data_3DO7
# 
_entry.id   3DO7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DO7         
NDB   PD1158       
RCSB  RCSB048281   
WWPDB D_1000048281 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DO7 
_pdbx_database_status.recvd_initial_deposition_date   2008-07-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fusco, A.'   1 
'Huang, D.B.' 2 
'Miller, D.'  3 
'Vu, D.'      4 
'Ghosh, G.'   5 
# 
_citation.id                        primary 
_citation.title                     
'NF-kapppaB p52:RelB heterodimer uses different binding modes to recognize different kappaB DNA' 
_citation.journal_abbrev            'TO BE PUBLISHED' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fusco, A.'   1 
primary 'Huang, D.B.' 2 
primary 'Miller, D.'  3 
primary 'Vu, D.'      4 
primary 'Ghosh, G.'   5 
# 
_cell.entry_id           3DO7 
_cell.length_a           77.640 
_cell.length_b           124.130 
_cell.length_c           189.590 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DO7 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*DCP*DGP*DGP*DGP*DAP*DAP*DTP*DTP*DCP*DCP*DC)-3'"         3334.186  3  ? ? 'kappa B site'              
'kappaB DNA' 
2 polymer man 'Avian reticuloendotheliosis viral (V-rel) oncogene related B' 33514.039 1  ? ? 'RHR (UNP residues 88-383)' ? 
3 polymer man 'Nuclear factor NF-kappa-B p100 subunit'                       33023.820 1  ? ? 'RHR (UNP residues 37-329)' ? 
4 water   nat water                                                          18.015    49 ? ? ?                           ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        
;DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10, Oncogene Lyt-10, Lyt10, Nuclear factor NF-kappa-B p52 subunit
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DC)' CGGGAATTCCC C,D,E ? 
2 'polypeptide(L)'        no no 
;SCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTQPAIELRDCGGLREVEVTACLVWKDW
PHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRIC
FQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFS
QADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSY
;
;SCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTQPAIELRDCGGLREVEVTACLVWKDW
PHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRIC
FQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFS
QADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSY
;
A     ? 
3 'polypeptide(L)'        no no 
;GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSE
LGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSA
FLRDSDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDF
SPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLV
;
;GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSE
LGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSA
FLRDSDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDF
SPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLV
;
B     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DG  n 
1 4   DG  n 
1 5   DA  n 
1 6   DA  n 
1 7   DT  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DC  n 
2 1   SER n 
2 2   CYS n 
2 3   THR n 
2 4   LEU n 
2 5   GLY n 
2 6   ARG n 
2 7   LEU n 
2 8   VAL n 
2 9   SER n 
2 10  PRO n 
2 11  GLY n 
2 12  PRO n 
2 13  CYS n 
2 14  PRO n 
2 15  ARG n 
2 16  PRO n 
2 17  TYR n 
2 18  LEU n 
2 19  VAL n 
2 20  ILE n 
2 21  THR n 
2 22  GLU n 
2 23  GLN n 
2 24  PRO n 
2 25  LYS n 
2 26  GLN n 
2 27  ARG n 
2 28  GLY n 
2 29  MET n 
2 30  ARG n 
2 31  PHE n 
2 32  ARG n 
2 33  TYR n 
2 34  GLU n 
2 35  CYS n 
2 36  GLU n 
2 37  GLY n 
2 38  ARG n 
2 39  SER n 
2 40  ALA n 
2 41  GLY n 
2 42  SER n 
2 43  ILE n 
2 44  LEU n 
2 45  GLY n 
2 46  GLU n 
2 47  SER n 
2 48  SER n 
2 49  THR n 
2 50  GLU n 
2 51  ALA n 
2 52  SER n 
2 53  LYS n 
2 54  THR n 
2 55  GLN n 
2 56  PRO n 
2 57  ALA n 
2 58  ILE n 
2 59  GLU n 
2 60  LEU n 
2 61  ARG n 
2 62  ASP n 
2 63  CYS n 
2 64  GLY n 
2 65  GLY n 
2 66  LEU n 
2 67  ARG n 
2 68  GLU n 
2 69  VAL n 
2 70  GLU n 
2 71  VAL n 
2 72  THR n 
2 73  ALA n 
2 74  CYS n 
2 75  LEU n 
2 76  VAL n 
2 77  TRP n 
2 78  LYS n 
2 79  ASP n 
2 80  TRP n 
2 81  PRO n 
2 82  HIS n 
2 83  ARG n 
2 84  VAL n 
2 85  HIS n 
2 86  PRO n 
2 87  HIS n 
2 88  SER n 
2 89  LEU n 
2 90  VAL n 
2 91  GLY n 
2 92  LYS n 
2 93  ASP n 
2 94  CYS n 
2 95  THR n 
2 96  ASP n 
2 97  GLY n 
2 98  VAL n 
2 99  CYS n 
2 100 ARG n 
2 101 VAL n 
2 102 ARG n 
2 103 LEU n 
2 104 ARG n 
2 105 PRO n 
2 106 HIS n 
2 107 VAL n 
2 108 SER n 
2 109 PRO n 
2 110 ARG n 
2 111 HIS n 
2 112 SER n 
2 113 PHE n 
2 114 ASN n 
2 115 ASN n 
2 116 LEU n 
2 117 GLY n 
2 118 ILE n 
2 119 GLN n 
2 120 CYS n 
2 121 VAL n 
2 122 ARG n 
2 123 LYS n 
2 124 LYS n 
2 125 GLU n 
2 126 ILE n 
2 127 GLU n 
2 128 ALA n 
2 129 ALA n 
2 130 ILE n 
2 131 GLU n 
2 132 ARG n 
2 133 LYS n 
2 134 ILE n 
2 135 GLN n 
2 136 LEU n 
2 137 GLY n 
2 138 ILE n 
2 139 ASP n 
2 140 PRO n 
2 141 TYR n 
2 142 ASN n 
2 143 ALA n 
2 144 GLY n 
2 145 SER n 
2 146 LEU n 
2 147 LYS n 
2 148 ASN n 
2 149 HIS n 
2 150 GLN n 
2 151 GLU n 
2 152 VAL n 
2 153 ASP n 
2 154 MET n 
2 155 ASN n 
2 156 VAL n 
2 157 VAL n 
2 158 ARG n 
2 159 ILE n 
2 160 CYS n 
2 161 PHE n 
2 162 GLN n 
2 163 ALA n 
2 164 SER n 
2 165 TYR n 
2 166 ARG n 
2 167 ASP n 
2 168 GLN n 
2 169 GLN n 
2 170 GLY n 
2 171 HIS n 
2 172 LEU n 
2 173 HIS n 
2 174 ARG n 
2 175 MET n 
2 176 ASP n 
2 177 PRO n 
2 178 ILE n 
2 179 LEU n 
2 180 SER n 
2 181 GLU n 
2 182 PRO n 
2 183 VAL n 
2 184 TYR n 
2 185 ASP n 
2 186 LYS n 
2 187 LYS n 
2 188 SER n 
2 189 THR n 
2 190 ASN n 
2 191 THR n 
2 192 SER n 
2 193 GLU n 
2 194 LEU n 
2 195 ARG n 
2 196 ILE n 
2 197 CYS n 
2 198 ARG n 
2 199 ILE n 
2 200 ASN n 
2 201 LYS n 
2 202 GLU n 
2 203 SER n 
2 204 GLY n 
2 205 PRO n 
2 206 CYS n 
2 207 THR n 
2 208 GLY n 
2 209 GLY n 
2 210 GLU n 
2 211 GLU n 
2 212 LEU n 
2 213 TYR n 
2 214 LEU n 
2 215 LEU n 
2 216 CYS n 
2 217 ASP n 
2 218 LYS n 
2 219 VAL n 
2 220 GLN n 
2 221 LYS n 
2 222 GLU n 
2 223 ASP n 
2 224 ILE n 
2 225 SER n 
2 226 VAL n 
2 227 VAL n 
2 228 PHE n 
2 229 SER n 
2 230 THR n 
2 231 ALA n 
2 232 SER n 
2 233 TRP n 
2 234 GLU n 
2 235 GLY n 
2 236 ARG n 
2 237 ALA n 
2 238 ASP n 
2 239 PHE n 
2 240 SER n 
2 241 GLN n 
2 242 ALA n 
2 243 ASP n 
2 244 VAL n 
2 245 HIS n 
2 246 ARG n 
2 247 GLN n 
2 248 ILE n 
2 249 ALA n 
2 250 ILE n 
2 251 VAL n 
2 252 PHE n 
2 253 LYS n 
2 254 THR n 
2 255 PRO n 
2 256 PRO n 
2 257 TYR n 
2 258 GLU n 
2 259 ASP n 
2 260 LEU n 
2 261 GLU n 
2 262 ILE n 
2 263 SER n 
2 264 GLU n 
2 265 PRO n 
2 266 VAL n 
2 267 THR n 
2 268 VAL n 
2 269 ASN n 
2 270 VAL n 
2 271 PHE n 
2 272 LEU n 
2 273 GLN n 
2 274 ARG n 
2 275 LEU n 
2 276 THR n 
2 277 ASP n 
2 278 GLY n 
2 279 VAL n 
2 280 CYS n 
2 281 SER n 
2 282 GLU n 
2 283 PRO n 
2 284 LEU n 
2 285 PRO n 
2 286 PHE n 
2 287 THR n 
2 288 TYR n 
2 289 LEU n 
2 290 PRO n 
2 291 ARG n 
2 292 ASP n 
2 293 HIS n 
2 294 ASP n 
2 295 SER n 
2 296 TYR n 
3 1   GLY n 
3 2   PRO n 
3 3   TYR n 
3 4   LEU n 
3 5   VAL n 
3 6   ILE n 
3 7   VAL n 
3 8   GLU n 
3 9   GLN n 
3 10  PRO n 
3 11  LYS n 
3 12  GLN n 
3 13  ARG n 
3 14  GLY n 
3 15  PHE n 
3 16  ARG n 
3 17  PHE n 
3 18  ARG n 
3 19  TYR n 
3 20  GLY n 
3 21  CYS n 
3 22  GLU n 
3 23  GLY n 
3 24  PRO n 
3 25  SER n 
3 26  HIS n 
3 27  GLY n 
3 28  GLY n 
3 29  LEU n 
3 30  PRO n 
3 31  GLY n 
3 32  ALA n 
3 33  SER n 
3 34  SER n 
3 35  GLU n 
3 36  LYS n 
3 37  GLY n 
3 38  ARG n 
3 39  LYS n 
3 40  THR n 
3 41  TYR n 
3 42  PRO n 
3 43  THR n 
3 44  VAL n 
3 45  LYS n 
3 46  ILE n 
3 47  CYS n 
3 48  ASN n 
3 49  TYR n 
3 50  GLU n 
3 51  GLY n 
3 52  PRO n 
3 53  ALA n 
3 54  LYS n 
3 55  ILE n 
3 56  GLU n 
3 57  VAL n 
3 58  ASP n 
3 59  LEU n 
3 60  VAL n 
3 61  THR n 
3 62  HIS n 
3 63  SER n 
3 64  ASP n 
3 65  PRO n 
3 66  PRO n 
3 67  ARG n 
3 68  ALA n 
3 69  HIS n 
3 70  ALA n 
3 71  HIS n 
3 72  SER n 
3 73  LEU n 
3 74  VAL n 
3 75  GLY n 
3 76  LYS n 
3 77  GLN n 
3 78  CYS n 
3 79  SER n 
3 80  GLU n 
3 81  LEU n 
3 82  GLY n 
3 83  ILE n 
3 84  CYS n 
3 85  ALA n 
3 86  VAL n 
3 87  SER n 
3 88  VAL n 
3 89  GLY n 
3 90  PRO n 
3 91  LYS n 
3 92  ASP n 
3 93  MET n 
3 94  THR n 
3 95  ALA n 
3 96  GLN n 
3 97  PHE n 
3 98  ASN n 
3 99  ASN n 
3 100 LEU n 
3 101 GLY n 
3 102 VAL n 
3 103 LEU n 
3 104 HIS n 
3 105 VAL n 
3 106 THR n 
3 107 LYS n 
3 108 LYS n 
3 109 ASN n 
3 110 MET n 
3 111 MET n 
3 112 GLY n 
3 113 THR n 
3 114 MET n 
3 115 ILE n 
3 116 GLN n 
3 117 LYS n 
3 118 LEU n 
3 119 GLN n 
3 120 ARG n 
3 121 GLN n 
3 122 ARG n 
3 123 LEU n 
3 124 ARG n 
3 125 SER n 
3 126 ARG n 
3 127 PRO n 
3 128 GLN n 
3 129 GLY n 
3 130 LEU n 
3 131 THR n 
3 132 GLU n 
3 133 ALA n 
3 134 GLU n 
3 135 GLN n 
3 136 ARG n 
3 137 GLU n 
3 138 LEU n 
3 139 GLU n 
3 140 GLN n 
3 141 GLU n 
3 142 ALA n 
3 143 LYS n 
3 144 GLU n 
3 145 LEU n 
3 146 LYS n 
3 147 LYS n 
3 148 VAL n 
3 149 MET n 
3 150 ASP n 
3 151 LEU n 
3 152 SER n 
3 153 ILE n 
3 154 VAL n 
3 155 ARG n 
3 156 LEU n 
3 157 ARG n 
3 158 PHE n 
3 159 SER n 
3 160 ALA n 
3 161 PHE n 
3 162 LEU n 
3 163 ARG n 
3 164 ASP n 
3 165 SER n 
3 166 ASP n 
3 167 GLY n 
3 168 SER n 
3 169 PHE n 
3 170 SER n 
3 171 LEU n 
3 172 PRO n 
3 173 LEU n 
3 174 LYS n 
3 175 PRO n 
3 176 VAL n 
3 177 ILE n 
3 178 SER n 
3 179 GLN n 
3 180 PRO n 
3 181 ILE n 
3 182 HIS n 
3 183 ASP n 
3 184 SER n 
3 185 LYS n 
3 186 SER n 
3 187 PRO n 
3 188 GLY n 
3 189 ALA n 
3 190 SER n 
3 191 ASN n 
3 192 LEU n 
3 193 LYS n 
3 194 ILE n 
3 195 SER n 
3 196 ARG n 
3 197 MET n 
3 198 ASP n 
3 199 LYS n 
3 200 THR n 
3 201 ALA n 
3 202 GLY n 
3 203 SER n 
3 204 VAL n 
3 205 ARG n 
3 206 GLY n 
3 207 GLY n 
3 208 ASP n 
3 209 GLU n 
3 210 VAL n 
3 211 TYR n 
3 212 LEU n 
3 213 LEU n 
3 214 CYS n 
3 215 ASP n 
3 216 LYS n 
3 217 VAL n 
3 218 GLN n 
3 219 LYS n 
3 220 ASP n 
3 221 ASP n 
3 222 ILE n 
3 223 GLU n 
3 224 VAL n 
3 225 ARG n 
3 226 PHE n 
3 227 TYR n 
3 228 GLU n 
3 229 ASP n 
3 230 ASP n 
3 231 GLU n 
3 232 ASN n 
3 233 GLY n 
3 234 TRP n 
3 235 GLN n 
3 236 ALA n 
3 237 PHE n 
3 238 GLY n 
3 239 ASP n 
3 240 PHE n 
3 241 SER n 
3 242 PRO n 
3 243 THR n 
3 244 ASP n 
3 245 VAL n 
3 246 HIS n 
3 247 LYS n 
3 248 GLN n 
3 249 TYR n 
3 250 ALA n 
3 251 ILE n 
3 252 VAL n 
3 253 PHE n 
3 254 ARG n 
3 255 THR n 
3 256 PRO n 
3 257 PRO n 
3 258 TYR n 
3 259 HIS n 
3 260 LYS n 
3 261 MET n 
3 262 LYS n 
3 263 ILE n 
3 264 GLU n 
3 265 ARG n 
3 266 PRO n 
3 267 VAL n 
3 268 THR n 
3 269 VAL n 
3 270 PHE n 
3 271 LEU n 
3 272 GLN n 
3 273 LEU n 
3 274 LYS n 
3 275 ARG n 
3 276 LYS n 
3 277 ARG n 
3 278 GLY n 
3 279 GLY n 
3 280 ASP n 
3 281 VAL n 
3 282 SER n 
3 283 ASP n 
3 284 SER n 
3 285 LYS n 
3 286 GLN n 
3 287 PHE n 
3 288 THR n 
3 289 TYR n 
3 290 TYR n 
3 291 PRO n 
3 292 LEU n 
3 293 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
2 1 sample ? ? ? mouse ? Relb           ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? 'T7 promoter' ? ? ? pET15b ? ? 
3 1 sample ? ? ? human ? 'NFKB2, LYT10' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? 'T7 promoter' ? ? ? pET11a ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q8VE46_MOUSE Q8VE46 2 
;SCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDW
PHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRIC
FQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFS
QADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSY
;
88 ? 
2 UNP NFKB2_HUMAN  Q00653 3 
;GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSE
LGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSA
FLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDF
SPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLV
;
37 ? 
3 PDB 3DO7         3DO7   1 CGGGAATTCCC ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DO7 A 1 ? 296 ? Q8VE46 88 ? 383 ? 88 383 
2 2 3DO7 B 1 ? 293 ? Q00653 37 ? 329 ? 37 329 
3 3 3DO7 C 1 ? 11  ? 3DO7   2  ? 12  ? 2  12  
4 3 3DO7 D 1 ? 11  ? 3DO7   13 ? 23  ? 13 23  
5 3 3DO7 E 1 ? 11  ? 3DO7   2  ? 12  ? 2  12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3DO7 GLN A 55  ? UNP Q8VE46 LEU 142 CONFLICT 142 1 
2 3DO7 ASP B 164 ? UNP Q00653 ALA 200 CONFLICT 200 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3DO7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'6% PEG 4000, 50 mM NaCl, 0.1% BOG, 10 mM DTT, 10 mM NaCitrate and 2 mM Spermidine, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 'PEG 4000' ? ? ? 
1 2  1 NaCl       ? ? ? 
1 3  1 BOG        ? ? ? 
1 4  1 DTT        ? ? ? 
1 5  1 NaCitrate  ? ? ? 
1 6  1 Spermidine ? ? ? 
1 7  2 'PEG 4000' ? ? ? 
1 8  2 NaCl       ? ? ? 
1 9  2 BOG        ? ? ? 
1 10 2 DTT        ? ? ? 
1 11 2 NaCitrate  ? ? ? 
1 12 2 Spermidine ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           106 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2005-01-01 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3DO7 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            3.05 
_reflns.number_obs                   16342 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.064 
_reflns.pdbx_netI_over_sigmaI        14.4 
_reflns.B_iso_Wilson_estimate        85.7 
_reflns.pdbx_redundancy              14 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.05 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   60 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.47 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        12 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1045 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3DO7 
_refine.ls_number_reflns_obs                     14478 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               53121.68 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.19 
_refine.ls_d_res_high                            3.05 
_refine.ls_percent_reflns_obs                    81.4 
_refine.ls_R_factor_obs                          0.23 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.9 
_refine.ls_number_reflns_R_free                  851 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               97.9 
_refine.aniso_B[1][1]                            30.17 
_refine.aniso_B[2][2]                            -21.71 
_refine.aniso_B[3][3]                            -8.46 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.196009 
_refine.solvent_model_param_bsol                 10.1666 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3DO7 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.26 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4595 
_refine_hist.pdbx_number_atoms_nucleic_acid   644 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             49 
_refine_hist.number_atoms_total               5288 
_refine_hist.d_res_high                       3.05 
_refine_hist.d_res_low                        29.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.9  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.07  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.05 
_refine_ls_shell.d_res_low                        3.24 
_refine_ls_shell.number_reflns_R_work             1114 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.percent_reflns_obs               40.4 
_refine_ls_shell.R_factor_R_free                  0.318 
_refine_ls_shell.R_factor_R_free_error            0.040 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DO7 
_struct.title                     'X-ray structure of a NF-kB p52/RelB/DNA complex' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DO7 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
;PROTEIN-DNA COMPLEX, Nucleus, Activator, Alternative splicing, ANK repeat, Chromosomal rearrangement, Cytoplasm, Disease mutation, DNA-binding, Phosphoprotein, Polymorphism, Proto-oncogene, Transcription, Transcription regulation, Ubl conjugation, TRANSCRIPTION-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU D 125 ? LEU D 136 ? GLU A 212 LEU A 223 1 ? 12 
HELX_P HELX_P2 2 SER D 240 ? ILE D 248 ? SER A 327 ILE A 335 5 ? 9  
HELX_P HELX_P3 3 CYS E 21  ? GLY E 23  ? CYS B 57  GLY B 59  5 ? 3  
HELX_P HELX_P4 4 ASN E 109 ? ARG E 122 ? ASN B 145 ARG B 158 1 ? 14 
HELX_P HELX_P5 5 THR E 131 ? LYS E 147 ? THR B 167 LYS B 183 1 ? 17 
HELX_P HELX_P6 6 SER E 241 ? VAL E 245 ? SER B 277 VAL B 281 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D CYS 94 SG ? ? ? 1_555 D CYS 99 SG ? ? A CYS 181 A CYS 186 1_555 ? ? ? ? ? ? ?            2.644 ? 
disulf2  disulf ? ? E CYS 78 SG ? ? ? 1_555 E CYS 84 SG ? ? B CYS 114 B CYS 120 1_555 ? ? ? ? ? ? ?            2.029 ? 
hydrog1  hydrog ? ? A DG  2  N1 ? ? ? 1_555 B DC  11 N3 ? ? C DG  3   D DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  2  N2 ? ? ? 1_555 B DC  11 O2 ? ? C DG  3   D DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  2  O6 ? ? ? 1_555 B DC  11 N4 ? ? C DG  3   D DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  3  N1 ? ? ? 1_555 B DC  10 N3 ? ? C DG  4   D DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  3  N2 ? ? ? 1_555 B DC  10 O2 ? ? C DG  4   D DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  3  O6 ? ? ? 1_555 B DC  10 N4 ? ? C DG  4   D DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  4  N1 ? ? ? 1_555 B DC  9  N3 ? ? C DG  5   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG  4  N2 ? ? ? 1_555 B DC  9  O2 ? ? C DG  5   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG  4  O6 ? ? ? 1_555 B DC  9  N4 ? ? C DG  5   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DA  5  N1 ? ? ? 1_555 B DT  8  N3 ? ? C DA  6   D DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DA  5  N6 ? ? ? 1_555 B DT  8  O4 ? ? C DA  6   D DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DA  6  N1 ? ? ? 1_555 B DT  7  N3 ? ? C DA  7   D DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA  6  N6 ? ? ? 1_555 B DT  7  O4 ? ? C DA  7   D DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  7  N3 ? ? ? 1_555 B DA  6  N1 ? ? C DT  8   D DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT  7  O4 ? ? ? 1_555 B DA  6  N6 ? ? C DT  8   D DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT  8  N3 ? ? ? 1_555 B DA  5  N1 ? ? C DT  9   D DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT  8  O4 ? ? ? 1_555 B DA  5  N6 ? ? C DT  9   D DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  9  N3 ? ? ? 1_555 B DG  4  N1 ? ? C DC  10  D DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  9  N4 ? ? ? 1_555 B DG  4  O6 ? ? C DC  10  D DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  9  O2 ? ? ? 1_555 B DG  4  N2 ? ? C DC  10  D DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  10 N3 ? ? ? 1_555 B DG  3  N1 ? ? C DC  11  D DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DC  10 N4 ? ? ? 1_555 B DG  3  O6 ? ? C DC  11  D DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  10 O2 ? ? ? 1_555 B DG  3  N2 ? ? C DC  11  D DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DG  2  N1 ? ? ? 1_555 C DC  11 N3 ? ? E DG  3   E DC  12  3_655 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog25 hydrog ? ? C DG  3  N1 ? ? ? 1_555 C DC  10 N3 ? ? E DG  4   E DC  11  3_655 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog26 hydrog ? ? C DG  4  N1 ? ? ? 1_555 C DC  9  N3 ? ? E DG  5   E DC  10  3_655 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog27 hydrog ? ? C DA  5  N6 ? ? ? 1_555 C DT  7  O4 ? ? E DA  6   E DT  8   3_655 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog28 hydrog ? ? C DA  5  N1 ? ? ? 1_555 C DT  8  N3 ? ? E DA  6   E DT  9   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DA  5  N6 ? ? ? 1_555 C DT  8  O4 ? ? E DA  6   E DT  9   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DA  6  N1 ? ? ? 1_555 C DT  7  N3 ? ? E DA  7   E DT  8   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DA  6  N6 ? ? ? 1_555 C DT  7  O4 ? ? E DA  7   E DT  8   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DT  7  O4 ? ? ? 1_555 C DA  5  N6 ? ? E DT  8   E DA  6   3_655 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog33 hydrog ? ? C DT  7  N3 ? ? ? 1_555 C DA  6  N1 ? ? E DT  8   E DA  7   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DT  7  O4 ? ? ? 1_555 C DA  6  N6 ? ? E DT  8   E DA  7   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DT  8  N3 ? ? ? 1_555 C DA  5  N1 ? ? E DT  9   E DA  6   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DT  8  O4 ? ? ? 1_555 C DA  5  N6 ? ? E DT  9   E DA  6   3_655 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DC  9  O2 ? ? ? 1_555 C DG  4  N2 ? ? E DC  10  E DG  5   3_655 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog38 hydrog ? ? C DC  10 O2 ? ? ? 1_555 C DG  3  N2 ? ? E DC  11  E DG  4   3_655 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog39 hydrog ? ? C DC  11 N4 ? ? ? 1_555 C DG  2  O6 ? ? E DC  12  E DG  3   3_655 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 3 ? 
H ? 3 ? 
I ? 4 ? 
J ? 3 ? 
K ? 3 ? 
L ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR D 17  ? ILE D 20  ? TYR A 104 ILE A 107 
A 2 ALA D 57  ? ARG D 61  ? ALA A 144 ARG A 148 
A 3 ARG D 110 ? SER D 112 ? ARG A 197 SER A 199 
B 1 ARG D 27  ? MET D 29  ? ARG A 114 MET A 116 
B 2 VAL D 183 ? ASP D 185 ? VAL A 270 ASP A 272 
B 3 VAL D 156 ? PHE D 161 ? VAL A 243 PHE A 248 
B 4 ALA D 73  ? VAL D 76  ? ALA A 160 VAL A 163 
B 5 VAL D 98  ? CYS D 99  ? VAL A 185 CYS A 186 
C 1 SER D 88  ? GLY D 91  ? SER A 175 GLY A 178 
C 2 LEU D 116 ? GLN D 119 ? LEU A 203 GLN A 206 
D 1 ILE D 196 ? ILE D 199 ? ILE A 283 ILE A 286 
D 2 LEU D 214 ? CYS D 216 ? LEU A 301 CYS A 303 
E 1 SER D 203 ? PRO D 205 ? SER A 290 PRO A 292 
E 2 LEU D 284 ? LEU D 289 ? LEU A 371 LEU A 376 
E 3 VAL D 266 ? GLN D 273 ? VAL A 353 GLN A 360 
E 4 SER D 225 ? VAL D 227 ? SER A 312 VAL A 314 
F 1 GLU D 210 ? LEU D 212 ? GLU A 297 LEU A 299 
F 2 PHE D 252 ? THR D 254 ? PHE A 339 THR A 341 
G 1 TYR E 3   ? VAL E 5   ? TYR B 39  VAL B 41  
G 2 THR E 43  ? CYS E 47  ? THR B 79  CYS B 83  
G 3 THR E 94  ? GLN E 96  ? THR B 130 GLN B 132 
H 1 ARG E 18  ? TYR E 19  ? ARG B 54  TYR B 55  
H 2 GLY E 101 ? HIS E 104 ? GLY B 137 HIS B 140 
H 3 LEU E 73  ? VAL E 74  ? LEU B 109 VAL B 110 
I 1 CYS E 84  ? VAL E 88  ? CYS B 120 VAL B 124 
I 2 ALA E 53  ? THR E 61  ? ALA B 89  THR B 97  
I 3 ILE E 153 ? ARG E 163 ? ILE B 189 ARG B 199 
I 4 VAL E 176 ? ILE E 177 ? VAL B 212 ILE B 213 
J 1 PHE E 169 ? LEU E 171 ? PHE B 205 LEU B 207 
J 2 ILE E 153 ? ARG E 163 ? ILE B 189 ARG B 199 
J 3 ILE E 181 ? HIS E 182 ? ILE B 217 HIS B 218 
K 1 ARG E 196 ? MET E 197 ? ARG B 232 MET B 233 
K 2 GLU E 209 ? LEU E 213 ? GLU B 245 LEU B 249 
K 3 ALA E 250 ? ARG E 254 ? ALA B 286 ARG B 290 
L 1 PHE E 226 ? TYR E 227 ? PHE B 262 TYR B 263 
L 2 VAL E 269 ? LEU E 271 ? VAL B 305 LEU B 307 
L 3 LYS E 285 ? PHE E 287 ? LYS B 321 PHE B 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR D 17  ? N TYR A 104 O ARG D 61  ? O ARG A 148 
A 2 3 N ILE D 58  ? N ILE A 145 O HIS D 111 ? O HIS A 198 
B 1 2 N GLY D 28  ? N GLY A 115 O TYR D 184 ? O TYR A 271 
B 2 3 O VAL D 183 ? O VAL A 270 N VAL D 157 ? N VAL A 244 
B 3 4 O ARG D 158 ? O ARG A 245 N VAL D 76  ? N VAL A 163 
B 4 5 N ALA D 73  ? N ALA A 160 O CYS D 99  ? O CYS A 186 
C 1 2 N VAL D 90  ? N VAL A 177 O GLY D 117 ? O GLY A 204 
D 1 2 N CYS D 197 ? N CYS A 284 O LEU D 215 ? O LEU A 302 
E 1 2 N GLY D 204 ? N GLY A 291 O THR D 287 ? O THR A 374 
E 2 3 O LEU D 284 ? O LEU A 371 N VAL D 270 ? N VAL A 357 
E 3 4 O PHE D 271 ? O PHE A 358 N VAL D 227 ? N VAL A 314 
F 1 2 N GLU D 210 ? N GLU A 297 O THR D 254 ? O THR A 341 
G 1 2 N VAL E 5   ? N VAL B 41  O LYS E 45  ? O LYS B 81  
G 2 3 N VAL E 44  ? N VAL B 80  O ALA E 95  ? O ALA B 131 
H 1 2 N ARG E 18  ? N ARG B 54  O HIS E 104 ? O HIS B 140 
H 2 3 O GLY E 101 ? O GLY B 137 N VAL E 74  ? N VAL B 110 
I 1 2 O CYS E 84  ? O CYS B 120 N VAL E 57  ? N VAL B 93  
I 2 3 N GLU E 56  ? N GLU B 92  O SER E 159 ? O SER B 195 
I 3 4 N PHE E 158 ? N PHE B 194 O VAL E 176 ? O VAL B 212 
J 1 2 O SER E 170 ? O SER B 206 N LEU E 162 ? N LEU B 198 
J 2 3 N VAL E 154 ? N VAL B 190 O ILE E 181 ? O ILE B 217 
K 1 2 N ARG E 196 ? N ARG B 232 O LEU E 213 ? O LEU B 249 
K 2 3 N LEU E 212 ? N LEU B 248 O ILE E 251 ? O ILE B 287 
L 1 2 N TYR E 227 ? N TYR B 263 O PHE E 270 ? O PHE B 306 
L 2 3 N VAL E 269 ? N VAL B 305 O PHE E 287 ? O PHE B 323 
# 
_database_PDB_matrix.entry_id          3DO7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DO7 
_atom_sites.fract_transf_matrix[1][1]   0.012880 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008056 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005275 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1   ? 29.791  68.679  56.115  1.00 105.51 ? 2   DC  C "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1   ? 28.793  67.754  56.537  1.00 89.71  ? 2   DC  C "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1   ? 29.170  67.076  57.835  1.00 76.13  ? 2   DC  C "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1   ? 30.355  66.267  57.641  1.00 71.96  ? 2   DC  C "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1   ? 29.487  68.031  58.988  1.00 82.66  ? 2   DC  C "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1   ? 29.018  67.464  60.211  1.00 94.00  ? 2   DC  C "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1   ? 31.005  68.058  59.003  1.00 79.75  ? 2   DC  C "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1   ? 31.348  66.641  58.585  1.00 73.95  ? 2   DC  C "C1'" 1 
ATOM   9    N N1    . DC  A 1 1   ? 32.667  66.507  57.946  1.00 66.49  ? 2   DC  C N1    1 
ATOM   10   C C2    . DC  A 1 1   ? 33.580  65.591  58.475  1.00 66.11  ? 2   DC  C C2    1 
ATOM   11   O O2    . DC  A 1 1   ? 33.242  64.904  59.449  1.00 118.16 ? 2   DC  C O2    1 
ATOM   12   N N3    . DC  A 1 1   ? 34.805  65.480  57.914  1.00 71.43  ? 2   DC  C N3    1 
ATOM   13   C C4    . DC  A 1 1   ? 35.131  66.238  56.864  1.00 70.45  ? 2   DC  C C4    1 
ATOM   14   N N4    . DC  A 1 1   ? 36.354  66.100  56.348  1.00 90.44  ? 2   DC  C N4    1 
ATOM   15   C C5    . DC  A 1 1   ? 34.214  67.172  56.298  1.00 72.39  ? 2   DC  C C5    1 
ATOM   16   C C6    . DC  A 1 1   ? 33.004  67.271  56.863  1.00 53.98  ? 2   DC  C C6    1 
ATOM   17   P P     . DG  A 1 2   ? 28.141  68.344  61.234  1.00 66.34  ? 3   DG  C P     1 
ATOM   18   O OP1   . DG  A 1 2   ? 27.490  69.495  60.563  1.00 40.12  ? 3   DG  C OP1   1 
ATOM   19   O OP2   . DG  A 1 2   ? 29.032  68.595  62.391  1.00 65.98  ? 3   DG  C OP2   1 
ATOM   20   O "O5'" . DG  A 1 2   ? 26.979  67.325  61.618  1.00 37.20  ? 3   DG  C "O5'" 1 
ATOM   21   C "C5'" . DG  A 1 2   ? 26.155  66.778  60.589  1.00 47.12  ? 3   DG  C "C5'" 1 
ATOM   22   C "C4'" . DG  A 1 2   ? 25.606  65.433  61.005  1.00 69.93  ? 3   DG  C "C4'" 1 
ATOM   23   O "O4'" . DG  A 1 2   ? 26.680  64.467  61.094  1.00 63.64  ? 3   DG  C "O4'" 1 
ATOM   24   C "C3'" . DG  A 1 2   ? 24.900  65.407  62.359  1.00 80.18  ? 3   DG  C "C3'" 1 
ATOM   25   O "O3'" . DG  A 1 2   ? 23.759  64.537  62.273  1.00 109.63 ? 3   DG  C "O3'" 1 
ATOM   26   C "C2'" . DG  A 1 2   ? 25.970  64.873  63.293  1.00 54.02  ? 3   DG  C "C2'" 1 
ATOM   27   C "C1'" . DG  A 1 2   ? 26.760  63.929  62.401  1.00 66.21  ? 3   DG  C "C1'" 1 
ATOM   28   N N9    . DG  A 1 2   ? 28.177  63.817  62.752  1.00 66.24  ? 3   DG  C N9    1 
ATOM   29   C C8    . DG  A 1 2   ? 29.069  64.853  62.922  1.00 37.27  ? 3   DG  C C8    1 
ATOM   30   N N7    . DG  A 1 2   ? 30.265  64.448  63.255  1.00 61.72  ? 3   DG  C N7    1 
ATOM   31   C C5    . DG  A 1 2   ? 30.164  63.063  63.305  1.00 33.81  ? 3   DG  C C5    1 
ATOM   32   C C6    . DG  A 1 2   ? 31.134  62.082  63.628  1.00 52.71  ? 3   DG  C C6    1 
ATOM   33   O O6    . DG  A 1 2   ? 32.319  62.241  63.947  1.00 36.10  ? 3   DG  C O6    1 
ATOM   34   N N1    . DG  A 1 2   ? 30.605  60.796  63.561  1.00 38.53  ? 3   DG  C N1    1 
ATOM   35   C C2    . DG  A 1 2   ? 29.308  60.493  63.230  1.00 37.70  ? 3   DG  C C2    1 
ATOM   36   N N2    . DG  A 1 2   ? 28.995  59.188  63.211  1.00 33.80  ? 3   DG  C N2    1 
ATOM   37   N N3    . DG  A 1 2   ? 28.390  61.400  62.935  1.00 49.31  ? 3   DG  C N3    1 
ATOM   38   C C4    . DG  A 1 2   ? 28.881  62.655  62.992  1.00 17.63  ? 3   DG  C C4    1 
ATOM   39   P P     . DG  A 1 3   ? 22.848  64.258  63.571  1.00 64.76  ? 4   DG  C P     1 
ATOM   40   O OP1   . DG  A 1 3   ? 21.461  64.019  63.109  1.00 66.75  ? 4   DG  C OP1   1 
ATOM   41   O OP2   . DG  A 1 3   ? 23.108  65.321  64.580  1.00 66.96  ? 4   DG  C OP2   1 
ATOM   42   O "O5'" . DG  A 1 3   ? 23.406  62.862  64.088  1.00 45.53  ? 4   DG  C "O5'" 1 
ATOM   43   C "C5'" . DG  A 1 3   ? 23.375  61.729  63.225  1.00 43.88  ? 4   DG  C "C5'" 1 
ATOM   44   C "C4'" . DG  A 1 3   ? 23.548  60.456  64.018  1.00 69.47  ? 4   DG  C "C4'" 1 
ATOM   45   O "O4'" . DG  A 1 3   ? 24.935  60.243  64.370  1.00 42.48  ? 4   DG  C "O4'" 1 
ATOM   46   C "C3'" . DG  A 1 3   ? 22.772  60.453  65.328  1.00 38.63  ? 4   DG  C "C3'" 1 
ATOM   47   O "O3'" . DG  A 1 3   ? 22.237  59.159  65.582  1.00 52.06  ? 4   DG  C "O3'" 1 
ATOM   48   C "C2'" . DG  A 1 3   ? 23.822  60.832  66.354  1.00 72.26  ? 4   DG  C "C2'" 1 
ATOM   49   C "C1'" . DG  A 1 3   ? 25.082  60.206  65.782  1.00 46.02  ? 4   DG  C "C1'" 1 
ATOM   50   N N9    . DG  A 1 3   ? 26.311  60.919  66.109  1.00 46.42  ? 4   DG  C N9    1 
ATOM   51   C C8    . DG  A 1 3   ? 26.497  62.283  66.170  1.00 52.70  ? 4   DG  C C8    1 
ATOM   52   N N7    . DG  A 1 3   ? 27.726  62.619  66.447  1.00 40.38  ? 4   DG  C N7    1 
ATOM   53   C C5    . DG  A 1 3   ? 28.390  61.403  66.588  1.00 50.45  ? 4   DG  C C5    1 
ATOM   54   C C6    . DG  A 1 3   ? 29.744  61.127  66.880  1.00 33.33  ? 4   DG  C C6    1 
ATOM   55   O O6    . DG  A 1 3   ? 30.659  61.922  67.080  1.00 65.06  ? 4   DG  C O6    1 
ATOM   56   N N1    . DG  A 1 3   ? 29.993  59.761  66.928  1.00 49.34  ? 4   DG  C N1    1 
ATOM   57   C C2    . DG  A 1 3   ? 29.060  58.785  66.718  1.00 48.18  ? 4   DG  C C2    1 
ATOM   58   N N2    . DG  A 1 3   ? 29.496  57.526  66.811  1.00 69.34  ? 4   DG  C N2    1 
ATOM   59   N N3    . DG  A 1 3   ? 27.791  59.027  66.440  1.00 64.87  ? 4   DG  C N3    1 
ATOM   60   C C4    . DG  A 1 3   ? 27.527  60.351  66.392  1.00 32.40  ? 4   DG  C C4    1 
ATOM   61   P P     . DG  A 1 4   ? 21.229  58.961  66.801  1.00 74.52  ? 5   DG  C P     1 
ATOM   62   O OP1   . DG  A 1 4   ? 20.066  58.127  66.391  1.00 42.42  ? 5   DG  C OP1   1 
ATOM   63   O OP2   . DG  A 1 4   ? 21.004  60.328  67.331  1.00 29.73  ? 5   DG  C OP2   1 
ATOM   64   O "O5'" . DG  A 1 4   ? 22.113  58.114  67.812  1.00 50.15  ? 5   DG  C "O5'" 1 
ATOM   65   C "C5'" . DG  A 1 4   ? 22.956  57.070  67.322  1.00 51.13  ? 5   DG  C "C5'" 1 
ATOM   66   C "C4'" . DG  A 1 4   ? 24.052  56.770  68.317  1.00 73.19  ? 5   DG  C "C4'" 1 
ATOM   67   O "O4'" . DG  A 1 4   ? 25.102  57.771  68.301  1.00 85.48  ? 5   DG  C "O4'" 1 
ATOM   68   C "C3'" . DG  A 1 4   ? 23.578  56.701  69.770  1.00 73.83  ? 5   DG  C "C3'" 1 
ATOM   69   O "O3'" . DG  A 1 4   ? 24.372  55.731  70.442  1.00 66.22  ? 5   DG  C "O3'" 1 
ATOM   70   C "C2'" . DG  A 1 4   ? 23.992  58.055  70.309  1.00 46.37  ? 5   DG  C "C2'" 1 
ATOM   71   C "C1'" . DG  A 1 4   ? 25.342  58.123  69.650  1.00 43.39  ? 5   DG  C "C1'" 1 
ATOM   72   N N9    . DG  A 1 4   ? 26.059  59.387  69.704  1.00 27.77  ? 5   DG  C N9    1 
ATOM   73   C C8    . DG  A 1 4   ? 25.560  60.663  69.622  1.00 33.94  ? 5   DG  C C8    1 
ATOM   74   N N7    . DG  A 1 4   ? 26.484  61.579  69.742  1.00 33.83  ? 5   DG  C N7    1 
ATOM   75   C C5    . DG  A 1 4   ? 27.660  60.857  69.905  1.00 45.76  ? 5   DG  C C5    1 
ATOM   76   C C6    . DG  A 1 4   ? 28.994  61.295  70.089  1.00 40.82  ? 5   DG  C C6    1 
ATOM   77   O O6    . DG  A 1 4   ? 29.426  62.454  70.134  1.00 43.59  ? 5   DG  C O6    1 
ATOM   78   N N1    . DG  A 1 4   ? 29.868  60.222  70.226  1.00 44.59  ? 5   DG  C N1    1 
ATOM   79   C C2    . DG  A 1 4   ? 29.504  58.901  70.190  1.00 47.78  ? 5   DG  C C2    1 
ATOM   80   N N2    . DG  A 1 4   ? 30.478  58.009  70.347  1.00 35.37  ? 5   DG  C N2    1 
ATOM   81   N N3    . DG  A 1 4   ? 28.271  58.483  70.014  1.00 59.63  ? 5   DG  C N3    1 
ATOM   82   C C4    . DG  A 1 4   ? 27.407  59.505  69.881  1.00 44.08  ? 5   DG  C C4    1 
ATOM   83   P P     . DA  A 1 5   ? 23.667  54.534  71.228  1.00 63.16  ? 6   DA  C P     1 
ATOM   84   O OP1   . DA  A 1 5   ? 22.982  53.664  70.238  1.00 58.57  ? 6   DA  C OP1   1 
ATOM   85   O OP2   . DA  A 1 5   ? 22.903  55.128  72.354  1.00 66.61  ? 6   DA  C OP2   1 
ATOM   86   O "O5'" . DA  A 1 5   ? 24.896  53.723  71.822  1.00 46.86  ? 6   DA  C "O5'" 1 
ATOM   87   C "C5'" . DA  A 1 5   ? 25.797  53.044  70.955  1.00 11.85  ? 6   DA  C "C5'" 1 
ATOM   88   C "C4'" . DA  A 1 5   ? 27.211  53.225  71.449  1.00 39.90  ? 6   DA  C "C4'" 1 
ATOM   89   O "O4'" . DA  A 1 5   ? 27.509  54.638  71.491  1.00 41.31  ? 6   DA  C "O4'" 1 
ATOM   90   C "C3'" . DA  A 1 5   ? 27.461  52.718  72.868  1.00 81.79  ? 6   DA  C "C3'" 1 
ATOM   91   O "O3'" . DA  A 1 5   ? 28.777  52.179  72.915  1.00 30.71  ? 6   DA  C "O3'" 1 
ATOM   92   C "C2'" . DA  A 1 5   ? 27.388  53.979  73.709  1.00 79.96  ? 6   DA  C "C2'" 1 
ATOM   93   C "C1'" . DA  A 1 5   ? 28.031  54.960  72.761  1.00 21.36  ? 6   DA  C "C1'" 1 
ATOM   94   N N9    . DA  A 1 5   ? 27.799  56.382  72.991  1.00 44.49  ? 6   DA  C N9    1 
ATOM   95   C C8    . DA  A 1 5   ? 26.620  57.075  72.942  1.00 48.53  ? 6   DA  C C8    1 
ATOM   96   N N7    . DA  A 1 5   ? 26.760  58.368  73.123  1.00 70.89  ? 6   DA  C N7    1 
ATOM   97   C C5    . DA  A 1 5   ? 28.123  58.530  73.319  1.00 25.06  ? 6   DA  C C5    1 
ATOM   98   C C6    . DA  A 1 5   ? 28.913  59.667  73.548  1.00 35.30  ? 6   DA  C C6    1 
ATOM   99   N N6    . DA  A 1 5   ? 28.418  60.899  73.615  1.00 39.98  ? 6   DA  C N6    1 
ATOM   100  N N1    . DA  A 1 5   ? 30.244  59.487  73.704  1.00 34.14  ? 6   DA  C N1    1 
ATOM   101  C C2    . DA  A 1 5   ? 30.733  58.244  73.622  1.00 70.48  ? 6   DA  C C2    1 
ATOM   102  N N3    . DA  A 1 5   ? 30.092  57.099  73.404  1.00 34.36  ? 6   DA  C N3    1 
ATOM   103  C C4    . DA  A 1 5   ? 28.774  57.315  73.257  1.00 41.04  ? 6   DA  C C4    1 
ATOM   104  P P     . DA  A 1 6   ? 29.168  51.149  74.073  1.00 84.08  ? 7   DA  C P     1 
ATOM   105  O OP1   . DA  A 1 6   ? 29.945  50.029  73.469  1.00 33.98  ? 7   DA  C OP1   1 
ATOM   106  O OP2   . DA  A 1 6   ? 27.943  50.862  74.882  1.00 35.27  ? 7   DA  C OP2   1 
ATOM   107  O "O5'" . DA  A 1 6   ? 30.191  52.000  74.928  1.00 61.82  ? 7   DA  C "O5'" 1 
ATOM   108  C "C5'" . DA  A 1 6   ? 31.349  52.500  74.305  1.00 45.68  ? 7   DA  C "C5'" 1 
ATOM   109  C "C4'" . DA  A 1 6   ? 32.054  53.457  75.225  1.00 77.26  ? 7   DA  C "C4'" 1 
ATOM   110  O "O4'" . DA  A 1 6   ? 31.363  54.728  75.269  1.00 45.48  ? 7   DA  C "O4'" 1 
ATOM   111  C "C3'" . DA  A 1 6   ? 32.196  52.981  76.668  1.00 58.81  ? 7   DA  C "C3'" 1 
ATOM   112  O "O3'" . DA  A 1 6   ? 33.557  53.187  77.054  1.00 60.89  ? 7   DA  C "O3'" 1 
ATOM   113  C "C2'" . DA  A 1 6   ? 31.224  53.876  77.430  1.00 47.76  ? 7   DA  C "C2'" 1 
ATOM   114  C "C1'" . DA  A 1 6   ? 31.271  55.154  76.611  1.00 53.12  ? 7   DA  C "C1'" 1 
ATOM   115  N N9    . DA  A 1 6   ? 30.132  56.068  76.696  1.00 18.05  ? 7   DA  C N9    1 
ATOM   116  C C8    . DA  A 1 6   ? 28.790  55.802  76.560  1.00 52.71  ? 7   DA  C C8    1 
ATOM   117  N N7    . DA  A 1 6   ? 28.029  56.875  76.611  1.00 41.82  ? 7   DA  C N7    1 
ATOM   118  C C5    . DA  A 1 6   ? 28.933  57.909  76.816  1.00 41.49  ? 7   DA  C C5    1 
ATOM   119  C C6    . DA  A 1 6   ? 28.763  59.296  76.949  1.00 60.14  ? 7   DA  C C6    1 
ATOM   120  N N6    . DA  A 1 6   ? 27.580  59.902  76.895  1.00 48.63  ? 7   DA  C N6    1 
ATOM   121  N N1    . DA  A 1 6   ? 29.870  60.051  77.142  1.00 33.38  ? 7   DA  C N1    1 
ATOM   122  C C2    . DA  A 1 6   ? 31.060  59.441  77.191  1.00 40.99  ? 7   DA  C C2    1 
ATOM   123  N N3    . DA  A 1 6   ? 31.348  58.145  77.075  1.00 51.30  ? 7   DA  C N3    1 
ATOM   124  C C4    . DA  A 1 6   ? 30.226  57.425  76.887  1.00 34.64  ? 7   DA  C C4    1 
ATOM   125  P P     . DT  A 1 7   ? 34.142  52.486  78.369  1.00 54.00  ? 8   DT  C P     1 
ATOM   126  O OP1   . DT  A 1 7   ? 35.414  51.782  78.080  1.00 61.47  ? 8   DT  C OP1   1 
ATOM   127  O OP2   . DT  A 1 7   ? 33.030  51.748  78.995  1.00 34.50  ? 8   DT  C OP2   1 
ATOM   128  O "O5'" . DT  A 1 7   ? 34.485  53.759  79.240  1.00 15.29  ? 8   DT  C "O5'" 1 
ATOM   129  C "C5'" . DT  A 1 7   ? 33.623  54.886  79.172  1.00 14.53  ? 8   DT  C "C5'" 1 
ATOM   130  C "C4'" . DT  A 1 7   ? 34.275  56.106  79.772  1.00 19.33  ? 8   DT  C "C4'" 1 
ATOM   131  O "O4'" . DT  A 1 7   ? 33.353  57.197  79.548  1.00 77.97  ? 8   DT  C "O4'" 1 
ATOM   132  C "C3'" . DT  A 1 7   ? 34.494  56.045  81.282  1.00 28.65  ? 8   DT  C "C3'" 1 
ATOM   133  O "O3'" . DT  A 1 7   ? 35.680  56.782  81.620  1.00 48.89  ? 8   DT  C "O3'" 1 
ATOM   134  C "C2'" . DT  A 1 7   ? 33.222  56.661  81.843  1.00 40.42  ? 8   DT  C "C2'" 1 
ATOM   135  C "C1'" . DT  A 1 7   ? 32.824  57.674  80.772  1.00 38.97  ? 8   DT  C "C1'" 1 
ATOM   136  N N1    . DT  A 1 7   ? 31.369  57.886  80.574  1.00 29.75  ? 8   DT  C N1    1 
ATOM   137  C C2    . DT  A 1 7   ? 30.913  59.184  80.545  1.00 45.82  ? 8   DT  C C2    1 
ATOM   138  O O2    . DT  A 1 7   ? 31.641  60.151  80.691  1.00 72.67  ? 8   DT  C O2    1 
ATOM   139  N N3    . DT  A 1 7   ? 29.560  59.315  80.335  1.00 41.57  ? 8   DT  C N3    1 
ATOM   140  C C4    . DT  A 1 7   ? 28.639  58.303  80.155  1.00 30.02  ? 8   DT  C C4    1 
ATOM   141  O O4    . DT  A 1 7   ? 27.459  58.577  79.968  1.00 55.97  ? 8   DT  C O4    1 
ATOM   142  C C5    . DT  A 1 7   ? 29.180  56.966  80.211  1.00 25.88  ? 8   DT  C C5    1 
ATOM   143  C C7    . DT  A 1 7   ? 28.242  55.807  80.041  1.00 8.03   ? 8   DT  C C7    1 
ATOM   144  C C6    . DT  A 1 7   ? 30.503  56.823  80.411  1.00 16.13  ? 8   DT  C C6    1 
ATOM   145  P P     . DT  A 1 8   ? 36.179  56.853  83.147  1.00 52.13  ? 9   DT  C P     1 
ATOM   146  O OP1   . DT  A 1 8   ? 37.618  56.512  83.252  1.00 63.78  ? 9   DT  C OP1   1 
ATOM   147  O OP2   . DT  A 1 8   ? 35.185  56.082  83.920  1.00 41.95  ? 9   DT  C OP2   1 
ATOM   148  O "O5'" . DT  A 1 8   ? 35.987  58.386  83.497  1.00 29.89  ? 9   DT  C "O5'" 1 
ATOM   149  C "C5'" . DT  A 1 8   ? 34.800  59.041  83.096  1.00 27.73  ? 9   DT  C "C5'" 1 
ATOM   150  C "C4'" . DT  A 1 8   ? 34.852  60.502  83.455  1.00 25.72  ? 9   DT  C "C4'" 1 
ATOM   151  O "O4'" . DT  A 1 8   ? 33.582  61.096  83.103  1.00 52.88  ? 9   DT  C "O4'" 1 
ATOM   152  C "C3'" . DT  A 1 8   ? 35.012  60.731  84.948  1.00 50.36  ? 9   DT  C "C3'" 1 
ATOM   153  O "O3'" . DT  A 1 8   ? 35.736  61.941  85.163  1.00 36.18  ? 9   DT  C "O3'" 1 
ATOM   154  C "C2'" . DT  A 1 8   ? 33.580  60.792  85.453  1.00 75.54  ? 9   DT  C "C2'" 1 
ATOM   155  C "C1'" . DT  A 1 8   ? 32.769  61.285  84.255  1.00 28.36  ? 9   DT  C "C1'" 1 
ATOM   156  N N1    . DT  A 1 8   ? 31.508  60.520  84.042  1.00 24.62  ? 9   DT  C N1    1 
ATOM   157  C C2    . DT  A 1 8   ? 30.331  61.219  83.860  1.00 50.87  ? 9   DT  C C2    1 
ATOM   158  O O2    . DT  A 1 8   ? 30.267  62.434  83.878  1.00 51.60  ? 9   DT  C O2    1 
ATOM   159  N N3    . DT  A 1 8   ? 29.225  60.432  83.663  1.00 32.88  ? 9   DT  C N3    1 
ATOM   160  C C4    . DT  A 1 8   ? 29.179  59.054  83.632  1.00 54.63  ? 9   DT  C C4    1 
ATOM   161  O O4    . DT  A 1 8   ? 28.113  58.474  83.445  1.00 41.97  ? 9   DT  C O4    1 
ATOM   162  C C5    . DT  A 1 8   ? 30.438  58.390  83.830  1.00 30.65  ? 9   DT  C C5    1 
ATOM   163  C C7    . DT  A 1 8   ? 30.462  56.894  83.815  1.00 33.46  ? 9   DT  C C7    1 
ATOM   164  C C6    . DT  A 1 8   ? 31.530  59.142  84.021  1.00 8.94   ? 9   DT  C C6    1 
ATOM   165  P P     . DC  A 1 9   ? 35.876  62.528  86.645  1.00 63.42  ? 10  DC  C P     1 
ATOM   166  O OP1   . DC  A 1 9   ? 37.103  63.371  86.691  1.00 57.51  ? 10  DC  C OP1   1 
ATOM   167  O OP2   . DC  A 1 9   ? 35.731  61.387  87.579  1.00 71.57  ? 10  DC  C OP2   1 
ATOM   168  O "O5'" . DC  A 1 9   ? 34.594  63.464  86.782  1.00 36.07  ? 10  DC  C "O5'" 1 
ATOM   169  C "C5'" . DC  A 1 9   ? 34.341  64.465  85.804  1.00 12.97  ? 10  DC  C "C5'" 1 
ATOM   170  C "C4'" . DC  A 1 9   ? 33.048  65.193  86.091  1.00 37.06  ? 10  DC  C "C4'" 1 
ATOM   171  O "O4'" . DC  A 1 9   ? 31.895  64.359  85.810  1.00 58.49  ? 10  DC  C "O4'" 1 
ATOM   172  C "C3'" . DC  A 1 9   ? 32.859  65.722  87.512  1.00 16.87  ? 10  DC  C "C3'" 1 
ATOM   173  O "O3'" . DC  A 1 9   ? 32.263  67.018  87.428  1.00 60.78  ? 10  DC  C "O3'" 1 
ATOM   174  C "C2'" . DC  A 1 9   ? 31.836  64.763  88.095  1.00 56.32  ? 10  DC  C "C2'" 1 
ATOM   175  C "C1'" . DC  A 1 9   ? 30.974  64.463  86.879  1.00 44.08  ? 10  DC  C "C1'" 1 
ATOM   176  N N1    . DC  A 1 9   ? 30.214  63.206  86.938  1.00 28.44  ? 10  DC  C N1    1 
ATOM   177  C C2    . DC  A 1 9   ? 28.822  63.243  86.825  1.00 36.74  ? 10  DC  C C2    1 
ATOM   178  O O2    . DC  A 1 9   ? 28.260  64.334  86.693  1.00 44.35  ? 10  DC  C O2    1 
ATOM   179  N N3    . DC  A 1 9   ? 28.125  62.088  86.862  1.00 41.49  ? 10  DC  C N3    1 
ATOM   180  C C4    . DC  A 1 9   ? 28.765  60.927  87.015  1.00 44.58  ? 10  DC  C C4    1 
ATOM   181  N N4    . DC  A 1 9   ? 28.039  59.807  87.051  1.00 68.88  ? 10  DC  C N4    1 
ATOM   182  C C5    . DC  A 1 9   ? 30.179  60.861  87.139  1.00 45.51  ? 10  DC  C C5    1 
ATOM   183  C C6    . DC  A 1 9   ? 30.858  62.014  87.097  1.00 37.90  ? 10  DC  C C6    1 
ATOM   184  P P     . DC  A 1 10  ? 32.555  68.110  88.566  1.00 83.62  ? 11  DC  C P     1 
ATOM   185  O OP1   . DC  A 1 10  ? 32.971  69.368  87.895  1.00 84.10  ? 11  DC  C OP1   1 
ATOM   186  O OP2   . DC  A 1 10  ? 33.451  67.476  89.570  1.00 64.23  ? 11  DC  C OP2   1 
ATOM   187  O "O5'" . DC  A 1 10  ? 31.122  68.361  89.210  1.00 105.54 ? 11  DC  C "O5'" 1 
ATOM   188  C "C5'" . DC  A 1 10  ? 30.030  67.503  88.900  1.00 97.39  ? 11  DC  C "C5'" 1 
ATOM   189  C "C4'" . DC  A 1 10  ? 28.736  68.278  88.920  1.00 101.90 ? 11  DC  C "C4'" 1 
ATOM   190  O "O4'" . DC  A 1 10  ? 27.666  67.352  88.624  1.00 114.60 ? 11  DC  C "O4'" 1 
ATOM   191  C "C3'" . DC  A 1 10  ? 28.403  68.852  90.291  1.00 108.83 ? 11  DC  C "C3'" 1 
ATOM   192  O "O3'" . DC  A 1 10  ? 27.473  69.941  90.197  1.00 89.27  ? 11  DC  C "O3'" 1 
ATOM   193  C "C2'" . DC  A 1 10  ? 27.710  67.685  90.967  1.00 103.31 ? 11  DC  C "C2'" 1 
ATOM   194  C "C1'" . DC  A 1 10  ? 26.985  66.986  89.817  1.00 97.93  ? 11  DC  C "C1'" 1 
ATOM   195  N N1    . DC  A 1 10  ? 27.040  65.520  89.919  1.00 56.24  ? 11  DC  C N1    1 
ATOM   196  C C2    . DC  A 1 10  ? 25.914  64.757  89.578  1.00 62.58  ? 11  DC  C C2    1 
ATOM   197  O O2    . DC  A 1 10  ? 24.884  65.335  89.209  1.00 73.47  ? 11  DC  C O2    1 
ATOM   198  N N3    . DC  A 1 10  ? 25.982  63.407  89.663  1.00 46.18  ? 11  DC  C N3    1 
ATOM   199  C C4    . DC  A 1 10  ? 27.112  62.822  90.071  1.00 53.34  ? 11  DC  C C4    1 
ATOM   200  N N4    . DC  A 1 10  ? 27.146  61.487  90.134  1.00 40.96  ? 11  DC  C N4    1 
ATOM   201  C C5    . DC  A 1 10  ? 28.262  63.577  90.433  1.00 59.90  ? 11  DC  C C5    1 
ATOM   202  C C6    . DC  A 1 10  ? 28.183  64.910  90.342  1.00 31.04  ? 11  DC  C C6    1 
ATOM   203  O "O5'" . DC  B 1 1   ? 26.365  54.443  96.915  1.00 92.45  ? 13  DC  D "O5'" 1 
ATOM   204  C "C5'" . DC  B 1 1   ? 25.356  53.589  97.454  1.00 76.52  ? 13  DC  D "C5'" 1 
ATOM   205  C "C4'" . DC  B 1 1   ? 23.954  54.031  97.107  1.00 69.11  ? 13  DC  D "C4'" 1 
ATOM   206  O "O4'" . DC  B 1 1   ? 23.779  55.399  97.558  1.00 64.31  ? 13  DC  D "O4'" 1 
ATOM   207  C "C3'" . DC  B 1 1   ? 23.629  54.027  95.611  1.00 73.81  ? 13  DC  D "C3'" 1 
ATOM   208  O "O3'" . DC  B 1 1   ? 22.333  53.480  95.334  1.00 101.87 ? 13  DC  D "O3'" 1 
ATOM   209  C "C2'" . DC  B 1 1   ? 23.660  55.492  95.230  1.00 107.07 ? 13  DC  D "C2'" 1 
ATOM   210  C "C1'" . DC  B 1 1   ? 23.270  56.200  96.513  1.00 17.78  ? 13  DC  D "C1'" 1 
ATOM   211  N N1    . DC  B 1 1   ? 23.899  57.529  96.600  1.00 64.89  ? 13  DC  D N1    1 
ATOM   212  C C2    . DC  B 1 1   ? 23.086  58.657  96.732  1.00 53.95  ? 13  DC  D C2    1 
ATOM   213  O O2    . DC  B 1 1   ? 21.865  58.502  96.865  1.00 65.53  ? 13  DC  D O2    1 
ATOM   214  N N3    . DC  B 1 1   ? 23.651  59.887  96.715  1.00 63.88  ? 13  DC  D N3    1 
ATOM   215  C C4    . DC  B 1 1   ? 24.975  60.010  96.593  1.00 65.73  ? 13  DC  D C4    1 
ATOM   216  N N4    . DC  B 1 1   ? 25.493  61.240  96.568  1.00 57.48  ? 13  DC  D N4    1 
ATOM   217  C C5    . DC  B 1 1   ? 25.829  58.876  96.489  1.00 58.06  ? 13  DC  D C5    1 
ATOM   218  C C6    . DC  B 1 1   ? 25.256  57.665  96.504  1.00 26.11  ? 13  DC  D C6    1 
ATOM   219  P P     . DG  B 1 2   ? 21.862  53.304  93.801  1.00 87.87  ? 14  DG  D P     1 
ATOM   220  O OP1   . DG  B 1 2   ? 21.167  52.010  93.624  1.00 50.07  ? 14  DG  D OP1   1 
ATOM   221  O OP2   . DG  B 1 2   ? 23.058  53.599  92.974  1.00 51.99  ? 14  DG  D OP2   1 
ATOM   222  O "O5'" . DG  B 1 2   ? 20.797  54.476  93.601  1.00 62.86  ? 14  DG  D "O5'" 1 
ATOM   223  C "C5'" . DG  B 1 2   ? 19.749  54.674  94.544  1.00 47.81  ? 14  DG  D "C5'" 1 
ATOM   224  C "C4'" . DG  B 1 2   ? 18.866  55.820  94.115  1.00 71.96  ? 14  DG  D "C4'" 1 
ATOM   225  O "O4'" . DG  B 1 2   ? 19.569  57.072  94.281  1.00 88.68  ? 14  DG  D "O4'" 1 
ATOM   226  C "C3'" . DG  B 1 2   ? 18.420  55.768  92.659  1.00 65.75  ? 14  DG  D "C3'" 1 
ATOM   227  O "O3'" . DG  B 1 2   ? 17.059  56.193  92.543  1.00 89.25  ? 14  DG  D "O3'" 1 
ATOM   228  C "C2'" . DG  B 1 2   ? 19.371  56.722  91.957  1.00 97.21  ? 14  DG  D "C2'" 1 
ATOM   229  C "C1'" . DG  B 1 2   ? 19.765  57.725  93.033  1.00 45.14  ? 14  DG  D "C1'" 1 
ATOM   230  N N9    . DG  B 1 2   ? 21.179  58.090  92.969  1.00 61.25  ? 14  DG  D N9    1 
ATOM   231  C C8    . DG  B 1 2   ? 22.237  57.209  92.937  1.00 46.09  ? 14  DG  D C8    1 
ATOM   232  N N7    . DG  B 1 2   ? 23.399  57.802  92.928  1.00 73.40  ? 14  DG  D N7    1 
ATOM   233  C C5    . DG  B 1 2   ? 23.097  59.159  92.945  1.00 81.36  ? 14  DG  D C5    1 
ATOM   234  C C6    . DG  B 1 2   ? 23.955  60.291  92.950  1.00 77.23  ? 14  DG  D C6    1 
ATOM   235  O O6    . DG  B 1 2   ? 25.189  60.322  92.945  1.00 83.68  ? 14  DG  D O6    1 
ATOM   236  N N1    . DG  B 1 2   ? 23.237  61.477  92.965  1.00 44.41  ? 14  DG  D N1    1 
ATOM   237  C C2    . DG  B 1 2   ? 21.874  61.568  92.977  1.00 76.61  ? 14  DG  D C2    1 
ATOM   238  N N2    . DG  B 1 2   ? 21.387  62.810  93.003  1.00 32.18  ? 14  DG  D N2    1 
ATOM   239  N N3    . DG  B 1 2   ? 21.055  60.524  92.970  1.00 40.87  ? 14  DG  D N3    1 
ATOM   240  C C4    . DG  B 1 2   ? 21.731  59.358  92.957  1.00 40.44  ? 14  DG  D C4    1 
ATOM   241  P P     . DG  B 1 3   ? 16.318  56.130  91.115  1.00 88.06  ? 15  DG  D P     1 
ATOM   242  O OP1   . DG  B 1 3   ? 14.869  56.331  91.380  1.00 58.66  ? 15  DG  D OP1   1 
ATOM   243  O OP2   . DG  B 1 3   ? 16.764  54.936  90.346  1.00 38.51  ? 15  DG  D OP2   1 
ATOM   244  O "O5'" . DG  B 1 3   ? 16.858  57.437  90.389  1.00 86.48  ? 15  DG  D "O5'" 1 
ATOM   245  C "C5'" . DG  B 1 3   ? 16.413  58.722  90.818  1.00 113.07 ? 15  DG  D "C5'" 1 
ATOM   246  C "C4'" . DG  B 1 3   ? 16.757  59.766  89.785  1.00 121.31 ? 15  DG  D "C4'" 1 
ATOM   247  O "O4'" . DG  B 1 3   ? 18.119  60.225  89.969  1.00 106.16 ? 15  DG  D "O4'" 1 
ATOM   248  C "C3'" . DG  B 1 3   ? 16.653  59.266  88.345  1.00 124.55 ? 15  DG  D "C3'" 1 
ATOM   249  O "O3'" . DG  B 1 3   ? 16.005  60.241  87.525  1.00 118.90 ? 15  DG  D "O3'" 1 
ATOM   250  C "C2'" . DG  B 1 3   ? 18.101  59.063  87.939  1.00 95.84  ? 15  DG  D "C2'" 1 
ATOM   251  C "C1'" . DG  B 1 3   ? 18.835  60.110  88.753  1.00 68.78  ? 15  DG  D "C1'" 1 
ATOM   252  N N9    . DG  B 1 3   ? 20.216  59.735  89.060  1.00 64.93  ? 15  DG  D N9    1 
ATOM   253  C C8    . DG  B 1 3   ? 20.741  58.464  89.076  1.00 69.08  ? 15  DG  D C8    1 
ATOM   254  N N7    . DG  B 1 3   ? 22.025  58.442  89.308  1.00 47.89  ? 15  DG  D N7    1 
ATOM   255  C C5    . DG  B 1 3   ? 22.368  59.774  89.477  1.00 52.43  ? 15  DG  D C5    1 
ATOM   256  C C6    . DG  B 1 3   ? 23.624  60.367  89.741  1.00 50.29  ? 15  DG  D C6    1 
ATOM   257  O O6    . DG  B 1 3   ? 24.717  59.815  89.892  1.00 38.71  ? 15  DG  D O6    1 
ATOM   258  N N1    . DG  B 1 3   ? 23.527  61.751  89.824  1.00 45.39  ? 15  DG  D N1    1 
ATOM   259  C C2    . DG  B 1 3   ? 22.364  62.471  89.680  1.00 63.93  ? 15  DG  D C2    1 
ATOM   260  N N2    . DG  B 1 3   ? 22.466  63.803  89.805  1.00 75.23  ? 15  DG  D N2    1 
ATOM   261  N N3    . DG  B 1 3   ? 21.186  61.927  89.432  1.00 56.78  ? 15  DG  D N3    1 
ATOM   262  C C4    . DG  B 1 3   ? 21.260  60.586  89.342  1.00 62.80  ? 15  DG  D C4    1 
ATOM   263  P P     . DG  B 1 4   ? 16.088  60.136  85.923  1.00 78.35  ? 16  DG  D P     1 
ATOM   264  O OP1   . DG  B 1 4   ? 14.736  60.445  85.385  1.00 86.37  ? 16  DG  D OP1   1 
ATOM   265  O OP2   . DG  B 1 4   ? 16.749  58.857  85.551  1.00 61.62  ? 16  DG  D OP2   1 
ATOM   266  O "O5'" . DG  B 1 4   ? 17.053  61.349  85.574  1.00 47.79  ? 16  DG  D "O5'" 1 
ATOM   267  C "C5'" . DG  B 1 4   ? 16.934  62.557  86.310  1.00 59.25  ? 16  DG  D "C5'" 1 
ATOM   268  C "C4'" . DG  B 1 4   ? 18.035  63.517  85.943  1.00 55.64  ? 16  DG  D "C4'" 1 
ATOM   269  O "O4'" . DG  B 1 4   ? 19.301  63.102  86.517  1.00 100.09 ? 16  DG  D "O4'" 1 
ATOM   270  C "C3'" . DG  B 1 4   ? 18.256  63.665  84.444  1.00 90.40  ? 16  DG  D "C3'" 1 
ATOM   271  O "O3'" . DG  B 1 4   ? 18.287  65.046  84.109  1.00 93.38  ? 16  DG  D "O3'" 1 
ATOM   272  C "C2'" . DG  B 1 4   ? 19.605  63.004  84.204  1.00 94.34  ? 16  DG  D "C2'" 1 
ATOM   273  C "C1'" . DG  B 1 4   ? 20.319  63.175  85.537  1.00 77.81  ? 16  DG  D "C1'" 1 
ATOM   274  N N9    . DG  B 1 4   ? 21.295  62.119  85.811  1.00 48.03  ? 16  DG  D N9    1 
ATOM   275  C C8    . DG  B 1 4   ? 21.056  60.766  85.836  1.00 65.10  ? 16  DG  D C8    1 
ATOM   276  N N7    . DG  B 1 4   ? 22.134  60.058  86.031  1.00 58.64  ? 16  DG  D N7    1 
ATOM   277  C C5    . DG  B 1 4   ? 23.147  60.997  86.161  1.00 41.74  ? 16  DG  D C5    1 
ATOM   278  C C6    . DG  B 1 4   ? 24.541  60.822  86.380  1.00 81.79  ? 16  DG  D C6    1 
ATOM   279  O O6    . DG  B 1 4   ? 25.177  59.763  86.502  1.00 70.10  ? 16  DG  D O6    1 
ATOM   280  N N1    . DG  B 1 4   ? 25.206  62.043  86.448  1.00 58.45  ? 16  DG  D N1    1 
ATOM   281  C C2    . DG  B 1 4   ? 24.609  63.273  86.324  1.00 64.99  ? 16  DG  D C2    1 
ATOM   282  N N2    . DG  B 1 4   ? 25.425  64.330  86.416  1.00 66.63  ? 16  DG  D N2    1 
ATOM   283  N N3    . DG  B 1 4   ? 23.308  63.450  86.120  1.00 50.32  ? 16  DG  D N3    1 
ATOM   284  C C4    . DG  B 1 4   ? 22.644  62.278  86.046  1.00 40.52  ? 16  DG  D C4    1 
ATOM   285  P P     . DA  B 1 5   ? 18.323  65.482  82.572  1.00 73.84  ? 17  DA  D P     1 
ATOM   286  O OP1   . DA  B 1 5   ? 17.392  66.619  82.361  1.00 78.34  ? 17  DA  D OP1   1 
ATOM   287  O OP2   . DA  B 1 5   ? 18.159  64.235  81.781  1.00 46.70  ? 17  DA  D OP2   1 
ATOM   288  O "O5'" . DA  B 1 5   ? 19.807  66.026  82.427  1.00 68.84  ? 17  DA  D "O5'" 1 
ATOM   289  C "C5'" . DA  B 1 5   ? 20.348  66.874  83.434  1.00 67.08  ? 17  DA  D "C5'" 1 
ATOM   290  C "C4'" . DA  B 1 5   ? 21.841  66.992  83.268  1.00 77.08  ? 17  DA  D "C4'" 1 
ATOM   291  O "O4'" . DA  B 1 5   ? 22.492  65.754  83.640  1.00 91.96  ? 17  DA  D "O4'" 1 
ATOM   292  C "C3'" . DA  B 1 5   ? 22.272  67.279  81.830  1.00 85.23  ? 17  DA  D "C3'" 1 
ATOM   293  O "O3'" . DA  B 1 5   ? 23.365  68.189  81.839  1.00 55.96  ? 17  DA  D "O3'" 1 
ATOM   294  C "C2'" . DA  B 1 5   ? 22.749  65.928  81.338  1.00 88.99  ? 17  DA  D "C2'" 1 
ATOM   295  C "C1'" . DA  B 1 5   ? 23.383  65.396  82.603  1.00 58.43  ? 17  DA  D "C1'" 1 
ATOM   296  N N9    . DA  B 1 5   ? 23.601  63.951  82.645  1.00 44.32  ? 17  DA  D N9    1 
ATOM   297  C C8    . DA  B 1 5   ? 22.732  62.920  82.385  1.00 82.38  ? 17  DA  D C8    1 
ATOM   298  N N7    . DA  B 1 5   ? 23.277  61.732  82.486  1.00 68.12  ? 17  DA  D N7    1 
ATOM   299  C C5    . DA  B 1 5   ? 24.591  62.000  82.844  1.00 60.25  ? 17  DA  D C5    1 
ATOM   300  C C6    . DA  B 1 5   ? 25.691  61.168  83.100  1.00 38.85  ? 17  DA  D C6    1 
ATOM   301  N N6    . DA  B 1 5   ? 25.642  59.838  83.021  1.00 58.38  ? 17  DA  D N6    1 
ATOM   302  N N1    . DA  B 1 5   ? 26.857  61.758  83.442  1.00 69.45  ? 17  DA  D N1    1 
ATOM   303  C C2    . DA  B 1 5   ? 26.905  63.093  83.513  1.00 54.63  ? 17  DA  D C2    1 
ATOM   304  N N3    . DA  B 1 5   ? 25.945  63.979  83.290  1.00 49.80  ? 17  DA  D N3    1 
ATOM   305  C C4    . DA  B 1 5   ? 24.800  63.361  82.954  1.00 54.93  ? 17  DA  D C4    1 
ATOM   306  P P     . DA  B 1 6   ? 23.582  69.174  80.592  1.00 98.60  ? 18  DA  D P     1 
ATOM   307  O OP1   . DA  B 1 6   ? 22.916  70.461  80.901  1.00 43.44  ? 18  DA  D OP1   1 
ATOM   308  O OP2   . DA  B 1 6   ? 23.226  68.425  79.362  1.00 41.79  ? 18  DA  D OP2   1 
ATOM   309  O "O5'" . DA  B 1 6   ? 25.148  69.426  80.606  1.00 51.32  ? 18  DA  D "O5'" 1 
ATOM   310  C "C5'" . DA  B 1 6   ? 25.811  69.626  81.840  1.00 76.28  ? 18  DA  D "C5'" 1 
ATOM   311  C "C4'" . DA  B 1 6   ? 27.207  69.058  81.786  1.00 72.52  ? 18  DA  D "C4'" 1 
ATOM   312  O "O4'" . DA  B 1 6   ? 27.211  67.612  81.815  1.00 68.86  ? 18  DA  D "O4'" 1 
ATOM   313  C "C3'" . DA  B 1 6   ? 28.004  69.467  80.560  1.00 68.92  ? 18  DA  D "C3'" 1 
ATOM   314  O "O3'" . DA  B 1 6   ? 29.282  69.885  81.010  1.00 49.97  ? 18  DA  D "O3'" 1 
ATOM   315  C "C2'" . DA  B 1 6   ? 28.059  68.199  79.723  1.00 81.95  ? 18  DA  D "C2'" 1 
ATOM   316  C "C1'" . DA  B 1 6   ? 28.016  67.105  80.768  1.00 50.92  ? 18  DA  D "C1'" 1 
ATOM   317  N N9    . DA  B 1 6   ? 27.416  65.844  80.336  1.00 44.20  ? 18  DA  D N9    1 
ATOM   318  C C8    . DA  B 1 6   ? 26.164  65.667  79.807  1.00 59.01  ? 18  DA  D C8    1 
ATOM   319  N N7    . DA  B 1 6   ? 25.857  64.408  79.582  1.00 44.15  ? 18  DA  D N7    1 
ATOM   320  C C5    . DA  B 1 6   ? 26.993  63.711  79.966  1.00 32.56  ? 18  DA  D C5    1 
ATOM   321  C C6    . DA  B 1 6   ? 27.307  62.338  79.959  1.00 61.94  ? 18  DA  D C6    1 
ATOM   322  N N6    . DA  B 1 6   ? 26.463  61.389  79.549  1.00 39.88  ? 18  DA  D N6    1 
ATOM   323  N N1    . DA  B 1 6   ? 28.532  61.971  80.396  1.00 44.86  ? 18  DA  D N1    1 
ATOM   324  C C2    . DA  B 1 6   ? 29.375  62.928  80.808  1.00 51.54  ? 18  DA  D C2    1 
ATOM   325  N N3    . DA  B 1 6   ? 29.198  64.252  80.862  1.00 46.38  ? 18  DA  D N3    1 
ATOM   326  C C4    . DA  B 1 6   ? 27.970  64.582  80.419  1.00 50.18  ? 18  DA  D C4    1 
ATOM   327  P P     . DT  B 1 7   ? 30.425  70.229  79.955  1.00 71.54  ? 19  DT  D P     1 
ATOM   328  O OP1   . DT  B 1 7   ? 31.419  71.036  80.715  1.00 26.95  ? 19  DT  D OP1   1 
ATOM   329  O OP2   . DT  B 1 7   ? 29.817  70.774  78.700  1.00 38.74  ? 19  DT  D OP2   1 
ATOM   330  O "O5'" . DT  B 1 7   ? 31.067  68.801  79.702  1.00 21.87  ? 19  DT  D "O5'" 1 
ATOM   331  C "C5'" . DT  B 1 7   ? 31.572  68.087  80.808  1.00 35.56  ? 19  DT  D "C5'" 1 
ATOM   332  C "C4'" . DT  B 1 7   ? 32.445  66.956  80.341  1.00 67.70  ? 19  DT  D "C4'" 1 
ATOM   333  O "O4'" . DT  B 1 7   ? 31.668  65.796  79.971  1.00 76.47  ? 19  DT  D "O4'" 1 
ATOM   334  C "C3'" . DT  B 1 7   ? 33.312  67.295  79.140  1.00 51.19  ? 19  DT  D "C3'" 1 
ATOM   335  O "O3'" . DT  B 1 7   ? 34.597  66.757  79.395  1.00 71.80  ? 19  DT  D "O3'" 1 
ATOM   336  C "C2'" . DT  B 1 7   ? 32.632  66.559  78.000  1.00 42.70  ? 19  DT  D "C2'" 1 
ATOM   337  C "C1'" . DT  B 1 7   ? 32.089  65.334  78.704  1.00 29.02  ? 19  DT  D "C1'" 1 
ATOM   338  N N1    . DT  B 1 7   ? 30.937  64.684  78.072  1.00 45.15  ? 19  DT  D N1    1 
ATOM   339  C C2    . DT  B 1 7   ? 30.961  63.317  77.973  1.00 66.95  ? 19  DT  D C2    1 
ATOM   340  O O2    . DT  B 1 7   ? 31.901  62.642  78.364  1.00 47.33  ? 19  DT  D O2    1 
ATOM   341  N N3    . DT  B 1 7   ? 29.836  62.764  77.410  1.00 43.52  ? 19  DT  D N3    1 
ATOM   342  C C4    . DT  B 1 7   ? 28.724  63.437  76.950  1.00 50.28  ? 19  DT  D C4    1 
ATOM   343  O O4    . DT  B 1 7   ? 27.785  62.814  76.480  1.00 61.40  ? 19  DT  D O4    1 
ATOM   344  C C5    . DT  B 1 7   ? 28.776  64.870  77.074  1.00 32.70  ? 19  DT  D C5    1 
ATOM   345  C C7    . DT  B 1 7   ? 27.618  65.681  76.601  1.00 36.15  ? 19  DT  D C7    1 
ATOM   346  C C6    . DT  B 1 7   ? 29.865  65.415  77.616  1.00 27.88  ? 19  DT  D C6    1 
ATOM   347  P P     . DT  B 1 8   ? 35.824  67.172  78.479  1.00 60.29  ? 20  DT  D P     1 
ATOM   348  O OP1   . DT  B 1 8   ? 36.970  67.448  79.375  1.00 45.83  ? 20  DT  D OP1   1 
ATOM   349  O OP2   . DT  B 1 8   ? 35.357  68.209  77.538  1.00 50.98  ? 20  DT  D OP2   1 
ATOM   350  O "O5'" . DT  B 1 8   ? 36.122  65.816  77.722  1.00 16.07  ? 20  DT  D "O5'" 1 
ATOM   351  C "C5'" . DT  B 1 8   ? 36.522  64.692  78.486  1.00 34.72  ? 20  DT  D "C5'" 1 
ATOM   352  C "C4'" . DT  B 1 8   ? 36.526  63.436  77.652  1.00 26.90  ? 20  DT  D "C4'" 1 
ATOM   353  O "O4'" . DT  B 1 8   ? 35.193  63.037  77.242  1.00 43.77  ? 20  DT  D "O4'" 1 
ATOM   354  C "C3'" . DT  B 1 8   ? 37.370  63.491  76.385  1.00 48.24  ? 20  DT  D "C3'" 1 
ATOM   355  O "O3'" . DT  B 1 8   ? 38.175  62.311  76.385  1.00 47.18  ? 20  DT  D "O3'" 1 
ATOM   356  C "C2'" . DT  B 1 8   ? 36.329  63.456  75.276  1.00 42.03  ? 20  DT  D "C2'" 1 
ATOM   357  C "C1'" . DT  B 1 8   ? 35.251  62.595  75.903  1.00 9.13   ? 20  DT  D "C1'" 1 
ATOM   358  N N1    . DT  B 1 8   ? 33.893  62.709  75.313  1.00 46.59  ? 20  DT  D N1    1 
ATOM   359  C C2    . DT  B 1 8   ? 33.207  61.548  74.978  1.00 59.10  ? 20  DT  D C2    1 
ATOM   360  O O2    . DT  B 1 8   ? 33.658  60.424  75.133  1.00 64.95  ? 20  DT  D O2    1 
ATOM   361  N N3    . DT  B 1 8   ? 31.958  61.755  74.449  1.00 59.52  ? 20  DT  D N3    1 
ATOM   362  C C4    . DT  B 1 8   ? 31.340  62.968  74.226  1.00 41.47  ? 20  DT  D C4    1 
ATOM   363  O O4    . DT  B 1 8   ? 30.214  63.000  73.753  1.00 44.84  ? 20  DT  D O4    1 
ATOM   364  C C5    . DT  B 1 8   ? 32.113  64.130  74.588  1.00 44.88  ? 20  DT  D C5    1 
ATOM   365  C C7    . DT  B 1 8   ? 31.516  65.488  74.374  1.00 46.18  ? 20  DT  D C7    1 
ATOM   366  C C6    . DT  B 1 8   ? 33.333  63.949  75.105  1.00 45.43  ? 20  DT  D C6    1 
ATOM   367  P P     . DC  B 1 9   ? 39.288  62.092  75.256  1.00 54.96  ? 21  DC  D P     1 
ATOM   368  O OP1   . DC  B 1 9   ? 40.588  61.772  75.900  1.00 52.54  ? 21  DC  D OP1   1 
ATOM   369  O OP2   . DC  B 1 9   ? 39.205  63.191  74.259  1.00 55.59  ? 21  DC  D OP2   1 
ATOM   370  O "O5'" . DC  B 1 9   ? 38.760  60.767  74.586  1.00 22.34  ? 21  DC  D "O5'" 1 
ATOM   371  C "C5'" . DC  B 1 9   ? 37.380  60.610  74.327  1.00 22.72  ? 21  DC  D "C5'" 1 
ATOM   372  C "C4'" . DC  B 1 9   ? 37.076  59.159  74.070  1.00 46.65  ? 21  DC  D "C4'" 1 
ATOM   373  O "O4'" . DC  B 1 9   ? 35.666  59.053  73.790  1.00 48.07  ? 21  DC  D "O4'" 1 
ATOM   374  C "C3'" . DC  B 1 9   ? 37.787  58.647  72.829  1.00 36.47  ? 21  DC  D "C3'" 1 
ATOM   375  O "O3'" . DC  B 1 9   ? 38.055  57.255  72.943  1.00 54.42  ? 21  DC  D "O3'" 1 
ATOM   376  C "C2'" . DC  B 1 9   ? 36.810  58.967  71.718  1.00 29.91  ? 21  DC  D "C2'" 1 
ATOM   377  C "C1'" . DC  B 1 9   ? 35.446  58.930  72.397  1.00 16.49  ? 21  DC  D "C1'" 1 
ATOM   378  N N1    . DC  B 1 9   ? 34.604  60.058  71.990  1.00 29.85  ? 21  DC  D N1    1 
ATOM   379  C C2    . DC  B 1 9   ? 33.326  59.806  71.493  1.00 38.39  ? 21  DC  D C2    1 
ATOM   380  O O2    . DC  B 1 9   ? 32.931  58.638  71.447  1.00 39.93  ? 21  DC  D O2    1 
ATOM   381  N N3    . DC  B 1 9   ? 32.557  60.841  71.077  1.00 34.72  ? 21  DC  D N3    1 
ATOM   382  C C4    . DC  B 1 9   ? 33.024  62.091  71.159  1.00 40.19  ? 21  DC  D C4    1 
ATOM   383  N N4    . DC  B 1 9   ? 32.239  63.087  70.739  1.00 20.63  ? 21  DC  D N4    1 
ATOM   384  C C5    . DC  B 1 9   ? 34.323  62.377  71.677  1.00 63.59  ? 21  DC  D C5    1 
ATOM   385  C C6    . DC  B 1 9   ? 35.074  61.337  72.078  1.00 11.04  ? 21  DC  D C6    1 
ATOM   386  P P     . DC  B 1 10  ? 38.741  56.478  71.723  1.00 53.75  ? 22  DC  D P     1 
ATOM   387  O OP1   . DC  B 1 10  ? 39.377  55.237  72.240  1.00 42.21  ? 22  DC  D OP1   1 
ATOM   388  O OP2   . DC  B 1 10  ? 39.550  57.475  70.971  1.00 82.70  ? 22  DC  D OP2   1 
ATOM   389  O "O5'" . DC  B 1 10  ? 37.496  56.003  70.864  1.00 37.49  ? 22  DC  D "O5'" 1 
ATOM   390  C "C5'" . DC  B 1 10  ? 36.517  55.168  71.470  1.00 53.10  ? 22  DC  D "C5'" 1 
ATOM   391  C "C4'" . DC  B 1 10  ? 35.539  54.661  70.441  1.00 65.23  ? 22  DC  D "C4'" 1 
ATOM   392  O "O4'" . DC  B 1 10  ? 34.567  55.679  70.105  1.00 58.21  ? 22  DC  D "O4'" 1 
ATOM   393  C "C3'" . DC  B 1 10  ? 36.181  54.223  69.130  1.00 45.95  ? 22  DC  D "C3'" 1 
ATOM   394  O "O3'" . DC  B 1 10  ? 35.628  52.967  68.760  1.00 55.22  ? 22  DC  D "O3'" 1 
ATOM   395  C "C2'" . DC  B 1 10  ? 35.807  55.328  68.157  1.00 38.70  ? 22  DC  D "C2'" 1 
ATOM   396  C "C1'" . DC  B 1 10  ? 34.480  55.829  68.697  1.00 51.84  ? 22  DC  D "C1'" 1 
ATOM   397  N N1    . DC  B 1 10  ? 34.197  57.251  68.421  1.00 36.07  ? 22  DC  D N1    1 
ATOM   398  C C2    . DC  B 1 10  ? 32.941  57.623  67.877  1.00 32.81  ? 22  DC  D C2    1 
ATOM   399  O O2    . DC  B 1 10  ? 32.107  56.738  67.601  1.00 49.59  ? 22  DC  D O2    1 
ATOM   400  N N3    . DC  B 1 10  ? 32.678  58.934  67.665  1.00 14.02  ? 22  DC  D N3    1 
ATOM   401  C C4    . DC  B 1 10  ? 33.601  59.852  67.951  1.00 36.75  ? 22  DC  D C4    1 
ATOM   402  N N4    . DC  B 1 10  ? 33.302  61.127  67.718  1.00 57.05  ? 22  DC  D N4    1 
ATOM   403  C C5    . DC  B 1 10  ? 34.879  59.502  68.484  1.00 62.50  ? 22  DC  D C5    1 
ATOM   404  C C6    . DC  B 1 10  ? 35.132  58.204  68.701  1.00 28.12  ? 22  DC  D C6    1 
ATOM   405  P P     . DC  B 1 11  ? 35.938  52.360  67.320  1.00 66.55  ? 23  DC  D P     1 
ATOM   406  O OP1   . DC  B 1 11  ? 35.671  50.908  67.376  1.00 20.98  ? 23  DC  D OP1   1 
ATOM   407  O OP2   . DC  B 1 11  ? 37.275  52.837  66.913  1.00 42.86  ? 23  DC  D OP2   1 
ATOM   408  O "O5'" . DC  B 1 11  ? 34.852  53.098  66.428  1.00 95.09  ? 23  DC  D "O5'" 1 
ATOM   409  C "C5'" . DC  B 1 11  ? 34.374  52.534  65.223  1.00 81.11  ? 23  DC  D "C5'" 1 
ATOM   410  C "C4'" . DC  B 1 11  ? 32.886  52.744  65.125  1.00 97.49  ? 23  DC  D "C4'" 1 
ATOM   411  O "O4'" . DC  B 1 11  ? 32.582  54.100  65.536  1.00 96.60  ? 23  DC  D "O4'" 1 
ATOM   412  C "C3'" . DC  B 1 11  ? 32.350  52.609  63.705  1.00 72.39  ? 23  DC  D "C3'" 1 
ATOM   413  O "O3'" . DC  B 1 11  ? 30.961  52.289  63.732  1.00 64.80  ? 23  DC  D "O3'" 1 
ATOM   414  C "C2'" . DC  B 1 11  ? 32.453  54.033  63.191  1.00 95.45  ? 23  DC  D "C2'" 1 
ATOM   415  C "C1'" . DC  B 1 11  ? 32.101  54.843  64.428  1.00 43.12  ? 23  DC  D "C1'" 1 
ATOM   416  N N1    . DC  B 1 11  ? 32.720  56.177  64.473  1.00 34.03  ? 23  DC  D N1    1 
ATOM   417  C C2    . DC  B 1 11  ? 31.971  57.278  64.047  1.00 49.05  ? 23  DC  D C2    1 
ATOM   418  O O2    . DC  B 1 11  ? 30.821  57.093  63.624  1.00 71.75  ? 23  DC  D O2    1 
ATOM   419  N N3    . DC  B 1 11  ? 32.514  58.510  64.105  1.00 27.15  ? 23  DC  D N3    1 
ATOM   420  C C4    . DC  B 1 11  ? 33.754  58.669  64.565  1.00 51.35  ? 23  DC  D C4    1 
ATOM   421  N N4    . DC  B 1 11  ? 34.245  59.909  64.623  1.00 35.19  ? 23  DC  D N4    1 
ATOM   422  C C5    . DC  B 1 11  ? 34.546  57.565  64.991  1.00 14.03  ? 23  DC  D C5    1 
ATOM   423  C C6    . DC  B 1 11  ? 33.995  56.347  64.927  1.00 53.20  ? 23  DC  D C6    1 
ATOM   424  O "O5'" . DC  C 1 1   ? 44.019  56.219  58.823  1.00 131.57 ? 2   DC  E "O5'" 1 
ATOM   425  C "C5'" . DC  C 1 1   ? 43.590  56.432  60.172  1.00 140.73 ? 2   DC  E "C5'" 1 
ATOM   426  C "C4'" . DC  C 1 1   ? 43.059  55.177  60.831  1.00 140.73 ? 2   DC  E "C4'" 1 
ATOM   427  O "O4'" . DC  C 1 1   ? 44.084  54.150  60.829  1.00 140.73 ? 2   DC  E "O4'" 1 
ATOM   428  C "C3'" . DC  C 1 1   ? 42.652  55.337  62.290  1.00 116.14 ? 2   DC  E "C3'" 1 
ATOM   429  O "O3'" . DC  C 1 1   ? 41.301  55.774  62.341  1.00 87.70  ? 2   DC  E "O3'" 1 
ATOM   430  C "C2'" . DC  C 1 1   ? 42.832  53.927  62.841  1.00 108.55 ? 2   DC  E "C2'" 1 
ATOM   431  C "C1'" . DC  C 1 1   ? 44.056  53.444  62.056  1.00 140.73 ? 2   DC  E "C1'" 1 
ATOM   432  N N1    . DC  C 1 1   ? 45.344  53.673  62.730  1.00 140.73 ? 2   DC  E N1    1 
ATOM   433  C C2    . DC  C 1 1   ? 45.579  53.073  63.971  1.00 140.73 ? 2   DC  E C2    1 
ATOM   434  O O2    . DC  C 1 1   ? 44.683  52.382  64.484  1.00 140.12 ? 2   DC  E O2    1 
ATOM   435  N N3    . DC  C 1 1   ? 46.776  53.261  64.580  1.00 140.73 ? 2   DC  E N3    1 
ATOM   436  C C4    . DC  C 1 1   ? 47.708  54.021  63.997  1.00 140.73 ? 2   DC  E C4    1 
ATOM   437  N N4    . DC  C 1 1   ? 48.875  54.176  64.628  1.00 140.73 ? 2   DC  E N4    1 
ATOM   438  C C5    . DC  C 1 1   ? 47.489  54.654  62.740  1.00 140.73 ? 2   DC  E C5    1 
ATOM   439  C C6    . DC  C 1 1   ? 46.304  54.456  62.147  1.00 140.73 ? 2   DC  E C6    1 
ATOM   440  P P     . DG  C 1 2   ? 40.631  56.153  63.746  1.00 91.45  ? 3   DG  E P     1 
ATOM   441  O OP1   . DG  C 1 2   ? 39.761  57.324  63.479  1.00 68.82  ? 3   DG  E OP1   1 
ATOM   442  O OP2   . DG  C 1 2   ? 41.691  56.243  64.781  1.00 118.53 ? 3   DG  E OP2   1 
ATOM   443  O "O5'" . DG  C 1 2   ? 39.701  54.904  64.064  1.00 71.27  ? 3   DG  E "O5'" 1 
ATOM   444  C "C5'" . DG  C 1 2   ? 39.198  54.103  63.002  1.00 105.68 ? 3   DG  E "C5'" 1 
ATOM   445  C "C4'" . DG  C 1 2   ? 37.696  54.200  62.943  1.00 45.60  ? 3   DG  E "C4'" 1 
ATOM   446  O "O4'" . DG  C 1 2   ? 37.288  55.579  62.905  1.00 47.03  ? 3   DG  E "O4'" 1 
ATOM   447  C "C3'" . DG  C 1 2   ? 37.038  53.612  61.704  1.00 64.90  ? 3   DG  E "C3'" 1 
ATOM   448  O "O3'" . DG  C 1 2   ? 36.829  52.227  61.931  1.00 74.87  ? 3   DG  E "O3'" 1 
ATOM   449  C "C2'" . DG  C 1 2   ? 35.692  54.344  61.628  1.00 54.20  ? 3   DG  E "C2'" 1 
ATOM   450  C "C1'" . DG  C 1 2   ? 35.962  55.607  62.444  1.00 45.47  ? 3   DG  E "C1'" 1 
ATOM   451  N N9    . DG  C 1 2   ? 35.592  56.932  61.951  1.00 30.72  ? 3   DG  E N9    1 
ATOM   452  C C8    . DG  C 1 2   ? 36.324  58.096  62.012  1.00 32.33  ? 3   DG  E C8    1 
ATOM   453  N N7    . DG  C 1 2   ? 35.636  59.151  61.663  1.00 37.58  ? 3   DG  E N7    1 
ATOM   454  C C5    . DG  C 1 2   ? 34.393  58.643  61.305  1.00 70.62  ? 3   DG  E C5    1 
ATOM   455  C C6    . DG  C 1 2   ? 33.215  59.307  60.861  1.00 73.89  ? 3   DG  E C6    1 
ATOM   456  O O6    . DG  C 1 2   ? 33.032  60.516  60.690  1.00 77.29  ? 3   DG  E O6    1 
ATOM   457  N N1    . DG  C 1 2   ? 32.183  58.409  60.617  1.00 43.85  ? 3   DG  E N1    1 
ATOM   458  C C2    . DG  C 1 2   ? 32.270  57.046  60.779  1.00 64.38  ? 3   DG  E C2    1 
ATOM   459  N N2    . DG  C 1 2   ? 31.166  56.340  60.510  1.00 58.79  ? 3   DG  E N2    1 
ATOM   460  N N3    . DG  C 1 2   ? 33.356  56.419  61.185  1.00 51.52  ? 3   DG  E N3    1 
ATOM   461  C C4    . DG  C 1 2   ? 34.368  57.273  61.436  1.00 52.11  ? 3   DG  E C4    1 
ATOM   462  P P     . DG  C 1 3   ? 36.752  51.216  60.688  1.00 73.90  ? 4   DG  E P     1 
ATOM   463  O OP1   . DG  C 1 3   ? 36.834  49.833  61.223  1.00 50.48  ? 4   DG  E OP1   1 
ATOM   464  O OP2   . DG  C 1 3   ? 37.744  51.683  59.685  1.00 80.63  ? 4   DG  E OP2   1 
ATOM   465  O "O5'" . DG  C 1 3   ? 35.296  51.438  60.085  1.00 92.87  ? 4   DG  E "O5'" 1 
ATOM   466  C "C5'" . DG  C 1 3   ? 34.228  50.554  60.396  1.00 68.87  ? 4   DG  E "C5'" 1 
ATOM   467  C "C4'" . DG  C 1 3   ? 33.076  50.804  59.457  1.00 103.67 ? 4   DG  E "C4'" 1 
ATOM   468  O "O4'" . DG  C 1 3   ? 32.689  52.195  59.577  1.00 107.31 ? 4   DG  E "O4'" 1 
ATOM   469  C "C3'" . DG  C 1 3   ? 33.383  50.583  57.983  1.00 104.08 ? 4   DG  E "C3'" 1 
ATOM   470  O "O3'" . DG  C 1 3   ? 33.027  49.238  57.659  1.00 111.35 ? 4   DG  E "O3'" 1 
ATOM   471  C "C2'" . DG  C 1 3   ? 32.480  51.596  57.284  1.00 114.87 ? 4   DG  E "C2'" 1 
ATOM   472  C "C1'" . DG  C 1 3   ? 32.414  52.736  58.302  1.00 98.06  ? 4   DG  E "C1'" 1 
ATOM   473  N N9    . DG  C 1 3   ? 33.328  53.855  58.105  1.00 89.84  ? 4   DG  E N9    1 
ATOM   474  C C8    . DG  C 1 3   ? 34.680  53.857  58.337  1.00 104.14 ? 4   DG  E C8    1 
ATOM   475  N N7    . DG  C 1 3   ? 35.223  55.035  58.196  1.00 106.80 ? 4   DG  E N7    1 
ATOM   476  C C5    . DG  C 1 3   ? 34.171  55.857  57.819  1.00 67.07  ? 4   DG  E C5    1 
ATOM   477  C C6    . DG  C 1 3   ? 34.146  57.247  57.555  1.00 103.27 ? 4   DG  E C6    1 
ATOM   478  O O6    . DG  C 1 3   ? 35.078  58.056  57.601  1.00 133.77 ? 4   DG  E O6    1 
ATOM   479  N N1    . DG  C 1 3   ? 32.872  57.678  57.213  1.00 65.30  ? 4   DG  E N1    1 
ATOM   480  C C2    . DG  C 1 3   ? 31.764  56.877  57.131  1.00 76.34  ? 4   DG  E C2    1 
ATOM   481  N N2    . DG  C 1 3   ? 30.625  57.487  56.785  1.00 71.82  ? 4   DG  E N2    1 
ATOM   482  N N3    . DG  C 1 3   ? 31.773  55.576  57.377  1.00 74.01  ? 4   DG  E N3    1 
ATOM   483  C C4    . DG  C 1 3   ? 33.000  55.137  57.720  1.00 73.64  ? 4   DG  E C4    1 
ATOM   484  P P     . DG  C 1 4   ? 32.952  48.768  56.121  1.00 110.15 ? 5   DG  E P     1 
ATOM   485  O OP1   . DG  C 1 4   ? 32.418  47.383  56.082  1.00 110.28 ? 5   DG  E OP1   1 
ATOM   486  O OP2   . DG  C 1 4   ? 34.265  49.061  55.483  1.00 74.56  ? 5   DG  E OP2   1 
ATOM   487  O "O5'" . DG  C 1 4   ? 31.848  49.719  55.479  1.00 82.32  ? 5   DG  E "O5'" 1 
ATOM   488  C "C5'" . DG  C 1 4   ? 31.883  50.042  54.095  1.00 121.91 ? 5   DG  E "C5'" 1 
ATOM   489  C "C4'" . DG  C 1 4   ? 31.180  51.354  53.852  1.00 114.89 ? 5   DG  E "C4'" 1 
ATOM   490  O "O4'" . DG  C 1 4   ? 31.752  52.370  54.703  1.00 117.04 ? 5   DG  E "O4'" 1 
ATOM   491  C "C3'" . DG  C 1 4   ? 31.311  51.911  52.447  1.00 107.70 ? 5   DG  E "C3'" 1 
ATOM   492  O "O3'" . DG  C 1 4   ? 30.273  51.369  51.646  1.00 97.25  ? 5   DG  E "O3'" 1 
ATOM   493  C "C2'" . DG  C 1 4   ? 31.099  53.408  52.654  1.00 107.12 ? 5   DG  E "C2'" 1 
ATOM   494  C "C1'" . DG  C 1 4   ? 31.671  53.622  54.055  1.00 88.42  ? 5   DG  E "C1'" 1 
ATOM   495  N N9    . DG  C 1 4   ? 32.980  54.266  54.125  1.00 87.41  ? 5   DG  E N9    1 
ATOM   496  C C8    . DG  C 1 4   ? 34.200  53.663  54.319  1.00 63.06  ? 5   DG  E C8    1 
ATOM   497  N N7    . DG  C 1 4   ? 35.180  54.517  54.432  1.00 43.53  ? 5   DG  E N7    1 
ATOM   498  C C5    . DG  C 1 4   ? 34.573  55.759  54.284  1.00 48.53  ? 5   DG  E C5    1 
ATOM   499  C C6    . DG  C 1 4   ? 35.120  57.059  54.334  1.00 70.17  ? 5   DG  E C6    1 
ATOM   500  O O6    . DG  C 1 4   ? 36.289  57.388  54.561  1.00 60.25  ? 5   DG  E O6    1 
ATOM   501  N N1    . DG  C 1 4   ? 34.150  58.034  54.102  1.00 50.19  ? 5   DG  E N1    1 
ATOM   502  C C2    . DG  C 1 4   ? 32.818  57.784  53.868  1.00 71.20  ? 5   DG  E C2    1 
ATOM   503  N N2    . DG  C 1 4   ? 32.034  58.840  53.653  1.00 33.72  ? 5   DG  E N2    1 
ATOM   504  N N3    . DG  C 1 4   ? 32.291  56.579  53.844  1.00 30.12  ? 5   DG  E N3    1 
ATOM   505  C C4    . DG  C 1 4   ? 33.220  55.617  54.059  1.00 37.54  ? 5   DG  E C4    1 
ATOM   506  P P     . DA  C 1 5   ? 30.430  51.350  50.057  1.00 94.33  ? 6   DA  E P     1 
ATOM   507  O OP1   . DA  C 1 5   ? 29.206  50.729  49.491  1.00 124.80 ? 6   DA  E OP1   1 
ATOM   508  O OP2   . DA  C 1 5   ? 31.757  50.747  49.777  1.00 88.72  ? 6   DA  E OP2   1 
ATOM   509  O "O5'" . DA  C 1 5   ? 30.445  52.894  49.658  1.00 108.24 ? 6   DA  E "O5'" 1 
ATOM   510  C "C5'" . DA  C 1 5   ? 29.288  53.702  49.860  1.00 72.26  ? 6   DA  E "C5'" 1 
ATOM   511  C "C4'" . DA  C 1 5   ? 29.620  55.169  49.685  1.00 91.02  ? 6   DA  E "C4'" 1 
ATOM   512  O "O4'" . DA  C 1 5   ? 30.677  55.528  50.593  1.00 120.23 ? 6   DA  E "O4'" 1 
ATOM   513  C "C3'" . DA  C 1 5   ? 30.109  55.629  48.318  1.00 89.21  ? 6   DA  E "C3'" 1 
ATOM   514  O "O3'" . DA  C 1 5   ? 28.963  55.986  47.543  1.00 72.36  ? 6   DA  E "O3'" 1 
ATOM   515  C "C2'" . DA  C 1 5   ? 30.918  56.888  48.639  1.00 89.45  ? 6   DA  E "C2'" 1 
ATOM   516  C "C1'" . DA  C 1 5   ? 31.363  56.650  50.084  1.00 84.61  ? 6   DA  E "C1'" 1 
ATOM   517  N N9    . DA  C 1 5   ? 32.790  56.471  50.335  1.00 76.59  ? 6   DA  E N9    1 
ATOM   518  C C8    . DA  C 1 5   ? 33.500  55.297  50.422  1.00 58.86  ? 6   DA  E C8    1 
ATOM   519  N N7    . DA  C 1 5   ? 34.752  55.462  50.768  1.00 35.64  ? 6   DA  E N7    1 
ATOM   520  C C5    . DA  C 1 5   ? 34.887  56.838  50.884  1.00 55.49  ? 6   DA  E C5    1 
ATOM   521  C C6    . DA  C 1 5   ? 35.976  57.656  51.222  1.00 69.01  ? 6   DA  E C6    1 
ATOM   522  N N6    . DA  C 1 5   ? 37.185  57.180  51.523  1.00 60.24  ? 6   DA  E N6    1 
ATOM   523  N N1    . DA  C 1 5   ? 35.778  58.992  51.247  1.00 65.78  ? 6   DA  E N1    1 
ATOM   524  C C2    . DA  C 1 5   ? 34.560  59.464  50.946  1.00 72.99  ? 6   DA  E C2    1 
ATOM   525  N N3    . DA  C 1 5   ? 33.457  58.797  50.610  1.00 50.87  ? 6   DA  E N3    1 
ATOM   526  C C4    . DA  C 1 5   ? 33.690  57.473  50.599  1.00 52.20  ? 6   DA  E C4    1 
ATOM   527  P P     . DA  C 1 6   ? 29.133  56.426  46.004  1.00 106.11 ? 7   DA  E P     1 
ATOM   528  O OP1   . DA  C 1 6   ? 27.784  56.742  45.463  1.00 61.00  ? 7   DA  E OP1   1 
ATOM   529  O OP2   . DA  C 1 6   ? 29.968  55.384  45.347  1.00 59.46  ? 7   DA  E OP2   1 
ATOM   530  O "O5'" . DA  C 1 6   ? 29.959  57.787  46.057  1.00 74.45  ? 7   DA  E "O5'" 1 
ATOM   531  C "C5'" . DA  C 1 6   ? 29.386  58.970  46.605  1.00 82.68  ? 7   DA  E "C5'" 1 
ATOM   532  C "C4'" . DA  C 1 6   ? 30.438  60.043  46.723  1.00 94.58  ? 7   DA  E "C4'" 1 
ATOM   533  O "O4'" . DA  C 1 6   ? 31.518  59.549  47.535  1.00 115.39 ? 7   DA  E "O4'" 1 
ATOM   534  C "C3'" . DA  C 1 6   ? 31.082  60.505  45.423  1.00 85.80  ? 7   DA  E "C3'" 1 
ATOM   535  O "O3'" . DA  C 1 6   ? 30.319  61.633  44.998  1.00 38.48  ? 7   DA  E "O3'" 1 
ATOM   536  C "C2'" . DA  C 1 6   ? 32.483  60.949  45.847  1.00 80.19  ? 7   DA  E "C2'" 1 
ATOM   537  C "C1'" . DA  C 1 6   ? 32.719  60.160  47.135  1.00 71.70  ? 7   DA  E "C1'" 1 
ATOM   538  N N9    . DA  C 1 6   ? 33.771  59.153  47.155  1.00 66.66  ? 7   DA  E N9    1 
ATOM   539  C C8    . DA  C 1 6   ? 33.694  57.815  46.843  1.00 50.49  ? 7   DA  E C8    1 
ATOM   540  N N7    . DA  C 1 6   ? 34.781  57.142  47.143  1.00 38.00  ? 7   DA  E N7    1 
ATOM   541  C C5    . DA  C 1 6   ? 35.644  58.110  47.643  1.00 63.22  ? 7   DA  E C5    1 
ATOM   542  C C6    . DA  C 1 6   ? 36.945  58.043  48.165  1.00 35.28  ? 7   DA  E C6    1 
ATOM   543  N N6    . DA  C 1 6   ? 37.634  56.909  48.287  1.00 49.97  ? 7   DA  E N6    1 
ATOM   544  N N1    . DA  C 1 6   ? 37.522  59.195  48.569  1.00 65.32  ? 7   DA  E N1    1 
ATOM   545  C C2    . DA  C 1 6   ? 36.822  60.332  48.462  1.00 94.35  ? 7   DA  E C2    1 
ATOM   546  N N3    . DA  C 1 6   ? 35.592  60.524  48.001  1.00 39.84  ? 7   DA  E N3    1 
ATOM   547  C C4    . DA  C 1 6   ? 35.049  59.360  47.611  1.00 36.13  ? 7   DA  E C4    1 
ATOM   548  P P     . DT  C 1 7   ? 30.816  62.544  43.765  1.00 68.34  ? 8   DT  E P     1 
ATOM   549  O OP1   . DT  C 1 7   ? 29.969  63.774  43.733  1.00 54.82  ? 8   DT  E OP1   1 
ATOM   550  O OP2   . DT  C 1 7   ? 30.921  61.664  42.562  1.00 48.12  ? 8   DT  E OP2   1 
ATOM   551  O "O5'" . DT  C 1 7   ? 32.267  63.044  44.170  1.00 49.36  ? 8   DT  E "O5'" 1 
ATOM   552  C "C5'" . DT  C 1 7   ? 32.429  64.177  45.002  1.00 42.60  ? 8   DT  E "C5'" 1 
ATOM   553  C "C4'" . DT  C 1 7   ? 33.886  64.391  45.273  1.00 59.68  ? 8   DT  E "C4'" 1 
ATOM   554  O "O4'" . DT  C 1 7   ? 34.468  63.128  45.635  1.00 85.29  ? 8   DT  E "O4'" 1 
ATOM   555  C "C3'" . DT  C 1 7   ? 34.708  64.836  44.079  1.00 60.06  ? 8   DT  E "C3'" 1 
ATOM   556  O "O3'" . DT  C 1 7   ? 34.695  66.247  44.129  1.00 62.16  ? 8   DT  E "O3'" 1 
ATOM   557  C "C2'" . DT  C 1 7   ? 36.114  64.312  44.381  1.00 51.53  ? 8   DT  E "C2'" 1 
ATOM   558  C "C1'" . DT  C 1 7   ? 35.841  63.164  45.350  1.00 57.85  ? 8   DT  E "C1'" 1 
ATOM   559  N N1    . DT  C 1 7   ? 36.283  61.813  45.004  1.00 51.17  ? 8   DT  E N1    1 
ATOM   560  C C2    . DT  C 1 7   ? 37.579  61.479  45.303  1.00 79.73  ? 8   DT  E C2    1 
ATOM   561  O O2    . DT  C 1 7   ? 38.404  62.288  45.693  1.00 71.71  ? 8   DT  E O2    1 
ATOM   562  N N3    . DT  C 1 7   ? 37.879  60.158  45.127  1.00 56.41  ? 8   DT  E N3    1 
ATOM   563  C C4    . DT  C 1 7   ? 37.035  59.169  44.674  1.00 41.90  ? 8   DT  E C4    1 
ATOM   564  O O4    . DT  C 1 7   ? 37.414  58.006  44.655  1.00 21.17  ? 8   DT  E O4    1 
ATOM   565  C C5    . DT  C 1 7   ? 35.718  59.608  44.280  1.00 73.52  ? 8   DT  E C5    1 
ATOM   566  C C7    . DT  C 1 7   ? 34.768  58.615  43.687  1.00 31.85  ? 8   DT  E C7    1 
ATOM   567  C C6    . DT  C 1 7   ? 35.412  60.898  44.464  1.00 43.98  ? 8   DT  E C6    1 
ATOM   568  P P     . DT  C 1 8   ? 35.414  67.080  42.978  1.00 63.67  ? 9   DT  E P     1 
ATOM   569  O OP1   . DT  C 1 8   ? 35.346  68.523  43.339  1.00 29.62  ? 9   DT  E OP1   1 
ATOM   570  O OP2   . DT  C 1 8   ? 34.825  66.602  41.698  1.00 62.08  ? 9   DT  E OP2   1 
ATOM   571  O "O5'" . DT  C 1 8   ? 36.937  66.624  43.075  1.00 84.50  ? 9   DT  E "O5'" 1 
ATOM   572  C "C5'" . DT  C 1 8   ? 37.790  67.151  44.086  1.00 24.73  ? 9   DT  E "C5'" 1 
ATOM   573  C "C4'" . DT  C 1 8   ? 39.168  66.536  43.985  1.00 77.34  ? 9   DT  E "C4'" 1 
ATOM   574  O "O4'" . DT  C 1 8   ? 39.077  65.100  44.044  1.00 42.98  ? 9   DT  E "O4'" 1 
ATOM   575  C "C3'" . DT  C 1 8   ? 39.953  66.803  42.710  1.00 61.90  ? 9   DT  E "C3'" 1 
ATOM   576  O "O3'" . DT  C 1 8   ? 40.655  68.018  42.953  1.00 80.97  ? 9   DT  E "O3'" 1 
ATOM   577  C "C2'" . DT  C 1 8   ? 40.923  65.617  42.622  1.00 53.34  ? 9   DT  E "C2'" 1 
ATOM   578  C "C1'" . DT  C 1 8   ? 40.256  64.553  43.500  1.00 41.04  ? 9   DT  E "C1'" 1 
ATOM   579  N N1    . DT  C 1 8   ? 39.947  63.232  42.931  1.00 24.99  ? 9   DT  E N1    1 
ATOM   580  C C2    . DT  C 1 8   ? 40.821  62.189  43.196  1.00 47.77  ? 9   DT  E C2    1 
ATOM   581  O O2    . DT  C 1 8   ? 41.893  62.332  43.764  1.00 63.08  ? 9   DT  E O2    1 
ATOM   582  N N3    . DT  C 1 8   ? 40.387  60.963  42.766  1.00 36.47  ? 9   DT  E N3    1 
ATOM   583  C C4    . DT  C 1 8   ? 39.218  60.681  42.101  1.00 59.02  ? 9   DT  E C4    1 
ATOM   584  O O4    . DT  C 1 8   ? 38.937  59.517  41.831  1.00 70.67  ? 9   DT  E O4    1 
ATOM   585  C C5    . DT  C 1 8   ? 38.391  61.829  41.786  1.00 38.47  ? 9   DT  E C5    1 
ATOM   586  C C7    . DT  C 1 8   ? 37.133  61.626  41.011  1.00 65.49  ? 9   DT  E C7    1 
ATOM   587  C C6    . DT  C 1 8   ? 38.796  63.032  42.210  1.00 49.23  ? 9   DT  E C6    1 
ATOM   588  P P     . DC  C 1 9   ? 41.817  68.492  41.959  1.00 72.54  ? 10  DC  E P     1 
ATOM   589  O OP1   . DC  C 1 9   ? 42.345  69.786  42.453  1.00 60.25  ? 10  DC  E OP1   1 
ATOM   590  O OP2   . DC  C 1 9   ? 41.263  68.400  40.585  1.00 97.36  ? 10  DC  E OP2   1 
ATOM   591  O "O5'" . DC  C 1 9   ? 42.967  67.406  42.146  1.00 56.77  ? 10  DC  E "O5'" 1 
ATOM   592  C "C5'" . DC  C 1 9   ? 43.696  67.332  43.355  1.00 39.83  ? 10  DC  E "C5'" 1 
ATOM   593  C "C4'" . DC  C 1 9   ? 44.563  66.104  43.366  1.00 36.63  ? 10  DC  E "C4'" 1 
ATOM   594  O "O4'" . DC  C 1 9   ? 43.755  64.966  43.015  1.00 49.68  ? 10  DC  E "O4'" 1 
ATOM   595  C "C3'" . DC  C 1 9   ? 45.701  66.068  42.362  1.00 36.71  ? 10  DC  E "C3'" 1 
ATOM   596  O "O3'" . DC  C 1 9   ? 46.835  66.663  42.978  1.00 69.51  ? 10  DC  E "O3'" 1 
ATOM   597  C "C2'" . DC  C 1 9   ? 45.951  64.571  42.157  1.00 35.23  ? 10  DC  E "C2'" 1 
ATOM   598  C "C1'" . DC  C 1 9   ? 44.590  63.957  42.489  1.00 23.22  ? 10  DC  E "C1'" 1 
ATOM   599  N N1    . DC  C 1 9   ? 43.850  63.213  41.448  1.00 35.06  ? 10  DC  E N1    1 
ATOM   600  C C2    . DC  C 1 9   ? 44.155  61.864  41.256  1.00 39.65  ? 10  DC  E C2    1 
ATOM   601  O O2    . DC  C 1 9   ? 45.138  61.392  41.846  1.00 50.05  ? 10  DC  E O2    1 
ATOM   602  N N3    . DC  C 1 9   ? 43.378  61.115  40.436  1.00 59.41  ? 10  DC  E N3    1 
ATOM   603  C C4    . DC  C 1 9   ? 42.347  61.675  39.808  1.00 55.22  ? 10  DC  E C4    1 
ATOM   604  N N4    . DC  C 1 9   ? 41.570  60.889  39.065  1.00 127.87 ? 10  DC  E N4    1 
ATOM   605  C C5    . DC  C 1 9   ? 42.063  63.068  39.920  1.00 75.77  ? 10  DC  E C5    1 
ATOM   606  C C6    . DC  C 1 9   ? 42.843  63.797  40.733  1.00 18.55  ? 10  DC  E C6    1 
ATOM   607  P P     . DC  C 1 10  ? 48.057  67.165  42.072  1.00 59.56  ? 11  DC  E P     1 
ATOM   608  O OP1   . DC  C 1 10  ? 49.164  67.594  42.961  1.00 67.94  ? 11  DC  E OP1   1 
ATOM   609  O OP2   . DC  C 1 10  ? 47.493  68.115  41.079  1.00 60.02  ? 11  DC  E OP2   1 
ATOM   610  O "O5'" . DC  C 1 10  ? 48.539  65.845  41.331  1.00 77.75  ? 11  DC  E "O5'" 1 
ATOM   611  C "C5'" . DC  C 1 10  ? 49.361  64.906  42.005  1.00 43.27  ? 11  DC  E "C5'" 1 
ATOM   612  C "C4'" . DC  C 1 10  ? 49.807  63.821  41.059  1.00 73.07  ? 11  DC  E "C4'" 1 
ATOM   613  O "O4'" . DC  C 1 10  ? 48.733  62.894  40.807  1.00 70.34  ? 11  DC  E "O4'" 1 
ATOM   614  C "C3'" . DC  C 1 10  ? 50.267  64.273  39.686  1.00 79.61  ? 11  DC  E "C3'" 1 
ATOM   615  O "O3'" . DC  C 1 10  ? 51.635  64.669  39.821  1.00 84.50  ? 11  DC  E "O3'" 1 
ATOM   616  C "C2'" . DC  C 1 10  ? 50.073  63.015  38.835  1.00 90.68  ? 11  DC  E "C2'" 1 
ATOM   617  C "C1'" . DC  C 1 10  ? 48.933  62.281  39.551  1.00 70.04  ? 11  DC  E "C1'" 1 
ATOM   618  N N1    . DC  C 1 10  ? 47.636  62.240  38.859  1.00 48.61  ? 11  DC  E N1    1 
ATOM   619  C C2    . DC  C 1 10  ? 47.143  61.000  38.421  1.00 60.89  ? 11  DC  E C2    1 
ATOM   620  O O2    . DC  C 1 10  ? 47.859  59.993  38.542  1.00 74.36  ? 11  DC  E O2    1 
ATOM   621  N N3    . DC  C 1 10  ? 45.907  60.933  37.878  1.00 57.02  ? 11  DC  E N3    1 
ATOM   622  C C4    . DC  C 1 10  ? 45.178  62.045  37.744  1.00 68.80  ? 11  DC  E C4    1 
ATOM   623  N N4    . DC  C 1 10  ? 43.950  61.931  37.240  1.00 43.20  ? 11  DC  E N4    1 
ATOM   624  C C5    . DC  C 1 10  ? 45.679  63.325  38.129  1.00 84.84  ? 11  DC  E C5    1 
ATOM   625  C C6    . DC  C 1 10  ? 46.900  63.376  38.677  1.00 44.01  ? 11  DC  E C6    1 
ATOM   626  P P     . DC  C 1 11  ? 52.638  64.571  38.567  1.00 83.09  ? 12  DC  E P     1 
ATOM   627  O OP1   . DC  C 1 11  ? 54.018  64.673  39.107  1.00 67.89  ? 12  DC  E OP1   1 
ATOM   628  O OP2   . DC  C 1 11  ? 52.188  65.530  37.517  1.00 44.58  ? 12  DC  E OP2   1 
ATOM   629  O "O5'" . DC  C 1 11  ? 52.464  63.069  38.067  1.00 50.43  ? 12  DC  E "O5'" 1 
ATOM   630  C "C5'" . DC  C 1 11  ? 53.098  62.599  36.884  1.00 88.36  ? 12  DC  E "C5'" 1 
ATOM   631  C "C4'" . DC  C 1 11  ? 52.978  61.095  36.803  1.00 87.86  ? 12  DC  E "C4'" 1 
ATOM   632  O "O4'" . DC  C 1 11  ? 51.585  60.720  36.928  1.00 81.70  ? 12  DC  E "O4'" 1 
ATOM   633  C "C3'" . DC  C 1 11  ? 53.450  60.491  35.485  1.00 100.78 ? 12  DC  E "C3'" 1 
ATOM   634  O "O3'" . DC  C 1 11  ? 53.792  59.124  35.714  1.00 130.53 ? 12  DC  E "O3'" 1 
ATOM   635  C "C2'" . DC  C 1 11  ? 52.179  60.491  34.659  1.00 100.15 ? 12  DC  E "C2'" 1 
ATOM   636  C "C1'" . DC  C 1 11  ? 51.106  60.191  35.701  1.00 62.77  ? 12  DC  E "C1'" 1 
ATOM   637  N N1    . DC  C 1 11  ? 49.815  60.833  35.410  1.00 70.98  ? 12  DC  E N1    1 
ATOM   638  C C2    . DC  C 1 11  ? 48.681  60.034  35.232  1.00 72.71  ? 12  DC  E C2    1 
ATOM   639  O O2    . DC  C 1 11  ? 48.786  58.807  35.373  1.00 58.33  ? 12  DC  E O2    1 
ATOM   640  N N3    . DC  C 1 11  ? 47.503  60.623  34.913  1.00 46.74  ? 12  DC  E N3    1 
ATOM   641  C C4    . DC  C 1 11  ? 47.436  61.951  34.779  1.00 80.85  ? 12  DC  E C4    1 
ATOM   642  N N4    . DC  C 1 11  ? 46.271  62.494  34.419  1.00 47.68  ? 12  DC  E N4    1 
ATOM   643  C C5    . DC  C 1 11  ? 48.568  62.784  34.994  1.00 84.80  ? 12  DC  E C5    1 
ATOM   644  C C6    . DC  C 1 11  ? 49.726  62.190  35.301  1.00 58.68  ? 12  DC  E C6    1 
ATOM   645  N N     . SER D 2 1   ? 41.488  5.156   90.583  1.00 114.41 ? 88  SER A N     1 
ATOM   646  C CA    . SER D 2 1   ? 40.750  6.432   90.352  1.00 127.50 ? 88  SER A CA    1 
ATOM   647  C C     . SER D 2 1   ? 39.488  6.516   91.212  1.00 136.59 ? 88  SER A C     1 
ATOM   648  O O     . SER D 2 1   ? 39.458  7.216   92.231  1.00 140.73 ? 88  SER A O     1 
ATOM   649  C CB    . SER D 2 1   ? 40.366  6.564   88.871  1.00 101.19 ? 88  SER A CB    1 
ATOM   650  O OG    . SER D 2 1   ? 41.510  6.695   88.044  1.00 138.86 ? 88  SER A OG    1 
ATOM   651  N N     . CYS D 2 2   ? 38.447  5.800   90.790  1.00 140.73 ? 89  CYS A N     1 
ATOM   652  C CA    . CYS D 2 2   ? 37.172  5.779   91.503  1.00 140.73 ? 89  CYS A CA    1 
ATOM   653  C C     . CYS D 2 2   ? 37.361  5.250   92.927  1.00 140.73 ? 89  CYS A C     1 
ATOM   654  O O     . CYS D 2 2   ? 37.834  4.128   93.135  1.00 128.32 ? 89  CYS A O     1 
ATOM   655  C CB    . CYS D 2 2   ? 36.161  4.908   90.739  1.00 128.45 ? 89  CYS A CB    1 
ATOM   656  S SG    . CYS D 2 2   ? 34.447  4.966   91.350  1.00 140.73 ? 89  CYS A SG    1 
ATOM   657  N N     . THR D 2 3   ? 36.988  6.070   93.905  1.00 140.73 ? 90  THR A N     1 
ATOM   658  C CA    . THR D 2 3   ? 37.124  5.703   95.310  1.00 140.73 ? 90  THR A CA    1 
ATOM   659  C C     . THR D 2 3   ? 36.189  4.576   95.753  1.00 140.73 ? 90  THR A C     1 
ATOM   660  O O     . THR D 2 3   ? 36.634  3.460   96.025  1.00 128.52 ? 90  THR A O     1 
ATOM   661  C CB    . THR D 2 3   ? 36.896  6.933   96.232  1.00 140.53 ? 90  THR A CB    1 
ATOM   662  O OG1   . THR D 2 3   ? 36.803  6.502   97.597  1.00 140.73 ? 90  THR A OG1   1 
ATOM   663  C CG2   . THR D 2 3   ? 35.623  7.679   95.838  1.00 114.59 ? 90  THR A CG2   1 
ATOM   664  N N     . LEU D 2 4   ? 34.894  4.872   95.815  1.00 140.73 ? 91  LEU A N     1 
ATOM   665  C CA    . LEU D 2 4   ? 33.903  3.897   96.252  1.00 140.73 ? 91  LEU A CA    1 
ATOM   666  C C     . LEU D 2 4   ? 32.834  3.659   95.182  1.00 140.73 ? 91  LEU A C     1 
ATOM   667  O O     . LEU D 2 4   ? 32.663  4.471   94.269  1.00 140.73 ? 91  LEU A O     1 
ATOM   668  C CB    . LEU D 2 4   ? 33.253  4.395   97.548  1.00 128.91 ? 91  LEU A CB    1 
ATOM   669  C CG    . LEU D 2 4   ? 34.227  5.028   98.557  1.00 134.29 ? 91  LEU A CG    1 
ATOM   670  C CD1   . LEU D 2 4   ? 33.460  5.662   99.718  1.00 97.47  ? 91  LEU A CD1   1 
ATOM   671  C CD2   . LEU D 2 4   ? 35.205  3.971   99.057  1.00 125.21 ? 91  LEU A CD2   1 
ATOM   672  N N     . GLY D 2 5   ? 32.126  2.536   95.298  1.00 140.73 ? 92  GLY A N     1 
ATOM   673  C CA    . GLY D 2 5   ? 31.073  2.203   94.349  1.00 140.73 ? 92  GLY A CA    1 
ATOM   674  C C     . GLY D 2 5   ? 29.731  2.727   94.832  1.00 140.73 ? 92  GLY A C     1 
ATOM   675  O O     . GLY D 2 5   ? 29.639  3.217   95.960  1.00 140.73 ? 92  GLY A O     1 
ATOM   676  N N     . ARG D 2 6   ? 28.689  2.625   94.006  1.00 140.73 ? 93  ARG A N     1 
ATOM   677  C CA    . ARG D 2 6   ? 27.373  3.129   94.406  1.00 140.73 ? 93  ARG A CA    1 
ATOM   678  C C     . ARG D 2 6   ? 26.750  2.361   95.571  1.00 140.73 ? 93  ARG A C     1 
ATOM   679  O O     . ARG D 2 6   ? 25.605  1.906   95.491  1.00 140.73 ? 93  ARG A O     1 
ATOM   680  C CB    . ARG D 2 6   ? 26.397  3.147   93.216  1.00 133.49 ? 93  ARG A CB    1 
ATOM   681  C CG    . ARG D 2 6   ? 26.046  1.787   92.633  1.00 105.48 ? 93  ARG A CG    1 
ATOM   682  C CD    . ARG D 2 6   ? 24.736  1.846   91.843  1.00 139.73 ? 93  ARG A CD    1 
ATOM   683  N NE    . ARG D 2 6   ? 24.767  2.825   90.756  1.00 138.85 ? 93  ARG A NE    1 
ATOM   684  C CZ    . ARG D 2 6   ? 23.738  3.088   89.953  1.00 140.73 ? 93  ARG A CZ    1 
ATOM   685  N NH1   . ARG D 2 6   ? 22.589  2.445   90.112  1.00 138.51 ? 93  ARG A NH1   1 
ATOM   686  N NH2   . ARG D 2 6   ? 23.859  3.993   88.990  1.00 136.14 ? 93  ARG A NH2   1 
ATOM   687  N N     . LEU D 2 7   ? 27.509  2.224   96.653  1.00 140.73 ? 94  LEU A N     1 
ATOM   688  C CA    . LEU D 2 7   ? 27.034  1.536   97.844  1.00 140.73 ? 94  LEU A CA    1 
ATOM   689  C C     . LEU D 2 7   ? 25.893  2.360   98.426  1.00 140.44 ? 94  LEU A C     1 
ATOM   690  O O     . LEU D 2 7   ? 25.952  3.592   98.435  1.00 126.76 ? 94  LEU A O     1 
ATOM   691  C CB    . LEU D 2 7   ? 28.167  1.412   98.866  1.00 134.37 ? 94  LEU A CB    1 
ATOM   692  C CG    . LEU D 2 7   ? 29.373  0.581   98.419  1.00 140.73 ? 94  LEU A CG    1 
ATOM   693  C CD1   . LEU D 2 7   ? 30.494  0.683   99.444  1.00 126.48 ? 94  LEU A CD1   1 
ATOM   694  C CD2   . LEU D 2 7   ? 28.946  -0.867  98.232  1.00 140.73 ? 94  LEU A CD2   1 
ATOM   695  N N     . VAL D 2 8   ? 24.853  1.684   98.904  1.00 140.73 ? 95  VAL A N     1 
ATOM   696  C CA    . VAL D 2 8   ? 23.701  2.372   99.473  1.00 140.73 ? 95  VAL A CA    1 
ATOM   697  C C     . VAL D 2 8   ? 24.089  3.121   100.752 1.00 140.73 ? 95  VAL A C     1 
ATOM   698  O O     . VAL D 2 8   ? 23.258  3.350   101.633 1.00 140.73 ? 95  VAL A O     1 
ATOM   699  C CB    . VAL D 2 8   ? 22.547  1.372   99.765  1.00 135.45 ? 95  VAL A CB    1 
ATOM   700  C CG1   . VAL D 2 8   ? 22.891  0.501   100.964 1.00 104.13 ? 95  VAL A CG1   1 
ATOM   701  C CG2   . VAL D 2 8   ? 21.244  2.126   99.982  1.00 139.05 ? 95  VAL A CG2   1 
ATOM   702  N N     . SER D 2 9   ? 25.360  3.505   100.841 1.00 140.73 ? 96  SER A N     1 
ATOM   703  C CA    . SER D 2 9   ? 25.862  4.234   101.996 1.00 140.73 ? 96  SER A CA    1 
ATOM   704  C C     . SER D 2 9   ? 25.086  5.541   102.174 1.00 140.61 ? 96  SER A C     1 
ATOM   705  O O     . SER D 2 9   ? 24.488  5.776   103.225 1.00 140.73 ? 96  SER A O     1 
ATOM   706  C CB    . SER D 2 9   ? 27.360  4.522   101.832 1.00 134.79 ? 96  SER A CB    1 
ATOM   707  O OG    . SER D 2 9   ? 27.883  5.198   102.964 1.00 138.11 ? 96  SER A OG    1 
ATOM   708  N N     . PRO D 2 10  ? 25.072  6.408   101.142 1.00 140.73 ? 97  PRO A N     1 
ATOM   709  C CA    . PRO D 2 10  ? 24.335  7.667   101.284 1.00 139.89 ? 97  PRO A CA    1 
ATOM   710  C C     . PRO D 2 10  ? 22.837  7.432   101.446 1.00 140.73 ? 97  PRO A C     1 
ATOM   711  O O     . PRO D 2 10  ? 22.236  7.886   102.421 1.00 136.75 ? 97  PRO A O     1 
ATOM   712  C CB    . PRO D 2 10  ? 24.677  8.412   99.996  1.00 118.38 ? 97  PRO A CB    1 
ATOM   713  C CG    . PRO D 2 10  ? 24.819  7.299   99.003  1.00 129.74 ? 97  PRO A CG    1 
ATOM   714  C CD    . PRO D 2 10  ? 25.622  6.274   99.779  1.00 140.73 ? 97  PRO A CD    1 
ATOM   715  N N     . GLY D 2 11  ? 22.247  6.708   100.496 1.00 134.30 ? 98  GLY A N     1 
ATOM   716  C CA    . GLY D 2 11  ? 20.823  6.424   100.548 1.00 140.73 ? 98  GLY A CA    1 
ATOM   717  C C     . GLY D 2 11  ? 20.015  7.706   100.490 1.00 140.73 ? 98  GLY A C     1 
ATOM   718  O O     . GLY D 2 11  ? 20.178  8.562   101.359 1.00 138.99 ? 98  GLY A O     1 
ATOM   719  N N     . PRO D 2 12  ? 19.122  7.861   99.494  1.00 140.73 ? 99  PRO A N     1 
ATOM   720  C CA    . PRO D 2 12  ? 18.287  9.058   99.329  1.00 140.73 ? 99  PRO A CA    1 
ATOM   721  C C     . PRO D 2 12  ? 18.109  9.866   100.616 1.00 140.73 ? 99  PRO A C     1 
ATOM   722  O O     . PRO D 2 12  ? 17.066  9.800   101.270 1.00 140.73 ? 99  PRO A O     1 
ATOM   723  C CB    . PRO D 2 12  ? 16.980  8.479   98.804  1.00 132.09 ? 99  PRO A CB    1 
ATOM   724  C CG    . PRO D 2 12  ? 17.473  7.409   97.884  1.00 129.45 ? 99  PRO A CG    1 
ATOM   725  C CD    . PRO D 2 12  ? 18.600  6.750   98.672  1.00 140.73 ? 99  PRO A CD    1 
ATOM   726  N N     . CYS D 2 13  ? 19.136  10.632  100.971 1.00 130.29 ? 100 CYS A N     1 
ATOM   727  C CA    . CYS D 2 13  ? 19.102  11.437  102.181 1.00 135.36 ? 100 CYS A CA    1 
ATOM   728  C C     . CYS D 2 13  ? 20.136  12.562  102.129 1.00 140.73 ? 100 CYS A C     1 
ATOM   729  O O     . CYS D 2 13  ? 19.776  13.740  102.145 1.00 140.73 ? 100 CYS A O     1 
ATOM   730  C CB    . CYS D 2 13  ? 19.339  10.545  103.405 1.00 119.67 ? 100 CYS A CB    1 
ATOM   731  S SG    . CYS D 2 13  ? 19.330  11.407  104.985 1.00 124.14 ? 100 CYS A SG    1 
ATOM   732  N N     . PRO D 2 14  ? 21.438  12.218  102.065 1.00 140.73 ? 101 PRO A N     1 
ATOM   733  C CA    . PRO D 2 14  ? 22.453  13.275  102.012 1.00 140.73 ? 101 PRO A CA    1 
ATOM   734  C C     . PRO D 2 14  ? 22.483  13.975  100.652 1.00 140.73 ? 101 PRO A C     1 
ATOM   735  O O     . PRO D 2 14  ? 21.445  14.138  100.007 1.00 140.73 ? 101 PRO A O     1 
ATOM   736  C CB    . PRO D 2 14  ? 23.744  12.520  102.317 1.00 140.73 ? 101 PRO A CB    1 
ATOM   737  C CG    . PRO D 2 14  ? 23.500  11.189  101.684 1.00 140.73 ? 101 PRO A CG    1 
ATOM   738  C CD    . PRO D 2 14  ? 22.070  10.885  102.085 1.00 140.73 ? 101 PRO A CD    1 
ATOM   739  N N     . ARG D 2 15  ? 23.675  14.380  100.223 1.00 140.44 ? 102 ARG A N     1 
ATOM   740  C CA    . ARG D 2 15  ? 23.857  15.070  98.946  1.00 140.73 ? 102 ARG A CA    1 
ATOM   741  C C     . ARG D 2 15  ? 23.263  16.476  98.964  1.00 140.73 ? 102 ARG A C     1 
ATOM   742  O O     . ARG D 2 15  ? 22.218  16.736  98.361  1.00 124.77 ? 102 ARG A O     1 
ATOM   743  C CB    . ARG D 2 15  ? 23.243  14.259  97.799  1.00 136.81 ? 102 ARG A CB    1 
ATOM   744  C CG    . ARG D 2 15  ? 24.009  12.992  97.471  1.00 132.70 ? 102 ARG A CG    1 
ATOM   745  C CD    . ARG D 2 15  ? 23.973  12.012  98.630  1.00 129.28 ? 102 ARG A CD    1 
ATOM   746  N NE    . ARG D 2 15  ? 24.948  10.938  98.474  1.00 140.73 ? 102 ARG A NE    1 
ATOM   747  C CZ    . ARG D 2 15  ? 26.265  11.118  98.473  1.00 140.73 ? 102 ARG A CZ    1 
ATOM   748  N NH1   . ARG D 2 15  ? 27.075  10.080  98.325  1.00 140.73 ? 102 ARG A NH1   1 
ATOM   749  N NH2   . ARG D 2 15  ? 26.773  12.335  98.625  1.00 134.84 ? 102 ARG A NH2   1 
ATOM   750  N N     . PRO D 2 16  ? 23.930  17.404  99.667  1.00 140.73 ? 103 PRO A N     1 
ATOM   751  C CA    . PRO D 2 16  ? 23.481  18.793  99.772  1.00 140.73 ? 103 PRO A CA    1 
ATOM   752  C C     . PRO D 2 16  ? 23.762  19.622  98.521  1.00 139.69 ? 103 PRO A C     1 
ATOM   753  O O     . PRO D 2 16  ? 24.703  19.351  97.773  1.00 134.84 ? 103 PRO A O     1 
ATOM   754  C CB    . PRO D 2 16  ? 24.246  19.303  100.988 1.00 140.73 ? 103 PRO A CB    1 
ATOM   755  C CG    . PRO D 2 16  ? 25.536  18.559  100.890 1.00 140.73 ? 103 PRO A CG    1 
ATOM   756  C CD    . PRO D 2 16  ? 25.075  17.158  100.563 1.00 140.73 ? 103 PRO A CD    1 
ATOM   757  N N     . TYR D 2 17  ? 22.926  20.631  98.305  1.00 135.93 ? 104 TYR A N     1 
ATOM   758  C CA    . TYR D 2 17  ? 23.059  21.532  97.169  1.00 124.58 ? 104 TYR A CA    1 
ATOM   759  C C     . TYR D 2 17  ? 22.254  22.783  97.509  1.00 119.66 ? 104 TYR A C     1 
ATOM   760  O O     . TYR D 2 17  ? 21.514  22.796  98.495  1.00 90.23  ? 104 TYR A O     1 
ATOM   761  C CB    . TYR D 2 17  ? 22.517  20.879  95.892  1.00 117.68 ? 104 TYR A CB    1 
ATOM   762  C CG    . TYR D 2 17  ? 21.009  20.807  95.830  1.00 138.67 ? 104 TYR A CG    1 
ATOM   763  C CD1   . TYR D 2 17  ? 20.282  20.102  96.789  1.00 140.73 ? 104 TYR A CD1   1 
ATOM   764  C CD2   . TYR D 2 17  ? 20.303  21.466  94.824  1.00 140.73 ? 104 TYR A CD2   1 
ATOM   765  C CE1   . TYR D 2 17  ? 18.889  20.058  96.749  1.00 136.99 ? 104 TYR A CE1   1 
ATOM   766  C CE2   . TYR D 2 17  ? 18.910  21.427  94.775  1.00 140.70 ? 104 TYR A CE2   1 
ATOM   767  C CZ    . TYR D 2 17  ? 18.212  20.723  95.741  1.00 135.12 ? 104 TYR A CZ    1 
ATOM   768  O OH    . TYR D 2 17  ? 16.838  20.694  95.709  1.00 140.73 ? 104 TYR A OH    1 
ATOM   769  N N     . LEU D 2 18  ? 22.401  23.830  96.701  1.00 134.34 ? 105 LEU A N     1 
ATOM   770  C CA    . LEU D 2 18  ? 21.688  25.087  96.934  1.00 134.43 ? 105 LEU A CA    1 
ATOM   771  C C     . LEU D 2 18  ? 20.736  25.436  95.792  1.00 128.69 ? 105 LEU A C     1 
ATOM   772  O O     . LEU D 2 18  ? 20.573  24.660  94.849  1.00 106.57 ? 105 LEU A O     1 
ATOM   773  C CB    . LEU D 2 18  ? 22.689  26.230  97.150  1.00 130.58 ? 105 LEU A CB    1 
ATOM   774  C CG    . LEU D 2 18  ? 23.747  26.524  96.079  1.00 114.08 ? 105 LEU A CG    1 
ATOM   775  C CD1   . LEU D 2 18  ? 24.581  27.716  96.525  1.00 86.43  ? 105 LEU A CD1   1 
ATOM   776  C CD2   . LEU D 2 18  ? 24.644  25.310  95.851  1.00 120.95 ? 105 LEU A CD2   1 
ATOM   777  N N     . VAL D 2 19  ? 20.102  26.603  95.878  1.00 123.72 ? 106 VAL A N     1 
ATOM   778  C CA    . VAL D 2 19  ? 19.169  27.015  94.835  1.00 113.96 ? 106 VAL A CA    1 
ATOM   779  C C     . VAL D 2 19  ? 18.705  28.472  94.943  1.00 108.18 ? 106 VAL A C     1 
ATOM   780  O O     . VAL D 2 19  ? 18.362  28.954  96.025  1.00 96.49  ? 106 VAL A O     1 
ATOM   781  C CB    . VAL D 2 19  ? 17.909  26.099  94.831  1.00 100.04 ? 106 VAL A CB    1 
ATOM   782  C CG1   . VAL D 2 19  ? 17.019  26.414  96.036  1.00 75.33  ? 106 VAL A CG1   1 
ATOM   783  C CG2   . VAL D 2 19  ? 17.137  26.277  93.531  1.00 129.27 ? 106 VAL A CG2   1 
ATOM   784  N N     . ILE D 2 20  ? 18.694  29.172  93.813  1.00 85.72  ? 107 ILE A N     1 
ATOM   785  C CA    . ILE D 2 20  ? 18.232  30.551  93.808  1.00 87.74  ? 107 ILE A CA    1 
ATOM   786  C C     . ILE D 2 20  ? 16.720  30.514  94.001  1.00 83.69  ? 107 ILE A C     1 
ATOM   787  O O     . ILE D 2 20  ? 16.006  29.866  93.233  1.00 68.62  ? 107 ILE A O     1 
ATOM   788  C CB    . ILE D 2 20  ? 18.528  31.264  92.469  1.00 87.67  ? 107 ILE A CB    1 
ATOM   789  C CG1   . ILE D 2 20  ? 20.019  31.183  92.140  1.00 95.11  ? 107 ILE A CG1   1 
ATOM   790  C CG2   . ILE D 2 20  ? 18.097  32.723  92.558  1.00 75.48  ? 107 ILE A CG2   1 
ATOM   791  C CD1   . ILE D 2 20  ? 20.366  31.689  90.754  1.00 79.33  ? 107 ILE A CD1   1 
ATOM   792  N N     . THR D 2 21  ? 16.239  31.197  95.033  1.00 88.74  ? 108 THR A N     1 
ATOM   793  C CA    . THR D 2 21  ? 14.812  31.248  95.318  1.00 96.97  ? 108 THR A CA    1 
ATOM   794  C C     . THR D 2 21  ? 14.202  32.456  94.628  1.00 99.12  ? 108 THR A C     1 
ATOM   795  O O     . THR D 2 21  ? 13.035  32.446  94.238  1.00 93.64  ? 108 THR A O     1 
ATOM   796  C CB    . THR D 2 21  ? 14.557  31.346  96.834  1.00 114.40 ? 108 THR A CB    1 
ATOM   797  O OG1   . THR D 2 21  ? 14.738  30.054  97.423  1.00 125.55 ? 108 THR A OG1   1 
ATOM   798  C CG2   . THR D 2 21  ? 13.147  31.852  97.124  1.00 95.39  ? 108 THR A CG2   1 
ATOM   799  N N     . GLU D 2 22  ? 15.014  33.494  94.477  1.00 109.02 ? 109 GLU A N     1 
ATOM   800  C CA    . GLU D 2 22  ? 14.580  34.729  93.845  1.00 109.19 ? 109 GLU A CA    1 
ATOM   801  C C     . GLU D 2 22  ? 15.727  35.262  92.992  1.00 104.93 ? 109 GLU A C     1 
ATOM   802  O O     . GLU D 2 22  ? 16.734  35.732  93.520  1.00 118.47 ? 109 GLU A O     1 
ATOM   803  C CB    . GLU D 2 22  ? 14.202  35.745  94.925  1.00 95.04  ? 109 GLU A CB    1 
ATOM   804  C CG    . GLU D 2 22  ? 12.831  36.362  94.764  1.00 70.20  ? 109 GLU A CG    1 
ATOM   805  C CD    . GLU D 2 22  ? 12.788  37.366  93.649  1.00 86.71  ? 109 GLU A CD    1 
ATOM   806  O OE1   . GLU D 2 22  ? 11.702  37.922  93.389  1.00 95.93  ? 109 GLU A OE1   1 
ATOM   807  O OE2   . GLU D 2 22  ? 13.848  37.601  93.037  1.00 87.21  ? 109 GLU A OE2   1 
ATOM   808  N N     . GLN D 2 23  ? 15.577  35.172  91.674  1.00 84.87  ? 110 GLN A N     1 
ATOM   809  C CA    . GLN D 2 23  ? 16.606  35.642  90.756  1.00 73.28  ? 110 GLN A CA    1 
ATOM   810  C C     . GLN D 2 23  ? 16.771  37.154  90.798  1.00 71.24  ? 110 GLN A C     1 
ATOM   811  O O     . GLN D 2 23  ? 15.829  37.893  91.087  1.00 85.12  ? 110 GLN A O     1 
ATOM   812  C CB    . GLN D 2 23  ? 16.285  35.200  89.333  1.00 54.37  ? 110 GLN A CB    1 
ATOM   813  C CG    . GLN D 2 23  ? 16.580  33.738  89.058  1.00 80.77  ? 110 GLN A CG    1 
ATOM   814  C CD    . GLN D 2 23  ? 18.054  33.467  88.824  1.00 68.85  ? 110 GLN A CD    1 
ATOM   815  O OE1   . GLN D 2 23  ? 18.901  33.796  89.654  1.00 89.47  ? 110 GLN A OE1   1 
ATOM   816  N NE2   . GLN D 2 23  ? 18.367  32.858  87.686  1.00 60.54  ? 110 GLN A NE2   1 
ATOM   817  N N     . PRO D 2 24  ? 17.987  37.635  90.507  1.00 67.50  ? 111 PRO A N     1 
ATOM   818  C CA    . PRO D 2 24  ? 18.265  39.072  90.519  1.00 68.42  ? 111 PRO A CA    1 
ATOM   819  C C     . PRO D 2 24  ? 17.656  39.729  89.289  1.00 81.60  ? 111 PRO A C     1 
ATOM   820  O O     . PRO D 2 24  ? 17.937  39.320  88.161  1.00 97.53  ? 111 PRO A O     1 
ATOM   821  C CB    . PRO D 2 24  ? 19.784  39.114  90.512  1.00 59.96  ? 111 PRO A CB    1 
ATOM   822  C CG    . PRO D 2 24  ? 20.121  37.951  89.608  1.00 70.28  ? 111 PRO A CG    1 
ATOM   823  C CD    . PRO D 2 24  ? 19.171  36.865  90.079  1.00 48.22  ? 111 PRO A CD    1 
ATOM   824  N N     . LYS D 2 25  ? 16.818  40.736  89.508  1.00 93.70  ? 112 LYS A N     1 
ATOM   825  C CA    . LYS D 2 25  ? 16.158  41.443  88.413  1.00 86.02  ? 112 LYS A CA    1 
ATOM   826  C C     . LYS D 2 25  ? 16.997  41.459  87.136  1.00 99.99  ? 112 LYS A C     1 
ATOM   827  O O     . LYS D 2 25  ? 18.140  41.922  87.138  1.00 91.48  ? 112 LYS A O     1 
ATOM   828  C CB    . LYS D 2 25  ? 15.826  42.875  88.840  1.00 68.50  ? 112 LYS A CB    1 
ATOM   829  C CG    . LYS D 2 25  ? 15.037  43.646  87.809  1.00 95.57  ? 112 LYS A CG    1 
ATOM   830  C CD    . LYS D 2 25  ? 13.798  42.877  87.384  1.00 76.64  ? 112 LYS A CD    1 
ATOM   831  C CE    . LYS D 2 25  ? 13.003  43.681  86.385  1.00 85.74  ? 112 LYS A CE    1 
ATOM   832  N NZ    . LYS D 2 25  ? 13.878  44.101  85.258  1.00 115.70 ? 112 LYS A NZ    1 
ATOM   833  N N     . GLN D 2 26  ? 16.415  40.940  86.056  1.00 113.58 ? 113 GLN A N     1 
ATOM   834  C CA    . GLN D 2 26  ? 17.082  40.862  84.756  1.00 115.44 ? 113 GLN A CA    1 
ATOM   835  C C     . GLN D 2 26  ? 17.802  42.150  84.386  1.00 109.70 ? 113 GLN A C     1 
ATOM   836  O O     . GLN D 2 26  ? 19.014  42.276  84.574  1.00 102.73 ? 113 GLN A O     1 
ATOM   837  C CB    . GLN D 2 26  ? 16.067  40.530  83.661  1.00 124.64 ? 113 GLN A CB    1 
ATOM   838  C CG    . GLN D 2 26  ? 15.256  39.275  83.917  1.00 133.92 ? 113 GLN A CG    1 
ATOM   839  C CD    . GLN D 2 26  ? 14.263  38.985  82.806  1.00 127.64 ? 113 GLN A CD    1 
ATOM   840  O OE1   . GLN D 2 26  ? 13.458  38.058  82.904  1.00 112.63 ? 113 GLN A OE1   1 
ATOM   841  N NE2   . GLN D 2 26  ? 14.319  39.776  81.739  1.00 111.72 ? 113 GLN A NE2   1 
ATOM   842  N N     . ARG D 2 27  ? 17.049  43.106  83.852  1.00 104.96 ? 114 ARG A N     1 
ATOM   843  C CA    . ARG D 2 27  ? 17.616  44.384  83.448  1.00 103.90 ? 114 ARG A CA    1 
ATOM   844  C C     . ARG D 2 27  ? 16.935  45.551  84.143  1.00 95.38  ? 114 ARG A C     1 
ATOM   845  O O     . ARG D 2 27  ? 15.710  45.590  84.252  1.00 90.16  ? 114 ARG A O     1 
ATOM   846  C CB    . ARG D 2 27  ? 17.495  44.570  81.936  1.00 115.67 ? 114 ARG A CB    1 
ATOM   847  C CG    . ARG D 2 27  ? 16.062  44.634  81.428  1.00 129.97 ? 114 ARG A CG    1 
ATOM   848  C CD    . ARG D 2 27  ? 15.689  43.363  80.694  1.00 124.08 ? 114 ARG A CD    1 
ATOM   849  N NE    . ARG D 2 27  ? 16.621  43.090  79.604  1.00 91.04  ? 114 ARG A NE    1 
ATOM   850  C CZ    . ARG D 2 27  ? 16.531  42.047  78.788  1.00 116.30 ? 114 ARG A CZ    1 
ATOM   851  N NH1   . ARG D 2 27  ? 17.427  41.879  77.826  1.00 107.34 ? 114 ARG A NH1   1 
ATOM   852  N NH2   . ARG D 2 27  ? 15.543  41.173  78.933  1.00 125.56 ? 114 ARG A NH2   1 
ATOM   853  N N     . GLY D 2 28  ? 17.743  46.506  84.592  1.00 91.11  ? 115 GLY A N     1 
ATOM   854  C CA    . GLY D 2 28  ? 17.220  47.676  85.270  1.00 93.36  ? 115 GLY A CA    1 
ATOM   855  C C     . GLY D 2 28  ? 18.286  48.278  86.157  1.00 94.81  ? 115 GLY A C     1 
ATOM   856  O O     . GLY D 2 28  ? 18.219  49.450  86.518  1.00 105.57 ? 115 GLY A O     1 
ATOM   857  N N     . MET D 2 29  ? 19.281  47.463  86.495  1.00 98.64  ? 116 MET A N     1 
ATOM   858  C CA    . MET D 2 29  ? 20.380  47.886  87.358  1.00 97.29  ? 116 MET A CA    1 
ATOM   859  C C     . MET D 2 29  ? 21.493  48.586  86.585  1.00 88.01  ? 116 MET A C     1 
ATOM   860  O O     . MET D 2 29  ? 22.097  48.004  85.685  1.00 109.23 ? 116 MET A O     1 
ATOM   861  C CB    . MET D 2 29  ? 20.981  46.676  88.084  1.00 83.08  ? 116 MET A CB    1 
ATOM   862  C CG    . MET D 2 29  ? 19.962  45.729  88.699  1.00 112.30 ? 116 MET A CG    1 
ATOM   863  S SD    . MET D 2 29  ? 18.773  46.525  89.804  1.00 131.57 ? 116 MET A SD    1 
ATOM   864  C CE    . MET D 2 29  ? 17.297  46.566  88.760  1.00 111.41 ? 116 MET A CE    1 
ATOM   865  N N     . ARG D 2 30  ? 21.765  49.834  86.943  1.00 65.68  ? 117 ARG A N     1 
ATOM   866  C CA    . ARG D 2 30  ? 22.829  50.590  86.300  1.00 44.46  ? 117 ARG A CA    1 
ATOM   867  C C     . ARG D 2 30  ? 24.217  50.199  86.829  1.00 45.53  ? 117 ARG A C     1 
ATOM   868  O O     . ARG D 2 30  ? 24.572  50.503  87.970  1.00 48.93  ? 117 ARG A O     1 
ATOM   869  C CB    . ARG D 2 30  ? 22.617  52.097  86.509  1.00 32.28  ? 117 ARG A CB    1 
ATOM   870  C CG    . ARG D 2 30  ? 23.887  52.840  86.915  1.00 83.21  ? 117 ARG A CG    1 
ATOM   871  C CD    . ARG D 2 30  ? 24.226  54.010  86.016  1.00 18.94  ? 117 ARG A CD    1 
ATOM   872  N NE    . ARG D 2 30  ? 23.469  55.211  86.348  1.00 20.43  ? 117 ARG A NE    1 
ATOM   873  C CZ    . ARG D 2 30  ? 23.986  56.436  86.338  1.00 70.63  ? 117 ARG A CZ    1 
ATOM   874  N NH1   . ARG D 2 30  ? 23.224  57.485  86.644  1.00 52.14  ? 117 ARG A NH1   1 
ATOM   875  N NH2   . ARG D 2 30  ? 25.271  56.606  86.045  1.00 11.11  ? 117 ARG A NH2   1 
ATOM   876  N N     . PHE D 2 31  ? 24.998  49.509  86.008  1.00 47.72  ? 118 PHE A N     1 
ATOM   877  C CA    . PHE D 2 31  ? 26.349  49.159  86.415  1.00 51.94  ? 118 PHE A CA    1 
ATOM   878  C C     . PHE D 2 31  ? 27.023  50.504  86.663  1.00 59.71  ? 118 PHE A C     1 
ATOM   879  O O     . PHE D 2 31  ? 26.624  51.515  86.080  1.00 84.37  ? 118 PHE A O     1 
ATOM   880  C CB    . PHE D 2 31  ? 27.083  48.422  85.287  1.00 27.52  ? 118 PHE A CB    1 
ATOM   881  C CG    . PHE D 2 31  ? 26.510  47.062  84.968  1.00 48.43  ? 118 PHE A CG    1 
ATOM   882  C CD1   . PHE D 2 31  ? 27.268  46.119  84.274  1.00 25.71  ? 118 PHE A CD1   1 
ATOM   883  C CD2   . PHE D 2 31  ? 25.225  46.711  85.383  1.00 46.58  ? 118 PHE A CD2   1 
ATOM   884  C CE1   . PHE D 2 31  ? 26.758  44.846  84.009  1.00 44.39  ? 118 PHE A CE1   1 
ATOM   885  C CE2   . PHE D 2 31  ? 24.709  45.443  85.123  1.00 63.28  ? 118 PHE A CE2   1 
ATOM   886  C CZ    . PHE D 2 31  ? 25.475  44.511  84.436  1.00 41.98  ? 118 PHE A CZ    1 
ATOM   887  N N     . ARG D 2 32  ? 28.026  50.534  87.531  1.00 72.80  ? 119 ARG A N     1 
ATOM   888  C CA    . ARG D 2 32  ? 28.728  51.784  87.801  1.00 63.42  ? 119 ARG A CA    1 
ATOM   889  C C     . ARG D 2 32  ? 30.231  51.549  87.702  1.00 66.65  ? 119 ARG A C     1 
ATOM   890  O O     . ARG D 2 32  ? 30.701  50.426  87.860  1.00 42.70  ? 119 ARG A O     1 
ATOM   891  C CB    . ARG D 2 32  ? 28.312  52.346  89.176  1.00 39.66  ? 119 ARG A CB    1 
ATOM   892  C CG    . ARG D 2 32  ? 26.789  52.581  89.257  1.00 30.46  ? 119 ARG A CG    1 
ATOM   893  C CD    . ARG D 2 32  ? 26.349  53.497  90.394  1.00 81.76  ? 119 ARG A CD    1 
ATOM   894  N NE    . ARG D 2 32  ? 26.020  54.862  89.964  1.00 30.51  ? 119 ARG A NE    1 
ATOM   895  C CZ    . ARG D 2 32  ? 24.790  55.331  89.768  1.00 66.71  ? 119 ARG A CZ    1 
ATOM   896  N NH1   . ARG D 2 32  ? 24.618  56.589  89.389  1.00 60.78  ? 119 ARG A NH1   1 
ATOM   897  N NH2   . ARG D 2 32  ? 23.734  54.552  89.944  1.00 79.36  ? 119 ARG A NH2   1 
ATOM   898  N N     . TYR D 2 33  ? 30.980  52.599  87.390  1.00 54.73  ? 120 TYR A N     1 
ATOM   899  C CA    . TYR D 2 33  ? 32.426  52.467  87.254  1.00 73.93  ? 120 TYR A CA    1 
ATOM   900  C C     . TYR D 2 33  ? 33.098  52.788  88.583  1.00 76.01  ? 120 TYR A C     1 
ATOM   901  O O     . TYR D 2 33  ? 32.461  53.298  89.503  1.00 84.41  ? 120 TYR A O     1 
ATOM   902  C CB    . TYR D 2 33  ? 32.955  53.427  86.177  1.00 91.34  ? 120 TYR A CB    1 
ATOM   903  C CG    . TYR D 2 33  ? 32.352  53.256  84.790  1.00 76.51  ? 120 TYR A CG    1 
ATOM   904  C CD1   . TYR D 2 33  ? 33.139  52.843  83.709  1.00 68.39  ? 120 TYR A CD1   1 
ATOM   905  C CD2   . TYR D 2 33  ? 31.007  53.533  84.551  1.00 67.82  ? 120 TYR A CD2   1 
ATOM   906  C CE1   . TYR D 2 33  ? 32.600  52.714  82.430  1.00 65.69  ? 120 TYR A CE1   1 
ATOM   907  C CE2   . TYR D 2 33  ? 30.460  53.405  83.275  1.00 77.95  ? 120 TYR A CE2   1 
ATOM   908  C CZ    . TYR D 2 33  ? 31.262  52.999  82.223  1.00 56.94  ? 120 TYR A CZ    1 
ATOM   909  O OH    . TYR D 2 33  ? 30.726  52.910  80.964  1.00 62.58  ? 120 TYR A OH    1 
ATOM   910  N N     . GLU D 2 34  ? 34.385  52.486  88.689  1.00 57.80  ? 121 GLU A N     1 
ATOM   911  C CA    . GLU D 2 34  ? 35.106  52.792  89.912  1.00 65.47  ? 121 GLU A CA    1 
ATOM   912  C C     . GLU D 2 34  ? 35.413  54.277  89.855  1.00 52.64  ? 121 GLU A C     1 
ATOM   913  O O     . GLU D 2 34  ? 36.196  54.796  90.645  1.00 68.46  ? 121 GLU A O     1 
ATOM   914  C CB    . GLU D 2 34  ? 36.406  51.985  90.003  1.00 86.08  ? 121 GLU A CB    1 
ATOM   915  C CG    . GLU D 2 34  ? 37.398  52.255  88.892  1.00 133.27 ? 121 GLU A CG    1 
ATOM   916  C CD    . GLU D 2 34  ? 38.596  51.332  88.961  1.00 140.33 ? 121 GLU A CD    1 
ATOM   917  O OE1   . GLU D 2 34  ? 38.389  50.100  89.000  1.00 140.73 ? 121 GLU A OE1   1 
ATOM   918  O OE2   . GLU D 2 34  ? 39.740  51.835  88.973  1.00 140.73 ? 121 GLU A OE2   1 
ATOM   919  N N     . CYS D 2 35  ? 34.787  54.949  88.895  1.00 67.11  ? 122 CYS A N     1 
ATOM   920  C CA    . CYS D 2 35  ? 34.962  56.384  88.692  1.00 68.55  ? 122 CYS A CA    1 
ATOM   921  C C     . CYS D 2 35  ? 33.823  57.111  89.390  1.00 71.45  ? 122 CYS A C     1 
ATOM   922  O O     . CYS D 2 35  ? 33.972  58.241  89.855  1.00 59.74  ? 122 CYS A O     1 
ATOM   923  C CB    . CYS D 2 35  ? 34.970  56.701  87.187  1.00 102.15 ? 122 CYS A CB    1 
ATOM   924  S SG    . CYS D 2 35  ? 33.646  57.790  86.567  1.00 83.67  ? 122 CYS A SG    1 
ATOM   925  N N     . GLU D 2 36  ? 32.681  56.444  89.464  1.00 72.07  ? 123 GLU A N     1 
ATOM   926  C CA    . GLU D 2 36  ? 31.524  57.022  90.115  1.00 75.14  ? 123 GLU A CA    1 
ATOM   927  C C     . GLU D 2 36  ? 31.612  56.747  91.605  1.00 86.98  ? 123 GLU A C     1 
ATOM   928  O O     . GLU D 2 36  ? 30.713  57.125  92.358  1.00 90.66  ? 123 GLU A O     1 
ATOM   929  C CB    . GLU D 2 36  ? 30.242  56.410  89.564  1.00 74.63  ? 123 GLU A CB    1 
ATOM   930  C CG    . GLU D 2 36  ? 29.898  56.827  88.160  1.00 60.07  ? 123 GLU A CG    1 
ATOM   931  C CD    . GLU D 2 36  ? 28.652  56.136  87.662  1.00 95.86  ? 123 GLU A CD    1 
ATOM   932  O OE1   . GLU D 2 36  ? 28.683  54.889  87.548  1.00 67.72  ? 123 GLU A OE1   1 
ATOM   933  O OE2   . GLU D 2 36  ? 27.648  56.836  87.398  1.00 89.05  ? 123 GLU A OE2   1 
ATOM   934  N N     . GLY D 2 37  ? 32.693  56.086  92.021  1.00 72.77  ? 124 GLY A N     1 
ATOM   935  C CA    . GLY D 2 37  ? 32.875  55.766  93.427  1.00 78.67  ? 124 GLY A CA    1 
ATOM   936  C C     . GLY D 2 37  ? 31.608  55.270  94.112  1.00 81.44  ? 124 GLY A C     1 
ATOM   937  O O     . GLY D 2 37  ? 30.760  56.056  94.527  1.00 80.54  ? 124 GLY A O     1 
ATOM   938  N N     . ARG D 2 38  ? 31.469  53.956  94.225  1.00 78.02  ? 125 ARG A N     1 
ATOM   939  C CA    . ARG D 2 38  ? 30.305  53.374  94.875  1.00 82.32  ? 125 ARG A CA    1 
ATOM   940  C C     . ARG D 2 38  ? 30.721  52.078  95.543  1.00 82.08  ? 125 ARG A C     1 
ATOM   941  O O     . ARG D 2 38  ? 31.840  51.608  95.356  1.00 79.20  ? 125 ARG A O     1 
ATOM   942  C CB    . ARG D 2 38  ? 29.197  53.108  93.853  1.00 98.40  ? 125 ARG A CB    1 
ATOM   943  C CG    . ARG D 2 38  ? 28.548  54.365  93.276  1.00 123.03 ? 125 ARG A CG    1 
ATOM   944  C CD    . ARG D 2 38  ? 27.915  55.198  94.376  1.00 105.79 ? 125 ARG A CD    1 
ATOM   945  N NE    . ARG D 2 38  ? 26.836  56.066  93.904  1.00 87.99  ? 125 ARG A NE    1 
ATOM   946  C CZ    . ARG D 2 38  ? 27.001  57.167  93.180  1.00 47.54  ? 125 ARG A CZ    1 
ATOM   947  N NH1   . ARG D 2 38  ? 28.216  57.563  92.827  1.00 36.79  ? 125 ARG A NH1   1 
ATOM   948  N NH2   . ARG D 2 38  ? 25.944  57.888  92.837  1.00 45.08  ? 125 ARG A NH2   1 
ATOM   949  N N     . SER D 2 39  ? 29.824  51.502  96.330  1.00 95.30  ? 126 SER A N     1 
ATOM   950  C CA    . SER D 2 39  ? 30.133  50.260  97.018  1.00 94.36  ? 126 SER A CA    1 
ATOM   951  C C     . SER D 2 39  ? 28.894  49.397  97.237  1.00 100.29 ? 126 SER A C     1 
ATOM   952  O O     . SER D 2 39  ? 28.978  48.175  97.237  1.00 94.29  ? 126 SER A O     1 
ATOM   953  C CB    . SER D 2 39  ? 30.801  50.573  98.353  1.00 80.04  ? 126 SER A CB    1 
ATOM   954  O OG    . SER D 2 39  ? 31.953  51.371  98.152  1.00 86.55  ? 126 SER A OG    1 
ATOM   955  N N     . ALA D 2 40  ? 27.743  50.037  97.408  1.00 95.53  ? 127 ALA A N     1 
ATOM   956  C CA    . ALA D 2 40  ? 26.502  49.313  97.631  1.00 83.45  ? 127 ALA A CA    1 
ATOM   957  C C     . ALA D 2 40  ? 25.505  49.562  96.511  1.00 69.72  ? 127 ALA A C     1 
ATOM   958  O O     . ALA D 2 40  ? 25.264  50.700  96.128  1.00 72.47  ? 127 ALA A O     1 
ATOM   959  C CB    . ALA D 2 40  ? 25.900  49.729  98.957  1.00 98.22  ? 127 ALA A CB    1 
ATOM   960  N N     . GLY D 2 41  ? 24.916  48.492  95.990  1.00 86.40  ? 128 GLY A N     1 
ATOM   961  C CA    . GLY D 2 41  ? 23.941  48.636  94.922  1.00 82.30  ? 128 GLY A CA    1 
ATOM   962  C C     . GLY D 2 41  ? 22.513  48.604  95.427  1.00 58.37  ? 128 GLY A C     1 
ATOM   963  O O     . GLY D 2 41  ? 22.232  49.025  96.542  1.00 54.08  ? 128 GLY A O     1 
ATOM   964  N N     . SER D 2 42  ? 21.607  48.097  94.605  1.00 52.01  ? 129 SER A N     1 
ATOM   965  C CA    . SER D 2 42  ? 20.203  48.018  94.979  1.00 43.37  ? 129 SER A CA    1 
ATOM   966  C C     . SER D 2 42  ? 19.489  46.888  94.252  1.00 62.41  ? 129 SER A C     1 
ATOM   967  O O     . SER D 2 42  ? 18.268  46.736  94.374  1.00 70.72  ? 129 SER A O     1 
ATOM   968  C CB    . SER D 2 42  ? 19.508  49.337  94.673  1.00 58.75  ? 129 SER A CB    1 
ATOM   969  O OG    . SER D 2 42  ? 20.078  50.369  95.447  1.00 39.70  ? 129 SER A OG    1 
ATOM   970  N N     . ILE D 2 43  ? 20.261  46.116  93.488  1.00 42.09  ? 130 ILE A N     1 
ATOM   971  C CA    . ILE D 2 43  ? 19.749  44.981  92.739  1.00 17.46  ? 130 ILE A CA    1 
ATOM   972  C C     . ILE D 2 43  ? 18.476  44.425  93.372  1.00 48.41  ? 130 ILE A C     1 
ATOM   973  O O     . ILE D 2 43  ? 18.408  44.235  94.592  1.00 64.87  ? 130 ILE A O     1 
ATOM   974  C CB    . ILE D 2 43  ? 20.776  43.838  92.700  1.00 48.45  ? 130 ILE A CB    1 
ATOM   975  C CG1   . ILE D 2 43  ? 22.028  44.270  91.921  1.00 53.94  ? 130 ILE A CG1   1 
ATOM   976  C CG2   . ILE D 2 43  ? 20.116  42.583  92.128  1.00 29.31  ? 130 ILE A CG2   1 
ATOM   977  C CD1   . ILE D 2 43  ? 23.090  43.165  91.760  1.00 33.24  ? 130 ILE A CD1   1 
ATOM   978  N N     . LEU D 2 44  ? 17.471  44.161  92.542  1.00 85.07  ? 131 LEU A N     1 
ATOM   979  C CA    . LEU D 2 44  ? 16.205  43.622  93.028  1.00 106.16 ? 131 LEU A CA    1 
ATOM   980  C C     . LEU D 2 44  ? 16.025  42.181  92.554  1.00 116.04 ? 131 LEU A C     1 
ATOM   981  O O     . LEU D 2 44  ? 16.902  41.612  91.898  1.00 99.04  ? 131 LEU A O     1 
ATOM   982  C CB    . LEU D 2 44  ? 15.029  44.475  92.533  1.00 103.83 ? 131 LEU A CB    1 
ATOM   983  C CG    . LEU D 2 44  ? 15.029  45.988  92.793  1.00 87.05  ? 131 LEU A CG    1 
ATOM   984  C CD1   . LEU D 2 44  ? 15.357  46.265  94.240  1.00 71.11  ? 131 LEU A CD1   1 
ATOM   985  C CD2   . LEU D 2 44  ? 16.043  46.665  91.898  1.00 80.27  ? 131 LEU A CD2   1 
ATOM   986  N N     . GLY D 2 45  ? 14.886  41.591  92.896  1.00 113.19 ? 132 GLY A N     1 
ATOM   987  C CA    . GLY D 2 45  ? 14.620  40.228  92.486  1.00 96.93  ? 132 GLY A CA    1 
ATOM   988  C C     . GLY D 2 45  ? 13.711  40.190  91.275  1.00 99.96  ? 132 GLY A C     1 
ATOM   989  O O     . GLY D 2 45  ? 12.630  40.775  91.297  1.00 116.94 ? 132 GLY A O     1 
ATOM   990  N N     . GLU D 2 46  ? 14.162  39.508  90.224  1.00 109.18 ? 133 GLU A N     1 
ATOM   991  C CA    . GLU D 2 46  ? 13.427  39.355  88.964  1.00 107.77 ? 133 GLU A CA    1 
ATOM   992  C C     . GLU D 2 46  ? 12.016  39.943  88.981  1.00 105.47 ? 133 GLU A C     1 
ATOM   993  O O     . GLU D 2 46  ? 11.686  40.832  88.186  1.00 96.91  ? 133 GLU A O     1 
ATOM   994  C CB    . GLU D 2 46  ? 13.363  37.869  88.586  1.00 84.10  ? 133 GLU A CB    1 
ATOM   995  C CG    . GLU D 2 46  ? 12.703  37.002  89.651  1.00 118.80 ? 133 GLU A CG    1 
ATOM   996  C CD    . GLU D 2 46  ? 12.929  35.521  89.434  1.00 126.30 ? 133 GLU A CD    1 
ATOM   997  O OE1   . GLU D 2 46  ? 12.631  35.034  88.323  1.00 132.09 ? 133 GLU A OE1   1 
ATOM   998  O OE2   . GLU D 2 46  ? 13.399  34.843  90.375  1.00 77.64  ? 133 GLU A OE2   1 
ATOM   999  N N     . SER D 2 47  ? 11.187  39.444  89.892  1.00 104.61 ? 134 SER A N     1 
ATOM   1000 C CA    . SER D 2 47  ? 9.816   39.910  90.021  1.00 116.90 ? 134 SER A CA    1 
ATOM   1001 C C     . SER D 2 47  ? 9.635   40.729  91.294  1.00 118.70 ? 134 SER A C     1 
ATOM   1002 O O     . SER D 2 47  ? 9.119   40.235  92.297  1.00 135.01 ? 134 SER A O     1 
ATOM   1003 C CB    . SER D 2 47  ? 8.860   38.715  90.025  1.00 125.46 ? 134 SER A CB    1 
ATOM   1004 O OG    . SER D 2 47  ? 9.236   37.772  91.012  1.00 138.28 ? 134 SER A OG    1 
ATOM   1005 N N     . SER D 2 48  ? 10.070  41.985  91.251  1.00 106.12 ? 135 SER A N     1 
ATOM   1006 C CA    . SER D 2 48  ? 9.945   42.868  92.403  1.00 106.06 ? 135 SER A CA    1 
ATOM   1007 C C     . SER D 2 48  ? 8.636   43.645  92.367  1.00 103.88 ? 135 SER A C     1 
ATOM   1008 O O     . SER D 2 48  ? 7.573   43.069  92.142  1.00 102.54 ? 135 SER A O     1 
ATOM   1009 C CB    . SER D 2 48  ? 11.129  43.838  92.462  1.00 121.87 ? 135 SER A CB    1 
ATOM   1010 O OG    . SER D 2 48  ? 12.324  43.168  92.827  1.00 107.50 ? 135 SER A OG    1 
ATOM   1011 N N     . THR D 2 49  ? 8.724   44.951  92.594  1.00 95.89  ? 136 THR A N     1 
ATOM   1012 C CA    . THR D 2 49  ? 7.557   45.825  92.600  1.00 107.57 ? 136 THR A CA    1 
ATOM   1013 C C     . THR D 2 49  ? 7.955   47.193  93.128  1.00 114.93 ? 136 THR A C     1 
ATOM   1014 O O     . THR D 2 49  ? 8.754   47.296  94.061  1.00 87.24  ? 136 THR A O     1 
ATOM   1015 C CB    . THR D 2 49  ? 6.434   45.277  93.504  1.00 128.59 ? 136 THR A CB    1 
ATOM   1016 O OG1   . THR D 2 49  ? 5.369   46.235  93.576  1.00 137.22 ? 136 THR A OG1   1 
ATOM   1017 C CG2   . THR D 2 49  ? 6.961   44.998  94.909  1.00 88.59  ? 136 THR A CG2   1 
ATOM   1018 N N     . GLU D 2 50  ? 7.395   48.242  92.535  1.00 133.14 ? 137 GLU A N     1 
ATOM   1019 C CA    . GLU D 2 50  ? 7.706   49.601  92.961  1.00 140.73 ? 137 GLU A CA    1 
ATOM   1020 C C     . GLU D 2 50  ? 7.368   49.775  94.440  1.00 140.73 ? 137 GLU A C     1 
ATOM   1021 O O     . GLU D 2 50  ? 7.861   50.692  95.099  1.00 140.73 ? 137 GLU A O     1 
ATOM   1022 C CB    . GLU D 2 50  ? 6.939   50.618  92.104  1.00 134.86 ? 137 GLU A CB    1 
ATOM   1023 C CG    . GLU D 2 50  ? 5.426   50.525  92.192  1.00 139.86 ? 137 GLU A CG    1 
ATOM   1024 C CD    . GLU D 2 50  ? 4.888   51.094  93.488  1.00 140.73 ? 137 GLU A CD    1 
ATOM   1025 O OE1   . GLU D 2 50  ? 5.152   52.283  93.769  1.00 140.73 ? 137 GLU A OE1   1 
ATOM   1026 O OE2   . GLU D 2 50  ? 4.202   50.353  94.224  1.00 140.73 ? 137 GLU A OE2   1 
ATOM   1027 N N     . ALA D 2 51  ? 6.530   48.880  94.956  1.00 140.73 ? 138 ALA A N     1 
ATOM   1028 C CA    . ALA D 2 51  ? 6.132   48.916  96.357  1.00 140.73 ? 138 ALA A CA    1 
ATOM   1029 C C     . ALA D 2 51  ? 7.152   48.142  97.188  1.00 140.73 ? 138 ALA A C     1 
ATOM   1030 O O     . ALA D 2 51  ? 8.334   48.488  97.208  1.00 140.73 ? 138 ALA A O     1 
ATOM   1031 C CB    . ALA D 2 51  ? 4.744   48.310  96.521  1.00 126.36 ? 138 ALA A CB    1 
ATOM   1032 N N     . SER D 2 52  ? 6.693   47.096  97.870  1.00 140.73 ? 139 SER A N     1 
ATOM   1033 C CA    . SER D 2 52  ? 7.571   46.269  98.695  1.00 134.93 ? 139 SER A CA    1 
ATOM   1034 C C     . SER D 2 52  ? 8.496   45.442  97.802  1.00 130.78 ? 139 SER A C     1 
ATOM   1035 O O     . SER D 2 52  ? 8.457   44.211  97.809  1.00 138.22 ? 139 SER A O     1 
ATOM   1036 C CB    . SER D 2 52  ? 6.737   45.345  99.593  1.00 106.75 ? 139 SER A CB    1 
ATOM   1037 O OG    . SER D 2 52  ? 5.881   44.515  98.824  1.00 137.59 ? 139 SER A OG    1 
ATOM   1038 N N     . LYS D 2 53  ? 9.328   46.137  97.034  1.00 123.03 ? 140 LYS A N     1 
ATOM   1039 C CA    . LYS D 2 53  ? 10.261  45.499  96.118  1.00 117.52 ? 140 LYS A CA    1 
ATOM   1040 C C     . LYS D 2 53  ? 11.044  44.352  96.749  1.00 107.94 ? 140 LYS A C     1 
ATOM   1041 O O     . LYS D 2 53  ? 11.796  44.542  97.706  1.00 91.28  ? 140 LYS A O     1 
ATOM   1042 C CB    . LYS D 2 53  ? 11.220  46.551  95.551  1.00 132.07 ? 140 LYS A CB    1 
ATOM   1043 C CG    . LYS D 2 53  ? 11.909  47.401  96.610  1.00 134.74 ? 140 LYS A CG    1 
ATOM   1044 C CD    . LYS D 2 53  ? 12.313  48.779  96.078  1.00 126.80 ? 140 LYS A CD    1 
ATOM   1045 C CE    . LYS D 2 53  ? 13.391  48.710  95.002  1.00 105.27 ? 140 LYS A CE    1 
ATOM   1046 N NZ    . LYS D 2 53  ? 12.936  48.060  93.737  1.00 114.41 ? 140 LYS A NZ    1 
ATOM   1047 N N     . THR D 2 54  ? 10.851  43.156  96.200  1.00 113.00 ? 141 THR A N     1 
ATOM   1048 C CA    . THR D 2 54  ? 11.533  41.960  96.678  1.00 109.89 ? 141 THR A CA    1 
ATOM   1049 C C     . THR D 2 54  ? 13.042  42.137  96.526  1.00 102.66 ? 141 THR A C     1 
ATOM   1050 O O     . THR D 2 54  ? 13.514  43.203  96.133  1.00 97.23  ? 141 THR A O     1 
ATOM   1051 C CB    . THR D 2 54  ? 11.089  40.714  95.878  1.00 94.05  ? 141 THR A CB    1 
ATOM   1052 O OG1   . THR D 2 54  ? 11.727  39.547  96.409  1.00 109.96 ? 141 THR A OG1   1 
ATOM   1053 C CG2   . THR D 2 54  ? 11.469  40.858  94.420  1.00 119.63 ? 141 THR A CG2   1 
ATOM   1054 N N     . GLN D 2 55  ? 13.797  41.090  96.839  1.00 83.78  ? 142 GLN A N     1 
ATOM   1055 C CA    . GLN D 2 55  ? 15.246  41.139  96.732  1.00 70.89  ? 142 GLN A CA    1 
ATOM   1056 C C     . GLN D 2 55  ? 15.799  39.760  96.412  1.00 65.84  ? 142 GLN A C     1 
ATOM   1057 O O     . GLN D 2 55  ? 15.103  38.758  96.563  1.00 82.50  ? 142 GLN A O     1 
ATOM   1058 C CB    . GLN D 2 55  ? 15.857  41.638  98.043  1.00 59.73  ? 142 GLN A CB    1 
ATOM   1059 C CG    . GLN D 2 55  ? 15.416  43.042  98.440  1.00 80.39  ? 142 GLN A CG    1 
ATOM   1060 C CD    . GLN D 2 55  ? 16.244  43.625  99.582  1.00 99.92  ? 142 GLN A CD    1 
ATOM   1061 O OE1   . GLN D 2 55  ? 15.976  44.734  100.057 1.00 103.10 ? 142 GLN A OE1   1 
ATOM   1062 N NE2   . GLN D 2 55  ? 17.258  42.882  100.025 1.00 89.28  ? 142 GLN A NE2   1 
ATOM   1063 N N     . PRO D 2 56  ? 17.062  39.693  95.954  1.00 66.54  ? 143 PRO A N     1 
ATOM   1064 C CA    . PRO D 2 56  ? 17.744  38.438  95.605  1.00 77.64  ? 143 PRO A CA    1 
ATOM   1065 C C     . PRO D 2 56  ? 17.880  37.503  96.810  1.00 104.82 ? 143 PRO A C     1 
ATOM   1066 O O     . PRO D 2 56  ? 18.801  37.650  97.614  1.00 124.49 ? 143 PRO A O     1 
ATOM   1067 C CB    . PRO D 2 56  ? 19.106  38.913  95.116  1.00 34.90  ? 143 PRO A CB    1 
ATOM   1068 C CG    . PRO D 2 56  ? 18.819  40.262  94.561  1.00 36.86  ? 143 PRO A CG    1 
ATOM   1069 C CD    . PRO D 2 56  ? 17.892  40.854  95.580  1.00 38.19  ? 143 PRO A CD    1 
ATOM   1070 N N     . ALA D 2 57  ? 16.971  36.540  96.926  1.00 125.96 ? 144 ALA A N     1 
ATOM   1071 C CA    . ALA D 2 57  ? 16.996  35.601  98.045  1.00 136.83 ? 144 ALA A CA    1 
ATOM   1072 C C     . ALA D 2 57  ? 17.235  34.156  97.608  1.00 140.73 ? 144 ALA A C     1 
ATOM   1073 O O     . ALA D 2 57  ? 16.644  33.679  96.636  1.00 140.73 ? 144 ALA A O     1 
ATOM   1074 C CB    . ALA D 2 57  ? 15.685  35.700  98.835  1.00 96.93  ? 144 ALA A CB    1 
ATOM   1075 N N     . ILE D 2 58  ? 18.103  33.464  98.339  1.00 138.58 ? 145 ILE A N     1 
ATOM   1076 C CA    . ILE D 2 58  ? 18.426  32.072  98.044  1.00 132.73 ? 145 ILE A CA    1 
ATOM   1077 C C     . ILE D 2 58  ? 18.431  31.247  99.335  1.00 127.50 ? 145 ILE A C     1 
ATOM   1078 O O     . ILE D 2 58  ? 18.644  31.786  100.418 1.00 108.60 ? 145 ILE A O     1 
ATOM   1079 C CB    . ILE D 2 58  ? 19.811  31.965  97.342  1.00 135.63 ? 145 ILE A CB    1 
ATOM   1080 C CG1   . ILE D 2 58  ? 20.944  32.337  98.306  1.00 128.27 ? 145 ILE A CG1   1 
ATOM   1081 C CG2   . ILE D 2 58  ? 19.854  32.904  96.151  1.00 119.18 ? 145 ILE A CG2   1 
ATOM   1082 C CD1   . ILE D 2 58  ? 21.626  31.141  98.970  1.00 64.63  ? 145 ILE A CD1   1 
ATOM   1083 N N     . GLU D 2 59  ? 18.178  29.946  99.214  1.00 126.67 ? 146 GLU A N     1 
ATOM   1084 C CA    . GLU D 2 59  ? 18.166  29.049  100.369 1.00 128.64 ? 146 GLU A CA    1 
ATOM   1085 C C     . GLU D 2 59  ? 19.009  27.805  100.114 1.00 126.42 ? 146 GLU A C     1 
ATOM   1086 O O     . GLU D 2 59  ? 19.575  27.632  99.033  1.00 120.51 ? 146 GLU A O     1 
ATOM   1087 C CB    . GLU D 2 59  ? 16.735  28.617  100.719 1.00 117.58 ? 146 GLU A CB    1 
ATOM   1088 C CG    . GLU D 2 59  ? 15.872  29.705  101.343 1.00 132.12 ? 146 GLU A CG    1 
ATOM   1089 C CD    . GLU D 2 59  ? 14.561  29.164  101.895 1.00 140.73 ? 146 GLU A CD    1 
ATOM   1090 O OE1   . GLU D 2 59  ? 14.598  28.289  102.789 1.00 140.73 ? 146 GLU A OE1   1 
ATOM   1091 O OE2   . GLU D 2 59  ? 13.494  29.615  101.434 1.00 131.55 ? 146 GLU A OE2   1 
ATOM   1092 N N     . LEU D 2 60  ? 19.085  26.939  101.120 1.00 125.54 ? 147 LEU A N     1 
ATOM   1093 C CA    . LEU D 2 60  ? 19.856  25.706  101.014 1.00 133.48 ? 147 LEU A CA    1 
ATOM   1094 C C     . LEU D 2 60  ? 18.952  24.492  101.193 1.00 128.22 ? 147 LEU A C     1 
ATOM   1095 O O     . LEU D 2 60  ? 18.006  24.517  101.980 1.00 139.05 ? 147 LEU A O     1 
ATOM   1096 C CB    . LEU D 2 60  ? 20.962  25.670  102.077 1.00 132.87 ? 147 LEU A CB    1 
ATOM   1097 C CG    . LEU D 2 60  ? 22.087  26.714  102.057 1.00 116.66 ? 147 LEU A CG    1 
ATOM   1098 C CD1   . LEU D 2 60  ? 22.855  26.639  103.373 1.00 87.41  ? 147 LEU A CD1   1 
ATOM   1099 C CD2   . LEU D 2 60  ? 23.020  26.479  100.877 1.00 69.11  ? 147 LEU A CD2   1 
ATOM   1100 N N     . ARG D 2 61  ? 19.249  23.432  100.454 1.00 111.87 ? 148 ARG A N     1 
ATOM   1101 C CA    . ARG D 2 61  ? 18.482  22.202  100.544 1.00 103.52 ? 148 ARG A CA    1 
ATOM   1102 C C     . ARG D 2 61  ? 19.437  21.032  100.768 1.00 97.95  ? 148 ARG A C     1 
ATOM   1103 O O     . ARG D 2 61  ? 20.377  20.835  99.993  1.00 82.40  ? 148 ARG A O     1 
ATOM   1104 C CB    . ARG D 2 61  ? 17.654  22.008  99.270  1.00 104.21 ? 148 ARG A CB    1 
ATOM   1105 C CG    . ARG D 2 61  ? 16.444  22.930  99.201  1.00 108.51 ? 148 ARG A CG    1 
ATOM   1106 C CD    . ARG D 2 61  ? 15.557  22.642  97.993  1.00 80.17  ? 148 ARG A CD    1 
ATOM   1107 N NE    . ARG D 2 61  ? 14.214  23.207  98.146  1.00 98.73  ? 148 ARG A NE    1 
ATOM   1108 C CZ    . ARG D 2 61  ? 13.953  24.494  98.359  1.00 122.83 ? 148 ARG A CZ    1 
ATOM   1109 N NH1   . ARG D 2 61  ? 14.942  25.374  98.444  1.00 131.68 ? 148 ARG A NH1   1 
ATOM   1110 N NH2   . ARG D 2 61  ? 12.698  24.903  98.493  1.00 113.53 ? 148 ARG A NH2   1 
ATOM   1111 N N     . ASP D 2 62  ? 19.192  20.273  101.836 1.00 95.50  ? 149 ASP A N     1 
ATOM   1112 C CA    . ASP D 2 62  ? 20.022  19.127  102.219 1.00 98.48  ? 149 ASP A CA    1 
ATOM   1113 C C     . ASP D 2 62  ? 21.223  19.584  103.045 1.00 100.42 ? 149 ASP A C     1 
ATOM   1114 O O     . ASP D 2 62  ? 22.283  18.947  103.045 1.00 77.70  ? 149 ASP A O     1 
ATOM   1115 C CB    . ASP D 2 62  ? 20.502  18.360  100.986 1.00 82.28  ? 149 ASP A CB    1 
ATOM   1116 C CG    . ASP D 2 62  ? 19.455  17.422  100.449 1.00 102.19 ? 149 ASP A CG    1 
ATOM   1117 O OD1   . ASP D 2 62  ? 18.275  17.830  100.379 1.00 81.09  ? 149 ASP A OD1   1 
ATOM   1118 O OD2   . ASP D 2 62  ? 19.815  16.280  100.093 1.00 84.55  ? 149 ASP A OD2   1 
ATOM   1119 N N     . CYS D 2 63  ? 21.038  20.695  103.751 1.00 98.71  ? 150 CYS A N     1 
ATOM   1120 C CA    . CYS D 2 63  ? 22.079  21.269  104.597 1.00 121.96 ? 150 CYS A CA    1 
ATOM   1121 C C     . CYS D 2 63  ? 22.065  20.617  105.978 1.00 136.48 ? 150 CYS A C     1 
ATOM   1122 O O     . CYS D 2 63  ? 22.773  21.047  106.892 1.00 138.14 ? 150 CYS A O     1 
ATOM   1123 C CB    . CYS D 2 63  ? 21.865  22.781  104.728 1.00 119.72 ? 150 CYS A CB    1 
ATOM   1124 S SG    . CYS D 2 63  ? 20.146  23.269  105.075 1.00 125.00 ? 150 CYS A SG    1 
ATOM   1125 N N     . GLY D 2 64  ? 21.249  19.575  106.115 1.00 140.73 ? 151 GLY A N     1 
ATOM   1126 C CA    . GLY D 2 64  ? 21.142  18.865  107.376 1.00 140.73 ? 151 GLY A CA    1 
ATOM   1127 C C     . GLY D 2 64  ? 22.425  18.145  107.732 1.00 139.20 ? 151 GLY A C     1 
ATOM   1128 O O     . GLY D 2 64  ? 22.985  17.412  106.915 1.00 115.15 ? 151 GLY A O     1 
ATOM   1129 N N     . GLY D 2 65  ? 22.885  18.346  108.962 1.00 138.54 ? 152 GLY A N     1 
ATOM   1130 C CA    . GLY D 2 65  ? 24.114  17.722  109.410 1.00 135.16 ? 152 GLY A CA    1 
ATOM   1131 C C     . GLY D 2 65  ? 25.240  18.723  109.281 1.00 132.83 ? 152 GLY A C     1 
ATOM   1132 O O     . GLY D 2 65  ? 26.363  18.482  109.723 1.00 139.07 ? 152 GLY A O     1 
ATOM   1133 N N     . LEU D 2 66  ? 24.925  19.859  108.666 1.00 123.70 ? 153 LEU A N     1 
ATOM   1134 C CA    . LEU D 2 66  ? 25.893  20.926  108.463 1.00 126.71 ? 153 LEU A CA    1 
ATOM   1135 C C     . LEU D 2 66  ? 25.828  21.915  109.621 1.00 135.03 ? 153 LEU A C     1 
ATOM   1136 O O     . LEU D 2 66  ? 24.767  22.124  110.204 1.00 138.45 ? 153 LEU A O     1 
ATOM   1137 C CB    . LEU D 2 66  ? 25.610  21.647  107.142 1.00 117.65 ? 153 LEU A CB    1 
ATOM   1138 C CG    . LEU D 2 66  ? 25.766  20.829  105.856 1.00 108.76 ? 153 LEU A CG    1 
ATOM   1139 C CD1   . LEU D 2 66  ? 25.335  21.674  104.659 1.00 82.37  ? 153 LEU A CD1   1 
ATOM   1140 C CD2   . LEU D 2 66  ? 27.215  20.375  105.704 1.00 79.13  ? 153 LEU A CD2   1 
ATOM   1141 N N     . ARG D 2 67  ? 26.967  22.523  109.944 1.00 138.27 ? 154 ARG A N     1 
ATOM   1142 C CA    . ARG D 2 67  ? 27.048  23.485  111.040 1.00 135.18 ? 154 ARG A CA    1 
ATOM   1143 C C     . ARG D 2 67  ? 27.019  24.931  110.548 1.00 128.32 ? 154 ARG A C     1 
ATOM   1144 O O     . ARG D 2 67  ? 26.209  25.739  111.005 1.00 124.77 ? 154 ARG A O     1 
ATOM   1145 C CB    . ARG D 2 67  ? 28.313  23.233  111.849 1.00 132.75 ? 154 ARG A CB    1 
ATOM   1146 N N     . GLU D 2 68  ? 27.915  25.252  109.623 1.00 119.52 ? 155 GLU A N     1 
ATOM   1147 C CA    . GLU D 2 68  ? 27.998  26.592  109.057 1.00 114.85 ? 155 GLU A CA    1 
ATOM   1148 C C     . GLU D 2 68  ? 28.511  26.496  107.625 1.00 114.80 ? 155 GLU A C     1 
ATOM   1149 O O     . GLU D 2 68  ? 29.485  25.793  107.351 1.00 103.77 ? 155 GLU A O     1 
ATOM   1150 C CB    . GLU D 2 68  ? 28.933  27.474  109.893 1.00 115.26 ? 155 GLU A CB    1 
ATOM   1151 C CG    . GLU D 2 68  ? 30.317  26.877  110.136 1.00 140.73 ? 155 GLU A CG    1 
ATOM   1152 C CD    . GLU D 2 68  ? 30.332  25.867  111.274 1.00 140.73 ? 155 GLU A CD    1 
ATOM   1153 O OE1   . GLU D 2 68  ? 31.332  25.128  111.411 1.00 140.73 ? 155 GLU A OE1   1 
ATOM   1154 O OE2   . GLU D 2 68  ? 29.346  25.821  112.041 1.00 140.73 ? 155 GLU A OE2   1 
ATOM   1155 N N     . VAL D 2 69  ? 27.850  27.206  106.717 1.00 130.61 ? 156 VAL A N     1 
ATOM   1156 C CA    . VAL D 2 69  ? 28.222  27.199  105.305 1.00 133.30 ? 156 VAL A CA    1 
ATOM   1157 C C     . VAL D 2 69  ? 28.503  28.609  104.785 1.00 139.56 ? 156 VAL A C     1 
ATOM   1158 O O     . VAL D 2 69  ? 27.938  29.585  105.279 1.00 140.73 ? 156 VAL A O     1 
ATOM   1159 C CB    . VAL D 2 69  ? 27.099  26.561  104.459 1.00 98.64  ? 156 VAL A CB    1 
ATOM   1160 C CG1   . VAL D 2 69  ? 27.510  26.499  102.996 1.00 114.23 ? 156 VAL A CG1   1 
ATOM   1161 C CG2   . VAL D 2 69  ? 26.793  25.169  104.984 1.00 127.30 ? 156 VAL A CG2   1 
ATOM   1162 N N     . GLU D 2 70  ? 29.376  28.708  103.785 1.00 131.18 ? 157 GLU A N     1 
ATOM   1163 C CA    . GLU D 2 70  ? 29.735  29.999  103.205 1.00 126.19 ? 157 GLU A CA    1 
ATOM   1164 C C     . GLU D 2 70  ? 29.354  30.092  101.727 1.00 127.60 ? 157 GLU A C     1 
ATOM   1165 O O     . GLU D 2 70  ? 29.604  29.169  100.954 1.00 129.47 ? 157 GLU A O     1 
ATOM   1166 C CB    . GLU D 2 70  ? 31.237  30.239  103.364 1.00 118.14 ? 157 GLU A CB    1 
ATOM   1167 C CG    . GLU D 2 70  ? 32.105  29.261  102.595 1.00 125.45 ? 157 GLU A CG    1 
ATOM   1168 C CD    . GLU D 2 70  ? 33.582  29.461  102.864 1.00 134.93 ? 157 GLU A CD    1 
ATOM   1169 O OE1   . GLU D 2 70  ? 34.080  30.587  102.652 1.00 122.48 ? 157 GLU A OE1   1 
ATOM   1170 O OE2   . GLU D 2 70  ? 34.245  28.490  103.288 1.00 139.43 ? 157 GLU A OE2   1 
ATOM   1171 N N     . VAL D 2 71  ? 28.755  31.219  101.343 1.00 132.78 ? 158 VAL A N     1 
ATOM   1172 C CA    . VAL D 2 71  ? 28.325  31.455  99.964  1.00 109.86 ? 158 VAL A CA    1 
ATOM   1173 C C     . VAL D 2 71  ? 29.358  32.271  99.185  1.00 100.18 ? 158 VAL A C     1 
ATOM   1174 O O     . VAL D 2 71  ? 30.096  33.063  99.764  1.00 104.07 ? 158 VAL A O     1 
ATOM   1175 C CB    . VAL D 2 71  ? 26.973  32.191  99.941  1.00 109.44 ? 158 VAL A CB    1 
ATOM   1176 C CG1   . VAL D 2 71  ? 25.928  31.356  100.663 1.00 62.55  ? 158 VAL A CG1   1 
ATOM   1177 C CG2   . VAL D 2 71  ? 27.108  33.558  100.602 1.00 106.41 ? 158 VAL A CG2   1 
ATOM   1178 N N     . THR D 2 72  ? 29.402  32.082  97.871  1.00 94.75  ? 159 THR A N     1 
ATOM   1179 C CA    . THR D 2 72  ? 30.370  32.788  97.036  1.00 108.55 ? 159 THR A CA    1 
ATOM   1180 C C     . THR D 2 72  ? 29.776  33.353  95.748  1.00 120.66 ? 159 THR A C     1 
ATOM   1181 O O     . THR D 2 72  ? 29.810  32.703  94.700  1.00 135.75 ? 159 THR A O     1 
ATOM   1182 C CB    . THR D 2 72  ? 31.553  31.854  96.666  1.00 115.94 ? 159 THR A CB    1 
ATOM   1183 O OG1   . THR D 2 72  ? 32.266  31.496  97.854  1.00 131.36 ? 159 THR A OG1   1 
ATOM   1184 C CG2   . THR D 2 72  ? 32.508  32.537  95.697  1.00 127.47 ? 159 THR A CG2   1 
ATOM   1185 N N     . ALA D 2 73  ? 29.241  34.568  95.831  1.00 120.41 ? 160 ALA A N     1 
ATOM   1186 C CA    . ALA D 2 73  ? 28.657  35.241  94.674  1.00 100.02 ? 160 ALA A CA    1 
ATOM   1187 C C     . ALA D 2 73  ? 29.791  35.891  93.878  1.00 87.30  ? 160 ALA A C     1 
ATOM   1188 O O     . ALA D 2 73  ? 30.620  36.596  94.446  1.00 97.79  ? 160 ALA A O     1 
ATOM   1189 C CB    . ALA D 2 73  ? 27.648  36.306  95.137  1.00 34.45  ? 160 ALA A CB    1 
ATOM   1190 N N     . CYS D 2 74  ? 29.828  35.646  92.570  1.00 72.17  ? 161 CYS A N     1 
ATOM   1191 C CA    . CYS D 2 74  ? 30.869  36.200  91.700  1.00 67.51  ? 161 CYS A CA    1 
ATOM   1192 C C     . CYS D 2 74  ? 30.353  36.383  90.265  1.00 81.27  ? 161 CYS A C     1 
ATOM   1193 O O     . CYS D 2 74  ? 29.440  35.677  89.832  1.00 78.48  ? 161 CYS A O     1 
ATOM   1194 C CB    . CYS D 2 74  ? 32.087  35.270  91.703  1.00 37.43  ? 161 CYS A CB    1 
ATOM   1195 S SG    . CYS D 2 74  ? 33.472  35.809  90.674  1.00 109.35 ? 161 CYS A SG    1 
ATOM   1196 N N     . LEU D 2 75  ? 30.948  37.318  89.526  1.00 84.87  ? 162 LEU A N     1 
ATOM   1197 C CA    . LEU D 2 75  ? 30.523  37.592  88.153  1.00 79.25  ? 162 LEU A CA    1 
ATOM   1198 C C     . LEU D 2 75  ? 31.258  36.838  87.047  1.00 80.30  ? 162 LEU A C     1 
ATOM   1199 O O     . LEU D 2 75  ? 32.475  36.949  86.906  1.00 107.79 ? 162 LEU A O     1 
ATOM   1200 C CB    . LEU D 2 75  ? 30.604  39.095  87.872  1.00 53.37  ? 162 LEU A CB    1 
ATOM   1201 C CG    . LEU D 2 75  ? 29.309  39.896  88.070  1.00 74.78  ? 162 LEU A CG    1 
ATOM   1202 C CD1   . LEU D 2 75  ? 28.723  39.632  89.448  1.00 104.52 ? 162 LEU A CD1   1 
ATOM   1203 C CD2   . LEU D 2 75  ? 29.594  41.383  87.871  1.00 60.76  ? 162 LEU A CD2   1 
ATOM   1204 N N     . VAL D 2 76  ? 30.499  36.076  86.263  1.00 74.55  ? 163 VAL A N     1 
ATOM   1205 C CA    . VAL D 2 76  ? 31.035  35.315  85.137  1.00 68.19  ? 163 VAL A CA    1 
ATOM   1206 C C     . VAL D 2 76  ? 30.195  35.647  83.899  1.00 73.87  ? 163 VAL A C     1 
ATOM   1207 O O     . VAL D 2 76  ? 29.078  36.156  84.025  1.00 59.45  ? 163 VAL A O     1 
ATOM   1208 C CB    . VAL D 2 76  ? 30.963  33.804  85.398  1.00 68.92  ? 163 VAL A CB    1 
ATOM   1209 C CG1   . VAL D 2 76  ? 31.935  33.425  86.493  1.00 108.18 ? 163 VAL A CG1   1 
ATOM   1210 C CG2   . VAL D 2 76  ? 29.547  33.413  85.784  1.00 47.96  ? 163 VAL A CG2   1 
ATOM   1211 N N     . TRP D 2 77  ? 30.726  35.360  82.712  1.00 57.52  ? 164 TRP A N     1 
ATOM   1212 C CA    . TRP D 2 77  ? 30.022  35.648  81.463  1.00 65.28  ? 164 TRP A CA    1 
ATOM   1213 C C     . TRP D 2 77  ? 28.619  35.051  81.396  1.00 74.24  ? 164 TRP A C     1 
ATOM   1214 O O     . TRP D 2 77  ? 27.996  34.799  82.426  1.00 84.46  ? 164 TRP A O     1 
ATOM   1215 C CB    . TRP D 2 77  ? 30.846  35.166  80.271  1.00 62.09  ? 164 TRP A CB    1 
ATOM   1216 C CG    . TRP D 2 77  ? 32.164  35.848  80.161  1.00 71.58  ? 164 TRP A CG    1 
ATOM   1217 C CD1   . TRP D 2 77  ? 32.742  36.665  81.089  1.00 95.68  ? 164 TRP A CD1   1 
ATOM   1218 C CD2   . TRP D 2 77  ? 33.109  35.725  79.092  1.00 100.40 ? 164 TRP A CD2   1 
ATOM   1219 N NE1   . TRP D 2 77  ? 33.990  37.056  80.667  1.00 118.39 ? 164 TRP A NE1   1 
ATOM   1220 C CE2   . TRP D 2 77  ? 34.239  36.495  79.443  1.00 106.29 ? 164 TRP A CE2   1 
ATOM   1221 C CE3   . TRP D 2 77  ? 33.109  35.042  77.871  1.00 113.46 ? 164 TRP A CE3   1 
ATOM   1222 C CZ2   . TRP D 2 77  ? 35.363  36.594  78.621  1.00 116.54 ? 164 TRP A CZ2   1 
ATOM   1223 C CZ3   . TRP D 2 77  ? 34.227  35.143  77.053  1.00 116.71 ? 164 TRP A CZ3   1 
ATOM   1224 C CH2   . TRP D 2 77  ? 35.337  35.917  77.431  1.00 116.52 ? 164 TRP A CH2   1 
ATOM   1225 N N     . LYS D 2 78  ? 28.117  34.824  80.186  1.00 84.34  ? 165 LYS A N     1 
ATOM   1226 C CA    . LYS D 2 78  ? 26.771  34.284  80.040  1.00 88.39  ? 165 LYS A CA    1 
ATOM   1227 C C     . LYS D 2 78  ? 26.694  33.037  79.171  1.00 97.97  ? 165 LYS A C     1 
ATOM   1228 O O     . LYS D 2 78  ? 25.646  32.398  79.096  1.00 83.24  ? 165 LYS A O     1 
ATOM   1229 C CB    . LYS D 2 78  ? 25.838  35.354  79.467  1.00 84.52  ? 165 LYS A CB    1 
ATOM   1230 C CG    . LYS D 2 78  ? 24.361  35.056  79.673  1.00 98.30  ? 165 LYS A CG    1 
ATOM   1231 C CD    . LYS D 2 78  ? 23.472  36.037  78.928  1.00 106.37 ? 165 LYS A CD    1 
ATOM   1232 C CE    . LYS D 2 78  ? 23.553  35.808  77.430  1.00 131.56 ? 165 LYS A CE    1 
ATOM   1233 N NZ    . LYS D 2 78  ? 23.232  34.391  77.079  1.00 113.88 ? 165 LYS A NZ    1 
ATOM   1234 N N     . ASP D 2 79  ? 27.795  32.688  78.516  1.00 105.55 ? 166 ASP A N     1 
ATOM   1235 C CA    . ASP D 2 79  ? 27.798  31.518  77.652  1.00 107.05 ? 166 ASP A CA    1 
ATOM   1236 C C     . ASP D 2 79  ? 28.764  30.442  78.125  1.00 101.46 ? 166 ASP A C     1 
ATOM   1237 O O     . ASP D 2 79  ? 29.525  30.653  79.064  1.00 101.51 ? 166 ASP A O     1 
ATOM   1238 C CB    . ASP D 2 79  ? 28.132  31.925  76.215  1.00 107.17 ? 166 ASP A CB    1 
ATOM   1239 C CG    . ASP D 2 79  ? 27.184  32.986  75.672  1.00 132.19 ? 166 ASP A CG    1 
ATOM   1240 O OD1   . ASP D 2 79  ? 27.278  34.155  76.106  1.00 140.73 ? 166 ASP A OD1   1 
ATOM   1241 O OD2   . ASP D 2 79  ? 26.340  32.648  74.814  1.00 139.95 ? 166 ASP A OD2   1 
ATOM   1242 N N     . TRP D 2 80  ? 28.713  29.291  77.460  1.00 111.60 ? 167 TRP A N     1 
ATOM   1243 C CA    . TRP D 2 80  ? 29.553  28.134  77.768  1.00 117.44 ? 167 TRP A CA    1 
ATOM   1244 C C     . TRP D 2 80  ? 30.767  28.425  78.655  1.00 113.53 ? 167 TRP A C     1 
ATOM   1245 O O     . TRP D 2 80  ? 30.806  28.000  79.808  1.00 107.30 ? 167 TRP A O     1 
ATOM   1246 C CB    . TRP D 2 80  ? 30.002  27.463  76.459  1.00 137.91 ? 167 TRP A CB    1 
ATOM   1247 C CG    . TRP D 2 80  ? 31.021  26.360  76.619  1.00 140.73 ? 167 TRP A CG    1 
ATOM   1248 C CD1   . TRP D 2 80  ? 32.004  26.026  75.730  1.00 131.88 ? 167 TRP A CD1   1 
ATOM   1249 C CD2   . TRP D 2 80  ? 31.150  25.447  77.719  1.00 140.73 ? 167 TRP A CD2   1 
ATOM   1250 N NE1   . TRP D 2 80  ? 32.739  24.969  76.207  1.00 121.47 ? 167 TRP A NE1   1 
ATOM   1251 C CE2   . TRP D 2 80  ? 32.239  24.594  77.426  1.00 138.25 ? 167 TRP A CE2   1 
ATOM   1252 C CE3   . TRP D 2 80  ? 30.457  25.270  78.925  1.00 133.53 ? 167 TRP A CE3   1 
ATOM   1253 C CZ2   . TRP D 2 80  ? 32.647  23.575  78.292  1.00 138.22 ? 167 TRP A CZ2   1 
ATOM   1254 C CZ3   . TRP D 2 80  ? 30.864  24.257  79.785  1.00 134.23 ? 167 TRP A CZ3   1 
ATOM   1255 C CH2   . TRP D 2 80  ? 31.952  23.425  79.465  1.00 132.53 ? 167 TRP A CH2   1 
ATOM   1256 N N     . PRO D 2 81  ? 31.775  29.147  78.136  1.00 113.81 ? 168 PRO A N     1 
ATOM   1257 C CA    . PRO D 2 81  ? 32.938  29.424  78.980  1.00 115.22 ? 168 PRO A CA    1 
ATOM   1258 C C     . PRO D 2 81  ? 32.651  30.545  79.976  1.00 122.76 ? 168 PRO A C     1 
ATOM   1259 O O     . PRO D 2 81  ? 33.076  31.685  79.777  1.00 109.96 ? 168 PRO A O     1 
ATOM   1260 C CB    . PRO D 2 81  ? 34.000  29.809  77.962  1.00 121.35 ? 168 PRO A CB    1 
ATOM   1261 C CG    . PRO D 2 81  ? 33.200  30.590  76.971  1.00 136.15 ? 168 PRO A CG    1 
ATOM   1262 C CD    . PRO D 2 81  ? 31.945  29.751  76.800  1.00 117.75 ? 168 PRO A CD    1 
ATOM   1263 N N     . HIS D 2 82  ? 31.923  30.211  81.042  1.00 127.58 ? 169 HIS A N     1 
ATOM   1264 C CA    . HIS D 2 82  ? 31.558  31.173  82.082  1.00 122.15 ? 169 HIS A CA    1 
ATOM   1265 C C     . HIS D 2 82  ? 32.783  31.719  82.806  1.00 121.15 ? 169 HIS A C     1 
ATOM   1266 O O     . HIS D 2 82  ? 32.798  31.780  84.034  1.00 111.78 ? 169 HIS A O     1 
ATOM   1267 C CB    . HIS D 2 82  ? 30.640  30.524  83.124  1.00 102.79 ? 169 HIS A CB    1 
ATOM   1268 C CG    . HIS D 2 82  ? 29.342  30.016  82.574  1.00 97.27  ? 169 HIS A CG    1 
ATOM   1269 N ND1   . HIS D 2 82  ? 29.272  29.020  81.624  1.00 54.26  ? 169 HIS A ND1   1 
ATOM   1270 C CD2   . HIS D 2 82  ? 28.062  30.341  82.871  1.00 97.92  ? 169 HIS A CD2   1 
ATOM   1271 C CE1   . HIS D 2 82  ? 28.005  28.754  81.359  1.00 85.09  ? 169 HIS A CE1   1 
ATOM   1272 N NE2   . HIS D 2 82  ? 27.251  29.543  82.104  1.00 94.19  ? 169 HIS A NE2   1 
ATOM   1273 N N     . ARG D 2 83  ? 33.806  32.114  82.053  1.00 120.32 ? 170 ARG A N     1 
ATOM   1274 C CA    . ARG D 2 83  ? 35.026  32.650  82.645  1.00 107.50 ? 170 ARG A CA    1 
ATOM   1275 C C     . ARG D 2 83  ? 34.689  33.736  83.660  1.00 112.88 ? 170 ARG A C     1 
ATOM   1276 O O     . ARG D 2 83  ? 33.585  34.284  83.663  1.00 113.41 ? 170 ARG A O     1 
ATOM   1277 C CB    . ARG D 2 83  ? 35.938  33.246  81.566  1.00 104.77 ? 170 ARG A CB    1 
ATOM   1278 C CG    . ARG D 2 83  ? 36.330  32.298  80.440  1.00 96.41  ? 170 ARG A CG    1 
ATOM   1279 C CD    . ARG D 2 83  ? 37.397  32.927  79.538  1.00 85.28  ? 170 ARG A CD    1 
ATOM   1280 N NE    . ARG D 2 83  ? 37.674  32.119  78.352  1.00 110.49 ? 170 ARG A NE    1 
ATOM   1281 C CZ    . ARG D 2 83  ? 36.785  31.875  77.393  1.00 122.66 ? 170 ARG A CZ    1 
ATOM   1282 N NH1   . ARG D 2 83  ? 35.562  32.380  77.480  1.00 129.87 ? 170 ARG A NH1   1 
ATOM   1283 N NH2   . ARG D 2 83  ? 37.111  31.124  76.349  1.00 99.01  ? 170 ARG A NH2   1 
ATOM   1284 N N     . VAL D 2 84  ? 35.642  34.042  84.529  1.00 114.76 ? 171 VAL A N     1 
ATOM   1285 C CA    . VAL D 2 84  ? 35.430  35.077  85.523  1.00 114.28 ? 171 VAL A CA    1 
ATOM   1286 C C     . VAL D 2 84  ? 35.258  36.406  84.788  1.00 110.89 ? 171 VAL A C     1 
ATOM   1287 O O     . VAL D 2 84  ? 36.176  36.878  84.115  1.00 109.38 ? 171 VAL A O     1 
ATOM   1288 C CB    . VAL D 2 84  ? 36.633  35.156  86.504  1.00 116.88 ? 171 VAL A CB    1 
ATOM   1289 C CG1   . VAL D 2 84  ? 37.947  35.270  85.732  1.00 74.61  ? 171 VAL A CG1   1 
ATOM   1290 C CG2   . VAL D 2 84  ? 36.462  36.334  87.444  1.00 133.60 ? 171 VAL A CG2   1 
ATOM   1291 N N     . HIS D 2 85  ? 34.073  36.999  84.898  1.00 91.95  ? 172 HIS A N     1 
ATOM   1292 C CA    . HIS D 2 85  ? 33.801  38.270  84.231  1.00 87.79  ? 172 HIS A CA    1 
ATOM   1293 C C     . HIS D 2 85  ? 34.625  39.407  84.835  1.00 87.10  ? 172 HIS A C     1 
ATOM   1294 O O     . HIS D 2 85  ? 34.779  39.490  86.051  1.00 108.73 ? 172 HIS A O     1 
ATOM   1295 C CB    . HIS D 2 85  ? 32.319  38.624  84.335  1.00 68.79  ? 172 HIS A CB    1 
ATOM   1296 C CG    . HIS D 2 85  ? 31.917  39.767  83.457  1.00 83.73  ? 172 HIS A CG    1 
ATOM   1297 N ND1   . HIS D 2 85  ? 31.258  39.588  82.260  1.00 67.63  ? 172 HIS A ND1   1 
ATOM   1298 C CD2   . HIS D 2 85  ? 32.136  41.097  83.570  1.00 68.42  ? 172 HIS A CD2   1 
ATOM   1299 C CE1   . HIS D 2 85  ? 31.090  40.760  81.673  1.00 51.05  ? 172 HIS A CE1   1 
ATOM   1300 N NE2   . HIS D 2 85  ? 31.614  41.692  82.447  1.00 78.41  ? 172 HIS A NE2   1 
ATOM   1301 N N     . PRO D 2 86  ? 35.155  40.307  83.991  1.00 99.50  ? 173 PRO A N     1 
ATOM   1302 C CA    . PRO D 2 86  ? 35.960  41.431  84.481  1.00 92.91  ? 173 PRO A CA    1 
ATOM   1303 C C     . PRO D 2 86  ? 35.243  42.357  85.459  1.00 86.38  ? 173 PRO A C     1 
ATOM   1304 O O     . PRO D 2 86  ? 35.841  42.818  86.431  1.00 74.77  ? 173 PRO A O     1 
ATOM   1305 C CB    . PRO D 2 86  ? 36.381  42.147  83.194  1.00 96.99  ? 173 PRO A CB    1 
ATOM   1306 C CG    . PRO D 2 86  ? 35.282  41.809  82.239  1.00 101.96 ? 173 PRO A CG    1 
ATOM   1307 C CD    . PRO D 2 86  ? 35.054  40.347  82.521  1.00 90.97  ? 173 PRO A CD    1 
ATOM   1308 N N     . HIS D 2 87  ? 33.970  42.642  85.206  1.00 84.31  ? 174 HIS A N     1 
ATOM   1309 C CA    . HIS D 2 87  ? 33.227  43.514  86.106  1.00 96.42  ? 174 HIS A CA    1 
ATOM   1310 C C     . HIS D 2 87  ? 33.145  42.886  87.480  1.00 96.20  ? 174 HIS A C     1 
ATOM   1311 O O     . HIS D 2 87  ? 32.689  41.755  87.639  1.00 127.15 ? 174 HIS A O     1 
ATOM   1312 C CB    . HIS D 2 87  ? 31.815  43.783  85.587  1.00 79.53  ? 174 HIS A CB    1 
ATOM   1313 C CG    . HIS D 2 87  ? 31.785  44.598  84.333  1.00 79.14  ? 174 HIS A CG    1 
ATOM   1314 N ND1   . HIS D 2 87  ? 32.851  45.367  83.927  1.00 50.42  ? 174 HIS A ND1   1 
ATOM   1315 C CD2   . HIS D 2 87  ? 30.810  44.780  83.412  1.00 59.30  ? 174 HIS A CD2   1 
ATOM   1316 C CE1   . HIS D 2 87  ? 32.535  45.992  82.804  1.00 124.30 ? 174 HIS A CE1   1 
ATOM   1317 N NE2   . HIS D 2 87  ? 31.304  45.652  82.472  1.00 124.34 ? 174 HIS A NE2   1 
ATOM   1318 N N     . SER D 2 88  ? 33.593  43.629  88.479  1.00 79.30  ? 175 SER A N     1 
ATOM   1319 C CA    . SER D 2 88  ? 33.575  43.125  89.837  1.00 72.39  ? 175 SER A CA    1 
ATOM   1320 C C     . SER D 2 88  ? 32.282  43.504  90.540  1.00 63.60  ? 175 SER A C     1 
ATOM   1321 O O     . SER D 2 88  ? 31.737  44.585  90.339  1.00 74.63  ? 175 SER A O     1 
ATOM   1322 C CB    . SER D 2 88  ? 34.782  43.671  90.600  1.00 86.40  ? 175 SER A CB    1 
ATOM   1323 O OG    . SER D 2 88  ? 35.976  43.429  89.871  1.00 64.55  ? 175 SER A OG    1 
ATOM   1324 N N     . LEU D 2 89  ? 31.789  42.587  91.355  1.00 63.60  ? 176 LEU A N     1 
ATOM   1325 C CA    . LEU D 2 89  ? 30.569  42.792  92.115  1.00 72.90  ? 176 LEU A CA    1 
ATOM   1326 C C     . LEU D 2 89  ? 30.884  43.471  93.452  1.00 71.71  ? 176 LEU A C     1 
ATOM   1327 O O     . LEU D 2 89  ? 31.602  42.916  94.285  1.00 98.03  ? 176 LEU A O     1 
ATOM   1328 C CB    . LEU D 2 89  ? 29.898  41.437  92.348  1.00 53.62  ? 176 LEU A CB    1 
ATOM   1329 C CG    . LEU D 2 89  ? 28.707  41.372  93.300  1.00 74.40  ? 176 LEU A CG    1 
ATOM   1330 C CD1   . LEU D 2 89  ? 27.713  42.469  92.971  1.00 52.73  ? 176 LEU A CD1   1 
ATOM   1331 C CD2   . LEU D 2 89  ? 28.063  39.999  93.203  1.00 42.68  ? 176 LEU A CD2   1 
ATOM   1332 N N     . VAL D 2 90  ? 30.354  44.674  93.654  1.00 43.91  ? 177 VAL A N     1 
ATOM   1333 C CA    . VAL D 2 90  ? 30.597  45.398  94.895  1.00 46.16  ? 177 VAL A CA    1 
ATOM   1334 C C     . VAL D 2 90  ? 29.408  45.336  95.845  1.00 50.58  ? 177 VAL A C     1 
ATOM   1335 O O     . VAL D 2 90  ? 28.313  44.927  95.460  1.00 74.86  ? 177 VAL A O     1 
ATOM   1336 C CB    . VAL D 2 90  ? 30.947  46.884  94.641  1.00 28.16  ? 177 VAL A CB    1 
ATOM   1337 C CG1   . VAL D 2 90  ? 32.246  46.981  93.879  1.00 55.96  ? 177 VAL A CG1   1 
ATOM   1338 C CG2   . VAL D 2 90  ? 29.828  47.574  93.882  1.00 47.84  ? 177 VAL A CG2   1 
ATOM   1339 N N     . GLY D 2 91  ? 29.644  45.748  97.088  1.00 73.25  ? 178 GLY A N     1 
ATOM   1340 C CA    . GLY D 2 91  ? 28.611  45.732  98.110  1.00 97.48  ? 178 GLY A CA    1 
ATOM   1341 C C     . GLY D 2 91  ? 29.168  45.284  99.451  1.00 110.97 ? 178 GLY A C     1 
ATOM   1342 O O     . GLY D 2 91  ? 30.383  45.136  99.612  1.00 109.35 ? 178 GLY A O     1 
ATOM   1343 N N     . LYS D 2 92  ? 28.279  45.063  100.416 1.00 107.79 ? 179 LYS A N     1 
ATOM   1344 C CA    . LYS D 2 92  ? 28.695  44.621  101.738 1.00 98.77  ? 179 LYS A CA    1 
ATOM   1345 C C     . LYS D 2 92  ? 29.261  43.207  101.656 1.00 89.88  ? 179 LYS A C     1 
ATOM   1346 O O     . LYS D 2 92  ? 28.737  42.361  100.940 1.00 81.19  ? 179 LYS A O     1 
ATOM   1347 C CB    . LYS D 2 92  ? 27.510  44.643  102.703 1.00 105.40 ? 179 LYS A CB    1 
ATOM   1348 C CG    . LYS D 2 92  ? 27.883  44.274  104.133 1.00 114.74 ? 179 LYS A CG    1 
ATOM   1349 C CD    . LYS D 2 92  ? 26.681  44.326  105.072 1.00 109.64 ? 179 LYS A CD    1 
ATOM   1350 C CE    . LYS D 2 92  ? 25.726  43.156  104.849 1.00 140.73 ? 179 LYS A CE    1 
ATOM   1351 N NZ    . LYS D 2 92  ? 26.312  41.841  105.246 1.00 140.73 ? 179 LYS A NZ    1 
ATOM   1352 N N     . ASP D 2 93  ? 30.333  42.961  102.399 1.00 94.10  ? 180 ASP A N     1 
ATOM   1353 C CA    . ASP D 2 93  ? 30.984  41.658  102.417 1.00 103.39 ? 180 ASP A CA    1 
ATOM   1354 C C     . ASP D 2 93  ? 31.508  41.210  101.061 1.00 104.30 ? 180 ASP A C     1 
ATOM   1355 O O     . ASP D 2 93  ? 31.767  40.024  100.855 1.00 117.80 ? 180 ASP A O     1 
ATOM   1356 C CB    . ASP D 2 93  ? 30.042  40.591  102.983 1.00 112.77 ? 180 ASP A CB    1 
ATOM   1357 C CG    . ASP D 2 93  ? 29.870  40.707  104.485 1.00 119.29 ? 180 ASP A CG    1 
ATOM   1358 O OD1   . ASP D 2 93  ? 30.899  40.844  105.182 1.00 74.33  ? 180 ASP A OD1   1 
ATOM   1359 O OD2   . ASP D 2 93  ? 28.719  40.655  104.970 1.00 108.37 ? 180 ASP A OD2   1 
ATOM   1360 N N     . CYS D 2 94  ? 31.667  42.157  100.140 1.00 88.91  ? 181 CYS A N     1 
ATOM   1361 C CA    . CYS D 2 94  ? 32.186  41.840  98.813  1.00 84.15  ? 181 CYS A CA    1 
ATOM   1362 C C     . CYS D 2 94  ? 33.628  42.316  98.769  1.00 83.02  ? 181 CYS A C     1 
ATOM   1363 O O     . CYS D 2 94  ? 33.887  43.517  98.812  1.00 82.39  ? 181 CYS A O     1 
ATOM   1364 C CB    . CYS D 2 94  ? 31.400  42.562  97.723  1.00 88.93  ? 181 CYS A CB    1 
ATOM   1365 S SG    . CYS D 2 94  ? 29.627  42.650  97.980  1.00 100.40 ? 181 CYS A SG    1 
ATOM   1366 N N     . THR D 2 95  ? 34.562  41.376  98.683  1.00 94.46  ? 182 THR A N     1 
ATOM   1367 C CA    . THR D 2 95  ? 35.981  41.710  98.650  1.00 104.24 ? 182 THR A CA    1 
ATOM   1368 C C     . THR D 2 95  ? 36.489  42.040  97.246  1.00 110.41 ? 182 THR A C     1 
ATOM   1369 O O     . THR D 2 95  ? 36.900  43.168  96.983  1.00 127.24 ? 182 THR A O     1 
ATOM   1370 C CB    . THR D 2 95  ? 36.816  40.564  99.233  1.00 119.50 ? 182 THR A CB    1 
ATOM   1371 O OG1   . THR D 2 95  ? 36.651  39.390  98.427  1.00 128.54 ? 182 THR A OG1   1 
ATOM   1372 C CG2   . THR D 2 95  ? 36.366  40.267  100.658 1.00 96.97  ? 182 THR A CG2   1 
ATOM   1373 N N     . ASP D 2 96  ? 36.473  41.058  96.350  1.00 94.28  ? 183 ASP A N     1 
ATOM   1374 C CA    . ASP D 2 96  ? 36.921  41.271  94.977  1.00 99.45  ? 183 ASP A CA    1 
ATOM   1375 C C     . ASP D 2 96  ? 35.959  40.644  93.990  1.00 100.66 ? 183 ASP A C     1 
ATOM   1376 O O     . ASP D 2 96  ? 36.202  39.550  93.480  1.00 126.10 ? 183 ASP A O     1 
ATOM   1377 C CB    . ASP D 2 96  ? 38.301  40.667  94.758  1.00 84.59  ? 183 ASP A CB    1 
ATOM   1378 C CG    . ASP D 2 96  ? 39.374  41.405  95.496  1.00 90.25  ? 183 ASP A CG    1 
ATOM   1379 O OD1   . ASP D 2 96  ? 39.648  42.568  95.137  1.00 101.32 ? 183 ASP A OD1   1 
ATOM   1380 O OD2   . ASP D 2 96  ? 39.938  40.817  96.440  1.00 73.87  ? 183 ASP A OD2   1 
ATOM   1381 N N     . GLY D 2 97  ? 34.865  41.336  93.716  1.00 102.98 ? 184 GLY A N     1 
ATOM   1382 C CA    . GLY D 2 97  ? 33.900  40.794  92.785  1.00 97.81  ? 184 GLY A CA    1 
ATOM   1383 C C     . GLY D 2 97  ? 33.240  39.569  93.372  1.00 84.20  ? 184 GLY A C     1 
ATOM   1384 O O     . GLY D 2 97  ? 32.594  38.802  92.657  1.00 103.92 ? 184 GLY A O     1 
ATOM   1385 N N     . VAL D 2 98  ? 33.415  39.380  94.677  1.00 72.45  ? 185 VAL A N     1 
ATOM   1386 C CA    . VAL D 2 98  ? 32.810  38.247  95.377  1.00 62.66  ? 185 VAL A CA    1 
ATOM   1387 C C     . VAL D 2 98  ? 32.300  38.621  96.761  1.00 63.26  ? 185 VAL A C     1 
ATOM   1388 O O     . VAL D 2 98  ? 32.961  39.323  97.525  1.00 88.51  ? 185 VAL A O     1 
ATOM   1389 C CB    . VAL D 2 98  ? 33.784  37.042  95.507  1.00 31.88  ? 185 VAL A CB    1 
ATOM   1390 C CG1   . VAL D 2 98  ? 35.153  37.518  95.926  1.00 45.85  ? 185 VAL A CG1   1 
ATOM   1391 C CG2   . VAL D 2 98  ? 33.238  36.041  96.518  1.00 58.63  ? 185 VAL A CG2   1 
ATOM   1392 N N     . CYS D 2 99  ? 31.099  38.145  97.059  1.00 40.00  ? 186 CYS A N     1 
ATOM   1393 C CA    . CYS D 2 99  ? 30.452  38.396  98.331  1.00 55.11  ? 186 CYS A CA    1 
ATOM   1394 C C     . CYS D 2 99  ? 30.415  37.097  99.096  1.00 67.37  ? 186 CYS A C     1 
ATOM   1395 O O     . CYS D 2 99  ? 30.415  36.019  98.497  1.00 74.32  ? 186 CYS A O     1 
ATOM   1396 C CB    . CYS D 2 99  ? 29.027  38.895  98.111  1.00 38.93  ? 186 CYS A CB    1 
ATOM   1397 S SG    . CYS D 2 99  ? 28.918  40.313  96.966  1.00 88.63  ? 186 CYS A SG    1 
ATOM   1398 N N     . ARG D 2 100 ? 30.391  37.202  100.420 1.00 87.84  ? 187 ARG A N     1 
ATOM   1399 C CA    . ARG D 2 100 ? 30.347  36.027  101.277 1.00 83.52  ? 187 ARG A CA    1 
ATOM   1400 C C     . ARG D 2 100 ? 29.475  36.269  102.486 1.00 83.05  ? 187 ARG A C     1 
ATOM   1401 O O     . ARG D 2 100 ? 29.438  37.370  103.037 1.00 101.23 ? 187 ARG A O     1 
ATOM   1402 C CB    . ARG D 2 100 ? 31.757  35.637  101.725 1.00 24.54  ? 187 ARG A CB    1 
ATOM   1403 C CG    . ARG D 2 100 ? 32.794  36.718  101.469 1.00 73.82  ? 187 ARG A CG    1 
ATOM   1404 C CD    . ARG D 2 100 ? 34.167  36.103  101.296 1.00 62.12  ? 187 ARG A CD    1 
ATOM   1405 N NE    . ARG D 2 100 ? 34.175  35.098  100.236 1.00 69.18  ? 187 ARG A NE    1 
ATOM   1406 C CZ    . ARG D 2 100 ? 35.238  34.376  99.901  1.00 97.14  ? 187 ARG A CZ    1 
ATOM   1407 N NH1   . ARG D 2 100 ? 36.385  34.546  100.546 1.00 42.04  ? 187 ARG A NH1   1 
ATOM   1408 N NH2   . ARG D 2 100 ? 35.158  33.492  98.916  1.00 65.67  ? 187 ARG A NH2   1 
ATOM   1409 N N     . VAL D 2 101 ? 28.752  35.233  102.878 1.00 71.10  ? 188 VAL A N     1 
ATOM   1410 C CA    . VAL D 2 101 ? 27.887  35.321  104.035 1.00 77.53  ? 188 VAL A CA    1 
ATOM   1411 C C     . VAL D 2 101 ? 27.856  33.974  104.744 1.00 93.88  ? 188 VAL A C     1 
ATOM   1412 O O     . VAL D 2 101 ? 27.348  32.984  104.217 1.00 107.82 ? 188 VAL A O     1 
ATOM   1413 C CB    . VAL D 2 101 ? 26.463  35.765  103.635 1.00 65.44  ? 188 VAL A CB    1 
ATOM   1414 C CG1   . VAL D 2 101 ? 25.540  35.723  104.842 1.00 76.91  ? 188 VAL A CG1   1 
ATOM   1415 C CG2   . VAL D 2 101 ? 26.510  37.181  103.085 1.00 51.29  ? 188 VAL A CG2   1 
ATOM   1416 N N     . ARG D 2 102 ? 28.433  33.957  105.940 1.00 111.61 ? 189 ARG A N     1 
ATOM   1417 C CA    . ARG D 2 102 ? 28.509  32.762  106.772 1.00 105.56 ? 189 ARG A CA    1 
ATOM   1418 C C     . ARG D 2 102 ? 27.131  32.479  107.352 1.00 105.82 ? 189 ARG A C     1 
ATOM   1419 O O     . ARG D 2 102 ? 26.957  32.486  108.567 1.00 126.56 ? 189 ARG A O     1 
ATOM   1420 C CB    . ARG D 2 102 ? 29.497  32.999  107.917 1.00 89.34  ? 189 ARG A CB    1 
ATOM   1421 C CG    . ARG D 2 102 ? 30.355  31.812  108.277 1.00 103.50 ? 189 ARG A CG    1 
ATOM   1422 C CD    . ARG D 2 102 ? 31.378  31.521  107.190 1.00 112.09 ? 189 ARG A CD    1 
ATOM   1423 N NE    . ARG D 2 102 ? 32.248  30.412  107.565 1.00 118.61 ? 189 ARG A NE    1 
ATOM   1424 C CZ    . ARG D 2 102 ? 31.811  29.193  107.869 1.00 131.94 ? 189 ARG A CZ    1 
ATOM   1425 N NH1   . ARG D 2 102 ? 30.511  28.927  107.840 1.00 140.73 ? 189 ARG A NH1   1 
ATOM   1426 N NH2   . ARG D 2 102 ? 32.670  28.241  108.209 1.00 110.48 ? 189 ARG A NH2   1 
ATOM   1427 N N     . LEU D 2 103 ? 26.154  32.239  106.484 1.00 103.16 ? 190 LEU A N     1 
ATOM   1428 C CA    . LEU D 2 103 ? 24.792  31.972  106.930 1.00 109.14 ? 190 LEU A CA    1 
ATOM   1429 C C     . LEU D 2 103 ? 24.672  30.634  107.652 1.00 115.05 ? 190 LEU A C     1 
ATOM   1430 O O     . LEU D 2 103 ? 25.135  29.601  107.155 1.00 95.87  ? 190 LEU A O     1 
ATOM   1431 C CB    . LEU D 2 103 ? 23.829  31.986  105.742 1.00 117.03 ? 190 LEU A CB    1 
ATOM   1432 C CG    . LEU D 2 103 ? 23.921  30.812  104.762 1.00 137.79 ? 190 LEU A CG    1 
ATOM   1433 C CD1   . LEU D 2 103 ? 22.804  30.924  103.738 1.00 140.73 ? 190 LEU A CD1   1 
ATOM   1434 C CD2   . LEU D 2 103 ? 25.282  30.797  104.081 1.00 140.47 ? 190 LEU A CD2   1 
ATOM   1435 N N     . ARG D 2 104 ? 24.050  30.660  108.829 1.00 117.03 ? 191 ARG A N     1 
ATOM   1436 C CA    . ARG D 2 104 ? 23.853  29.452  109.616 1.00 108.84 ? 191 ARG A CA    1 
ATOM   1437 C C     . ARG D 2 104 ? 22.883  28.571  108.853 1.00 113.44 ? 191 ARG A C     1 
ATOM   1438 O O     . ARG D 2 104 ? 21.733  28.945  108.626 1.00 123.83 ? 191 ARG A O     1 
ATOM   1439 C CB    . ARG D 2 104 ? 23.280  29.796  110.982 1.00 121.53 ? 191 ARG A CB    1 
ATOM   1440 N N     . PRO D 2 105 ? 23.343  27.387  108.431 1.00 107.81 ? 192 PRO A N     1 
ATOM   1441 C CA    . PRO D 2 105 ? 22.518  26.436  107.682 1.00 112.60 ? 192 PRO A CA    1 
ATOM   1442 C C     . PRO D 2 105 ? 21.158  26.176  108.325 1.00 115.62 ? 192 PRO A C     1 
ATOM   1443 O O     . PRO D 2 105 ? 20.145  26.743  107.913 1.00 102.40 ? 192 PRO A O     1 
ATOM   1444 C CB    . PRO D 2 105 ? 23.390  25.185  107.645 1.00 112.90 ? 192 PRO A CB    1 
ATOM   1445 C CG    . PRO D 2 105 ? 24.772  25.760  107.582 1.00 117.74 ? 192 PRO A CG    1 
ATOM   1446 C CD    . PRO D 2 105 ? 24.713  26.876  108.605 1.00 103.20 ? 192 PRO A CD    1 
ATOM   1447 N N     . HIS D 2 106 ? 21.148  25.319  109.341 1.00 128.76 ? 193 HIS A N     1 
ATOM   1448 C CA    . HIS D 2 106 ? 19.923  24.955  110.043 1.00 139.37 ? 193 HIS A CA    1 
ATOM   1449 C C     . HIS D 2 106 ? 19.031  26.146  110.369 1.00 140.73 ? 193 HIS A C     1 
ATOM   1450 O O     . HIS D 2 106 ? 18.123  26.480  109.606 1.00 122.54 ? 193 HIS A O     1 
ATOM   1451 C CB    . HIS D 2 106 ? 20.267  24.195  111.328 1.00 125.79 ? 193 HIS A CB    1 
ATOM   1452 C CG    . HIS D 2 106 ? 21.008  22.918  111.086 1.00 140.73 ? 193 HIS A CG    1 
ATOM   1453 N ND1   . HIS D 2 106 ? 20.522  21.920  110.268 1.00 140.73 ? 193 HIS A ND1   1 
ATOM   1454 C CD2   . HIS D 2 106 ? 22.208  22.483  111.538 1.00 140.73 ? 193 HIS A CD2   1 
ATOM   1455 C CE1   . HIS D 2 106 ? 21.391  20.927  110.224 1.00 140.73 ? 193 HIS A CE1   1 
ATOM   1456 N NE2   . HIS D 2 106 ? 22.424  21.243  110.985 1.00 140.73 ? 193 HIS A NE2   1 
ATOM   1457 N N     . VAL D 2 107 ? 19.292  26.778  111.507 1.00 140.73 ? 194 VAL A N     1 
ATOM   1458 C CA    . VAL D 2 107 ? 18.517  27.927  111.947 1.00 139.61 ? 194 VAL A CA    1 
ATOM   1459 C C     . VAL D 2 107 ? 18.349  28.973  110.846 1.00 140.73 ? 194 VAL A C     1 
ATOM   1460 O O     . VAL D 2 107 ? 19.153  29.897  110.724 1.00 140.73 ? 194 VAL A O     1 
ATOM   1461 C CB    . VAL D 2 107 ? 19.170  28.580  113.182 1.00 138.53 ? 194 VAL A CB    1 
ATOM   1462 C CG1   . VAL D 2 107 ? 19.069  27.638  114.371 1.00 126.34 ? 194 VAL A CG1   1 
ATOM   1463 C CG2   . VAL D 2 107 ? 20.631  28.899  112.894 1.00 131.39 ? 194 VAL A CG2   1 
ATOM   1464 N N     . SER D 2 108 ? 17.299  28.808  110.047 1.00 134.64 ? 195 SER A N     1 
ATOM   1465 C CA    . SER D 2 108 ? 16.987  29.725  108.953 1.00 136.03 ? 195 SER A CA    1 
ATOM   1466 C C     . SER D 2 108 ? 18.019  29.760  107.828 1.00 137.22 ? 195 SER A C     1 
ATOM   1467 O O     . SER D 2 108 ? 18.931  30.586  107.836 1.00 139.69 ? 195 SER A O     1 
ATOM   1468 C CB    . SER D 2 108 ? 16.788  31.143  109.491 1.00 138.46 ? 195 SER A CB    1 
ATOM   1469 O OG    . SER D 2 108 ? 16.623  32.067  108.429 1.00 115.39 ? 195 SER A OG    1 
ATOM   1470 N N     . PRO D 2 109 ? 17.887  28.857  106.847 1.00 139.47 ? 196 PRO A N     1 
ATOM   1471 C CA    . PRO D 2 109 ? 18.807  28.792  105.708 1.00 140.60 ? 196 PRO A CA    1 
ATOM   1472 C C     . PRO D 2 109 ? 18.273  29.657  104.568 1.00 137.63 ? 196 PRO A C     1 
ATOM   1473 O O     . PRO D 2 109 ? 17.565  29.166  103.687 1.00 140.73 ? 196 PRO A O     1 
ATOM   1474 C CB    . PRO D 2 109 ? 18.799  27.314  105.357 1.00 140.73 ? 196 PRO A CB    1 
ATOM   1475 C CG    . PRO D 2 109 ? 17.362  26.960  105.580 1.00 140.73 ? 196 PRO A CG    1 
ATOM   1476 C CD    . PRO D 2 109 ? 17.025  27.661  106.890 1.00 136.29 ? 196 PRO A CD    1 
ATOM   1477 N N     . ARG D 2 110 ? 18.613  30.942  104.585 1.00 125.02 ? 197 ARG A N     1 
ATOM   1478 C CA    . ARG D 2 110 ? 18.136  31.861  103.560 1.00 110.87 ? 197 ARG A CA    1 
ATOM   1479 C C     . ARG D 2 110 ? 18.765  33.246  103.719 1.00 108.51 ? 197 ARG A C     1 
ATOM   1480 O O     . ARG D 2 110 ? 18.729  33.827  104.802 1.00 92.07  ? 197 ARG A O     1 
ATOM   1481 C CB    . ARG D 2 110 ? 16.607  31.960  103.657 1.00 101.49 ? 197 ARG A CB    1 
ATOM   1482 C CG    . ARG D 2 110 ? 16.119  32.358  105.045 1.00 133.13 ? 197 ARG A CG    1 
ATOM   1483 C CD    . ARG D 2 110 ? 14.807  31.680  105.431 1.00 138.98 ? 197 ARG A CD    1 
ATOM   1484 N NE    . ARG D 2 110 ? 13.683  32.084  104.592 1.00 139.42 ? 197 ARG A NE    1 
ATOM   1485 C CZ    . ARG D 2 110 ? 12.419  31.745  104.829 1.00 139.82 ? 197 ARG A CZ    1 
ATOM   1486 N NH1   . ARG D 2 110 ? 11.455  32.153  104.016 1.00 139.76 ? 197 ARG A NH1   1 
ATOM   1487 N NH2   . ARG D 2 110 ? 12.118  31.001  105.885 1.00 139.75 ? 197 ARG A NH2   1 
ATOM   1488 N N     . HIS D 2 111 ? 19.351  33.774  102.647 1.00 122.18 ? 198 HIS A N     1 
ATOM   1489 C CA    . HIS D 2 111 ? 19.959  35.100  102.713 1.00 132.11 ? 198 HIS A CA    1 
ATOM   1490 C C     . HIS D 2 111 ? 19.411  36.073  101.672 1.00 132.59 ? 198 HIS A C     1 
ATOM   1491 O O     . HIS D 2 111 ? 19.464  35.817  100.469 1.00 140.73 ? 198 HIS A O     1 
ATOM   1492 C CB    . HIS D 2 111 ? 21.483  35.015  102.578 1.00 121.18 ? 198 HIS A CB    1 
ATOM   1493 C CG    . HIS D 2 111 ? 22.169  36.344  102.706 1.00 128.64 ? 198 HIS A CG    1 
ATOM   1494 N ND1   . HIS D 2 111 ? 21.853  37.249  103.696 1.00 134.73 ? 198 HIS A ND1   1 
ATOM   1495 C CD2   . HIS D 2 111 ? 23.145  36.921  101.967 1.00 120.14 ? 198 HIS A CD2   1 
ATOM   1496 C CE1   . HIS D 2 111 ? 22.603  38.328  103.561 1.00 113.44 ? 198 HIS A CE1   1 
ATOM   1497 N NE2   . HIS D 2 111 ? 23.395  38.155  102.519 1.00 117.13 ? 198 HIS A NE2   1 
ATOM   1498 N N     . SER D 2 112 ? 18.878  37.191  102.157 1.00 124.40 ? 199 SER A N     1 
ATOM   1499 C CA    . SER D 2 112 ? 18.333  38.230  101.295 1.00 119.73 ? 199 SER A CA    1 
ATOM   1500 C C     . SER D 2 112 ? 19.385  39.321  101.190 1.00 130.66 ? 199 SER A C     1 
ATOM   1501 O O     . SER D 2 112 ? 19.706  39.976  102.181 1.00 140.73 ? 199 SER A O     1 
ATOM   1502 C CB    . SER D 2 112 ? 17.059  38.821  101.899 1.00 84.05  ? 199 SER A CB    1 
ATOM   1503 O OG    . SER D 2 112 ? 16.095  37.820  102.150 1.00 77.20  ? 199 SER A OG    1 
ATOM   1504 N N     . PHE D 2 113 ? 19.926  39.512  99.992  1.00 132.03 ? 200 PHE A N     1 
ATOM   1505 C CA    . PHE D 2 113 ? 20.948  40.528  99.781  1.00 119.99 ? 200 PHE A CA    1 
ATOM   1506 C C     . PHE D 2 113 ? 20.304  41.904  99.656  1.00 123.96 ? 200 PHE A C     1 
ATOM   1507 O O     . PHE D 2 113 ? 19.282  42.059  98.990  1.00 138.74 ? 200 PHE A O     1 
ATOM   1508 C CB    . PHE D 2 113 ? 21.758  40.211  98.522  1.00 79.26  ? 200 PHE A CB    1 
ATOM   1509 C CG    . PHE D 2 113 ? 22.388  38.844  98.532  1.00 58.35  ? 200 PHE A CG    1 
ATOM   1510 C CD1   . PHE D 2 113 ? 21.598  37.700  98.505  1.00 53.76  ? 200 PHE A CD1   1 
ATOM   1511 C CD2   . PHE D 2 113 ? 23.774  38.698  98.546  1.00 93.68  ? 200 PHE A CD2   1 
ATOM   1512 C CE1   . PHE D 2 113 ? 22.180  36.425  98.488  1.00 99.45  ? 200 PHE A CE1   1 
ATOM   1513 C CE2   . PHE D 2 113 ? 24.369  37.425  98.529  1.00 61.51  ? 200 PHE A CE2   1 
ATOM   1514 C CZ    . PHE D 2 113 ? 23.570  36.289  98.499  1.00 44.87  ? 200 PHE A CZ    1 
ATOM   1515 N N     . ASN D 2 114 ? 20.907  42.898  100.301 1.00 113.52 ? 201 ASN A N     1 
ATOM   1516 C CA    . ASN D 2 114 ? 20.386  44.258  100.266 1.00 113.45 ? 201 ASN A CA    1 
ATOM   1517 C C     . ASN D 2 114 ? 21.289  45.143  99.407  1.00 110.68 ? 201 ASN A C     1 
ATOM   1518 O O     . ASN D 2 114 ? 21.240  45.088  98.179  1.00 118.95 ? 201 ASN A O     1 
ATOM   1519 C CB    . ASN D 2 114 ? 20.300  44.817  101.687 1.00 116.29 ? 201 ASN A CB    1 
ATOM   1520 C CG    . ASN D 2 114 ? 19.310  45.958  101.805 1.00 140.73 ? 201 ASN A CG    1 
ATOM   1521 O OD1   . ASN D 2 114 ? 19.348  46.912  101.024 1.00 140.73 ? 201 ASN A OD1   1 
ATOM   1522 N ND2   . ASN D 2 114 ? 18.417  45.870  102.787 1.00 135.89 ? 201 ASN A ND2   1 
ATOM   1523 N N     . ASN D 2 115 ? 22.111  45.960  100.057 1.00 115.19 ? 202 ASN A N     1 
ATOM   1524 C CA    . ASN D 2 115 ? 23.026  46.840  99.342  1.00 118.09 ? 202 ASN A CA    1 
ATOM   1525 C C     . ASN D 2 115 ? 23.970  46.001  98.484  1.00 112.87 ? 202 ASN A C     1 
ATOM   1526 O O     . ASN D 2 115 ? 25.037  45.585  98.940  1.00 115.94 ? 202 ASN A O     1 
ATOM   1527 C CB    . ASN D 2 115 ? 23.834  47.680  100.333 1.00 136.87 ? 202 ASN A CB    1 
ATOM   1528 C CG    . ASN D 2 115 ? 22.964  48.611  101.156 1.00 140.73 ? 202 ASN A CG    1 
ATOM   1529 O OD1   . ASN D 2 115 ? 22.133  49.343  100.616 1.00 136.99 ? 202 ASN A OD1   1 
ATOM   1530 N ND2   . ASN D 2 115 ? 23.159  48.594  102.469 1.00 132.00 ? 202 ASN A ND2   1 
ATOM   1531 N N     . LEU D 2 116 ? 23.573  45.765  97.237  1.00 82.13  ? 203 LEU A N     1 
ATOM   1532 C CA    . LEU D 2 116 ? 24.367  44.957  96.325  1.00 78.23  ? 203 LEU A CA    1 
ATOM   1533 C C     . LEU D 2 116 ? 24.384  45.585  94.927  1.00 87.60  ? 203 LEU A C     1 
ATOM   1534 O O     . LEU D 2 116 ? 23.332  45.861  94.350  1.00 92.87  ? 203 LEU A O     1 
ATOM   1535 C CB    . LEU D 2 116 ? 23.770  43.546  96.277  1.00 67.58  ? 203 LEU A CB    1 
ATOM   1536 C CG    . LEU D 2 116 ? 24.641  42.318  95.977  1.00 82.73  ? 203 LEU A CG    1 
ATOM   1537 C CD1   . LEU D 2 116 ? 24.926  42.210  94.494  1.00 75.94  ? 203 LEU A CD1   1 
ATOM   1538 C CD2   . LEU D 2 116 ? 25.931  42.395  96.787  1.00 67.83  ? 203 LEU A CD2   1 
ATOM   1539 N N     . GLY D 2 117 ? 25.580  45.821  94.390  1.00 94.59  ? 204 GLY A N     1 
ATOM   1540 C CA    . GLY D 2 117 ? 25.686  46.414  93.067  1.00 112.04 ? 204 GLY A CA    1 
ATOM   1541 C C     . GLY D 2 117 ? 26.919  45.980  92.293  1.00 116.88 ? 204 GLY A C     1 
ATOM   1542 O O     . GLY D 2 117 ? 27.859  45.435  92.871  1.00 133.07 ? 204 GLY A O     1 
ATOM   1543 N N     . ILE D 2 118 ? 26.916  46.222  90.983  1.00 107.63 ? 205 ILE A N     1 
ATOM   1544 C CA    . ILE D 2 118 ? 28.040  45.855  90.123  1.00 78.94  ? 205 ILE A CA    1 
ATOM   1545 C C     . ILE D 2 118 ? 28.941  47.063  89.850  1.00 67.63  ? 205 ILE A C     1 
ATOM   1546 O O     . ILE D 2 118 ? 28.583  48.207  90.145  1.00 71.77  ? 205 ILE A O     1 
ATOM   1547 C CB    . ILE D 2 118 ? 27.562  45.277  88.749  1.00 89.03  ? 205 ILE A CB    1 
ATOM   1548 C CG1   . ILE D 2 118 ? 26.713  44.017  88.950  1.00 78.38  ? 205 ILE A CG1   1 
ATOM   1549 C CG2   . ILE D 2 118 ? 28.760  44.922  87.877  1.00 41.83  ? 205 ILE A CG2   1 
ATOM   1550 C CD1   . ILE D 2 118 ? 25.250  44.290  89.235  1.00 75.29  ? 205 ILE A CD1   1 
ATOM   1551 N N     . GLN D 2 119 ? 30.114  46.787  89.288  1.00 47.91  ? 206 GLN A N     1 
ATOM   1552 C CA    . GLN D 2 119 ? 31.100  47.803  88.953  1.00 36.66  ? 206 GLN A CA    1 
ATOM   1553 C C     . GLN D 2 119 ? 31.681  47.480  87.597  1.00 55.93  ? 206 GLN A C     1 
ATOM   1554 O O     . GLN D 2 119 ? 32.454  46.535  87.459  1.00 86.64  ? 206 GLN A O     1 
ATOM   1555 C CB    . GLN D 2 119 ? 32.232  47.819  89.973  1.00 56.24  ? 206 GLN A CB    1 
ATOM   1556 C CG    . GLN D 2 119 ? 32.155  48.948  90.969  1.00 56.61  ? 206 GLN A CG    1 
ATOM   1557 C CD    . GLN D 2 119 ? 33.523  49.494  91.276  1.00 101.86 ? 206 GLN A CD    1 
ATOM   1558 O OE1   . GLN D 2 119 ? 33.674  50.408  92.088  1.00 68.60  ? 206 GLN A OE1   1 
ATOM   1559 N NE2   . GLN D 2 119 ? 34.540  48.935  90.619  1.00 29.38  ? 206 GLN A NE2   1 
ATOM   1560 N N     . CYS D 2 120 ? 31.319  48.281  86.603  1.00 64.38  ? 207 CYS A N     1 
ATOM   1561 C CA    . CYS D 2 120 ? 31.772  48.069  85.237  1.00 53.60  ? 207 CYS A CA    1 
ATOM   1562 C C     . CYS D 2 120 ? 33.075  48.765  84.913  1.00 55.77  ? 207 CYS A C     1 
ATOM   1563 O O     . CYS D 2 120 ? 33.139  49.991  84.903  1.00 64.46  ? 207 CYS A O     1 
ATOM   1564 C CB    . CYS D 2 120 ? 30.695  48.545  84.269  1.00 94.03  ? 207 CYS A CB    1 
ATOM   1565 S SG    . CYS D 2 120 ? 30.142  50.217  84.611  1.00 91.36  ? 207 CYS A SG    1 
ATOM   1566 N N     . VAL D 2 121 ? 34.108  47.978  84.633  1.00 38.14  ? 208 VAL A N     1 
ATOM   1567 C CA    . VAL D 2 121 ? 35.415  48.534  84.292  1.00 57.49  ? 208 VAL A CA    1 
ATOM   1568 C C     . VAL D 2 121 ? 35.498  48.941  82.814  1.00 37.63  ? 208 VAL A C     1 
ATOM   1569 O O     . VAL D 2 121 ? 34.958  48.264  81.946  1.00 25.52  ? 208 VAL A O     1 
ATOM   1570 C CB    . VAL D 2 121 ? 36.541  47.521  84.576  1.00 64.04  ? 208 VAL A CB    1 
ATOM   1571 C CG1   . VAL D 2 121 ? 36.359  46.926  85.957  1.00 123.63 ? 208 VAL A CG1   1 
ATOM   1572 C CG2   . VAL D 2 121 ? 36.550  46.432  83.516  1.00 113.16 ? 208 VAL A CG2   1 
ATOM   1573 N N     . ARG D 2 122 ? 36.181  50.048  82.537  1.00 53.65  ? 209 ARG A N     1 
ATOM   1574 C CA    . ARG D 2 122 ? 36.348  50.522  81.171  1.00 57.73  ? 209 ARG A CA    1 
ATOM   1575 C C     . ARG D 2 122 ? 36.820  49.369  80.297  1.00 74.94  ? 209 ARG A C     1 
ATOM   1576 O O     . ARG D 2 122 ? 37.341  48.376  80.804  1.00 59.54  ? 209 ARG A O     1 
ATOM   1577 C CB    . ARG D 2 122 ? 37.365  51.663  81.135  1.00 82.96  ? 209 ARG A CB    1 
ATOM   1578 C CG    . ARG D 2 122 ? 36.959  52.847  81.992  1.00 61.85  ? 209 ARG A CG    1 
ATOM   1579 C CD    . ARG D 2 122 ? 37.845  53.008  83.202  1.00 51.21  ? 209 ARG A CD    1 
ATOM   1580 N NE    . ARG D 2 122 ? 39.134  53.603  82.867  1.00 88.61  ? 209 ARG A NE    1 
ATOM   1581 C CZ    . ARG D 2 122 ? 39.950  54.150  83.761  1.00 99.65  ? 209 ARG A CZ    1 
ATOM   1582 N NH1   . ARG D 2 122 ? 41.109  54.671  83.381  1.00 92.67  ? 209 ARG A NH1   1 
ATOM   1583 N NH2   . ARG D 2 122 ? 39.603  54.183  85.038  1.00 89.27  ? 209 ARG A NH2   1 
ATOM   1584 N N     . LYS D 2 123 ? 36.637  49.496  78.987  1.00 78.18  ? 210 LYS A N     1 
ATOM   1585 C CA    . LYS D 2 123 ? 37.029  48.435  78.066  1.00 77.43  ? 210 LYS A CA    1 
ATOM   1586 C C     . LYS D 2 123 ? 38.532  48.217  77.956  1.00 77.52  ? 210 LYS A C     1 
ATOM   1587 O O     . LYS D 2 123 ? 39.003  47.079  77.950  1.00 77.23  ? 210 LYS A O     1 
ATOM   1588 C CB    . LYS D 2 123 ? 36.446  48.700  76.680  1.00 78.25  ? 210 LYS A CB    1 
ATOM   1589 C CG    . LYS D 2 123 ? 34.930  48.579  76.616  1.00 132.63 ? 210 LYS A CG    1 
ATOM   1590 C CD    . LYS D 2 123 ? 34.414  48.810  75.201  1.00 138.94 ? 210 LYS A CD    1 
ATOM   1591 C CE    . LYS D 2 123 ? 32.901  48.660  75.126  1.00 127.34 ? 210 LYS A CE    1 
ATOM   1592 N NZ    . LYS D 2 123 ? 32.381  48.933  73.757  1.00 126.84 ? 210 LYS A NZ    1 
ATOM   1593 N N     . LYS D 2 124 ? 39.282  49.309  77.869  1.00 91.05  ? 211 LYS A N     1 
ATOM   1594 C CA    . LYS D 2 124 ? 40.730  49.228  77.758  1.00 91.68  ? 211 LYS A CA    1 
ATOM   1595 C C     . LYS D 2 124 ? 41.363  48.633  79.013  1.00 95.24  ? 211 LYS A C     1 
ATOM   1596 O O     . LYS D 2 124 ? 42.529  48.884  79.313  1.00 124.18 ? 211 LYS A O     1 
ATOM   1597 C CB    . LYS D 2 124 ? 41.315  50.614  77.484  1.00 72.08  ? 211 LYS A CB    1 
ATOM   1598 C CG    . LYS D 2 124 ? 41.073  51.133  76.073  1.00 100.39 ? 211 LYS A CG    1 
ATOM   1599 C CD    . LYS D 2 124 ? 41.748  52.485  75.866  1.00 121.31 ? 211 LYS A CD    1 
ATOM   1600 C CE    . LYS D 2 124 ? 41.708  52.929  74.403  1.00 72.80  ? 211 LYS A CE    1 
ATOM   1601 N NZ    . LYS D 2 124 ? 42.522  52.044  73.518  1.00 125.95 ? 211 LYS A NZ    1 
ATOM   1602 N N     . GLU D 2 125 ? 40.581  47.844  79.741  1.00 78.57  ? 212 GLU A N     1 
ATOM   1603 C CA    . GLU D 2 125 ? 41.036  47.186  80.964  1.00 69.63  ? 212 GLU A CA    1 
ATOM   1604 C C     . GLU D 2 125 ? 40.566  45.745  80.889  1.00 79.99  ? 212 GLU A C     1 
ATOM   1605 O O     . GLU D 2 125 ? 41.358  44.815  80.998  1.00 96.53  ? 212 GLU A O     1 
ATOM   1606 C CB    . GLU D 2 125 ? 40.431  47.868  82.194  1.00 52.48  ? 212 GLU A CB    1 
ATOM   1607 C CG    . GLU D 2 125 ? 40.927  49.295  82.418  1.00 48.23  ? 212 GLU A CG    1 
ATOM   1608 C CD    . GLU D 2 125 ? 40.100  50.054  83.439  1.00 82.97  ? 212 GLU A CD    1 
ATOM   1609 O OE1   . GLU D 2 125 ? 40.392  51.243  83.670  1.00 85.89  ? 212 GLU A OE1   1 
ATOM   1610 O OE2   . GLU D 2 125 ? 39.154  49.468  84.008  1.00 73.01  ? 212 GLU A OE2   1 
ATOM   1611 N N     . ILE D 2 126 ? 39.261  45.591  80.698  1.00 96.09  ? 213 ILE A N     1 
ATOM   1612 C CA    . ILE D 2 126 ? 38.596  44.300  80.567  1.00 102.42 ? 213 ILE A CA    1 
ATOM   1613 C C     . ILE D 2 126 ? 39.511  43.087  80.682  1.00 110.64 ? 213 ILE A C     1 
ATOM   1614 O O     . ILE D 2 126 ? 39.485  42.377  81.687  1.00 118.79 ? 213 ILE A O     1 
ATOM   1615 C CB    . ILE D 2 126 ? 37.850  44.235  79.219  1.00 94.25  ? 213 ILE A CB    1 
ATOM   1616 C CG1   . ILE D 2 126 ? 36.861  45.397  79.136  1.00 83.97  ? 213 ILE A CG1   1 
ATOM   1617 C CG2   . ILE D 2 126 ? 37.105  42.928  79.084  1.00 74.58  ? 213 ILE A CG2   1 
ATOM   1618 C CD1   . ILE D 2 126 ? 36.135  45.488  77.835  1.00 39.58  ? 213 ILE A CD1   1 
ATOM   1619 N N     . GLU D 2 127 ? 40.315  42.852  79.648  1.00 106.49 ? 214 GLU A N     1 
ATOM   1620 C CA    . GLU D 2 127 ? 41.236  41.717  79.625  1.00 107.75 ? 214 GLU A CA    1 
ATOM   1621 C C     . GLU D 2 127 ? 42.135  41.647  80.860  1.00 101.05 ? 214 GLU A C     1 
ATOM   1622 O O     . GLU D 2 127 ? 42.047  40.700  81.639  1.00 93.94  ? 214 GLU A O     1 
ATOM   1623 C CB    . GLU D 2 127 ? 42.084  41.766  78.350  1.00 131.07 ? 214 GLU A CB    1 
ATOM   1624 C CG    . GLU D 2 127 ? 41.249  41.703  77.071  1.00 140.73 ? 214 GLU A CG    1 
ATOM   1625 C CD    . GLU D 2 127 ? 42.087  41.707  75.805  1.00 140.73 ? 214 GLU A CD    1 
ATOM   1626 O OE1   . GLU D 2 127 ? 42.868  40.753  75.600  1.00 140.73 ? 214 GLU A OE1   1 
ATOM   1627 O OE2   . GLU D 2 127 ? 41.960  42.665  75.013  1.00 127.20 ? 214 GLU A OE2   1 
ATOM   1628 N N     . ALA D 2 128 ? 42.996  42.644  81.039  1.00 99.63  ? 215 ALA A N     1 
ATOM   1629 C CA    . ALA D 2 128 ? 43.891  42.679  82.192  1.00 100.46 ? 215 ALA A CA    1 
ATOM   1630 C C     . ALA D 2 128 ? 43.106  42.480  83.491  1.00 97.81  ? 215 ALA A C     1 
ATOM   1631 O O     . ALA D 2 128 ? 43.563  41.798  84.407  1.00 85.40  ? 215 ALA A O     1 
ATOM   1632 C CB    . ALA D 2 128 ? 44.642  44.010  82.228  1.00 94.95  ? 215 ALA A CB    1 
ATOM   1633 N N     . ALA D 2 129 ? 41.921  43.078  83.562  1.00 95.17  ? 216 ALA A N     1 
ATOM   1634 C CA    . ALA D 2 129 ? 41.073  42.962  84.741  1.00 92.24  ? 216 ALA A CA    1 
ATOM   1635 C C     . ALA D 2 129 ? 40.716  41.505  84.989  1.00 87.34  ? 216 ALA A C     1 
ATOM   1636 O O     . ALA D 2 129 ? 40.373  41.121  86.106  1.00 91.50  ? 216 ALA A O     1 
ATOM   1637 C CB    . ALA D 2 129 ? 39.806  43.782  84.555  1.00 127.69 ? 216 ALA A CB    1 
ATOM   1638 N N     . ILE D 2 130 ? 40.788  40.698  83.934  1.00 76.95  ? 217 ILE A N     1 
ATOM   1639 C CA    . ILE D 2 130 ? 40.486  39.273  84.034  1.00 77.97  ? 217 ILE A CA    1 
ATOM   1640 C C     . ILE D 2 130 ? 41.748  38.539  84.476  1.00 85.08  ? 217 ILE A C     1 
ATOM   1641 O O     . ILE D 2 130 ? 41.688  37.521  85.168  1.00 75.25  ? 217 ILE A O     1 
ATOM   1642 C CB    . ILE D 2 130 ? 40.030  38.701  82.679  1.00 63.13  ? 217 ILE A CB    1 
ATOM   1643 C CG1   . ILE D 2 130 ? 38.843  39.504  82.151  1.00 72.19  ? 217 ILE A CG1   1 
ATOM   1644 C CG2   . ILE D 2 130 ? 39.624  37.255  82.832  1.00 74.28  ? 217 ILE A CG2   1 
ATOM   1645 C CD1   . ILE D 2 130 ? 38.323  39.016  80.821  1.00 93.86  ? 217 ILE A CD1   1 
ATOM   1646 N N     . GLU D 2 131 ? 42.892  39.081  84.074  1.00 115.27 ? 218 GLU A N     1 
ATOM   1647 C CA    . GLU D 2 131 ? 44.180  38.503  84.423  1.00 121.65 ? 218 GLU A CA    1 
ATOM   1648 C C     . GLU D 2 131 ? 44.393  38.672  85.923  1.00 116.78 ? 218 GLU A C     1 
ATOM   1649 O O     . GLU D 2 131 ? 44.766  37.727  86.618  1.00 120.95 ? 218 GLU A O     1 
ATOM   1650 C CB    . GLU D 2 131 ? 45.297  39.212  83.654  1.00 116.45 ? 218 GLU A CB    1 
ATOM   1651 C CG    . GLU D 2 131 ? 46.567  38.392  83.506  1.00 119.66 ? 218 GLU A CG    1 
ATOM   1652 C CD    . GLU D 2 131 ? 46.374  37.172  82.620  1.00 133.07 ? 218 GLU A CD    1 
ATOM   1653 O OE1   . GLU D 2 131 ? 47.319  36.362  82.512  1.00 120.71 ? 218 GLU A OE1   1 
ATOM   1654 O OE2   . GLU D 2 131 ? 45.282  37.025  82.027  1.00 127.47 ? 218 GLU A OE2   1 
ATOM   1655 N N     . ARG D 2 132 ? 44.148  39.883  86.415  1.00 94.67  ? 219 ARG A N     1 
ATOM   1656 C CA    . ARG D 2 132 ? 44.299  40.180  87.834  1.00 92.66  ? 219 ARG A CA    1 
ATOM   1657 C C     . ARG D 2 132 ? 43.549  39.138  88.656  1.00 91.65  ? 219 ARG A C     1 
ATOM   1658 O O     . ARG D 2 132 ? 44.145  38.419  89.455  1.00 106.73 ? 219 ARG A O     1 
ATOM   1659 C CB    . ARG D 2 132 ? 43.752  41.576  88.136  1.00 85.93  ? 219 ARG A CB    1 
ATOM   1660 C CG    . ARG D 2 132 ? 43.890  42.009  89.589  1.00 64.86  ? 219 ARG A CG    1 
ATOM   1661 C CD    . ARG D 2 132 ? 43.370  43.429  89.777  1.00 117.43 ? 219 ARG A CD    1 
ATOM   1662 N NE    . ARG D 2 132 ? 44.091  44.401  88.953  1.00 121.05 ? 219 ARG A NE    1 
ATOM   1663 C CZ    . ARG D 2 132 ? 45.306  44.871  89.222  1.00 115.08 ? 219 ARG A CZ    1 
ATOM   1664 N NH1   . ARG D 2 132 ? 45.958  44.465  90.305  1.00 100.05 ? 219 ARG A NH1   1 
ATOM   1665 N NH2   . ARG D 2 132 ? 45.872  45.750  88.406  1.00 135.23 ? 219 ARG A NH2   1 
ATOM   1666 N N     . LYS D 2 133 ? 42.241  39.061  88.453  1.00 83.71  ? 220 LYS A N     1 
ATOM   1667 C CA    . LYS D 2 133 ? 41.406  38.102  89.160  1.00 88.29  ? 220 LYS A CA    1 
ATOM   1668 C C     . LYS D 2 133 ? 41.975  36.695  89.003  1.00 92.24  ? 220 LYS A C     1 
ATOM   1669 O O     . LYS D 2 133 ? 42.051  35.931  89.968  1.00 87.75  ? 220 LYS A O     1 
ATOM   1670 C CB    . LYS D 2 133 ? 39.990  38.137  88.595  1.00 107.20 ? 220 LYS A CB    1 
ATOM   1671 C CG    . LYS D 2 133 ? 39.251  39.430  88.839  1.00 104.50 ? 220 LYS A CG    1 
ATOM   1672 C CD    . LYS D 2 133 ? 37.989  39.486  88.008  1.00 88.26  ? 220 LYS A CD    1 
ATOM   1673 C CE    . LYS D 2 133 ? 36.999  40.458  88.611  1.00 64.32  ? 220 LYS A CE    1 
ATOM   1674 N NZ    . LYS D 2 133 ? 36.542  39.978  89.941  1.00 78.17  ? 220 LYS A NZ    1 
ATOM   1675 N N     . ILE D 2 134 ? 42.357  36.350  87.775  1.00 117.70 ? 221 ILE A N     1 
ATOM   1676 C CA    . ILE D 2 134 ? 42.925  35.033  87.508  1.00 113.03 ? 221 ILE A CA    1 
ATOM   1677 C C     . ILE D 2 134 ? 44.015  34.768  88.534  1.00 115.75 ? 221 ILE A C     1 
ATOM   1678 O O     . ILE D 2 134 ? 43.895  33.856  89.355  1.00 89.00  ? 221 ILE A O     1 
ATOM   1679 C CB    . ILE D 2 134 ? 43.543  34.949  86.089  1.00 92.24  ? 221 ILE A CB    1 
ATOM   1680 C CG1   . ILE D 2 134 ? 42.437  34.839  85.041  1.00 89.57  ? 221 ILE A CG1   1 
ATOM   1681 C CG2   . ILE D 2 134 ? 44.471  33.747  85.992  1.00 82.74  ? 221 ILE A CG2   1 
ATOM   1682 C CD1   . ILE D 2 134 ? 42.949  34.729  83.621  1.00 114.97 ? 221 ILE A CD1   1 
ATOM   1683 N N     . GLN D 2 135 ? 45.065  35.586  88.481  1.00 109.16 ? 222 GLN A N     1 
ATOM   1684 C CA    . GLN D 2 135 ? 46.203  35.482  89.389  1.00 109.02 ? 222 GLN A CA    1 
ATOM   1685 C C     . GLN D 2 135 ? 45.734  35.209  90.809  1.00 106.58 ? 222 GLN A C     1 
ATOM   1686 O O     . GLN D 2 135 ? 46.171  34.249  91.444  1.00 130.78 ? 222 GLN A O     1 
ATOM   1687 C CB    . GLN D 2 135 ? 47.004  36.781  89.388  1.00 93.00  ? 222 GLN A CB    1 
ATOM   1688 C CG    . GLN D 2 135 ? 47.382  37.300  88.018  1.00 122.34 ? 222 GLN A CG    1 
ATOM   1689 C CD    . GLN D 2 135 ? 48.180  38.587  88.097  1.00 121.99 ? 222 GLN A CD    1 
ATOM   1690 O OE1   . GLN D 2 135 ? 48.467  39.218  87.082  1.00 113.17 ? 222 GLN A OE1   1 
ATOM   1691 N NE2   . GLN D 2 135 ? 48.549  38.981  89.311  1.00 110.40 ? 222 GLN A NE2   1 
ATOM   1692 N N     . LEU D 2 136 ? 44.847  36.066  91.304  1.00 87.86  ? 223 LEU A N     1 
ATOM   1693 C CA    . LEU D 2 136 ? 44.314  35.922  92.653  1.00 80.52  ? 223 LEU A CA    1 
ATOM   1694 C C     . LEU D 2 136 ? 43.375  34.720  92.709  1.00 72.16  ? 223 LEU A C     1 
ATOM   1695 O O     . LEU D 2 136 ? 42.446  34.676  93.520  1.00 75.34  ? 223 LEU A O     1 
ATOM   1696 C CB    . LEU D 2 136 ? 43.578  37.202  93.068  1.00 95.40  ? 223 LEU A CB    1 
ATOM   1697 C CG    . LEU D 2 136 ? 43.020  37.293  94.491  1.00 114.15 ? 223 LEU A CG    1 
ATOM   1698 C CD1   . LEU D 2 136 ? 44.101  36.925  95.496  1.00 136.82 ? 223 LEU A CD1   1 
ATOM   1699 C CD2   . LEU D 2 136 ? 42.504  38.701  94.749  1.00 107.70 ? 223 LEU A CD2   1 
ATOM   1700 N N     . GLY D 2 137 ? 43.628  33.754  91.827  1.00 37.47  ? 224 GLY A N     1 
ATOM   1701 C CA    . GLY D 2 137 ? 42.840  32.538  91.781  1.00 68.19  ? 224 GLY A CA    1 
ATOM   1702 C C     . GLY D 2 137 ? 41.350  32.765  91.866  1.00 89.57  ? 224 GLY A C     1 
ATOM   1703 O O     . GLY D 2 137 ? 40.705  32.380  92.844  1.00 70.97  ? 224 GLY A O     1 
ATOM   1704 N N     . ILE D 2 138 ? 40.801  33.402  90.839  1.00 116.07 ? 225 ILE A N     1 
ATOM   1705 C CA    . ILE D 2 138 ? 39.372  33.668  90.794  1.00 116.05 ? 225 ILE A CA    1 
ATOM   1706 C C     . ILE D 2 138 ? 38.819  33.182  89.461  1.00 112.66 ? 225 ILE A C     1 
ATOM   1707 O O     . ILE D 2 138 ? 39.030  33.809  88.422  1.00 122.44 ? 225 ILE A O     1 
ATOM   1708 C CB    . ILE D 2 138 ? 39.067  35.174  90.943  1.00 91.03  ? 225 ILE A CB    1 
ATOM   1709 C CG1   . ILE D 2 138 ? 39.785  35.741  92.168  1.00 107.85 ? 225 ILE A CG1   1 
ATOM   1710 C CG2   . ILE D 2 138 ? 37.568  35.381  91.104  1.00 102.67 ? 225 ILE A CG2   1 
ATOM   1711 C CD1   . ILE D 2 138 ? 39.584  37.235  92.360  1.00 70.36  ? 225 ILE A CD1   1 
ATOM   1712 N N     . ASP D 2 139 ? 38.120  32.052  89.499  1.00 107.02 ? 226 ASP A N     1 
ATOM   1713 C CA    . ASP D 2 139 ? 37.524  31.461  88.308  1.00 110.06 ? 226 ASP A CA    1 
ATOM   1714 C C     . ASP D 2 139 ? 36.752  30.210  88.709  1.00 106.33 ? 226 ASP A C     1 
ATOM   1715 O O     . ASP D 2 139 ? 37.295  29.104  88.702  1.00 116.33 ? 226 ASP A O     1 
ATOM   1716 C CB    . ASP D 2 139 ? 38.607  31.098  87.292  1.00 106.30 ? 226 ASP A CB    1 
ATOM   1717 C CG    . ASP D 2 139 ? 38.032  30.586  85.984  1.00 124.10 ? 226 ASP A CG    1 
ATOM   1718 O OD1   . ASP D 2 139 ? 38.825  30.379  85.038  1.00 94.41  ? 226 ASP A OD1   1 
ATOM   1719 O OD2   . ASP D 2 139 ? 36.795  30.388  85.903  1.00 75.62  ? 226 ASP A OD2   1 
ATOM   1720 N N     . PRO D 2 140 ? 35.470  30.375  89.070  1.00 100.00 ? 227 PRO A N     1 
ATOM   1721 C CA    . PRO D 2 140 ? 34.580  29.285  89.487  1.00 95.60  ? 227 PRO A CA    1 
ATOM   1722 C C     . PRO D 2 140 ? 34.501  28.084  88.539  1.00 98.94  ? 227 PRO A C     1 
ATOM   1723 O O     . PRO D 2 140 ? 33.682  27.191  88.749  1.00 96.68  ? 227 PRO A O     1 
ATOM   1724 C CB    . PRO D 2 140 ? 33.236  29.983  89.645  1.00 47.78  ? 227 PRO A CB    1 
ATOM   1725 C CG    . PRO D 2 140 ? 33.638  31.341  90.119  1.00 98.91  ? 227 PRO A CG    1 
ATOM   1726 C CD    . PRO D 2 140 ? 34.801  31.681  89.223  1.00 47.29  ? 227 PRO A CD    1 
ATOM   1727 N N     . TYR D 2 141 ? 35.332  28.064  87.498  1.00 90.97  ? 228 TYR A N     1 
ATOM   1728 C CA    . TYR D 2 141 ? 35.346  26.950  86.552  1.00 91.18  ? 228 TYR A CA    1 
ATOM   1729 C C     . TYR D 2 141 ? 36.712  26.801  85.895  1.00 102.44 ? 228 TYR A C     1 
ATOM   1730 O O     . TYR D 2 141 ? 36.919  25.908  85.075  1.00 101.04 ? 228 TYR A O     1 
ATOM   1731 C CB    . TYR D 2 141 ? 34.297  27.141  85.457  1.00 85.53  ? 228 TYR A CB    1 
ATOM   1732 C CG    . TYR D 2 141 ? 32.902  27.407  85.968  1.00 87.67  ? 228 TYR A CG    1 
ATOM   1733 C CD1   . TYR D 2 141 ? 32.392  28.704  86.015  1.00 111.21 ? 228 TYR A CD1   1 
ATOM   1734 C CD2   . TYR D 2 141 ? 32.094  26.367  86.412  1.00 50.71  ? 228 TYR A CD2   1 
ATOM   1735 C CE1   . TYR D 2 141 ? 31.107  28.957  86.491  1.00 86.11  ? 228 TYR A CE1   1 
ATOM   1736 C CE2   . TYR D 2 141 ? 30.814  26.607  86.888  1.00 55.30  ? 228 TYR A CE2   1 
ATOM   1737 C CZ    . TYR D 2 141 ? 30.327  27.902  86.926  1.00 38.19  ? 228 TYR A CZ    1 
ATOM   1738 O OH    . TYR D 2 141 ? 29.062  28.140  87.411  1.00 68.82  ? 228 TYR A OH    1 
ATOM   1739 N N     . ASN D 2 142 ? 37.638  27.684  86.259  1.00 119.83 ? 229 ASN A N     1 
ATOM   1740 C CA    . ASN D 2 142 ? 38.994  27.671  85.713  1.00 125.10 ? 229 ASN A CA    1 
ATOM   1741 C C     . ASN D 2 142 ? 39.012  27.418  84.207  1.00 121.82 ? 229 ASN A C     1 
ATOM   1742 O O     . ASN D 2 142 ? 39.345  26.324  83.755  1.00 135.19 ? 229 ASN A O     1 
ATOM   1743 C CB    . ASN D 2 142 ? 39.852  26.623  86.438  1.00 118.19 ? 229 ASN A CB    1 
ATOM   1744 C CG    . ASN D 2 142 ? 40.096  26.974  87.903  1.00 129.32 ? 229 ASN A CG    1 
ATOM   1745 O OD1   . ASN D 2 142 ? 39.167  27.004  88.712  1.00 111.77 ? 229 ASN A OD1   1 
ATOM   1746 N ND2   . ASN D 2 142 ? 41.352  27.246  88.246  1.00 126.83 ? 229 ASN A ND2   1 
ATOM   1747 N N     . ALA D 2 143 ? 38.654  28.440  83.435  1.00 108.95 ? 230 ALA A N     1 
ATOM   1748 C CA    . ALA D 2 143 ? 38.624  28.334  81.981  1.00 106.32 ? 230 ALA A CA    1 
ATOM   1749 C C     . ALA D 2 143 ? 39.036  29.649  81.323  1.00 113.66 ? 230 ALA A C     1 
ATOM   1750 O O     . ALA D 2 143 ? 38.408  30.093  80.363  1.00 128.83 ? 230 ALA A O     1 
ATOM   1751 C CB    . ALA D 2 143 ? 37.221  27.936  81.519  1.00 80.36  ? 230 ALA A CB    1 
ATOM   1752 N N     . GLY D 2 144 ? 40.096  30.265  81.832  1.00 109.43 ? 231 GLY A N     1 
ATOM   1753 C CA    . GLY D 2 144 ? 40.547  31.528  81.274  1.00 126.16 ? 231 GLY A CA    1 
ATOM   1754 C C     . GLY D 2 144 ? 41.216  31.427  79.916  1.00 137.13 ? 231 GLY A C     1 
ATOM   1755 O O     . GLY D 2 144 ? 42.329  30.913  79.804  1.00 140.13 ? 231 GLY A O     1 
ATOM   1756 N N     . SER D 2 145 ? 40.536  31.920  78.882  1.00 140.73 ? 232 SER A N     1 
ATOM   1757 C CA    . SER D 2 145 ? 41.066  31.907  77.518  1.00 139.30 ? 232 SER A CA    1 
ATOM   1758 C C     . SER D 2 145 ? 41.168  33.330  76.985  1.00 136.60 ? 232 SER A C     1 
ATOM   1759 O O     . SER D 2 145 ? 40.227  33.844  76.376  1.00 108.27 ? 232 SER A O     1 
ATOM   1760 C CB    . SER D 2 145 ? 40.163  31.093  76.592  1.00 140.73 ? 232 SER A CB    1 
ATOM   1761 O OG    . SER D 2 145 ? 40.568  31.245  75.240  1.00 140.73 ? 232 SER A OG    1 
ATOM   1762 N N     . LEU D 2 146 ? 42.318  33.957  77.200  1.00 140.73 ? 233 LEU A N     1 
ATOM   1763 C CA    . LEU D 2 146 ? 42.519  35.329  76.760  1.00 140.73 ? 233 LEU A CA    1 
ATOM   1764 C C     . LEU D 2 146 ? 43.431  35.469  75.547  1.00 139.49 ? 233 LEU A C     1 
ATOM   1765 O O     . LEU D 2 146 ? 44.285  34.617  75.289  1.00 112.94 ? 233 LEU A O     1 
ATOM   1766 C CB    . LEU D 2 146 ? 43.071  36.169  77.916  1.00 140.73 ? 233 LEU A CB    1 
ATOM   1767 C CG    . LEU D 2 146 ? 42.260  36.180  79.218  1.00 140.73 ? 233 LEU A CG    1 
ATOM   1768 C CD1   . LEU D 2 146 ? 40.794  36.481  78.908  1.00 140.73 ? 233 LEU A CD1   1 
ATOM   1769 C CD2   . LEU D 2 146 ? 42.390  34.836  79.923  1.00 131.76 ? 233 LEU A CD2   1 
ATOM   1770 N N     . LYS D 2 147 ? 43.227  36.559  74.811  1.00 140.73 ? 234 LYS A N     1 
ATOM   1771 C CA    . LYS D 2 147 ? 44.007  36.869  73.619  1.00 140.73 ? 234 LYS A CA    1 
ATOM   1772 C C     . LYS D 2 147 ? 43.780  35.871  72.486  1.00 140.73 ? 234 LYS A C     1 
ATOM   1773 O O     . LYS D 2 147 ? 44.528  34.903  72.335  1.00 140.73 ? 234 LYS A O     1 
ATOM   1774 C CB    . LYS D 2 147 ? 45.494  36.931  73.971  1.00 140.73 ? 234 LYS A CB    1 
ATOM   1775 C CG    . LYS D 2 147 ? 45.833  37.937  75.063  1.00 107.91 ? 234 LYS A CG    1 
ATOM   1776 C CD    . LYS D 2 147 ? 47.338  38.131  75.156  1.00 109.21 ? 234 LYS A CD    1 
ATOM   1777 C CE    . LYS D 2 147 ? 47.890  38.673  73.841  1.00 113.45 ? 234 LYS A CE    1 
ATOM   1778 N NZ    . LYS D 2 147 ? 49.377  38.738  73.816  1.00 65.35  ? 234 LYS A NZ    1 
ATOM   1779 N N     . ASN D 2 148 ? 42.743  36.132  71.693  1.00 135.84 ? 235 ASN A N     1 
ATOM   1780 C CA    . ASN D 2 148 ? 42.360  35.299  70.553  1.00 123.66 ? 235 ASN A CA    1 
ATOM   1781 C C     . ASN D 2 148 ? 40.922  35.646  70.184  1.00 116.46 ? 235 ASN A C     1 
ATOM   1782 O O     . ASN D 2 148 ? 40.672  36.408  69.249  1.00 95.60  ? 235 ASN A O     1 
ATOM   1783 C CB    . ASN D 2 148 ? 42.437  33.815  70.912  1.00 139.69 ? 235 ASN A CB    1 
ATOM   1784 C CG    . ASN D 2 148 ? 42.091  32.914  69.743  1.00 140.73 ? 235 ASN A CG    1 
ATOM   1785 O OD1   . ASN D 2 148 ? 41.919  31.706  69.908  1.00 136.71 ? 235 ASN A OD1   1 
ATOM   1786 N ND2   . ASN D 2 148 ? 41.993  33.495  68.551  1.00 134.77 ? 235 ASN A ND2   1 
ATOM   1787 N N     . HIS D 2 149 ? 39.982  35.069  70.926  1.00 121.32 ? 236 HIS A N     1 
ATOM   1788 C CA    . HIS D 2 149 ? 38.562  35.323  70.718  1.00 128.86 ? 236 HIS A CA    1 
ATOM   1789 C C     . HIS D 2 149 ? 38.015  35.970  71.992  1.00 127.43 ? 236 HIS A C     1 
ATOM   1790 O O     . HIS D 2 149 ? 37.982  35.349  73.054  1.00 126.59 ? 236 HIS A O     1 
ATOM   1791 C CB    . HIS D 2 149 ? 37.816  34.016  70.398  1.00 140.73 ? 236 HIS A CB    1 
ATOM   1792 C CG    . HIS D 2 149 ? 37.901  32.975  71.476  1.00 140.73 ? 236 HIS A CG    1 
ATOM   1793 N ND1   . HIS D 2 149 ? 39.100  32.488  71.952  1.00 136.03 ? 236 HIS A ND1   1 
ATOM   1794 C CD2   . HIS D 2 149 ? 36.932  32.318  72.157  1.00 140.73 ? 236 HIS A CD2   1 
ATOM   1795 C CE1   . HIS D 2 149 ? 38.866  31.576  72.878  1.00 117.06 ? 236 HIS A CE1   1 
ATOM   1796 N NE2   . HIS D 2 149 ? 37.559  31.454  73.022  1.00 139.17 ? 236 HIS A NE2   1 
ATOM   1797 N N     . GLN D 2 150 ? 37.601  37.228  71.887  1.00 125.78 ? 237 GLN A N     1 
ATOM   1798 C CA    . GLN D 2 150 ? 37.091  37.940  73.050  1.00 128.48 ? 237 GLN A CA    1 
ATOM   1799 C C     . GLN D 2 150 ? 35.597  38.246  72.965  1.00 134.34 ? 237 GLN A C     1 
ATOM   1800 O O     . GLN D 2 150 ? 34.759  37.354  73.107  1.00 131.11 ? 237 GLN A O     1 
ATOM   1801 C CB    . GLN D 2 150 ? 37.877  39.244  73.244  1.00 114.15 ? 237 GLN A CB    1 
ATOM   1802 C CG    . GLN D 2 150 ? 37.802  39.824  74.654  1.00 107.21 ? 237 GLN A CG    1 
ATOM   1803 C CD    . GLN D 2 150 ? 38.570  38.997  75.675  1.00 123.97 ? 237 GLN A CD    1 
ATOM   1804 O OE1   . GLN D 2 150 ? 38.558  39.298  76.868  1.00 112.03 ? 237 GLN A OE1   1 
ATOM   1805 N NE2   . GLN D 2 150 ? 39.247  37.952  75.207  1.00 125.68 ? 237 GLN A NE2   1 
ATOM   1806 N N     . GLU D 2 151 ? 35.277  39.515  72.725  1.00 134.76 ? 238 GLU A N     1 
ATOM   1807 C CA    . GLU D 2 151 ? 33.895  39.975  72.639  1.00 130.36 ? 238 GLU A CA    1 
ATOM   1808 C C     . GLU D 2 151 ? 33.177  39.586  73.922  1.00 115.12 ? 238 GLU A C     1 
ATOM   1809 O O     . GLU D 2 151 ? 32.518  38.548  73.996  1.00 114.33 ? 238 GLU A O     1 
ATOM   1810 C CB    . GLU D 2 151 ? 33.174  39.355  71.441  1.00 139.04 ? 238 GLU A CB    1 
ATOM   1811 C CG    . GLU D 2 151 ? 32.141  40.285  70.805  1.00 140.73 ? 238 GLU A CG    1 
ATOM   1812 C CD    . GLU D 2 151 ? 31.248  40.984  71.826  1.00 137.77 ? 238 GLU A CD    1 
ATOM   1813 O OE1   . GLU D 2 151 ? 30.487  40.293  72.540  1.00 120.27 ? 238 GLU A OE1   1 
ATOM   1814 O OE2   . GLU D 2 151 ? 31.309  42.230  71.912  1.00 113.94 ? 238 GLU A OE2   1 
ATOM   1815 N N     . VAL D 2 152 ? 33.319  40.429  74.933  1.00 101.41 ? 239 VAL A N     1 
ATOM   1816 C CA    . VAL D 2 152 ? 32.698  40.191  76.224  1.00 96.14  ? 239 VAL A CA    1 
ATOM   1817 C C     . VAL D 2 152 ? 31.491  41.100  76.413  1.00 97.13  ? 239 VAL A C     1 
ATOM   1818 O O     . VAL D 2 152 ? 31.588  42.317  76.250  1.00 80.76  ? 239 VAL A O     1 
ATOM   1819 C CB    . VAL D 2 152 ? 33.710  40.440  77.351  1.00 94.48  ? 239 VAL A CB    1 
ATOM   1820 C CG1   . VAL D 2 152 ? 34.797  39.391  77.300  1.00 91.12  ? 239 VAL A CG1   1 
ATOM   1821 C CG2   . VAL D 2 152 ? 34.332  41.818  77.192  1.00 96.21  ? 239 VAL A CG2   1 
ATOM   1822 N N     . ASP D 2 153 ? 30.355  40.506  76.756  1.00 104.88 ? 240 ASP A N     1 
ATOM   1823 C CA    . ASP D 2 153 ? 29.129  41.269  76.960  1.00 110.25 ? 240 ASP A CA    1 
ATOM   1824 C C     . ASP D 2 153 ? 29.217  42.210  78.162  1.00 104.20 ? 240 ASP A C     1 
ATOM   1825 O O     . ASP D 2 153 ? 28.785  41.875  79.270  1.00 102.68 ? 240 ASP A O     1 
ATOM   1826 C CB    . ASP D 2 153 ? 27.947  40.319  77.135  1.00 119.79 ? 240 ASP A CB    1 
ATOM   1827 C CG    . ASP D 2 153 ? 27.792  39.370  75.969  1.00 94.40  ? 240 ASP A CG    1 
ATOM   1828 O OD1   . ASP D 2 153 ? 27.799  39.851  74.814  1.00 117.13 ? 240 ASP A OD1   1 
ATOM   1829 O OD2   . ASP D 2 153 ? 27.657  38.149  76.211  1.00 113.80 ? 240 ASP A OD2   1 
ATOM   1830 N N     . MET D 2 154 ? 29.774  43.392  77.925  1.00 76.53  ? 241 MET A N     1 
ATOM   1831 C CA    . MET D 2 154 ? 29.933  44.405  78.958  1.00 64.41  ? 241 MET A CA    1 
ATOM   1832 C C     . MET D 2 154 ? 28.596  44.948  79.457  1.00 63.15  ? 241 MET A C     1 
ATOM   1833 O O     . MET D 2 154 ? 28.560  45.896  80.244  1.00 93.61  ? 241 MET A O     1 
ATOM   1834 C CB    . MET D 2 154 ? 30.772  45.563  78.416  1.00 98.21  ? 241 MET A CB    1 
ATOM   1835 C CG    . MET D 2 154 ? 32.075  45.789  79.157  1.00 111.36 ? 241 MET A CG    1 
ATOM   1836 S SD    . MET D 2 154 ? 33.238  44.446  78.915  1.00 99.31  ? 241 MET A SD    1 
ATOM   1837 C CE    . MET D 2 154 ? 32.545  43.181  79.959  1.00 83.41  ? 241 MET A CE    1 
ATOM   1838 N N     . ASN D 2 155 ? 27.500  44.351  79.007  1.00 57.02  ? 242 ASN A N     1 
ATOM   1839 C CA    . ASN D 2 155 ? 26.179  44.815  79.407  1.00 79.61  ? 242 ASN A CA    1 
ATOM   1840 C C     . ASN D 2 155 ? 25.430  43.771  80.218  1.00 84.72  ? 242 ASN A C     1 
ATOM   1841 O O     . ASN D 2 155 ? 24.444  44.089  80.887  1.00 95.42  ? 242 ASN A O     1 
ATOM   1842 C CB    . ASN D 2 155 ? 25.357  45.192  78.167  1.00 93.96  ? 242 ASN A CB    1 
ATOM   1843 C CG    . ASN D 2 155 ? 25.946  46.371  77.403  1.00 115.81 ? 242 ASN A CG    1 
ATOM   1844 O OD1   . ASN D 2 155 ? 25.623  46.584  76.237  1.00 81.35  ? 242 ASN A OD1   1 
ATOM   1845 N ND2   . ASN D 2 155 ? 26.801  47.147  78.063  1.00 91.73  ? 242 ASN A ND2   1 
ATOM   1846 N N     . VAL D 2 156 ? 25.889  42.524  80.154  1.00 74.27  ? 243 VAL A N     1 
ATOM   1847 C CA    . VAL D 2 156 ? 25.236  41.452  80.894  1.00 66.77  ? 243 VAL A CA    1 
ATOM   1848 C C     . VAL D 2 156 ? 26.243  40.531  81.552  1.00 62.75  ? 243 VAL A C     1 
ATOM   1849 O O     . VAL D 2 156 ? 27.362  40.357  81.057  1.00 48.78  ? 243 VAL A O     1 
ATOM   1850 C CB    . VAL D 2 156 ? 24.332  40.604  79.994  1.00 60.79  ? 243 VAL A CB    1 
ATOM   1851 C CG1   . VAL D 2 156 ? 25.168  39.869  78.979  1.00 49.00  ? 243 VAL A CG1   1 
ATOM   1852 C CG2   . VAL D 2 156 ? 23.531  39.625  80.840  1.00 84.16  ? 243 VAL A CG2   1 
ATOM   1853 N N     . VAL D 2 157 ? 25.819  39.933  82.663  1.00 70.07  ? 244 VAL A N     1 
ATOM   1854 C CA    . VAL D 2 157 ? 26.659  39.037  83.445  1.00 71.52  ? 244 VAL A CA    1 
ATOM   1855 C C     . VAL D 2 157 ? 25.816  38.026  84.214  1.00 82.01  ? 244 VAL A C     1 
ATOM   1856 O O     . VAL D 2 157 ? 24.618  38.224  84.437  1.00 79.34  ? 244 VAL A O     1 
ATOM   1857 C CB    . VAL D 2 157 ? 27.484  39.826  84.485  1.00 62.55  ? 244 VAL A CB    1 
ATOM   1858 C CG1   . VAL D 2 157 ? 28.511  40.726  83.784  1.00 11.68  ? 244 VAL A CG1   1 
ATOM   1859 C CG2   . VAL D 2 157 ? 26.530  40.657  85.360  1.00 41.56  ? 244 VAL A CG2   1 
ATOM   1860 N N     . ARG D 2 158 ? 26.469  36.947  84.624  1.00 61.61  ? 245 ARG A N     1 
ATOM   1861 C CA    . ARG D 2 158 ? 25.835  35.891  85.395  1.00 63.72  ? 245 ARG A CA    1 
ATOM   1862 C C     . ARG D 2 158 ? 26.569  35.818  86.718  1.00 54.75  ? 245 ARG A C     1 
ATOM   1863 O O     . ARG D 2 158 ? 27.798  35.778  86.747  1.00 53.92  ? 245 ARG A O     1 
ATOM   1864 C CB    . ARG D 2 158 ? 25.959  34.543  84.676  1.00 55.10  ? 245 ARG A CB    1 
ATOM   1865 C CG    . ARG D 2 158 ? 25.054  34.380  83.470  1.00 89.15  ? 245 ARG A CG    1 
ATOM   1866 C CD    . ARG D 2 158 ? 25.326  33.072  82.750  1.00 111.26 ? 245 ARG A CD    1 
ATOM   1867 N NE    . ARG D 2 158 ? 24.399  32.847  81.645  1.00 83.36  ? 245 ARG A NE    1 
ATOM   1868 C CZ    . ARG D 2 158 ? 23.118  32.529  81.795  1.00 95.07  ? 245 ARG A CZ    1 
ATOM   1869 N NH1   . ARG D 2 158 ? 22.602  32.393  83.007  1.00 80.24  ? 245 ARG A NH1   1 
ATOM   1870 N NH2   . ARG D 2 158 ? 22.350  32.344  80.731  1.00 89.46  ? 245 ARG A NH2   1 
ATOM   1871 N N     . ILE D 2 159 ? 25.825  35.807  87.816  1.00 81.05  ? 246 ILE A N     1 
ATOM   1872 C CA    . ILE D 2 159 ? 26.452  35.719  89.124  1.00 88.20  ? 246 ILE A CA    1 
ATOM   1873 C C     . ILE D 2 159 ? 26.440  34.259  89.598  1.00 86.27  ? 246 ILE A C     1 
ATOM   1874 O O     . ILE D 2 159 ? 25.403  33.721  89.989  1.00 94.55  ? 246 ILE A O     1 
ATOM   1875 C CB    . ILE D 2 159 ? 25.745  36.656  90.149  1.00 64.15  ? 246 ILE A CB    1 
ATOM   1876 C CG1   . ILE D 2 159 ? 26.506  36.651  91.471  1.00 90.88  ? 246 ILE A CG1   1 
ATOM   1877 C CG2   . ILE D 2 159 ? 24.314  36.211  90.390  1.00 57.61  ? 246 ILE A CG2   1 
ATOM   1878 C CD1   . ILE D 2 159 ? 26.298  35.399  92.296  1.00 63.51  ? 246 ILE A CD1   1 
ATOM   1879 N N     . CYS D 2 160 ? 27.610  33.626  89.535  1.00 73.32  ? 247 CYS A N     1 
ATOM   1880 C CA    . CYS D 2 160 ? 27.787  32.235  89.938  1.00 82.53  ? 247 CYS A CA    1 
ATOM   1881 C C     . CYS D 2 160 ? 27.741  32.073  91.445  1.00 94.85  ? 247 CYS A C     1 
ATOM   1882 O O     . CYS D 2 160 ? 28.125  32.974  92.184  1.00 110.95 ? 247 CYS A O     1 
ATOM   1883 C CB    . CYS D 2 160 ? 29.131  31.716  89.437  1.00 69.68  ? 247 CYS A CB    1 
ATOM   1884 S SG    . CYS D 2 160 ? 29.526  30.052  90.000  1.00 76.64  ? 247 CYS A SG    1 
ATOM   1885 N N     . PHE D 2 161 ? 27.281  30.912  91.899  1.00 108.45 ? 248 PHE A N     1 
ATOM   1886 C CA    . PHE D 2 161 ? 27.205  30.636  93.329  1.00 112.30 ? 248 PHE A CA    1 
ATOM   1887 C C     . PHE D 2 161 ? 27.970  29.378  93.705  1.00 113.51 ? 248 PHE A C     1 
ATOM   1888 O O     . PHE D 2 161 ? 27.646  28.282  93.247  1.00 133.72 ? 248 PHE A O     1 
ATOM   1889 C CB    . PHE D 2 161 ? 25.754  30.483  93.787  1.00 83.11  ? 248 PHE A CB    1 
ATOM   1890 C CG    . PHE D 2 161 ? 24.941  31.730  93.649  1.00 72.13  ? 248 PHE A CG    1 
ATOM   1891 C CD1   . PHE D 2 161 ? 24.418  32.106  92.418  1.00 73.22  ? 248 PHE A CD1   1 
ATOM   1892 C CD2   . PHE D 2 161 ? 24.693  32.526  94.751  1.00 43.38  ? 248 PHE A CD2   1 
ATOM   1893 C CE1   . PHE D 2 161 ? 23.651  33.259  92.287  1.00 56.48  ? 248 PHE A CE1   1 
ATOM   1894 C CE2   . PHE D 2 161 ? 23.928  33.683  94.635  1.00 95.55  ? 248 PHE A CE2   1 
ATOM   1895 C CZ    . PHE D 2 161 ? 23.405  34.051  93.398  1.00 76.12  ? 248 PHE A CZ    1 
ATOM   1896 N N     . GLN D 2 162 ? 28.986  29.550  94.543  1.00 100.19 ? 249 GLN A N     1 
ATOM   1897 C CA    . GLN D 2 162 ? 29.800  28.439  95.013  1.00 110.06 ? 249 GLN A CA    1 
ATOM   1898 C C     . GLN D 2 162 ? 29.615  28.382  96.532  1.00 120.44 ? 249 GLN A C     1 
ATOM   1899 O O     . GLN D 2 162 ? 30.138  29.233  97.250  1.00 137.90 ? 249 GLN A O     1 
ATOM   1900 C CB    . GLN D 2 162 ? 31.275  28.689  94.672  1.00 128.21 ? 249 GLN A CB    1 
ATOM   1901 C CG    . GLN D 2 162 ? 31.499  29.329  93.304  1.00 129.19 ? 249 GLN A CG    1 
ATOM   1902 C CD    . GLN D 2 162 ? 32.970  29.587  92.994  1.00 136.04 ? 249 GLN A CD    1 
ATOM   1903 O OE1   . GLN D 2 162 ? 33.694  28.690  92.545  1.00 79.75  ? 249 GLN A OE1   1 
ATOM   1904 N NE2   . GLN D 2 162 ? 33.420  30.819  93.242  1.00 98.63  ? 249 GLN A NE2   1 
ATOM   1905 N N     . ALA D 2 163 ? 28.864  27.395  97.018  1.00 118.39 ? 250 ALA A N     1 
ATOM   1906 C CA    . ALA D 2 163 ? 28.616  27.258  98.456  1.00 126.80 ? 250 ALA A CA    1 
ATOM   1907 C C     . ALA D 2 163 ? 29.445  26.144  99.105  1.00 121.44 ? 250 ALA A C     1 
ATOM   1908 O O     . ALA D 2 163 ? 29.208  24.958  98.867  1.00 105.99 ? 250 ALA A O     1 
ATOM   1909 C CB    . ALA D 2 163 ? 27.133  27.018  98.703  1.00 139.46 ? 250 ALA A CB    1 
ATOM   1910 N N     . SER D 2 164 ? 30.407  26.540  99.937  1.00 121.01 ? 251 SER A N     1 
ATOM   1911 C CA    . SER D 2 164 ? 31.295  25.600  100.621 1.00 121.24 ? 251 SER A CA    1 
ATOM   1912 C C     . SER D 2 164 ? 30.764  25.182  101.993 1.00 123.68 ? 251 SER A C     1 
ATOM   1913 O O     . SER D 2 164 ? 30.454  26.027  102.833 1.00 100.53 ? 251 SER A O     1 
ATOM   1914 C CB    . SER D 2 164 ? 32.685  26.223  100.784 1.00 116.62 ? 251 SER A CB    1 
ATOM   1915 O OG    . SER D 2 164 ? 33.200  26.668  99.540  1.00 99.25  ? 251 SER A OG    1 
ATOM   1916 N N     . TYR D 2 165 ? 30.673  23.873  102.215 1.00 129.11 ? 252 TYR A N     1 
ATOM   1917 C CA    . TYR D 2 165 ? 30.185  23.332  103.480 1.00 134.64 ? 252 TYR A CA    1 
ATOM   1918 C C     . TYR D 2 165 ? 31.334  23.085  104.455 1.00 131.27 ? 252 TYR A C     1 
ATOM   1919 O O     . TYR D 2 165 ? 32.505  23.229  104.101 1.00 138.67 ? 252 TYR A O     1 
ATOM   1920 C CB    . TYR D 2 165 ? 29.424  22.038  103.234 1.00 129.66 ? 252 TYR A CB    1 
ATOM   1921 N N     . ARG D 2 166 ? 30.991  22.704  105.682 1.00 135.16 ? 253 ARG A N     1 
ATOM   1922 C CA    . ARG D 2 166 ? 31.992  22.444  106.712 1.00 140.73 ? 253 ARG A CA    1 
ATOM   1923 C C     . ARG D 2 166 ? 31.463  21.542  107.830 1.00 140.73 ? 253 ARG A C     1 
ATOM   1924 O O     . ARG D 2 166 ? 30.497  21.886  108.513 1.00 140.73 ? 253 ARG A O     1 
ATOM   1925 C CB    . ARG D 2 166 ? 32.475  23.773  107.304 1.00 140.73 ? 253 ARG A CB    1 
ATOM   1926 C CG    . ARG D 2 166 ? 33.400  23.646  108.509 1.00 140.73 ? 253 ARG A CG    1 
ATOM   1927 C CD    . ARG D 2 166 ? 34.752  23.030  108.159 1.00 140.73 ? 253 ARG A CD    1 
ATOM   1928 N NE    . ARG D 2 166 ? 34.643  21.654  107.679 1.00 140.73 ? 253 ARG A NE    1 
ATOM   1929 C CZ    . ARG D 2 166 ? 35.683  20.851  107.471 1.00 140.73 ? 253 ARG A CZ    1 
ATOM   1930 N NH1   . ARG D 2 166 ? 35.491  19.617  107.032 1.00 125.83 ? 253 ARG A NH1   1 
ATOM   1931 N NH2   . ARG D 2 166 ? 36.916  21.279  107.708 1.00 140.73 ? 253 ARG A NH2   1 
ATOM   1932 N N     . ASP D 2 167 ? 32.098  20.385  108.012 1.00 137.99 ? 254 ASP A N     1 
ATOM   1933 C CA    . ASP D 2 167 ? 31.693  19.453  109.061 1.00 129.73 ? 254 ASP A CA    1 
ATOM   1934 C C     . ASP D 2 167 ? 32.777  19.343  110.128 1.00 126.14 ? 254 ASP A C     1 
ATOM   1935 O O     . ASP D 2 167 ? 33.908  19.794  109.932 1.00 125.94 ? 254 ASP A O     1 
ATOM   1936 C CB    . ASP D 2 167 ? 31.404  18.059  108.488 1.00 129.15 ? 254 ASP A CB    1 
ATOM   1937 C CG    . ASP D 2 167 ? 32.662  17.336  108.035 1.00 104.14 ? 254 ASP A CG    1 
ATOM   1938 O OD1   . ASP D 2 167 ? 33.236  17.728  107.000 1.00 109.00 ? 254 ASP A OD1   1 
ATOM   1939 O OD2   . ASP D 2 167 ? 33.076  16.376  108.716 1.00 118.82 ? 254 ASP A OD2   1 
ATOM   1940 N N     . GLN D 2 168 ? 32.423  18.741  111.257 1.00 122.27 ? 255 GLN A N     1 
ATOM   1941 C CA    . GLN D 2 168 ? 33.354  18.570  112.363 1.00 129.08 ? 255 GLN A CA    1 
ATOM   1942 C C     . GLN D 2 168 ? 34.671  17.970  111.877 1.00 131.97 ? 255 GLN A C     1 
ATOM   1943 O O     . GLN D 2 168 ? 35.749  18.489  112.174 1.00 130.71 ? 255 GLN A O     1 
ATOM   1944 C CB    . GLN D 2 168 ? 32.724  17.675  113.432 1.00 114.36 ? 255 GLN A CB    1 
ATOM   1945 C CG    . GLN D 2 168 ? 31.373  18.174  113.928 1.00 134.38 ? 255 GLN A CG    1 
ATOM   1946 C CD    . GLN D 2 168 ? 30.775  17.294  115.011 1.00 140.73 ? 255 GLN A CD    1 
ATOM   1947 O OE1   . GLN D 2 168 ? 29.664  17.541  115.479 1.00 140.73 ? 255 GLN A OE1   1 
ATOM   1948 N NE2   . GLN D 2 168 ? 31.511  16.265  115.417 1.00 140.73 ? 255 GLN A NE2   1 
ATOM   1949 N N     . GLN D 2 169 ? 34.573  16.878  111.123 1.00 135.21 ? 256 GLN A N     1 
ATOM   1950 C CA    . GLN D 2 169 ? 35.743  16.194  110.580 1.00 133.30 ? 256 GLN A CA    1 
ATOM   1951 C C     . GLN D 2 169 ? 36.496  17.061  109.573 1.00 139.01 ? 256 GLN A C     1 
ATOM   1952 O O     . GLN D 2 169 ? 36.143  18.219  109.344 1.00 133.54 ? 256 GLN A O     1 
ATOM   1953 C CB    . GLN D 2 169 ? 35.318  14.887  109.900 1.00 140.02 ? 256 GLN A CB    1 
ATOM   1954 C CG    . GLN D 2 169 ? 35.185  13.692  110.831 1.00 105.29 ? 256 GLN A CG    1 
ATOM   1955 C CD    . GLN D 2 169 ? 36.533  13.124  111.235 1.00 134.41 ? 256 GLN A CD    1 
ATOM   1956 O OE1   . GLN D 2 169 ? 37.298  12.644  110.396 1.00 140.73 ? 256 GLN A OE1   1 
ATOM   1957 N NE2   . GLN D 2 169 ? 36.833  13.179  112.524 1.00 115.19 ? 256 GLN A NE2   1 
ATOM   1958 N N     . GLY D 2 170 ? 37.541  16.485  108.984 1.00 140.73 ? 257 GLY A N     1 
ATOM   1959 C CA    . GLY D 2 170 ? 38.325  17.194  107.989 1.00 136.93 ? 257 GLY A CA    1 
ATOM   1960 C C     . GLY D 2 170 ? 37.859  16.757  106.614 1.00 132.87 ? 257 GLY A C     1 
ATOM   1961 O O     . GLY D 2 170 ? 38.655  16.338  105.773 1.00 125.94 ? 257 GLY A O     1 
ATOM   1962 N N     . HIS D 2 171 ? 36.551  16.856  106.395 1.00 129.56 ? 258 HIS A N     1 
ATOM   1963 C CA    . HIS D 2 171 ? 35.937  16.459  105.135 1.00 130.71 ? 258 HIS A CA    1 
ATOM   1964 C C     . HIS D 2 171 ? 35.132  17.625  104.547 1.00 137.56 ? 258 HIS A C     1 
ATOM   1965 O O     . HIS D 2 171 ? 33.984  17.452  104.132 1.00 140.73 ? 258 HIS A O     1 
ATOM   1966 C CB    . HIS D 2 171 ? 35.018  15.254  105.385 1.00 107.50 ? 258 HIS A CB    1 
ATOM   1967 C CG    . HIS D 2 171 ? 34.981  14.267  104.259 1.00 125.66 ? 258 HIS A CG    1 
ATOM   1968 N ND1   . HIS D 2 171 ? 36.106  13.608  103.808 1.00 135.97 ? 258 HIS A ND1   1 
ATOM   1969 C CD2   . HIS D 2 171 ? 33.950  13.799  103.516 1.00 137.81 ? 258 HIS A CD2   1 
ATOM   1970 C CE1   . HIS D 2 171 ? 35.770  12.777  102.838 1.00 129.68 ? 258 HIS A CE1   1 
ATOM   1971 N NE2   . HIS D 2 171 ? 34.467  12.873  102.641 1.00 140.73 ? 258 HIS A NE2   1 
ATOM   1972 N N     . LEU D 2 172 ? 35.739  18.811  104.513 1.00 133.45 ? 259 LEU A N     1 
ATOM   1973 C CA    . LEU D 2 172 ? 35.075  20.005  103.986 1.00 129.53 ? 259 LEU A CA    1 
ATOM   1974 C C     . LEU D 2 172 ? 34.896  19.972  102.467 1.00 125.09 ? 259 LEU A C     1 
ATOM   1975 O O     . LEU D 2 172 ? 35.708  20.524  101.720 1.00 88.61  ? 259 LEU A O     1 
ATOM   1976 C CB    . LEU D 2 172 ? 35.850  21.268  104.385 1.00 132.26 ? 259 LEU A CB    1 
ATOM   1977 C CG    . LEU D 2 172 ? 37.309  21.412  103.937 1.00 133.51 ? 259 LEU A CG    1 
ATOM   1978 C CD1   . LEU D 2 172 ? 37.814  22.802  104.321 1.00 92.61  ? 259 LEU A CD1   1 
ATOM   1979 C CD2   . LEU D 2 172 ? 38.169  20.317  104.572 1.00 85.54  ? 259 LEU A CD2   1 
ATOM   1980 N N     . HIS D 2 173 ? 33.816  19.335  102.024 1.00 131.93 ? 260 HIS A N     1 
ATOM   1981 C CA    . HIS D 2 173 ? 33.505  19.207  100.602 1.00 140.73 ? 260 HIS A CA    1 
ATOM   1982 C C     . HIS D 2 173 ? 32.924  20.498  100.016 1.00 140.73 ? 260 HIS A C     1 
ATOM   1983 O O     . HIS D 2 173 ? 32.657  21.458  100.740 1.00 140.73 ? 260 HIS A O     1 
ATOM   1984 C CB    . HIS D 2 173 ? 32.505  18.065  100.398 1.00 133.26 ? 260 HIS A CB    1 
ATOM   1985 C CG    . HIS D 2 173 ? 31.146  18.347  100.964 1.00 140.73 ? 260 HIS A CG    1 
ATOM   1986 N ND1   . HIS D 2 173 ? 30.949  18.719  102.277 1.00 139.92 ? 260 HIS A ND1   1 
ATOM   1987 C CD2   . HIS D 2 173 ? 29.918  18.319  100.393 1.00 135.50 ? 260 HIS A CD2   1 
ATOM   1988 C CE1   . HIS D 2 173 ? 29.660  18.909  102.491 1.00 126.78 ? 260 HIS A CE1   1 
ATOM   1989 N NE2   . HIS D 2 173 ? 29.012  18.673  101.363 1.00 134.92 ? 260 HIS A NE2   1 
ATOM   1990 N N     . ARG D 2 174 ? 32.731  20.507  98.699  1.00 140.73 ? 261 ARG A N     1 
ATOM   1991 C CA    . ARG D 2 174 ? 32.170  21.664  98.008  1.00 133.25 ? 261 ARG A CA    1 
ATOM   1992 C C     . ARG D 2 174 ? 31.021  21.234  97.102  1.00 129.26 ? 261 ARG A C     1 
ATOM   1993 O O     . ARG D 2 174 ? 31.142  20.275  96.339  1.00 132.16 ? 261 ARG A O     1 
ATOM   1994 C CB    . ARG D 2 174 ? 33.238  22.365  97.161  1.00 128.56 ? 261 ARG A CB    1 
ATOM   1995 C CG    . ARG D 2 174 ? 33.802  21.516  96.032  1.00 95.52  ? 261 ARG A CG    1 
ATOM   1996 C CD    . ARG D 2 174 ? 34.660  22.341  95.093  1.00 115.14 ? 261 ARG A CD    1 
ATOM   1997 N NE    . ARG D 2 174 ? 35.599  23.184  95.824  1.00 129.09 ? 261 ARG A NE    1 
ATOM   1998 C CZ    . ARG D 2 174 ? 36.600  23.853  95.259  1.00 137.27 ? 261 ARG A CZ    1 
ATOM   1999 N NH1   . ARG D 2 174 ? 36.803  23.775  93.949  1.00 126.97 ? 261 ARG A NH1   1 
ATOM   2000 N NH2   . ARG D 2 174 ? 37.398  24.606  96.006  1.00 131.65 ? 261 ARG A NH2   1 
ATOM   2001 N N     . MET D 2 175 ? 29.905  21.947  97.189  1.00 105.13 ? 262 MET A N     1 
ATOM   2002 C CA    . MET D 2 175 ? 28.749  21.629  96.366  1.00 97.53  ? 262 MET A CA    1 
ATOM   2003 C C     . MET D 2 175 ? 29.023  21.988  94.908  1.00 102.66 ? 262 MET A C     1 
ATOM   2004 O O     . MET D 2 175 ? 30.177  22.076  94.491  1.00 91.64  ? 262 MET A O     1 
ATOM   2005 C CB    . MET D 2 175 ? 27.523  22.390  96.873  1.00 83.32  ? 262 MET A CB    1 
ATOM   2006 C CG    . MET D 2 175 ? 26.999  21.883  98.198  1.00 85.01  ? 262 MET A CG    1 
ATOM   2007 S SD    . MET D 2 175 ? 25.556  22.791  98.752  1.00 104.32 ? 262 MET A SD    1 
ATOM   2008 C CE    . MET D 2 175 ? 26.304  23.958  99.849  1.00 59.95  ? 262 MET A CE    1 
ATOM   2009 N N     . ASP D 2 176 ? 27.961  22.181  94.133  1.00 122.07 ? 263 ASP A N     1 
ATOM   2010 C CA    . ASP D 2 176 ? 28.100  22.540  92.728  1.00 115.95 ? 263 ASP A CA    1 
ATOM   2011 C C     . ASP D 2 176 ? 27.666  23.986  92.512  1.00 111.59 ? 263 ASP A C     1 
ATOM   2012 O O     . ASP D 2 176 ? 26.742  24.472  93.166  1.00 107.28 ? 263 ASP A O     1 
ATOM   2013 C CB    . ASP D 2 176 ? 27.259  21.616  91.840  1.00 116.71 ? 263 ASP A CB    1 
ATOM   2014 C CG    . ASP D 2 176 ? 27.751  20.184  91.854  1.00 109.26 ? 263 ASP A CG    1 
ATOM   2015 O OD1   . ASP D 2 176 ? 27.556  19.499  92.879  1.00 101.49 ? 263 ASP A OD1   1 
ATOM   2016 O OD2   . ASP D 2 176 ? 28.337  19.745  90.843  1.00 114.99 ? 263 ASP A OD2   1 
ATOM   2017 N N     . PRO D 2 177 ? 28.335  24.693  91.588  1.00 104.21 ? 264 PRO A N     1 
ATOM   2018 C CA    . PRO D 2 177 ? 28.048  26.093  91.257  1.00 107.36 ? 264 PRO A CA    1 
ATOM   2019 C C     . PRO D 2 177 ? 26.625  26.331  90.748  1.00 104.46 ? 264 PRO A C     1 
ATOM   2020 O O     . PRO D 2 177 ? 26.012  25.445  90.156  1.00 123.49 ? 264 PRO A O     1 
ATOM   2021 C CB    . PRO D 2 177 ? 29.088  26.409  90.182  1.00 121.17 ? 264 PRO A CB    1 
ATOM   2022 C CG    . PRO D 2 177 ? 30.227  25.497  90.527  1.00 102.80 ? 264 PRO A CG    1 
ATOM   2023 C CD    . PRO D 2 177 ? 29.515  24.215  90.847  1.00 113.71 ? 264 PRO A CD    1 
ATOM   2024 N N     . ILE D 2 178 ? 26.108  27.532  90.987  1.00 100.66 ? 265 ILE A N     1 
ATOM   2025 C CA    . ILE D 2 178 ? 24.772  27.912  90.529  1.00 98.72  ? 265 ILE A CA    1 
ATOM   2026 C C     . ILE D 2 178 ? 24.868  29.215  89.731  1.00 110.46 ? 265 ILE A C     1 
ATOM   2027 O O     . ILE D 2 178 ? 25.545  30.158  90.142  1.00 126.01 ? 265 ILE A O     1 
ATOM   2028 C CB    . ILE D 2 178 ? 23.787  28.091  91.721  1.00 73.37  ? 265 ILE A CB    1 
ATOM   2029 C CG1   . ILE D 2 178 ? 23.094  26.761  92.037  1.00 69.96  ? 265 ILE A CG1   1 
ATOM   2030 C CG2   . ILE D 2 178 ? 22.728  29.132  91.386  1.00 83.24  ? 265 ILE A CG2   1 
ATOM   2031 C CD1   . ILE D 2 178 ? 24.034  25.599  92.320  1.00 72.64  ? 265 ILE A CD1   1 
ATOM   2032 N N     . LEU D 2 179 ? 24.197  29.257  88.584  1.00 99.62  ? 266 LEU A N     1 
ATOM   2033 C CA    . LEU D 2 179 ? 24.220  30.439  87.729  1.00 75.35  ? 266 LEU A CA    1 
ATOM   2034 C C     . LEU D 2 179 ? 22.917  31.210  87.811  1.00 68.44  ? 266 LEU A C     1 
ATOM   2035 O O     . LEU D 2 179 ? 21.854  30.631  88.042  1.00 69.76  ? 266 LEU A O     1 
ATOM   2036 C CB    . LEU D 2 179 ? 24.487  30.037  86.284  1.00 55.43  ? 266 LEU A CB    1 
ATOM   2037 C CG    . LEU D 2 179 ? 25.918  29.596  85.971  1.00 79.86  ? 266 LEU A CG    1 
ATOM   2038 C CD1   . LEU D 2 179 ? 26.823  30.813  85.962  1.00 81.33  ? 266 LEU A CD1   1 
ATOM   2039 C CD2   . LEU D 2 179 ? 26.390  28.559  86.993  1.00 65.09  ? 266 LEU A CD2   1 
ATOM   2040 N N     . SER D 2 180 ? 23.004  32.520  87.612  1.00 66.76  ? 267 SER A N     1 
ATOM   2041 C CA    . SER D 2 180 ? 21.828  33.368  87.689  1.00 81.25  ? 267 SER A CA    1 
ATOM   2042 C C     . SER D 2 180 ? 21.233  33.728  86.331  1.00 86.26  ? 267 SER A C     1 
ATOM   2043 O O     . SER D 2 180 ? 21.880  33.615  85.282  1.00 55.50  ? 267 SER A O     1 
ATOM   2044 C CB    . SER D 2 180 ? 22.152  34.660  88.459  1.00 72.54  ? 267 SER A CB    1 
ATOM   2045 O OG    . SER D 2 180 ? 22.917  35.565  87.677  1.00 55.27  ? 267 SER A OG    1 
ATOM   2046 N N     . GLU D 2 181 ? 19.977  34.155  86.374  1.00 95.61  ? 268 GLU A N     1 
ATOM   2047 C CA    . GLU D 2 181 ? 19.264  34.564  85.185  1.00 111.74 ? 268 GLU A CA    1 
ATOM   2048 C C     . GLU D 2 181 ? 19.879  35.906  84.810  1.00 109.64 ? 268 GLU A C     1 
ATOM   2049 O O     . GLU D 2 181 ? 19.542  36.936  85.400  1.00 114.88 ? 268 GLU A O     1 
ATOM   2050 C CB    . GLU D 2 181 ? 17.775  34.713  85.496  1.00 95.01  ? 268 GLU A CB    1 
ATOM   2051 C CG    . GLU D 2 181 ? 16.866  34.076  84.455  1.00 115.42 ? 268 GLU A CG    1 
ATOM   2052 C CD    . GLU D 2 181 ? 17.184  32.607  84.210  1.00 105.35 ? 268 GLU A CD    1 
ATOM   2053 O OE1   . GLU D 2 181 ? 18.225  32.305  83.586  1.00 80.89  ? 268 GLU A OE1   1 
ATOM   2054 O OE2   . GLU D 2 181 ? 16.388  31.751  84.647  1.00 93.70  ? 268 GLU A OE2   1 
ATOM   2055 N N     . PRO D 2 182 ? 20.795  35.901  83.821  1.00 99.70  ? 269 PRO A N     1 
ATOM   2056 C CA    . PRO D 2 182 ? 21.535  37.040  83.277  1.00 86.97  ? 269 PRO A CA    1 
ATOM   2057 C C     . PRO D 2 182 ? 21.068  38.424  83.707  1.00 77.76  ? 269 PRO A C     1 
ATOM   2058 O O     . PRO D 2 182 ? 19.868  38.719  83.718  1.00 78.75  ? 269 PRO A O     1 
ATOM   2059 C CB    . PRO D 2 182 ? 21.416  36.821  81.780  1.00 62.56  ? 269 PRO A CB    1 
ATOM   2060 C CG    . PRO D 2 182 ? 21.630  35.365  81.688  1.00 84.56  ? 269 PRO A CG    1 
ATOM   2061 C CD    . PRO D 2 182 ? 20.814  34.793  82.846  1.00 80.94  ? 269 PRO A CD    1 
ATOM   2062 N N     . VAL D 2 183 ? 22.029  39.269  84.068  1.00 59.21  ? 270 VAL A N     1 
ATOM   2063 C CA    . VAL D 2 183 ? 21.715  40.624  84.481  1.00 61.00  ? 270 VAL A CA    1 
ATOM   2064 C C     . VAL D 2 183 ? 22.124  41.586  83.382  1.00 63.34  ? 270 VAL A C     1 
ATOM   2065 O O     . VAL D 2 183 ? 23.241  41.529  82.870  1.00 64.72  ? 270 VAL A O     1 
ATOM   2066 C CB    . VAL D 2 183 ? 22.456  41.020  85.755  1.00 52.56  ? 270 VAL A CB    1 
ATOM   2067 C CG1   . VAL D 2 183 ? 21.814  42.280  86.341  1.00 58.37  ? 270 VAL A CG1   1 
ATOM   2068 C CG2   . VAL D 2 183 ? 22.439  39.869  86.741  1.00 32.57  ? 270 VAL A CG2   1 
ATOM   2069 N N     . TYR D 2 184 ? 21.208  42.475  83.027  1.00 57.97  ? 271 TYR A N     1 
ATOM   2070 C CA    . TYR D 2 184 ? 21.471  43.439  81.978  1.00 63.52  ? 271 TYR A CA    1 
ATOM   2071 C C     . TYR D 2 184 ? 21.514  44.862  82.521  1.00 57.25  ? 271 TYR A C     1 
ATOM   2072 O O     . TYR D 2 184 ? 20.633  45.285  83.268  1.00 54.65  ? 271 TYR A O     1 
ATOM   2073 C CB    . TYR D 2 184 ? 20.403  43.329  80.880  1.00 68.38  ? 271 TYR A CB    1 
ATOM   2074 C CG    . TYR D 2 184 ? 20.375  41.999  80.160  1.00 48.10  ? 271 TYR A CG    1 
ATOM   2075 C CD1   . TYR D 2 184 ? 19.378  41.068  80.414  1.00 41.75  ? 271 TYR A CD1   1 
ATOM   2076 C CD2   . TYR D 2 184 ? 21.356  41.673  79.232  1.00 29.50  ? 271 TYR A CD2   1 
ATOM   2077 C CE1   . TYR D 2 184 ? 19.363  39.835  79.757  1.00 60.10  ? 271 TYR A CE1   1 
ATOM   2078 C CE2   . TYR D 2 184 ? 21.354  40.451  78.570  1.00 51.00  ? 271 TYR A CE2   1 
ATOM   2079 C CZ    . TYR D 2 184 ? 20.360  39.528  78.834  1.00 64.75  ? 271 TYR A CZ    1 
ATOM   2080 O OH    . TYR D 2 184 ? 20.383  38.291  78.197  1.00 47.77  ? 271 TYR A OH    1 
ATOM   2081 N N     . ASP D 2 185 ? 22.550  45.595  82.136  1.00 74.44  ? 272 ASP A N     1 
ATOM   2082 C CA    . ASP D 2 185 ? 22.718  46.970  82.575  1.00 80.56  ? 272 ASP A CA    1 
ATOM   2083 C C     . ASP D 2 185 ? 21.645  47.882  81.980  1.00 92.00  ? 272 ASP A C     1 
ATOM   2084 O O     . ASP D 2 185 ? 21.249  47.722  80.825  1.00 118.59 ? 272 ASP A O     1 
ATOM   2085 C CB    . ASP D 2 185 ? 24.103  47.464  82.168  1.00 82.06  ? 272 ASP A CB    1 
ATOM   2086 C CG    . ASP D 2 185 ? 24.382  48.873  82.636  1.00 101.40 ? 272 ASP A CG    1 
ATOM   2087 O OD1   . ASP D 2 185 ? 25.445  49.402  82.268  1.00 64.94  ? 272 ASP A OD1   1 
ATOM   2088 O OD2   . ASP D 2 185 ? 23.554  49.450  83.369  1.00 116.08 ? 272 ASP A OD2   1 
ATOM   2089 N N     . LYS D 2 186 ? 21.171  48.832  82.778  1.00 66.74  ? 273 LYS A N     1 
ATOM   2090 C CA    . LYS D 2 186 ? 20.161  49.773  82.324  1.00 66.09  ? 273 LYS A CA    1 
ATOM   2091 C C     . LYS D 2 186 ? 20.773  50.868  81.467  1.00 73.30  ? 273 LYS A C     1 
ATOM   2092 O O     . LYS D 2 186 ? 20.120  51.392  80.576  1.00 62.47  ? 273 LYS A O     1 
ATOM   2093 C CB    . LYS D 2 186 ? 19.467  50.426  83.516  1.00 72.81  ? 273 LYS A CB    1 
ATOM   2094 C CG    . LYS D 2 186 ? 18.683  51.683  83.140  1.00 69.63  ? 273 LYS A CG    1 
ATOM   2095 C CD    . LYS D 2 186 ? 18.192  52.440  84.370  1.00 101.99 ? 273 LYS A CD    1 
ATOM   2096 C CE    . LYS D 2 186 ? 17.404  53.686  83.978  1.00 70.09  ? 273 LYS A CE    1 
ATOM   2097 N NZ    . LYS D 2 186 ? 17.024  54.534  85.148  1.00 64.35  ? 273 LYS A NZ    1 
ATOM   2098 N N     . LYS D 2 187 ? 22.029  51.213  81.731  1.00 100.91 ? 274 LYS A N     1 
ATOM   2099 C CA    . LYS D 2 187 ? 22.681  52.287  80.993  1.00 89.95  ? 274 LYS A CA    1 
ATOM   2100 C C     . LYS D 2 187 ? 22.962  51.991  79.515  1.00 87.74  ? 274 LYS A C     1 
ATOM   2101 O O     . LYS D 2 187 ? 23.296  52.899  78.747  1.00 73.89  ? 274 LYS A O     1 
ATOM   2102 C CB    . LYS D 2 187 ? 23.971  52.718  81.718  1.00 75.84  ? 274 LYS A CB    1 
ATOM   2103 C CG    . LYS D 2 187 ? 25.212  51.886  81.426  1.00 83.33  ? 274 LYS A CG    1 
ATOM   2104 C CD    . LYS D 2 187 ? 26.421  52.415  82.207  1.00 36.34  ? 274 LYS A CD    1 
ATOM   2105 C CE    . LYS D 2 187 ? 27.751  51.814  81.725  1.00 111.08 ? 274 LYS A CE    1 
ATOM   2106 N NZ    . LYS D 2 187 ? 27.881  50.321  81.846  1.00 57.49  ? 274 LYS A NZ    1 
ATOM   2107 N N     . SER D 2 188 ? 22.812  50.734  79.108  1.00 73.25  ? 275 SER A N     1 
ATOM   2108 C CA    . SER D 2 188 ? 23.052  50.369  77.713  1.00 78.43  ? 275 SER A CA    1 
ATOM   2109 C C     . SER D 2 188 ? 21.790  50.425  76.862  1.00 75.38  ? 275 SER A C     1 
ATOM   2110 O O     . SER D 2 188 ? 20.838  49.688  77.100  1.00 105.50 ? 275 SER A O     1 
ATOM   2111 C CB    . SER D 2 188 ? 23.642  48.969  77.612  1.00 78.61  ? 275 SER A CB    1 
ATOM   2112 O OG    . SER D 2 188 ? 23.719  48.586  76.250  1.00 76.13  ? 275 SER A OG    1 
ATOM   2113 N N     . THR D 2 189 ? 21.801  51.292  75.858  1.00 85.41  ? 276 THR A N     1 
ATOM   2114 C CA    . THR D 2 189 ? 20.661  51.467  74.959  1.00 93.17  ? 276 THR A CA    1 
ATOM   2115 C C     . THR D 2 189 ? 20.196  50.159  74.315  1.00 86.23  ? 276 THR A C     1 
ATOM   2116 O O     . THR D 2 189 ? 18.998  49.913  74.148  1.00 72.03  ? 276 THR A O     1 
ATOM   2117 C CB    . THR D 2 189 ? 21.005  52.474  73.838  1.00 72.11  ? 276 THR A CB    1 
ATOM   2118 O OG1   . THR D 2 189 ? 19.952  52.493  72.868  1.00 127.01 ? 276 THR A OG1   1 
ATOM   2119 C CG2   . THR D 2 189 ? 22.309  52.087  73.159  1.00 90.15  ? 276 THR A CG2   1 
ATOM   2120 N N     . ASN D 2 190 ? 21.154  49.319  73.961  1.00 64.01  ? 277 ASN A N     1 
ATOM   2121 C CA    . ASN D 2 190 ? 20.846  48.055  73.323  1.00 58.96  ? 277 ASN A CA    1 
ATOM   2122 C C     . ASN D 2 190 ? 20.144  47.043  74.216  1.00 66.25  ? 277 ASN A C     1 
ATOM   2123 O O     . ASN D 2 190 ? 19.351  46.232  73.738  1.00 67.58  ? 277 ASN A O     1 
ATOM   2124 C CB    . ASN D 2 190 ? 22.129  47.437  72.778  1.00 70.52  ? 277 ASN A CB    1 
ATOM   2125 C CG    . ASN D 2 190 ? 22.178  45.943  72.981  1.00 41.74  ? 277 ASN A CG    1 
ATOM   2126 O OD1   . ASN D 2 190 ? 22.324  45.469  74.106  1.00 91.63  ? 277 ASN A OD1   1 
ATOM   2127 N ND2   . ASN D 2 190 ? 22.042  45.189  71.893  1.00 84.36  ? 277 ASN A ND2   1 
ATOM   2128 N N     . THR D 2 191 ? 20.431  47.081  75.512  1.00 92.25  ? 278 THR A N     1 
ATOM   2129 C CA    . THR D 2 191 ? 19.840  46.115  76.426  1.00 82.23  ? 278 THR A CA    1 
ATOM   2130 C C     . THR D 2 191 ? 18.986  46.706  77.548  1.00 68.79  ? 278 THR A C     1 
ATOM   2131 O O     . THR D 2 191 ? 18.496  45.983  78.415  1.00 58.03  ? 278 THR A O     1 
ATOM   2132 C CB    . THR D 2 191 ? 20.946  45.223  77.032  1.00 54.49  ? 278 THR A CB    1 
ATOM   2133 O OG1   . THR D 2 191 ? 20.357  44.260  77.908  1.00 95.72  ? 278 THR A OG1   1 
ATOM   2134 C CG2   . THR D 2 191 ? 21.949  46.060  77.815  1.00 76.77  ? 278 THR A CG2   1 
ATOM   2135 N N     . SER D 2 192 ? 18.790  48.016  77.531  1.00 56.50  ? 279 SER A N     1 
ATOM   2136 C CA    . SER D 2 192 ? 17.985  48.648  78.568  1.00 67.14  ? 279 SER A CA    1 
ATOM   2137 C C     . SER D 2 192 ? 16.564  48.103  78.507  1.00 68.64  ? 279 SER A C     1 
ATOM   2138 O O     . SER D 2 192 ? 16.291  47.141  77.785  1.00 57.26  ? 279 SER A O     1 
ATOM   2139 C CB    . SER D 2 192 ? 17.970  50.167  78.379  1.00 85.07  ? 279 SER A CB    1 
ATOM   2140 O OG    . SER D 2 192 ? 17.429  50.532  77.121  1.00 55.53  ? 279 SER A OG    1 
ATOM   2141 N N     . GLU D 2 193 ? 15.662  48.710  79.269  1.00 62.08  ? 280 GLU A N     1 
ATOM   2142 C CA    . GLU D 2 193 ? 14.272  48.280  79.275  1.00 71.69  ? 280 GLU A CA    1 
ATOM   2143 C C     . GLU D 2 193 ? 13.499  49.276  78.428  1.00 75.39  ? 280 GLU A C     1 
ATOM   2144 O O     . GLU D 2 193 ? 13.694  50.485  78.567  1.00 58.55  ? 280 GLU A O     1 
ATOM   2145 C CB    . GLU D 2 193 ? 13.723  48.270  80.701  1.00 105.91 ? 280 GLU A CB    1 
ATOM   2146 C CG    . GLU D 2 193 ? 12.294  47.761  80.811  1.00 115.95 ? 280 GLU A CG    1 
ATOM   2147 C CD    . GLU D 2 193 ? 11.724  47.911  82.209  1.00 113.09 ? 280 GLU A CD    1 
ATOM   2148 O OE1   . GLU D 2 193 ? 12.335  47.375  83.160  1.00 100.42 ? 280 GLU A OE1   1 
ATOM   2149 O OE2   . GLU D 2 193 ? 10.665  48.563  82.351  1.00 76.05  ? 280 GLU A OE2   1 
ATOM   2150 N N     . LEU D 2 194 ? 12.633  48.769  77.554  1.00 78.70  ? 281 LEU A N     1 
ATOM   2151 C CA    . LEU D 2 194 ? 11.838  49.621  76.665  1.00 89.48  ? 281 LEU A CA    1 
ATOM   2152 C C     . LEU D 2 194 ? 10.660  50.291  77.377  1.00 74.10  ? 281 LEU A C     1 
ATOM   2153 O O     . LEU D 2 194 ? 10.083  49.725  78.302  1.00 79.71  ? 281 LEU A O     1 
ATOM   2154 C CB    . LEU D 2 194 ? 11.337  48.800  75.473  1.00 105.00 ? 281 LEU A CB    1 
ATOM   2155 C CG    . LEU D 2 194 ? 12.413  48.040  74.685  1.00 137.63 ? 281 LEU A CG    1 
ATOM   2156 C CD1   . LEU D 2 194 ? 11.773  47.338  73.497  1.00 136.09 ? 281 LEU A CD1   1 
ATOM   2157 C CD2   . LEU D 2 194 ? 13.491  49.002  74.209  1.00 140.73 ? 281 LEU A CD2   1 
ATOM   2158 N N     . ARG D 2 195 ? 10.296  51.494  76.937  1.00 65.46  ? 282 ARG A N     1 
ATOM   2159 C CA    . ARG D 2 195 ? 9.205   52.215  77.577  1.00 70.17  ? 282 ARG A CA    1 
ATOM   2160 C C     . ARG D 2 195 ? 8.717   53.460  76.833  1.00 73.57  ? 282 ARG A C     1 
ATOM   2161 O O     . ARG D 2 195 ? 9.471   54.417  76.654  1.00 88.68  ? 282 ARG A O     1 
ATOM   2162 C CB    . ARG D 2 195 ? 9.638   52.617  78.994  1.00 38.28  ? 282 ARG A CB    1 
ATOM   2163 C CG    . ARG D 2 195 ? 8.533   53.181  79.876  1.00 98.39  ? 282 ARG A CG    1 
ATOM   2164 C CD    . ARG D 2 195 ? 8.593   54.698  80.013  1.00 66.87  ? 282 ARG A CD    1 
ATOM   2165 N NE    . ARG D 2 195 ? 9.877   55.167  80.533  1.00 119.44 ? 282 ARG A NE    1 
ATOM   2166 C CZ    . ARG D 2 195 ? 10.081  56.382  81.037  1.00 118.23 ? 282 ARG A CZ    1 
ATOM   2167 N NH1   . ARG D 2 195 ? 9.080   57.251  81.099  1.00 84.78  ? 282 ARG A NH1   1 
ATOM   2168 N NH2   . ARG D 2 195 ? 11.289  56.736  81.465  1.00 86.10  ? 282 ARG A NH2   1 
ATOM   2169 N N     . ILE D 2 196 ? 7.457   53.439  76.400  1.00 76.02  ? 283 ILE A N     1 
ATOM   2170 C CA    . ILE D 2 196 ? 6.853   54.591  75.725  1.00 66.04  ? 283 ILE A CA    1 
ATOM   2171 C C     . ILE D 2 196 ? 6.522   55.575  76.845  1.00 63.06  ? 283 ILE A C     1 
ATOM   2172 O O     . ILE D 2 196 ? 6.327   55.172  77.988  1.00 68.07  ? 283 ILE A O     1 
ATOM   2173 C CB    . ILE D 2 196 ? 5.531   54.226  75.033  1.00 61.17  ? 283 ILE A CB    1 
ATOM   2174 C CG1   . ILE D 2 196 ? 5.765   53.164  73.959  1.00 43.70  ? 283 ILE A CG1   1 
ATOM   2175 C CG2   . ILE D 2 196 ? 4.909   55.473  74.438  1.00 65.38  ? 283 ILE A CG2   1 
ATOM   2176 C CD1   . ILE D 2 196 ? 4.492   52.443  73.512  1.00 68.19  ? 283 ILE A CD1   1 
ATOM   2177 N N     . CYS D 2 197 ? 6.435   56.858  76.531  1.00 49.00  ? 284 CYS A N     1 
ATOM   2178 C CA    . CYS D 2 197 ? 6.146   57.835  77.567  1.00 55.75  ? 284 CYS A CA    1 
ATOM   2179 C C     . CYS D 2 197 ? 4.968   58.734  77.237  1.00 74.77  ? 284 CYS A C     1 
ATOM   2180 O O     . CYS D 2 197 ? 4.531   59.520  78.079  1.00 72.03  ? 284 CYS A O     1 
ATOM   2181 C CB    . CYS D 2 197 ? 7.395   58.669  77.838  1.00 72.49  ? 284 CYS A CB    1 
ATOM   2182 S SG    . CYS D 2 197 ? 8.840   57.635  78.196  1.00 88.38  ? 284 CYS A SG    1 
ATOM   2183 N N     . ARG D 2 198 ? 4.467   58.616  76.009  1.00 82.26  ? 285 ARG A N     1 
ATOM   2184 C CA    . ARG D 2 198 ? 3.313   59.389  75.552  1.00 79.58  ? 285 ARG A CA    1 
ATOM   2185 C C     . ARG D 2 198 ? 3.070   59.173  74.061  1.00 78.80  ? 285 ARG A C     1 
ATOM   2186 O O     . ARG D 2 198 ? 3.957   58.714  73.340  1.00 91.61  ? 285 ARG A O     1 
ATOM   2187 C CB    . ARG D 2 198 ? 3.504   60.890  75.829  1.00 77.43  ? 285 ARG A CB    1 
ATOM   2188 C CG    . ARG D 2 198 ? 2.275   61.547  76.474  1.00 59.18  ? 285 ARG A CG    1 
ATOM   2189 C CD    . ARG D 2 198 ? 2.349   63.076  76.543  1.00 54.06  ? 285 ARG A CD    1 
ATOM   2190 N NE    . ARG D 2 198 ? 3.431   63.581  77.389  1.00 69.34  ? 285 ARG A NE    1 
ATOM   2191 C CZ    . ARG D 2 198 ? 3.632   64.871  77.646  1.00 48.59  ? 285 ARG A CZ    1 
ATOM   2192 N NH1   . ARG D 2 198 ? 2.822   65.783  77.125  1.00 96.70  ? 285 ARG A NH1   1 
ATOM   2193 N NH2   . ARG D 2 198 ? 4.647   65.258  78.409  1.00 76.93  ? 285 ARG A NH2   1 
ATOM   2194 N N     . ILE D 2 199 ? 1.856   59.485  73.613  1.00 74.39  ? 286 ILE A N     1 
ATOM   2195 C CA    . ILE D 2 199 ? 1.502   59.359  72.201  1.00 84.57  ? 286 ILE A CA    1 
ATOM   2196 C C     . ILE D 2 199 ? 0.465   60.410  71.802  1.00 109.89 ? 286 ILE A C     1 
ATOM   2197 O O     . ILE D 2 199 ? -0.279  60.908  72.645  1.00 117.57 ? 286 ILE A O     1 
ATOM   2198 C CB    . ILE D 2 199 ? 0.954   57.951  71.855  1.00 63.48  ? 286 ILE A CB    1 
ATOM   2199 C CG1   . ILE D 2 199 ? 2.034   56.895  72.082  1.00 47.86  ? 286 ILE A CG1   1 
ATOM   2200 C CG2   . ILE D 2 199 ? 0.517   57.903  70.393  1.00 49.34  ? 286 ILE A CG2   1 
ATOM   2201 C CD1   . ILE D 2 199 ? 1.680   55.537  71.515  1.00 26.37  ? 286 ILE A CD1   1 
ATOM   2202 N N     . ASN D 2 200 ? 0.437   60.742  70.513  1.00 124.46 ? 287 ASN A N     1 
ATOM   2203 C CA    . ASN D 2 200 ? -0.483  61.736  69.968  1.00 123.59 ? 287 ASN A CA    1 
ATOM   2204 C C     . ASN D 2 200 ? -1.930  61.555  70.401  1.00 118.78 ? 287 ASN A C     1 
ATOM   2205 O O     . ASN D 2 200 ? -2.335  62.032  71.460  1.00 107.38 ? 287 ASN A O     1 
ATOM   2206 C CB    . ASN D 2 200 ? -0.410  61.724  68.440  1.00 132.08 ? 287 ASN A CB    1 
ATOM   2207 C CG    . ASN D 2 200 ? 0.304   62.937  67.883  1.00 128.88 ? 287 ASN A CG    1 
ATOM   2208 O OD1   . ASN D 2 200 ? 1.416   63.261  68.296  1.00 112.39 ? 287 ASN A OD1   1 
ATOM   2209 N ND2   . ASN D 2 200 ? -0.334  63.615  66.935  1.00 127.65 ? 287 ASN A ND2   1 
ATOM   2210 N N     . LYS D 2 201 ? -2.712  60.878  69.567  1.00 115.71 ? 288 LYS A N     1 
ATOM   2211 C CA    . LYS D 2 201 ? -4.117  60.643  69.865  1.00 124.21 ? 288 LYS A CA    1 
ATOM   2212 C C     . LYS D 2 201 ? -4.314  59.201  70.300  1.00 121.18 ? 288 LYS A C     1 
ATOM   2213 O O     . LYS D 2 201 ? -3.450  58.357  70.070  1.00 110.44 ? 288 LYS A O     1 
ATOM   2214 C CB    . LYS D 2 201 ? -4.980  60.931  68.629  1.00 140.73 ? 288 LYS A CB    1 
ATOM   2215 C CG    . LYS D 2 201 ? -4.842  62.349  68.072  1.00 140.73 ? 288 LYS A CG    1 
ATOM   2216 C CD    . LYS D 2 201 ? -4.037  62.389  66.770  1.00 137.90 ? 288 LYS A CD    1 
ATOM   2217 C CE    . LYS D 2 201 ? -4.794  61.725  65.619  1.00 138.23 ? 288 LYS A CE    1 
ATOM   2218 N NZ    . LYS D 2 201 ? -4.079  61.825  64.309  1.00 102.20 ? 288 LYS A NZ    1 
ATOM   2219 N N     . GLU D 2 202 ? -5.451  58.925  70.929  1.00 117.30 ? 289 GLU A N     1 
ATOM   2220 C CA    . GLU D 2 202 ? -5.762  57.579  71.393  1.00 106.08 ? 289 GLU A CA    1 
ATOM   2221 C C     . GLU D 2 202 ? -6.694  56.858  70.423  1.00 104.41 ? 289 GLU A C     1 
ATOM   2222 O O     . GLU D 2 202 ? -6.844  55.635  70.482  1.00 94.63  ? 289 GLU A O     1 
ATOM   2223 C CB    . GLU D 2 202 ? -6.402  57.622  72.787  1.00 85.29  ? 289 GLU A CB    1 
ATOM   2224 C CG    . GLU D 2 202 ? -7.700  58.424  72.888  1.00 113.38 ? 289 GLU A CG    1 
ATOM   2225 C CD    . GLU D 2 202 ? -7.486  59.930  72.808  1.00 135.95 ? 289 GLU A CD    1 
ATOM   2226 O OE1   . GLU D 2 202 ? -7.146  60.437  71.715  1.00 133.72 ? 289 GLU A OE1   1 
ATOM   2227 O OE2   . GLU D 2 202 ? -7.657  60.607  73.847  1.00 124.61 ? 289 GLU A OE2   1 
ATOM   2228 N N     . SER D 2 203 ? -7.317  57.620  69.530  1.00 102.40 ? 290 SER A N     1 
ATOM   2229 C CA    . SER D 2 203 ? -8.229  57.042  68.554  1.00 99.89  ? 290 SER A CA    1 
ATOM   2230 C C     . SER D 2 203 ? -7.839  57.360  67.107  1.00 97.96  ? 290 SER A C     1 
ATOM   2231 O O     . SER D 2 203 ? -7.547  58.508  66.755  1.00 85.46  ? 290 SER A O     1 
ATOM   2232 C CB    . SER D 2 203 ? -9.664  57.508  68.841  1.00 101.16 ? 290 SER A CB    1 
ATOM   2233 O OG    . SER D 2 203 ? -9.718  58.901  69.089  1.00 135.59 ? 290 SER A OG    1 
ATOM   2234 N N     . GLY D 2 204 ? -7.824  56.323  66.276  1.00 90.25  ? 291 GLY A N     1 
ATOM   2235 C CA    . GLY D 2 204 ? -7.474  56.490  64.880  1.00 112.65 ? 291 GLY A CA    1 
ATOM   2236 C C     . GLY D 2 204 ? -8.288  55.555  64.005  1.00 122.25 ? 291 GLY A C     1 
ATOM   2237 O O     . GLY D 2 204 ? -8.401  54.367  64.314  1.00 138.59 ? 291 GLY A O     1 
ATOM   2238 N N     . PRO D 2 205 ? -8.875  56.058  62.906  1.00 126.08 ? 292 PRO A N     1 
ATOM   2239 C CA    . PRO D 2 205 ? -9.678  55.220  62.012  1.00 118.24 ? 292 PRO A CA    1 
ATOM   2240 C C     . PRO D 2 205 ? -8.927  53.965  61.573  1.00 116.60 ? 292 PRO A C     1 
ATOM   2241 O O     . PRO D 2 205 ? -7.711  54.001  61.371  1.00 96.63  ? 292 PRO A O     1 
ATOM   2242 C CB    . PRO D 2 205 ? -9.976  56.157  60.845  1.00 124.05 ? 292 PRO A CB    1 
ATOM   2243 C CG    . PRO D 2 205 ? -10.033 57.497  61.502  1.00 134.60 ? 292 PRO A CG    1 
ATOM   2244 C CD    . PRO D 2 205 ? -8.840  57.450  62.424  1.00 133.86 ? 292 PRO A CD    1 
ATOM   2245 N N     . CYS D 2 206 ? -9.651  52.858  61.429  1.00 121.98 ? 293 CYS A N     1 
ATOM   2246 C CA    . CYS D 2 206 ? -9.038  51.603  61.006  1.00 130.47 ? 293 CYS A CA    1 
ATOM   2247 C C     . CYS D 2 206 ? -8.504  51.748  59.585  1.00 136.26 ? 293 CYS A C     1 
ATOM   2248 O O     . CYS D 2 206 ? -7.832  50.857  59.062  1.00 119.12 ? 293 CYS A O     1 
ATOM   2249 C CB    . CYS D 2 206 ? -10.055 50.463  61.068  1.00 132.12 ? 293 CYS A CB    1 
ATOM   2250 S SG    . CYS D 2 206 ? -11.438 50.642  59.931  1.00 117.59 ? 293 CYS A SG    1 
ATOM   2251 N N     . THR D 2 207 ? -8.815  52.883  58.965  1.00 140.73 ? 294 THR A N     1 
ATOM   2252 C CA    . THR D 2 207 ? -8.362  53.176  57.611  1.00 140.73 ? 294 THR A CA    1 
ATOM   2253 C C     . THR D 2 207 ? -6.833  53.245  57.603  1.00 140.73 ? 294 THR A C     1 
ATOM   2254 O O     . THR D 2 207 ? -6.195  53.125  56.555  1.00 140.73 ? 294 THR A O     1 
ATOM   2255 C CB    . THR D 2 207 ? -8.945  54.524  57.111  1.00 136.90 ? 294 THR A CB    1 
ATOM   2256 O OG1   . THR D 2 207 ? -8.465  54.798  55.791  1.00 109.62 ? 294 THR A OG1   1 
ATOM   2257 C CG2   . THR D 2 207 ? -8.533  55.661  58.031  1.00 129.13 ? 294 THR A CG2   1 
ATOM   2258 N N     . GLY D 2 208 ? -6.255  53.436  58.787  1.00 138.57 ? 295 GLY A N     1 
ATOM   2259 C CA    . GLY D 2 208 ? -4.811  53.511  58.913  1.00 133.00 ? 295 GLY A CA    1 
ATOM   2260 C C     . GLY D 2 208 ? -4.194  54.712  58.222  1.00 127.66 ? 295 GLY A C     1 
ATOM   2261 O O     . GLY D 2 208 ? -4.839  55.755  58.076  1.00 98.83  ? 295 GLY A O     1 
ATOM   2262 N N     . GLY D 2 209 ? -2.940  54.559  57.802  1.00 124.44 ? 296 GLY A N     1 
ATOM   2263 C CA    . GLY D 2 209 ? -2.228  55.629  57.124  1.00 120.50 ? 296 GLY A CA    1 
ATOM   2264 C C     . GLY D 2 209 ? -2.051  56.875  57.970  1.00 119.69 ? 296 GLY A C     1 
ATOM   2265 O O     . GLY D 2 209 ? -1.334  57.800  57.589  1.00 116.88 ? 296 GLY A O     1 
ATOM   2266 N N     . GLU D 2 210 ? -2.707  56.897  59.125  1.00 130.74 ? 297 GLU A N     1 
ATOM   2267 C CA    . GLU D 2 210 ? -2.638  58.032  60.035  1.00 134.69 ? 297 GLU A CA    1 
ATOM   2268 C C     . GLU D 2 210 ? -1.257  58.129  60.675  1.00 131.79 ? 297 GLU A C     1 
ATOM   2269 O O     . GLU D 2 210 ? -0.720  57.135  61.160  1.00 122.32 ? 297 GLU A O     1 
ATOM   2270 C CB    . GLU D 2 210 ? -3.712  57.888  61.117  1.00 137.66 ? 297 GLU A CB    1 
ATOM   2271 C CG    . GLU D 2 210 ? -3.887  59.107  62.006  1.00 140.73 ? 297 GLU A CG    1 
ATOM   2272 C CD    . GLU D 2 210 ? -5.015  58.933  63.004  1.00 140.73 ? 297 GLU A CD    1 
ATOM   2273 O OE1   . GLU D 2 210 ? -6.156  58.658  62.570  1.00 127.41 ? 297 GLU A OE1   1 
ATOM   2274 O OE2   . GLU D 2 210 ? -4.763  59.073  64.220  1.00 126.96 ? 297 GLU A OE2   1 
ATOM   2275 N N     . GLU D 2 211 ? -0.685  59.329  60.669  1.00 124.04 ? 298 GLU A N     1 
ATOM   2276 C CA    . GLU D 2 211 ? 0.634   59.550  61.254  1.00 106.26 ? 298 GLU A CA    1 
ATOM   2277 C C     . GLU D 2 211 ? 0.504   59.945  62.725  1.00 84.26  ? 298 GLU A C     1 
ATOM   2278 O O     . GLU D 2 211 ? -0.248  60.858  63.063  1.00 67.56  ? 298 GLU A O     1 
ATOM   2279 C CB    . GLU D 2 211 ? 1.376   60.660  60.495  1.00 103.77 ? 298 GLU A CB    1 
ATOM   2280 C CG    . GLU D 2 211 ? 2.809   60.866  60.966  1.00 101.60 ? 298 GLU A CG    1 
ATOM   2281 C CD    . GLU D 2 211 ? 3.345   62.254  60.675  1.00 93.57  ? 298 GLU A CD    1 
ATOM   2282 O OE1   . GLU D 2 211 ? 2.809   63.234  61.231  1.00 67.85  ? 298 GLU A OE1   1 
ATOM   2283 O OE2   . GLU D 2 211 ? 4.311   62.362  59.896  1.00 69.38  ? 298 GLU A OE2   1 
ATOM   2284 N N     . LEU D 2 212 ? 1.238   59.257  63.594  1.00 86.88  ? 299 LEU A N     1 
ATOM   2285 C CA    . LEU D 2 212 ? 1.209   59.547  65.027  1.00 92.72  ? 299 LEU A CA    1 
ATOM   2286 C C     . LEU D 2 212 ? 2.625   59.743  65.562  1.00 93.11  ? 299 LEU A C     1 
ATOM   2287 O O     . LEU D 2 212 ? 3.571   59.117  65.084  1.00 78.97  ? 299 LEU A O     1 
ATOM   2288 C CB    . LEU D 2 212 ? 0.548   58.396  65.803  1.00 97.66  ? 299 LEU A CB    1 
ATOM   2289 C CG    . LEU D 2 212 ? -0.963  58.126  65.778  1.00 96.02  ? 299 LEU A CG    1 
ATOM   2290 C CD1   . LEU D 2 212 ? -1.703  59.258  66.470  1.00 97.03  ? 299 LEU A CD1   1 
ATOM   2291 C CD2   . LEU D 2 212 ? -1.442  57.956  64.351  1.00 101.70 ? 299 LEU A CD2   1 
ATOM   2292 N N     . TYR D 2 213 ? 2.772   60.619  66.550  1.00 99.38  ? 300 TYR A N     1 
ATOM   2293 C CA    . TYR D 2 213 ? 4.079   60.842  67.156  1.00 109.47 ? 300 TYR A CA    1 
ATOM   2294 C C     . TYR D 2 213 ? 4.190   59.983  68.406  1.00 115.93 ? 300 TYR A C     1 
ATOM   2295 O O     . TYR D 2 213 ? 3.252   59.266  68.752  1.00 138.85 ? 300 TYR A O     1 
ATOM   2296 C CB    . TYR D 2 213 ? 4.293   62.317  67.510  1.00 88.71  ? 300 TYR A CB    1 
ATOM   2297 C CG    . TYR D 2 213 ? 4.891   63.136  66.384  1.00 105.61 ? 300 TYR A CG    1 
ATOM   2298 C CD1   . TYR D 2 213 ? 5.567   64.324  66.650  1.00 48.20  ? 300 TYR A CD1   1 
ATOM   2299 C CD2   . TYR D 2 213 ? 4.779   62.724  65.052  1.00 98.31  ? 300 TYR A CD2   1 
ATOM   2300 C CE1   . TYR D 2 213 ? 6.122   65.087  65.620  1.00 119.78 ? 300 TYR A CE1   1 
ATOM   2301 C CE2   . TYR D 2 213 ? 5.329   63.480  64.015  1.00 125.13 ? 300 TYR A CE2   1 
ATOM   2302 C CZ    . TYR D 2 213 ? 6.000   64.661  64.306  1.00 124.00 ? 300 TYR A CZ    1 
ATOM   2303 O OH    . TYR D 2 213 ? 6.547   65.416  63.290  1.00 116.22 ? 300 TYR A OH    1 
ATOM   2304 N N     . LEU D 2 214 ? 5.329   60.063  69.086  1.00 127.08 ? 301 LEU A N     1 
ATOM   2305 C CA    . LEU D 2 214 ? 5.553   59.253  70.279  1.00 107.27 ? 301 LEU A CA    1 
ATOM   2306 C C     . LEU D 2 214 ? 6.909   59.550  70.903  1.00 99.15  ? 301 LEU A C     1 
ATOM   2307 O O     . LEU D 2 214 ? 7.889   59.811  70.195  1.00 89.54  ? 301 LEU A O     1 
ATOM   2308 C CB    . LEU D 2 214 ? 5.481   57.772  69.888  1.00 85.43  ? 301 LEU A CB    1 
ATOM   2309 C CG    . LEU D 2 214 ? 5.829   56.607  70.813  1.00 64.42  ? 301 LEU A CG    1 
ATOM   2310 C CD1   . LEU D 2 214 ? 5.621   55.323  70.027  1.00 50.92  ? 301 LEU A CD1   1 
ATOM   2311 C CD2   . LEU D 2 214 ? 7.258   56.678  71.290  1.00 80.37  ? 301 LEU A CD2   1 
ATOM   2312 N N     . LEU D 2 215 ? 6.957   59.507  72.231  1.00 76.88  ? 302 LEU A N     1 
ATOM   2313 C CA    . LEU D 2 215 ? 8.197   59.732  72.973  1.00 83.88  ? 302 LEU A CA    1 
ATOM   2314 C C     . LEU D 2 215 ? 8.568   58.417  73.658  1.00 81.20  ? 302 LEU A C     1 
ATOM   2315 O O     . LEU D 2 215 ? 7.695   57.602  73.955  1.00 108.31 ? 302 LEU A O     1 
ATOM   2316 C CB    . LEU D 2 215 ? 8.021   60.847  74.022  1.00 70.50  ? 302 LEU A CB    1 
ATOM   2317 C CG    . LEU D 2 215 ? 7.962   62.308  73.542  1.00 77.80  ? 302 LEU A CG    1 
ATOM   2318 C CD1   . LEU D 2 215 ? 6.861   62.438  72.508  1.00 71.82  ? 302 LEU A CD1   1 
ATOM   2319 C CD2   . LEU D 2 215 ? 7.721   63.276  74.725  1.00 28.98  ? 302 LEU A CD2   1 
ATOM   2320 N N     . CYS D 2 216 ? 9.856   58.201  73.895  1.00 83.49  ? 303 CYS A N     1 
ATOM   2321 C CA    . CYS D 2 216 ? 10.291  56.973  74.545  1.00 74.17  ? 303 CYS A CA    1 
ATOM   2322 C C     . CYS D 2 216 ? 11.625  57.152  75.257  1.00 66.87  ? 303 CYS A C     1 
ATOM   2323 O O     . CYS D 2 216 ? 12.047  58.276  75.533  1.00 63.04  ? 303 CYS A O     1 
ATOM   2324 C CB    . CYS D 2 216 ? 10.397  55.844  73.511  1.00 68.83  ? 303 CYS A CB    1 
ATOM   2325 S SG    . CYS D 2 216 ? 11.575  56.102  72.160  1.00 71.14  ? 303 CYS A SG    1 
ATOM   2326 N N     . ASP D 2 217 ? 12.280  56.042  75.580  1.00 38.38  ? 304 ASP A N     1 
ATOM   2327 C CA    . ASP D 2 217 ? 13.586  56.110  76.220  1.00 72.61  ? 304 ASP A CA    1 
ATOM   2328 C C     . ASP D 2 217 ? 14.589  55.722  75.144  1.00 66.26  ? 304 ASP A C     1 
ATOM   2329 O O     . ASP D 2 217 ? 14.237  55.008  74.208  1.00 84.40  ? 304 ASP A O     1 
ATOM   2330 C CB    . ASP D 2 217 ? 13.652  55.153  77.410  1.00 96.83  ? 304 ASP A CB    1 
ATOM   2331 C CG    . ASP D 2 217 ? 12.667  55.525  78.502  1.00 112.02 ? 304 ASP A CG    1 
ATOM   2332 O OD1   . ASP D 2 217 ? 11.448  55.426  78.249  1.00 134.77 ? 304 ASP A OD1   1 
ATOM   2333 O OD2   . ASP D 2 217 ? 13.106  55.923  79.604  1.00 102.82 ? 304 ASP A OD2   1 
ATOM   2334 N N     . LYS D 2 218 ? 15.825  56.200  75.258  1.00 60.44  ? 305 LYS A N     1 
ATOM   2335 C CA    . LYS D 2 218 ? 16.849  55.905  74.253  1.00 54.63  ? 305 LYS A CA    1 
ATOM   2336 C C     . LYS D 2 218 ? 16.752  54.498  73.653  1.00 65.15  ? 305 LYS A C     1 
ATOM   2337 O O     . LYS D 2 218 ? 16.938  53.485  74.342  1.00 62.36  ? 305 LYS A O     1 
ATOM   2338 C CB    . LYS D 2 218 ? 18.254  56.140  74.829  1.00 49.27  ? 305 LYS A CB    1 
ATOM   2339 C CG    . LYS D 2 218 ? 18.533  57.581  75.245  1.00 45.73  ? 305 LYS A CG    1 
ATOM   2340 C CD    . LYS D 2 218 ? 19.990  57.762  75.664  1.00 87.32  ? 305 LYS A CD    1 
ATOM   2341 C CE    . LYS D 2 218 ? 20.947  57.541  74.487  1.00 111.82 ? 305 LYS A CE    1 
ATOM   2342 N NZ    . LYS D 2 218 ? 22.382  57.845  74.806  1.00 93.86  ? 305 LYS A NZ    1 
ATOM   2343 N N     . VAL D 2 219 ? 16.454  54.464  72.355  1.00 71.67  ? 306 VAL A N     1 
ATOM   2344 C CA    . VAL D 2 219 ? 16.305  53.232  71.584  1.00 58.90  ? 306 VAL A CA    1 
ATOM   2345 C C     . VAL D 2 219 ? 17.184  53.325  70.335  1.00 58.05  ? 306 VAL A C     1 
ATOM   2346 O O     . VAL D 2 219 ? 17.514  54.427  69.901  1.00 59.22  ? 306 VAL A O     1 
ATOM   2347 C CB    . VAL D 2 219 ? 14.853  53.062  71.150  1.00 46.14  ? 306 VAL A CB    1 
ATOM   2348 C CG1   . VAL D 2 219 ? 14.371  54.344  70.524  1.00 24.29  ? 306 VAL A CG1   1 
ATOM   2349 C CG2   . VAL D 2 219 ? 14.730  51.921  70.161  1.00 56.36  ? 306 VAL A CG2   1 
ATOM   2350 N N     . GLN D 2 220 ? 17.557  52.183  69.754  1.00 30.65  ? 307 GLN A N     1 
ATOM   2351 C CA    . GLN D 2 220 ? 18.414  52.180  68.563  1.00 72.61  ? 307 GLN A CA    1 
ATOM   2352 C C     . GLN D 2 220 ? 17.644  52.166  67.241  1.00 79.37  ? 307 GLN A C     1 
ATOM   2353 O O     . GLN D 2 220 ? 17.197  51.105  66.790  1.00 66.05  ? 307 GLN A O     1 
ATOM   2354 C CB    . GLN D 2 220 ? 19.353  50.975  68.581  1.00 104.00 ? 307 GLN A CB    1 
ATOM   2355 C CG    . GLN D 2 220 ? 20.164  50.802  69.846  1.00 77.16  ? 307 GLN A CG    1 
ATOM   2356 C CD    . GLN D 2 220 ? 21.494  50.138  69.564  1.00 106.07 ? 307 GLN A CD    1 
ATOM   2357 O OE1   . GLN D 2 220 ? 22.491  50.813  69.296  1.00 76.95  ? 307 GLN A OE1   1 
ATOM   2358 N NE2   . GLN D 2 220 ? 21.514  48.808  69.597  1.00 70.59  ? 307 GLN A NE2   1 
ATOM   2359 N N     . LYS D 2 221 ? 17.521  53.339  66.616  1.00 68.87  ? 308 LYS A N     1 
ATOM   2360 C CA    . LYS D 2 221 ? 16.804  53.490  65.348  1.00 62.79  ? 308 LYS A CA    1 
ATOM   2361 C C     . LYS D 2 221 ? 16.946  52.280  64.443  1.00 55.97  ? 308 LYS A C     1 
ATOM   2362 O O     . LYS D 2 221 ? 15.959  51.650  64.069  1.00 49.83  ? 308 LYS A O     1 
ATOM   2363 C CB    . LYS D 2 221 ? 17.291  54.739  64.602  1.00 93.25  ? 308 LYS A CB    1 
ATOM   2364 C CG    . LYS D 2 221 ? 18.792  54.778  64.332  1.00 137.22 ? 308 LYS A CG    1 
ATOM   2365 C CD    . LYS D 2 221 ? 19.206  56.064  63.623  1.00 129.95 ? 308 LYS A CD    1 
ATOM   2366 C CE    . LYS D 2 221 ? 20.717  56.133  63.421  1.00 139.38 ? 308 LYS A CE    1 
ATOM   2367 N NZ    . LYS D 2 221 ? 21.477  56.115  64.709  1.00 107.39 ? 308 LYS A NZ    1 
ATOM   2368 N N     . GLU D 2 222 ? 18.188  51.953  64.108  1.00 63.80  ? 309 GLU A N     1 
ATOM   2369 C CA    . GLU D 2 222 ? 18.488  50.826  63.234  1.00 85.43  ? 309 GLU A CA    1 
ATOM   2370 C C     . GLU D 2 222 ? 18.127  49.467  63.831  1.00 77.68  ? 309 GLU A C     1 
ATOM   2371 O O     . GLU D 2 222 ? 18.689  48.442  63.450  1.00 77.26  ? 309 GLU A O     1 
ATOM   2372 C CB    . GLU D 2 222 ? 19.974  50.862  62.853  1.00 102.62 ? 309 GLU A CB    1 
ATOM   2373 C CG    . GLU D 2 222 ? 20.921  51.014  64.033  1.00 120.57 ? 309 GLU A CG    1 
ATOM   2374 C CD    . GLU D 2 222 ? 20.976  49.773  64.898  1.00 135.84 ? 309 GLU A CD    1 
ATOM   2375 O OE1   . GLU D 2 222 ? 21.495  48.739  64.427  1.00 114.08 ? 309 GLU A OE1   1 
ATOM   2376 O OE2   . GLU D 2 222 ? 20.496  49.830  66.049  1.00 137.22 ? 309 GLU A OE2   1 
ATOM   2377 N N     . ASP D 2 223 ? 17.181  49.456  64.763  1.00 85.22  ? 310 ASP A N     1 
ATOM   2378 C CA    . ASP D 2 223 ? 16.771  48.211  65.396  1.00 92.32  ? 310 ASP A CA    1 
ATOM   2379 C C     . ASP D 2 223 ? 15.628  48.423  66.375  1.00 99.32  ? 310 ASP A C     1 
ATOM   2380 O O     . ASP D 2 223 ? 15.830  48.419  67.588  1.00 92.47  ? 310 ASP A O     1 
ATOM   2381 C CB    . ASP D 2 223 ? 17.952  47.577  66.135  1.00 73.51  ? 310 ASP A CB    1 
ATOM   2382 C CG    . ASP D 2 223 ? 17.560  46.318  66.885  1.00 109.17 ? 310 ASP A CG    1 
ATOM   2383 O OD1   . ASP D 2 223 ? 17.170  45.337  66.223  1.00 117.78 ? 310 ASP A OD1   1 
ATOM   2384 O OD2   . ASP D 2 223 ? 17.635  46.311  68.134  1.00 103.12 ? 310 ASP A OD2   1 
ATOM   2385 N N     . ILE D 2 224 ? 14.424  48.604  65.848  1.00 114.56 ? 311 ILE A N     1 
ATOM   2386 C CA    . ILE D 2 224 ? 13.258  48.805  66.693  1.00 117.63 ? 311 ILE A CA    1 
ATOM   2387 C C     . ILE D 2 224 ? 12.038  48.960  65.796  1.00 125.15 ? 311 ILE A C     1 
ATOM   2388 O O     . ILE D 2 224 ? 12.139  49.492  64.690  1.00 138.53 ? 311 ILE A O     1 
ATOM   2389 C CB    . ILE D 2 224 ? 13.438  50.064  67.589  1.00 107.20 ? 311 ILE A CB    1 
ATOM   2390 C CG1   . ILE D 2 224 ? 12.476  50.013  68.781  1.00 119.60 ? 311 ILE A CG1   1 
ATOM   2391 C CG2   . ILE D 2 224 ? 13.224  51.326  66.774  1.00 80.08  ? 311 ILE A CG2   1 
ATOM   2392 C CD1   . ILE D 2 224 ? 11.023  50.276  68.450  1.00 93.87  ? 311 ILE A CD1   1 
ATOM   2393 N N     . SER D 2 225 ? 10.892  48.476  66.264  1.00 120.42 ? 312 SER A N     1 
ATOM   2394 C CA    . SER D 2 225 ? 9.657   48.568  65.495  1.00 120.00 ? 312 SER A CA    1 
ATOM   2395 C C     . SER D 2 225 ? 8.437   48.603  66.408  1.00 101.66 ? 312 SER A C     1 
ATOM   2396 O O     . SER D 2 225 ? 8.264   47.727  67.251  1.00 118.88 ? 312 SER A O     1 
ATOM   2397 C CB    . SER D 2 225 ? 9.547   47.380  64.540  1.00 134.62 ? 312 SER A CB    1 
ATOM   2398 O OG    . SER D 2 225 ? 9.535   46.162  65.260  1.00 140.73 ? 312 SER A OG    1 
ATOM   2399 N N     . VAL D 2 226 ? 7.598   49.620  66.233  1.00 90.52  ? 313 VAL A N     1 
ATOM   2400 C CA    . VAL D 2 226 ? 6.382   49.776  67.026  1.00 103.60 ? 313 VAL A CA    1 
ATOM   2401 C C     . VAL D 2 226 ? 5.294   48.848  66.476  1.00 110.80 ? 313 VAL A C     1 
ATOM   2402 O O     . VAL D 2 226 ? 5.124   48.730  65.263  1.00 109.07 ? 313 VAL A O     1 
ATOM   2403 C CB    . VAL D 2 226 ? 5.884   51.242  66.979  1.00 118.20 ? 313 VAL A CB    1 
ATOM   2404 C CG1   . VAL D 2 226 ? 5.598   51.647  65.543  1.00 140.50 ? 313 VAL A CG1   1 
ATOM   2405 C CG2   . VAL D 2 226 ? 4.642   51.405  67.837  1.00 117.34 ? 313 VAL A CG2   1 
ATOM   2406 N N     . VAL D 2 227 ? 4.558   48.190  67.366  1.00 120.15 ? 314 VAL A N     1 
ATOM   2407 C CA    . VAL D 2 227 ? 3.514   47.264  66.938  1.00 126.91 ? 314 VAL A CA    1 
ATOM   2408 C C     . VAL D 2 227 ? 2.130   47.573  67.510  1.00 133.30 ? 314 VAL A C     1 
ATOM   2409 O O     . VAL D 2 227 ? 1.987   48.341  68.464  1.00 136.34 ? 314 VAL A O     1 
ATOM   2410 C CB    . VAL D 2 227 ? 3.879   45.808  67.317  1.00 115.86 ? 314 VAL A CB    1 
ATOM   2411 C CG1   . VAL D 2 227 ? 5.176   45.398  66.643  1.00 97.20  ? 314 VAL A CG1   1 
ATOM   2412 C CG2   . VAL D 2 227 ? 4.018   45.686  68.820  1.00 138.05 ? 314 VAL A CG2   1 
ATOM   2413 N N     . PHE D 2 228 ? 1.115   46.956  66.909  1.00 133.10 ? 315 PHE A N     1 
ATOM   2414 C CA    . PHE D 2 228 ? -0.275  47.121  67.327  1.00 121.70 ? 315 PHE A CA    1 
ATOM   2415 C C     . PHE D 2 228 ? -0.886  45.745  67.576  1.00 135.71 ? 315 PHE A C     1 
ATOM   2416 O O     . PHE D 2 228 ? -2.073  45.523  67.336  1.00 140.73 ? 315 PHE A O     1 
ATOM   2417 C CB    . PHE D 2 228 ? -1.059  47.856  66.240  1.00 86.29  ? 315 PHE A CB    1 
ATOM   2418 C CG    . PHE D 2 228 ? -0.661  49.289  66.087  1.00 70.48  ? 315 PHE A CG    1 
ATOM   2419 C CD1   . PHE D 2 228 ? -1.143  50.255  66.966  1.00 79.37  ? 315 PHE A CD1   1 
ATOM   2420 C CD2   . PHE D 2 228 ? 0.240   49.672  65.099  1.00 95.08  ? 315 PHE A CD2   1 
ATOM   2421 C CE1   . PHE D 2 228 ? -0.732  51.586  66.865  1.00 70.74  ? 315 PHE A CE1   1 
ATOM   2422 C CE2   . PHE D 2 228 ? 0.659   51.000  64.990  1.00 114.12 ? 315 PHE A CE2   1 
ATOM   2423 C CZ    . PHE D 2 228 ? 0.171   51.958  65.877  1.00 93.04  ? 315 PHE A CZ    1 
ATOM   2424 N N     . SER D 2 229 ? -0.052  44.832  68.066  1.00 140.73 ? 316 SER A N     1 
ATOM   2425 C CA    . SER D 2 229 ? -0.452  43.459  68.353  1.00 134.95 ? 316 SER A CA    1 
ATOM   2426 C C     . SER D 2 229 ? -1.660  43.371  69.280  1.00 135.18 ? 316 SER A C     1 
ATOM   2427 O O     . SER D 2 229 ? -2.013  44.341  69.955  1.00 122.84 ? 316 SER A O     1 
ATOM   2428 C CB    . SER D 2 229 ? 0.725   42.693  68.971  1.00 131.19 ? 316 SER A CB    1 
ATOM   2429 O OG    . SER D 2 229 ? 0.414   41.322  69.150  1.00 71.97  ? 316 SER A OG    1 
ATOM   2430 N N     . THR D 2 230 ? -2.283  42.194  69.293  1.00 138.62 ? 317 THR A N     1 
ATOM   2431 C CA    . THR D 2 230 ? -3.454  41.908  70.120  1.00 137.49 ? 317 THR A CA    1 
ATOM   2432 C C     . THR D 2 230 ? -3.924  40.472  69.914  1.00 130.22 ? 317 THR A C     1 
ATOM   2433 O O     . THR D 2 230 ? -3.338  39.718  69.135  1.00 133.56 ? 317 THR A O     1 
ATOM   2434 C CB    . THR D 2 230 ? -4.640  42.837  69.786  1.00 140.73 ? 317 THR A CB    1 
ATOM   2435 O OG1   . THR D 2 230 ? -4.557  43.251  68.417  1.00 133.15 ? 317 THR A OG1   1 
ATOM   2436 C CG2   . THR D 2 230 ? -4.653  44.044  70.706  1.00 140.73 ? 317 THR A CG2   1 
ATOM   2437 N N     . ALA D 2 231 ? -4.982  40.102  70.627  1.00 118.59 ? 318 ALA A N     1 
ATOM   2438 C CA    . ALA D 2 231 ? -5.549  38.766  70.512  1.00 123.31 ? 318 ALA A CA    1 
ATOM   2439 C C     . ALA D 2 231 ? -6.228  38.665  69.150  1.00 128.19 ? 318 ALA A C     1 
ATOM   2440 O O     . ALA D 2 231 ? -7.072  39.497  68.813  1.00 140.73 ? 318 ALA A O     1 
ATOM   2441 C CB    . ALA D 2 231 ? -6.565  38.530  71.625  1.00 114.08 ? 318 ALA A CB    1 
ATOM   2442 N N     . SER D 2 232 ? -5.844  37.656  68.371  1.00 117.63 ? 319 SER A N     1 
ATOM   2443 C CA    . SER D 2 232 ? -6.403  37.424  67.040  1.00 124.14 ? 319 SER A CA    1 
ATOM   2444 C C     . SER D 2 232 ? -5.647  38.172  65.941  1.00 131.95 ? 319 SER A C     1 
ATOM   2445 O O     . SER D 2 232 ? -5.622  37.729  64.791  1.00 131.66 ? 319 SER A O     1 
ATOM   2446 C CB    . SER D 2 232 ? -7.891  37.808  67.004  1.00 123.36 ? 319 SER A CB    1 
ATOM   2447 O OG    . SER D 2 232 ? -8.456  37.609  65.719  1.00 99.29  ? 319 SER A OG    1 
ATOM   2448 N N     . TRP D 2 233 ? -5.029  39.300  66.287  1.00 136.38 ? 320 TRP A N     1 
ATOM   2449 C CA    . TRP D 2 233 ? -4.281  40.075  65.298  1.00 129.66 ? 320 TRP A CA    1 
ATOM   2450 C C     . TRP D 2 233 ? -2.992  40.679  65.843  1.00 115.99 ? 320 TRP A C     1 
ATOM   2451 O O     . TRP D 2 233 ? -2.848  40.885  67.050  1.00 105.72 ? 320 TRP A O     1 
ATOM   2452 C CB    . TRP D 2 233 ? -5.149  41.193  64.723  1.00 135.28 ? 320 TRP A CB    1 
ATOM   2453 C CG    . TRP D 2 233 ? -4.496  41.926  63.584  1.00 134.73 ? 320 TRP A CG    1 
ATOM   2454 C CD1   . TRP D 2 233 ? -4.058  41.389  62.405  1.00 132.20 ? 320 TRP A CD1   1 
ATOM   2455 C CD2   . TRP D 2 233 ? -4.215  43.328  63.515  1.00 124.77 ? 320 TRP A CD2   1 
ATOM   2456 N NE1   . TRP D 2 233 ? -3.524  42.371  61.606  1.00 127.31 ? 320 TRP A NE1   1 
ATOM   2457 C CE2   . TRP D 2 233 ? -3.610  43.572  62.261  1.00 116.76 ? 320 TRP A CE2   1 
ATOM   2458 C CE3   . TRP D 2 233 ? -4.421  44.404  64.389  1.00 132.12 ? 320 TRP A CE3   1 
ATOM   2459 C CZ2   . TRP D 2 233 ? -3.203  44.848  61.862  1.00 91.25  ? 320 TRP A CZ2   1 
ATOM   2460 C CZ3   . TRP D 2 233 ? -4.016  45.674  63.991  1.00 123.29 ? 320 TRP A CZ3   1 
ATOM   2461 C CH2   . TRP D 2 233 ? -3.416  45.884  62.736  1.00 103.39 ? 320 TRP A CH2   1 
ATOM   2462 N N     . GLU D 2 234 ? -2.068  40.977  64.932  1.00 99.57  ? 321 GLU A N     1 
ATOM   2463 C CA    . GLU D 2 234 ? -0.776  41.547  65.287  1.00 97.12  ? 321 GLU A CA    1 
ATOM   2464 C C     . GLU D 2 234 ? -0.183  42.304  64.103  1.00 94.66  ? 321 GLU A C     1 
ATOM   2465 O O     . GLU D 2 234 ? 0.620   41.757  63.349  1.00 84.38  ? 321 GLU A O     1 
ATOM   2466 C CB    . GLU D 2 234 ? 0.169   40.421  65.703  1.00 122.19 ? 321 GLU A CB    1 
ATOM   2467 C CG    . GLU D 2 234 ? 1.570   40.864  66.051  1.00 127.33 ? 321 GLU A CG    1 
ATOM   2468 C CD    . GLU D 2 234 ? 2.447   39.701  66.455  1.00 121.69 ? 321 GLU A CD    1 
ATOM   2469 O OE1   . GLU D 2 234 ? 2.087   39.005  67.429  1.00 113.91 ? 321 GLU A OE1   1 
ATOM   2470 O OE2   . GLU D 2 234 ? 3.489   39.484  65.798  1.00 94.85  ? 321 GLU A OE2   1 
ATOM   2471 N N     . GLY D 2 235 ? -0.577  43.564  63.944  1.00 93.68  ? 322 GLY A N     1 
ATOM   2472 C CA    . GLY D 2 235 ? -0.072  44.360  62.836  1.00 109.69 ? 322 GLY A CA    1 
ATOM   2473 C C     . GLY D 2 235 ? 0.821   45.501  63.279  1.00 103.60 ? 322 GLY A C     1 
ATOM   2474 O O     . GLY D 2 235 ? 0.409   46.366  64.054  1.00 98.81  ? 322 GLY A O     1 
ATOM   2475 N N     . ARG D 2 236 ? 2.046   45.517  62.773  1.00 101.47 ? 323 ARG A N     1 
ATOM   2476 C CA    . ARG D 2 236 ? 2.990   46.556  63.153  1.00 111.11 ? 323 ARG A CA    1 
ATOM   2477 C C     . ARG D 2 236 ? 3.146   47.673  62.120  1.00 109.14 ? 323 ARG A C     1 
ATOM   2478 O O     . ARG D 2 236 ? 3.256   47.419  60.917  1.00 92.91  ? 323 ARG A O     1 
ATOM   2479 C CB    . ARG D 2 236 ? 4.342   45.916  63.468  1.00 102.61 ? 323 ARG A CB    1 
ATOM   2480 C CG    . ARG D 2 236 ? 4.911   45.067  62.355  1.00 103.92 ? 323 ARG A CG    1 
ATOM   2481 C CD    . ARG D 2 236 ? 6.014   44.162  62.877  1.00 102.02 ? 323 ARG A CD    1 
ATOM   2482 N NE    . ARG D 2 236 ? 6.887   43.685  61.806  1.00 130.77 ? 323 ARG A NE    1 
ATOM   2483 C CZ    . ARG D 2 236 ? 7.762   44.448  61.154  1.00 129.70 ? 323 ARG A CZ    1 
ATOM   2484 N NH1   . ARG D 2 236 ? 8.513   43.926  60.191  1.00 123.58 ? 323 ARG A NH1   1 
ATOM   2485 N NH2   . ARG D 2 236 ? 7.894   45.732  61.470  1.00 80.72  ? 323 ARG A NH2   1 
ATOM   2486 N N     . ALA D 2 237 ? 3.151   48.911  62.616  1.00 101.37 ? 324 ALA A N     1 
ATOM   2487 C CA    . ALA D 2 237 ? 3.279   50.108  61.788  1.00 76.04  ? 324 ALA A CA    1 
ATOM   2488 C C     . ALA D 2 237 ? 4.441   50.029  60.826  1.00 77.42  ? 324 ALA A C     1 
ATOM   2489 O O     . ALA D 2 237 ? 5.071   48.986  60.675  1.00 84.22  ? 324 ALA A O     1 
ATOM   2490 C CB    . ALA D 2 237 ? 3.436   51.335  62.666  1.00 53.51  ? 324 ALA A CB    1 
ATOM   2491 N N     . ASP D 2 238 ? 4.718   51.149  60.171  1.00 86.30  ? 325 ASP A N     1 
ATOM   2492 C CA    . ASP D 2 238 ? 5.810   51.228  59.211  1.00 96.95  ? 325 ASP A CA    1 
ATOM   2493 C C     . ASP D 2 238 ? 6.388   52.634  59.197  1.00 89.17  ? 325 ASP A C     1 
ATOM   2494 O O     . ASP D 2 238 ? 5.663   53.628  59.271  1.00 80.23  ? 325 ASP A O     1 
ATOM   2495 C CB    . ASP D 2 238 ? 5.327   50.827  57.809  1.00 112.98 ? 325 ASP A CB    1 
ATOM   2496 C CG    . ASP D 2 238 ? 4.013   51.483  57.434  1.00 140.23 ? 325 ASP A CG    1 
ATOM   2497 O OD1   . ASP D 2 238 ? 3.980   52.727  57.313  1.00 140.73 ? 325 ASP A OD1   1 
ATOM   2498 O OD2   . ASP D 2 238 ? 3.011   50.753  57.265  1.00 134.43 ? 325 ASP A OD2   1 
ATOM   2499 N N     . PHE D 2 239 ? 7.709   52.697  59.112  1.00 87.35  ? 326 PHE A N     1 
ATOM   2500 C CA    . PHE D 2 239 ? 8.442   53.952  59.108  1.00 90.37  ? 326 PHE A CA    1 
ATOM   2501 C C     . PHE D 2 239 ? 9.897   53.578  58.893  1.00 95.58  ? 326 PHE A C     1 
ATOM   2502 O O     . PHE D 2 239 ? 10.228  52.395  58.788  1.00 102.46 ? 326 PHE A O     1 
ATOM   2503 C CB    . PHE D 2 239 ? 8.275   54.667  60.452  1.00 109.64 ? 326 PHE A CB    1 
ATOM   2504 C CG    . PHE D 2 239 ? 8.777   53.871  61.629  1.00 116.98 ? 326 PHE A CG    1 
ATOM   2505 C CD1   . PHE D 2 239 ? 8.418   52.533  61.791  1.00 128.78 ? 326 PHE A CD1   1 
ATOM   2506 C CD2   . PHE D 2 239 ? 9.604   54.456  62.577  1.00 89.10  ? 326 PHE A CD2   1 
ATOM   2507 C CE1   . PHE D 2 239 ? 8.875   51.794  62.874  1.00 85.58  ? 326 PHE A CE1   1 
ATOM   2508 C CE2   . PHE D 2 239 ? 10.067  53.722  63.669  1.00 83.57  ? 326 PHE A CE2   1 
ATOM   2509 C CZ    . PHE D 2 239 ? 9.702   52.389  63.816  1.00 120.82 ? 326 PHE A CZ    1 
ATOM   2510 N N     . SER D 2 240 ? 10.770  54.574  58.830  1.00 82.84  ? 327 SER A N     1 
ATOM   2511 C CA    . SER D 2 240 ? 12.180  54.297  58.620  1.00 80.39  ? 327 SER A CA    1 
ATOM   2512 C C     . SER D 2 240 ? 13.024  54.971  59.683  1.00 74.24  ? 327 SER A C     1 
ATOM   2513 O O     . SER D 2 240 ? 12.578  55.919  60.339  1.00 60.36  ? 327 SER A O     1 
ATOM   2514 C CB    . SER D 2 240 ? 12.619  54.772  57.232  1.00 94.14  ? 327 SER A CB    1 
ATOM   2515 O OG    . SER D 2 240 ? 12.530  56.183  57.115  1.00 136.00 ? 327 SER A OG    1 
ATOM   2516 N N     . GLN D 2 241 ? 14.247  54.469  59.838  1.00 69.54  ? 328 GLN A N     1 
ATOM   2517 C CA    . GLN D 2 241 ? 15.198  54.983  60.813  1.00 55.24  ? 328 GLN A CA    1 
ATOM   2518 C C     . GLN D 2 241 ? 15.225  56.504  60.782  1.00 51.96  ? 328 GLN A C     1 
ATOM   2519 O O     . GLN D 2 241 ? 15.605  57.147  61.757  1.00 77.28  ? 328 GLN A O     1 
ATOM   2520 C CB    . GLN D 2 241 ? 16.597  54.441  60.513  1.00 54.57  ? 328 GLN A CB    1 
ATOM   2521 C CG    . GLN D 2 241 ? 16.632  52.968  60.123  1.00 37.22  ? 328 GLN A CG    1 
ATOM   2522 C CD    . GLN D 2 241 ? 18.044  52.404  60.114  1.00 99.42  ? 328 GLN A CD    1 
ATOM   2523 O OE1   . GLN D 2 241 ? 19.019  53.147  60.001  1.00 66.39  ? 328 GLN A OE1   1 
ATOM   2524 N NE2   . GLN D 2 241 ? 18.158  51.083  60.224  1.00 59.43  ? 328 GLN A NE2   1 
ATOM   2525 N N     . ALA D 2 242 ? 14.817  57.073  59.653  1.00 62.59  ? 329 ALA A N     1 
ATOM   2526 C CA    . ALA D 2 242 ? 14.800  58.520  59.494  1.00 78.72  ? 329 ALA A CA    1 
ATOM   2527 C C     . ALA D 2 242 ? 13.815  59.192  60.445  1.00 75.11  ? 329 ALA A C     1 
ATOM   2528 O O     . ALA D 2 242 ? 13.986  60.362  60.804  1.00 68.57  ? 329 ALA A O     1 
ATOM   2529 C CB    . ALA D 2 242 ? 14.457  58.876  58.055  1.00 124.41 ? 329 ALA A CB    1 
ATOM   2530 N N     . ASP D 2 243 ? 12.793  58.447  60.861  1.00 71.33  ? 330 ASP A N     1 
ATOM   2531 C CA    . ASP D 2 243 ? 11.771  58.981  61.754  1.00 83.86  ? 330 ASP A CA    1 
ATOM   2532 C C     . ASP D 2 243 ? 12.053  58.699  63.223  1.00 88.73  ? 330 ASP A C     1 
ATOM   2533 O O     . ASP D 2 243 ? 11.189  58.890  64.078  1.00 87.70  ? 330 ASP A O     1 
ATOM   2534 C CB    . ASP D 2 243 ? 10.413  58.410  61.366  1.00 80.43  ? 330 ASP A CB    1 
ATOM   2535 C CG    . ASP D 2 243 ? 10.177  58.458  59.871  1.00 106.17 ? 330 ASP A CG    1 
ATOM   2536 O OD1   . ASP D 2 243 ? 10.807  57.656  59.151  1.00 91.51  ? 330 ASP A OD1   1 
ATOM   2537 O OD2   . ASP D 2 243 ? 9.376   59.304  59.419  1.00 109.49 ? 330 ASP A OD2   1 
ATOM   2538 N N     . VAL D 2 244 ? 13.270  58.245  63.505  1.00 91.30  ? 331 VAL A N     1 
ATOM   2539 C CA    . VAL D 2 244 ? 13.695  57.945  64.867  1.00 83.66  ? 331 VAL A CA    1 
ATOM   2540 C C     . VAL D 2 244 ? 14.482  59.141  65.413  1.00 74.23  ? 331 VAL A C     1 
ATOM   2541 O O     . VAL D 2 244 ? 15.712  59.102  65.530  1.00 77.17  ? 331 VAL A O     1 
ATOM   2542 C CB    . VAL D 2 244 ? 14.580  56.682  64.901  1.00 88.98  ? 331 VAL A CB    1 
ATOM   2543 C CG1   . VAL D 2 244 ? 14.999  56.373  66.330  1.00 91.04  ? 331 VAL A CG1   1 
ATOM   2544 C CG2   . VAL D 2 244 ? 13.824  55.507  64.307  1.00 78.07  ? 331 VAL A CG2   1 
ATOM   2545 N N     . HIS D 2 245 ? 13.753  60.199  65.746  1.00 33.01  ? 332 HIS A N     1 
ATOM   2546 C CA    . HIS D 2 245 ? 14.351  61.419  66.261  1.00 55.86  ? 332 HIS A CA    1 
ATOM   2547 C C     . HIS D 2 245 ? 15.212  61.195  67.505  1.00 77.38  ? 332 HIS A C     1 
ATOM   2548 O O     . HIS D 2 245 ? 14.712  60.824  68.566  1.00 91.04  ? 332 HIS A O     1 
ATOM   2549 C CB    . HIS D 2 245 ? 13.258  62.441  66.577  1.00 47.05  ? 332 HIS A CB    1 
ATOM   2550 C CG    . HIS D 2 245 ? 13.783  63.769  67.029  1.00 44.95  ? 332 HIS A CG    1 
ATOM   2551 N ND1   . HIS D 2 245 ? 14.352  64.680  66.164  1.00 61.43  ? 332 HIS A ND1   1 
ATOM   2552 C CD2   . HIS D 2 245 ? 13.820  64.344  68.256  1.00 89.50  ? 332 HIS A CD2   1 
ATOM   2553 C CE1   . HIS D 2 245 ? 14.715  65.758  66.839  1.00 87.30  ? 332 HIS A CE1   1 
ATOM   2554 N NE2   . HIS D 2 245 ? 14.404  65.579  68.110  1.00 42.08  ? 332 HIS A NE2   1 
ATOM   2555 N N     . ARG D 2 246 ? 16.510  61.422  67.348  1.00 86.12  ? 333 ARG A N     1 
ATOM   2556 C CA    . ARG D 2 246 ? 17.491  61.297  68.419  1.00 80.53  ? 333 ARG A CA    1 
ATOM   2557 C C     . ARG D 2 246 ? 17.217  60.295  69.546  1.00 74.75  ? 333 ARG A C     1 
ATOM   2558 O O     . ARG D 2 246 ? 17.233  60.647  70.724  1.00 45.70  ? 333 ARG A O     1 
ATOM   2559 C CB    . ARG D 2 246 ? 17.755  62.690  68.995  1.00 72.32  ? 333 ARG A CB    1 
ATOM   2560 C CG    . ARG D 2 246 ? 18.437  63.619  67.993  1.00 122.41 ? 333 ARG A CG    1 
ATOM   2561 C CD    . ARG D 2 246 ? 18.556  65.048  68.502  1.00 131.98 ? 333 ARG A CD    1 
ATOM   2562 N NE    . ARG D 2 246 ? 19.313  65.891  67.576  1.00 128.44 ? 333 ARG A NE    1 
ATOM   2563 C CZ    . ARG D 2 246 ? 20.638  65.870  67.452  1.00 122.22 ? 333 ARG A CZ    1 
ATOM   2564 N NH1   . ARG D 2 246 ? 21.367  65.054  68.199  1.00 96.61  ? 333 ARG A NH1   1 
ATOM   2565 N NH2   . ARG D 2 246 ? 21.234  66.665  66.573  1.00 138.43 ? 333 ARG A NH2   1 
ATOM   2566 N N     . GLN D 2 247 ? 16.976  59.040  69.174  1.00 89.78  ? 334 GLN A N     1 
ATOM   2567 C CA    . GLN D 2 247 ? 16.737  57.961  70.134  1.00 94.70  ? 334 GLN A CA    1 
ATOM   2568 C C     . GLN D 2 247 ? 15.642  58.148  71.182  1.00 90.26  ? 334 GLN A C     1 
ATOM   2569 O O     . GLN D 2 247 ? 15.532  57.338  72.098  1.00 113.12 ? 334 GLN A O     1 
ATOM   2570 C CB    . GLN D 2 247 ? 18.042  57.622  70.864  1.00 68.92  ? 334 GLN A CB    1 
ATOM   2571 C CG    . GLN D 2 247 ? 19.070  56.928  69.995  1.00 82.26  ? 334 GLN A CG    1 
ATOM   2572 C CD    . GLN D 2 247 ? 20.248  56.400  70.785  1.00 76.80  ? 334 GLN A CD    1 
ATOM   2573 O OE1   . GLN D 2 247 ? 21.065  57.164  71.294  1.00 45.97  ? 334 GLN A OE1   1 
ATOM   2574 N NE2   . GLN D 2 247 ? 20.337  55.083  70.897  1.00 44.10  ? 334 GLN A NE2   1 
ATOM   2575 N N     . ILE D 2 248 ? 14.823  59.184  71.056  1.00 68.47  ? 335 ILE A N     1 
ATOM   2576 C CA    . ILE D 2 248 ? 13.781  59.414  72.048  1.00 65.72  ? 335 ILE A CA    1 
ATOM   2577 C C     . ILE D 2 248 ? 12.447  59.877  71.479  1.00 59.69  ? 335 ILE A C     1 
ATOM   2578 O O     . ILE D 2 248 ? 11.708  60.608  72.137  1.00 59.18  ? 335 ILE A O     1 
ATOM   2579 C CB    . ILE D 2 248 ? 14.261  60.445  73.085  1.00 61.41  ? 335 ILE A CB    1 
ATOM   2580 C CG1   . ILE D 2 248 ? 14.890  61.648  72.380  1.00 57.10  ? 335 ILE A CG1   1 
ATOM   2581 C CG2   . ILE D 2 248 ? 15.279  59.813  74.011  1.00 114.92 ? 335 ILE A CG2   1 
ATOM   2582 C CD1   . ILE D 2 248 ? 13.913  62.508  71.615  1.00 73.93  ? 335 ILE A CD1   1 
ATOM   2583 N N     . ALA D 2 249 ? 12.137  59.449  70.260  1.00 59.60  ? 336 ALA A N     1 
ATOM   2584 C CA    . ALA D 2 249 ? 10.891  59.837  69.601  1.00 52.60  ? 336 ALA A CA    1 
ATOM   2585 C C     . ALA D 2 249 ? 10.729  59.126  68.257  1.00 62.52  ? 336 ALA A C     1 
ATOM   2586 O O     . ALA D 2 249 ? 11.706  58.905  67.528  1.00 69.99  ? 336 ALA A O     1 
ATOM   2587 C CB    . ALA D 2 249 ? 10.863  61.354  69.396  1.00 39.84  ? 336 ALA A CB    1 
ATOM   2588 N N     . ILE D 2 250 ? 9.489   58.772  67.930  1.00 68.79  ? 337 ILE A N     1 
ATOM   2589 C CA    . ILE D 2 250 ? 9.206   58.089  66.670  1.00 68.98  ? 337 ILE A CA    1 
ATOM   2590 C C     . ILE D 2 250 ? 8.019   58.684  65.927  1.00 78.02  ? 337 ILE A C     1 
ATOM   2591 O O     . ILE D 2 250 ? 7.008   59.048  66.530  1.00 98.96  ? 337 ILE A O     1 
ATOM   2592 C CB    . ILE D 2 250 ? 8.927   56.580  66.887  1.00 50.00  ? 337 ILE A CB    1 
ATOM   2593 C CG1   . ILE D 2 250 ? 10.231  55.848  67.215  1.00 50.82  ? 337 ILE A CG1   1 
ATOM   2594 C CG2   . ILE D 2 250 ? 8.262   55.982  65.654  1.00 40.08  ? 337 ILE A CG2   1 
ATOM   2595 C CD1   . ILE D 2 250 ? 10.071  54.345  67.307  1.00 44.31  ? 337 ILE A CD1   1 
ATOM   2596 N N     . VAL D 2 251 ? 8.159   58.769  64.608  1.00 82.53  ? 338 VAL A N     1 
ATOM   2597 C CA    . VAL D 2 251 ? 7.115   59.293  63.735  1.00 76.72  ? 338 VAL A CA    1 
ATOM   2598 C C     . VAL D 2 251 ? 6.722   58.173  62.778  1.00 69.20  ? 338 VAL A C     1 
ATOM   2599 O O     . VAL D 2 251 ? 7.326   57.992  61.729  1.00 97.08  ? 338 VAL A O     1 
ATOM   2600 C CB    . VAL D 2 251 ? 7.628   60.504  62.946  1.00 96.94  ? 338 VAL A CB    1 
ATOM   2601 C CG1   . VAL D 2 251 ? 6.531   61.048  62.042  1.00 101.07 ? 338 VAL A CG1   1 
ATOM   2602 C CG2   . VAL D 2 251 ? 8.120   61.571  63.923  1.00 61.71  ? 338 VAL A CG2   1 
ATOM   2603 N N     . PHE D 2 252 ? 5.702   57.421  63.165  1.00 67.15  ? 339 PHE A N     1 
ATOM   2604 C CA    . PHE D 2 252 ? 5.225   56.283  62.391  1.00 76.79  ? 339 PHE A CA    1 
ATOM   2605 C C     . PHE D 2 252 ? 3.877   56.530  61.733  1.00 85.64  ? 339 PHE A C     1 
ATOM   2606 O O     . PHE D 2 252 ? 3.251   57.574  61.923  1.00 85.11  ? 339 PHE A O     1 
ATOM   2607 C CB    . PHE D 2 252 ? 5.112   55.056  63.299  1.00 94.21  ? 339 PHE A CB    1 
ATOM   2608 C CG    . PHE D 2 252 ? 4.275   55.293  64.527  1.00 78.45  ? 339 PHE A CG    1 
ATOM   2609 C CD1   . PHE D 2 252 ? 4.735   56.119  65.553  1.00 95.83  ? 339 PHE A CD1   1 
ATOM   2610 C CD2   . PHE D 2 252 ? 3.007   54.733  64.638  1.00 128.34 ? 339 PHE A CD2   1 
ATOM   2611 C CE1   . PHE D 2 252 ? 3.943   56.385  66.667  1.00 109.28 ? 339 PHE A CE1   1 
ATOM   2612 C CE2   . PHE D 2 252 ? 2.207   54.994  65.749  1.00 136.76 ? 339 PHE A CE2   1 
ATOM   2613 C CZ    . PHE D 2 252 ? 2.676   55.822  66.764  1.00 137.23 ? 339 PHE A CZ    1 
ATOM   2614 N N     . LYS D 2 253 ? 3.432   55.537  60.973  1.00 93.11  ? 340 LYS A N     1 
ATOM   2615 C CA    . LYS D 2 253 ? 2.166   55.605  60.260  1.00 106.72 ? 340 LYS A CA    1 
ATOM   2616 C C     . LYS D 2 253 ? 1.329   54.386  60.645  1.00 102.61 ? 340 LYS A C     1 
ATOM   2617 O O     . LYS D 2 253 ? 1.689   53.252  60.329  1.00 88.63  ? 340 LYS A O     1 
ATOM   2618 C CB    . LYS D 2 253 ? 2.444   55.635  58.751  1.00 133.04 ? 340 LYS A CB    1 
ATOM   2619 C CG    . LYS D 2 253 ? 1.232   55.865  57.859  1.00 140.73 ? 340 LYS A CG    1 
ATOM   2620 C CD    . LYS D 2 253 ? 1.597   56.701  56.626  1.00 140.73 ? 340 LYS A CD    1 
ATOM   2621 C CE    . LYS D 2 253 ? 2.754   56.106  55.827  1.00 140.73 ? 340 LYS A CE    1 
ATOM   2622 N NZ    . LYS D 2 253 ? 2.433   54.783  55.224  1.00 118.82 ? 340 LYS A NZ    1 
ATOM   2623 N N     . THR D 2 254 ? 0.221   54.633  61.340  1.00 98.05  ? 341 THR A N     1 
ATOM   2624 C CA    . THR D 2 254 ? -0.681  53.578  61.799  1.00 102.52 ? 341 THR A CA    1 
ATOM   2625 C C     . THR D 2 254 ? -1.156  52.681  60.664  1.00 111.35 ? 341 THR A C     1 
ATOM   2626 O O     . THR D 2 254 ? -1.887  53.126  59.781  1.00 129.35 ? 341 THR A O     1 
ATOM   2627 C CB    . THR D 2 254 ? -1.925  54.171  62.481  1.00 112.99 ? 341 THR A CB    1 
ATOM   2628 O OG1   . THR D 2 254 ? -1.523  55.081  63.513  1.00 85.31  ? 341 THR A OG1   1 
ATOM   2629 C CG2   . THR D 2 254 ? -2.773  53.064  63.091  1.00 130.05 ? 341 THR A CG2   1 
ATOM   2630 N N     . PRO D 2 255 ? -0.763  51.396  60.682  1.00 120.26 ? 342 PRO A N     1 
ATOM   2631 C CA    . PRO D 2 255 ? -1.163  50.452  59.635  1.00 123.92 ? 342 PRO A CA    1 
ATOM   2632 C C     . PRO D 2 255 ? -2.644  50.119  59.747  1.00 129.91 ? 342 PRO A C     1 
ATOM   2633 O O     . PRO D 2 255 ? -3.202  50.119  60.842  1.00 115.29 ? 342 PRO A O     1 
ATOM   2634 C CB    . PRO D 2 255 ? -0.283  49.245  59.920  1.00 104.18 ? 342 PRO A CB    1 
ATOM   2635 C CG    . PRO D 2 255 ? -0.259  49.235  61.411  1.00 122.64 ? 342 PRO A CG    1 
ATOM   2636 C CD    . PRO D 2 255 ? -0.019  50.700  61.747  1.00 131.35 ? 342 PRO A CD    1 
ATOM   2637 N N     . PRO D 2 256 ? -3.301  49.838  58.612  1.00 139.50 ? 343 PRO A N     1 
ATOM   2638 C CA    . PRO D 2 256 ? -4.728  49.506  58.640  1.00 137.12 ? 343 PRO A CA    1 
ATOM   2639 C C     . PRO D 2 256 ? -4.998  48.212  59.407  1.00 128.70 ? 343 PRO A C     1 
ATOM   2640 O O     . PRO D 2 256 ? -4.120  47.353  59.524  1.00 109.60 ? 343 PRO A O     1 
ATOM   2641 C CB    . PRO D 2 256 ? -5.088  49.405  57.157  1.00 140.73 ? 343 PRO A CB    1 
ATOM   2642 C CG    . PRO D 2 256 ? -3.802  48.949  56.528  1.00 140.73 ? 343 PRO A CG    1 
ATOM   2643 C CD    . PRO D 2 256 ? -2.778  49.802  57.236  1.00 140.73 ? 343 PRO A CD    1 
ATOM   2644 N N     . TYR D 2 257 ? -6.215  48.087  59.934  1.00 125.96 ? 344 TYR A N     1 
ATOM   2645 C CA    . TYR D 2 257 ? -6.609  46.908  60.700  1.00 130.89 ? 344 TYR A CA    1 
ATOM   2646 C C     . TYR D 2 257 ? -6.542  45.673  59.811  1.00 135.80 ? 344 TYR A C     1 
ATOM   2647 O O     . TYR D 2 257 ? -6.168  45.760  58.641  1.00 140.73 ? 344 TYR A O     1 
ATOM   2648 C CB    . TYR D 2 257 ? -8.034  47.074  61.233  1.00 110.04 ? 344 TYR A CB    1 
ATOM   2649 C CG    . TYR D 2 257 ? -8.332  46.237  62.456  1.00 130.94 ? 344 TYR A CG    1 
ATOM   2650 C CD1   . TYR D 2 257 ? -7.717  46.513  63.675  1.00 140.73 ? 344 TYR A CD1   1 
ATOM   2651 C CD2   . TYR D 2 257 ? -9.233  45.172  62.399  1.00 137.24 ? 344 TYR A CD2   1 
ATOM   2652 C CE1   . TYR D 2 257 ? -7.990  45.753  64.813  1.00 140.73 ? 344 TYR A CE1   1 
ATOM   2653 C CE2   . TYR D 2 257 ? -9.515  44.402  63.532  1.00 133.42 ? 344 TYR A CE2   1 
ATOM   2654 C CZ    . TYR D 2 257 ? -8.888  44.700  64.737  1.00 138.84 ? 344 TYR A CZ    1 
ATOM   2655 O OH    . TYR D 2 257 ? -9.152  43.955  65.866  1.00 104.07 ? 344 TYR A OH    1 
ATOM   2656 N N     . GLU D 2 258 ? -6.905  44.522  60.364  1.00 132.62 ? 345 GLU A N     1 
ATOM   2657 C CA    . GLU D 2 258 ? -6.881  43.294  59.586  1.00 128.60 ? 345 GLU A CA    1 
ATOM   2658 C C     . GLU D 2 258 ? -8.154  43.197  58.761  1.00 136.41 ? 345 GLU A C     1 
ATOM   2659 O O     . GLU D 2 258 ? -8.934  42.255  58.903  1.00 140.73 ? 345 GLU A O     1 
ATOM   2660 C CB    . GLU D 2 258 ? -6.748  42.082  60.506  1.00 114.67 ? 345 GLU A CB    1 
ATOM   2661 C CG    . GLU D 2 258 ? -7.838  41.945  61.538  1.00 110.98 ? 345 GLU A CG    1 
ATOM   2662 C CD    . GLU D 2 258 ? -7.634  40.725  62.406  1.00 111.69 ? 345 GLU A CD    1 
ATOM   2663 O OE1   . GLU D 2 258 ? -7.448  39.622  61.847  1.00 130.43 ? 345 GLU A OE1   1 
ATOM   2664 O OE2   . GLU D 2 258 ? -7.659  40.865  63.645  1.00 99.92  ? 345 GLU A OE2   1 
ATOM   2665 N N     . ASP D 2 259 ? -8.354  44.192  57.900  1.00 140.73 ? 346 ASP A N     1 
ATOM   2666 C CA    . ASP D 2 259 ? -9.525  44.250  57.033  1.00 140.73 ? 346 ASP A CA    1 
ATOM   2667 C C     . ASP D 2 259 ? -10.794 44.118  57.870  1.00 139.45 ? 346 ASP A C     1 
ATOM   2668 O O     . ASP D 2 259 ? -11.369 43.032  57.968  1.00 140.73 ? 346 ASP A O     1 
ATOM   2669 C CB    . ASP D 2 259 ? -9.461  43.125  55.999  1.00 140.73 ? 346 ASP A CB    1 
ATOM   2670 C CG    . ASP D 2 259 ? -8.072  42.950  55.415  1.00 140.73 ? 346 ASP A CG    1 
ATOM   2671 O OD1   . ASP D 2 259 ? -7.495  43.952  54.939  1.00 140.73 ? 346 ASP A OD1   1 
ATOM   2672 O OD2   . ASP D 2 259 ? -7.556  41.812  55.429  1.00 140.73 ? 346 ASP A OD2   1 
ATOM   2673 N N     . LEU D 2 260 ? -11.229 45.219  58.474  1.00 125.18 ? 347 LEU A N     1 
ATOM   2674 C CA    . LEU D 2 260 ? -12.426 45.184  59.300  1.00 124.57 ? 347 LEU A CA    1 
ATOM   2675 C C     . LEU D 2 260 ? -13.020 46.570  59.525  1.00 132.23 ? 347 LEU A C     1 
ATOM   2676 O O     . LEU D 2 260 ? -12.298 47.567  59.602  1.00 127.29 ? 347 LEU A O     1 
ATOM   2677 C CB    . LEU D 2 260 ? -12.100 44.529  60.644  1.00 112.97 ? 347 LEU A CB    1 
ATOM   2678 C CG    . LEU D 2 260 ? -13.215 43.765  61.369  1.00 132.05 ? 347 LEU A CG    1 
ATOM   2679 C CD1   . LEU D 2 260 ? -14.331 44.713  61.780  1.00 112.49 ? 347 LEU A CD1   1 
ATOM   2680 C CD2   . LEU D 2 260 ? -13.746 42.661  60.462  1.00 137.07 ? 347 LEU A CD2   1 
ATOM   2681 N N     . GLU D 2 261 ? -14.346 46.612  59.629  1.00 140.73 ? 348 GLU A N     1 
ATOM   2682 C CA    . GLU D 2 261 ? -15.088 47.849  59.841  1.00 135.19 ? 348 GLU A CA    1 
ATOM   2683 C C     . GLU D 2 261 ? -16.319 47.579  60.711  1.00 131.42 ? 348 GLU A C     1 
ATOM   2684 O O     . GLU D 2 261 ? -16.938 48.509  61.236  1.00 97.77  ? 348 GLU A O     1 
ATOM   2685 C CB    . GLU D 2 261 ? -15.533 48.418  58.491  1.00 132.57 ? 348 GLU A CB    1 
ATOM   2686 C CG    . GLU D 2 261 ? -16.290 47.411  57.629  1.00 133.72 ? 348 GLU A CG    1 
ATOM   2687 C CD    . GLU D 2 261 ? -16.768 47.994  56.311  1.00 138.31 ? 348 GLU A CD    1 
ATOM   2688 O OE1   . GLU D 2 261 ? -17.641 48.888  56.335  1.00 140.73 ? 348 GLU A OE1   1 
ATOM   2689 O OE2   . GLU D 2 261 ? -16.268 47.556  55.252  1.00 140.73 ? 348 GLU A OE2   1 
ATOM   2690 N N     . ILE D 2 262 ? -16.656 46.296  60.853  1.00 140.47 ? 349 ILE A N     1 
ATOM   2691 C CA    . ILE D 2 262 ? -17.811 45.851  61.630  1.00 140.73 ? 349 ILE A CA    1 
ATOM   2692 C C     . ILE D 2 262 ? -18.196 46.765  62.789  1.00 140.73 ? 349 ILE A C     1 
ATOM   2693 O O     . ILE D 2 262 ? -17.505 46.831  63.808  1.00 140.73 ? 349 ILE A O     1 
ATOM   2694 C CB    . ILE D 2 262 ? -17.608 44.401  62.169  1.00 131.00 ? 349 ILE A CB    1 
ATOM   2695 C CG1   . ILE D 2 262 ? -17.940 43.377  61.076  1.00 126.25 ? 349 ILE A CG1   1 
ATOM   2696 C CG2   . ILE D 2 262 ? -18.510 44.147  63.368  1.00 101.31 ? 349 ILE A CG2   1 
ATOM   2697 C CD1   . ILE D 2 262 ? -17.054 43.446  59.853  1.00 106.14 ? 349 ILE A CD1   1 
ATOM   2698 N N     . SER D 2 263 ? -19.313 47.464  62.602  1.00 140.73 ? 350 SER A N     1 
ATOM   2699 C CA    . SER D 2 263 ? -19.876 48.387  63.585  1.00 140.73 ? 350 SER A CA    1 
ATOM   2700 C C     . SER D 2 263 ? -18.882 49.195  64.424  1.00 140.73 ? 350 SER A C     1 
ATOM   2701 O O     . SER D 2 263 ? -17.760 49.462  63.991  1.00 140.73 ? 350 SER A O     1 
ATOM   2702 C CB    . SER D 2 263 ? -20.849 47.626  64.497  1.00 140.73 ? 350 SER A CB    1 
ATOM   2703 O OG    . SER D 2 263 ? -20.375 46.321  64.784  1.00 140.73 ? 350 SER A OG    1 
ATOM   2704 N N     . GLU D 2 264 ? -19.312 49.591  65.619  1.00 133.14 ? 351 GLU A N     1 
ATOM   2705 C CA    . GLU D 2 264 ? -18.492 50.389  66.528  1.00 138.03 ? 351 GLU A CA    1 
ATOM   2706 C C     . GLU D 2 264 ? -17.040 49.897  66.643  1.00 136.81 ? 351 GLU A C     1 
ATOM   2707 O O     . GLU D 2 264 ? -16.741 48.735  66.360  1.00 136.96 ? 351 GLU A O     1 
ATOM   2708 C CB    . GLU D 2 264 ? -19.147 50.438  67.917  1.00 140.73 ? 351 GLU A CB    1 
ATOM   2709 C CG    . GLU D 2 264 ? -20.622 50.880  67.927  1.00 135.21 ? 351 GLU A CG    1 
ATOM   2710 C CD    . GLU D 2 264 ? -20.856 52.267  67.334  1.00 124.46 ? 351 GLU A CD    1 
ATOM   2711 O OE1   . GLU D 2 264 ? -20.314 53.258  67.871  1.00 118.53 ? 351 GLU A OE1   1 
ATOM   2712 O OE2   . GLU D 2 264 ? -21.591 52.362  66.329  1.00 126.03 ? 351 GLU A OE2   1 
ATOM   2713 N N     . PRO D 2 265 ? -16.125 50.793  67.064  1.00 137.58 ? 352 PRO A N     1 
ATOM   2714 C CA    . PRO D 2 265 ? -14.677 50.618  67.263  1.00 136.60 ? 352 PRO A CA    1 
ATOM   2715 C C     . PRO D 2 265 ? -14.210 49.551  68.255  1.00 138.42 ? 352 PRO A C     1 
ATOM   2716 O O     . PRO D 2 265 ? -14.925 49.196  69.195  1.00 138.71 ? 352 PRO A O     1 
ATOM   2717 C CB    . PRO D 2 265 ? -14.221 52.007  67.707  1.00 133.33 ? 352 PRO A CB    1 
ATOM   2718 C CG    . PRO D 2 265 ? -15.212 52.915  67.073  1.00 140.73 ? 352 PRO A CG    1 
ATOM   2719 C CD    . PRO D 2 265 ? -16.501 52.194  67.327  1.00 132.04 ? 352 PRO A CD    1 
ATOM   2720 N N     . VAL D 2 266 ? -12.985 49.068  68.039  1.00 140.73 ? 353 VAL A N     1 
ATOM   2721 C CA    . VAL D 2 266 ? -12.363 48.061  68.901  1.00 139.39 ? 353 VAL A CA    1 
ATOM   2722 C C     . VAL D 2 266 ? -10.969 48.534  69.333  1.00 140.73 ? 353 VAL A C     1 
ATOM   2723 O O     . VAL D 2 266 ? -10.154 48.947  68.504  1.00 140.73 ? 353 VAL A O     1 
ATOM   2724 C CB    . VAL D 2 266 ? -12.245 46.683  68.188  1.00 129.61 ? 353 VAL A CB    1 
ATOM   2725 C CG1   . VAL D 2 266 ? -11.277 46.764  67.012  1.00 68.56  ? 353 VAL A CG1   1 
ATOM   2726 C CG2   . VAL D 2 266 ? -11.796 45.628  69.184  1.00 92.37  ? 353 VAL A CG2   1 
ATOM   2727 N N     . THR D 2 267 ? -10.705 48.468  70.636  1.00 137.07 ? 354 THR A N     1 
ATOM   2728 C CA    . THR D 2 267 ? -9.429  48.910  71.194  1.00 122.86 ? 354 THR A CA    1 
ATOM   2729 C C     . THR D 2 267 ? -8.301  47.899  70.984  1.00 121.54 ? 354 THR A C     1 
ATOM   2730 O O     . THR D 2 267 ? -8.535  46.694  70.899  1.00 116.72 ? 354 THR A O     1 
ATOM   2731 C CB    . THR D 2 267 ? -9.568  49.211  72.710  1.00 126.82 ? 354 THR A CB    1 
ATOM   2732 O OG1   . THR D 2 267 ? -8.477  50.031  73.142  1.00 105.88 ? 354 THR A OG1   1 
ATOM   2733 C CG2   . THR D 2 267 ? -9.564  47.921  73.517  1.00 105.84 ? 354 THR A CG2   1 
ATOM   2734 N N     . VAL D 2 268 ? -7.078  48.412  70.899  1.00 110.16 ? 355 VAL A N     1 
ATOM   2735 C CA    . VAL D 2 268 ? -5.889  47.589  70.705  1.00 98.68  ? 355 VAL A CA    1 
ATOM   2736 C C     . VAL D 2 268 ? -4.715  48.183  71.480  1.00 96.30  ? 355 VAL A C     1 
ATOM   2737 O O     . VAL D 2 268 ? -4.682  49.385  71.771  1.00 80.66  ? 355 VAL A O     1 
ATOM   2738 C CB    . VAL D 2 268 ? -5.509  47.496  69.202  1.00 102.92 ? 355 VAL A CB    1 
ATOM   2739 C CG1   . VAL D 2 268 ? -5.368  48.889  68.614  1.00 112.31 ? 355 VAL A CG1   1 
ATOM   2740 C CG2   . VAL D 2 268 ? -4.209  46.727  69.032  1.00 92.95  ? 355 VAL A CG2   1 
ATOM   2741 N N     . ASN D 2 269 ? -3.754  47.330  71.817  1.00 120.46 ? 356 ASN A N     1 
ATOM   2742 C CA    . ASN D 2 269 ? -2.577  47.758  72.558  1.00 132.31 ? 356 ASN A CA    1 
ATOM   2743 C C     . ASN D 2 269 ? -1.377  47.943  71.634  1.00 125.61 ? 356 ASN A C     1 
ATOM   2744 O O     . ASN D 2 269 ? -1.180  47.179  70.686  1.00 113.96 ? 356 ASN A O     1 
ATOM   2745 C CB    . ASN D 2 269 ? -2.242  46.733  73.642  1.00 140.32 ? 356 ASN A CB    1 
ATOM   2746 C CG    . ASN D 2 269 ? -2.104  45.330  73.088  1.00 139.48 ? 356 ASN A CG    1 
ATOM   2747 O OD1   . ASN D 2 269 ? -1.330  45.089  72.161  1.00 135.55 ? 356 ASN A OD1   1 
ATOM   2748 N ND2   . ASN D 2 269 ? -2.855  44.392  73.658  1.00 128.69 ? 356 ASN A ND2   1 
ATOM   2749 N N     . VAL D 2 270 ? -0.581  48.969  71.925  1.00 107.78 ? 357 VAL A N     1 
ATOM   2750 C CA    . VAL D 2 270 ? 0.608   49.289  71.145  1.00 106.68 ? 357 VAL A CA    1 
ATOM   2751 C C     . VAL D 2 270 ? 1.839   49.328  72.049  1.00 114.23 ? 357 VAL A C     1 
ATOM   2752 O O     . VAL D 2 270 ? 1.787   49.853  73.161  1.00 114.04 ? 357 VAL A O     1 
ATOM   2753 C CB    . VAL D 2 270 ? 0.446   50.650  70.438  1.00 84.33  ? 357 VAL A CB    1 
ATOM   2754 C CG1   . VAL D 2 270 ? -0.013  51.702  71.428  1.00 84.74  ? 357 VAL A CG1   1 
ATOM   2755 C CG2   . VAL D 2 270 ? 1.755   51.063  69.800  1.00 101.13 ? 357 VAL A CG2   1 
ATOM   2756 N N     . PHE D 2 271 ? 2.944   48.774  71.563  1.00 125.81 ? 358 PHE A N     1 
ATOM   2757 C CA    . PHE D 2 271 ? 4.184   48.722  72.330  1.00 120.12 ? 358 PHE A CA    1 
ATOM   2758 C C     . PHE D 2 271 ? 5.391   48.565  71.404  1.00 107.06 ? 358 PHE A C     1 
ATOM   2759 O O     . PHE D 2 271 ? 5.239   48.398  70.193  1.00 110.88 ? 358 PHE A O     1 
ATOM   2760 C CB    . PHE D 2 271 ? 4.132   47.545  73.301  1.00 135.88 ? 358 PHE A CB    1 
ATOM   2761 C CG    . PHE D 2 271 ? 3.793   46.239  72.641  1.00 127.50 ? 358 PHE A CG    1 
ATOM   2762 C CD1   . PHE D 2 271 ? 2.521   46.016  72.124  1.00 117.12 ? 358 PHE A CD1   1 
ATOM   2763 C CD2   . PHE D 2 271 ? 4.754   45.245  72.506  1.00 136.09 ? 358 PHE A CD2   1 
ATOM   2764 C CE1   . PHE D 2 271 ? 2.211   44.824  71.480  1.00 94.22  ? 358 PHE A CE1   1 
ATOM   2765 C CE2   . PHE D 2 271 ? 4.455   44.049  71.864  1.00 136.47 ? 358 PHE A CE2   1 
ATOM   2766 C CZ    . PHE D 2 271 ? 3.179   43.838  71.349  1.00 120.61 ? 358 PHE A CZ    1 
ATOM   2767 N N     . LEU D 2 272 ? 6.588   48.608  71.981  1.00 71.54  ? 359 LEU A N     1 
ATOM   2768 C CA    . LEU D 2 272 ? 7.817   48.481  71.202  1.00 56.68  ? 359 LEU A CA    1 
ATOM   2769 C C     . LEU D 2 272 ? 8.438   47.087  71.266  1.00 60.30  ? 359 LEU A C     1 
ATOM   2770 O O     . LEU D 2 272 ? 8.468   46.446  72.317  1.00 95.34  ? 359 LEU A O     1 
ATOM   2771 C CB    . LEU D 2 272 ? 8.850   49.518  71.665  1.00 63.10  ? 359 LEU A CB    1 
ATOM   2772 C CG    . LEU D 2 272 ? 8.546   51.001  71.402  1.00 65.02  ? 359 LEU A CG    1 
ATOM   2773 C CD1   . LEU D 2 272 ? 7.251   51.365  72.070  1.00 74.29  ? 359 LEU A CD1   1 
ATOM   2774 C CD2   . LEU D 2 272 ? 9.664   51.887  71.926  1.00 74.14  ? 359 LEU A CD2   1 
ATOM   2775 N N     . GLN D 2 273 ? 8.937   46.631  70.122  1.00 77.93  ? 360 GLN A N     1 
ATOM   2776 C CA    . GLN D 2 273 ? 9.578   45.328  70.017  1.00 82.37  ? 360 GLN A CA    1 
ATOM   2777 C C     . GLN D 2 273 ? 10.935  45.468  69.344  1.00 88.81  ? 360 GLN A C     1 
ATOM   2778 O O     . GLN D 2 273 ? 11.027  45.831  68.172  1.00 107.33 ? 360 GLN A O     1 
ATOM   2779 C CB    . GLN D 2 273 ? 8.708   44.365  69.218  1.00 86.87  ? 360 GLN A CB    1 
ATOM   2780 C CG    . GLN D 2 273 ? 9.333   43.001  69.045  1.00 89.87  ? 360 GLN A CG    1 
ATOM   2781 C CD    . GLN D 2 273 ? 8.332   41.967  68.597  1.00 121.16 ? 360 GLN A CD    1 
ATOM   2782 O OE1   . GLN D 2 273 ? 7.347   41.702  69.290  1.00 101.00 ? 360 GLN A OE1   1 
ATOM   2783 N NE2   . GLN D 2 273 ? 8.573   41.371  67.432  1.00 78.55  ? 360 GLN A NE2   1 
ATOM   2784 N N     . ARG D 2 274 ? 11.988  45.172  70.097  1.00 76.99  ? 361 ARG A N     1 
ATOM   2785 C CA    . ARG D 2 274 ? 13.345  45.277  69.590  1.00 70.00  ? 361 ARG A CA    1 
ATOM   2786 C C     . ARG D 2 274 ? 13.634  44.256  68.497  1.00 69.53  ? 361 ARG A C     1 
ATOM   2787 O O     . ARG D 2 274 ? 13.614  43.049  68.737  1.00 53.44  ? 361 ARG A O     1 
ATOM   2788 C CB    . ARG D 2 274 ? 14.335  45.113  70.745  1.00 73.84  ? 361 ARG A CB    1 
ATOM   2789 C CG    . ARG D 2 274 ? 15.739  45.614  70.437  1.00 89.62  ? 361 ARG A CG    1 
ATOM   2790 C CD    . ARG D 2 274 ? 16.290  46.402  71.613  1.00 99.21  ? 361 ARG A CD    1 
ATOM   2791 N NE    . ARG D 2 274 ? 16.236  45.630  72.850  1.00 88.28  ? 361 ARG A NE    1 
ATOM   2792 C CZ    . ARG D 2 274 ? 16.429  46.139  74.061  1.00 111.82 ? 361 ARG A CZ    1 
ATOM   2793 N NH1   . ARG D 2 274 ? 16.692  47.428  74.223  1.00 84.81  ? 361 ARG A NH1   1 
ATOM   2794 N NH2   . ARG D 2 274 ? 16.364  45.348  75.117  1.00 49.80  ? 361 ARG A NH2   1 
ATOM   2795 N N     . LEU D 2 275 ? 13.909  44.762  67.298  1.00 76.50  ? 362 LEU A N     1 
ATOM   2796 C CA    . LEU D 2 275 ? 14.208  43.936  66.131  1.00 98.54  ? 362 LEU A CA    1 
ATOM   2797 C C     . LEU D 2 275 ? 15.486  43.115  66.282  1.00 111.84 ? 362 LEU A C     1 
ATOM   2798 O O     . LEU D 2 275 ? 16.092  42.730  65.279  1.00 118.82 ? 362 LEU A O     1 
ATOM   2799 C CB    . LEU D 2 275 ? 14.343  44.824  64.892  1.00 103.95 ? 362 LEU A CB    1 
ATOM   2800 C CG    . LEU D 2 275 ? 13.090  45.524  64.362  1.00 117.39 ? 362 LEU A CG    1 
ATOM   2801 C CD1   . LEU D 2 275 ? 13.483  46.706  63.486  1.00 120.84 ? 362 LEU A CD1   1 
ATOM   2802 C CD2   . LEU D 2 275 ? 12.250  44.518  63.585  1.00 87.56  ? 362 LEU A CD2   1 
ATOM   2803 N N     . THR D 2 276 ? 15.899  42.843  67.518  1.00 111.64 ? 363 THR A N     1 
ATOM   2804 C CA    . THR D 2 276 ? 17.119  42.075  67.737  1.00 101.09 ? 363 THR A CA    1 
ATOM   2805 C C     . THR D 2 276 ? 16.980  40.916  68.728  1.00 93.61  ? 363 THR A C     1 
ATOM   2806 O O     . THR D 2 276 ? 17.446  39.802  68.457  1.00 76.22  ? 363 THR A O     1 
ATOM   2807 C CB    . THR D 2 276 ? 18.268  42.993  68.201  1.00 93.57  ? 363 THR A CB    1 
ATOM   2808 O OG1   . THR D 2 276 ? 19.504  42.275  68.131  1.00 95.18  ? 363 THR A OG1   1 
ATOM   2809 C CG2   . THR D 2 276 ? 18.049  43.453  69.629  1.00 117.04 ? 363 THR A CG2   1 
ATOM   2810 N N     . ASP D 2 277 ? 16.345  41.171  69.870  1.00 96.05  ? 364 ASP A N     1 
ATOM   2811 C CA    . ASP D 2 277 ? 16.171  40.129  70.876  1.00 98.27  ? 364 ASP A CA    1 
ATOM   2812 C C     . ASP D 2 277 ? 14.702  39.847  71.169  1.00 93.61  ? 364 ASP A C     1 
ATOM   2813 O O     . ASP D 2 277 ? 14.356  38.765  71.639  1.00 92.87  ? 364 ASP A O     1 
ATOM   2814 C CB    . ASP D 2 277 ? 16.895  40.511  72.172  1.00 116.44 ? 364 ASP A CB    1 
ATOM   2815 C CG    . ASP D 2 277 ? 16.178  41.596  72.946  1.00 137.07 ? 364 ASP A CG    1 
ATOM   2816 O OD1   . ASP D 2 277 ? 15.036  41.353  73.379  1.00 140.73 ? 364 ASP A OD1   1 
ATOM   2817 O OD2   . ASP D 2 277 ? 16.756  42.688  73.127  1.00 140.73 ? 364 ASP A OD2   1 
ATOM   2818 N N     . GLY D 2 278 ? 13.841  40.826  70.902  1.00 93.32  ? 365 GLY A N     1 
ATOM   2819 C CA    . GLY D 2 278 ? 12.422  40.634  71.136  1.00 77.88  ? 365 GLY A CA    1 
ATOM   2820 C C     . GLY D 2 278 ? 11.804  41.416  72.285  1.00 78.21  ? 365 GLY A C     1 
ATOM   2821 O O     . GLY D 2 278 ? 10.638  41.796  72.209  1.00 78.28  ? 365 GLY A O     1 
ATOM   2822 N N     . VAL D 2 279 ? 12.566  41.656  73.347  1.00 78.59  ? 366 VAL A N     1 
ATOM   2823 C CA    . VAL D 2 279 ? 12.052  42.389  74.505  1.00 89.28  ? 366 VAL A CA    1 
ATOM   2824 C C     . VAL D 2 279 ? 11.022  43.464  74.149  1.00 94.87  ? 366 VAL A C     1 
ATOM   2825 O O     . VAL D 2 279 ? 11.328  44.428  73.446  1.00 91.56  ? 366 VAL A O     1 
ATOM   2826 C CB    . VAL D 2 279 ? 13.195  43.054  75.316  1.00 66.88  ? 366 VAL A CB    1 
ATOM   2827 C CG1   . VAL D 2 279 ? 13.971  42.001  76.079  1.00 88.72  ? 366 VAL A CG1   1 
ATOM   2828 C CG2   . VAL D 2 279 ? 14.115  43.816  74.390  1.00 75.73  ? 366 VAL A CG2   1 
ATOM   2829 N N     . CYS D 2 280 ? 9.797   43.280  74.636  1.00 92.17  ? 367 CYS A N     1 
ATOM   2830 C CA    . CYS D 2 280 ? 8.715   44.223  74.382  1.00 84.95  ? 367 CYS A CA    1 
ATOM   2831 C C     . CYS D 2 280 ? 8.645   45.196  75.540  1.00 77.68  ? 367 CYS A C     1 
ATOM   2832 O O     . CYS D 2 280 ? 9.451   45.121  76.468  1.00 95.15  ? 367 CYS A O     1 
ATOM   2833 C CB    . CYS D 2 280 ? 7.381   43.489  74.256  1.00 88.38  ? 367 CYS A CB    1 
ATOM   2834 S SG    . CYS D 2 280 ? 7.353   42.205  72.991  1.00 84.62  ? 367 CYS A SG    1 
ATOM   2835 N N     . SER D 2 281 ? 7.676   46.104  75.489  1.00 77.77  ? 368 SER A N     1 
ATOM   2836 C CA    . SER D 2 281 ? 7.518   47.097  76.545  1.00 90.43  ? 368 SER A CA    1 
ATOM   2837 C C     . SER D 2 281 ? 6.068   47.235  76.986  1.00 95.37  ? 368 SER A C     1 
ATOM   2838 O O     . SER D 2 281 ? 5.165   46.630  76.399  1.00 75.20  ? 368 SER A O     1 
ATOM   2839 C CB    . SER D 2 281 ? 8.043   48.463  76.078  1.00 80.97  ? 368 SER A CB    1 
ATOM   2840 O OG    . SER D 2 281 ? 7.296   48.956  74.979  1.00 129.21 ? 368 SER A OG    1 
ATOM   2841 N N     . GLU D 2 282 ? 5.861   48.034  78.030  1.00 110.48 ? 369 GLU A N     1 
ATOM   2842 C CA    . GLU D 2 282 ? 4.532   48.279  78.570  1.00 127.77 ? 369 GLU A CA    1 
ATOM   2843 C C     . GLU D 2 282 ? 3.682   48.828  77.434  1.00 123.94 ? 369 GLU A C     1 
ATOM   2844 O O     . GLU D 2 282 ? 3.958   49.909  76.913  1.00 140.66 ? 369 GLU A O     1 
ATOM   2845 C CB    . GLU D 2 282 ? 4.614   49.302  79.706  1.00 140.73 ? 369 GLU A CB    1 
ATOM   2846 C CG    . GLU D 2 282 ? 3.421   49.291  80.653  1.00 140.73 ? 369 GLU A CG    1 
ATOM   2847 C CD    . GLU D 2 282 ? 3.364   48.034  81.516  1.00 140.73 ? 369 GLU A CD    1 
ATOM   2848 O OE1   . GLU D 2 282 ? 2.404   47.898  82.308  1.00 114.28 ? 369 GLU A OE1   1 
ATOM   2849 O OE2   . GLU D 2 282 ? 4.278   47.184  81.405  1.00 129.83 ? 369 GLU A OE2   1 
ATOM   2850 N N     . PRO D 2 283 ? 2.638   48.087  77.028  1.00 109.47 ? 370 PRO A N     1 
ATOM   2851 C CA    . PRO D 2 283 ? 1.761   48.524  75.940  1.00 94.12  ? 370 PRO A CA    1 
ATOM   2852 C C     . PRO D 2 283 ? 0.871   49.705  76.319  1.00 93.10  ? 370 PRO A C     1 
ATOM   2853 O O     . PRO D 2 283 ? 0.491   49.861  77.485  1.00 95.37  ? 370 PRO A O     1 
ATOM   2854 C CB    . PRO D 2 283 ? 0.958   47.267  75.634  1.00 56.84  ? 370 PRO A CB    1 
ATOM   2855 C CG    . PRO D 2 283 ? 0.773   46.687  76.989  1.00 74.67  ? 370 PRO A CG    1 
ATOM   2856 C CD    . PRO D 2 283 ? 2.161   46.812  77.595  1.00 91.73  ? 370 PRO A CD    1 
ATOM   2857 N N     . LEU D 2 284 ? 0.557   50.537  75.327  1.00 77.95  ? 371 LEU A N     1 
ATOM   2858 C CA    . LEU D 2 284 ? -0.300  51.702  75.525  1.00 76.29  ? 371 LEU A CA    1 
ATOM   2859 C C     . LEU D 2 284 ? -1.649  51.507  74.837  1.00 75.35  ? 371 LEU A C     1 
ATOM   2860 O O     . LEU D 2 284 ? -1.773  50.742  73.876  1.00 75.13  ? 371 LEU A O     1 
ATOM   2861 C CB    . LEU D 2 284 ? 0.371   52.978  74.991  1.00 73.80  ? 371 LEU A CB    1 
ATOM   2862 C CG    . LEU D 2 284 ? 1.252   53.805  75.940  1.00 73.65  ? 371 LEU A CG    1 
ATOM   2863 C CD1   . LEU D 2 284 ? 0.398   54.586  76.954  1.00 52.22  ? 371 LEU A CD1   1 
ATOM   2864 C CD2   . LEU D 2 284 ? 2.221   52.875  76.642  1.00 78.82  ? 371 LEU A CD2   1 
ATOM   2865 N N     . PRO D 2 285 ? -2.686  52.189  75.341  1.00 83.50  ? 372 PRO A N     1 
ATOM   2866 C CA    . PRO D 2 285 ? -4.051  52.125  74.814  1.00 88.39  ? 372 PRO A CA    1 
ATOM   2867 C C     . PRO D 2 285 ? -4.264  52.900  73.515  1.00 102.97 ? 372 PRO A C     1 
ATOM   2868 O O     . PRO D 2 285 ? -3.968  54.097  73.437  1.00 96.31  ? 372 PRO A O     1 
ATOM   2869 C CB    . PRO D 2 285 ? -4.888  52.701  75.958  1.00 118.31 ? 372 PRO A CB    1 
ATOM   2870 C CG    . PRO D 2 285 ? -4.031  52.458  77.185  1.00 96.75  ? 372 PRO A CG    1 
ATOM   2871 C CD    . PRO D 2 285 ? -2.675  52.818  76.673  1.00 78.14  ? 372 PRO A CD    1 
ATOM   2872 N N     . PHE D 2 286 ? -4.780  52.210  72.499  1.00 99.45  ? 373 PHE A N     1 
ATOM   2873 C CA    . PHE D 2 286 ? -5.072  52.832  71.210  1.00 99.12  ? 373 PHE A CA    1 
ATOM   2874 C C     . PHE D 2 286 ? -6.414  52.302  70.732  1.00 105.67 ? 373 PHE A C     1 
ATOM   2875 O O     . PHE D 2 286 ? -6.853  51.240  71.171  1.00 120.27 ? 373 PHE A O     1 
ATOM   2876 C CB    . PHE D 2 286 ? -4.003  52.493  70.172  1.00 86.42  ? 373 PHE A CB    1 
ATOM   2877 C CG    . PHE D 2 286 ? -4.089  53.328  68.917  1.00 82.74  ? 373 PHE A CG    1 
ATOM   2878 C CD1   . PHE D 2 286 ? -3.544  52.870  67.722  1.00 102.22 ? 373 PHE A CD1   1 
ATOM   2879 C CD2   . PHE D 2 286 ? -4.694  54.586  68.935  1.00 86.37  ? 373 PHE A CD2   1 
ATOM   2880 C CE1   . PHE D 2 286 ? -3.603  53.650  66.560  1.00 114.70 ? 373 PHE A CE1   1 
ATOM   2881 C CE2   . PHE D 2 286 ? -4.756  55.372  67.782  1.00 62.20  ? 373 PHE A CE2   1 
ATOM   2882 C CZ    . PHE D 2 286 ? -4.209  54.905  66.594  1.00 94.86  ? 373 PHE A CZ    1 
ATOM   2883 N N     . THR D 2 287 ? -7.065  53.028  69.831  1.00 104.59 ? 374 THR A N     1 
ATOM   2884 C CA    . THR D 2 287 ? -8.363  52.594  69.333  1.00 117.20 ? 374 THR A CA    1 
ATOM   2885 C C     . THR D 2 287 ? -8.590  52.858  67.846  1.00 113.29 ? 374 THR A C     1 
ATOM   2886 O O     . THR D 2 287 ? -8.261  53.929  67.334  1.00 93.15  ? 374 THR A O     1 
ATOM   2887 C CB    . THR D 2 287 ? -9.501  53.268  70.121  1.00 135.27 ? 374 THR A CB    1 
ATOM   2888 O OG1   . THR D 2 287 ? -9.403  54.690  69.971  1.00 140.73 ? 374 THR A OG1   1 
ATOM   2889 C CG2   . THR D 2 287 ? -9.413  52.911  71.603  1.00 140.73 ? 374 THR A CG2   1 
ATOM   2890 N N     . TYR D 2 288 ? -9.161  51.866  67.167  1.00 126.41 ? 375 TYR A N     1 
ATOM   2891 C CA    . TYR D 2 288 ? -9.465  51.955  65.740  1.00 135.54 ? 375 TYR A CA    1 
ATOM   2892 C C     . TYR D 2 288 ? -10.931 52.313  65.514  1.00 140.73 ? 375 TYR A C     1 
ATOM   2893 O O     . TYR D 2 288 ? -11.800 51.918  66.292  1.00 140.73 ? 375 TYR A O     1 
ATOM   2894 C CB    . TYR D 2 288 ? -9.166  50.623  65.050  1.00 106.25 ? 375 TYR A CB    1 
ATOM   2895 C CG    . TYR D 2 288 ? -7.709  50.416  64.723  1.00 123.35 ? 375 TYR A CG    1 
ATOM   2896 C CD1   . TYR D 2 288 ? -6.727  50.564  65.700  1.00 116.70 ? 375 TYR A CD1   1 
ATOM   2897 C CD2   . TYR D 2 288 ? -7.311  50.071  63.431  1.00 134.32 ? 375 TYR A CD2   1 
ATOM   2898 C CE1   . TYR D 2 288 ? -5.382  50.376  65.398  1.00 137.58 ? 375 TYR A CE1   1 
ATOM   2899 C CE2   . TYR D 2 288 ? -5.970  49.879  63.120  1.00 135.06 ? 375 TYR A CE2   1 
ATOM   2900 C CZ    . TYR D 2 288 ? -5.011  50.033  64.107  1.00 125.09 ? 375 TYR A CZ    1 
ATOM   2901 O OH    . TYR D 2 288 ? -3.684  49.846  63.804  1.00 140.73 ? 375 TYR A OH    1 
ATOM   2902 N N     . LEU D 2 289 ? -11.199 53.054  64.442  1.00 137.16 ? 376 LEU A N     1 
ATOM   2903 C CA    . LEU D 2 289 ? -12.562 53.462  64.114  1.00 125.79 ? 376 LEU A CA    1 
ATOM   2904 C C     . LEU D 2 289 ? -13.024 52.758  62.835  1.00 125.52 ? 376 LEU A C     1 
ATOM   2905 O O     . LEU D 2 289 ? -12.235 52.558  61.911  1.00 99.37  ? 376 LEU A O     1 
ATOM   2906 C CB    . LEU D 2 289 ? -12.624 54.983  63.927  1.00 91.00  ? 376 LEU A CB    1 
ATOM   2907 C CG    . LEU D 2 289 ? -12.101 55.859  65.074  1.00 126.56 ? 376 LEU A CG    1 
ATOM   2908 C CD1   . LEU D 2 289 ? -12.012 57.312  64.625  1.00 89.55  ? 376 LEU A CD1   1 
ATOM   2909 C CD2   . LEU D 2 289 ? -13.010 55.722  66.282  1.00 124.88 ? 376 LEU A CD2   1 
ATOM   2910 N N     . PRO D 2 290 ? -14.312 52.369  62.773  1.00 135.97 ? 377 PRO A N     1 
ATOM   2911 C CA    . PRO D 2 290 ? -14.883 51.686  61.608  1.00 138.31 ? 377 PRO A CA    1 
ATOM   2912 C C     . PRO D 2 290 ? -15.022 52.646  60.433  1.00 140.73 ? 377 PRO A C     1 
ATOM   2913 O O     . PRO D 2 290 ? -16.090 53.214  60.203  1.00 139.32 ? 377 PRO A O     1 
ATOM   2914 C CB    . PRO D 2 290 ? -16.233 51.209  62.126  1.00 126.56 ? 377 PRO A CB    1 
ATOM   2915 C CG    . PRO D 2 290 ? -16.630 52.324  63.038  1.00 131.68 ? 377 PRO A CG    1 
ATOM   2916 C CD    . PRO D 2 290 ? -15.345 52.589  63.801  1.00 140.71 ? 377 PRO A CD    1 
ATOM   2917 N N     . ARG D 2 291 ? -13.931 52.822  59.695  1.00 140.73 ? 378 ARG A N     1 
ATOM   2918 C CA    . ARG D 2 291 ? -13.912 53.721  58.551  1.00 132.62 ? 378 ARG A CA    1 
ATOM   2919 C C     . ARG D 2 291 ? -14.518 55.064  58.951  1.00 133.22 ? 378 ARG A C     1 
ATOM   2920 O O     . ARG D 2 291 ? -14.530 55.417  60.130  1.00 122.65 ? 378 ARG A O     1 
ATOM   2921 C CB    . ARG D 2 291 ? -14.694 53.113  57.386  1.00 90.93  ? 378 ARG A CB    1 
ATOM   2922 C CG    . ARG D 2 291 ? -14.482 53.831  56.064  1.00 103.02 ? 378 ARG A CG    1 
ATOM   2923 C CD    . ARG D 2 291 ? -13.057 53.655  55.565  1.00 110.87 ? 378 ARG A CD    1 
ATOM   2924 N NE    . ARG D 2 291 ? -12.802 52.289  55.113  1.00 127.15 ? 378 ARG A NE    1 
ATOM   2925 C CZ    . ARG D 2 291 ? -13.390 51.729  54.061  1.00 119.37 ? 378 ARG A CZ    1 
ATOM   2926 N NH1   . ARG D 2 291 ? -13.098 50.483  53.724  1.00 101.45 ? 378 ARG A NH1   1 
ATOM   2927 N NH2   . ARG D 2 291 ? -14.268 52.413  53.343  1.00 108.42 ? 378 ARG A NH2   1 
ATOM   2928 N N     . ASP D 2 292 ? -15.030 55.802  57.970  1.00 137.10 ? 379 ASP A N     1 
ATOM   2929 C CA    . ASP D 2 292 ? -15.625 57.112  58.212  1.00 139.45 ? 379 ASP A CA    1 
ATOM   2930 C C     . ASP D 2 292 ? -16.835 57.055  59.144  1.00 138.83 ? 379 ASP A C     1 
ATOM   2931 O O     . ASP D 2 292 ? -17.179 56.001  59.686  1.00 121.67 ? 379 ASP A O     1 
ATOM   2932 C CB    . ASP D 2 292 ? -16.020 57.761  56.879  1.00 140.73 ? 379 ASP A CB    1 
ATOM   2933 C CG    . ASP D 2 292 ? -16.424 59.217  57.031  1.00 140.73 ? 379 ASP A CG    1 
ATOM   2934 O OD1   . ASP D 2 292 ? -15.611 60.014  57.547  1.00 136.15 ? 379 ASP A OD1   1 
ATOM   2935 O OD2   . ASP D 2 292 ? -17.555 59.566  56.630  1.00 140.22 ? 379 ASP A OD2   1 
ATOM   2936 N N     . HIS D 2 293 ? -17.474 58.208  59.321  1.00 140.73 ? 380 HIS A N     1 
ATOM   2937 C CA    . HIS D 2 293 ? -18.636 58.339  60.188  1.00 140.73 ? 380 HIS A CA    1 
ATOM   2938 C C     . HIS D 2 293 ? -19.643 59.314  59.582  1.00 140.73 ? 380 HIS A C     1 
ATOM   2939 O O     . HIS D 2 293 ? -20.285 60.076  60.307  1.00 140.73 ? 380 HIS A O     1 
ATOM   2940 C CB    . HIS D 2 293 ? -18.197 58.864  61.555  1.00 122.10 ? 380 HIS A CB    1 
ATOM   2941 C CG    . HIS D 2 293 ? -17.526 60.202  61.493  1.00 129.08 ? 380 HIS A CG    1 
ATOM   2942 N ND1   . HIS D 2 293 ? -18.143 61.319  60.973  1.00 131.73 ? 380 HIS A ND1   1 
ATOM   2943 C CD2   . HIS D 2 293 ? -16.289 60.598  61.871  1.00 138.42 ? 380 HIS A CD2   1 
ATOM   2944 C CE1   . HIS D 2 293 ? -17.315 62.346  61.034  1.00 135.08 ? 380 HIS A CE1   1 
ATOM   2945 N NE2   . HIS D 2 293 ? -16.183 61.935  61.575  1.00 139.74 ? 380 HIS A NE2   1 
ATOM   2946 N N     . ASP D 2 294 ? -19.779 59.297  58.258  1.00 135.00 ? 381 ASP A N     1 
ATOM   2947 C CA    . ASP D 2 294 ? -20.712 60.200  57.593  1.00 137.02 ? 381 ASP A CA    1 
ATOM   2948 C C     . ASP D 2 294 ? -22.049 60.246  58.329  1.00 140.73 ? 381 ASP A C     1 
ATOM   2949 O O     . ASP D 2 294 ? -22.709 59.220  58.506  1.00 140.73 ? 381 ASP A O     1 
ATOM   2950 C CB    . ASP D 2 294 ? -20.927 59.780  56.132  1.00 127.70 ? 381 ASP A CB    1 
ATOM   2951 C CG    . ASP D 2 294 ? -21.334 58.326  55.989  1.00 140.73 ? 381 ASP A CG    1 
ATOM   2952 O OD1   . ASP D 2 294 ? -21.722 57.926  54.870  1.00 120.51 ? 381 ASP A OD1   1 
ATOM   2953 O OD2   . ASP D 2 294 ? -21.258 57.584  56.992  1.00 140.73 ? 381 ASP A OD2   1 
ATOM   2954 N N     . SER D 2 295 ? -22.434 61.445  58.762  1.00 140.73 ? 382 SER A N     1 
ATOM   2955 C CA    . SER D 2 295 ? -23.683 61.650  59.491  1.00 140.73 ? 382 SER A CA    1 
ATOM   2956 C C     . SER D 2 295 ? -23.823 63.106  59.933  1.00 140.73 ? 382 SER A C     1 
ATOM   2957 O O     . SER D 2 295 ? -23.050 63.970  59.511  1.00 140.73 ? 382 SER A O     1 
ATOM   2958 C CB    . SER D 2 295 ? -23.729 60.734  60.718  1.00 140.73 ? 382 SER A CB    1 
ATOM   2959 O OG    . SER D 2 295 ? -22.569 60.892  61.517  1.00 132.17 ? 382 SER A OG    1 
ATOM   2960 N N     . TYR D 2 296 ? -24.815 63.374  60.779  1.00 138.16 ? 383 TYR A N     1 
ATOM   2961 C CA    . TYR D 2 296 ? -25.050 64.722  61.290  1.00 131.47 ? 383 TYR A CA    1 
ATOM   2962 C C     . TYR D 2 296 ? -23.979 65.106  62.308  1.00 118.87 ? 383 TYR A C     1 
ATOM   2963 O O     . TYR D 2 296 ? -23.920 64.437  63.363  1.00 127.46 ? 383 TYR A O     1 
ATOM   2964 C CB    . TYR D 2 296 ? -26.433 64.815  61.946  1.00 121.77 ? 383 TYR A CB    1 
ATOM   2965 C CG    . TYR D 2 296 ? -27.586 65.050  60.988  1.00 137.95 ? 383 TYR A CG    1 
ATOM   2966 C CD1   . TYR D 2 296 ? -27.597 66.155  60.135  1.00 140.31 ? 383 TYR A CD1   1 
ATOM   2967 C CD2   . TYR D 2 296 ? -28.689 64.193  60.966  1.00 128.99 ? 383 TYR A CD2   1 
ATOM   2968 C CE1   . TYR D 2 296 ? -28.679 66.407  59.286  1.00 135.41 ? 383 TYR A CE1   1 
ATOM   2969 C CE2   . TYR D 2 296 ? -29.778 64.435  60.121  1.00 135.61 ? 383 TYR A CE2   1 
ATOM   2970 C CZ    . TYR D 2 296 ? -29.765 65.546  59.285  1.00 136.11 ? 383 TYR A CZ    1 
ATOM   2971 O OH    . TYR D 2 296 ? -30.838 65.802  58.455  1.00 110.99 ? 383 TYR A OH    1 
ATOM   2972 N N     . GLY E 3 1   ? 46.366  103.061 55.564  1.00 84.79  ? 37  GLY B N     1 
ATOM   2973 C CA    . GLY E 3 1   ? 47.634  102.515 56.136  1.00 108.36 ? 37  GLY B CA    1 
ATOM   2974 C C     . GLY E 3 1   ? 47.455  101.149 56.775  1.00 102.70 ? 37  GLY B C     1 
ATOM   2975 O O     . GLY E 3 1   ? 46.886  100.248 56.152  1.00 93.64  ? 37  GLY B O     1 
ATOM   2976 N N     . PRO E 3 2   ? 47.948  100.956 58.014  1.00 117.89 ? 38  PRO B N     1 
ATOM   2977 C CA    . PRO E 3 2   ? 47.829  99.677  58.728  1.00 122.95 ? 38  PRO B CA    1 
ATOM   2978 C C     . PRO E 3 2   ? 46.367  99.330  59.017  1.00 129.17 ? 38  PRO B C     1 
ATOM   2979 O O     . PRO E 3 2   ? 45.968  99.176  60.175  1.00 127.05 ? 38  PRO B O     1 
ATOM   2980 C CB    . PRO E 3 2   ? 48.624  99.924  60.014  1.00 112.51 ? 38  PRO B CB    1 
ATOM   2981 C CG    . PRO E 3 2   ? 49.643  100.930 59.597  1.00 84.12  ? 38  PRO B CG    1 
ATOM   2982 C CD    . PRO E 3 2   ? 48.820  101.882 58.760  1.00 77.49  ? 38  PRO B CD    1 
ATOM   2983 N N     . TYR E 3 3   ? 45.574  99.202  57.958  1.00 104.53 ? 39  TYR B N     1 
ATOM   2984 C CA    . TYR E 3 3   ? 44.158  98.896  58.094  1.00 116.17 ? 39  TYR B CA    1 
ATOM   2985 C C     . TYR E 3 3   ? 43.833  97.474  57.647  1.00 119.04 ? 39  TYR B C     1 
ATOM   2986 O O     . TYR E 3 3   ? 44.281  97.026  56.590  1.00 122.90 ? 39  TYR B O     1 
ATOM   2987 C CB    . TYR E 3 3   ? 43.346  99.907  57.285  1.00 112.20 ? 39  TYR B CB    1 
ATOM   2988 C CG    . TYR E 3 3   ? 41.861  99.654  57.279  1.00 107.06 ? 39  TYR B CG    1 
ATOM   2989 C CD1   . TYR E 3 3   ? 41.141  99.585  58.469  1.00 131.04 ? 39  TYR B CD1   1 
ATOM   2990 C CD2   . TYR E 3 3   ? 41.171  99.501  56.080  1.00 94.95  ? 39  TYR B CD2   1 
ATOM   2991 C CE1   . TYR E 3 3   ? 39.762  99.370  58.464  1.00 140.73 ? 39  TYR B CE1   1 
ATOM   2992 C CE2   . TYR E 3 3   ? 39.797  99.287  56.060  1.00 130.74 ? 39  TYR B CE2   1 
ATOM   2993 C CZ    . TYR E 3 3   ? 39.096  99.223  57.253  1.00 137.85 ? 39  TYR B CZ    1 
ATOM   2994 O OH    . TYR E 3 3   ? 37.732  99.020  57.233  1.00 123.94 ? 39  TYR B OH    1 
ATOM   2995 N N     . LEU E 3 4   ? 43.048  96.774  58.464  1.00 120.27 ? 40  LEU B N     1 
ATOM   2996 C CA    . LEU E 3 4   ? 42.653  95.394  58.187  1.00 98.60  ? 40  LEU B CA    1 
ATOM   2997 C C     . LEU E 3 4   ? 41.146  95.241  58.366  1.00 82.05  ? 40  LEU B C     1 
ATOM   2998 O O     . LEU E 3 4   ? 40.550  95.897  59.218  1.00 93.86  ? 40  LEU B O     1 
ATOM   2999 C CB    . LEU E 3 4   ? 43.391  94.447  59.142  1.00 102.45 ? 40  LEU B CB    1 
ATOM   3000 C CG    . LEU E 3 4   ? 43.219  92.930  59.001  1.00 116.67 ? 40  LEU B CG    1 
ATOM   3001 C CD1   . LEU E 3 4   ? 44.221  92.218  59.905  1.00 110.33 ? 40  LEU B CD1   1 
ATOM   3002 C CD2   . LEU E 3 4   ? 41.802  92.526  59.360  1.00 66.99  ? 40  LEU B CD2   1 
ATOM   3003 N N     . VAL E 3 5   ? 40.533  94.367  57.575  1.00 61.74  ? 41  VAL B N     1 
ATOM   3004 C CA    . VAL E 3 5   ? 39.089  94.151  57.672  1.00 79.89  ? 41  VAL B CA    1 
ATOM   3005 C C     . VAL E 3 5   ? 38.618  92.729  57.352  1.00 84.87  ? 41  VAL B C     1 
ATOM   3006 O O     . VAL E 3 5   ? 38.849  92.210  56.261  1.00 114.36 ? 41  VAL B O     1 
ATOM   3007 C CB    . VAL E 3 5   ? 38.306  95.147  56.761  1.00 65.40  ? 41  VAL B CB    1 
ATOM   3008 C CG1   . VAL E 3 5   ? 38.927  95.188  55.372  1.00 104.52 ? 41  VAL B CG1   1 
ATOM   3009 C CG2   . VAL E 3 5   ? 36.839  94.734  56.668  1.00 61.04  ? 41  VAL B CG2   1 
ATOM   3010 N N     . ILE E 3 6   ? 37.948  92.111  58.316  1.00 73.72  ? 42  ILE B N     1 
ATOM   3011 C CA    . ILE E 3 6   ? 37.419  90.768  58.137  1.00 71.24  ? 42  ILE B CA    1 
ATOM   3012 C C     . ILE E 3 6   ? 36.210  90.857  57.209  1.00 72.90  ? 42  ILE B C     1 
ATOM   3013 O O     . ILE E 3 6   ? 35.134  91.279  57.626  1.00 64.20  ? 42  ILE B O     1 
ATOM   3014 C CB    . ILE E 3 6   ? 36.959  90.167  59.486  1.00 84.17  ? 42  ILE B CB    1 
ATOM   3015 C CG1   . ILE E 3 6   ? 38.125  90.147  60.477  1.00 86.29  ? 42  ILE B CG1   1 
ATOM   3016 C CG2   . ILE E 3 6   ? 36.411  88.758  59.275  1.00 61.67  ? 42  ILE B CG2   1 
ATOM   3017 C CD1   . ILE E 3 6   ? 37.769  89.568  61.843  1.00 83.36  ? 42  ILE B CD1   1 
ATOM   3018 N N     . VAL E 3 7   ? 36.388  90.466  55.952  1.00 104.87 ? 43  VAL B N     1 
ATOM   3019 C CA    . VAL E 3 7   ? 35.299  90.509  54.981  1.00 109.59 ? 43  VAL B CA    1 
ATOM   3020 C C     . VAL E 3 7   ? 34.173  89.559  55.380  1.00 111.63 ? 43  VAL B C     1 
ATOM   3021 O O     . VAL E 3 7   ? 33.087  89.999  55.746  1.00 121.46 ? 43  VAL B O     1 
ATOM   3022 C CB    . VAL E 3 7   ? 35.785  90.126  53.570  1.00 97.67  ? 43  VAL B CB    1 
ATOM   3023 C CG1   . VAL E 3 7   ? 34.639  90.246  52.579  1.00 78.05  ? 43  VAL B CG1   1 
ATOM   3024 C CG2   . VAL E 3 7   ? 36.946  91.016  53.163  1.00 66.78  ? 43  VAL B CG2   1 
ATOM   3025 N N     . GLU E 3 8   ? 34.427  88.257  55.291  1.00 96.19  ? 44  GLU B N     1 
ATOM   3026 C CA    . GLU E 3 8   ? 33.426  87.271  55.670  1.00 84.60  ? 44  GLU B CA    1 
ATOM   3027 C C     . GLU E 3 8   ? 33.706  86.873  57.099  1.00 91.80  ? 44  GLU B C     1 
ATOM   3028 O O     . GLU E 3 8   ? 34.858  86.699  57.487  1.00 110.19 ? 44  GLU B O     1 
ATOM   3029 C CB    . GLU E 3 8   ? 33.491  86.040  54.769  1.00 78.48  ? 44  GLU B CB    1 
ATOM   3030 C CG    . GLU E 3 8   ? 32.543  84.907  55.159  1.00 106.85 ? 44  GLU B CG    1 
ATOM   3031 C CD    . GLU E 3 8   ? 31.080  85.332  55.253  1.00 109.33 ? 44  GLU B CD    1 
ATOM   3032 O OE1   . GLU E 3 8   ? 30.196  84.469  55.041  1.00 100.54 ? 44  GLU B OE1   1 
ATOM   3033 O OE2   . GLU E 3 8   ? 30.811  86.517  55.553  1.00 87.10  ? 44  GLU B OE2   1 
ATOM   3034 N N     . GLN E 3 9   ? 32.647  86.732  57.884  1.00 93.40  ? 45  GLN B N     1 
ATOM   3035 C CA    . GLN E 3 9   ? 32.799  86.381  59.282  1.00 94.30  ? 45  GLN B CA    1 
ATOM   3036 C C     . GLN E 3 9   ? 32.575  84.887  59.513  1.00 87.98  ? 45  GLN B C     1 
ATOM   3037 O O     . GLN E 3 9   ? 31.801  84.246  58.794  1.00 73.38  ? 45  GLN B O     1 
ATOM   3038 C CB    . GLN E 3 9   ? 31.808  87.195  60.119  1.00 90.58  ? 45  GLN B CB    1 
ATOM   3039 C CG    . GLN E 3 9   ? 32.325  87.586  61.496  1.00 94.36  ? 45  GLN B CG    1 
ATOM   3040 C CD    . GLN E 3 9   ? 33.351  88.706  61.441  1.00 116.03 ? 45  GLN B CD    1 
ATOM   3041 O OE1   . GLN E 3 9   ? 33.942  89.076  62.459  1.00 100.49 ? 45  GLN B OE1   1 
ATOM   3042 N NE2   . GLN E 3 9   ? 33.559  89.257  60.247  1.00 85.38  ? 45  GLN B NE2   1 
ATOM   3043 N N     . PRO E 3 10  ? 33.269  84.306  60.509  1.00 79.83  ? 46  PRO B N     1 
ATOM   3044 C CA    . PRO E 3 10  ? 33.116  82.881  60.812  1.00 73.88  ? 46  PRO B CA    1 
ATOM   3045 C C     . PRO E 3 10  ? 31.754  82.572  61.416  1.00 70.70  ? 46  PRO B C     1 
ATOM   3046 O O     . PRO E 3 10  ? 31.233  83.348  62.220  1.00 77.66  ? 46  PRO B O     1 
ATOM   3047 C CB    . PRO E 3 10  ? 34.253  82.606  61.795  1.00 68.26  ? 46  PRO B CB    1 
ATOM   3048 C CG    . PRO E 3 10  ? 34.440  83.910  62.474  1.00 46.75  ? 46  PRO B CG    1 
ATOM   3049 C CD    . PRO E 3 10  ? 34.356  84.887  61.318  1.00 44.57  ? 46  PRO B CD    1 
ATOM   3050 N N     . LYS E 3 11  ? 31.180  81.441  61.018  1.00 78.35  ? 47  LYS B N     1 
ATOM   3051 C CA    . LYS E 3 11  ? 29.885  81.018  61.532  1.00 70.37  ? 47  LYS B CA    1 
ATOM   3052 C C     . LYS E 3 11  ? 30.005  81.089  63.051  1.00 72.93  ? 47  LYS B C     1 
ATOM   3053 O O     . LYS E 3 11  ? 30.949  80.553  63.628  1.00 78.54  ? 47  LYS B O     1 
ATOM   3054 C CB    . LYS E 3 11  ? 29.584  79.576  61.094  1.00 64.57  ? 47  LYS B CB    1 
ATOM   3055 C CG    . LYS E 3 11  ? 28.167  79.353  60.582  1.00 117.84 ? 47  LYS B CG    1 
ATOM   3056 C CD    . LYS E 3 11  ? 27.120  79.713  61.623  1.00 116.78 ? 47  LYS B CD    1 
ATOM   3057 C CE    . LYS E 3 11  ? 25.719  79.472  61.089  1.00 113.44 ? 47  LYS B CE    1 
ATOM   3058 N NZ    . LYS E 3 11  ? 24.663  79.752  62.101  1.00 97.89  ? 47  LYS B NZ    1 
ATOM   3059 N N     . GLN E 3 12  ? 29.058  81.761  63.693  1.00 75.39  ? 48  GLN B N     1 
ATOM   3060 C CA    . GLN E 3 12  ? 29.087  81.901  65.141  1.00 84.65  ? 48  GLN B CA    1 
ATOM   3061 C C     . GLN E 3 12  ? 28.747  80.603  65.862  1.00 84.43  ? 48  GLN B C     1 
ATOM   3062 O O     . GLN E 3 12  ? 29.382  80.249  66.852  1.00 78.03  ? 48  GLN B O     1 
ATOM   3063 C CB    . GLN E 3 12  ? 28.109  82.992  65.574  1.00 111.64 ? 48  GLN B CB    1 
ATOM   3064 C CG    . GLN E 3 12  ? 28.369  84.344  64.940  1.00 129.45 ? 48  GLN B CG    1 
ATOM   3065 C CD    . GLN E 3 12  ? 27.240  85.320  65.188  1.00 126.50 ? 48  GLN B CD    1 
ATOM   3066 O OE1   . GLN E 3 12  ? 26.902  85.620  66.334  1.00 101.79 ? 48  GLN B OE1   1 
ATOM   3067 N NE2   . GLN E 3 12  ? 26.643  85.819  64.112  1.00 78.20  ? 48  GLN B NE2   1 
ATOM   3068 N N     . ARG E 3 13  ? 27.741  79.891  65.371  1.00 67.86  ? 49  ARG B N     1 
ATOM   3069 C CA    . ARG E 3 13  ? 27.347  78.650  66.014  1.00 86.89  ? 49  ARG B CA    1 
ATOM   3070 C C     . ARG E 3 13  ? 27.055  77.572  64.987  1.00 89.17  ? 49  ARG B C     1 
ATOM   3071 O O     . ARG E 3 13  ? 26.310  77.799  64.034  1.00 111.30 ? 49  ARG B O     1 
ATOM   3072 C CB    . ARG E 3 13  ? 26.123  78.887  66.890  1.00 92.67  ? 49  ARG B CB    1 
ATOM   3073 N N     . GLY E 3 14  ? 27.644  76.398  65.188  1.00 90.40  ? 50  GLY B N     1 
ATOM   3074 C CA    . GLY E 3 14  ? 27.431  75.305  64.261  1.00 81.60  ? 50  GLY B CA    1 
ATOM   3075 C C     . GLY E 3 14  ? 28.682  74.483  64.029  1.00 70.88  ? 50  GLY B C     1 
ATOM   3076 O O     . GLY E 3 14  ? 28.599  73.306  63.686  1.00 37.20  ? 50  GLY B O     1 
ATOM   3077 N N     . PHE E 3 15  ? 29.848  75.088  64.212  1.00 67.07  ? 51  PHE B N     1 
ATOM   3078 C CA    . PHE E 3 15  ? 31.077  74.347  64.002  1.00 72.61  ? 51  PHE B CA    1 
ATOM   3079 C C     . PHE E 3 15  ? 31.397  73.529  65.242  1.00 64.02  ? 51  PHE B C     1 
ATOM   3080 O O     . PHE E 3 15  ? 31.558  74.094  66.323  1.00 71.34  ? 51  PHE B O     1 
ATOM   3081 C CB    . PHE E 3 15  ? 32.236  75.294  63.710  1.00 79.77  ? 51  PHE B CB    1 
ATOM   3082 C CG    . PHE E 3 15  ? 33.499  74.586  63.332  1.00 85.92  ? 51  PHE B CG    1 
ATOM   3083 C CD1   . PHE E 3 15  ? 34.724  74.994  63.845  1.00 57.14  ? 51  PHE B CD1   1 
ATOM   3084 C CD2   . PHE E 3 15  ? 33.459  73.485  62.480  1.00 74.50  ? 51  PHE B CD2   1 
ATOM   3085 C CE1   . PHE E 3 15  ? 35.889  74.314  63.520  1.00 89.32  ? 51  PHE B CE1   1 
ATOM   3086 C CE2   . PHE E 3 15  ? 34.619  72.799  62.149  1.00 91.40  ? 51  PHE B CE2   1 
ATOM   3087 C CZ    . PHE E 3 15  ? 35.836  73.212  62.670  1.00 99.08  ? 51  PHE B CZ    1 
ATOM   3088 N N     . ARG E 3 16  ? 31.494  72.207  65.088  1.00 38.64  ? 52  ARG B N     1 
ATOM   3089 C CA    . ARG E 3 16  ? 31.800  71.320  66.214  1.00 38.15  ? 52  ARG B CA    1 
ATOM   3090 C C     . ARG E 3 16  ? 33.284  71.153  66.534  1.00 36.91  ? 52  ARG B C     1 
ATOM   3091 O O     . ARG E 3 16  ? 34.006  70.488  65.789  1.00 62.83  ? 52  ARG B O     1 
ATOM   3092 C CB    . ARG E 3 16  ? 31.201  69.942  65.956  1.00 42.00  ? 52  ARG B CB    1 
ATOM   3093 C CG    . ARG E 3 16  ? 31.761  68.799  66.814  1.00 21.58  ? 52  ARG B CG    1 
ATOM   3094 C CD    . ARG E 3 16  ? 30.926  67.549  66.547  1.00 50.05  ? 52  ARG B CD    1 
ATOM   3095 N NE    . ARG E 3 16  ? 31.477  66.323  67.112  1.00 41.57  ? 52  ARG B NE    1 
ATOM   3096 C CZ    . ARG E 3 16  ? 30.907  65.124  66.989  1.00 78.52  ? 52  ARG B CZ    1 
ATOM   3097 N NH1   . ARG E 3 16  ? 31.477  64.057  67.531  1.00 42.30  ? 52  ARG B NH1   1 
ATOM   3098 N NH2   . ARG E 3 16  ? 29.763  64.985  66.327  1.00 39.23  ? 52  ARG B NH2   1 
ATOM   3099 N N     . PHE E 3 17  ? 33.742  71.749  67.633  1.00 49.50  ? 53  PHE B N     1 
ATOM   3100 C CA    . PHE E 3 17  ? 35.141  71.593  68.025  1.00 50.03  ? 53  PHE B CA    1 
ATOM   3101 C C     . PHE E 3 17  ? 35.402  70.095  68.003  1.00 55.94  ? 53  PHE B C     1 
ATOM   3102 O O     . PHE E 3 17  ? 34.495  69.292  68.248  1.00 38.37  ? 53  PHE B O     1 
ATOM   3103 C CB    . PHE E 3 17  ? 35.394  72.110  69.441  1.00 65.32  ? 53  PHE B CB    1 
ATOM   3104 C CG    . PHE E 3 17  ? 35.322  73.605  69.574  1.00 61.81  ? 53  PHE B CG    1 
ATOM   3105 C CD1   . PHE E 3 17  ? 35.959  74.244  70.637  1.00 80.35  ? 53  PHE B CD1   1 
ATOM   3106 C CD2   . PHE E 3 17  ? 34.634  74.376  68.646  1.00 35.77  ? 53  PHE B CD2   1 
ATOM   3107 C CE1   . PHE E 3 17  ? 35.913  75.625  70.773  1.00 79.18  ? 53  PHE B CE1   1 
ATOM   3108 C CE2   . PHE E 3 17  ? 34.580  75.768  68.773  1.00 36.98  ? 53  PHE B CE2   1 
ATOM   3109 C CZ    . PHE E 3 17  ? 35.223  76.390  69.836  1.00 95.38  ? 53  PHE B CZ    1 
ATOM   3110 N N     . ARG E 3 18  ? 36.634  69.708  67.708  1.00 64.57  ? 54  ARG B N     1 
ATOM   3111 C CA    . ARG E 3 18  ? 36.947  68.293  67.650  1.00 55.80  ? 54  ARG B CA    1 
ATOM   3112 C C     . ARG E 3 18  ? 38.067  67.956  68.610  1.00 60.73  ? 54  ARG B C     1 
ATOM   3113 O O     . ARG E 3 18  ? 39.001  68.736  68.800  1.00 69.87  ? 54  ARG B O     1 
ATOM   3114 C CB    . ARG E 3 18  ? 37.358  67.890  66.231  1.00 9.71   ? 54  ARG B CB    1 
ATOM   3115 C CG    . ARG E 3 18  ? 36.667  66.664  65.708  1.00 53.64  ? 54  ARG B CG    1 
ATOM   3116 C CD    . ARG E 3 18  ? 35.394  67.029  64.989  1.00 15.09  ? 54  ARG B CD    1 
ATOM   3117 N NE    . ARG E 3 18  ? 34.514  65.868  64.921  1.00 72.51  ? 54  ARG B NE    1 
ATOM   3118 C CZ    . ARG E 3 18  ? 33.478  65.750  64.099  1.00 43.35  ? 54  ARG B CZ    1 
ATOM   3119 N NH1   . ARG E 3 18  ? 32.739  64.647  64.133  1.00 28.48  ? 54  ARG B NH1   1 
ATOM   3120 N NH2   . ARG E 3 18  ? 33.191  66.716  63.230  1.00 43.89  ? 54  ARG B NH2   1 
ATOM   3121 N N     . TYR E 3 19  ? 37.956  66.782  69.213  1.00 34.35  ? 55  TYR B N     1 
ATOM   3122 C CA    . TYR E 3 19  ? 38.946  66.298  70.153  1.00 52.27  ? 55  TYR B CA    1 
ATOM   3123 C C     . TYR E 3 19  ? 40.106  65.708  69.368  1.00 63.01  ? 55  TYR B C     1 
ATOM   3124 O O     . TYR E 3 19  ? 39.954  65.341  68.206  1.00 98.36  ? 55  TYR B O     1 
ATOM   3125 C CB    . TYR E 3 19  ? 38.311  65.235  71.053  1.00 49.83  ? 55  TYR B CB    1 
ATOM   3126 C CG    . TYR E 3 19  ? 37.438  65.807  72.150  1.00 66.27  ? 55  TYR B CG    1 
ATOM   3127 C CD1   . TYR E 3 19  ? 38.004  66.345  73.310  1.00 58.72  ? 55  TYR B CD1   1 
ATOM   3128 C CD2   . TYR E 3 19  ? 36.050  65.850  72.014  1.00 54.40  ? 55  TYR B CD2   1 
ATOM   3129 C CE1   . TYR E 3 19  ? 37.210  66.912  74.305  1.00 85.70  ? 55  TYR B CE1   1 
ATOM   3130 C CE2   . TYR E 3 19  ? 35.247  66.419  73.001  1.00 70.17  ? 55  TYR B CE2   1 
ATOM   3131 C CZ    . TYR E 3 19  ? 35.835  66.948  74.142  1.00 66.56  ? 55  TYR B CZ    1 
ATOM   3132 O OH    . TYR E 3 19  ? 35.046  67.518  75.109  1.00 74.89  ? 55  TYR B OH    1 
ATOM   3133 N N     . GLY E 3 20  ? 41.266  65.621  70.003  1.00 68.17  ? 56  GLY B N     1 
ATOM   3134 C CA    . GLY E 3 20  ? 42.425  65.069  69.334  1.00 38.91  ? 56  GLY B CA    1 
ATOM   3135 C C     . GLY E 3 20  ? 42.241  63.624  68.901  1.00 45.31  ? 56  GLY B C     1 
ATOM   3136 O O     . GLY E 3 20  ? 42.740  63.210  67.852  1.00 75.45  ? 56  GLY B O     1 
ATOM   3137 N N     . CYS E 3 21  ? 41.527  62.847  69.708  1.00 25.83  ? 57  CYS B N     1 
ATOM   3138 C CA    . CYS E 3 21  ? 41.288  61.439  69.392  1.00 34.36  ? 57  CYS B CA    1 
ATOM   3139 C C     . CYS E 3 21  ? 40.296  61.325  68.246  1.00 58.32  ? 57  CYS B C     1 
ATOM   3140 O O     . CYS E 3 21  ? 39.885  60.226  67.878  1.00 57.74  ? 57  CYS B O     1 
ATOM   3141 C CB    . CYS E 3 21  ? 40.706  60.726  70.607  1.00 56.54  ? 57  CYS B CB    1 
ATOM   3142 S SG    . CYS E 3 21  ? 39.082  61.373  71.090  1.00 79.09  ? 57  CYS B SG    1 
ATOM   3143 N N     . GLU E 3 22  ? 39.904  62.462  67.688  1.00 59.98  ? 58  GLU B N     1 
ATOM   3144 C CA    . GLU E 3 22  ? 38.930  62.464  66.613  1.00 68.51  ? 58  GLU B CA    1 
ATOM   3145 C C     . GLU E 3 22  ? 39.518  62.676  65.242  1.00 52.97  ? 58  GLU B C     1 
ATOM   3146 O O     . GLU E 3 22  ? 38.970  62.189  64.258  1.00 70.04  ? 58  GLU B O     1 
ATOM   3147 C CB    . GLU E 3 22  ? 37.852  63.511  66.879  1.00 91.26  ? 58  GLU B CB    1 
ATOM   3148 C CG    . GLU E 3 22  ? 36.945  63.159  68.047  1.00 88.10  ? 58  GLU B CG    1 
ATOM   3149 C CD    . GLU E 3 22  ? 35.731  64.052  68.118  1.00 80.88  ? 58  GLU B CD    1 
ATOM   3150 O OE1   . GLU E 3 22  ? 35.888  65.255  68.417  1.00 52.45  ? 58  GLU B OE1   1 
ATOM   3151 O OE2   . GLU E 3 22  ? 34.621  63.545  67.862  1.00 50.24  ? 58  GLU B OE2   1 
ATOM   3152 N N     . GLY E 3 23  ? 40.626  63.399  65.170  1.00 50.67  ? 59  GLY B N     1 
ATOM   3153 C CA    . GLY E 3 23  ? 41.248  63.627  63.880  1.00 59.66  ? 59  GLY B CA    1 
ATOM   3154 C C     . GLY E 3 23  ? 41.440  65.092  63.556  1.00 70.61  ? 59  GLY B C     1 
ATOM   3155 O O     . GLY E 3 23  ? 40.763  65.952  64.131  1.00 81.85  ? 59  GLY B O     1 
ATOM   3156 N N     . PRO E 3 24  ? 42.365  65.412  62.635  1.00 79.57  ? 60  PRO B N     1 
ATOM   3157 C CA    . PRO E 3 24  ? 42.654  66.790  62.227  1.00 81.34  ? 60  PRO B CA    1 
ATOM   3158 C C     . PRO E 3 24  ? 41.921  67.258  60.972  1.00 82.84  ? 60  PRO B C     1 
ATOM   3159 O O     . PRO E 3 24  ? 42.060  68.420  60.574  1.00 60.07  ? 60  PRO B O     1 
ATOM   3160 C CB    . PRO E 3 24  ? 44.158  66.761  62.024  1.00 49.34  ? 60  PRO B CB    1 
ATOM   3161 C CG    . PRO E 3 24  ? 44.334  65.428  61.376  1.00 81.60  ? 60  PRO B CG    1 
ATOM   3162 C CD    . PRO E 3 24  ? 43.441  64.507  62.187  1.00 36.77  ? 60  PRO B CD    1 
ATOM   3163 N N     . SER E 3 25  ? 41.137  66.375  60.357  1.00 74.90  ? 61  SER B N     1 
ATOM   3164 C CA    . SER E 3 25  ? 40.423  66.739  59.137  1.00 83.33  ? 61  SER B CA    1 
ATOM   3165 C C     . SER E 3 25  ? 38.912  66.490  59.093  1.00 77.05  ? 61  SER B C     1 
ATOM   3166 O O     . SER E 3 25  ? 38.420  65.831  58.179  1.00 58.63  ? 61  SER B O     1 
ATOM   3167 C CB    . SER E 3 25  ? 41.077  66.037  57.954  1.00 95.39  ? 61  SER B CB    1 
ATOM   3168 O OG    . SER E 3 25  ? 41.233  64.658  58.232  1.00 87.44  ? 61  SER B OG    1 
ATOM   3169 N N     . HIS E 3 26  ? 38.167  67.014  60.060  1.00 80.63  ? 62  HIS B N     1 
ATOM   3170 C CA    . HIS E 3 26  ? 36.720  66.832  60.050  1.00 69.61  ? 62  HIS B CA    1 
ATOM   3171 C C     . HIS E 3 26  ? 36.070  68.032  59.373  1.00 74.66  ? 62  HIS B C     1 
ATOM   3172 O O     . HIS E 3 26  ? 34.841  68.162  59.334  1.00 64.33  ? 62  HIS B O     1 
ATOM   3173 C CB    . HIS E 3 26  ? 36.188  66.659  61.473  1.00 72.02  ? 62  HIS B CB    1 
ATOM   3174 C CG    . HIS E 3 26  ? 36.360  65.273  62.008  1.00 55.95  ? 62  HIS B CG    1 
ATOM   3175 N ND1   . HIS E 3 26  ? 35.537  64.230  61.644  1.00 62.06  ? 62  HIS B ND1   1 
ATOM   3176 C CD2   . HIS E 3 26  ? 37.303  64.741  62.821  1.00 62.55  ? 62  HIS B CD2   1 
ATOM   3177 C CE1   . HIS E 3 26  ? 35.967  63.114  62.205  1.00 71.00  ? 62  HIS B CE1   1 
ATOM   3178 N NE2   . HIS E 3 26  ? 37.038  63.396  62.924  1.00 80.00  ? 62  HIS B NE2   1 
ATOM   3179 N N     . GLY E 3 27  ? 36.908  68.905  58.827  1.00 68.88  ? 63  GLY B N     1 
ATOM   3180 C CA    . GLY E 3 27  ? 36.394  70.075  58.146  1.00 69.25  ? 63  GLY B CA    1 
ATOM   3181 C C     . GLY E 3 27  ? 37.090  71.368  58.514  1.00 63.36  ? 63  GLY B C     1 
ATOM   3182 O O     . GLY E 3 27  ? 38.056  71.390  59.273  1.00 86.58  ? 63  GLY B O     1 
ATOM   3183 N N     . GLY E 3 28  ? 36.580  72.457  57.958  1.00 41.72  ? 64  GLY B N     1 
ATOM   3184 C CA    . GLY E 3 28  ? 37.141  73.762  58.221  1.00 54.91  ? 64  GLY B CA    1 
ATOM   3185 C C     . GLY E 3 28  ? 36.064  74.753  58.600  1.00 59.01  ? 64  GLY B C     1 
ATOM   3186 O O     . GLY E 3 28  ? 34.991  74.814  57.996  1.00 54.77  ? 64  GLY B O     1 
ATOM   3187 N N     . LEU E 3 29  ? 36.364  75.536  59.621  1.00 61.26  ? 65  LEU B N     1 
ATOM   3188 C CA    . LEU E 3 29  ? 35.457  76.549  60.131  1.00 70.57  ? 65  LEU B CA    1 
ATOM   3189 C C     . LEU E 3 29  ? 34.793  77.322  58.991  1.00 72.69  ? 65  LEU B C     1 
ATOM   3190 O O     . LEU E 3 29  ? 35.447  78.095  58.295  1.00 100.75 ? 65  LEU B O     1 
ATOM   3191 C CB    . LEU E 3 29  ? 36.245  77.493  61.038  1.00 40.82  ? 65  LEU B CB    1 
ATOM   3192 C CG    . LEU E 3 29  ? 35.561  78.640  61.761  1.00 59.74  ? 65  LEU B CG    1 
ATOM   3193 C CD1   . LEU E 3 29  ? 34.470  78.106  62.673  1.00 75.46  ? 65  LEU B CD1   1 
ATOM   3194 C CD2   . LEU E 3 29  ? 36.622  79.390  62.557  1.00 43.09  ? 65  LEU B CD2   1 
ATOM   3195 N N     . PRO E 3 30  ? 33.485  77.108  58.779  1.00 67.85  ? 66  PRO B N     1 
ATOM   3196 C CA    . PRO E 3 30  ? 32.733  77.788  57.718  1.00 82.82  ? 66  PRO B CA    1 
ATOM   3197 C C     . PRO E 3 30  ? 32.532  79.282  57.960  1.00 92.32  ? 66  PRO B C     1 
ATOM   3198 O O     . PRO E 3 30  ? 33.173  79.874  58.832  1.00 119.74 ? 66  PRO B O     1 
ATOM   3199 C CB    . PRO E 3 30  ? 31.414  77.028  57.690  1.00 79.21  ? 66  PRO B CB    1 
ATOM   3200 C CG    . PRO E 3 30  ? 31.247  76.615  59.112  1.00 114.97 ? 66  PRO B CG    1 
ATOM   3201 C CD    . PRO E 3 30  ? 32.630  76.124  59.464  1.00 102.34 ? 66  PRO B CD    1 
ATOM   3202 N N     . GLY E 3 31  ? 31.642  79.885  57.176  1.00 104.71 ? 67  GLY B N     1 
ATOM   3203 C CA    . GLY E 3 31  ? 31.372  81.306  57.312  1.00 115.31 ? 67  GLY B CA    1 
ATOM   3204 C C     . GLY E 3 31  ? 29.900  81.603  57.529  1.00 120.34 ? 67  GLY B C     1 
ATOM   3205 O O     . GLY E 3 31  ? 29.042  80.770  57.236  1.00 135.38 ? 67  GLY B O     1 
ATOM   3206 N N     . ALA E 3 32  ? 29.606  82.793  58.042  1.00 106.54 ? 68  ALA B N     1 
ATOM   3207 C CA    . ALA E 3 32  ? 28.228  83.189  58.306  1.00 101.44 ? 68  ALA B CA    1 
ATOM   3208 C C     . ALA E 3 32  ? 27.340  83.013  57.078  1.00 103.46 ? 68  ALA B C     1 
ATOM   3209 O O     . ALA E 3 32  ? 26.370  82.251  57.108  1.00 102.36 ? 68  ALA B O     1 
ATOM   3210 C CB    . ALA E 3 32  ? 28.185  84.636  58.777  1.00 88.76  ? 68  ALA B CB    1 
ATOM   3211 N N     . SER E 3 33  ? 27.680  83.715  56.000  1.00 102.22 ? 69  SER B N     1 
ATOM   3212 C CA    . SER E 3 33  ? 26.907  83.644  54.764  1.00 117.99 ? 69  SER B CA    1 
ATOM   3213 C C     . SER E 3 33  ? 27.286  82.419  53.937  1.00 111.24 ? 69  SER B C     1 
ATOM   3214 O O     . SER E 3 33  ? 27.244  82.451  52.710  1.00 133.10 ? 69  SER B O     1 
ATOM   3215 C CB    . SER E 3 33  ? 27.120  84.920  53.938  1.00 136.02 ? 69  SER B CB    1 
ATOM   3216 O OG    . SER E 3 33  ? 26.260  84.961  52.809  1.00 133.88 ? 69  SER B OG    1 
ATOM   3217 N N     . SER E 3 34  ? 27.648  81.338  54.619  1.00 84.95  ? 70  SER B N     1 
ATOM   3218 C CA    . SER E 3 34  ? 28.038  80.096  53.959  1.00 83.69  ? 70  SER B CA    1 
ATOM   3219 C C     . SER E 3 34  ? 26.968  79.026  54.086  1.00 86.55  ? 70  SER B C     1 
ATOM   3220 O O     . SER E 3 34  ? 26.632  78.603  55.190  1.00 106.28 ? 70  SER B O     1 
ATOM   3221 C CB    . SER E 3 34  ? 29.332  79.562  54.568  1.00 66.14  ? 70  SER B CB    1 
ATOM   3222 O OG    . SER E 3 34  ? 29.528  78.206  54.206  1.00 103.32 ? 70  SER B OG    1 
ATOM   3223 N N     . GLU E 3 35  ? 26.434  78.586  52.953  1.00 80.41  ? 71  GLU B N     1 
ATOM   3224 C CA    . GLU E 3 35  ? 25.405  77.558  52.955  1.00 82.16  ? 71  GLU B CA    1 
ATOM   3225 C C     . GLU E 3 35  ? 25.643  76.604  51.802  1.00 89.53  ? 71  GLU B C     1 
ATOM   3226 O O     . GLU E 3 35  ? 26.594  76.772  51.042  1.00 82.82  ? 71  GLU B O     1 
ATOM   3227 C CB    . GLU E 3 35  ? 24.014  78.191  52.833  1.00 108.42 ? 71  GLU B CB    1 
ATOM   3228 C CG    . GLU E 3 35  ? 23.628  79.085  54.013  1.00 129.35 ? 71  GLU B CG    1 
ATOM   3229 C CD    . GLU E 3 35  ? 24.038  80.545  53.836  1.00 135.84 ? 71  GLU B CD    1 
ATOM   3230 O OE1   . GLU E 3 35  ? 25.181  80.812  53.404  1.00 90.50  ? 71  GLU B OE1   1 
ATOM   3231 O OE2   . GLU E 3 35  ? 23.213  81.433  54.145  1.00 114.66 ? 71  GLU B OE2   1 
ATOM   3232 N N     . LYS E 3 36  ? 24.785  75.598  51.683  1.00 107.92 ? 72  LYS B N     1 
ATOM   3233 C CA    . LYS E 3 36  ? 24.885  74.614  50.608  1.00 119.78 ? 72  LYS B CA    1 
ATOM   3234 C C     . LYS E 3 36  ? 24.908  75.364  49.278  1.00 115.22 ? 72  LYS B C     1 
ATOM   3235 O O     . LYS E 3 36  ? 24.774  76.586  49.252  1.00 105.28 ? 72  LYS B O     1 
ATOM   3236 C CB    . LYS E 3 36  ? 23.672  73.675  50.641  1.00 133.50 ? 72  LYS B CB    1 
ATOM   3237 C CG    . LYS E 3 36  ? 22.885  73.685  51.958  1.00 123.01 ? 72  LYS B CG    1 
ATOM   3238 C CD    . LYS E 3 36  ? 22.163  75.016  52.178  1.00 124.37 ? 72  LYS B CD    1 
ATOM   3239 C CE    . LYS E 3 36  ? 21.492  75.084  53.544  1.00 95.08  ? 72  LYS B CE    1 
ATOM   3240 N NZ    . LYS E 3 36  ? 20.918  76.436  53.821  1.00 95.87  ? 72  LYS B NZ    1 
ATOM   3241 N N     . GLY E 3 37  ? 25.070  74.646  48.173  1.00 122.34 ? 73  GLY B N     1 
ATOM   3242 C CA    . GLY E 3 37  ? 25.089  75.310  46.876  1.00 123.53 ? 73  GLY B CA    1 
ATOM   3243 C C     . GLY E 3 37  ? 26.352  76.116  46.638  1.00 130.96 ? 73  GLY B C     1 
ATOM   3244 O O     . GLY E 3 37  ? 26.954  76.044  45.565  1.00 115.78 ? 73  GLY B O     1 
ATOM   3245 N N     . ARG E 3 38  ? 26.739  76.908  47.634  1.00 126.62 ? 74  ARG B N     1 
ATOM   3246 C CA    . ARG E 3 38  ? 27.952  77.709  47.560  1.00 110.63 ? 74  ARG B CA    1 
ATOM   3247 C C     . ARG E 3 38  ? 28.489  77.933  48.967  1.00 96.87  ? 74  ARG B C     1 
ATOM   3248 O O     . ARG E 3 38  ? 27.891  78.643  49.780  1.00 85.71  ? 74  ARG B O     1 
ATOM   3249 C CB    . ARG E 3 38  ? 27.700  79.052  46.858  1.00 111.02 ? 74  ARG B CB    1 
ATOM   3250 C CG    . ARG E 3 38  ? 27.171  80.190  47.724  1.00 109.61 ? 74  ARG B CG    1 
ATOM   3251 C CD    . ARG E 3 38  ? 27.458  81.522  47.043  1.00 72.43  ? 74  ARG B CD    1 
ATOM   3252 N NE    . ARG E 3 38  ? 26.943  82.669  47.783  1.00 92.25  ? 74  ARG B NE    1 
ATOM   3253 C CZ    . ARG E 3 38  ? 27.103  83.932  47.395  1.00 112.43 ? 74  ARG B CZ    1 
ATOM   3254 N NH1   . ARG E 3 38  ? 26.602  84.923  48.124  1.00 106.91 ? 74  ARG B NH1   1 
ATOM   3255 N NH2   . ARG E 3 38  ? 27.769  84.204  46.279  1.00 106.13 ? 74  ARG B NH2   1 
ATOM   3256 N N     . LYS E 3 39  ? 29.618  77.298  49.252  1.00 87.85  ? 75  LYS B N     1 
ATOM   3257 C CA    . LYS E 3 39  ? 30.249  77.411  50.554  1.00 77.35  ? 75  LYS B CA    1 
ATOM   3258 C C     . LYS E 3 39  ? 30.928  78.766  50.679  1.00 77.12  ? 75  LYS B C     1 
ATOM   3259 O O     . LYS E 3 39  ? 31.057  79.496  49.695  1.00 57.08  ? 75  LYS B O     1 
ATOM   3260 C CB    . LYS E 3 39  ? 31.268  76.288  50.731  1.00 95.68  ? 75  LYS B CB    1 
ATOM   3261 C CG    . LYS E 3 39  ? 30.697  74.913  50.452  1.00 76.39  ? 75  LYS B CG    1 
ATOM   3262 C CD    . LYS E 3 39  ? 31.739  73.831  50.650  1.00 102.81 ? 75  LYS B CD    1 
ATOM   3263 C CE    . LYS E 3 39  ? 31.163  72.462  50.330  1.00 131.68 ? 75  LYS B CE    1 
ATOM   3264 N NZ    . LYS E 3 39  ? 32.145  71.369  50.565  1.00 140.73 ? 75  LYS B NZ    1 
ATOM   3265 N N     . THR E 3 40  ? 31.364  79.090  51.892  1.00 76.93  ? 76  THR B N     1 
ATOM   3266 C CA    . THR E 3 40  ? 32.021  80.361  52.172  1.00 78.61  ? 76  THR B CA    1 
ATOM   3267 C C     . THR E 3 40  ? 32.903  80.226  53.408  1.00 69.88  ? 76  THR B C     1 
ATOM   3268 O O     . THR E 3 40  ? 32.529  79.548  54.362  1.00 77.51  ? 76  THR B O     1 
ATOM   3269 C CB    . THR E 3 40  ? 30.981  81.457  52.424  1.00 84.83  ? 76  THR B CB    1 
ATOM   3270 O OG1   . THR E 3 40  ? 30.115  81.557  51.288  1.00 65.92  ? 76  THR B OG1   1 
ATOM   3271 C CG2   . THR E 3 40  ? 31.661  82.790  52.667  1.00 110.73 ? 76  THR B CG2   1 
ATOM   3272 N N     . TYR E 3 41  ? 34.067  80.872  53.398  1.00 82.33  ? 77  TYR B N     1 
ATOM   3273 C CA    . TYR E 3 41  ? 34.981  80.780  54.535  1.00 70.87  ? 77  TYR B CA    1 
ATOM   3274 C C     . TYR E 3 41  ? 35.430  82.112  55.121  1.00 78.05  ? 77  TYR B C     1 
ATOM   3275 O O     . TYR E 3 41  ? 35.373  83.156  54.466  1.00 88.63  ? 77  TYR B O     1 
ATOM   3276 C CB    . TYR E 3 41  ? 36.215  79.948  54.156  1.00 67.70  ? 77  TYR B CB    1 
ATOM   3277 C CG    . TYR E 3 41  ? 35.854  78.549  53.738  1.00 72.21  ? 77  TYR B CG    1 
ATOM   3278 C CD1   . TYR E 3 41  ? 35.208  77.694  54.621  1.00 104.28 ? 77  TYR B CD1   1 
ATOM   3279 C CD2   . TYR E 3 41  ? 36.085  78.106  52.441  1.00 102.98 ? 77  TYR B CD2   1 
ATOM   3280 C CE1   . TYR E 3 41  ? 34.789  76.433  54.225  1.00 105.86 ? 77  TYR B CE1   1 
ATOM   3281 C CE2   . TYR E 3 41  ? 35.671  76.843  52.032  1.00 128.84 ? 77  TYR B CE2   1 
ATOM   3282 C CZ    . TYR E 3 41  ? 35.020  76.012  52.931  1.00 112.11 ? 77  TYR B CZ    1 
ATOM   3283 O OH    . TYR E 3 41  ? 34.576  74.769  52.539  1.00 125.34 ? 77  TYR B OH    1 
ATOM   3284 N N     . PRO E 3 42  ? 35.884  82.078  56.382  1.00 88.98  ? 78  PRO B N     1 
ATOM   3285 C CA    . PRO E 3 42  ? 36.372  83.220  57.159  1.00 99.37  ? 78  PRO B CA    1 
ATOM   3286 C C     . PRO E 3 42  ? 37.434  84.021  56.421  1.00 103.04 ? 78  PRO B C     1 
ATOM   3287 O O     . PRO E 3 42  ? 38.629  83.839  56.656  1.00 115.76 ? 78  PRO B O     1 
ATOM   3288 C CB    . PRO E 3 42  ? 36.929  82.558  58.413  1.00 105.71 ? 78  PRO B CB    1 
ATOM   3289 C CG    . PRO E 3 42  ? 36.013  81.397  58.597  1.00 122.27 ? 78  PRO B CG    1 
ATOM   3290 C CD    . PRO E 3 42  ? 35.905  80.852  57.198  1.00 77.52  ? 78  PRO B CD    1 
ATOM   3291 N N     . THR E 3 43  ? 37.002  84.910  55.533  1.00 93.24  ? 79  THR B N     1 
ATOM   3292 C CA    . THR E 3 43  ? 37.949  85.721  54.783  1.00 94.60  ? 79  THR B CA    1 
ATOM   3293 C C     . THR E 3 43  ? 38.177  87.105  55.396  1.00 91.12  ? 79  THR B C     1 
ATOM   3294 O O     . THR E 3 43  ? 37.278  87.702  55.991  1.00 89.52  ? 79  THR B O     1 
ATOM   3295 C CB    . THR E 3 43  ? 37.516  85.866  53.291  1.00 101.71 ? 79  THR B CB    1 
ATOM   3296 O OG1   . THR E 3 43  ? 38.431  86.731  52.607  1.00 128.41 ? 79  THR B OG1   1 
ATOM   3297 C CG2   . THR E 3 43  ? 36.113  86.424  53.177  1.00 65.13  ? 79  THR B CG2   1 
ATOM   3298 N N     . VAL E 3 44  ? 39.404  87.590  55.259  1.00 85.68  ? 80  VAL B N     1 
ATOM   3299 C CA    . VAL E 3 44  ? 39.792  88.897  55.766  1.00 90.62  ? 80  VAL B CA    1 
ATOM   3300 C C     . VAL E 3 44  ? 40.384  89.668  54.585  1.00 91.91  ? 80  VAL B C     1 
ATOM   3301 O O     . VAL E 3 44  ? 40.560  89.107  53.504  1.00 76.46  ? 80  VAL B O     1 
ATOM   3302 C CB    . VAL E 3 44  ? 40.846  88.764  56.899  1.00 94.60  ? 80  VAL B CB    1 
ATOM   3303 C CG1   . VAL E 3 44  ? 42.169  88.278  56.339  1.00 89.45  ? 80  VAL B CG1   1 
ATOM   3304 C CG2   . VAL E 3 44  ? 41.021  90.084  57.604  1.00 82.25  ? 80  VAL B CG2   1 
ATOM   3305 N N     . LYS E 3 45  ? 40.690  90.947  54.784  1.00 103.90 ? 81  LYS B N     1 
ATOM   3306 C CA    . LYS E 3 45  ? 41.254  91.760  53.710  1.00 107.40 ? 81  LYS B CA    1 
ATOM   3307 C C     . LYS E 3 45  ? 42.101  92.919  54.228  1.00 110.01 ? 81  LYS B C     1 
ATOM   3308 O O     . LYS E 3 45  ? 42.058  93.249  55.415  1.00 128.24 ? 81  LYS B O     1 
ATOM   3309 C CB    . LYS E 3 45  ? 40.132  92.297  52.833  1.00 130.60 ? 81  LYS B CB    1 
ATOM   3310 N N     . ILE E 3 46  ? 42.874  93.532  53.332  1.00 80.13  ? 82  ILE B N     1 
ATOM   3311 C CA    . ILE E 3 46  ? 43.711  94.667  53.707  1.00 74.45  ? 82  ILE B CA    1 
ATOM   3312 C C     . ILE E 3 46  ? 43.595  95.848  52.743  1.00 73.42  ? 82  ILE B C     1 
ATOM   3313 O O     . ILE E 3 46  ? 43.952  95.751  51.569  1.00 79.30  ? 82  ILE B O     1 
ATOM   3314 C CB    . ILE E 3 46  ? 45.194  94.286  53.792  1.00 54.56  ? 82  ILE B CB    1 
ATOM   3315 C CG1   . ILE E 3 46  ? 45.370  93.046  54.668  1.00 63.88  ? 82  ILE B CG1   1 
ATOM   3316 C CG2   . ILE E 3 46  ? 45.977  95.463  54.371  1.00 52.44  ? 82  ILE B CG2   1 
ATOM   3317 C CD1   . ILE E 3 46  ? 46.804  92.628  54.852  1.00 46.40  ? 82  ILE B CD1   1 
ATOM   3318 N N     . CYS E 3 47  ? 43.103  96.969  53.252  1.00 90.78  ? 83  CYS B N     1 
ATOM   3319 C CA    . CYS E 3 47  ? 42.945  98.165  52.441  1.00 101.55 ? 83  CYS B CA    1 
ATOM   3320 C C     . CYS E 3 47  ? 44.180  99.031  52.651  1.00 110.61 ? 83  CYS B C     1 
ATOM   3321 O O     . CYS E 3 47  ? 44.845  98.919  53.685  1.00 128.35 ? 83  CYS B O     1 
ATOM   3322 C CB    . CYS E 3 47  ? 41.692  98.923  52.875  1.00 119.54 ? 83  CYS B CB    1 
ATOM   3323 S SG    . CYS E 3 47  ? 40.255  97.856  53.173  1.00 110.62 ? 83  CYS B SG    1 
ATOM   3324 N N     . ASN E 3 48  ? 44.493  99.883  51.675  1.00 93.45  ? 84  ASN B N     1 
ATOM   3325 C CA    . ASN E 3 48  ? 45.657  100.759 51.780  1.00 96.29  ? 84  ASN B CA    1 
ATOM   3326 C C     . ASN E 3 48  ? 46.851  99.902  52.203  1.00 116.97 ? 84  ASN B C     1 
ATOM   3327 O O     . ASN E 3 48  ? 47.503  100.172 53.217  1.00 116.52 ? 84  ASN B O     1 
ATOM   3328 C CB    . ASN E 3 48  ? 45.389  101.835 52.832  1.00 68.79  ? 84  ASN B CB    1 
ATOM   3329 C CG    . ASN E 3 48  ? 43.977  102.375 52.759  1.00 63.12  ? 84  ASN B CG    1 
ATOM   3330 O OD1   . ASN E 3 48  ? 43.627  103.112 51.839  1.00 92.41  ? 84  ASN B OD1   1 
ATOM   3331 N ND2   . ASN E 3 48  ? 43.152  101.998 53.728  1.00 83.05  ? 84  ASN B ND2   1 
ATOM   3332 N N     . TYR E 3 49  ? 47.119  98.866  51.414  1.00 137.08 ? 85  TYR B N     1 
ATOM   3333 C CA    . TYR E 3 49  ? 48.202  97.923  51.680  1.00 128.45 ? 85  TYR B CA    1 
ATOM   3334 C C     . TYR E 3 49  ? 49.590  98.449  51.353  1.00 127.81 ? 85  TYR B C     1 
ATOM   3335 O O     . TYR E 3 49  ? 49.775  99.636  51.085  1.00 140.73 ? 85  TYR B O     1 
ATOM   3336 C CB    . TYR E 3 49  ? 47.976  96.640  50.880  1.00 115.35 ? 85  TYR B CB    1 
ATOM   3337 C CG    . TYR E 3 49  ? 48.141  96.793  49.376  1.00 121.55 ? 85  TYR B CG    1 
ATOM   3338 C CD1   . TYR E 3 49  ? 47.286  97.606  48.633  1.00 115.84 ? 85  TYR B CD1   1 
ATOM   3339 C CD2   . TYR E 3 49  ? 49.124  96.077  48.688  1.00 124.77 ? 85  TYR B CD2   1 
ATOM   3340 C CE1   . TYR E 3 49  ? 47.402  97.692  47.241  1.00 132.71 ? 85  TYR B CE1   1 
ATOM   3341 C CE2   . TYR E 3 49  ? 49.249  96.156  47.304  1.00 100.04 ? 85  TYR B CE2   1 
ATOM   3342 C CZ    . TYR E 3 49  ? 48.383  96.961  46.585  1.00 122.47 ? 85  TYR B CZ    1 
ATOM   3343 O OH    . TYR E 3 49  ? 48.473  97.005  45.210  1.00 83.52  ? 85  TYR B OH    1 
ATOM   3344 N N     . GLU E 3 50  ? 50.565  97.546  51.386  1.00 106.68 ? 86  GLU B N     1 
ATOM   3345 C CA    . GLU E 3 50  ? 51.939  97.892  51.060  1.00 114.34 ? 86  GLU B CA    1 
ATOM   3346 C C     . GLU E 3 50  ? 52.596  96.758  50.266  1.00 121.50 ? 86  GLU B C     1 
ATOM   3347 O O     . GLU E 3 50  ? 53.821  96.666  50.183  1.00 137.00 ? 86  GLU B O     1 
ATOM   3348 C CB    . GLU E 3 50  ? 52.740  98.193  52.331  1.00 87.64  ? 86  GLU B CB    1 
ATOM   3349 C CG    . GLU E 3 50  ? 54.147  98.708  52.038  1.00 116.15 ? 86  GLU B CG    1 
ATOM   3350 C CD    . GLU E 3 50  ? 54.836  99.301  53.250  1.00 131.26 ? 86  GLU B CD    1 
ATOM   3351 O OE1   . GLU E 3 50  ? 54.816  98.654  54.319  1.00 92.23  ? 86  GLU B OE1   1 
ATOM   3352 O OE2   . GLU E 3 50  ? 55.405  100.410 53.127  1.00 137.15 ? 86  GLU B OE2   1 
ATOM   3353 N N     . GLY E 3 51  ? 51.766  95.901  49.678  1.00 123.32 ? 87  GLY B N     1 
ATOM   3354 C CA    . GLY E 3 51  ? 52.273  94.789  48.894  1.00 126.19 ? 87  GLY B CA    1 
ATOM   3355 C C     . GLY E 3 51  ? 52.197  93.447  49.601  1.00 117.89 ? 87  GLY B C     1 
ATOM   3356 O O     . GLY E 3 51  ? 51.480  93.305  50.592  1.00 90.44  ? 87  GLY B O     1 
ATOM   3357 N N     . PRO E 3 52  ? 52.935  92.436  49.114  1.00 121.74 ? 88  PRO B N     1 
ATOM   3358 C CA    . PRO E 3 52  ? 52.945  91.097  49.709  1.00 131.89 ? 88  PRO B CA    1 
ATOM   3359 C C     . PRO E 3 52  ? 53.042  91.135  51.232  1.00 140.73 ? 88  PRO B C     1 
ATOM   3360 O O     . PRO E 3 52  ? 53.771  91.954  51.793  1.00 140.73 ? 88  PRO B O     1 
ATOM   3361 C CB    . PRO E 3 52  ? 54.165  90.453  49.064  1.00 128.70 ? 88  PRO B CB    1 
ATOM   3362 C CG    . PRO E 3 52  ? 54.148  91.044  47.700  1.00 108.88 ? 88  PRO B CG    1 
ATOM   3363 C CD    . PRO E 3 52  ? 53.874  92.506  47.980  1.00 97.81  ? 88  PRO B CD    1 
ATOM   3364 N N     . ALA E 3 53  ? 52.303  90.247  51.893  1.00 140.64 ? 89  ALA B N     1 
ATOM   3365 C CA    . ALA E 3 53  ? 52.308  90.182  53.352  1.00 133.31 ? 89  ALA B CA    1 
ATOM   3366 C C     . ALA E 3 53  ? 51.630  88.919  53.875  1.00 122.39 ? 89  ALA B C     1 
ATOM   3367 O O     . ALA E 3 53  ? 50.872  88.266  53.158  1.00 97.57  ? 89  ALA B O     1 
ATOM   3368 C CB    . ALA E 3 53  ? 51.624  91.411  53.928  1.00 140.73 ? 89  ALA B CB    1 
ATOM   3369 N N     . LYS E 3 54  ? 51.907  88.583  55.131  1.00 111.24 ? 90  LYS B N     1 
ATOM   3370 C CA    . LYS E 3 54  ? 51.326  87.398  55.754  1.00 103.24 ? 90  LYS B CA    1 
ATOM   3371 C C     . LYS E 3 54  ? 50.223  87.756  56.750  1.00 103.81 ? 90  LYS B C     1 
ATOM   3372 O O     . LYS E 3 54  ? 49.916  88.933  56.951  1.00 103.15 ? 90  LYS B O     1 
ATOM   3373 C CB    . LYS E 3 54  ? 52.416  86.581  56.456  1.00 75.47  ? 90  LYS B CB    1 
ATOM   3374 C CG    . LYS E 3 54  ? 53.088  87.277  57.625  1.00 71.70  ? 90  LYS B CG    1 
ATOM   3375 C CD    . LYS E 3 54  ? 54.208  86.403  58.150  1.00 61.78  ? 90  LYS B CD    1 
ATOM   3376 C CE    . LYS E 3 54  ? 54.844  86.978  59.409  1.00 89.28  ? 90  LYS B CE    1 
ATOM   3377 N NZ    . LYS E 3 54  ? 55.919  86.072  59.931  1.00 59.33  ? 90  LYS B NZ    1 
ATOM   3378 N N     . ILE E 3 55  ? 49.628  86.739  57.370  1.00 110.73 ? 91  ILE B N     1 
ATOM   3379 C CA    . ILE E 3 55  ? 48.554  86.963  58.331  1.00 108.57 ? 91  ILE B CA    1 
ATOM   3380 C C     . ILE E 3 55  ? 48.454  85.877  59.407  1.00 117.97 ? 91  ILE B C     1 
ATOM   3381 O O     . ILE E 3 55  ? 47.709  84.910  59.243  1.00 137.29 ? 91  ILE B O     1 
ATOM   3382 C CB    . ILE E 3 55  ? 47.184  87.043  57.620  1.00 77.56  ? 91  ILE B CB    1 
ATOM   3383 C CG1   . ILE E 3 55  ? 47.245  88.043  56.464  1.00 75.34  ? 91  ILE B CG1   1 
ATOM   3384 C CG2   . ILE E 3 55  ? 46.112  87.453  58.617  1.00 94.79  ? 91  ILE B CG2   1 
ATOM   3385 C CD1   . ILE E 3 55  ? 45.979  88.129  55.645  1.00 69.09  ? 91  ILE B CD1   1 
ATOM   3386 N N     . GLU E 3 56  ? 49.196  86.032  60.502  1.00 115.45 ? 92  GLU B N     1 
ATOM   3387 C CA    . GLU E 3 56  ? 49.134  85.052  61.584  1.00 107.27 ? 92  GLU B CA    1 
ATOM   3388 C C     . GLU E 3 56  ? 47.746  85.106  62.211  1.00 112.23 ? 92  GLU B C     1 
ATOM   3389 O O     . GLU E 3 56  ? 47.224  86.191  62.470  1.00 136.03 ? 92  GLU B O     1 
ATOM   3390 C CB    . GLU E 3 56  ? 50.164  85.351  62.683  1.00 88.86  ? 92  GLU B CB    1 
ATOM   3391 C CG    . GLU E 3 56  ? 51.621  85.102  62.318  1.00 100.67 ? 92  GLU B CG    1 
ATOM   3392 C CD    . GLU E 3 56  ? 52.488  84.792  63.541  1.00 109.72 ? 92  GLU B CD    1 
ATOM   3393 O OE1   . GLU E 3 56  ? 52.346  85.476  64.581  1.00 88.93  ? 92  GLU B OE1   1 
ATOM   3394 O OE2   . GLU E 3 56  ? 53.321  83.863  63.457  1.00 90.57  ? 92  GLU B OE2   1 
ATOM   3395 N N     . VAL E 3 57  ? 47.147  83.942  62.453  1.00 95.37  ? 93  VAL B N     1 
ATOM   3396 C CA    . VAL E 3 57  ? 45.827  83.891  63.077  1.00 78.71  ? 93  VAL B CA    1 
ATOM   3397 C C     . VAL E 3 57  ? 45.698  82.740  64.067  1.00 69.29  ? 93  VAL B C     1 
ATOM   3398 O O     . VAL E 3 57  ? 45.770  81.572  63.693  1.00 73.40  ? 93  VAL B O     1 
ATOM   3399 C CB    . VAL E 3 57  ? 44.710  83.776  62.028  1.00 60.89  ? 93  VAL B CB    1 
ATOM   3400 C CG1   . VAL E 3 57  ? 44.675  85.035  61.189  1.00 75.83  ? 93  VAL B CG1   1 
ATOM   3401 C CG2   . VAL E 3 57  ? 44.938  82.561  61.151  1.00 117.95 ? 93  VAL B CG2   1 
ATOM   3402 N N     . ASP E 3 58  ? 45.512  83.085  65.337  1.00 81.96  ? 94  ASP B N     1 
ATOM   3403 C CA    . ASP E 3 58  ? 45.374  82.083  66.387  1.00 90.65  ? 94  ASP B CA    1 
ATOM   3404 C C     . ASP E 3 58  ? 44.029  82.222  67.100  1.00 93.51  ? 94  ASP B C     1 
ATOM   3405 O O     . ASP E 3 58  ? 43.241  83.133  66.805  1.00 73.82  ? 94  ASP B O     1 
ATOM   3406 C CB    . ASP E 3 58  ? 46.527  82.211  67.396  1.00 66.27  ? 94  ASP B CB    1 
ATOM   3407 C CG    . ASP E 3 58  ? 46.606  83.592  68.019  1.00 85.21  ? 94  ASP B CG    1 
ATOM   3408 O OD1   . ASP E 3 58  ? 45.692  83.936  68.789  1.00 93.31  ? 94  ASP B OD1   1 
ATOM   3409 O OD2   . ASP E 3 58  ? 47.571  84.336  67.739  1.00 85.63  ? 94  ASP B OD2   1 
ATOM   3410 N N     . LEU E 3 59  ? 43.762  81.306  68.027  1.00 79.60  ? 95  LEU B N     1 
ATOM   3411 C CA    . LEU E 3 59  ? 42.517  81.332  68.776  1.00 71.77  ? 95  LEU B CA    1 
ATOM   3412 C C     . LEU E 3 59  ? 42.733  82.081  70.073  1.00 78.53  ? 95  LEU B C     1 
ATOM   3413 O O     . LEU E 3 59  ? 43.677  81.803  70.811  1.00 64.83  ? 95  LEU B O     1 
ATOM   3414 C CB    . LEU E 3 59  ? 42.036  79.909  69.073  1.00 55.40  ? 95  LEU B CB    1 
ATOM   3415 C CG    . LEU E 3 59  ? 41.646  79.030  67.876  1.00 63.32  ? 95  LEU B CG    1 
ATOM   3416 C CD1   . LEU E 3 59  ? 41.240  77.656  68.365  1.00 71.09  ? 95  LEU B CD1   1 
ATOM   3417 C CD2   . LEU E 3 59  ? 40.501  79.664  67.111  1.00 80.86  ? 95  LEU B CD2   1 
ATOM   3418 N N     . VAL E 3 60  ? 41.859  83.041  70.344  1.00 85.33  ? 96  VAL B N     1 
ATOM   3419 C CA    . VAL E 3 60  ? 41.960  83.820  71.565  1.00 90.59  ? 96  VAL B CA    1 
ATOM   3420 C C     . VAL E 3 60  ? 40.819  83.494  72.510  1.00 97.28  ? 96  VAL B C     1 
ATOM   3421 O O     . VAL E 3 60  ? 39.842  82.846  72.130  1.00 124.18 ? 96  VAL B O     1 
ATOM   3422 C CB    . VAL E 3 60  ? 41.915  85.317  71.277  1.00 70.70  ? 96  VAL B CB    1 
ATOM   3423 C CG1   . VAL E 3 60  ? 43.011  85.681  70.317  1.00 60.28  ? 96  VAL B CG1   1 
ATOM   3424 C CG2   . VAL E 3 60  ? 40.549  85.699  70.735  1.00 88.66  ? 96  VAL B CG2   1 
ATOM   3425 N N     . THR E 3 61  ? 40.952  83.961  73.743  1.00 70.92  ? 97  THR B N     1 
ATOM   3426 C CA    . THR E 3 61  ? 39.943  83.739  74.761  1.00 66.89  ? 97  THR B CA    1 
ATOM   3427 C C     . THR E 3 61  ? 38.750  84.657  74.529  1.00 69.49  ? 97  THR B C     1 
ATOM   3428 O O     . THR E 3 61  ? 38.906  85.868  74.356  1.00 74.79  ? 97  THR B O     1 
ATOM   3429 C CB    . THR E 3 61  ? 40.514  84.013  76.139  1.00 61.26  ? 97  THR B CB    1 
ATOM   3430 O OG1   . THR E 3 61  ? 39.480  83.889  77.121  1.00 118.53 ? 97  THR B OG1   1 
ATOM   3431 C CG2   . THR E 3 61  ? 41.096  85.404  76.178  1.00 52.48  ? 97  THR B CG2   1 
ATOM   3432 N N     . HIS E 3 62  ? 37.560  84.059  74.524  1.00 93.89  ? 98  HIS B N     1 
ATOM   3433 C CA    . HIS E 3 62  ? 36.305  84.775  74.309  1.00 101.37 ? 98  HIS B CA    1 
ATOM   3434 C C     . HIS E 3 62  ? 36.202  86.061  75.119  1.00 104.71 ? 98  HIS B C     1 
ATOM   3435 O O     . HIS E 3 62  ? 35.557  87.018  74.692  1.00 92.06  ? 98  HIS B O     1 
ATOM   3436 C CB    . HIS E 3 62  ? 35.126  83.854  74.634  1.00 114.89 ? 98  HIS B CB    1 
ATOM   3437 C CG    . HIS E 3 62  ? 33.806  84.558  74.692  1.00 139.98 ? 98  HIS B CG    1 
ATOM   3438 N ND1   . HIS E 3 62  ? 33.358  85.385  73.684  1.00 140.73 ? 98  HIS B ND1   1 
ATOM   3439 C CD2   . HIS E 3 62  ? 32.837  84.557  75.637  1.00 140.73 ? 98  HIS B CD2   1 
ATOM   3440 C CE1   . HIS E 3 62  ? 32.170  85.865  74.007  1.00 137.20 ? 98  HIS B CE1   1 
ATOM   3441 N NE2   . HIS E 3 62  ? 31.832  85.378  75.188  1.00 140.73 ? 98  HIS B NE2   1 
ATOM   3442 N N     . SER E 3 63  ? 36.829  86.078  76.291  1.00 122.51 ? 99  SER B N     1 
ATOM   3443 C CA    . SER E 3 63  ? 36.806  87.264  77.137  1.00 129.86 ? 99  SER B CA    1 
ATOM   3444 C C     . SER E 3 63  ? 37.267  88.430  76.276  1.00 125.27 ? 99  SER B C     1 
ATOM   3445 O O     . SER E 3 63  ? 38.371  88.405  75.731  1.00 131.81 ? 99  SER B O     1 
ATOM   3446 C CB    . SER E 3 63  ? 37.745  87.086  78.334  1.00 130.94 ? 99  SER B CB    1 
ATOM   3447 O OG    . SER E 3 63  ? 39.087  86.931  77.915  1.00 139.20 ? 99  SER B OG    1 
ATOM   3448 N N     . ASP E 3 64  ? 36.417  89.445  76.152  1.00 114.55 ? 100 ASP B N     1 
ATOM   3449 C CA    . ASP E 3 64  ? 36.724  90.610  75.332  1.00 117.81 ? 100 ASP B CA    1 
ATOM   3450 C C     . ASP E 3 64  ? 38.207  90.972  75.295  1.00 119.92 ? 100 ASP B C     1 
ATOM   3451 O O     . ASP E 3 64  ? 38.754  91.216  74.220  1.00 140.46 ? 100 ASP B O     1 
ATOM   3452 C CB    . ASP E 3 64  ? 35.918  91.824  75.790  1.00 108.32 ? 100 ASP B CB    1 
ATOM   3453 C CG    . ASP E 3 64  ? 35.951  92.950  74.776  1.00 136.56 ? 100 ASP B CG    1 
ATOM   3454 O OD1   . ASP E 3 64  ? 37.063  93.360  74.384  1.00 137.46 ? 100 ASP B OD1   1 
ATOM   3455 O OD2   . ASP E 3 64  ? 34.868  93.419  74.366  1.00 140.73 ? 100 ASP B OD2   1 
ATOM   3456 N N     . PRO E 3 65  ? 38.875  91.030  76.465  1.00 113.32 ? 101 PRO B N     1 
ATOM   3457 C CA    . PRO E 3 65  ? 40.301  91.371  76.422  1.00 109.57 ? 101 PRO B CA    1 
ATOM   3458 C C     . PRO E 3 65  ? 41.006  90.283  75.614  1.00 123.33 ? 101 PRO B C     1 
ATOM   3459 O O     . PRO E 3 65  ? 41.157  89.151  76.079  1.00 129.16 ? 101 PRO B O     1 
ATOM   3460 C CB    . PRO E 3 65  ? 40.709  91.352  77.895  1.00 73.49  ? 101 PRO B CB    1 
ATOM   3461 C CG    . PRO E 3 65  ? 39.442  91.687  78.606  1.00 72.10  ? 101 PRO B CG    1 
ATOM   3462 C CD    . PRO E 3 65  ? 38.421  90.871  77.856  1.00 73.52  ? 101 PRO B CD    1 
ATOM   3463 N N     . PRO E 3 66  ? 41.433  90.608  74.387  1.00 114.19 ? 102 PRO B N     1 
ATOM   3464 C CA    . PRO E 3 66  ? 42.107  89.596  73.574  1.00 92.87  ? 102 PRO B CA    1 
ATOM   3465 C C     . PRO E 3 66  ? 43.300  88.975  74.284  1.00 83.48  ? 102 PRO B C     1 
ATOM   3466 O O     . PRO E 3 66  ? 44.311  89.636  74.523  1.00 67.96  ? 102 PRO B O     1 
ATOM   3467 C CB    . PRO E 3 66  ? 42.497  90.370  72.318  1.00 91.87  ? 102 PRO B CB    1 
ATOM   3468 C CG    . PRO E 3 66  ? 42.711  91.761  72.835  1.00 115.16 ? 102 PRO B CG    1 
ATOM   3469 C CD    . PRO E 3 66  ? 41.536  91.938  73.762  1.00 137.54 ? 102 PRO B CD    1 
ATOM   3470 N N     . ARG E 3 67  ? 43.156  87.704  74.639  1.00 92.92  ? 103 ARG B N     1 
ATOM   3471 C CA    . ARG E 3 67  ? 44.212  86.953  75.307  1.00 95.84  ? 103 ARG B CA    1 
ATOM   3472 C C     . ARG E 3 67  ? 44.273  85.587  74.640  1.00 101.14 ? 103 ARG B C     1 
ATOM   3473 O O     . ARG E 3 67  ? 43.361  85.217  73.903  1.00 99.57  ? 103 ARG B O     1 
ATOM   3474 C CB    . ARG E 3 67  ? 43.909  86.801  76.797  1.00 95.85  ? 103 ARG B CB    1 
ATOM   3475 C CG    . ARG E 3 67  ? 43.732  88.120  77.527  1.00 91.20  ? 103 ARG B CG    1 
ATOM   3476 C CD    . ARG E 3 67  ? 44.982  88.985  77.420  1.00 129.23 ? 103 ARG B CD    1 
ATOM   3477 N NE    . ARG E 3 67  ? 46.146  88.348  78.030  1.00 134.82 ? 103 ARG B NE    1 
ATOM   3478 C CZ    . ARG E 3 67  ? 47.344  88.918  78.139  1.00 137.82 ? 103 ARG B CZ    1 
ATOM   3479 N NH1   . ARG E 3 67  ? 47.546  90.145  77.677  1.00 98.19  ? 103 ARG B NH1   1 
ATOM   3480 N NH2   . ARG E 3 67  ? 48.341  88.260  78.715  1.00 140.73 ? 103 ARG B NH2   1 
ATOM   3481 N N     . ALA E 3 68  ? 45.348  84.848  74.896  1.00 109.26 ? 104 ALA B N     1 
ATOM   3482 C CA    . ALA E 3 68  ? 45.551  83.526  74.305  1.00 103.78 ? 104 ALA B CA    1 
ATOM   3483 C C     . ALA E 3 68  ? 44.353  82.588  74.454  1.00 103.65 ? 104 ALA B C     1 
ATOM   3484 O O     . ALA E 3 68  ? 43.208  83.026  74.528  1.00 131.80 ? 104 ALA B O     1 
ATOM   3485 C CB    . ALA E 3 68  ? 46.790  82.884  74.913  1.00 62.03  ? 104 ALA B CB    1 
ATOM   3486 N N     . HIS E 3 69  ? 44.631  81.291  74.484  1.00 81.99  ? 105 HIS B N     1 
ATOM   3487 C CA    . HIS E 3 69  ? 43.590  80.287  74.641  1.00 85.63  ? 105 HIS B CA    1 
ATOM   3488 C C     . HIS E 3 69  ? 44.240  78.913  74.684  1.00 77.39  ? 105 HIS B C     1 
ATOM   3489 O O     . HIS E 3 69  ? 45.334  78.734  74.160  1.00 98.14  ? 105 HIS B O     1 
ATOM   3490 C CB    . HIS E 3 69  ? 42.594  80.346  73.480  1.00 78.32  ? 105 HIS B CB    1 
ATOM   3491 C CG    . HIS E 3 69  ? 41.279  79.697  73.786  1.00 97.09  ? 105 HIS B CG    1 
ATOM   3492 N ND1   . HIS E 3 69  ? 41.178  78.430  74.325  1.00 44.99  ? 105 HIS B ND1   1 
ATOM   3493 C CD2   . HIS E 3 69  ? 40.009  80.154  73.656  1.00 66.28  ? 105 HIS B CD2   1 
ATOM   3494 C CE1   . HIS E 3 69  ? 39.904  78.138  74.515  1.00 83.30  ? 105 HIS B CE1   1 
ATOM   3495 N NE2   . HIS E 3 69  ? 39.175  79.165  74.119  1.00 59.90  ? 105 HIS B NE2   1 
ATOM   3496 N N     . ALA E 3 70  ? 43.576  77.949  75.308  1.00 53.58  ? 106 ALA B N     1 
ATOM   3497 C CA    . ALA E 3 70  ? 44.121  76.601  75.396  1.00 53.16  ? 106 ALA B CA    1 
ATOM   3498 C C     . ALA E 3 70  ? 43.869  75.841  74.092  1.00 59.89  ? 106 ALA B C     1 
ATOM   3499 O O     . ALA E 3 70  ? 44.710  75.063  73.623  1.00 60.59  ? 106 ALA B O     1 
ATOM   3500 C CB    . ALA E 3 70  ? 43.491  75.862  76.559  1.00 57.87  ? 106 ALA B CB    1 
ATOM   3501 N N     . HIS E 3 71  ? 42.704  76.072  73.505  1.00 69.68  ? 107 HIS B N     1 
ATOM   3502 C CA    . HIS E 3 71  ? 42.367  75.400  72.268  1.00 94.29  ? 107 HIS B CA    1 
ATOM   3503 C C     . HIS E 3 71  ? 43.263  75.889  71.149  1.00 108.76 ? 107 HIS B C     1 
ATOM   3504 O O     . HIS E 3 71  ? 43.113  77.005  70.659  1.00 130.66 ? 107 HIS B O     1 
ATOM   3505 C CB    . HIS E 3 71  ? 40.894  75.625  71.931  1.00 74.64  ? 107 HIS B CB    1 
ATOM   3506 C CG    . HIS E 3 71  ? 39.967  74.728  72.690  1.00 91.82  ? 107 HIS B CG    1 
ATOM   3507 N ND1   . HIS E 3 71  ? 38.621  74.986  72.827  1.00 76.28  ? 107 HIS B ND1   1 
ATOM   3508 C CD2   . HIS E 3 71  ? 40.194  73.558  73.334  1.00 86.03  ? 107 HIS B CD2   1 
ATOM   3509 C CE1   . HIS E 3 71  ? 38.058  74.013  73.522  1.00 101.03 ? 107 HIS B CE1   1 
ATOM   3510 N NE2   . HIS E 3 71  ? 38.991  73.134  73.842  1.00 89.09  ? 107 HIS B NE2   1 
ATOM   3511 N N     . SER E 3 72  ? 44.216  75.047  70.767  1.00 112.06 ? 108 SER B N     1 
ATOM   3512 C CA    . SER E 3 72  ? 45.134  75.379  69.694  1.00 98.42  ? 108 SER B CA    1 
ATOM   3513 C C     . SER E 3 72  ? 44.480  75.072  68.358  1.00 86.42  ? 108 SER B C     1 
ATOM   3514 O O     . SER E 3 72  ? 44.016  73.957  68.116  1.00 80.11  ? 108 SER B O     1 
ATOM   3515 C CB    . SER E 3 72  ? 46.433  74.582  69.831  1.00 94.89  ? 108 SER B CB    1 
ATOM   3516 O OG    . SER E 3 72  ? 47.172  75.008  70.962  1.00 119.07 ? 108 SER B OG    1 
ATOM   3517 N N     . LEU E 3 73  ? 44.428  76.086  67.505  1.00 85.27  ? 109 LEU B N     1 
ATOM   3518 C CA    . LEU E 3 73  ? 43.852  75.962  66.177  1.00 79.39  ? 109 LEU B CA    1 
ATOM   3519 C C     . LEU E 3 73  ? 44.761  75.013  65.404  1.00 79.39  ? 109 LEU B C     1 
ATOM   3520 O O     . LEU E 3 73  ? 45.987  75.131  65.471  1.00 86.19  ? 109 LEU B O     1 
ATOM   3521 C CB    . LEU E 3 73  ? 43.824  77.339  65.515  1.00 76.54  ? 109 LEU B CB    1 
ATOM   3522 C CG    . LEU E 3 73  ? 43.021  77.511  64.230  1.00 53.89  ? 109 LEU B CG    1 
ATOM   3523 C CD1   . LEU E 3 73  ? 41.581  77.090  64.441  1.00 74.87  ? 109 LEU B CD1   1 
ATOM   3524 C CD2   . LEU E 3 73  ? 43.096  78.963  63.805  1.00 34.22  ? 109 LEU B CD2   1 
ATOM   3525 N N     . VAL E 3 74  ? 44.172  74.068  64.678  1.00 63.80  ? 110 VAL B N     1 
ATOM   3526 C CA    . VAL E 3 74  ? 44.979  73.113  63.934  1.00 73.58  ? 110 VAL B CA    1 
ATOM   3527 C C     . VAL E 3 74  ? 44.552  72.982  62.476  1.00 86.02  ? 110 VAL B C     1 
ATOM   3528 O O     . VAL E 3 74  ? 43.372  73.094  62.147  1.00 113.59 ? 110 VAL B O     1 
ATOM   3529 C CB    . VAL E 3 74  ? 44.957  71.722  64.631  1.00 65.74  ? 110 VAL B CB    1 
ATOM   3530 C CG1   . VAL E 3 74  ? 43.595  71.064  64.468  1.00 33.08  ? 110 VAL B CG1   1 
ATOM   3531 C CG2   . VAL E 3 74  ? 46.074  70.847  64.086  1.00 71.44  ? 110 VAL B CG2   1 
ATOM   3532 N N     . GLY E 3 75  ? 45.527  72.753  61.603  1.00 88.47  ? 111 GLY B N     1 
ATOM   3533 C CA    . GLY E 3 75  ? 45.239  72.620  60.186  1.00 98.50  ? 111 GLY B CA    1 
ATOM   3534 C C     . GLY E 3 75  ? 46.505  72.544  59.354  1.00 112.25 ? 111 GLY B C     1 
ATOM   3535 O O     . GLY E 3 75  ? 47.596  72.848  59.841  1.00 103.56 ? 111 GLY B O     1 
ATOM   3536 N N     . LYS E 3 76  ? 46.356  72.142  58.095  1.00 116.67 ? 112 LYS B N     1 
ATOM   3537 C CA    . LYS E 3 76  ? 47.488  72.004  57.181  1.00 132.46 ? 112 LYS B CA    1 
ATOM   3538 C C     . LYS E 3 76  ? 48.540  73.085  57.394  1.00 127.84 ? 112 LYS B C     1 
ATOM   3539 O O     . LYS E 3 76  ? 49.674  72.792  57.769  1.00 117.68 ? 112 LYS B O     1 
ATOM   3540 C CB    . LYS E 3 76  ? 47.000  72.034  55.725  1.00 137.57 ? 112 LYS B CB    1 
ATOM   3541 C CG    . LYS E 3 76  ? 46.056  70.886  55.342  1.00 135.62 ? 112 LYS B CG    1 
ATOM   3542 C CD    . LYS E 3 76  ? 46.728  69.778  54.512  1.00 95.47  ? 112 LYS B CD    1 
ATOM   3543 C CE    . LYS E 3 76  ? 47.806  69.016  55.275  1.00 98.22  ? 112 LYS B CE    1 
ATOM   3544 N NZ    . LYS E 3 76  ? 49.032  69.821  55.511  1.00 126.94 ? 112 LYS B NZ    1 
ATOM   3545 N N     . GLN E 3 77  ? 48.154  74.335  57.165  1.00 115.95 ? 113 GLN B N     1 
ATOM   3546 C CA    . GLN E 3 77  ? 49.063  75.463  57.318  1.00 107.30 ? 113 GLN B CA    1 
ATOM   3547 C C     . GLN E 3 77  ? 48.994  76.090  58.702  1.00 92.83  ? 113 GLN B C     1 
ATOM   3548 O O     . GLN E 3 77  ? 48.738  77.287  58.831  1.00 99.27  ? 113 GLN B O     1 
ATOM   3549 C CB    . GLN E 3 77  ? 48.756  76.527  56.261  1.00 123.52 ? 113 GLN B CB    1 
ATOM   3550 C CG    . GLN E 3 77  ? 47.274  76.803  56.082  1.00 139.75 ? 113 GLN B CG    1 
ATOM   3551 C CD    . GLN E 3 77  ? 46.543  75.620  55.478  1.00 140.73 ? 113 GLN B CD    1 
ATOM   3552 O OE1   . GLN E 3 77  ? 46.770  75.263  54.323  1.00 140.73 ? 113 GLN B OE1   1 
ATOM   3553 N NE2   . GLN E 3 77  ? 45.670  74.997  56.262  1.00 138.58 ? 113 GLN B NE2   1 
ATOM   3554 N N     . CYS E 3 78  ? 49.227  75.283  59.733  1.00 81.61  ? 114 CYS B N     1 
ATOM   3555 C CA    . CYS E 3 78  ? 49.190  75.769  61.112  1.00 82.81  ? 114 CYS B CA    1 
ATOM   3556 C C     . CYS E 3 78  ? 50.457  75.406  61.875  1.00 79.22  ? 114 CYS B C     1 
ATOM   3557 O O     . CYS E 3 78  ? 50.991  74.306  61.731  1.00 59.31  ? 114 CYS B O     1 
ATOM   3558 C CB    . CYS E 3 78  ? 47.980  75.195  61.841  1.00 53.84  ? 114 CYS B CB    1 
ATOM   3559 S SG    . CYS E 3 78  ? 46.388  75.676  61.115  1.00 88.44  ? 114 CYS B SG    1 
ATOM   3560 N N     . SER E 3 79  ? 50.937  76.335  62.691  1.00 86.20  ? 115 SER B N     1 
ATOM   3561 C CA    . SER E 3 79  ? 52.144  76.098  63.464  1.00 95.23  ? 115 SER B CA    1 
ATOM   3562 C C     . SER E 3 79  ? 51.940  74.985  64.486  1.00 80.81  ? 115 SER B C     1 
ATOM   3563 O O     . SER E 3 79  ? 52.014  75.210  65.694  1.00 77.09  ? 115 SER B O     1 
ATOM   3564 C CB    . SER E 3 79  ? 52.589  77.393  64.153  1.00 122.70 ? 115 SER B CB    1 
ATOM   3565 O OG    . SER E 3 79  ? 51.515  78.015  64.832  1.00 110.72 ? 115 SER B OG    1 
ATOM   3566 N N     . GLU E 3 80  ? 51.696  73.777  63.986  1.00 85.04  ? 116 GLU B N     1 
ATOM   3567 C CA    . GLU E 3 80  ? 51.476  72.613  64.833  1.00 100.62 ? 116 GLU B CA    1 
ATOM   3568 C C     . GLU E 3 80  ? 50.469  72.950  65.922  1.00 114.75 ? 116 GLU B C     1 
ATOM   3569 O O     . GLU E 3 80  ? 49.266  72.723  65.766  1.00 130.68 ? 116 GLU B O     1 
ATOM   3570 C CB    . GLU E 3 80  ? 52.787  72.149  65.476  1.00 121.11 ? 116 GLU B CB    1 
ATOM   3571 C CG    . GLU E 3 80  ? 53.862  71.688  64.499  1.00 136.41 ? 116 GLU B CG    1 
ATOM   3572 C CD    . GLU E 3 80  ? 54.654  72.837  63.896  1.00 140.73 ? 116 GLU B CD    1 
ATOM   3573 O OE1   . GLU E 3 80  ? 54.058  73.667  63.181  1.00 140.73 ? 116 GLU B OE1   1 
ATOM   3574 O OE2   . GLU E 3 80  ? 55.877  72.909  64.139  1.00 140.73 ? 116 GLU B OE2   1 
ATOM   3575 N N     . LEU E 3 81  ? 50.971  73.499  67.025  1.00 130.79 ? 117 LEU B N     1 
ATOM   3576 C CA    . LEU E 3 81  ? 50.127  73.878  68.151  1.00 137.74 ? 117 LEU B CA    1 
ATOM   3577 C C     . LEU E 3 81  ? 50.073  75.397  68.319  1.00 127.38 ? 117 LEU B C     1 
ATOM   3578 O O     . LEU E 3 81  ? 50.815  75.970  69.117  1.00 123.32 ? 117 LEU B O     1 
ATOM   3579 C CB    . LEU E 3 81  ? 50.650  73.237  69.445  1.00 132.85 ? 117 LEU B CB    1 
ATOM   3580 C CG    . LEU E 3 81  ? 50.714  71.708  69.559  1.00 133.77 ? 117 LEU B CG    1 
ATOM   3581 C CD1   . LEU E 3 81  ? 49.339  71.118  69.292  1.00 63.92  ? 117 LEU B CD1   1 
ATOM   3582 C CD2   . LEU E 3 81  ? 51.738  71.149  68.581  1.00 136.26 ? 117 LEU B CD2   1 
ATOM   3583 N N     . GLY E 3 82  ? 49.196  76.049  67.561  1.00 102.44 ? 118 GLY B N     1 
ATOM   3584 C CA    . GLY E 3 82  ? 49.085  77.488  67.682  1.00 81.18  ? 118 GLY B CA    1 
ATOM   3585 C C     . GLY E 3 82  ? 48.503  78.236  66.498  1.00 95.07  ? 118 GLY B C     1 
ATOM   3586 O O     . GLY E 3 82  ? 47.326  78.073  66.151  1.00 78.80  ? 118 GLY B O     1 
ATOM   3587 N N     . ILE E 3 83  ? 49.352  79.048  65.870  1.00 98.11  ? 119 ILE B N     1 
ATOM   3588 C CA    . ILE E 3 83  ? 48.973  79.904  64.746  1.00 96.73  ? 119 ILE B CA    1 
ATOM   3589 C C     . ILE E 3 83  ? 49.088  79.334  63.337  1.00 87.34  ? 119 ILE B C     1 
ATOM   3590 O O     . ILE E 3 83  ? 50.024  78.607  63.014  1.00 96.45  ? 119 ILE B O     1 
ATOM   3591 C CB    . ILE E 3 83  ? 49.796  81.198  64.769  1.00 89.93  ? 119 ILE B CB    1 
ATOM   3592 C CG1   . ILE E 3 83  ? 49.885  81.731  66.201  1.00 125.91 ? 119 ILE B CG1   1 
ATOM   3593 C CG2   . ILE E 3 83  ? 49.164  82.224  63.846  1.00 109.62 ? 119 ILE B CG2   1 
ATOM   3594 C CD1   . ILE E 3 83  ? 50.872  82.868  66.381  1.00 100.53 ? 119 ILE B CD1   1 
ATOM   3595 N N     . CYS E 3 84  ? 48.125  79.693  62.494  1.00 80.40  ? 120 CYS B N     1 
ATOM   3596 C CA    . CYS E 3 84  ? 48.118  79.258  61.106  1.00 105.52 ? 120 CYS B CA    1 
ATOM   3597 C C     . CYS E 3 84  ? 48.399  80.522  60.305  1.00 115.58 ? 120 CYS B C     1 
ATOM   3598 O O     . CYS E 3 84  ? 47.636  81.487  60.381  1.00 114.26 ? 120 CYS B O     1 
ATOM   3599 C CB    . CYS E 3 84  ? 46.751  78.693  60.717  1.00 105.32 ? 120 CYS B CB    1 
ATOM   3600 S SG    . CYS E 3 84  ? 46.038  77.511  61.906  1.00 125.65 ? 120 CYS B SG    1 
ATOM   3601 N N     . ALA E 3 85  ? 49.491  80.519  59.544  1.00 125.97 ? 121 ALA B N     1 
ATOM   3602 C CA    . ALA E 3 85  ? 49.879  81.686  58.756  1.00 99.66  ? 121 ALA B CA    1 
ATOM   3603 C C     . ALA E 3 85  ? 49.877  81.471  57.245  1.00 94.86  ? 121 ALA B C     1 
ATOM   3604 O O     . ALA E 3 85  ? 50.388  80.467  56.748  1.00 107.90 ? 121 ALA B O     1 
ATOM   3605 C CB    . ALA E 3 85  ? 51.258  82.167  59.204  1.00 89.75  ? 121 ALA B CB    1 
ATOM   3606 N N     . VAL E 3 86  ? 49.308  82.433  56.523  1.00 78.17  ? 122 VAL B N     1 
ATOM   3607 C CA    . VAL E 3 86  ? 49.246  82.376  55.066  1.00 89.97  ? 122 VAL B CA    1 
ATOM   3608 C C     . VAL E 3 86  ? 49.805  83.671  54.489  1.00 100.45 ? 122 VAL B C     1 
ATOM   3609 O O     . VAL E 3 86  ? 50.162  84.580  55.238  1.00 87.00  ? 122 VAL B O     1 
ATOM   3610 C CB    . VAL E 3 86  ? 47.798  82.218  54.560  1.00 65.31  ? 122 VAL B CB    1 
ATOM   3611 C CG1   . VAL E 3 86  ? 47.132  81.041  55.250  1.00 111.40 ? 122 VAL B CG1   1 
ATOM   3612 C CG2   . VAL E 3 86  ? 47.022  83.512  54.786  1.00 52.24  ? 122 VAL B CG2   1 
ATOM   3613 N N     . SER E 3 87  ? 49.866  83.753  53.161  1.00 106.52 ? 123 SER B N     1 
ATOM   3614 C CA    . SER E 3 87  ? 50.377  84.939  52.481  1.00 107.80 ? 123 SER B CA    1 
ATOM   3615 C C     . SER E 3 87  ? 49.370  85.515  51.485  1.00 106.57 ? 123 SER B C     1 
ATOM   3616 O O     . SER E 3 87  ? 48.280  84.975  51.305  1.00 97.34  ? 123 SER B O     1 
ATOM   3617 C CB    . SER E 3 87  ? 51.685  84.609  51.758  1.00 108.27 ? 123 SER B CB    1 
ATOM   3618 O OG    . SER E 3 87  ? 52.707  84.272  52.680  1.00 130.23 ? 123 SER B OG    1 
ATOM   3619 N N     . VAL E 3 88  ? 49.744  86.616  50.839  1.00 129.07 ? 124 VAL B N     1 
ATOM   3620 C CA    . VAL E 3 88  ? 48.875  87.270  49.863  1.00 134.27 ? 124 VAL B CA    1 
ATOM   3621 C C     . VAL E 3 88  ? 49.644  87.816  48.657  1.00 140.73 ? 124 VAL B C     1 
ATOM   3622 O O     . VAL E 3 88  ? 50.764  88.321  48.791  1.00 138.79 ? 124 VAL B O     1 
ATOM   3623 C CB    . VAL E 3 88  ? 48.106  88.440  50.503  1.00 127.88 ? 124 VAL B CB    1 
ATOM   3624 C CG1   . VAL E 3 88  ? 47.235  87.929  51.627  1.00 70.74  ? 124 VAL B CG1   1 
ATOM   3625 C CG2   . VAL E 3 88  ? 49.085  89.482  51.021  1.00 138.06 ? 124 VAL B CG2   1 
ATOM   3626 N N     . GLY E 3 89  ? 49.030  87.708  47.482  1.00 140.73 ? 125 GLY B N     1 
ATOM   3627 C CA    . GLY E 3 89  ? 49.652  88.206  46.268  1.00 140.73 ? 125 GLY B CA    1 
ATOM   3628 C C     . GLY E 3 89  ? 49.608  89.722  46.259  1.00 140.73 ? 125 GLY B C     1 
ATOM   3629 O O     . GLY E 3 89  ? 48.738  90.311  46.897  1.00 140.73 ? 125 GLY B O     1 
ATOM   3630 N N     . PRO E 3 90  ? 50.521  90.384  45.530  1.00 134.15 ? 126 PRO B N     1 
ATOM   3631 C CA    . PRO E 3 90  ? 50.584  91.848  45.447  1.00 129.23 ? 126 PRO B CA    1 
ATOM   3632 C C     . PRO E 3 90  ? 49.244  92.544  45.220  1.00 126.37 ? 126 PRO B C     1 
ATOM   3633 O O     . PRO E 3 90  ? 48.995  93.606  45.788  1.00 133.40 ? 126 PRO B O     1 
ATOM   3634 C CB    . PRO E 3 90  ? 51.570  92.084  44.303  1.00 138.16 ? 126 PRO B CB    1 
ATOM   3635 C CG    . PRO E 3 90  ? 51.411  90.857  43.455  1.00 140.46 ? 126 PRO B CG    1 
ATOM   3636 C CD    . PRO E 3 90  ? 51.368  89.772  44.496  1.00 138.01 ? 126 PRO B CD    1 
ATOM   3637 N N     . LYS E 3 91  ? 48.390  91.957  44.388  1.00 133.50 ? 127 LYS B N     1 
ATOM   3638 C CA    . LYS E 3 91  ? 47.078  92.541  44.115  1.00 133.37 ? 127 LYS B CA    1 
ATOM   3639 C C     . LYS E 3 91  ? 46.035  91.977  45.071  1.00 136.32 ? 127 LYS B C     1 
ATOM   3640 O O     . LYS E 3 91  ? 45.489  92.705  45.903  1.00 140.73 ? 127 LYS B O     1 
ATOM   3641 C CB    . LYS E 3 91  ? 46.647  92.279  42.667  1.00 113.30 ? 127 LYS B CB    1 
ATOM   3642 C CG    . LYS E 3 91  ? 47.384  93.111  41.621  1.00 111.88 ? 127 LYS B CG    1 
ATOM   3643 C CD    . LYS E 3 91  ? 48.844  92.701  41.497  1.00 124.99 ? 127 LYS B CD    1 
ATOM   3644 C CE    . LYS E 3 91  ? 49.573  93.524  40.442  1.00 112.71 ? 127 LYS B CE    1 
ATOM   3645 N NZ    . LYS E 3 91  ? 49.645  94.965  40.808  1.00 128.02 ? 127 LYS B NZ    1 
ATOM   3646 N N     . ASP E 3 92  ? 45.753  90.683  44.952  1.00 130.73 ? 128 ASP B N     1 
ATOM   3647 C CA    . ASP E 3 92  ? 44.779  90.047  45.831  1.00 111.62 ? 128 ASP B CA    1 
ATOM   3648 C C     . ASP E 3 92  ? 45.264  90.246  47.259  1.00 103.69 ? 128 ASP B C     1 
ATOM   3649 O O     . ASP E 3 92  ? 46.096  89.487  47.755  1.00 93.25  ? 128 ASP B O     1 
ATOM   3650 C CB    . ASP E 3 92  ? 44.670  88.553  45.522  1.00 117.55 ? 128 ASP B CB    1 
ATOM   3651 C CG    . ASP E 3 92  ? 43.681  87.843  46.425  1.00 137.35 ? 128 ASP B CG    1 
ATOM   3652 O OD1   . ASP E 3 92  ? 43.846  87.907  47.661  1.00 139.79 ? 128 ASP B OD1   1 
ATOM   3653 O OD2   . ASP E 3 92  ? 42.738  87.216  45.900  1.00 137.58 ? 128 ASP B OD2   1 
ATOM   3654 N N     . MET E 3 93  ? 44.746  91.282  47.907  1.00 90.45  ? 129 MET B N     1 
ATOM   3655 C CA    . MET E 3 93  ? 45.134  91.599  49.272  1.00 88.32  ? 129 MET B CA    1 
ATOM   3656 C C     . MET E 3 93  ? 44.135  91.078  50.293  1.00 87.92  ? 129 MET B C     1 
ATOM   3657 O O     . MET E 3 93  ? 43.997  91.638  51.382  1.00 101.55 ? 129 MET B O     1 
ATOM   3658 C CB    . MET E 3 93  ? 45.286  93.111  49.426  1.00 74.46  ? 129 MET B CB    1 
ATOM   3659 C CG    . MET E 3 93  ? 46.567  93.660  48.844  1.00 76.66  ? 129 MET B CG    1 
ATOM   3660 S SD    . MET E 3 93  ? 48.004  93.129  49.795  1.00 119.35 ? 129 MET B SD    1 
ATOM   3661 C CE    . MET E 3 93  ? 49.015  92.434  48.530  1.00 82.75  ? 129 MET B CE    1 
ATOM   3662 N N     . THR E 3 94  ? 43.444  90.001  49.935  1.00 83.97  ? 130 THR B N     1 
ATOM   3663 C CA    . THR E 3 94  ? 42.451  89.402  50.816  1.00 79.81  ? 130 THR B CA    1 
ATOM   3664 C C     . THR E 3 94  ? 42.747  87.922  51.037  1.00 80.87  ? 130 THR B C     1 
ATOM   3665 O O     . THR E 3 94  ? 42.930  87.168  50.075  1.00 81.86  ? 130 THR B O     1 
ATOM   3666 C CB    . THR E 3 94  ? 41.019  89.540  50.225  1.00 99.81  ? 130 THR B CB    1 
ATOM   3667 O OG1   . THR E 3 94  ? 40.944  88.848  48.972  1.00 81.44  ? 130 THR B OG1   1 
ATOM   3668 C CG2   . THR E 3 94  ? 40.672  91.006  49.998  1.00 86.82  ? 130 THR B CG2   1 
ATOM   3669 N N     . ALA E 3 95  ? 42.797  87.509  52.302  1.00 78.86  ? 131 ALA B N     1 
ATOM   3670 C CA    . ALA E 3 95  ? 43.059  86.108  52.632  1.00 84.74  ? 131 ALA B CA    1 
ATOM   3671 C C     . ALA E 3 95  ? 41.775  85.371  53.028  1.00 76.93  ? 131 ALA B C     1 
ATOM   3672 O O     . ALA E 3 95  ? 40.929  85.914  53.731  1.00 72.95  ? 131 ALA B O     1 
ATOM   3673 C CB    . ALA E 3 95  ? 44.105  86.010  53.761  1.00 46.95  ? 131 ALA B CB    1 
ATOM   3674 N N     . GLN E 3 96  ? 41.635  84.138  52.549  1.00 70.14  ? 132 GLN B N     1 
ATOM   3675 C CA    . GLN E 3 96  ? 40.475  83.306  52.844  1.00 70.99  ? 132 GLN B CA    1 
ATOM   3676 C C     . GLN E 3 96  ? 40.981  81.985  53.407  1.00 79.73  ? 132 GLN B C     1 
ATOM   3677 O O     . GLN E 3 96  ? 41.836  81.344  52.794  1.00 112.75 ? 132 GLN B O     1 
ATOM   3678 C CB    . GLN E 3 96  ? 39.669  83.034  51.574  1.00 55.42  ? 132 GLN B CB    1 
ATOM   3679 C CG    . GLN E 3 96  ? 38.521  82.072  51.812  1.00 100.37 ? 132 GLN B CG    1 
ATOM   3680 C CD    . GLN E 3 96  ? 37.858  81.607  50.534  1.00 75.87  ? 132 GLN B CD    1 
ATOM   3681 O OE1   . GLN E 3 96  ? 38.517  81.077  49.641  1.00 83.23  ? 132 GLN B OE1   1 
ATOM   3682 N NE2   . GLN E 3 96  ? 36.542  81.788  50.446  1.00 94.44  ? 132 GLN B NE2   1 
ATOM   3683 N N     . PHE E 3 97  ? 40.450  81.565  54.555  1.00 75.94  ? 133 PHE B N     1 
ATOM   3684 C CA    . PHE E 3 97  ? 40.904  80.319  55.178  1.00 75.36  ? 133 PHE B CA    1 
ATOM   3685 C C     . PHE E 3 97  ? 39.903  79.163  55.115  1.00 63.89  ? 133 PHE B C     1 
ATOM   3686 O O     . PHE E 3 97  ? 39.097  78.973  56.022  1.00 61.52  ? 133 PHE B O     1 
ATOM   3687 C CB    . PHE E 3 97  ? 41.281  80.559  56.642  1.00 47.66  ? 133 PHE B CB    1 
ATOM   3688 C CG    . PHE E 3 97  ? 42.227  81.709  56.858  1.00 62.51  ? 133 PHE B CG    1 
ATOM   3689 C CD1   . PHE E 3 97  ? 41.884  83.001  56.462  1.00 49.76  ? 133 PHE B CD1   1 
ATOM   3690 C CD2   . PHE E 3 97  ? 43.436  81.511  57.517  1.00 65.06  ? 133 PHE B CD2   1 
ATOM   3691 C CE1   . PHE E 3 97  ? 42.736  84.087  56.729  1.00 24.01  ? 133 PHE B CE1   1 
ATOM   3692 C CE2   . PHE E 3 97  ? 44.294  82.580  57.789  1.00 53.17  ? 133 PHE B CE2   1 
ATOM   3693 C CZ    . PHE E 3 97  ? 43.944  83.870  57.396  1.00 62.45  ? 133 PHE B CZ    1 
ATOM   3694 N N     . ASN E 3 98  ? 39.961  78.387  54.042  1.00 71.72  ? 134 ASN B N     1 
ATOM   3695 C CA    . ASN E 3 98  ? 39.068  77.251  53.890  1.00 79.33  ? 134 ASN B CA    1 
ATOM   3696 C C     . ASN E 3 98  ? 39.330  76.276  55.033  1.00 85.53  ? 134 ASN B C     1 
ATOM   3697 O O     . ASN E 3 98  ? 38.729  76.384  56.100  1.00 117.17 ? 134 ASN B O     1 
ATOM   3698 C CB    . ASN E 3 98  ? 39.314  76.584  52.535  1.00 62.88  ? 134 ASN B CB    1 
ATOM   3699 C CG    . ASN E 3 98  ? 40.714  76.855  51.999  1.00 81.60  ? 134 ASN B CG    1 
ATOM   3700 O OD1   . ASN E 3 98  ? 41.707  76.304  52.486  1.00 76.47  ? 134 ASN B OD1   1 
ATOM   3701 N ND2   . ASN E 3 98  ? 40.798  77.727  50.999  1.00 95.24  ? 134 ASN B ND2   1 
ATOM   3702 N N     . ASN E 3 99  ? 40.244  75.339  54.808  1.00 90.00  ? 135 ASN B N     1 
ATOM   3703 C CA    . ASN E 3 99  ? 40.602  74.342  55.813  1.00 74.20  ? 135 ASN B CA    1 
ATOM   3704 C C     . ASN E 3 99  ? 41.134  74.988  57.089  1.00 78.34  ? 135 ASN B C     1 
ATOM   3705 O O     . ASN E 3 99  ? 42.278  75.436  57.141  1.00 84.87  ? 135 ASN B O     1 
ATOM   3706 C CB    . ASN E 3 99  ? 41.657  73.390  55.250  1.00 77.23  ? 135 ASN B CB    1 
ATOM   3707 C CG    . ASN E 3 99  ? 42.244  72.487  56.306  1.00 69.70  ? 135 ASN B CG    1 
ATOM   3708 O OD1   . ASN E 3 99  ? 41.540  71.676  56.903  1.00 107.36 ? 135 ASN B OD1   1 
ATOM   3709 N ND2   . ASN E 3 99  ? 43.542  72.625  56.547  1.00 90.16  ? 135 ASN B ND2   1 
ATOM   3710 N N     . LEU E 3 100 ? 40.296  75.014  58.121  1.00 84.99  ? 136 LEU B N     1 
ATOM   3711 C CA    . LEU E 3 100 ? 40.657  75.607  59.404  1.00 84.16  ? 136 LEU B CA    1 
ATOM   3712 C C     . LEU E 3 100 ? 39.820  74.963  60.510  1.00 88.40  ? 136 LEU B C     1 
ATOM   3713 O O     . LEU E 3 100 ? 38.612  75.173  60.574  1.00 84.78  ? 136 LEU B O     1 
ATOM   3714 C CB    . LEU E 3 100 ? 40.396  77.114  59.345  1.00 59.10  ? 136 LEU B CB    1 
ATOM   3715 C CG    . LEU E 3 100 ? 40.800  78.035  60.496  1.00 60.00  ? 136 LEU B CG    1 
ATOM   3716 C CD1   . LEU E 3 100 ? 42.258  77.820  60.887  1.00 41.64  ? 136 LEU B CD1   1 
ATOM   3717 C CD2   . LEU E 3 100 ? 40.569  79.476  60.043  1.00 36.59  ? 136 LEU B CD2   1 
ATOM   3718 N N     . GLY E 3 101 ? 40.460  74.170  61.366  1.00 74.08  ? 137 GLY B N     1 
ATOM   3719 C CA    . GLY E 3 101 ? 39.741  73.514  62.445  1.00 68.91  ? 137 GLY B CA    1 
ATOM   3720 C C     . GLY E 3 101 ? 40.280  73.847  63.825  1.00 81.05  ? 137 GLY B C     1 
ATOM   3721 O O     . GLY E 3 101 ? 41.363  74.416  63.953  1.00 99.92  ? 137 GLY B O     1 
ATOM   3722 N N     . VAL E 3 102 ? 39.531  73.491  64.864  1.00 76.92  ? 138 VAL B N     1 
ATOM   3723 C CA    . VAL E 3 102 ? 39.960  73.760  66.235  1.00 77.49  ? 138 VAL B CA    1 
ATOM   3724 C C     . VAL E 3 102 ? 40.128  72.492  67.090  1.00 74.67  ? 138 VAL B C     1 
ATOM   3725 O O     . VAL E 3 102 ? 39.252  71.615  67.119  1.00 77.78  ? 138 VAL B O     1 
ATOM   3726 C CB    . VAL E 3 102 ? 38.972  74.712  66.936  1.00 71.67  ? 138 VAL B CB    1 
ATOM   3727 C CG1   . VAL E 3 102 ? 37.551  74.230  66.730  1.00 123.58 ? 138 VAL B CG1   1 
ATOM   3728 C CG2   . VAL E 3 102 ? 39.295  74.797  68.419  1.00 101.62 ? 138 VAL B CG2   1 
ATOM   3729 N N     . LEU E 3 103 ? 41.262  72.400  67.783  1.00 54.12  ? 139 LEU B N     1 
ATOM   3730 C CA    . LEU E 3 103 ? 41.546  71.252  68.638  1.00 57.12  ? 139 LEU B CA    1 
ATOM   3731 C C     . LEU E 3 103 ? 41.006  71.479  70.048  1.00 60.84  ? 139 LEU B C     1 
ATOM   3732 O O     . LEU E 3 103 ? 41.418  72.404  70.751  1.00 58.04  ? 139 LEU B O     1 
ATOM   3733 C CB    . LEU E 3 103 ? 43.049  71.002  68.710  1.00 44.08  ? 139 LEU B CB    1 
ATOM   3734 C CG    . LEU E 3 103 ? 43.485  69.981  69.766  1.00 49.80  ? 139 LEU B CG    1 
ATOM   3735 C CD1   . LEU E 3 103 ? 43.120  68.574  69.314  1.00 55.38  ? 139 LEU B CD1   1 
ATOM   3736 C CD2   . LEU E 3 103 ? 44.980  70.105  70.005  1.00 46.42  ? 139 LEU B CD2   1 
ATOM   3737 N N     . HIS E 3 104 ? 40.083  70.621  70.457  1.00 73.09  ? 140 HIS B N     1 
ATOM   3738 C CA    . HIS E 3 104 ? 39.474  70.727  71.773  1.00 76.61  ? 140 HIS B CA    1 
ATOM   3739 C C     . HIS E 3 104 ? 40.311  69.976  72.813  1.00 74.88  ? 140 HIS B C     1 
ATOM   3740 O O     . HIS E 3 104 ? 40.466  68.753  72.746  1.00 87.16  ? 140 HIS B O     1 
ATOM   3741 C CB    . HIS E 3 104 ? 38.047  70.173  71.712  1.00 79.82  ? 140 HIS B CB    1 
ATOM   3742 C CG    . HIS E 3 104 ? 37.228  70.458  72.932  1.00 70.90  ? 140 HIS B CG    1 
ATOM   3743 N ND1   . HIS E 3 104 ? 37.580  70.010  74.188  1.00 61.23  ? 140 HIS B ND1   1 
ATOM   3744 C CD2   . HIS E 3 104 ? 36.060  71.125  73.084  1.00 70.39  ? 140 HIS B CD2   1 
ATOM   3745 C CE1   . HIS E 3 104 ? 36.665  70.388  75.061  1.00 54.43  ? 140 HIS B CE1   1 
ATOM   3746 N NE2   . HIS E 3 104 ? 35.731  71.067  74.417  1.00 64.95  ? 140 HIS B NE2   1 
ATOM   3747 N N     . VAL E 3 105 ? 40.864  70.722  73.764  1.00 53.30  ? 141 VAL B N     1 
ATOM   3748 C CA    . VAL E 3 105 ? 41.677  70.147  74.829  1.00 57.50  ? 141 VAL B CA    1 
ATOM   3749 C C     . VAL E 3 105 ? 40.763  69.841  76.013  1.00 66.72  ? 141 VAL B C     1 
ATOM   3750 O O     . VAL E 3 105 ? 39.959  70.683  76.407  1.00 92.54  ? 141 VAL B O     1 
ATOM   3751 C CB    . VAL E 3 105 ? 42.777  71.133  75.269  1.00 74.70  ? 141 VAL B CB    1 
ATOM   3752 C CG1   . VAL E 3 105 ? 42.160  72.459  75.675  1.00 74.56  ? 141 VAL B CG1   1 
ATOM   3753 C CG2   . VAL E 3 105 ? 43.574  70.547  76.416  1.00 82.36  ? 141 VAL B CG2   1 
ATOM   3754 N N     . THR E 3 106 ? 40.882  68.638  76.572  1.00 71.08  ? 142 THR B N     1 
ATOM   3755 C CA    . THR E 3 106 ? 40.048  68.225  77.694  1.00 64.57  ? 142 THR B CA    1 
ATOM   3756 C C     . THR E 3 106 ? 40.169  69.138  78.896  1.00 67.75  ? 142 THR B C     1 
ATOM   3757 O O     . THR E 3 106 ? 41.171  69.837  79.066  1.00 59.01  ? 142 THR B O     1 
ATOM   3758 C CB    . THR E 3 106 ? 40.391  66.812  78.174  1.00 48.73  ? 142 THR B CB    1 
ATOM   3759 O OG1   . THR E 3 106 ? 41.780  66.745  78.514  1.00 118.10 ? 142 THR B OG1   1 
ATOM   3760 C CG2   . THR E 3 106 ? 40.074  65.796  77.105  1.00 84.61  ? 142 THR B CG2   1 
ATOM   3761 N N     . LYS E 3 107 ? 39.136  69.115  79.734  1.00 68.72  ? 143 LYS B N     1 
ATOM   3762 C CA    . LYS E 3 107 ? 39.100  69.919  80.947  1.00 73.11  ? 143 LYS B CA    1 
ATOM   3763 C C     . LYS E 3 107 ? 40.259  69.501  81.851  1.00 75.98  ? 143 LYS B C     1 
ATOM   3764 O O     . LYS E 3 107 ? 40.930  70.338  82.451  1.00 51.67  ? 143 LYS B O     1 
ATOM   3765 C CB    . LYS E 3 107 ? 37.767  69.704  81.675  1.00 60.63  ? 143 LYS B CB    1 
ATOM   3766 C CG    . LYS E 3 107 ? 37.565  70.596  82.898  1.00 71.18  ? 143 LYS B CG    1 
ATOM   3767 C CD    . LYS E 3 107 ? 36.393  70.130  83.767  1.00 91.41  ? 143 LYS B CD    1 
ATOM   3768 C CE    . LYS E 3 107 ? 36.332  70.918  85.079  1.00 119.80 ? 143 LYS B CE    1 
ATOM   3769 N NZ    . LYS E 3 107 ? 35.414  70.319  86.097  1.00 66.00  ? 143 LYS B NZ    1 
ATOM   3770 N N     . LYS E 3 108 ? 40.490  68.195  81.929  1.00 76.33  ? 144 LYS B N     1 
ATOM   3771 C CA    . LYS E 3 108 ? 41.552  67.629  82.750  1.00 66.82  ? 144 LYS B CA    1 
ATOM   3772 C C     . LYS E 3 108 ? 42.946  67.903  82.177  1.00 70.72  ? 144 LYS B C     1 
ATOM   3773 O O     . LYS E 3 108 ? 43.956  67.510  82.760  1.00 62.81  ? 144 LYS B O     1 
ATOM   3774 C CB    . LYS E 3 108 ? 41.307  66.120  82.894  1.00 90.97  ? 144 LYS B CB    1 
ATOM   3775 C CG    . LYS E 3 108 ? 42.379  65.320  83.632  1.00 59.01  ? 144 LYS B CG    1 
ATOM   3776 C CD    . LYS E 3 108 ? 41.808  63.995  84.166  1.00 80.34  ? 144 LYS B CD    1 
ATOM   3777 C CE    . LYS E 3 108 ? 41.137  63.161  83.065  1.00 125.85 ? 144 LYS B CE    1 
ATOM   3778 N NZ    . LYS E 3 108 ? 40.357  61.982  83.577  1.00 61.10  ? 144 LYS B NZ    1 
ATOM   3779 N N     . ASN E 3 109 ? 43.007  68.588  81.040  1.00 69.59  ? 145 ASN B N     1 
ATOM   3780 C CA    . ASN E 3 109 ? 44.289  68.889  80.418  1.00 64.31  ? 145 ASN B CA    1 
ATOM   3781 C C     . ASN E 3 109 ? 44.457  70.349  80.052  1.00 65.04  ? 145 ASN B C     1 
ATOM   3782 O O     . ASN E 3 109 ? 45.575  70.809  79.821  1.00 69.68  ? 145 ASN B O     1 
ATOM   3783 C CB    . ASN E 3 109 ? 44.481  68.035  79.169  1.00 62.46  ? 145 ASN B CB    1 
ATOM   3784 C CG    . ASN E 3 109 ? 45.028  66.665  79.485  1.00 103.84 ? 145 ASN B CG    1 
ATOM   3785 O OD1   . ASN E 3 109 ? 44.994  65.759  78.649  1.00 87.63  ? 145 ASN B OD1   1 
ATOM   3786 N ND2   . ASN E 3 109 ? 45.553  66.505  80.695  1.00 87.33  ? 145 ASN B ND2   1 
ATOM   3787 N N     . MET E 3 110 ? 43.355  71.086  79.995  1.00 69.42  ? 146 MET B N     1 
ATOM   3788 C CA    . MET E 3 110 ? 43.443  72.497  79.650  1.00 92.08  ? 146 MET B CA    1 
ATOM   3789 C C     . MET E 3 110 ? 44.354  73.203  80.659  1.00 92.84  ? 146 MET B C     1 
ATOM   3790 O O     . MET E 3 110 ? 44.612  74.401  80.561  1.00 120.60 ? 146 MET B O     1 
ATOM   3791 C CB    . MET E 3 110 ? 42.039  73.124  79.605  1.00 78.25  ? 146 MET B CB    1 
ATOM   3792 C CG    . MET E 3 110 ? 41.343  73.242  80.936  1.00 116.90 ? 146 MET B CG    1 
ATOM   3793 S SD    . MET E 3 110 ? 41.962  74.657  81.837  1.00 119.09 ? 146 MET B SD    1 
ATOM   3794 C CE    . MET E 3 110 ? 41.070  75.950  81.004  1.00 56.95  ? 146 MET B CE    1 
ATOM   3795 N N     . MET E 3 111 ? 44.847  72.435  81.625  1.00 104.24 ? 147 MET B N     1 
ATOM   3796 C CA    . MET E 3 111 ? 45.756  72.943  82.642  1.00 105.25 ? 147 MET B CA    1 
ATOM   3797 C C     . MET E 3 111 ? 47.176  72.888  82.082  1.00 93.09  ? 147 MET B C     1 
ATOM   3798 O O     . MET E 3 111 ? 47.666  73.865  81.510  1.00 63.03  ? 147 MET B O     1 
ATOM   3799 C CB    . MET E 3 111 ? 45.645  72.090  83.917  1.00 134.74 ? 147 MET B CB    1 
ATOM   3800 C CG    . MET E 3 111 ? 46.834  72.174  84.887  1.00 134.13 ? 147 MET B CG    1 
ATOM   3801 S SD    . MET E 3 111 ? 47.169  73.796  85.623  1.00 124.03 ? 147 MET B SD    1 
ATOM   3802 C CE    . MET E 3 111 ? 46.354  73.643  87.242  1.00 96.69  ? 147 MET B CE    1 
ATOM   3803 N N     . GLY E 3 112 ? 47.823  71.734  82.235  1.00 74.36  ? 148 GLY B N     1 
ATOM   3804 C CA    . GLY E 3 112 ? 49.181  71.564  81.746  1.00 82.93  ? 148 GLY B CA    1 
ATOM   3805 C C     . GLY E 3 112 ? 49.404  72.166  80.371  1.00 89.91  ? 148 GLY B C     1 
ATOM   3806 O O     . GLY E 3 112 ? 50.531  72.481  79.988  1.00 96.13  ? 148 GLY B O     1 
ATOM   3807 N N     . THR E 3 113 ? 48.322  72.322  79.620  1.00 83.11  ? 149 THR B N     1 
ATOM   3808 C CA    . THR E 3 113 ? 48.401  72.893  78.290  1.00 71.91  ? 149 THR B CA    1 
ATOM   3809 C C     . THR E 3 113 ? 48.704  74.381  78.377  1.00 81.71  ? 149 THR B C     1 
ATOM   3810 O O     . THR E 3 113 ? 49.848  74.791  78.214  1.00 76.35  ? 149 THR B O     1 
ATOM   3811 C CB    . THR E 3 113 ? 47.073  72.688  77.522  1.00 82.40  ? 149 THR B CB    1 
ATOM   3812 O OG1   . THR E 3 113 ? 46.921  71.300  77.197  1.00 69.18  ? 149 THR B OG1   1 
ATOM   3813 C CG2   . THR E 3 113 ? 47.039  73.532  76.245  1.00 40.21  ? 149 THR B CG2   1 
ATOM   3814 N N     . MET E 3 114 ? 47.674  75.176  78.650  1.00 99.64  ? 150 MET B N     1 
ATOM   3815 C CA    . MET E 3 114 ? 47.801  76.627  78.736  1.00 109.69 ? 150 MET B CA    1 
ATOM   3816 C C     . MET E 3 114 ? 49.087  77.077  79.421  1.00 104.44 ? 150 MET B C     1 
ATOM   3817 O O     . MET E 3 114 ? 49.711  78.045  78.998  1.00 104.46 ? 150 MET B O     1 
ATOM   3818 C CB    . MET E 3 114 ? 46.585  77.226  79.449  1.00 94.79  ? 150 MET B CB    1 
ATOM   3819 C CG    . MET E 3 114 ? 46.346  78.690  79.113  1.00 122.54 ? 150 MET B CG    1 
ATOM   3820 S SD    . MET E 3 114 ? 46.334  79.022  77.319  1.00 126.79 ? 150 MET B SD    1 
ATOM   3821 C CE    . MET E 3 114 ? 46.996  80.715  77.246  1.00 57.64  ? 150 MET B CE    1 
ATOM   3822 N N     . ILE E 3 115 ? 49.488  76.370  80.472  1.00 98.58  ? 151 ILE B N     1 
ATOM   3823 C CA    . ILE E 3 115 ? 50.715  76.715  81.183  1.00 102.63 ? 151 ILE B CA    1 
ATOM   3824 C C     . ILE E 3 115 ? 51.898  76.556  80.236  1.00 86.83  ? 151 ILE B C     1 
ATOM   3825 O O     . ILE E 3 115 ? 52.715  77.460  80.084  1.00 73.49  ? 151 ILE B O     1 
ATOM   3826 C CB    . ILE E 3 115 ? 50.912  75.816  82.434  1.00 118.81 ? 151 ILE B CB    1 
ATOM   3827 C CG1   . ILE E 3 115 ? 52.255  76.118  83.098  1.00 133.53 ? 151 ILE B CG1   1 
ATOM   3828 C CG2   . ILE E 3 115 ? 50.842  74.358  82.051  1.00 132.80 ? 151 ILE B CG2   1 
ATOM   3829 C CD1   . ILE E 3 115 ? 52.482  75.341  84.380  1.00 127.21 ? 151 ILE B CD1   1 
ATOM   3830 N N     . GLN E 3 116 ? 51.968  75.397  79.592  1.00 85.97  ? 152 GLN B N     1 
ATOM   3831 C CA    . GLN E 3 116 ? 53.023  75.080  78.635  1.00 88.15  ? 152 GLN B CA    1 
ATOM   3832 C C     . GLN E 3 116 ? 52.994  76.075  77.481  1.00 85.48  ? 152 GLN B C     1 
ATOM   3833 O O     . GLN E 3 116 ? 54.034  76.509  76.990  1.00 88.89  ? 152 GLN B O     1 
ATOM   3834 C CB    . GLN E 3 116 ? 52.817  73.664  78.097  1.00 89.71  ? 152 GLN B CB    1 
ATOM   3835 C CG    . GLN E 3 116 ? 53.809  73.230  77.042  1.00 91.71  ? 152 GLN B CG    1 
ATOM   3836 C CD    . GLN E 3 116 ? 53.461  71.873  76.463  1.00 128.47 ? 152 GLN B CD    1 
ATOM   3837 O OE1   . GLN E 3 116 ? 53.310  70.892  77.196  1.00 136.12 ? 152 GLN B OE1   1 
ATOM   3838 N NE2   . GLN E 3 116 ? 53.329  71.807  75.142  1.00 130.97 ? 152 GLN B NE2   1 
ATOM   3839 N N     . LYS E 3 117 ? 51.788  76.421  77.050  1.00 75.36  ? 153 LYS B N     1 
ATOM   3840 C CA    . LYS E 3 117 ? 51.605  77.368  75.962  1.00 77.92  ? 153 LYS B CA    1 
ATOM   3841 C C     . LYS E 3 117 ? 52.151  78.731  76.385  1.00 82.43  ? 153 LYS B C     1 
ATOM   3842 O O     . LYS E 3 117 ? 52.576  79.537  75.552  1.00 81.50  ? 153 LYS B O     1 
ATOM   3843 C CB    . LYS E 3 117 ? 50.114  77.464  75.613  1.00 58.85  ? 153 LYS B CB    1 
ATOM   3844 C CG    . LYS E 3 117 ? 49.773  78.514  74.574  1.00 75.80  ? 153 LYS B CG    1 
ATOM   3845 C CD    . LYS E 3 117 ? 48.344  78.364  74.066  1.00 118.61 ? 153 LYS B CD    1 
ATOM   3846 C CE    . LYS E 3 117 ? 48.148  77.045  73.327  1.00 91.44  ? 153 LYS B CE    1 
ATOM   3847 N NZ    . LYS E 3 117 ? 46.811  76.962  72.674  1.00 90.79  ? 153 LYS B NZ    1 
ATOM   3848 N N     . LEU E 3 118 ? 52.139  78.975  77.692  1.00 94.67  ? 154 LEU B N     1 
ATOM   3849 C CA    . LEU E 3 118 ? 52.636  80.227  78.246  1.00 92.03  ? 154 LEU B CA    1 
ATOM   3850 C C     . LEU E 3 118 ? 54.153  80.196  78.265  1.00 86.03  ? 154 LEU B C     1 
ATOM   3851 O O     . LEU E 3 118 ? 54.811  81.175  77.921  1.00 72.98  ? 154 LEU B O     1 
ATOM   3852 C CB    . LEU E 3 118 ? 52.114  80.425  79.674  1.00 102.75 ? 154 LEU B CB    1 
ATOM   3853 C CG    . LEU E 3 118 ? 50.875  81.302  79.896  1.00 95.80  ? 154 LEU B CG    1 
ATOM   3854 C CD1   . LEU E 3 118 ? 51.200  82.702  79.427  1.00 96.39  ? 154 LEU B CD1   1 
ATOM   3855 C CD2   . LEU E 3 118 ? 49.670  80.763  79.149  1.00 99.97  ? 154 LEU B CD2   1 
ATOM   3856 N N     . GLN E 3 119 ? 54.703  79.059  78.674  1.00 83.28  ? 155 GLN B N     1 
ATOM   3857 C CA    . GLN E 3 119 ? 56.144  78.911  78.735  1.00 83.02  ? 155 GLN B CA    1 
ATOM   3858 C C     . GLN E 3 119 ? 56.751  79.335  77.408  1.00 80.34  ? 155 GLN B C     1 
ATOM   3859 O O     . GLN E 3 119 ? 57.765  80.027  77.374  1.00 92.10  ? 155 GLN B O     1 
ATOM   3860 C CB    . GLN E 3 119 ? 56.517  77.463  79.080  1.00 59.53  ? 155 GLN B CB    1 
ATOM   3861 C CG    . GLN E 3 119 ? 56.065  77.076  80.487  1.00 76.02  ? 155 GLN B CG    1 
ATOM   3862 C CD    . GLN E 3 119 ? 56.443  75.664  80.899  1.00 84.50  ? 155 GLN B CD    1 
ATOM   3863 O OE1   . GLN E 3 119 ? 56.073  75.212  81.982  1.00 94.21  ? 155 GLN B OE1   1 
ATOM   3864 N NE2   . GLN E 3 119 ? 57.180  74.964  80.047  1.00 69.11  ? 155 GLN B NE2   1 
ATOM   3865 N N     . ARG E 3 120 ? 56.116  78.948  76.311  1.00 79.62  ? 156 ARG B N     1 
ATOM   3866 C CA    . ARG E 3 120 ? 56.636  79.314  75.007  1.00 87.03  ? 156 ARG B CA    1 
ATOM   3867 C C     . ARG E 3 120 ? 56.582  80.821  74.772  1.00 81.29  ? 156 ARG B C     1 
ATOM   3868 O O     . ARG E 3 120 ? 57.559  81.410  74.317  1.00 75.99  ? 156 ARG B O     1 
ATOM   3869 C CB    . ARG E 3 120 ? 55.886  78.552  73.917  1.00 88.85  ? 156 ARG B CB    1 
ATOM   3870 C CG    . ARG E 3 120 ? 56.050  77.048  74.077  1.00 116.57 ? 156 ARG B CG    1 
ATOM   3871 C CD    . ARG E 3 120 ? 55.520  76.238  72.905  1.00 108.56 ? 156 ARG B CD    1 
ATOM   3872 N NE    . ARG E 3 120 ? 55.665  74.806  73.166  1.00 135.32 ? 156 ARG B NE    1 
ATOM   3873 C CZ    . ARG E 3 120 ? 56.829  74.195  73.377  1.00 137.87 ? 156 ARG B CZ    1 
ATOM   3874 N NH1   . ARG E 3 120 ? 57.963  74.884  73.353  1.00 126.78 ? 156 ARG B NH1   1 
ATOM   3875 N NH2   . ARG E 3 120 ? 56.858  72.891  73.627  1.00 121.50 ? 156 ARG B NH2   1 
ATOM   3876 N N     . GLN E 3 121 ? 55.462  81.456  75.098  1.00 93.75  ? 157 GLN B N     1 
ATOM   3877 C CA    . GLN E 3 121 ? 55.358  82.901  74.905  1.00 120.18 ? 157 GLN B CA    1 
ATOM   3878 C C     . GLN E 3 121 ? 56.448  83.591  75.731  1.00 127.38 ? 157 GLN B C     1 
ATOM   3879 O O     . GLN E 3 121 ? 56.687  84.792  75.597  1.00 137.42 ? 157 GLN B O     1 
ATOM   3880 C CB    . GLN E 3 121 ? 53.964  83.405  75.319  1.00 138.57 ? 157 GLN B CB    1 
ATOM   3881 C CG    . GLN E 3 121 ? 53.733  83.599  76.823  1.00 140.73 ? 157 GLN B CG    1 
ATOM   3882 C CD    . GLN E 3 121 ? 54.160  84.976  77.324  1.00 140.73 ? 157 GLN B CD    1 
ATOM   3883 O OE1   . GLN E 3 121 ? 53.667  86.004  76.853  1.00 135.16 ? 157 GLN B OE1   1 
ATOM   3884 N NE2   . GLN E 3 121 ? 55.076  84.998  78.287  1.00 132.66 ? 157 GLN B NE2   1 
ATOM   3885 N N     . ARG E 3 122 ? 57.107  82.811  76.581  1.00 115.71 ? 158 ARG B N     1 
ATOM   3886 C CA    . ARG E 3 122 ? 58.179  83.310  77.433  1.00 103.00 ? 158 ARG B CA    1 
ATOM   3887 C C     . ARG E 3 122 ? 59.459  82.598  77.029  1.00 93.28  ? 158 ARG B C     1 
ATOM   3888 O O     . ARG E 3 122 ? 60.075  82.925  76.016  1.00 84.64  ? 158 ARG B O     1 
ATOM   3889 C CB    . ARG E 3 122 ? 57.871  83.001  78.900  1.00 112.78 ? 158 ARG B CB    1 
ATOM   3890 C CG    . ARG E 3 122 ? 58.833  83.629  79.902  1.00 128.46 ? 158 ARG B CG    1 
ATOM   3891 C CD    . ARG E 3 122 ? 58.658  85.138  79.937  1.00 140.73 ? 158 ARG B CD    1 
ATOM   3892 N NE    . ARG E 3 122 ? 57.246  85.497  80.050  1.00 140.73 ? 158 ARG B NE    1 
ATOM   3893 C CZ    . ARG E 3 122 ? 56.784  86.743  80.061  1.00 133.24 ? 158 ARG B CZ    1 
ATOM   3894 N NH1   . ARG E 3 122 ? 57.620  87.769  79.969  1.00 127.64 ? 158 ARG B NH1   1 
ATOM   3895 N NH2   . ARG E 3 122 ? 55.479  86.960  80.154  1.00 119.11 ? 158 ARG B NH2   1 
ATOM   3896 N N     . LEU E 3 123 ? 59.828  81.607  77.836  1.00 96.10  ? 159 LEU B N     1 
ATOM   3897 C CA    . LEU E 3 123 ? 61.020  80.789  77.638  1.00 94.84  ? 159 LEU B CA    1 
ATOM   3898 C C     . LEU E 3 123 ? 61.374  80.527  76.181  1.00 83.56  ? 159 LEU B C     1 
ATOM   3899 O O     . LEU E 3 123 ? 62.537  80.638  75.797  1.00 92.48  ? 159 LEU B O     1 
ATOM   3900 C CB    . LEU E 3 123 ? 60.850  79.455  78.379  1.00 116.49 ? 159 LEU B CB    1 
ATOM   3901 C CG    . LEU E 3 123 ? 61.837  78.300  78.169  1.00 132.46 ? 159 LEU B CG    1 
ATOM   3902 C CD1   . LEU E 3 123 ? 61.558  77.615  76.842  1.00 140.73 ? 159 LEU B CD1   1 
ATOM   3903 C CD2   . LEU E 3 123 ? 63.266  78.815  78.241  1.00 139.86 ? 159 LEU B CD2   1 
ATOM   3904 N N     . ARG E 3 124 ? 60.382  80.175  75.370  1.00 95.14  ? 160 ARG B N     1 
ATOM   3905 C CA    . ARG E 3 124 ? 60.642  79.895  73.963  1.00 117.81 ? 160 ARG B CA    1 
ATOM   3906 C C     . ARG E 3 124 ? 61.325  81.081  73.289  1.00 121.04 ? 160 ARG B C     1 
ATOM   3907 O O     . ARG E 3 124 ? 62.439  80.954  72.777  1.00 129.74 ? 160 ARG B O     1 
ATOM   3908 C CB    . ARG E 3 124 ? 59.344  79.551  73.230  1.00 131.96 ? 160 ARG B CB    1 
ATOM   3909 C CG    . ARG E 3 124 ? 59.480  78.416  72.221  1.00 140.73 ? 160 ARG B CG    1 
ATOM   3910 C CD    . ARG E 3 124 ? 59.982  77.132  72.889  1.00 140.73 ? 160 ARG B CD    1 
ATOM   3911 N NE    . ARG E 3 124 ? 61.420  77.166  73.156  1.00 133.76 ? 160 ARG B NE    1 
ATOM   3912 C CZ    . ARG E 3 124 ? 62.071  76.262  73.882  1.00 135.18 ? 160 ARG B CZ    1 
ATOM   3913 N NH1   . ARG E 3 124 ? 61.415  75.246  74.427  1.00 138.70 ? 160 ARG B NH1   1 
ATOM   3914 N NH2   . ARG E 3 124 ? 63.384  76.369  74.057  1.00 99.19  ? 160 ARG B NH2   1 
ATOM   3915 N N     . SER E 3 125 ? 60.662  82.232  73.288  1.00 131.27 ? 161 SER B N     1 
ATOM   3916 C CA    . SER E 3 125 ? 61.236  83.431  72.689  1.00 138.23 ? 161 SER B CA    1 
ATOM   3917 C C     . SER E 3 125 ? 62.157  84.098  73.709  1.00 140.50 ? 161 SER B C     1 
ATOM   3918 O O     . SER E 3 125 ? 62.276  83.626  74.842  1.00 140.73 ? 161 SER B O     1 
ATOM   3919 C CB    . SER E 3 125 ? 60.125  84.396  72.272  1.00 140.73 ? 161 SER B CB    1 
ATOM   3920 O OG    . SER E 3 125 ? 59.280  83.799  71.304  1.00 140.73 ? 161 SER B OG    1 
ATOM   3921 N N     . ARG E 3 126 ? 62.815  85.184  73.310  1.00 127.29 ? 162 ARG B N     1 
ATOM   3922 C CA    . ARG E 3 126 ? 63.716  85.895  74.214  1.00 123.20 ? 162 ARG B CA    1 
ATOM   3923 C C     . ARG E 3 126 ? 64.796  84.937  74.741  1.00 129.14 ? 162 ARG B C     1 
ATOM   3924 O O     . ARG E 3 126 ? 64.910  83.804  74.261  1.00 125.11 ? 162 ARG B O     1 
ATOM   3925 C CB    . ARG E 3 126 ? 62.910  86.500  75.369  1.00 75.08  ? 162 ARG B CB    1 
ATOM   3926 N N     . PRO E 3 127 ? 65.604  85.373  75.729  1.00 140.73 ? 163 PRO B N     1 
ATOM   3927 C CA    . PRO E 3 127 ? 66.639  84.468  76.240  1.00 140.73 ? 163 PRO B CA    1 
ATOM   3928 C C     . PRO E 3 127 ? 66.081  83.154  76.769  1.00 140.73 ? 163 PRO B C     1 
ATOM   3929 O O     . PRO E 3 127 ? 65.055  83.137  77.454  1.00 129.23 ? 163 PRO B O     1 
ATOM   3930 C CB    . PRO E 3 127 ? 67.314  85.296  77.333  1.00 140.73 ? 163 PRO B CB    1 
ATOM   3931 C CG    . PRO E 3 127 ? 66.214  86.194  77.806  1.00 140.73 ? 163 PRO B CG    1 
ATOM   3932 C CD    . PRO E 3 127 ? 65.602  86.630  76.499  1.00 140.73 ? 163 PRO B CD    1 
ATOM   3933 N N     . GLN E 3 128 ? 66.768  82.062  76.445  1.00 138.23 ? 164 GLN B N     1 
ATOM   3934 C CA    . GLN E 3 128 ? 66.355  80.728  76.870  1.00 138.55 ? 164 GLN B CA    1 
ATOM   3935 C C     . GLN E 3 128 ? 66.518  80.519  78.372  1.00 135.25 ? 164 GLN B C     1 
ATOM   3936 O O     . GLN E 3 128 ? 66.739  81.468  79.128  1.00 116.45 ? 164 GLN B O     1 
ATOM   3937 C CB    . GLN E 3 128 ? 67.159  79.661  76.123  1.00 125.07 ? 164 GLN B CB    1 
ATOM   3938 C CG    . GLN E 3 128 ? 68.662  79.831  76.247  1.00 129.13 ? 164 GLN B CG    1 
ATOM   3939 C CD    . GLN E 3 128 ? 69.421  78.543  75.987  1.00 137.52 ? 164 GLN B CD    1 
ATOM   3940 O OE1   . GLN E 3 128 ? 69.401  77.617  76.803  1.00 107.50 ? 164 GLN B OE1   1 
ATOM   3941 N NE2   . GLN E 3 128 ? 70.093  78.476  74.846  1.00 137.18 ? 164 GLN B NE2   1 
ATOM   3942 N N     . GLY E 3 129 ? 66.407  79.262  78.790  1.00 135.07 ? 165 GLY B N     1 
ATOM   3943 C CA    . GLY E 3 129 ? 66.541  78.931  80.194  1.00 130.68 ? 165 GLY B CA    1 
ATOM   3944 C C     . GLY E 3 129 ? 65.701  79.836  81.069  1.00 138.01 ? 165 GLY B C     1 
ATOM   3945 O O     . GLY E 3 129 ? 66.200  80.830  81.595  1.00 139.96 ? 165 GLY B O     1 
ATOM   3946 N N     . LEU E 3 130 ? 64.421  79.506  81.212  1.00 137.84 ? 166 LEU B N     1 
ATOM   3947 C CA    . LEU E 3 130 ? 63.524  80.297  82.046  1.00 119.38 ? 166 LEU B CA    1 
ATOM   3948 C C     . LEU E 3 130 ? 63.844  79.991  83.506  1.00 105.57 ? 166 LEU B C     1 
ATOM   3949 O O     . LEU E 3 130 ? 64.102  78.841  83.871  1.00 81.74  ? 166 LEU B O     1 
ATOM   3950 C CB    . LEU E 3 130 ? 62.054  79.986  81.708  1.00 109.89 ? 166 LEU B CB    1 
ATOM   3951 C CG    . LEU E 3 130 ? 61.404  78.596  81.825  1.00 98.73  ? 166 LEU B CG    1 
ATOM   3952 C CD1   . LEU E 3 130 ? 62.371  77.499  81.406  1.00 82.34  ? 166 LEU B CD1   1 
ATOM   3953 C CD2   . LEU E 3 130 ? 60.950  78.373  83.240  1.00 70.03  ? 166 LEU B CD2   1 
ATOM   3954 N N     . THR E 3 131 ? 63.849  81.030  84.334  1.00 97.76  ? 167 THR B N     1 
ATOM   3955 C CA    . THR E 3 131 ? 64.170  80.881  85.749  1.00 106.78 ? 167 THR B CA    1 
ATOM   3956 C C     . THR E 3 131 ? 62.963  80.510  86.606  1.00 98.03  ? 167 THR B C     1 
ATOM   3957 O O     . THR E 3 131 ? 61.849  80.980  86.367  1.00 73.57  ? 167 THR B O     1 
ATOM   3958 C CB    . THR E 3 131 ? 64.792  82.176  86.300  1.00 134.74 ? 167 THR B CB    1 
ATOM   3959 O OG1   . THR E 3 131 ? 65.898  82.563  85.473  1.00 140.73 ? 167 THR B OG1   1 
ATOM   3960 C CG2   . THR E 3 131 ? 65.277  81.965  87.731  1.00 140.73 ? 167 THR B CG2   1 
ATOM   3961 N N     . GLU E 3 132 ? 63.200  79.669  87.610  1.00 98.31  ? 168 GLU B N     1 
ATOM   3962 C CA    . GLU E 3 132 ? 62.144  79.218  88.509  1.00 92.98  ? 168 GLU B CA    1 
ATOM   3963 C C     . GLU E 3 132 ? 61.198  80.354  88.862  1.00 103.16 ? 168 GLU B C     1 
ATOM   3964 O O     . GLU E 3 132 ? 60.031  80.131  89.196  1.00 100.04 ? 168 GLU B O     1 
ATOM   3965 C CB    . GLU E 3 132 ? 62.753  78.629  89.782  1.00 65.81  ? 168 GLU B CB    1 
ATOM   3966 C CG    . GLU E 3 132 ? 63.542  77.357  89.543  1.00 78.41  ? 168 GLU B CG    1 
ATOM   3967 C CD    . GLU E 3 132 ? 64.196  76.835  90.807  1.00 124.65 ? 168 GLU B CD    1 
ATOM   3968 O OE1   . GLU E 3 132 ? 63.472  76.617  91.806  1.00 106.91 ? 168 GLU B OE1   1 
ATOM   3969 O OE2   . GLU E 3 132 ? 65.433  76.643  90.797  1.00 112.10 ? 168 GLU B OE2   1 
ATOM   3970 N N     . ALA E 3 133 ? 61.710  81.576  88.780  1.00 100.33 ? 169 ALA B N     1 
ATOM   3971 C CA    . ALA E 3 133 ? 60.911  82.753  89.071  1.00 122.59 ? 169 ALA B CA    1 
ATOM   3972 C C     . ALA E 3 133 ? 59.683  82.779  88.164  1.00 126.67 ? 169 ALA B C     1 
ATOM   3973 O O     . ALA E 3 133 ? 58.557  82.581  88.622  1.00 135.79 ? 169 ALA B O     1 
ATOM   3974 C CB    . ALA E 3 133 ? 61.747  84.010  88.863  1.00 140.23 ? 169 ALA B CB    1 
ATOM   3975 N N     . GLU E 3 134 ? 59.911  83.016  86.874  1.00 131.68 ? 170 GLU B N     1 
ATOM   3976 C CA    . GLU E 3 134 ? 58.830  83.073  85.898  1.00 123.29 ? 170 GLU B CA    1 
ATOM   3977 C C     . GLU E 3 134 ? 57.914  81.863  86.065  1.00 130.61 ? 170 GLU B C     1 
ATOM   3978 O O     . GLU E 3 134 ? 56.690  81.998  86.066  1.00 133.57 ? 170 GLU B O     1 
ATOM   3979 C CB    . GLU E 3 134 ? 59.392  83.094  84.474  1.00 134.53 ? 170 GLU B CB    1 
ATOM   3980 C CG    . GLU E 3 134 ? 60.536  84.081  84.237  1.00 87.99  ? 170 GLU B CG    1 
ATOM   3981 C CD    . GLU E 3 134 ? 61.909  83.488  84.544  1.00 101.83 ? 170 GLU B CD    1 
ATOM   3982 O OE1   . GLU E 3 134 ? 62.167  83.154  85.714  1.00 56.82  ? 170 GLU B OE1   1 
ATOM   3983 O OE2   . GLU E 3 134 ? 62.733  83.354  83.610  1.00 99.73  ? 170 GLU B OE2   1 
ATOM   3984 N N     . GLN E 3 135 ? 58.520  80.685  86.205  1.00 126.74 ? 171 GLN B N     1 
ATOM   3985 C CA    . GLN E 3 135 ? 57.782  79.436  86.385  1.00 112.34 ? 171 GLN B CA    1 
ATOM   3986 C C     . GLN E 3 135 ? 56.586  79.641  87.306  1.00 110.10 ? 171 GLN B C     1 
ATOM   3987 O O     . GLN E 3 135 ? 55.467  79.238  86.982  1.00 98.78  ? 171 GLN B O     1 
ATOM   3988 C CB    . GLN E 3 135 ? 58.712  78.365  86.965  1.00 109.13 ? 171 GLN B CB    1 
ATOM   3989 C CG    . GLN E 3 135 ? 58.022  77.098  87.467  1.00 133.09 ? 171 GLN B CG    1 
ATOM   3990 C CD    . GLN E 3 135 ? 57.206  76.391  86.399  1.00 132.34 ? 171 GLN B CD    1 
ATOM   3991 O OE1   . GLN E 3 135 ? 57.634  76.268  85.252  1.00 138.50 ? 171 GLN B OE1   1 
ATOM   3992 N NE2   . GLN E 3 135 ? 56.029  75.905  86.780  1.00 112.16 ? 171 GLN B NE2   1 
ATOM   3993 N N     . ARG E 3 136 ? 56.831  80.282  88.445  1.00 103.34 ? 172 ARG B N     1 
ATOM   3994 C CA    . ARG E 3 136 ? 55.782  80.552  89.425  1.00 108.61 ? 172 ARG B CA    1 
ATOM   3995 C C     . ARG E 3 136 ? 54.675  81.416  88.814  1.00 95.98  ? 172 ARG B C     1 
ATOM   3996 O O     . ARG E 3 136 ? 53.486  81.132  88.986  1.00 61.53  ? 172 ARG B O     1 
ATOM   3997 C CB    . ARG E 3 136 ? 56.376  81.263  90.650  1.00 126.32 ? 172 ARG B CB    1 
ATOM   3998 C CG    . ARG E 3 136 ? 55.647  80.986  91.967  1.00 140.73 ? 172 ARG B CG    1 
ATOM   3999 C CD    . ARG E 3 136 ? 55.942  79.574  92.478  1.00 140.73 ? 172 ARG B CD    1 
ATOM   4000 N NE    . ARG E 3 136 ? 55.248  79.262  93.729  1.00 140.73 ? 172 ARG B NE    1 
ATOM   4001 C CZ    . ARG E 3 136 ? 53.930  79.107  93.842  1.00 140.73 ? 172 ARG B CZ    1 
ATOM   4002 N NH1   . ARG E 3 136 ? 53.390  78.824  95.024  1.00 98.07  ? 172 ARG B NH1   1 
ATOM   4003 N NH2   . ARG E 3 136 ? 53.151  79.229  92.773  1.00 133.68 ? 172 ARG B NH2   1 
ATOM   4004 N N     . GLU E 3 137 ? 55.072  82.469  88.101  1.00 93.27  ? 173 GLU B N     1 
ATOM   4005 C CA    . GLU E 3 137 ? 54.119  83.378  87.468  1.00 99.24  ? 173 GLU B CA    1 
ATOM   4006 C C     . GLU E 3 137 ? 53.333  82.630  86.405  1.00 109.05 ? 173 GLU B C     1 
ATOM   4007 O O     . GLU E 3 137 ? 52.117  82.782  86.288  1.00 110.93 ? 173 GLU B O     1 
ATOM   4008 C CB    . GLU E 3 137 ? 54.839  84.541  86.791  1.00 92.13  ? 173 GLU B CB    1 
ATOM   4009 C CG    . GLU E 3 137 ? 55.876  85.244  87.629  1.00 124.67 ? 173 GLU B CG    1 
ATOM   4010 C CD    . GLU E 3 137 ? 56.612  86.308  86.835  1.00 140.17 ? 173 GLU B CD    1 
ATOM   4011 O OE1   . GLU E 3 137 ? 55.975  87.314  86.449  1.00 140.73 ? 173 GLU B OE1   1 
ATOM   4012 O OE2   . GLU E 3 137 ? 57.824  86.130  86.585  1.00 140.45 ? 173 GLU B OE2   1 
ATOM   4013 N N     . LEU E 3 138 ? 54.048  81.836  85.617  1.00 124.81 ? 174 LEU B N     1 
ATOM   4014 C CA    . LEU E 3 138 ? 53.430  81.063  84.554  1.00 123.63 ? 174 LEU B CA    1 
ATOM   4015 C C     . LEU E 3 138 ? 52.284  80.263  85.147  1.00 123.87 ? 174 LEU B C     1 
ATOM   4016 O O     . LEU E 3 138 ? 51.153  80.325  84.661  1.00 97.68  ? 174 LEU B O     1 
ATOM   4017 C CB    . LEU E 3 138 ? 54.463  80.129  83.918  1.00 114.92 ? 174 LEU B CB    1 
ATOM   4018 C CG    . LEU E 3 138 ? 55.684  80.815  83.293  1.00 123.64 ? 174 LEU B CG    1 
ATOM   4019 C CD1   . LEU E 3 138 ? 56.589  79.768  82.671  1.00 121.81 ? 174 LEU B CD1   1 
ATOM   4020 C CD2   . LEU E 3 138 ? 55.241  81.825  82.241  1.00 104.09 ? 174 LEU B CD2   1 
ATOM   4021 N N     . GLU E 3 139 ? 52.586  79.529  86.213  1.00 129.97 ? 175 GLU B N     1 
ATOM   4022 C CA    . GLU E 3 139 ? 51.590  78.717  86.898  1.00 128.28 ? 175 GLU B CA    1 
ATOM   4023 C C     . GLU E 3 139 ? 50.442  79.595  87.388  1.00 122.08 ? 175 GLU B C     1 
ATOM   4024 O O     . GLU E 3 139 ? 49.295  79.153  87.445  1.00 128.86 ? 175 GLU B O     1 
ATOM   4025 C CB    . GLU E 3 139 ? 52.233  77.987  88.075  1.00 127.41 ? 175 GLU B CB    1 
ATOM   4026 C CG    . GLU E 3 139 ? 53.416  77.125  87.677  1.00 124.85 ? 175 GLU B CG    1 
ATOM   4027 C CD    . GLU E 3 139 ? 54.116  76.509  88.869  1.00 134.54 ? 175 GLU B CD    1 
ATOM   4028 O OE1   . GLU E 3 139 ? 54.470  77.258  89.803  1.00 135.57 ? 175 GLU B OE1   1 
ATOM   4029 O OE2   . GLU E 3 139 ? 54.320  75.279  88.869  1.00 140.73 ? 175 GLU B OE2   1 
ATOM   4030 N N     . GLN E 3 140 ? 50.748  80.839  87.743  1.00 103.65 ? 176 GLN B N     1 
ATOM   4031 C CA    . GLN E 3 140 ? 49.710  81.751  88.203  1.00 101.82 ? 176 GLN B CA    1 
ATOM   4032 C C     . GLN E 3 140 ? 48.812  82.179  87.046  1.00 101.88 ? 176 GLN B C     1 
ATOM   4033 O O     . GLN E 3 140 ? 47.656  81.773  86.973  1.00 103.79 ? 176 GLN B O     1 
ATOM   4034 C CB    . GLN E 3 140 ? 50.324  82.984  88.870  1.00 108.84 ? 176 GLN B CB    1 
ATOM   4035 C CG    . GLN E 3 140 ? 50.805  82.741  90.291  1.00 105.06 ? 176 GLN B CG    1 
ATOM   4036 C CD    . GLN E 3 140 ? 49.680  82.354  91.241  1.00 124.90 ? 176 GLN B CD    1 
ATOM   4037 O OE1   . GLN E 3 140 ? 49.912  82.110  92.424  1.00 116.50 ? 176 GLN B OE1   1 
ATOM   4038 N NE2   . GLN E 3 140 ? 48.457  82.300  90.728  1.00 108.87 ? 176 GLN B NE2   1 
ATOM   4039 N N     . GLU E 3 141 ? 49.348  82.993  86.142  1.00 109.13 ? 177 GLU B N     1 
ATOM   4040 C CA    . GLU E 3 141 ? 48.582  83.467  84.993  1.00 114.35 ? 177 GLU B CA    1 
ATOM   4041 C C     . GLU E 3 141 ? 47.770  82.333  84.365  1.00 120.22 ? 177 GLU B C     1 
ATOM   4042 O O     . GLU E 3 141 ? 46.700  82.562  83.792  1.00 125.69 ? 177 GLU B O     1 
ATOM   4043 C CB    . GLU E 3 141 ? 49.526  84.088  83.952  1.00 109.62 ? 177 GLU B CB    1 
ATOM   4044 C CG    . GLU E 3 141 ? 48.902  84.312  82.577  1.00 113.91 ? 177 GLU B CG    1 
ATOM   4045 C CD    . GLU E 3 141 ? 47.828  85.388  82.558  1.00 124.42 ? 177 GLU B CD    1 
ATOM   4046 O OE1   . GLU E 3 141 ? 47.005  85.444  83.500  1.00 89.11  ? 177 GLU B OE1   1 
ATOM   4047 O OE2   . GLU E 3 141 ? 47.800  86.171  81.582  1.00 75.90  ? 177 GLU B OE2   1 
ATOM   4048 N N     . ALA E 3 142 ? 48.277  81.108  84.479  1.00 107.32 ? 178 ALA B N     1 
ATOM   4049 C CA    . ALA E 3 142 ? 47.582  79.950  83.929  1.00 108.41 ? 178 ALA B CA    1 
ATOM   4050 C C     . ALA E 3 142 ? 46.279  79.726  84.691  1.00 111.24 ? 178 ALA B C     1 
ATOM   4051 O O     . ALA E 3 142 ? 45.188  80.036  84.195  1.00 94.48  ? 178 ALA B O     1 
ATOM   4052 C CB    . ALA E 3 142 ? 48.466  78.713  84.028  1.00 76.77  ? 178 ALA B CB    1 
ATOM   4053 N N     . LYS E 3 143 ? 46.404  79.194  85.903  1.00 117.73 ? 179 LYS B N     1 
ATOM   4054 C CA    . LYS E 3 143 ? 45.250  78.927  86.749  1.00 124.45 ? 179 LYS B CA    1 
ATOM   4055 C C     . LYS E 3 143 ? 44.457  80.204  87.005  1.00 119.75 ? 179 LYS B C     1 
ATOM   4056 O O     . LYS E 3 143 ? 43.238  80.165  87.164  1.00 137.09 ? 179 LYS B O     1 
ATOM   4057 C CB    . LYS E 3 143 ? 45.704  78.311  88.076  1.00 134.82 ? 179 LYS B CB    1 
ATOM   4058 C CG    . LYS E 3 143 ? 46.691  79.161  88.848  1.00 135.23 ? 179 LYS B CG    1 
ATOM   4059 C CD    . LYS E 3 143 ? 47.233  78.427  90.065  1.00 114.53 ? 179 LYS B CD    1 
ATOM   4060 C CE    . LYS E 3 143 ? 48.075  77.222  89.672  1.00 93.38  ? 179 LYS B CE    1 
ATOM   4061 N NZ    . LYS E 3 143 ? 48.763  76.626  90.852  1.00 77.60  ? 179 LYS B NZ    1 
ATOM   4062 N N     . GLU E 3 144 ? 45.151  81.337  87.039  1.00 97.26  ? 180 GLU B N     1 
ATOM   4063 C CA    . GLU E 3 144 ? 44.495  82.619  87.260  1.00 95.57  ? 180 GLU B CA    1 
ATOM   4064 C C     . GLU E 3 144 ? 43.761  83.050  85.992  1.00 87.45  ? 180 GLU B C     1 
ATOM   4065 O O     . GLU E 3 144 ? 43.612  84.246  85.717  1.00 66.59  ? 180 GLU B O     1 
ATOM   4066 C CB    . GLU E 3 144 ? 45.519  83.690  87.657  1.00 127.70 ? 180 GLU B CB    1 
ATOM   4067 C CG    . GLU E 3 144 ? 46.176  83.476  89.019  1.00 140.71 ? 180 GLU B CG    1 
ATOM   4068 C CD    . GLU E 3 144 ? 45.187  83.543  90.174  1.00 140.73 ? 180 GLU B CD    1 
ATOM   4069 O OE1   . GLU E 3 144 ? 44.474  84.564  90.294  1.00 140.73 ? 180 GLU B OE1   1 
ATOM   4070 O OE2   . GLU E 3 144 ? 45.128  82.577  90.967  1.00 134.38 ? 180 GLU B OE2   1 
ATOM   4071 N N     . LEU E 3 145 ? 43.310  82.071  85.217  1.00 91.30  ? 181 LEU B N     1 
ATOM   4072 C CA    . LEU E 3 145 ? 42.582  82.353  83.987  1.00 113.91 ? 181 LEU B CA    1 
ATOM   4073 C C     . LEU E 3 145 ? 41.627  81.202  83.681  1.00 119.08 ? 181 LEU B C     1 
ATOM   4074 O O     . LEU E 3 145 ? 40.624  81.371  82.982  1.00 105.14 ? 181 LEU B O     1 
ATOM   4075 C CB    . LEU E 3 145 ? 43.562  82.550  82.826  1.00 110.93 ? 181 LEU B CB    1 
ATOM   4076 C CG    . LEU E 3 145 ? 43.079  83.443  81.675  1.00 106.40 ? 181 LEU B CG    1 
ATOM   4077 C CD1   . LEU E 3 145 ? 41.900  82.811  80.960  1.00 92.55  ? 181 LEU B CD1   1 
ATOM   4078 C CD2   . LEU E 3 145 ? 42.694  84.804  82.230  1.00 87.46  ? 181 LEU B CD2   1 
ATOM   4079 N N     . LYS E 3 146 ? 41.943  80.032  84.226  1.00 114.14 ? 182 LYS B N     1 
ATOM   4080 C CA    . LYS E 3 146 ? 41.127  78.845  84.017  1.00 114.08 ? 182 LYS B CA    1 
ATOM   4081 C C     . LYS E 3 146 ? 39.635  79.126  84.164  1.00 129.45 ? 182 LYS B C     1 
ATOM   4082 O O     . LYS E 3 146 ? 38.834  78.678  83.345  1.00 139.43 ? 182 LYS B O     1 
ATOM   4083 C CB    . LYS E 3 146 ? 41.540  77.742  84.997  1.00 72.31  ? 182 LYS B CB    1 
ATOM   4084 C CG    . LYS E 3 146 ? 40.778  76.436  84.814  1.00 63.14  ? 182 LYS B CG    1 
ATOM   4085 C CD    . LYS E 3 146 ? 41.411  75.300  85.598  1.00 55.01  ? 182 LYS B CD    1 
ATOM   4086 C CE    . LYS E 3 146 ? 40.781  73.962  85.221  1.00 100.11 ? 182 LYS B CE    1 
ATOM   4087 N NZ    . LYS E 3 146 ? 41.454  72.800  85.876  1.00 96.72  ? 182 LYS B NZ    1 
ATOM   4088 N N     . LYS E 3 147 ? 39.268  79.882  85.194  1.00 140.73 ? 183 LYS B N     1 
ATOM   4089 C CA    . LYS E 3 147 ? 37.864  80.188  85.449  1.00 140.08 ? 183 LYS B CA    1 
ATOM   4090 C C     . LYS E 3 147 ? 37.353  81.469  84.785  1.00 134.06 ? 183 LYS B C     1 
ATOM   4091 O O     . LYS E 3 147 ? 36.378  82.068  85.243  1.00 131.42 ? 183 LYS B O     1 
ATOM   4092 C CB    . LYS E 3 147 ? 37.616  80.255  86.961  1.00 140.73 ? 183 LYS B CB    1 
ATOM   4093 C CG    . LYS E 3 147 ? 36.434  79.415  87.446  1.00 135.05 ? 183 LYS B CG    1 
ATOM   4094 C CD    . LYS E 3 147 ? 35.125  79.878  86.829  1.00 102.10 ? 183 LYS B CD    1 
ATOM   4095 C CE    . LYS E 3 147 ? 33.960  79.035  87.314  1.00 91.23  ? 183 LYS B CE    1 
ATOM   4096 N NZ    . LYS E 3 147 ? 32.673  79.461  86.692  1.00 98.76  ? 183 LYS B NZ    1 
ATOM   4097 N N     . VAL E 3 148 ? 38.002  81.885  83.703  1.00 119.14 ? 184 VAL B N     1 
ATOM   4098 C CA    . VAL E 3 148 ? 37.580  83.085  82.994  1.00 131.32 ? 184 VAL B CA    1 
ATOM   4099 C C     . VAL E 3 148 ? 37.891  82.939  81.504  1.00 134.84 ? 184 VAL B C     1 
ATOM   4100 O O     . VAL E 3 148 ? 38.215  83.909  80.813  1.00 140.73 ? 184 VAL B O     1 
ATOM   4101 C CB    . VAL E 3 148 ? 38.272  84.340  83.576  1.00 132.05 ? 184 VAL B CB    1 
ATOM   4102 C CG1   . VAL E 3 148 ? 39.771  84.220  83.430  1.00 140.42 ? 184 VAL B CG1   1 
ATOM   4103 C CG2   . VAL E 3 148 ? 37.748  85.596  82.893  1.00 137.60 ? 184 VAL B CG2   1 
ATOM   4104 N N     . MET E 3 149 ? 37.778  81.707  81.021  1.00 127.16 ? 185 MET B N     1 
ATOM   4105 C CA    . MET E 3 149 ? 38.030  81.386  79.621  1.00 104.02 ? 185 MET B CA    1 
ATOM   4106 C C     . MET E 3 149 ? 37.072  80.286  79.173  1.00 95.09  ? 185 MET B C     1 
ATOM   4107 O O     . MET E 3 149 ? 37.411  79.100  79.227  1.00 80.72  ? 185 MET B O     1 
ATOM   4108 C CB    . MET E 3 149 ? 39.470  80.908  79.447  1.00 111.70 ? 185 MET B CB    1 
ATOM   4109 C CG    . MET E 3 149 ? 39.843  80.560  78.022  1.00 121.07 ? 185 MET B CG    1 
ATOM   4110 S SD    . MET E 3 149 ? 41.456  79.792  77.955  1.00 97.75  ? 185 MET B SD    1 
ATOM   4111 C CE    . MET E 3 149 ? 41.023  78.123  78.355  1.00 112.92 ? 185 MET B CE    1 
ATOM   4112 N N     . ASP E 3 150 ? 35.880  80.681  78.728  1.00 104.01 ? 186 ASP B N     1 
ATOM   4113 C CA    . ASP E 3 150 ? 34.877  79.717  78.292  1.00 105.87 ? 186 ASP B CA    1 
ATOM   4114 C C     . ASP E 3 150 ? 35.455  78.696  77.310  1.00 102.82 ? 186 ASP B C     1 
ATOM   4115 O O     . ASP E 3 150 ? 35.654  78.978  76.125  1.00 106.44 ? 186 ASP B O     1 
ATOM   4116 C CB    . ASP E 3 150 ? 33.678  80.430  77.664  1.00 65.05  ? 186 ASP B CB    1 
ATOM   4117 C CG    . ASP E 3 150 ? 32.563  79.468  77.297  1.00 101.41 ? 186 ASP B CG    1 
ATOM   4118 O OD1   . ASP E 3 150 ? 32.790  78.583  76.445  1.00 104.60 ? 186 ASP B OD1   1 
ATOM   4119 O OD2   . ASP E 3 150 ? 31.460  79.588  77.866  1.00 97.11  ? 186 ASP B OD2   1 
ATOM   4120 N N     . LEU E 3 151 ? 35.712  77.500  77.828  1.00 89.50  ? 187 LEU B N     1 
ATOM   4121 C CA    . LEU E 3 151 ? 36.281  76.408  77.055  1.00 63.54  ? 187 LEU B CA    1 
ATOM   4122 C C     . LEU E 3 151 ? 35.415  75.973  75.884  1.00 63.40  ? 187 LEU B C     1 
ATOM   4123 O O     . LEU E 3 151 ? 35.745  74.990  75.223  1.00 56.53  ? 187 LEU B O     1 
ATOM   4124 C CB    . LEU E 3 151 ? 36.499  75.204  77.958  1.00 34.48  ? 187 LEU B CB    1 
ATOM   4125 C CG    . LEU E 3 151 ? 37.701  74.319  77.677  1.00 25.96  ? 187 LEU B CG    1 
ATOM   4126 C CD1   . LEU E 3 151 ? 38.963  75.077  78.070  1.00 50.68  ? 187 LEU B CD1   1 
ATOM   4127 C CD2   . LEU E 3 151 ? 37.598  73.033  78.488  1.00 80.45  ? 187 LEU B CD2   1 
ATOM   4128 N N     . SER E 3 152 ? 34.318  76.686  75.624  1.00 48.75  ? 188 SER B N     1 
ATOM   4129 C CA    . SER E 3 152 ? 33.433  76.313  74.521  1.00 60.52  ? 188 SER B CA    1 
ATOM   4130 C C     . SER E 3 152 ? 33.079  77.422  73.548  1.00 50.47  ? 188 SER B C     1 
ATOM   4131 O O     . SER E 3 152 ? 32.194  77.253  72.707  1.00 81.02  ? 188 SER B O     1 
ATOM   4132 C CB    . SER E 3 152 ? 32.142  75.694  75.060  1.00 79.32  ? 188 SER B CB    1 
ATOM   4133 O OG    . SER E 3 152 ? 32.363  74.370  75.519  1.00 105.94 ? 188 SER B OG    1 
ATOM   4134 N N     . ILE E 3 153 ? 33.766  78.551  73.650  1.00 55.47  ? 189 ILE B N     1 
ATOM   4135 C CA    . ILE E 3 153 ? 33.507  79.662  72.749  1.00 72.63  ? 189 ILE B CA    1 
ATOM   4136 C C     . ILE E 3 153 ? 34.819  80.394  72.475  1.00 71.29  ? 189 ILE B C     1 
ATOM   4137 O O     . ILE E 3 153 ? 35.491  80.864  73.399  1.00 53.64  ? 189 ILE B O     1 
ATOM   4138 C CB    . ILE E 3 153 ? 32.436  80.621  73.351  1.00 78.17  ? 189 ILE B CB    1 
ATOM   4139 C CG1   . ILE E 3 153 ? 32.038  81.680  72.325  1.00 129.61 ? 189 ILE B CG1   1 
ATOM   4140 C CG2   . ILE E 3 153 ? 32.964  81.284  74.605  1.00 114.66 ? 189 ILE B CG2   1 
ATOM   4141 C CD1   . ILE E 3 153 ? 30.936  82.601  72.801  1.00 133.55 ? 189 ILE B CD1   1 
ATOM   4142 N N     . VAL E 3 154 ? 35.196  80.464  71.202  1.00 88.46  ? 190 VAL B N     1 
ATOM   4143 C CA    . VAL E 3 154 ? 36.442  81.123  70.825  1.00 81.81  ? 190 VAL B CA    1 
ATOM   4144 C C     . VAL E 3 154 ? 36.289  82.196  69.761  1.00 80.99  ? 190 VAL B C     1 
ATOM   4145 O O     . VAL E 3 154 ? 35.278  82.268  69.060  1.00 75.82  ? 190 VAL B O     1 
ATOM   4146 C CB    . VAL E 3 154 ? 37.472  80.117  70.300  1.00 81.61  ? 190 VAL B CB    1 
ATOM   4147 C CG1   . VAL E 3 154 ? 37.867  79.151  71.390  1.00 57.54  ? 190 VAL B CG1   1 
ATOM   4148 C CG2   . VAL E 3 154 ? 36.897  79.378  69.125  1.00 35.93  ? 190 VAL B CG2   1 
ATOM   4149 N N     . ARG E 3 155 ? 37.321  83.025  69.650  1.00 88.45  ? 191 ARG B N     1 
ATOM   4150 C CA    . ARG E 3 155 ? 37.345  84.100  68.673  1.00 107.70 ? 191 ARG B CA    1 
ATOM   4151 C C     . ARG E 3 155 ? 38.686  84.103  67.942  1.00 114.65 ? 191 ARG B C     1 
ATOM   4152 O O     . ARG E 3 155 ? 39.745  83.944  68.551  1.00 122.48 ? 191 ARG B O     1 
ATOM   4153 C CB    . ARG E 3 155 ? 37.134  85.445  69.362  1.00 99.75  ? 191 ARG B CB    1 
ATOM   4154 C CG    . ARG E 3 155 ? 35.882  85.519  70.213  1.00 112.39 ? 191 ARG B CG    1 
ATOM   4155 C CD    . ARG E 3 155 ? 35.760  86.881  70.879  1.00 98.32  ? 191 ARG B CD    1 
ATOM   4156 N NE    . ARG E 3 155 ? 36.953  87.226  71.646  1.00 75.04  ? 191 ARG B NE    1 
ATOM   4157 C CZ    . ARG E 3 155 ? 37.184  88.429  72.159  1.00 86.71  ? 191 ARG B CZ    1 
ATOM   4158 N NH1   . ARG E 3 155 ? 36.303  89.405  71.991  1.00 98.11  ? 191 ARG B NH1   1 
ATOM   4159 N NH2   . ARG E 3 155 ? 38.304  88.662  72.827  1.00 82.26  ? 191 ARG B NH2   1 
ATOM   4160 N N     . LEU E 3 156 ? 38.624  84.276  66.628  1.00 101.36 ? 192 LEU B N     1 
ATOM   4161 C CA    . LEU E 3 156 ? 39.811  84.307  65.786  1.00 72.28  ? 192 LEU B CA    1 
ATOM   4162 C C     . LEU E 3 156 ? 40.443  85.686  65.891  1.00 79.18  ? 192 LEU B C     1 
ATOM   4163 O O     . LEU E 3 156 ? 39.736  86.690  65.973  1.00 70.71  ? 192 LEU B O     1 
ATOM   4164 C CB    . LEU E 3 156 ? 39.422  84.059  64.328  1.00 57.42  ? 192 LEU B CB    1 
ATOM   4165 C CG    . LEU E 3 156 ? 38.875  82.724  63.804  1.00 39.32  ? 192 LEU B CG    1 
ATOM   4166 C CD1   . LEU E 3 156 ? 38.181  81.926  64.892  1.00 70.16  ? 192 LEU B CD1   1 
ATOM   4167 C CD2   . LEU E 3 156 ? 37.923  83.029  62.645  1.00 29.32  ? 192 LEU B CD2   1 
ATOM   4168 N N     . ARG E 3 157 ? 41.769  85.742  65.886  1.00 88.69  ? 193 ARG B N     1 
ATOM   4169 C CA    . ARG E 3 157 ? 42.463  87.020  65.951  1.00 97.13  ? 193 ARG B CA    1 
ATOM   4170 C C     . ARG E 3 157 ? 43.390  87.131  64.748  1.00 111.34 ? 193 ARG B C     1 
ATOM   4171 O O     . ARG E 3 157 ? 44.541  86.694  64.783  1.00 132.92 ? 193 ARG B O     1 
ATOM   4172 C CB    . ARG E 3 157 ? 43.256  87.143  67.253  1.00 67.99  ? 193 ARG B CB    1 
ATOM   4173 C CG    . ARG E 3 157 ? 44.292  86.056  67.455  1.00 76.15  ? 193 ARG B CG    1 
ATOM   4174 C CD    . ARG E 3 157 ? 45.683  86.614  67.337  1.00 74.94  ? 193 ARG B CD    1 
ATOM   4175 N NE    . ARG E 3 157 ? 45.915  87.691  68.297  1.00 64.83  ? 193 ARG B NE    1 
ATOM   4176 C CZ    . ARG E 3 157 ? 46.172  87.515  69.593  1.00 87.59  ? 193 ARG B CZ    1 
ATOM   4177 N NH1   . ARG E 3 157 ? 46.369  88.570  70.372  1.00 105.70 ? 193 ARG B NH1   1 
ATOM   4178 N NH2   . ARG E 3 157 ? 46.243  86.299  70.118  1.00 60.07  ? 193 ARG B NH2   1 
ATOM   4179 N N     . PHE E 3 158 ? 42.862  87.709  63.675  1.00 105.15 ? 194 PHE B N     1 
ATOM   4180 C CA    . PHE E 3 158 ? 43.609  87.895  62.439  1.00 85.90  ? 194 PHE B CA    1 
ATOM   4181 C C     . PHE E 3 158 ? 44.647  89.001  62.576  1.00 86.19  ? 194 PHE B C     1 
ATOM   4182 O O     . PHE E 3 158 ? 44.329  90.180  62.446  1.00 102.00 ? 194 PHE B O     1 
ATOM   4183 C CB    . PHE E 3 158 ? 42.636  88.231  61.317  1.00 86.58  ? 194 PHE B CB    1 
ATOM   4184 C CG    . PHE E 3 158 ? 41.622  87.167  61.076  1.00 70.93  ? 194 PHE B CG    1 
ATOM   4185 C CD1   . PHE E 3 158 ? 41.829  86.197  60.102  1.00 121.16 ? 194 PHE B CD1   1 
ATOM   4186 C CD2   . PHE E 3 158 ? 40.475  87.106  61.849  1.00 76.32  ? 194 PHE B CD2   1 
ATOM   4187 C CE1   . PHE E 3 158 ? 40.906  85.175  59.899  1.00 104.73 ? 194 PHE B CE1   1 
ATOM   4188 C CE2   . PHE E 3 158 ? 39.543  86.090  61.656  1.00 124.67 ? 194 PHE B CE2   1 
ATOM   4189 C CZ    . PHE E 3 158 ? 39.760  85.121  60.678  1.00 121.94 ? 194 PHE B CZ    1 
ATOM   4190 N N     . SER E 3 159 ? 45.889  88.617  62.833  1.00 83.19  ? 195 SER B N     1 
ATOM   4191 C CA    . SER E 3 159 ? 46.957  89.592  62.995  1.00 79.35  ? 195 SER B CA    1 
ATOM   4192 C C     . SER E 3 159 ? 47.897  89.637  61.788  1.00 87.94  ? 195 SER B C     1 
ATOM   4193 O O     . SER E 3 159 ? 48.706  88.724  61.579  1.00 74.33  ? 195 SER B O     1 
ATOM   4194 C CB    . SER E 3 159 ? 47.738  89.283  64.272  1.00 37.77  ? 195 SER B CB    1 
ATOM   4195 O OG    . SER E 3 159 ? 47.944  87.888  64.411  1.00 51.00  ? 195 SER B OG    1 
ATOM   4196 N N     . ALA E 3 160 ? 47.776  90.711  61.006  1.00 93.26  ? 196 ALA B N     1 
ATOM   4197 C CA    . ALA E 3 160 ? 48.585  90.929  59.806  1.00 101.22 ? 196 ALA B CA    1 
ATOM   4198 C C     . ALA E 3 160 ? 49.985  91.453  60.135  1.00 113.61 ? 196 ALA B C     1 
ATOM   4199 O O     . ALA E 3 160 ? 50.187  92.101  61.160  1.00 130.47 ? 196 ALA B O     1 
ATOM   4200 C CB    . ALA E 3 160 ? 47.873  91.901  58.884  1.00 92.45  ? 196 ALA B CB    1 
ATOM   4201 N N     . PHE E 3 161 ? 50.946  91.176  59.255  1.00 120.72 ? 197 PHE B N     1 
ATOM   4202 C CA    . PHE E 3 161 ? 52.331  91.603  59.460  1.00 130.42 ? 197 PHE B CA    1 
ATOM   4203 C C     . PHE E 3 161 ? 53.079  91.902  58.155  1.00 133.47 ? 197 PHE B C     1 
ATOM   4204 O O     . PHE E 3 161 ? 53.031  91.119  57.206  1.00 140.73 ? 197 PHE B O     1 
ATOM   4205 C CB    . PHE E 3 161 ? 53.084  90.525  60.247  1.00 129.30 ? 197 PHE B CB    1 
ATOM   4206 C CG    . PHE E 3 161 ? 52.623  90.381  61.669  1.00 130.69 ? 197 PHE B CG    1 
ATOM   4207 C CD1   . PHE E 3 161 ? 53.172  91.168  62.675  1.00 138.86 ? 197 PHE B CD1   1 
ATOM   4208 C CD2   . PHE E 3 161 ? 51.612  89.482  62.000  1.00 121.78 ? 197 PHE B CD2   1 
ATOM   4209 C CE1   . PHE E 3 161 ? 52.722  91.065  63.988  1.00 134.66 ? 197 PHE B CE1   1 
ATOM   4210 C CE2   . PHE E 3 161 ? 51.153  89.371  63.311  1.00 84.77  ? 197 PHE B CE2   1 
ATOM   4211 C CZ    . PHE E 3 161 ? 51.710  90.165  64.306  1.00 122.38 ? 197 PHE B CZ    1 
ATOM   4212 N N     . LEU E 3 162 ? 53.776  93.036  58.121  1.00 131.61 ? 198 LEU B N     1 
ATOM   4213 C CA    . LEU E 3 162 ? 54.543  93.447  56.945  1.00 128.44 ? 198 LEU B CA    1 
ATOM   4214 C C     . LEU E 3 162 ? 56.042  93.237  57.165  1.00 134.71 ? 198 LEU B C     1 
ATOM   4215 O O     . LEU E 3 162 ? 56.469  92.921  58.275  1.00 140.73 ? 198 LEU B O     1 
ATOM   4216 C CB    . LEU E 3 162 ? 54.277  94.923  56.631  1.00 103.20 ? 198 LEU B CB    1 
ATOM   4217 C CG    . LEU E 3 162 ? 52.930  95.323  56.020  1.00 81.80  ? 198 LEU B CG    1 
ATOM   4218 C CD1   . LEU E 3 162 ? 51.786  94.849  56.895  1.00 124.30 ? 198 LEU B CD1   1 
ATOM   4219 C CD2   . LEU E 3 162 ? 52.887  96.834  55.860  1.00 66.36  ? 198 LEU B CD2   1 
ATOM   4220 N N     . ARG E 3 163 ? 56.835  93.415  56.108  1.00 133.53 ? 199 ARG B N     1 
ATOM   4221 C CA    . ARG E 3 163 ? 58.286  93.247  56.199  1.00 130.04 ? 199 ARG B CA    1 
ATOM   4222 C C     . ARG E 3 163 ? 58.980  94.581  56.486  1.00 124.44 ? 199 ARG B C     1 
ATOM   4223 O O     . ARG E 3 163 ? 58.876  95.526  55.705  1.00 120.83 ? 199 ARG B O     1 
ATOM   4224 C CB    . ARG E 3 163 ? 58.839  92.641  54.901  1.00 138.38 ? 199 ARG B CB    1 
ATOM   4225 C CG    . ARG E 3 163 ? 58.665  93.513  53.661  1.00 140.73 ? 199 ARG B CG    1 
ATOM   4226 C CD    . ARG E 3 163 ? 59.347  92.906  52.434  1.00 129.15 ? 199 ARG B CD    1 
ATOM   4227 N NE    . ARG E 3 163 ? 58.576  91.827  51.819  1.00 140.73 ? 199 ARG B NE    1 
ATOM   4228 C CZ    . ARG E 3 163 ? 57.419  91.999  51.183  1.00 140.73 ? 199 ARG B CZ    1 
ATOM   4229 N NH1   . ARG E 3 163 ? 56.788  90.958  50.653  1.00 140.39 ? 199 ARG B NH1   1 
ATOM   4230 N NH2   . ARG E 3 163 ? 56.892  93.212  51.074  1.00 140.73 ? 199 ARG B NH2   1 
ATOM   4231 N N     . ASP E 3 164 ? 59.685  94.652  57.612  1.00 125.65 ? 200 ASP B N     1 
ATOM   4232 C CA    . ASP E 3 164 ? 60.392  95.868  58.007  1.00 126.99 ? 200 ASP B CA    1 
ATOM   4233 C C     . ASP E 3 164 ? 61.778  95.931  57.372  1.00 133.03 ? 200 ASP B C     1 
ATOM   4234 O O     . ASP E 3 164 ? 62.790  95.709  58.039  1.00 135.02 ? 200 ASP B O     1 
ATOM   4235 C CB    . ASP E 3 164 ? 60.519  95.932  59.533  1.00 133.27 ? 200 ASP B CB    1 
ATOM   4236 C CG    . ASP E 3 164 ? 61.240  97.183  60.012  1.00 111.40 ? 200 ASP B CG    1 
ATOM   4237 O OD1   . ASP E 3 164 ? 60.747  98.302  59.752  1.00 98.03  ? 200 ASP B OD1   1 
ATOM   4238 O OD2   . ASP E 3 164 ? 62.304  97.045  60.653  1.00 122.66 ? 200 ASP B OD2   1 
ATOM   4239 N N     . SER E 3 165 ? 61.816  96.241  56.078  1.00 129.61 ? 201 SER B N     1 
ATOM   4240 C CA    . SER E 3 165 ? 63.070  96.330  55.338  1.00 132.86 ? 201 SER B CA    1 
ATOM   4241 C C     . SER E 3 165 ? 63.932  95.094  55.576  1.00 137.34 ? 201 SER B C     1 
ATOM   4242 O O     . SER E 3 165 ? 63.477  94.116  56.169  1.00 140.73 ? 201 SER B O     1 
ATOM   4243 C CB    . SER E 3 165 ? 63.843  97.583  55.745  1.00 121.35 ? 201 SER B CB    1 
ATOM   4244 O OG    . SER E 3 165 ? 65.032  97.708  54.984  1.00 140.40 ? 201 SER B OG    1 
ATOM   4245 N N     . ASP E 3 166 ? 65.177  95.145  55.109  1.00 138.85 ? 202 ASP B N     1 
ATOM   4246 C CA    . ASP E 3 166 ? 66.118  94.037  55.252  1.00 140.73 ? 202 ASP B CA    1 
ATOM   4247 C C     . ASP E 3 166 ? 65.480  92.701  54.858  1.00 140.73 ? 202 ASP B C     1 
ATOM   4248 O O     . ASP E 3 166 ? 65.984  91.631  55.214  1.00 135.52 ? 202 ASP B O     1 
ATOM   4249 C CB    . ASP E 3 166 ? 66.636  93.967  56.694  1.00 140.73 ? 202 ASP B CB    1 
ATOM   4250 C CG    . ASP E 3 166 ? 65.626  93.364  57.653  1.00 140.73 ? 202 ASP B CG    1 
ATOM   4251 O OD1   . ASP E 3 166 ? 65.454  92.127  57.638  1.00 132.91 ? 202 ASP B OD1   1 
ATOM   4252 O OD2   . ASP E 3 166 ? 64.998  94.127  58.418  1.00 123.34 ? 202 ASP B OD2   1 
ATOM   4253 N N     . GLY E 3 167 ? 64.375  92.774  54.118  1.00 140.73 ? 203 GLY B N     1 
ATOM   4254 C CA    . GLY E 3 167 ? 63.676  91.578  53.682  1.00 138.05 ? 203 GLY B CA    1 
ATOM   4255 C C     . GLY E 3 167 ? 63.305  90.656  54.828  1.00 140.73 ? 203 GLY B C     1 
ATOM   4256 O O     . GLY E 3 167 ? 63.832  89.547  54.932  1.00 140.73 ? 203 GLY B O     1 
ATOM   4257 N N     . SER E 3 168 ? 62.398  91.111  55.690  1.00 140.73 ? 204 SER B N     1 
ATOM   4258 C CA    . SER E 3 168 ? 61.967  90.310  56.832  1.00 140.73 ? 204 SER B CA    1 
ATOM   4259 C C     . SER E 3 168 ? 60.693  90.850  57.468  1.00 140.73 ? 204 SER B C     1 
ATOM   4260 O O     . SER E 3 168 ? 60.640  92.002  57.901  1.00 140.73 ? 204 SER B O     1 
ATOM   4261 C CB    . SER E 3 168 ? 63.067  90.260  57.897  1.00 140.73 ? 204 SER B CB    1 
ATOM   4262 O OG    . SER E 3 168 ? 63.172  91.500  58.577  1.00 140.73 ? 204 SER B OG    1 
ATOM   4263 N N     . PHE E 3 169 ? 59.669  90.003  57.526  1.00 137.45 ? 205 PHE B N     1 
ATOM   4264 C CA    . PHE E 3 169 ? 58.394  90.375  58.121  1.00 125.87 ? 205 PHE B CA    1 
ATOM   4265 C C     . PHE E 3 169 ? 58.557  90.526  59.626  1.00 124.13 ? 205 PHE B C     1 
ATOM   4266 O O     . PHE E 3 169 ? 59.275  89.755  60.263  1.00 133.82 ? 205 PHE B O     1 
ATOM   4267 C CB    . PHE E 3 169 ? 57.344  89.310  57.808  1.00 99.78  ? 205 PHE B CB    1 
ATOM   4268 C CG    . PHE E 3 169 ? 56.954  89.259  56.361  1.00 108.21 ? 205 PHE B CG    1 
ATOM   4269 C CD1   . PHE E 3 169 ? 56.112  90.227  55.820  1.00 121.06 ? 205 PHE B CD1   1 
ATOM   4270 C CD2   . PHE E 3 169 ? 57.455  88.265  55.527  1.00 74.89  ? 205 PHE B CD2   1 
ATOM   4271 C CE1   . PHE E 3 169 ? 55.773  90.207  54.465  1.00 121.84 ? 205 PHE B CE1   1 
ATOM   4272 C CE2   . PHE E 3 169 ? 57.125  88.235  54.174  1.00 82.00  ? 205 PHE B CE2   1 
ATOM   4273 C CZ    . PHE E 3 169 ? 56.281  89.210  53.640  1.00 95.66  ? 205 PHE B CZ    1 
ATOM   4274 N N     . SER E 3 170 ? 57.890  91.530  60.186  1.00 107.29 ? 206 SER B N     1 
ATOM   4275 C CA    . SER E 3 170 ? 57.962  91.802  61.613  1.00 101.44 ? 206 SER B CA    1 
ATOM   4276 C C     . SER E 3 170 ? 57.153  93.041  61.977  1.00 104.99 ? 206 SER B C     1 
ATOM   4277 O O     . SER E 3 170 ? 56.912  93.310  63.154  1.00 116.51 ? 206 SER B O     1 
ATOM   4278 C CB    . SER E 3 170 ? 59.422  91.994  62.034  1.00 130.83 ? 206 SER B CB    1 
ATOM   4279 O OG    . SER E 3 170 ? 60.058  92.979  61.238  1.00 140.73 ? 206 SER B OG    1 
ATOM   4280 N N     . LEU E 3 171 ? 56.739  93.796  60.966  1.00 110.28 ? 207 LEU B N     1 
ATOM   4281 C CA    . LEU E 3 171 ? 55.950  95.002  61.192  1.00 119.58 ? 207 LEU B CA    1 
ATOM   4282 C C     . LEU E 3 171 ? 54.501  94.644  61.499  1.00 118.94 ? 207 LEU B C     1 
ATOM   4283 O O     . LEU E 3 171 ? 53.741  94.289  60.595  1.00 139.47 ? 207 LEU B O     1 
ATOM   4284 C CB    . LEU E 3 171 ? 55.995  95.906  59.961  1.00 104.96 ? 207 LEU B CB    1 
ATOM   4285 C CG    . LEU E 3 171 ? 55.065  97.123  60.007  1.00 137.39 ? 207 LEU B CG    1 
ATOM   4286 C CD1   . LEU E 3 171 ? 55.350  97.958  61.253  1.00 109.62 ? 207 LEU B CD1   1 
ATOM   4287 C CD2   . LEU E 3 171 ? 55.248  97.952  58.744  1.00 139.65 ? 207 LEU B CD2   1 
ATOM   4288 N N     . PRO E 3 172 ? 54.092  94.743  62.778  1.00 108.21 ? 208 PRO B N     1 
ATOM   4289 C CA    . PRO E 3 172 ? 52.720  94.422  63.182  1.00 96.79  ? 208 PRO B CA    1 
ATOM   4290 C C     . PRO E 3 172 ? 51.660  95.201  62.411  1.00 102.66 ? 208 PRO B C     1 
ATOM   4291 O O     . PRO E 3 172 ? 51.967  95.941  61.475  1.00 76.68  ? 208 PRO B O     1 
ATOM   4292 C CB    . PRO E 3 172 ? 52.713  94.743  64.674  1.00 115.21 ? 208 PRO B CB    1 
ATOM   4293 C CG    . PRO E 3 172 ? 53.709  95.845  64.779  1.00 91.84  ? 208 PRO B CG    1 
ATOM   4294 C CD    . PRO E 3 172 ? 54.832  95.331  63.908  1.00 98.68  ? 208 PRO B CD    1 
ATOM   4295 N N     . LEU E 3 173 ? 50.408  95.024  62.809  1.00 116.08 ? 209 LEU B N     1 
ATOM   4296 C CA    . LEU E 3 173 ? 49.301  95.697  62.151  1.00 129.33 ? 209 LEU B CA    1 
ATOM   4297 C C     . LEU E 3 173 ? 48.190  95.854  63.179  1.00 131.71 ? 209 LEU B C     1 
ATOM   4298 O O     . LEU E 3 173 ? 48.448  95.860  64.383  1.00 138.89 ? 209 LEU B O     1 
ATOM   4299 C CB    . LEU E 3 173 ? 48.820  94.850  60.970  1.00 137.93 ? 209 LEU B CB    1 
ATOM   4300 C CG    . LEU E 3 173 ? 48.437  95.548  59.662  1.00 140.48 ? 209 LEU B CG    1 
ATOM   4301 C CD1   . LEU E 3 173 ? 47.199  96.400  59.859  1.00 140.73 ? 209 LEU B CD1   1 
ATOM   4302 C CD2   . LEU E 3 173 ? 49.604  96.388  59.181  1.00 140.73 ? 209 LEU B CD2   1 
ATOM   4303 N N     . LYS E 3 174 ? 46.956  95.979  62.707  1.00 129.79 ? 210 LYS B N     1 
ATOM   4304 C CA    . LYS E 3 174 ? 45.824  96.125  63.607  1.00 124.26 ? 210 LYS B CA    1 
ATOM   4305 C C     . LYS E 3 174 ? 45.063  94.811  63.694  1.00 108.56 ? 210 LYS B C     1 
ATOM   4306 O O     . LYS E 3 174 ? 44.130  94.572  62.923  1.00 108.78 ? 210 LYS B O     1 
ATOM   4307 C CB    . LYS E 3 174 ? 44.891  97.230  63.118  1.00 120.79 ? 210 LYS B CB    1 
ATOM   4308 C CG    . LYS E 3 174 ? 43.747  97.493  64.072  1.00 132.94 ? 210 LYS B CG    1 
ATOM   4309 C CD    . LYS E 3 174 ? 44.263  97.840  65.459  1.00 113.71 ? 210 LYS B CD    1 
ATOM   4310 C CE    . LYS E 3 174 ? 43.116  97.976  66.425  1.00 109.60 ? 210 LYS B CE    1 
ATOM   4311 N NZ    . LYS E 3 174 ? 42.080  98.880  65.866  1.00 90.64  ? 210 LYS B NZ    1 
ATOM   4312 N N     . PRO E 3 175 ? 45.452  93.941  64.639  1.00 85.47  ? 211 PRO B N     1 
ATOM   4313 C CA    . PRO E 3 175 ? 44.794  92.646  64.810  1.00 82.89  ? 211 PRO B CA    1 
ATOM   4314 C C     . PRO E 3 175 ? 43.352  92.804  65.238  1.00 85.49  ? 211 PRO B C     1 
ATOM   4315 O O     . PRO E 3 175 ? 43.076  93.299  66.328  1.00 97.95  ? 211 PRO B O     1 
ATOM   4316 C CB    . PRO E 3 175 ? 45.642  91.967  65.877  1.00 89.53  ? 211 PRO B CB    1 
ATOM   4317 C CG    . PRO E 3 175 ? 46.078  93.115  66.723  1.00 55.95  ? 211 PRO B CG    1 
ATOM   4318 C CD    . PRO E 3 175 ? 46.467  94.149  65.689  1.00 98.96  ? 211 PRO B CD    1 
ATOM   4319 N N     . VAL E 3 176 ? 42.432  92.396  64.373  1.00 88.35  ? 212 VAL B N     1 
ATOM   4320 C CA    . VAL E 3 176 ? 41.015  92.486  64.690  1.00 96.26  ? 212 VAL B CA    1 
ATOM   4321 C C     . VAL E 3 176 ? 40.556  91.080  65.040  1.00 101.71 ? 212 VAL B C     1 
ATOM   4322 O O     . VAL E 3 176 ? 41.162  90.103  64.600  1.00 102.86 ? 212 VAL B O     1 
ATOM   4323 C CB    . VAL E 3 176 ? 40.202  92.996  63.497  1.00 88.59  ? 212 VAL B CB    1 
ATOM   4324 C CG1   . VAL E 3 176 ? 40.050  91.897  62.473  1.00 54.03  ? 212 VAL B CG1   1 
ATOM   4325 C CG2   . VAL E 3 176 ? 38.852  93.498  63.969  1.00 110.73 ? 212 VAL B CG2   1 
ATOM   4326 N N     . ILE E 3 177 ? 39.491  90.977  65.829  1.00 107.07 ? 213 ILE B N     1 
ATOM   4327 C CA    . ILE E 3 177 ? 38.973  89.675  66.245  1.00 95.10  ? 213 ILE B CA    1 
ATOM   4328 C C     . ILE E 3 177 ? 37.611  89.345  65.629  1.00 88.87  ? 213 ILE B C     1 
ATOM   4329 O O     . ILE E 3 177 ? 36.788  90.227  65.390  1.00 79.53  ? 213 ILE B O     1 
ATOM   4330 C CB    . ILE E 3 177 ? 38.870  89.591  67.795  1.00 83.77  ? 213 ILE B CB    1 
ATOM   4331 C CG1   . ILE E 3 177 ? 40.270  89.528  68.416  1.00 84.70  ? 213 ILE B CG1   1 
ATOM   4332 C CG2   . ILE E 3 177 ? 38.080  88.366  68.205  1.00 100.23 ? 213 ILE B CG2   1 
ATOM   4333 C CD1   . ILE E 3 177 ? 41.087  90.794  68.265  1.00 89.38  ? 213 ILE B CD1   1 
ATOM   4334 N N     . SER E 3 178 ? 37.389  88.061  65.372  1.00 76.94  ? 214 SER B N     1 
ATOM   4335 C CA    . SER E 3 178 ? 36.138  87.587  64.794  1.00 93.66  ? 214 SER B CA    1 
ATOM   4336 C C     . SER E 3 178 ? 35.127  87.287  65.895  1.00 104.91 ? 214 SER B C     1 
ATOM   4337 O O     . SER E 3 178 ? 35.474  86.708  66.930  1.00 120.71 ? 214 SER B O     1 
ATOM   4338 C CB    . SER E 3 178 ? 36.389  86.314  64.002  1.00 108.21 ? 214 SER B CB    1 
ATOM   4339 O OG    . SER E 3 178 ? 36.865  85.300  64.865  1.00 92.72  ? 214 SER B OG    1 
ATOM   4340 N N     . GLN E 3 179 ? 33.873  87.668  65.670  1.00 106.06 ? 215 GLN B N     1 
ATOM   4341 C CA    . GLN E 3 179 ? 32.840  87.424  66.664  1.00 87.45  ? 215 GLN B CA    1 
ATOM   4342 C C     . GLN E 3 179 ? 32.817  85.953  67.036  1.00 97.98  ? 215 GLN B C     1 
ATOM   4343 O O     . GLN E 3 179 ? 32.850  85.084  66.168  1.00 116.72 ? 215 GLN B O     1 
ATOM   4344 C CB    . GLN E 3 179 ? 31.469  87.866  66.150  1.00 85.84  ? 215 GLN B CB    1 
ATOM   4345 C CG    . GLN E 3 179 ? 31.071  87.303  64.811  1.00 53.57  ? 215 GLN B CG    1 
ATOM   4346 C CD    . GLN E 3 179 ? 29.852  88.020  64.238  1.00 103.98 ? 215 GLN B CD    1 
ATOM   4347 O OE1   . GLN E 3 179 ? 29.705  89.238  64.405  1.00 57.69  ? 215 GLN B OE1   1 
ATOM   4348 N NE2   . GLN E 3 179 ? 28.980  87.276  63.548  1.00 57.49  ? 215 GLN B NE2   1 
ATOM   4349 N N     . PRO E 3 180 ? 32.765  85.662  68.344  1.00 96.29  ? 216 PRO B N     1 
ATOM   4350 C CA    . PRO E 3 180 ? 32.741  84.324  68.936  1.00 84.64  ? 216 PRO B CA    1 
ATOM   4351 C C     . PRO E 3 180 ? 32.067  83.236  68.114  1.00 85.17  ? 216 PRO B C     1 
ATOM   4352 O O     . PRO E 3 180 ? 31.188  83.502  67.292  1.00 78.63  ? 216 PRO B O     1 
ATOM   4353 C CB    . PRO E 3 180 ? 32.038  84.560  70.262  1.00 87.19  ? 216 PRO B CB    1 
ATOM   4354 C CG    . PRO E 3 180 ? 32.588  85.872  70.663  1.00 95.82  ? 216 PRO B CG    1 
ATOM   4355 C CD    . PRO E 3 180 ? 32.517  86.679  69.381  1.00 106.90 ? 216 PRO B CD    1 
ATOM   4356 N N     . ILE E 3 181 ? 32.502  82.006  68.360  1.00 73.65  ? 217 ILE B N     1 
ATOM   4357 C CA    . ILE E 3 181 ? 31.974  80.833  67.688  1.00 78.22  ? 217 ILE B CA    1 
ATOM   4358 C C     . ILE E 3 181 ? 31.720  79.756  68.738  1.00 85.54  ? 217 ILE B C     1 
ATOM   4359 O O     . ILE E 3 181 ? 32.635  79.307  69.435  1.00 80.72  ? 217 ILE B O     1 
ATOM   4360 C CB    . ILE E 3 181 ? 32.957  80.338  66.621  1.00 88.96  ? 217 ILE B CB    1 
ATOM   4361 C CG1   . ILE E 3 181 ? 34.367  80.260  67.209  1.00 72.86  ? 217 ILE B CG1   1 
ATOM   4362 C CG2   . ILE E 3 181 ? 32.933  81.287  65.433  1.00 97.78  ? 217 ILE B CG2   1 
ATOM   4363 C CD1   . ILE E 3 181 ? 35.459  80.108  66.178  1.00 76.55  ? 217 ILE B CD1   1 
ATOM   4364 N N     . HIS E 3 182 ? 30.459  79.357  68.845  1.00 89.87  ? 218 HIS B N     1 
ATOM   4365 C CA    . HIS E 3 182 ? 30.024  78.376  69.828  1.00 91.88  ? 218 HIS B CA    1 
ATOM   4366 C C     . HIS E 3 182 ? 30.222  76.939  69.377  1.00 69.89  ? 218 HIS B C     1 
ATOM   4367 O O     . HIS E 3 182 ? 29.762  76.561  68.291  1.00 46.51  ? 218 HIS B O     1 
ATOM   4368 C CB    . HIS E 3 182 ? 28.542  78.596  70.139  1.00 129.44 ? 218 HIS B CB    1 
ATOM   4369 C CG    . HIS E 3 182 ? 28.178  80.030  70.379  1.00 119.51 ? 218 HIS B CG    1 
ATOM   4370 N ND1   . HIS E 3 182 ? 26.871  80.461  70.463  1.00 103.06 ? 218 HIS B ND1   1 
ATOM   4371 C CD2   . HIS E 3 182 ? 28.950  81.130  70.548  1.00 92.62  ? 218 HIS B CD2   1 
ATOM   4372 C CE1   . HIS E 3 182 ? 26.855  81.765  70.670  1.00 83.73  ? 218 HIS B CE1   1 
ATOM   4373 N NE2   . HIS E 3 182 ? 28.102  82.195  70.725  1.00 74.77  ? 218 HIS B NE2   1 
ATOM   4374 N N     . ASP E 3 183 ? 30.879  76.139  70.219  1.00 38.61  ? 219 ASP B N     1 
ATOM   4375 C CA    . ASP E 3 183 ? 31.110  74.731  69.900  1.00 40.65  ? 219 ASP B CA    1 
ATOM   4376 C C     . ASP E 3 183 ? 29.777  74.026  69.669  1.00 44.02  ? 219 ASP B C     1 
ATOM   4377 O O     . ASP E 3 183 ? 28.948  73.927  70.573  1.00 59.27  ? 219 ASP B O     1 
ATOM   4378 C CB    . ASP E 3 183 ? 31.843  74.033  71.042  1.00 35.39  ? 219 ASP B CB    1 
ATOM   4379 C CG    . ASP E 3 183 ? 31.985  72.531  70.820  1.00 72.91  ? 219 ASP B CG    1 
ATOM   4380 O OD1   . ASP E 3 183 ? 31.292  71.987  69.937  1.00 57.13  ? 219 ASP B OD1   1 
ATOM   4381 O OD2   . ASP E 3 183 ? 32.779  71.882  71.538  1.00 45.99  ? 219 ASP B OD2   1 
ATOM   4382 N N     . SER E 3 184 ? 29.584  73.525  68.455  1.00 52.44  ? 220 SER B N     1 
ATOM   4383 C CA    . SER E 3 184 ? 28.368  72.810  68.082  1.00 62.97  ? 220 SER B CA    1 
ATOM   4384 C C     . SER E 3 184 ? 28.008  71.669  69.037  1.00 72.56  ? 220 SER B C     1 
ATOM   4385 O O     . SER E 3 184 ? 27.066  70.932  68.790  1.00 60.20  ? 220 SER B O     1 
ATOM   4386 C CB    . SER E 3 184 ? 28.517  72.250  66.664  1.00 84.15  ? 220 SER B CB    1 
ATOM   4387 O OG    . SER E 3 184 ? 27.446  71.386  66.335  1.00 131.66 ? 220 SER B OG    1 
ATOM   4388 N N     . LYS E 3 185 ? 28.757  71.507  70.119  1.00 66.43  ? 221 LYS B N     1 
ATOM   4389 C CA    . LYS E 3 185 ? 28.452  70.444  71.068  1.00 76.51  ? 221 LYS B CA    1 
ATOM   4390 C C     . LYS E 3 185 ? 28.168  70.931  72.487  1.00 78.36  ? 221 LYS B C     1 
ATOM   4391 O O     . LYS E 3 185 ? 27.209  70.475  73.124  1.00 65.54  ? 221 LYS B O     1 
ATOM   4392 C CB    . LYS E 3 185 ? 29.578  69.408  71.101  1.00 67.12  ? 221 LYS B CB    1 
ATOM   4393 C CG    . LYS E 3 185 ? 29.454  68.315  70.048  1.00 39.19  ? 221 LYS B CG    1 
ATOM   4394 C CD    . LYS E 3 185 ? 28.101  67.602  70.097  1.00 65.36  ? 221 LYS B CD    1 
ATOM   4395 C CE    . LYS E 3 185 ? 28.161  66.210  69.457  1.00 43.04  ? 221 LYS B CE    1 
ATOM   4396 N NZ    . LYS E 3 185 ? 29.090  65.275  70.169  1.00 55.51  ? 221 LYS B NZ    1 
ATOM   4397 N N     . SER E 3 186 ? 28.993  71.850  72.979  1.00 75.59  ? 222 SER B N     1 
ATOM   4398 C CA    . SER E 3 186 ? 28.813  72.370  74.325  1.00 71.37  ? 222 SER B CA    1 
ATOM   4399 C C     . SER E 3 186 ? 27.330  72.557  74.608  1.00 74.33  ? 222 SER B C     1 
ATOM   4400 O O     . SER E 3 186 ? 26.652  73.313  73.908  1.00 56.59  ? 222 SER B O     1 
ATOM   4401 C CB    . SER E 3 186 ? 29.536  73.702  74.494  1.00 89.69  ? 222 SER B CB    1 
ATOM   4402 O OG    . SER E 3 186 ? 29.345  74.199  75.809  1.00 88.25  ? 222 SER B OG    1 
ATOM   4403 N N     . PRO E 3 187 ? 26.811  71.861  75.642  1.00 82.75  ? 223 PRO B N     1 
ATOM   4404 C CA    . PRO E 3 187 ? 25.407  71.913  76.054  1.00 78.92  ? 223 PRO B CA    1 
ATOM   4405 C C     . PRO E 3 187 ? 24.752  73.268  75.842  1.00 78.06  ? 223 PRO B C     1 
ATOM   4406 O O     . PRO E 3 187 ? 23.649  73.354  75.306  1.00 106.52 ? 223 PRO B O     1 
ATOM   4407 C CB    . PRO E 3 187 ? 25.478  71.511  77.519  1.00 98.37  ? 223 PRO B CB    1 
ATOM   4408 C CG    . PRO E 3 187 ? 26.529  70.449  77.481  1.00 102.72 ? 223 PRO B CG    1 
ATOM   4409 C CD    . PRO E 3 187 ? 27.601  71.080  76.617  1.00 74.39  ? 223 PRO B CD    1 
ATOM   4410 N N     . GLY E 3 188 ? 25.438  74.325  76.254  1.00 49.34  ? 224 GLY B N     1 
ATOM   4411 C CA    . GLY E 3 188 ? 24.889  75.657  76.088  1.00 53.10  ? 224 GLY B CA    1 
ATOM   4412 C C     . GLY E 3 188 ? 25.606  76.471  75.022  1.00 83.98  ? 224 GLY B C     1 
ATOM   4413 O O     . GLY E 3 188 ? 26.206  77.505  75.327  1.00 67.67  ? 224 GLY B O     1 
ATOM   4414 N N     . ALA E 3 189 ? 25.539  76.021  73.769  1.00 94.36  ? 225 ALA B N     1 
ATOM   4415 C CA    . ALA E 3 189 ? 26.205  76.737  72.685  1.00 102.65 ? 225 ALA B CA    1 
ATOM   4416 C C     . ALA E 3 189 ? 25.707  76.403  71.277  1.00 104.65 ? 225 ALA B C     1 
ATOM   4417 O O     . ALA E 3 189 ? 25.756  77.253  70.385  1.00 119.25 ? 225 ALA B O     1 
ATOM   4418 C CB    . ALA E 3 189 ? 27.706  76.500  72.766  1.00 59.70  ? 225 ALA B CB    1 
ATOM   4419 N N     . SER E 3 190 ? 25.234  75.176  71.072  1.00 107.79 ? 226 SER B N     1 
ATOM   4420 C CA    . SER E 3 190 ? 24.753  74.758  69.756  1.00 86.98  ? 226 SER B CA    1 
ATOM   4421 C C     . SER E 3 190 ? 23.667  75.682  69.197  1.00 89.46  ? 226 SER B C     1 
ATOM   4422 O O     . SER E 3 190 ? 23.376  76.737  69.765  1.00 83.85  ? 226 SER B O     1 
ATOM   4423 C CB    . SER E 3 190 ? 24.240  73.310  69.810  1.00 100.00 ? 226 SER B CB    1 
ATOM   4424 O OG    . SER E 3 190 ? 23.228  73.144  70.789  1.00 93.39  ? 226 SER B OG    1 
ATOM   4425 N N     . ASN E 3 191 ? 23.073  75.292  68.074  1.00 82.53  ? 227 ASN B N     1 
ATOM   4426 C CA    . ASN E 3 191 ? 22.038  76.108  67.464  1.00 96.14  ? 227 ASN B CA    1 
ATOM   4427 C C     . ASN E 3 191 ? 20.656  75.532  67.688  1.00 95.39  ? 227 ASN B C     1 
ATOM   4428 O O     . ASN E 3 191 ? 20.344  74.439  67.223  1.00 104.88 ? 227 ASN B O     1 
ATOM   4429 C CB    . ASN E 3 191 ? 22.275  76.262  65.961  1.00 118.77 ? 227 ASN B CB    1 
ATOM   4430 C CG    . ASN E 3 191 ? 21.219  77.129  65.295  1.00 138.48 ? 227 ASN B CG    1 
ATOM   4431 O OD1   . ASN E 3 191 ? 20.037  76.783  65.275  1.00 140.73 ? 227 ASN B OD1   1 
ATOM   4432 N ND2   . ASN E 3 191 ? 21.643  78.268  64.754  1.00 140.73 ? 227 ASN B ND2   1 
ATOM   4433 N N     . LEU E 3 192 ? 19.827  76.286  68.396  1.00 103.12 ? 228 LEU B N     1 
ATOM   4434 C CA    . LEU E 3 192 ? 18.469  75.856  68.676  1.00 98.05  ? 228 LEU B CA    1 
ATOM   4435 C C     . LEU E 3 192 ? 17.660  75.701  67.403  1.00 95.04  ? 228 LEU B C     1 
ATOM   4436 O O     . LEU E 3 192 ? 16.868  76.572  67.054  1.00 118.70 ? 228 LEU B O     1 
ATOM   4437 C CB    . LEU E 3 192 ? 17.777  76.853  69.602  1.00 84.34  ? 228 LEU B CB    1 
ATOM   4438 C CG    . LEU E 3 192 ? 18.181  76.748  71.069  1.00 88.27  ? 228 LEU B CG    1 
ATOM   4439 C CD1   . LEU E 3 192 ? 19.633  77.149  71.251  1.00 105.69 ? 228 LEU B CD1   1 
ATOM   4440 C CD2   . LEU E 3 192 ? 17.274  77.637  71.885  1.00 97.76  ? 228 LEU B CD2   1 
ATOM   4441 N N     . LYS E 3 193 ? 17.872  74.597  66.699  1.00 66.78  ? 229 LYS B N     1 
ATOM   4442 C CA    . LYS E 3 193 ? 17.124  74.353  65.483  1.00 77.40  ? 229 LYS B CA    1 
ATOM   4443 C C     . LYS E 3 193 ? 15.957  73.465  65.900  1.00 74.99  ? 229 LYS B C     1 
ATOM   4444 O O     . LYS E 3 193 ? 15.870  73.080  67.074  1.00 53.55  ? 229 LYS B O     1 
ATOM   4445 C CB    . LYS E 3 193 ? 18.002  73.664  64.433  1.00 62.29  ? 229 LYS B CB    1 
ATOM   4446 C CG    . LYS E 3 193 ? 18.198  72.177  64.625  1.00 82.33  ? 229 LYS B CG    1 
ATOM   4447 C CD    . LYS E 3 193 ? 17.582  71.398  63.468  1.00 52.14  ? 229 LYS B CD    1 
ATOM   4448 C CE    . LYS E 3 193 ? 17.790  69.891  63.657  1.00 122.71 ? 229 LYS B CE    1 
ATOM   4449 N NZ    . LYS E 3 193 ? 17.194  69.047  62.580  1.00 66.47  ? 229 LYS B NZ    1 
ATOM   4450 N N     . ILE E 3 194 ? 15.075  73.149  64.949  1.00 55.15  ? 230 ILE B N     1 
ATOM   4451 C CA    . ILE E 3 194 ? 13.887  72.334  65.210  1.00 42.48  ? 230 ILE B CA    1 
ATOM   4452 C C     . ILE E 3 194 ? 13.660  71.340  64.084  1.00 45.48  ? 230 ILE B C     1 
ATOM   4453 O O     . ILE E 3 194 ? 13.349  71.740  62.962  1.00 67.80  ? 230 ILE B O     1 
ATOM   4454 C CB    . ILE E 3 194 ? 12.620  73.214  65.302  1.00 53.51  ? 230 ILE B CB    1 
ATOM   4455 C CG1   . ILE E 3 194 ? 12.826  74.324  66.343  1.00 51.40  ? 230 ILE B CG1   1 
ATOM   4456 C CG2   . ILE E 3 194 ? 11.395  72.327  65.609  1.00 37.06  ? 230 ILE B CG2   1 
ATOM   4457 C CD1   . ILE E 3 194 ? 11.692  75.307  66.441  1.00 60.54  ? 230 ILE B CD1   1 
ATOM   4458 N N     . SER E 3 195 ? 13.796  70.053  64.390  1.00 63.95  ? 231 SER B N     1 
ATOM   4459 C CA    . SER E 3 195 ? 13.618  68.991  63.397  1.00 88.60  ? 231 SER B CA    1 
ATOM   4460 C C     . SER E 3 195 ? 12.268  69.048  62.685  1.00 96.87  ? 231 SER B C     1 
ATOM   4461 O O     . SER E 3 195 ? 12.205  69.085  61.457  1.00 52.42  ? 231 SER B O     1 
ATOM   4462 C CB    . SER E 3 195 ? 13.783  67.619  64.057  1.00 128.61 ? 231 SER B CB    1 
ATOM   4463 O OG    . SER E 3 195 ? 13.546  66.570  63.133  1.00 136.41 ? 231 SER B OG    1 
ATOM   4464 N N     . ARG E 3 196 ? 11.195  69.029  63.467  1.00 109.89 ? 232 ARG B N     1 
ATOM   4465 C CA    . ARG E 3 196 ? 9.834   69.096  62.946  1.00 112.04 ? 232 ARG B CA    1 
ATOM   4466 C C     . ARG E 3 196 ? 8.837   69.033  64.096  1.00 118.37 ? 232 ARG B C     1 
ATOM   4467 O O     . ARG E 3 196 ? 9.212   68.753  65.234  1.00 111.54 ? 232 ARG B O     1 
ATOM   4468 C CB    . ARG E 3 196 ? 9.555   67.966  61.938  1.00 103.45 ? 232 ARG B CB    1 
ATOM   4469 C CG    . ARG E 3 196 ? 9.757   66.538  62.439  1.00 46.43  ? 232 ARG B CG    1 
ATOM   4470 C CD    . ARG E 3 196 ? 9.144   65.532  61.456  1.00 70.35  ? 232 ARG B CD    1 
ATOM   4471 N NE    . ARG E 3 196 ? 9.597   64.157  61.674  1.00 58.80  ? 232 ARG B NE    1 
ATOM   4472 C CZ    . ARG E 3 196 ? 9.162   63.099  60.984  1.00 86.35  ? 232 ARG B CZ    1 
ATOM   4473 N NH1   . ARG E 3 196 ? 8.253   63.238  60.025  1.00 57.18  ? 232 ARG B NH1   1 
ATOM   4474 N NH2   . ARG E 3 196 ? 9.651   61.893  61.240  1.00 90.21  ? 232 ARG B NH2   1 
ATOM   4475 N N     . MET E 3 197 ? 7.571   69.309  63.799  1.00 121.74 ? 233 MET B N     1 
ATOM   4476 C CA    . MET E 3 197 ? 6.526   69.294  64.817  1.00 114.96 ? 233 MET B CA    1 
ATOM   4477 C C     . MET E 3 197 ? 5.354   68.400  64.441  1.00 121.14 ? 233 MET B C     1 
ATOM   4478 O O     . MET E 3 197 ? 5.159   68.059  63.273  1.00 112.26 ? 233 MET B O     1 
ATOM   4479 C CB    . MET E 3 197 ? 6.001   70.707  65.060  1.00 113.11 ? 233 MET B CB    1 
ATOM   4480 C CG    . MET E 3 197 ? 7.036   71.689  65.552  1.00 76.65  ? 233 MET B CG    1 
ATOM   4481 S SD    . MET E 3 197 ? 6.381   73.360  65.487  1.00 108.69 ? 233 MET B SD    1 
ATOM   4482 C CE    . MET E 3 197 ? 5.642   73.492  67.101  1.00 112.71 ? 233 MET B CE    1 
ATOM   4483 N N     . ASP E 3 198 ? 4.569   68.045  65.454  1.00 126.12 ? 234 ASP B N     1 
ATOM   4484 C CA    . ASP E 3 198 ? 3.399   67.195  65.293  1.00 121.14 ? 234 ASP B CA    1 
ATOM   4485 C C     . ASP E 3 198 ? 2.357   67.874  64.401  1.00 113.12 ? 234 ASP B C     1 
ATOM   4486 O O     . ASP E 3 198 ? 2.613   68.119  63.227  1.00 92.85  ? 234 ASP B O     1 
ATOM   4487 C CB    . ASP E 3 198 ? 2.818   66.881  66.676  1.00 120.09 ? 234 ASP B CB    1 
ATOM   4488 C CG    . ASP E 3 198 ? 1.716   65.849  66.628  1.00 136.83 ? 234 ASP B CG    1 
ATOM   4489 O OD1   . ASP E 3 198 ? 1.877   64.835  65.914  1.00 130.29 ? 234 ASP B OD1   1 
ATOM   4490 O OD2   . ASP E 3 198 ? 0.695   66.048  67.321  1.00 140.49 ? 234 ASP B OD2   1 
ATOM   4491 N N     . LYS E 3 199 ? 1.191   68.188  64.956  1.00 124.56 ? 235 LYS B N     1 
ATOM   4492 C CA    . LYS E 3 199 ? 0.135   68.833  64.182  1.00 130.00 ? 235 LYS B CA    1 
ATOM   4493 C C     . LYS E 3 199 ? 0.572   70.230  63.747  1.00 125.34 ? 235 LYS B C     1 
ATOM   4494 O O     . LYS E 3 199 ? 0.967   71.053  64.573  1.00 126.09 ? 235 LYS B O     1 
ATOM   4495 C CB    . LYS E 3 199 ? -1.154  68.916  65.008  1.00 133.97 ? 235 LYS B CB    1 
ATOM   4496 C CG    . LYS E 3 199 ? -2.413  69.139  64.179  1.00 140.64 ? 235 LYS B CG    1 
ATOM   4497 C CD    . LYS E 3 199 ? -3.672  68.918  65.008  1.00 140.73 ? 235 LYS B CD    1 
ATOM   4498 C CE    . LYS E 3 199 ? -4.928  68.969  64.143  1.00 140.54 ? 235 LYS B CE    1 
ATOM   4499 N NZ    . LYS E 3 199 ? -6.181  68.764  64.935  1.00 136.85 ? 235 LYS B NZ    1 
ATOM   4500 N N     . THR E 3 200 ? 0.500   70.486  62.444  1.00 116.49 ? 236 THR B N     1 
ATOM   4501 C CA    . THR E 3 200 ? 0.896   71.774  61.880  1.00 102.70 ? 236 THR B CA    1 
ATOM   4502 C C     . THR E 3 200 ? -0.168  72.846  62.078  1.00 113.09 ? 236 THR B C     1 
ATOM   4503 O O     . THR E 3 200 ? 0.143   73.982  62.445  1.00 124.28 ? 236 THR B O     1 
ATOM   4504 C CB    . THR E 3 200 ? 1.187   71.647  60.376  1.00 70.88  ? 236 THR B CB    1 
ATOM   4505 O OG1   . THR E 3 200 ? 1.437   72.944  59.827  1.00 118.71 ? 236 THR B OG1   1 
ATOM   4506 C CG2   . THR E 3 200 ? 0.012   71.009  59.659  1.00 75.91  ? 236 THR B CG2   1 
ATOM   4507 N N     . ALA E 3 201 ? -1.421  72.481  61.823  1.00 124.52 ? 237 ALA B N     1 
ATOM   4508 C CA    . ALA E 3 201 ? -2.539  73.403  61.985  1.00 130.15 ? 237 ALA B CA    1 
ATOM   4509 C C     . ALA E 3 201 ? -2.856  73.550  63.473  1.00 131.92 ? 237 ALA B C     1 
ATOM   4510 O O     . ALA E 3 201 ? -3.143  72.568  64.162  1.00 127.84 ? 237 ALA B O     1 
ATOM   4511 C CB    . ALA E 3 201 ? -3.758  72.886  61.230  1.00 137.08 ? 237 ALA B CB    1 
ATOM   4512 N N     . GLY E 3 202 ? -2.798  74.786  63.960  1.00 132.23 ? 238 GLY B N     1 
ATOM   4513 C CA    . GLY E 3 202 ? -3.066  75.046  65.362  1.00 125.62 ? 238 GLY B CA    1 
ATOM   4514 C C     . GLY E 3 202 ? -4.528  74.946  65.753  1.00 138.52 ? 238 GLY B C     1 
ATOM   4515 O O     . GLY E 3 202 ? -5.118  73.864  65.728  1.00 134.93 ? 238 GLY B O     1 
ATOM   4516 N N     . SER E 3 203 ? -5.112  76.082  66.122  1.00 140.73 ? 239 SER B N     1 
ATOM   4517 C CA    . SER E 3 203 ? -6.510  76.135  66.531  1.00 140.73 ? 239 SER B CA    1 
ATOM   4518 C C     . SER E 3 203 ? -7.054  77.554  66.403  1.00 140.40 ? 239 SER B C     1 
ATOM   4519 O O     . SER E 3 203 ? -7.490  77.972  65.328  1.00 133.61 ? 239 SER B O     1 
ATOM   4520 C CB    . SER E 3 203 ? -6.652  75.655  67.982  1.00 140.73 ? 239 SER B CB    1 
ATOM   4521 O OG    . SER E 3 203 ? -5.899  76.463  68.873  1.00 137.94 ? 239 SER B OG    1 
ATOM   4522 N N     . VAL E 3 204 ? -7.020  78.295  67.507  1.00 139.03 ? 240 VAL B N     1 
ATOM   4523 C CA    . VAL E 3 204 ? -7.508  79.665  67.523  1.00 133.78 ? 240 VAL B CA    1 
ATOM   4524 C C     . VAL E 3 204 ? -7.209  80.359  68.854  1.00 130.91 ? 240 VAL B C     1 
ATOM   4525 O O     . VAL E 3 204 ? -6.396  81.284  68.908  1.00 111.47 ? 240 VAL B O     1 
ATOM   4526 C CB    . VAL E 3 204 ? -9.034  79.708  67.230  1.00 136.32 ? 240 VAL B CB    1 
ATOM   4527 C CG1   . VAL E 3 204 ? -9.783  78.741  68.153  1.00 82.02  ? 240 VAL B CG1   1 
ATOM   4528 C CG2   . VAL E 3 204 ? -9.553  81.127  67.389  1.00 125.44 ? 240 VAL B CG2   1 
ATOM   4529 N N     . ARG E 3 205 ? -7.861  79.909  69.922  1.00 128.50 ? 241 ARG B N     1 
ATOM   4530 C CA    . ARG E 3 205 ? -7.657  80.492  71.243  1.00 130.73 ? 241 ARG B CA    1 
ATOM   4531 C C     . ARG E 3 205 ? -6.246  80.187  71.735  1.00 132.32 ? 241 ARG B C     1 
ATOM   4532 O O     . ARG E 3 205 ? -5.274  80.379  71.003  1.00 139.19 ? 241 ARG B O     1 
ATOM   4533 C CB    . ARG E 3 205 ? -8.686  79.941  72.220  1.00 133.63 ? 241 ARG B CB    1 
ATOM   4534 N N     . GLY E 3 206 ? -6.139  79.711  72.973  1.00 127.50 ? 242 GLY B N     1 
ATOM   4535 C CA    . GLY E 3 206 ? -4.836  79.392  73.529  1.00 127.67 ? 242 GLY B CA    1 
ATOM   4536 C C     . GLY E 3 206 ? -4.792  78.148  74.396  1.00 125.15 ? 242 GLY B C     1 
ATOM   4537 O O     . GLY E 3 206 ? -4.815  78.239  75.623  1.00 109.95 ? 242 GLY B O     1 
ATOM   4538 N N     . GLY E 3 207 ? -4.719  76.984  73.759  1.00 120.73 ? 243 GLY B N     1 
ATOM   4539 C CA    . GLY E 3 207 ? -4.665  75.739  74.503  1.00 112.55 ? 243 GLY B CA    1 
ATOM   4540 C C     . GLY E 3 207 ? -4.750  74.507  73.621  1.00 116.33 ? 243 GLY B C     1 
ATOM   4541 O O     . GLY E 3 207 ? -5.784  73.837  73.580  1.00 114.10 ? 243 GLY B O     1 
ATOM   4542 N N     . ASP E 3 208 ? -3.669  74.204  72.910  1.00 121.77 ? 244 ASP B N     1 
ATOM   4543 C CA    . ASP E 3 208 ? -3.647  73.036  72.039  1.00 124.10 ? 244 ASP B CA    1 
ATOM   4544 C C     . ASP E 3 208 ? -2.295  72.334  72.063  1.00 116.48 ? 244 ASP B C     1 
ATOM   4545 O O     . ASP E 3 208 ? -1.251  72.953  71.847  1.00 100.98 ? 244 ASP B O     1 
ATOM   4546 C CB    . ASP E 3 208 ? -4.002  73.430  70.606  1.00 132.58 ? 244 ASP B CB    1 
ATOM   4547 C CG    . ASP E 3 208 ? -5.003  72.482  69.980  1.00 137.67 ? 244 ASP B CG    1 
ATOM   4548 O OD1   . ASP E 3 208 ? -4.751  71.257  69.997  1.00 107.39 ? 244 ASP B OD1   1 
ATOM   4549 O OD2   . ASP E 3 208 ? -6.041  72.963  69.477  1.00 140.20 ? 244 ASP B OD2   1 
ATOM   4550 N N     . GLU E 3 209 ? -2.331  71.033  72.321  1.00 108.41 ? 245 GLU B N     1 
ATOM   4551 C CA    . GLU E 3 209 ? -1.123  70.225  72.398  1.00 106.44 ? 245 GLU B CA    1 
ATOM   4552 C C     . GLU E 3 209 ? -0.545  69.873  71.035  1.00 118.14 ? 245 GLU B C     1 
ATOM   4553 O O     . GLU E 3 209 ? -1.276  69.638  70.068  1.00 117.38 ? 245 GLU B O     1 
ATOM   4554 C CB    . GLU E 3 209 ? -1.403  68.944  73.194  1.00 112.20 ? 245 GLU B CB    1 
ATOM   4555 C CG    . GLU E 3 209 ? -0.275  67.921  73.160  1.00 115.65 ? 245 GLU B CG    1 
ATOM   4556 C CD    . GLU E 3 209 ? -0.472  66.793  74.156  1.00 111.60 ? 245 GLU B CD    1 
ATOM   4557 O OE1   . GLU E 3 209 ? -0.386  67.058  75.372  1.00 93.76  ? 245 GLU B OE1   1 
ATOM   4558 O OE2   . GLU E 3 209 ? -0.710  65.645  73.723  1.00 113.07 ? 245 GLU B OE2   1 
ATOM   4559 N N     . VAL E 3 210 ? 0.782   69.843  70.978  1.00 119.46 ? 246 VAL B N     1 
ATOM   4560 C CA    . VAL E 3 210 ? 1.508   69.513  69.762  1.00 115.74 ? 246 VAL B CA    1 
ATOM   4561 C C     . VAL E 3 210 ? 2.868   68.959  70.176  1.00 131.08 ? 246 VAL B C     1 
ATOM   4562 O O     . VAL E 3 210 ? 3.546   69.529  71.036  1.00 115.53 ? 246 VAL B O     1 
ATOM   4563 C CB    . VAL E 3 210 ? 1.704   70.765  68.870  1.00 102.84 ? 246 VAL B CB    1 
ATOM   4564 C CG1   . VAL E 3 210 ? 2.617   71.771  69.566  1.00 60.40  ? 246 VAL B CG1   1 
ATOM   4565 C CG2   . VAL E 3 210 ? 2.265   70.360  67.519  1.00 84.32  ? 246 VAL B CG2   1 
ATOM   4566 N N     . TYR E 3 211 ? 3.251   67.832  69.585  1.00 135.73 ? 247 TYR B N     1 
ATOM   4567 C CA    . TYR E 3 211 ? 4.532   67.212  69.897  1.00 136.47 ? 247 TYR B CA    1 
ATOM   4568 C C     . TYR E 3 211 ? 5.617   67.830  69.031  1.00 133.19 ? 247 TYR B C     1 
ATOM   4569 O O     . TYR E 3 211 ? 5.608   67.680  67.810  1.00 127.27 ? 247 TYR B O     1 
ATOM   4570 C CB    . TYR E 3 211 ? 4.476   65.699  69.656  1.00 135.81 ? 247 TYR B CB    1 
ATOM   4571 C CG    . TYR E 3 211 ? 3.591   64.937  70.622  1.00 130.19 ? 247 TYR B CG    1 
ATOM   4572 C CD1   . TYR E 3 211 ? 3.429   63.556  70.509  1.00 135.07 ? 247 TYR B CD1   1 
ATOM   4573 C CD2   . TYR E 3 211 ? 2.911   65.592  71.648  1.00 100.80 ? 247 TYR B CD2   1 
ATOM   4574 C CE1   . TYR E 3 211 ? 2.614   62.850  71.392  1.00 140.06 ? 247 TYR B CE1   1 
ATOM   4575 C CE2   . TYR E 3 211 ? 2.094   64.897  72.533  1.00 135.54 ? 247 TYR B CE2   1 
ATOM   4576 C CZ    . TYR E 3 211 ? 1.949   63.528  72.402  1.00 138.05 ? 247 TYR B CZ    1 
ATOM   4577 O OH    . TYR E 3 211 ? 1.144   62.843  73.286  1.00 124.14 ? 247 TYR B OH    1 
ATOM   4578 N N     . LEU E 3 212 ? 6.547   68.529  69.672  1.00 131.04 ? 248 LEU B N     1 
ATOM   4579 C CA    . LEU E 3 212 ? 7.639   69.171  68.955  1.00 116.92 ? 248 LEU B CA    1 
ATOM   4580 C C     . LEU E 3 212 ? 8.964   68.449  69.149  1.00 103.30 ? 248 LEU B C     1 
ATOM   4581 O O     . LEU E 3 212 ? 9.351   68.112  70.265  1.00 103.04 ? 248 LEU B O     1 
ATOM   4582 C CB    . LEU E 3 212 ? 7.783   70.631  69.392  1.00 104.50 ? 248 LEU B CB    1 
ATOM   4583 C CG    . LEU E 3 212 ? 8.918   71.403  68.715  1.00 102.97 ? 248 LEU B CG    1 
ATOM   4584 C CD1   . LEU E 3 212 ? 8.654   72.893  68.806  1.00 92.24  ? 248 LEU B CD1   1 
ATOM   4585 C CD2   . LEU E 3 212 ? 10.249  71.038  69.365  1.00 84.51  ? 248 LEU B CD2   1 
ATOM   4586 N N     . LEU E 3 213 ? 9.659   68.230  68.042  1.00 94.54  ? 249 LEU B N     1 
ATOM   4587 C CA    . LEU E 3 213 ? 10.947  67.559  68.049  1.00 84.98  ? 249 LEU B CA    1 
ATOM   4588 C C     . LEU E 3 213 ? 12.049  68.578  67.786  1.00 94.30  ? 249 LEU B C     1 
ATOM   4589 O O     . LEU E 3 213 ? 11.945  69.385  66.860  1.00 110.53 ? 249 LEU B O     1 
ATOM   4590 C CB    . LEU E 3 213 ? 10.957  66.471  66.977  1.00 27.00  ? 249 LEU B CB    1 
ATOM   4591 C CG    . LEU E 3 213 ? 10.119  65.241  67.333  1.00 39.73  ? 249 LEU B CG    1 
ATOM   4592 C CD1   . LEU E 3 213 ? 8.704   65.645  67.649  1.00 65.74  ? 249 LEU B CD1   1 
ATOM   4593 C CD2   . LEU E 3 213 ? 10.149  64.249  66.183  1.00 100.44 ? 249 LEU B CD2   1 
ATOM   4594 N N     . CYS E 3 214 ? 13.103  68.548  68.596  1.00 76.98  ? 250 CYS B N     1 
ATOM   4595 C CA    . CYS E 3 214 ? 14.188  69.503  68.416  1.00 83.01  ? 250 CYS B CA    1 
ATOM   4596 C C     . CYS E 3 214 ? 15.573  68.924  68.667  1.00 70.55  ? 250 CYS B C     1 
ATOM   4597 O O     . CYS E 3 214 ? 15.778  67.712  68.659  1.00 64.85  ? 250 CYS B O     1 
ATOM   4598 C CB    . CYS E 3 214 ? 13.988  70.704  69.345  1.00 108.69 ? 250 CYS B CB    1 
ATOM   4599 S SG    . CYS E 3 214 ? 14.530  70.424  71.051  1.00 104.01 ? 250 CYS B SG    1 
ATOM   4600 N N     . ASP E 3 215 ? 16.520  69.829  68.885  1.00 69.48  ? 251 ASP B N     1 
ATOM   4601 C CA    . ASP E 3 215 ? 17.893  69.468  69.166  1.00 71.63  ? 251 ASP B CA    1 
ATOM   4602 C C     . ASP E 3 215 ? 18.176  69.746  70.630  1.00 64.61  ? 251 ASP B C     1 
ATOM   4603 O O     . ASP E 3 215 ? 17.498  70.557  71.266  1.00 71.55  ? 251 ASP B O     1 
ATOM   4604 C CB    . ASP E 3 215 ? 18.854  70.283  68.299  1.00 99.68  ? 251 ASP B CB    1 
ATOM   4605 C CG    . ASP E 3 215 ? 19.538  69.443  67.243  1.00 92.00  ? 251 ASP B CG    1 
ATOM   4606 O OD1   . ASP E 3 215 ? 18.870  69.046  66.272  1.00 64.98  ? 251 ASP B OD1   1 
ATOM   4607 O OD2   . ASP E 3 215 ? 20.746  69.170  67.388  1.00 98.75  ? 251 ASP B OD2   1 
ATOM   4608 N N     . LYS E 3 216 ? 19.191  69.067  71.149  1.00 80.77  ? 252 LYS B N     1 
ATOM   4609 C CA    . LYS E 3 216 ? 19.602  69.198  72.538  1.00 63.17  ? 252 LYS B CA    1 
ATOM   4610 C C     . LYS E 3 216 ? 19.389  70.592  73.087  1.00 61.95  ? 252 LYS B C     1 
ATOM   4611 O O     . LYS E 3 216 ? 19.825  71.586  72.503  1.00 57.14  ? 252 LYS B O     1 
ATOM   4612 C CB    . LYS E 3 216 ? 21.069  68.810  72.681  1.00 49.64  ? 252 LYS B CB    1 
ATOM   4613 C CG    . LYS E 3 216 ? 21.514  68.610  74.106  1.00 34.19  ? 252 LYS B CG    1 
ATOM   4614 C CD    . LYS E 3 216 ? 22.736  67.699  74.149  1.00 70.34  ? 252 LYS B CD    1 
ATOM   4615 C CE    . LYS E 3 216 ? 23.215  67.453  75.572  1.00 48.58  ? 252 LYS B CE    1 
ATOM   4616 N NZ    . LYS E 3 216 ? 23.793  68.686  76.172  1.00 106.38 ? 252 LYS B NZ    1 
ATOM   4617 N N     . VAL E 3 217 ? 18.704  70.643  74.220  1.00 79.07  ? 253 VAL B N     1 
ATOM   4618 C CA    . VAL E 3 217 ? 18.403  71.887  74.908  1.00 93.61  ? 253 VAL B CA    1 
ATOM   4619 C C     . VAL E 3 217 ? 18.367  71.565  76.392  1.00 101.18 ? 253 VAL B C     1 
ATOM   4620 O O     . VAL E 3 217 ? 18.021  70.447  76.771  1.00 90.82  ? 253 VAL B O     1 
ATOM   4621 C CB    . VAL E 3 217 ? 17.035  72.435  74.485  1.00 95.38  ? 253 VAL B CB    1 
ATOM   4622 C CG1   . VAL E 3 217 ? 15.982  71.335  74.575  1.00 70.83  ? 253 VAL B CG1   1 
ATOM   4623 C CG2   . VAL E 3 217 ? 16.661  73.605  75.373  1.00 106.11 ? 253 VAL B CG2   1 
ATOM   4624 N N     . GLN E 3 218 ? 18.716  72.533  77.229  1.00 94.74  ? 254 GLN B N     1 
ATOM   4625 C CA    . GLN E 3 218 ? 18.720  72.307  78.668  1.00 118.01 ? 254 GLN B CA    1 
ATOM   4626 C C     . GLN E 3 218 ? 17.332  72.511  79.288  1.00 131.04 ? 254 GLN B C     1 
ATOM   4627 O O     . GLN E 3 218 ? 16.475  73.166  78.694  1.00 140.73 ? 254 GLN B O     1 
ATOM   4628 C CB    . GLN E 3 218 ? 19.775  73.211  79.305  1.00 110.73 ? 254 GLN B CB    1 
ATOM   4629 C CG    . GLN E 3 218 ? 21.180  72.900  78.783  1.00 72.88  ? 254 GLN B CG    1 
ATOM   4630 C CD    . GLN E 3 218 ? 22.193  73.986  79.097  1.00 78.27  ? 254 GLN B CD    1 
ATOM   4631 O OE1   . GLN E 3 218 ? 22.025  75.136  78.701  1.00 86.94  ? 254 GLN B OE1   1 
ATOM   4632 N NE2   . GLN E 3 218 ? 23.255  73.621  79.805  1.00 99.22  ? 254 GLN B NE2   1 
ATOM   4633 N N     . LYS E 3 219 ? 17.116  71.935  80.471  1.00 132.73 ? 255 LYS B N     1 
ATOM   4634 C CA    . LYS E 3 219 ? 15.829  72.006  81.176  1.00 129.68 ? 255 LYS B CA    1 
ATOM   4635 C C     . LYS E 3 219 ? 15.246  73.405  81.377  1.00 119.10 ? 255 LYS B C     1 
ATOM   4636 O O     . LYS E 3 219 ? 14.132  73.558  81.878  1.00 96.94  ? 255 LYS B O     1 
ATOM   4637 C CB    . LYS E 3 219 ? 15.943  71.328  82.542  1.00 128.50 ? 255 LYS B CB    1 
ATOM   4638 C CG    . LYS E 3 219 ? 14.600  71.080  83.232  1.00 133.30 ? 255 LYS B CG    1 
ATOM   4639 C CD    . LYS E 3 219 ? 14.045  69.691  82.922  1.00 104.88 ? 255 LYS B CD    1 
ATOM   4640 C CE    . LYS E 3 219 ? 13.866  69.459  81.430  1.00 140.11 ? 255 LYS B CE    1 
ATOM   4641 N NZ    . LYS E 3 219 ? 13.468  68.056  81.127  1.00 138.62 ? 255 LYS B NZ    1 
ATOM   4642 N N     . ASP E 3 220 ? 16.007  74.422  81.005  1.00 123.36 ? 256 ASP B N     1 
ATOM   4643 C CA    . ASP E 3 220 ? 15.568  75.802  81.136  1.00 113.38 ? 256 ASP B CA    1 
ATOM   4644 C C     . ASP E 3 220 ? 16.187  76.503  79.939  1.00 101.30 ? 256 ASP B C     1 
ATOM   4645 O O     . ASP E 3 220 ? 16.427  75.863  78.915  1.00 87.29  ? 256 ASP B O     1 
ATOM   4646 C CB    . ASP E 3 220 ? 16.099  76.394  82.438  1.00 136.43 ? 256 ASP B CB    1 
ATOM   4647 C CG    . ASP E 3 220 ? 16.272  75.345  83.524  1.00 137.25 ? 256 ASP B CG    1 
ATOM   4648 O OD1   . ASP E 3 220 ? 15.298  74.619  83.817  1.00 111.28 ? 256 ASP B OD1   1 
ATOM   4649 O OD2   . ASP E 3 220 ? 17.387  75.244  84.082  1.00 133.75 ? 256 ASP B OD2   1 
ATOM   4650 N N     . ASP E 3 221 ? 16.453  77.799  80.048  1.00 85.32  ? 257 ASP B N     1 
ATOM   4651 C CA    . ASP E 3 221 ? 17.062  78.511  78.934  1.00 99.22  ? 257 ASP B CA    1 
ATOM   4652 C C     . ASP E 3 221 ? 16.375  78.076  77.649  1.00 114.91 ? 257 ASP B C     1 
ATOM   4653 O O     . ASP E 3 221 ? 16.981  78.072  76.576  1.00 133.67 ? 257 ASP B O     1 
ATOM   4654 C CB    . ASP E 3 221 ? 18.534  78.143  78.855  1.00 67.40  ? 257 ASP B CB    1 
ATOM   4655 C CG    . ASP E 3 221 ? 19.241  78.357  80.159  1.00 93.19  ? 257 ASP B CG    1 
ATOM   4656 O OD1   . ASP E 3 221 ? 19.818  79.450  80.343  1.00 92.52  ? 257 ASP B OD1   1 
ATOM   4657 O OD2   . ASP E 3 221 ? 19.199  77.440  81.007  1.00 61.67  ? 257 ASP B OD2   1 
ATOM   4658 N N     . ILE E 3 222 ? 15.106  77.707  77.770  1.00 133.43 ? 258 ILE B N     1 
ATOM   4659 C CA    . ILE E 3 222 ? 14.339  77.234  76.631  1.00 133.05 ? 258 ILE B CA    1 
ATOM   4660 C C     . ILE E 3 222 ? 12.884  77.684  76.724  1.00 140.73 ? 258 ILE B C     1 
ATOM   4661 O O     . ILE E 3 222 ? 12.319  77.760  77.817  1.00 140.73 ? 258 ILE B O     1 
ATOM   4662 C CB    . ILE E 3 222 ? 14.391  75.696  76.571  1.00 122.48 ? 258 ILE B CB    1 
ATOM   4663 C CG1   . ILE E 3 222 ? 13.699  75.193  75.303  1.00 104.67 ? 258 ILE B CG1   1 
ATOM   4664 C CG2   . ILE E 3 222 ? 13.773  75.114  77.835  1.00 72.86  ? 258 ILE B CG2   1 
ATOM   4665 C CD1   . ILE E 3 222 ? 14.393  75.627  74.019  1.00 73.28  ? 258 ILE B CD1   1 
ATOM   4666 N N     . GLU E 3 223 ? 12.287  77.980  75.572  1.00 134.99 ? 259 GLU B N     1 
ATOM   4667 C CA    . GLU E 3 223 ? 10.895  78.419  75.503  1.00 125.66 ? 259 GLU B CA    1 
ATOM   4668 C C     . GLU E 3 223 ? 10.469  78.679  74.062  1.00 119.01 ? 259 GLU B C     1 
ATOM   4669 O O     . GLU E 3 223 ? 11.102  79.456  73.348  1.00 134.16 ? 259 GLU B O     1 
ATOM   4670 C CB    . GLU E 3 223 ? 10.698  79.686  76.339  1.00 137.85 ? 259 GLU B CB    1 
ATOM   4671 C CG    . GLU E 3 223 ? 11.703  80.788  76.044  1.00 140.73 ? 259 GLU B CG    1 
ATOM   4672 C CD    . GLU E 3 223 ? 11.545  81.985  76.964  1.00 140.73 ? 259 GLU B CD    1 
ATOM   4673 O OE1   . GLU E 3 223 ? 12.346  82.937  76.841  1.00 140.73 ? 259 GLU B OE1   1 
ATOM   4674 O OE2   . GLU E 3 223 ? 10.621  81.973  77.808  1.00 140.73 ? 259 GLU B OE2   1 
ATOM   4675 N N     . VAL E 3 224 ? 9.393   78.027  73.639  1.00 99.68  ? 260 VAL B N     1 
ATOM   4676 C CA    . VAL E 3 224 ? 8.889   78.185  72.280  1.00 118.33 ? 260 VAL B CA    1 
ATOM   4677 C C     . VAL E 3 224 ? 8.240   79.553  72.075  1.00 134.29 ? 260 VAL B C     1 
ATOM   4678 O O     . VAL E 3 224 ? 7.696   80.140  73.012  1.00 140.73 ? 260 VAL B O     1 
ATOM   4679 C CB    . VAL E 3 224 ? 7.857   77.087  71.940  1.00 113.75 ? 260 VAL B CB    1 
ATOM   4680 C CG1   . VAL E 3 224 ? 7.348   77.267  70.519  1.00 114.07 ? 260 VAL B CG1   1 
ATOM   4681 C CG2   . VAL E 3 224 ? 8.489   75.721  72.099  1.00 109.95 ? 260 VAL B CG2   1 
ATOM   4682 N N     . ARG E 3 225 ? 8.306   80.052  70.841  1.00 140.73 ? 261 ARG B N     1 
ATOM   4683 C CA    . ARG E 3 225 ? 7.727   81.346  70.495  1.00 140.73 ? 261 ARG B CA    1 
ATOM   4684 C C     . ARG E 3 225 ? 7.267   81.393  69.037  1.00 136.03 ? 261 ARG B C     1 
ATOM   4685 O O     . ARG E 3 225 ? 7.882   80.791  68.154  1.00 125.39 ? 261 ARG B O     1 
ATOM   4686 C CB    . ARG E 3 225 ? 8.740   82.468  70.742  1.00 140.73 ? 261 ARG B CB    1 
ATOM   4687 C CG    . ARG E 3 225 ? 8.217   83.856  70.390  1.00 140.73 ? 261 ARG B CG    1 
ATOM   4688 C CD    . ARG E 3 225 ? 9.298   84.920  70.522  1.00 140.73 ? 261 ARG B CD    1 
ATOM   4689 N NE    . ARG E 3 225 ? 8.818   86.247  70.142  1.00 129.23 ? 261 ARG B NE    1 
ATOM   4690 C CZ    . ARG E 3 225 ? 9.565   87.347  70.159  1.00 126.63 ? 261 ARG B CZ    1 
ATOM   4691 N NH1   . ARG E 3 225 ? 9.045   88.514  69.796  1.00 103.46 ? 261 ARG B NH1   1 
ATOM   4692 N NH2   . ARG E 3 225 ? 10.835  87.280  70.538  1.00 110.18 ? 261 ARG B NH2   1 
ATOM   4693 N N     . PHE E 3 226 ? 6.177   82.118  68.801  1.00 138.03 ? 262 PHE B N     1 
ATOM   4694 C CA    . PHE E 3 226 ? 5.616   82.282  67.466  1.00 140.73 ? 262 PHE B CA    1 
ATOM   4695 C C     . PHE E 3 226 ? 5.256   83.758  67.290  1.00 140.73 ? 262 PHE B C     1 
ATOM   4696 O O     . PHE E 3 226 ? 5.068   84.473  68.278  1.00 140.73 ? 262 PHE B O     1 
ATOM   4697 C CB    . PHE E 3 226 ? 4.369   81.413  67.309  1.00 139.17 ? 262 PHE B CB    1 
ATOM   4698 N N     . TYR E 3 227 ? 5.164   84.217  66.044  1.00 139.66 ? 263 TYR B N     1 
ATOM   4699 C CA    . TYR E 3 227 ? 4.830   85.615  65.781  1.00 140.73 ? 263 TYR B CA    1 
ATOM   4700 C C     . TYR E 3 227 ? 4.791   85.966  64.296  1.00 140.73 ? 263 TYR B C     1 
ATOM   4701 O O     . TYR E 3 227 ? 4.703   85.088  63.440  1.00 140.73 ? 263 TYR B O     1 
ATOM   4702 C CB    . TYR E 3 227 ? 5.829   86.540  66.490  1.00 140.71 ? 263 TYR B CB    1 
ATOM   4703 C CG    . TYR E 3 227 ? 7.285   86.269  66.157  1.00 139.37 ? 263 TYR B CG    1 
ATOM   4704 C CD1   . TYR E 3 227 ? 7.745   86.317  64.838  1.00 132.57 ? 263 TYR B CD1   1 
ATOM   4705 C CD2   . TYR E 3 227 ? 8.204   85.974  67.164  1.00 135.05 ? 263 TYR B CD2   1 
ATOM   4706 C CE1   . TYR E 3 227 ? 9.083   86.077  64.531  1.00 99.90  ? 263 TYR B CE1   1 
ATOM   4707 C CE2   . TYR E 3 227 ? 9.543   85.733  66.869  1.00 102.03 ? 263 TYR B CE2   1 
ATOM   4708 C CZ    . TYR E 3 227 ? 9.977   85.787  65.552  1.00 104.65 ? 263 TYR B CZ    1 
ATOM   4709 O OH    . TYR E 3 227 ? 11.305  85.563  65.258  1.00 97.05  ? 263 TYR B OH    1 
ATOM   4710 N N     . GLU E 3 228 ? 4.864   87.267  64.021  1.00 132.92 ? 264 GLU B N     1 
ATOM   4711 C CA    . GLU E 3 228 ? 4.847   87.839  62.671  1.00 128.67 ? 264 GLU B CA    1 
ATOM   4712 C C     . GLU E 3 228 ? 4.569   89.322  62.883  1.00 134.19 ? 264 GLU B C     1 
ATOM   4713 O O     . GLU E 3 228 ? 3.464   89.799  62.623  1.00 135.97 ? 264 GLU B O     1 
ATOM   4714 C CB    . GLU E 3 228 ? 3.735   87.218  61.823  1.00 96.80  ? 264 GLU B CB    1 
ATOM   4715 N N     . ASP E 3 229 ? 5.582   90.047  63.353  1.00 140.73 ? 265 ASP B N     1 
ATOM   4716 C CA    . ASP E 3 229 ? 5.430   91.466  63.655  1.00 140.73 ? 265 ASP B CA    1 
ATOM   4717 C C     . ASP E 3 229 ? 5.865   92.514  62.631  1.00 140.73 ? 265 ASP B C     1 
ATOM   4718 O O     . ASP E 3 229 ? 7.015   92.958  62.635  1.00 140.73 ? 265 ASP B O     1 
ATOM   4719 C CB    . ASP E 3 229 ? 6.115   91.785  64.992  1.00 140.73 ? 265 ASP B CB    1 
ATOM   4720 C CG    . ASP E 3 229 ? 7.610   91.508  64.973  1.00 130.88 ? 265 ASP B CG    1 
ATOM   4721 O OD1   . ASP E 3 229 ? 8.293   91.869  65.955  1.00 108.00 ? 265 ASP B OD1   1 
ATOM   4722 O OD2   . ASP E 3 229 ? 8.106   90.929  63.984  1.00 121.05 ? 265 ASP B OD2   1 
ATOM   4723 N N     . ASP E 3 230 ? 4.939   92.915  61.763  1.00 140.73 ? 266 ASP B N     1 
ATOM   4724 C CA    . ASP E 3 230 ? 5.220   93.968  60.790  1.00 140.49 ? 266 ASP B CA    1 
ATOM   4725 C C     . ASP E 3 230 ? 4.947   95.242  61.582  1.00 140.73 ? 266 ASP B C     1 
ATOM   4726 O O     . ASP E 3 230 ? 5.173   96.360  61.114  1.00 135.12 ? 266 ASP B O     1 
ATOM   4727 C CB    . ASP E 3 230 ? 4.267   93.894  59.591  1.00 125.77 ? 266 ASP B CB    1 
ATOM   4728 C CG    . ASP E 3 230 ? 4.531   92.694  58.704  1.00 122.86 ? 266 ASP B CG    1 
ATOM   4729 O OD1   . ASP E 3 230 ? 5.660   92.567  58.175  1.00 118.64 ? 266 ASP B OD1   1 
ATOM   4730 O OD2   . ASP E 3 230 ? 3.599   91.882  58.532  1.00 118.41 ? 266 ASP B OD2   1 
ATOM   4731 N N     . GLU E 3 231 ? 4.445   95.035  62.798  1.00 140.73 ? 267 GLU B N     1 
ATOM   4732 C CA    . GLU E 3 231 ? 4.123   96.106  63.730  1.00 140.73 ? 267 GLU B CA    1 
ATOM   4733 C C     . GLU E 3 231 ? 5.320   96.314  64.655  1.00 140.73 ? 267 GLU B C     1 
ATOM   4734 O O     . GLU E 3 231 ? 6.467   96.121  64.249  1.00 140.73 ? 267 GLU B O     1 
ATOM   4735 C CB    . GLU E 3 231 ? 2.885   95.728  64.557  1.00 129.51 ? 267 GLU B CB    1 
ATOM   4736 C CG    . GLU E 3 231 ? 3.022   94.424  65.349  1.00 134.24 ? 267 GLU B CG    1 
ATOM   4737 C CD    . GLU E 3 231 ? 2.236   93.267  64.743  1.00 131.65 ? 267 GLU B CD    1 
ATOM   4738 O OE1   . GLU E 3 231 ? 2.433   92.967  63.544  1.00 121.95 ? 267 GLU B OE1   1 
ATOM   4739 O OE2   . GLU E 3 231 ? 1.422   92.652  65.469  1.00 124.03 ? 267 GLU B OE2   1 
ATOM   4740 N N     . ASN E 3 232 ? 5.056   96.708  65.896  1.00 140.73 ? 268 ASN B N     1 
ATOM   4741 C CA    . ASN E 3 232 ? 6.130   96.916  66.856  1.00 140.73 ? 268 ASN B CA    1 
ATOM   4742 C C     . ASN E 3 232 ? 6.250   95.712  67.793  1.00 140.73 ? 268 ASN B C     1 
ATOM   4743 O O     . ASN E 3 232 ? 6.335   95.862  69.016  1.00 136.08 ? 268 ASN B O     1 
ATOM   4744 C CB    . ASN E 3 232 ? 5.887   98.191  67.669  1.00 132.79 ? 268 ASN B CB    1 
ATOM   4745 C CG    . ASN E 3 232 ? 6.987   98.450  68.683  1.00 131.59 ? 268 ASN B CG    1 
ATOM   4746 O OD1   . ASN E 3 232 ? 8.162   98.562  68.327  1.00 125.75 ? 268 ASN B OD1   1 
ATOM   4747 N ND2   . ASN E 3 232 ? 6.611   98.542  69.954  1.00 137.33 ? 268 ASN B ND2   1 
ATOM   4748 N N     . GLY E 3 233 ? 6.248   94.516  67.208  1.00 140.73 ? 269 GLY B N     1 
ATOM   4749 C CA    . GLY E 3 233 ? 6.370   93.304  67.999  1.00 140.73 ? 269 GLY B CA    1 
ATOM   4750 C C     . GLY E 3 233 ? 5.075   92.558  68.254  1.00 140.73 ? 269 GLY B C     1 
ATOM   4751 O O     . GLY E 3 233 ? 4.014   92.949  67.765  1.00 134.95 ? 269 GLY B O     1 
ATOM   4752 N N     . TRP E 3 234 ? 5.185   91.477  69.026  1.00 140.73 ? 270 TRP B N     1 
ATOM   4753 C CA    . TRP E 3 234 ? 4.069   90.608  69.411  1.00 140.73 ? 270 TRP B CA    1 
ATOM   4754 C C     . TRP E 3 234 ? 4.605   89.203  69.660  1.00 140.73 ? 270 TRP B C     1 
ATOM   4755 O O     . TRP E 3 234 ? 5.174   88.585  68.759  1.00 140.73 ? 270 TRP B O     1 
ATOM   4756 C CB    . TRP E 3 234 ? 3.006   90.526  68.314  1.00 140.73 ? 270 TRP B CB    1 
ATOM   4757 C CG    . TRP E 3 234 ? 1.848   89.676  68.720  1.00 134.89 ? 270 TRP B CG    1 
ATOM   4758 C CD1   . TRP E 3 234 ? 0.845   90.016  69.581  1.00 140.73 ? 270 TRP B CD1   1 
ATOM   4759 C CD2   . TRP E 3 234 ? 1.610   88.316  68.341  1.00 138.31 ? 270 TRP B CD2   1 
ATOM   4760 N NE1   . TRP E 3 234 ? -0.006  88.952  69.762  1.00 136.86 ? 270 TRP B NE1   1 
ATOM   4761 C CE2   . TRP E 3 234 ? 0.437   87.896  69.009  1.00 140.73 ? 270 TRP B CE2   1 
ATOM   4762 C CE3   . TRP E 3 234 ? 2.267   87.412  67.493  1.00 132.68 ? 270 TRP B CE3   1 
ATOM   4763 C CZ2   . TRP E 3 234 ? -0.087  86.604  68.867  1.00 140.73 ? 270 TRP B CZ2   1 
ATOM   4764 C CZ3   . TRP E 3 234 ? 1.744   86.126  67.352  1.00 140.07 ? 270 TRP B CZ3   1 
ATOM   4765 C CH2   . TRP E 3 234 ? 0.575   85.739  68.033  1.00 140.73 ? 270 TRP B CH2   1 
ATOM   4766 N N     . GLN E 3 235 ? 4.415   88.689  70.872  1.00 140.73 ? 271 GLN B N     1 
ATOM   4767 C CA    . GLN E 3 235 ? 4.909   87.356  71.194  1.00 139.72 ? 271 GLN B CA    1 
ATOM   4768 C C     . GLN E 3 235 ? 3.879   86.441  71.854  1.00 140.73 ? 271 GLN B C     1 
ATOM   4769 O O     . GLN E 3 235 ? 2.707   86.798  71.997  1.00 140.73 ? 271 GLN B O     1 
ATOM   4770 C CB    . GLN E 3 235 ? 6.146   87.465  72.088  1.00 127.31 ? 271 GLN B CB    1 
ATOM   4771 C CG    . GLN E 3 235 ? 5.908   88.181  73.407  1.00 112.04 ? 271 GLN B CG    1 
ATOM   4772 C CD    . GLN E 3 235 ? 7.169   88.275  74.249  1.00 121.17 ? 271 GLN B CD    1 
ATOM   4773 O OE1   . GLN E 3 235 ? 7.148   88.788  75.370  1.00 101.73 ? 271 GLN B OE1   1 
ATOM   4774 N NE2   . GLN E 3 235 ? 8.277   87.779  73.710  1.00 101.30 ? 271 GLN B NE2   1 
ATOM   4775 N N     . ALA E 3 236 ? 4.341   85.252  72.242  1.00 140.73 ? 272 ALA B N     1 
ATOM   4776 C CA    . ALA E 3 236 ? 3.512   84.238  72.893  1.00 140.73 ? 272 ALA B CA    1 
ATOM   4777 C C     . ALA E 3 236 ? 4.349   82.973  73.103  1.00 140.73 ? 272 ALA B C     1 
ATOM   4778 O O     . ALA E 3 236 ? 5.094   82.564  72.210  1.00 136.78 ? 272 ALA B O     1 
ATOM   4779 C CB    . ALA E 3 236 ? 2.291   83.927  72.033  1.00 140.73 ? 272 ALA B CB    1 
ATOM   4780 N N     . PHE E 3 237 ? 4.226   82.358  74.279  1.00 137.18 ? 273 PHE B N     1 
ATOM   4781 C CA    . PHE E 3 237 ? 4.986   81.147  74.602  1.00 120.11 ? 273 PHE B CA    1 
ATOM   4782 C C     . PHE E 3 237 ? 4.178   79.857  74.430  1.00 106.12 ? 273 PHE B C     1 
ATOM   4783 O O     . PHE E 3 237 ? 3.421   79.722  73.472  1.00 104.55 ? 273 PHE B O     1 
ATOM   4784 C CB    . PHE E 3 237 ? 5.522   81.235  76.037  1.00 119.34 ? 273 PHE B CB    1 
ATOM   4785 C CG    . PHE E 3 237 ? 6.436   82.408  76.274  1.00 105.27 ? 273 PHE B CG    1 
ATOM   4786 C CD1   . PHE E 3 237 ? 7.612   82.551  75.544  1.00 83.75  ? 273 PHE B CD1   1 
ATOM   4787 C CD2   . PHE E 3 237 ? 6.122   83.367  77.231  1.00 113.75 ? 273 PHE B CD2   1 
ATOM   4788 C CE1   . PHE E 3 237 ? 8.460   83.629  75.764  1.00 97.92  ? 273 PHE B CE1   1 
ATOM   4789 C CE2   . PHE E 3 237 ? 6.964   84.448  77.458  1.00 125.50 ? 273 PHE B CE2   1 
ATOM   4790 C CZ    . PHE E 3 237 ? 8.136   84.579  76.722  1.00 113.77 ? 273 PHE B CZ    1 
ATOM   4791 N N     . GLY E 3 238 ? 4.343   78.908  75.349  1.00 84.41  ? 274 GLY B N     1 
ATOM   4792 C CA    . GLY E 3 238 ? 3.606   77.660  75.238  1.00 92.38  ? 274 GLY B CA    1 
ATOM   4793 C C     . GLY E 3 238 ? 3.450   76.877  76.528  1.00 100.03 ? 274 GLY B C     1 
ATOM   4794 O O     . GLY E 3 238 ? 2.337   76.491  76.897  1.00 78.85  ? 274 GLY B O     1 
ATOM   4795 N N     . ASP E 3 239 ? 4.569   76.639  77.207  1.00 127.66 ? 275 ASP B N     1 
ATOM   4796 C CA    . ASP E 3 239 ? 4.590   75.891  78.465  1.00 140.73 ? 275 ASP B CA    1 
ATOM   4797 C C     . ASP E 3 239 ? 5.996   75.835  79.053  1.00 140.73 ? 275 ASP B C     1 
ATOM   4798 O O     . ASP E 3 239 ? 6.849   75.090  78.567  1.00 140.73 ? 275 ASP B O     1 
ATOM   4799 C CB    . ASP E 3 239 ? 4.098   74.456  78.252  1.00 138.17 ? 275 ASP B CB    1 
ATOM   4800 C CG    . ASP E 3 239 ? 4.529   73.524  79.373  1.00 121.66 ? 275 ASP B CG    1 
ATOM   4801 O OD1   . ASP E 3 239 ? 4.176   73.794  80.537  1.00 109.96 ? 275 ASP B OD1   1 
ATOM   4802 O OD2   . ASP E 3 239 ? 5.227   72.527  79.093  1.00 124.80 ? 275 ASP B OD2   1 
ATOM   4803 N N     . PHE E 3 240 ? 6.237   76.611  80.105  1.00 140.73 ? 276 PHE B N     1 
ATOM   4804 C CA    . PHE E 3 240 ? 7.551   76.623  80.737  1.00 135.86 ? 276 PHE B CA    1 
ATOM   4805 C C     . PHE E 3 240 ? 7.740   75.456  81.707  1.00 128.91 ? 276 PHE B C     1 
ATOM   4806 O O     . PHE E 3 240 ? 8.729   75.404  82.442  1.00 107.20 ? 276 PHE B O     1 
ATOM   4807 C CB    . PHE E 3 240 ? 7.790   77.958  81.465  1.00 133.98 ? 276 PHE B CB    1 
ATOM   4808 C CG    . PHE E 3 240 ? 6.822   78.240  82.595  1.00 140.73 ? 276 PHE B CG    1 
ATOM   4809 C CD1   . PHE E 3 240 ? 7.073   79.286  83.481  1.00 136.61 ? 276 PHE B CD1   1 
ATOM   4810 C CD2   . PHE E 3 240 ? 5.668   77.476  82.775  1.00 140.73 ? 276 PHE B CD2   1 
ATOM   4811 C CE1   . PHE E 3 240 ? 6.193   79.571  84.524  1.00 119.62 ? 276 PHE B CE1   1 
ATOM   4812 C CE2   . PHE E 3 240 ? 4.780   77.752  83.815  1.00 134.59 ? 276 PHE B CE2   1 
ATOM   4813 C CZ    . PHE E 3 240 ? 5.046   78.801  84.692  1.00 140.35 ? 276 PHE B CZ    1 
ATOM   4814 N N     . SER E 3 241 ? 6.795   74.519  81.703  1.00 112.36 ? 277 SER B N     1 
ATOM   4815 C CA    . SER E 3 241 ? 6.877   73.363  82.588  1.00 104.47 ? 277 SER B CA    1 
ATOM   4816 C C     . SER E 3 241 ? 7.848   72.308  82.068  1.00 96.23  ? 277 SER B C     1 
ATOM   4817 O O     . SER E 3 241 ? 7.555   71.599  81.103  1.00 69.74  ? 277 SER B O     1 
ATOM   4818 C CB    . SER E 3 241 ? 5.507   72.729  82.773  1.00 81.10  ? 277 SER B CB    1 
ATOM   4819 O OG    . SER E 3 241 ? 5.632   71.541  83.524  1.00 81.50  ? 277 SER B OG    1 
ATOM   4820 N N     . PRO E 3 242 ? 9.013   72.177  82.725  1.00 88.16  ? 278 PRO B N     1 
ATOM   4821 C CA    . PRO E 3 242 ? 10.041  71.209  82.337  1.00 84.73  ? 278 PRO B CA    1 
ATOM   4822 C C     . PRO E 3 242 ? 9.521   69.807  82.079  1.00 75.64  ? 278 PRO B C     1 
ATOM   4823 O O     . PRO E 3 242 ? 9.773   69.246  81.027  1.00 65.87  ? 278 PRO B O     1 
ATOM   4824 C CB    . PRO E 3 242 ? 11.033  71.266  83.504  1.00 77.08  ? 278 PRO B CB    1 
ATOM   4825 C CG    . PRO E 3 242 ? 10.194  71.729  84.657  1.00 93.94  ? 278 PRO B CG    1 
ATOM   4826 C CD    . PRO E 3 242 ? 9.355   72.797  84.016  1.00 102.43 ? 278 PRO B CD    1 
ATOM   4827 N N     . THR E 3 243 ? 8.799   69.251  83.044  1.00 101.63 ? 279 THR B N     1 
ATOM   4828 C CA    . THR E 3 243 ? 8.246   67.903  82.930  1.00 115.68 ? 279 THR B CA    1 
ATOM   4829 C C     . THR E 3 243 ? 8.014   67.456  81.484  1.00 121.16 ? 279 THR B C     1 
ATOM   4830 O O     . THR E 3 243 ? 8.153   66.277  81.156  1.00 131.70 ? 279 THR B O     1 
ATOM   4831 C CB    . THR E 3 243 ? 6.910   67.800  83.698  1.00 115.30 ? 279 THR B CB    1 
ATOM   4832 O OG1   . THR E 3 243 ? 6.368   66.483  83.549  1.00 120.36 ? 279 THR B OG1   1 
ATOM   4833 C CG2   . THR E 3 243 ? 5.915   68.810  83.162  1.00 129.16 ? 279 THR B CG2   1 
ATOM   4834 N N     . ASP E 3 244 ? 7.672   68.405  80.622  1.00 120.61 ? 280 ASP B N     1 
ATOM   4835 C CA    . ASP E 3 244 ? 7.400   68.121  79.221  1.00 125.29 ? 280 ASP B CA    1 
ATOM   4836 C C     . ASP E 3 244 ? 8.621   68.169  78.292  1.00 119.53 ? 280 ASP B C     1 
ATOM   4837 O O     . ASP E 3 244 ? 8.483   68.009  77.080  1.00 126.61 ? 280 ASP B O     1 
ATOM   4838 C CB    . ASP E 3 244 ? 6.313   69.079  78.731  1.00 134.43 ? 280 ASP B CB    1 
ATOM   4839 C CG    . ASP E 3 244 ? 5.013   68.918  79.502  1.00 131.47 ? 280 ASP B CG    1 
ATOM   4840 O OD1   . ASP E 3 244 ? 4.227   69.886  79.573  1.00 127.46 ? 280 ASP B OD1   1 
ATOM   4841 O OD2   . ASP E 3 244 ? 4.778   67.811  80.034  1.00 101.36 ? 280 ASP B OD2   1 
ATOM   4842 N N     . VAL E 3 245 ? 9.807   68.396  78.855  1.00 95.04  ? 281 VAL B N     1 
ATOM   4843 C CA    . VAL E 3 245 ? 11.042  68.429  78.068  1.00 80.39  ? 281 VAL B CA    1 
ATOM   4844 C C     . VAL E 3 245 ? 11.551  66.996  78.082  1.00 71.47  ? 281 VAL B C     1 
ATOM   4845 O O     . VAL E 3 245 ? 12.208  66.576  79.033  1.00 77.69  ? 281 VAL B O     1 
ATOM   4846 C CB    . VAL E 3 245 ? 12.128  69.335  78.707  1.00 75.21  ? 281 VAL B CB    1 
ATOM   4847 C CG1   . VAL E 3 245 ? 13.371  69.352  77.832  1.00 100.02 ? 281 VAL B CG1   1 
ATOM   4848 C CG2   . VAL E 3 245 ? 11.602  70.748  78.896  1.00 73.84  ? 281 VAL B CG2   1 
ATOM   4849 N N     . HIS E 3 246 ? 11.250  66.253  77.022  1.00 73.04  ? 282 HIS B N     1 
ATOM   4850 C CA    . HIS E 3 246 ? 11.624  64.848  76.929  1.00 69.14  ? 282 HIS B CA    1 
ATOM   4851 C C     . HIS E 3 246 ? 13.068  64.531  76.558  1.00 77.29  ? 282 HIS B C     1 
ATOM   4852 O O     . HIS E 3 246 ? 13.428  64.540  75.379  1.00 95.77  ? 282 HIS B O     1 
ATOM   4853 C CB    . HIS E 3 246 ? 10.701  64.156  75.937  1.00 62.02  ? 282 HIS B CB    1 
ATOM   4854 C CG    . HIS E 3 246 ? 10.833  62.668  75.928  1.00 57.58  ? 282 HIS B CG    1 
ATOM   4855 N ND1   . HIS E 3 246 ? 10.554  61.890  77.030  1.00 92.02  ? 282 HIS B ND1   1 
ATOM   4856 C CD2   . HIS E 3 246 ? 11.186  61.811  74.941  1.00 89.15  ? 282 HIS B CD2   1 
ATOM   4857 C CE1   . HIS E 3 246 ? 10.726  60.617  76.722  1.00 103.65 ? 282 HIS B CE1   1 
ATOM   4858 N NE2   . HIS E 3 246 ? 11.108  60.542  75.460  1.00 68.46  ? 282 HIS B NE2   1 
ATOM   4859 N N     . LYS E 3 247 ? 13.880  64.224  77.566  1.00 78.46  ? 283 LYS B N     1 
ATOM   4860 C CA    . LYS E 3 247 ? 15.287  63.877  77.363  1.00 71.96  ? 283 LYS B CA    1 
ATOM   4861 C C     . LYS E 3 247 ? 16.067  64.810  76.446  1.00 77.80  ? 283 LYS B C     1 
ATOM   4862 O O     . LYS E 3 247 ? 16.612  64.359  75.433  1.00 75.15  ? 283 LYS B O     1 
ATOM   4863 C CB    . LYS E 3 247 ? 15.420  62.454  76.804  1.00 69.17  ? 283 LYS B CB    1 
ATOM   4864 C CG    . LYS E 3 247 ? 15.520  61.337  77.836  1.00 74.58  ? 283 LYS B CG    1 
ATOM   4865 C CD    . LYS E 3 247 ? 14.187  61.060  78.505  1.00 85.14  ? 283 LYS B CD    1 
ATOM   4866 C CE    . LYS E 3 247 ? 14.137  59.646  79.076  1.00 100.45 ? 283 LYS B CE    1 
ATOM   4867 N NZ    . LYS E 3 247 ? 14.073  58.604  78.003  1.00 70.14  ? 283 LYS B NZ    1 
ATOM   4868 N N     . GLN E 3 248 ? 16.114  66.098  76.781  1.00 56.12  ? 284 GLN B N     1 
ATOM   4869 C CA    . GLN E 3 248 ? 16.886  67.063  75.992  1.00 53.34  ? 284 GLN B CA    1 
ATOM   4870 C C     . GLN E 3 248 ? 16.459  67.304  74.537  1.00 60.65  ? 284 GLN B C     1 
ATOM   4871 O O     . GLN E 3 248 ? 16.447  68.446  74.077  1.00 60.48  ? 284 GLN B O     1 
ATOM   4872 C CB    . GLN E 3 248 ? 18.363  66.640  75.983  1.00 57.08  ? 284 GLN B CB    1 
ATOM   4873 C CG    . GLN E 3 248 ? 18.985  66.403  77.353  1.00 44.07  ? 284 GLN B CG    1 
ATOM   4874 C CD    . GLN E 3 248 ? 19.577  67.660  77.951  1.00 94.98  ? 284 GLN B CD    1 
ATOM   4875 O OE1   . GLN E 3 248 ? 18.920  68.693  78.035  1.00 82.73  ? 284 GLN B OE1   1 
ATOM   4876 N NE2   . GLN E 3 248 ? 20.829  67.576  78.373  1.00 57.46  ? 284 GLN B NE2   1 
ATOM   4877 N N     . TYR E 3 249 ? 16.123  66.235  73.818  1.00 62.49  ? 285 TYR B N     1 
ATOM   4878 C CA    . TYR E 3 249 ? 15.760  66.328  72.402  1.00 73.85  ? 285 TYR B CA    1 
ATOM   4879 C C     . TYR E 3 249 ? 14.276  66.373  72.046  1.00 73.80  ? 285 TYR B C     1 
ATOM   4880 O O     . TYR E 3 249 ? 13.867  65.824  71.018  1.00 64.04  ? 285 TYR B O     1 
ATOM   4881 C CB    . TYR E 3 249 ? 16.405  65.167  71.636  1.00 87.74  ? 285 TYR B CB    1 
ATOM   4882 C CG    . TYR E 3 249 ? 17.881  65.002  71.898  1.00 81.00  ? 285 TYR B CG    1 
ATOM   4883 C CD1   . TYR E 3 249 ? 18.451  63.737  72.009  1.00 74.71  ? 285 TYR B CD1   1 
ATOM   4884 C CD2   . TYR E 3 249 ? 18.708  66.108  72.041  1.00 79.43  ? 285 TYR B CD2   1 
ATOM   4885 C CE1   . TYR E 3 249 ? 19.817  63.581  72.258  1.00 122.77 ? 285 TYR B CE1   1 
ATOM   4886 C CE2   . TYR E 3 249 ? 20.070  65.963  72.290  1.00 71.84  ? 285 TYR B CE2   1 
ATOM   4887 C CZ    . TYR E 3 249 ? 20.620  64.703  72.397  1.00 120.45 ? 285 TYR B CZ    1 
ATOM   4888 O OH    . TYR E 3 249 ? 21.972  64.578  72.636  1.00 118.15 ? 285 TYR B OH    1 
ATOM   4889 N N     . ALA E 3 250 ? 13.462  67.022  72.869  1.00 76.56  ? 286 ALA B N     1 
ATOM   4890 C CA    . ALA E 3 250 ? 12.038  67.108  72.564  1.00 79.92  ? 286 ALA B CA    1 
ATOM   4891 C C     . ALA E 3 250 ? 11.239  67.903  73.584  1.00 77.59  ? 286 ALA B C     1 
ATOM   4892 O O     . ALA E 3 250 ? 11.598  67.966  74.758  1.00 77.15  ? 286 ALA B O     1 
ATOM   4893 C CB    . ALA E 3 250 ? 11.443  65.704  72.418  1.00 66.77  ? 286 ALA B CB    1 
ATOM   4894 N N     . ILE E 3 251 ? 10.152  68.507  73.109  1.00 82.47  ? 287 ILE B N     1 
ATOM   4895 C CA    . ILE E 3 251 ? 9.256   69.300  73.943  1.00 88.03  ? 287 ILE B CA    1 
ATOM   4896 C C     . ILE E 3 251 ? 7.828   69.229  73.402  1.00 85.17  ? 287 ILE B C     1 
ATOM   4897 O O     . ILE E 3 251 ? 7.610   69.281  72.193  1.00 84.05  ? 287 ILE B O     1 
ATOM   4898 C CB    . ILE E 3 251 ? 9.673   70.798  73.989  1.00 76.80  ? 287 ILE B CB    1 
ATOM   4899 C CG1   . ILE E 3 251 ? 11.032  70.955  74.670  1.00 79.00  ? 287 ILE B CG1   1 
ATOM   4900 C CG2   . ILE E 3 251 ? 8.634   71.602  74.757  1.00 117.17 ? 287 ILE B CG2   1 
ATOM   4901 C CD1   . ILE E 3 251 ? 11.451  72.401  74.871  1.00 68.32  ? 287 ILE B CD1   1 
ATOM   4902 N N     . VAL E 3 252 ? 6.864   69.096  74.309  1.00 101.40 ? 288 VAL B N     1 
ATOM   4903 C CA    . VAL E 3 252 ? 5.448   69.059  73.948  1.00 101.21 ? 288 VAL B CA    1 
ATOM   4904 C C     . VAL E 3 252 ? 4.747   70.154  74.755  1.00 108.27 ? 288 VAL B C     1 
ATOM   4905 O O     . VAL E 3 252 ? 4.948   70.269  75.969  1.00 74.77  ? 288 VAL B O     1 
ATOM   4906 C CB    . VAL E 3 252 ? 4.810   67.689  74.261  1.00 92.06  ? 288 VAL B CB    1 
ATOM   4907 C CG1   . VAL E 3 252 ? 5.211   67.227  75.648  1.00 90.74  ? 288 VAL B CG1   1 
ATOM   4908 C CG2   . VAL E 3 252 ? 3.304   67.797  74.156  1.00 66.26  ? 288 VAL B CG2   1 
ATOM   4909 N N     . PHE E 3 253 ? 3.930   70.960  74.084  1.00 112.19 ? 289 PHE B N     1 
ATOM   4910 C CA    . PHE E 3 253 ? 3.254   72.062  74.762  1.00 117.09 ? 289 PHE B CA    1 
ATOM   4911 C C     . PHE E 3 253 ? 1.884   72.434  74.192  1.00 111.00 ? 289 PHE B C     1 
ATOM   4912 O O     . PHE E 3 253 ? 1.384   71.825  73.238  1.00 91.48  ? 289 PHE B O     1 
ATOM   4913 C CB    . PHE E 3 253 ? 4.148   73.301  74.719  1.00 119.73 ? 289 PHE B CB    1 
ATOM   4914 C CG    . PHE E 3 253 ? 4.274   73.896  73.346  1.00 130.02 ? 289 PHE B CG    1 
ATOM   4915 C CD1   . PHE E 3 253 ? 4.754   73.133  72.284  1.00 132.09 ? 289 PHE B CD1   1 
ATOM   4916 C CD2   . PHE E 3 253 ? 3.875   75.206  73.101  1.00 139.83 ? 289 PHE B CD2   1 
ATOM   4917 C CE1   . PHE E 3 253 ? 4.831   73.663  71.000  1.00 129.68 ? 289 PHE B CE1   1 
ATOM   4918 C CE2   . PHE E 3 253 ? 3.948   75.747  71.818  1.00 137.17 ? 289 PHE B CE2   1 
ATOM   4919 C CZ    . PHE E 3 253 ? 4.426   74.972  70.766  1.00 140.73 ? 289 PHE B CZ    1 
ATOM   4920 N N     . ARG E 3 254 ? 1.294   73.461  74.792  1.00 111.29 ? 290 ARG B N     1 
ATOM   4921 C CA    . ARG E 3 254 ? -0.005  73.959  74.377  1.00 105.28 ? 290 ARG B CA    1 
ATOM   4922 C C     . ARG E 3 254 ? 0.124   75.331  73.711  1.00 90.77  ? 290 ARG B C     1 
ATOM   4923 O O     . ARG E 3 254 ? 0.806   76.231  74.219  1.00 67.35  ? 290 ARG B O     1 
ATOM   4924 C CB    . ARG E 3 254 ? -0.946  74.048  75.585  1.00 134.45 ? 290 ARG B CB    1 
ATOM   4925 C CG    . ARG E 3 254 ? -0.383  74.843  76.753  1.00 140.73 ? 290 ARG B CG    1 
ATOM   4926 C CD    . ARG E 3 254 ? -1.414  75.045  77.856  1.00 135.55 ? 290 ARG B CD    1 
ATOM   4927 N NE    . ARG E 3 254 ? -0.813  75.629  79.053  1.00 133.30 ? 290 ARG B NE    1 
ATOM   4928 C CZ    . ARG E 3 254 ? -1.488  75.991  80.141  1.00 124.93 ? 290 ARG B CZ    1 
ATOM   4929 N NH1   . ARG E 3 254 ? -0.844  76.509  81.177  1.00 126.97 ? 290 ARG B NH1   1 
ATOM   4930 N NH2   . ARG E 3 254 ? -2.805  75.845  80.198  1.00 72.11  ? 290 ARG B NH2   1 
ATOM   4931 N N     . THR E 3 255 ? -0.544  75.466  72.569  1.00 51.81  ? 291 THR B N     1 
ATOM   4932 C CA    . THR E 3 255 ? -0.561  76.689  71.780  1.00 60.12  ? 291 THR B CA    1 
ATOM   4933 C C     . THR E 3 255 ? -1.113  77.879  72.572  1.00 66.72  ? 291 THR B C     1 
ATOM   4934 O O     . THR E 3 255 ? -2.174  77.785  73.180  1.00 63.78  ? 291 THR B O     1 
ATOM   4935 C CB    . THR E 3 255 ? -1.435  76.488  70.543  1.00 69.65  ? 291 THR B CB    1 
ATOM   4936 O OG1   . THR E 3 255 ? -2.809  76.410  70.943  1.00 123.32 ? 291 THR B OG1   1 
ATOM   4937 C CG2   . THR E 3 255 ? -1.066  75.189  69.838  1.00 98.09  ? 291 THR B CG2   1 
ATOM   4938 N N     . PRO E 3 256 ? -0.399  79.018  72.570  1.00 108.25 ? 292 PRO B N     1 
ATOM   4939 C CA    . PRO E 3 256 ? -0.846  80.214  73.296  1.00 121.68 ? 292 PRO B CA    1 
ATOM   4940 C C     . PRO E 3 256 ? -1.927  80.984  72.533  1.00 130.40 ? 292 PRO B C     1 
ATOM   4941 O O     . PRO E 3 256 ? -1.977  80.952  71.300  1.00 137.65 ? 292 PRO B O     1 
ATOM   4942 C CB    . PRO E 3 256 ? 0.438   81.016  73.441  1.00 106.53 ? 292 PRO B CB    1 
ATOM   4943 C CG    . PRO E 3 256 ? 1.104   80.755  72.127  1.00 138.17 ? 292 PRO B CG    1 
ATOM   4944 C CD    . PRO E 3 256 ? 0.922   79.251  71.956  1.00 133.24 ? 292 PRO B CD    1 
ATOM   4945 N N     . PRO E 3 257 ? -2.806  81.691  73.262  1.00 124.26 ? 293 PRO B N     1 
ATOM   4946 C CA    . PRO E 3 257 ? -3.888  82.468  72.655  1.00 120.06 ? 293 PRO B CA    1 
ATOM   4947 C C     . PRO E 3 257 ? -3.432  83.750  71.966  1.00 122.29 ? 293 PRO B C     1 
ATOM   4948 O O     . PRO E 3 257 ? -3.154  84.753  72.624  1.00 111.87 ? 293 PRO B O     1 
ATOM   4949 C CB    . PRO E 3 257 ? -4.808  82.746  73.838  1.00 132.29 ? 293 PRO B CB    1 
ATOM   4950 C CG    . PRO E 3 257 ? -3.840  82.901  74.961  1.00 133.40 ? 293 PRO B CG    1 
ATOM   4951 C CD    . PRO E 3 257 ? -2.882  81.752  74.733  1.00 137.31 ? 293 PRO B CD    1 
ATOM   4952 N N     . TYR E 3 258 ? -3.358  83.710  70.638  1.00 133.61 ? 294 TYR B N     1 
ATOM   4953 C CA    . TYR E 3 258 ? -2.949  84.873  69.855  1.00 139.59 ? 294 TYR B CA    1 
ATOM   4954 C C     . TYR E 3 258 ? -4.005  85.959  69.998  1.00 140.73 ? 294 TYR B C     1 
ATOM   4955 O O     . TYR E 3 258 ? -5.200  85.662  70.063  1.00 140.73 ? 294 TYR B O     1 
ATOM   4956 C CB    . TYR E 3 258 ? -2.799  84.497  68.383  1.00 103.58 ? 294 TYR B CB    1 
ATOM   4957 N N     . HIS E 3 259 ? -3.570  87.214  70.045  1.00 140.73 ? 295 HIS B N     1 
ATOM   4958 C CA    . HIS E 3 259 ? -4.502  88.328  70.185  1.00 140.73 ? 295 HIS B CA    1 
ATOM   4959 C C     . HIS E 3 259 ? -5.220  88.564  68.863  1.00 130.32 ? 295 HIS B C     1 
ATOM   4960 O O     . HIS E 3 259 ? -5.536  89.701  68.513  1.00 101.34 ? 295 HIS B O     1 
ATOM   4961 C CB    . HIS E 3 259 ? -3.758  89.598  70.612  1.00 140.73 ? 295 HIS B CB    1 
ATOM   4962 C CG    . HIS E 3 259 ? -4.642  90.634  71.239  1.00 140.73 ? 295 HIS B CG    1 
ATOM   4963 N ND1   . HIS E 3 259 ? -5.426  90.372  72.342  1.00 140.73 ? 295 HIS B ND1   1 
ATOM   4964 C CD2   . HIS E 3 259 ? -4.860  91.933  70.923  1.00 140.73 ? 295 HIS B CD2   1 
ATOM   4965 C CE1   . HIS E 3 259 ? -6.089  91.464  72.680  1.00 135.79 ? 295 HIS B CE1   1 
ATOM   4966 N NE2   . HIS E 3 259 ? -5.763  92.425  71.835  1.00 140.73 ? 295 HIS B NE2   1 
ATOM   4967 N N     . LYS E 3 260 ? -5.481  87.473  68.144  1.00 136.57 ? 296 LYS B N     1 
ATOM   4968 C CA    . LYS E 3 260 ? -6.151  87.519  66.847  1.00 140.73 ? 296 LYS B CA    1 
ATOM   4969 C C     . LYS E 3 260 ? -7.628  87.895  66.947  1.00 140.73 ? 296 LYS B C     1 
ATOM   4970 O O     . LYS E 3 260 ? -8.505  87.083  66.641  1.00 128.65 ? 296 LYS B O     1 
ATOM   4971 C CB    . LYS E 3 260 ? -6.011  86.167  66.141  1.00 140.73 ? 296 LYS B CB    1 
ATOM   4972 N N     . MET E 3 261 ? -7.888  89.132  67.371  1.00 140.73 ? 297 MET B N     1 
ATOM   4973 C CA    . MET E 3 261 ? -9.251  89.642  67.510  1.00 140.73 ? 297 MET B CA    1 
ATOM   4974 C C     . MET E 3 261 ? -10.020 89.373  66.227  1.00 136.92 ? 297 MET B C     1 
ATOM   4975 O O     . MET E 3 261 ? -11.175 88.939  66.253  1.00 99.75  ? 297 MET B O     1 
ATOM   4976 C CB    . MET E 3 261 ? -9.239  91.155  67.756  1.00 140.73 ? 297 MET B CB    1 
ATOM   4977 C CG    . MET E 3 261 ? -8.378  91.622  68.916  1.00 140.73 ? 297 MET B CG    1 
ATOM   4978 S SD    . MET E 3 261 ? -8.344  93.432  69.025  1.00 140.73 ? 297 MET B SD    1 
ATOM   4979 C CE    . MET E 3 261 ? -9.584  93.734  70.301  1.00 140.73 ? 297 MET B CE    1 
ATOM   4980 N N     . LYS E 3 262 ? -9.356  89.644  65.106  1.00 135.88 ? 298 LYS B N     1 
ATOM   4981 C CA    . LYS E 3 262 ? -9.935  89.460  63.784  1.00 140.73 ? 298 LYS B CA    1 
ATOM   4982 C C     . LYS E 3 262 ? -10.097 87.975  63.469  1.00 139.45 ? 298 LYS B C     1 
ATOM   4983 O O     . LYS E 3 262 ? -9.261  87.378  62.790  1.00 136.24 ? 298 LYS B O     1 
ATOM   4984 C CB    . LYS E 3 262 ? -9.039  90.125  62.733  1.00 140.26 ? 298 LYS B CB    1 
ATOM   4985 C CG    . LYS E 3 262 ? -9.763  90.550  61.465  1.00 126.51 ? 298 LYS B CG    1 
ATOM   4986 C CD    . LYS E 3 262 ? -10.749 91.670  61.757  1.00 119.37 ? 298 LYS B CD    1 
ATOM   4987 C CE    . LYS E 3 262 ? -11.474 92.111  60.500  1.00 133.87 ? 298 LYS B CE    1 
ATOM   4988 N NZ    . LYS E 3 262 ? -12.454 93.196  60.775  1.00 103.12 ? 298 LYS B NZ    1 
ATOM   4989 N N     . ILE E 3 263 ? -11.177 87.385  63.967  1.00 133.64 ? 299 ILE B N     1 
ATOM   4990 C CA    . ILE E 3 263 ? -11.451 85.971  63.742  1.00 136.17 ? 299 ILE B CA    1 
ATOM   4991 C C     . ILE E 3 263 ? -11.891 85.694  62.304  1.00 140.73 ? 299 ILE B C     1 
ATOM   4992 O O     . ILE E 3 263 ? -12.667 84.771  62.051  1.00 140.73 ? 299 ILE B O     1 
ATOM   4993 C CB    . ILE E 3 263 ? -12.550 85.443  64.711  1.00 133.30 ? 299 ILE B CB    1 
ATOM   4994 C CG1   . ILE E 3 263 ? -13.791 86.345  64.661  1.00 135.61 ? 299 ILE B CG1   1 
ATOM   4995 C CG2   . ILE E 3 263 ? -11.991 85.331  66.127  1.00 80.73  ? 299 ILE B CG2   1 
ATOM   4996 C CD1   . ILE E 3 263 ? -13.615 87.721  65.278  1.00 118.41 ? 299 ILE B CD1   1 
ATOM   4997 N N     . GLU E 3 264 ? -11.385 86.488  61.363  1.00 140.73 ? 300 GLU B N     1 
ATOM   4998 C CA    . GLU E 3 264 ? -11.737 86.327  59.954  1.00 140.11 ? 300 GLU B CA    1 
ATOM   4999 C C     . GLU E 3 264 ? -11.132 85.065  59.337  1.00 139.09 ? 300 GLU B C     1 
ATOM   5000 O O     . GLU E 3 264 ? -11.121 84.002  59.962  1.00 134.51 ? 300 GLU B O     1 
ATOM   5001 C CB    . GLU E 3 264 ? -11.294 87.558  59.151  1.00 140.73 ? 300 GLU B CB    1 
ATOM   5002 C CG    . GLU E 3 264 ? -9.792  87.797  59.131  1.00 126.27 ? 300 GLU B CG    1 
ATOM   5003 C CD    . GLU E 3 264 ? -9.373  88.776  58.045  1.00 140.73 ? 300 GLU B CD    1 
ATOM   5004 O OE1   . GLU E 3 264 ? -8.157  89.045  57.921  1.00 140.73 ? 300 GLU B OE1   1 
ATOM   5005 O OE2   . GLU E 3 264 ? -10.257 89.273  57.313  1.00 140.73 ? 300 GLU B OE2   1 
ATOM   5006 N N     . ARG E 3 265 ? -10.639 85.187  58.106  1.00 140.73 ? 301 ARG B N     1 
ATOM   5007 C CA    . ARG E 3 265 ? -10.028 84.064  57.396  1.00 140.73 ? 301 ARG B CA    1 
ATOM   5008 C C     . ARG E 3 265 ? -8.831  83.499  58.169  1.00 140.73 ? 301 ARG B C     1 
ATOM   5009 O O     . ARG E 3 265 ? -8.382  84.092  59.153  1.00 140.73 ? 301 ARG B O     1 
ATOM   5010 C CB    . ARG E 3 265 ? -9.584  84.505  55.995  1.00 137.59 ? 301 ARG B CB    1 
ATOM   5011 C CG    . ARG E 3 265 ? -10.721 84.930  55.072  1.00 140.73 ? 301 ARG B CG    1 
ATOM   5012 C CD    . ARG E 3 265 ? -10.226 85.122  53.638  1.00 139.44 ? 301 ARG B CD    1 
ATOM   5013 N NE    . ARG E 3 265 ? -9.778  83.868  53.028  1.00 140.73 ? 301 ARG B NE    1 
ATOM   5014 C CZ    . ARG E 3 265 ? -9.218  83.774  51.823  1.00 140.73 ? 301 ARG B CZ    1 
ATOM   5015 N NH1   . ARG E 3 265 ? -8.845  82.591  51.352  1.00 132.84 ? 301 ARG B NH1   1 
ATOM   5016 N NH2   . ARG E 3 265 ? -9.025  84.864  51.092  1.00 139.90 ? 301 ARG B NH2   1 
ATOM   5017 N N     . PRO E 3 266 ? -8.300  82.341  57.733  1.00 140.73 ? 302 PRO B N     1 
ATOM   5018 C CA    . PRO E 3 266 ? -7.154  81.719  58.409  1.00 140.57 ? 302 PRO B CA    1 
ATOM   5019 C C     . PRO E 3 266 ? -5.837  82.486  58.275  1.00 140.73 ? 302 PRO B C     1 
ATOM   5020 O O     . PRO E 3 266 ? -5.404  82.808  57.170  1.00 140.73 ? 302 PRO B O     1 
ATOM   5021 C CB    . PRO E 3 266 ? -7.090  80.336  57.767  1.00 140.19 ? 302 PRO B CB    1 
ATOM   5022 C CG    . PRO E 3 266 ? -7.572  80.598  56.373  1.00 128.71 ? 302 PRO B CG    1 
ATOM   5023 C CD    . PRO E 3 266 ? -8.760  81.500  56.610  1.00 127.94 ? 302 PRO B CD    1 
ATOM   5024 N N     . VAL E 3 267 ? -5.202  82.770  59.409  1.00 139.71 ? 303 VAL B N     1 
ATOM   5025 C CA    . VAL E 3 267 ? -3.933  83.495  59.416  1.00 140.73 ? 303 VAL B CA    1 
ATOM   5026 C C     . VAL E 3 267 ? -2.766  82.597  59.833  1.00 140.73 ? 303 VAL B C     1 
ATOM   5027 O O     . VAL E 3 267 ? -2.780  81.990  60.908  1.00 140.73 ? 303 VAL B O     1 
ATOM   5028 C CB    . VAL E 3 267 ? -3.992  84.718  60.365  1.00 140.73 ? 303 VAL B CB    1 
ATOM   5029 C CG1   . VAL E 3 267 ? -4.332  84.270  61.779  1.00 131.19 ? 303 VAL B CG1   1 
ATOM   5030 C CG2   . VAL E 3 267 ? -2.662  85.460  60.342  1.00 140.73 ? 303 VAL B CG2   1 
ATOM   5031 N N     . THR E 3 268 ? -1.755  82.523  58.970  1.00 140.62 ? 304 THR B N     1 
ATOM   5032 C CA    . THR E 3 268 ? -0.570  81.706  59.220  1.00 124.40 ? 304 THR B CA    1 
ATOM   5033 C C     . THR E 3 268 ? 0.558   82.579  59.755  1.00 116.08 ? 304 THR B C     1 
ATOM   5034 O O     . THR E 3 268 ? 0.895   83.601  59.159  1.00 119.90 ? 304 THR B O     1 
ATOM   5035 C CB    . THR E 3 268 ? -0.090  81.031  57.926  1.00 131.16 ? 304 THR B CB    1 
ATOM   5036 O OG1   . THR E 3 268 ? 0.454   82.023  57.043  1.00 79.48  ? 304 THR B OG1   1 
ATOM   5037 C CG2   . THR E 3 268 ? -1.255  80.335  57.232  1.00 122.39 ? 304 THR B CG2   1 
ATOM   5038 N N     . VAL E 3 269 ? 1.145   82.175  60.876  1.00 116.64 ? 305 VAL B N     1 
ATOM   5039 C CA    . VAL E 3 269 ? 2.226   82.949  61.472  1.00 121.35 ? 305 VAL B CA    1 
ATOM   5040 C C     . VAL E 3 269 ? 3.533   82.174  61.593  1.00 129.28 ? 305 VAL B C     1 
ATOM   5041 O O     . VAL E 3 269 ? 3.598   80.977  61.303  1.00 117.02 ? 305 VAL B O     1 
ATOM   5042 C CB    . VAL E 3 269 ? 1.838   83.475  62.879  1.00 139.23 ? 305 VAL B CB    1 
ATOM   5043 C CG1   . VAL E 3 269 ? 0.611   84.371  62.778  1.00 140.73 ? 305 VAL B CG1   1 
ATOM   5044 C CG2   . VAL E 3 269 ? 1.579   82.309  63.824  1.00 133.70 ? 305 VAL B CG2   1 
ATOM   5045 N N     . PHE E 3 270 ? 4.572   82.882  62.021  1.00 140.73 ? 306 PHE B N     1 
ATOM   5046 C CA    . PHE E 3 270 ? 5.896   82.307  62.202  1.00 140.53 ? 306 PHE B CA    1 
ATOM   5047 C C     . PHE E 3 270 ? 6.000   81.602  63.539  1.00 135.56 ? 306 PHE B C     1 
ATOM   5048 O O     . PHE E 3 270 ? 5.271   81.916  64.480  1.00 121.02 ? 306 PHE B O     1 
ATOM   5049 C CB    . PHE E 3 270 ? 6.968   83.399  62.126  1.00 140.73 ? 306 PHE B CB    1 
ATOM   5050 C CG    . PHE E 3 270 ? 7.468   83.665  60.735  1.00 140.73 ? 306 PHE B CG    1 
ATOM   5051 C CD1   . PHE E 3 270 ? 6.577   83.858  59.683  1.00 140.73 ? 306 PHE B CD1   1 
ATOM   5052 C CD2   . PHE E 3 270 ? 8.835   83.730  60.477  1.00 140.73 ? 306 PHE B CD2   1 
ATOM   5053 C CE1   . PHE E 3 270 ? 7.039   84.111  58.394  1.00 140.73 ? 306 PHE B CE1   1 
ATOM   5054 C CE2   . PHE E 3 270 ? 9.308   83.983  59.191  1.00 134.32 ? 306 PHE B CE2   1 
ATOM   5055 C CZ    . PHE E 3 270 ? 8.408   84.174  58.147  1.00 140.28 ? 306 PHE B CZ    1 
ATOM   5056 N N     . LEU E 3 271 ? 6.916   80.645  63.607  1.00 137.75 ? 307 LEU B N     1 
ATOM   5057 C CA    . LEU E 3 271 ? 7.153   79.884  64.821  1.00 131.99 ? 307 LEU B CA    1 
ATOM   5058 C C     . LEU E 3 271 ? 8.613   79.465  64.854  1.00 128.37 ? 307 LEU B C     1 
ATOM   5059 O O     . LEU E 3 271 ? 9.156   78.994  63.850  1.00 128.82 ? 307 LEU B O     1 
ATOM   5060 C CB    . LEU E 3 271 ? 6.257   78.644  64.862  1.00 133.14 ? 307 LEU B CB    1 
ATOM   5061 C CG    . LEU E 3 271 ? 6.423   77.738  66.086  1.00 132.32 ? 307 LEU B CG    1 
ATOM   5062 C CD1   . LEU E 3 271 ? 6.189   78.531  67.365  1.00 136.18 ? 307 LEU B CD1   1 
ATOM   5063 C CD2   . LEU E 3 271 ? 5.447   76.582  65.990  1.00 86.96  ? 307 LEU B CD2   1 
ATOM   5064 N N     . GLN E 3 272 ? 9.246   79.647  66.007  1.00 125.42 ? 308 GLN B N     1 
ATOM   5065 C CA    . GLN E 3 272 ? 10.647  79.285  66.164  1.00 119.03 ? 308 GLN B CA    1 
ATOM   5066 C C     . GLN E 3 272 ? 11.132  79.301  67.607  1.00 111.04 ? 308 GLN B C     1 
ATOM   5067 O O     . GLN E 3 272 ? 10.849  80.224  68.373  1.00 103.51 ? 308 GLN B O     1 
ATOM   5068 C CB    . GLN E 3 272 ? 11.521  80.193  65.293  1.00 132.46 ? 308 GLN B CB    1 
ATOM   5069 C CG    . GLN E 3 272 ? 11.073  81.639  65.229  1.00 130.25 ? 308 GLN B CG    1 
ATOM   5070 C CD    . GLN E 3 272 ? 11.596  82.330  63.990  1.00 97.44  ? 308 GLN B CD    1 
ATOM   5071 O OE1   . GLN E 3 272 ? 11.371  81.867  62.873  1.00 116.81 ? 308 GLN B OE1   1 
ATOM   5072 N NE2   . GLN E 3 272 ? 12.299  83.441  64.178  1.00 128.82 ? 308 GLN B NE2   1 
ATOM   5073 N N     . LEU E 3 273 ? 11.872  78.256  67.956  1.00 101.65 ? 309 LEU B N     1 
ATOM   5074 C CA    . LEU E 3 273 ? 12.415  78.069  69.294  1.00 104.42 ? 309 LEU B CA    1 
ATOM   5075 C C     . LEU E 3 273 ? 13.431  79.154  69.658  1.00 105.69 ? 309 LEU B C     1 
ATOM   5076 O O     . LEU E 3 273 ? 14.112  79.690  68.781  1.00 120.95 ? 309 LEU B O     1 
ATOM   5077 C CB    . LEU E 3 273 ? 13.064  76.683  69.363  1.00 111.07 ? 309 LEU B CB    1 
ATOM   5078 C CG    . LEU E 3 273 ? 13.384  76.045  70.713  1.00 91.13  ? 309 LEU B CG    1 
ATOM   5079 C CD1   . LEU E 3 273 ? 12.136  76.009  71.582  1.00 126.50 ? 309 LEU B CD1   1 
ATOM   5080 C CD2   . LEU E 3 273 ? 13.898  74.637  70.481  1.00 59.54  ? 309 LEU B CD2   1 
ATOM   5081 N N     . LYS E 3 274 ? 13.530  79.472  70.950  1.00 69.84  ? 310 LYS B N     1 
ATOM   5082 C CA    . LYS E 3 274 ? 14.465  80.495  71.425  1.00 82.13  ? 310 LYS B CA    1 
ATOM   5083 C C     . LYS E 3 274 ? 15.130  80.127  72.750  1.00 84.49  ? 310 LYS B C     1 
ATOM   5084 O O     . LYS E 3 274 ? 14.606  79.330  73.530  1.00 76.41  ? 310 LYS B O     1 
ATOM   5085 C CB    . LYS E 3 274 ? 13.740  81.826  71.614  1.00 106.72 ? 310 LYS B CB    1 
ATOM   5086 C CG    . LYS E 3 274 ? 12.893  82.261  70.439  1.00 129.54 ? 310 LYS B CG    1 
ATOM   5087 C CD    . LYS E 3 274 ? 13.729  82.523  69.205  1.00 113.74 ? 310 LYS B CD    1 
ATOM   5088 C CE    . LYS E 3 274 ? 12.889  83.218  68.163  1.00 97.89  ? 310 LYS B CE    1 
ATOM   5089 N NZ    . LYS E 3 274 ? 12.357  84.485  68.730  1.00 71.92  ? 310 LYS B NZ    1 
ATOM   5090 N N     . ARG E 3 275 ? 16.289  80.719  73.010  1.00 110.14 ? 311 ARG B N     1 
ATOM   5091 C CA    . ARG E 3 275 ? 16.990  80.452  74.257  1.00 126.61 ? 311 ARG B CA    1 
ATOM   5092 C C     . ARG E 3 275 ? 16.820  81.666  75.147  1.00 132.36 ? 311 ARG B C     1 
ATOM   5093 O O     . ARG E 3 275 ? 16.779  82.797  74.662  1.00 140.73 ? 311 ARG B O     1 
ATOM   5094 C CB    . ARG E 3 275 ? 18.478  80.189  74.010  1.00 140.73 ? 311 ARG B CB    1 
ATOM   5095 C CG    . ARG E 3 275 ? 19.262  79.913  75.284  1.00 140.73 ? 311 ARG B CG    1 
ATOM   5096 C CD    . ARG E 3 275 ? 20.684  79.446  75.004  1.00 140.73 ? 311 ARG B CD    1 
ATOM   5097 N NE    . ARG E 3 275 ? 20.724  78.159  74.312  1.00 115.50 ? 311 ARG B NE    1 
ATOM   5098 C CZ    . ARG E 3 275 ? 21.806  77.392  74.226  1.00 130.07 ? 311 ARG B CZ    1 
ATOM   5099 N NH1   . ARG E 3 275 ? 21.758  76.238  73.575  1.00 135.77 ? 311 ARG B NH1   1 
ATOM   5100 N NH2   . ARG E 3 275 ? 22.939  77.773  74.802  1.00 113.69 ? 311 ARG B NH2   1 
ATOM   5101 N N     . LYS E 3 276 ? 16.717  81.435  76.449  1.00 135.81 ? 312 LYS B N     1 
ATOM   5102 C CA    . LYS E 3 276 ? 16.532  82.536  77.378  1.00 140.19 ? 312 LYS B CA    1 
ATOM   5103 C C     . LYS E 3 276 ? 17.735  83.473  77.376  1.00 140.73 ? 312 LYS B C     1 
ATOM   5104 O O     . LYS E 3 276 ? 17.721  84.509  76.708  1.00 140.73 ? 312 LYS B O     1 
ATOM   5105 C CB    . LYS E 3 276 ? 16.279  82.001  78.791  1.00 136.98 ? 312 LYS B CB    1 
ATOM   5106 C CG    . LYS E 3 276 ? 15.558  82.997  79.681  1.00 140.73 ? 312 LYS B CG    1 
ATOM   5107 C CD    . LYS E 3 276 ? 15.158  82.391  81.013  1.00 134.95 ? 312 LYS B CD    1 
ATOM   5108 C CE    . LYS E 3 276 ? 14.180  83.299  81.746  1.00 118.67 ? 312 LYS B CE    1 
ATOM   5109 N NZ    . LYS E 3 276 ? 14.708  84.682  81.897  1.00 115.66 ? 312 LYS B NZ    1 
ATOM   5110 N N     . ARG E 3 277 ? 18.779  83.103  78.109  1.00 137.67 ? 313 ARG B N     1 
ATOM   5111 C CA    . ARG E 3 277 ? 19.980  83.927  78.202  1.00 124.70 ? 313 ARG B CA    1 
ATOM   5112 C C     . ARG E 3 277 ? 20.614  84.224  76.841  1.00 115.94 ? 313 ARG B C     1 
ATOM   5113 O O     . ARG E 3 277 ? 20.726  85.385  76.439  1.00 87.20  ? 313 ARG B O     1 
ATOM   5114 C CB    . ARG E 3 277 ? 21.007  83.252  79.112  1.00 129.12 ? 313 ARG B CB    1 
ATOM   5115 C CG    . ARG E 3 277 ? 21.566  84.155  80.207  1.00 140.73 ? 313 ARG B CG    1 
ATOM   5116 C CD    . ARG E 3 277 ? 22.388  85.319  79.653  1.00 140.73 ? 313 ARG B CD    1 
ATOM   5117 N NE    . ARG E 3 277 ? 21.612  86.201  78.784  1.00 140.73 ? 313 ARG B NE    1 
ATOM   5118 C CZ    . ARG E 3 277 ? 22.033  87.384  78.347  1.00 132.82 ? 313 ARG B CZ    1 
ATOM   5119 N NH1   . ARG E 3 277 ? 21.259  88.116  77.555  1.00 111.24 ? 313 ARG B NH1   1 
ATOM   5120 N NH2   . ARG E 3 277 ? 23.224  87.842  78.714  1.00 111.70 ? 313 ARG B NH2   1 
ATOM   5121 N N     . GLY E 3 278 ? 21.028  83.172  76.140  1.00 117.39 ? 314 GLY B N     1 
ATOM   5122 C CA    . GLY E 3 278 ? 21.650  83.347  74.838  1.00 130.43 ? 314 GLY B CA    1 
ATOM   5123 C C     . GLY E 3 278 ? 20.758  84.014  73.806  1.00 123.01 ? 314 GLY B C     1 
ATOM   5124 O O     . GLY E 3 278 ? 21.233  84.783  72.970  1.00 129.85 ? 314 GLY B O     1 
ATOM   5125 N N     . GLY E 3 279 ? 19.464  83.720  73.862  1.00 106.34 ? 315 GLY B N     1 
ATOM   5126 C CA    . GLY E 3 279 ? 18.536  84.304  72.915  1.00 96.03  ? 315 GLY B CA    1 
ATOM   5127 C C     . GLY E 3 279 ? 18.738  83.784  71.502  1.00 98.44  ? 315 GLY B C     1 
ATOM   5128 O O     . GLY E 3 279 ? 18.758  84.563  70.546  1.00 102.50 ? 315 GLY B O     1 
ATOM   5129 N N     . ASP E 3 280 ? 18.881  82.468  71.361  1.00 82.02  ? 316 ASP B N     1 
ATOM   5130 C CA    . ASP E 3 280 ? 19.077  81.870  70.044  1.00 93.80  ? 316 ASP B CA    1 
ATOM   5131 C C     . ASP E 3 280 ? 17.775  81.868  69.251  1.00 97.21  ? 316 ASP B C     1 
ATOM   5132 O O     . ASP E 3 280 ? 16.840  82.595  69.578  1.00 99.16  ? 316 ASP B O     1 
ATOM   5133 C CB    . ASP E 3 280 ? 19.596  80.438  70.183  1.00 116.01 ? 316 ASP B CB    1 
ATOM   5134 C CG    . ASP E 3 280 ? 20.831  80.347  71.059  1.00 134.36 ? 316 ASP B CG    1 
ATOM   5135 O OD1   . ASP E 3 280 ? 21.487  79.284  71.051  1.00 133.18 ? 316 ASP B OD1   1 
ATOM   5136 O OD2   . ASP E 3 280 ? 21.142  81.334  71.758  1.00 127.39 ? 316 ASP B OD2   1 
ATOM   5137 N N     . VAL E 3 281 ? 17.717  81.044  68.210  1.00 108.37 ? 317 VAL B N     1 
ATOM   5138 C CA    . VAL E 3 281 ? 16.525  80.957  67.373  1.00 120.23 ? 317 VAL B CA    1 
ATOM   5139 C C     . VAL E 3 281 ? 16.649  79.813  66.371  1.00 117.64 ? 317 VAL B C     1 
ATOM   5140 O O     . VAL E 3 281 ? 17.638  79.080  66.372  1.00 134.30 ? 317 VAL B O     1 
ATOM   5141 C CB    . VAL E 3 281 ? 16.300  82.281  66.594  1.00 125.32 ? 317 VAL B CB    1 
ATOM   5142 C CG1   . VAL E 3 281 ? 17.456  82.526  65.640  1.00 135.46 ? 317 VAL B CG1   1 
ATOM   5143 C CG2   . VAL E 3 281 ? 14.984  82.236  65.832  1.00 122.14 ? 317 VAL B CG2   1 
ATOM   5144 N N     . SER E 3 282 ? 15.634  79.665  65.526  1.00 108.87 ? 318 SER B N     1 
ATOM   5145 C CA    . SER E 3 282 ? 15.617  78.632  64.498  1.00 116.90 ? 318 SER B CA    1 
ATOM   5146 C C     . SER E 3 282 ? 15.129  79.255  63.196  1.00 115.46 ? 318 SER B C     1 
ATOM   5147 O O     . SER E 3 282 ? 15.305  80.455  62.980  1.00 123.73 ? 318 SER B O     1 
ATOM   5148 C CB    . SER E 3 282 ? 14.693  77.486  64.904  1.00 139.56 ? 318 SER B CB    1 
ATOM   5149 O OG    . SER E 3 282 ? 13.350  77.925  64.976  1.00 140.73 ? 318 SER B OG    1 
ATOM   5150 N N     . ASP E 3 283 ? 14.504  78.447  62.339  1.00 126.54 ? 319 ASP B N     1 
ATOM   5151 C CA    . ASP E 3 283 ? 14.011  78.927  61.045  1.00 136.48 ? 319 ASP B CA    1 
ATOM   5152 C C     . ASP E 3 283 ? 12.515  79.233  61.009  1.00 138.66 ? 319 ASP B C     1 
ATOM   5153 O O     . ASP E 3 283 ? 11.822  79.153  62.027  1.00 119.37 ? 319 ASP B O     1 
ATOM   5154 C CB    . ASP E 3 283 ? 14.349  77.916  59.938  1.00 135.13 ? 319 ASP B CB    1 
ATOM   5155 C CG    . ASP E 3 283 ? 13.455  76.686  59.967  1.00 140.73 ? 319 ASP B CG    1 
ATOM   5156 O OD1   . ASP E 3 283 ? 13.337  76.053  61.040  1.00 125.28 ? 319 ASP B OD1   1 
ATOM   5157 O OD2   . ASP E 3 283 ? 12.878  76.346  58.912  1.00 137.75 ? 319 ASP B OD2   1 
ATOM   5158 N N     . SER E 3 284 ? 12.029  79.576  59.818  1.00 138.10 ? 320 SER B N     1 
ATOM   5159 C CA    . SER E 3 284 ? 10.625  79.919  59.623  1.00 139.38 ? 320 SER B CA    1 
ATOM   5160 C C     . SER E 3 284 ? 9.719   78.710  59.413  1.00 136.75 ? 320 SER B C     1 
ATOM   5161 O O     . SER E 3 284 ? 9.573   78.207  58.298  1.00 130.68 ? 320 SER B O     1 
ATOM   5162 C CB    . SER E 3 284 ? 10.471  80.876  58.434  1.00 140.50 ? 320 SER B CB    1 
ATOM   5163 O OG    . SER E 3 284 ? 10.690  80.220  57.196  1.00 115.40 ? 320 SER B OG    1 
ATOM   5164 N N     . LYS E 3 285 ? 9.110   78.248  60.500  1.00 139.71 ? 321 LYS B N     1 
ATOM   5165 C CA    . LYS E 3 285 ? 8.196   77.119  60.438  1.00 118.68 ? 321 LYS B CA    1 
ATOM   5166 C C     . LYS E 3 285 ? 6.792   77.703  60.328  1.00 112.85 ? 321 LYS B C     1 
ATOM   5167 O O     . LYS E 3 285 ? 6.421   78.603  61.089  1.00 87.00  ? 321 LYS B O     1 
ATOM   5168 C CB    . LYS E 3 285 ? 8.331   76.264  61.697  1.00 113.92 ? 321 LYS B CB    1 
ATOM   5169 C CG    . LYS E 3 285 ? 9.769   75.887  62.015  1.00 102.25 ? 321 LYS B CG    1 
ATOM   5170 C CD    . LYS E 3 285 ? 9.846   74.796  63.066  1.00 123.41 ? 321 LYS B CD    1 
ATOM   5171 C CE    . LYS E 3 285 ? 9.309   73.475  62.533  1.00 138.61 ? 321 LYS B CE    1 
ATOM   5172 N NZ    . LYS E 3 285 ? 10.079  72.995  61.350  1.00 131.97 ? 321 LYS B NZ    1 
ATOM   5173 N N     . GLN E 3 286 ? 6.017   77.194  59.376  1.00 110.27 ? 322 GLN B N     1 
ATOM   5174 C CA    . GLN E 3 286 ? 4.666   77.692  59.142  1.00 127.65 ? 322 GLN B CA    1 
ATOM   5175 C C     . GLN E 3 286 ? 3.607   77.108  60.068  1.00 140.01 ? 322 GLN B C     1 
ATOM   5176 O O     . GLN E 3 286 ? 3.334   75.907  60.041  1.00 140.73 ? 322 GLN B O     1 
ATOM   5177 C CB    . GLN E 3 286 ? 4.262   77.427  57.690  1.00 118.89 ? 322 GLN B CB    1 
ATOM   5178 C CG    . GLN E 3 286 ? 3.186   78.359  57.164  1.00 122.01 ? 322 GLN B CG    1 
ATOM   5179 C CD    . GLN E 3 286 ? 3.670   79.794  57.028  1.00 140.73 ? 322 GLN B CD    1 
ATOM   5180 O OE1   . GLN E 3 286 ? 2.961   80.652  56.502  1.00 140.73 ? 322 GLN B OE1   1 
ATOM   5181 N NE2   . GLN E 3 286 ? 4.883   80.062  57.502  1.00 140.73 ? 322 GLN B NE2   1 
ATOM   5182 N N     . PHE E 3 287 ? 3.010   77.973  60.883  1.00 140.73 ? 323 PHE B N     1 
ATOM   5183 C CA    . PHE E 3 287 ? 1.960   77.570  61.812  1.00 140.73 ? 323 PHE B CA    1 
ATOM   5184 C C     . PHE E 3 287 ? 0.678   78.310  61.436  1.00 140.73 ? 323 PHE B C     1 
ATOM   5185 O O     . PHE E 3 287 ? 0.501   79.482  61.773  1.00 140.73 ? 323 PHE B O     1 
ATOM   5186 C CB    . PHE E 3 287 ? 2.365   77.903  63.242  1.00 131.77 ? 323 PHE B CB    1 
ATOM   5187 N N     . THR E 3 288 ? -0.209  77.616  60.730  1.00 140.73 ? 324 THR B N     1 
ATOM   5188 C CA    . THR E 3 288 ? -1.471  78.199  60.289  1.00 140.73 ? 324 THR B CA    1 
ATOM   5189 C C     . THR E 3 288 ? -2.517  78.194  61.405  1.00 140.73 ? 324 THR B C     1 
ATOM   5190 O O     . THR E 3 288 ? -2.376  77.483  62.401  1.00 140.73 ? 324 THR B O     1 
ATOM   5191 C CB    . THR E 3 288 ? -2.033  77.430  59.072  1.00 137.23 ? 324 THR B CB    1 
ATOM   5192 O OG1   . THR E 3 288 ? -2.690  76.235  59.514  1.00 131.43 ? 324 THR B OG1   1 
ATOM   5193 C CG2   . THR E 3 288 ? -0.901  77.044  58.125  1.00 108.23 ? 324 THR B CG2   1 
ATOM   5194 N N     . TYR E 3 289 ? -3.563  78.996  61.231  1.00 140.73 ? 325 TYR B N     1 
ATOM   5195 C CA    . TYR E 3 289 ? -4.645  79.092  62.206  1.00 133.02 ? 325 TYR B CA    1 
ATOM   5196 C C     . TYR E 3 289 ? -5.995  78.798  61.559  1.00 130.34 ? 325 TYR B C     1 
ATOM   5197 O O     . TYR E 3 289 ? -6.090  78.681  60.337  1.00 137.48 ? 325 TYR B O     1 
ATOM   5198 C CB    . TYR E 3 289 ? -4.670  80.484  62.832  1.00 117.48 ? 325 TYR B CB    1 
ATOM   5199 C CG    . TYR E 3 289 ? -3.832  80.615  64.082  1.00 126.80 ? 325 TYR B CG    1 
ATOM   5200 C CD1   . TYR E 3 289 ? -4.078  79.808  65.193  1.00 134.23 ? 325 TYR B CD1   1 
ATOM   5201 C CD2   . TYR E 3 289 ? -2.834  81.584  64.180  1.00 116.19 ? 325 TYR B CD2   1 
ATOM   5202 C CE1   . TYR E 3 289 ? -3.358  79.967  66.375  1.00 126.38 ? 325 TYR B CE1   1 
ATOM   5203 C CE2   . TYR E 3 289 ? -2.107  81.750  65.358  1.00 90.20  ? 325 TYR B CE2   1 
ATOM   5204 C CZ    . TYR E 3 289 ? -2.377  80.941  66.452  1.00 111.67 ? 325 TYR B CZ    1 
ATOM   5205 O OH    . TYR E 3 289 ? -1.686  81.119  67.629  1.00 119.59 ? 325 TYR B OH    1 
ATOM   5206 N N     . TYR E 3 290 ? -7.037  78.683  62.377  1.00 116.28 ? 326 TYR B N     1 
ATOM   5207 C CA    . TYR E 3 290 ? -8.369  78.392  61.858  1.00 117.59 ? 326 TYR B CA    1 
ATOM   5208 C C     . TYR E 3 290 ? -9.518  79.038  62.625  1.00 124.44 ? 326 TYR B C     1 
ATOM   5209 O O     . TYR E 3 290 ? -9.397  79.353  63.810  1.00 138.41 ? 326 TYR B O     1 
ATOM   5210 C CB    . TYR E 3 290 ? -8.593  76.877  61.801  1.00 78.78  ? 326 TYR B CB    1 
ATOM   5211 C CG    . TYR E 3 290 ? -8.111  76.240  60.518  1.00 109.64 ? 326 TYR B CG    1 
ATOM   5212 C CD1   . TYR E 3 290 ? -8.672  76.597  59.293  1.00 117.20 ? 326 TYR B CD1   1 
ATOM   5213 C CD2   . TYR E 3 290 ? -7.098  75.283  60.526  1.00 123.99 ? 326 TYR B CD2   1 
ATOM   5214 C CE1   . TYR E 3 290 ? -8.237  76.017  58.104  1.00 135.37 ? 326 TYR B CE1   1 
ATOM   5215 C CE2   . TYR E 3 290 ? -6.654  74.695  59.340  1.00 135.41 ? 326 TYR B CE2   1 
ATOM   5216 C CZ    . TYR E 3 290 ? -7.230  75.068  58.133  1.00 135.88 ? 326 TYR B CZ    1 
ATOM   5217 O OH    . TYR E 3 290 ? -6.807  74.496  56.956  1.00 108.82 ? 326 TYR B OH    1 
ATOM   5218 N N     . PRO E 3 291 ? -10.650 79.260  61.935  1.00 134.29 ? 327 PRO B N     1 
ATOM   5219 C CA    . PRO E 3 291 ? -11.855 79.864  62.512  1.00 134.50 ? 327 PRO B CA    1 
ATOM   5220 C C     . PRO E 3 291 ? -12.646 78.836  63.319  1.00 137.94 ? 327 PRO B C     1 
ATOM   5221 O O     . PRO E 3 291 ? -13.171 77.865  62.771  1.00 133.10 ? 327 PRO B O     1 
ATOM   5222 C CB    . PRO E 3 291 ? -12.632 80.336  61.281  1.00 138.73 ? 327 PRO B CB    1 
ATOM   5223 C CG    . PRO E 3 291 ? -11.571 80.491  60.225  1.00 138.91 ? 327 PRO B CG    1 
ATOM   5224 C CD    . PRO E 3 291 ? -10.728 79.278  60.464  1.00 106.63 ? 327 PRO B CD    1 
ATOM   5225 N N     . LEU E 3 292 ? -12.722 79.061  64.624  1.00 140.73 ? 328 LEU B N     1 
ATOM   5226 C CA    . LEU E 3 292 ? -13.441 78.180  65.536  1.00 140.73 ? 328 LEU B CA    1 
ATOM   5227 C C     . LEU E 3 292 ? -14.824 77.754  65.028  1.00 140.73 ? 328 LEU B C     1 
ATOM   5228 O O     . LEU E 3 292 ? -15.453 78.464  64.243  1.00 140.73 ? 328 LEU B O     1 
ATOM   5229 C CB    . LEU E 3 292 ? -13.575 78.873  66.899  1.00 132.96 ? 328 LEU B CB    1 
ATOM   5230 C CG    . LEU E 3 292 ? -14.009 80.349  66.950  1.00 124.42 ? 328 LEU B CG    1 
ATOM   5231 C CD1   . LEU E 3 292 ? -12.969 81.235  66.262  1.00 82.40  ? 328 LEU B CD1   1 
ATOM   5232 C CD2   . LEU E 3 292 ? -15.374 80.515  66.297  1.00 93.28  ? 328 LEU B CD2   1 
ATOM   5233 N N     . VAL E 3 293 ? -15.284 76.587  65.476  1.00 137.91 ? 329 VAL B N     1 
ATOM   5234 C CA    . VAL E 3 293 ? -16.599 76.068  65.094  1.00 133.09 ? 329 VAL B CA    1 
ATOM   5235 C C     . VAL E 3 293 ? -17.149 75.171  66.197  1.00 122.86 ? 329 VAL B C     1 
ATOM   5236 O O     . VAL E 3 293 ? -16.309 74.601  66.926  1.00 122.62 ? 329 VAL B O     1 
ATOM   5237 C CB    . VAL E 3 293 ? -16.546 75.245  63.780  1.00 137.20 ? 329 VAL B CB    1 
ATOM   5238 C CG1   . VAL E 3 293 ? -15.665 74.022  63.965  1.00 136.82 ? 329 VAL B CG1   1 
ATOM   5239 C CG2   . VAL E 3 293 ? -17.961 74.825  63.365  1.00 91.86  ? 329 VAL B CG2   1 
HETATM 5240 O O     . HOH F 4 .   ? 26.697  71.520  88.606  1.00 35.22  ? 404 HOH C O     1 
HETATM 5241 O O     . HOH G 4 .   ? 14.430  62.391  87.470  1.00 52.59  ? 405 HOH D O     1 
HETATM 5242 O O     . HOH G 4 .   ? 15.553  56.694  86.855  1.00 82.73  ? 426 HOH D O     1 
HETATM 5243 O O     . HOH G 4 .   ? 16.109  65.565  87.096  1.00 45.11  ? 435 HOH D O     1 
HETATM 5244 O O     . HOH H 4 .   ? 26.184  54.575  43.070  1.00 62.51  ? 403 HOH E O     1 
HETATM 5245 O O     . HOH H 4 .   ? 49.246  70.107  41.931  1.00 47.52  ? 418 HOH E O     1 
HETATM 5246 O O     . HOH H 4 .   ? 21.554  48.452  38.292  1.00 64.91  ? 419 HOH E O     1 
HETATM 5247 O O     . HOH H 4 .   ? 47.580  55.367  55.936  1.00 80.48  ? 422 HOH E O     1 
HETATM 5248 O O     . HOH I 4 .   ? 5.101   64.752  61.143  1.00 54.50  ? 407 HOH A O     1 
HETATM 5249 O O     . HOH I 4 .   ? 11.216  29.814  102.721 1.00 55.58  ? 410 HOH A O     1 
HETATM 5250 O O     . HOH I 4 .   ? 10.805  33.651  95.612  1.00 62.60  ? 412 HOH A O     1 
HETATM 5251 O O     . HOH I 4 .   ? 16.708  20.156  110.231 1.00 67.10  ? 414 HOH A O     1 
HETATM 5252 O O     . HOH I 4 .   ? -22.716 53.193  73.028  1.00 66.40  ? 420 HOH A O     1 
HETATM 5253 O O     . HOH I 4 .   ? 1.159   61.014  80.597  1.00 57.59  ? 423 HOH A O     1 
HETATM 5254 O O     . HOH I 4 .   ? 9.334   34.729  87.779  1.00 69.88  ? 425 HOH A O     1 
HETATM 5255 O O     . HOH I 4 .   ? -22.986 64.670  68.269  1.00 81.20  ? 427 HOH A O     1 
HETATM 5256 O O     . HOH I 4 .   ? 29.422  48.173  102.964 1.00 52.00  ? 429 HOH A O     1 
HETATM 5257 O O     . HOH I 4 .   ? 18.289  36.563  104.515 1.00 37.84  ? 431 HOH A O     1 
HETATM 5258 O O     . HOH I 4 .   ? 40.105  28.689  91.125  1.00 56.48  ? 434 HOH A O     1 
HETATM 5259 O O     . HOH I 4 .   ? 17.566  36.944  71.276  1.00 52.36  ? 436 HOH A O     1 
HETATM 5260 O O     . HOH I 4 .   ? -21.996 51.223  54.469  1.00 75.95  ? 439 HOH A O     1 
HETATM 5261 O O     . HOH I 4 .   ? 12.209  53.328  75.745  1.00 58.89  ? 440 HOH A O     1 
HETATM 5262 O O     . HOH I 4 .   ? 10.858  44.233  56.346  1.00 93.76  ? 442 HOH A O     1 
HETATM 5263 O O     . HOH I 4 .   ? -15.073 55.215  52.007  1.00 73.44  ? 443 HOH A O     1 
HETATM 5264 O O     . HOH I 4 .   ? -17.023 52.442  51.704  1.00 74.87  ? 445 HOH A O     1 
HETATM 5265 O O     . HOH I 4 .   ? 9.459   29.318  114.222 1.00 63.83  ? 446 HOH A O     1 
HETATM 5266 O O     . HOH J 4 .   ? 67.022  85.400  83.472  1.00 43.66  ? 401 HOH B O     1 
HETATM 5267 O O     . HOH J 4 .   ? 57.612  90.432  81.941  1.00 81.53  ? 402 HOH B O     1 
HETATM 5268 O O     . HOH J 4 .   ? 40.330  69.986  59.074  1.00 37.37  ? 406 HOH B O     1 
HETATM 5269 O O     . HOH J 4 .   ? 60.816  70.552  76.501  1.00 64.48  ? 408 HOH B O     1 
HETATM 5270 O O     . HOH J 4 .   ? 35.760  83.661  78.161  1.00 55.55  ? 409 HOH B O     1 
HETATM 5271 O O     . HOH J 4 .   ? -5.854  71.683  66.885  1.00 80.43  ? 411 HOH B O     1 
HETATM 5272 O O     . HOH J 4 .   ? 46.695  79.667  69.815  1.00 47.34  ? 413 HOH B O     1 
HETATM 5273 O O     . HOH J 4 .   ? 3.190   68.097  82.191  1.00 44.37  ? 415 HOH B O     1 
HETATM 5274 O O     . HOH J 4 .   ? 45.913  75.059  93.456  1.00 67.13  ? 416 HOH B O     1 
HETATM 5275 O O     . HOH J 4 .   ? 33.422  80.567  82.495  1.00 79.63  ? 417 HOH B O     1 
HETATM 5276 O O     . HOH J 4 .   ? 49.757  102.640 50.497  1.00 64.43  ? 421 HOH B O     1 
HETATM 5277 O O     . HOH J 4 .   ? -7.138  90.371  54.862  1.00 83.37  ? 424 HOH B O     1 
HETATM 5278 O O     . HOH J 4 .   ? 60.996  74.175  77.865  1.00 63.74  ? 428 HOH B O     1 
HETATM 5279 O O     . HOH J 4 .   ? 55.651  67.827  78.399  1.00 59.91  ? 430 HOH B O     1 
HETATM 5280 O O     . HOH J 4 .   ? 21.357  85.192  70.453  1.00 70.48  ? 432 HOH B O     1 
HETATM 5281 O O     . HOH J 4 .   ? 24.165  66.911  48.392  1.00 57.88  ? 433 HOH B O     1 
HETATM 5282 O O     . HOH J 4 .   ? 55.259  89.577  81.631  1.00 68.37  ? 437 HOH B O     1 
HETATM 5283 O O     . HOH J 4 .   ? 54.980  74.641  59.860  1.00 69.62  ? 438 HOH B O     1 
HETATM 5284 O O     . HOH J 4 .   ? -15.908 82.005  53.338  1.00 66.76  ? 441 HOH B O     1 
HETATM 5285 O O     . HOH J 4 .   ? 15.430  85.869  84.087  1.00 65.03  ? 444 HOH B O     1 
HETATM 5286 O O     . HOH J 4 .   ? -1.006  97.858  58.633  1.00 54.20  ? 447 HOH B O     1 
HETATM 5287 O O     . HOH J 4 .   ? 10.783  96.347  69.503  1.00 75.00  ? 448 HOH B O     1 
HETATM 5288 O O     . HOH J 4 .   ? 55.274  85.152  64.437  1.00 64.04  ? 449 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   2   2   DC  CYT C . n 
A 1 2   DG  2   3   3   DG  GUA C . n 
A 1 3   DG  3   4   4   DG  GUA C . n 
A 1 4   DG  4   5   5   DG  GUA C . n 
A 1 5   DA  5   6   6   DA  ADE C . n 
A 1 6   DA  6   7   7   DA  ADE C . n 
A 1 7   DT  7   8   8   DT  THY C . n 
A 1 8   DT  8   9   9   DT  THY C . n 
A 1 9   DC  9   10  10  DC  CYT C . n 
A 1 10  DC  10  11  11  DC  CYT C . n 
A 1 11  DC  11  12  ?   ?   ?   C . n 
B 1 1   DC  1   13  13  DC  CYT D . n 
B 1 2   DG  2   14  14  DG  GUA D . n 
B 1 3   DG  3   15  15  DG  GUA D . n 
B 1 4   DG  4   16  16  DG  GUA D . n 
B 1 5   DA  5   17  17  DA  ADE D . n 
B 1 6   DA  6   18  18  DA  ADE D . n 
B 1 7   DT  7   19  19  DT  THY D . n 
B 1 8   DT  8   20  20  DT  THY D . n 
B 1 9   DC  9   21  21  DC  CYT D . n 
B 1 10  DC  10  22  22  DC  CYT D . n 
B 1 11  DC  11  23  23  DC  CYT D . n 
C 1 1   DC  1   2   2   DC  CYT E . n 
C 1 2   DG  2   3   3   DG  GUA E . n 
C 1 3   DG  3   4   4   DG  GUA E . n 
C 1 4   DG  4   5   5   DG  GUA E . n 
C 1 5   DA  5   6   6   DA  ADE E . n 
C 1 6   DA  6   7   7   DA  ADE E . n 
C 1 7   DT  7   8   8   DT  THY E . n 
C 1 8   DT  8   9   9   DT  THY E . n 
C 1 9   DC  9   10  10  DC  CYT E . n 
C 1 10  DC  10  11  11  DC  CYT E . n 
C 1 11  DC  11  12  12  DC  CYT E . n 
D 2 1   SER 1   88  88  SER SER A . n 
D 2 2   CYS 2   89  89  CYS CYS A . n 
D 2 3   THR 3   90  90  THR THR A . n 
D 2 4   LEU 4   91  91  LEU LEU A . n 
D 2 5   GLY 5   92  92  GLY GLY A . n 
D 2 6   ARG 6   93  93  ARG ARG A . n 
D 2 7   LEU 7   94  94  LEU LEU A . n 
D 2 8   VAL 8   95  95  VAL VAL A . n 
D 2 9   SER 9   96  96  SER SER A . n 
D 2 10  PRO 10  97  97  PRO PRO A . n 
D 2 11  GLY 11  98  98  GLY GLY A . n 
D 2 12  PRO 12  99  99  PRO PRO A . n 
D 2 13  CYS 13  100 100 CYS CYS A . n 
D 2 14  PRO 14  101 101 PRO PRO A . n 
D 2 15  ARG 15  102 102 ARG ARG A . n 
D 2 16  PRO 16  103 103 PRO PRO A . n 
D 2 17  TYR 17  104 104 TYR TYR A . n 
D 2 18  LEU 18  105 105 LEU LEU A . n 
D 2 19  VAL 19  106 106 VAL VAL A . n 
D 2 20  ILE 20  107 107 ILE ILE A . n 
D 2 21  THR 21  108 108 THR THR A . n 
D 2 22  GLU 22  109 109 GLU GLU A . n 
D 2 23  GLN 23  110 110 GLN GLN A . n 
D 2 24  PRO 24  111 111 PRO PRO A . n 
D 2 25  LYS 25  112 112 LYS LYS A . n 
D 2 26  GLN 26  113 113 GLN GLN A . n 
D 2 27  ARG 27  114 114 ARG ARG A . n 
D 2 28  GLY 28  115 115 GLY GLY A . n 
D 2 29  MET 29  116 116 MET MET A . n 
D 2 30  ARG 30  117 117 ARG ARG A . n 
D 2 31  PHE 31  118 118 PHE PHE A . n 
D 2 32  ARG 32  119 119 ARG ARG A . n 
D 2 33  TYR 33  120 120 TYR TYR A . n 
D 2 34  GLU 34  121 121 GLU GLU A . n 
D 2 35  CYS 35  122 122 CYS CYS A . n 
D 2 36  GLU 36  123 123 GLU GLU A . n 
D 2 37  GLY 37  124 124 GLY GLY A . n 
D 2 38  ARG 38  125 125 ARG ARG A . n 
D 2 39  SER 39  126 126 SER SER A . n 
D 2 40  ALA 40  127 127 ALA ALA A . n 
D 2 41  GLY 41  128 128 GLY GLY A . n 
D 2 42  SER 42  129 129 SER SER A . n 
D 2 43  ILE 43  130 130 ILE ILE A . n 
D 2 44  LEU 44  131 131 LEU LEU A . n 
D 2 45  GLY 45  132 132 GLY GLY A . n 
D 2 46  GLU 46  133 133 GLU GLU A . n 
D 2 47  SER 47  134 134 SER SER A . n 
D 2 48  SER 48  135 135 SER SER A . n 
D 2 49  THR 49  136 136 THR THR A . n 
D 2 50  GLU 50  137 137 GLU GLU A . n 
D 2 51  ALA 51  138 138 ALA ALA A . n 
D 2 52  SER 52  139 139 SER SER A . n 
D 2 53  LYS 53  140 140 LYS LYS A . n 
D 2 54  THR 54  141 141 THR THR A . n 
D 2 55  GLN 55  142 142 GLN GLN A . n 
D 2 56  PRO 56  143 143 PRO PRO A . n 
D 2 57  ALA 57  144 144 ALA ALA A . n 
D 2 58  ILE 58  145 145 ILE ILE A . n 
D 2 59  GLU 59  146 146 GLU GLU A . n 
D 2 60  LEU 60  147 147 LEU LEU A . n 
D 2 61  ARG 61  148 148 ARG ARG A . n 
D 2 62  ASP 62  149 149 ASP ASP A . n 
D 2 63  CYS 63  150 150 CYS CYS A . n 
D 2 64  GLY 64  151 151 GLY GLY A . n 
D 2 65  GLY 65  152 152 GLY GLY A . n 
D 2 66  LEU 66  153 153 LEU LEU A . n 
D 2 67  ARG 67  154 154 ARG ALA A . n 
D 2 68  GLU 68  155 155 GLU GLU A . n 
D 2 69  VAL 69  156 156 VAL VAL A . n 
D 2 70  GLU 70  157 157 GLU GLU A . n 
D 2 71  VAL 71  158 158 VAL VAL A . n 
D 2 72  THR 72  159 159 THR THR A . n 
D 2 73  ALA 73  160 160 ALA ALA A . n 
D 2 74  CYS 74  161 161 CYS CYS A . n 
D 2 75  LEU 75  162 162 LEU LEU A . n 
D 2 76  VAL 76  163 163 VAL VAL A . n 
D 2 77  TRP 77  164 164 TRP TRP A . n 
D 2 78  LYS 78  165 165 LYS LYS A . n 
D 2 79  ASP 79  166 166 ASP ASP A . n 
D 2 80  TRP 80  167 167 TRP TRP A . n 
D 2 81  PRO 81  168 168 PRO PRO A . n 
D 2 82  HIS 82  169 169 HIS HIS A . n 
D 2 83  ARG 83  170 170 ARG ARG A . n 
D 2 84  VAL 84  171 171 VAL VAL A . n 
D 2 85  HIS 85  172 172 HIS HIS A . n 
D 2 86  PRO 86  173 173 PRO PRO A . n 
D 2 87  HIS 87  174 174 HIS HIS A . n 
D 2 88  SER 88  175 175 SER SER A . n 
D 2 89  LEU 89  176 176 LEU LEU A . n 
D 2 90  VAL 90  177 177 VAL VAL A . n 
D 2 91  GLY 91  178 178 GLY GLY A . n 
D 2 92  LYS 92  179 179 LYS LYS A . n 
D 2 93  ASP 93  180 180 ASP ASP A . n 
D 2 94  CYS 94  181 181 CYS CYS A . n 
D 2 95  THR 95  182 182 THR THR A . n 
D 2 96  ASP 96  183 183 ASP ASP A . n 
D 2 97  GLY 97  184 184 GLY GLY A . n 
D 2 98  VAL 98  185 185 VAL VAL A . n 
D 2 99  CYS 99  186 186 CYS CYS A . n 
D 2 100 ARG 100 187 187 ARG ARG A . n 
D 2 101 VAL 101 188 188 VAL VAL A . n 
D 2 102 ARG 102 189 189 ARG ARG A . n 
D 2 103 LEU 103 190 190 LEU LEU A . n 
D 2 104 ARG 104 191 191 ARG ALA A . n 
D 2 105 PRO 105 192 192 PRO PRO A . n 
D 2 106 HIS 106 193 193 HIS HIS A . n 
D 2 107 VAL 107 194 194 VAL VAL A . n 
D 2 108 SER 108 195 195 SER SER A . n 
D 2 109 PRO 109 196 196 PRO PRO A . n 
D 2 110 ARG 110 197 197 ARG ARG A . n 
D 2 111 HIS 111 198 198 HIS HIS A . n 
D 2 112 SER 112 199 199 SER SER A . n 
D 2 113 PHE 113 200 200 PHE PHE A . n 
D 2 114 ASN 114 201 201 ASN ASN A . n 
D 2 115 ASN 115 202 202 ASN ASN A . n 
D 2 116 LEU 116 203 203 LEU LEU A . n 
D 2 117 GLY 117 204 204 GLY GLY A . n 
D 2 118 ILE 118 205 205 ILE ILE A . n 
D 2 119 GLN 119 206 206 GLN GLN A . n 
D 2 120 CYS 120 207 207 CYS CYS A . n 
D 2 121 VAL 121 208 208 VAL VAL A . n 
D 2 122 ARG 122 209 209 ARG ARG A . n 
D 2 123 LYS 123 210 210 LYS LYS A . n 
D 2 124 LYS 124 211 211 LYS LYS A . n 
D 2 125 GLU 125 212 212 GLU GLU A . n 
D 2 126 ILE 126 213 213 ILE ILE A . n 
D 2 127 GLU 127 214 214 GLU GLU A . n 
D 2 128 ALA 128 215 215 ALA ALA A . n 
D 2 129 ALA 129 216 216 ALA ALA A . n 
D 2 130 ILE 130 217 217 ILE ILE A . n 
D 2 131 GLU 131 218 218 GLU GLU A . n 
D 2 132 ARG 132 219 219 ARG ARG A . n 
D 2 133 LYS 133 220 220 LYS LYS A . n 
D 2 134 ILE 134 221 221 ILE ILE A . n 
D 2 135 GLN 135 222 222 GLN GLN A . n 
D 2 136 LEU 136 223 223 LEU LEU A . n 
D 2 137 GLY 137 224 224 GLY GLY A . n 
D 2 138 ILE 138 225 225 ILE ILE A . n 
D 2 139 ASP 139 226 226 ASP ASP A . n 
D 2 140 PRO 140 227 227 PRO PRO A . n 
D 2 141 TYR 141 228 228 TYR TYR A . n 
D 2 142 ASN 142 229 229 ASN ASN A . n 
D 2 143 ALA 143 230 230 ALA ALA A . n 
D 2 144 GLY 144 231 231 GLY GLY A . n 
D 2 145 SER 145 232 232 SER SER A . n 
D 2 146 LEU 146 233 233 LEU LEU A . n 
D 2 147 LYS 147 234 234 LYS LYS A . n 
D 2 148 ASN 148 235 235 ASN ASN A . n 
D 2 149 HIS 149 236 236 HIS HIS A . n 
D 2 150 GLN 150 237 237 GLN GLN A . n 
D 2 151 GLU 151 238 238 GLU GLU A . n 
D 2 152 VAL 152 239 239 VAL VAL A . n 
D 2 153 ASP 153 240 240 ASP ASP A . n 
D 2 154 MET 154 241 241 MET MET A . n 
D 2 155 ASN 155 242 242 ASN ASN A . n 
D 2 156 VAL 156 243 243 VAL VAL A . n 
D 2 157 VAL 157 244 244 VAL VAL A . n 
D 2 158 ARG 158 245 245 ARG ARG A . n 
D 2 159 ILE 159 246 246 ILE ILE A . n 
D 2 160 CYS 160 247 247 CYS CYS A . n 
D 2 161 PHE 161 248 248 PHE PHE A . n 
D 2 162 GLN 162 249 249 GLN GLN A . n 
D 2 163 ALA 163 250 250 ALA ALA A . n 
D 2 164 SER 164 251 251 SER SER A . n 
D 2 165 TYR 165 252 252 TYR ALA A . n 
D 2 166 ARG 166 253 253 ARG ARG A . n 
D 2 167 ASP 167 254 254 ASP ASP A . n 
D 2 168 GLN 168 255 255 GLN GLN A . n 
D 2 169 GLN 169 256 256 GLN GLN A . n 
D 2 170 GLY 170 257 257 GLY GLY A . n 
D 2 171 HIS 171 258 258 HIS HIS A . n 
D 2 172 LEU 172 259 259 LEU LEU A . n 
D 2 173 HIS 173 260 260 HIS HIS A . n 
D 2 174 ARG 174 261 261 ARG ARG A . n 
D 2 175 MET 175 262 262 MET MET A . n 
D 2 176 ASP 176 263 263 ASP ASP A . n 
D 2 177 PRO 177 264 264 PRO PRO A . n 
D 2 178 ILE 178 265 265 ILE ILE A . n 
D 2 179 LEU 179 266 266 LEU LEU A . n 
D 2 180 SER 180 267 267 SER SER A . n 
D 2 181 GLU 181 268 268 GLU GLU A . n 
D 2 182 PRO 182 269 269 PRO PRO A . n 
D 2 183 VAL 183 270 270 VAL VAL A . n 
D 2 184 TYR 184 271 271 TYR TYR A . n 
D 2 185 ASP 185 272 272 ASP ASP A . n 
D 2 186 LYS 186 273 273 LYS LYS A . n 
D 2 187 LYS 187 274 274 LYS LYS A . n 
D 2 188 SER 188 275 275 SER SER A . n 
D 2 189 THR 189 276 276 THR THR A . n 
D 2 190 ASN 190 277 277 ASN ASN A . n 
D 2 191 THR 191 278 278 THR THR A . n 
D 2 192 SER 192 279 279 SER SER A . n 
D 2 193 GLU 193 280 280 GLU GLU A . n 
D 2 194 LEU 194 281 281 LEU LEU A . n 
D 2 195 ARG 195 282 282 ARG ARG A . n 
D 2 196 ILE 196 283 283 ILE ILE A . n 
D 2 197 CYS 197 284 284 CYS CYS A . n 
D 2 198 ARG 198 285 285 ARG ARG A . n 
D 2 199 ILE 199 286 286 ILE ILE A . n 
D 2 200 ASN 200 287 287 ASN ASN A . n 
D 2 201 LYS 201 288 288 LYS LYS A . n 
D 2 202 GLU 202 289 289 GLU GLU A . n 
D 2 203 SER 203 290 290 SER SER A . n 
D 2 204 GLY 204 291 291 GLY GLY A . n 
D 2 205 PRO 205 292 292 PRO PRO A . n 
D 2 206 CYS 206 293 293 CYS CYS A . n 
D 2 207 THR 207 294 294 THR THR A . n 
D 2 208 GLY 208 295 295 GLY GLY A . n 
D 2 209 GLY 209 296 296 GLY GLY A . n 
D 2 210 GLU 210 297 297 GLU GLU A . n 
D 2 211 GLU 211 298 298 GLU GLU A . n 
D 2 212 LEU 212 299 299 LEU LEU A . n 
D 2 213 TYR 213 300 300 TYR TYR A . n 
D 2 214 LEU 214 301 301 LEU LEU A . n 
D 2 215 LEU 215 302 302 LEU LEU A . n 
D 2 216 CYS 216 303 303 CYS CYS A . n 
D 2 217 ASP 217 304 304 ASP ASP A . n 
D 2 218 LYS 218 305 305 LYS LYS A . n 
D 2 219 VAL 219 306 306 VAL VAL A . n 
D 2 220 GLN 220 307 307 GLN GLN A . n 
D 2 221 LYS 221 308 308 LYS LYS A . n 
D 2 222 GLU 222 309 309 GLU GLU A . n 
D 2 223 ASP 223 310 310 ASP ASP A . n 
D 2 224 ILE 224 311 311 ILE ILE A . n 
D 2 225 SER 225 312 312 SER SER A . n 
D 2 226 VAL 226 313 313 VAL VAL A . n 
D 2 227 VAL 227 314 314 VAL VAL A . n 
D 2 228 PHE 228 315 315 PHE PHE A . n 
D 2 229 SER 229 316 316 SER SER A . n 
D 2 230 THR 230 317 317 THR THR A . n 
D 2 231 ALA 231 318 318 ALA ALA A . n 
D 2 232 SER 232 319 319 SER SER A . n 
D 2 233 TRP 233 320 320 TRP TRP A . n 
D 2 234 GLU 234 321 321 GLU GLU A . n 
D 2 235 GLY 235 322 322 GLY GLY A . n 
D 2 236 ARG 236 323 323 ARG ARG A . n 
D 2 237 ALA 237 324 324 ALA ALA A . n 
D 2 238 ASP 238 325 325 ASP ASP A . n 
D 2 239 PHE 239 326 326 PHE PHE A . n 
D 2 240 SER 240 327 327 SER SER A . n 
D 2 241 GLN 241 328 328 GLN GLN A . n 
D 2 242 ALA 242 329 329 ALA ALA A . n 
D 2 243 ASP 243 330 330 ASP ASP A . n 
D 2 244 VAL 244 331 331 VAL VAL A . n 
D 2 245 HIS 245 332 332 HIS HIS A . n 
D 2 246 ARG 246 333 333 ARG ARG A . n 
D 2 247 GLN 247 334 334 GLN GLN A . n 
D 2 248 ILE 248 335 335 ILE ILE A . n 
D 2 249 ALA 249 336 336 ALA ALA A . n 
D 2 250 ILE 250 337 337 ILE ILE A . n 
D 2 251 VAL 251 338 338 VAL VAL A . n 
D 2 252 PHE 252 339 339 PHE PHE A . n 
D 2 253 LYS 253 340 340 LYS LYS A . n 
D 2 254 THR 254 341 341 THR THR A . n 
D 2 255 PRO 255 342 342 PRO PRO A . n 
D 2 256 PRO 256 343 343 PRO PRO A . n 
D 2 257 TYR 257 344 344 TYR TYR A . n 
D 2 258 GLU 258 345 345 GLU GLU A . n 
D 2 259 ASP 259 346 346 ASP ASP A . n 
D 2 260 LEU 260 347 347 LEU LEU A . n 
D 2 261 GLU 261 348 348 GLU GLU A . n 
D 2 262 ILE 262 349 349 ILE ILE A . n 
D 2 263 SER 263 350 350 SER SER A . n 
D 2 264 GLU 264 351 351 GLU GLU A . n 
D 2 265 PRO 265 352 352 PRO PRO A . n 
D 2 266 VAL 266 353 353 VAL VAL A . n 
D 2 267 THR 267 354 354 THR THR A . n 
D 2 268 VAL 268 355 355 VAL VAL A . n 
D 2 269 ASN 269 356 356 ASN ASN A . n 
D 2 270 VAL 270 357 357 VAL VAL A . n 
D 2 271 PHE 271 358 358 PHE PHE A . n 
D 2 272 LEU 272 359 359 LEU LEU A . n 
D 2 273 GLN 273 360 360 GLN GLN A . n 
D 2 274 ARG 274 361 361 ARG ARG A . n 
D 2 275 LEU 275 362 362 LEU LEU A . n 
D 2 276 THR 276 363 363 THR THR A . n 
D 2 277 ASP 277 364 364 ASP ASP A . n 
D 2 278 GLY 278 365 365 GLY GLY A . n 
D 2 279 VAL 279 366 366 VAL VAL A . n 
D 2 280 CYS 280 367 367 CYS CYS A . n 
D 2 281 SER 281 368 368 SER SER A . n 
D 2 282 GLU 282 369 369 GLU GLU A . n 
D 2 283 PRO 283 370 370 PRO PRO A . n 
D 2 284 LEU 284 371 371 LEU LEU A . n 
D 2 285 PRO 285 372 372 PRO PRO A . n 
D 2 286 PHE 286 373 373 PHE PHE A . n 
D 2 287 THR 287 374 374 THR THR A . n 
D 2 288 TYR 288 375 375 TYR TYR A . n 
D 2 289 LEU 289 376 376 LEU LEU A . n 
D 2 290 PRO 290 377 377 PRO PRO A . n 
D 2 291 ARG 291 378 378 ARG ARG A . n 
D 2 292 ASP 292 379 379 ASP ASP A . n 
D 2 293 HIS 293 380 380 HIS HIS A . n 
D 2 294 ASP 294 381 381 ASP ASP A . n 
D 2 295 SER 295 382 382 SER SER A . n 
D 2 296 TYR 296 383 383 TYR TYR A . n 
E 3 1   GLY 1   37  37  GLY GLY B . n 
E 3 2   PRO 2   38  38  PRO PRO B . n 
E 3 3   TYR 3   39  39  TYR TYR B . n 
E 3 4   LEU 4   40  40  LEU LEU B . n 
E 3 5   VAL 5   41  41  VAL VAL B . n 
E 3 6   ILE 6   42  42  ILE ILE B . n 
E 3 7   VAL 7   43  43  VAL VAL B . n 
E 3 8   GLU 8   44  44  GLU GLU B . n 
E 3 9   GLN 9   45  45  GLN GLN B . n 
E 3 10  PRO 10  46  46  PRO PRO B . n 
E 3 11  LYS 11  47  47  LYS LYS B . n 
E 3 12  GLN 12  48  48  GLN GLN B . n 
E 3 13  ARG 13  49  49  ARG ALA B . n 
E 3 14  GLY 14  50  50  GLY GLY B . n 
E 3 15  PHE 15  51  51  PHE PHE B . n 
E 3 16  ARG 16  52  52  ARG ARG B . n 
E 3 17  PHE 17  53  53  PHE PHE B . n 
E 3 18  ARG 18  54  54  ARG ARG B . n 
E 3 19  TYR 19  55  55  TYR TYR B . n 
E 3 20  GLY 20  56  56  GLY GLY B . n 
E 3 21  CYS 21  57  57  CYS CYS B . n 
E 3 22  GLU 22  58  58  GLU GLU B . n 
E 3 23  GLY 23  59  59  GLY GLY B . n 
E 3 24  PRO 24  60  60  PRO PRO B . n 
E 3 25  SER 25  61  61  SER SER B . n 
E 3 26  HIS 26  62  62  HIS HIS B . n 
E 3 27  GLY 27  63  63  GLY GLY B . n 
E 3 28  GLY 28  64  64  GLY GLY B . n 
E 3 29  LEU 29  65  65  LEU LEU B . n 
E 3 30  PRO 30  66  66  PRO PRO B . n 
E 3 31  GLY 31  67  67  GLY GLY B . n 
E 3 32  ALA 32  68  68  ALA ALA B . n 
E 3 33  SER 33  69  69  SER SER B . n 
E 3 34  SER 34  70  70  SER SER B . n 
E 3 35  GLU 35  71  71  GLU GLU B . n 
E 3 36  LYS 36  72  72  LYS LYS B . n 
E 3 37  GLY 37  73  73  GLY GLY B . n 
E 3 38  ARG 38  74  74  ARG ARG B . n 
E 3 39  LYS 39  75  75  LYS LYS B . n 
E 3 40  THR 40  76  76  THR THR B . n 
E 3 41  TYR 41  77  77  TYR TYR B . n 
E 3 42  PRO 42  78  78  PRO PRO B . n 
E 3 43  THR 43  79  79  THR THR B . n 
E 3 44  VAL 44  80  80  VAL VAL B . n 
E 3 45  LYS 45  81  81  LYS ALA B . n 
E 3 46  ILE 46  82  82  ILE ILE B . n 
E 3 47  CYS 47  83  83  CYS CYS B . n 
E 3 48  ASN 48  84  84  ASN ASN B . n 
E 3 49  TYR 49  85  85  TYR TYR B . n 
E 3 50  GLU 50  86  86  GLU GLU B . n 
E 3 51  GLY 51  87  87  GLY GLY B . n 
E 3 52  PRO 52  88  88  PRO PRO B . n 
E 3 53  ALA 53  89  89  ALA ALA B . n 
E 3 54  LYS 54  90  90  LYS LYS B . n 
E 3 55  ILE 55  91  91  ILE ILE B . n 
E 3 56  GLU 56  92  92  GLU GLU B . n 
E 3 57  VAL 57  93  93  VAL VAL B . n 
E 3 58  ASP 58  94  94  ASP ASP B . n 
E 3 59  LEU 59  95  95  LEU LEU B . n 
E 3 60  VAL 60  96  96  VAL VAL B . n 
E 3 61  THR 61  97  97  THR THR B . n 
E 3 62  HIS 62  98  98  HIS HIS B . n 
E 3 63  SER 63  99  99  SER SER B . n 
E 3 64  ASP 64  100 100 ASP ASP B . n 
E 3 65  PRO 65  101 101 PRO PRO B . n 
E 3 66  PRO 66  102 102 PRO PRO B . n 
E 3 67  ARG 67  103 103 ARG ARG B . n 
E 3 68  ALA 68  104 104 ALA ALA B . n 
E 3 69  HIS 69  105 105 HIS HIS B . n 
E 3 70  ALA 70  106 106 ALA ALA B . n 
E 3 71  HIS 71  107 107 HIS HIS B . n 
E 3 72  SER 72  108 108 SER SER B . n 
E 3 73  LEU 73  109 109 LEU LEU B . n 
E 3 74  VAL 74  110 110 VAL VAL B . n 
E 3 75  GLY 75  111 111 GLY GLY B . n 
E 3 76  LYS 76  112 112 LYS LYS B . n 
E 3 77  GLN 77  113 113 GLN GLN B . n 
E 3 78  CYS 78  114 114 CYS CYS B . n 
E 3 79  SER 79  115 115 SER SER B . n 
E 3 80  GLU 80  116 116 GLU GLU B . n 
E 3 81  LEU 81  117 117 LEU LEU B . n 
E 3 82  GLY 82  118 118 GLY GLY B . n 
E 3 83  ILE 83  119 119 ILE ILE B . n 
E 3 84  CYS 84  120 120 CYS CYS B . n 
E 3 85  ALA 85  121 121 ALA ALA B . n 
E 3 86  VAL 86  122 122 VAL VAL B . n 
E 3 87  SER 87  123 123 SER SER B . n 
E 3 88  VAL 88  124 124 VAL VAL B . n 
E 3 89  GLY 89  125 125 GLY GLY B . n 
E 3 90  PRO 90  126 126 PRO PRO B . n 
E 3 91  LYS 91  127 127 LYS LYS B . n 
E 3 92  ASP 92  128 128 ASP ASP B . n 
E 3 93  MET 93  129 129 MET MET B . n 
E 3 94  THR 94  130 130 THR THR B . n 
E 3 95  ALA 95  131 131 ALA ALA B . n 
E 3 96  GLN 96  132 132 GLN GLN B . n 
E 3 97  PHE 97  133 133 PHE PHE B . n 
E 3 98  ASN 98  134 134 ASN ASN B . n 
E 3 99  ASN 99  135 135 ASN ASN B . n 
E 3 100 LEU 100 136 136 LEU LEU B . n 
E 3 101 GLY 101 137 137 GLY GLY B . n 
E 3 102 VAL 102 138 138 VAL VAL B . n 
E 3 103 LEU 103 139 139 LEU LEU B . n 
E 3 104 HIS 104 140 140 HIS HIS B . n 
E 3 105 VAL 105 141 141 VAL VAL B . n 
E 3 106 THR 106 142 142 THR THR B . n 
E 3 107 LYS 107 143 143 LYS LYS B . n 
E 3 108 LYS 108 144 144 LYS LYS B . n 
E 3 109 ASN 109 145 145 ASN ASN B . n 
E 3 110 MET 110 146 146 MET MET B . n 
E 3 111 MET 111 147 147 MET MET B . n 
E 3 112 GLY 112 148 148 GLY GLY B . n 
E 3 113 THR 113 149 149 THR THR B . n 
E 3 114 MET 114 150 150 MET MET B . n 
E 3 115 ILE 115 151 151 ILE ILE B . n 
E 3 116 GLN 116 152 152 GLN GLN B . n 
E 3 117 LYS 117 153 153 LYS LYS B . n 
E 3 118 LEU 118 154 154 LEU LEU B . n 
E 3 119 GLN 119 155 155 GLN GLN B . n 
E 3 120 ARG 120 156 156 ARG ARG B . n 
E 3 121 GLN 121 157 157 GLN GLN B . n 
E 3 122 ARG 122 158 158 ARG ARG B . n 
E 3 123 LEU 123 159 159 LEU LEU B . n 
E 3 124 ARG 124 160 160 ARG ARG B . n 
E 3 125 SER 125 161 161 SER SER B . n 
E 3 126 ARG 126 162 162 ARG ALA B . n 
E 3 127 PRO 127 163 163 PRO PRO B . n 
E 3 128 GLN 128 164 164 GLN GLN B . n 
E 3 129 GLY 129 165 165 GLY GLY B . n 
E 3 130 LEU 130 166 166 LEU LEU B . n 
E 3 131 THR 131 167 167 THR THR B . n 
E 3 132 GLU 132 168 168 GLU GLU B . n 
E 3 133 ALA 133 169 169 ALA ALA B . n 
E 3 134 GLU 134 170 170 GLU GLU B . n 
E 3 135 GLN 135 171 171 GLN GLN B . n 
E 3 136 ARG 136 172 172 ARG ARG B . n 
E 3 137 GLU 137 173 173 GLU GLU B . n 
E 3 138 LEU 138 174 174 LEU LEU B . n 
E 3 139 GLU 139 175 175 GLU GLU B . n 
E 3 140 GLN 140 176 176 GLN GLN B . n 
E 3 141 GLU 141 177 177 GLU GLU B . n 
E 3 142 ALA 142 178 178 ALA ALA B . n 
E 3 143 LYS 143 179 179 LYS LYS B . n 
E 3 144 GLU 144 180 180 GLU GLU B . n 
E 3 145 LEU 145 181 181 LEU LEU B . n 
E 3 146 LYS 146 182 182 LYS LYS B . n 
E 3 147 LYS 147 183 183 LYS LYS B . n 
E 3 148 VAL 148 184 184 VAL VAL B . n 
E 3 149 MET 149 185 185 MET MET B . n 
E 3 150 ASP 150 186 186 ASP ASP B . n 
E 3 151 LEU 151 187 187 LEU LEU B . n 
E 3 152 SER 152 188 188 SER SER B . n 
E 3 153 ILE 153 189 189 ILE ILE B . n 
E 3 154 VAL 154 190 190 VAL VAL B . n 
E 3 155 ARG 155 191 191 ARG ARG B . n 
E 3 156 LEU 156 192 192 LEU LEU B . n 
E 3 157 ARG 157 193 193 ARG ARG B . n 
E 3 158 PHE 158 194 194 PHE PHE B . n 
E 3 159 SER 159 195 195 SER SER B . n 
E 3 160 ALA 160 196 196 ALA ALA B . n 
E 3 161 PHE 161 197 197 PHE PHE B . n 
E 3 162 LEU 162 198 198 LEU LEU B . n 
E 3 163 ARG 163 199 199 ARG ARG B . n 
E 3 164 ASP 164 200 200 ASP ASP B . n 
E 3 165 SER 165 201 201 SER SER B . n 
E 3 166 ASP 166 202 202 ASP ASP B . n 
E 3 167 GLY 167 203 203 GLY GLY B . n 
E 3 168 SER 168 204 204 SER SER B . n 
E 3 169 PHE 169 205 205 PHE PHE B . n 
E 3 170 SER 170 206 206 SER SER B . n 
E 3 171 LEU 171 207 207 LEU LEU B . n 
E 3 172 PRO 172 208 208 PRO PRO B . n 
E 3 173 LEU 173 209 209 LEU LEU B . n 
E 3 174 LYS 174 210 210 LYS LYS B . n 
E 3 175 PRO 175 211 211 PRO PRO B . n 
E 3 176 VAL 176 212 212 VAL VAL B . n 
E 3 177 ILE 177 213 213 ILE ILE B . n 
E 3 178 SER 178 214 214 SER SER B . n 
E 3 179 GLN 179 215 215 GLN GLN B . n 
E 3 180 PRO 180 216 216 PRO PRO B . n 
E 3 181 ILE 181 217 217 ILE ILE B . n 
E 3 182 HIS 182 218 218 HIS HIS B . n 
E 3 183 ASP 183 219 219 ASP ASP B . n 
E 3 184 SER 184 220 220 SER SER B . n 
E 3 185 LYS 185 221 221 LYS LYS B . n 
E 3 186 SER 186 222 222 SER SER B . n 
E 3 187 PRO 187 223 223 PRO PRO B . n 
E 3 188 GLY 188 224 224 GLY GLY B . n 
E 3 189 ALA 189 225 225 ALA ALA B . n 
E 3 190 SER 190 226 226 SER SER B . n 
E 3 191 ASN 191 227 227 ASN ASN B . n 
E 3 192 LEU 192 228 228 LEU LEU B . n 
E 3 193 LYS 193 229 229 LYS LYS B . n 
E 3 194 ILE 194 230 230 ILE ILE B . n 
E 3 195 SER 195 231 231 SER SER B . n 
E 3 196 ARG 196 232 232 ARG ARG B . n 
E 3 197 MET 197 233 233 MET MET B . n 
E 3 198 ASP 198 234 234 ASP ASP B . n 
E 3 199 LYS 199 235 235 LYS LYS B . n 
E 3 200 THR 200 236 236 THR THR B . n 
E 3 201 ALA 201 237 237 ALA ALA B . n 
E 3 202 GLY 202 238 238 GLY GLY B . n 
E 3 203 SER 203 239 239 SER SER B . n 
E 3 204 VAL 204 240 240 VAL VAL B . n 
E 3 205 ARG 205 241 241 ARG ALA B . n 
E 3 206 GLY 206 242 242 GLY GLY B . n 
E 3 207 GLY 207 243 243 GLY GLY B . n 
E 3 208 ASP 208 244 244 ASP ASP B . n 
E 3 209 GLU 209 245 245 GLU GLU B . n 
E 3 210 VAL 210 246 246 VAL VAL B . n 
E 3 211 TYR 211 247 247 TYR TYR B . n 
E 3 212 LEU 212 248 248 LEU LEU B . n 
E 3 213 LEU 213 249 249 LEU LEU B . n 
E 3 214 CYS 214 250 250 CYS CYS B . n 
E 3 215 ASP 215 251 251 ASP ASP B . n 
E 3 216 LYS 216 252 252 LYS LYS B . n 
E 3 217 VAL 217 253 253 VAL VAL B . n 
E 3 218 GLN 218 254 254 GLN GLN B . n 
E 3 219 LYS 219 255 255 LYS LYS B . n 
E 3 220 ASP 220 256 256 ASP ASP B . n 
E 3 221 ASP 221 257 257 ASP ASP B . n 
E 3 222 ILE 222 258 258 ILE ILE B . n 
E 3 223 GLU 223 259 259 GLU GLU B . n 
E 3 224 VAL 224 260 260 VAL VAL B . n 
E 3 225 ARG 225 261 261 ARG ARG B . n 
E 3 226 PHE 226 262 262 PHE PHE B . n 
E 3 227 TYR 227 263 263 TYR TYR B . n 
E 3 228 GLU 228 264 264 GLU GLU B . n 
E 3 229 ASP 229 265 265 ASP ASP B . n 
E 3 230 ASP 230 266 266 ASP ASP B . n 
E 3 231 GLU 231 267 267 GLU GLU B . n 
E 3 232 ASN 232 268 268 ASN ASN B . n 
E 3 233 GLY 233 269 269 GLY GLY B . n 
E 3 234 TRP 234 270 270 TRP TRP B . n 
E 3 235 GLN 235 271 271 GLN GLN B . n 
E 3 236 ALA 236 272 272 ALA ALA B . n 
E 3 237 PHE 237 273 273 PHE PHE B . n 
E 3 238 GLY 238 274 274 GLY GLY B . n 
E 3 239 ASP 239 275 275 ASP ASP B . n 
E 3 240 PHE 240 276 276 PHE PHE B . n 
E 3 241 SER 241 277 277 SER SER B . n 
E 3 242 PRO 242 278 278 PRO PRO B . n 
E 3 243 THR 243 279 279 THR THR B . n 
E 3 244 ASP 244 280 280 ASP ASP B . n 
E 3 245 VAL 245 281 281 VAL VAL B . n 
E 3 246 HIS 246 282 282 HIS HIS B . n 
E 3 247 LYS 247 283 283 LYS LYS B . n 
E 3 248 GLN 248 284 284 GLN GLN B . n 
E 3 249 TYR 249 285 285 TYR TYR B . n 
E 3 250 ALA 250 286 286 ALA ALA B . n 
E 3 251 ILE 251 287 287 ILE ILE B . n 
E 3 252 VAL 252 288 288 VAL VAL B . n 
E 3 253 PHE 253 289 289 PHE PHE B . n 
E 3 254 ARG 254 290 290 ARG ARG B . n 
E 3 255 THR 255 291 291 THR THR B . n 
E 3 256 PRO 256 292 292 PRO PRO B . n 
E 3 257 PRO 257 293 293 PRO PRO B . n 
E 3 258 TYR 258 294 294 TYR TYR B . n 
E 3 259 HIS 259 295 295 HIS HIS B . n 
E 3 260 LYS 260 296 296 LYS LYS B . n 
E 3 261 MET 261 297 297 MET MET B . n 
E 3 262 LYS 262 298 298 LYS LYS B . n 
E 3 263 ILE 263 299 299 ILE ILE B . n 
E 3 264 GLU 264 300 300 GLU GLU B . n 
E 3 265 ARG 265 301 301 ARG ARG B . n 
E 3 266 PRO 266 302 302 PRO PRO B . n 
E 3 267 VAL 267 303 303 VAL VAL B . n 
E 3 268 THR 268 304 304 THR THR B . n 
E 3 269 VAL 269 305 305 VAL VAL B . n 
E 3 270 PHE 270 306 306 PHE PHE B . n 
E 3 271 LEU 271 307 307 LEU LEU B . n 
E 3 272 GLN 272 308 308 GLN GLN B . n 
E 3 273 LEU 273 309 309 LEU LEU B . n 
E 3 274 LYS 274 310 310 LYS LYS B . n 
E 3 275 ARG 275 311 311 ARG ARG B . n 
E 3 276 LYS 276 312 312 LYS LYS B . n 
E 3 277 ARG 277 313 313 ARG ARG B . n 
E 3 278 GLY 278 314 314 GLY GLY B . n 
E 3 279 GLY 279 315 315 GLY GLY B . n 
E 3 280 ASP 280 316 316 ASP ASP B . n 
E 3 281 VAL 281 317 317 VAL VAL B . n 
E 3 282 SER 282 318 318 SER SER B . n 
E 3 283 ASP 283 319 319 ASP ASP B . n 
E 3 284 SER 284 320 320 SER SER B . n 
E 3 285 LYS 285 321 321 LYS LYS B . n 
E 3 286 GLN 286 322 322 GLN GLN B . n 
E 3 287 PHE 287 323 323 PHE ALA B . n 
E 3 288 THR 288 324 324 THR THR B . n 
E 3 289 TYR 289 325 325 TYR TYR B . n 
E 3 290 TYR 290 326 326 TYR TYR B . n 
E 3 291 PRO 291 327 327 PRO PRO B . n 
E 3 292 LEU 292 328 328 LEU LEU B . n 
E 3 293 VAL 293 329 329 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 4 HOH 1  404 404 HOH TIP C . 
G 4 HOH 1  405 405 HOH TIP D . 
G 4 HOH 2  426 426 HOH TIP D . 
G 4 HOH 3  435 435 HOH TIP D . 
H 4 HOH 1  403 403 HOH TIP E . 
H 4 HOH 2  418 418 HOH TIP E . 
H 4 HOH 3  419 419 HOH TIP E . 
H 4 HOH 4  422 422 HOH TIP E . 
I 4 HOH 1  407 407 HOH TIP A . 
I 4 HOH 2  410 410 HOH TIP A . 
I 4 HOH 3  412 412 HOH TIP A . 
I 4 HOH 4  414 414 HOH TIP A . 
I 4 HOH 5  420 420 HOH TIP A . 
I 4 HOH 6  423 423 HOH TIP A . 
I 4 HOH 7  425 425 HOH TIP A . 
I 4 HOH 8  427 427 HOH TIP A . 
I 4 HOH 9  429 429 HOH TIP A . 
I 4 HOH 10 431 431 HOH TIP A . 
I 4 HOH 11 434 434 HOH TIP A . 
I 4 HOH 12 436 436 HOH TIP A . 
I 4 HOH 13 439 439 HOH TIP A . 
I 4 HOH 14 440 440 HOH TIP A . 
I 4 HOH 15 442 442 HOH TIP A . 
I 4 HOH 16 443 443 HOH TIP A . 
I 4 HOH 17 445 445 HOH TIP A . 
I 4 HOH 18 446 446 HOH TIP A . 
J 4 HOH 1  401 401 HOH TIP B . 
J 4 HOH 2  402 402 HOH TIP B . 
J 4 HOH 3  406 406 HOH TIP B . 
J 4 HOH 4  408 408 HOH TIP B . 
J 4 HOH 5  409 409 HOH TIP B . 
J 4 HOH 6  411 411 HOH TIP B . 
J 4 HOH 7  413 413 HOH TIP B . 
J 4 HOH 8  415 415 HOH TIP B . 
J 4 HOH 9  416 416 HOH TIP B . 
J 4 HOH 10 417 417 HOH TIP B . 
J 4 HOH 11 421 421 HOH TIP B . 
J 4 HOH 12 424 424 HOH TIP B . 
J 4 HOH 13 428 428 HOH TIP B . 
J 4 HOH 14 430 430 HOH TIP B . 
J 4 HOH 15 432 432 HOH TIP B . 
J 4 HOH 16 433 433 HOH TIP B . 
J 4 HOH 17 437 437 HOH TIP B . 
J 4 HOH 18 438 438 HOH TIP B . 
J 4 HOH 19 441 441 HOH TIP B . 
J 4 HOH 20 444 444 HOH TIP B . 
J 4 HOH 21 447 447 HOH TIP B . 
J 4 HOH 22 448 448 HOH TIP B . 
J 4 HOH 23 449 449 HOH TIP B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,D,E,F,G,I,J 
2 1,2 C,H             
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5500  ? 
1 MORE         -34.9 ? 
1 'SSA (A^2)'  34880 ? 
2 'ABSA (A^2)' 840   ? 
2 MORE         -10.7 ? 
2 'SSA (A^2)'  4520  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 77.6400000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 94.7950000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1 ? 1 
HKL-2000 'data collection' .   ? 2 
HKL-2000 'data reduction'  .   ? 3 
HKL-2000 'data scaling'    .   ? 4 
AMoRE    phasing           .   ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C3'" C DG  5   ? ? "C2'" C DG  5   ? ? "C1'" C DG  5   ? ? 97.46  102.40 -4.94 0.80 N 
2 1 "O4'" E DG  3   ? ? "C1'" E DG  3   ? ? N9    E DG  3   ? ? 111.59 108.30 3.29  0.30 N 
3 1 C     A GLU 351 ? ? N     A PRO 352 ? ? CA    A PRO 352 ? ? 129.11 119.30 9.81  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ARG A 93  ? ? -66.21  52.32   
2   1 VAL A 95  ? ? -65.48  26.85   
3   1 PRO A 99  ? ? -21.99  77.64   
4   1 CYS A 100 ? ? -160.24 -63.07  
5   1 PRO A 101 ? ? -72.89  -145.55 
6   1 ARG A 102 ? ? 69.51   73.27   
7   1 LYS A 112 ? ? -30.04  122.75  
8   1 GLN A 113 ? ? -44.90  -82.42  
9   1 SER A 126 ? ? -149.74 -31.40  
10  1 SER A 129 ? ? -153.42 4.54    
11  1 ILE A 130 ? ? -25.00  134.15  
12  1 GLU A 133 ? ? -5.28   -59.26  
13  1 SER A 134 ? ? -108.80 78.51   
14  1 SER A 135 ? ? -90.90  -132.49 
15  1 THR A 136 ? ? 170.01  141.50  
16  1 ALA A 138 ? ? -86.98  -119.88 
17  1 THR A 141 ? ? -61.05  -175.68 
18  1 PRO A 143 ? ? -61.73  97.73   
19  1 ASP A 149 ? ? 84.44   28.37   
20  1 TRP A 164 ? ? -54.16  -155.58 
21  1 TRP A 167 ? ? -15.89  -69.62  
22  1 HIS A 169 ? ? -63.38  46.48   
23  1 ARG A 170 ? ? -49.71  161.80  
24  1 PRO A 192 ? ? -49.27  -80.09  
25  1 HIS A 193 ? ? -44.72  -86.69  
26  1 VAL A 194 ? ? -48.82  88.28   
27  1 SER A 195 ? ? 65.05   86.69   
28  1 ARG A 197 ? ? -174.66 127.70  
29  1 ASN A 201 ? ? -108.10 -102.92 
30  1 ASN A 202 ? ? -60.00  91.31   
31  1 ARG A 209 ? ? -49.31  160.07  
32  1 LYS A 211 ? ? -65.04  24.76   
33  1 GLU A 212 ? ? -134.37 -55.12  
34  1 ILE A 213 ? ? 0.73    -72.93  
35  1 LEU A 223 ? ? -71.04  27.34   
36  1 ASP A 226 ? ? -177.79 88.19   
37  1 PRO A 227 ? ? -51.65  6.48    
38  1 TYR A 228 ? ? -153.11 -0.75   
39  1 ASN A 229 ? ? 42.35   75.48   
40  1 ALA A 230 ? ? -144.98 44.38   
41  1 LYS A 234 ? ? 66.08   86.22   
42  1 ASN A 235 ? ? 162.22  -80.94  
43  1 GLN A 237 ? ? -112.09 -106.43 
44  1 GLU A 238 ? ? 55.42   84.48   
45  1 ASP A 240 ? ? -65.91  84.67   
46  1 MET A 241 ? ? -66.05  6.72    
47  1 GLN A 256 ? ? -65.12  -176.94 
48  1 MET A 262 ? ? -70.76  -158.15 
49  1 PRO A 269 ? ? -10.88  134.56  
50  1 SER A 279 ? ? -62.12  -171.19 
51  1 ARG A 282 ? ? -169.43 116.97  
52  1 ARG A 285 ? ? 173.13  160.76  
53  1 ASN A 287 ? ? -48.17  -95.35  
54  1 LEU A 301 ? ? -178.32 144.38  
55  1 LYS A 305 ? ? -35.60  114.67  
56  1 GLU A 309 ? ? -65.78  24.46   
57  1 ASP A 310 ? ? -176.97 76.08   
58  1 ILE A 311 ? ? -179.16 146.14  
59  1 SER A 319 ? ? 88.67   -27.80  
60  1 GLU A 321 ? ? -156.38 84.66   
61  1 ALA A 324 ? ? -50.08  -171.53 
62  1 ARG A 333 ? ? 29.06   54.54   
63  1 GLN A 334 ? ? 53.90   9.98    
64  1 ILE A 335 ? ? -140.21 30.63   
65  1 ALA A 336 ? ? -175.65 143.75  
66  1 TYR A 344 ? ? -62.13  -178.46 
67  1 ASP A 346 ? ? 53.26   81.34   
68  1 GLU A 348 ? ? -146.03 -14.48  
69  1 ILE A 349 ? ? -29.05  107.82  
70  1 SER A 350 ? ? 35.96   -153.69 
71  1 GLU A 351 ? ? -44.45  157.83  
72  1 LEU A 362 ? ? -63.92  23.71   
73  1 THR A 363 ? ? -131.12 -46.04  
74  1 VAL A 366 ? ? -32.90  116.48  
75  1 ARG A 378 ? ? 48.46   -155.73 
76  1 ASP A 379 ? ? -61.33  -175.33 
77  1 HIS A 380 ? ? -142.96 36.71   
78  1 SER A 382 ? ? 176.62  -170.03 
79  1 PRO B 38  ? ? -64.07  60.06   
80  1 LEU B 65  ? ? -43.08  109.43  
81  1 PRO B 66  ? ? -69.29  -167.13 
82  1 SER B 69  ? ? -81.76  32.74   
83  1 LYS B 72  ? ? -54.31  176.40  
84  1 PRO B 78  ? ? -51.63  82.01   
85  1 TYR B 85  ? ? -76.08  -169.86 
86  1 GLU B 86  ? ? -141.27 19.47   
87  1 ILE B 91  ? ? -151.68 87.54   
88  1 ALA B 104 ? ? -50.32  -152.07 
89  1 GLN B 113 ? ? -92.91  56.77   
90  1 SER B 115 ? ? -65.24  64.33   
91  1 GLU B 116 ? ? 48.12   -86.46  
92  1 LYS B 127 ? ? -92.14  -66.13  
93  1 ASP B 128 ? ? -58.35  95.71   
94  1 ASN B 134 ? ? -61.51  -90.45  
95  1 ASN B 135 ? ? -59.45  104.12  
96  1 MET B 146 ? ? -58.42  -1.14   
97  1 MET B 147 ? ? -85.09  -86.22  
98  1 THR B 149 ? ? -71.14  -79.94  
99  1 MET B 150 ? ? -39.57  -39.29  
100 1 GLN B 157 ? ? -59.63  -9.72   
101 1 ARG B 158 ? ? -116.59 -101.73 
102 1 ARG B 162 ? ? 56.79   -171.06 
103 1 GLN B 164 ? ? -69.35  -167.67 
104 1 GLN B 176 ? ? -71.52  -70.49  
105 1 ALA B 178 ? ? -66.56  -75.24  
106 1 GLU B 180 ? ? -75.06  29.76   
107 1 LEU B 181 ? ? -152.07 -23.11  
108 1 VAL B 184 ? ? -148.66 34.04   
109 1 ASP B 186 ? ? -49.45  102.89  
110 1 LEU B 187 ? ? -61.06  5.49    
111 1 SER B 201 ? ? 49.46   -170.71 
112 1 ASP B 202 ? ? 47.27   18.28   
113 1 SER B 206 ? ? 177.51  -12.05  
114 1 PRO B 208 ? ? -55.23  -174.99 
115 1 LEU B 209 ? ? -152.61 -156.00 
116 1 PRO B 216 ? ? -31.15  153.93  
117 1 SER B 220 ? ? -52.25  4.37    
118 1 SER B 222 ? ? -39.47  119.98  
119 1 ALA B 225 ? ? -161.34 -29.95  
120 1 SER B 226 ? ? -55.13  -172.86 
121 1 LEU B 228 ? ? -62.75  78.29   
122 1 ARG B 232 ? ? 179.21  169.01  
123 1 ASP B 234 ? ? -63.21  -115.61 
124 1 SER B 239 ? ? -159.15 -95.03  
125 1 VAL B 240 ? ? -173.13 -67.90  
126 1 ARG B 241 ? ? -67.55  -131.61 
127 1 LYS B 252 ? ? -32.91  127.65  
128 1 LYS B 255 ? ? -52.42  -5.78   
129 1 ASP B 256 ? ? -145.92 -152.35 
130 1 ASP B 257 ? ? 43.36   29.41   
131 1 GLU B 259 ? ? -179.59 124.99  
132 1 TYR B 263 ? ? 179.07  -162.05 
133 1 GLU B 264 ? ? 165.01  74.43   
134 1 GLU B 267 ? ? -94.52  -147.97 
135 1 ASN B 268 ? ? -100.32 47.23   
136 1 TRP B 270 ? ? 152.15  120.73  
137 1 ALA B 272 ? ? 176.02  137.13  
138 1 PHE B 273 ? ? -99.48  -139.83 
139 1 ASP B 275 ? ? -177.09 105.39  
140 1 THR B 279 ? ? -25.89  -32.95  
141 1 GLN B 284 ? ? 63.34   -42.15  
142 1 TYR B 285 ? ? -97.51  35.73   
143 1 HIS B 295 ? ? -74.78  34.69   
144 1 ILE B 299 ? ? -72.63  31.27   
145 1 GLU B 300 ? ? -70.81  -138.70 
146 1 ARG B 301 ? ? -59.05  170.27  
147 1 LYS B 312 ? ? -63.86  -81.60  
148 1 ASP B 316 ? ? -74.19  -162.18 
149 1 VAL B 317 ? ? -172.43 -178.02 
150 1 SER B 318 ? ? -135.66 -151.72 
151 1 LEU B 328 ? ? -45.29  153.07  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG E 3  ? ? 0.062 'SIDE CHAIN' 
2 1 DA E 7  ? ? 0.068 'SIDE CHAIN' 
3 1 DT E 8  ? ? 0.081 'SIDE CHAIN' 
4 1 DT E 9  ? ? 0.064 'SIDE CHAIN' 
5 1 DC E 10 ? ? 0.075 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 154 ? CG  ? D ARG 67  CG  
2  1 Y 1 A ARG 154 ? CD  ? D ARG 67  CD  
3  1 Y 1 A ARG 154 ? NE  ? D ARG 67  NE  
4  1 Y 1 A ARG 154 ? CZ  ? D ARG 67  CZ  
5  1 Y 1 A ARG 154 ? NH1 ? D ARG 67  NH1 
6  1 Y 1 A ARG 154 ? NH2 ? D ARG 67  NH2 
7  1 Y 1 A ARG 191 ? CG  ? D ARG 104 CG  
8  1 Y 1 A ARG 191 ? CD  ? D ARG 104 CD  
9  1 Y 1 A ARG 191 ? NE  ? D ARG 104 NE  
10 1 Y 1 A ARG 191 ? CZ  ? D ARG 104 CZ  
11 1 Y 1 A ARG 191 ? NH1 ? D ARG 104 NH1 
12 1 Y 1 A ARG 191 ? NH2 ? D ARG 104 NH2 
13 1 Y 1 A TYR 252 ? CG  ? D TYR 165 CG  
14 1 Y 1 A TYR 252 ? CD1 ? D TYR 165 CD1 
15 1 Y 1 A TYR 252 ? CD2 ? D TYR 165 CD2 
16 1 Y 1 A TYR 252 ? CE1 ? D TYR 165 CE1 
17 1 Y 1 A TYR 252 ? CE2 ? D TYR 165 CE2 
18 1 Y 1 A TYR 252 ? CZ  ? D TYR 165 CZ  
19 1 Y 1 A TYR 252 ? OH  ? D TYR 165 OH  
20 1 Y 1 B ARG 49  ? CG  ? E ARG 13  CG  
21 1 Y 1 B ARG 49  ? CD  ? E ARG 13  CD  
22 1 Y 1 B ARG 49  ? NE  ? E ARG 13  NE  
23 1 Y 1 B ARG 49  ? CZ  ? E ARG 13  CZ  
24 1 Y 1 B ARG 49  ? NH1 ? E ARG 13  NH1 
25 1 Y 1 B ARG 49  ? NH2 ? E ARG 13  NH2 
26 1 Y 1 B LYS 81  ? CG  ? E LYS 45  CG  
27 1 Y 1 B LYS 81  ? CD  ? E LYS 45  CD  
28 1 Y 1 B LYS 81  ? CE  ? E LYS 45  CE  
29 1 Y 1 B LYS 81  ? NZ  ? E LYS 45  NZ  
30 1 Y 1 B ARG 162 ? CG  ? E ARG 126 CG  
31 1 Y 1 B ARG 162 ? CD  ? E ARG 126 CD  
32 1 Y 1 B ARG 162 ? NE  ? E ARG 126 NE  
33 1 Y 1 B ARG 162 ? CZ  ? E ARG 126 CZ  
34 1 Y 1 B ARG 162 ? NH1 ? E ARG 126 NH1 
35 1 Y 1 B ARG 162 ? NH2 ? E ARG 126 NH2 
36 1 Y 1 B ARG 241 ? CG  ? E ARG 205 CG  
37 1 Y 1 B ARG 241 ? CD  ? E ARG 205 CD  
38 1 Y 1 B ARG 241 ? NE  ? E ARG 205 NE  
39 1 Y 1 B ARG 241 ? CZ  ? E ARG 205 CZ  
40 1 Y 1 B ARG 241 ? NH1 ? E ARG 205 NH1 
41 1 Y 1 B ARG 241 ? NH2 ? E ARG 205 NH2 
42 1 Y 1 B PHE 262 ? CG  ? E PHE 226 CG  
43 1 Y 1 B PHE 262 ? CD1 ? E PHE 226 CD1 
44 1 Y 1 B PHE 262 ? CD2 ? E PHE 226 CD2 
45 1 Y 1 B PHE 262 ? CE1 ? E PHE 226 CE1 
46 1 Y 1 B PHE 262 ? CE2 ? E PHE 226 CE2 
47 1 Y 1 B PHE 262 ? CZ  ? E PHE 226 CZ  
48 1 Y 1 B GLU 264 ? CG  ? E GLU 228 CG  
49 1 Y 1 B GLU 264 ? CD  ? E GLU 228 CD  
50 1 Y 1 B GLU 264 ? OE1 ? E GLU 228 OE1 
51 1 Y 1 B GLU 264 ? OE2 ? E GLU 228 OE2 
52 1 Y 1 B TYR 294 ? CG  ? E TYR 258 CG  
53 1 Y 1 B TYR 294 ? CD1 ? E TYR 258 CD1 
54 1 Y 1 B TYR 294 ? CD2 ? E TYR 258 CD2 
55 1 Y 1 B TYR 294 ? CE1 ? E TYR 258 CE1 
56 1 Y 1 B TYR 294 ? CE2 ? E TYR 258 CE2 
57 1 Y 1 B TYR 294 ? CZ  ? E TYR 258 CZ  
58 1 Y 1 B TYR 294 ? OH  ? E TYR 258 OH  
59 1 Y 1 B LYS 296 ? CG  ? E LYS 260 CG  
60 1 Y 1 B LYS 296 ? CD  ? E LYS 260 CD  
61 1 Y 1 B LYS 296 ? CE  ? E LYS 260 CE  
62 1 Y 1 B LYS 296 ? NZ  ? E LYS 260 NZ  
63 1 Y 1 B PHE 323 ? CG  ? E PHE 287 CG  
64 1 Y 1 B PHE 323 ? CD1 ? E PHE 287 CD1 
65 1 Y 1 B PHE 323 ? CD2 ? E PHE 287 CD2 
66 1 Y 1 B PHE 323 ? CE1 ? E PHE 287 CE1 
67 1 Y 1 B PHE 323 ? CE2 ? E PHE 287 CE2 
68 1 Y 1 B PHE 323 ? CZ  ? E PHE 287 CZ  
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     C 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     DC 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      12 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    DC 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     11 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3DO7 'double helix'        
3DO7 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 11 1_555 -0.271 0.007  0.302  5.868  3.466   2.196   1  C_DG3:DC23_D  C 3  ? D 23 ? 19 1 
1 A DG 3  1_555 B DC 10 1_555 -0.051 -0.117 0.281  10.380 -0.840  -2.271  2  C_DG4:DC22_D  C 4  ? D 22 ? 19 1 
1 A DG 4  1_555 B DC 9  1_555 -0.162 -0.104 0.111  14.309 -4.920  1.582   3  C_DG5:DC21_D  C 5  ? D 21 ? 19 1 
1 A DA 5  1_555 B DT 8  1_555 0.242  -0.068 0.121  7.158  -14.954 -8.255  4  C_DA6:DT20_D  C 6  ? D 20 ? 20 1 
1 A DA 6  1_555 B DT 7  1_555 0.049  -0.222 0.147  -0.283 -19.598 0.755   5  C_DA7:DT19_D  C 7  ? D 19 ? 20 1 
1 A DT 7  1_555 B DA 6  1_555 -0.078 -0.088 -0.029 -2.252 -12.488 1.633   6  C_DT8:DA18_D  C 8  ? D 18 ? 20 1 
1 A DT 8  1_555 B DA 5  1_555 -0.084 -0.234 -0.142 -4.693 -3.398  1.075   7  C_DT9:DA17_D  C 9  ? D 17 ? 20 1 
1 A DC 9  1_555 B DG 4  1_555 -0.017 -0.060 0.152  -4.644 -2.666  -1.068  8  C_DC10:DG16_D C 10 ? D 16 ? 19 1 
1 A DC 10 1_555 B DG 3  1_555 -0.039 -0.126 -0.733 2.086  -10.815 1.541   9  C_DC11:DG15_D C 11 ? D 15 ? 19 1 
1 C DG 2  1_555 C DC 11 3_655 -0.815 -0.274 -0.183 -8.811 -7.583  -13.581 10 E_DG3:DC12_E  E 3  ? E 12 ? ?  ? 
1 C DG 3  1_555 C DC 10 3_655 -0.257 0.566  0.807  2.200  -12.349 14.529  11 E_DG4:DC11_E  E 4  ? E 11 ? ?  1 
1 C DG 4  1_555 C DC 9  3_655 0.194  0.125  1.032  7.573  -29.265 7.266   12 E_DG5:DC10_E  E 5  ? E 10 ? ?  1 
1 C DA 5  1_555 C DT 8  3_655 0.107  -0.287 0.449  0.122  -18.271 8.830   13 E_DA6:DT9_E   E 6  ? E 9  ? 20 1 
1 C DA 6  1_555 C DT 7  3_655 0.396  -0.163 0.653  8.147  -18.766 13.029  14 E_DA7:DT8_E   E 7  ? E 8  ? 20 1 
1 C DT 7  1_555 C DA 6  3_655 -0.396 -0.163 0.653  -8.147 -18.766 13.029  15 E_DT8:DA7_E   E 8  ? E 7  ? 20 1 
1 C DT 8  1_555 C DA 5  3_655 -0.107 -0.287 0.449  -0.122 -18.271 8.830   16 E_DT9:DA6_E   E 9  ? E 6  ? 20 1 
1 C DC 9  1_555 C DG 4  3_655 -0.194 0.125  1.032  -7.573 -29.265 7.266   17 E_DC10:DG5_E  E 10 ? E 5  ? ?  1 
1 C DC 10 1_555 C DG 3  3_655 0.257  0.566  0.807  -2.200 -12.349 14.529  18 E_DC11:DG4_E  E 11 ? E 4  ? ?  1 
1 C DC 11 1_555 C DG 2  3_655 0.815  -0.274 -0.183 8.811  -7.583  -13.581 19 E_DC12:DG3_E  E 12 ? E 3  ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 11 1_555 A DG 3  1_555 B DC 10 1_555 -0.391 -0.638 3.338 2.253  -1.487 34.912 -0.832 0.996  3.331 -2.473  
-3.748  35.013 1  CC_DG3DG4:DC22DC23_DD   C 3  ? D 23 ? C 4  ? D 22 ? 
1 A DG 3  1_555 B DC 10 1_555 A DG 4  1_555 B DC 9  1_555 0.825  -0.342 3.276 1.788  0.774  27.591 -0.905 -1.289 3.311 1.619   
-3.743  27.658 2  CC_DG4DG5:DC21DC22_DD   C 4  ? D 22 ? C 5  ? D 21 ? 
1 A DG 4  1_555 B DC 9  1_555 A DA 5  1_555 B DT 8  1_555 -1.010 -0.379 3.459 -2.998 -6.230 42.558 0.144  1.058  3.537 -8.515  
4.098   43.090 3  CC_DG5DA6:DT20DC21_DD   C 5  ? D 21 ? C 6  ? D 20 ? 
1 A DA 5  1_555 B DT 8  1_555 A DA 6  1_555 B DT 7  1_555 0.309  -0.512 3.425 -0.780 -0.554 37.131 -0.726 -0.595 3.425 -0.870  
1.225   37.143 4  CC_DA6DA7:DT19DT20_DD   C 6  ? D 20 ? C 7  ? D 19 ? 
1 A DA 6  1_555 B DT 7  1_555 A DT 7  1_555 B DA 6  1_555 0.068  -1.009 3.218 1.914  -0.438 32.633 -1.718 0.205  3.230 -0.779  
-3.402  32.690 5  CC_DA7DT8:DA18DT19_DD   C 7  ? D 19 ? C 8  ? D 18 ? 
1 A DT 7  1_555 B DA 6  1_555 A DT 8  1_555 B DA 5  1_555 0.383  -0.222 3.397 -0.863 -3.213 40.773 0.048  -0.646 3.396 -4.602  
1.237   40.903 6  CC_DT8DT9:DA17DA18_DD   C 8  ? D 18 ? C 9  ? D 17 ? 
1 A DT 8  1_555 B DA 5  1_555 A DC 9  1_555 B DG 4  1_555 -0.291 -0.610 3.422 -4.547 -5.577 30.553 -0.006 -0.377 3.482 -10.404 
8.481   31.369 7  CC_DT9DC10:DG16DA17_DD  C 9  ? D 17 ? C 10 ? D 16 ? 
1 A DC 9  1_555 B DG 4  1_555 A DC 10 1_555 B DG 3  1_555 -0.411 -0.710 3.173 8.674  0.806  33.018 -1.332 2.012  2.956 1.389   
-14.940 34.117 8  CC_DC10DC11:DG15DG16_DD C 10 ? D 16 ? C 11 ? D 15 ? 
1 C DG 2  1_555 C DC 11 3_655 C DG 3  1_555 C DC 10 3_655 -0.107 0.512  3.167 -7.357 -5.176 43.639 1.135  -0.512 3.068 -6.875  
9.773   44.512 9  EE_DG3DG4:DC11DC12_EE   E 3  ? E 12 ? E 4  ? E 11 ? 
1 C DG 3  1_555 C DC 10 3_655 C DG 4  1_555 C DC 9  3_655 0.344  -0.260 3.133 0.556  6.542  30.423 -1.675 -0.541 3.019 12.287  
-1.045  31.107 10 EE_DG4DG5:DC10DC11_EE   E 4  ? E 11 ? E 5  ? E 10 ? 
1 C DG 4  1_555 C DC 9  3_655 C DA 5  1_555 C DT 8  3_655 0.247  -0.596 3.423 4.165  -3.824 34.098 -0.376 0.267  3.472 -6.466  
-7.043  34.549 11 EE_DG5DA6:DT9DC10_EE    E 5  ? E 10 ? E 6  ? E 9  ? 
1 C DA 5  1_555 C DT 8  3_655 C DA 6  1_555 C DT 7  3_655 0.230  -0.419 3.023 -1.249 -2.035 36.136 -0.409 -0.533 3.032 -3.276  
2.011   36.212 12 EE_DA6DA7:DT8DT9_EE     E 6  ? E 9  ? E 7  ? E 8  ? 
1 C DA 6  1_555 C DT 7  3_655 C DT 7  1_555 C DA 6  3_655 0.000  -0.643 3.556 0.000  -3.039 32.134 -0.565 0.000  3.600 -5.476  
0.000   32.274 13 EE_DA7DT8:DA7DT8_EE     E 7  ? E 8  ? E 8  ? E 7  ? 
1 C DT 7  1_555 C DA 6  3_655 C DT 8  1_555 C DA 5  3_655 -0.230 -0.419 3.023 1.249  -2.035 36.136 -0.409 0.533  3.032 -3.276  
-2.011  36.212 14 EE_DT8DT9:DA6DA7_EE     E 8  ? E 7  ? E 9  ? E 6  ? 
1 C DT 8  1_555 C DA 5  3_655 C DC 9  1_555 C DG 4  3_655 -0.247 -0.596 3.423 -4.165 -3.824 34.098 -0.376 -0.267 3.472 -6.466  
7.043   34.549 15 EE_DT9DC10:DG5DA6_EE    E 9  ? E 6  ? E 10 ? E 5  ? 
1 C DC 9  1_555 C DG 4  3_655 C DC 10 1_555 C DG 3  3_655 -0.344 -0.260 3.133 -0.556 6.542  30.423 -1.675 0.541  3.019 12.287  
1.045   31.107 16 EE_DC10DC11:DG4DG5_EE   E 10 ? E 5  ? E 11 ? E 4  ? 
1 C DC 10 1_555 C DG 3  3_655 C DC 11 1_555 C DG 2  3_655 0.107  0.512  3.167 7.357  -5.176 43.639 1.135  0.512  3.068 -6.875  
-9.773  44.512 17 EE_DC11DC12:DG3DG4_EE   E 11 ? E 4  ? E 12 ? E 3  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#