data_3DOX
# 
_entry.id   3DOX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DOX         
RCSB  RCSB048307   
WWPDB D_1000048307 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1G6L . unspecified 
PDB 1LV1 . unspecified 
PDB 2NPH . unspecified 
# 
_pdbx_database_status.entry_id                        3DOX 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-07-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hosur, M.V.'   1 
'Ferrer, J.-L.' 2 
'Das, A.'       3 
'Prashar, V.'   4 
'Bihani, S.'    5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'X-ray structure of HIV-1 protease in situ product complex' Proteins                   74  594   602   2009 PSFGEY US 
0887-3585 0867 ? 18704947 10.1002/prot.22174                                            
1       '1.9 A x-ray study shows closed flap conformation in crystals of tethered HIV-1 PR' Proteins                   43  57    
64    2001 PSFGEY US 0887-3585 0867 ? 11170214 '10.1002/1097-0134(20010401)43:1<57::AID-PROT1017>3.0.CO;2-D' 
2       'Observation of a tetrahedral reaction intermediate in the HIV-1 protease-substrate complex' Biochem.J.                 
389 365   371   2005 BIJOAK UK 0264-6021 0043 ? 15794743 10.1042/BJ20041804                                            
3       'Rapid screening for HIV-1 protease inhibitor leads through X-ray diffraction' 'Acta Crystallogr.,Sect.D' 60  594   596   
2004 ABCRE6 DK 0907-4449 0766 ? 14993705 10.1107/S0907444903029676                                     
4       
;Crystal structure of HIV-1 protease in situ product complex and observation of a low-barrier hydrogen bond between catalytic aspartates
;
Proc.Natl.Acad.Sci.Usa     103 18464 18469 2006 PNASA6 US 0027-8424 0040 ? 17116869 10.1073/pnas.0605809103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bihani, S.'    1  
primary 'Das, A.'       2  
primary 'Prashar, V.'   3  
primary 'Ferrer, J.-L.' 4  
primary 'Hosur, M.V.'   5  
1       'Pillai, B.'    6  
1       'Kannan, K.K.'  7  
1       'Hosur, M.V.'   8  
2       'Kumar, M.'     9  
2       'Prashar, V.'   10 
2       'Mahale, S.'    11 
2       'Hosur, M.V.'   12 
3       'Pillai, B.'    13 
3       'Kannan, K.K.'  14 
3       'Bhat, S.V.'    15 
3       'Hosur, M.V.'   16 
4       'Das, A.'       17 
4       'Prashar, V.'   18 
4       'Mahale, S.'    19 
4       'Serre, L.'     20 
4       'Ferrer, J.-L.' 21 
4       'Hosur, M.V.'   22 
# 
_cell.entry_id           3DOX 
_cell.length_a           62.380 
_cell.length_b           62.380 
_cell.length_c           82.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DOX 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HIV-1 PROTEASE'           21902.760 1   3.4.23.16 'C95M, C1095A' ? 'TETHERED DIMER LINKED BY GGSSG' 
2 polymer syn 'A PEPTIDE SUBSTRATE-SQNY' 510.498   1   ?         ?              ? ?                                
3 polymer syn 'A PEPTIDE SUBSTRATE-PIV'  327.419   1   ?         ?              ? ?                                
4 water   nat water                      18.015    193 ?         ?              ? ?                                
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Pr160Gag-Pol, Matrix protein p17, MA, Capsid protein p24, CA, Spacer peptide p2, Nucleocapsid protein p7, NC, Transframe peptide, TF, p6-pol, p6*, Protease, Retropepsin, PR, Reverse transcriptase/ribonuclease H, p66 RT, p51 RT, p15, Integrase, IN
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGMTLNFGGSSGPQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKV
RQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
;
;PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGMTLNFGGSSGPQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKV
RQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
;
A ? 
2 'polypeptide(L)' no no SQNY SQNY P ? 
3 'polypeptide(L)' no no PIV PIV Q ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   GLN n 
1 3   VAL n 
1 4   THR n 
1 5   LEU n 
1 6   TRP n 
1 7   GLN n 
1 8   ARG n 
1 9   PRO n 
1 10  LEU n 
1 11  VAL n 
1 12  THR n 
1 13  ILE n 
1 14  LYS n 
1 15  ILE n 
1 16  GLY n 
1 17  GLY n 
1 18  GLN n 
1 19  LEU n 
1 20  LYS n 
1 21  GLU n 
1 22  ALA n 
1 23  LEU n 
1 24  LEU n 
1 25  ASP n 
1 26  THR n 
1 27  GLY n 
1 28  ALA n 
1 29  ASP n 
1 30  ASP n 
1 31  THR n 
1 32  VAL n 
1 33  LEU n 
1 34  GLU n 
1 35  GLU n 
1 36  MET n 
1 37  SER n 
1 38  LEU n 
1 39  PRO n 
1 40  GLY n 
1 41  ARG n 
1 42  TRP n 
1 43  LYS n 
1 44  PRO n 
1 45  LYS n 
1 46  MET n 
1 47  ILE n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  GLY n 
1 52  GLY n 
1 53  PHE n 
1 54  ILE n 
1 55  LYS n 
1 56  VAL n 
1 57  ARG n 
1 58  GLN n 
1 59  TYR n 
1 60  ASP n 
1 61  GLN n 
1 62  ILE n 
1 63  LEU n 
1 64  ILE n 
1 65  GLU n 
1 66  ILE n 
1 67  CYS n 
1 68  GLY n 
1 69  HIS n 
1 70  LYS n 
1 71  ALA n 
1 72  ILE n 
1 73  GLY n 
1 74  THR n 
1 75  VAL n 
1 76  LEU n 
1 77  VAL n 
1 78  GLY n 
1 79  PRO n 
1 80  THR n 
1 81  PRO n 
1 82  VAL n 
1 83  ASN n 
1 84  ILE n 
1 85  ILE n 
1 86  GLY n 
1 87  ARG n 
1 88  ASN n 
1 89  LEU n 
1 90  LEU n 
1 91  THR n 
1 92  GLN n 
1 93  ILE n 
1 94  GLY n 
1 95  MET n 
1 96  THR n 
1 97  LEU n 
1 98  ASN n 
1 99  PHE n 
1 100 GLY n 
1 101 GLY n 
1 102 SER n 
1 103 SER n 
1 104 GLY n 
1 105 PRO n 
1 106 GLN n 
1 107 VAL n 
1 108 THR n 
1 109 LEU n 
1 110 TRP n 
1 111 GLN n 
1 112 ARG n 
1 113 PRO n 
1 114 LEU n 
1 115 VAL n 
1 116 THR n 
1 117 ILE n 
1 118 LYS n 
1 119 ILE n 
1 120 GLY n 
1 121 GLY n 
1 122 GLN n 
1 123 LEU n 
1 124 LYS n 
1 125 GLU n 
1 126 ALA n 
1 127 LEU n 
1 128 LEU n 
1 129 ASP n 
1 130 THR n 
1 131 GLY n 
1 132 ALA n 
1 133 ASP n 
1 134 ASP n 
1 135 THR n 
1 136 VAL n 
1 137 LEU n 
1 138 GLU n 
1 139 GLU n 
1 140 MET n 
1 141 SER n 
1 142 LEU n 
1 143 PRO n 
1 144 GLY n 
1 145 ARG n 
1 146 TRP n 
1 147 LYS n 
1 148 PRO n 
1 149 LYS n 
1 150 MET n 
1 151 ILE n 
1 152 GLY n 
1 153 GLY n 
1 154 ILE n 
1 155 GLY n 
1 156 GLY n 
1 157 PHE n 
1 158 ILE n 
1 159 LYS n 
1 160 VAL n 
1 161 ARG n 
1 162 GLN n 
1 163 TYR n 
1 164 ASP n 
1 165 GLN n 
1 166 ILE n 
1 167 LEU n 
1 168 ILE n 
1 169 GLU n 
1 170 ILE n 
1 171 CYS n 
1 172 GLY n 
1 173 HIS n 
1 174 LYS n 
1 175 ALA n 
1 176 ILE n 
1 177 GLY n 
1 178 THR n 
1 179 VAL n 
1 180 LEU n 
1 181 VAL n 
1 182 GLY n 
1 183 PRO n 
1 184 THR n 
1 185 PRO n 
1 186 VAL n 
1 187 ASN n 
1 188 ILE n 
1 189 ILE n 
1 190 GLY n 
1 191 ARG n 
1 192 ASN n 
1 193 LEU n 
1 194 LEU n 
1 195 THR n 
1 196 GLN n 
1 197 ILE n 
1 198 GLY n 
1 199 ALA n 
1 200 THR n 
1 201 LEU n 
1 202 ASN n 
1 203 PHE n 
2 1   SER n 
2 2   GLN n 
2 3   ASN n 
2 4   TYR n 
3 1   PRO n 
3 2   ILE n 
3 3   VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   99  'HIV-1, HIV-1 M:B_HXB2R' ? gag-pol ? ? ? ? ? ? 
'Human immunodeficiency virus type 1 (isolate HXB2 group M subtype B)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
1 2 sample ? 105 203 'HIV-1, HIV-1 M:B_HXB2R' ? gag-pol ? ? ? ? ? ? 
'Human immunodeficiency virus type 1 (isolate HXB2 group M subtype B)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'The peptide was chemically synthesized.' 
3 1 sample ? ? ? ? ? 'The peptide was chemically synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POL_HV1H2 P04585 1 
;PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
489 ? 
2 PDB 3DOX      3DOX   2 SQNY                                                                                                   ? 
? 
3 PDB 3DOX      3DOX   3 PIV                                                                                                    ? 
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DOX A 1   ? 99  ? P04585 489 ? 587 ? 1    99   
2 1 3DOX A 105 ? 203 ? P04585 489 ? 587 ? 1001 1099 
3 2 3DOX P 1   ? 4   ? 3DOX   1   ? 4   ? 1    4    
4 3 3DOX Q 1   ? 3   ? 3DOX   1   ? 3   ? 1    3    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3DOX MET A 95  ? UNP P04585 CYS 583 ENGINEERED       95   1 
1 3DOX GLY A 100 ? UNP P04585 ?   ?   'SEE REMARK 999' 996  2 
1 3DOX GLY A 101 ? UNP P04585 ?   ?   'SEE REMARK 999' 997  3 
1 3DOX SER A 102 ? UNP P04585 ?   ?   'SEE REMARK 999' 998  4 
1 3DOX SER A 103 ? UNP P04585 ?   ?   'SEE REMARK 999' 999  5 
1 3DOX GLY A 104 ? UNP P04585 ?   ?   'SEE REMARK 999' 1000 6 
2 3DOX ALA A 199 ? UNP P04585 CYS 583 ENGINEERED       1095 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3DOX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.03 
_exptl_crystal.density_percent_sol   39.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            300.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '1-5% saturated ammonium sulfate, pH 6.2, Soaking, temperature 300.0K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-12-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double Crystal Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97644 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97644 
# 
_reflns.entry_id                     3DOX 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   12068 
_reflns.number_all                   12272 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.03 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3DOX 
_refine.ls_number_reflns_obs                     12068 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.11 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.236 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  604 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.00 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               34.13 
_refine.aniso_B[1][1]                            -1.09500 
_refine.aniso_B[2][2]                            -1.09500 
_refine.aniso_B[3][3]                            2.19100 
_refine.aniso_B[1][2]                            -1.39500 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 77.83 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1573 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             193 
_refine_hist.number_atoms_total               1766 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        45.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.256 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.228 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.246 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.822 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:PROTEIN_REP.PARAM CNS_TOPPAR:PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:DNA-RNA_REP.PARAM CNS_TOPPAR:DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:WATER_REP.PARAM   CNS_TOPPAR:WATER.TOP   'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ION.PARAM         CNS_TOPPAR:ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DOX 
_struct.title                     'X-ray structure of HIV-1 protease in situ product complex' 
_struct.pdbx_descriptor           'HIV-1 PROTEASE (E.C.3.4.23.16), A PEPTIDE SUBSTRATE-SQNY, A PEPTIDE SUBSTRATE-PIV' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DOX 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HIV-1 protease; transition state; reaction intermediate; catalysis; inhibitor; X-ray Crystallography, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Cytoplasm, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Host-virus interaction, Hydrolase, Lipoprotein, Magnesium, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, Ribosomal frameshifting, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc, Zinc-finger
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 86  ? THR A 91  ? GLY A 86   THR A 91   1 ? 6 
HELX_P HELX_P2 2 GLN A 92  ? GLY A 94  ? GLN A 92   GLY A 94   5 ? 3 
HELX_P HELX_P3 3 GLY A 190 ? THR A 195 ? GLY A 1086 THR A 1091 1 ? 6 
HELX_P HELX_P4 4 GLN A 196 ? GLY A 198 ? GLN A 1092 GLY A 1094 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 8 ? 
C ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 2   ? THR A 4   ? GLN A 2    THR A 4    
A 2 THR A 200 ? ASN A 202 ? THR A 1096 ASN A 1098 
A 3 THR A 96  ? ASN A 98  ? THR A 96   ASN A 98   
A 4 VAL A 107 ? THR A 108 ? VAL A 1003 THR A 1004 
B 1 LYS A 43  ? GLY A 49  ? LYS A 43   GLY A 49   
B 2 GLY A 52  ? ILE A 66  ? GLY A 52   ILE A 66   
B 3 HIS A 69  ? VAL A 77  ? HIS A 69   VAL A 77   
B 4 VAL A 32  ? LEU A 33  ? VAL A 32   LEU A 33   
B 5 ILE A 84  ? ILE A 85  ? ILE A 84   ILE A 85   
B 6 GLN A 18  ? LEU A 24  ? GLN A 18   LEU A 24   
B 7 LEU A 10  ? ILE A 15  ? LEU A 10   ILE A 15   
B 8 GLY A 52  ? ILE A 66  ? GLY A 52   ILE A 66   
C 1 LYS A 147 ? GLY A 153 ? LYS A 1043 GLY A 1049 
C 2 GLY A 156 ? ILE A 170 ? GLY A 1052 ILE A 1066 
C 3 HIS A 173 ? GLY A 182 ? HIS A 1069 GLY A 1078 
C 4 VAL A 136 ? GLU A 138 ? VAL A 1032 GLU A 1034 
C 5 ILE A 188 ? ILE A 189 ? ILE A 1084 ILE A 1085 
C 6 GLN A 122 ? LEU A 128 ? GLN A 1018 LEU A 1024 
C 7 LEU A 114 ? ILE A 119 ? LEU A 1010 ILE A 1015 
C 8 GLY A 156 ? ILE A 170 ? GLY A 1052 ILE A 1066 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 3   ? N VAL A 3    O LEU A 201 ? O LEU A 1097 
A 2 3 O THR A 200 ? O THR A 1096 N ASN A 98  ? N ASN A 98   
A 3 4 N LEU A 97  ? N LEU A 97   O VAL A 107 ? O VAL A 1003 
B 1 2 N LYS A 45  ? N LYS A 45   O VAL A 56  ? O VAL A 56   
B 2 3 N ILE A 64  ? N ILE A 64   O ALA A 71  ? O ALA A 71   
B 3 4 O LEU A 76  ? O LEU A 76   N LEU A 33  ? N LEU A 33   
B 4 5 N VAL A 32  ? N VAL A 32   O ILE A 84  ? O ILE A 84   
B 5 6 O ILE A 85  ? O ILE A 85   N LEU A 23  ? N LEU A 23   
B 6 7 O LYS A 20  ? O LYS A 20   N ILE A 13  ? N ILE A 13   
B 7 8 N LYS A 14  ? N LYS A 14   O GLU A 65  ? O GLU A 65   
C 1 2 N LYS A 149 ? N LYS A 1045 O VAL A 160 ? O VAL A 1056 
C 2 3 N ILE A 170 ? N ILE A 1066 O HIS A 173 ? O HIS A 1069 
C 3 4 O LEU A 180 ? O LEU A 1076 N LEU A 137 ? N LEU A 1033 
C 4 5 N VAL A 136 ? N VAL A 1032 O ILE A 188 ? O ILE A 1084 
C 5 6 O ILE A 189 ? O ILE A 1085 N LEU A 127 ? N LEU A 1023 
C 6 7 O LYS A 124 ? O LYS A 1020 N ILE A 117 ? N ILE A 1013 
C 7 8 N LYS A 118 ? N LYS A 1014 O GLU A 169 ? O GLU A 1065 
# 
_atom_sites.entry_id                    3DOX 
_atom_sites.fract_transf_matrix[1][1]   0.016031 
_atom_sites.fract_transf_matrix[1][2]   0.009255 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018511 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012195 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1   ? -13.455 39.574 31.187 1.00 40.16  ? 1    PRO A N   1 
ATOM   2    C CA  . PRO A 1 1   ? -12.930 39.360 29.823 1.00 38.88  ? 1    PRO A CA  1 
ATOM   3    C C   . PRO A 1 1   ? -13.642 38.240 29.069 1.00 38.80  ? 1    PRO A C   1 
ATOM   4    O O   . PRO A 1 1   ? -14.003 37.213 29.644 1.00 39.86  ? 1    PRO A O   1 
ATOM   5    C CB  . PRO A 1 1   ? -11.447 39.051 29.967 1.00 36.69  ? 1    PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1   ? -11.380 38.518 31.388 1.00 41.15  ? 1    PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1   ? -12.371 39.387 32.167 1.00 45.17  ? 1    PRO A CD  1 
ATOM   8    N N   . GLN A 1 2   ? -13.850 38.454 27.775 1.00 37.66  ? 2    GLN A N   1 
ATOM   9    C CA  . GLN A 1 2   ? -14.500 37.462 26.932 1.00 35.32  ? 2    GLN A CA  1 
ATOM   10   C C   . GLN A 1 2   ? -13.446 36.874 26.013 1.00 34.98  ? 2    GLN A C   1 
ATOM   11   O O   . GLN A 1 2   ? -12.555 37.585 25.549 1.00 37.01  ? 2    GLN A O   1 
ATOM   12   C CB  . GLN A 1 2   ? -15.610 38.101 26.094 1.00 35.54  ? 2    GLN A CB  1 
ATOM   13   C CG  . GLN A 1 2   ? -16.300 37.118 25.157 1.00 36.44  ? 2    GLN A CG  1 
ATOM   14   C CD  . GLN A 1 2   ? -17.457 37.734 24.390 1.00 46.00  ? 2    GLN A CD  1 
ATOM   15   O OE1 . GLN A 1 2   ? -17.266 38.616 23.554 1.00 45.97  ? 2    GLN A OE1 1 
ATOM   16   N NE2 . GLN A 1 2   ? -18.669 37.269 24.675 1.00 45.09  ? 2    GLN A NE2 1 
ATOM   17   N N   . VAL A 1 3   ? -13.536 35.577 25.751 1.00 32.61  ? 3    VAL A N   1 
ATOM   18   C CA  . VAL A 1 3   ? -12.564 34.946 24.877 1.00 31.88  ? 3    VAL A CA  1 
ATOM   19   C C   . VAL A 1 3   ? -13.203 34.031 23.841 1.00 30.02  ? 3    VAL A C   1 
ATOM   20   O O   . VAL A 1 3   ? -14.066 33.204 24.160 1.00 27.97  ? 3    VAL A O   1 
ATOM   21   C CB  . VAL A 1 3   ? -11.515 34.156 25.702 1.00 39.18  ? 3    VAL A CB  1 
ATOM   22   C CG1 . VAL A 1 3   ? -12.208 33.203 26.648 1.00 44.91  ? 3    VAL A CG1 1 
ATOM   23   C CG2 . VAL A 1 3   ? -10.574 33.402 24.777 1.00 34.09  ? 3    VAL A CG2 1 
ATOM   24   N N   . THR A 1 4   ? -12.783 34.214 22.594 1.00 28.55  ? 4    THR A N   1 
ATOM   25   C CA  . THR A 1 4   ? -13.255 33.409 21.478 1.00 27.17  ? 4    THR A CA  1 
ATOM   26   C C   . THR A 1 4   ? -12.405 32.139 21.460 1.00 26.21  ? 4    THR A C   1 
ATOM   27   O O   . THR A 1 4   ? -11.374 32.070 22.132 1.00 25.34  ? 4    THR A O   1 
ATOM   28   C CB  . THR A 1 4   ? -13.102 34.163 20.151 1.00 29.76  ? 4    THR A CB  1 
ATOM   29   O OG1 . THR A 1 4   ? -11.812 34.783 20.106 1.00 37.11  ? 4    THR A OG1 1 
ATOM   30   C CG2 . THR A 1 4   ? -14.183 35.224 20.015 1.00 35.02  ? 4    THR A CG2 1 
ATOM   31   N N   . LEU A 1 5   ? -12.815 31.142 20.684 1.00 24.15  ? 5    LEU A N   1 
ATOM   32   C CA  . LEU A 1 5   ? -12.095 29.874 20.671 1.00 20.75  ? 5    LEU A CA  1 
ATOM   33   C C   . LEU A 1 5   ? -11.359 29.490 19.387 1.00 20.44  ? 5    LEU A C   1 
ATOM   34   O O   . LEU A 1 5   ? -11.089 28.305 19.143 1.00 18.19  ? 5    LEU A O   1 
ATOM   35   C CB  . LEU A 1 5   ? -13.066 28.765 21.093 1.00 17.89  ? 5    LEU A CB  1 
ATOM   36   C CG  . LEU A 1 5   ? -13.589 28.940 22.531 1.00 14.19  ? 5    LEU A CG  1 
ATOM   37   C CD1 . LEU A 1 5   ? -14.816 28.067 22.766 1.00 18.64  ? 5    LEU A CD1 1 
ATOM   38   C CD2 . LEU A 1 5   ? -12.478 28.597 23.521 1.00 10.81  ? 5    LEU A CD2 1 
ATOM   39   N N   . TRP A 1 6   ? -11.023 30.492 18.576 1.00 18.63  ? 6    TRP A N   1 
ATOM   40   C CA  . TRP A 1 6   ? -10.293 30.258 17.335 1.00 20.69  ? 6    TRP A CA  1 
ATOM   41   C C   . TRP A 1 6   ? -8.891  29.791 17.694 1.00 21.17  ? 6    TRP A C   1 
ATOM   42   O O   . TRP A 1 6   ? -8.210  29.152 16.894 1.00 23.32  ? 6    TRP A O   1 
ATOM   43   C CB  . TRP A 1 6   ? -10.245 31.541 16.500 1.00 20.94  ? 6    TRP A CB  1 
ATOM   44   C CG  . TRP A 1 6   ? -11.617 32.086 16.241 1.00 21.36  ? 6    TRP A CG  1 
ATOM   45   C CD1 . TRP A 1 6   ? -12.308 32.972 17.016 1.00 30.37  ? 6    TRP A CD1 1 
ATOM   46   C CD2 . TRP A 1 6   ? -12.503 31.704 15.183 1.00 25.24  ? 6    TRP A CD2 1 
ATOM   47   N NE1 . TRP A 1 6   ? -13.571 33.162 16.511 1.00 21.92  ? 6    TRP A NE1 1 
ATOM   48   C CE2 . TRP A 1 6   ? -13.718 32.396 15.386 1.00 27.46  ? 6    TRP A CE2 1 
ATOM   49   C CE3 . TRP A 1 6   ? -12.389 30.840 14.086 1.00 28.48  ? 6    TRP A CE3 1 
ATOM   50   C CZ2 . TRP A 1 6   ? -14.816 32.250 14.530 1.00 28.89  ? 6    TRP A CZ2 1 
ATOM   51   C CZ3 . TRP A 1 6   ? -13.480 30.694 13.236 1.00 23.61  ? 6    TRP A CZ3 1 
ATOM   52   C CH2 . TRP A 1 6   ? -14.677 31.396 13.464 1.00 30.69  ? 6    TRP A CH2 1 
ATOM   53   N N   . GLN A 1 7   ? -8.466  30.107 18.915 1.00 20.02  ? 7    GLN A N   1 
ATOM   54   C CA  . GLN A 1 7   ? -7.157  29.683 19.405 1.00 19.31  ? 7    GLN A CA  1 
ATOM   55   C C   . GLN A 1 7   ? -7.395  28.987 20.742 1.00 19.22  ? 7    GLN A C   1 
ATOM   56   O O   . GLN A 1 7   ? -8.471  29.111 21.319 1.00 20.17  ? 7    GLN A O   1 
ATOM   57   C CB  . GLN A 1 7   ? -6.241  30.890 19.626 1.00 25.41  ? 7    GLN A CB  1 
ATOM   58   C CG  . GLN A 1 7   ? -6.627  31.746 20.825 1.00 44.34  ? 7    GLN A CG  1 
ATOM   59   C CD  . GLN A 1 7   ? -5.691  32.922 21.040 1.00 57.75  ? 7    GLN A CD  1 
ATOM   60   O OE1 . GLN A 1 7   ? -5.821  33.660 22.018 1.00 67.54  ? 7    GLN A OE1 1 
ATOM   61   N NE2 . GLN A 1 7   ? -4.744  33.104 20.125 1.00 62.07  ? 7    GLN A NE2 1 
ATOM   62   N N   . ARG A 1 8   ? -6.407  28.251 21.233 1.00 16.84  ? 8    ARG A N   1 
ATOM   63   C CA  . ARG A 1 8   ? -6.562  27.595 22.528 1.00 19.67  ? 8    ARG A CA  1 
ATOM   64   C C   . ARG A 1 8   ? -6.729  28.668 23.595 1.00 20.00  ? 8    ARG A C   1 
ATOM   65   O O   . ARG A 1 8   ? -5.984  29.650 23.621 1.00 18.23  ? 8    ARG A O   1 
ATOM   66   C CB  . ARG A 1 8   ? -5.335  26.754 22.868 1.00 18.65  ? 8    ARG A CB  1 
ATOM   67   C CG  . ARG A 1 8   ? -5.126  25.563 21.957 1.00 30.36  ? 8    ARG A CG  1 
ATOM   68   C CD  . ARG A 1 8   ? -3.964  24.688 22.426 1.00 31.89  ? 8    ARG A CD  1 
ATOM   69   N NE  . ARG A 1 8   ? -3.793  23.532 21.552 1.00 45.68  ? 8    ARG A NE  1 
ATOM   70   C CZ  . ARG A 1 8   ? -2.917  22.554 21.757 1.00 53.53  ? 8    ARG A CZ  1 
ATOM   71   N NH1 . ARG A 1 8   ? -2.120  22.581 22.816 1.00 47.34  ? 8    ARG A NH1 1 
ATOM   72   N NH2 . ARG A 1 8   ? -2.838  21.547 20.897 1.00 46.50  ? 8    ARG A NH2 1 
ATOM   73   N N   . PRO A 1 9   ? -7.717  28.502 24.485 1.00 17.87  ? 9    PRO A N   1 
ATOM   74   C CA  . PRO A 1 9   ? -7.929  29.492 25.543 1.00 17.44  ? 9    PRO A CA  1 
ATOM   75   C C   . PRO A 1 9   ? -6.879  29.349 26.639 1.00 17.46  ? 9    PRO A C   1 
ATOM   76   O O   . PRO A 1 9   ? -7.131  28.748 27.686 1.00 18.62  ? 9    PRO A O   1 
ATOM   77   C CB  . PRO A 1 9   ? -9.334  29.166 26.033 1.00 15.73  ? 9    PRO A CB  1 
ATOM   78   C CG  . PRO A 1 9   ? -9.388  27.685 25.893 1.00 19.41  ? 9    PRO A CG  1 
ATOM   79   C CD  . PRO A 1 9   ? -8.771  27.474 24.510 1.00 20.91  ? 9    PRO A CD  1 
ATOM   80   N N   . LEU A 1 10  ? -5.696  29.900 26.399 1.00 19.09  ? 10   LEU A N   1 
ATOM   81   C CA  . LEU A 1 10  ? -4.620  29.818 27.382 1.00 19.43  ? 10   LEU A CA  1 
ATOM   82   C C   . LEU A 1 10  ? -4.645  30.992 28.345 1.00 20.55  ? 10   LEU A C   1 
ATOM   83   O O   . LEU A 1 10  ? -5.022  32.106 27.976 1.00 22.79  ? 10   LEU A O   1 
ATOM   84   C CB  . LEU A 1 10  ? -3.262  29.770 26.680 1.00 24.24  ? 10   LEU A CB  1 
ATOM   85   C CG  . LEU A 1 10  ? -2.985  28.553 25.794 1.00 28.86  ? 10   LEU A CG  1 
ATOM   86   C CD1 . LEU A 1 10  ? -1.610  28.700 25.160 1.00 39.03  ? 10   LEU A CD1 1 
ATOM   87   C CD2 . LEU A 1 10  ? -3.056  27.275 26.622 1.00 34.11  ? 10   LEU A CD2 1 
ATOM   88   N N   . VAL A 1 11  ? -4.260  30.737 29.589 1.00 19.63  ? 11   VAL A N   1 
ATOM   89   C CA  . VAL A 1 11  ? -4.210  31.789 30.593 1.00 19.65  ? 11   VAL A CA  1 
ATOM   90   C C   . VAL A 1 11  ? -2.932  31.655 31.405 1.00 19.81  ? 11   VAL A C   1 
ATOM   91   O O   . VAL A 1 11  ? -2.281  30.611 31.393 1.00 20.40  ? 11   VAL A O   1 
ATOM   92   C CB  . VAL A 1 11  ? -5.418  31.731 31.565 1.00 22.32  ? 11   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 11  ? -6.705  31.995 30.808 1.00 28.63  ? 11   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 11  ? -5.474  30.381 32.267 1.00 21.80  ? 11   VAL A CG2 1 
ATOM   95   N N   . THR A 1 12  ? -2.555  32.725 32.087 1.00 19.35  ? 12   THR A N   1 
ATOM   96   C CA  . THR A 1 12  ? -1.373  32.690 32.925 1.00 20.55  ? 12   THR A CA  1 
ATOM   97   C C   . THR A 1 12  ? -1.875  32.376 34.330 1.00 19.20  ? 12   THR A C   1 
ATOM   98   O O   . THR A 1 12  ? -2.871  32.937 34.780 1.00 21.67  ? 12   THR A O   1 
ATOM   99   C CB  . THR A 1 12  ? -0.631  34.055 32.926 1.00 20.26  ? 12   THR A CB  1 
ATOM   100  O OG1 . THR A 1 12  ? -0.061  34.292 31.635 1.00 29.33  ? 12   THR A OG1 1 
ATOM   101  C CG2 . THR A 1 12  ? 0.468   34.058 33.956 1.00 24.93  ? 12   THR A CG2 1 
ATOM   102  N N   . ILE A 1 13  ? -1.206  31.459 35.011 1.00 19.64  ? 13   ILE A N   1 
ATOM   103  C CA  . ILE A 1 13  ? -1.604  31.102 36.362 1.00 19.36  ? 13   ILE A CA  1 
ATOM   104  C C   . ILE A 1 13  ? -0.392  31.162 37.275 1.00 21.72  ? 13   ILE A C   1 
ATOM   105  O O   . ILE A 1 13  ? 0.742   30.977 36.826 1.00 19.46  ? 13   ILE A O   1 
ATOM   106  C CB  . ILE A 1 13  ? -2.189  29.672 36.434 1.00 21.84  ? 13   ILE A CB  1 
ATOM   107  C CG1 . ILE A 1 13  ? -1.080  28.638 36.238 1.00 20.87  ? 13   ILE A CG1 1 
ATOM   108  C CG2 . ILE A 1 13  ? -3.249  29.486 35.354 1.00 20.16  ? 13   ILE A CG2 1 
ATOM   109  C CD1 . ILE A 1 13  ? -1.540  27.201 36.404 1.00 22.05  ? 13   ILE A CD1 1 
ATOM   110  N N   . LYS A 1 14  ? -0.631  31.463 38.545 1.00 20.02  ? 14   LYS A N   1 
ATOM   111  C CA  . LYS A 1 14  ? 0.446   31.495 39.517 1.00 19.63  ? 14   LYS A CA  1 
ATOM   112  C C   . LYS A 1 14  ? 0.019   30.516 40.582 1.00 21.56  ? 14   LYS A C   1 
ATOM   113  O O   . LYS A 1 14  ? -1.078  30.626 41.138 1.00 22.94  ? 14   LYS A O   1 
ATOM   114  C CB  . LYS A 1 14  ? 0.633   32.883 40.129 1.00 20.17  ? 14   LYS A CB  1 
ATOM   115  C CG  . LYS A 1 14  ? 1.812   32.920 41.115 1.00 21.89  ? 14   LYS A CG  1 
ATOM   116  C CD  . LYS A 1 14  ? 2.059   34.313 41.687 1.00 34.60  ? 14   LYS A CD  1 
ATOM   117  C CE  . LYS A 1 14  ? 3.236   34.298 42.660 1.00 40.67  ? 14   LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 14  ? 3.461   35.614 43.328 1.00 37.10  ? 14   LYS A NZ  1 
ATOM   119  N N   . ILE A 1 15  ? 0.883   29.548 40.849 1.00 19.78  ? 15   ILE A N   1 
ATOM   120  C CA  . ILE A 1 15  ? 0.596   28.518 41.826 1.00 22.30  ? 15   ILE A CA  1 
ATOM   121  C C   . ILE A 1 15  ? 1.901   28.040 42.449 1.00 22.12  ? 15   ILE A C   1 
ATOM   122  O O   . ILE A 1 15  ? 2.902   27.849 41.751 1.00 22.24  ? 15   ILE A O   1 
ATOM   123  C CB  . ILE A 1 15  ? -0.115  27.330 41.149 1.00 24.90  ? 15   ILE A CB  1 
ATOM   124  C CG1 . ILE A 1 15  ? -0.389  26.228 42.169 1.00 24.67  ? 15   ILE A CG1 1 
ATOM   125  C CG2 . ILE A 1 15  ? 0.733   26.804 40.001 1.00 25.21  ? 15   ILE A CG2 1 
ATOM   126  C CD1 . ILE A 1 15  ? -1.203  25.098 41.599 1.00 27.00  ? 15   ILE A CD1 1 
ATOM   127  N N   . GLY A 1 16  ? 1.892   27.862 43.763 1.00 20.59  ? 16   GLY A N   1 
ATOM   128  C CA  . GLY A 1 16  ? 3.094   27.403 44.442 1.00 21.88  ? 16   GLY A CA  1 
ATOM   129  C C   . GLY A 1 16  ? 4.252   28.363 44.256 1.00 21.43  ? 16   GLY A C   1 
ATOM   130  O O   . GLY A 1 16  ? 5.411   27.955 44.305 1.00 22.23  ? 16   GLY A O   1 
ATOM   131  N N   . GLY A 1 17  ? 3.932   29.639 44.042 1.00 22.16  ? 17   GLY A N   1 
ATOM   132  C CA  . GLY A 1 17  ? 4.955   30.656 43.853 1.00 21.68  ? 17   GLY A CA  1 
ATOM   133  C C   . GLY A 1 17  ? 5.554   30.701 42.455 1.00 22.14  ? 17   GLY A C   1 
ATOM   134  O O   . GLY A 1 17  ? 6.469   31.486 42.195 1.00 22.73  ? 17   GLY A O   1 
ATOM   135  N N   . GLN A 1 18  ? 5.032   29.877 41.550 1.00 22.44  ? 18   GLN A N   1 
ATOM   136  C CA  . GLN A 1 18  ? 5.542   29.806 40.177 1.00 20.12  ? 18   GLN A CA  1 
ATOM   137  C C   . GLN A 1 18  ? 4.507   30.218 39.139 1.00 20.04  ? 18   GLN A C   1 
ATOM   138  O O   . GLN A 1 18  ? 3.302   30.019 39.334 1.00 19.47  ? 18   GLN A O   1 
ATOM   139  C CB  . GLN A 1 18  ? 5.986   28.381 39.871 1.00 23.52  ? 18   GLN A CB  1 
ATOM   140  C CG  . GLN A 1 18  ? 6.959   27.803 40.879 1.00 23.37  ? 18   GLN A CG  1 
ATOM   141  C CD  . GLN A 1 18  ? 6.883   26.297 40.928 1.00 27.06  ? 18   GLN A CD  1 
ATOM   142  O OE1 . GLN A 1 18  ? 7.164   25.614 39.940 1.00 31.79  ? 18   GLN A OE1 1 
ATOM   143  N NE2 . GLN A 1 18  ? 6.482   25.767 42.076 1.00 23.11  ? 18   GLN A NE2 1 
ATOM   144  N N   . LEU A 1 19  ? 4.992   30.768 38.027 1.00 17.90  ? 19   LEU A N   1 
ATOM   145  C CA  . LEU A 1 19  ? 4.132   31.202 36.939 1.00 16.38  ? 19   LEU A CA  1 
ATOM   146  C C   . LEU A 1 19  ? 4.097   30.148 35.841 1.00 18.88  ? 19   LEU A C   1 
ATOM   147  O O   . LEU A 1 19  ? 5.124   29.591 35.455 1.00 17.88  ? 19   LEU A O   1 
ATOM   148  C CB  . LEU A 1 19  ? 4.635   32.524 36.355 1.00 21.13  ? 19   LEU A CB  1 
ATOM   149  C CG  . LEU A 1 19  ? 4.798   33.698 37.318 1.00 20.25  ? 19   LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 19  ? 5.331   34.906 36.552 1.00 33.35  ? 19   LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 19  ? 3.469   34.024 37.983 1.00 24.38  ? 19   LEU A CD2 1 
ATOM   152  N N   . LYS A 1 20  ? 2.906   29.864 35.343 1.00 17.74  ? 20   LYS A N   1 
ATOM   153  C CA  . LYS A 1 20  ? 2.766   28.878 34.285 1.00 19.25  ? 20   LYS A CA  1 
ATOM   154  C C   . LYS A 1 20  ? 1.616   29.254 33.377 1.00 17.86  ? 20   LYS A C   1 
ATOM   155  O O   . LYS A 1 20  ? 0.861   30.177 33.668 1.00 18.65  ? 20   LYS A O   1 
ATOM   156  C CB  . LYS A 1 20  ? 2.530   27.484 34.882 1.00 20.76  ? 20   LYS A CB  1 
ATOM   157  C CG  . LYS A 1 20  ? 3.734   26.954 35.661 1.00 27.95  ? 20   LYS A CG  1 
ATOM   158  C CD  . LYS A 1 20  ? 3.482   25.586 36.251 1.00 44.32  ? 20   LYS A CD  1 
ATOM   159  C CE  . LYS A 1 20  ? 4.723   25.080 36.976 1.00 34.08  ? 20   LYS A CE  1 
ATOM   160  N NZ  . LYS A 1 20  ? 5.899   24.992 36.061 1.00 47.28  ? 20   LYS A NZ  1 
ATOM   161  N N   . GLU A 1 21  ? 1.513   28.544 32.263 1.00 17.40  ? 21   GLU A N   1 
ATOM   162  C CA  . GLU A 1 21  ? 0.440   28.760 31.311 1.00 20.36  ? 21   GLU A CA  1 
ATOM   163  C C   . GLU A 1 21  ? -0.461  27.534 31.425 1.00 20.00  ? 21   GLU A C   1 
ATOM   164  O O   . GLU A 1 21  ? 0.021   26.430 31.653 1.00 22.58  ? 21   GLU A O   1 
ATOM   165  C CB  . GLU A 1 21  ? 1.001   28.882 29.892 1.00 23.45  ? 21   GLU A CB  1 
ATOM   166  C CG  . GLU A 1 21  ? 1.754   30.174 29.636 1.00 41.35  ? 21   GLU A CG  1 
ATOM   167  C CD  . GLU A 1 21  ? 1.104   31.015 28.550 1.00 52.70  ? 21   GLU A CD  1 
ATOM   168  O OE1 . GLU A 1 21  ? 1.102   30.577 27.381 1.00 49.30  ? 21   GLU A OE1 1 
ATOM   169  O OE2 . GLU A 1 21  ? 0.587   32.109 28.868 1.00 57.40  ? 21   GLU A OE2 1 
ATOM   170  N N   . ALA A 1 22  ? -1.763  27.731 31.285 1.00 19.24  ? 22   ALA A N   1 
ATOM   171  C CA  . ALA A 1 22  ? -2.700  26.623 31.386 1.00 20.13  ? 22   ALA A CA  1 
ATOM   172  C C   . ALA A 1 22  ? -3.875  26.829 30.445 1.00 21.23  ? 22   ALA A C   1 
ATOM   173  O O   . ALA A 1 22  ? -4.175  27.951 30.027 1.00 21.29  ? 22   ALA A O   1 
ATOM   174  C CB  . ALA A 1 22  ? -3.193  26.487 32.810 1.00 18.17  ? 22   ALA A CB  1 
ATOM   175  N N   . LEU A 1 23  ? -4.543  25.730 30.125 1.00 21.52  ? 23   LEU A N   1 
ATOM   176  C CA  . LEU A 1 23  ? -5.671  25.759 29.221 1.00 21.25  ? 23   LEU A CA  1 
ATOM   177  C C   . LEU A 1 23  ? -6.998  25.758 29.967 1.00 22.26  ? 23   LEU A C   1 
ATOM   178  O O   . LEU A 1 23  ? -7.234  24.900 30.820 1.00 23.76  ? 23   LEU A O   1 
ATOM   179  C CB  . LEU A 1 23  ? -5.586  24.544 28.286 1.00 27.40  ? 23   LEU A CB  1 
ATOM   180  C CG  . LEU A 1 23  ? -6.672  24.286 27.239 1.00 33.78  ? 23   LEU A CG  1 
ATOM   181  C CD1 . LEU A 1 23  ? -6.702  25.421 26.233 1.00 33.00  ? 23   LEU A CD1 1 
ATOM   182  C CD2 . LEU A 1 23  ? -6.387  22.964 26.532 1.00 29.46  ? 23   LEU A CD2 1 
ATOM   183  N N   . LEU A 1 24  ? -7.854  26.732 29.665 1.00 20.54  ? 24   LEU A N   1 
ATOM   184  C CA  . LEU A 1 24  ? -9.177  26.777 30.281 1.00 20.04  ? 24   LEU A CA  1 
ATOM   185  C C   . LEU A 1 24  ? -9.915  25.617 29.613 1.00 20.40  ? 24   LEU A C   1 
ATOM   186  O O   . LEU A 1 24  ? -10.200 25.645 28.409 1.00 19.53  ? 24   LEU A O   1 
ATOM   187  C CB  . LEU A 1 24  ? -9.860  28.110 29.986 1.00 21.59  ? 24   LEU A CB  1 
ATOM   188  C CG  . LEU A 1 24  ? -9.184  29.337 30.602 1.00 18.22  ? 24   LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 24  ? -9.942  30.582 30.180 1.00 21.23  ? 24   LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 24  ? -9.135  29.224 32.114 1.00 23.39  ? 24   LEU A CD2 1 
ATOM   191  N N   . ASP A 1 25  ? -10.219 24.599 30.410 1.00 19.70  ? 25   ASP A N   1 
ATOM   192  C CA  . ASP A 1 25  ? -10.839 23.381 29.913 1.00 18.86  ? 25   ASP A CA  1 
ATOM   193  C C   . ASP A 1 25  ? -12.222 23.061 30.480 1.00 17.70  ? 25   ASP A C   1 
ATOM   194  O O   . ASP A 1 25  ? -12.335 22.454 31.553 1.00 18.40  ? 25   ASP A O   1 
ATOM   195  C CB  . ASP A 1 25  ? -9.891  22.219 30.217 1.00 16.43  ? 25   ASP A CB  1 
ATOM   196  C CG  . ASP A 1 25  ? -10.200 20.986 29.409 1.00 19.58  ? 25   ASP A CG  1 
ATOM   197  O OD1 . ASP A 1 25  ? -11.362 20.818 28.988 1.00 22.78  ? 25   ASP A OD1 1 
ATOM   198  O OD2 . ASP A 1 25  ? -9.271  20.176 29.212 1.00 29.02  ? 25   ASP A OD2 1 
ATOM   199  N N   . THR A 1 26  ? -13.266 23.430 29.744 1.00 16.90  ? 26   THR A N   1 
ATOM   200  C CA  . THR A 1 26  ? -14.639 23.177 30.177 1.00 16.14  ? 26   THR A CA  1 
ATOM   201  C C   . THR A 1 26  ? -14.980 21.696 30.181 1.00 17.39  ? 26   THR A C   1 
ATOM   202  O O   . THR A 1 26  ? -15.938 21.279 30.831 1.00 18.71  ? 26   THR A O   1 
ATOM   203  C CB  . THR A 1 26  ? -15.668 23.904 29.276 1.00 15.55  ? 26   THR A CB  1 
ATOM   204  O OG1 . THR A 1 26  ? -15.479 23.514 27.906 1.00 16.16  ? 26   THR A OG1 1 
ATOM   205  C CG2 . THR A 1 26  ? -15.503 25.423 29.405 1.00 20.24  ? 26   THR A CG2 1 
ATOM   206  N N   . GLY A 1 27  ? -14.194 20.905 29.457 1.00 15.87  ? 27   GLY A N   1 
ATOM   207  C CA  . GLY A 1 27  ? -14.444 19.478 29.386 1.00 18.58  ? 27   GLY A CA  1 
ATOM   208  C C   . GLY A 1 27  ? -13.782 18.712 30.516 1.00 20.80  ? 27   GLY A C   1 
ATOM   209  O O   . GLY A 1 27  ? -13.938 17.500 30.624 1.00 24.06  ? 27   GLY A O   1 
ATOM   210  N N   . ALA A 1 28  ? -13.054 19.426 31.367 1.00 18.78  ? 28   ALA A N   1 
ATOM   211  C CA  . ALA A 1 28  ? -12.352 18.814 32.482 1.00 19.26  ? 28   ALA A CA  1 
ATOM   212  C C   . ALA A 1 28  ? -13.060 19.078 33.808 1.00 18.42  ? 28   ALA A C   1 
ATOM   213  O O   . ALA A 1 28  ? -13.328 20.227 34.160 1.00 18.09  ? 28   ALA A O   1 
ATOM   214  C CB  . ALA A 1 28  ? -10.917 19.349 32.539 1.00 17.61  ? 28   ALA A CB  1 
ATOM   215  N N   . ASP A 1 29  ? -13.371 18.009 34.538 1.00 19.45  ? 29   ASP A N   1 
ATOM   216  C CA  . ASP A 1 29  ? -14.025 18.158 35.831 1.00 18.21  ? 29   ASP A CA  1 
ATOM   217  C C   . ASP A 1 29  ? -13.028 18.766 36.806 1.00 20.36  ? 29   ASP A C   1 
ATOM   218  O O   . ASP A 1 29  ? -13.392 19.569 37.668 1.00 18.93  ? 29   ASP A O   1 
ATOM   219  C CB  . ASP A 1 29  ? -14.479 16.809 36.395 1.00 25.12  ? 29   ASP A CB  1 
ATOM   220  C CG  . ASP A 1 29  ? -15.495 16.119 35.514 1.00 26.31  ? 29   ASP A CG  1 
ATOM   221  O OD1 . ASP A 1 29  ? -16.266 16.824 34.832 1.00 26.86  ? 29   ASP A OD1 1 
ATOM   222  O OD2 . ASP A 1 29  ? -15.528 14.871 35.520 1.00 32.62  ? 29   ASP A OD2 1 
ATOM   223  N N   . ASP A 1 30  ? -11.767 18.371 36.672 1.00 17.33  ? 30   ASP A N   1 
ATOM   224  C CA  . ASP A 1 30  ? -10.749 18.888 37.566 1.00 22.99  ? 30   ASP A CA  1 
ATOM   225  C C   . ASP A 1 30  ? -9.589  19.561 36.875 1.00 21.84  ? 30   ASP A C   1 
ATOM   226  O O   . ASP A 1 30  ? -9.525  19.631 35.654 1.00 23.53  ? 30   ASP A O   1 
ATOM   227  C CB  . ASP A 1 30  ? -10.207 17.789 38.467 1.00 31.88  ? 30   ASP A CB  1 
ATOM   228  C CG  . ASP A 1 30  ? -11.237 16.729 38.771 1.00 41.88  ? 30   ASP A CG  1 
ATOM   229  O OD1 . ASP A 1 30  ? -12.169 16.986 39.568 1.00 57.41  ? 30   ASP A OD1 1 
ATOM   230  O OD2 . ASP A 1 30  ? -11.105 15.633 38.207 1.00 34.75  ? 30   ASP A OD2 1 
ATOM   231  N N   . THR A 1 31  ? -8.686  20.066 37.702 1.00 20.50  ? 31   THR A N   1 
ATOM   232  C CA  . THR A 1 31  ? -7.506  20.773 37.268 1.00 20.13  ? 31   THR A CA  1 
ATOM   233  C C   . THR A 1 31  ? -6.297  19.849 37.382 1.00 21.45  ? 31   THR A C   1 
ATOM   234  O O   . THR A 1 31  ? -6.049  19.255 38.431 1.00 22.49  ? 31   THR A O   1 
ATOM   235  C CB  . THR A 1 31  ? -7.323  22.029 38.142 1.00 21.55  ? 31   THR A CB  1 
ATOM   236  O OG1 . THR A 1 31  ? -8.444  22.901 37.939 1.00 16.95  ? 31   THR A OG1 1 
ATOM   237  C CG2 . THR A 1 31  ? -6.034  22.755 37.804 1.00 17.98  ? 31   THR A CG2 1 
ATOM   238  N N   . VAL A 1 32  ? -5.566  19.704 36.285 1.00 21.73  ? 32   VAL A N   1 
ATOM   239  C CA  . VAL A 1 32  ? -4.389  18.845 36.277 1.00 23.31  ? 32   VAL A CA  1 
ATOM   240  C C   . VAL A 1 32  ? -3.210  19.603 35.702 1.00 22.27  ? 32   VAL A C   1 
ATOM   241  O O   . VAL A 1 32  ? -3.279  20.149 34.600 1.00 22.14  ? 32   VAL A O   1 
ATOM   242  C CB  . VAL A 1 32  ? -4.616  17.557 35.441 1.00 21.65  ? 32   VAL A CB  1 
ATOM   243  C CG1 . VAL A 1 32  ? -3.310  16.794 35.297 1.00 22.77  ? 32   VAL A CG1 1 
ATOM   244  C CG2 . VAL A 1 32  ? -5.636  16.677 36.125 1.00 30.99  ? 32   VAL A CG2 1 
ATOM   245  N N   . LEU A 1 33  ? -2.126  19.635 36.462 1.00 23.02  ? 33   LEU A N   1 
ATOM   246  C CA  . LEU A 1 33  ? -0.932  20.337 36.029 1.00 23.34  ? 33   LEU A CA  1 
ATOM   247  C C   . LEU A 1 33  ? 0.226   19.381 35.826 1.00 23.28  ? 33   LEU A C   1 
ATOM   248  O O   . LEU A 1 33  ? 0.302   18.334 36.472 1.00 23.30  ? 33   LEU A O   1 
ATOM   249  C CB  . LEU A 1 33  ? -0.542  21.389 37.068 1.00 25.15  ? 33   LEU A CB  1 
ATOM   250  C CG  . LEU A 1 33  ? -1.617  22.407 37.455 1.00 31.08  ? 33   LEU A CG  1 
ATOM   251  C CD1 . LEU A 1 33  ? -1.051  23.351 38.500 1.00 31.92  ? 33   LEU A CD1 1 
ATOM   252  C CD2 . LEU A 1 33  ? -2.081  23.175 36.225 1.00 27.28  ? 33   LEU A CD2 1 
ATOM   253  N N   . GLU A 1 34  ? 1.120   19.750 34.918 1.00 21.62  ? 34   GLU A N   1 
ATOM   254  C CA  . GLU A 1 34  ? 2.305   18.957 34.636 1.00 26.91  ? 34   GLU A CA  1 
ATOM   255  C C   . GLU A 1 34  ? 3.110   18.896 35.924 1.00 27.92  ? 34   GLU A C   1 
ATOM   256  O O   . GLU A 1 34  ? 2.836   19.640 36.871 1.00 28.02  ? 34   GLU A O   1 
ATOM   257  C CB  . GLU A 1 34  ? 3.133   19.631 33.545 1.00 27.98  ? 34   GLU A CB  1 
ATOM   258  C CG  . GLU A 1 34  ? 3.608   21.026 33.929 1.00 47.96  ? 34   GLU A CG  1 
ATOM   259  C CD  . GLU A 1 34  ? 4.415   21.696 32.833 1.00 62.19  ? 34   GLU A CD  1 
ATOM   260  O OE1 . GLU A 1 34  ? 4.885   22.834 33.053 1.00 68.34  ? 34   GLU A OE1 1 
ATOM   261  O OE2 . GLU A 1 34  ? 4.578   21.086 31.754 1.00 69.17  ? 34   GLU A OE2 1 
ATOM   262  N N   . GLU A 1 35  ? 4.106   18.018 35.966 1.00 30.08  ? 35   GLU A N   1 
ATOM   263  C CA  . GLU A 1 35  ? 4.925   17.885 37.162 1.00 29.82  ? 35   GLU A CA  1 
ATOM   264  C C   . GLU A 1 35  ? 5.504   19.230 37.586 1.00 29.31  ? 35   GLU A C   1 
ATOM   265  O O   . GLU A 1 35  ? 5.999   19.994 36.762 1.00 29.04  ? 35   GLU A O   1 
ATOM   266  C CB  . GLU A 1 35  ? 6.062   16.886 36.931 1.00 36.15  ? 35   GLU A CB  1 
ATOM   267  C CG  . GLU A 1 35  ? 6.769   16.490 38.215 1.00 40.38  ? 35   GLU A CG  1 
ATOM   268  C CD  . GLU A 1 35  ? 5.792   15.989 39.260 1.00 53.72  ? 35   GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 35  ? 5.078   15.004 38.976 1.00 59.13  ? 35   GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 35  ? 5.729   16.581 40.358 1.00 48.62  ? 35   GLU A OE2 1 
ATOM   271  N N   . MET A 1 36  ? 5.424   19.516 38.879 1.00 30.71  ? 36   MET A N   1 
ATOM   272  C CA  . MET A 1 36  ? 5.941   20.763 39.420 1.00 31.07  ? 36   MET A CA  1 
ATOM   273  C C   . MET A 1 36  ? 6.087   20.622 40.924 1.00 31.81  ? 36   MET A C   1 
ATOM   274  O O   . MET A 1 36  ? 5.542   19.696 41.523 1.00 29.76  ? 36   MET A O   1 
ATOM   275  C CB  . MET A 1 36  ? 4.988   21.918 39.119 1.00 27.89  ? 36   MET A CB  1 
ATOM   276  C CG  . MET A 1 36  ? 3.697   21.855 39.913 1.00 36.45  ? 36   MET A CG  1 
ATOM   277  S SD  . MET A 1 36  ? 2.667   23.288 39.632 1.00 37.42  ? 36   MET A SD  1 
ATOM   278  C CE  . MET A 1 36  ? 3.499   24.523 40.661 1.00 30.42  ? 36   MET A CE  1 
ATOM   279  N N   . SER A 1 37  ? 6.814   21.562 41.520 1.00 33.60  ? 37   SER A N   1 
ATOM   280  C CA  . SER A 1 37  ? 7.062   21.583 42.952 1.00 34.58  ? 37   SER A CA  1 
ATOM   281  C C   . SER A 1 37  ? 5.955   22.295 43.726 1.00 35.83  ? 37   SER A C   1 
ATOM   282  O O   . SER A 1 37  ? 5.744   23.493 43.554 1.00 37.39  ? 37   SER A O   1 
ATOM   283  C CB  . SER A 1 37  ? 8.405   22.273 43.223 1.00 39.67  ? 37   SER A CB  1 
ATOM   284  O OG  . SER A 1 37  ? 8.546   22.627 44.589 1.00 48.09  ? 37   SER A OG  1 
ATOM   285  N N   . LEU A 1 38  ? 5.250   21.548 44.572 1.00 37.27  ? 38   LEU A N   1 
ATOM   286  C CA  . LEU A 1 38  ? 4.184   22.104 45.399 1.00 39.31  ? 38   LEU A CA  1 
ATOM   287  C C   . LEU A 1 38  ? 4.406   21.692 46.853 1.00 42.16  ? 38   LEU A C   1 
ATOM   288  O O   . LEU A 1 38  ? 4.792   20.554 47.137 1.00 43.45  ? 38   LEU A O   1 
ATOM   289  C CB  . LEU A 1 38  ? 2.807   21.616 44.931 1.00 38.58  ? 38   LEU A CB  1 
ATOM   290  C CG  . LEU A 1 38  ? 2.234   22.208 43.638 1.00 34.73  ? 38   LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 38  ? 0.838   21.649 43.400 1.00 33.91  ? 38   LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 38  ? 2.188   23.724 43.737 1.00 28.10  ? 38   LEU A CD2 1 
ATOM   293  N N   . PRO A 1 39  ? 4.175   22.620 47.793 1.00 42.96  ? 39   PRO A N   1 
ATOM   294  C CA  . PRO A 1 39  ? 4.349   22.361 49.226 1.00 43.77  ? 39   PRO A CA  1 
ATOM   295  C C   . PRO A 1 39  ? 3.223   21.521 49.821 1.00 44.41  ? 39   PRO A C   1 
ATOM   296  O O   . PRO A 1 39  ? 2.148   21.405 49.236 1.00 43.48  ? 39   PRO A O   1 
ATOM   297  C CB  . PRO A 1 39  ? 4.444   23.767 49.820 1.00 45.70  ? 39   PRO A CB  1 
ATOM   298  C CG  . PRO A 1 39  ? 3.638   24.617 48.899 1.00 49.37  ? 39   PRO A CG  1 
ATOM   299  C CD  . PRO A 1 39  ? 3.725   23.966 47.547 1.00 43.18  ? 39   PRO A CD  1 
ATOM   300  N N   . GLY A 1 40  ? 3.484   20.943 50.989 1.00 45.49  ? 40   GLY A N   1 
ATOM   301  C CA  . GLY A 1 40  ? 2.481   20.148 51.674 1.00 46.65  ? 40   GLY A CA  1 
ATOM   302  C C   . GLY A 1 40  ? 2.325   18.713 51.211 1.00 47.81  ? 40   GLY A C   1 
ATOM   303  O O   . GLY A 1 40  ? 3.055   18.236 50.336 1.00 47.75  ? 40   GLY A O   1 
ATOM   304  N N   . ARG A 1 41  ? 1.365   18.018 51.815 1.00 46.60  ? 41   ARG A N   1 
ATOM   305  C CA  . ARG A 1 41  ? 1.103   16.631 51.465 1.00 46.94  ? 41   ARG A CA  1 
ATOM   306  C C   . ARG A 1 41  ? 0.079   16.521 50.343 1.00 44.86  ? 41   ARG A C   1 
ATOM   307  O O   . ARG A 1 41  ? -0.655  17.463 50.049 1.00 42.68  ? 41   ARG A O   1 
ATOM   308  C CB  . ARG A 1 41  ? 0.598   15.844 52.679 1.00 51.43  ? 41   ARG A CB  1 
ATOM   309  C CG  . ARG A 1 41  ? 0.235   14.402 52.332 1.00 65.23  ? 41   ARG A CG  1 
ATOM   310  C CD  . ARG A 1 41  ? -0.372  13.632 53.490 1.00 76.88  ? 41   ARG A CD  1 
ATOM   311  N NE  . ARG A 1 41  ? -0.919  12.353 53.041 1.00 78.26  ? 41   ARG A NE  1 
ATOM   312  C CZ  . ARG A 1 41  ? -0.217  11.415 52.411 1.00 81.68  ? 41   ARG A CZ  1 
ATOM   313  N NH1 . ARG A 1 41  ? 1.070   11.602 52.150 1.00 80.57  ? 41   ARG A NH1 1 
ATOM   314  N NH2 . ARG A 1 41  ? -0.806  10.287 52.035 1.00 83.84  ? 41   ARG A NH2 1 
ATOM   315  N N   . TRP A 1 42  ? 0.045   15.350 49.724 1.00 44.41  ? 42   TRP A N   1 
ATOM   316  C CA  . TRP A 1 42  ? -0.867  15.059 48.635 1.00 44.80  ? 42   TRP A CA  1 
ATOM   317  C C   . TRP A 1 42  ? -1.382  13.644 48.840 1.00 45.76  ? 42   TRP A C   1 
ATOM   318  O O   . TRP A 1 42  ? -0.979  12.959 49.781 1.00 47.11  ? 42   TRP A O   1 
ATOM   319  C CB  . TRP A 1 42  ? -0.130  15.146 47.304 1.00 44.38  ? 42   TRP A CB  1 
ATOM   320  C CG  . TRP A 1 42  ? 1.213   14.497 47.353 1.00 45.90  ? 42   TRP A CG  1 
ATOM   321  C CD1 . TRP A 1 42  ? 2.355   15.020 47.889 1.00 46.41  ? 42   TRP A CD1 1 
ATOM   322  C CD2 . TRP A 1 42  ? 1.551   13.185 46.889 1.00 46.98  ? 42   TRP A CD2 1 
ATOM   323  N NE1 . TRP A 1 42  ? 3.382   14.117 47.787 1.00 49.32  ? 42   TRP A NE1 1 
ATOM   324  C CE2 . TRP A 1 42  ? 2.918   12.983 47.180 1.00 49.37  ? 42   TRP A CE2 1 
ATOM   325  C CE3 . TRP A 1 42  ? 0.831   12.162 46.260 1.00 48.37  ? 42   TRP A CE3 1 
ATOM   326  C CZ2 . TRP A 1 42  ? 3.583   11.793 46.858 1.00 43.62  ? 42   TRP A CZ2 1 
ATOM   327  C CZ3 . TRP A 1 42  ? 1.493   10.979 45.939 1.00 44.49  ? 42   TRP A CZ3 1 
ATOM   328  C CH2 . TRP A 1 42  ? 2.856   10.807 46.241 1.00 49.74  ? 42   TRP A CH2 1 
ATOM   329  N N   . LYS A 1 43  ? -2.271  13.209 47.957 1.00 46.01  ? 43   LYS A N   1 
ATOM   330  C CA  . LYS A 1 43  ? -2.837  11.871 48.041 1.00 45.51  ? 43   LYS A CA  1 
ATOM   331  C C   . LYS A 1 43  ? -2.771  11.227 46.665 1.00 45.25  ? 43   LYS A C   1 
ATOM   332  O O   . LYS A 1 43  ? -3.071  11.869 45.659 1.00 44.41  ? 43   LYS A O   1 
ATOM   333  C CB  . LYS A 1 43  ? -4.261  11.926 48.596 1.00 46.45  ? 43   LYS A CB  1 
ATOM   334  C CG  . LYS A 1 43  ? -4.361  12.526 49.988 1.00 58.68  ? 43   LYS A CG  1 
ATOM   335  C CD  . LYS A 1 43  ? -5.748  12.329 50.575 1.00 59.06  ? 43   LYS A CD  1 
ATOM   336  C CE  . LYS A 1 43  ? -5.849  12.929 51.967 1.00 69.11  ? 43   LYS A CE  1 
ATOM   337  N NZ  . LYS A 1 43  ? -7.203  12.743 52.554 1.00 76.47  ? 43   LYS A NZ  1 
ATOM   338  N N   . PRO A 1 44  ? -2.344  9.957  46.599 1.00 45.53  ? 44   PRO A N   1 
ATOM   339  C CA  . PRO A 1 44  ? -2.255  9.261  45.313 1.00 44.15  ? 44   PRO A CA  1 
ATOM   340  C C   . PRO A 1 44  ? -3.638  9.174  44.679 1.00 42.63  ? 44   PRO A C   1 
ATOM   341  O O   . PRO A 1 44  ? -4.634  8.973  45.373 1.00 43.56  ? 44   PRO A O   1 
ATOM   342  C CB  . PRO A 1 44  ? -1.710  7.891  45.705 1.00 47.88  ? 44   PRO A CB  1 
ATOM   343  C CG  . PRO A 1 44  ? -0.860  8.201  46.891 1.00 45.66  ? 44   PRO A CG  1 
ATOM   344  C CD  . PRO A 1 44  ? -1.741  9.145  47.671 1.00 46.63  ? 44   PRO A CD  1 
ATOM   345  N N   . LYS A 1 45  ? -3.706  9.337  43.365 1.00 41.84  ? 45   LYS A N   1 
ATOM   346  C CA  . LYS A 1 45  ? -4.989  9.270  42.686 1.00 40.14  ? 45   LYS A CA  1 
ATOM   347  C C   . LYS A 1 45  ? -4.823  8.984  41.201 1.00 38.79  ? 45   LYS A C   1 
ATOM   348  O O   . LYS A 1 45  ? -3.790  9.288  40.603 1.00 38.04  ? 45   LYS A O   1 
ATOM   349  C CB  . LYS A 1 45  ? -5.752  10.584 42.885 1.00 42.95  ? 45   LYS A CB  1 
ATOM   350  C CG  . LYS A 1 45  ? -7.182  10.567 42.365 1.00 52.01  ? 45   LYS A CG  1 
ATOM   351  C CD  . LYS A 1 45  ? -7.879  11.898 42.617 1.00 56.28  ? 45   LYS A CD  1 
ATOM   352  C CE  . LYS A 1 45  ? -9.300  11.896 42.076 1.00 53.82  ? 45   LYS A CE  1 
ATOM   353  N NZ  . LYS A 1 45  ? -9.967  13.213 42.268 1.00 55.49  ? 45   LYS A NZ  1 
ATOM   354  N N   . MET A 1 46  ? -5.846  8.381  40.612 1.00 37.30  ? 46   MET A N   1 
ATOM   355  C CA  . MET A 1 46  ? -5.825  8.064  39.198 1.00 35.93  ? 46   MET A CA  1 
ATOM   356  C C   . MET A 1 46  ? -6.995  8.761  38.530 1.00 33.79  ? 46   MET A C   1 
ATOM   357  O O   . MET A 1 46  ? -8.126  8.685  39.004 1.00 36.23  ? 46   MET A O   1 
ATOM   358  C CB  . MET A 1 46  ? -5.939  6.558  38.982 1.00 38.57  ? 46   MET A CB  1 
ATOM   359  C CG  . MET A 1 46  ? -4.760  5.768  39.508 1.00 45.95  ? 46   MET A CG  1 
ATOM   360  S SD  . MET A 1 46  ? -5.073  4.008  39.409 1.00 59.87  ? 46   MET A SD  1 
ATOM   361  C CE  . MET A 1 46  ? -4.875  3.745  37.663 1.00 47.37  ? 46   MET A CE  1 
ATOM   362  N N   . ILE A 1 47  ? -6.717  9.457  37.437 1.00 31.56  ? 47   ILE A N   1 
ATOM   363  C CA  . ILE A 1 47  ? -7.764  10.146 36.707 1.00 28.14  ? 47   ILE A CA  1 
ATOM   364  C C   . ILE A 1 47  ? -7.785  9.600  35.292 1.00 28.86  ? 47   ILE A C   1 
ATOM   365  O O   . ILE A 1 47  ? -6.761  9.146  34.777 1.00 28.74  ? 47   ILE A O   1 
ATOM   366  C CB  . ILE A 1 47  ? -7.522  11.672 36.675 1.00 29.09  ? 47   ILE A CB  1 
ATOM   367  C CG1 . ILE A 1 47  ? -6.216  11.992 35.950 1.00 28.93  ? 47   ILE A CG1 1 
ATOM   368  C CG2 . ILE A 1 47  ? -7.461  12.211 38.095 1.00 31.40  ? 47   ILE A CG2 1 
ATOM   369  C CD1 . ILE A 1 47  ? -5.961  13.470 35.807 1.00 30.43  ? 47   ILE A CD1 1 
ATOM   370  N N   . GLY A 1 48  ? -8.956  9.635  34.668 1.00 28.75  ? 48   GLY A N   1 
ATOM   371  C CA  . GLY A 1 48  ? -9.075  9.135  33.315 1.00 30.61  ? 48   GLY A CA  1 
ATOM   372  C C   . GLY A 1 48  ? -9.211  10.243 32.287 1.00 29.90  ? 48   GLY A C   1 
ATOM   373  O O   . GLY A 1 48  ? -9.380  11.414 32.627 1.00 30.66  ? 48   GLY A O   1 
ATOM   374  N N   . GLY A 1 49  ? -9.132  9.855  31.022 1.00 30.31  ? 49   GLY A N   1 
ATOM   375  C CA  . GLY A 1 49  ? -9.253  10.789 29.922 1.00 30.81  ? 49   GLY A CA  1 
ATOM   376  C C   . GLY A 1 49  ? -9.009  9.999  28.657 1.00 32.13  ? 49   GLY A C   1 
ATOM   377  O O   . GLY A 1 49  ? -8.900  8.771  28.712 1.00 30.53  ? 49   GLY A O   1 
ATOM   378  N N   . ILE A 1 50  ? -8.936  10.679 27.518 1.00 32.92  ? 50   ILE A N   1 
ATOM   379  C CA  . ILE A 1 50  ? -8.669  9.988  26.267 1.00 34.44  ? 50   ILE A CA  1 
ATOM   380  C C   . ILE A 1 50  ? -7.246  9.443  26.368 1.00 34.84  ? 50   ILE A C   1 
ATOM   381  O O   . ILE A 1 50  ? -6.351  10.107 26.901 1.00 35.93  ? 50   ILE A O   1 
ATOM   382  C CB  . ILE A 1 50  ? -8.781  10.945 25.051 1.00 37.22  ? 50   ILE A CB  1 
ATOM   383  C CG1 . ILE A 1 50  ? -10.247 11.310 24.814 1.00 38.04  ? 50   ILE A CG1 1 
ATOM   384  C CG2 . ILE A 1 50  ? -8.207  10.284 23.804 1.00 39.10  ? 50   ILE A CG2 1 
ATOM   385  C CD1 . ILE A 1 50  ? -10.488 12.142 23.567 1.00 40.79  ? 50   ILE A CD1 1 
ATOM   386  N N   . GLY A 1 51  ? -7.040  8.233  25.867 1.00 33.41  ? 51   GLY A N   1 
ATOM   387  C CA  . GLY A 1 51  ? -5.723  7.636  25.940 1.00 31.06  ? 51   GLY A CA  1 
ATOM   388  C C   . GLY A 1 51  ? -5.666  6.686  27.119 1.00 30.96  ? 51   GLY A C   1 
ATOM   389  O O   . GLY A 1 51  ? -4.915  5.711  27.107 1.00 31.45  ? 51   GLY A O   1 
ATOM   390  N N   . GLY A 1 52  ? -6.465  6.967  28.144 1.00 28.73  ? 52   GLY A N   1 
ATOM   391  C CA  . GLY A 1 52  ? -6.486  6.103  29.308 1.00 27.79  ? 52   GLY A CA  1 
ATOM   392  C C   . GLY A 1 52  ? -6.466  6.822  30.644 1.00 28.04  ? 52   GLY A C   1 
ATOM   393  O O   . GLY A 1 52  ? -7.182  7.803  30.859 1.00 28.91  ? 52   GLY A O   1 
ATOM   394  N N   . PHE A 1 53  ? -5.628  6.338  31.549 1.00 26.87  ? 53   PHE A N   1 
ATOM   395  C CA  . PHE A 1 53  ? -5.539  6.921  32.880 1.00 28.54  ? 53   PHE A CA  1 
ATOM   396  C C   . PHE A 1 53  ? -4.104  7.268  33.240 1.00 28.62  ? 53   PHE A C   1 
ATOM   397  O O   . PHE A 1 53  ? -3.165  6.717  32.673 1.00 29.11  ? 53   PHE A O   1 
ATOM   398  C CB  . PHE A 1 53  ? -6.076  5.919  33.904 1.00 26.62  ? 53   PHE A CB  1 
ATOM   399  C CG  . PHE A 1 53  ? -5.278  4.647  33.975 1.00 41.42  ? 53   PHE A CG  1 
ATOM   400  C CD1 . PHE A 1 53  ? -4.045  4.614  34.623 1.00 53.92  ? 53   PHE A CD1 1 
ATOM   401  C CD2 . PHE A 1 53  ? -5.751  3.480  33.384 1.00 48.80  ? 53   PHE A CD2 1 
ATOM   402  C CE1 . PHE A 1 53  ? -3.296  3.436  34.680 1.00 60.93  ? 53   PHE A CE1 1 
ATOM   403  C CE2 . PHE A 1 53  ? -5.011  2.298  33.435 1.00 57.40  ? 53   PHE A CE2 1 
ATOM   404  C CZ  . PHE A 1 53  ? -3.783  2.275  34.085 1.00 57.06  ? 53   PHE A CZ  1 
ATOM   405  N N   . ILE A 1 54  ? -3.944  8.186  34.185 1.00 28.91  ? 54   ILE A N   1 
ATOM   406  C CA  . ILE A 1 54  ? -2.617  8.553  34.659 1.00 30.28  ? 54   ILE A CA  1 
ATOM   407  C C   . ILE A 1 54  ? -2.676  8.731  36.165 1.00 30.35  ? 54   ILE A C   1 
ATOM   408  O O   . ILE A 1 54  ? -3.700  9.141  36.714 1.00 28.62  ? 54   ILE A O   1 
ATOM   409  C CB  . ILE A 1 54  ? -2.091  9.875  34.041 1.00 29.21  ? 54   ILE A CB  1 
ATOM   410  C CG1 . ILE A 1 54  ? -2.997  11.042 34.437 1.00 30.18  ? 54   ILE A CG1 1 
ATOM   411  C CG2 . ILE A 1 54  ? -1.969  9.735  32.531 1.00 28.01  ? 54   ILE A CG2 1 
ATOM   412  C CD1 . ILE A 1 54  ? -2.379  12.401 34.159 1.00 21.39  ? 54   ILE A CD1 1 
ATOM   413  N N   . LYS A 1 55  ? -1.578  8.406  36.836 1.00 31.67  ? 55   LYS A N   1 
ATOM   414  C CA  . LYS A 1 55  ? -1.518  8.566  38.276 1.00 32.15  ? 55   LYS A CA  1 
ATOM   415  C C   . LYS A 1 55  ? -1.108  10.003 38.554 1.00 30.76  ? 55   LYS A C   1 
ATOM   416  O O   . LYS A 1 55  ? -0.244  10.554 37.873 1.00 31.02  ? 55   LYS A O   1 
ATOM   417  C CB  . LYS A 1 55  ? -0.497  7.601  38.883 1.00 37.05  ? 55   LYS A CB  1 
ATOM   418  C CG  . LYS A 1 55  ? -0.952  6.151  38.897 1.00 50.02  ? 55   LYS A CG  1 
ATOM   419  C CD  . LYS A 1 55  ? -0.969  5.586  40.316 1.00 62.18  ? 55   LYS A CD  1 
ATOM   420  C CE  . LYS A 1 55  ? -1.900  6.379  41.228 1.00 67.94  ? 55   LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 55  ? -1.974  5.805  42.602 1.00 68.38  ? 55   LYS A NZ  1 
ATOM   422  N N   . VAL A 1 56  ? -1.740  10.614 39.545 1.00 31.13  ? 56   VAL A N   1 
ATOM   423  C CA  . VAL A 1 56  ? -1.423  11.988 39.898 1.00 31.12  ? 56   VAL A CA  1 
ATOM   424  C C   . VAL A 1 56  ? -1.351  12.141 41.402 1.00 31.31  ? 56   VAL A C   1 
ATOM   425  O O   . VAL A 1 56  ? -1.762  11.252 42.147 1.00 32.28  ? 56   VAL A O   1 
ATOM   426  C CB  . VAL A 1 56  ? -2.490  12.976 39.374 1.00 25.15  ? 56   VAL A CB  1 
ATOM   427  C CG1 . VAL A 1 56  ? -2.594  12.883 37.861 1.00 23.95  ? 56   VAL A CG1 1 
ATOM   428  C CG2 . VAL A 1 56  ? -3.831  12.685 40.034 1.00 25.19  ? 56   VAL A CG2 1 
ATOM   429  N N   . ARG A 1 57  ? -0.811  13.272 41.840 1.00 31.54  ? 57   ARG A N   1 
ATOM   430  C CA  . ARG A 1 57  ? -0.718  13.576 43.257 1.00 30.66  ? 57   ARG A CA  1 
ATOM   431  C C   . ARG A 1 57  ? -1.807  14.609 43.487 1.00 29.17  ? 57   ARG A C   1 
ATOM   432  O O   . ARG A 1 57  ? -1.865  15.618 42.787 1.00 30.44  ? 57   ARG A O   1 
ATOM   433  C CB  . ARG A 1 57  ? 0.656   14.162 43.593 1.00 31.28  ? 57   ARG A CB  1 
ATOM   434  C CG  . ARG A 1 57  ? 1.825   13.279 43.177 1.00 36.23  ? 57   ARG A CG  1 
ATOM   435  C CD  . ARG A 1 57  ? 3.085   13.641 43.948 1.00 39.26  ? 57   ARG A CD  1 
ATOM   436  N NE  . ARG A 1 57  ? 3.482   15.034 43.764 1.00 39.01  ? 57   ARG A NE  1 
ATOM   437  C CZ  . ARG A 1 57  ? 4.069   15.503 42.670 1.00 43.69  ? 57   ARG A CZ  1 
ATOM   438  N NH1 . ARG A 1 57  ? 4.332   14.687 41.657 1.00 45.28  ? 57   ARG A NH1 1 
ATOM   439  N NH2 . ARG A 1 57  ? 4.393   16.787 42.588 1.00 47.25  ? 57   ARG A NH2 1 
ATOM   440  N N   . GLN A 1 58  ? -2.679  14.362 44.456 1.00 29.59  ? 58   GLN A N   1 
ATOM   441  C CA  . GLN A 1 58  ? -3.767  15.288 44.720 1.00 29.91  ? 58   GLN A CA  1 
ATOM   442  C C   . GLN A 1 58  ? -3.499  16.287 45.834 1.00 30.76  ? 58   GLN A C   1 
ATOM   443  O O   . GLN A 1 58  ? -3.410  15.917 47.004 1.00 31.52  ? 58   GLN A O   1 
ATOM   444  C CB  . GLN A 1 58  ? -5.043  14.527 45.050 1.00 25.14  ? 58   GLN A CB  1 
ATOM   445  C CG  . GLN A 1 58  ? -6.252  15.434 45.224 1.00 32.00  ? 58   GLN A CG  1 
ATOM   446  C CD  . GLN A 1 58  ? -7.487  14.688 45.674 1.00 39.90  ? 58   GLN A CD  1 
ATOM   447  O OE1 . GLN A 1 58  ? -7.851  13.666 45.096 1.00 40.26  ? 58   GLN A OE1 1 
ATOM   448  N NE2 . GLN A 1 58  ? -8.147  15.204 46.703 1.00 41.02  ? 58   GLN A NE2 1 
ATOM   449  N N   . TYR A 1 59  ? -3.383  17.559 45.465 1.00 30.61  ? 59   TYR A N   1 
ATOM   450  C CA  . TYR A 1 59  ? -3.163  18.617 46.441 1.00 29.23  ? 59   TYR A CA  1 
ATOM   451  C C   . TYR A 1 59  ? -4.472  19.359 46.657 1.00 29.67  ? 59   TYR A C   1 
ATOM   452  O O   . TYR A 1 59  ? -5.066  19.880 45.710 1.00 30.43  ? 59   TYR A O   1 
ATOM   453  C CB  . TYR A 1 59  ? -2.092  19.596 45.955 1.00 26.23  ? 59   TYR A CB  1 
ATOM   454  C CG  . TYR A 1 59  ? -0.710  19.009 45.871 1.00 30.40  ? 59   TYR A CG  1 
ATOM   455  C CD1 . TYR A 1 59  ? -0.344  18.182 44.812 1.00 22.59  ? 59   TYR A CD1 1 
ATOM   456  C CD2 . TYR A 1 59  ? 0.235   19.269 46.863 1.00 37.45  ? 59   TYR A CD2 1 
ATOM   457  C CE1 . TYR A 1 59  ? 0.934   17.629 44.740 1.00 30.04  ? 59   TYR A CE1 1 
ATOM   458  C CE2 . TYR A 1 59  ? 1.512   18.721 46.803 1.00 27.39  ? 59   TYR A CE2 1 
ATOM   459  C CZ  . TYR A 1 59  ? 1.856   17.904 45.741 1.00 37.74  ? 59   TYR A CZ  1 
ATOM   460  O OH  . TYR A 1 59  ? 3.123   17.369 45.680 1.00 37.64  ? 59   TYR A OH  1 
ATOM   461  N N   . ASP A 1 60  ? -4.927  19.406 47.902 1.00 29.64  ? 60   ASP A N   1 
ATOM   462  C CA  . ASP A 1 60  ? -6.172  20.090 48.216 1.00 29.19  ? 60   ASP A CA  1 
ATOM   463  C C   . ASP A 1 60  ? -5.906  21.441 48.857 1.00 30.16  ? 60   ASP A C   1 
ATOM   464  O O   . ASP A 1 60  ? -4.826  21.680 49.405 1.00 31.30  ? 60   ASP A O   1 
ATOM   465  C CB  . ASP A 1 60  ? -7.023  19.240 49.159 1.00 36.36  ? 60   ASP A CB  1 
ATOM   466  C CG  . ASP A 1 60  ? -7.345  17.877 48.583 1.00 41.83  ? 60   ASP A CG  1 
ATOM   467  O OD1 . ASP A 1 60  ? -7.960  17.823 47.500 1.00 38.60  ? 60   ASP A OD1 1 
ATOM   468  O OD2 . ASP A 1 60  ? -6.982  16.860 49.213 1.00 47.16  ? 60   ASP A OD2 1 
ATOM   469  N N   . GLN A 1 61  ? -6.897  22.323 48.783 1.00 29.30  ? 61   GLN A N   1 
ATOM   470  C CA  . GLN A 1 61  ? -6.784  23.649 49.364 1.00 29.42  ? 61   GLN A CA  1 
ATOM   471  C C   . GLN A 1 61  ? -5.595  24.433 48.834 1.00 29.92  ? 61   GLN A C   1 
ATOM   472  O O   . GLN A 1 61  ? -4.935  25.159 49.580 1.00 28.64  ? 61   GLN A O   1 
ATOM   473  C CB  . GLN A 1 61  ? -6.685  23.545 50.888 1.00 35.03  ? 61   GLN A CB  1 
ATOM   474  C CG  . GLN A 1 61  ? -8.021  23.523 51.600 1.00 50.63  ? 61   GLN A CG  1 
ATOM   475  C CD  . GLN A 1 61  ? -8.846  24.761 51.304 1.00 59.17  ? 61   GLN A CD  1 
ATOM   476  O OE1 . GLN A 1 61  ? -9.499  24.852 50.263 1.00 65.49  ? 61   GLN A OE1 1 
ATOM   477  N NE2 . GLN A 1 61  ? -8.805  25.732 52.212 1.00 55.47  ? 61   GLN A NE2 1 
ATOM   478  N N   . ILE A 1 62  ? -5.310  24.299 47.547 1.00 28.38  ? 62   ILE A N   1 
ATOM   479  C CA  . ILE A 1 62  ? -4.184  25.031 46.996 1.00 26.68  ? 62   ILE A CA  1 
ATOM   480  C C   . ILE A 1 62  ? -4.639  26.355 46.402 1.00 25.04  ? 62   ILE A C   1 
ATOM   481  O O   . ILE A 1 62  ? -5.624  26.415 45.669 1.00 24.35  ? 62   ILE A O   1 
ATOM   482  C CB  . ILE A 1 62  ? -3.443  24.209 45.925 1.00 33.19  ? 62   ILE A CB  1 
ATOM   483  C CG1 . ILE A 1 62  ? -2.224  24.983 45.429 1.00 33.37  ? 62   ILE A CG1 1 
ATOM   484  C CG2 . ILE A 1 62  ? -4.359  23.902 44.775 1.00 37.35  ? 62   ILE A CG2 1 
ATOM   485  C CD1 . ILE A 1 62  ? -1.267  24.134 44.637 1.00 41.31  ? 62   ILE A CD1 1 
ATOM   486  N N   . LEU A 1 63  ? -3.922  27.421 46.743 1.00 24.65  ? 63   LEU A N   1 
ATOM   487  C CA  . LEU A 1 63  ? -4.243  28.741 46.232 1.00 22.84  ? 63   LEU A CA  1 
ATOM   488  C C   . LEU A 1 63  ? -3.691  28.863 44.828 1.00 22.98  ? 63   LEU A C   1 
ATOM   489  O O   . LEU A 1 63  ? -2.524  28.575 44.582 1.00 22.71  ? 63   LEU A O   1 
ATOM   490  C CB  . LEU A 1 63  ? -3.620  29.831 47.111 1.00 22.52  ? 63   LEU A CB  1 
ATOM   491  C CG  . LEU A 1 63  ? -3.742  31.251 46.557 1.00 26.17  ? 63   LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 63  ? -5.214  31.575 46.279 1.00 25.55  ? 63   LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 63  ? -3.143  32.237 47.549 1.00 30.42  ? 63   LEU A CD2 1 
ATOM   494  N N   . ILE A 1 64  ? -4.534  29.301 43.907 1.00 21.38  ? 64   ILE A N   1 
ATOM   495  C CA  . ILE A 1 64  ? -4.108  29.464 42.537 1.00 22.39  ? 64   ILE A CA  1 
ATOM   496  C C   . ILE A 1 64  ? -4.655  30.779 42.003 1.00 22.24  ? 64   ILE A C   1 
ATOM   497  O O   . ILE A 1 64  ? -5.761  31.197 42.345 1.00 23.59  ? 64   ILE A O   1 
ATOM   498  C CB  . ILE A 1 64  ? -4.588  28.268 41.664 1.00 25.11  ? 64   ILE A CB  1 
ATOM   499  C CG1 . ILE A 1 64  ? -4.207  28.492 40.202 1.00 25.88  ? 64   ILE A CG1 1 
ATOM   500  C CG2 . ILE A 1 64  ? -6.087  28.083 41.812 1.00 30.70  ? 64   ILE A CG2 1 
ATOM   501  C CD1 . ILE A 1 64  ? -4.405  27.256 39.330 1.00 32.19  ? 64   ILE A CD1 1 
ATOM   502  N N   . GLU A 1 65  ? -3.852  31.449 41.194 1.00 22.19  ? 65   GLU A N   1 
ATOM   503  C CA  . GLU A 1 65  ? -4.253  32.711 40.610 1.00 25.26  ? 65   GLU A CA  1 
ATOM   504  C C   . GLU A 1 65  ? -4.342  32.495 39.106 1.00 26.97  ? 65   GLU A C   1 
ATOM   505  O O   . GLU A 1 65  ? -3.338  32.234 38.446 1.00 26.89  ? 65   GLU A O   1 
ATOM   506  C CB  . GLU A 1 65  ? -3.224  33.789 40.951 1.00 27.34  ? 65   GLU A CB  1 
ATOM   507  C CG  . GLU A 1 65  ? -3.572  35.181 40.459 1.00 50.97  ? 65   GLU A CG  1 
ATOM   508  C CD  . GLU A 1 65  ? -2.594  36.229 40.958 1.00 61.69  ? 65   GLU A CD  1 
ATOM   509  O OE1 . GLU A 1 65  ? -2.733  37.408 40.565 1.00 71.05  ? 65   GLU A OE1 1 
ATOM   510  O OE2 . GLU A 1 65  ? -1.689  35.875 41.747 1.00 66.24  ? 65   GLU A OE2 1 
ATOM   511  N N   . ILE A 1 66  ? -5.559  32.584 38.577 1.00 27.50  ? 66   ILE A N   1 
ATOM   512  C CA  . ILE A 1 66  ? -5.803  32.382 37.157 1.00 28.37  ? 66   ILE A CA  1 
ATOM   513  C C   . ILE A 1 66  ? -6.085  33.721 36.492 1.00 29.77  ? 66   ILE A C   1 
ATOM   514  O O   . ILE A 1 66  ? -7.181  34.272 36.615 1.00 27.89  ? 66   ILE A O   1 
ATOM   515  C CB  . ILE A 1 66  ? -7.001  31.433 36.949 1.00 26.56  ? 66   ILE A CB  1 
ATOM   516  C CG1 . ILE A 1 66  ? -6.753  30.129 37.709 1.00 28.12  ? 66   ILE A CG1 1 
ATOM   517  C CG2 . ILE A 1 66  ? -7.200  31.151 35.469 1.00 29.88  ? 66   ILE A CG2 1 
ATOM   518  C CD1 . ILE A 1 66  ? -7.934  29.188 37.727 1.00 33.64  ? 66   ILE A CD1 1 
ATOM   519  N N   . CYS A 1 67  ? -5.084  34.238 35.786 1.00 32.86  ? 67   CYS A N   1 
ATOM   520  C CA  . CYS A 1 67  ? -5.196  35.523 35.111 1.00 35.23  ? 67   CYS A CA  1 
ATOM   521  C C   . CYS A 1 67  ? -5.647  36.586 36.109 1.00 37.06  ? 67   CYS A C   1 
ATOM   522  O O   . CYS A 1 67  ? -6.531  37.391 35.819 1.00 38.22  ? 67   CYS A O   1 
ATOM   523  C CB  . CYS A 1 67  ? -6.190  35.437 33.949 1.00 41.12  ? 67   CYS A CB  1 
ATOM   524  S SG  . CYS A 1 67  ? -5.436  35.612 32.306 1.00 57.38  ? 67   CYS A SG  1 
ATOM   525  N N   . GLY A 1 68  ? -5.041  36.570 37.293 1.00 38.04  ? 68   GLY A N   1 
ATOM   526  C CA  . GLY A 1 68  ? -5.385  37.545 38.312 1.00 38.65  ? 68   GLY A CA  1 
ATOM   527  C C   . GLY A 1 68  ? -6.503  37.154 39.263 1.00 38.81  ? 68   GLY A C   1 
ATOM   528  O O   . GLY A 1 68  ? -6.566  37.673 40.377 1.00 41.42  ? 68   GLY A O   1 
ATOM   529  N N   . HIS A 1 69  ? -7.392  36.256 38.844 1.00 35.97  ? 69   HIS A N   1 
ATOM   530  C CA  . HIS A 1 69  ? -8.490  35.841 39.712 1.00 33.53  ? 69   HIS A CA  1 
ATOM   531  C C   . HIS A 1 69  ? -8.037  34.749 40.671 1.00 32.13  ? 69   HIS A C   1 
ATOM   532  O O   . HIS A 1 69  ? -7.520  33.713 40.249 1.00 32.57  ? 69   HIS A O   1 
ATOM   533  C CB  . HIS A 1 69  ? -9.678  35.342 38.884 1.00 31.80  ? 69   HIS A CB  1 
ATOM   534  C CG  . HIS A 1 69  ? -10.243 36.371 37.959 1.00 38.41  ? 69   HIS A CG  1 
ATOM   535  N ND1 . HIS A 1 69  ? -9.539  36.875 36.885 1.00 43.21  ? 69   HIS A ND1 1 
ATOM   536  C CD2 . HIS A 1 69  ? -11.443 36.999 37.948 1.00 40.62  ? 69   HIS A CD2 1 
ATOM   537  C CE1 . HIS A 1 69  ? -10.281 37.767 36.254 1.00 45.01  ? 69   HIS A CE1 1 
ATOM   538  N NE2 . HIS A 1 69  ? -11.442 37.861 36.879 1.00 50.52  ? 69   HIS A NE2 1 
ATOM   539  N N   . LYS A 1 70  ? -8.239  34.984 41.963 1.00 31.12  ? 70   LYS A N   1 
ATOM   540  C CA  . LYS A 1 70  ? -7.837  34.025 42.983 1.00 29.33  ? 70   LYS A CA  1 
ATOM   541  C C   . LYS A 1 70  ? -8.867  32.926 43.207 1.00 28.81  ? 70   LYS A C   1 
ATOM   542  O O   . LYS A 1 70  ? -10.072 33.161 43.146 1.00 29.49  ? 70   LYS A O   1 
ATOM   543  C CB  . LYS A 1 70  ? -7.575  34.737 44.309 1.00 27.43  ? 70   LYS A CB  1 
ATOM   544  C CG  . LYS A 1 70  ? -6.446  35.748 44.264 1.00 37.15  ? 70   LYS A CG  1 
ATOM   545  C CD  . LYS A 1 70  ? -6.237  36.389 45.628 1.00 36.55  ? 70   LYS A CD  1 
ATOM   546  C CE  . LYS A 1 70  ? -5.222  37.514 45.551 1.00 49.32  ? 70   LYS A CE  1 
ATOM   547  N NZ  . LYS A 1 70  ? -3.928  37.052 44.986 1.00 41.53  ? 70   LYS A NZ  1 
ATOM   548  N N   . ALA A 1 71  ? -8.373  31.725 43.476 1.00 28.48  ? 71   ALA A N   1 
ATOM   549  C CA  . ALA A 1 71  ? -9.228  30.574 43.729 1.00 27.15  ? 71   ALA A CA  1 
ATOM   550  C C   . ALA A 1 71  ? -8.452  29.574 44.566 1.00 26.14  ? 71   ALA A C   1 
ATOM   551  O O   . ALA A 1 71  ? -7.229  29.505 44.479 1.00 26.17  ? 71   ALA A O   1 
ATOM   552  C CB  . ALA A 1 71  ? -9.653  29.932 42.407 1.00 24.39  ? 71   ALA A CB  1 
ATOM   553  N N   . ILE A 1 72  ? -9.166  28.820 45.395 1.00 24.32  ? 72   ILE A N   1 
ATOM   554  C CA  . ILE A 1 72  ? -8.550  27.798 46.225 1.00 24.25  ? 72   ILE A CA  1 
ATOM   555  C C   . ILE A 1 72  ? -9.279  26.501 45.934 1.00 25.71  ? 72   ILE A C   1 
ATOM   556  O O   . ILE A 1 72  ? -10.503 26.463 45.896 1.00 24.21  ? 72   ILE A O   1 
ATOM   557  C CB  . ILE A 1 72  ? -8.693  28.074 47.731 1.00 25.41  ? 72   ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 72  ? -7.891  29.315 48.122 1.00 31.17  ? 72   ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 72  ? -8.195  26.860 48.516 1.00 19.65  ? 72   ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 72  ? -7.923  29.619 49.610 1.00 35.52  ? 72   ILE A CD1 1 
ATOM   561  N N   . GLY A 1 73  ? -8.527  25.435 45.726 1.00 24.56  ? 73   GLY A N   1 
ATOM   562  C CA  . GLY A 1 73  ? -9.171  24.178 45.437 1.00 24.67  ? 73   GLY A CA  1 
ATOM   563  C C   . GLY A 1 73  ? -8.154  23.096 45.226 1.00 23.25  ? 73   GLY A C   1 
ATOM   564  O O   . GLY A 1 73  ? -6.969  23.266 45.517 1.00 22.99  ? 73   GLY A O   1 
ATOM   565  N N   . THR A 1 74  ? -8.634  21.980 44.700 1.00 24.10  ? 74   THR A N   1 
ATOM   566  C CA  . THR A 1 74  ? -7.808  20.822 44.443 1.00 22.51  ? 74   THR A CA  1 
ATOM   567  C C   . THR A 1 74  ? -7.088  20.918 43.108 1.00 23.18  ? 74   THR A C   1 
ATOM   568  O O   . THR A 1 74  ? -7.657  21.326 42.102 1.00 23.24  ? 74   THR A O   1 
ATOM   569  C CB  . THR A 1 74  ? -8.679  19.549 44.476 1.00 24.35  ? 74   THR A CB  1 
ATOM   570  O OG1 . THR A 1 74  ? -9.234  19.404 45.787 1.00 28.23  ? 74   THR A OG1 1 
ATOM   571  C CG2 . THR A 1 74  ? -7.868  18.320 44.128 1.00 23.91  ? 74   THR A CG2 1 
ATOM   572  N N   . VAL A 1 75  ? -5.820  20.542 43.116 1.00 23.14  ? 75   VAL A N   1 
ATOM   573  C CA  . VAL A 1 75  ? -5.009  20.553 41.911 1.00 25.29  ? 75   VAL A CA  1 
ATOM   574  C C   . VAL A 1 75  ? -4.330  19.203 41.840 1.00 23.50  ? 75   VAL A C   1 
ATOM   575  O O   . VAL A 1 75  ? -3.805  18.709 42.836 1.00 27.21  ? 75   VAL A O   1 
ATOM   576  C CB  . VAL A 1 75  ? -3.931  21.663 41.953 1.00 25.30  ? 75   VAL A CB  1 
ATOM   577  C CG1 . VAL A 1 75  ? -2.828  21.363 40.947 1.00 30.54  ? 75   VAL A CG1 1 
ATOM   578  C CG2 . VAL A 1 75  ? -4.568  23.010 41.636 1.00 30.67  ? 75   VAL A CG2 1 
ATOM   579  N N   . LEU A 1 76  ? -4.360  18.595 40.666 1.00 23.85  ? 76   LEU A N   1 
ATOM   580  C CA  . LEU A 1 76  ? -3.725  17.307 40.486 1.00 21.98  ? 76   LEU A CA  1 
ATOM   581  C C   . LEU A 1 76  ? -2.447  17.531 39.696 1.00 22.28  ? 76   LEU A C   1 
ATOM   582  O O   . LEU A 1 76  ? -2.422  18.300 38.733 1.00 22.93  ? 76   LEU A O   1 
ATOM   583  C CB  . LEU A 1 76  ? -4.661  16.353 39.745 1.00 20.33  ? 76   LEU A CB  1 
ATOM   584  C CG  . LEU A 1 76  ? -6.015  16.120 40.421 1.00 23.18  ? 76   LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 76  ? -6.781  15.090 39.616 1.00 31.38  ? 76   LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 76  ? -5.830  15.634 41.854 1.00 24.02  ? 76   LEU A CD2 1 
ATOM   587  N N   . VAL A 1 77  ? -1.378  16.876 40.121 1.00 21.44  ? 77   VAL A N   1 
ATOM   588  C CA  . VAL A 1 77  ? -0.100  17.018 39.445 1.00 24.75  ? 77   VAL A CA  1 
ATOM   589  C C   . VAL A 1 77  ? 0.336   15.660 38.920 1.00 24.77  ? 77   VAL A C   1 
ATOM   590  O O   . VAL A 1 77  ? 0.441   14.699 39.675 1.00 26.44  ? 77   VAL A O   1 
ATOM   591  C CB  . VAL A 1 77  ? 0.973   17.566 40.411 1.00 31.22  ? 77   VAL A CB  1 
ATOM   592  C CG1 . VAL A 1 77  ? 2.273   17.823 39.659 1.00 29.87  ? 77   VAL A CG1 1 
ATOM   593  C CG2 . VAL A 1 77  ? 0.469   18.837 41.067 1.00 29.90  ? 77   VAL A CG2 1 
ATOM   594  N N   . GLY A 1 78  ? 0.572   15.575 37.619 1.00 27.09  ? 78   GLY A N   1 
ATOM   595  C CA  . GLY A 1 78  ? 0.979   14.310 37.048 1.00 29.04  ? 78   GLY A CA  1 
ATOM   596  C C   . GLY A 1 78  ? 1.439   14.426 35.614 1.00 29.61  ? 78   GLY A C   1 
ATOM   597  O O   . GLY A 1 78  ? 1.651   15.530 35.112 1.00 30.15  ? 78   GLY A O   1 
ATOM   598  N N   . PRO A 1 79  ? 1.596   13.289 34.923 1.00 30.54  ? 79   PRO A N   1 
ATOM   599  C CA  . PRO A 1 79  ? 2.039   13.247 33.530 1.00 30.47  ? 79   PRO A CA  1 
ATOM   600  C C   . PRO A 1 79  ? 1.009   13.702 32.490 1.00 32.05  ? 79   PRO A C   1 
ATOM   601  O O   . PRO A 1 79  ? 0.744   12.992 31.515 1.00 32.34  ? 79   PRO A O   1 
ATOM   602  C CB  . PRO A 1 79  ? 2.450   11.786 33.353 1.00 35.21  ? 79   PRO A CB  1 
ATOM   603  C CG  . PRO A 1 79  ? 1.478   11.073 34.225 1.00 31.52  ? 79   PRO A CG  1 
ATOM   604  C CD  . PRO A 1 79  ? 1.462   11.928 35.472 1.00 31.29  ? 79   PRO A CD  1 
ATOM   605  N N   . THR A 1 80  ? 0.431   14.882 32.700 1.00 31.56  ? 80   THR A N   1 
ATOM   606  C CA  . THR A 1 80  ? -0.533  15.425 31.750 1.00 30.86  ? 80   THR A CA  1 
ATOM   607  C C   . THR A 1 80  ? 0.259   16.154 30.671 1.00 31.32  ? 80   THR A C   1 
ATOM   608  O O   . THR A 1 80  ? 1.247   16.826 30.961 1.00 31.81  ? 80   THR A O   1 
ATOM   609  C CB  . THR A 1 80  ? -1.510  16.417 32.424 1.00 28.26  ? 80   THR A CB  1 
ATOM   610  O OG1 . THR A 1 80  ? -2.363  16.998 31.429 1.00 23.14  ? 80   THR A OG1 1 
ATOM   611  C CG2 . THR A 1 80  ? -0.749  17.519 33.153 1.00 21.64  ? 80   THR A CG2 1 
ATOM   612  N N   . PRO A 1 81  ? -0.144  16.007 29.404 1.00 32.03  ? 81   PRO A N   1 
ATOM   613  C CA  . PRO A 1 81  ? 0.578   16.683 28.318 1.00 33.28  ? 81   PRO A CA  1 
ATOM   614  C C   . PRO A 1 81  ? 0.364   18.200 28.262 1.00 33.16  ? 81   PRO A C   1 
ATOM   615  O O   . PRO A 1 81  ? 1.111   18.915 27.596 1.00 34.16  ? 81   PRO A O   1 
ATOM   616  C CB  . PRO A 1 81  ? 0.069   15.968 27.068 1.00 31.30  ? 81   PRO A CB  1 
ATOM   617  C CG  . PRO A 1 81  ? -1.312  15.554 27.461 1.00 34.26  ? 81   PRO A CG  1 
ATOM   618  C CD  . PRO A 1 81  ? -1.148  15.071 28.873 1.00 30.89  ? 81   PRO A CD  1 
ATOM   619  N N   . VAL A 1 82  ? -0.652  18.692 28.966 1.00 32.13  ? 82   VAL A N   1 
ATOM   620  C CA  . VAL A 1 82  ? -0.938  20.124 28.984 1.00 29.10  ? 82   VAL A CA  1 
ATOM   621  C C   . VAL A 1 82  ? -1.545  20.511 30.328 1.00 28.11  ? 82   VAL A C   1 
ATOM   622  O O   . VAL A 1 82  ? -2.329  19.747 30.891 1.00 26.86  ? 82   VAL A O   1 
ATOM   623  C CB  . VAL A 1 82  ? -1.944  20.518 27.867 1.00 37.80  ? 82   VAL A CB  1 
ATOM   624  C CG1 . VAL A 1 82  ? -2.193  22.023 27.893 1.00 37.52  ? 82   VAL A CG1 1 
ATOM   625  C CG2 . VAL A 1 82  ? -1.413  20.099 26.502 1.00 41.63  ? 82   VAL A CG2 1 
ATOM   626  N N   . ASN A 1 83  ? -1.178  21.679 30.854 1.00 24.39  ? 83   ASN A N   1 
ATOM   627  C CA  . ASN A 1 83  ? -1.749  22.119 32.123 1.00 24.38  ? 83   ASN A CA  1 
ATOM   628  C C   . ASN A 1 83  ? -3.170  22.523 31.800 1.00 21.68  ? 83   ASN A C   1 
ATOM   629  O O   . ASN A 1 83  ? -3.396  23.277 30.855 1.00 23.75  ? 83   ASN A O   1 
ATOM   630  C CB  . ASN A 1 83  ? -1.045  23.357 32.690 1.00 29.03  ? 83   ASN A CB  1 
ATOM   631  C CG  . ASN A 1 83  ? 0.416   23.126 33.002 1.00 31.99  ? 83   ASN A CG  1 
ATOM   632  O OD1 . ASN A 1 83  ? 0.805   22.087 33.538 1.00 23.79  ? 83   ASN A OD1 1 
ATOM   633  N ND2 . ASN A 1 83  ? 1.235   24.120 32.694 1.00 20.35  ? 83   ASN A ND2 1 
ATOM   634  N N   . ILE A 1 84  ? -4.136  22.019 32.552 1.00 20.93  ? 84   ILE A N   1 
ATOM   635  C CA  . ILE A 1 84  ? -5.505  22.418 32.287 1.00 20.35  ? 84   ILE A CA  1 
ATOM   636  C C   . ILE A 1 84  ? -6.249  22.813 33.547 1.00 18.12  ? 84   ILE A C   1 
ATOM   637  O O   . ILE A 1 84  ? -6.091  22.209 34.603 1.00 18.28  ? 84   ILE A O   1 
ATOM   638  C CB  . ILE A 1 84  ? -6.300  21.330 31.534 1.00 24.07  ? 84   ILE A CB  1 
ATOM   639  C CG1 . ILE A 1 84  ? -6.270  20.013 32.292 1.00 24.37  ? 84   ILE A CG1 1 
ATOM   640  C CG2 . ILE A 1 84  ? -5.736  21.150 30.142 1.00 26.01  ? 84   ILE A CG2 1 
ATOM   641  C CD1 . ILE A 1 84  ? -6.787  18.850 31.446 1.00 41.63  ? 84   ILE A CD1 1 
ATOM   642  N N   . ILE A 1 85  ? -7.035  23.872 33.424 1.00 18.90  ? 85   ILE A N   1 
ATOM   643  C CA  . ILE A 1 85  ? -7.828  24.374 34.530 1.00 18.45  ? 85   ILE A CA  1 
ATOM   644  C C   . ILE A 1 85  ? -9.212  23.797 34.322 1.00 17.63  ? 85   ILE A C   1 
ATOM   645  O O   . ILE A 1 85  ? -9.882  24.123 33.343 1.00 20.92  ? 85   ILE A O   1 
ATOM   646  C CB  . ILE A 1 85  ? -7.906  25.910 34.504 1.00 15.43  ? 85   ILE A CB  1 
ATOM   647  C CG1 . ILE A 1 85  ? -6.494  26.504 34.454 1.00 22.92  ? 85   ILE A CG1 1 
ATOM   648  C CG2 . ILE A 1 85  ? -8.659  26.415 35.732 1.00 15.29  ? 85   ILE A CG2 1 
ATOM   649  C CD1 . ILE A 1 85  ? -5.603  26.095 35.607 1.00 22.63  ? 85   ILE A CD1 1 
ATOM   650  N N   . GLY A 1 86  ? -9.634  22.935 35.240 1.00 18.39  ? 86   GLY A N   1 
ATOM   651  C CA  . GLY A 1 86  ? -10.936 22.309 35.126 1.00 16.72  ? 86   GLY A CA  1 
ATOM   652  C C   . GLY A 1 86  ? -12.048 23.085 35.798 1.00 18.27  ? 86   GLY A C   1 
ATOM   653  O O   . GLY A 1 86  ? -11.811 24.110 36.427 1.00 18.06  ? 86   GLY A O   1 
ATOM   654  N N   . ARG A 1 87  ? -13.267 22.571 35.674 1.00 18.81  ? 87   ARG A N   1 
ATOM   655  C CA  . ARG A 1 87  ? -14.442 23.215 36.241 1.00 18.23  ? 87   ARG A CA  1 
ATOM   656  C C   . ARG A 1 87  ? -14.368 23.490 37.736 1.00 20.17  ? 87   ARG A C   1 
ATOM   657  O O   . ARG A 1 87  ? -14.939 24.474 38.203 1.00 20.39  ? 87   ARG A O   1 
ATOM   658  C CB  . ARG A 1 87  ? -15.704 22.396 35.929 1.00 17.91  ? 87   ARG A CB  1 
ATOM   659  C CG  . ARG A 1 87  ? -16.113 22.434 34.450 1.00 13.96  ? 87   ARG A CG  1 
ATOM   660  C CD  . ARG A 1 87  ? -17.469 21.748 34.188 1.00 26.45  ? 87   ARG A CD  1 
ATOM   661  N NE  . ARG A 1 87  ? -17.495 20.347 34.616 1.00 19.21  ? 87   ARG A NE  1 
ATOM   662  C CZ  . ARG A 1 87  ? -18.059 19.918 35.741 1.00 18.20  ? 87   ARG A CZ  1 
ATOM   663  N NH1 . ARG A 1 87  ? -18.653 20.775 36.558 1.00 17.47  ? 87   ARG A NH1 1 
ATOM   664  N NH2 . ARG A 1 87  ? -18.018 18.633 36.053 1.00 22.75  ? 87   ARG A NH2 1 
ATOM   665  N N   . ASN A 1 88  ? -13.671 22.643 38.488 1.00 19.45  ? 88   ASN A N   1 
ATOM   666  C CA  . ASN A 1 88  ? -13.573 22.866 39.926 1.00 22.74  ? 88   ASN A CA  1 
ATOM   667  C C   . ASN A 1 88  ? -13.049 24.273 40.204 1.00 23.99  ? 88   ASN A C   1 
ATOM   668  O O   . ASN A 1 88  ? -13.425 24.896 41.200 1.00 23.69  ? 88   ASN A O   1 
ATOM   669  C CB  . ASN A 1 88  ? -12.679 21.802 40.596 1.00 18.16  ? 88   ASN A CB  1 
ATOM   670  C CG  . ASN A 1 88  ? -11.194 22.002 40.325 1.00 25.20  ? 88   ASN A CG  1 
ATOM   671  O OD1 . ASN A 1 88  ? -10.739 21.983 39.178 1.00 22.20  ? 88   ASN A OD1 1 
ATOM   672  N ND2 . ASN A 1 88  ? -10.426 22.181 41.394 1.00 21.89  ? 88   ASN A ND2 1 
ATOM   673  N N   . LEU A 1 89  ? -12.208 24.789 39.309 1.00 21.11  ? 89   LEU A N   1 
ATOM   674  C CA  . LEU A 1 89  ? -11.665 26.129 39.495 1.00 21.70  ? 89   LEU A CA  1 
ATOM   675  C C   . LEU A 1 89  ? -12.327 27.171 38.599 1.00 20.90  ? 89   LEU A C   1 
ATOM   676  O O   . LEU A 1 89  ? -12.424 28.340 38.974 1.00 19.94  ? 89   LEU A O   1 
ATOM   677  C CB  . LEU A 1 89  ? -10.152 26.140 39.265 1.00 14.86  ? 89   LEU A CB  1 
ATOM   678  C CG  . LEU A 1 89  ? -9.311  25.353 40.270 1.00 22.68  ? 89   LEU A CG  1 
ATOM   679  C CD1 . LEU A 1 89  ? -7.836  25.500 39.915 1.00 19.71  ? 89   LEU A CD1 1 
ATOM   680  C CD2 . LEU A 1 89  ? -9.581  25.867 41.684 1.00 18.89  ? 89   LEU A CD2 1 
ATOM   681  N N   . LEU A 1 90  ? -12.782 26.753 37.420 1.00 18.68  ? 90   LEU A N   1 
ATOM   682  C CA  . LEU A 1 90  ? -13.447 27.671 36.503 1.00 18.70  ? 90   LEU A CA  1 
ATOM   683  C C   . LEU A 1 90  ? -14.674 28.316 37.166 1.00 19.65  ? 90   LEU A C   1 
ATOM   684  O O   . LEU A 1 90  ? -14.942 29.503 36.968 1.00 21.36  ? 90   LEU A O   1 
ATOM   685  C CB  . LEU A 1 90  ? -13.855 26.934 35.218 1.00 16.33  ? 90   LEU A CB  1 
ATOM   686  C CG  . LEU A 1 90  ? -12.696 26.358 34.383 1.00 16.00  ? 90   LEU A CG  1 
ATOM   687  C CD1 . LEU A 1 90  ? -13.249 25.541 33.228 1.00 18.32  ? 90   LEU A CD1 1 
ATOM   688  C CD2 . LEU A 1 90  ? -11.810 27.491 33.857 1.00 17.14  ? 90   LEU A CD2 1 
ATOM   689  N N   . THR A 1 91  ? -15.412 27.542 37.958 1.00 22.20  ? 91   THR A N   1 
ATOM   690  C CA  . THR A 1 91  ? -16.595 28.069 38.644 1.00 24.53  ? 91   THR A CA  1 
ATOM   691  C C   . THR A 1 91  ? -16.191 29.142 39.654 1.00 27.16  ? 91   THR A C   1 
ATOM   692  O O   . THR A 1 91  ? -16.910 30.125 39.861 1.00 26.61  ? 91   THR A O   1 
ATOM   693  C CB  . THR A 1 91  ? -17.357 26.966 39.416 1.00 23.55  ? 91   THR A CB  1 
ATOM   694  O OG1 . THR A 1 91  ? -16.458 26.294 40.305 1.00 29.16  ? 91   THR A OG1 1 
ATOM   695  C CG2 . THR A 1 91  ? -17.963 25.955 38.457 1.00 25.23  ? 91   THR A CG2 1 
ATOM   696  N N   . GLN A 1 92  ? -15.037 28.945 40.285 1.00 26.03  ? 92   GLN A N   1 
ATOM   697  C CA  . GLN A 1 92  ? -14.544 29.895 41.269 1.00 28.92  ? 92   GLN A CA  1 
ATOM   698  C C   . GLN A 1 92  ? -14.223 31.259 40.687 1.00 28.21  ? 92   GLN A C   1 
ATOM   699  O O   . GLN A 1 92  ? -14.278 32.266 41.392 1.00 31.94  ? 92   GLN A O   1 
ATOM   700  C CB  . GLN A 1 92  ? -13.300 29.355 41.959 1.00 25.62  ? 92   GLN A CB  1 
ATOM   701  C CG  . GLN A 1 92  ? -13.581 28.611 43.233 1.00 44.61  ? 92   GLN A CG  1 
ATOM   702  C CD  . GLN A 1 92  ? -12.442 28.751 44.214 1.00 62.40  ? 92   GLN A CD  1 
ATOM   703  O OE1 . GLN A 1 92  ? -12.168 29.841 44.721 1.00 72.63  ? 92   GLN A OE1 1 
ATOM   704  N NE2 . GLN A 1 92  ? -11.761 27.650 44.478 1.00 69.99  ? 92   GLN A NE2 1 
ATOM   705  N N   . ILE A 1 93  ? -13.887 31.303 39.405 1.00 26.73  ? 93   ILE A N   1 
ATOM   706  C CA  . ILE A 1 93  ? -13.564 32.577 38.788 1.00 25.67  ? 93   ILE A CA  1 
ATOM   707  C C   . ILE A 1 93  ? -14.711 33.086 37.911 1.00 26.19  ? 93   ILE A C   1 
ATOM   708  O O   . ILE A 1 93  ? -14.511 33.917 37.031 1.00 27.02  ? 93   ILE A O   1 
ATOM   709  C CB  . ILE A 1 93  ? -12.245 32.488 37.971 1.00 24.65  ? 93   ILE A CB  1 
ATOM   710  C CG1 . ILE A 1 93  ? -12.383 31.496 36.818 1.00 20.34  ? 93   ILE A CG1 1 
ATOM   711  C CG2 . ILE A 1 93  ? -11.099 32.046 38.886 1.00 22.13  ? 93   ILE A CG2 1 
ATOM   712  C CD1 . ILE A 1 93  ? -11.153 31.447 35.933 1.00 23.65  ? 93   ILE A CD1 1 
ATOM   713  N N   . GLY A 1 94  ? -15.914 32.576 38.176 1.00 27.42  ? 94   GLY A N   1 
ATOM   714  C CA  . GLY A 1 94  ? -17.098 32.985 37.441 1.00 26.77  ? 94   GLY A CA  1 
ATOM   715  C C   . GLY A 1 94  ? -17.074 32.745 35.946 1.00 28.49  ? 94   GLY A C   1 
ATOM   716  O O   . GLY A 1 94  ? -17.623 33.534 35.182 1.00 28.98  ? 94   GLY A O   1 
ATOM   717  N N   . MET A 1 95  ? -16.457 31.647 35.531 1.00 26.87  ? 95   MET A N   1 
ATOM   718  C CA  . MET A 1 95  ? -16.351 31.295 34.121 1.00 26.74  ? 95   MET A CA  1 
ATOM   719  C C   . MET A 1 95  ? -17.676 30.778 33.557 1.00 27.26  ? 95   MET A C   1 
ATOM   720  O O   . MET A 1 95  ? -18.335 29.938 34.172 1.00 26.57  ? 95   MET A O   1 
ATOM   721  C CB  . MET A 1 95  ? -15.288 30.208 33.955 1.00 31.46  ? 95   MET A CB  1 
ATOM   722  C CG  . MET A 1 95  ? -14.835 29.953 32.530 1.00 43.00  ? 95   MET A CG  1 
ATOM   723  S SD  . MET A 1 95  ? -13.617 31.162 31.990 1.00 55.38  ? 95   MET A SD  1 
ATOM   724  C CE  . MET A 1 95  ? -14.573 32.092 30.859 1.00 61.45  ? 95   MET A CE  1 
ATOM   725  N N   . THR A 1 96  ? -18.066 31.274 32.387 1.00 25.40  ? 96   THR A N   1 
ATOM   726  C CA  . THR A 1 96  ? -19.292 30.805 31.749 1.00 27.67  ? 96   THR A CA  1 
ATOM   727  C C   . THR A 1 96  ? -19.044 30.582 30.265 1.00 27.73  ? 96   THR A C   1 
ATOM   728  O O   . THR A 1 96  ? -18.153 31.197 29.675 1.00 28.40  ? 96   THR A O   1 
ATOM   729  C CB  . THR A 1 96  ? -20.456 31.818 31.889 1.00 25.68  ? 96   THR A CB  1 
ATOM   730  O OG1 . THR A 1 96  ? -20.159 32.987 31.122 1.00 26.24  ? 96   THR A OG1 1 
ATOM   731  C CG2 . THR A 1 96  ? -20.665 32.202 33.340 1.00 32.82  ? 96   THR A CG2 1 
ATOM   732  N N   . LEU A 1 97  ? -19.828 29.692 29.670 1.00 28.86  ? 97   LEU A N   1 
ATOM   733  C CA  . LEU A 1 97  ? -19.727 29.401 28.245 1.00 29.15  ? 97   LEU A CA  1 
ATOM   734  C C   . LEU A 1 97  ? -20.929 30.075 27.597 1.00 29.37  ? 97   LEU A C   1 
ATOM   735  O O   . LEU A 1 97  ? -22.043 29.943 28.085 1.00 33.18  ? 97   LEU A O   1 
ATOM   736  C CB  . LEU A 1 97  ? -19.793 27.891 28.003 1.00 34.43  ? 97   LEU A CB  1 
ATOM   737  C CG  . LEU A 1 97  ? -18.584 27.198 27.379 1.00 35.48  ? 97   LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 97  ? -18.920 25.724 27.137 1.00 28.60  ? 97   LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 97  ? -18.215 27.884 26.069 1.00 27.18  ? 97   LEU A CD2 1 
ATOM   740  N N   . ASN A 1 98  ? -20.709 30.800 26.508 1.00 30.68  ? 98   ASN A N   1 
ATOM   741  C CA  . ASN A 1 98  ? -21.800 31.491 25.829 1.00 33.36  ? 98   ASN A CA  1 
ATOM   742  C C   . ASN A 1 98  ? -21.836 31.122 24.352 1.00 34.47  ? 98   ASN A C   1 
ATOM   743  O O   . ASN A 1 98  ? -20.811 31.166 23.671 1.00 33.28  ? 98   ASN A O   1 
ATOM   744  C CB  . ASN A 1 98  ? -21.623 33.003 25.963 1.00 30.90  ? 98   ASN A CB  1 
ATOM   745  C CG  . ASN A 1 98  ? -21.432 33.440 27.399 1.00 47.15  ? 98   ASN A CG  1 
ATOM   746  O OD1 . ASN A 1 98  ? -22.382 33.482 28.180 1.00 43.01  ? 98   ASN A OD1 1 
ATOM   747  N ND2 . ASN A 1 98  ? -20.192 33.753 27.760 1.00 45.59  ? 98   ASN A ND2 1 
ATOM   748  N N   . PHE A 1 99  ? -23.021 30.767 23.861 1.00 35.41  ? 99   PHE A N   1 
ATOM   749  C CA  . PHE A 1 99  ? -23.186 30.399 22.462 1.00 36.84  ? 99   PHE A CA  1 
ATOM   750  C C   . PHE A 1 99  ? -24.653 30.506 22.052 1.00 37.85  ? 99   PHE A C   1 
ATOM   751  O O   . PHE A 1 99  ? -25.400 31.325 22.590 1.00 38.54  ? 99   PHE A O   1 
ATOM   752  C CB  . PHE A 1 99  ? -22.663 28.974 22.226 1.00 33.74  ? 99   PHE A CB  1 
ATOM   753  C CG  . PHE A 1 99  ? -23.673 27.888 22.502 1.00 39.05  ? 99   PHE A CG  1 
ATOM   754  C CD1 . PHE A 1 99  ? -24.616 27.533 21.539 1.00 40.30  ? 99   PHE A CD1 1 
ATOM   755  C CD2 . PHE A 1 99  ? -23.678 27.217 23.719 1.00 34.11  ? 99   PHE A CD2 1 
ATOM   756  C CE1 . PHE A 1 99  ? -25.544 26.522 21.785 1.00 39.99  ? 99   PHE A CE1 1 
ATOM   757  C CE2 . PHE A 1 99  ? -24.602 26.206 23.973 1.00 39.02  ? 99   PHE A CE2 1 
ATOM   758  C CZ  . PHE A 1 99  ? -25.536 25.859 23.006 1.00 32.38  ? 99   PHE A CZ  1 
ATOM   759  N N   . PRO A 1 105 ? -27.955 32.111 25.179 1.00 39.06  ? 1001 PRO A N   1 
ATOM   760  C CA  . PRO A 1 105 ? -27.605 30.790 25.705 1.00 38.48  ? 1001 PRO A CA  1 
ATOM   761  C C   . PRO A 1 105 ? -26.309 30.811 26.521 1.00 39.20  ? 1001 PRO A C   1 
ATOM   762  O O   . PRO A 1 105 ? -25.244 30.438 26.024 1.00 38.32  ? 1001 PRO A O   1 
ATOM   763  C CB  . PRO A 1 105 ? -27.482 29.942 24.444 1.00 31.72  ? 1001 PRO A CB  1 
ATOM   764  C CG  . PRO A 1 105 ? -28.490 30.564 23.531 1.00 46.34  ? 1001 PRO A CG  1 
ATOM   765  C CD  . PRO A 1 105 ? -28.242 32.043 23.736 1.00 41.79  ? 1001 PRO A CD  1 
ATOM   766  N N   . GLN A 1 106 ? -26.403 31.264 27.768 1.00 39.45  ? 1002 GLN A N   1 
ATOM   767  C CA  . GLN A 1 106 ? -25.241 31.316 28.646 1.00 38.85  ? 1002 GLN A CA  1 
ATOM   768  C C   . GLN A 1 106 ? -25.230 30.056 29.492 1.00 38.31  ? 1002 GLN A C   1 
ATOM   769  O O   . GLN A 1 106 ? -26.286 29.532 29.849 1.00 40.76  ? 1002 GLN A O   1 
ATOM   770  C CB  . GLN A 1 106 ? -25.290 32.545 29.555 1.00 38.23  ? 1002 GLN A CB  1 
ATOM   771  C CG  . GLN A 1 106 ? -24.082 32.647 30.482 1.00 50.90  ? 1002 GLN A CG  1 
ATOM   772  C CD  . GLN A 1 106 ? -24.092 33.893 31.347 1.00 58.09  ? 1002 GLN A CD  1 
ATOM   773  O OE1 . GLN A 1 106 ? -24.976 34.079 32.185 1.00 64.92  ? 1002 GLN A OE1 1 
ATOM   774  N NE2 . GLN A 1 106 ? -23.100 34.755 31.149 1.00 63.27  ? 1002 GLN A NE2 1 
ATOM   775  N N   . VAL A 1 107 ? -24.041 29.571 29.821 1.00 37.04  ? 1003 VAL A N   1 
ATOM   776  C CA  . VAL A 1 107 ? -23.930 28.350 30.608 1.00 35.26  ? 1003 VAL A CA  1 
ATOM   777  C C   . VAL A 1 107 ? -22.861 28.421 31.693 1.00 33.90  ? 1003 VAL A C   1 
ATOM   778  O O   . VAL A 1 107 ? -21.695 28.688 31.407 1.00 33.15  ? 1003 VAL A O   1 
ATOM   779  C CB  . VAL A 1 107 ? -23.608 27.151 29.689 1.00 35.09  ? 1003 VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 107 ? -23.526 25.881 30.502 1.00 26.59  ? 1003 VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 107 ? -24.663 27.032 28.598 1.00 38.34  ? 1003 VAL A CG2 1 
ATOM   782  N N   . THR A 1 108 ? -23.261 28.187 32.939 1.00 32.69  ? 1004 THR A N   1 
ATOM   783  C CA  . THR A 1 108 ? -22.311 28.191 34.044 1.00 30.30  ? 1004 THR A CA  1 
ATOM   784  C C   . THR A 1 108 ? -21.627 26.829 34.023 1.00 27.76  ? 1004 THR A C   1 
ATOM   785  O O   . THR A 1 108 ? -22.055 25.936 33.295 1.00 27.44  ? 1004 THR A O   1 
ATOM   786  C CB  . THR A 1 108 ? -23.008 28.405 35.403 1.00 34.19  ? 1004 THR A CB  1 
ATOM   787  O OG1 . THR A 1 108 ? -24.148 27.544 35.500 1.00 42.03  ? 1004 THR A OG1 1 
ATOM   788  C CG2 . THR A 1 108 ? -23.444 29.857 35.551 1.00 34.84  ? 1004 THR A CG2 1 
ATOM   789  N N   . LEU A 1 109 ? -20.579 26.659 34.820 1.00 24.62  ? 1005 LEU A N   1 
ATOM   790  C CA  . LEU A 1 109 ? -19.845 25.403 34.807 1.00 23.36  ? 1005 LEU A CA  1 
ATOM   791  C C   . LEU A 1 109 ? -19.892 24.561 36.078 1.00 21.79  ? 1005 LEU A C   1 
ATOM   792  O O   . LEU A 1 109 ? -18.975 23.783 36.346 1.00 19.74  ? 1005 LEU A O   1 
ATOM   793  C CB  . LEU A 1 109 ? -18.391 25.685 34.394 1.00 18.31  ? 1005 LEU A CB  1 
ATOM   794  C CG  . LEU A 1 109 ? -18.273 26.212 32.957 1.00 20.05  ? 1005 LEU A CG  1 
ATOM   795  C CD1 . LEU A 1 109 ? -16.941 26.909 32.738 1.00 15.62  ? 1005 LEU A CD1 1 
ATOM   796  C CD2 . LEU A 1 109 ? -18.450 25.043 31.982 1.00 16.29  ? 1005 LEU A CD2 1 
ATOM   797  N N   . TRP A 1 110 ? -20.960 24.710 36.859 1.00 20.92  ? 1006 TRP A N   1 
ATOM   798  C CA  . TRP A 1 110 ? -21.109 23.928 38.081 1.00 21.15  ? 1006 TRP A CA  1 
ATOM   799  C C   . TRP A 1 110 ? -21.402 22.484 37.692 1.00 21.51  ? 1006 TRP A C   1 
ATOM   800  O O   . TRP A 1 110 ? -21.174 21.548 38.462 1.00 22.98  ? 1006 TRP A O   1 
ATOM   801  C CB  . TRP A 1 110 ? -22.227 24.515 38.946 1.00 23.32  ? 1006 TRP A CB  1 
ATOM   802  C CG  . TRP A 1 110 ? -21.969 25.953 39.261 1.00 23.05  ? 1006 TRP A CG  1 
ATOM   803  C CD1 . TRP A 1 110 ? -22.350 27.038 38.525 1.00 23.40  ? 1006 TRP A CD1 1 
ATOM   804  C CD2 . TRP A 1 110 ? -21.188 26.460 40.347 1.00 19.38  ? 1006 TRP A CD2 1 
ATOM   805  N NE1 . TRP A 1 110 ? -21.854 28.191 39.084 1.00 21.02  ? 1006 TRP A NE1 1 
ATOM   806  C CE2 . TRP A 1 110 ? -21.143 27.866 40.207 1.00 23.38  ? 1006 TRP A CE2 1 
ATOM   807  C CE3 . TRP A 1 110 ? -20.529 25.865 41.427 1.00 25.76  ? 1006 TRP A CE3 1 
ATOM   808  C CZ2 . TRP A 1 110 ? -20.453 28.685 41.106 1.00 36.84  ? 1006 TRP A CZ2 1 
ATOM   809  C CZ3 . TRP A 1 110 ? -19.843 26.681 42.321 1.00 24.93  ? 1006 TRP A CZ3 1 
ATOM   810  C CH2 . TRP A 1 110 ? -19.816 28.074 42.157 1.00 27.94  ? 1006 TRP A CH2 1 
ATOM   811  N N   . GLN A 1 111 ? -21.895 22.310 36.472 1.00 20.43  ? 1007 GLN A N   1 
ATOM   812  C CA  . GLN A 1 111 ? -22.183 20.983 35.942 1.00 21.12  ? 1007 GLN A CA  1 
ATOM   813  C C   . GLN A 1 111 ? -21.453 20.852 34.617 1.00 20.73  ? 1007 GLN A C   1 
ATOM   814  O O   . GLN A 1 111 ? -21.036 21.852 34.042 1.00 21.33  ? 1007 GLN A O   1 
ATOM   815  C CB  . GLN A 1 111 ? -23.685 20.814 35.701 1.00 23.57  ? 1007 GLN A CB  1 
ATOM   816  C CG  . GLN A 1 111 ? -24.518 20.692 36.961 1.00 31.42  ? 1007 GLN A CG  1 
ATOM   817  C CD  . GLN A 1 111 ? -26.005 20.635 36.659 1.00 42.21  ? 1007 GLN A CD  1 
ATOM   818  O OE1 . GLN A 1 111 ? -26.813 20.290 37.519 1.00 58.71  ? 1007 GLN A OE1 1 
ATOM   819  N NE2 . GLN A 1 111 ? -26.373 20.979 35.429 1.00 39.42  ? 1007 GLN A NE2 1 
ATOM   820  N N   . ARG A 1 112 ? -21.288 19.626 34.135 1.00 22.31  ? 1008 ARG A N   1 
ATOM   821  C CA  . ARG A 1 112 ? -20.636 19.417 32.848 1.00 22.69  ? 1008 ARG A CA  1 
ATOM   822  C C   . ARG A 1 112 ? -21.477 20.118 31.793 1.00 22.12  ? 1008 ARG A C   1 
ATOM   823  O O   . ARG A 1 112 ? -22.699 19.976 31.770 1.00 21.50  ? 1008 ARG A O   1 
ATOM   824  C CB  . ARG A 1 112 ? -20.561 17.928 32.500 1.00 21.91  ? 1008 ARG A CB  1 
ATOM   825  C CG  . ARG A 1 112 ? -19.633 17.110 33.380 1.00 29.74  ? 1008 ARG A CG  1 
ATOM   826  C CD  . ARG A 1 112 ? -19.377 15.750 32.748 1.00 31.22  ? 1008 ARG A CD  1 
ATOM   827  N NE  . ARG A 1 112 ? -18.294 15.033 33.408 1.00 40.54  ? 1008 ARG A NE  1 
ATOM   828  C CZ  . ARG A 1 112 ? -17.698 13.958 32.901 1.00 55.65  ? 1008 ARG A CZ  1 
ATOM   829  N NH1 . ARG A 1 112 ? -18.081 13.475 31.726 1.00 51.78  ? 1008 ARG A NH1 1 
ATOM   830  N NH2 . ARG A 1 112 ? -16.716 13.364 33.568 1.00 48.68  ? 1008 ARG A NH2 1 
ATOM   831  N N   . PRO A 1 113 ? -20.836 20.895 30.907 1.00 22.55  ? 1009 PRO A N   1 
ATOM   832  C CA  . PRO A 1 113 ? -21.584 21.597 29.862 1.00 20.61  ? 1009 PRO A CA  1 
ATOM   833  C C   . PRO A 1 113 ? -21.979 20.639 28.746 1.00 22.52  ? 1009 PRO A C   1 
ATOM   834  O O   . PRO A 1 113 ? -21.331 20.572 27.695 1.00 20.87  ? 1009 PRO A O   1 
ATOM   835  C CB  . PRO A 1 113 ? -20.602 22.660 29.403 1.00 15.07  ? 1009 PRO A CB  1 
ATOM   836  C CG  . PRO A 1 113 ? -19.293 21.953 29.512 1.00 18.74  ? 1009 PRO A CG  1 
ATOM   837  C CD  . PRO A 1 113 ? -19.412 21.273 30.875 1.00 19.84  ? 1009 PRO A CD  1 
ATOM   838  N N   . LEU A 1 114 ? -23.050 19.892 28.981 1.00 23.56  ? 1010 LEU A N   1 
ATOM   839  C CA  . LEU A 1 114 ? -23.525 18.926 28.003 1.00 23.94  ? 1010 LEU A CA  1 
ATOM   840  C C   . LEU A 1 114 ? -24.514 19.546 27.030 1.00 24.44  ? 1010 LEU A C   1 
ATOM   841  O O   . LEU A 1 114 ? -25.243 20.477 27.372 1.00 25.57  ? 1010 LEU A O   1 
ATOM   842  C CB  . LEU A 1 114 ? -24.175 17.739 28.714 1.00 27.99  ? 1010 LEU A CB  1 
ATOM   843  C CG  . LEU A 1 114 ? -23.287 16.972 29.697 1.00 33.33  ? 1010 LEU A CG  1 
ATOM   844  C CD1 . LEU A 1 114 ? -24.096 15.872 30.367 1.00 34.22  ? 1010 LEU A CD1 1 
ATOM   845  C CD2 . LEU A 1 114 ? -22.092 16.385 28.959 1.00 43.37  ? 1010 LEU A CD2 1 
ATOM   846  N N   . VAL A 1 115 ? -24.520 19.030 25.805 1.00 22.29  ? 1011 VAL A N   1 
ATOM   847  C CA  . VAL A 1 115 ? -25.427 19.504 24.773 1.00 20.00  ? 1011 VAL A CA  1 
ATOM   848  C C   . VAL A 1 115 ? -25.982 18.322 23.987 1.00 20.09  ? 1011 VAL A C   1 
ATOM   849  O O   . VAL A 1 115 ? -25.436 17.217 24.023 1.00 18.74  ? 1011 VAL A O   1 
ATOM   850  C CB  . VAL A 1 115 ? -24.725 20.464 23.763 1.00 27.62  ? 1011 VAL A CB  1 
ATOM   851  C CG1 . VAL A 1 115 ? -24.264 21.724 24.469 1.00 31.21  ? 1011 VAL A CG1 1 
ATOM   852  C CG2 . VAL A 1 115 ? -23.542 19.765 23.092 1.00 21.31  ? 1011 VAL A CG2 1 
ATOM   853  N N   . THR A 1 116 ? -27.091 18.549 23.297 1.00 19.85  ? 1012 THR A N   1 
ATOM   854  C CA  . THR A 1 116 ? -27.664 17.506 22.475 1.00 21.81  ? 1012 THR A CA  1 
ATOM   855  C C   . THR A 1 116 ? -27.180 17.788 21.056 1.00 22.50  ? 1012 THR A C   1 
ATOM   856  O O   . THR A 1 116 ? -27.214 18.927 20.594 1.00 24.87  ? 1012 THR A O   1 
ATOM   857  C CB  . THR A 1 116 ? -29.210 17.525 22.501 1.00 20.75  ? 1012 THR A CB  1 
ATOM   858  O OG1 . THR A 1 116 ? -29.670 17.223 23.824 1.00 29.23  ? 1012 THR A OG1 1 
ATOM   859  C CG2 . THR A 1 116 ? -29.761 16.494 21.536 1.00 27.39  ? 1012 THR A CG2 1 
ATOM   860  N N   . ILE A 1 117 ? -26.697 16.758 20.378 1.00 21.93  ? 1013 ILE A N   1 
ATOM   861  C CA  . ILE A 1 117 ? -26.221 16.927 19.018 1.00 22.33  ? 1013 ILE A CA  1 
ATOM   862  C C   . ILE A 1 117 ? -26.910 15.930 18.110 1.00 22.94  ? 1013 ILE A C   1 
ATOM   863  O O   . ILE A 1 117 ? -27.403 14.896 18.565 1.00 22.02  ? 1013 ILE A O   1 
ATOM   864  C CB  . ILE A 1 117 ? -24.700 16.689 18.903 1.00 24.70  ? 1013 ILE A CB  1 
ATOM   865  C CG1 . ILE A 1 117 ? -24.381 15.227 19.220 1.00 22.96  ? 1013 ILE A CG1 1 
ATOM   866  C CG2 . ILE A 1 117 ? -23.953 17.610 19.859 1.00 21.14  ? 1013 ILE A CG2 1 
ATOM   867  C CD1 . ILE A 1 117 ? -22.953 14.825 18.922 1.00 24.89  ? 1013 ILE A CD1 1 
ATOM   868  N N   . LYS A 1 118 ? -26.958 16.260 16.827 1.00 21.39  ? 1014 LYS A N   1 
ATOM   869  C CA  . LYS A 1 118 ? -27.538 15.370 15.838 1.00 21.27  ? 1014 LYS A CA  1 
ATOM   870  C C   . LYS A 1 118 ? -26.485 15.229 14.759 1.00 21.63  ? 1014 LYS A C   1 
ATOM   871  O O   . LYS A 1 118 ? -26.034 16.222 14.175 1.00 21.76  ? 1014 LYS A O   1 
ATOM   872  C CB  . LYS A 1 118 ? -28.821 15.945 15.237 1.00 23.91  ? 1014 LYS A CB  1 
ATOM   873  C CG  . LYS A 1 118 ? -29.452 15.011 14.202 1.00 19.52  ? 1014 LYS A CG  1 
ATOM   874  C CD  . LYS A 1 118 ? -30.709 15.615 13.602 1.00 31.68  ? 1014 LYS A CD  1 
ATOM   875  C CE  . LYS A 1 118 ? -31.348 14.659 12.606 1.00 36.99  ? 1014 LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 118 ? -32.601 15.209 12.024 1.00 36.10  ? 1014 LYS A NZ  1 
ATOM   877  N N   . ILE A 1 119 ? -26.081 13.990 14.511 1.00 19.66  ? 1015 ILE A N   1 
ATOM   878  C CA  . ILE A 1 119 ? -25.063 13.711 13.519 1.00 20.18  ? 1015 ILE A CA  1 
ATOM   879  C C   . ILE A 1 119 ? -25.297 12.320 12.950 1.00 20.15  ? 1015 ILE A C   1 
ATOM   880  O O   . ILE A 1 119 ? -25.626 11.387 13.681 1.00 20.35  ? 1015 ILE A O   1 
ATOM   881  C CB  . ILE A 1 119 ? -23.659 13.772 14.151 1.00 17.89  ? 1015 ILE A CB  1 
ATOM   882  C CG1 . ILE A 1 119 ? -22.596 13.554 13.076 1.00 22.73  ? 1015 ILE A CG1 1 
ATOM   883  C CG2 . ILE A 1 119 ? -23.536 12.727 15.262 1.00 25.60  ? 1015 ILE A CG2 1 
ATOM   884  C CD1 . ILE A 1 119 ? -21.176 13.655 13.599 1.00 31.69  ? 1015 ILE A CD1 1 
ATOM   885  N N   . GLY A 1 120 ? -25.127 12.187 11.643 1.00 22.85  ? 1016 GLY A N   1 
ATOM   886  C CA  . GLY A 1 120 ? -25.330 10.896 11.011 1.00 23.02  ? 1016 GLY A CA  1 
ATOM   887  C C   . GLY A 1 120 ? -26.756 10.428 11.203 1.00 22.89  ? 1016 GLY A C   1 
ATOM   888  O O   . GLY A 1 120 ? -27.026 9.231  11.210 1.00 21.86  ? 1016 GLY A O   1 
ATOM   889  N N   . GLY A 1 121 ? -27.668 11.384 11.370 1.00 22.64  ? 1017 GLY A N   1 
ATOM   890  C CA  . GLY A 1 121 ? -29.069 11.055 11.565 1.00 22.81  ? 1017 GLY A CA  1 
ATOM   891  C C   . GLY A 1 121 ? -29.392 10.564 12.964 1.00 22.73  ? 1017 GLY A C   1 
ATOM   892  O O   . GLY A 1 121 ? -30.537 10.227 13.258 1.00 22.91  ? 1017 GLY A O   1 
ATOM   893  N N   . GLN A 1 122 ? -28.387 10.538 13.833 1.00 21.70  ? 1018 GLN A N   1 
ATOM   894  C CA  . GLN A 1 122 ? -28.556 10.066 15.207 1.00 19.10  ? 1018 GLN A CA  1 
ATOM   895  C C   . GLN A 1 122 ? -28.462 11.180 16.243 1.00 19.68  ? 1018 GLN A C   1 
ATOM   896  O O   . GLN A 1 122 ? -27.773 12.183 16.035 1.00 19.11  ? 1018 GLN A O   1 
ATOM   897  C CB  . GLN A 1 122 ? -27.491 9.019  15.505 1.00 17.92  ? 1018 GLN A CB  1 
ATOM   898  C CG  . GLN A 1 122 ? -27.498 7.875  14.501 1.00 19.98  ? 1018 GLN A CG  1 
ATOM   899  C CD  . GLN A 1 122 ? -26.167 7.189  14.414 1.00 23.40  ? 1018 GLN A CD  1 
ATOM   900  O OE1 . GLN A 1 122 ? -25.711 6.576  15.376 1.00 31.83  ? 1018 GLN A OE1 1 
ATOM   901  N NE2 . GLN A 1 122 ? -25.522 7.299  13.258 1.00 22.69  ? 1018 GLN A NE2 1 
ATOM   902  N N   . LEU A 1 123 ? -29.150 10.989 17.364 1.00 17.46  ? 1019 LEU A N   1 
ATOM   903  C CA  . LEU A 1 123 ? -29.131 11.966 18.441 1.00 18.45  ? 1019 LEU A CA  1 
ATOM   904  C C   . LEU A 1 123 ? -28.201 11.484 19.543 1.00 19.45  ? 1019 LEU A C   1 
ATOM   905  O O   . LEU A 1 123 ? -28.231 10.320 19.931 1.00 21.04  ? 1019 LEU A O   1 
ATOM   906  C CB  . LEU A 1 123 ? -30.539 12.167 19.006 1.00 19.52  ? 1019 LEU A CB  1 
ATOM   907  C CG  . LEU A 1 123 ? -31.613 12.660 18.037 1.00 18.38  ? 1019 LEU A CG  1 
ATOM   908  C CD1 . LEU A 1 123 ? -32.922 12.846 18.800 1.00 30.48  ? 1019 LEU A CD1 1 
ATOM   909  C CD2 . LEU A 1 123 ? -31.185 13.973 17.399 1.00 21.63  ? 1019 LEU A CD2 1 
ATOM   910  N N   . LYS A 1 124 ? -27.370 12.385 20.043 1.00 19.24  ? 1020 LYS A N   1 
ATOM   911  C CA  . LYS A 1 124 ? -26.430 12.041 21.101 1.00 18.56  ? 1020 LYS A CA  1 
ATOM   912  C C   . LYS A 1 124 ? -26.190 13.220 22.008 1.00 18.43  ? 1020 LYS A C   1 
ATOM   913  O O   . LYS A 1 124 ? -26.600 14.341 21.708 1.00 20.62  ? 1020 LYS A O   1 
ATOM   914  C CB  . LYS A 1 124 ? -25.096 11.601 20.498 1.00 18.45  ? 1020 LYS A CB  1 
ATOM   915  C CG  . LYS A 1 124 ? -25.174 10.277 19.765 1.00 23.80  ? 1020 LYS A CG  1 
ATOM   916  C CD  . LYS A 1 124 ? -23.958 10.040 18.906 1.00 30.36  ? 1020 LYS A CD  1 
ATOM   917  C CE  . LYS A 1 124 ? -24.082 8.712  18.184 1.00 35.29  ? 1020 LYS A CE  1 
ATOM   918  N NZ  . LYS A 1 124 ? -24.225 7.593  19.154 1.00 42.59  ? 1020 LYS A NZ  1 
ATOM   919  N N   . GLU A 1 125 ? -25.547 12.950 23.137 1.00 19.23  ? 1021 GLU A N   1 
ATOM   920  C CA  . GLU A 1 125 ? -25.189 13.994 24.077 1.00 20.20  ? 1021 GLU A CA  1 
ATOM   921  C C   . GLU A 1 125 ? -23.678 14.132 23.959 1.00 20.76  ? 1021 GLU A C   1 
ATOM   922  O O   . GLU A 1 125 ? -22.968 13.137 23.774 1.00 22.95  ? 1021 GLU A O   1 
ATOM   923  C CB  . GLU A 1 125 ? -25.560 13.604 25.509 1.00 25.04  ? 1021 GLU A CB  1 
ATOM   924  C CG  . GLU A 1 125 ? -27.053 13.603 25.784 1.00 39.82  ? 1021 GLU A CG  1 
ATOM   925  C CD  . GLU A 1 125 ? -27.375 13.455 27.260 1.00 48.22  ? 1021 GLU A CD  1 
ATOM   926  O OE1 . GLU A 1 125 ? -27.148 12.359 27.821 1.00 50.44  ? 1021 GLU A OE1 1 
ATOM   927  O OE2 . GLU A 1 125 ? -27.849 14.444 27.858 1.00 45.57  ? 1021 GLU A OE2 1 
ATOM   928  N N   . ALA A 1 126 ? -23.191 15.360 24.049 1.00 18.52  ? 1022 ALA A N   1 
ATOM   929  C CA  . ALA A 1 126 ? -21.763 15.618 23.955 1.00 18.91  ? 1022 ALA A CA  1 
ATOM   930  C C   . ALA A 1 126 ? -21.351 16.710 24.930 1.00 19.97  ? 1022 ALA A C   1 
ATOM   931  O O   . ALA A 1 126 ? -22.178 17.503 25.392 1.00 20.53  ? 1022 ALA A O   1 
ATOM   932  C CB  . ALA A 1 126 ? -21.401 16.022 22.549 1.00 15.59  ? 1022 ALA A CB  1 
ATOM   933  N N   . LEU A 1 127 ? -20.057 16.753 25.220 1.00 21.36  ? 1023 LEU A N   1 
ATOM   934  C CA  . LEU A 1 127 ? -19.497 17.721 26.144 1.00 20.07  ? 1023 LEU A CA  1 
ATOM   935  C C   . LEU A 1 127 ? -18.842 18.884 25.404 1.00 20.84  ? 1023 LEU A C   1 
ATOM   936  O O   . LEU A 1 127 ? -17.991 18.668 24.537 1.00 23.43  ? 1023 LEU A O   1 
ATOM   937  C CB  . LEU A 1 127 ? -18.459 17.010 27.023 1.00 22.97  ? 1023 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 127 ? -17.783 17.759 28.172 1.00 31.87  ? 1023 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 127 ? -18.836 18.167 29.188 1.00 35.91  ? 1023 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 127 ? -16.726 16.858 28.829 1.00 24.56  ? 1023 LEU A CD2 1 
ATOM   941  N N   . LEU A 1 128 ? -19.244 20.114 25.720 1.00 19.68  ? 1024 LEU A N   1 
ATOM   942  C CA  . LEU A 1 128 ? -18.620 21.282 25.096 1.00 18.76  ? 1024 LEU A CA  1 
ATOM   943  C C   . LEU A 1 128 ? -17.257 21.380 25.784 1.00 20.23  ? 1024 LEU A C   1 
ATOM   944  O O   . LEU A 1 128 ? -17.164 21.704 26.975 1.00 19.57  ? 1024 LEU A O   1 
ATOM   945  C CB  . LEU A 1 128 ? -19.449 22.541 25.346 1.00 23.77  ? 1024 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 128 ? -20.843 22.536 24.712 1.00 19.18  ? 1024 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 128 ? -21.517 23.867 25.002 1.00 20.18  ? 1024 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 128 ? -20.758 22.290 23.210 1.00 20.02  ? 1024 LEU A CD2 1 
ATOM   949  N N   . ASP A 1 129 ? -16.207 21.089 25.022 1.00 17.80  ? 1025 ASP A N   1 
ATOM   950  C CA  . ASP A 1 129 ? -14.844 21.047 25.539 1.00 18.21  ? 1025 ASP A CA  1 
ATOM   951  C C   . ASP A 1 129 ? -13.875 22.088 24.957 1.00 16.79  ? 1025 ASP A C   1 
ATOM   952  O O   . ASP A 1 129 ? -13.277 21.872 23.902 1.00 17.50  ? 1025 ASP A O   1 
ATOM   953  C CB  . ASP A 1 129 ? -14.294 19.647 25.274 1.00 19.20  ? 1025 ASP A CB  1 
ATOM   954  C CG  . ASP A 1 129 ? -13.017 19.372 26.015 1.00 22.30  ? 1025 ASP A CG  1 
ATOM   955  O OD1 . ASP A 1 129 ? -12.334 20.333 26.411 1.00 26.56  ? 1025 ASP A OD1 1 
ATOM   956  O OD2 . ASP A 1 129 ? -12.696 18.186 26.189 1.00 25.47  ? 1025 ASP A OD2 1 
ATOM   957  N N   . THR A 1 130 ? -13.698 23.198 25.665 1.00 17.55  ? 1026 THR A N   1 
ATOM   958  C CA  . THR A 1 130 ? -12.799 24.256 25.221 1.00 16.26  ? 1026 THR A CA  1 
ATOM   959  C C   . THR A 1 130 ? -11.341 23.817 25.229 1.00 17.06  ? 1026 THR A C   1 
ATOM   960  O O   . THR A 1 130 ? -10.503 24.453 24.602 1.00 17.79  ? 1026 THR A O   1 
ATOM   961  C CB  . THR A 1 130 ? -12.917 25.517 26.111 1.00 14.87  ? 1026 THR A CB  1 
ATOM   962  O OG1 . THR A 1 130 ? -12.693 25.161 27.481 1.00 17.32  ? 1026 THR A OG1 1 
ATOM   963  C CG2 . THR A 1 130 ? -14.294 26.155 25.959 1.00 18.50  ? 1026 THR A CG2 1 
ATOM   964  N N   . GLY A 1 131 ? -11.038 22.736 25.943 1.00 17.58  ? 1027 GLY A N   1 
ATOM   965  C CA  . GLY A 1 131 ? -9.671  22.256 26.003 1.00 18.23  ? 1027 GLY A CA  1 
ATOM   966  C C   . GLY A 1 131 ? -9.307  21.330 24.856 1.00 21.67  ? 1027 GLY A C   1 
ATOM   967  O O   . GLY A 1 131 ? -8.145  20.955 24.699 1.00 22.97  ? 1027 GLY A O   1 
ATOM   968  N N   . ALA A 1 132 ? -10.299 20.967 24.047 1.00 19.85  ? 1028 ALA A N   1 
ATOM   969  C CA  . ALA A 1 132 ? -10.081 20.072 22.918 1.00 19.38  ? 1028 ALA A CA  1 
ATOM   970  C C   . ALA A 1 132 ? -10.019 20.833 21.598 1.00 19.76  ? 1028 ALA A C   1 
ATOM   971  O O   . ALA A 1 132 ? -10.895 21.635 21.292 1.00 14.99  ? 1028 ALA A O   1 
ATOM   972  C CB  . ALA A 1 132 ? -11.200 19.024 22.864 1.00 19.40  ? 1028 ALA A CB  1 
ATOM   973  N N   . ASP A 1 133 ? -8.972  20.577 20.820 1.00 21.12  ? 1029 ASP A N   1 
ATOM   974  C CA  . ASP A 1 133 ? -8.804  21.222 19.524 1.00 21.85  ? 1029 ASP A CA  1 
ATOM   975  C C   . ASP A 1 133 ? -9.795  20.611 18.551 1.00 22.57  ? 1029 ASP A C   1 
ATOM   976  O O   . ASP A 1 133 ? -10.377 21.299 17.706 1.00 22.87  ? 1029 ASP A O   1 
ATOM   977  C CB  . ASP A 1 133 ? -7.400  20.964 18.970 1.00 20.13  ? 1029 ASP A CB  1 
ATOM   978  C CG  . ASP A 1 133 ? -6.304  21.572 19.821 1.00 27.86  ? 1029 ASP A CG  1 
ATOM   979  O OD1 . ASP A 1 133 ? -5.140  21.170 19.625 1.00 33.42  ? 1029 ASP A OD1 1 
ATOM   980  O OD2 . ASP A 1 133 ? -6.594  22.448 20.669 1.00 27.32  ? 1029 ASP A OD2 1 
ATOM   981  N N   . ASP A 1 134 ? -9.965  19.300 18.684 1.00 21.61  ? 1030 ASP A N   1 
ATOM   982  C CA  . ASP A 1 134 ? -10.828 18.531 17.803 1.00 23.50  ? 1030 ASP A CA  1 
ATOM   983  C C   . ASP A 1 134 ? -12.078 18.006 18.477 1.00 23.03  ? 1030 ASP A C   1 
ATOM   984  O O   . ASP A 1 134 ? -12.221 18.056 19.698 1.00 23.10  ? 1030 ASP A O   1 
ATOM   985  C CB  . ASP A 1 134 ? -10.046 17.346 17.238 1.00 23.46  ? 1030 ASP A CB  1 
ATOM   986  C CG  . ASP A 1 134 ? -8.766  17.771 16.548 1.00 27.47  ? 1030 ASP A CG  1 
ATOM   987  O OD1 . ASP A 1 134 ? -7.783  17.008 16.612 1.00 34.90  ? 1030 ASP A OD1 1 
ATOM   988  O OD2 . ASP A 1 134 ? -8.744  18.862 15.937 1.00 36.52  ? 1030 ASP A OD2 1 
ATOM   989  N N   . THR A 1 135 ? -12.986 17.506 17.648 1.00 21.65  ? 1031 THR A N   1 
ATOM   990  C CA  . THR A 1 135 ? -14.227 16.934 18.112 1.00 19.75  ? 1031 THR A CA  1 
ATOM   991  C C   . THR A 1 135 ? -14.057 15.420 18.030 1.00 19.87  ? 1031 THR A C   1 
ATOM   992  O O   . THR A 1 135 ? -13.687 14.881 16.992 1.00 18.61  ? 1031 THR A O   1 
ATOM   993  C CB  . THR A 1 135 ? -15.393 17.409 17.236 1.00 13.96  ? 1031 THR A CB  1 
ATOM   994  O OG1 . THR A 1 135 ? -15.631 18.802 17.484 1.00 16.88  ? 1031 THR A OG1 1 
ATOM   995  C CG2 . THR A 1 135 ? -16.647 16.605 17.531 1.00 17.64  ? 1031 THR A CG2 1 
ATOM   996  N N   . VAL A 1 136 ? -14.306 14.742 19.140 1.00 20.80  ? 1032 VAL A N   1 
ATOM   997  C CA  . VAL A 1 136 ? -14.139 13.295 19.193 1.00 20.36  ? 1032 VAL A CA  1 
ATOM   998  C C   . VAL A 1 136 ? -15.396 12.635 19.741 1.00 19.67  ? 1032 VAL A C   1 
ATOM   999  O O   . VAL A 1 136 ? -15.854 12.978 20.832 1.00 18.14  ? 1032 VAL A O   1 
ATOM   1000 C CB  . VAL A 1 136 ? -12.940 12.927 20.097 1.00 25.25  ? 1032 VAL A CB  1 
ATOM   1001 C CG1 . VAL A 1 136 ? -12.613 11.440 19.968 1.00 21.76  ? 1032 VAL A CG1 1 
ATOM   1002 C CG2 . VAL A 1 136 ? -11.744 13.785 19.730 1.00 18.06  ? 1032 VAL A CG2 1 
ATOM   1003 N N   . LEU A 1 137 ? -15.950 11.692 18.982 1.00 19.78  ? 1033 LEU A N   1 
ATOM   1004 C CA  . LEU A 1 137 ? -17.165 10.999 19.403 1.00 22.21  ? 1033 LEU A CA  1 
ATOM   1005 C C   . LEU A 1 137 ? -16.941 9.501  19.580 1.00 23.46  ? 1033 LEU A C   1 
ATOM   1006 O O   . LEU A 1 137 ? -16.108 8.904  18.893 1.00 22.83  ? 1033 LEU A O   1 
ATOM   1007 C CB  . LEU A 1 137 ? -18.278 11.212 18.371 1.00 26.68  ? 1033 LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 137 ? -18.652 12.649 18.000 1.00 30.35  ? 1033 LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 137 ? -19.777 12.626 16.984 1.00 30.39  ? 1033 LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 137 ? -19.068 13.418 19.242 1.00 30.66  ? 1033 LEU A CD2 1 
ATOM   1011 N N   . GLU A 1 138 ? -17.700 8.903  20.494 1.00 22.39  ? 1034 GLU A N   1 
ATOM   1012 C CA  . GLU A 1 138 ? -17.608 7.473  20.753 1.00 25.79  ? 1034 GLU A CA  1 
ATOM   1013 C C   . GLU A 1 138 ? -18.023 6.724  19.493 1.00 26.84  ? 1034 GLU A C   1 
ATOM   1014 O O   . GLU A 1 138 ? -18.781 7.247  18.681 1.00 26.97  ? 1034 GLU A O   1 
ATOM   1015 C CB  . GLU A 1 138 ? -18.533 7.080  21.908 1.00 27.93  ? 1034 GLU A CB  1 
ATOM   1016 C CG  . GLU A 1 138 ? -18.224 7.772  23.226 1.00 42.28  ? 1034 GLU A CG  1 
ATOM   1017 C CD  . GLU A 1 138 ? -19.154 7.338  24.347 1.00 57.38  ? 1034 GLU A CD  1 
ATOM   1018 O OE1 . GLU A 1 138 ? -20.380 7.558  24.226 1.00 58.95  ? 1034 GLU A OE1 1 
ATOM   1019 O OE2 . GLU A 1 138 ? -18.659 6.775  25.348 1.00 62.62  ? 1034 GLU A OE2 1 
ATOM   1020 N N   . GLU A 1 139 ? -17.521 5.504  19.329 1.00 28.36  ? 1035 GLU A N   1 
ATOM   1021 C CA  . GLU A 1 139 ? -17.849 4.694  18.157 1.00 29.52  ? 1035 GLU A CA  1 
ATOM   1022 C C   . GLU A 1 139 ? -19.325 4.820  17.783 1.00 28.41  ? 1035 GLU A C   1 
ATOM   1023 O O   . GLU A 1 139 ? -20.203 4.713  18.635 1.00 27.90  ? 1035 GLU A O   1 
ATOM   1024 C CB  . GLU A 1 139 ? -17.504 3.221  18.415 1.00 38.77  ? 1035 GLU A CB  1 
ATOM   1025 C CG  . GLU A 1 139 ? -17.993 2.259  17.338 1.00 48.62  ? 1035 GLU A CG  1 
ATOM   1026 C CD  . GLU A 1 139 ? -17.428 2.567  15.962 1.00 60.11  ? 1035 GLU A CD  1 
ATOM   1027 O OE1 . GLU A 1 139 ? -17.798 1.860  15.002 1.00 71.16  ? 1035 GLU A OE1 1 
ATOM   1028 O OE2 . GLU A 1 139 ? -16.617 3.509  15.836 1.00 65.82  ? 1035 GLU A OE2 1 
ATOM   1029 N N   . MET A 1 140 ? -19.583 5.052  16.500 1.00 30.08  ? 1036 MET A N   1 
ATOM   1030 C CA  . MET A 1 140 ? -20.942 5.200  15.999 1.00 31.26  ? 1036 MET A CA  1 
ATOM   1031 C C   . MET A 1 140 ? -20.941 5.007  14.489 1.00 32.39  ? 1036 MET A C   1 
ATOM   1032 O O   . MET A 1 140 ? -19.889 5.062  13.855 1.00 32.13  ? 1036 MET A O   1 
ATOM   1033 C CB  . MET A 1 140 ? -21.475 6.595  16.324 1.00 29.92  ? 1036 MET A CB  1 
ATOM   1034 C CG  . MET A 1 140 ? -20.729 7.708  15.605 1.00 34.27  ? 1036 MET A CG  1 
ATOM   1035 S SD  . MET A 1 140 ? -21.466 9.323  15.871 1.00 39.47  ? 1036 MET A SD  1 
ATOM   1036 C CE  . MET A 1 140 ? -22.764 9.328  14.605 1.00 37.66  ? 1036 MET A CE  1 
ATOM   1037 N N   . SER A 1 141 ? -22.125 4.787  13.922 1.00 35.47  ? 1037 SER A N   1 
ATOM   1038 C CA  . SER A 1 141 ? -22.274 4.591  12.484 1.00 35.57  ? 1037 SER A CA  1 
ATOM   1039 C C   . SER A 1 141 ? -22.299 5.930  11.764 1.00 36.96  ? 1037 SER A C   1 
ATOM   1040 O O   . SER A 1 141 ? -23.205 6.737  11.971 1.00 36.82  ? 1037 SER A O   1 
ATOM   1041 C CB  . SER A 1 141 ? -23.568 3.828  12.183 1.00 40.05  ? 1037 SER A CB  1 
ATOM   1042 O OG  . SER A 1 141 ? -23.822 3.790  10.785 1.00 42.34  ? 1037 SER A OG  1 
ATOM   1043 N N   . LEU A 1 142 ? -21.305 6.158  10.911 1.00 38.96  ? 1038 LEU A N   1 
ATOM   1044 C CA  . LEU A 1 142 ? -21.213 7.404  10.168 1.00 42.06  ? 1038 LEU A CA  1 
ATOM   1045 C C   . LEU A 1 142 ? -21.068 7.132  8.673  1.00 45.36  ? 1038 LEU A C   1 
ATOM   1046 O O   . LEU A 1 142 ? -20.316 6.248  8.263  1.00 46.80  ? 1038 LEU A O   1 
ATOM   1047 C CB  . LEU A 1 142 ? -20.019 8.218  10.673 1.00 41.76  ? 1038 LEU A CB  1 
ATOM   1048 C CG  . LEU A 1 142 ? -20.204 9.736  10.733 1.00 43.84  ? 1038 LEU A CG  1 
ATOM   1049 C CD1 . LEU A 1 142 ? -21.414 10.062 11.595 1.00 42.30  ? 1038 LEU A CD1 1 
ATOM   1050 C CD2 . LEU A 1 142 ? -18.954 10.391 11.307 1.00 36.27  ? 1038 LEU A CD2 1 
ATOM   1051 N N   . PRO A 1 143 ? -21.800 7.884  7.839  1.00 47.67  ? 1039 PRO A N   1 
ATOM   1052 C CA  . PRO A 1 143 ? -21.744 7.715  6.383  1.00 50.34  ? 1039 PRO A CA  1 
ATOM   1053 C C   . PRO A 1 143 ? -20.463 8.296  5.791  1.00 50.99  ? 1039 PRO A C   1 
ATOM   1054 O O   . PRO A 1 143 ? -19.875 9.221  6.352  1.00 51.19  ? 1039 PRO A O   1 
ATOM   1055 C CB  . PRO A 1 143 ? -23.034 8.385  5.909  1.00 50.62  ? 1039 PRO A CB  1 
ATOM   1056 C CG  . PRO A 1 143 ? -23.307 9.435  6.932  1.00 52.52  ? 1039 PRO A CG  1 
ATOM   1057 C CD  . PRO A 1 143 ? -22.717 8.928  8.218  1.00 51.59  ? 1039 PRO A CD  1 
ATOM   1058 N N   . GLY A 1 144 ? -20.033 7.750  4.659  1.00 52.40  ? 1040 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 144 ? -18.846 8.268  4.004  1.00 53.02  ? 1040 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 144 ? -17.524 7.572  4.258  1.00 53.54  ? 1040 GLY A C   1 
ATOM   1061 O O   . GLY A 1 144 ? -17.450 6.540  4.930  1.00 53.43  ? 1040 GLY A O   1 
ATOM   1062 N N   . ARG A 1 145 ? -16.471 8.163  3.704  1.00 52.98  ? 1041 ARG A N   1 
ATOM   1063 C CA  . ARG A 1 145 ? -15.119 7.640  3.825  1.00 53.48  ? 1041 ARG A CA  1 
ATOM   1064 C C   . ARG A 1 145 ? -14.369 8.329  4.963  1.00 51.76  ? 1041 ARG A C   1 
ATOM   1065 O O   . ARG A 1 145 ? -14.677 9.464  5.324  1.00 50.36  ? 1041 ARG A O   1 
ATOM   1066 C CB  . ARG A 1 145 ? -14.376 7.850  2.504  1.00 57.91  ? 1041 ARG A CB  1 
ATOM   1067 C CG  . ARG A 1 145 ? -13.027 7.162  2.413  1.00 74.40  ? 1041 ARG A CG  1 
ATOM   1068 C CD  . ARG A 1 145 ? -12.485 7.251  0.993  1.00 86.13  ? 1041 ARG A CD  1 
ATOM   1069 N NE  . ARG A 1 145 ? -13.416 6.670  0.028  1.00 93.67  ? 1041 ARG A NE  1 
ATOM   1070 C CZ  . ARG A 1 145 ? -13.223 6.658  -1.287 1.00 97.60  ? 1041 ARG A CZ  1 
ATOM   1071 N NH1 . ARG A 1 145 ? -12.128 7.199  -1.805 1.00 101.40 ? 1041 ARG A NH1 1 
ATOM   1072 N NH2 . ARG A 1 145 ? -14.126 6.104  -2.085 1.00 98.68  ? 1041 ARG A NH2 1 
ATOM   1073 N N   . TRP A 1 146 ? -13.385 7.634  5.520  1.00 51.13  ? 1042 TRP A N   1 
ATOM   1074 C CA  . TRP A 1 146 ? -12.587 8.165  6.618  1.00 50.31  ? 1042 TRP A CA  1 
ATOM   1075 C C   . TRP A 1 146 ? -11.120 7.796  6.450  1.00 50.20  ? 1042 TRP A C   1 
ATOM   1076 O O   . TRP A 1 146 ? -10.777 6.926  5.650  1.00 50.81  ? 1042 TRP A O   1 
ATOM   1077 C CB  . TRP A 1 146 ? -13.088 7.612  7.951  1.00 49.56  ? 1042 TRP A CB  1 
ATOM   1078 C CG  . TRP A 1 146 ? -13.174 6.117  7.970  1.00 50.92  ? 1042 TRP A CG  1 
ATOM   1079 C CD1 . TRP A 1 146 ? -14.180 5.348  7.461  1.00 51.92  ? 1042 TRP A CD1 1 
ATOM   1080 C CD2 . TRP A 1 146 ? -12.195 5.207  8.490  1.00 49.99  ? 1042 TRP A CD2 1 
ATOM   1081 N NE1 . TRP A 1 146 ? -13.890 4.015  7.631  1.00 54.83  ? 1042 TRP A NE1 1 
ATOM   1082 C CE2 . TRP A 1 146 ? -12.680 3.900  8.257  1.00 53.66  ? 1042 TRP A CE2 1 
ATOM   1083 C CE3 . TRP A 1 146 ? -10.958 5.370  9.125  1.00 49.77  ? 1042 TRP A CE3 1 
ATOM   1084 C CZ2 . TRP A 1 146 ? -11.963 2.758  8.642  1.00 53.25  ? 1042 TRP A CZ2 1 
ATOM   1085 C CZ3 . TRP A 1 146 ? -10.247 4.234  9.507  1.00 51.17  ? 1042 TRP A CZ3 1 
ATOM   1086 C CH2 . TRP A 1 146 ? -10.754 2.945  9.263  1.00 48.84  ? 1042 TRP A CH2 1 
ATOM   1087 N N   . LYS A 1 147 ? -10.257 8.464  7.208  1.00 49.26  ? 1043 LYS A N   1 
ATOM   1088 C CA  . LYS A 1 147 ? -8.824  8.197  7.156  1.00 48.64  ? 1043 LYS A CA  1 
ATOM   1089 C C   . LYS A 1 147 ? -8.271  7.947  8.555  1.00 47.58  ? 1043 LYS A C   1 
ATOM   1090 O O   . LYS A 1 147 ? -8.610  8.654  9.502  1.00 47.61  ? 1043 LYS A O   1 
ATOM   1091 C CB  . LYS A 1 147 ? -8.084  9.368  6.505  1.00 44.90  ? 1043 LYS A CB  1 
ATOM   1092 C CG  . LYS A 1 147 ? -8.461  9.590  5.049  1.00 53.99  ? 1043 LYS A CG  1 
ATOM   1093 C CD  . LYS A 1 147 ? -7.590  10.643 4.370  1.00 55.53  ? 1043 LYS A CD  1 
ATOM   1094 C CE  . LYS A 1 147 ? -7.827  12.041 4.930  1.00 48.08  ? 1043 LYS A CE  1 
ATOM   1095 N NZ  . LYS A 1 147 ? -7.375  12.176 6.337  1.00 51.10  ? 1043 LYS A NZ  1 
ATOM   1096 N N   . PRO A 1 148 ? -7.421  6.919  8.702  1.00 47.62  ? 1044 PRO A N   1 
ATOM   1097 C CA  . PRO A 1 148 ? -6.821  6.580  9.995  1.00 46.00  ? 1044 PRO A CA  1 
ATOM   1098 C C   . PRO A 1 148 ? -6.095  7.777  10.596 1.00 44.23  ? 1044 PRO A C   1 
ATOM   1099 O O   . PRO A 1 148 ? -5.475  8.563  9.881  1.00 43.50  ? 1044 PRO A O   1 
ATOM   1100 C CB  . PRO A 1 148 ? -5.867  5.446  9.638  1.00 47.11  ? 1044 PRO A CB  1 
ATOM   1101 C CG  . PRO A 1 148 ? -6.571  4.771  8.512  1.00 49.52  ? 1044 PRO A CG  1 
ATOM   1102 C CD  . PRO A 1 148 ? -7.017  5.943  7.675  1.00 48.64  ? 1044 PRO A CD  1 
ATOM   1103 N N   . LYS A 1 149 ? -6.182  7.921  11.912 1.00 43.36  ? 1045 LYS A N   1 
ATOM   1104 C CA  . LYS A 1 149 ? -5.517  9.028  12.580 1.00 42.03  ? 1045 LYS A CA  1 
ATOM   1105 C C   . LYS A 1 149 ? -5.429  8.772  14.076 1.00 40.43  ? 1045 LYS A C   1 
ATOM   1106 O O   . LYS A 1 149 ? -6.298  8.129  14.661 1.00 40.75  ? 1045 LYS A O   1 
ATOM   1107 C CB  . LYS A 1 149 ? -6.268  10.336 12.316 1.00 42.87  ? 1045 LYS A CB  1 
ATOM   1108 C CG  . LYS A 1 149 ? -5.574  11.574 12.872 1.00 48.03  ? 1045 LYS A CG  1 
ATOM   1109 C CD  . LYS A 1 149 ? -6.417  12.830 12.692 1.00 51.08  ? 1045 LYS A CD  1 
ATOM   1110 C CE  . LYS A 1 149 ? -5.729  14.047 13.299 1.00 56.01  ? 1045 LYS A CE  1 
ATOM   1111 N NZ  . LYS A 1 149 ? -6.585  15.265 13.257 1.00 53.42  ? 1045 LYS A NZ  1 
ATOM   1112 N N   . MET A 1 150 ? -4.363  9.264  14.693 1.00 39.21  ? 1046 MET A N   1 
ATOM   1113 C CA  . MET A 1 150 ? -4.183  9.091  16.122 1.00 37.12  ? 1046 MET A CA  1 
ATOM   1114 C C   . MET A 1 150 ? -4.177  10.443 16.809 1.00 34.21  ? 1046 MET A C   1 
ATOM   1115 O O   . MET A 1 150 ? -3.675  11.427 16.269 1.00 36.58  ? 1046 MET A O   1 
ATOM   1116 C CB  . MET A 1 150 ? -2.876  8.353  16.421 1.00 42.66  ? 1046 MET A CB  1 
ATOM   1117 C CG  . MET A 1 150 ? -2.910  6.874  16.074 1.00 50.51  ? 1046 MET A CG  1 
ATOM   1118 S SD  . MET A 1 150 ? -1.390  6.033  16.532 1.00 61.61  ? 1046 MET A SD  1 
ATOM   1119 C CE  . MET A 1 150 ? -0.389  6.365  15.083 1.00 55.41  ? 1046 MET A CE  1 
ATOM   1120 N N   . ILE A 1 151 ? -4.765  10.492 17.993 1.00 31.06  ? 1047 ILE A N   1 
ATOM   1121 C CA  . ILE A 1 151 ? -4.802  11.721 18.760 1.00 27.00  ? 1047 ILE A CA  1 
ATOM   1122 C C   . ILE A 1 151 ? -4.395  11.400 20.189 1.00 26.00  ? 1047 ILE A C   1 
ATOM   1123 O O   . ILE A 1 151 ? -4.666  10.310 20.696 1.00 24.90  ? 1047 ILE A O   1 
ATOM   1124 C CB  . ILE A 1 151 ? -6.210  12.368 18.750 1.00 25.49  ? 1047 ILE A CB  1 
ATOM   1125 C CG1 . ILE A 1 151 ? -7.253  11.376 19.267 1.00 29.15  ? 1047 ILE A CG1 1 
ATOM   1126 C CG2 . ILE A 1 151 ? -6.548  12.855 17.342 1.00 23.78  ? 1047 ILE A CG2 1 
ATOM   1127 C CD1 . ILE A 1 151 ? -8.650  11.953 19.357 1.00 33.29  ? 1047 ILE A CD1 1 
ATOM   1128 N N   . GLY A 1 152 ? -3.726  12.347 20.830 1.00 26.57  ? 1048 GLY A N   1 
ATOM   1129 C CA  . GLY A 1 152 ? -3.291  12.135 22.196 1.00 28.46  ? 1048 GLY A CA  1 
ATOM   1130 C C   . GLY A 1 152 ? -4.239  12.767 23.192 1.00 28.75  ? 1048 GLY A C   1 
ATOM   1131 O O   . GLY A 1 152 ? -5.162  13.484 22.823 1.00 28.65  ? 1048 GLY A O   1 
ATOM   1132 N N   . GLY A 1 153 ? -4.010  12.480 24.464 1.00 31.14  ? 1049 GLY A N   1 
ATOM   1133 C CA  . GLY A 1 153 ? -4.839  13.021 25.518 1.00 32.37  ? 1049 GLY A CA  1 
ATOM   1134 C C   . GLY A 1 153 ? -4.118  12.775 26.823 1.00 33.90  ? 1049 GLY A C   1 
ATOM   1135 O O   . GLY A 1 153 ? -2.959  12.370 26.826 1.00 33.24  ? 1049 GLY A O   1 
ATOM   1136 N N   . ILE A 1 154 ? -4.807  13.006 27.931 1.00 34.90  ? 1050 ILE A N   1 
ATOM   1137 C CA  . ILE A 1 154 ? -4.232  12.814 29.254 1.00 37.26  ? 1050 ILE A CA  1 
ATOM   1138 C C   . ILE A 1 154 ? -3.633  11.432 29.505 1.00 36.74  ? 1050 ILE A C   1 
ATOM   1139 O O   . ILE A 1 154 ? -2.541  11.318 30.061 1.00 40.00  ? 1050 ILE A O   1 
ATOM   1140 C CB  . ILE A 1 154 ? -5.290  13.087 30.333 1.00 40.66  ? 1050 ILE A CB  1 
ATOM   1141 C CG1 . ILE A 1 154 ? -5.636  14.567 30.326 1.00 49.39  ? 1050 ILE A CG1 1 
ATOM   1142 C CG2 . ILE A 1 154 ? -4.782  12.656 31.704 1.00 47.72  ? 1050 ILE A CG2 1 
ATOM   1143 C CD1 . ILE A 1 154 ? -4.531  15.452 30.834 1.00 53.51  ? 1050 ILE A CD1 1 
ATOM   1144 N N   . GLY A 1 155 ? -4.344  10.386 29.102 1.00 34.64  ? 1051 GLY A N   1 
ATOM   1145 C CA  . GLY A 1 155 ? -3.848  9.043  29.331 1.00 32.90  ? 1051 GLY A CA  1 
ATOM   1146 C C   . GLY A 1 155 ? -3.005  8.440  28.223 1.00 32.32  ? 1051 GLY A C   1 
ATOM   1147 O O   . GLY A 1 155 ? -2.585  7.288  28.325 1.00 34.25  ? 1051 GLY A O   1 
ATOM   1148 N N   . GLY A 1 156 ? -2.748  9.204  27.167 1.00 29.53  ? 1052 GLY A N   1 
ATOM   1149 C CA  . GLY A 1 156 ? -1.954  8.687  26.065 1.00 27.45  ? 1052 GLY A CA  1 
ATOM   1150 C C   . GLY A 1 156 ? -2.592  8.972  24.714 1.00 27.39  ? 1052 GLY A C   1 
ATOM   1151 O O   . GLY A 1 156 ? -3.059  10.080 24.464 1.00 27.59  ? 1052 GLY A O   1 
ATOM   1152 N N   . PHE A 1 157 ? -2.623  7.979  23.835 1.00 27.52  ? 1053 PHE A N   1 
ATOM   1153 C CA  . PHE A 1 157 ? -3.206  8.172  22.511 1.00 27.33  ? 1053 PHE A CA  1 
ATOM   1154 C C   . PHE A 1 157 ? -4.233  7.106  22.153 1.00 28.75  ? 1053 PHE A C   1 
ATOM   1155 O O   . PHE A 1 157 ? -4.234  6.008  22.708 1.00 27.30  ? 1053 PHE A O   1 
ATOM   1156 C CB  . PHE A 1 157 ? -2.113  8.159  21.435 1.00 26.98  ? 1053 PHE A CB  1 
ATOM   1157 C CG  . PHE A 1 157 ? -1.153  9.318  21.512 1.00 34.61  ? 1053 PHE A CG  1 
ATOM   1158 C CD1 . PHE A 1 157 ? -0.315  9.479  22.611 1.00 41.48  ? 1053 PHE A CD1 1 
ATOM   1159 C CD2 . PHE A 1 157 ? -1.080  10.246 20.476 1.00 42.68  ? 1053 PHE A CD2 1 
ATOM   1160 C CE1 . PHE A 1 157 ? 0.588   10.542 22.675 1.00 43.30  ? 1053 PHE A CE1 1 
ATOM   1161 C CE2 . PHE A 1 157 ? -0.181  11.312 20.532 1.00 39.69  ? 1053 PHE A CE2 1 
ATOM   1162 C CZ  . PHE A 1 157 ? 0.652   11.460 21.636 1.00 36.33  ? 1053 PHE A CZ  1 
ATOM   1163 N N   . ILE A 1 158 ? -5.110  7.439  21.214 1.00 27.56  ? 1054 ILE A N   1 
ATOM   1164 C CA  . ILE A 1 158 ? -6.101  6.484  20.749 1.00 28.54  ? 1054 ILE A CA  1 
ATOM   1165 C C   . ILE A 1 158 ? -6.182  6.582  19.239 1.00 28.51  ? 1054 ILE A C   1 
ATOM   1166 O O   . ILE A 1 158 ? -5.926  7.639  18.654 1.00 27.40  ? 1054 ILE A O   1 
ATOM   1167 C CB  . ILE A 1 158 ? -7.514  6.746  21.329 1.00 26.26  ? 1054 ILE A CB  1 
ATOM   1168 C CG1 . ILE A 1 158 ? -8.009  8.132  20.914 1.00 32.13  ? 1054 ILE A CG1 1 
ATOM   1169 C CG2 . ILE A 1 158 ? -7.499  6.581  22.842 1.00 24.19  ? 1054 ILE A CG2 1 
ATOM   1170 C CD1 . ILE A 1 158 ? -9.473  8.370  21.227 1.00 23.83  ? 1054 ILE A CD1 1 
ATOM   1171 N N   . LYS A 1 159 ? -6.510  5.467  18.603 1.00 28.00  ? 1055 LYS A N   1 
ATOM   1172 C CA  . LYS A 1 159 ? -6.657  5.459  17.160 1.00 29.95  ? 1055 LYS A CA  1 
ATOM   1173 C C   . LYS A 1 159 ? -8.101  5.873  16.914 1.00 28.91  ? 1055 LYS A C   1 
ATOM   1174 O O   . LYS A 1 159 ? -9.010  5.391  17.587 1.00 29.48  ? 1055 LYS A O   1 
ATOM   1175 C CB  . LYS A 1 159 ? -6.415  4.057  16.593 1.00 31.82  ? 1055 LYS A CB  1 
ATOM   1176 C CG  . LYS A 1 159 ? -4.978  3.558  16.708 1.00 42.90  ? 1055 LYS A CG  1 
ATOM   1177 C CD  . LYS A 1 159 ? -4.827  2.196  16.027 1.00 49.35  ? 1055 LYS A CD  1 
ATOM   1178 C CE  . LYS A 1 159 ? -3.370  1.788  15.869 1.00 50.88  ? 1055 LYS A CE  1 
ATOM   1179 N NZ  . LYS A 1 159 ? -2.685  1.607  17.175 1.00 58.00  ? 1055 LYS A NZ  1 
ATOM   1180 N N   . VAL A 1 160 ? -8.311  6.772  15.965 1.00 28.88  ? 1056 VAL A N   1 
ATOM   1181 C CA  . VAL A 1 160 ? -9.658  7.226  15.660 1.00 30.80  ? 1056 VAL A CA  1 
ATOM   1182 C C   . VAL A 1 160 ? -9.874  7.257  14.161 1.00 31.94  ? 1056 VAL A C   1 
ATOM   1183 O O   . VAL A 1 160 ? -8.918  7.227  13.386 1.00 31.87  ? 1056 VAL A O   1 
ATOM   1184 C CB  . VAL A 1 160 ? -9.918  8.652  16.209 1.00 27.15  ? 1056 VAL A CB  1 
ATOM   1185 C CG1 . VAL A 1 160 ? -9.729  8.677  17.721 1.00 28.72  ? 1056 VAL A CG1 1 
ATOM   1186 C CG2 . VAL A 1 160 ? -8.987  9.645  15.532 1.00 20.81  ? 1056 VAL A CG2 1 
ATOM   1187 N N   . ARG A 1 161 ? -11.140 7.300  13.759 1.00 33.53  ? 1057 ARG A N   1 
ATOM   1188 C CA  . ARG A 1 161 ? -11.477 7.378  12.348 1.00 33.20  ? 1057 ARG A CA  1 
ATOM   1189 C C   . ARG A 1 161 ? -11.827 8.834  12.077 1.00 32.96  ? 1057 ARG A C   1 
ATOM   1190 O O   . ARG A 1 161 ? -12.683 9.409  12.745 1.00 32.95  ? 1057 ARG A O   1 
ATOM   1191 C CB  . ARG A 1 161 ? -12.670 6.474  12.020 1.00 35.85  ? 1057 ARG A CB  1 
ATOM   1192 C CG  . ARG A 1 161 ? -12.432 5.000  12.310 1.00 36.00  ? 1057 ARG A CG  1 
ATOM   1193 C CD  . ARG A 1 161 ? -13.382 4.119  11.502 1.00 37.90  ? 1057 ARG A CD  1 
ATOM   1194 N NE  . ARG A 1 161 ? -14.787 4.364  11.808 1.00 42.90  ? 1057 ARG A NE  1 
ATOM   1195 C CZ  . ARG A 1 161 ? -15.372 4.044  12.958 1.00 46.84  ? 1057 ARG A CZ  1 
ATOM   1196 N NH1 . ARG A 1 161 ? -14.673 3.461  13.923 1.00 56.69  ? 1057 ARG A NH1 1 
ATOM   1197 N NH2 . ARG A 1 161 ? -16.661 4.306  13.144 1.00 50.42  ? 1057 ARG A NH2 1 
ATOM   1198 N N   . GLN A 1 162 ? -11.156 9.439  11.107 1.00 33.68  ? 1058 GLN A N   1 
ATOM   1199 C CA  . GLN A 1 162 ? -11.416 10.833 10.790 1.00 32.89  ? 1058 GLN A CA  1 
ATOM   1200 C C   . GLN A 1 162 ? -12.363 11.035 9.615  1.00 33.81  ? 1058 GLN A C   1 
ATOM   1201 O O   . GLN A 1 162 ? -12.105 10.557 8.510  1.00 33.74  ? 1058 GLN A O   1 
ATOM   1202 C CB  . GLN A 1 162 ? -10.111 11.553 10.492 1.00 32.64  ? 1058 GLN A CB  1 
ATOM   1203 C CG  . GLN A 1 162 ? -10.279 13.037 10.265 1.00 32.78  ? 1058 GLN A CG  1 
ATOM   1204 C CD  . GLN A 1 162 ? -9.002  13.688 9.801  1.00 32.30  ? 1058 GLN A CD  1 
ATOM   1205 O OE1 . GLN A 1 162 ? -7.915  13.307 10.228 1.00 31.10  ? 1058 GLN A OE1 1 
ATOM   1206 N NE2 . GLN A 1 162 ? -9.123  14.686 8.933  1.00 35.69  ? 1058 GLN A NE2 1 
ATOM   1207 N N   . TYR A 1 163 ? -13.456 11.748 9.868  1.00 32.67  ? 1059 TYR A N   1 
ATOM   1208 C CA  . TYR A 1 163 ? -14.438 12.066 8.839  1.00 33.18  ? 1059 TYR A CA  1 
ATOM   1209 C C   . TYR A 1 163 ? -14.428 13.575 8.628  1.00 34.11  ? 1059 TYR A C   1 
ATOM   1210 O O   . TYR A 1 163 ? -14.535 14.343 9.585  1.00 33.43  ? 1059 TYR A O   1 
ATOM   1211 C CB  . TYR A 1 163 ? -15.848 11.642 9.262  1.00 28.53  ? 1059 TYR A CB  1 
ATOM   1212 C CG  . TYR A 1 163 ? -16.061 10.156 9.419  1.00 34.14  ? 1059 TYR A CG  1 
ATOM   1213 C CD1 . TYR A 1 163 ? -15.573 9.475  10.531 1.00 30.07  ? 1059 TYR A CD1 1 
ATOM   1214 C CD2 . TYR A 1 163 ? -16.781 9.433  8.466  1.00 41.22  ? 1059 TYR A CD2 1 
ATOM   1215 C CE1 . TYR A 1 163 ? -15.801 8.110  10.695 1.00 37.47  ? 1059 TYR A CE1 1 
ATOM   1216 C CE2 . TYR A 1 163 ? -17.013 8.070  8.619  1.00 34.95  ? 1059 TYR A CE2 1 
ATOM   1217 C CZ  . TYR A 1 163 ? -16.522 7.417  9.737  1.00 38.22  ? 1059 TYR A CZ  1 
ATOM   1218 O OH  . TYR A 1 163 ? -16.766 6.075  9.910  1.00 35.07  ? 1059 TYR A OH  1 
ATOM   1219 N N   . ASP A 1 164 ? -14.293 14.003 7.379  1.00 36.16  ? 1060 ASP A N   1 
ATOM   1220 C CA  . ASP A 1 164 ? -14.284 15.430 7.065  1.00 37.67  ? 1060 ASP A CA  1 
ATOM   1221 C C   . ASP A 1 164 ? -15.651 15.854 6.547  1.00 38.06  ? 1060 ASP A C   1 
ATOM   1222 O O   . ASP A 1 164 ? -16.496 15.014 6.232  1.00 40.05  ? 1060 ASP A O   1 
ATOM   1223 C CB  . ASP A 1 164 ? -13.234 15.741 5.994  1.00 45.60  ? 1060 ASP A CB  1 
ATOM   1224 C CG  . ASP A 1 164 ? -11.817 15.500 6.472  1.00 51.71  ? 1060 ASP A CG  1 
ATOM   1225 O OD1 . ASP A 1 164 ? -11.534 14.392 6.973  1.00 59.15  ? 1060 ASP A OD1 1 
ATOM   1226 O OD2 . ASP A 1 164 ? -10.983 16.418 6.338  1.00 59.26  ? 1060 ASP A OD2 1 
ATOM   1227 N N   . GLN A 1 165 ? -15.863 17.162 6.469  1.00 36.60  ? 1061 GLN A N   1 
ATOM   1228 C CA  . GLN A 1 165 ? -17.109 17.721 5.960  1.00 35.99  ? 1061 GLN A CA  1 
ATOM   1229 C C   . GLN A 1 165 ? -18.349 17.041 6.527  1.00 34.81  ? 1061 GLN A C   1 
ATOM   1230 O O   . GLN A 1 165 ? -19.258 16.673 5.784  1.00 34.10  ? 1061 GLN A O   1 
ATOM   1231 C CB  . GLN A 1 165 ? -17.138 17.616 4.432  1.00 42.02  ? 1061 GLN A CB  1 
ATOM   1232 C CG  . GLN A 1 165 ? -15.846 18.034 3.740  1.00 53.13  ? 1061 GLN A CG  1 
ATOM   1233 C CD  . GLN A 1 165 ? -15.445 19.464 4.048  1.00 68.25  ? 1061 GLN A CD  1 
ATOM   1234 O OE1 . GLN A 1 165 ? -15.187 19.814 5.200  1.00 77.46  ? 1061 GLN A OE1 1 
ATOM   1235 N NE2 . GLN A 1 165 ? -15.391 20.301 3.016  1.00 67.10  ? 1061 GLN A NE2 1 
ATOM   1236 N N   . ILE A 1 166 ? -18.395 16.870 7.840  1.00 31.19  ? 1062 ILE A N   1 
ATOM   1237 C CA  . ILE A 1 166 ? -19.552 16.238 8.454  1.00 28.23  ? 1062 ILE A CA  1 
ATOM   1238 C C   . ILE A 1 166 ? -20.507 17.280 9.023  1.00 25.53  ? 1062 ILE A C   1 
ATOM   1239 O O   . ILE A 1 166 ? -20.100 18.150 9.790  1.00 23.01  ? 1062 ILE A O   1 
ATOM   1240 C CB  . ILE A 1 166 ? -19.138 15.284 9.593  1.00 32.52  ? 1062 ILE A CB  1 
ATOM   1241 C CG1 . ILE A 1 166 ? -18.365 14.092 9.024  1.00 36.78  ? 1062 ILE A CG1 1 
ATOM   1242 C CG2 . ILE A 1 166 ? -20.375 14.806 10.342 1.00 31.25  ? 1062 ILE A CG2 1 
ATOM   1243 C CD1 . ILE A 1 166 ? -19.185 13.212 8.093  1.00 36.76  ? 1062 ILE A CD1 1 
ATOM   1244 N N   . LEU A 1 167 ? -21.779 17.191 8.642  1.00 24.19  ? 1063 LEU A N   1 
ATOM   1245 C CA  . LEU A 1 167 ? -22.777 18.118 9.155  1.00 23.76  ? 1063 LEU A CA  1 
ATOM   1246 C C   . LEU A 1 167 ? -23.197 17.677 10.545 1.00 24.19  ? 1063 LEU A C   1 
ATOM   1247 O O   . LEU A 1 167 ? -23.577 16.522 10.761 1.00 23.50  ? 1063 LEU A O   1 
ATOM   1248 C CB  . LEU A 1 167 ? -24.016 18.159 8.255  1.00 25.19  ? 1063 LEU A CB  1 
ATOM   1249 C CG  . LEU A 1 167 ? -25.186 18.959 8.843  1.00 20.40  ? 1063 LEU A CG  1 
ATOM   1250 C CD1 . LEU A 1 167 ? -24.789 20.430 8.971  1.00 29.76  ? 1063 LEU A CD1 1 
ATOM   1251 C CD2 . LEU A 1 167 ? -26.418 18.821 7.951  1.00 21.75  ? 1063 LEU A CD2 1 
ATOM   1252 N N   . ILE A 1 168 ? -23.141 18.607 11.488 1.00 23.62  ? 1064 ILE A N   1 
ATOM   1253 C CA  . ILE A 1 168 ? -23.524 18.308 12.852 1.00 24.83  ? 1064 ILE A CA  1 
ATOM   1254 C C   . ILE A 1 168 ? -24.352 19.453 13.415 1.00 24.98  ? 1064 ILE A C   1 
ATOM   1255 O O   . ILE A 1 168 ? -24.097 20.621 13.129 1.00 25.56  ? 1064 ILE A O   1 
ATOM   1256 C CB  . ILE A 1 168 ? -22.274 18.077 13.739 1.00 25.75  ? 1064 ILE A CB  1 
ATOM   1257 C CG1 . ILE A 1 168 ? -22.696 17.706 15.162 1.00 35.95  ? 1064 ILE A CG1 1 
ATOM   1258 C CG2 . ILE A 1 168 ? -21.403 19.317 13.738 1.00 39.09  ? 1064 ILE A CG2 1 
ATOM   1259 C CD1 . ILE A 1 168 ? -21.536 17.280 16.049 1.00 39.74  ? 1064 ILE A CD1 1 
ATOM   1260 N N   . GLU A 1 169 ? -25.374 19.110 14.183 1.00 24.20  ? 1065 GLU A N   1 
ATOM   1261 C CA  . GLU A 1 169 ? -26.205 20.121 14.803 1.00 26.56  ? 1065 GLU A CA  1 
ATOM   1262 C C   . GLU A 1 169 ? -25.947 20.045 16.296 1.00 27.80  ? 1065 GLU A C   1 
ATOM   1263 O O   . GLU A 1 169 ? -26.084 18.985 16.904 1.00 27.04  ? 1065 GLU A O   1 
ATOM   1264 C CB  . GLU A 1 169 ? -27.681 19.877 14.494 1.00 30.59  ? 1065 GLU A CB  1 
ATOM   1265 C CG  . GLU A 1 169 ? -28.030 20.096 13.037 1.00 32.05  ? 1065 GLU A CG  1 
ATOM   1266 C CD  . GLU A 1 169 ? -29.522 20.207 12.807 1.00 45.49  ? 1065 GLU A CD  1 
ATOM   1267 O OE1 . GLU A 1 169 ? -30.147 21.103 13.412 1.00 49.31  ? 1065 GLU A OE1 1 
ATOM   1268 O OE2 . GLU A 1 169 ? -30.067 19.403 12.021 1.00 42.83  ? 1065 GLU A OE2 1 
ATOM   1269 N N   . ILE A 1 170 ? -25.556 21.176 16.876 1.00 29.48  ? 1066 ILE A N   1 
ATOM   1270 C CA  . ILE A 1 170 ? -25.243 21.257 18.299 1.00 31.58  ? 1066 ILE A CA  1 
ATOM   1271 C C   . ILE A 1 170 ? -26.242 22.199 18.955 1.00 33.23  ? 1066 ILE A C   1 
ATOM   1272 O O   . ILE A 1 170 ? -26.165 23.417 18.784 1.00 32.17  ? 1066 ILE A O   1 
ATOM   1273 C CB  . ILE A 1 170 ? -23.807 21.791 18.501 1.00 33.64  ? 1066 ILE A CB  1 
ATOM   1274 C CG1 . ILE A 1 170 ? -22.826 20.926 17.706 1.00 32.13  ? 1066 ILE A CG1 1 
ATOM   1275 C CG2 . ILE A 1 170 ? -23.440 21.784 19.982 1.00 33.46  ? 1066 ILE A CG2 1 
ATOM   1276 C CD1 . ILE A 1 170 ? -21.417 21.465 17.671 1.00 27.97  ? 1066 ILE A CD1 1 
ATOM   1277 N N   . CYS A 1 171 ? -27.173 21.621 19.711 1.00 34.59  ? 1067 CYS A N   1 
ATOM   1278 C CA  . CYS A 1 171 ? -28.222 22.381 20.372 1.00 36.92  ? 1067 CYS A CA  1 
ATOM   1279 C C   . CYS A 1 171 ? -28.910 23.313 19.377 1.00 37.40  ? 1067 CYS A C   1 
ATOM   1280 O O   . CYS A 1 171 ? -29.058 24.509 19.628 1.00 37.73  ? 1067 CYS A O   1 
ATOM   1281 C CB  . CYS A 1 171 ? -27.656 23.180 21.549 1.00 40.92  ? 1067 CYS A CB  1 
ATOM   1282 S SG  . CYS A 1 171 ? -27.820 22.343 23.154 1.00 58.33  ? 1067 CYS A SG  1 
ATOM   1283 N N   . GLY A 1 172 ? -29.316 22.749 18.242 1.00 39.00  ? 1068 GLY A N   1 
ATOM   1284 C CA  . GLY A 1 172 ? -30.002 23.520 17.218 1.00 39.03  ? 1068 GLY A CA  1 
ATOM   1285 C C   . GLY A 1 172 ? -29.120 24.264 16.227 1.00 39.56  ? 1068 GLY A C   1 
ATOM   1286 O O   . GLY A 1 172 ? -29.589 24.648 15.151 1.00 40.76  ? 1068 GLY A O   1 
ATOM   1287 N N   . HIS A 1 173 ? -27.851 24.471 16.573 1.00 36.46  ? 1069 HIS A N   1 
ATOM   1288 C CA  . HIS A 1 173 ? -26.934 25.191 15.693 1.00 33.38  ? 1069 HIS A CA  1 
ATOM   1289 C C   . HIS A 1 173 ? -26.168 24.262 14.762 1.00 32.38  ? 1069 HIS A C   1 
ATOM   1290 O O   . HIS A 1 173 ? -25.521 23.310 15.202 1.00 32.42  ? 1069 HIS A O   1 
ATOM   1291 C CB  . HIS A 1 173 ? -25.960 26.028 16.523 1.00 30.68  ? 1069 HIS A CB  1 
ATOM   1292 C CG  . HIS A 1 173 ? -26.636 27.003 17.433 1.00 38.22  ? 1069 HIS A CG  1 
ATOM   1293 N ND1 . HIS A 1 173 ? -27.398 26.609 18.515 1.00 37.32  ? 1069 HIS A ND1 1 
ATOM   1294 C CD2 . HIS A 1 173 ? -26.697 28.356 17.409 1.00 41.47  ? 1069 HIS A CD2 1 
ATOM   1295 C CE1 . HIS A 1 173 ? -27.896 27.672 19.113 1.00 41.45  ? 1069 HIS A CE1 1 
ATOM   1296 N NE2 . HIS A 1 173 ? -27.486 28.748 18.462 1.00 50.37  ? 1069 HIS A NE2 1 
ATOM   1297 N N   . LYS A 1 174 ? -26.243 24.552 13.468 1.00 31.03  ? 1070 LYS A N   1 
ATOM   1298 C CA  . LYS A 1 174 ? -25.582 23.741 12.465 1.00 29.22  ? 1070 LYS A CA  1 
ATOM   1299 C C   . LYS A 1 174 ? -24.133 24.122 12.227 1.00 28.62  ? 1070 LYS A C   1 
ATOM   1300 O O   . LYS A 1 174 ? -23.763 25.296 12.236 1.00 28.24  ? 1070 LYS A O   1 
ATOM   1301 C CB  . LYS A 1 174 ? -26.353 23.807 11.143 1.00 30.06  ? 1070 LYS A CB  1 
ATOM   1302 C CG  . LYS A 1 174 ? -27.718 23.143 11.201 1.00 39.00  ? 1070 LYS A CG  1 
ATOM   1303 C CD  . LYS A 1 174 ? -28.426 23.195 9.859  1.00 44.90  ? 1070 LYS A CD  1 
ATOM   1304 C CE  . LYS A 1 174 ? -29.798 22.537 9.937  1.00 43.02  ? 1070 LYS A CE  1 
ATOM   1305 N NZ  . LYS A 1 174 ? -30.706 23.253 10.876 1.00 55.09  ? 1070 LYS A NZ  1 
ATOM   1306 N N   . ALA A 1 175 ? -23.311 23.104 12.026 1.00 27.88  ? 1071 ALA A N   1 
ATOM   1307 C CA  . ALA A 1 175 ? -21.900 23.302 11.755 1.00 27.79  ? 1071 ALA A CA  1 
ATOM   1308 C C   . ALA A 1 175 ? -21.453 22.147 10.883 1.00 27.81  ? 1071 ALA A C   1 
ATOM   1309 O O   . ALA A 1 175 ? -22.092 21.092 10.858 1.00 26.70  ? 1071 ALA A O   1 
ATOM   1310 C CB  . ALA A 1 175 ? -21.104 23.323 13.058 1.00 26.68  ? 1071 ALA A CB  1 
ATOM   1311 N N   . ILE A 1 176 ? -20.374 22.365 10.143 1.00 25.59  ? 1072 ILE A N   1 
ATOM   1312 C CA  . ILE A 1 176 ? -19.810 21.343 9.286  1.00 26.18  ? 1072 ILE A CA  1 
ATOM   1313 C C   . ILE A 1 176 ? -18.325 21.376 9.572  1.00 27.09  ? 1072 ILE A C   1 
ATOM   1314 O O   . ILE A 1 176 ? -17.719 22.445 9.627  1.00 25.55  ? 1072 ILE A O   1 
ATOM   1315 C CB  . ILE A 1 176 ? -20.006 21.639 7.788  1.00 33.36  ? 1072 ILE A CB  1 
ATOM   1316 C CG1 . ILE A 1 176 ? -21.493 21.666 7.439  1.00 35.10  ? 1072 ILE A CG1 1 
ATOM   1317 C CG2 . ILE A 1 176 ? -19.298 20.571 6.965  1.00 26.95  ? 1072 ILE A CG2 1 
ATOM   1318 C CD1 . ILE A 1 176 ? -21.763 21.856 5.958  1.00 46.86  ? 1072 ILE A CD1 1 
ATOM   1319 N N   . GLY A 1 177 ? -17.740 20.206 9.770  1.00 26.54  ? 1073 GLY A N   1 
ATOM   1320 C CA  . GLY A 1 177 ? -16.325 20.160 10.053 1.00 25.00  ? 1073 GLY A CA  1 
ATOM   1321 C C   . GLY A 1 177 ? -15.872 18.731 10.198 1.00 24.06  ? 1073 GLY A C   1 
ATOM   1322 O O   . GLY A 1 177 ? -16.583 17.798 9.844  1.00 23.71  ? 1073 GLY A O   1 
ATOM   1323 N N   . THR A 1 178 ? -14.683 18.565 10.750 1.00 24.69  ? 1074 THR A N   1 
ATOM   1324 C CA  . THR A 1 178 ? -14.119 17.250 10.937 1.00 23.01  ? 1074 THR A CA  1 
ATOM   1325 C C   . THR A 1 178 ? -14.572 16.624 12.245 1.00 22.37  ? 1074 THR A C   1 
ATOM   1326 O O   . THR A 1 178 ? -14.612 17.273 13.286 1.00 22.86  ? 1074 THR A O   1 
ATOM   1327 C CB  . THR A 1 178 ? -12.584 17.339 10.889 1.00 26.43  ? 1074 THR A CB  1 
ATOM   1328 O OG1 . THR A 1 178 ? -12.194 17.858 9.614  1.00 22.78  ? 1074 THR A OG1 1 
ATOM   1329 C CG2 . THR A 1 178 ? -11.951 15.979 11.097 1.00 24.62  ? 1074 THR A CG2 1 
ATOM   1330 N N   . VAL A 1 179 ? -14.932 15.353 12.179 1.00 21.49  ? 1075 VAL A N   1 
ATOM   1331 C CA  . VAL A 1 179 ? -15.365 14.629 13.360 1.00 23.42  ? 1075 VAL A CA  1 
ATOM   1332 C C   . VAL A 1 179 ? -14.519 13.372 13.448 1.00 23.81  ? 1075 VAL A C   1 
ATOM   1333 O O   . VAL A 1 179 ? -14.351 12.668 12.457 1.00 24.79  ? 1075 VAL A O   1 
ATOM   1334 C CB  . VAL A 1 179 ? -16.861 14.240 13.268 1.00 22.87  ? 1075 VAL A CB  1 
ATOM   1335 C CG1 . VAL A 1 179 ? -17.222 13.299 14.406 1.00 26.87  ? 1075 VAL A CG1 1 
ATOM   1336 C CG2 . VAL A 1 179 ? -17.732 15.496 13.326 1.00 25.54  ? 1075 VAL A CG2 1 
ATOM   1337 N N   . LEU A 1 180 ? -13.968 13.108 14.626 1.00 24.22  ? 1076 LEU A N   1 
ATOM   1338 C CA  . LEU A 1 180 ? -13.151 11.921 14.825 1.00 24.62  ? 1076 LEU A CA  1 
ATOM   1339 C C   . LEU A 1 180 ? -13.978 10.936 15.651 1.00 25.15  ? 1076 LEU A C   1 
ATOM   1340 O O   . LEU A 1 180 ? -14.628 11.318 16.626 1.00 25.64  ? 1076 LEU A O   1 
ATOM   1341 C CB  . LEU A 1 180 ? -11.853 12.279 15.561 1.00 22.19  ? 1076 LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 180 ? -11.004 13.442 15.023 1.00 18.75  ? 1076 LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 180 ? -9.810  13.658 15.961 1.00 21.61  ? 1076 LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 180 ? -10.512 13.157 13.601 1.00 21.28  ? 1076 LEU A CD2 1 
ATOM   1345 N N   . VAL A 1 181 ? -13.967 9.674  15.248 1.00 25.14  ? 1077 VAL A N   1 
ATOM   1346 C CA  . VAL A 1 181 ? -14.725 8.650  15.954 1.00 28.42  ? 1077 VAL A CA  1 
ATOM   1347 C C   . VAL A 1 181 ? -13.774 7.590  16.488 1.00 28.05  ? 1077 VAL A C   1 
ATOM   1348 O O   . VAL A 1 181 ? -12.972 7.033  15.741 1.00 30.62  ? 1077 VAL A O   1 
ATOM   1349 C CB  . VAL A 1 181 ? -15.760 7.987  15.014 1.00 29.70  ? 1077 VAL A CB  1 
ATOM   1350 C CG1 . VAL A 1 181 ? -16.550 6.927  15.764 1.00 35.89  ? 1077 VAL A CG1 1 
ATOM   1351 C CG2 . VAL A 1 181 ? -16.686 9.045  14.447 1.00 32.99  ? 1077 VAL A CG2 1 
ATOM   1352 N N   . GLY A 1 182 ? -13.860 7.315  17.782 1.00 30.12  ? 1078 GLY A N   1 
ATOM   1353 C CA  . GLY A 1 182 ? -12.977 6.323  18.357 1.00 31.30  ? 1078 GLY A CA  1 
ATOM   1354 C C   . GLY A 1 182 ? -13.218 6.043  19.825 1.00 32.45  ? 1078 GLY A C   1 
ATOM   1355 O O   . GLY A 1 182 ? -14.245 6.435  20.380 1.00 32.12  ? 1078 GLY A O   1 
ATOM   1356 N N   . PRO A 1 183 ? -12.267 5.361  20.481 1.00 32.93  ? 1079 PRO A N   1 
ATOM   1357 C CA  . PRO A 1 183 ? -12.269 4.963  21.892 1.00 33.34  ? 1079 PRO A CA  1 
ATOM   1358 C C   . PRO A 1 183 ? -12.279 6.090  22.930 1.00 32.51  ? 1079 PRO A C   1 
ATOM   1359 O O   . PRO A 1 183 ? -11.618 5.980  23.965 1.00 34.15  ? 1079 PRO A O   1 
ATOM   1360 C CB  . PRO A 1 183 ? -11.006 4.108  22.007 1.00 32.13  ? 1079 PRO A CB  1 
ATOM   1361 C CG  . PRO A 1 183 ? -10.831 3.569  20.637 1.00 35.87  ? 1079 PRO A CG  1 
ATOM   1362 C CD  . PRO A 1 183 ? -11.108 4.772  19.789 1.00 34.50  ? 1079 PRO A CD  1 
ATOM   1363 N N   . THR A 1 184 ? -13.020 7.163  22.669 1.00 31.49  ? 1080 THR A N   1 
ATOM   1364 C CA  . THR A 1 184 ? -13.089 8.269  23.619 1.00 30.60  ? 1080 THR A CA  1 
ATOM   1365 C C   . THR A 1 184 ? -14.048 7.947  24.766 1.00 31.14  ? 1080 THR A C   1 
ATOM   1366 O O   . THR A 1 184 ? -15.114 7.371  24.553 1.00 32.03  ? 1080 THR A O   1 
ATOM   1367 C CB  . THR A 1 184 ? -13.542 9.581  22.938 1.00 30.93  ? 1080 THR A CB  1 
ATOM   1368 O OG1 . THR A 1 184 ? -13.658 10.614 23.926 1.00 24.84  ? 1080 THR A OG1 1 
ATOM   1369 C CG2 . THR A 1 184 ? -14.882 9.392  22.233 1.00 18.63  ? 1080 THR A CG2 1 
ATOM   1370 N N   . PRO A 1 185 ? -13.671 8.309  26.003 1.00 31.91  ? 1081 PRO A N   1 
ATOM   1371 C CA  . PRO A 1 185 ? -14.489 8.063  27.197 1.00 33.44  ? 1081 PRO A CA  1 
ATOM   1372 C C   . PRO A 1 185 ? -15.777 8.886  27.202 1.00 33.20  ? 1081 PRO A C   1 
ATOM   1373 O O   . PRO A 1 185 ? -16.688 8.631  27.992 1.00 33.08  ? 1081 PRO A O   1 
ATOM   1374 C CB  . PRO A 1 185 ? -13.559 8.465  28.345 1.00 32.37  ? 1081 PRO A CB  1 
ATOM   1375 C CG  . PRO A 1 185 ? -12.196 8.302  27.769 1.00 38.13  ? 1081 PRO A CG  1 
ATOM   1376 C CD  . PRO A 1 185 ? -12.357 8.850  26.385 1.00 33.22  ? 1081 PRO A CD  1 
ATOM   1377 N N   . VAL A 1 186 ? -15.844 9.880  26.323 1.00 32.13  ? 1082 VAL A N   1 
ATOM   1378 C CA  . VAL A 1 186 ? -17.020 10.734 26.241 1.00 30.95  ? 1082 VAL A CA  1 
ATOM   1379 C C   . VAL A 1 186 ? -17.008 11.520 24.939 1.00 28.91  ? 1082 VAL A C   1 
ATOM   1380 O O   . VAL A 1 186 ? -15.944 11.804 24.391 1.00 27.83  ? 1082 VAL A O   1 
ATOM   1381 C CB  . VAL A 1 186 ? -17.066 11.726 27.435 1.00 35.36  ? 1082 VAL A CB  1 
ATOM   1382 C CG1 . VAL A 1 186 ? -15.842 12.625 27.414 1.00 36.99  ? 1082 VAL A CG1 1 
ATOM   1383 C CG2 . VAL A 1 186 ? -18.343 12.555 27.382 1.00 42.78  ? 1082 VAL A CG2 1 
ATOM   1384 N N   . ASN A 1 187 ? -18.192 11.856 24.435 1.00 26.68  ? 1083 ASN A N   1 
ATOM   1385 C CA  . ASN A 1 187 ? -18.283 12.627 23.203 1.00 23.08  ? 1083 ASN A CA  1 
ATOM   1386 C C   . ASN A 1 187 ? -17.906 14.058 23.541 1.00 19.04  ? 1083 ASN A C   1 
ATOM   1387 O O   . ASN A 1 187 ? -18.493 14.654 24.442 1.00 19.79  ? 1083 ASN A O   1 
ATOM   1388 C CB  . ASN A 1 187 ? -19.710 12.626 22.645 1.00 23.28  ? 1083 ASN A CB  1 
ATOM   1389 C CG  . ASN A 1 187 ? -20.231 11.233 22.337 1.00 34.09  ? 1083 ASN A CG  1 
ATOM   1390 O OD1 . ASN A 1 187 ? -19.496 10.365 21.864 1.00 28.90  ? 1083 ASN A OD1 1 
ATOM   1391 N ND2 . ASN A 1 187 ? -21.521 11.024 22.581 1.00 20.50  ? 1083 ASN A ND2 1 
ATOM   1392 N N   . ILE A 1 188 ? -16.932 14.614 22.835 1.00 18.40  ? 1084 ILE A N   1 
ATOM   1393 C CA  . ILE A 1 188 ? -16.534 15.989 23.100 1.00 17.94  ? 1084 ILE A CA  1 
ATOM   1394 C C   . ILE A 1 188 ? -16.582 16.838 21.842 1.00 17.81  ? 1084 ILE A C   1 
ATOM   1395 O O   . ILE A 1 188 ? -16.161 16.404 20.775 1.00 18.23  ? 1084 ILE A O   1 
ATOM   1396 C CB  . ILE A 1 188 ? -15.100 16.083 23.680 1.00 21.78  ? 1084 ILE A CB  1 
ATOM   1397 C CG1 . ILE A 1 188 ? -14.123 15.325 22.783 1.00 19.55  ? 1084 ILE A CG1 1 
ATOM   1398 C CG2 . ILE A 1 188 ? -15.078 15.568 25.119 1.00 23.11  ? 1084 ILE A CG2 1 
ATOM   1399 C CD1 . ILE A 1 188 ? -12.698 15.336 23.286 1.00 27.01  ? 1084 ILE A CD1 1 
ATOM   1400 N N   . ILE A 1 189 ? -17.116 18.046 21.979 1.00 17.57  ? 1085 ILE A N   1 
ATOM   1401 C CA  . ILE A 1 189 ? -17.190 18.987 20.869 1.00 16.42  ? 1085 ILE A CA  1 
ATOM   1402 C C   . ILE A 1 189 ? -16.007 19.922 21.084 1.00 17.45  ? 1085 ILE A C   1 
ATOM   1403 O O   . ILE A 1 189 ? -15.966 20.666 22.066 1.00 18.64  ? 1085 ILE A O   1 
ATOM   1404 C CB  . ILE A 1 189 ? -18.486 19.806 20.896 1.00 17.44  ? 1085 ILE A CB  1 
ATOM   1405 C CG1 . ILE A 1 189 ? -19.700 18.870 20.932 1.00 22.48  ? 1085 ILE A CG1 1 
ATOM   1406 C CG2 . ILE A 1 189 ? -18.539 20.734 19.674 1.00 18.42  ? 1085 ILE A CG2 1 
ATOM   1407 C CD1 . ILE A 1 189 ? -19.852 17.989 19.706 1.00 15.78  ? 1085 ILE A CD1 1 
ATOM   1408 N N   . GLY A 1 190 ? -15.043 19.859 20.173 1.00 17.64  ? 1086 GLY A N   1 
ATOM   1409 C CA  . GLY A 1 190 ? -13.857 20.683 20.282 1.00 17.18  ? 1086 GLY A CA  1 
ATOM   1410 C C   . GLY A 1 190 ? -13.989 22.018 19.584 1.00 18.27  ? 1086 GLY A C   1 
ATOM   1411 O O   . GLY A 1 190 ? -15.003 22.298 18.951 1.00 15.71  ? 1086 GLY A O   1 
ATOM   1412 N N   . ARG A 1 191 ? -12.937 22.826 19.692 1.00 18.31  ? 1087 ARG A N   1 
ATOM   1413 C CA  . ARG A 1 191 ? -12.895 24.165 19.119 1.00 17.36  ? 1087 ARG A CA  1 
ATOM   1414 C C   . ARG A 1 191 ? -13.148 24.275 17.620 1.00 16.92  ? 1087 ARG A C   1 
ATOM   1415 O O   . ARG A 1 191 ? -13.604 25.315 17.153 1.00 17.76  ? 1087 ARG A O   1 
ATOM   1416 C CB  . ARG A 1 191 ? -11.557 24.839 19.465 1.00 16.90  ? 1087 ARG A CB  1 
ATOM   1417 C CG  . ARG A 1 191 ? -11.353 25.057 20.969 1.00 15.87  ? 1087 ARG A CG  1 
ATOM   1418 C CD  . ARG A 1 191 ? -10.146 25.966 21.266 1.00 17.75  ? 1087 ARG A CD  1 
ATOM   1419 N NE  . ARG A 1 191 ? -8.889  25.400 20.783 1.00 15.70  ? 1087 ARG A NE  1 
ATOM   1420 C CZ  . ARG A 1 191 ? -8.333  25.708 19.615 1.00 22.71  ? 1087 ARG A CZ  1 
ATOM   1421 N NH1 . ARG A 1 191 ? -8.913  26.588 18.813 1.00 14.87  ? 1087 ARG A NH1 1 
ATOM   1422 N NH2 . ARG A 1 191 ? -7.214  25.109 19.237 1.00 21.72  ? 1087 ARG A NH2 1 
ATOM   1423 N N   . ASN A 1 192 ? -12.865 23.223 16.862 1.00 16.50  ? 1088 ASN A N   1 
ATOM   1424 C CA  . ASN A 1 192 ? -13.096 23.290 15.422 1.00 19.16  ? 1088 ASN A CA  1 
ATOM   1425 C C   . ASN A 1 192 ? -14.582 23.484 15.144 1.00 21.63  ? 1088 ASN A C   1 
ATOM   1426 O O   . ASN A 1 192 ? -14.954 24.086 14.137 1.00 20.84  ? 1088 ASN A O   1 
ATOM   1427 C CB  . ASN A 1 192 ? -12.581 22.030 14.714 1.00 19.94  ? 1088 ASN A CB  1 
ATOM   1428 C CG  . ASN A 1 192 ? -13.390 20.795 15.040 1.00 28.38  ? 1088 ASN A CG  1 
ATOM   1429 O OD1 . ASN A 1 192 ? -13.555 20.434 16.205 1.00 26.47  ? 1088 ASN A OD1 1 
ATOM   1430 N ND2 . ASN A 1 192 ? -13.891 20.125 14.002 1.00 24.11  ? 1088 ASN A ND2 1 
ATOM   1431 N N   . LEU A 1 193 ? -15.430 22.983 16.043 1.00 19.11  ? 1089 LEU A N   1 
ATOM   1432 C CA  . LEU A 1 193 ? -16.868 23.140 15.874 1.00 19.08  ? 1089 LEU A CA  1 
ATOM   1433 C C   . LEU A 1 193 ? -17.414 24.237 16.782 1.00 18.81  ? 1089 LEU A C   1 
ATOM   1434 O O   . LEU A 1 193 ? -18.372 24.915 16.422 1.00 20.67  ? 1089 LEU A O   1 
ATOM   1435 C CB  . LEU A 1 193 ? -17.601 21.824 16.149 1.00 15.02  ? 1089 LEU A CB  1 
ATOM   1436 C CG  . LEU A 1 193 ? -17.442 20.708 15.112 1.00 21.90  ? 1089 LEU A CG  1 
ATOM   1437 C CD1 . LEU A 1 193 ? -18.283 19.503 15.514 1.00 28.28  ? 1089 LEU A CD1 1 
ATOM   1438 C CD2 . LEU A 1 193 ? -17.879 21.219 13.748 1.00 26.79  ? 1089 LEU A CD2 1 
ATOM   1439 N N   . LEU A 1 194 ? -16.807 24.416 17.954 1.00 16.67  ? 1090 LEU A N   1 
ATOM   1440 C CA  . LEU A 1 194 ? -17.259 25.452 18.881 1.00 18.24  ? 1090 LEU A CA  1 
ATOM   1441 C C   . LEU A 1 194 ? -17.207 26.840 18.250 1.00 19.28  ? 1090 LEU A C   1 
ATOM   1442 O O   . LEU A 1 194 ? -18.083 27.666 18.479 1.00 19.83  ? 1090 LEU A O   1 
ATOM   1443 C CB  . LEU A 1 194 ? -16.422 25.449 20.165 1.00 15.29  ? 1090 LEU A CB  1 
ATOM   1444 C CG  . LEU A 1 194 ? -16.550 24.209 21.062 1.00 19.92  ? 1090 LEU A CG  1 
ATOM   1445 C CD1 . LEU A 1 194 ? -15.568 24.331 22.215 1.00 16.23  ? 1090 LEU A CD1 1 
ATOM   1446 C CD2 . LEU A 1 194 ? -17.988 24.057 21.571 1.00 18.52  ? 1090 LEU A CD2 1 
ATOM   1447 N N   . THR A 1 195 ? -16.177 27.098 17.453 1.00 20.89  ? 1091 THR A N   1 
ATOM   1448 C CA  . THR A 1 195 ? -16.044 28.397 16.809 1.00 22.77  ? 1091 THR A CA  1 
ATOM   1449 C C   . THR A 1 195 ? -17.240 28.670 15.894 1.00 24.24  ? 1091 THR A C   1 
ATOM   1450 O O   . THR A 1 195 ? -17.732 29.793 15.820 1.00 25.09  ? 1091 THR A O   1 
ATOM   1451 C CB  . THR A 1 195 ? -14.737 28.480 15.980 1.00 21.62  ? 1091 THR A CB  1 
ATOM   1452 O OG1 . THR A 1 195 ? -14.644 27.344 15.110 1.00 24.19  ? 1091 THR A OG1 1 
ATOM   1453 C CG2 . THR A 1 195 ? -13.523 28.503 16.904 1.00 19.53  ? 1091 THR A CG2 1 
ATOM   1454 N N   . GLN A 1 196 ? -17.717 27.634 15.212 1.00 24.54  ? 1092 GLN A N   1 
ATOM   1455 C CA  . GLN A 1 196 ? -18.845 27.789 14.306 1.00 24.24  ? 1092 GLN A CA  1 
ATOM   1456 C C   . GLN A 1 196 ? -20.161 28.144 14.985 1.00 25.90  ? 1092 GLN A C   1 
ATOM   1457 O O   . GLN A 1 196 ? -21.009 28.805 14.388 1.00 27.69  ? 1092 GLN A O   1 
ATOM   1458 C CB  . GLN A 1 196 ? -19.019 26.529 13.466 1.00 22.37  ? 1092 GLN A CB  1 
ATOM   1459 C CG  . GLN A 1 196 ? -17.907 26.330 12.465 1.00 30.02  ? 1092 GLN A CG  1 
ATOM   1460 C CD  . GLN A 1 196 ? -18.166 25.165 11.541 1.00 40.17  ? 1092 GLN A CD  1 
ATOM   1461 O OE1 . GLN A 1 196 ? -19.155 25.148 10.800 1.00 28.85  ? 1092 GLN A OE1 1 
ATOM   1462 N NE2 . GLN A 1 196 ? -17.278 24.178 11.576 1.00 41.19  ? 1092 GLN A NE2 1 
ATOM   1463 N N   . ILE A 1 197 ? -20.344 27.723 16.228 1.00 23.91  ? 1093 ILE A N   1 
ATOM   1464 C CA  . ILE A 1 197 ? -21.585 28.044 16.910 1.00 25.92  ? 1093 ILE A CA  1 
ATOM   1465 C C   . ILE A 1 197 ? -21.408 29.299 17.758 1.00 27.57  ? 1093 ILE A C   1 
ATOM   1466 O O   . ILE A 1 197 ? -22.221 29.594 18.636 1.00 28.83  ? 1093 ILE A O   1 
ATOM   1467 C CB  . ILE A 1 197 ? -22.068 26.865 17.784 1.00 26.79  ? 1093 ILE A CB  1 
ATOM   1468 C CG1 . ILE A 1 197 ? -21.057 26.556 18.887 1.00 24.49  ? 1093 ILE A CG1 1 
ATOM   1469 C CG2 . ILE A 1 197 ? -22.265 25.637 16.916 1.00 29.91  ? 1093 ILE A CG2 1 
ATOM   1470 C CD1 . ILE A 1 197 ? -21.508 25.440 19.805 1.00 29.64  ? 1093 ILE A CD1 1 
ATOM   1471 N N   . GLY A 1 198 ? -20.335 30.034 17.477 1.00 27.17  ? 1094 GLY A N   1 
ATOM   1472 C CA  . GLY A 1 198 ? -20.050 31.265 18.193 1.00 27.51  ? 1094 GLY A CA  1 
ATOM   1473 C C   . GLY A 1 198 ? -19.887 31.104 19.691 1.00 28.44  ? 1094 GLY A C   1 
ATOM   1474 O O   . GLY A 1 198 ? -20.377 31.924 20.460 1.00 30.07  ? 1094 GLY A O   1 
ATOM   1475 N N   . ALA A 1 199 ? -19.197 30.052 20.115 1.00 27.77  ? 1095 ALA A N   1 
ATOM   1476 C CA  . ALA A 1 199 ? -18.996 29.818 21.537 1.00 25.59  ? 1095 ALA A CA  1 
ATOM   1477 C C   . ALA A 1 199 ? -17.905 30.724 22.085 1.00 25.36  ? 1095 ALA A C   1 
ATOM   1478 O O   . ALA A 1 199 ? -16.883 30.935 21.433 1.00 25.17  ? 1095 ALA A O   1 
ATOM   1479 C CB  . ALA A 1 199 ? -18.626 28.365 21.775 1.00 25.62  ? 1095 ALA A CB  1 
ATOM   1480 N N   . THR A 1 200 ? -18.123 31.257 23.283 1.00 24.06  ? 1096 THR A N   1 
ATOM   1481 C CA  . THR A 1 200 ? -17.134 32.119 23.922 1.00 26.05  ? 1096 THR A CA  1 
ATOM   1482 C C   . THR A 1 200 ? -17.034 31.788 25.402 1.00 26.33  ? 1096 THR A C   1 
ATOM   1483 O O   . THR A 1 200 ? -17.980 31.278 26.005 1.00 27.61  ? 1096 THR A O   1 
ATOM   1484 C CB  . THR A 1 200 ? -17.512 33.615 23.814 1.00 23.59  ? 1096 THR A CB  1 
ATOM   1485 O OG1 . THR A 1 200 ? -18.667 33.877 24.627 1.00 25.58  ? 1096 THR A OG1 1 
ATOM   1486 C CG2 . THR A 1 200 ? -17.814 33.988 22.377 1.00 29.21  ? 1096 THR A CG2 1 
ATOM   1487 N N   . LEU A 1 201 ? -15.873 32.055 25.983 1.00 26.82  ? 1097 LEU A N   1 
ATOM   1488 C CA  . LEU A 1 201 ? -15.688 31.843 27.406 1.00 27.47  ? 1097 LEU A CA  1 
ATOM   1489 C C   . LEU A 1 201 ? -15.683 33.244 28.016 1.00 28.18  ? 1097 LEU A C   1 
ATOM   1490 O O   . LEU A 1 201 ? -15.041 34.144 27.490 1.00 30.09  ? 1097 LEU A O   1 
ATOM   1491 C CB  . LEU A 1 201 ? -14.360 31.135 27.683 1.00 30.88  ? 1097 LEU A CB  1 
ATOM   1492 C CG  . LEU A 1 201 ? -14.327 29.613 27.566 1.00 25.03  ? 1097 LEU A CG  1 
ATOM   1493 C CD1 . LEU A 1 201 ? -12.900 29.105 27.800 1.00 27.16  ? 1097 LEU A CD1 1 
ATOM   1494 C CD2 . LEU A 1 201 ? -15.283 29.015 28.604 1.00 19.81  ? 1097 LEU A CD2 1 
ATOM   1495 N N   . ASN A 1 202 ? -16.411 33.435 29.109 1.00 30.26  ? 1098 ASN A N   1 
ATOM   1496 C CA  . ASN A 1 202 ? -16.468 34.741 29.755 1.00 33.53  ? 1098 ASN A CA  1 
ATOM   1497 C C   . ASN A 1 202 ? -16.246 34.647 31.263 1.00 34.89  ? 1098 ASN A C   1 
ATOM   1498 O O   . ASN A 1 202 ? -16.890 33.851 31.951 1.00 32.76  ? 1098 ASN A O   1 
ATOM   1499 C CB  . ASN A 1 202 ? -17.818 35.409 29.475 1.00 34.06  ? 1098 ASN A CB  1 
ATOM   1500 C CG  . ASN A 1 202 ? -18.029 35.702 27.995 1.00 35.42  ? 1098 ASN A CG  1 
ATOM   1501 O OD1 . ASN A 1 202 ? -17.973 34.802 27.157 1.00 55.99  ? 1098 ASN A OD1 1 
ATOM   1502 N ND2 . ASN A 1 202 ? -18.271 36.964 27.671 1.00 34.29  ? 1098 ASN A ND2 1 
ATOM   1503 N N   . PHE A 1 203 ? -15.325 35.459 31.773 1.00 36.40  ? 1099 PHE A N   1 
ATOM   1504 C CA  . PHE A 1 203 ? -15.041 35.469 33.202 1.00 39.26  ? 1099 PHE A CA  1 
ATOM   1505 C C   . PHE A 1 203 ? -14.483 36.816 33.643 1.00 41.00  ? 1099 PHE A C   1 
ATOM   1506 O O   . PHE A 1 203 ? -13.937 36.901 34.765 1.00 42.76  ? 1099 PHE A O   1 
ATOM   1507 C CB  . PHE A 1 203 ? -14.064 34.338 33.554 1.00 38.43  ? 1099 PHE A CB  1 
ATOM   1508 C CG  . PHE A 1 203 ? -12.648 34.569 33.090 1.00 43.43  ? 1099 PHE A CG  1 
ATOM   1509 C CD1 . PHE A 1 203 ? -11.680 35.041 33.975 1.00 46.71  ? 1099 PHE A CD1 1 
ATOM   1510 C CD2 . PHE A 1 203 ? -12.271 34.280 31.783 1.00 39.44  ? 1099 PHE A CD2 1 
ATOM   1511 C CE1 . PHE A 1 203 ? -10.356 35.215 33.564 1.00 39.34  ? 1099 PHE A CE1 1 
ATOM   1512 C CE2 . PHE A 1 203 ? -10.953 34.451 31.363 1.00 43.67  ? 1099 PHE A CE2 1 
ATOM   1513 C CZ  . PHE A 1 203 ? -9.994  34.917 32.255 1.00 36.57  ? 1099 PHE A CZ  1 
ATOM   1514 O OXT . PHE A 1 203 ? -14.627 37.782 32.862 1.00 43.83  ? 1099 PHE A OXT 1 
ATOM   1515 N N   A SER B 2 1   ? -2.761  16.114 16.955 0.73 84.44  ? 1    SER P N   1 
ATOM   1516 C CA  A SER B 2 1   ? -3.387  15.188 17.941 0.73 84.61  ? 1    SER P CA  1 
ATOM   1517 C C   A SER B 2 1   ? -3.904  15.948 19.162 0.73 84.52  ? 1    SER P C   1 
ATOM   1518 O O   A SER B 2 1   ? -4.248  17.129 19.071 0.73 83.98  ? 1    SER P O   1 
ATOM   1519 C CB  A SER B 2 1   ? -2.369  14.129 18.379 0.73 83.57  ? 1    SER P CB  1 
ATOM   1520 O OG  A SER B 2 1   ? -1.210  14.726 18.935 0.73 84.10  ? 1    SER P OG  1 
ATOM   1521 N N   A GLN B 2 2   ? -3.964  15.261 20.299 0.73 85.12  ? 2    GLN P N   1 
ATOM   1522 C CA  A GLN B 2 2   ? -4.429  15.851 21.551 0.73 85.87  ? 2    GLN P CA  1 
ATOM   1523 C C   A GLN B 2 2   ? -5.900  16.260 21.540 0.73 84.94  ? 2    GLN P C   1 
ATOM   1524 O O   A GLN B 2 2   ? -6.492  16.462 20.481 0.73 86.56  ? 2    GLN P O   1 
ATOM   1525 C CB  A GLN B 2 2   ? -3.567  17.061 21.924 0.73 86.16  ? 2    GLN P CB  1 
ATOM   1526 C CG  A GLN B 2 2   ? -2.131  16.713 22.279 0.73 86.91  ? 2    GLN P CG  1 
ATOM   1527 C CD  A GLN B 2 2   ? -1.351  17.911 22.784 0.73 87.45  ? 2    GLN P CD  1 
ATOM   1528 O OE1 A GLN B 2 2   ? -1.115  18.868 22.047 0.73 86.93  ? 2    GLN P OE1 1 
ATOM   1529 N NE2 A GLN B 2 2   ? -0.950  17.866 24.049 0.73 87.51  ? 2    GLN P NE2 1 
ATOM   1530 N N   A ASN B 2 3   ? -6.465  16.374 22.740 0.73 83.51  ? 3    ASN P N   1 
ATOM   1531 C CA  A ASN B 2 3   ? -7.857  16.757 22.968 0.73 82.41  ? 3    ASN P CA  1 
ATOM   1532 C C   A ASN B 2 3   ? -8.163  16.555 24.448 0.73 83.16  ? 3    ASN P C   1 
ATOM   1533 O O   A ASN B 2 3   ? -8.227  15.422 24.926 0.73 84.21  ? 3    ASN P O   1 
ATOM   1534 C CB  A ASN B 2 3   ? -8.804  15.905 22.123 0.73 80.37  ? 3    ASN P CB  1 
ATOM   1535 C CG  A ASN B 2 3   ? -9.090  16.524 20.772 0.73 79.65  ? 3    ASN P CG  1 
ATOM   1536 O OD1 A ASN B 2 3   ? -9.741  15.916 19.926 0.73 82.01  ? 3    ASN P OD1 1 
ATOM   1537 N ND2 A ASN B 2 3   ? -8.609  17.745 20.564 0.73 80.78  ? 3    ASN P ND2 1 
ATOM   1538 N N   A TYR B 2 4   ? -8.354  17.658 25.169 0.73 83.03  ? 4    TYR P N   1 
ATOM   1539 C CA  A TYR B 2 4   ? -8.618  17.603 26.604 0.73 82.57  ? 4    TYR P CA  1 
ATOM   1540 C C   A TYR B 2 4   ? -9.878  18.351 27.006 0.73 82.09  ? 4    TYR P C   1 
ATOM   1541 O O   A TYR B 2 4   ? -10.575 17.883 27.932 0.73 82.05  ? 4    TYR P O   1 
ATOM   1542 C CB  A TYR B 2 4   ? -7.416  18.165 27.362 0.73 81.29  ? 4    TYR P CB  1 
ATOM   1543 C CG  A TYR B 2 4   ? -6.113  17.677 26.788 0.73 81.47  ? 4    TYR P CG  1 
ATOM   1544 C CD1 A TYR B 2 4   ? -5.561  18.277 25.655 0.73 80.50  ? 4    TYR P CD1 1 
ATOM   1545 C CD2 A TYR B 2 4   ? -5.478  16.559 27.318 0.73 80.98  ? 4    TYR P CD2 1 
ATOM   1546 C CE1 A TYR B 2 4   ? -4.416  17.769 25.061 0.73 82.81  ? 4    TYR P CE1 1 
ATOM   1547 C CE2 A TYR B 2 4   ? -4.337  16.043 26.732 0.73 82.96  ? 4    TYR P CE2 1 
ATOM   1548 C CZ  A TYR B 2 4   ? -3.810  16.650 25.602 0.73 84.09  ? 4    TYR P CZ  1 
ATOM   1549 O OH  A TYR B 2 4   ? -2.686  16.125 25.008 0.73 85.63  ? 4    TYR P OH  1 
ATOM   1550 O OXT A TYR B 2 4   ? -10.140 19.407 26.404 0.73 83.08  ? 4    TYR P OXT 1 
ATOM   1551 N N   A PRO C 3 1   ? -11.554 16.139 28.814 0.73 70.06  ? 1    PRO Q N   1 
ATOM   1552 C CA  A PRO C 3 1   ? -11.816 14.932 29.635 0.73 71.01  ? 1    PRO Q CA  1 
ATOM   1553 C C   A PRO C 3 1   ? -10.676 14.585 30.593 0.73 71.95  ? 1    PRO Q C   1 
ATOM   1554 O O   A PRO C 3 1   ? -9.691  13.948 30.203 0.73 71.75  ? 1    PRO Q O   1 
ATOM   1555 C CB  A PRO C 3 1   ? -12.042 13.785 28.663 0.73 70.41  ? 1    PRO Q CB  1 
ATOM   1556 C CG  A PRO C 3 1   ? -11.189 14.241 27.479 0.73 69.68  ? 1    PRO Q CG  1 
ATOM   1557 C CD  A PRO C 3 1   ? -11.485 15.757 27.393 0.73 68.67  ? 1    PRO Q CD  1 
ATOM   1558 N N   A ILE C 3 2   ? -10.818 14.999 31.850 0.73 74.01  ? 2    ILE Q N   1 
ATOM   1559 C CA  A ILE C 3 2   ? -9.805  14.723 32.864 0.73 76.62  ? 2    ILE Q CA  1 
ATOM   1560 C C   A ILE C 3 2   ? -10.374 14.965 34.245 0.73 77.69  ? 2    ILE Q C   1 
ATOM   1561 O O   A ILE C 3 2   ? -11.249 15.818 34.419 0.73 78.87  ? 2    ILE Q O   1 
ATOM   1562 C CB  A ILE C 3 2   ? -8.595  15.685 32.782 0.73 76.56  ? 2    ILE Q CB  1 
ATOM   1563 C CG1 A ILE C 3 2   ? -8.983  17.025 33.417 0.73 79.54  ? 2    ILE Q CG1 1 
ATOM   1564 C CG2 A ILE C 3 2   ? -8.190  15.926 31.347 0.73 76.79  ? 2    ILE Q CG2 1 
ATOM   1565 C CD1 A ILE C 3 2   ? -7.878  17.754 34.124 0.73 81.63  ? 2    ILE Q CD1 1 
ATOM   1566 N N   A VAL C 3 3   ? -9.897  14.210 35.228 0.73 79.94  ? 3    VAL Q N   1 
ATOM   1567 C CA  A VAL C 3 3   ? -10.319 14.496 36.582 0.73 81.97  ? 3    VAL Q CA  1 
ATOM   1568 C C   A VAL C 3 3   ? -9.153  14.453 37.561 0.73 83.23  ? 3    VAL Q C   1 
ATOM   1569 O O   A VAL C 3 3   ? -8.021  14.658 37.086 0.73 85.40  ? 3    VAL Q O   1 
ATOM   1570 C CB  A VAL C 3 3   ? -11.524 13.623 37.134 0.73 80.71  ? 3    VAL Q CB  1 
ATOM   1571 C CG1 A VAL C 3 3   ? -12.546 13.338 36.038 0.73 80.56  ? 3    VAL Q CG1 1 
ATOM   1572 C CG2 A VAL C 3 3   ? -11.023 12.421 37.880 0.73 80.71  ? 3    VAL Q CG2 1 
ATOM   1573 O OXT . VAL C 3 3   ? -9.374  14.255 38.777 0.00 83.08  ? 3    VAL Q OXT 1 
HETATM 1574 O O   . HOH D 4 .   ? -13.783 18.982 7.643  1.00 25.35  ? 1100 HOH A O   1 
HETATM 1575 O O   . HOH D 4 .   ? -8.207  24.134 23.106 1.00 20.19  ? 1101 HOH A O   1 
HETATM 1576 O O   . HOH D 4 .   ? -16.609 19.000 32.459 1.00 19.68  ? 1102 HOH A O   1 
HETATM 1577 O O   . HOH D 4 .   ? -11.428 21.974 44.067 1.00 23.13  ? 1103 HOH A O   1 
HETATM 1578 O O   . HOH D 4 .   ? -8.488  19.232 40.516 1.00 21.60  ? 1104 HOH A O   1 
HETATM 1579 O O   . HOH D 4 .   ? -12.385 17.068 14.731 1.00 19.41  ? 1105 HOH A O   1 
HETATM 1580 O O   . HOH D 4 .   ? -9.006  21.277 47.945 1.00 33.73  ? 1106 HOH A O   1 
HETATM 1581 O O   . HOH D 4 .   ? -9.319  38.499 24.724 1.00 50.35  ? 1107 HOH A O   1 
HETATM 1582 O O   . HOH D 4 .   ? -27.245 28.177 25.709 1.00 41.07  ? 1108 HOH A O   1 
HETATM 1583 O O   . HOH D 4 .   ? -22.513 23.523 32.591 1.00 30.55  ? 1109 HOH A O   1 
HETATM 1584 O O   . HOH D 4 .   ? -5.915  21.790 23.411 1.00 33.36  ? 1110 HOH A O   1 
HETATM 1585 O O   . HOH D 4 .   ? 8.128   30.538 37.713 1.00 31.50  ? 1111 HOH A O   1 
HETATM 1586 O O   . HOH D 4 .   ? -9.143  31.262 23.238 1.00 28.50  ? 1112 HOH A O   1 
HETATM 1587 O O   . HOH D 4 .   ? -24.237 14.196 9.838  1.00 18.57  ? 1113 HOH A O   1 
HETATM 1588 O O   . HOH D 4 .   ? -23.178 15.025 7.158  1.00 30.74  ? 1114 HOH A O   1 
HETATM 1589 O O   . HOH D 4 .   ? -22.492 8.174  22.005 1.00 29.99  ? 1115 HOH A O   1 
HETATM 1590 O O   . HOH D 4 .   ? 1.533   31.256 44.529 1.00 21.37  ? 1116 HOH A O   1 
HETATM 1591 O O   . HOH D 4 .   ? -0.820  11.721 14.377 1.00 46.10  ? 1117 HOH A O   1 
HETATM 1592 O O   . HOH D 4 .   ? -19.560 8.906  28.460 1.00 47.79  ? 1118 HOH A O   1 
HETATM 1593 O O   . HOH D 4 .   ? -13.283 20.788 11.264 1.00 24.85  ? 1119 HOH A O   1 
HETATM 1594 O O   . HOH D 4 .   ? -26.588 15.039 7.666  1.00 33.69  ? 1120 HOH A O   1 
HETATM 1595 O O   . HOH D 4 .   ? -0.532  31.618 43.633 1.00 34.70  ? 1121 HOH A O   1 
HETATM 1596 O O   . HOH D 4 .   ? -15.506 19.467 39.184 1.00 32.63  ? 1122 HOH A O   1 
HETATM 1597 O O   . HOH D 4 .   ? 9.404   28.793 37.897 1.00 47.26  ? 1123 HOH A O   1 
HETATM 1598 O O   . HOH D 4 .   ? -21.985 17.331 35.957 1.00 33.84  ? 1124 HOH A O   1 
HETATM 1599 O O   . HOH D 4 .   ? -2.455  34.972 37.241 1.00 38.84  ? 1125 HOH A O   1 
HETATM 1600 O O   . HOH D 4 .   ? -24.330 4.320  15.642 1.00 28.59  ? 1126 HOH A O   1 
HETATM 1601 O O   . HOH D 4 .   ? 7.247   25.977 34.456 1.00 39.92  ? 1127 HOH A O   1 
HETATM 1602 O O   . HOH D 4 .   ? -18.941 4.459  27.624 1.00 54.66  ? 1128 HOH A O   1 
HETATM 1603 O O   . HOH D 4 .   ? 8.200   26.239 38.089 1.00 36.78  ? 1129 HOH A O   1 
HETATM 1604 O O   . HOH D 4 .   ? 3.762   26.674 31.577 1.00 23.98  ? 1130 HOH A O   1 
HETATM 1605 O O   . HOH D 4 .   ? -19.365 36.685 20.235 1.00 47.02  ? 1131 HOH A O   1 
HETATM 1606 O O   . HOH D 4 .   ? -24.530 18.465 33.022 1.00 30.00  ? 1132 HOH A O   1 
HETATM 1607 O O   . HOH D 4 .   ? -13.191 13.980 40.069 1.00 45.60  ? 1133 HOH A O   1 
HETATM 1608 O O   . HOH D 4 .   ? -23.039 6.918  30.059 1.00 39.20  ? 1134 HOH A O   1 
HETATM 1609 O O   . HOH D 4 .   ? -12.687 32.009 44.713 1.00 31.50  ? 1135 HOH A O   1 
HETATM 1610 O O   . HOH D 4 .   ? 10.225  22.020 39.535 1.00 46.98  ? 1136 HOH A O   1 
HETATM 1611 O O   . HOH D 4 .   ? -7.613  5.593  4.114  1.00 54.86  ? 1137 HOH A O   1 
HETATM 1612 O O   . HOH D 4 .   ? -4.953  32.607 24.966 1.00 40.57  ? 1138 HOH A O   1 
HETATM 1613 O O   . HOH D 4 .   ? -26.967 5.936  17.442 1.00 40.10  ? 1139 HOH A O   1 
HETATM 1614 O O   . HOH D 4 .   ? 8.237   23.246 39.745 1.00 22.56  ? 1140 HOH A O   1 
HETATM 1615 O O   . HOH D 4 .   ? 7.906   14.131 45.064 1.00 51.43  ? 1141 HOH A O   1 
HETATM 1616 O O   . HOH D 4 .   ? 0.077   36.889 30.495 1.00 41.31  ? 1142 HOH A O   1 
HETATM 1617 O O   . HOH D 4 .   ? 11.671  23.223 44.507 1.00 32.42  ? 1143 HOH A O   1 
HETATM 1618 O O   . HOH D 4 .   ? -29.265 19.923 17.890 1.00 40.42  ? 1144 HOH A O   1 
HETATM 1619 O O   . HOH D 4 .   ? -9.433  10.927 50.882 1.00 46.04  ? 1145 HOH A O   1 
HETATM 1620 O O   . HOH D 4 .   ? -10.661 26.397 14.872 1.00 44.19  ? 1146 HOH A O   1 
HETATM 1621 O O   . HOH D 4 .   ? -29.415 6.226  17.613 1.00 57.28  ? 1147 HOH A O   1 
HETATM 1622 O O   . HOH D 4 .   ? -25.877 6.757  20.142 1.00 31.77  ? 1148 HOH A O   1 
HETATM 1623 O O   . HOH D 4 .   ? -20.111 15.352 37.018 1.00 48.52  ? 1149 HOH A O   1 
HETATM 1624 O O   . HOH D 4 .   ? -15.184 31.033 19.261 1.00 29.45  ? 1150 HOH A O   1 
HETATM 1625 O O   . HOH D 4 .   ? -9.156  11.564 47.991 1.00 35.02  ? 1151 HOH A O   1 
HETATM 1626 O O   . HOH D 4 .   ? -16.586 6.232  -4.445 1.00 62.62  ? 1152 HOH A O   1 
HETATM 1627 O O   . HOH D 4 .   ? -10.336 46.334 33.386 1.00 39.16  ? 1153 HOH A O   1 
HETATM 1628 O O   . HOH D 4 .   ? -15.847 25.018 43.110 1.00 49.43  ? 1154 HOH A O   1 
HETATM 1629 O O   . HOH D 4 .   ? -14.752 2.342  20.421 1.00 44.48  ? 1155 HOH A O   1 
HETATM 1630 O O   . HOH D 4 .   ? -20.424 6.411  30.055 1.00 59.81  ? 1156 HOH A O   1 
HETATM 1631 O O   . HOH D 4 .   ? -19.366 28.738 36.020 1.00 26.00  ? 1157 HOH A O   1 
HETATM 1632 O O   . HOH D 4 .   ? 4.672   17.805 47.639 1.00 36.42  ? 1158 HOH A O   1 
HETATM 1633 O O   . HOH D 4 .   ? -11.589 12.308 47.622 1.00 30.71  ? 1159 HOH A O   1 
HETATM 1634 O O   . HOH D 4 .   ? -4.543  4.368  43.313 1.00 61.55  ? 1160 HOH A O   1 
HETATM 1635 O O   . HOH D 4 .   ? -3.673  30.656 22.459 1.00 33.33  ? 1161 HOH A O   1 
HETATM 1636 O O   . HOH D 4 .   ? -9.047  23.239 16.512 1.00 31.97  ? 1162 HOH A O   1 
HETATM 1637 O O   . HOH D 4 .   ? -4.621  30.473 17.632 1.00 42.20  ? 1163 HOH A O   1 
HETATM 1638 O O   . HOH D 4 .   ? -4.066  27.684 19.553 1.00 29.08  ? 1164 HOH A O   1 
HETATM 1639 O O   . HOH D 4 .   ? -1.558  27.432 48.150 1.00 31.17  ? 1165 HOH A O   1 
HETATM 1640 O O   . HOH D 4 .   ? -0.297  28.098 45.574 1.00 24.83  ? 1166 HOH A O   1 
HETATM 1641 O O   . HOH D 4 .   ? -13.965 42.756 28.635 1.00 55.54  ? 1167 HOH A O   1 
HETATM 1642 O O   . HOH D 4 .   ? -7.903  11.019 46.078 1.00 35.25  ? 1168 HOH A O   1 
HETATM 1643 O O   . HOH D 4 .   ? -22.753 33.456 20.929 1.00 37.90  ? 1169 HOH A O   1 
HETATM 1644 O O   . HOH D 4 .   ? -19.947 22.038 40.941 1.00 44.88  ? 1170 HOH A O   1 
HETATM 1645 O O   . HOH D 4 .   ? -19.499 18.659 38.832 1.00 42.13  ? 1171 HOH A O   1 
HETATM 1646 O O   . HOH D 4 .   ? -21.164 34.328 36.265 1.00 55.20  ? 1172 HOH A O   1 
HETATM 1647 O O   . HOH D 4 .   ? -27.879 16.930 26.775 1.00 48.26  ? 1173 HOH A O   1 
HETATM 1648 O O   . HOH D 4 .   ? -27.755 14.329 11.010 1.00 20.21  ? 1174 HOH A O   1 
HETATM 1649 O O   . HOH D 4 .   ? -28.298 10.243 26.367 1.00 45.22  ? 1175 HOH A O   1 
HETATM 1650 O O   . HOH D 4 .   ? -6.727  26.468 16.524 1.00 43.57  ? 1176 HOH A O   1 
HETATM 1651 O O   . HOH D 4 .   ? -29.309 10.497 29.644 1.00 38.77  ? 1177 HOH A O   1 
HETATM 1652 O O   . HOH D 4 .   ? -20.766 4.185  20.957 1.00 49.82  ? 1178 HOH A O   1 
HETATM 1653 O O   . HOH D 4 .   ? -25.824 1.511  10.905 1.00 32.89  ? 1179 HOH A O   1 
HETATM 1654 O O   . HOH D 4 .   ? -0.682  12.456 25.104 1.00 34.71  ? 1180 HOH A O   1 
HETATM 1655 O O   . HOH D 4 .   ? -1.808  10.230 12.985 1.00 39.44  ? 1181 HOH A O   1 
HETATM 1656 O O   . HOH D 4 .   ? -6.584  35.596 30.471 1.00 51.94  ? 1182 HOH A O   1 
HETATM 1657 O O   . HOH D 4 .   ? -6.739  33.330 26.444 1.00 50.08  ? 1183 HOH A O   1 
HETATM 1658 O O   . HOH D 4 .   ? -1.318  33.644 28.218 1.00 58.69  ? 1184 HOH A O   1 
HETATM 1659 O O   . HOH D 4 .   ? 0.491   29.319 49.013 1.00 53.16  ? 1185 HOH A O   1 
HETATM 1660 O O   . HOH D 4 .   ? -7.266  33.307 24.155 1.00 29.22  ? 1186 HOH A O   1 
HETATM 1661 O O   . HOH D 4 .   ? 2.246   30.424 49.986 1.00 59.88  ? 1187 HOH A O   1 
HETATM 1662 O O   . HOH D 4 .   ? -15.798 16.542 32.307 1.00 53.87  ? 1188 HOH A O   1 
HETATM 1663 O O   . HOH D 4 .   ? 3.986   16.417 31.808 1.00 38.78  ? 1189 HOH A O   1 
HETATM 1664 O O   . HOH D 4 .   ? 6.346   18.923 44.818 1.00 38.12  ? 1190 HOH A O   1 
HETATM 1665 O O   . HOH D 4 .   ? -2.118  8.473  10.105 1.00 42.30  ? 1191 HOH A O   1 
HETATM 1666 O O   . HOH D 4 .   ? 0.701   -2.465 27.607 1.00 55.53  ? 1192 HOH A O   1 
HETATM 1667 O O   . HOH D 4 .   ? -0.431  -4.597 26.339 1.00 47.91  ? 1193 HOH A O   1 
HETATM 1668 O O   . HOH D 4 .   ? -9.248  37.610 42.939 1.00 33.44  ? 1194 HOH A O   1 
HETATM 1669 O O   . HOH D 4 .   ? -27.003 34.535 21.900 1.00 46.07  ? 1195 HOH A O   1 
HETATM 1670 O O   . HOH D 4 .   ? -30.559 8.646  17.633 1.00 23.81  ? 1196 HOH A O   1 
HETATM 1671 O O   . HOH D 4 .   ? -16.171 4.217  21.512 1.00 35.43  ? 1197 HOH A O   1 
HETATM 1672 O O   . HOH D 4 .   ? -6.549  5.237  13.289 1.00 44.23  ? 1198 HOH A O   1 
HETATM 1673 O O   . HOH D 4 .   ? -9.546  33.321 19.901 1.00 44.26  ? 1199 HOH A O   1 
HETATM 1674 O O   . HOH D 4 .   ? 1.524   21.708 26.400 1.00 53.60  ? 1200 HOH A O   1 
HETATM 1675 O O   . HOH D 4 .   ? -22.993 19.374 43.029 1.00 40.44  ? 1201 HOH A O   1 
HETATM 1676 O O   . HOH D 4 .   ? -12.856 42.897 31.619 1.00 47.19  ? 1202 HOH A O   1 
HETATM 1677 O O   . HOH D 4 .   ? -32.228 7.773  19.512 1.00 38.77  ? 1203 HOH A O   1 
HETATM 1678 O O   . HOH D 4 .   ? -14.062 43.049 35.322 1.00 42.74  ? 1204 HOH A O   1 
HETATM 1679 O O   . HOH D 4 .   ? -15.862 41.597 31.250 1.00 55.61  ? 1205 HOH A O   1 
HETATM 1680 O O   . HOH D 4 .   ? -1.025  2.487  23.586 1.00 48.61  ? 1206 HOH A O   1 
HETATM 1681 O O   . HOH D 4 .   ? 0.997   1.116  21.553 1.00 51.69  ? 1207 HOH A O   1 
HETATM 1682 O O   . HOH D 4 .   ? -3.101  8.870  51.033 1.00 46.15  ? 1208 HOH A O   1 
HETATM 1683 O O   . HOH D 4 .   ? -15.248 4.172  24.177 1.00 63.32  ? 1209 HOH A O   1 
HETATM 1684 O O   . HOH D 4 .   ? -3.516  23.964 18.272 1.00 39.91  ? 1210 HOH A O   1 
HETATM 1685 O O   . HOH D 4 .   ? -11.541 14.735 46.548 1.00 43.51  ? 1211 HOH A O   1 
HETATM 1686 O O   . HOH D 4 .   ? -25.107 7.925  10.217 1.00 29.92  ? 1212 HOH A O   1 
HETATM 1687 O O   . HOH D 4 .   ? -10.476 42.236 26.861 1.00 65.84  ? 1213 HOH A O   1 
HETATM 1688 O O   . HOH D 4 .   ? -11.075 17.105 48.200 1.00 56.46  ? 1214 HOH A O   1 
HETATM 1689 O O   . HOH D 4 .   ? -6.256  40.902 41.207 1.00 53.49  ? 1215 HOH A O   1 
HETATM 1690 O O   . HOH D 4 .   ? -32.541 28.060 20.412 1.00 45.23  ? 1216 HOH A O   1 
HETATM 1691 O O   . HOH D 4 .   ? 3.641   11.976 38.838 1.00 45.48  ? 1217 HOH A O   1 
HETATM 1692 O O   . HOH D 4 .   ? 4.226   18.368 28.478 1.00 48.32  ? 1218 HOH A O   1 
HETATM 1693 O O   . HOH D 4 .   ? -16.781 21.235 39.778 1.00 43.74  ? 1219 HOH A O   1 
HETATM 1694 O O   . HOH D 4 .   ? -10.132 17.915 13.875 1.00 36.38  ? 1220 HOH A O   1 
HETATM 1695 O O   . HOH D 4 .   ? -26.767 35.328 27.907 1.00 49.48  ? 1221 HOH A O   1 
HETATM 1696 O O   . HOH D 4 .   ? -24.212 24.891 35.408 1.00 30.58  ? 1222 HOH A O   1 
HETATM 1697 O O   . HOH D 4 .   ? -27.309 16.714 11.522 1.00 35.56  ? 1223 HOH A O   1 
HETATM 1698 O O   . HOH D 4 .   ? -25.442 22.873 31.785 1.00 37.70  ? 1224 HOH A O   1 
HETATM 1699 O O   . HOH D 4 .   ? -15.154 1.932  10.520 1.00 50.76  ? 1225 HOH A O   1 
HETATM 1700 O O   . HOH D 4 .   ? -9.250  18.026 4.782  1.00 50.29  ? 1226 HOH A O   1 
HETATM 1701 O O   . HOH D 4 .   ? 0.583   23.507 29.487 1.00 28.49  ? 1227 HOH A O   1 
HETATM 1702 O O   . HOH D 4 .   ? 1.027   25.213 28.368 1.00 57.09  ? 1228 HOH A O   1 
HETATM 1703 O O   . HOH D 4 .   ? -15.076 27.164 12.221 1.00 41.09  ? 1229 HOH A O   1 
HETATM 1704 O O   . HOH D 4 .   ? -9.752  35.699 22.721 1.00 37.80  ? 1230 HOH A O   1 
HETATM 1705 O O   . HOH D 4 .   ? -12.017 42.506 37.070 1.00 57.27  ? 1231 HOH A O   1 
HETATM 1706 O O   . HOH D 4 .   ? -18.354 13.905 36.665 1.00 49.06  ? 1232 HOH A O   1 
HETATM 1707 O O   . HOH D 4 .   ? 3.572   28.248 48.173 1.00 55.74  ? 1233 HOH A O   1 
HETATM 1708 O O   . HOH D 4 .   ? -28.594 18.908 27.875 1.00 47.70  ? 1234 HOH A O   1 
HETATM 1709 O O   . HOH D 4 .   ? -11.947 18.615 41.594 1.00 42.86  ? 1235 HOH A O   1 
HETATM 1710 O O   . HOH D 4 .   ? -6.962  6.205  43.925 1.00 57.06  ? 1236 HOH A O   1 
HETATM 1711 O O   . HOH D 4 .   ? -2.524  4.979  25.181 1.00 68.69  ? 1237 HOH A O   1 
HETATM 1712 O O   . HOH D 4 .   ? -3.182  4.913  30.214 1.00 40.88  ? 1238 HOH A O   1 
HETATM 1713 O O   . HOH D 4 .   ? -10.570 9.683  39.850 1.00 47.29  ? 1239 HOH A O   1 
HETATM 1714 O O   . HOH D 4 .   ? -9.969  6.701  40.872 1.00 47.59  ? 1240 HOH A O   1 
HETATM 1715 O O   . HOH D 4 .   ? -11.368 11.212 36.042 1.00 45.48  ? 1241 HOH A O   1 
HETATM 1716 O O   . HOH D 4 .   ? -12.288 22.940 48.469 1.00 34.80  ? 1242 HOH A O   1 
HETATM 1717 O O   . HOH D 4 .   ? -8.534  6.984  42.403 1.00 37.11  ? 1243 HOH A O   1 
HETATM 1718 O O   . HOH D 4 .   ? -18.322 31.585 42.737 1.00 51.69  ? 1244 HOH A O   1 
HETATM 1719 O O   . HOH D 4 .   ? -23.301 36.185 21.426 1.00 41.74  ? 1245 HOH A O   1 
HETATM 1720 O O   . HOH D 4 .   ? -13.097 44.803 37.524 1.00 69.38  ? 1246 HOH A O   1 
HETATM 1721 O O   . HOH D 4 .   ? -14.852 38.785 35.437 1.00 41.04  ? 1247 HOH A O   1 
HETATM 1722 O O   . HOH D 4 .   ? -20.782 11.328 26.125 1.00 38.67  ? 1248 HOH A O   1 
HETATM 1723 O O   . HOH D 4 .   ? -21.851 13.004 27.674 1.00 54.05  ? 1249 HOH A O   1 
HETATM 1724 O O   . HOH D 4 .   ? -1.912  2.328  31.496 1.00 56.19  ? 1250 HOH A O   1 
HETATM 1725 O O   . HOH D 4 .   ? 12.834  21.406 40.989 1.00 42.08  ? 1251 HOH A O   1 
HETATM 1726 O O   . HOH D 4 .   ? -12.299 40.953 26.406 1.00 43.37  ? 1252 HOH A O   1 
HETATM 1727 O O   . HOH D 4 .   ? -6.714  16.861 52.298 1.00 51.74  ? 1253 HOH A O   1 
HETATM 1728 O O   . HOH D 4 .   ? 3.277   36.701 46.188 1.00 49.01  ? 1254 HOH A O   1 
HETATM 1729 O O   . HOH D 4 .   ? 1.317   41.020 45.649 1.00 46.40  ? 1255 HOH A O   1 
HETATM 1730 O O   . HOH D 4 .   ? -17.433 9.613  1.437  1.00 45.99  ? 1256 HOH A O   1 
HETATM 1731 O O   . HOH D 4 .   ? -13.376 40.546 35.056 1.00 51.47  ? 1257 HOH A O   1 
HETATM 1732 O O   . HOH D 4 .   ? -16.919 40.370 33.442 1.00 41.37  ? 1258 HOH A O   1 
HETATM 1733 O O   . HOH D 4 .   ? -7.121  36.547 27.101 1.00 53.48  ? 1259 HOH A O   1 
HETATM 1734 O O   . HOH D 4 .   ? -32.094 18.997 10.618 1.00 66.23  ? 1260 HOH A O   1 
HETATM 1735 O O   . HOH D 4 .   ? -14.270 26.482 49.208 1.00 47.19  ? 1261 HOH A O   1 
HETATM 1736 O O   . HOH D 4 .   ? 0.649   7.820  34.975 1.00 31.70  ? 1262 HOH A O   1 
HETATM 1737 O O   . HOH D 4 .   ? -0.798  4.958  34.544 1.00 64.30  ? 1263 HOH A O   1 
HETATM 1738 O O   . HOH D 4 .   ? -11.806 35.388 41.073 1.00 63.24  ? 1264 HOH A O   1 
HETATM 1739 O O   . HOH D 4 .   ? -23.284 4.858  18.564 1.00 39.06  ? 1265 HOH A O   1 
HETATM 1740 O O   . HOH D 4 .   ? -16.327 0.091  11.124 1.00 55.31  ? 1266 HOH A O   1 
HETATM 1741 O O   . HOH D 4 .   ? -12.252 1.528  14.702 1.00 49.37  ? 1267 HOH A O   1 
HETATM 1742 O O   . HOH D 4 .   ? -19.566 3.963  10.565 1.00 38.88  ? 1268 HOH A O   1 
HETATM 1743 O O   . HOH D 4 .   ? -4.110  42.063 41.290 1.00 59.90  ? 1269 HOH A O   1 
HETATM 1744 O O   . HOH D 4 .   ? -24.802 22.711 28.444 1.00 32.83  ? 1270 HOH A O   1 
HETATM 1745 O O   . HOH D 4 .   ? 2.273   13.322 51.341 1.00 44.11  ? 1271 HOH A O   1 
HETATM 1746 O O   . HOH D 4 .   ? -24.274 47.100 14.392 1.00 48.81  ? 1272 HOH A O   1 
HETATM 1747 O O   . HOH D 4 .   ? -29.475 28.279 21.106 1.00 53.22  ? 1273 HOH A O   1 
HETATM 1748 O O   . HOH D 4 .   ? -25.241 10.025 23.878 1.00 33.51  ? 1274 HOH A O   1 
HETATM 1749 O O   . HOH D 4 .   ? -13.924 12.332 5.037  1.00 42.59  ? 1275 HOH A O   1 
HETATM 1750 O O   . HOH D 4 .   ? -8.693  21.290 14.431 1.00 60.02  ? 1276 HOH A O   1 
HETATM 1751 O O   . HOH D 4 .   ? -10.242 6.663  30.485 1.00 42.90  ? 1277 HOH A O   1 
HETATM 1752 O O   B HOH D 4 .   ? -7.197  17.078 28.472 0.27 12.79  ? 1278 HOH A O   1 
HETATM 1753 O O   B HOH D 4 .   ? -7.635  15.397 22.908 0.27 34.91  ? 1279 HOH A O   1 
HETATM 1754 O O   B HOH D 4 .   ? -8.677  17.246 20.489 0.27 1.00   ? 1280 HOH A O   1 
HETATM 1755 O O   B HOH D 4 .   ? -9.883  18.467 26.719 0.27 39.58  ? 1281 HOH A O   1 
HETATM 1756 O O   B HOH D 4 .   ? -7.334  18.534 26.477 0.27 36.86  ? 1282 HOH A O   1 
HETATM 1757 O O   B HOH D 4 .   ? -11.145 17.815 28.683 0.27 17.97  ? 1283 HOH A O   1 
HETATM 1758 O O   B HOH D 4 .   ? -9.824  14.713 32.926 0.27 44.01  ? 1284 HOH A O   1 
HETATM 1759 O O   B HOH D 4 .   ? -10.634 16.205 34.812 0.27 1.00   ? 1285 HOH A O   1 
HETATM 1760 O O   . HOH E 4 .   ? -6.494  19.189 21.832 1.00 33.83  ? 6    HOH P O   1 
HETATM 1761 O O   . HOH E 4 .   ? -0.995  14.938 23.637 1.00 42.58  ? 7    HOH P O   1 
HETATM 1762 O O   . HOH E 4 .   ? -3.877  19.257 17.975 1.00 46.62  ? 9    HOH P O   1 
HETATM 1763 O O   . HOH F 4 .   ? -7.964  13.992 27.653 1.00 36.41  ? 5    HOH Q O   1 
HETATM 1764 O O   . HOH F 4 .   ? -14.440 13.951 30.959 1.00 55.54  ? 6    HOH Q O   1 
HETATM 1765 O O   . HOH F 4 .   ? -13.208 11.050 31.375 1.00 54.67  ? 7    HOH Q O   1 
HETATM 1766 O O   . HOH F 4 .   ? -13.117 15.305 33.129 1.00 32.63  ? 8    HOH Q O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1    1    PRO PRO A . n 
A 1 2   GLN 2   2    2    GLN GLN A . n 
A 1 3   VAL 3   3    3    VAL VAL A . n 
A 1 4   THR 4   4    4    THR THR A . n 
A 1 5   LEU 5   5    5    LEU LEU A . n 
A 1 6   TRP 6   6    6    TRP TRP A . n 
A 1 7   GLN 7   7    7    GLN GLN A . n 
A 1 8   ARG 8   8    8    ARG ARG A . n 
A 1 9   PRO 9   9    9    PRO PRO A . n 
A 1 10  LEU 10  10   10   LEU LEU A . n 
A 1 11  VAL 11  11   11   VAL VAL A . n 
A 1 12  THR 12  12   12   THR THR A . n 
A 1 13  ILE 13  13   13   ILE ILE A . n 
A 1 14  LYS 14  14   14   LYS LYS A . n 
A 1 15  ILE 15  15   15   ILE ILE A . n 
A 1 16  GLY 16  16   16   GLY GLY A . n 
A 1 17  GLY 17  17   17   GLY GLY A . n 
A 1 18  GLN 18  18   18   GLN GLN A . n 
A 1 19  LEU 19  19   19   LEU LEU A . n 
A 1 20  LYS 20  20   20   LYS LYS A . n 
A 1 21  GLU 21  21   21   GLU GLU A . n 
A 1 22  ALA 22  22   22   ALA ALA A . n 
A 1 23  LEU 23  23   23   LEU LEU A . n 
A 1 24  LEU 24  24   24   LEU LEU A . n 
A 1 25  ASP 25  25   25   ASP ASP A . n 
A 1 26  THR 26  26   26   THR THR A . n 
A 1 27  GLY 27  27   27   GLY GLY A . n 
A 1 28  ALA 28  28   28   ALA ALA A . n 
A 1 29  ASP 29  29   29   ASP ASP A . n 
A 1 30  ASP 30  30   30   ASP ASP A . n 
A 1 31  THR 31  31   31   THR THR A . n 
A 1 32  VAL 32  32   32   VAL VAL A . n 
A 1 33  LEU 33  33   33   LEU LEU A . n 
A 1 34  GLU 34  34   34   GLU GLU A . n 
A 1 35  GLU 35  35   35   GLU GLU A . n 
A 1 36  MET 36  36   36   MET MET A . n 
A 1 37  SER 37  37   37   SER SER A . n 
A 1 38  LEU 38  38   38   LEU LEU A . n 
A 1 39  PRO 39  39   39   PRO PRO A . n 
A 1 40  GLY 40  40   40   GLY GLY A . n 
A 1 41  ARG 41  41   41   ARG ARG A . n 
A 1 42  TRP 42  42   42   TRP TRP A . n 
A 1 43  LYS 43  43   43   LYS LYS A . n 
A 1 44  PRO 44  44   44   PRO PRO A . n 
A 1 45  LYS 45  45   45   LYS LYS A . n 
A 1 46  MET 46  46   46   MET MET A . n 
A 1 47  ILE 47  47   47   ILE ILE A . n 
A 1 48  GLY 48  48   48   GLY GLY A . n 
A 1 49  GLY 49  49   49   GLY GLY A . n 
A 1 50  ILE 50  50   50   ILE ILE A . n 
A 1 51  GLY 51  51   51   GLY GLY A . n 
A 1 52  GLY 52  52   52   GLY GLY A . n 
A 1 53  PHE 53  53   53   PHE PHE A . n 
A 1 54  ILE 54  54   54   ILE ILE A . n 
A 1 55  LYS 55  55   55   LYS LYS A . n 
A 1 56  VAL 56  56   56   VAL VAL A . n 
A 1 57  ARG 57  57   57   ARG ARG A . n 
A 1 58  GLN 58  58   58   GLN GLN A . n 
A 1 59  TYR 59  59   59   TYR TYR A . n 
A 1 60  ASP 60  60   60   ASP ASP A . n 
A 1 61  GLN 61  61   61   GLN GLN A . n 
A 1 62  ILE 62  62   62   ILE ILE A . n 
A 1 63  LEU 63  63   63   LEU LEU A . n 
A 1 64  ILE 64  64   64   ILE ILE A . n 
A 1 65  GLU 65  65   65   GLU GLU A . n 
A 1 66  ILE 66  66   66   ILE ILE A . n 
A 1 67  CYS 67  67   67   CYS CYS A . n 
A 1 68  GLY 68  68   68   GLY GLY A . n 
A 1 69  HIS 69  69   69   HIS HIS A . n 
A 1 70  LYS 70  70   70   LYS LYS A . n 
A 1 71  ALA 71  71   71   ALA ALA A . n 
A 1 72  ILE 72  72   72   ILE ILE A . n 
A 1 73  GLY 73  73   73   GLY GLY A . n 
A 1 74  THR 74  74   74   THR THR A . n 
A 1 75  VAL 75  75   75   VAL VAL A . n 
A 1 76  LEU 76  76   76   LEU LEU A . n 
A 1 77  VAL 77  77   77   VAL VAL A . n 
A 1 78  GLY 78  78   78   GLY GLY A . n 
A 1 79  PRO 79  79   79   PRO PRO A . n 
A 1 80  THR 80  80   80   THR THR A . n 
A 1 81  PRO 81  81   81   PRO PRO A . n 
A 1 82  VAL 82  82   82   VAL VAL A . n 
A 1 83  ASN 83  83   83   ASN ASN A . n 
A 1 84  ILE 84  84   84   ILE ILE A . n 
A 1 85  ILE 85  85   85   ILE ILE A . n 
A 1 86  GLY 86  86   86   GLY GLY A . n 
A 1 87  ARG 87  87   87   ARG ARG A . n 
A 1 88  ASN 88  88   88   ASN ASN A . n 
A 1 89  LEU 89  89   89   LEU LEU A . n 
A 1 90  LEU 90  90   90   LEU LEU A . n 
A 1 91  THR 91  91   91   THR THR A . n 
A 1 92  GLN 92  92   92   GLN GLN A . n 
A 1 93  ILE 93  93   93   ILE ILE A . n 
A 1 94  GLY 94  94   94   GLY GLY A . n 
A 1 95  MET 95  95   95   MET MET A . n 
A 1 96  THR 96  96   96   THR THR A . n 
A 1 97  LEU 97  97   97   LEU LEU A . n 
A 1 98  ASN 98  98   98   ASN ASN A . n 
A 1 99  PHE 99  99   99   PHE PHE A . n 
A 1 100 GLY 100 996  ?    ?   ?   A . n 
A 1 101 GLY 101 997  ?    ?   ?   A . n 
A 1 102 SER 102 998  ?    ?   ?   A . n 
A 1 103 SER 103 999  ?    ?   ?   A . n 
A 1 104 GLY 104 1000 ?    ?   ?   A . n 
A 1 105 PRO 105 1001 1001 PRO PRO A . n 
A 1 106 GLN 106 1002 1002 GLN GLN A . n 
A 1 107 VAL 107 1003 1003 VAL VAL A . n 
A 1 108 THR 108 1004 1004 THR THR A . n 
A 1 109 LEU 109 1005 1005 LEU LEU A . n 
A 1 110 TRP 110 1006 1006 TRP TRP A . n 
A 1 111 GLN 111 1007 1007 GLN GLN A . n 
A 1 112 ARG 112 1008 1008 ARG ARG A . n 
A 1 113 PRO 113 1009 1009 PRO PRO A . n 
A 1 114 LEU 114 1010 1010 LEU LEU A . n 
A 1 115 VAL 115 1011 1011 VAL VAL A . n 
A 1 116 THR 116 1012 1012 THR THR A . n 
A 1 117 ILE 117 1013 1013 ILE ILE A . n 
A 1 118 LYS 118 1014 1014 LYS LYS A . n 
A 1 119 ILE 119 1015 1015 ILE ILE A . n 
A 1 120 GLY 120 1016 1016 GLY GLY A . n 
A 1 121 GLY 121 1017 1017 GLY GLY A . n 
A 1 122 GLN 122 1018 1018 GLN GLN A . n 
A 1 123 LEU 123 1019 1019 LEU LEU A . n 
A 1 124 LYS 124 1020 1020 LYS LYS A . n 
A 1 125 GLU 125 1021 1021 GLU GLU A . n 
A 1 126 ALA 126 1022 1022 ALA ALA A . n 
A 1 127 LEU 127 1023 1023 LEU LEU A . n 
A 1 128 LEU 128 1024 1024 LEU LEU A . n 
A 1 129 ASP 129 1025 1025 ASP ASP A . n 
A 1 130 THR 130 1026 1026 THR THR A . n 
A 1 131 GLY 131 1027 1027 GLY GLY A . n 
A 1 132 ALA 132 1028 1028 ALA ALA A . n 
A 1 133 ASP 133 1029 1029 ASP ASP A . n 
A 1 134 ASP 134 1030 1030 ASP ASP A . n 
A 1 135 THR 135 1031 1031 THR THR A . n 
A 1 136 VAL 136 1032 1032 VAL VAL A . n 
A 1 137 LEU 137 1033 1033 LEU LEU A . n 
A 1 138 GLU 138 1034 1034 GLU GLU A . n 
A 1 139 GLU 139 1035 1035 GLU GLU A . n 
A 1 140 MET 140 1036 1036 MET MET A . n 
A 1 141 SER 141 1037 1037 SER SER A . n 
A 1 142 LEU 142 1038 1038 LEU LEU A . n 
A 1 143 PRO 143 1039 1039 PRO PRO A . n 
A 1 144 GLY 144 1040 1040 GLY GLY A . n 
A 1 145 ARG 145 1041 1041 ARG ARG A . n 
A 1 146 TRP 146 1042 1042 TRP TRP A . n 
A 1 147 LYS 147 1043 1043 LYS LYS A . n 
A 1 148 PRO 148 1044 1044 PRO PRO A . n 
A 1 149 LYS 149 1045 1045 LYS LYS A . n 
A 1 150 MET 150 1046 1046 MET MET A . n 
A 1 151 ILE 151 1047 1047 ILE ILE A . n 
A 1 152 GLY 152 1048 1048 GLY GLY A . n 
A 1 153 GLY 153 1049 1049 GLY GLY A . n 
A 1 154 ILE 154 1050 1050 ILE ILE A . n 
A 1 155 GLY 155 1051 1051 GLY GLY A . n 
A 1 156 GLY 156 1052 1052 GLY GLY A . n 
A 1 157 PHE 157 1053 1053 PHE PHE A . n 
A 1 158 ILE 158 1054 1054 ILE ILE A . n 
A 1 159 LYS 159 1055 1055 LYS LYS A . n 
A 1 160 VAL 160 1056 1056 VAL VAL A . n 
A 1 161 ARG 161 1057 1057 ARG ARG A . n 
A 1 162 GLN 162 1058 1058 GLN GLN A . n 
A 1 163 TYR 163 1059 1059 TYR TYR A . n 
A 1 164 ASP 164 1060 1060 ASP ASP A . n 
A 1 165 GLN 165 1061 1061 GLN GLN A . n 
A 1 166 ILE 166 1062 1062 ILE ILE A . n 
A 1 167 LEU 167 1063 1063 LEU LEU A . n 
A 1 168 ILE 168 1064 1064 ILE ILE A . n 
A 1 169 GLU 169 1065 1065 GLU GLU A . n 
A 1 170 ILE 170 1066 1066 ILE ILE A . n 
A 1 171 CYS 171 1067 1067 CYS CYS A . n 
A 1 172 GLY 172 1068 1068 GLY GLY A . n 
A 1 173 HIS 173 1069 1069 HIS HIS A . n 
A 1 174 LYS 174 1070 1070 LYS LYS A . n 
A 1 175 ALA 175 1071 1071 ALA ALA A . n 
A 1 176 ILE 176 1072 1072 ILE ILE A . n 
A 1 177 GLY 177 1073 1073 GLY GLY A . n 
A 1 178 THR 178 1074 1074 THR THR A . n 
A 1 179 VAL 179 1075 1075 VAL VAL A . n 
A 1 180 LEU 180 1076 1076 LEU LEU A . n 
A 1 181 VAL 181 1077 1077 VAL VAL A . n 
A 1 182 GLY 182 1078 1078 GLY GLY A . n 
A 1 183 PRO 183 1079 1079 PRO PRO A . n 
A 1 184 THR 184 1080 1080 THR THR A . n 
A 1 185 PRO 185 1081 1081 PRO PRO A . n 
A 1 186 VAL 186 1082 1082 VAL VAL A . n 
A 1 187 ASN 187 1083 1083 ASN ASN A . n 
A 1 188 ILE 188 1084 1084 ILE ILE A . n 
A 1 189 ILE 189 1085 1085 ILE ILE A . n 
A 1 190 GLY 190 1086 1086 GLY GLY A . n 
A 1 191 ARG 191 1087 1087 ARG ARG A . n 
A 1 192 ASN 192 1088 1088 ASN ASN A . n 
A 1 193 LEU 193 1089 1089 LEU LEU A . n 
A 1 194 LEU 194 1090 1090 LEU LEU A . n 
A 1 195 THR 195 1091 1091 THR THR A . n 
A 1 196 GLN 196 1092 1092 GLN GLN A . n 
A 1 197 ILE 197 1093 1093 ILE ILE A . n 
A 1 198 GLY 198 1094 1094 GLY GLY A . n 
A 1 199 ALA 199 1095 1095 ALA ALA A . n 
A 1 200 THR 200 1096 1096 THR THR A . n 
A 1 201 LEU 201 1097 1097 LEU LEU A . n 
A 1 202 ASN 202 1098 1098 ASN ASN A . n 
A 1 203 PHE 203 1099 1099 PHE PHE A . n 
B 2 1   SER 1   1    1    SER SER P . n 
B 2 2   GLN 2   2    2    GLN GLN P . n 
B 2 3   ASN 3   3    3    ASN ASN P . n 
B 2 4   TYR 4   4    4    TYR TYR P . n 
C 3 1   PRO 1   1    1    PRO PRO Q . n 
C 3 2   ILE 2   2    2    ILE ILE Q . n 
C 3 3   VAL 3   3    3    VAL VAL Q . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   1100 1100 HOH HOH A . 
D 4 HOH 2   1101 1101 HOH HOH A . 
D 4 HOH 3   1102 1102 HOH HOH A . 
D 4 HOH 4   1103 1103 HOH HOH A . 
D 4 HOH 5   1104 1104 HOH HOH A . 
D 4 HOH 6   1105 1105 HOH HOH A . 
D 4 HOH 7   1106 1106 HOH HOH A . 
D 4 HOH 8   1107 1107 HOH HOH A . 
D 4 HOH 9   1108 1108 HOH HOH A . 
D 4 HOH 10  1109 1109 HOH HOH A . 
D 4 HOH 11  1110 1110 HOH HOH A . 
D 4 HOH 12  1111 1111 HOH HOH A . 
D 4 HOH 13  1112 1112 HOH HOH A . 
D 4 HOH 14  1113 1113 HOH HOH A . 
D 4 HOH 15  1114 1114 HOH HOH A . 
D 4 HOH 16  1115 1115 HOH HOH A . 
D 4 HOH 17  1116 1116 HOH HOH A . 
D 4 HOH 18  1117 1117 HOH HOH A . 
D 4 HOH 19  1118 1118 HOH HOH A . 
D 4 HOH 20  1119 1119 HOH HOH A . 
D 4 HOH 21  1120 1120 HOH HOH A . 
D 4 HOH 22  1121 1121 HOH HOH A . 
D 4 HOH 23  1122 1122 HOH HOH A . 
D 4 HOH 24  1123 1123 HOH HOH A . 
D 4 HOH 25  1124 1124 HOH HOH A . 
D 4 HOH 26  1125 1125 HOH HOH A . 
D 4 HOH 27  1126 1126 HOH HOH A . 
D 4 HOH 28  1127 1127 HOH HOH A . 
D 4 HOH 29  1128 1128 HOH HOH A . 
D 4 HOH 30  1129 1130 HOH HOH A . 
D 4 HOH 31  1130 1131 HOH HOH A . 
D 4 HOH 32  1131 1132 HOH HOH A . 
D 4 HOH 33  1132 1133 HOH HOH A . 
D 4 HOH 34  1133 1134 HOH HOH A . 
D 4 HOH 35  1134 1135 HOH HOH A . 
D 4 HOH 36  1135 1136 HOH HOH A . 
D 4 HOH 37  1136 1137 HOH HOH A . 
D 4 HOH 38  1137 1138 HOH HOH A . 
D 4 HOH 39  1138 1139 HOH HOH A . 
D 4 HOH 40  1139 1140 HOH HOH A . 
D 4 HOH 41  1140 1141 HOH HOH A . 
D 4 HOH 42  1141 1142 HOH HOH A . 
D 4 HOH 43  1142 1143 HOH HOH A . 
D 4 HOH 44  1143 1144 HOH HOH A . 
D 4 HOH 45  1144 1145 HOH HOH A . 
D 4 HOH 46  1145 1146 HOH HOH A . 
D 4 HOH 47  1146 1147 HOH HOH A . 
D 4 HOH 48  1147 1148 HOH HOH A . 
D 4 HOH 49  1148 1149 HOH HOH A . 
D 4 HOH 50  1149 1150 HOH HOH A . 
D 4 HOH 51  1150 1151 HOH HOH A . 
D 4 HOH 52  1151 1152 HOH HOH A . 
D 4 HOH 53  1152 1153 HOH HOH A . 
D 4 HOH 54  1153 1154 HOH HOH A . 
D 4 HOH 55  1154 1155 HOH HOH A . 
D 4 HOH 56  1155 1156 HOH HOH A . 
D 4 HOH 57  1156 1157 HOH HOH A . 
D 4 HOH 58  1157 1158 HOH HOH A . 
D 4 HOH 59  1158 1159 HOH HOH A . 
D 4 HOH 60  1159 1160 HOH HOH A . 
D 4 HOH 61  1160 1161 HOH HOH A . 
D 4 HOH 62  1161 1162 HOH HOH A . 
D 4 HOH 63  1162 1163 HOH HOH A . 
D 4 HOH 64  1163 1164 HOH HOH A . 
D 4 HOH 65  1164 1166 HOH HOH A . 
D 4 HOH 66  1165 1167 HOH HOH A . 
D 4 HOH 67  1166 1168 HOH HOH A . 
D 4 HOH 68  1167 1169 HOH HOH A . 
D 4 HOH 69  1168 1170 HOH HOH A . 
D 4 HOH 70  1169 1171 HOH HOH A . 
D 4 HOH 71  1170 1173 HOH HOH A . 
D 4 HOH 72  1171 1174 HOH HOH A . 
D 4 HOH 73  1172 1175 HOH HOH A . 
D 4 HOH 74  1173 1176 HOH HOH A . 
D 4 HOH 75  1174 1177 HOH HOH A . 
D 4 HOH 76  1175 1178 HOH HOH A . 
D 4 HOH 77  1176 1179 HOH HOH A . 
D 4 HOH 78  1177 1180 HOH HOH A . 
D 4 HOH 79  1178 1181 HOH HOH A . 
D 4 HOH 80  1179 1182 HOH HOH A . 
D 4 HOH 81  1180 1183 HOH HOH A . 
D 4 HOH 82  1181 1185 HOH HOH A . 
D 4 HOH 83  1182 1187 HOH HOH A . 
D 4 HOH 84  1183 1188 HOH HOH A . 
D 4 HOH 85  1184 1189 HOH HOH A . 
D 4 HOH 86  1185 1190 HOH HOH A . 
D 4 HOH 87  1186 1191 HOH HOH A . 
D 4 HOH 88  1187 1192 HOH HOH A . 
D 4 HOH 89  1188 1193 HOH HOH A . 
D 4 HOH 90  1189 1194 HOH HOH A . 
D 4 HOH 91  1190 1195 HOH HOH A . 
D 4 HOH 92  1191 1196 HOH HOH A . 
D 4 HOH 93  1192 1198 HOH HOH A . 
D 4 HOH 94  1193 1199 HOH HOH A . 
D 4 HOH 95  1194 1200 HOH HOH A . 
D 4 HOH 96  1195 1202 HOH HOH A . 
D 4 HOH 97  1196 1203 HOH HOH A . 
D 4 HOH 98  1197 1204 HOH HOH A . 
D 4 HOH 99  1198 1205 HOH HOH A . 
D 4 HOH 100 1199 1206 HOH HOH A . 
D 4 HOH 101 1200 1207 HOH HOH A . 
D 4 HOH 102 1201 1208 HOH HOH A . 
D 4 HOH 103 1202 1209 HOH HOH A . 
D 4 HOH 104 1203 1210 HOH HOH A . 
D 4 HOH 105 1204 1211 HOH HOH A . 
D 4 HOH 106 1205 1212 HOH HOH A . 
D 4 HOH 107 1206 1213 HOH HOH A . 
D 4 HOH 108 1207 1214 HOH HOH A . 
D 4 HOH 109 1208 1216 HOH HOH A . 
D 4 HOH 110 1209 1217 HOH HOH A . 
D 4 HOH 111 1210 1218 HOH HOH A . 
D 4 HOH 112 1211 1219 HOH HOH A . 
D 4 HOH 113 1212 1220 HOH HOH A . 
D 4 HOH 114 1213 1221 HOH HOH A . 
D 4 HOH 115 1214 1222 HOH HOH A . 
D 4 HOH 116 1215 1223 HOH HOH A . 
D 4 HOH 117 1216 1224 HOH HOH A . 
D 4 HOH 118 1217 1226 HOH HOH A . 
D 4 HOH 119 1218 1227 HOH HOH A . 
D 4 HOH 120 1219 1228 HOH HOH A . 
D 4 HOH 121 1220 1229 HOH HOH A . 
D 4 HOH 122 1221 1230 HOH HOH A . 
D 4 HOH 123 1222 1231 HOH HOH A . 
D 4 HOH 124 1223 1232 HOH HOH A . 
D 4 HOH 125 1224 1233 HOH HOH A . 
D 4 HOH 126 1225 1235 HOH HOH A . 
D 4 HOH 127 1226 1236 HOH HOH A . 
D 4 HOH 128 1227 1237 HOH HOH A . 
D 4 HOH 129 1228 1238 HOH HOH A . 
D 4 HOH 130 1229 1239 HOH HOH A . 
D 4 HOH 131 1230 1240 HOH HOH A . 
D 4 HOH 132 1231 1243 HOH HOH A . 
D 4 HOH 133 1232 1244 HOH HOH A . 
D 4 HOH 134 1233 1246 HOH HOH A . 
D 4 HOH 135 1234 1247 HOH HOH A . 
D 4 HOH 136 1235 1248 HOH HOH A . 
D 4 HOH 137 1236 1249 HOH HOH A . 
D 4 HOH 138 1237 1252 HOH HOH A . 
D 4 HOH 139 1238 1253 HOH HOH A . 
D 4 HOH 140 1239 1254 HOH HOH A . 
D 4 HOH 141 1240 1255 HOH HOH A . 
D 4 HOH 142 1241 1256 HOH HOH A . 
D 4 HOH 143 1242 1258 HOH HOH A . 
D 4 HOH 144 1243 1259 HOH HOH A . 
D 4 HOH 145 1244 1260 HOH HOH A . 
D 4 HOH 146 1245 1261 HOH HOH A . 
D 4 HOH 147 1246 1262 HOH HOH A . 
D 4 HOH 148 1247 1263 HOH HOH A . 
D 4 HOH 149 1248 1264 HOH HOH A . 
D 4 HOH 150 1249 1265 HOH HOH A . 
D 4 HOH 151 1250 1267 HOH HOH A . 
D 4 HOH 152 1251 1268 HOH HOH A . 
D 4 HOH 153 1252 1269 HOH HOH A . 
D 4 HOH 154 1253 1270 HOH HOH A . 
D 4 HOH 155 1254 1271 HOH HOH A . 
D 4 HOH 156 1255 1272 HOH HOH A . 
D 4 HOH 157 1256 1273 HOH HOH A . 
D 4 HOH 158 1257 1274 HOH HOH A . 
D 4 HOH 159 1258 1275 HOH HOH A . 
D 4 HOH 160 1259 1276 HOH HOH A . 
D 4 HOH 161 1260 1277 HOH HOH A . 
D 4 HOH 162 1261 1279 HOH HOH A . 
D 4 HOH 163 1262 1280 HOH HOH A . 
D 4 HOH 164 1263 1281 HOH HOH A . 
D 4 HOH 165 1264 1282 HOH HOH A . 
D 4 HOH 166 1265 1283 HOH HOH A . 
D 4 HOH 167 1266 1284 HOH HOH A . 
D 4 HOH 168 1267 1285 HOH HOH A . 
D 4 HOH 169 1268 1287 HOH HOH A . 
D 4 HOH 170 1269 1288 HOH HOH A . 
D 4 HOH 171 1270 1289 HOH HOH A . 
D 4 HOH 172 1271 1290 HOH HOH A . 
D 4 HOH 173 1272 1291 HOH HOH A . 
D 4 HOH 174 1273 1293 HOH HOH A . 
D 4 HOH 175 1274 1294 HOH HOH A . 
D 4 HOH 176 1275 1295 HOH HOH A . 
D 4 HOH 177 1276 1296 HOH HOH A . 
D 4 HOH 178 1277 1297 HOH HOH A . 
D 4 HOH 179 1278 10   HOH HOH A . 
D 4 HOH 180 1279 11   HOH HOH A . 
D 4 HOH 181 1280 12   HOH HOH A . 
D 4 HOH 182 1281 13   HOH HOH A . 
D 4 HOH 183 1282 14   HOH HOH A . 
D 4 HOH 184 1283 15   HOH HOH A . 
D 4 HOH 185 1284 9    HOH HOH A . 
D 4 HOH 186 1285 10   HOH HOH A . 
E 4 HOH 1   6    6    HOH HOH P . 
E 4 HOH 2   7    7    HOH HOH P . 
E 4 HOH 3   9    9    HOH HOH P . 
F 4 HOH 1   5    5    HOH HOH Q . 
F 4 HOH 2   6    6    HOH HOH Q . 
F 4 HOH 3   7    7    HOH HOH Q . 
F 4 HOH 4   8    8    HOH HOH Q . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1590 ? 
1 MORE         -7   ? 
1 'SSA (A^2)'  9230 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-09 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-08-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Refinement description'    
4 3 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen               
2 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
3 3 'Structure model' software                     
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
CNS         .     ?               package 'Axel T. Brunger' axel.brunger@yale.edu refinement        http://cns-online.org/ 
Fortran_77 ? 1 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB               help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 2 
XDS         .     ?               ?       ?                 ?                     'data scaling'    ? ?          ? 3 
XDS         .     ?               ?       ?                 ?                     'data reduction'  ? ?          ? 4 
CNS         .     ?               ?       ?                 ?                     phasing           ? ?          ? 5 
# 
_pdbx_database_remark.id     600 
_pdbx_database_remark.text   
;Some waters and the short peptide partially occupy the electron density. In some unit cells the water 
cluster is there while in others the ligand is present.
;
# 
_pdbx_entry_details.entry_id             3DOX 
_pdbx_entry_details.sequence_details     
'THIS CONSTRUCT INCLUDES A LINKER THAT CONSIST OF 996TH GLY, 997TH GLY, 998TH SER, 999TH SER AND 1000TH GLY.' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 1227 ? ? O  A HOH 1228 ? ? 2.09 
2 1 NZ  A LYS 1020 ? ? O  A HOH 1148 ? ? 2.10 
3 1 O   A HOH 1240 ? ? O  A HOH 1243 ? ? 2.12 
4 1 OD2 A ASP 30   ? ? CA Q VAL 3    ? A 2.13 
5 1 SG  A CYS 67   ? ? O  A HOH 1182 ? ? 2.16 
6 1 O   A HOH 1111 ? ? O  A HOH 1123 ? ? 2.17 
7 1 CB  A PRO 1001 ? ? O  A HOH 1108 ? ? 2.18 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 1163 ? ? 1_555 O A HOH 1177 ? ? 5_554 1.91 
2 1 O A HOH 1132 ? ? 1_555 O A HOH 1255 ? ? 5_454 2.16 
3 1 O A HOH 1142 ? ? 1_555 O A HOH 1144 ? ? 6_665 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 1079 ? ? -62.95 38.63  
2 1 GLN P 2    ? A 65.29  158.57 
3 1 ASN P 3    ? A 171.12 110.70 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 996  ? A GLY 100 
2 1 Y 1 A GLY 997  ? A GLY 101 
3 1 Y 1 A SER 998  ? A SER 102 
4 1 Y 1 A SER 999  ? A SER 103 
5 1 Y 1 A GLY 1000 ? A GLY 104 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#