167 C CA  . ASP C 1 439 ? 12.230  48.799  48.014  1.00 33.72 ? 477 ASP C CA  1 
ATOM   10168 C C   . ASP C 1 439 ? 12.514  48.810  46.499  1.00 33.52 ? 477 ASP C C   1 
ATOM   10169 O O   . ASP C 1 439 ? 12.019  49.659  45.779  1.00 33.21 ? 477 ASP C O   1 
ATOM   10170 C CB  . ASP C 1 439 ? 10.927  48.044  48.336  1.00 33.45 ? 477 ASP C CB  1 
ATOM   10171 C CG  . ASP C 1 439 ? 10.765  47.728  49.848  1.00 35.66 ? 477 ASP C CG  1 
ATOM   10172 O OD1 . ASP C 1 439 ? 11.779  47.646  50.561  1.00 39.70 ? 477 ASP C OD1 1 
ATOM   10173 O OD2 . ASP C 1 439 ? 9.616   47.598  50.336  1.00 38.94 ? 477 ASP C OD2 1 
ATOM   10174 N N   . VAL C 1 440 ? 13.320  47.865  46.032  1.00 34.85 ? 478 VAL C N   1 
ATOM   10175 C CA  . VAL C 1 440 ? 13.701  47.761  44.610  1.00 34.99 ? 478 VAL C CA  1 
ATOM   10176 C C   . VAL C 1 440 ? 13.177  46.422  44.040  1.00 35.51 ? 478 VAL C C   1 
ATOM   10177 O O   . VAL C 1 440 ? 13.329  45.398  44.637  1.00 33.76 ? 478 VAL C O   1 
ATOM   10178 C CB  . VAL C 1 440 ? 15.240  47.865  44.383  1.00 34.71 ? 478 VAL C CB  1 
ATOM   10179 C CG1 . VAL C 1 440 ? 15.543  48.183  42.925  1.00 35.50 ? 478 VAL C CG1 1 
ATOM   10180 C CG2 . VAL C 1 440 ? 15.908  48.962  45.253  1.00 33.15 ? 478 VAL C CG2 1 
ATOM   10181 N N   . ASP C 1 441 ? 12.554  46.463  42.873  1.00 37.42 ? 479 ASP C N   1 
ATOM   10182 C CA  . ASP C 1 441 ? 12.090  45.263  42.182  1.00 38.53 ? 479 ASP C CA  1 
ATOM   10183 C C   . ASP C 1 441 ? 12.609  45.282  40.746  1.00 38.61 ? 479 ASP C C   1 
ATOM   10184 O O   . ASP C 1 441 ? 12.459  46.283  40.046  1.00 37.98 ? 479 ASP C O   1 
ATOM   10185 C CB  . ASP C 1 441 ? 10.551  45.243  42.166  1.00 39.37 ? 479 ASP C CB  1 
ATOM   10186 C CG  . ASP C 1 441 ? 9.994   43.957  41.601  1.00 41.65 ? 479 ASP C CG  1 
ATOM   10187 O OD1 . ASP C 1 441 ? 10.393  42.890  42.094  1.00 47.73 ? 479 ASP C OD1 1 
ATOM   10188 O OD2 . ASP C 1 441 ? 9.172   44.010  40.669  1.00 45.58 ? 479 ASP C OD2 1 
ATOM   10189 N N   . LYS C 1 442 ? 13.169  44.155  40.311  1.00 39.65 ? 480 LYS C N   1 
ATOM   10190 C CA  . LYS C 1 442 ? 13.727  44.006  38.975  1.00 40.57 ? 480 LYS C CA  1 
ATOM   10191 C C   . LYS C 1 442 ? 12.740  44.232  37.839  1.00 40.63 ? 480 LYS C C   1 
ATOM   10192 O O   . LYS C 1 442 ? 13.164  44.543  36.729  1.00 41.00 ? 480 LYS C O   1 
ATOM   10193 C CB  . LYS C 1 442 ? 14.433  42.645  38.820  1.00 40.92 ? 480 LYS C CB  1 
ATOM   10194 C CG  . LYS C 1 442 ? 13.552  41.417  38.673  1.00 42.28 ? 480 LYS C CG  1 
ATOM   10195 C CD  . LYS C 1 442 ? 14.366  40.142  38.903  1.00 41.59 ? 480 LYS C CD  1 
ATOM   10196 N N   . LYS C 1 443 ? 11.447  44.081  38.139  1.00 41.09 ? 481 LYS C N   1 
ATOM   10197 C CA  . LYS C 1 443 ? 10.336  44.208  37.195  1.00 40.92 ? 481 LYS C CA  1 
ATOM   10198 C C   . LYS C 1 443 ? 9.499   45.493  37.391  1.00 40.76 ? 481 LYS C C   1 
ATOM   10199 O O   . LYS C 1 443 ? 9.076   46.121  36.410  1.00 39.90 ? 481 LYS C O   1 
ATOM   10200 C CB  . LYS C 1 443 ? 9.396   43.002  37.349  1.00 40.97 ? 481 LYS C CB  1 
ATOM   10201 N N   . LYS C 1 444 ? 9.243   45.856  38.651  1.00 39.96 ? 482 LYS C N   1 
ATOM   10202 C CA  . LYS C 1 444 ? 8.402   47.023  38.979  1.00 39.64 ? 482 LYS C CA  1 
ATOM   10203 C C   . LYS C 1 444 ? 9.165   48.359  39.221  1.00 38.40 ? 482 LYS C C   1 
ATOM   10204 O O   . LYS C 1 444 ? 8.586   49.446  39.093  1.00 38.20 ? 482 LYS C O   1 
ATOM   10205 C CB  . LYS C 1 444 ? 7.552   46.697  40.212  1.00 39.88 ? 482 LYS C CB  1 
ATOM   10206 C CG  . LYS C 1 444 ? 6.531   45.599  39.999  1.00 42.45 ? 482 LYS C CG  1 
ATOM   10207 C CD  . LYS C 1 444 ? 5.865   45.197  41.310  1.00 45.30 ? 482 LYS C CD  1 
ATOM   10208 C CE  . LYS C 1 444 ? 4.982   43.983  41.144  1.00 45.49 ? 482 LYS C CE  1 
ATOM   10209 N NZ  . LYS C 1 444 ? 4.599   43.449  42.484  1.00 46.90 ? 482 LYS C NZ  1 
ATOM   10210 N N   . GLY C 1 445 ? 10.439  48.277  39.597  1.00 37.19 ? 483 GLY C N   1 
ATOM   10211 C CA  . GLY C 1 445 ? 11.228  49.457  39.893  1.00 35.83 ? 483 GLY C CA  1 
ATOM   10212 C C   . GLY C 1 445 ? 11.202  49.765  41.368  1.00 35.17 ? 483 GLY C C   1 
ATOM   10213 O O   . GLY C 1 445 ? 11.194  48.862  42.197  1.00 35.83 ? 483 GLY C O   1 
ATOM   10214 N N   . LEU C 1 446 ? 11.155  51.049  41.694  1.00 35.31 ? 484 LEU C N   1 
ATOM   10215 C CA  . LEU C 1 446 ? 11.325  51.541  43.054  1.00 35.08 ? 484 LEU C CA  1 
ATOM   10216 C C   . LEU C 1 446 ? 10.003  51.816  43.732  1.00 35.01 ? 484 LEU C C   1 
ATOM   10217 O O   . LEU C 1 446 ? 9.033   52.231  43.086  1.00 36.98 ? 484 LEU C O   1 
ATOM   10218 C CB  . LEU C 1 446 ? 12.140  52.848  43.065  1.00 34.46 ? 484 LEU C CB  1 
ATOM   10219 C CG  . LEU C 1 446 ? 13.584  52.835  42.642  1.00 34.64 ? 484 LEU C CG  1 
ATOM   10220 C CD1 . LEU C 1 446 ? 14.172  54.261  42.755  1.00 35.62 ? 484 LEU C CD1 1 
ATOM   10221 C CD2 . LEU C 1 446 ? 14.420  51.816  43.461  1.00 32.52 ? 484 LEU C CD2 1 
ATOM   10222 N N   . THR C 1 447 ? 9.969   51.587  45.045  1.00 34.87 ? 485 THR C N   1 
ATOM   10223 C CA  . THR C 1 447 ? 8.858   51.993  45.898  1.00 34.06 ? 485 THR C CA  1 
ATOM   10224 C C   . THR C 1 447 ? 9.394   52.709  47.118  1.00 33.77 ? 485 THR C C   1 
ATOM   10225 O O   . THR C 1 447 ? 10.160  52.117  47.878  1.00 32.39 ? 485 THR C O   1 
ATOM   10226 C CB  . THR C 1 447 ? 8.057   50.795  46.365  1.00 34.64 ? 485 THR C CB  1 
ATOM   10227 O OG1 . THR C 1 447 ? 7.578   50.106  45.213  1.00 36.60 ? 485 THR C OG1 1 
ATOM   10228 C CG2 . THR C 1 447 ? 6.855   51.246  47.166  1.00 33.59 ? 485 THR C CG2 1 
ATOM   10229 N N   . LEU C 1 448 ? 9.018   53.983  47.295  1.00 33.47 ? 486 LEU C N   1 
ATOM   10230 C CA  . LEU C 1 448 ? 9.409   54.723  48.493  1.00 33.41 ? 486 LEU C CA  1 
ATOM   10231 C C   . LEU C 1 448 ? 8.628   54.126  49.657  1.00 34.00 ? 486 LEU C C   1 
ATOM   10232 O O   . LEU C 1 448 ? 7.401   54.156  49.660  1.00 35.48 ? 486 LEU C O   1 
ATOM   10233 C CB  . LEU C 1 448 ? 9.097   56.217  48.335  1.00 33.29 ? 486 LEU C CB  1 
ATOM   10234 C CG  . LEU C 1 448 ? 9.513   57.146  49.484  1.00 33.05 ? 486 LEU C CG  1 
ATOM   10235 C CD1 . LEU C 1 448 ? 11.024  57.323  49.521  1.00 28.35 ? 486 LEU C CD1 1 
ATOM   10236 C CD2 . LEU C 1 448 ? 8.786   58.533  49.422  1.00 32.33 ? 486 LEU C CD2 1 
ATOM   10237 N N   . ILE C 1 449 ? 9.302   53.565  50.651  1.00 34.76 ? 487 ILE C N   1 
ATOM   10238 C CA  . ILE C 1 449 ? 8.562   52.990  51.814  1.00 34.26 ? 487 ILE C CA  1 
ATOM   10239 C C   . ILE C 1 449 ? 8.736   53.822  53.096  1.00 34.81 ? 487 ILE C C   1 
ATOM   10240 O O   . ILE C 1 449 ? 7.918   53.737  54.012  1.00 35.49 ? 487 ILE C O   1 
ATOM   10241 C CB  . ILE C 1 449 ? 8.921   51.471  52.053  1.00 34.05 ? 487 ILE C CB  1 
ATOM   10242 C CG1 . ILE C 1 449 ? 10.406  51.299  52.418  1.00 33.31 ? 487 ILE C CG1 1 
ATOM   10243 C CG2 . ILE C 1 449 ? 8.553   50.647  50.815  1.00 32.95 ? 487 ILE C CG2 1 
ATOM   10244 C CD1 . ILE C 1 449 ? 10.797  49.959  52.986  1.00 33.29 ? 487 ILE C CD1 1 
ATOM   10245 N N   . GLU C 1 450 ? 9.805   54.609  53.165  1.00 35.28 ? 488 GLU C N   1 
ATOM   10246 C CA  . GLU C 1 450 ? 10.053  55.512  54.285  1.00 35.62 ? 488 GLU C CA  1 
ATOM   10247 C C   . GLU C 1 450 ? 10.641  56.803  53.775  1.00 35.64 ? 488 GLU C C   1 
ATOM   10248 O O   . GLU C 1 450 ? 11.201  56.844  52.702  1.00 35.05 ? 488 GLU C O   1 
ATOM   10249 C CB  . GLU C 1 450 ? 10.999  54.901  55.318  1.00 35.73 ? 488 GLU C CB  1 
ATOM   10250 C CG  . GLU C 1 450 ? 10.516  53.604  55.885  1.00 36.82 ? 488 GLU C CG  1 
ATOM   10251 C CD  . GLU C 1 450 ? 11.363  53.079  57.026  1.00 39.90 ? 488 GLU C CD  1 
ATOM   10252 O OE1 . GLU C 1 450 ? 12.236  53.802  57.561  1.00 42.00 ? 488 GLU C OE1 1 
ATOM   10253 O OE2 . GLU C 1 450 ? 11.148  51.906  57.386  1.00 42.09 ? 488 GLU C OE2 1 
ATOM   10254 N N   . LEU C 1 451 ? 10.498  57.852  54.573  1.00 36.43 ? 489 LEU C N   1 
ATOM   10255 C CA  . LEU C 1 451 ? 10.818  59.206  54.169  1.00 37.08 ? 489 LEU C CA  1 
ATOM   10256 C C   . LEU C 1 451 ? 11.214  59.991  55.405  1.00 36.99 ? 489 LEU C C   1 
ATOM   10257 O O   . LEU C 1 451 ? 10.443  60.043  56.346  1.00 37.22 ? 489 LEU C O   1 
ATOM   10258 C CB  . LEU C 1 451 ? 9.564   59.846  53.544  1.00 38.13 ? 489 LEU C CB  1 
ATOM   10259 C CG  . LEU C 1 451 ? 9.653   61.294  53.060  1.00 37.90 ? 489 LEU C CG  1 
ATOM   10260 C CD1 . LEU C 1 451 ? 10.949  61.474  52.270  1.00 39.92 ? 489 LEU C CD1 1 
ATOM   10261 C CD2 . LEU C 1 451 ? 8.453   61.623  52.206  1.00 38.01 ? 489 LEU C CD2 1 
ATOM   10262 N N   . TRP C 1 452 ? 12.385  60.621  55.402  1.00 37.43 ? 490 TRP C N   1 
ATOM   10263 C CA  . TRP C 1 452 ? 12.859  61.327  56.574  1.00 37.86 ? 490 TRP C CA  1 
ATOM   10264 C C   . TRP C 1 452 ? 11.869  62.439  56.993  1.00 38.63 ? 490 TRP C C   1 
ATOM   10265 O O   . TRP C 1 452 ? 11.259  63.126  56.150  1.00 38.34 ? 490 TRP C O   1 
ATOM   10266 C CB  . TRP C 1 452 ? 14.246  61.905  56.311  1.00 38.60 ? 490 TRP C CB  1 
ATOM   10267 C CG  . TRP C 1 452 ? 14.763  62.720  57.436  1.00 39.06 ? 490 TRP C CG  1 
ATOM   10268 C CD1 . TRP C 1 452 ? 14.670  64.078  57.575  1.00 39.52 ? 490 TRP C CD1 1 
ATOM   10269 C CD2 . TRP C 1 452 ? 15.421  62.237  58.614  1.00 39.46 ? 490 TRP C CD2 1 
ATOM   10270 N NE1 . TRP C 1 452 ? 15.248  64.471  58.752  1.00 39.07 ? 490 TRP C NE1 1 
ATOM   10271 C CE2 . TRP C 1 452 ? 15.713  63.365  59.416  1.00 40.02 ? 490 TRP C CE2 1 
ATOM   10272 C CE3 . TRP C 1 452 ? 15.792  60.969  59.067  1.00 39.83 ? 490 TRP C CE3 1 
ATOM   10273 C CZ2 . TRP C 1 452 ? 16.362  63.263  60.651  1.00 39.57 ? 490 TRP C CZ2 1 
ATOM   10274 C CZ3 . TRP C 1 452 ? 16.434  60.869  60.307  1.00 40.00 ? 490 TRP C CZ3 1 
ATOM   10275 C CH2 . TRP C 1 452 ? 16.707  62.013  61.081  1.00 39.08 ? 490 TRP C CH2 1 
ATOM   10276 N N   . GLU C 1 453 ? 11.709  62.612  58.301  1.00 38.20 ? 491 GLU C N   1 
ATOM   10277 C CA  . GLU C 1 453 ? 10.552  63.320  58.807  1.00 38.65 ? 491 GLU C CA  1 
ATOM   10278 C C   . GLU C 1 453 ? 10.662  64.848  58.569  1.00 38.16 ? 491 GLU C C   1 
ATOM   10279 O O   . GLU C 1 453 ? 11.631  65.568  58.985  1.00 38.65 ? 491 GLU C O   1 
ATOM   10280 C CB  . GLU C 1 453 ? 10.260  62.949  60.271  1.00 38.41 ? 491 GLU C CB  1 
ATOM   10281 C CG  . GLU C 1 453 ? 10.810  63.869  61.366  1.00 39.62 ? 491 GLU C CG  1 
ATOM   10282 C CD  . GLU C 1 453 ? 10.054  63.679  62.685  1.00 40.07 ? 491 GLU C CD  1 
ATOM   10283 O OE1 . GLU C 1 453 ? 9.728   64.680  63.375  1.00 42.83 ? 491 GLU C OE1 1 
ATOM   10284 O OE2 . GLU C 1 453 ? 9.760   62.515  63.031  1.00 42.72 ? 491 GLU C OE2 1 
ATOM   10285 N N   . GLY C 1 454 ? 9.661   65.329  57.791  1.00 37.50 ? 492 GLY C N   1 
ATOM   10286 C CA  . GLY C 1 454 ? 9.666   66.707  57.352  1.00 37.54 ? 492 GLY C CA  1 
ATOM   10287 C C   . GLY C 1 454 ? 10.134  66.848  55.924  1.00 37.50 ? 492 GLY C C   1 
ATOM   10288 O O   . GLY C 1 454 ? 10.304  67.963  55.445  1.00 37.53 ? 492 GLY C O   1 
ATOM   10289 N N   . LEU C 1 455 ? 10.378  65.724  55.245  1.00 37.71 ? 493 LEU C N   1 
ATOM   10290 C CA  . LEU C 1 455 ? 10.576  65.738  53.794  1.00 37.42 ? 493 LEU C CA  1 
ATOM   10291 C C   . LEU C 1 455 ? 9.253   65.438  53.079  1.00 37.41 ? 493 LEU C C   1 
ATOM   10292 O O   . LEU C 1 455 ? 8.292   64.943  53.685  1.00 37.75 ? 493 LEU C O   1 
ATOM   10293 C CB  . LEU C 1 455 ? 11.700  64.788  53.357  1.00 37.42 ? 493 LEU C CB  1 
ATOM   10294 C CG  . LEU C 1 455 ? 13.092  65.265  53.788  1.00 37.14 ? 493 LEU C CG  1 
ATOM   10295 C CD1 . LEU C 1 455 ? 14.179  64.342  53.268  1.00 35.66 ? 493 LEU C CD1 1 
ATOM   10296 C CD2 . LEU C 1 455 ? 13.340  66.685  53.318  1.00 37.46 ? 493 LEU C CD2 1 
ATOM   10297 N N   . THR C 1 456 ? 9.202   65.818  51.806  1.00 36.83 ? 494 THR C N   1 
ATOM   10298 C CA  . THR C 1 456 ? 8.061   65.567  50.943  1.00 36.41 ? 494 THR C CA  1 
ATOM   10299 C C   . THR C 1 456 ? 8.462   64.565  49.864  1.00 35.72 ? 494 THR C C   1 
ATOM   10300 O O   . THR C 1 456 ? 9.634   64.430  49.534  1.00 35.73 ? 494 THR C O   1 
ATOM   10301 C CB  . THR C 1 456 ? 7.594   66.878  50.278  1.00 36.32 ? 494 THR C CB  1 
ATOM   10302 O OG1 . THR C 1 456 ? 7.253   67.819  51.301  1.00 37.67 ? 494 THR C OG1 1 
ATOM   10303 C CG2 . THR C 1 456 ? 6.389   66.654  49.353  1.00 35.40 ? 494 THR C CG2 1 
ATOM   10304 N N   . VAL C 1 457 ? 7.470   63.849  49.352  1.00 35.56 ? 495 VAL C N   1 
ATOM   10305 C CA  . VAL C 1 457 ? 7.613   63.004  48.188  1.00 35.59 ? 495 VAL C CA  1 
ATOM   10306 C C   . VAL C 1 457 ? 8.183   63.823  47.032  1.00 35.75 ? 495 VAL C C   1 
ATOM   10307 O O   . VAL C 1 457 ? 9.071   63.348  46.321  1.00 34.57 ? 495 VAL C O   1 
ATOM   10308 C CB  . VAL C 1 457 ? 6.253   62.341  47.814  1.00 35.80 ? 495 VAL C CB  1 
ATOM   10309 C CG1 . VAL C 1 457 ? 6.231   61.851  46.373  1.00 36.05 ? 495 VAL C CG1 1 
ATOM   10310 C CG2 . VAL C 1 457 ? 5.952   61.202  48.775  1.00 35.53 ? 495 VAL C CG2 1 
ATOM   10311 N N   . ASP C 1 458 ? 7.709   65.063  46.865  1.00 35.92 ? 496 ASP C N   1 
ATOM   10312 C CA  . ASP C 1 458 ? 8.287   65.943  45.849  1.00 36.12 ? 496 ASP C CA  1 
ATOM   10313 C C   . ASP C 1 458 ? 9.777   66.271  46.104  1.00 36.19 ? 496 ASP C C   1 
ATOM   10314 O O   . ASP C 1 458 ? 10.571  66.318  45.146  1.00 36.14 ? 496 ASP C O   1 
ATOM   10315 C CB  . ASP C 1 458 ? 7.469   67.221  45.655  1.00 36.36 ? 496 ASP C CB  1 
ATOM   10316 C CG  . ASP C 1 458 ? 7.656   67.825  44.261  1.00 37.75 ? 496 ASP C CG  1 
ATOM   10317 O OD1 . ASP C 1 458 ? 8.589   67.416  43.517  1.00 40.81 ? 496 ASP C OD1 1 
ATOM   10318 O OD2 . ASP C 1 458 ? 6.861   68.701  43.887  1.00 40.30 ? 496 ASP C OD2 1 
ATOM   10319 N N   . ASP C 1 459 ? 10.162  66.472  47.367  1.00 36.18 ? 497 ASP C N   1 
ATOM   10320 C CA  . ASP C 1 459 ? 11.582  66.679  47.727  1.00 36.82 ? 497 ASP C CA  1 
ATOM   10321 C C   . ASP C 1 459 ? 12.496  65.539  47.306  1.00 36.96 ? 497 ASP C C   1 
ATOM   10322 O O   . ASP C 1 459 ? 13.611  65.770  46.837  1.00 36.87 ? 497 ASP C O   1 
ATOM   10323 C CB  . ASP C 1 459 ? 11.771  66.837  49.230  1.00 37.01 ? 497 ASP C CB  1 
ATOM   10324 C CG  . ASP C 1 459 ? 11.105  68.072  49.768  1.00 38.28 ? 497 ASP C CG  1 
ATOM   10325 O OD1 . ASP C 1 459 ? 10.879  69.015  48.979  1.00 40.90 ? 497 ASP C OD1 1 
ATOM   10326 O OD2 . ASP C 1 459 ? 10.803  68.085  50.982  1.00 39.84 ? 497 ASP C OD2 1 
ATOM   10327 N N   . VAL C 1 460 ? 12.032  64.317  47.553  1.00 36.75 ? 498 VAL C N   1 
ATOM   10328 C CA  . VAL C 1 460 ? 12.779  63.126  47.228  1.00 36.82 ? 498 VAL C CA  1 
ATOM   10329 C C   . VAL C 1 460 ? 12.853  62.983  45.713  1.00 36.90 ? 498 VAL C C   1 
ATOM   10330 O O   . VAL C 1 460 ? 13.904  62.668  45.181  1.00 37.49 ? 498 VAL C O   1 
ATOM   10331 C CB  . VAL C 1 460 ? 12.150  61.879  47.874  1.00 36.24 ? 498 VAL C CB  1 
ATOM   10332 C CG1 . VAL C 1 460 ? 12.795  60.609  47.338  1.00 36.75 ? 498 VAL C CG1 1 
ATOM   10333 C CG2 . VAL C 1 460 ? 12.290  61.980  49.363  1.00 35.65 ? 498 VAL C CG2 1 
ATOM   10334 N N   . GLN C 1 461 ? 11.743  63.240  45.028  1.00 36.94 ? 499 GLN C N   1 
ATOM   10335 C CA  . GLN C 1 461 ? 11.714  63.203  43.570  1.00 37.14 ? 499 GLN C CA  1 
ATOM   10336 C C   . GLN C 1 461 ? 12.711  64.176  42.925  1.00 36.38 ? 499 GLN C C   1 
ATOM   10337 O O   . GLN C 1 461 ? 13.266  63.866  41.876  1.00 36.60 ? 499 GLN C O   1 
ATOM   10338 C CB  . GLN C 1 461 ? 10.291  63.473  43.055  1.00 37.64 ? 499 GLN C CB  1 
ATOM   10339 C CG  . GLN C 1 461 ? 10.130  63.385  41.533  1.00 38.90 ? 499 GLN C CG  1 
ATOM   10340 C CD  . GLN C 1 461 ? 10.458  61.998  40.961  1.00 40.31 ? 499 GLN C CD  1 
ATOM   10341 O OE1 . GLN C 1 461 ? 9.547   61.223  40.669  1.00 42.68 ? 499 GLN C OE1 1 
ATOM   10342 N NE2 . GLN C 1 461 ? 11.745  61.694  40.790  1.00 37.85 ? 499 GLN C NE2 1 
ATOM   10343 N N   . LYS C 1 462 ? 12.957  65.323  43.560  1.00 35.85 ? 500 LYS C N   1 
ATOM   10344 C CA  . LYS C 1 462 ? 13.907  66.313  43.044  1.00 35.70 ? 500 LYS C CA  1 
ATOM   10345 C C   . LYS C 1 462 ? 15.368  65.827  43.147  1.00 35.78 ? 500 LYS C C   1 
ATOM   10346 O O   . LYS C 1 462 ? 16.270  66.367  42.503  1.00 35.98 ? 500 LYS C O   1 
ATOM   10347 C CB  . LYS C 1 462 ? 13.720  67.673  43.750  1.00 36.15 ? 500 LYS C CB  1 
ATOM   10348 N N   . SER C 1 463 ? 15.596  64.806  43.955  1.00 35.07 ? 501 SER C N   1 
ATOM   10349 C CA  . SER C 1 463 ? 16.918  64.284  44.163  1.00 34.98 ? 501 SER C CA  1 
ATOM   10350 C C   . SER C 1 463 ? 17.084  62.854  43.600  1.00 35.02 ? 501 SER C C   1 
ATOM   10351 O O   . SER C 1 463 ? 18.090  62.218  43.848  1.00 35.04 ? 501 SER C O   1 
ATOM   10352 C CB  . SER C 1 463 ? 17.244  64.330  45.657  1.00 35.45 ? 501 SER C CB  1 
ATOM   10353 O OG  . SER C 1 463 ? 17.238  65.655  46.132  1.00 33.63 ? 501 SER C OG  1 
ATOM   10354 N N   . THR C 1 464 ? 16.124  62.405  42.790  1.00 35.14 ? 502 THR C N   1 
ATOM   10355 C CA  . THR C 1 464 ? 16.053  61.042  42.284  1.00 35.49 ? 502 THR C CA  1 
ATOM   10356 C C   . THR C 1 464 ? 15.868  61.080  40.758  1.00 36.19 ? 502 THR C C   1 
ATOM   10357 O O   . THR C 1 464 ? 14.914  61.662  40.257  1.00 35.58 ? 502 THR C O   1 
ATOM   10358 C CB  . THR C 1 464 ? 14.891  60.287  42.978  1.00 35.58 ? 502 THR C CB  1 
ATOM   10359 O OG1 . THR C 1 464 ? 15.161  60.216  44.379  1.00 35.21 ? 502 THR C OG1 1 
ATOM   10360 C CG2 . THR C 1 464 ? 14.721  58.889  42.435  1.00 36.47 ? 502 THR C CG2 1 
ATOM   10361 N N   . GLY C 1 465 ? 16.785  60.447  40.025  1.00 37.16 ? 503 GLY C N   1 
ATOM   10362 C CA  . GLY C 1 465 ? 16.772  60.483  38.565  1.00 38.11 ? 503 GLY C CA  1 
ATOM   10363 C C   . GLY C 1 465 ? 15.760  59.597  37.860  1.00 38.54 ? 503 GLY C C   1 
ATOM   10364 O O   . GLY C 1 465 ? 15.834  59.402  36.657  1.00 39.18 ? 503 GLY C O   1 
ATOM   10365 N N   . CYS C 1 466 ? 14.814  59.042  38.597  1.00 39.06 ? 504 CYS C N   1 
ATOM   10366 C CA  . CYS C 1 466 ? 13.737  58.254  37.997  1.00 38.91 ? 504 CYS C CA  1 
ATOM   10367 C C   . CYS C 1 466 ? 12.458  58.418  38.808  1.00 39.32 ? 504 CYS C C   1 
ATOM   10368 O O   . CYS C 1 466 ? 12.467  58.922  39.940  1.00 38.87 ? 504 CYS C O   1 
ATOM   10369 C CB  . CYS C 1 466 ? 14.134  56.774  37.925  1.00 38.68 ? 504 CYS C CB  1 
ATOM   10370 S SG  . CYS C 1 466 ? 14.573  56.048  39.551  1.00 37.22 ? 504 CYS C SG  1 
ATOM   10371 N N   . ASP C 1 467 ? 11.360  57.976  38.222  1.00 39.97 ? 505 ASP C N   1 
ATOM   10372 C CA  . ASP C 1 467 ? 10.076  57.940  38.931  1.00 40.78 ? 505 ASP C CA  1 
ATOM   10373 C C   . ASP C 1 467 ? 10.112  56.808  39.965  1.00 40.11 ? 505 ASP C C   1 
ATOM   10374 O O   . ASP C 1 467 ? 10.990  55.939  39.911  1.00 40.17 ? 505 ASP C O   1 
ATOM   10375 C CB  . ASP C 1 467 ? 8.951   57.676  37.932  1.00 41.20 ? 505 ASP C CB  1 
ATOM   10376 C CG  . ASP C 1 467 ? 9.105   56.315  37.262  1.00 44.76 ? 505 ASP C CG  1 
ATOM   10377 O OD1 . ASP C 1 467 ? 10.281  55.893  37.031  1.00 48.22 ? 505 ASP C OD1 1 
ATOM   10378 O OD2 . ASP C 1 467 ? 8.079   55.659  37.002  1.00 49.37 ? 505 ASP C OD2 1 
ATOM   10379 N N   . PHE C 1 468 ? 9.144   56.818  40.883  1.00 39.29 ? 506 PHE C N   1 
ATOM   10380 C CA  . PHE C 1 468 ? 8.976   55.766  41.892  1.00 38.50 ? 506 PHE C CA  1 
ATOM   10381 C C   . PHE C 1 468 ? 7.552   55.736  42.439  1.00 38.61 ? 506 PHE C C   1 
ATOM   10382 O O   . PHE C 1 468 ? 6.852   56.748  42.466  1.00 38.47 ? 506 PHE C O   1 
ATOM   10383 C CB  . PHE C 1 468 ? 9.952   55.949  43.059  1.00 37.92 ? 506 PHE C CB  1 
ATOM   10384 C CG  . PHE C 1 468 ? 9.961   57.342  43.646  1.00 37.24 ? 506 PHE C CG  1 
ATOM   10385 C CD1 . PHE C 1 468 ? 9.050   57.708  44.650  1.00 36.35 ? 506 PHE C CD1 1 
ATOM   10386 C CD2 . PHE C 1 468 ? 10.878  58.289  43.197  1.00 34.89 ? 506 PHE C CD2 1 
ATOM   10387 C CE1 . PHE C 1 468 ? 9.069   58.973  45.203  1.00 34.65 ? 506 PHE C CE1 1 
ATOM   10388 C CE2 . PHE C 1 468 ? 10.906  59.542  43.745  1.00 35.50 ? 506 PHE C CE2 1 
ATOM   10389 C CZ  . PHE C 1 468 ? 9.984   59.897  44.752  1.00 36.07 ? 506 PHE C CZ  1 
ATOM   10390 N N   . ALA C 1 469 ? 7.130   54.562  42.877  1.00 38.86 ? 507 ALA C N   1 
ATOM   10391 C CA  . ALA C 1 469 ? 5.818   54.404  43.491  1.00 38.18 ? 507 ALA C CA  1 
ATOM   10392 C C   . ALA C 1 469 ? 6.016   54.742  44.956  1.00 38.63 ? 507 ALA C C   1 
ATOM   10393 O O   . ALA C 1 469 ? 7.131   54.605  45.499  1.00 39.60 ? 507 ALA C O   1 
ATOM   10394 C CB  . ALA C 1 469 ? 5.319   52.995  43.318  1.00 37.70 ? 507 ALA C CB  1 
ATOM   10395 N N   . VAL C 1 470 ? 4.968   55.253  45.579  1.00 39.04 ? 508 VAL C N   1 
ATOM   10396 C CA  . VAL C 1 470 ? 4.978   55.506  47.002  1.00 39.36 ? 508 VAL C CA  1 
ATOM   10397 C C   . VAL C 1 470 ? 4.123   54.415  47.573  1.00 39.96 ? 508 VAL C C   1 
ATOM   10398 O O   . VAL C 1 470 ? 3.035   54.163  47.054  1.00 40.72 ? 508 VAL C O   1 
ATOM   10399 C CB  . VAL C 1 470 ? 4.398   56.886  47.349  1.00 39.17 ? 508 VAL C CB  1 
ATOM   10400 C CG1 . VAL C 1 470 ? 4.271   57.046  48.861  1.00 38.42 ? 508 VAL C CG1 1 
ATOM   10401 C CG2 . VAL C 1 470 ? 5.279   57.985  46.764  1.00 38.50 ? 508 VAL C CG2 1 
ATOM   10402 N N   . SER C 1 471 ? 4.606   53.754  48.617  1.00 40.54 ? 509 SER C N   1 
ATOM   10403 C CA  . SER C 1 471 ? 3.802   52.734  49.282  1.00 41.30 ? 509 SER C CA  1 
ATOM   10404 C C   . SER C 1 471 ? 2.621   53.385  50.010  1.00 41.51 ? 509 SER C C   1 
ATOM   10405 O O   . SER C 1 471 ? 2.782   54.474  50.565  1.00 41.23 ? 509 SER C O   1 
ATOM   10406 C CB  . SER C 1 471 ? 4.638   51.949  50.289  1.00 41.54 ? 509 SER C CB  1 
ATOM   10407 O OG  . SER C 1 471 ? 3.786   51.230  51.168  1.00 41.19 ? 509 SER C OG  1 
ATOM   10408 N N   . PRO C 1 472 ? 1.436   52.720  50.022  1.00 42.19 ? 510 PRO C N   1 
ATOM   10409 C CA  . PRO C 1 472 ? 0.362   53.166  50.921  1.00 42.44 ? 510 PRO C CA  1 
ATOM   10410 C C   . PRO C 1 472 ? 0.689   53.060  52.423  1.00 42.45 ? 510 PRO C C   1 
ATOM   10411 O O   . PRO C 1 472 ? -0.029  53.660  53.247  1.00 42.28 ? 510 PRO C O   1 
ATOM   10412 C CB  . PRO C 1 472 ? -0.821  52.241  50.561  1.00 42.59 ? 510 PRO C CB  1 
ATOM   10413 C CG  . PRO C 1 472 ? -0.510  51.702  49.214  1.00 42.64 ? 510 PRO C CG  1 
ATOM   10414 C CD  . PRO C 1 472 ? 0.996   51.569  49.208  1.00 42.28 ? 510 PRO C CD  1 
ATOM   10415 N N   . LYS C 1 473 ? 1.741   52.308  52.754  1.00 42.20 ? 511 LYS C N   1 
ATOM   10416 C CA  . LYS C 1 473 ? 2.279   52.166  54.122  1.00 42.30 ? 511 LYS C CA  1 
ATOM   10417 C C   . LYS C 1 473 ? 3.475   53.100  54.458  1.00 41.98 ? 511 LYS C C   1 
ATOM   10418 O O   . LYS C 1 473 ? 4.185   52.875  55.447  1.00 41.78 ? 511 LYS C O   1 
ATOM   10419 C CB  . LYS C 1 473 ? 2.724   50.717  54.338  1.00 42.06 ? 511 LYS C CB  1 
ATOM   10420 N N   . LEU C 1 474 ? 3.670   54.141  53.650  1.00 41.50 ? 512 LEU C N   1 
ATOM   10421 C CA  . LEU C 1 474 ? 4.715   55.158  53.863  1.00 41.51 ? 512 LEU C CA  1 
ATOM   10422 C C   . LEU C 1 474 ? 4.783   55.677  55.302  1.00 41.57 ? 512 LEU C C   1 
ATOM   10423 O O   . LEU C 1 474 ? 3.764   55.997  55.892  1.00 42.21 ? 512 LEU C O   1 
ATOM   10424 C CB  . LEU C 1 474 ? 4.481   56.346  52.907  1.00 41.64 ? 512 LEU C CB  1 
ATOM   10425 C CG  . LEU C 1 474 ? 5.609   57.353  52.690  1.00 41.31 ? 512 LEU C CG  1 
ATOM   10426 C CD1 . LEU C 1 474 ? 6.733   56.696  51.949  1.00 39.23 ? 512 LEU C CD1 1 
ATOM   10427 C CD2 . LEU C 1 474 ? 5.094   58.542  51.914  1.00 40.65 ? 512 LEU C CD2 1 
ATOM   10428 N N   . MET C 1 475 ? 5.994   55.816  55.825  1.00 41.47 ? 513 MET C N   1 
ATOM   10429 C CA  . MET C 1 475 ? 6.242   56.049  57.246  1.00 41.86 ? 513 MET C CA  1 
ATOM   10430 C C   . MET C 1 475 ? 7.417   57.033  57.371  1.00 40.79 ? 513 MET C C   1 
ATOM   10431 O O   . MET C 1 475 ? 8.199   57.150  56.446  1.00 41.78 ? 513 MET C O   1 
ATOM   10432 C CB  . MET C 1 475 ? 6.604   54.694  57.895  1.00 41.80 ? 513 MET C CB  1 
ATOM   10433 C CG  . MET C 1 475 ? 6.857   54.710  59.404  1.00 42.27 ? 513 MET C CG  1 
ATOM   10434 S SD  . MET C 1 475 ? 7.785   53.272  60.007  1.00 44.93 ? 513 MET C SD  1 
ATOM   10435 C CE  . MET C 1 475 ? 7.983   53.712  61.810  1.00 42.83 ? 513 MET C CE  1 
ATOM   10436 N N   . PRO C 1 476 ? 7.536   57.768  58.489  1.00 39.83 ? 514 PRO C N   1 
ATOM   10437 C CA  . PRO C 1 476 ? 8.832   58.394  58.808  1.00 38.82 ? 514 PRO C CA  1 
ATOM   10438 C C   . PRO C 1 476 ? 10.004  57.390  58.836  1.00 38.20 ? 514 PRO C C   1 
ATOM   10439 O O   . PRO C 1 476 ? 9.816   56.193  59.083  1.00 37.21 ? 514 PRO C O   1 
ATOM   10440 C CB  . PRO C 1 476 ? 8.590   59.011  60.190  1.00 39.26 ? 514 PRO C CB  1 
ATOM   10441 C CG  . PRO C 1 476 ? 7.116   59.297  60.212  1.00 39.22 ? 514 PRO C CG  1 
ATOM   10442 C CD  . PRO C 1 476 ? 6.494   58.135  59.467  1.00 39.71 ? 514 PRO C CD  1 
ATOM   10443 N N   . MET C 1 477 ? 11.208  57.868  58.533  1.00 37.54 ? 515 MET C N   1 
ATOM   10444 C CA  . MET C 1 477 ? 12.362  56.980  58.435  1.00 37.01 ? 515 MET C CA  1 
ATOM   10445 C C   . MET C 1 477 ? 12.797  56.606  59.850  1.00 35.94 ? 515 MET C C   1 
ATOM   10446 O O   . MET C 1 477 ? 13.038  57.479  60.685  1.00 35.36 ? 515 MET C O   1 
ATOM   10447 C CB  . MET C 1 477 ? 13.510  57.647  57.668  1.00 37.10 ? 515 MET C CB  1 
ATOM   10448 C CG  . MET C 1 477 ? 14.563  56.683  57.244  1.00 36.77 ? 515 MET C CG  1 
ATOM   10449 S SD  . MET C 1 477 ? 15.941  57.445  56.398  1.00 38.17 ? 515 MET C SD  1 
ATOM   10450 C CE  . MET C 1 477 ? 17.069  57.626  57.770  1.00 37.55 ? 515 MET C CE  1 
ATOM   10451 N N   . GLN C 1 478 ? 12.884  55.310  60.125  1.00 34.81 ? 516 GLN C N   1 
ATOM   10452 C CA  . GLN C 1 478 ? 13.110  54.871  61.487  1.00 34.16 ? 516 GLN C CA  1 
ATOM   10453 C C   . GLN C 1 478 ? 14.553  55.165  61.848  1.00 33.74 ? 516 GLN C C   1 
ATOM   10454 O O   . GLN C 1 478 ? 15.387  55.401  60.960  1.00 34.29 ? 516 GLN C O   1 
ATOM   10455 C CB  . GLN C 1 478 ? 12.815  53.393  61.629  1.00 34.53 ? 516 GLN C CB  1 
ATOM   10456 C CG  . GLN C 1 478 ? 11.425  52.894  61.160  1.00 34.90 ? 516 GLN C CG  1 
ATOM   10457 C CD  . GLN C 1 478 ? 11.416  51.357  60.966  1.00 35.32 ? 516 GLN C CD  1 
ATOM   10458 O OE1 . GLN C 1 478 ? 11.126  50.597  61.894  1.00 40.00 ? 516 GLN C OE1 1 
ATOM   10459 N NE2 . GLN C 1 478 ? 11.735  50.908  59.764  1.00 35.34 ? 516 GLN C NE2 1 
ATOM   10460 N N   . GLN C 1 479 ? 14.841  55.186  63.143  1.00 33.26 ? 517 GLN C N   1 
ATOM   10461 C CA  . GLN C 1 479 ? 16.185  55.410  63.686  1.00 33.30 ? 517 GLN C CA  1 
ATOM   10462 C C   . GLN C 1 479 ? 16.363  54.539  64.936  1.00 33.99 ? 517 GLN C C   1 
ATOM   10463 O O   . GLN C 1 479 ? 15.523  54.551  65.819  1.00 33.44 ? 517 GLN C O   1 
ATOM   10464 C CB  . GLN C 1 479 ? 16.398  56.904  64.013  1.00 33.20 ? 517 GLN C CB  1 
ATOM   10465 C CG  . GLN C 1 479 ? 16.364  57.859  62.782  1.00 32.07 ? 517 GLN C CG  1 
ATOM   10466 C CD  . GLN C 1 479 ? 17.621  57.737  61.888  1.00 34.18 ? 517 GLN C CD  1 
ATOM   10467 O OE1 . GLN C 1 479 ? 18.669  58.292  62.224  1.00 34.32 ? 517 GLN C OE1 1 
ATOM   10468 N NE2 . GLN C 1 479 ? 17.513  57.016  60.748  1.00 29.84 ? 517 GLN C NE2 1 
ATOM   10469 N N   . ILE C 1 480 ? 17.438  53.757  65.001  1.00 35.57 ? 518 ILE C N   1 
ATOM   10470 C CA  . ILE C 1 480 ? 17.675  52.834  66.137  1.00 36.27 ? 518 ILE C CA  1 
ATOM   10471 C C   . ILE C 1 480 ? 17.874  53.619  67.449  1.00 37.57 ? 518 ILE C C   1 
ATOM   10472 O O   . ILE C 1 480 ? 18.627  54.600  67.482  1.00 38.29 ? 518 ILE C O   1 
ATOM   10473 C CB  . ILE C 1 480 ? 18.878  51.884  65.851  1.00 36.62 ? 518 ILE C CB  1 
ATOM   10474 C CG1 . ILE C 1 480 ? 18.966  50.742  66.890  1.00 36.62 ? 518 ILE C CG1 1 
ATOM   10475 C CG2 . ILE C 1 480 ? 20.204  52.655  65.785  1.00 36.12 ? 518 ILE C CG2 1 
ATOM   10476 C CD1 . ILE C 1 480 ? 19.886  49.582  66.427  1.00 35.77 ? 518 ILE C CD1 1 
ATOM   10477 N N   . ALA C 1 481 ? 17.147  53.236  68.501  1.00 38.30 ? 519 ALA C N   1 
ATOM   10478 C CA  . ALA C 1 481 ? 17.259  53.891  69.806  1.00 38.77 ? 519 ALA C CA  1 
ATOM   10479 C C   . ALA C 1 481 ? 17.384  52.838  70.893  1.00 39.08 ? 519 ALA C C   1 
ATOM   10480 O O   . ALA C 1 481 ? 17.512  53.174  72.070  1.00 39.79 ? 519 ALA C O   1 
ATOM   10481 C CB  . ALA C 1 481 ? 16.047  54.812  70.090  1.00 38.75 ? 519 ALA C CB  1 
ATOM   10482 N N   . THR D 1 2   ? 21.388  28.303  64.889  1.00 41.66 ? 40  THR D N   1 
ATOM   10483 C CA  . THR D 1 2   ? 21.232  26.826  64.965  1.00 41.48 ? 40  THR D CA  1 
ATOM   10484 C C   . THR D 1 2   ? 20.109  26.516  65.898  1.00 42.02 ? 40  THR D C   1 
ATOM   10485 O O   . THR D 1 2   ? 19.913  27.173  66.911  1.00 42.48 ? 40  THR D O   1 
ATOM   10486 C CB  . THR D 1 2   ? 22.528  26.153  65.471  1.00 41.98 ? 40  THR D CB  1 
ATOM   10487 O OG1 . THR D 1 2   ? 23.635  26.602  64.656  1.00 40.98 ? 40  THR D OG1 1 
ATOM   10488 C CG2 . THR D 1 2   ? 22.396  24.611  65.442  1.00 40.06 ? 40  THR D CG2 1 
ATOM   10489 N N   . LYS D 1 3   ? 19.337  25.509  65.570  1.00 42.48 ? 41  LYS D N   1 
ATOM   10490 C CA  . LYS D 1 3   ? 18.315  25.091  66.494  1.00 42.25 ? 41  LYS D CA  1 
ATOM   10491 C C   . LYS D 1 3   ? 18.677  23.728  67.048  1.00 41.78 ? 41  LYS D C   1 
ATOM   10492 O O   . LYS D 1 3   ? 18.998  22.803  66.326  1.00 40.18 ? 41  LYS D O   1 
ATOM   10493 C CB  . LYS D 1 3   ? 16.935  25.124  65.835  1.00 42.53 ? 41  LYS D CB  1 
ATOM   10494 C CG  . LYS D 1 3   ? 15.871  25.614  66.798  1.00 44.54 ? 41  LYS D CG  1 
ATOM   10495 C CD  . LYS D 1 3   ? 14.521  24.937  66.596  1.00 46.63 ? 41  LYS D CD  1 
ATOM   10496 C CE  . LYS D 1 3   ? 13.526  25.328  67.689  1.00 46.92 ? 41  LYS D CE  1 
ATOM   10497 N NZ  . LYS D 1 3   ? 12.157  25.314  67.128  1.00 48.15 ? 41  LYS D NZ  1 
ATOM   10498 N N   . PHE D 1 4   ? 18.648  23.644  68.370  1.00 42.54 ? 42  PHE D N   1 
ATOM   10499 C CA  . PHE D 1 4   ? 18.995  22.443  69.086  1.00 42.93 ? 42  PHE D CA  1 
ATOM   10500 C C   . PHE D 1 4   ? 17.686  21.662  69.370  1.00 42.65 ? 42  PHE D C   1 
ATOM   10501 O O   . PHE D 1 4   ? 16.648  22.251  69.692  1.00 41.58 ? 42  PHE D O   1 
ATOM   10502 C CB  . PHE D 1 4   ? 19.763  22.804  70.371  1.00 43.71 ? 42  PHE D CB  1 
ATOM   10503 C CG  . PHE D 1 4   ? 21.071  23.503  70.110  1.00 45.30 ? 42  PHE D CG  1 
ATOM   10504 C CD1 . PHE D 1 4   ? 21.102  24.863  69.755  1.00 46.62 ? 42  PHE D CD1 1 
ATOM   10505 C CD2 . PHE D 1 4   ? 22.275  22.806  70.185  1.00 46.74 ? 42  PHE D CD2 1 
ATOM   10506 C CE1 . PHE D 1 4   ? 22.306  25.515  69.496  1.00 45.81 ? 42  PHE D CE1 1 
ATOM   10507 C CE2 . PHE D 1 4   ? 23.494  23.450  69.914  1.00 47.38 ? 42  PHE D CE2 1 
ATOM   10508 C CZ  . PHE D 1 4   ? 23.503  24.808  69.559  1.00 46.33 ? 42  PHE D CZ  1 
ATOM   10509 N N   . TYR D 1 5   ? 17.752  20.342  69.208  1.00 42.47 ? 43  TYR D N   1 
ATOM   10510 C CA  . TYR D 1 5   ? 16.600  19.467  69.378  1.00 42.37 ? 43  TYR D CA  1 
ATOM   10511 C C   . TYR D 1 5   ? 16.935  18.382  70.345  1.00 42.28 ? 43  TYR D C   1 
ATOM   10512 O O   . TYR D 1 5   ? 18.050  17.877  70.393  1.00 41.84 ? 43  TYR D O   1 
ATOM   10513 C CB  . TYR D 1 5   ? 16.174  18.813  68.072  1.00 42.41 ? 43  TYR D CB  1 
ATOM   10514 C CG  . TYR D 1 5   ? 15.534  19.775  67.130  1.00 42.47 ? 43  TYR D CG  1 
ATOM   10515 C CD1 . TYR D 1 5   ? 16.304  20.551  66.297  1.00 41.24 ? 43  TYR D CD1 1 
ATOM   10516 C CD2 . TYR D 1 5   ? 14.151  19.921  67.088  1.00 42.71 ? 43  TYR D CD2 1 
ATOM   10517 C CE1 . TYR D 1 5   ? 15.732  21.443  65.448  1.00 42.89 ? 43  TYR D CE1 1 
ATOM   10518 C CE2 . TYR D 1 5   ? 13.560  20.812  66.231  1.00 43.05 ? 43  TYR D CE2 1 
ATOM   10519 C CZ  . TYR D 1 5   ? 14.363  21.574  65.414  1.00 42.90 ? 43  TYR D CZ  1 
ATOM   10520 O OH  . TYR D 1 5   ? 13.796  22.466  64.556  1.00 43.93 ? 43  TYR D OH  1 
ATOM   10521 N N   . THR D 1 6   ? 15.925  18.018  71.106  1.00 42.31 ? 44  THR D N   1 
ATOM   10522 C CA  . THR D 1 6   ? 16.047  16.961  72.057  1.00 42.61 ? 44  THR D CA  1 
ATOM   10523 C C   . THR D 1 6   ? 15.401  15.686  71.450  1.00 42.92 ? 44  THR D C   1 
ATOM   10524 O O   . THR D 1 6   ? 15.729  14.570  71.851  1.00 42.79 ? 44  THR D O   1 
ATOM   10525 C CB  . THR D 1 6   ? 15.452  17.435  73.400  1.00 42.49 ? 44  THR D CB  1 
ATOM   10526 O OG1 . THR D 1 6   ? 15.366  16.340  74.315  1.00 43.68 ? 44  THR D OG1 1 
ATOM   10527 C CG2 . THR D 1 6   ? 14.083  18.080  73.196  1.00 41.81 ? 44  THR D CG2 1 
ATOM   10528 N N   . ASP D 1 7   ? 14.548  15.842  70.436  1.00 42.60 ? 45  ASP D N   1 
ATOM   10529 C CA  . ASP D 1 7   ? 13.861  14.694  69.848  1.00 42.55 ? 45  ASP D CA  1 
ATOM   10530 C C   . ASP D 1 7   ? 14.202  14.623  68.357  1.00 41.53 ? 45  ASP D C   1 
ATOM   10531 O O   . ASP D 1 7   ? 13.834  15.515  67.615  1.00 41.61 ? 45  ASP D O   1 
ATOM   10532 C CB  . ASP D 1 7   ? 12.348  14.840  70.093  1.00 42.88 ? 45  ASP D CB  1 
ATOM   10533 C CG  . ASP D 1 7   ? 11.520  13.630  69.621  1.00 44.23 ? 45  ASP D CG  1 
ATOM   10534 O OD1 . ASP D 1 7   ? 12.066  12.555  69.254  1.00 45.38 ? 45  ASP D OD1 1 
ATOM   10535 O OD2 . ASP D 1 7   ? 10.277  13.775  69.639  1.00 46.28 ? 45  ASP D OD2 1 
ATOM   10536 N N   . PRO D 1 8   ? 14.910  13.563  67.916  1.00 40.49 ? 46  PRO D N   1 
ATOM   10537 C CA  . PRO D 1 8   ? 15.280  13.453  66.505  1.00 40.24 ? 46  PRO D CA  1 
ATOM   10538 C C   . PRO D 1 8   ? 14.100  13.343  65.538  1.00 39.95 ? 46  PRO D C   1 
ATOM   10539 O O   . PRO D 1 8   ? 14.247  13.702  64.364  1.00 39.78 ? 46  PRO D O   1 
ATOM   10540 C CB  . PRO D 1 8   ? 16.138  12.185  66.464  1.00 39.95 ? 46  PRO D CB  1 
ATOM   10541 C CG  . PRO D 1 8   ? 15.693  11.408  67.616  1.00 40.56 ? 46  PRO D CG  1 
ATOM   10542 C CD  . PRO D 1 8   ? 15.428  12.420  68.678  1.00 40.59 ? 46  PRO D CD  1 
ATOM   10543 N N   . VAL D 1 9   ? 12.950  12.847  66.014  1.00 39.48 ? 47  VAL D N   1 
ATOM   10544 C CA  . VAL D 1 9   ? 11.716  12.897  65.220  1.00 38.75 ? 47  VAL D CA  1 
ATOM   10545 C C   . VAL D 1 9   ? 11.282  14.348  65.029  1.00 38.91 ? 47  VAL D C   1 
ATOM   10546 O O   . VAL D 1 9   ? 10.900  14.740  63.924  1.00 38.72 ? 47  VAL D O   1 
ATOM   10547 C CB  . VAL D 1 9   ? 10.574  12.039  65.822  1.00 38.87 ? 47  VAL D CB  1 
ATOM   10548 C CG1 . VAL D 1 9   ? 9.223   12.443  65.241  1.00 36.41 ? 47  VAL D CG1 1 
ATOM   10549 C CG2 . VAL D 1 9   ? 10.861  10.561  65.577  1.00 38.52 ? 47  VAL D CG2 1 
ATOM   10550 N N   . GLU D 1 10  ? 11.381  15.164  66.076  1.00 38.93 ? 48  GLU D N   1 
ATOM   10551 C CA  . GLU D 1 10  ? 11.045  16.583  65.921  1.00 39.24 ? 48  GLU D CA  1 
ATOM   10552 C C   . GLU D 1 10  ? 11.960  17.295  64.915  1.00 38.81 ? 48  GLU D C   1 
ATOM   10553 O O   . GLU D 1 10  ? 11.515  18.182  64.186  1.00 39.58 ? 48  GLU D O   1 
ATOM   10554 C CB  . GLU D 1 10  ? 11.074  17.305  67.264  1.00 39.46 ? 48  GLU D CB  1 
ATOM   10555 C CG  . GLU D 1 10  ? 10.120  18.504  67.304  1.00 41.15 ? 48  GLU D CG  1 
ATOM   10556 C CD  . GLU D 1 10  ? 8.621   18.109  67.391  1.00 42.20 ? 48  GLU D CD  1 
ATOM   10557 O OE1 . GLU D 1 10  ? 8.272   16.904  67.490  1.00 43.77 ? 48  GLU D OE1 1 
ATOM   10558 O OE2 . GLU D 1 10  ? 7.775   19.024  67.359  1.00 42.82 ? 48  GLU D OE2 1 
ATOM   10559 N N   . ALA D 1 11  ? 13.223  16.886  64.871  1.00 38.17 ? 49  ALA D N   1 
ATOM   10560 C CA  . ALA D 1 11  ? 14.246  17.487  63.994  1.00 37.78 ? 49  ALA D CA  1 
ATOM   10561 C C   . ALA D 1 11  ? 14.065  17.190  62.485  1.00 37.48 ? 49  ALA D C   1 
ATOM   10562 O O   . ALA D 1 11  ? 14.509  17.981  61.651  1.00 37.01 ? 49  ALA D O   1 
ATOM   10563 C CB  . ALA D 1 11  ? 15.613  17.058  64.444  1.00 37.06 ? 49  ALA D CB  1 
ATOM   10564 N N   . VAL D 1 12  ? 13.424  16.067  62.145  1.00 37.00 ? 50  VAL D N   1 
ATOM   10565 C CA  . VAL D 1 12  ? 13.177  15.673  60.739  1.00 36.90 ? 50  VAL D CA  1 
ATOM   10566 C C   . VAL D 1 12  ? 11.673  15.517  60.428  1.00 37.53 ? 50  VAL D C   1 
ATOM   10567 O O   . VAL D 1 12  ? 11.268  15.028  59.367  1.00 36.82 ? 50  VAL D O   1 
ATOM   10568 C CB  . VAL D 1 12  ? 13.904  14.353  60.406  1.00 36.98 ? 50  VAL D CB  1 
ATOM   10569 C CG1 . VAL D 1 12  ? 15.395  14.496  60.640  1.00 36.40 ? 50  VAL D CG1 1 
ATOM   10570 C CG2 . VAL D 1 12  ? 13.345  13.190  61.246  1.00 36.71 ? 50  VAL D CG2 1 
ATOM   10571 N N   . LYS D 1 13  ? 10.859  15.958  61.376  1.00 37.89 ? 51  LYS D N   1 
ATOM   10572 C CA  . LYS D 1 13  ? 9.406   15.944  61.286  1.00 38.73 ? 51  LYS D CA  1 
ATOM   10573 C C   . LYS D 1 13  ? 8.873   16.392  59.919  1.00 38.66 ? 51  LYS D C   1 
ATOM   10574 O O   . LYS D 1 13  ? 7.884   15.836  59.406  1.00 37.64 ? 51  LYS D O   1 
ATOM   10575 C CB  . LYS D 1 13  ? 8.884   16.902  62.357  1.00 39.13 ? 51  LYS D CB  1 
ATOM   10576 C CG  . LYS D 1 13  ? 7.569   16.586  62.901  1.00 40.02 ? 51  LYS D CG  1 
ATOM   10577 C CD  . LYS D 1 13  ? 7.176   17.622  63.969  1.00 42.24 ? 51  LYS D CD  1 
ATOM   10578 C CE  . LYS D 1 13  ? 7.218   19.082  63.448  1.00 42.91 ? 51  LYS D CE  1 
ATOM   10579 N NZ  . LYS D 1 13  ? 6.288   19.954  64.257  1.00 42.23 ? 51  LYS D NZ  1 
ATOM   10580 N N   . ASP D 1 14  ? 9.533   17.402  59.340  1.00 38.44 ? 52  ASP D N   1 
ATOM   10581 C CA  . ASP D 1 14  ? 8.984   18.079  58.182  1.00 38.40 ? 52  ASP D CA  1 
ATOM   10582 C C   . ASP D 1 14  ? 9.579   17.661  56.855  1.00 38.10 ? 52  ASP D C   1 
ATOM   10583 O O   . ASP D 1 14  ? 9.388   18.361  55.879  1.00 38.91 ? 52  ASP D O   1 
ATOM   10584 C CB  . ASP D 1 14  ? 8.986   19.603  58.369  1.00 38.30 ? 52  ASP D CB  1 
ATOM   10585 C CG  . ASP D 1 14  ? 10.381  20.207  58.652  1.00 40.78 ? 52  ASP D CG  1 
ATOM   10586 O OD1 . ASP D 1 14  ? 11.412  19.483  58.817  1.00 40.69 ? 52  ASP D OD1 1 
ATOM   10587 O OD2 . ASP D 1 14  ? 10.414  21.464  58.721  1.00 39.29 ? 52  ASP D OD2 1 
ATOM   10588 N N   . ILE D 1 15  ? 10.281  16.528  56.793  1.00 37.86 ? 53  ILE D N   1 
ATOM   10589 C CA  . ILE D 1 15  ? 10.782  16.052  55.499  1.00 37.40 ? 53  ILE D CA  1 
ATOM   10590 C C   . ILE D 1 15  ? 9.564   15.586  54.692  1.00 37.49 ? 53  ILE D C   1 
ATOM   10591 O O   . ILE D 1 15  ? 8.837   14.646  55.101  1.00 37.87 ? 53  ILE D O   1 
ATOM   10592 C CB  . ILE D 1 15  ? 11.880  14.930  55.587  1.00 37.36 ? 53  ILE D CB  1 
ATOM   10593 C CG1 . ILE D 1 15  ? 12.885  15.230  56.703  1.00 37.45 ? 53  ILE D CG1 1 
ATOM   10594 C CG2 . ILE D 1 15  ? 12.633  14.810  54.253  1.00 36.42 ? 53  ILE D CG2 1 
ATOM   10595 C CD1 . ILE D 1 15  ? 14.275  14.580  56.535  1.00 36.75 ? 53  ILE D CD1 1 
ATOM   10596 N N   . PRO D 1 16  ? 9.298   16.264  53.562  1.00 37.20 ? 54  PRO D N   1 
ATOM   10597 C CA  . PRO D 1 16  ? 8.151   15.878  52.770  1.00 37.13 ? 54  PRO D CA  1 
ATOM   10598 C C   . PRO D 1 16  ? 8.423   14.616  51.976  1.00 36.94 ? 54  PRO D C   1 
ATOM   10599 O O   . PRO D 1 16  ? 9.559   14.371  51.585  1.00 37.24 ? 54  PRO D O   1 
ATOM   10600 C CB  . PRO D 1 16  ? 7.972   17.065  51.815  1.00 37.19 ? 54  PRO D CB  1 
ATOM   10601 C CG  . PRO D 1 16  ? 9.300   17.633  51.677  1.00 36.64 ? 54  PRO D CG  1 
ATOM   10602 C CD  . PRO D 1 16  ? 10.027  17.396  52.955  1.00 36.98 ? 54  PRO D CD  1 
ATOM   10603 N N   . ASP D 1 17  ? 7.388   13.825  51.735  1.00 36.74 ? 55  ASP D N   1 
ATOM   10604 C CA  . ASP D 1 17  ? 7.504   12.732  50.795  1.00 36.89 ? 55  ASP D CA  1 
ATOM   10605 C C   . ASP D 1 17  ? 8.118   13.309  49.534  1.00 36.41 ? 55  ASP D C   1 
ATOM   10606 O O   . ASP D 1 17  ? 7.836   14.448  49.178  1.00 36.46 ? 55  ASP D O   1 
ATOM   10607 C CB  . ASP D 1 17  ? 6.140   12.123  50.481  1.00 37.05 ? 55  ASP D CB  1 
ATOM   10608 C CG  . ASP D 1 17  ? 5.589   11.271  51.620  1.00 38.34 ? 55  ASP D CG  1 
ATOM   10609 O OD1 . ASP D 1 17  ? 6.370   10.727  52.434  1.00 42.97 ? 55  ASP D OD1 1 
ATOM   10610 O OD2 . ASP D 1 17  ? 4.356   11.127  51.683  1.00 37.18 ? 55  ASP D OD2 1 
ATOM   10611 N N   . GLY D 1 18  ? 9.008   12.560  48.890  1.00 35.76 ? 56  GLY D N   1 
ATOM   10612 C CA  . GLY D 1 18  ? 9.662   13.065  47.678  1.00 34.77 ? 56  GLY D CA  1 
ATOM   10613 C C   . GLY D 1 18  ? 10.842  14.017  47.868  1.00 33.69 ? 56  GLY D C   1 
ATOM   10614 O O   . GLY D 1 18  ? 11.392  14.485  46.887  1.00 33.74 ? 56  GLY D O   1 
ATOM   10615 N N   . ALA D 1 19  ? 11.252  14.298  49.100  1.00 32.52 ? 57  ALA D N   1 
ATOM   10616 C CA  . ALA D 1 19  ? 12.428  15.118  49.334  1.00 31.60 ? 57  ALA D CA  1 
ATOM   10617 C C   . ALA D 1 19  ? 13.699  14.444  48.833  1.00 31.99 ? 57  ALA D C   1 
ATOM   10618 O O   . ALA D 1 19  ? 13.809  13.212  48.841  1.00 32.08 ? 57  ALA D O   1 
ATOM   10619 C CB  . ALA D 1 19  ? 12.581  15.458  50.807  1.00 31.52 ? 57  ALA D CB  1 
ATOM   10620 N N   . THR D 1 20  ? 14.648  15.271  48.388  1.00 31.73 ? 58  THR D N   1 
ATOM   10621 C CA  . THR D 1 20  ? 16.035  14.874  48.184  1.00 31.80 ? 58  THR D CA  1 
ATOM   10622 C C   . THR D 1 20  ? 16.794  15.174  49.483  1.00 32.23 ? 58  THR D C   1 
ATOM   10623 O O   . THR D 1 20  ? 16.853  16.327  49.991  1.00 32.07 ? 58  THR D O   1 
ATOM   10624 C CB  . THR D 1 20  ? 16.637  15.612  47.029  1.00 31.85 ? 58  THR D CB  1 
ATOM   10625 O OG1 . THR D 1 20  ? 15.889  15.304  45.854  1.00 33.75 ? 58  THR D OG1 1 
ATOM   10626 C CG2 . THR D 1 20  ? 18.100  15.259  46.798  1.00 32.99 ? 58  THR D CG2 1 
ATOM   10627 N N   . VAL D 1 21  ? 17.331  14.100  50.039  1.00 32.18 ? 59  VAL D N   1 
ATOM   10628 C CA  . VAL D 1 21  ? 17.986  14.129  51.315  1.00 31.94 ? 59  VAL D CA  1 
ATOM   10629 C C   . VAL D 1 21  ? 19.423  13.668  51.072  1.00 32.41 ? 59  VAL D C   1 
ATOM   10630 O O   . VAL D 1 21  ? 19.661  12.599  50.488  1.00 32.00 ? 59  VAL D O   1 
ATOM   10631 C CB  . VAL D 1 21  ? 17.236  13.196  52.266  1.00 32.43 ? 59  VAL D CB  1 
ATOM   10632 C CG1 . VAL D 1 21  ? 17.897  13.120  53.631  1.00 30.88 ? 59  VAL D CG1 1 
ATOM   10633 C CG2 . VAL D 1 21  ? 15.796  13.670  52.384  1.00 30.68 ? 59  VAL D CG2 1 
ATOM   10634 N N   . LEU D 1 22  ? 20.365  14.523  51.462  1.00 32.74 ? 60  LEU D N   1 
ATOM   10635 C CA  . LEU D 1 22  ? 21.791  14.210  51.472  1.00 33.01 ? 60  LEU D CA  1 
ATOM   10636 C C   . LEU D 1 22  ? 22.107  13.420  52.755  1.00 33.22 ? 60  LEU D C   1 
ATOM   10637 O O   . LEU D 1 22  ? 21.747  13.861  53.833  1.00 33.48 ? 60  LEU D O   1 
ATOM   10638 C CB  . LEU D 1 22  ? 22.579  15.519  51.428  1.00 32.44 ? 60  LEU D CB  1 
ATOM   10639 C CG  . LEU D 1 22  ? 22.248  16.558  50.349  1.00 32.10 ? 60  LEU D CG  1 
ATOM   10640 C CD1 . LEU D 1 22  ? 23.385  17.572  50.227  1.00 28.68 ? 60  LEU D CD1 1 
ATOM   10641 C CD2 . LEU D 1 22  ? 21.969  15.861  49.010  1.00 32.10 ? 60  LEU D CD2 1 
ATOM   10642 N N   . VAL D 1 23  ? 22.733  12.242  52.636  1.00 33.61 ? 61  VAL D N   1 
ATOM   10643 C CA  . VAL D 1 23  ? 23.073  11.417  53.824  1.00 32.87 ? 61  VAL D CA  1 
ATOM   10644 C C   . VAL D 1 23  ? 24.568  11.044  53.951  1.00 33.36 ? 61  VAL D C   1 
ATOM   10645 O O   . VAL D 1 23  ? 25.160  10.334  53.116  1.00 33.83 ? 61  VAL D O   1 
ATOM   10646 C CB  . VAL D 1 23  ? 22.236  10.136  53.932  1.00 32.93 ? 61  VAL D CB  1 
ATOM   10647 C CG1 . VAL D 1 23  ? 22.349  9.571   55.355  1.00 27.75 ? 61  VAL D CG1 1 
ATOM   10648 C CG2 . VAL D 1 23  ? 20.763  10.394  53.511  1.00 31.34 ? 61  VAL D CG2 1 
ATOM   10649 N N   . GLY D 1 24  ? 25.166  11.528  55.035  1.00 33.13 ? 62  GLY D N   1 
ATOM   10650 C CA  . GLY D 1 24  ? 26.588  11.431  55.237  1.00 33.50 ? 62  GLY D CA  1 
ATOM   10651 C C   . GLY D 1 24  ? 27.053  10.027  55.505  1.00 34.11 ? 62  GLY D C   1 
ATOM   10652 O O   . GLY D 1 24  ? 26.232  9.121   55.770  1.00 33.84 ? 62  GLY D O   1 
ATOM   10653 N N   . GLY D 1 25  ? 28.370  9.841   55.351  1.00 34.21 ? 63  GLY D N   1 
ATOM   10654 C CA  . GLY D 1 25  ? 29.019  8.569   55.624  1.00 34.45 ? 63  GLY D CA  1 
ATOM   10655 C C   . GLY D 1 25  ? 29.735  7.886   54.469  1.00 33.95 ? 63  GLY D C   1 
ATOM   10656 O O   . GLY D 1 25  ? 29.405  8.050   53.327  1.00 32.05 ? 63  GLY D O   1 
ATOM   10657 N N   . PHE D 1 26  ? 30.718  7.080   54.835  1.00 34.67 ? 64  PHE D N   1 
ATOM   10658 C CA  . PHE D 1 26  ? 31.494  6.288   53.915  1.00 35.92 ? 64  PHE D CA  1 
ATOM   10659 C C   . PHE D 1 26  ? 31.467  4.898   54.498  1.00 35.88 ? 64  PHE D C   1 
ATOM   10660 O O   . PHE D 1 26  ? 32.002  4.679   55.577  1.00 36.69 ? 64  PHE D O   1 
ATOM   10661 C CB  . PHE D 1 26  ? 32.924  6.855   53.866  1.00 36.22 ? 64  PHE D CB  1 
ATOM   10662 C CG  . PHE D 1 26  ? 33.828  6.168   52.885  1.00 37.92 ? 64  PHE D CG  1 
ATOM   10663 C CD1 . PHE D 1 26  ? 34.072  6.732   51.624  1.00 37.40 ? 64  PHE D CD1 1 
ATOM   10664 C CD2 . PHE D 1 26  ? 34.452  4.968   53.215  1.00 37.85 ? 64  PHE D CD2 1 
ATOM   10665 C CE1 . PHE D 1 26  ? 34.925  6.112   50.717  1.00 37.54 ? 64  PHE D CE1 1 
ATOM   10666 C CE2 . PHE D 1 26  ? 35.307  4.359   52.308  1.00 38.10 ? 64  PHE D CE2 1 
ATOM   10667 C CZ  . PHE D 1 26  ? 35.539  4.945   51.051  1.00 35.87 ? 64  PHE D CZ  1 
ATOM   10668 N N   . GLY D 1 27  ? 30.836  3.947   53.826  1.00 35.89 ? 65  GLY D N   1 
ATOM   10669 C CA  . GLY D 1 27  ? 30.559  2.677   54.479  1.00 35.22 ? 65  GLY D CA  1 
ATOM   10670 C C   . GLY D 1 27  ? 29.556  2.902   55.601  1.00 35.40 ? 65  GLY D C   1 
ATOM   10671 O O   . GLY D 1 27  ? 28.521  3.556   55.392  1.00 35.73 ? 65  GLY D O   1 
ATOM   10672 N N   . LEU D 1 28  ? 29.843  2.309   56.764  1.00 35.14 ? 66  LEU D N   1 
ATOM   10673 C CA  . LEU D 1 28  ? 29.158  2.593   58.030  1.00 34.82 ? 66  LEU D CA  1 
ATOM   10674 C C   . LEU D 1 28  ? 29.899  3.630   58.881  1.00 34.84 ? 66  LEU D C   1 
ATOM   10675 O O   . LEU D 1 28  ? 29.452  3.942   59.974  1.00 33.77 ? 66  LEU D O   1 
ATOM   10676 C CB  . LEU D 1 28  ? 29.008  1.310   58.855  1.00 35.34 ? 66  LEU D CB  1 
ATOM   10677 C CG  . LEU D 1 28  ? 28.296  0.168   58.121  1.00 34.58 ? 66  LEU D CG  1 
ATOM   10678 C CD1 . LEU D 1 28  ? 28.210  -1.090  59.028  1.00 34.30 ? 66  LEU D CD1 1 
ATOM   10679 C CD2 . LEU D 1 28  ? 26.925  0.630   57.628  1.00 31.88 ? 66  LEU D CD2 1 
ATOM   10680 N N   . CYS D 1 29  ? 31.014  4.169   58.362  1.00 34.94 ? 67  CYS D N   1 
ATOM   10681 C CA  . CYS D 1 29  ? 31.835  5.159   59.062  1.00 34.16 ? 67  CYS D CA  1 
ATOM   10682 C C   . CYS D 1 29  ? 31.260  6.553   58.870  1.00 33.35 ? 67  CYS D C   1 
ATOM   10683 O O   . CYS D 1 29  ? 31.170  7.055   57.735  1.00 33.19 ? 67  CYS D O   1 
ATOM   10684 C CB  . CYS D 1 29  ? 33.269  5.114   58.540  1.00 33.69 ? 67  CYS D CB  1 
ATOM   10685 S SG  . CYS D 1 29  ? 34.411  6.267   59.311  1.00 36.79 ? 67  CYS D SG  1 
ATOM   10686 N N   . GLY D 1 30  ? 30.900  7.183   59.980  1.00 32.23 ? 68  GLY D N   1 
ATOM   10687 C CA  . GLY D 1 30  ? 30.329  8.513   59.980  1.00 32.19 ? 68  GLY D CA  1 
ATOM   10688 C C   . GLY D 1 30  ? 28.946  8.547   59.358  1.00 33.04 ? 68  GLY D C   1 
ATOM   10689 O O   . GLY D 1 30  ? 28.649  9.412   58.536  1.00 31.95 ? 68  GLY D O   1 
ATOM   10690 N N   . ILE D 1 31  ? 28.101  7.588   59.723  1.00 34.21 ? 69  ILE D N   1 
ATOM   10691 C CA  . ILE D 1 31  ? 26.711  7.607   59.278  1.00 35.01 ? 69  ILE D CA  1 
ATOM   10692 C C   . ILE D 1 31  ? 25.842  8.214   60.401  1.00 35.55 ? 69  ILE D C   1 
ATOM   10693 O O   . ILE D 1 31  ? 26.121  7.994   61.600  1.00 35.11 ? 69  ILE D O   1 
ATOM   10694 C CB  . ILE D 1 31  ? 26.188  6.179   58.848  1.00 35.70 ? 69  ILE D CB  1 
ATOM   10695 C CG1 . ILE D 1 31  ? 26.141  5.211   60.013  1.00 34.89 ? 69  ILE D CG1 1 
ATOM   10696 C CG2 . ILE D 1 31  ? 27.029  5.580   57.715  1.00 36.36 ? 69  ILE D CG2 1 
ATOM   10697 C CD1 . ILE D 1 31  ? 25.684  3.859   59.609  1.00 36.74 ? 69  ILE D CD1 1 
ATOM   10698 N N   . PRO D 1 32  ? 24.795  8.991   60.014  1.00 35.21 ? 70  PRO D N   1 
ATOM   10699 C CA  . PRO D 1 32  ? 23.846  9.532   60.968  1.00 35.27 ? 70  PRO D CA  1 
ATOM   10700 C C   . PRO D 1 32  ? 22.814  8.461   61.411  1.00 35.39 ? 70  PRO D C   1 
ATOM   10701 O O   . PRO D 1 32  ? 21.710  8.370   60.867  1.00 35.12 ? 70  PRO D O   1 
ATOM   10702 C CB  . PRO D 1 32  ? 23.206  10.675  60.172  1.00 35.30 ? 70  PRO D CB  1 
ATOM   10703 C CG  . PRO D 1 32  ? 23.152  10.133  58.773  1.00 34.39 ? 70  PRO D CG  1 
ATOM   10704 C CD  . PRO D 1 32  ? 24.449  9.388   58.630  1.00 35.58 ? 70  PRO D CD  1 
ATOM   10705 N N   . GLU D 1 33  ? 23.199  7.653   62.404  1.00 35.68 ? 71  GLU D N   1 
ATOM   10706 C CA  . GLU D 1 33  ? 22.402  6.517   62.854  1.00 35.06 ? 71  GLU D CA  1 
ATOM   10707 C C   . GLU D 1 33  ? 21.066  6.903   63.490  1.00 35.70 ? 71  GLU D C   1 
ATOM   10708 O O   . GLU D 1 33  ? 20.035  6.211   63.301  1.00 35.65 ? 71  GLU D O   1 
ATOM   10709 C CB  . GLU D 1 33  ? 23.193  5.692   63.879  1.00 35.43 ? 71  GLU D CB  1 
ATOM   10710 C CG  . GLU D 1 33  ? 24.456  4.992   63.350  1.00 34.41 ? 71  GLU D CG  1 
ATOM   10711 C CD  . GLU D 1 33  ? 25.245  4.276   64.451  1.00 34.88 ? 71  GLU D CD  1 
ATOM   10712 O OE1 . GLU D 1 33  ? 24.603  3.722   65.402  1.00 34.45 ? 71  GLU D OE1 1 
ATOM   10713 O OE2 . GLU D 1 33  ? 26.506  4.258   64.360  1.00 32.07 ? 71  GLU D OE2 1 
ATOM   10714 N N   . ASN D 1 34  ? 21.089  7.968   64.290  1.00 35.55 ? 72  ASN D N   1 
ATOM   10715 C CA  . ASN D 1 34  ? 19.907  8.387   65.062  1.00 34.97 ? 72  ASN D CA  1 
ATOM   10716 C C   . ASN D 1 34  ? 18.935  9.121   64.167  1.00 34.62 ? 72  ASN D C   1 
ATOM   10717 O O   . ASN D 1 34  ? 17.727  9.053   64.366  1.00 34.51 ? 72  ASN D O   1 
ATOM   10718 C CB  . ASN D 1 34  ? 20.308  9.314   66.233  1.00 35.53 ? 72  ASN D CB  1 
ATOM   10719 C CG  . ASN D 1 34  ? 20.962  8.571   67.366  1.00 34.03 ? 72  ASN D CG  1 
ATOM   10720 O OD1 . ASN D 1 34  ? 20.298  7.908   68.113  1.00 36.87 ? 72  ASN D OD1 1 
ATOM   10721 N ND2 . ASN D 1 34  ? 22.265  8.677   67.488  1.00 34.86 ? 72  ASN D ND2 1 
ATOM   10722 N N   . LEU D 1 35  ? 19.467  9.860   63.200  1.00 33.51 ? 73  LEU D N   1 
ATOM   10723 C CA  . LEU D 1 35  ? 18.610  10.577  62.265  1.00 33.40 ? 73  LEU D CA  1 
ATOM   10724 C C   . LEU D 1 35  ? 17.978  9.583   61.268  1.00 33.09 ? 73  LEU D C   1 
ATOM   10725 O O   . LEU D 1 35  ? 16.829  9.745   60.935  1.00 32.81 ? 73  LEU D O   1 
ATOM   10726 C CB  . LEU D 1 35  ? 19.351  11.729  61.556  1.00 33.13 ? 73  LEU D CB  1 
ATOM   10727 C CG  . LEU D 1 35  ? 19.786  12.959  62.396  1.00 33.07 ? 73  LEU D CG  1 
ATOM   10728 C CD1 . LEU D 1 35  ? 20.662  13.873  61.604  1.00 29.15 ? 73  LEU D CD1 1 
ATOM   10729 C CD2 . LEU D 1 35  ? 18.597  13.748  62.975  1.00 34.10 ? 73  LEU D CD2 1 
ATOM   10730 N N   . ILE D 1 36  ? 18.713  8.558   60.828  1.00 32.93 ? 74  ILE D N   1 
ATOM   10731 C CA  . ILE D 1 36  ? 18.155  7.522   59.954  1.00 34.04 ? 74  ILE D CA  1 
ATOM   10732 C C   . ILE D 1 36  ? 17.029  6.785   60.657  1.00 34.48 ? 74  ILE D C   1 
ATOM   10733 O O   . ILE D 1 36  ? 16.014  6.420   60.047  1.00 34.68 ? 74  ILE D O   1 
ATOM   10734 C CB  . ILE D 1 36  ? 19.228  6.489   59.497  1.00 34.16 ? 74  ILE D CB  1 
ATOM   10735 C CG1 . ILE D 1 36  ? 20.106  7.089   58.394  1.00 35.44 ? 74  ILE D CG1 1 
ATOM   10736 C CG2 . ILE D 1 36  ? 18.572  5.171   59.000  1.00 33.78 ? 74  ILE D CG2 1 
ATOM   10737 C CD1 . ILE D 1 36  ? 21.360  6.269   58.051  1.00 35.31 ? 74  ILE D CD1 1 
ATOM   10738 N N   . ASP D 1 37  ? 17.202  6.592   61.957  1.00 35.01 ? 75  ASP D N   1 
ATOM   10739 C CA  . ASP D 1 37  ? 16.198  5.931   62.770  1.00 35.53 ? 75  ASP D CA  1 
ATOM   10740 C C   . ASP D 1 37  ? 14.926  6.763   62.976  1.00 35.08 ? 75  ASP D C   1 
ATOM   10741 O O   . ASP D 1 37  ? 13.839  6.210   63.070  1.00 35.83 ? 75  ASP D O   1 
ATOM   10742 C CB  . ASP D 1 37  ? 16.805  5.590   64.105  1.00 35.90 ? 75  ASP D CB  1 
ATOM   10743 C CG  . ASP D 1 37  ? 15.940  4.719   64.886  1.00 38.64 ? 75  ASP D CG  1 
ATOM   10744 O OD1 . ASP D 1 37  ? 16.064  3.480   64.725  1.00 42.14 ? 75  ASP D OD1 1 
ATOM   10745 O OD2 . ASP D 1 37  ? 15.121  5.278   65.644  1.00 43.15 ? 75  ASP D OD2 1 
ATOM   10746 N N   . ALA D 1 38  ? 15.065  8.085   63.044  1.00 34.96 ? 76  ALA D N   1 
ATOM   10747 C CA  . ALA D 1 38  ? 13.929  9.012   63.125  1.00 34.38 ? 76  ALA D CA  1 
ATOM   10748 C C   . ALA D 1 38  ? 13.078  9.018   61.834  1.00 34.64 ? 76  ALA D C   1 
ATOM   10749 O O   . ALA D 1 38  ? 11.870  9.219   61.897  1.00 33.13 ? 76  ALA D O   1 
ATOM   10750 C CB  . ALA D 1 38  ? 14.426  10.420  63.427  1.00 34.35 ? 76  ALA D CB  1 
ATOM   10751 N N   . LEU D 1 39  ? 13.728  8.827   60.674  1.00 34.68 ? 77  LEU D N   1 
ATOM   10752 C CA  . LEU D 1 39  ? 13.022  8.669   59.391  1.00 34.45 ? 77  LEU D CA  1 
ATOM   10753 C C   . LEU D 1 39  ? 12.242  7.356   59.247  1.00 34.54 ? 77  LEU D C   1 
ATOM   10754 O O   . LEU D 1 39  ? 11.231  7.299   58.543  1.00 33.78 ? 77  LEU D O   1 
ATOM   10755 C CB  . LEU D 1 39  ? 14.003  8.826   58.212  1.00 34.67 ? 77  LEU D CB  1 
ATOM   10756 C CG  . LEU D 1 39  ? 14.102  10.240  57.665  1.00 33.51 ? 77  LEU D CG  1 
ATOM   10757 C CD1 . LEU D 1 39  ? 14.511  11.192  58.787  1.00 34.69 ? 77  LEU D CD1 1 
ATOM   10758 C CD2 . LEU D 1 39  ? 15.090  10.266  56.513  1.00 36.33 ? 77  LEU D CD2 1 
ATOM   10759 N N   . LEU D 1 40  ? 12.705  6.302   59.909  1.00 34.77 ? 78  LEU D N   1 
ATOM   10760 C CA  . LEU D 1 40  ? 11.955  5.061   59.944  1.00 34.96 ? 78  LEU D CA  1 
ATOM   10761 C C   . LEU D 1 40  ? 10.650  5.212   60.745  1.00 35.02 ? 78  LEU D C   1 
ATOM   10762 O O   . LEU D 1 40  ? 9.663   4.506   60.468  1.00 33.99 ? 78  LEU D O   1 
ATOM   10763 C CB  . LEU D 1 40  ? 12.794  3.934   60.554  1.00 35.75 ? 78  LEU D CB  1 
ATOM   10764 C CG  . LEU D 1 40  ? 13.881  3.259   59.715  1.00 36.96 ? 78  LEU D CG  1 
ATOM   10765 C CD1 . LEU D 1 40  ? 14.905  2.597   60.668  1.00 38.41 ? 78  LEU D CD1 1 
ATOM   10766 C CD2 . LEU D 1 40  ? 13.245  2.227   58.765  1.00 36.82 ? 78  LEU D CD2 1 
ATOM   10767 N N   . LYS D 1 41  ? 10.673  6.111   61.736  1.00 34.91 ? 79  LYS D N   1 
ATOM   10768 C CA  . LYS D 1 41  ? 9.516   6.422   62.573  1.00 34.97 ? 79  LYS D CA  1 
ATOM   10769 C C   . LYS D 1 41  ? 8.572   7.358   61.849  1.00 34.79 ? 79  LYS D C   1 
ATOM   10770 O O   . LYS D 1 41  ? 7.377   7.164   61.890  1.00 33.91 ? 79  LYS D O   1 
ATOM   10771 C CB  . LYS D 1 41  ? 9.937   7.067   63.894  1.00 35.22 ? 79  LYS D CB  1 
ATOM   10772 C CG  . LYS D 1 41  ? 10.910  6.232   64.707  1.00 37.08 ? 79  LYS D CG  1 
ATOM   10773 C CD  . LYS D 1 41  ? 10.854  6.555   66.205  1.00 38.87 ? 79  LYS D CD  1 
ATOM   10774 C CE  . LYS D 1 41  ? 11.958  5.826   66.980  1.00 39.37 ? 79  LYS D CE  1 
ATOM   10775 N NZ  . LYS D 1 41  ? 11.815  4.339   66.899  1.00 40.33 ? 79  LYS D NZ  1 
ATOM   10776 N N   . THR D 1 42  ? 9.100   8.380   61.176  1.00 34.94 ? 80  THR D N   1 
ATOM   10777 C CA  . THR D 1 42  ? 8.211   9.279   60.416  1.00 34.96 ? 80  THR D CA  1 
ATOM   10778 C C   . THR D 1 42  ? 7.565   8.591   59.200  1.00 34.93 ? 80  THR D C   1 
ATOM   10779 O O   . THR D 1 42  ? 6.523   9.035   58.710  1.00 35.23 ? 80  THR D O   1 
ATOM   10780 C CB  . THR D 1 42  ? 8.899   10.569  59.942  1.00 34.54 ? 80  THR D CB  1 
ATOM   10781 O OG1 . THR D 1 42  ? 9.710   10.288  58.792  1.00 34.49 ? 80  THR D OG1 1 
ATOM   10782 C CG2 . THR D 1 42  ? 9.710   11.204  61.074  1.00 34.39 ? 80  THR D CG2 1 
ATOM   10783 N N   . GLY D 1 43  ? 8.184   7.523   58.712  1.00 34.89 ? 81  GLY D N   1 
ATOM   10784 C CA  . GLY D 1 43  ? 7.674   6.818   57.550  1.00 34.96 ? 81  GLY D CA  1 
ATOM   10785 C C   . GLY D 1 43  ? 7.657   7.642   56.274  1.00 35.28 ? 81  GLY D C   1 
ATOM   10786 O O   . GLY D 1 43  ? 6.887   7.324   55.366  1.00 34.90 ? 81  GLY D O   1 
ATOM   10787 N N   . VAL D 1 44  ? 8.496   8.691   56.190  1.00 35.58 ? 82  VAL D N   1 
ATOM   10788 C CA  . VAL D 1 44  ? 8.550   9.554   55.004  1.00 35.70 ? 82  VAL D CA  1 
ATOM   10789 C C   . VAL D 1 44  ? 9.047   8.707   53.846  1.00 35.96 ? 82  VAL D C   1 
ATOM   10790 O O   . VAL D 1 44  ? 9.963   7.891   54.019  1.00 35.87 ? 82  VAL D O   1 
ATOM   10791 C CB  . VAL D 1 44  ? 9.480   10.813  55.176  1.00 35.82 ? 82  VAL D CB  1 
ATOM   10792 C CG1 . VAL D 1 44  ? 10.894  10.415  55.452  1.00 35.64 ? 82  VAL D CG1 1 
ATOM   10793 C CG2 . VAL D 1 44  ? 9.410   11.696  53.952  1.00 35.58 ? 82  VAL D CG2 1 
ATOM   10794 N N   . LYS D 1 45  ? 8.429   8.893   52.680  1.00 35.74 ? 83  LYS D N   1 
ATOM   10795 C CA  . LYS D 1 45  ? 8.652   8.008   51.546  1.00 35.63 ? 83  LYS D CA  1 
ATOM   10796 C C   . LYS D 1 45  ? 8.991   8.753   50.257  1.00 35.25 ? 83  LYS D C   1 
ATOM   10797 O O   . LYS D 1 45  ? 8.977   9.985   50.194  1.00 35.38 ? 83  LYS D O   1 
ATOM   10798 C CB  . LYS D 1 45  ? 7.419   7.110   51.342  1.00 35.22 ? 83  LYS D CB  1 
ATOM   10799 N N   . GLY D 1 46  ? 9.312   7.983   49.226  1.00 35.24 ? 84  GLY D N   1 
ATOM   10800 C CA  . GLY D 1 46  ? 9.613   8.544   47.903  1.00 35.24 ? 84  GLY D CA  1 
ATOM   10801 C C   . GLY D 1 46  ? 10.856  9.407   47.835  1.00 34.73 ? 84  GLY D C   1 
ATOM   10802 O O   . GLY D 1 46  ? 10.973  10.237  46.942  1.00 35.18 ? 84  GLY D O   1 
ATOM   10803 N N   . LEU D 1 47  ? 11.793  9.193   48.761  1.00 34.76 ? 85  LEU D N   1 
ATOM   10804 C CA  . LEU D 1 47  ? 13.016  10.006  48.890  1.00 34.42 ? 85  LEU D CA  1 
ATOM   10805 C C   . LEU D 1 47  ? 14.004  9.749   47.757  1.00 34.28 ? 85  LEU D C   1 
ATOM   10806 O O   . LEU D 1 47  ? 14.127  8.619   47.310  1.00 35.38 ? 85  LEU D O   1 
ATOM   10807 C CB  . LEU D 1 47  ? 13.733  9.664   50.202  1.00 34.31 ? 85  LEU D CB  1 
ATOM   10808 C CG  . LEU D 1 47  ? 13.030  9.841   51.555  1.00 33.96 ? 85  LEU D CG  1 
ATOM   10809 C CD1 . LEU D 1 47  ? 13.913  9.393   52.733  1.00 29.50 ? 85  LEU D CD1 1 
ATOM   10810 C CD2 . LEU D 1 47  ? 12.602  11.271  51.749  1.00 33.67 ? 85  LEU D CD2 1 
ATOM   10811 N N   . THR D 1 48  ? 14.713  10.777  47.297  1.00 34.04 ? 86  THR D N   1 
ATOM   10812 C CA  . THR D 1 48  ? 15.974  10.551  46.587  1.00 33.42 ? 86  THR D CA  1 
ATOM   10813 C C   . THR D 1 48  ? 17.081  10.717  47.626  1.00 33.62 ? 86  THR D C   1 
ATOM   10814 O O   . THR D 1 48  ? 17.291  11.836  48.115  1.00 31.91 ? 86  THR D O   1 
ATOM   10815 C CB  . THR D 1 48  ? 16.199  11.517  45.416  1.00 33.12 ? 86  THR D CB  1 
ATOM   10816 O OG1 . THR D 1 48  ? 15.240  11.253  44.409  1.00 34.52 ? 86  THR D OG1 1 
ATOM   10817 C CG2 . THR D 1 48  ? 17.638  11.382  44.805  1.00 30.64 ? 86  THR D CG2 1 
ATOM   10818 N N   . ALA D 1 49  ? 17.739  9.604   47.992  1.00 33.60 ? 87  ALA D N   1 
ATOM   10819 C CA  . ALA D 1 49  ? 18.861  9.642   48.930  1.00 34.70 ? 87  ALA D CA  1 
ATOM   10820 C C   . ALA D 1 49  ? 20.169  9.834   48.176  1.00 34.94 ? 87  ALA D C   1 
ATOM   10821 O O   . ALA D 1 49  ? 20.545  8.991   47.365  1.00 36.19 ? 87  ALA D O   1 
ATOM   10822 C CB  . ALA D 1 49  ? 18.922  8.352   49.778  1.00 34.41 ? 87  ALA D CB  1 
ATOM   10823 N N   . VAL D 1 50  ? 20.856  10.945  48.428  1.00 35.59 ? 88  VAL D N   1 
ATOM   10824 C CA  . VAL D 1 50  ? 22.214  11.117  47.928  1.00 35.17 ? 88  VAL D CA  1 
ATOM   10825 C C   . VAL D 1 50  ? 23.171  10.627  49.010  1.00 35.29 ? 88  VAL D C   1 
ATOM   10826 O O   . VAL D 1 50  ? 23.343  11.261  50.039  1.00 35.82 ? 88  VAL D O   1 
ATOM   10827 C CB  . VAL D 1 50  ? 22.551  12.586  47.526  1.00 34.69 ? 88  VAL D CB  1 
ATOM   10828 C CG1 . VAL D 1 50  ? 23.965  12.638  46.999  1.00 33.89 ? 88  VAL D CG1 1 
ATOM   10829 C CG2 . VAL D 1 50  ? 21.593  13.133  46.512  1.00 32.76 ? 88  VAL D CG2 1 
ATOM   10830 N N   . SER D 1 51  ? 23.819  9.503   48.761  1.00 35.78 ? 89  SER D N   1 
ATOM   10831 C CA  . SER D 1 51  ? 24.614  8.815   49.793  1.00 36.22 ? 89  SER D CA  1 
ATOM   10832 C C   . SER D 1 51  ? 25.734  8.086   49.073  1.00 35.88 ? 89  SER D C   1 
ATOM   10833 O O   . SER D 1 51  ? 25.481  7.484   48.045  1.00 36.84 ? 89  SER D O   1 
ATOM   10834 C CB  . SER D 1 51  ? 23.723  7.840   50.556  1.00 36.10 ? 89  SER D CB  1 
ATOM   10835 O OG  . SER D 1 51  ? 24.454  7.057   51.488  1.00 36.96 ? 89  SER D OG  1 
ATOM   10836 N N   . ASN D 1 52  ? 26.964  8.158   49.560  1.00 35.07 ? 90  ASN D N   1 
ATOM   10837 C CA  . ASN D 1 52  ? 28.054  7.520   48.832  1.00 34.96 ? 90  ASN D CA  1 
ATOM   10838 C C   . ASN D 1 52  ? 27.827  6.025   48.636  1.00 34.77 ? 90  ASN D C   1 
ATOM   10839 O O   . ASN D 1 52  ? 28.075  5.500   47.544  1.00 34.53 ? 90  ASN D O   1 
ATOM   10840 C CB  . ASN D 1 52  ? 29.383  7.724   49.533  1.00 35.22 ? 90  ASN D CB  1 
ATOM   10841 C CG  . ASN D 1 52  ? 30.556  7.333   48.666  1.00 34.85 ? 90  ASN D CG  1 
ATOM   10842 O OD1 . ASN D 1 52  ? 30.636  7.757   47.505  1.00 33.55 ? 90  ASN D OD1 1 
ATOM   10843 N ND2 . ASN D 1 52  ? 31.471  6.510   49.212  1.00 36.07 ? 90  ASN D ND2 1 
ATOM   10844 N N   . ASN D 1 53  ? 27.345  5.383   49.703  1.00 33.56 ? 91  ASN D N   1 
ATOM   10845 C CA  . ASN D 1 53  ? 27.162  3.934   49.802  1.00 33.40 ? 91  ASN D CA  1 
ATOM   10846 C C   . ASN D 1 53  ? 25.724  3.617   50.251  1.00 33.53 ? 91  ASN D C   1 
ATOM   10847 O O   . ASN D 1 53  ? 24.974  4.513   50.684  1.00 33.08 ? 91  ASN D O   1 
ATOM   10848 C CB  . ASN D 1 53  ? 28.201  3.307   50.769  1.00 32.99 ? 91  ASN D CB  1 
ATOM   10849 C CG  . ASN D 1 53  ? 29.646  3.659   50.385  1.00 31.65 ? 91  ASN D CG  1 
ATOM   10850 O OD1 . ASN D 1 53  ? 30.302  4.455   51.037  1.00 31.16 ? 91  ASN D OD1 1 
ATOM   10851 N ND2 . ASN D 1 53  ? 30.103  3.115   49.281  1.00 30.83 ? 91  ASN D ND2 1 
ATOM   10852 N N   . ALA D 1 54  ? 25.339  2.353   50.072  1.00 33.62 ? 92  ALA D N   1 
ATOM   10853 C CA  . ALA D 1 54  ? 24.007  1.840   50.415  1.00 34.17 ? 92  ALA D CA  1 
ATOM   10854 C C   . ALA D 1 54  ? 23.988  1.199   51.791  1.00 34.70 ? 92  ALA D C   1 
ATOM   10855 O O   . ALA D 1 54  ? 23.101  0.390   52.060  1.00 34.38 ? 92  ALA D O   1 
ATOM   10856 C CB  . ALA D 1 54  ? 23.542  0.785   49.363  1.00 34.05 ? 92  ALA D CB  1 
ATOM   10857 N N   . GLY D 1 55  ? 24.962  1.533   52.643  1.00 35.18 ? 93  GLY D N   1 
ATOM   10858 C CA  . GLY D 1 55  ? 25.082  0.944   53.973  1.00 36.12 ? 93  GLY D CA  1 
ATOM   10859 C C   . GLY D 1 55  ? 25.393  -0.533  53.885  1.00 36.57 ? 93  GLY D C   1 
ATOM   10860 O O   . GLY D 1 55  ? 26.254  -0.947  53.125  1.00 37.85 ? 93  GLY D O   1 
ATOM   10861 N N   . VAL D 1 56  ? 24.713  -1.335  54.686  1.00 36.98 ? 94  VAL D N   1 
ATOM   10862 C CA  . VAL D 1 56  ? 24.752  -2.779  54.524  1.00 36.93 ? 94  VAL D CA  1 
ATOM   10863 C C   . VAL D 1 56  ? 23.278  -3.221  54.611  1.00 37.77 ? 94  VAL D C   1 
ATOM   10864 O O   . VAL D 1 56  ? 22.412  -2.367  54.812  1.00 37.69 ? 94  VAL D O   1 
ATOM   10865 C CB  . VAL D 1 56  ? 25.744  -3.469  55.546  1.00 36.83 ? 94  VAL D CB  1 
ATOM   10866 C CG1 . VAL D 1 56  ? 27.199  -3.061  55.232  1.00 35.74 ? 94  VAL D CG1 1 
ATOM   10867 C CG2 . VAL D 1 56  ? 25.396  -3.143  57.006  1.00 35.27 ? 94  VAL D CG2 1 
ATOM   10868 N N   . ASP D 1 57  ? 22.976  -4.502  54.410  1.00 38.29 ? 95  ASP D N   1 
ATOM   10869 C CA  . ASP D 1 57  ? 21.575  -4.967  54.418  1.00 39.12 ? 95  ASP D CA  1 
ATOM   10870 C C   . ASP D 1 57  ? 20.863  -4.472  55.691  1.00 39.59 ? 95  ASP D C   1 
ATOM   10871 O O   . ASP D 1 57  ? 19.773  -3.909  55.638  1.00 39.71 ? 95  ASP D O   1 
ATOM   10872 C CB  . ASP D 1 57  ? 21.477  -6.527  54.313  1.00 39.08 ? 95  ASP D CB  1 
ATOM   10873 N N   . ASN D 1 58  ? 21.516  -4.661  56.830  1.00 40.37 ? 96  ASN D N   1 
ATOM   10874 C CA  . ASN D 1 58  ? 20.874  -4.483  58.137  1.00 40.50 ? 96  ASN D CA  1 
ATOM   10875 C C   . ASN D 1 58  ? 21.160  -3.137  58.843  1.00 40.22 ? 96  ASN D C   1 
ATOM   10876 O O   . ASN D 1 58  ? 20.754  -2.941  59.997  1.00 40.71 ? 96  ASN D O   1 
ATOM   10877 C CB  . ASN D 1 58  ? 21.214  -5.685  59.061  1.00 40.47 ? 96  ASN D CB  1 
ATOM   10878 C CG  . ASN D 1 58  ? 22.726  -5.935  59.215  1.00 39.85 ? 96  ASN D CG  1 
ATOM   10879 O OD1 . ASN D 1 58  ? 23.550  -5.181  58.710  1.00 41.72 ? 96  ASN D OD1 1 
ATOM   10880 N ND2 . ASN D 1 58  ? 23.077  -6.993  59.933  1.00 38.91 ? 96  ASN D ND2 1 
ATOM   10881 N N   . PHE D 1 59  ? 21.818  -2.205  58.154  1.00 39.57 ? 97  PHE D N   1 
ATOM   10882 C CA  . PHE D 1 59  ? 22.264  -0.966  58.795  1.00 38.67 ? 97  PHE D CA  1 
ATOM   10883 C C   . PHE D 1 59  ? 22.499  0.189   57.807  1.00 38.56 ? 97  PHE D C   1 
ATOM   10884 O O   . PHE D 1 59  ? 22.614  -0.002  56.596  1.00 38.65 ? 97  PHE D O   1 
ATOM   10885 C CB  . PHE D 1 59  ? 23.544  -1.241  59.612  1.00 38.57 ? 97  PHE D CB  1 
ATOM   10886 C CG  . PHE D 1 59  ? 23.641  -0.441  60.892  1.00 37.78 ? 97  PHE D CG  1 
ATOM   10887 C CD1 . PHE D 1 59  ? 22.648  -0.522  61.853  1.00 37.41 ? 97  PHE D CD1 1 
ATOM   10888 C CD2 . PHE D 1 59  ? 24.717  0.405   61.123  1.00 37.92 ? 97  PHE D CD2 1 
ATOM   10889 C CE1 . PHE D 1 59  ? 22.731  0.222   63.027  1.00 38.37 ? 97  PHE D CE1 1 
ATOM   10890 C CE2 . PHE D 1 59  ? 24.801  1.160   62.292  1.00 37.58 ? 97  PHE D CE2 1 
ATOM   10891 C CZ  . PHE D 1 59  ? 23.822  1.065   63.241  1.00 38.50 ? 97  PHE D CZ  1 
ATOM   10892 N N   . GLY D 1 60  ? 22.579  1.393   58.355  1.00 37.97 ? 98  GLY D N   1 
ATOM   10893 C CA  . GLY D 1 60  ? 22.713  2.590   57.568  1.00 37.37 ? 98  GLY D CA  1 
ATOM   10894 C C   . GLY D 1 60  ? 21.469  2.853   56.733  1.00 37.23 ? 98  GLY D C   1 
ATOM   10895 O O   . GLY D 1 60  ? 20.348  2.649   57.183  1.00 37.34 ? 98  GLY D O   1 
ATOM   10896 N N   . LEU D 1 61  ? 21.686  3.298   55.505  1.00 36.82 ? 99  LEU D N   1 
ATOM   10897 C CA  . LEU D 1 61  ? 20.611  3.648   54.577  1.00 37.05 ? 99  LEU D CA  1 
ATOM   10898 C C   . LEU D 1 61  ? 19.875  2.389   54.122  1.00 35.76 ? 99  LEU D C   1 
ATOM   10899 O O   . LEU D 1 61  ? 18.714  2.433   53.719  1.00 34.89 ? 99  LEU D O   1 
ATOM   10900 C CB  . LEU D 1 61  ? 21.217  4.408   53.378  1.00 37.04 ? 99  LEU D CB  1 
ATOM   10901 C CG  . LEU D 1 61  ? 20.300  5.457   52.772  1.00 39.23 ? 99  LEU D CG  1 
ATOM   10902 C CD1 . LEU D 1 61  ? 20.318  6.721   53.634  1.00 38.64 ? 99  LEU D CD1 1 
ATOM   10903 C CD2 . LEU D 1 61  ? 20.733  5.762   51.329  1.00 41.76 ? 99  LEU D CD2 1 
ATOM   10904 N N   . GLY D 1 62  ? 20.579  1.262   54.230  1.00 35.56 ? 100 GLY D N   1 
ATOM   10905 C CA  . GLY D 1 62  ? 19.999  -0.066  54.150  1.00 35.11 ? 100 GLY D CA  1 
ATOM   10906 C C   . GLY D 1 62  ? 18.766  -0.280  55.009  1.00 35.35 ? 100 GLY D C   1 
ATOM   10907 O O   . GLY D 1 62  ? 17.956  -1.165  54.711  1.00 35.21 ? 100 GLY D O   1 
ATOM   10908 N N   . LEU D 1 63  ? 18.614  0.515   56.068  1.00 35.41 ? 101 LEU D N   1 
ATOM   10909 C CA  . LEU D 1 63  ? 17.375  0.522   56.858  1.00 35.76 ? 101 LEU D CA  1 
ATOM   10910 C C   . LEU D 1 63  ? 16.195  1.130   56.089  1.00 35.26 ? 101 LEU D C   1 
ATOM   10911 O O   . LEU D 1 63  ? 15.104  0.575   56.070  1.00 35.12 ? 101 LEU D O   1 
ATOM   10912 C CB  . LEU D 1 63  ? 17.588  1.304   58.157  1.00 36.15 ? 101 LEU D CB  1 
ATOM   10913 C CG  . LEU D 1 63  ? 18.548  0.599   59.118  1.00 36.44 ? 101 LEU D CG  1 
ATOM   10914 C CD1 . LEU D 1 63  ? 19.082  1.559   60.166  1.00 37.38 ? 101 LEU D CD1 1 
ATOM   10915 C CD2 . LEU D 1 63  ? 17.832  -0.586  59.747  1.00 37.06 ? 101 LEU D CD2 1 
ATOM   10916 N N   . LEU D 1 64  ? 16.444  2.281   55.458  1.00 34.97 ? 102 LEU D N   1 
ATOM   10917 C CA  . LEU D 1 64  ? 15.432  2.999   54.677  1.00 33.62 ? 102 LEU D CA  1 
ATOM   10918 C C   . LEU D 1 64  ? 15.127  2.253   53.372  1.00 33.16 ? 102 LEU D C   1 
ATOM   10919 O O   . LEU D 1 64  ? 14.027  2.321   52.858  1.00 33.56 ? 102 LEU D O   1 
ATOM   10920 C CB  . LEU D 1 64  ? 15.903  4.450   54.418  1.00 34.04 ? 102 LEU D CB  1 
ATOM   10921 C CG  . LEU D 1 64  ? 16.209  5.364   55.623  1.00 32.03 ? 102 LEU D CG  1 
ATOM   10922 C CD1 . LEU D 1 64  ? 16.446  6.774   55.173  1.00 31.45 ? 102 LEU D CD1 1 
ATOM   10923 C CD2 . LEU D 1 64  ? 15.085  5.377   56.629  1.00 31.26 ? 102 LEU D CD2 1 
ATOM   10924 N N   . LEU D 1 65  ? 16.090  1.506   52.850  1.00 32.52 ? 103 LEU D N   1 
ATOM   10925 C CA  . LEU D 1 65  ? 15.834  0.615   51.733  1.00 32.00 ? 103 LEU D CA  1 
ATOM   10926 C C   . LEU D 1 65  ? 14.880  -0.527  52.126  1.00 32.17 ? 103 LEU D C   1 
ATOM   10927 O O   . LEU D 1 65  ? 13.865  -0.697  51.460  1.00 32.01 ? 103 LEU D O   1 
ATOM   10928 C CB  . LEU D 1 65  ? 17.133  0.046   51.155  1.00 31.83 ? 103 LEU D CB  1 
ATOM   10929 C CG  . LEU D 1 65  ? 18.030  1.016   50.363  1.00 32.80 ? 103 LEU D CG  1 
ATOM   10930 C CD1 . LEU D 1 65  ? 19.474  0.492   50.263  1.00 33.12 ? 103 LEU D CD1 1 
ATOM   10931 C CD2 . LEU D 1 65  ? 17.444  1.301   48.974  1.00 29.73 ? 103 LEU D CD2 1 
ATOM   10932 N N   . ARG D 1 66  ? 15.188  -1.299  53.181  1.00 31.95 ? 104 ARG D N   1 
ATOM   10933 C CA  . ARG D 1 66  ? 14.305  -2.419  53.598  1.00 32.27 ? 104 ARG D CA  1 
ATOM   10934 C C   . ARG D 1 66  ? 12.868  -1.962  53.923  1.00 32.25 ? 104 ARG D C   1 
ATOM   10935 O O   . ARG D 1 66  ? 11.911  -2.725  53.730  1.00 32.91 ? 104 ARG D O   1 
ATOM   10936 C CB  . ARG D 1 66  ? 14.884  -3.225  54.780  1.00 32.15 ? 104 ARG D CB  1 
ATOM   10937 N N   . SER D 1 67  ? 12.728  -0.724  54.402  1.00 32.47 ? 105 SER D N   1 
ATOM   10938 C CA  . SER D 1 67  ? 11.417  -0.116  54.684  1.00 32.22 ? 105 SER D CA  1 
ATOM   10939 C C   . SER D 1 67  ? 10.769  0.536   53.445  1.00 32.27 ? 105 SER D C   1 
ATOM   10940 O O   . SER D 1 67  ? 9.701   1.142   53.546  1.00 32.27 ? 105 SER D O   1 
ATOM   10941 C CB  . SER D 1 67  ? 11.557  0.926   55.800  1.00 32.33 ? 105 SER D CB  1 
ATOM   10942 O OG  . SER D 1 67  ? 12.415  1.978   55.393  1.00 31.84 ? 105 SER D OG  1 
ATOM   10943 N N   . LYS D 1 68  ? 11.406  0.411   52.282  1.00 32.38 ? 106 LYS D N   1 
ATOM   10944 C CA  . LYS D 1 68  ? 10.832  0.906   51.025  1.00 32.47 ? 106 LYS D CA  1 
ATOM   10945 C C   . LYS D 1 68  ? 10.530  2.424   51.061  1.00 31.96 ? 106 LYS D C   1 
ATOM   10946 O O   . LYS D 1 68  ? 9.561   2.895   50.467  1.00 31.30 ? 106 LYS D O   1 
ATOM   10947 C CB  . LYS D 1 68  ? 9.570   0.075   50.650  1.00 32.60 ? 106 LYS D CB  1 
ATOM   10948 C CG  . LYS D 1 68  ? 9.871   -1.384  50.259  1.00 33.34 ? 106 LYS D CG  1 
ATOM   10949 C CD  . LYS D 1 68  ? 11.188  -1.450  49.438  1.00 34.77 ? 106 LYS D CD  1 
ATOM   10950 N N   . GLN D 1 69  ? 11.368  3.184   51.756  1.00 31.53 ? 107 GLN D N   1 
ATOM   10951 C CA  . GLN D 1 69  ? 11.206  4.638   51.811  1.00 31.53 ? 107 GLN D CA  1 
ATOM   10952 C C   . GLN D 1 69  ? 12.047  5.415   50.788  1.00 31.71 ? 107 GLN D C   1 
ATOM   10953 O O   . GLN D 1 69  ? 11.889  6.617   50.653  1.00 31.11 ? 107 GLN D O   1 
ATOM   10954 C CB  . GLN D 1 69  ? 11.550  5.138   53.198  1.00 31.72 ? 107 GLN D CB  1 
ATOM   10955 C CG  . GLN D 1 69  ? 10.547  4.747   54.232  1.00 31.22 ? 107 GLN D CG  1 
ATOM   10956 C CD  . GLN D 1 69  ? 11.014  5.105   55.615  1.00 30.71 ? 107 GLN D CD  1 
ATOM   10957 O OE1 . GLN D 1 69  ? 11.244  4.233   56.434  1.00 34.13 ? 107 GLN D OE1 1 
ATOM   10958 N NE2 . GLN D 1 69  ? 11.166  6.380   55.876  1.00 28.13 ? 107 GLN D NE2 1 
ATOM   10959 N N   . ILE D 1 70  ? 12.934  4.726   50.078  1.00 32.02 ? 108 ILE D N   1 
ATOM   10960 C CA  . ILE D 1 70  ? 13.781  5.340   49.071  1.00 31.94 ? 108 ILE D CA  1 
ATOM   10961 C C   . ILE D 1 70  ? 13.302  5.013   47.639  1.00 32.37 ? 108 ILE D C   1 
ATOM   10962 O O   . ILE D 1 70  ? 13.192  3.854   47.243  1.00 31.43 ? 108 ILE D O   1 
ATOM   10963 C CB  . ILE D 1 70  ? 15.268  4.952   49.314  1.00 31.86 ? 108 ILE D CB  1 
ATOM   10964 C CG1 . ILE D 1 70  ? 15.705  5.446   50.697  1.00 32.21 ? 108 ILE D CG1 1 
ATOM   10965 C CG2 . ILE D 1 70  ? 16.209  5.589   48.294  1.00 31.87 ? 108 ILE D CG2 1 
ATOM   10966 C CD1 . ILE D 1 70  ? 17.168  5.278   50.940  1.00 32.78 ? 108 ILE D CD1 1 
ATOM   10967 N N   . LYS D 1 71  ? 13.034  6.048   46.857  1.00 33.52 ? 109 LYS D N   1 
ATOM   10968 C CA  . LYS D 1 71  ? 12.659  5.874   45.455  1.00 34.96 ? 109 LYS D CA  1 
ATOM   10969 C C   . LYS D 1 71  ? 13.909  5.770   44.577  1.00 34.73 ? 109 LYS D C   1 
ATOM   10970 O O   . LYS D 1 71  ? 14.023  4.860   43.747  1.00 34.28 ? 109 LYS D O   1 
ATOM   10971 C CB  . LYS D 1 71  ? 11.793  7.050   45.003  1.00 35.33 ? 109 LYS D CB  1 
ATOM   10972 C CG  . LYS D 1 71  ? 11.320  6.973   43.555  1.00 37.37 ? 109 LYS D CG  1 
ATOM   10973 C CD  . LYS D 1 71  ? 10.436  8.166   43.173  1.00 37.54 ? 109 LYS D CD  1 
ATOM   10974 C CE  . LYS D 1 71  ? 10.081  8.165   41.678  1.00 40.09 ? 109 LYS D CE  1 
ATOM   10975 N NZ  . LYS D 1 71  ? 10.245  6.827   41.020  1.00 42.03 ? 109 LYS D NZ  1 
ATOM   10976 N N   . ARG D 1 72  ? 14.834  6.712   44.774  1.00 35.12 ? 110 ARG D N   1 
ATOM   10977 C CA  . ARG D 1 72  ? 16.102  6.763   44.038  1.00 35.32 ? 110 ARG D CA  1 
ATOM   10978 C C   . ARG D 1 72  ? 17.315  6.981   44.961  1.00 35.75 ? 110 ARG D C   1 
ATOM   10979 O O   . ARG D 1 72  ? 17.237  7.731   45.923  1.00 35.38 ? 110 ARG D O   1 
ATOM   10980 C CB  . ARG D 1 72  ? 16.059  7.859   42.982  1.00 35.22 ? 110 ARG D CB  1 
ATOM   10981 C CG  . ARG D 1 72  ? 17.314  7.943   42.159  1.00 36.04 ? 110 ARG D CG  1 
ATOM   10982 C CD  . ARG D 1 72  ? 17.221  8.991   41.074  1.00 37.44 ? 110 ARG D CD  1 
ATOM   10983 N NE  . ARG D 1 72  ? 16.411  8.535   39.961  1.00 39.28 ? 110 ARG D NE  1 
ATOM   10984 C CZ  . ARG D 1 72  ? 16.516  8.980   38.706  1.00 40.80 ? 110 ARG D CZ  1 
ATOM   10985 N NH1 . ARG D 1 72  ? 17.430  9.886   38.382  1.00 42.04 ? 110 ARG D NH1 1 
ATOM   10986 N NH2 . ARG D 1 72  ? 15.711  8.496   37.761  1.00 41.13 ? 110 ARG D NH2 1 
ATOM   10987 N N   . MET D 1 73  ? 18.413  6.290   44.649  1.00 35.95 ? 111 MET D N   1 
ATOM   10988 C CA  . MET D 1 73  ? 19.698  6.490   45.267  1.00 36.42 ? 111 MET D CA  1 
ATOM   10989 C C   . MET D 1 73  ? 20.618  7.173   44.282  1.00 36.36 ? 111 MET D C   1 
ATOM   10990 O O   . MET D 1 73  ? 20.725  6.744   43.125  1.00 36.21 ? 111 MET D O   1 
ATOM   10991 C CB  . MET D 1 73  ? 20.357  5.158   45.612  1.00 36.91 ? 111 MET D CB  1 
ATOM   10992 C CG  . MET D 1 73  ? 19.649  4.329   46.628  1.00 38.57 ? 111 MET D CG  1 
ATOM   10993 S SD  . MET D 1 73  ? 20.034  4.672   48.348  1.00 46.04 ? 111 MET D SD  1 
ATOM   10994 C CE  . MET D 1 73  ? 21.806  4.376   48.519  1.00 43.02 ? 111 MET D CE  1 
ATOM   10995 N N   . VAL D 1 74  ? 21.301  8.221   44.737  1.00 35.59 ? 112 VAL D N   1 
ATOM   10996 C CA  . VAL D 1 74  ? 22.474  8.694   44.025  1.00 35.20 ? 112 VAL D CA  1 
ATOM   10997 C C   . VAL D 1 74  ? 23.748  8.273   44.799  1.00 35.50 ? 112 VAL D C   1 
ATOM   10998 O O   . VAL D 1 74  ? 24.008  8.800   45.874  1.00 35.37 ? 112 VAL D O   1 
ATOM   10999 C CB  . VAL D 1 74  ? 22.387  10.204  43.841  1.00 35.32 ? 112 VAL D CB  1 
ATOM   11000 C CG1 . VAL D 1 74  ? 23.631  10.745  43.123  1.00 33.24 ? 112 VAL D CG1 1 
ATOM   11001 C CG2 . VAL D 1 74  ? 21.079  10.542  43.127  1.00 33.92 ? 112 VAL D CG2 1 
ATOM   11002 N N   . SER D 1 75  ? 24.546  7.361   44.225  1.00 35.49 ? 113 SER D N   1 
ATOM   11003 C CA  . SER D 1 75  ? 25.723  6.777   44.915  1.00 35.40 ? 113 SER D CA  1 
ATOM   11004 C C   . SER D 1 75  ? 26.956  6.358   44.053  1.00 34.41 ? 113 SER D C   1 
ATOM   11005 O O   . SER D 1 75  ? 26.868  6.164   42.842  1.00 34.19 ? 113 SER D O   1 
ATOM   11006 C CB  . SER D 1 75  ? 25.234  5.565   45.704  1.00 35.27 ? 113 SER D CB  1 
ATOM   11007 O OG  . SER D 1 75  ? 23.937  5.790   46.227  1.00 38.22 ? 113 SER D OG  1 
ATOM   11008 N N   . SER D 1 76  ? 28.100  6.168   44.696  1.00 34.76 ? 114 SER D N   1 
ATOM   11009 C CA  . SER D 1 76  ? 29.327  5.724   43.993  1.00 35.41 ? 114 SER D CA  1 
ATOM   11010 C C   . SER D 1 76  ? 29.590  4.186   44.064  1.00 36.48 ? 114 SER D C   1 
ATOM   11011 O O   . SER D 1 76  ? 30.109  3.542   43.117  1.00 35.69 ? 114 SER D O   1 
ATOM   11012 C CB  . SER D 1 76  ? 30.534  6.504   44.530  1.00 35.68 ? 114 SER D CB  1 
ATOM   11013 O OG  . SER D 1 76  ? 30.969  5.989   45.796  1.00 36.64 ? 114 SER D OG  1 
ATOM   11014 N N   . TYR D 1 77  ? 29.240  3.607   45.202  1.00 37.53 ? 115 TYR D N   1 
ATOM   11015 C CA  . TYR D 1 77  ? 29.524  2.220   45.463  1.00 38.27 ? 115 TYR D CA  1 
ATOM   11016 C C   . TYR D 1 77  ? 28.412  1.683   46.323  1.00 38.45 ? 115 TYR D C   1 
ATOM   11017 O O   . TYR D 1 77  ? 28.130  2.193   47.407  1.00 37.65 ? 115 TYR D O   1 
ATOM   11018 C CB  . TYR D 1 77  ? 30.874  2.079   46.166  1.00 39.21 ? 115 TYR D CB  1 
ATOM   11019 C CG  . TYR D 1 77  ? 31.289  0.661   46.421  1.00 40.54 ? 115 TYR D CG  1 
ATOM   11020 C CD1 . TYR D 1 77  ? 31.903  -0.101  45.422  1.00 41.96 ? 115 TYR D CD1 1 
ATOM   11021 C CD2 . TYR D 1 77  ? 31.084  0.074   47.667  1.00 41.09 ? 115 TYR D CD2 1 
ATOM   11022 C CE1 . TYR D 1 77  ? 32.282  -1.410  45.656  1.00 41.76 ? 115 TYR D CE1 1 
ATOM   11023 C CE2 . TYR D 1 77  ? 31.447  -1.219  47.903  1.00 42.01 ? 115 TYR D CE2 1 
ATOM   11024 C CZ  . TYR D 1 77  ? 32.051  -1.965  46.905  1.00 41.67 ? 115 TYR D CZ  1 
ATOM   11025 O OH  . TYR D 1 77  ? 32.407  -3.269  47.174  1.00 41.25 ? 115 TYR D OH  1 
ATOM   11026 N N   . VAL D 1 78  ? 27.821  0.603   45.830  1.00 38.83 ? 116 VAL D N   1 
ATOM   11027 C CA  . VAL D 1 78  ? 26.656  0.013   46.415  1.00 38.88 ? 116 VAL D CA  1 
ATOM   11028 C C   . VAL D 1 78  ? 26.846  -1.512  46.678  1.00 39.24 ? 116 VAL D C   1 
ATOM   11029 O O   . VAL D 1 78  ? 25.878  -2.259  46.771  1.00 37.89 ? 116 VAL D O   1 
ATOM   11030 C CB  . VAL D 1 78  ? 25.495  0.298   45.477  1.00 39.27 ? 116 VAL D CB  1 
ATOM   11031 C CG1 . VAL D 1 78  ? 25.222  1.834   45.445  1.00 38.83 ? 116 VAL D CG1 1 
ATOM   11032 C CG2 . VAL D 1 78  ? 25.798  -0.267  44.031  1.00 39.76 ? 116 VAL D CG2 1 
ATOM   11033 N N   . GLY D 1 79  ? 28.104  -1.939  46.808  1.00 39.25 ? 117 GLY D N   1 
ATOM   11034 C CA  . GLY D 1 79  ? 28.433  -3.295  47.195  1.00 39.58 ? 117 GLY D CA  1 
ATOM   11035 C C   . GLY D 1 79  ? 28.266  -3.511  48.693  1.00 39.71 ? 117 GLY D C   1 
ATOM   11036 O O   . GLY D 1 79  ? 28.291  -2.550  49.468  1.00 40.16 ? 117 GLY D O   1 
ATOM   11037 N N   . GLU D 1 80  ? 28.102  -4.780  49.073  1.00 39.12 ? 118 GLU D N   1 
ATOM   11038 C CA  . GLU D 1 80  ? 27.916  -5.249  50.463  1.00 39.09 ? 118 GLU D CA  1 
ATOM   11039 C C   . GLU D 1 80  ? 26.520  -4.975  51.045  1.00 38.86 ? 118 GLU D C   1 
ATOM   11040 O O   . GLU D 1 80  ? 26.361  -4.714  52.236  1.00 38.06 ? 118 GLU D O   1 
ATOM   11041 C CB  . GLU D 1 80  ? 29.039  -4.779  51.389  1.00 38.89 ? 118 GLU D CB  1 
ATOM   11042 C CG  . GLU D 1 80  ? 30.353  -5.547  51.180  1.00 40.27 ? 118 GLU D CG  1 
ATOM   11043 C CD  . GLU D 1 80  ? 31.115  -5.129  49.913  1.00 42.33 ? 118 GLU D CD  1 
ATOM   11044 O OE1 . GLU D 1 80  ? 31.424  -3.920  49.756  1.00 42.96 ? 118 GLU D OE1 1 
ATOM   11045 O OE2 . GLU D 1 80  ? 31.413  -6.014  49.078  1.00 42.91 ? 118 GLU D OE2 1 
ATOM   11046 N N   . ASN D 1 81  ? 25.510  -5.070  50.184  1.00 39.40 ? 119 ASN D N   1 
ATOM   11047 C CA  . ASN D 1 81  ? 24.112  -4.910  50.587  1.00 40.05 ? 119 ASN D CA  1 
ATOM   11048 C C   . ASN D 1 81  ? 23.288  -5.685  49.570  1.00 41.04 ? 119 ASN D C   1 
ATOM   11049 O O   . ASN D 1 81  ? 23.012  -5.191  48.478  1.00 40.92 ? 119 ASN D O   1 
ATOM   11050 C CB  . ASN D 1 81  ? 23.700  -3.423  50.658  1.00 39.93 ? 119 ASN D CB  1 
ATOM   11051 C CG  . ASN D 1 81  ? 22.239  -3.221  51.086  1.00 39.12 ? 119 ASN D CG  1 
ATOM   11052 O OD1 . ASN D 1 81  ? 21.430  -4.125  51.001  1.00 37.02 ? 119 ASN D OD1 1 
ATOM   11053 N ND2 . ASN D 1 81  ? 21.906  -2.015  51.531  1.00 40.28 ? 119 ASN D ND2 1 
ATOM   11054 N N   . ALA D 1 82  ? 22.954  -6.924  49.940  1.00 42.03 ? 120 ALA D N   1 
ATOM   11055 C CA  . ALA D 1 82  ? 22.196  -7.843  49.099  1.00 42.77 ? 120 ALA D CA  1 
ATOM   11056 C C   . ALA D 1 82  ? 20.813  -7.290  48.703  1.00 43.52 ? 120 ALA D C   1 
ATOM   11057 O O   . ALA D 1 82  ? 20.430  -7.376  47.525  1.00 44.16 ? 120 ALA D O   1 
ATOM   11058 C CB  . ALA D 1 82  ? 22.048  -9.217  49.816  1.00 42.33 ? 120 ALA D CB  1 
ATOM   11059 N N   . GLU D 1 83  ? 20.072  -6.739  49.677  1.00 44.17 ? 121 GLU D N   1 
ATOM   11060 C CA  . GLU D 1 83  ? 18.691  -6.254  49.447  1.00 44.31 ? 121 GLU D CA  1 
ATOM   11061 C C   . GLU D 1 83  ? 18.702  -5.113  48.408  1.00 44.48 ? 121 GLU D C   1 
ATOM   11062 O O   . GLU D 1 83  ? 17.865  -5.081  47.501  1.00 44.45 ? 121 GLU D O   1 
ATOM   11063 C CB  . GLU D 1 83  ? 18.014  -5.843  50.776  1.00 44.15 ? 121 GLU D CB  1 
ATOM   11064 C CG  . GLU D 1 83  ? 16.732  -4.980  50.676  1.00 44.52 ? 121 GLU D CG  1 
ATOM   11065 C CD  . GLU D 1 83  ? 15.465  -5.740  50.278  1.00 46.46 ? 121 GLU D CD  1 
ATOM   11066 O OE1 . GLU D 1 83  ? 15.554  -6.915  49.852  1.00 47.67 ? 121 GLU D OE1 1 
ATOM   11067 O OE2 . GLU D 1 83  ? 14.359  -5.157  50.400  1.00 46.79 ? 121 GLU D OE2 1 
ATOM   11068 N N   . PHE D 1 84  ? 19.674  -4.213  48.518  1.00 44.66 ? 122 PHE D N   1 
ATOM   11069 C CA  . PHE D 1 84  ? 19.872  -3.166  47.500  1.00 44.46 ? 122 PHE D CA  1 
ATOM   11070 C C   . PHE D 1 84  ? 20.062  -3.739  46.081  1.00 44.19 ? 122 PHE D C   1 
ATOM   11071 O O   . PHE D 1 84  ? 19.410  -3.283  45.142  1.00 43.57 ? 122 PHE D O   1 
ATOM   11072 C CB  . PHE D 1 84  ? 21.072  -2.295  47.820  1.00 44.53 ? 122 PHE D CB  1 
ATOM   11073 C CG  . PHE D 1 84  ? 21.372  -1.307  46.733  1.00 44.89 ? 122 PHE D CG  1 
ATOM   11074 C CD1 . PHE D 1 84  ? 22.247  -1.633  45.700  1.00 44.99 ? 122 PHE D CD1 1 
ATOM   11075 C CD2 . PHE D 1 84  ? 20.723  -0.083  46.700  1.00 44.65 ? 122 PHE D CD2 1 
ATOM   11076 C CE1 . PHE D 1 84  ? 22.491  -0.740  44.669  1.00 44.24 ? 122 PHE D CE1 1 
ATOM   11077 C CE2 . PHE D 1 84  ? 20.975  0.817   45.680  1.00 45.84 ? 122 PHE D CE2 1 
ATOM   11078 C CZ  . PHE D 1 84  ? 21.863  0.484   44.665  1.00 45.47 ? 122 PHE D CZ  1 
ATOM   11079 N N   . GLU D 1 85  ? 20.987  -4.706  45.955  1.00 43.94 ? 123 GLU D N   1 
ATOM   11080 C CA  . GLU D 1 85  ? 21.271  -5.432  44.699  1.00 43.31 ? 123 GLU D CA  1 
ATOM   11081 C C   . GLU D 1 85  ? 20.019  -6.093  44.164  1.00 42.95 ? 123 GLU D C   1 
ATOM   11082 O O   . GLU D 1 85  ? 19.786  -6.128  42.949  1.00 42.00 ? 123 GLU D O   1 
ATOM   11083 C CB  . GLU D 1 85  ? 22.332  -6.522  44.918  1.00 43.29 ? 123 GLU D CB  1 
ATOM   11084 N N   . ARG D 1 86  ? 19.212  -6.616  45.080  1.00 42.82 ? 124 ARG D N   1 
ATOM   11085 C CA  . ARG D 1 86  ? 17.936  -7.173  44.693  1.00 42.93 ? 124 ARG D CA  1 
ATOM   11086 C C   . ARG D 1 86  ? 16.996  -6.103  44.122  1.00 42.55 ? 124 ARG D C   1 
ATOM   11087 O O   . ARG D 1 86  ? 16.581  -6.212  42.968  1.00 42.71 ? 124 ARG D O   1 
ATOM   11088 C CB  . ARG D 1 86  ? 17.275  -7.908  45.853  1.00 43.11 ? 124 ARG D CB  1 
ATOM   11089 C CG  . ARG D 1 86  ? 16.336  -9.002  45.369  1.00 43.89 ? 124 ARG D CG  1 
ATOM   11090 C CD  . ARG D 1 86  ? 15.423  -9.492  46.472  1.00 45.29 ? 124 ARG D CD  1 
ATOM   11091 N NE  . ARG D 1 86  ? 14.766  -8.385  47.167  1.00 45.88 ? 124 ARG D NE  1 
ATOM   11092 C CZ  . ARG D 1 86  ? 13.798  -7.626  46.652  1.00 46.77 ? 124 ARG D CZ  1 
ATOM   11093 N NH1 . ARG D 1 86  ? 13.283  -6.643  47.380  1.00 46.99 ? 124 ARG D NH1 1 
ATOM   11094 N NH2 . ARG D 1 86  ? 13.334  -7.831  45.420  1.00 47.56 ? 124 ARG D NH2 1 
ATOM   11095 N N   . GLN D 1 87  ? 16.660  -5.095  44.928  1.00 41.96 ? 125 GLN D N   1 
ATOM   11096 C CA  . GLN D 1 87  ? 15.766  -3.999  44.505  1.00 42.02 ? 125 GLN D CA  1 
ATOM   11097 C C   . GLN D 1 87  ? 16.191  -3.331  43.189  1.00 42.23 ? 125 GLN D C   1 
ATOM   11098 O O   . GLN D 1 87  ? 15.346  -2.975  42.369  1.00 41.28 ? 125 GLN D O   1 
ATOM   11099 C CB  . GLN D 1 87  ? 15.648  -2.935  45.607  1.00 41.98 ? 125 GLN D CB  1 
ATOM   11100 C CG  . GLN D 1 87  ? 14.877  -3.403  46.850  1.00 42.02 ? 125 GLN D CG  1 
ATOM   11101 C CD  . GLN D 1 87  ? 14.621  -2.288  47.855  1.00 41.81 ? 125 GLN D CD  1 
ATOM   11102 O OE1 . GLN D 1 87  ? 14.392  -1.136  47.480  1.00 42.64 ? 125 GLN D OE1 1 
ATOM   11103 N NE2 . GLN D 1 87  ? 14.640  -2.631  49.139  1.00 41.33 ? 125 GLN D NE2 1 
ATOM   11104 N N   . TYR D 1 88  ? 17.498  -3.169  42.988  1.00 42.98 ? 126 TYR D N   1 
ATOM   11105 C CA  . TYR D 1 88  ? 18.021  -2.590  41.745  1.00 44.00 ? 126 TYR D CA  1 
ATOM   11106 C C   . TYR D 1 88  ? 17.860  -3.524  40.535  1.00 43.78 ? 126 TYR D C   1 
ATOM   11107 O O   . TYR D 1 88  ? 17.195  -3.158  39.573  1.00 43.08 ? 126 TYR D O   1 
ATOM   11108 C CB  . TYR D 1 88  ? 19.482  -2.169  41.919  1.00 45.15 ? 126 TYR D CB  1 
ATOM   11109 C CG  . TYR D 1 88  ? 20.140  -1.587  40.670  1.00 46.86 ? 126 TYR D CG  1 
ATOM   11110 C CD1 . TYR D 1 88  ? 19.395  -0.945  39.671  1.00 48.12 ? 126 TYR D CD1 1 
ATOM   11111 C CD2 . TYR D 1 88  ? 21.523  -1.652  40.511  1.00 48.98 ? 126 TYR D CD2 1 
ATOM   11112 C CE1 . TYR D 1 88  ? 20.013  -0.416  38.535  1.00 48.82 ? 126 TYR D CE1 1 
ATOM   11113 C CE2 . TYR D 1 88  ? 22.151  -1.115  39.393  1.00 49.72 ? 126 TYR D CE2 1 
ATOM   11114 C CZ  . TYR D 1 88  ? 21.393  -0.504  38.407  1.00 48.69 ? 126 TYR D CZ  1 
ATOM   11115 O OH  . TYR D 1 88  ? 22.037  0.004   37.304  1.00 47.90 ? 126 TYR D OH  1 
ATOM   11116 N N   . LEU D 1 89  ? 18.461  -4.720  40.593  1.00 43.80 ? 127 LEU D N   1 
ATOM   11117 C CA  . LEU D 1 89  ? 18.364  -5.695  39.495  1.00 43.82 ? 127 LEU D CA  1 
ATOM   11118 C C   . LEU D 1 89  ? 16.928  -6.193  39.259  1.00 43.40 ? 127 LEU D C   1 
ATOM   11119 O O   . LEU D 1 89  ? 16.615  -6.625  38.154  1.00 43.61 ? 127 LEU D O   1 
ATOM   11120 C CB  . LEU D 1 89  ? 19.340  -6.880  39.682  1.00 43.93 ? 127 LEU D CB  1 
ATOM   11121 C CG  . LEU D 1 89  ? 20.825  -6.561  39.402  1.00 44.87 ? 127 LEU D CG  1 
ATOM   11122 C CD1 . LEU D 1 89  ? 21.745  -7.699  39.819  1.00 43.23 ? 127 LEU D CD1 1 
ATOM   11123 C CD2 . LEU D 1 89  ? 21.048  -6.217  37.928  1.00 45.51 ? 127