data_3DYQ
# 
_entry.id   3DYQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DYQ         
RCSB  RCSB048656   
WWPDB D_1000048656 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3DY8 . unspecified 
PDB 3DYL . unspecified 
PDB 3DYN . unspecified 
PDB 3DYS . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DYQ 
_pdbx_database_status.recvd_initial_deposition_date   2008-07-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, S.'       1 
'Mansour, M.N.' 2 
'Dillman, K.'   3 
'Perez, J.'     4 
'Danley, D.'    5 
'Menniti, F.'   6 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for the catalytic mechanism of human phosphodiesterase 9.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                13309 
_citation.page_last                 13314 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18757755 
_citation.pdbx_database_id_DOI      10.1073/pnas.0708850105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, S.'       1 
primary 'Mansour, M.N.' 2 
primary 'Dillman, K.S.' 3 
primary 'Perez, J.R.'   4 
primary 'Danley, D.E.'  5 
primary 'Aeed, P.A.'    6 
primary 'Simons, S.P.'  7 
primary 'Lemotte, P.K.' 8 
primary 'Menniti, F.S.' 9 
# 
_cell.entry_id           3DYQ 
_cell.length_a           103.650 
_cell.length_b           103.650 
_cell.length_c           270.041 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DYQ 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
;
38862.926 2   3.1.4.35 ? 'Catalytic domain, UNP residues 242-566' ? 
2 non-polymer syn 'SODIUM ION'                                                    22.990    4   ?        ? ? ? 
3 non-polymer syn 'CYCLIC GUANOSINE MONOPHOSPHATE'                                345.205   1   ?        ? ? ? 
4 non-polymer syn 3-ISOBUTYL-1-METHYLXANTHINE                                     222.244   1   ?        ? ? ? 
5 water       nat water                                                           18.015    238 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHC
FCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPE
CNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWV
DCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRID
DAMKELQKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHC
FCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPE
CNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWV
DCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRID
DAMKELQKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   THR n 
1 6   TYR n 
1 7   PRO n 
1 8   LYS n 
1 9   TYR n 
1 10  LEU n 
1 11  LEU n 
1 12  SER n 
1 13  PRO n 
1 14  GLU n 
1 15  THR n 
1 16  ILE n 
1 17  GLU n 
1 18  ALA n 
1 19  LEU n 
1 20  ARG n 
1 21  LYS n 
1 22  PRO n 
1 23  THR n 
1 24  PHE n 
1 25  ASP n 
1 26  VAL n 
1 27  TRP n 
1 28  LEU n 
1 29  TRP n 
1 30  GLU n 
1 31  PRO n 
1 32  ASN n 
1 33  GLU n 
1 34  MET n 
1 35  LEU n 
1 36  SER n 
1 37  CYS n 
1 38  LEU n 
1 39  GLU n 
1 40  HIS n 
1 41  MET n 
1 42  TYR n 
1 43  HIS n 
1 44  ASP n 
1 45  LEU n 
1 46  GLY n 
1 47  LEU n 
1 48  VAL n 
1 49  ARG n 
1 50  ASP n 
1 51  PHE n 
1 52  SER n 
1 53  ILE n 
1 54  ASN n 
1 55  PRO n 
1 56  VAL n 
1 57  THR n 
1 58  LEU n 
1 59  ARG n 
1 60  ARG n 
1 61  TRP n 
1 62  LEU n 
1 63  PHE n 
1 64  CYS n 
1 65  VAL n 
1 66  HIS n 
1 67  ASP n 
1 68  ASN n 
1 69  TYR n 
1 70  ARG n 
1 71  ASN n 
1 72  ASN n 
1 73  PRO n 
1 74  PHE n 
1 75  HIS n 
1 76  ASN n 
1 77  PHE n 
1 78  ARG n 
1 79  HIS n 
1 80  CYS n 
1 81  PHE n 
1 82  CYS n 
1 83  VAL n 
1 84  ALA n 
1 85  GLN n 
1 86  MET n 
1 87  MET n 
1 88  TYR n 
1 89  SER n 
1 90  MET n 
1 91  VAL n 
1 92  TRP n 
1 93  LEU n 
1 94  CYS n 
1 95  SER n 
1 96  LEU n 
1 97  GLN n 
1 98  GLU n 
1 99  LYS n 
1 100 PHE n 
1 101 SER n 
1 102 GLN n 
1 103 THR n 
1 104 ASP n 
1 105 ILE n 
1 106 LEU n 
1 107 ILE n 
1 108 LEU n 
1 109 MET n 
1 110 THR n 
1 111 ALA n 
1 112 ALA n 
1 113 ILE n 
1 114 CYS n 
1 115 HIS n 
1 116 ASP n 
1 117 LEU n 
1 118 ASP n 
1 119 HIS n 
1 120 PRO n 
1 121 GLY n 
1 122 TYR n 
1 123 ASN n 
1 124 ASN n 
1 125 THR n 
1 126 TYR n 
1 127 GLN n 
1 128 ILE n 
1 129 ASN n 
1 130 ALA n 
1 131 ARG n 
1 132 THR n 
1 133 GLU n 
1 134 LEU n 
1 135 ALA n 
1 136 VAL n 
1 137 ARG n 
1 138 TYR n 
1 139 ASN n 
1 140 ASP n 
1 141 ILE n 
1 142 SER n 
1 143 PRO n 
1 144 LEU n 
1 145 GLU n 
1 146 ASN n 
1 147 HIS n 
1 148 HIS n 
1 149 CYS n 
1 150 ALA n 
1 151 VAL n 
1 152 ALA n 
1 153 PHE n 
1 154 GLN n 
1 155 ILE n 
1 156 LEU n 
1 157 ALA n 
1 158 GLU n 
1 159 PRO n 
1 160 GLU n 
1 161 CYS n 
1 162 ASN n 
1 163 ILE n 
1 164 PHE n 
1 165 SER n 
1 166 ASN n 
1 167 ILE n 
1 168 PRO n 
1 169 PRO n 
1 170 ASP n 
1 171 GLY n 
1 172 PHE n 
1 173 LYS n 
1 174 GLN n 
1 175 ILE n 
1 176 ARG n 
1 177 GLN n 
1 178 GLY n 
1 179 MET n 
1 180 ILE n 
1 181 THR n 
1 182 LEU n 
1 183 ILE n 
1 184 LEU n 
1 185 ALA n 
1 186 THR n 
1 187 ASP n 
1 188 MET n 
1 189 ALA n 
1 190 ARG n 
1 191 HIS n 
1 192 ALA n 
1 193 GLU n 
1 194 ILE n 
1 195 MET n 
1 196 ASP n 
1 197 SER n 
1 198 PHE n 
1 199 LYS n 
1 200 GLU n 
1 201 LYS n 
1 202 MET n 
1 203 GLU n 
1 204 ASN n 
1 205 PHE n 
1 206 ASP n 
1 207 TYR n 
1 208 SER n 
1 209 ASN n 
1 210 GLU n 
1 211 GLU n 
1 212 HIS n 
1 213 MET n 
1 214 THR n 
1 215 LEU n 
1 216 LEU n 
1 217 LYS n 
1 218 MET n 
1 219 ILE n 
1 220 LEU n 
1 221 ILE n 
1 222 LYS n 
1 223 CYS n 
1 224 CYS n 
1 225 ASP n 
1 226 ILE n 
1 227 SER n 
1 228 ASN n 
1 229 GLU n 
1 230 VAL n 
1 231 ARG n 
1 232 PRO n 
1 233 MET n 
1 234 GLU n 
1 235 VAL n 
1 236 ALA n 
1 237 GLU n 
1 238 PRO n 
1 239 TRP n 
1 240 VAL n 
1 241 ASP n 
1 242 CYS n 
1 243 LEU n 
1 244 LEU n 
1 245 GLU n 
1 246 GLU n 
1 247 TYR n 
1 248 PHE n 
1 249 MET n 
1 250 GLN n 
1 251 SER n 
1 252 ASP n 
1 253 ARG n 
1 254 GLU n 
1 255 LYS n 
1 256 SER n 
1 257 GLU n 
1 258 GLY n 
1 259 LEU n 
1 260 PRO n 
1 261 VAL n 
1 262 ALA n 
1 263 PRO n 
1 264 PHE n 
1 265 MET n 
1 266 ASP n 
1 267 ARG n 
1 268 ASP n 
1 269 LYS n 
1 270 VAL n 
1 271 THR n 
1 272 LYS n 
1 273 ALA n 
1 274 THR n 
1 275 ALA n 
1 276 GLN n 
1 277 ILE n 
1 278 GLY n 
1 279 PHE n 
1 280 ILE n 
1 281 LYS n 
1 282 PHE n 
1 283 VAL n 
1 284 LEU n 
1 285 ILE n 
1 286 PRO n 
1 287 MET n 
1 288 PHE n 
1 289 GLU n 
1 290 THR n 
1 291 VAL n 
1 292 THR n 
1 293 LYS n 
1 294 LEU n 
1 295 PHE n 
1 296 PRO n 
1 297 MET n 
1 298 VAL n 
1 299 GLU n 
1 300 GLU n 
1 301 ILE n 
1 302 MET n 
1 303 LEU n 
1 304 GLN n 
1 305 PRO n 
1 306 LEU n 
1 307 TRP n 
1 308 GLU n 
1 309 SER n 
1 310 ARG n 
1 311 ASP n 
1 312 ARG n 
1 313 TYR n 
1 314 GLU n 
1 315 GLU n 
1 316 LEU n 
1 317 LYS n 
1 318 ARG n 
1 319 ILE n 
1 320 ASP n 
1 321 ASP n 
1 322 ALA n 
1 323 MET n 
1 324 LYS n 
1 325 GLU n 
1 326 LEU n 
1 327 GLN n 
1 328 LYS n 
1 329 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PDE9A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'N-His tag (removed after purification) catalytic domain' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDE9A_HUMAN 
_struct_ref.pdbx_db_accession          O76083 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVA
QMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIF
SNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLL
EEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMK
ELQKK
;
_struct_ref.pdbx_align_begin           242 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DYQ A 5 ? 329 ? O76083 242 ? 566 ? 182 506 
2 1 3DYQ B 5 ? 329 ? O76083 242 ? 566 ? 182 506 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3DYQ GLY A 1 ? UNP O76083 ? ? 'EXPRESSION TAG' 178 1 
1 3DYQ SER A 2 ? UNP O76083 ? ? 'EXPRESSION TAG' 179 2 
1 3DYQ HIS A 3 ? UNP O76083 ? ? 'EXPRESSION TAG' 180 3 
1 3DYQ MET A 4 ? UNP O76083 ? ? 'EXPRESSION TAG' 181 4 
2 3DYQ GLY B 1 ? UNP O76083 ? ? 'EXPRESSION TAG' 178 5 
2 3DYQ SER B 2 ? UNP O76083 ? ? 'EXPRESSION TAG' 179 6 
2 3DYQ HIS B 3 ? UNP O76083 ? ? 'EXPRESSION TAG' 180 7 
2 3DYQ MET B 4 ? UNP O76083 ? ? 'EXPRESSION TAG' 181 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                          ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                         ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                       ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                  ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                         ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                        ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                  ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                          ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                        ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                            ? 'H2 O'            18.015  
IBM non-polymer         . 3-ISOBUTYL-1-METHYLXANTHINE      ? 'C10 H14 N4 O2'   222.244 
ILE 'L-peptide linking' y ISOLEUCINE                       ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                          ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                           ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                       ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                     ? 'Na 1'            22.990  
PCG non-polymer         . 'CYCLIC GUANOSINE MONOPHOSPHATE' ? 'C10 H12 N5 O7 P' 345.205 
PHE 'L-peptide linking' y PHENYLALANINE                    ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                          ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                           ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                        ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                       ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                         ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                           ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3DYQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.66 
_exptl_crystal.density_percent_sol   73.58 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3DYQ 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   65299 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3DYQ 
_refine.ls_number_reflns_obs                     46414 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.54 
_refine.ls_R_factor_obs                          0.19885 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19566 
_refine.ls_R_factor_R_free                       0.22627 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  5261 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.B_iso_mean                               40.023 
_refine.aniso_B[1][1]                            1.86 
_refine.aniso_B[2][2]                            1.86 
_refine.aniso_B[3][3]                            -3.72 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1TBM' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.249 
_refine.pdbx_overall_ESU_R_Free                  0.206 
_refine.overall_SU_ML                            0.149 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             14.204 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5412 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             238 
_refine_hist.number_atoms_total               5693 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 5595 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 3816 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.350  1.963  ? 7584 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.832  3.000  ? 9298 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.529  5.000  ? 654  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.991 24.317 ? 278  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.570 15.000 ? 1000 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.603 15.000 ? 32   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.077  0.200  ? 817  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 6101 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 1129 'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.262  0.200  ? 1557 'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.213  0.200  ? 4053 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.201  0.200  ? 2827 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.092  0.200  ? 2788 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.207  0.200  ? 250  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.203  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.270  0.200  ? 21   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.300  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.268  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.717  1.500  ? 3300 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.187  1.500  ? 1288 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.499  2.000  ? 5380 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.760  3.000  ? 2389 'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.327  4.500  ? 2204 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1723 0.06 0.05 'tight positional'  1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 2334 0.22 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 1723 0.16 0.50 'tight thermal'     1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 2334 0.75 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.565 
_refine_ls_shell.number_reflns_R_work             3396 
_refine_ls_shell.R_factor_R_work                  0.320 
_refine_ls_shell.percent_reflns_obs               99.60 
_refine_ls_shell.R_factor_R_free                  0.368 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             356 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 178 A 427 1 2 A GLY 1   ? A GLN 250 ? 1 ? 
2 B 178 B 427 1 2 B GLY 1   ? B GLN 250 ? 1 ? 
1 A 448 A 488 2 2 A THR 271 ? A ASP 311 ? 1 ? 
2 B 448 B 488 2 2 B THR 271 ? B ASP 311 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3DYQ 
_struct.title                     'human phosphodiestrase 9 (inhibited by omitting divalent cation) in complex with cGMP' 
_struct.pdbx_descriptor           
;High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DYQ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'PHOSPHODIESTERASE, ENZYME MECHANISM, cGMP, Hydrolase, Manganese, Metal-binding, Phosphoprotein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 12  ? LEU A 19  ? SER A 189 LEU A 196 1 ? 8  
HELX_P HELX_P2  2  GLU A 30  ? LEU A 45  ? GLU A 207 LEU A 222 1 ? 16 
HELX_P HELX_P3  3  GLY A 46  ? PHE A 51  ? GLY A 223 PHE A 228 1 ? 6  
HELX_P HELX_P4  4  ASN A 54  ? TYR A 69  ? ASN A 231 TYR A 246 1 ? 16 
HELX_P HELX_P5  5  ASN A 76  ? CYS A 94  ? ASN A 253 CYS A 271 1 ? 19 
HELX_P HELX_P6  6  SER A 95  ? LYS A 99  ? SER A 272 LYS A 276 5 ? 5  
HELX_P HELX_P7  7  SER A 101 ? HIS A 115 ? SER A 278 HIS A 292 1 ? 15 
HELX_P HELX_P8  8  ASN A 123 ? ARG A 131 ? ASN A 300 ARG A 308 1 ? 9  
HELX_P HELX_P9  9  THR A 132 ? TYR A 138 ? THR A 309 TYR A 315 1 ? 7  
HELX_P HELX_P10 10 SER A 142 ? GLU A 158 ? SER A 319 GLU A 335 1 ? 17 
HELX_P HELX_P11 11 PRO A 159 ? ASN A 162 ? PRO A 336 ASN A 339 5 ? 4  
HELX_P HELX_P12 12 PRO A 168 ? THR A 186 ? PRO A 345 THR A 363 1 ? 19 
HELX_P HELX_P13 13 ASP A 187 ? ALA A 189 ? ASP A 364 ALA A 366 5 ? 3  
HELX_P HELX_P14 14 ARG A 190 ? GLU A 203 ? ARG A 367 GLU A 380 1 ? 14 
HELX_P HELX_P15 15 ASN A 209 ? ILE A 226 ? ASN A 386 ILE A 403 1 ? 18 
HELX_P HELX_P16 16 SER A 227 ? ARG A 231 ? SER A 404 ARG A 408 5 ? 5  
HELX_P HELX_P17 17 PRO A 232 ? GLY A 258 ? PRO A 409 GLY A 435 1 ? 27 
HELX_P HELX_P18 18 ALA A 262 ? ASP A 266 ? ALA A 439 ASP A 443 5 ? 5  
HELX_P HELX_P19 19 THR A 271 ? VAL A 283 ? THR A 448 VAL A 460 1 ? 13 
HELX_P HELX_P20 20 VAL A 283 ? PHE A 295 ? VAL A 460 PHE A 472 1 ? 13 
HELX_P HELX_P21 21 PRO A 296 ? LYS A 324 ? PRO A 473 LYS A 501 1 ? 29 
HELX_P HELX_P22 22 SER B 12  ? LEU B 19  ? SER B 189 LEU B 196 1 ? 8  
HELX_P HELX_P23 23 GLU B 30  ? LEU B 45  ? GLU B 207 LEU B 222 1 ? 16 
HELX_P HELX_P24 24 GLY B 46  ? SER B 52  ? GLY B 223 SER B 229 1 ? 7  
HELX_P HELX_P25 25 ASN B 54  ? TYR B 69  ? ASN B 231 TYR B 246 1 ? 16 
HELX_P HELX_P26 26 ASN B 76  ? CYS B 94  ? ASN B 253 CYS B 271 1 ? 19 
HELX_P HELX_P27 27 SER B 95  ? PHE B 100 ? SER B 272 PHE B 277 1 ? 6  
HELX_P HELX_P28 28 SER B 101 ? HIS B 115 ? SER B 278 HIS B 292 1 ? 15 
HELX_P HELX_P29 29 ASN B 123 ? ALA B 130 ? ASN B 300 ALA B 307 1 ? 8  
HELX_P HELX_P30 30 THR B 132 ? TYR B 138 ? THR B 309 TYR B 315 1 ? 7  
HELX_P HELX_P31 31 SER B 142 ? GLU B 158 ? SER B 319 GLU B 335 1 ? 17 
HELX_P HELX_P32 32 PRO B 159 ? ASN B 162 ? PRO B 336 ASN B 339 5 ? 4  
HELX_P HELX_P33 33 PRO B 168 ? THR B 186 ? PRO B 345 THR B 363 1 ? 19 
HELX_P HELX_P34 34 ASP B 187 ? ALA B 189 ? ASP B 364 ALA B 366 5 ? 3  
HELX_P HELX_P35 35 ARG B 190 ? GLU B 203 ? ARG B 367 GLU B 380 1 ? 14 
HELX_P HELX_P36 36 ASN B 209 ? ILE B 226 ? ASN B 386 ILE B 403 1 ? 18 
HELX_P HELX_P37 37 SER B 227 ? ARG B 231 ? SER B 404 ARG B 408 5 ? 5  
HELX_P HELX_P38 38 PRO B 232 ? GLY B 258 ? PRO B 409 GLY B 435 1 ? 27 
HELX_P HELX_P39 39 ALA B 262 ? ASP B 266 ? ALA B 439 ASP B 443 5 ? 5  
HELX_P HELX_P40 40 THR B 271 ? VAL B 283 ? THR B 448 VAL B 460 1 ? 13 
HELX_P HELX_P41 41 VAL B 283 ? PHE B 295 ? VAL B 460 PHE B 472 1 ? 13 
HELX_P HELX_P42 42 PRO B 296 ? LYS B 328 ? PRO B 473 LYS B 505 1 ? 33 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 79  NE2 ? ? ? 1_555 C NA  . NA  ? ? A HIS 256 A NA  901 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc2  metalc ? ? A HIS 115 NE2 ? ? ? 1_555 C NA  . NA  ? ? A HIS 292 A NA  901 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc3  metalc ? ? A ASP 116 OD1 ? ? ? 1_555 D NA  . NA  ? ? A ASP 293 A NA  902 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc4  metalc ? ? A ASP 116 OD2 ? ? ? 1_555 C NA  . NA  ? ? A ASP 293 A NA  901 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc5  metalc ? ? A ASP 225 OD1 ? ? ? 1_555 C NA  . NA  ? ? A ASP 402 A NA  901 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc6  metalc ? ? B HIS 79  NE2 ? ? ? 1_555 F NA  . NA  ? ? B HIS 256 B NA  901 1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc7  metalc ? ? B HIS 115 NE2 ? ? ? 1_555 F NA  . NA  ? ? B HIS 292 B NA  901 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc8  metalc ? ? B ASP 116 OD1 ? ? ? 1_555 G NA  . NA  ? ? B ASP 293 B NA  902 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc9  metalc ? ? B ASP 116 OD2 ? ? ? 1_555 F NA  . NA  ? ? B ASP 293 B NA  901 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc10 metalc ? ? B ASP 225 OD1 ? ? ? 1_555 F NA  . NA  ? ? B ASP 402 B NA  901 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc11 metalc ? ? C NA  .   NA  ? ? ? 1_555 E PCG . O1A ? ? A NA  901 A PCG 900 1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc12 metalc ? ? D NA  .   NA  ? ? ? 1_555 I HOH . O   ? ? A NA  902 A HOH 93  1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc13 metalc ? ? D NA  .   NA  ? ? ? 1_555 I HOH . O   ? ? A NA  902 A HOH 95  1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc14 metalc ? ? D NA  .   NA  ? ? ? 1_555 E PCG . O1A ? ? A NA  902 A PCG 900 1_555 ? ? ? ? ? ? ? 2.918 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 901'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 902'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA B 901'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA B 902'  
AC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PCG A 900' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE IBM B 900' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  HIS A 79  ? HIS A 256  . ? 1_555 ? 
2  AC1 6  HIS A 115 ? HIS A 292  . ? 1_555 ? 
3  AC1 6  ASP A 116 ? ASP A 293  . ? 1_555 ? 
4  AC1 6  ASP A 225 ? ASP A 402  . ? 1_555 ? 
5  AC1 6  PCG E .   ? PCG A 900  . ? 1_555 ? 
6  AC1 6  NA  D .   ? NA  A 902  . ? 1_555 ? 
7  AC2 5  HOH I .   ? HOH A 93   . ? 1_555 ? 
8  AC2 5  HOH I .   ? HOH A 95   . ? 1_555 ? 
9  AC2 5  ASP A 116 ? ASP A 293  . ? 1_555 ? 
10 AC2 5  PCG E .   ? PCG A 900  . ? 1_555 ? 
11 AC2 5  NA  C .   ? NA  A 901  . ? 1_555 ? 
12 AC3 5  HIS B 79  ? HIS B 256  . ? 1_555 ? 
13 AC3 5  HIS B 115 ? HIS B 292  . ? 1_555 ? 
14 AC3 5  ASP B 116 ? ASP B 293  . ? 1_555 ? 
15 AC3 5  ASP B 225 ? ASP B 402  . ? 1_555 ? 
16 AC3 5  NA  G .   ? NA  B 902  . ? 1_555 ? 
17 AC4 2  ASP B 116 ? ASP B 293  . ? 1_555 ? 
18 AC4 2  NA  F .   ? NA  B 901  . ? 1_555 ? 
19 AC5 13 HOH I .   ? HOH A 92   . ? 1_555 ? 
20 AC5 13 HIS A 75  ? HIS A 252  . ? 1_555 ? 
21 AC5 13 MET A 188 ? MET A 365  . ? 1_555 ? 
22 AC5 13 ASP A 225 ? ASP A 402  . ? 1_555 ? 
23 AC5 13 ILE A 226 ? ILE A 403  . ? 1_555 ? 
24 AC5 13 LEU A 243 ? LEU A 420  . ? 1_555 ? 
25 AC5 13 TYR A 247 ? TYR A 424  . ? 1_555 ? 
26 AC5 13 ALA A 275 ? ALA A 452  . ? 1_555 ? 
27 AC5 13 GLN A 276 ? GLN A 453  . ? 1_555 ? 
28 AC5 13 PHE A 279 ? PHE A 456  . ? 1_555 ? 
29 AC5 13 NA  C .   ? NA  A 901  . ? 1_555 ? 
30 AC5 13 NA  D .   ? NA  A 902  . ? 1_555 ? 
31 AC5 13 HOH I .   ? HOH A 1020 . ? 1_555 ? 
32 AC6 10 ALA A 322 ? ALA A 499  . ? 5_645 ? 
33 AC6 10 MET A 323 ? MET A 500  . ? 5_645 ? 
34 AC6 10 ILE B 226 ? ILE B 403  . ? 1_555 ? 
35 AC6 10 LEU B 243 ? LEU B 420  . ? 1_555 ? 
36 AC6 10 TYR B 247 ? TYR B 424  . ? 1_555 ? 
37 AC6 10 ALA B 275 ? ALA B 452  . ? 1_555 ? 
38 AC6 10 GLN B 276 ? GLN B 453  . ? 1_555 ? 
39 AC6 10 PHE B 279 ? PHE B 456  . ? 1_555 ? 
40 AC6 10 HOH J .   ? HOH B 1037 . ? 1_555 ? 
41 AC6 10 HOH J .   ? HOH B 1049 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3DYQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DYQ 
_atom_sites.fract_transf_matrix[1][1]   0.009648 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009648 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003703 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 91.637  50.699 76.693  1.00 71.32  ? 178  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 92.495  49.482 76.774  1.00 70.68  ? 178  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 93.811  49.828 77.441  1.00 69.86  ? 178  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 93.948  49.704 78.680  1.00 70.92  ? 178  GLY A O     1 
ATOM   5    N  N     . SER A 1 2   ? 94.740  50.360 76.638  1.00 67.58  ? 179  SER A N     1 
ATOM   6    C  CA    . SER A 1 2   ? 96.170  50.018 76.758  1.00 66.08  ? 179  SER A CA    1 
ATOM   7    C  C     . SER A 1 2   ? 97.031  50.977 77.606  1.00 64.03  ? 179  SER A C     1 
ATOM   8    O  O     . SER A 1 2   ? 96.790  52.182 77.639  1.00 64.10  ? 179  SER A O     1 
ATOM   9    C  CB    . SER A 1 2   ? 96.749  49.852 75.345  1.00 66.73  ? 179  SER A CB    1 
ATOM   10   O  OG    . SER A 1 2   ? 96.033  48.843 74.611  1.00 67.19  ? 179  SER A OG    1 
ATOM   11   N  N     . HIS A 1 3   ? 98.058  50.424 78.253  1.00 61.49  ? 180  HIS A N     1 
ATOM   12   C  CA    . HIS A 1 3   ? 98.847  51.133 79.268  1.00 59.45  ? 180  HIS A CA    1 
ATOM   13   C  C     . HIS A 1 3   ? 99.809  52.194 78.686  1.00 58.17  ? 180  HIS A C     1 
ATOM   14   O  O     . HIS A 1 3   ? 100.480 52.904 79.416  1.00 58.30  ? 180  HIS A O     1 
ATOM   15   C  CB    . HIS A 1 3   ? 99.630  50.103 80.077  1.00 59.19  ? 180  HIS A CB    1 
ATOM   16   C  CG    . HIS A 1 3   ? 100.915 49.683 79.429  1.00 59.78  ? 180  HIS A CG    1 
ATOM   17   N  ND1   . HIS A 1 3   ? 100.978 48.717 78.445  1.00 59.10  ? 180  HIS A ND1   1 
ATOM   18   C  CD2   . HIS A 1 3   ? 102.183 50.131 79.600  1.00 57.30  ? 180  HIS A CD2   1 
ATOM   19   C  CE1   . HIS A 1 3   ? 102.235 48.563 78.068  1.00 57.83  ? 180  HIS A CE1   1 
ATOM   20   N  NE2   . HIS A 1 3   ? 102.987 49.399 78.763  1.00 57.81  ? 180  HIS A NE2   1 
ATOM   21   N  N     . MET A 1 4   ? 99.956  52.211 77.372  1.00 56.75  ? 181  MET A N     1 
ATOM   22   C  CA    . MET A 1 4   ? 100.796 53.177 76.693  1.00 55.36  ? 181  MET A CA    1 
ATOM   23   C  C     . MET A 1 4   ? 100.171 53.342 75.310  1.00 54.91  ? 181  MET A C     1 
ATOM   24   O  O     . MET A 1 4   ? 99.228  52.621 74.961  1.00 54.66  ? 181  MET A O     1 
ATOM   25   C  CB    . MET A 1 4   ? 102.255 52.683 76.609  1.00 55.05  ? 181  MET A CB    1 
ATOM   26   C  CG    . MET A 1 4   ? 102.495 51.534 75.632  1.00 52.67  ? 181  MET A CG    1 
ATOM   27   S  SD    . MET A 1 4   ? 104.210 51.365 75.112  1.00 48.77  ? 181  MET A SD    1 
ATOM   28   C  CE    . MET A 1 4   ? 104.820 52.999 75.406  1.00 47.39  ? 181  MET A CE    1 
ATOM   29   N  N     . THR A 1 5   ? 100.695 54.282 74.529  1.00 54.42  ? 182  THR A N     1 
ATOM   30   C  CA    . THR A 1 5   ? 100.105 54.623 73.246  1.00 53.67  ? 182  THR A CA    1 
ATOM   31   C  C     . THR A 1 5   ? 100.956 54.069 72.122  1.00 53.71  ? 182  THR A C     1 
ATOM   32   O  O     . THR A 1 5   ? 102.179 54.081 72.186  1.00 54.12  ? 182  THR A O     1 
ATOM   33   C  CB    . THR A 1 5   ? 99.934  56.152 73.107  1.00 53.56  ? 182  THR A CB    1 
ATOM   34   O  OG1   . THR A 1 5   ? 99.104  56.624 74.176  1.00 53.10  ? 182  THR A OG1   1 
ATOM   35   C  CG2   . THR A 1 5   ? 99.312  56.509 71.773  1.00 52.33  ? 182  THR A CG2   1 
ATOM   36   N  N     . TYR A 1 6   ? 100.292 53.570 71.098  1.00 53.55  ? 183  TYR A N     1 
ATOM   37   C  CA    . TYR A 1 6   ? 100.969 52.950 69.991  1.00 54.30  ? 183  TYR A CA    1 
ATOM   38   C  C     . TYR A 1 6   ? 100.665 53.722 68.677  1.00 55.43  ? 183  TYR A C     1 
ATOM   39   O  O     . TYR A 1 6   ? 99.612  54.324 68.526  1.00 55.89  ? 183  TYR A O     1 
ATOM   40   C  CB    . TYR A 1 6   ? 100.532 51.465 69.901  1.00 53.45  ? 183  TYR A CB    1 
ATOM   41   C  CG    . TYR A 1 6   ? 100.770 50.660 71.176  1.00 51.70  ? 183  TYR A CG    1 
ATOM   42   C  CD1   . TYR A 1 6   ? 99.811  50.594 72.168  1.00 48.72  ? 183  TYR A CD1   1 
ATOM   43   C  CD2   . TYR A 1 6   ? 101.947 49.931 71.360  1.00 51.84  ? 183  TYR A CD2   1 
ATOM   44   C  CE1   . TYR A 1 6   ? 100.020 49.857 73.313  1.00 48.84  ? 183  TYR A CE1   1 
ATOM   45   C  CE2   . TYR A 1 6   ? 102.157 49.183 72.497  1.00 49.72  ? 183  TYR A CE2   1 
ATOM   46   C  CZ    . TYR A 1 6   ? 101.193 49.153 73.473  1.00 48.82  ? 183  TYR A CZ    1 
ATOM   47   O  OH    . TYR A 1 6   ? 101.405 48.441 74.633  1.00 49.07  ? 183  TYR A OH    1 
ATOM   48   N  N     . PRO A 1 7   ? 101.628 53.770 67.757  1.00 56.57  ? 184  PRO A N     1 
ATOM   49   C  CA    . PRO A 1 7   ? 101.369 54.153 66.391  1.00 57.34  ? 184  PRO A CA    1 
ATOM   50   C  C     . PRO A 1 7   ? 100.119 53.555 65.772  1.00 58.36  ? 184  PRO A C     1 
ATOM   51   O  O     . PRO A 1 7   ? 99.818  52.347 65.948  1.00 58.16  ? 184  PRO A O     1 
ATOM   52   C  CB    . PRO A 1 7   ? 102.599 53.626 65.631  1.00 57.90  ? 184  PRO A CB    1 
ATOM   53   C  CG    . PRO A 1 7   ? 103.539 53.062 66.673  1.00 57.63  ? 184  PRO A CG    1 
ATOM   54   C  CD    . PRO A 1 7   ? 103.066 53.611 67.987  1.00 57.04  ? 184  PRO A CD    1 
ATOM   55   N  N     . LYS A 1 8   ? 99.490  54.366 64.921  1.00 58.91  ? 185  LYS A N     1 
ATOM   56   C  CA    . LYS A 1 8   ? 98.189  54.037 64.391  1.00 58.82  ? 185  LYS A CA    1 
ATOM   57   C  C     . LYS A 1 8   ? 98.299  52.786 63.550  1.00 57.99  ? 185  LYS A C     1 
ATOM   58   O  O     . LYS A 1 8   ? 97.314  52.060 63.440  1.00 57.98  ? 185  LYS A O     1 
ATOM   59   C  CB    . LYS A 1 8   ? 97.608  55.169 63.550  1.00 59.69  ? 185  LYS A CB    1 
ATOM   60   C  CG    . LYS A 1 8   ? 97.932  56.589 63.997  1.00 62.58  ? 185  LYS A CG    1 
ATOM   61   C  CD    . LYS A 1 8   ? 96.784  57.572 63.622  1.00 68.66  ? 185  LYS A CD    1 
ATOM   62   C  CE    . LYS A 1 8   ? 97.251  58.788 62.779  1.00 71.18  ? 185  LYS A CE    1 
ATOM   63   N  NZ    . LYS A 1 8   ? 97.093  58.609 61.292  1.00 71.45  ? 185  LYS A NZ    1 
ATOM   64   N  N     . TYR A 1 9   ? 99.481  52.522 62.969  1.00 57.12  ? 186  TYR A N     1 
ATOM   65   C  CA    . TYR A 1 9   ? 99.674  51.327 62.096  1.00 56.48  ? 186  TYR A CA    1 
ATOM   66   C  C     . TYR A 1 9   ? 99.840  50.058 62.908  1.00 54.39  ? 186  TYR A C     1 
ATOM   67   O  O     . TYR A 1 9   ? 99.898  48.958 62.355  1.00 54.11  ? 186  TYR A O     1 
ATOM   68   C  CB    . TYR A 1 9   ? 100.881 51.476 61.168  1.00 57.68  ? 186  TYR A CB    1 
ATOM   69   C  CG    . TYR A 1 9   ? 102.130 51.907 61.902  1.00 59.78  ? 186  TYR A CG    1 
ATOM   70   C  CD1   . TYR A 1 9   ? 102.975 50.958 62.513  1.00 60.76  ? 186  TYR A CD1   1 
ATOM   71   C  CD2   . TYR A 1 9   ? 102.452 53.264 62.022  1.00 60.29  ? 186  TYR A CD2   1 
ATOM   72   C  CE1   . TYR A 1 9   ? 104.099 51.356 63.226  1.00 60.86  ? 186  TYR A CE1   1 
ATOM   73   C  CE2   . TYR A 1 9   ? 103.582 53.669 62.718  1.00 61.37  ? 186  TYR A CE2   1 
ATOM   74   C  CZ    . TYR A 1 9   ? 104.396 52.714 63.322  1.00 61.72  ? 186  TYR A CZ    1 
ATOM   75   O  OH    . TYR A 1 9   ? 105.506 53.128 64.004  1.00 61.59  ? 186  TYR A OH    1 
ATOM   76   N  N     . LEU A 1 10  ? 99.956  50.217 64.220  1.00 52.38  ? 187  LEU A N     1 
ATOM   77   C  CA    . LEU A 1 10  ? 99.696  49.110 65.127  1.00 50.57  ? 187  LEU A CA    1 
ATOM   78   C  C     . LEU A 1 10  ? 98.232  49.191 65.505  1.00 49.71  ? 187  LEU A C     1 
ATOM   79   O  O     . LEU A 1 10  ? 97.809  50.009 66.323  1.00 49.84  ? 187  LEU A O     1 
ATOM   80   C  CB    . LEU A 1 10  ? 100.615 49.173 66.351  1.00 50.47  ? 187  LEU A CB    1 
ATOM   81   C  CG    . LEU A 1 10  ? 102.091 49.242 65.979  1.00 46.51  ? 187  LEU A CG    1 
ATOM   82   C  CD1   . LEU A 1 10  ? 102.898 49.231 67.201  1.00 44.19  ? 187  LEU A CD1   1 
ATOM   83   C  CD2   . LEU A 1 10  ? 102.444 48.085 65.044  1.00 43.66  ? 187  LEU A CD2   1 
ATOM   84   N  N     . LEU A 1 11  ? 97.458  48.362 64.838  1.00 48.67  ? 188  LEU A N     1 
ATOM   85   C  CA    . LEU A 1 11  ? 96.043  48.326 65.031  1.00 48.42  ? 188  LEU A CA    1 
ATOM   86   C  C     . LEU A 1 11  ? 95.768  47.945 66.466  1.00 48.04  ? 188  LEU A C     1 
ATOM   87   O  O     . LEU A 1 11  ? 96.383  47.023 66.969  1.00 49.36  ? 188  LEU A O     1 
ATOM   88   C  CB    . LEU A 1 11  ? 95.462  47.257 64.112  1.00 48.79  ? 188  LEU A CB    1 
ATOM   89   C  CG    . LEU A 1 11  ? 95.760  47.447 62.620  1.00 48.95  ? 188  LEU A CG    1 
ATOM   90   C  CD1   . LEU A 1 11  ? 95.224  46.237 61.821  1.00 46.64  ? 188  LEU A CD1   1 
ATOM   91   C  CD2   . LEU A 1 11  ? 95.149  48.785 62.125  1.00 47.22  ? 188  LEU A CD2   1 
ATOM   92   N  N     . SER A 1 12  ? 94.814  48.603 67.107  1.00 46.95  ? 189  SER A N     1 
ATOM   93   C  CA    . SER A 1 12  ? 94.410  48.229 68.460  1.00 46.18  ? 189  SER A CA    1 
ATOM   94   C  C     . SER A 1 12  ? 93.606  46.940 68.444  1.00 45.26  ? 189  SER A C     1 
ATOM   95   O  O     . SER A 1 12  ? 93.030  46.587 67.416  1.00 45.71  ? 189  SER A O     1 
ATOM   96   C  CB    . SER A 1 12  ? 93.559  49.348 69.059  1.00 46.38  ? 189  SER A CB    1 
ATOM   97   O  OG    . SER A 1 12  ? 92.350  49.509 68.335  1.00 45.80  ? 189  SER A OG    1 
ATOM   98   N  N     . PRO A 1 13  ? 93.531  46.248 69.592  1.00 45.08  ? 190  PRO A N     1 
ATOM   99   C  CA    . PRO A 1 13  ? 92.654  45.084 69.757  1.00 44.93  ? 190  PRO A CA    1 
ATOM   100  C  C     . PRO A 1 13  ? 91.214  45.370 69.381  1.00 45.29  ? 190  PRO A C     1 
ATOM   101  O  O     . PRO A 1 13  ? 90.582  44.534 68.766  1.00 44.99  ? 190  PRO A O     1 
ATOM   102  C  CB    . PRO A 1 13  ? 92.748  44.790 71.240  1.00 44.06  ? 190  PRO A CB    1 
ATOM   103  C  CG    . PRO A 1 13  ? 94.097  45.289 71.627  1.00 44.26  ? 190  PRO A CG    1 
ATOM   104  C  CD    . PRO A 1 13  ? 94.269  46.538 70.835  1.00 45.49  ? 190  PRO A CD    1 
ATOM   105  N  N     . GLU A 1 14  ? 90.723  46.566 69.710  1.00 46.36  ? 191  GLU A N     1 
ATOM   106  C  CA    . GLU A 1 14  ? 89.343  46.978 69.362  1.00 47.05  ? 191  GLU A CA    1 
ATOM   107  C  C     . GLU A 1 14  ? 89.155  47.059 67.840  1.00 46.15  ? 191  GLU A C     1 
ATOM   108  O  O     . GLU A 1 14  ? 88.141  46.626 67.301  1.00 45.97  ? 191  GLU A O     1 
ATOM   109  C  CB    . GLU A 1 14  ? 88.955  48.328 70.009  1.00 47.42  ? 191  GLU A CB    1 
ATOM   110  C  CG    . GLU A 1 14  ? 89.202  48.399 71.543  1.00 53.37  ? 191  GLU A CG    1 
ATOM   111  C  CD    . GLU A 1 14  ? 90.673  48.707 71.884  1.00 59.05  ? 191  GLU A CD    1 
ATOM   112  O  OE1   . GLU A 1 14  ? 91.194  49.702 71.333  1.00 64.25  ? 191  GLU A OE1   1 
ATOM   113  O  OE2   . GLU A 1 14  ? 91.310  47.959 72.669  1.00 60.78  ? 191  GLU A OE2   1 
ATOM   114  N  N     . THR A 1 15  ? 90.148  47.591 67.147  1.00 45.25  ? 192  THR A N     1 
ATOM   115  C  CA    . THR A 1 15  ? 90.064  47.679 65.713  1.00 44.42  ? 192  THR A CA    1 
ATOM   116  C  C     . THR A 1 15  ? 90.064  46.306 65.084  1.00 44.68  ? 192  THR A C     1 
ATOM   117  O  O     . THR A 1 15  ? 89.212  46.020 64.244  1.00 44.46  ? 192  THR A O     1 
ATOM   118  C  CB    . THR A 1 15  ? 91.186  48.531 65.155  1.00 44.44  ? 192  THR A CB    1 
ATOM   119  O  OG1   . THR A 1 15  ? 91.045  49.852 65.688  1.00 42.70  ? 192  THR A OG1   1 
ATOM   120  C  CG2   . THR A 1 15  ? 91.128  48.591 63.637  1.00 41.39  ? 192  THR A CG2   1 
ATOM   121  N  N     . ILE A 1 16  ? 90.987  45.452 65.512  1.00 45.09  ? 193  ILE A N     1 
ATOM   122  C  CA    . ILE A 1 16  ? 91.065  44.078 64.997  1.00 45.82  ? 193  ILE A CA    1 
ATOM   123  C  C     . ILE A 1 16  ? 89.725  43.379 65.096  1.00 46.17  ? 193  ILE A C     1 
ATOM   124  O  O     . ILE A 1 16  ? 89.285  42.714 64.175  1.00 46.99  ? 193  ILE A O     1 
ATOM   125  C  CB    . ILE A 1 16  ? 92.130  43.254 65.777  1.00 46.87  ? 193  ILE A CB    1 
ATOM   126  C  CG1   . ILE A 1 16  ? 93.534  43.603 65.274  1.00 46.71  ? 193  ILE A CG1   1 
ATOM   127  C  CG2   . ILE A 1 16  ? 91.863  41.736 65.700  1.00 44.50  ? 193  ILE A CG2   1 
ATOM   128  C  CD1   . ILE A 1 16  ? 94.610  42.961 66.097  1.00 47.86  ? 193  ILE A CD1   1 
ATOM   129  N  N     . GLU A 1 17  ? 89.076  43.560 66.225  1.00 47.27  ? 194  GLU A N     1 
ATOM   130  C  CA    . GLU A 1 17  ? 87.755  43.015 66.482  1.00 48.99  ? 194  GLU A CA    1 
ATOM   131  C  C     . GLU A 1 17  ? 86.697  43.639 65.555  1.00 47.61  ? 194  GLU A C     1 
ATOM   132  O  O     . GLU A 1 17  ? 85.923  42.950 64.908  1.00 48.42  ? 194  GLU A O     1 
ATOM   133  C  CB    . GLU A 1 17  ? 87.429  43.294 67.958  1.00 50.35  ? 194  GLU A CB    1 
ATOM   134  C  CG    . GLU A 1 17  ? 86.218  42.580 68.508  1.00 58.21  ? 194  GLU A CG    1 
ATOM   135  C  CD    . GLU A 1 17  ? 86.369  41.063 68.503  1.00 66.70  ? 194  GLU A CD    1 
ATOM   136  O  OE1   . GLU A 1 17  ? 85.586  40.399 69.222  1.00 73.22  ? 194  GLU A OE1   1 
ATOM   137  O  OE2   . GLU A 1 17  ? 87.266  40.535 67.798  1.00 69.78  ? 194  GLU A OE2   1 
ATOM   138  N  N     . ALA A 1 18  ? 86.720  44.951 65.444  1.00 45.91  ? 195  ALA A N     1 
ATOM   139  C  CA    . ALA A 1 18  ? 85.721  45.668 64.682  1.00 45.14  ? 195  ALA A CA    1 
ATOM   140  C  C     . ALA A 1 18  ? 85.815  45.301 63.202  1.00 45.38  ? 195  ALA A C     1 
ATOM   141  O  O     . ALA A 1 18  ? 84.833  45.378 62.455  1.00 45.17  ? 195  ALA A O     1 
ATOM   142  C  CB    . ALA A 1 18  ? 85.928  47.152 64.867  1.00 43.14  ? 195  ALA A CB    1 
ATOM   143  N  N     . LEU A 1 19  ? 87.014  44.919 62.785  1.00 45.18  ? 196  LEU A N     1 
ATOM   144  C  CA    . LEU A 1 19  ? 87.307  44.678 61.384  1.00 44.95  ? 196  LEU A CA    1 
ATOM   145  C  C     . LEU A 1 19  ? 86.578  43.454 60.859  1.00 45.11  ? 196  LEU A C     1 
ATOM   146  O  O     . LEU A 1 19  ? 86.484  43.264 59.668  1.00 44.37  ? 196  LEU A O     1 
ATOM   147  C  CB    . LEU A 1 19  ? 88.813  44.483 61.233  1.00 44.91  ? 196  LEU A CB    1 
ATOM   148  C  CG    . LEU A 1 19  ? 89.469  44.578 59.865  1.00 44.19  ? 196  LEU A CG    1 
ATOM   149  C  CD1   . LEU A 1 19  ? 89.279  45.963 59.277  1.00 39.02  ? 196  LEU A CD1   1 
ATOM   150  C  CD2   . LEU A 1 19  ? 90.963  44.196 60.009  1.00 41.49  ? 196  LEU A CD2   1 
ATOM   151  N  N     . ARG A 1 20  ? 86.048  42.630 61.756  1.00 46.34  ? 197  ARG A N     1 
ATOM   152  C  CA    . ARG A 1 20  ? 85.378  41.388 61.371  1.00 47.19  ? 197  ARG A CA    1 
ATOM   153  C  C     . ARG A 1 20  ? 83.929  41.595 60.986  1.00 46.31  ? 197  ARG A C     1 
ATOM   154  O  O     . ARG A 1 20  ? 83.235  40.673 60.599  1.00 44.78  ? 197  ARG A O     1 
ATOM   155  C  CB    . ARG A 1 20  ? 85.460  40.406 62.530  1.00 48.17  ? 197  ARG A CB    1 
ATOM   156  C  CG    . ARG A 1 20  ? 86.735  39.614 62.488  1.00 53.59  ? 197  ARG A CG    1 
ATOM   157  C  CD    . ARG A 1 20  ? 87.257  39.192 63.843  1.00 59.93  ? 197  ARG A CD    1 
ATOM   158  N  NE    . ARG A 1 20  ? 88.085  38.007 63.667  1.00 61.92  ? 197  ARG A NE    1 
ATOM   159  C  CZ    . ARG A 1 20  ? 87.576  36.792 63.557  1.00 67.56  ? 197  ARG A CZ    1 
ATOM   160  N  NH1   . ARG A 1 20  ? 86.267  36.613 63.639  1.00 69.13  ? 197  ARG A NH1   1 
ATOM   161  N  NH2   . ARG A 1 20  ? 88.366  35.747 63.380  1.00 71.74  ? 197  ARG A NH2   1 
ATOM   162  N  N     . LYS A 1 21  ? 83.479  42.826 61.107  1.00 46.40  ? 198  LYS A N     1 
ATOM   163  C  CA    . LYS A 1 21  ? 82.078  43.127 60.992  1.00 47.33  ? 198  LYS A CA    1 
ATOM   164  C  C     . LYS A 1 21  ? 81.827  44.192 59.939  1.00 46.13  ? 198  LYS A C     1 
ATOM   165  O  O     . LYS A 1 21  ? 82.674  45.027 59.667  1.00 45.53  ? 198  LYS A O     1 
ATOM   166  C  CB    . LYS A 1 21  ? 81.544  43.586 62.342  1.00 47.77  ? 198  LYS A CB    1 
ATOM   167  C  CG    . LYS A 1 21  ? 81.398  42.445 63.328  1.00 51.13  ? 198  LYS A CG    1 
ATOM   168  C  CD    . LYS A 1 21  ? 81.209  42.942 64.782  1.00 58.31  ? 198  LYS A CD    1 
ATOM   169  C  CE    . LYS A 1 21  ? 82.344  42.461 65.733  1.00 61.61  ? 198  LYS A CE    1 
ATOM   170  N  NZ    . LYS A 1 21  ? 82.368  43.158 67.069  1.00 62.20  ? 198  LYS A NZ    1 
ATOM   171  N  N     . PRO A 1 22  ? 80.677  44.095 59.285  1.00 45.70  ? 199  PRO A N     1 
ATOM   172  C  CA    . PRO A 1 22  ? 80.315  45.002 58.209  1.00 45.11  ? 199  PRO A CA    1 
ATOM   173  C  C     . PRO A 1 22  ? 79.950  46.391 58.700  1.00 44.26  ? 199  PRO A C     1 
ATOM   174  O  O     . PRO A 1 22  ? 79.702  47.280 57.899  1.00 44.57  ? 199  PRO A O     1 
ATOM   175  C  CB    . PRO A 1 22  ? 79.111  44.299 57.546  1.00 45.16  ? 199  PRO A CB    1 
ATOM   176  C  CG    . PRO A 1 22  ? 78.550  43.389 58.607  1.00 44.75  ? 199  PRO A CG    1 
ATOM   177  C  CD    . PRO A 1 22  ? 79.703  42.992 59.454  1.00 45.34  ? 199  PRO A CD    1 
ATOM   178  N  N     . THR A 1 23  ? 79.929  46.587 60.006  1.00 43.42  ? 200  THR A N     1 
ATOM   179  C  CA    . THR A 1 23  ? 79.712  47.910 60.560  1.00 42.49  ? 200  THR A CA    1 
ATOM   180  C  C     . THR A 1 23  ? 80.996  48.737 60.622  1.00 43.14  ? 200  THR A C     1 
ATOM   181  O  O     . THR A 1 23  ? 80.953  49.918 60.958  1.00 42.59  ? 200  THR A O     1 
ATOM   182  C  CB    . THR A 1 23  ? 79.132  47.794 61.950  1.00 42.40  ? 200  THR A CB    1 
ATOM   183  O  OG1   . THR A 1 23  ? 79.923  46.863 62.708  1.00 43.48  ? 200  THR A OG1   1 
ATOM   184  C  CG2   . THR A 1 23  ? 77.672  47.310 61.898  1.00 39.76  ? 200  THR A CG2   1 
ATOM   185  N  N     . PHE A 1 24  ? 82.138  48.145 60.276  1.00 43.52  ? 201  PHE A N     1 
ATOM   186  C  CA    . PHE A 1 24  ? 83.419  48.841 60.394  1.00 43.87  ? 201  PHE A CA    1 
ATOM   187  C  C     . PHE A 1 24  ? 83.417  50.191 59.670  1.00 44.31  ? 201  PHE A C     1 
ATOM   188  O  O     . PHE A 1 24  ? 82.990  50.303 58.539  1.00 44.78  ? 201  PHE A O     1 
ATOM   189  C  CB    . PHE A 1 24  ? 84.508  47.963 59.833  1.00 43.62  ? 201  PHE A CB    1 
ATOM   190  C  CG    . PHE A 1 24  ? 85.904  48.459 60.087  1.00 44.02  ? 201  PHE A CG    1 
ATOM   191  C  CD1   . PHE A 1 24  ? 86.532  48.217 61.290  1.00 46.36  ? 201  PHE A CD1   1 
ATOM   192  C  CD2   . PHE A 1 24  ? 86.632  49.071 59.086  1.00 44.58  ? 201  PHE A CD2   1 
ATOM   193  C  CE1   . PHE A 1 24  ? 87.855  48.633 61.512  1.00 45.21  ? 201  PHE A CE1   1 
ATOM   194  C  CE2   . PHE A 1 24  ? 87.957  49.456 59.294  1.00 43.84  ? 201  PHE A CE2   1 
ATOM   195  C  CZ    . PHE A 1 24  ? 88.561  49.225 60.517  1.00 43.29  ? 201  PHE A CZ    1 
ATOM   196  N  N     . ASP A 1 25  ? 83.900  51.226 60.318  1.00 45.18  ? 202  ASP A N     1 
ATOM   197  C  CA    . ASP A 1 25  ? 83.929  52.521 59.676  1.00 45.97  ? 202  ASP A CA    1 
ATOM   198  C  C     . ASP A 1 25  ? 85.151  52.654 58.787  1.00 45.80  ? 202  ASP A C     1 
ATOM   199  O  O     . ASP A 1 25  ? 86.244  52.994 59.241  1.00 44.68  ? 202  ASP A O     1 
ATOM   200  C  CB    . ASP A 1 25  ? 83.967  53.630 60.705  1.00 47.03  ? 202  ASP A CB    1 
ATOM   201  C  CG    . ASP A 1 25  ? 83.762  54.992 60.097  1.00 48.36  ? 202  ASP A CG    1 
ATOM   202  O  OD1   . ASP A 1 25  ? 83.707  55.957 60.878  1.00 54.26  ? 202  ASP A OD1   1 
ATOM   203  O  OD2   . ASP A 1 25  ? 83.614  55.099 58.864  1.00 48.57  ? 202  ASP A OD2   1 
ATOM   204  N  N     . VAL A 1 26  ? 84.923  52.475 57.500  1.00 45.97  ? 203  VAL A N     1 
ATOM   205  C  CA    . VAL A 1 26  ? 85.980  52.500 56.531  1.00 45.74  ? 203  VAL A CA    1 
ATOM   206  C  C     . VAL A 1 26  ? 86.549  53.904 56.318  1.00 47.39  ? 203  VAL A C     1 
ATOM   207  O  O     . VAL A 1 26  ? 87.478  54.050 55.536  1.00 48.81  ? 203  VAL A O     1 
ATOM   208  C  CB    . VAL A 1 26  ? 85.490  51.961 55.167  1.00 45.95  ? 203  VAL A CB    1 
ATOM   209  C  CG1   . VAL A 1 26  ? 84.847  50.574 55.321  1.00 43.29  ? 203  VAL A CG1   1 
ATOM   210  C  CG2   . VAL A 1 26  ? 84.522  52.967 54.511  1.00 43.45  ? 203  VAL A CG2   1 
ATOM   211  N  N     . TRP A 1 27  ? 86.006  54.934 56.976  1.00 47.65  ? 204  TRP A N     1 
ATOM   212  C  CA    . TRP A 1 27  ? 86.488  56.312 56.784  1.00 47.83  ? 204  TRP A CA    1 
ATOM   213  C  C     . TRP A 1 27  ? 87.495  56.746 57.852  1.00 48.49  ? 204  TRP A C     1 
ATOM   214  O  O     . TRP A 1 27  ? 88.131  57.779 57.733  1.00 48.47  ? 204  TRP A O     1 
ATOM   215  C  CB    . TRP A 1 27  ? 85.301  57.289 56.770  1.00 47.22  ? 204  TRP A CB    1 
ATOM   216  C  CG    . TRP A 1 27  ? 84.365  57.092 55.612  1.00 47.31  ? 204  TRP A CG    1 
ATOM   217  C  CD1   . TRP A 1 27  ? 83.125  56.518 55.642  1.00 46.90  ? 204  TRP A CD1   1 
ATOM   218  C  CD2   . TRP A 1 27  ? 84.604  57.451 54.239  1.00 49.36  ? 204  TRP A CD2   1 
ATOM   219  N  NE1   . TRP A 1 27  ? 82.576  56.503 54.383  1.00 47.42  ? 204  TRP A NE1   1 
ATOM   220  C  CE2   . TRP A 1 27  ? 83.451  57.088 53.506  1.00 47.17  ? 204  TRP A CE2   1 
ATOM   221  C  CE3   . TRP A 1 27  ? 85.678  58.063 53.558  1.00 48.79  ? 204  TRP A CE3   1 
ATOM   222  C  CZ2   . TRP A 1 27  ? 83.333  57.322 52.125  1.00 47.69  ? 204  TRP A CZ2   1 
ATOM   223  C  CZ3   . TRP A 1 27  ? 85.561  58.287 52.179  1.00 46.58  ? 204  TRP A CZ3   1 
ATOM   224  C  CH2   . TRP A 1 27  ? 84.402  57.907 51.482  1.00 47.02  ? 204  TRP A CH2   1 
ATOM   225  N  N     . LEU A 1 28  ? 87.583  55.978 58.927  1.00 49.43  ? 205  LEU A N     1 
ATOM   226  C  CA    . LEU A 1 28  ? 88.353  56.350 60.090  1.00 49.97  ? 205  LEU A CA    1 
ATOM   227  C  C     . LEU A 1 28  ? 89.832  56.391 59.800  1.00 49.88  ? 205  LEU A C     1 
ATOM   228  O  O     . LEU A 1 28  ? 90.582  57.037 60.527  1.00 50.91  ? 205  LEU A O     1 
ATOM   229  C  CB    . LEU A 1 28  ? 88.126  55.322 61.196  1.00 50.30  ? 205  LEU A CB    1 
ATOM   230  C  CG    . LEU A 1 28  ? 87.285  55.690 62.410  1.00 53.17  ? 205  LEU A CG    1 
ATOM   231  C  CD1   . LEU A 1 28  ? 88.237  56.232 63.551  1.00 52.55  ? 205  LEU A CD1   1 
ATOM   232  C  CD2   . LEU A 1 28  ? 86.160  56.667 61.986  1.00 52.38  ? 205  LEU A CD2   1 
ATOM   233  N  N     . TRP A 1 29  ? 90.251  55.666 58.776  1.00 49.85  ? 206  TRP A N     1 
ATOM   234  C  CA    . TRP A 1 29  ? 91.622  55.167 58.687  1.00 51.11  ? 206  TRP A CA    1 
ATOM   235  C  C     . TRP A 1 29  ? 92.349  55.748 57.503  1.00 51.01  ? 206  TRP A C     1 
ATOM   236  O  O     . TRP A 1 29  ? 91.792  55.853 56.423  1.00 50.68  ? 206  TRP A O     1 
ATOM   237  C  CB    . TRP A 1 29  ? 91.630  53.645 58.514  1.00 52.91  ? 206  TRP A CB    1 
ATOM   238  C  CG    . TRP A 1 29  ? 90.811  53.002 59.518  1.00 54.74  ? 206  TRP A CG    1 
ATOM   239  C  CD1   . TRP A 1 29  ? 89.565  52.482 59.346  1.00 55.29  ? 206  TRP A CD1   1 
ATOM   240  C  CD2   . TRP A 1 29  ? 91.111  52.898 60.910  1.00 54.38  ? 206  TRP A CD2   1 
ATOM   241  N  NE1   . TRP A 1 29  ? 89.077  52.059 60.550  1.00 57.63  ? 206  TRP A NE1   1 
ATOM   242  C  CE2   . TRP A 1 29  ? 90.004  52.309 61.528  1.00 55.68  ? 206  TRP A CE2   1 
ATOM   243  C  CE3   . TRP A 1 29  ? 92.188  53.289 61.692  1.00 56.40  ? 206  TRP A CE3   1 
ATOM   244  C  CZ2   . TRP A 1 29  ? 89.946  52.083 62.893  1.00 56.68  ? 206  TRP A CZ2   1 
ATOM   245  C  CZ3   . TRP A 1 29  ? 92.140  53.057 63.049  1.00 57.34  ? 206  TRP A CZ3   1 
ATOM   246  C  CH2   . TRP A 1 29  ? 91.024  52.462 63.636  1.00 57.65  ? 206  TRP A CH2   1 
ATOM   247  N  N     . GLU A 1 30  ? 93.624  56.029 57.680  1.00 51.03  ? 207  GLU A N     1 
ATOM   248  C  CA    . GLU A 1 30  ? 94.436  56.449 56.560  1.00 52.18  ? 207  GLU A CA    1 
ATOM   249  C  C     . GLU A 1 30  ? 94.967  55.229 55.846  1.00 50.91  ? 207  GLU A C     1 
ATOM   250  O  O     . GLU A 1 30  ? 94.809  54.135 56.331  1.00 50.93  ? 207  GLU A O     1 
ATOM   251  C  CB    . GLU A 1 30  ? 95.543  57.376 57.039  1.00 52.96  ? 207  GLU A CB    1 
ATOM   252  C  CG    . GLU A 1 30  ? 95.048  58.817 57.094  1.00 58.90  ? 207  GLU A CG    1 
ATOM   253  C  CD    . GLU A 1 30  ? 95.929  59.720 57.916  1.00 66.21  ? 207  GLU A CD    1 
ATOM   254  O  OE1   . GLU A 1 30  ? 96.955  59.240 58.459  1.00 71.82  ? 207  GLU A OE1   1 
ATOM   255  O  OE2   . GLU A 1 30  ? 95.592  60.924 58.017  1.00 73.64  ? 207  GLU A OE2   1 
ATOM   256  N  N     . PRO A 1 31  ? 95.557  55.407 54.662  1.00 50.41  ? 208  PRO A N     1 
ATOM   257  C  CA    . PRO A 1 31  ? 95.984  54.275 53.849  1.00 49.94  ? 208  PRO A CA    1 
ATOM   258  C  C     . PRO A 1 31  ? 96.906  53.280 54.554  1.00 49.24  ? 208  PRO A C     1 
ATOM   259  O  O     . PRO A 1 31  ? 96.683  52.069 54.488  1.00 48.69  ? 208  PRO A O     1 
ATOM   260  C  CB    . PRO A 1 31  ? 96.689  54.958 52.669  1.00 50.44  ? 208  PRO A CB    1 
ATOM   261  C  CG    . PRO A 1 31  ? 95.981  56.219 52.526  1.00 49.07  ? 208  PRO A CG    1 
ATOM   262  C  CD    . PRO A 1 31  ? 95.805  56.672 53.955  1.00 50.29  ? 208  PRO A CD    1 
ATOM   263  N  N     . ASN A 1 32  ? 97.880  53.775 55.297  1.00 49.21  ? 209  ASN A N     1 
ATOM   264  C  CA    . ASN A 1 32  ? 98.797  52.859 55.958  1.00 49.62  ? 209  ASN A CA    1 
ATOM   265  C  C     . ASN A 1 32  ? 98.084  52.060 57.062  1.00 48.32  ? 209  ASN A C     1 
ATOM   266  O  O     . ASN A 1 32  ? 98.463  50.923 57.325  1.00 48.35  ? 209  ASN A O     1 
ATOM   267  C  CB    . ASN A 1 32  ? 100.064 53.570 56.457  1.00 49.60  ? 209  ASN A CB    1 
ATOM   268  C  CG    . ASN A 1 32  ? 99.801  54.464 57.659  1.00 55.95  ? 209  ASN A CG    1 
ATOM   269  O  OD1   . ASN A 1 32  ? 98.793  55.179 57.697  1.00 65.20  ? 209  ASN A OD1   1 
ATOM   270  N  ND2   . ASN A 1 32  ? 100.700 54.428 58.662  1.00 59.72  ? 209  ASN A ND2   1 
ATOM   271  N  N     . GLU A 1 33  ? 97.025  52.613 57.662  1.00 47.03  ? 210  GLU A N     1 
ATOM   272  C  CA    . GLU A 1 33  ? 96.178  51.829 58.575  1.00 46.38  ? 210  GLU A CA    1 
ATOM   273  C  C     . GLU A 1 33  ? 95.332  50.787 57.837  1.00 44.85  ? 210  GLU A C     1 
ATOM   274  O  O     . GLU A 1 33  ? 95.149  49.646 58.301  1.00 43.17  ? 210  GLU A O     1 
ATOM   275  C  CB    . GLU A 1 33  ? 95.265  52.739 59.357  1.00 46.43  ? 210  GLU A CB    1 
ATOM   276  C  CG    . GLU A 1 33  ? 95.995  53.579 60.341  1.00 50.60  ? 210  GLU A CG    1 
ATOM   277  C  CD    . GLU A 1 33  ? 95.247  54.882 60.693  1.00 57.98  ? 210  GLU A CD    1 
ATOM   278  O  OE1   . GLU A 1 33  ? 94.538  54.896 61.738  1.00 60.12  ? 210  GLU A OE1   1 
ATOM   279  O  OE2   . GLU A 1 33  ? 95.383  55.887 59.938  1.00 61.59  ? 210  GLU A OE2   1 
ATOM   280  N  N     . MET A 1 34  ? 94.794  51.186 56.693  1.00 43.80  ? 211  MET A N     1 
ATOM   281  C  CA    . MET A 1 34  ? 94.050  50.241 55.883  1.00 44.08  ? 211  MET A CA    1 
ATOM   282  C  C     . MET A 1 34  ? 94.968  49.107 55.441  1.00 43.44  ? 211  MET A C     1 
ATOM   283  O  O     . MET A 1 34  ? 94.570  47.926 55.436  1.00 43.27  ? 211  MET A O     1 
ATOM   284  C  CB    . MET A 1 34  ? 93.391  50.918 54.688  1.00 43.85  ? 211  MET A CB    1 
ATOM   285  C  CG    . MET A 1 34  ? 92.111  51.616 55.053  1.00 44.59  ? 211  MET A CG    1 
ATOM   286  S  SD    . MET A 1 34  ? 91.395  52.507 53.661  1.00 47.01  ? 211  MET A SD    1 
ATOM   287  C  CE    . MET A 1 34  ? 92.455  53.943 53.511  1.00 39.66  ? 211  MET A CE    1 
ATOM   288  N  N     . LEU A 1 35  ? 96.204  49.458 55.099  1.00 42.70  ? 212  LEU A N     1 
ATOM   289  C  CA    . LEU A 1 35  ? 97.138  48.444 54.651  1.00 42.08  ? 212  LEU A CA    1 
ATOM   290  C  C     . LEU A 1 35  ? 97.404  47.458 55.771  1.00 42.02  ? 212  LEU A C     1 
ATOM   291  O  O     . LEU A 1 35  ? 97.410  46.239 55.551  1.00 42.55  ? 212  LEU A O     1 
ATOM   292  C  CB    . LEU A 1 35  ? 98.427  49.068 54.154  1.00 42.38  ? 212  LEU A CB    1 
ATOM   293  C  CG    . LEU A 1 35  ? 98.355  49.776 52.789  1.00 41.36  ? 212  LEU A CG    1 
ATOM   294  C  CD1   . LEU A 1 35  ? 99.552  50.673 52.644  1.00 35.63  ? 212  LEU A CD1   1 
ATOM   295  C  CD2   . LEU A 1 35  ? 98.278  48.791 51.628  1.00 39.80  ? 212  LEU A CD2   1 
ATOM   296  N  N     . SER A 1 36  ? 97.493  47.963 56.994  1.00 41.25  ? 213  SER A N     1 
ATOM   297  C  CA    . SER A 1 36  ? 97.661  47.075 58.126  1.00 41.55  ? 213  SER A CA    1 
ATOM   298  C  C     . SER A 1 36  ? 96.463  46.121 58.297  1.00 41.01  ? 213  SER A C     1 
ATOM   299  O  O     . SER A 1 36  ? 96.626  44.940 58.600  1.00 40.65  ? 213  SER A O     1 
ATOM   300  C  CB    . SER A 1 36  ? 97.877  47.876 59.392  1.00 41.07  ? 213  SER A CB    1 
ATOM   301  O  OG    . SER A 1 36  ? 99.197  48.335 59.469  1.00 42.58  ? 213  SER A OG    1 
ATOM   302  N  N     . CYS A 1 37  ? 95.266  46.650 58.143  1.00 40.73  ? 214  CYS A N     1 
ATOM   303  C  CA    . CYS A 1 37  ? 94.079  45.827 58.187  1.00 41.87  ? 214  CYS A CA    1 
ATOM   304  C  C     . CYS A 1 37  ? 94.098  44.704 57.165  1.00 41.94  ? 214  CYS A C     1 
ATOM   305  O  O     . CYS A 1 37  ? 93.735  43.572 57.461  1.00 41.39  ? 214  CYS A O     1 
ATOM   306  C  CB    . CYS A 1 37  ? 92.853  46.707 57.950  1.00 42.37  ? 214  CYS A CB    1 
ATOM   307  S  SG    . CYS A 1 37  ? 92.617  47.801 59.342  1.00 44.65  ? 214  CYS A SG    1 
ATOM   308  N  N     . LEU A 1 38  ? 94.502  45.027 55.944  1.00 42.32  ? 215  LEU A N     1 
ATOM   309  C  CA    . LEU A 1 38  ? 94.481  44.024 54.907  1.00 42.81  ? 215  LEU A CA    1 
ATOM   310  C  C     . LEU A 1 38  ? 95.476  42.934 55.264  1.00 42.95  ? 215  LEU A C     1 
ATOM   311  O  O     . LEU A 1 38  ? 95.187  41.735 55.137  1.00 42.56  ? 215  LEU A O     1 
ATOM   312  C  CB    . LEU A 1 38  ? 94.804  44.640 53.547  1.00 42.54  ? 215  LEU A CB    1 
ATOM   313  C  CG    . LEU A 1 38  ? 93.691  45.525 52.991  1.00 42.19  ? 215  LEU A CG    1 
ATOM   314  C  CD1   . LEU A 1 38  ? 94.090  46.166 51.663  1.00 36.88  ? 215  LEU A CD1   1 
ATOM   315  C  CD2   . LEU A 1 38  ? 92.380  44.712 52.866  1.00 37.97  ? 215  LEU A CD2   1 
ATOM   316  N  N     . GLU A 1 39  ? 96.643  43.364 55.724  1.00 42.89  ? 216  GLU A N     1 
ATOM   317  C  CA    . GLU A 1 39  ? 97.671  42.450 56.188  1.00 42.79  ? 216  GLU A CA    1 
ATOM   318  C  C     . GLU A 1 39  ? 97.124  41.515 57.235  1.00 42.79  ? 216  GLU A C     1 
ATOM   319  O  O     . GLU A 1 39  ? 97.299  40.291 57.166  1.00 42.44  ? 216  GLU A O     1 
ATOM   320  C  CB    . GLU A 1 39  ? 98.816  43.243 56.791  1.00 42.92  ? 216  GLU A CB    1 
ATOM   321  C  CG    . GLU A 1 39  ? 99.958  42.418 57.307  1.00 43.27  ? 216  GLU A CG    1 
ATOM   322  C  CD    . GLU A 1 39  ? 101.015 43.286 57.946  1.00 45.92  ? 216  GLU A CD    1 
ATOM   323  O  OE1   . GLU A 1 39  ? 102.099 42.763 58.249  1.00 44.31  ? 216  GLU A OE1   1 
ATOM   324  O  OE2   . GLU A 1 39  ? 100.752 44.494 58.151  1.00 51.67  ? 216  GLU A OE2   1 
ATOM   325  N  N     . HIS A 1 40  ? 96.459  42.089 58.218  1.00 42.79  ? 217  HIS A N     1 
ATOM   326  C  CA    . HIS A 1 40  ? 95.945  41.292 59.303  1.00 43.40  ? 217  HIS A CA    1 
ATOM   327  C  C     . HIS A 1 40  ? 94.980  40.226 58.788  1.00 42.91  ? 217  HIS A C     1 
ATOM   328  O  O     . HIS A 1 40  ? 94.971  39.102 59.270  1.00 43.31  ? 217  HIS A O     1 
ATOM   329  C  CB    . HIS A 1 40  ? 95.250  42.175 60.323  1.00 43.38  ? 217  HIS A CB    1 
ATOM   330  C  CG    . HIS A 1 40  ? 94.433  41.406 61.301  1.00 46.75  ? 217  HIS A CG    1 
ATOM   331  N  ND1   . HIS A 1 40  ? 95.001  40.612 62.271  1.00 50.29  ? 217  HIS A ND1   1 
ATOM   332  C  CD2   . HIS A 1 40  ? 93.092  41.230 61.403  1.00 48.42  ? 217  HIS A CD2   1 
ATOM   333  C  CE1   . HIS A 1 40  ? 94.042  40.003 62.951  1.00 50.20  ? 217  HIS A CE1   1 
ATOM   334  N  NE2   . HIS A 1 40  ? 92.876  40.359 62.442  1.00 49.33  ? 217  HIS A NE2   1 
ATOM   335  N  N     . MET A 1 41  ? 94.136  40.590 57.841  1.00 42.14  ? 218  MET A N     1 
ATOM   336  C  CA    . MET A 1 41  ? 93.194  39.630 57.269  1.00 41.80  ? 218  MET A CA    1 
ATOM   337  C  C     . MET A 1 41  ? 93.889  38.400 56.726  1.00 40.96  ? 218  MET A C     1 
ATOM   338  O  O     . MET A 1 41  ? 93.419  37.287 56.901  1.00 40.93  ? 218  MET A O     1 
ATOM   339  C  CB    . MET A 1 41  ? 92.394  40.265 56.144  1.00 41.18  ? 218  MET A CB    1 
ATOM   340  C  CG    . MET A 1 41  ? 91.436  41.306 56.612  1.00 42.40  ? 218  MET A CG    1 
ATOM   341  S  SD    . MET A 1 41  ? 90.804  42.239 55.227  1.00 45.10  ? 218  MET A SD    1 
ATOM   342  C  CE    . MET A 1 41  ? 90.210  43.696 56.089  1.00 42.56  ? 218  MET A CE    1 
ATOM   343  N  N     . TYR A 1 42  ? 95.026  38.603 56.086  1.00 40.79  ? 219  TYR A N     1 
ATOM   344  C  CA    . TYR A 1 42  ? 95.725  37.499 55.450  1.00 40.91  ? 219  TYR A CA    1 
ATOM   345  C  C     . TYR A 1 42  ? 96.323  36.565 56.492  1.00 40.84  ? 219  TYR A C     1 
ATOM   346  O  O     . TYR A 1 42  ? 96.293  35.335 56.346  1.00 40.20  ? 219  TYR A O     1 
ATOM   347  C  CB    . TYR A 1 42  ? 96.767  38.013 54.430  1.00 41.22  ? 219  TYR A CB    1 
ATOM   348  C  CG    . TYR A 1 42  ? 96.205  38.205 53.020  1.00 39.27  ? 219  TYR A CG    1 
ATOM   349  C  CD1   . TYR A 1 42  ? 95.335  39.223 52.729  1.00 40.60  ? 219  TYR A CD1   1 
ATOM   350  C  CD2   . TYR A 1 42  ? 96.485  37.299 52.016  1.00 41.97  ? 219  TYR A CD2   1 
ATOM   351  C  CE1   . TYR A 1 42  ? 94.780  39.360 51.434  1.00 42.83  ? 219  TYR A CE1   1 
ATOM   352  C  CE2   . TYR A 1 42  ? 95.976  37.439 50.731  1.00 42.57  ? 219  TYR A CE2   1 
ATOM   353  C  CZ    . TYR A 1 42  ? 95.113  38.465 50.436  1.00 43.28  ? 219  TYR A CZ    1 
ATOM   354  O  OH    . TYR A 1 42  ? 94.579  38.567 49.145  1.00 41.72  ? 219  TYR A OH    1 
ATOM   355  N  N     . HIS A 1 43  ? 96.792  37.141 57.586  1.00 40.63  ? 220  HIS A N     1 
ATOM   356  C  CA    . HIS A 1 43  ? 97.291  36.333 58.691  1.00 40.52  ? 220  HIS A CA    1 
ATOM   357  C  C     . HIS A 1 43  ? 96.138  35.639 59.367  1.00 40.66  ? 220  HIS A C     1 
ATOM   358  O  O     . HIS A 1 43  ? 96.165  34.445 59.572  1.00 38.72  ? 220  HIS A O     1 
ATOM   359  C  CB    . HIS A 1 43  ? 98.023  37.214 59.699  1.00 40.92  ? 220  HIS A CB    1 
ATOM   360  C  CG    . HIS A 1 43  ? 99.387  37.638 59.247  1.00 40.35  ? 220  HIS A CG    1 
ATOM   361  N  ND1   . HIS A 1 43  ? 100.485 36.806 59.316  1.00 37.89  ? 220  HIS A ND1   1 
ATOM   362  C  CD2   . HIS A 1 43  ? 99.821  38.789 58.682  1.00 36.77  ? 220  HIS A CD2   1 
ATOM   363  C  CE1   . HIS A 1 43  ? 101.547 37.446 58.854  1.00 35.51  ? 220  HIS A CE1   1 
ATOM   364  N  NE2   . HIS A 1 43  ? 101.168 38.645 58.451  1.00 35.44  ? 220  HIS A NE2   1 
ATOM   365  N  N     . ASP A 1 44  ? 95.098  36.407 59.670  1.00 41.64  ? 221  ASP A N     1 
ATOM   366  C  CA    . ASP A 1 44  ? 94.004  35.932 60.505  1.00 42.19  ? 221  ASP A CA    1 
ATOM   367  C  C     . ASP A 1 44  ? 93.246  34.798 59.811  1.00 42.40  ? 221  ASP A C     1 
ATOM   368  O  O     . ASP A 1 44  ? 92.751  33.875 60.463  1.00 41.67  ? 221  ASP A O     1 
ATOM   369  C  CB    . ASP A 1 44  ? 93.052  37.099 60.844  1.00 42.48  ? 221  ASP A CB    1 
ATOM   370  C  CG    . ASP A 1 44  ? 91.932  36.686 61.776  1.00 43.55  ? 221  ASP A CG    1 
ATOM   371  O  OD1   . ASP A 1 44  ? 90.780  37.031 61.508  1.00 43.91  ? 221  ASP A OD1   1 
ATOM   372  O  OD2   . ASP A 1 44  ? 92.201  35.965 62.758  1.00 47.82  ? 221  ASP A OD2   1 
ATOM   373  N  N     . LEU A 1 45  ? 93.143  34.873 58.487  1.00 42.83  ? 222  LEU A N     1 
ATOM   374  C  CA    . LEU A 1 45  ? 92.420  33.840 57.723  1.00 42.82  ? 222  LEU A CA    1 
ATOM   375  C  C     . LEU A 1 45  ? 93.252  32.559 57.495  1.00 43.07  ? 222  LEU A C     1 
ATOM   376  O  O     . LEU A 1 45  ? 92.730  31.548 56.973  1.00 43.51  ? 222  LEU A O     1 
ATOM   377  C  CB    . LEU A 1 45  ? 91.941  34.392 56.374  1.00 42.08  ? 222  LEU A CB    1 
ATOM   378  C  CG    . LEU A 1 45  ? 90.810  35.419 56.433  1.00 41.41  ? 222  LEU A CG    1 
ATOM   379  C  CD1   . LEU A 1 45  ? 90.725  36.131 55.122  1.00 36.52  ? 222  LEU A CD1   1 
ATOM   380  C  CD2   . LEU A 1 45  ? 89.466  34.808 56.775  1.00 39.57  ? 222  LEU A CD2   1 
ATOM   381  N  N     . GLY A 1 46  ? 94.523  32.593 57.902  1.00 42.49  ? 223  GLY A N     1 
ATOM   382  C  CA    . GLY A 1 46  ? 95.405  31.436 57.813  1.00 41.88  ? 223  GLY A CA    1 
ATOM   383  C  C     . GLY A 1 46  ? 96.038  31.323 56.451  1.00 42.53  ? 223  GLY A C     1 
ATOM   384  O  O     . GLY A 1 46  ? 96.698  30.325 56.138  1.00 43.75  ? 223  GLY A O     1 
ATOM   385  N  N     . LEU A 1 47  ? 95.851  32.355 55.636  1.00 42.65  ? 224  LEU A N     1 
ATOM   386  C  CA    . LEU A 1 47  ? 96.399  32.370 54.298  1.00 42.71  ? 224  LEU A CA    1 
ATOM   387  C  C     . LEU A 1 47  ? 97.937  32.470 54.296  1.00 43.62  ? 224  LEU A C     1 
ATOM   388  O  O     . LEU A 1 47  ? 98.598  31.824 53.476  1.00 44.09  ? 224  LEU A O     1 
ATOM   389  C  CB    . LEU A 1 47  ? 95.800  33.522 53.495  1.00 43.31  ? 224  LEU A CB    1 
ATOM   390  C  CG    . LEU A 1 47  ? 94.280  33.569 53.290  1.00 42.81  ? 224  LEU A CG    1 
ATOM   391  C  CD1   . LEU A 1 47  ? 93.852  34.823 52.414  1.00 35.12  ? 224  LEU A CD1   1 
ATOM   392  C  CD2   . LEU A 1 47  ? 93.810  32.226 52.736  1.00 36.66  ? 224  LEU A CD2   1 
ATOM   393  N  N     . VAL A 1 48  ? 98.512  33.272 55.195  1.00 43.17  ? 225  VAL A N     1 
ATOM   394  C  CA    . VAL A 1 48  ? 99.958  33.321 55.320  1.00 42.82  ? 225  VAL A CA    1 
ATOM   395  C  C     . VAL A 1 48  ? 100.478 31.941 55.742  1.00 43.56  ? 225  VAL A C     1 
ATOM   396  O  O     . VAL A 1 48  ? 101.474 31.425 55.203  1.00 42.27  ? 225  VAL A O     1 
ATOM   397  C  CB    . VAL A 1 48  ? 100.386 34.346 56.357  1.00 42.86  ? 225  VAL A CB    1 
ATOM   398  C  CG1   . VAL A 1 48  ? 101.868 34.208 56.654  1.00 40.33  ? 225  VAL A CG1   1 
ATOM   399  C  CG2   . VAL A 1 48  ? 100.013 35.742 55.875  1.00 43.06  ? 225  VAL A CG2   1 
ATOM   400  N  N     . ARG A 1 49  ? 99.788  31.341 56.709  1.00 43.92  ? 226  ARG A N     1 
ATOM   401  C  CA    . ARG A 1 49  ? 100.166 30.013 57.202  1.00 44.72  ? 226  ARG A CA    1 
ATOM   402  C  C     . ARG A 1 49  ? 100.090 28.991 56.076  1.00 43.94  ? 226  ARG A C     1 
ATOM   403  O  O     . ARG A 1 49  ? 101.057 28.318 55.787  1.00 43.36  ? 226  ARG A O     1 
ATOM   404  C  CB    . ARG A 1 49  ? 99.234  29.612 58.343  1.00 45.59  ? 226  ARG A CB    1 
ATOM   405  C  CG    . ARG A 1 49  ? 99.534  28.296 59.015  1.00 50.33  ? 226  ARG A CG    1 
ATOM   406  C  CD    . ARG A 1 49  ? 98.406  27.883 60.018  1.00 55.64  ? 226  ARG A CD    1 
ATOM   407  N  NE    . ARG A 1 49  ? 97.114  27.603 59.344  1.00 59.79  ? 226  ARG A NE    1 
ATOM   408  C  CZ    . ARG A 1 49  ? 95.964  28.256 59.560  1.00 60.80  ? 226  ARG A CZ    1 
ATOM   409  N  NH1   . ARG A 1 49  ? 95.865  29.218 60.473  1.00 62.23  ? 226  ARG A NH1   1 
ATOM   410  N  NH2   . ARG A 1 49  ? 94.891  27.950 58.850  1.00 60.77  ? 226  ARG A NH2   1 
ATOM   411  N  N     . ASP A 1 50  ? 98.952  28.917 55.407  1.00 43.45  ? 227  ASP A N     1 
ATOM   412  C  CA    . ASP A 1 50  ? 98.697  27.779 54.543  1.00 44.27  ? 227  ASP A CA    1 
ATOM   413  C  C     . ASP A 1 50  ? 99.334  27.892 53.166  1.00 44.88  ? 227  ASP A C     1 
ATOM   414  O  O     . ASP A 1 50  ? 99.384  26.898 52.416  1.00 45.85  ? 227  ASP A O     1 
ATOM   415  C  CB    . ASP A 1 50  ? 97.196  27.525 54.381  1.00 44.44  ? 227  ASP A CB    1 
ATOM   416  C  CG    . ASP A 1 50  ? 96.547  27.113 55.660  1.00 43.02  ? 227  ASP A CG    1 
ATOM   417  O  OD1   . ASP A 1 50  ? 97.294  26.723 56.561  1.00 44.10  ? 227  ASP A OD1   1 
ATOM   418  O  OD2   . ASP A 1 50  ? 95.319  27.254 55.787  1.00 41.02  ? 227  ASP A OD2   1 
ATOM   419  N  N     . PHE A 1 51  ? 99.802  29.083 52.816  1.00 44.13  ? 228  PHE A N     1 
ATOM   420  C  CA    . PHE A 1 51  ? 100.376 29.288 51.497  1.00 43.54  ? 228  PHE A CA    1 
ATOM   421  C  C     . PHE A 1 51  ? 101.834 29.779 51.600  1.00 42.17  ? 228  PHE A C     1 
ATOM   422  O  O     . PHE A 1 51  ? 102.422 30.246 50.611  1.00 41.16  ? 228  PHE A O     1 
ATOM   423  C  CB    . PHE A 1 51  ? 99.469  30.235 50.691  1.00 44.15  ? 228  PHE A CB    1 
ATOM   424  C  CG    . PHE A 1 51  ? 98.109  29.621 50.356  1.00 46.59  ? 228  PHE A CG    1 
ATOM   425  C  CD1   . PHE A 1 51  ? 98.002  28.614 49.399  1.00 44.63  ? 228  PHE A CD1   1 
ATOM   426  C  CD2   . PHE A 1 51  ? 96.958  30.014 51.029  1.00 47.56  ? 228  PHE A CD2   1 
ATOM   427  C  CE1   . PHE A 1 51  ? 96.783  28.027 49.125  1.00 44.15  ? 228  PHE A CE1   1 
ATOM   428  C  CE2   . PHE A 1 51  ? 95.732  29.429 50.755  1.00 45.17  ? 228  PHE A CE2   1 
ATOM   429  C  CZ    . PHE A 1 51  ? 95.646  28.431 49.811  1.00 45.32  ? 228  PHE A CZ    1 
ATOM   430  N  N     . SER A 1 52  ? 102.398 29.668 52.801  1.00 40.05  ? 229  SER A N     1 
ATOM   431  C  CA    . SER A 1 52  ? 103.748 30.123 53.057  1.00 39.91  ? 229  SER A CA    1 
ATOM   432  C  C     . SER A 1 52  ? 104.057 31.486 52.445  1.00 39.40  ? 229  SER A C     1 
ATOM   433  O  O     . SER A 1 52  ? 105.052 31.648 51.765  1.00 38.27  ? 229  SER A O     1 
ATOM   434  C  CB    . SER A 1 52  ? 104.720 29.101 52.494  1.00 40.22  ? 229  SER A CB    1 
ATOM   435  O  OG    . SER A 1 52  ? 104.470 27.821 53.025  1.00 39.98  ? 229  SER A OG    1 
ATOM   436  N  N     . ILE A 1 53  ? 103.168 32.448 52.643  1.00 39.72  ? 230  ILE A N     1 
ATOM   437  C  CA    . ILE A 1 53  ? 103.385 33.801 52.138  1.00 40.32  ? 230  ILE A CA    1 
ATOM   438  C  C     . ILE A 1 53  ? 104.463 34.473 52.995  1.00 40.58  ? 230  ILE A C     1 
ATOM   439  O  O     . ILE A 1 53  ? 104.318 34.528 54.216  1.00 40.24  ? 230  ILE A O     1 
ATOM   440  C  CB    . ILE A 1 53  ? 102.084 34.631 52.227  1.00 40.87  ? 230  ILE A CB    1 
ATOM   441  C  CG1   . ILE A 1 53  ? 100.916 33.865 51.548  1.00 40.62  ? 230  ILE A CG1   1 
ATOM   442  C  CG2   . ILE A 1 53  ? 102.300 36.057 51.688  1.00 39.06  ? 230  ILE A CG2   1 
ATOM   443  C  CD1   . ILE A 1 53  ? 99.583  34.634 51.454  1.00 39.66  ? 230  ILE A CD1   1 
ATOM   444  N  N     . ASN A 1 54  ? 105.573 34.895 52.387  1.00 41.41  ? 231  ASN A N     1 
ATOM   445  C  CA    . ASN A 1 54  ? 106.599 35.606 53.158  1.00 43.15  ? 231  ASN A CA    1 
ATOM   446  C  C     . ASN A 1 54  ? 105.943 36.887 53.672  1.00 42.50  ? 231  ASN A C     1 
ATOM   447  O  O     . ASN A 1 54  ? 105.404 37.676 52.890  1.00 43.05  ? 231  ASN A O     1 
ATOM   448  C  CB    . ASN A 1 54  ? 107.885 35.895 52.345  1.00 43.46  ? 231  ASN A CB    1 
ATOM   449  C  CG    . ASN A 1 54  ? 108.803 36.993 52.996  1.00 51.48  ? 231  ASN A CG    1 
ATOM   450  O  OD1   . ASN A 1 54  ? 109.025 37.059 54.228  1.00 55.90  ? 231  ASN A OD1   1 
ATOM   451  N  ND2   . ASN A 1 54  ? 109.340 37.870 52.136  1.00 62.36  ? 231  ASN A ND2   1 
ATOM   452  N  N     . PRO A 1 55  ? 105.904 37.053 54.996  1.00 41.80  ? 232  PRO A N     1 
ATOM   453  C  CA    . PRO A 1 55  ? 105.235 38.197 55.619  1.00 42.50  ? 232  PRO A CA    1 
ATOM   454  C  C     . PRO A 1 55  ? 105.698 39.579 55.179  1.00 42.06  ? 232  PRO A C     1 
ATOM   455  O  O     . PRO A 1 55  ? 104.888 40.515 55.197  1.00 41.77  ? 232  PRO A O     1 
ATOM   456  C  CB    . PRO A 1 55  ? 105.486 37.986 57.128  1.00 42.95  ? 232  PRO A CB    1 
ATOM   457  C  CG    . PRO A 1 55  ? 105.673 36.520 57.269  1.00 41.58  ? 232  PRO A CG    1 
ATOM   458  C  CD    . PRO A 1 55  ? 106.413 36.110 56.005  1.00 42.15  ? 232  PRO A CD    1 
ATOM   459  N  N     . VAL A 1 56  ? 106.959 39.710 54.777  1.00 42.04  ? 233  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 56  ? 107.414 40.997 54.250  1.00 42.07  ? 233  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 56  ? 106.945 41.195 52.816  1.00 41.70  ? 233  VAL A C     1 
ATOM   462  O  O     . VAL A 1 56  ? 106.473 42.257 52.466  1.00 42.43  ? 233  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 56  ? 108.925 41.188 54.406  1.00 41.84  ? 233  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 56  ? 109.357 42.511 53.765  1.00 42.76  ? 233  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 56  ? 109.288 41.172 55.883  1.00 37.85  ? 233  VAL A CG2   1 
ATOM   466  N  N     . THR A 1 57  ? 106.978 40.147 52.011  1.00 41.89  ? 234  THR A N     1 
ATOM   467  C  CA    . THR A 1 57  ? 106.353 40.218 50.684  1.00 41.37  ? 234  THR A CA    1 
ATOM   468  C  C     . THR A 1 57  ? 104.862 40.624 50.794  1.00 41.92  ? 234  THR A C     1 
ATOM   469  O  O     . THR A 1 57  ? 104.376 41.478 50.042  1.00 42.62  ? 234  THR A O     1 
ATOM   470  C  CB    . THR A 1 57  ? 106.489 38.877 49.945  1.00 41.06  ? 234  THR A CB    1 
ATOM   471  O  OG1   . THR A 1 57  ? 107.859 38.459 49.975  1.00 39.23  ? 234  THR A OG1   1 
ATOM   472  C  CG2   . THR A 1 57  ? 106.036 38.986 48.496  1.00 38.65  ? 234  THR A CG2   1 
ATOM   473  N  N     . LEU A 1 58  ? 104.133 40.031 51.731  1.00 42.24  ? 235  LEU A N     1 
ATOM   474  C  CA    . LEU A 1 58  ? 102.721 40.374 51.897  1.00 41.62  ? 235  LEU A CA    1 
ATOM   475  C  C     . LEU A 1 58  ? 102.556 41.877 51.996  1.00 41.61  ? 235  LEU A C     1 
ATOM   476  O  O     . LEU A 1 58  ? 101.678 42.449 51.377  1.00 41.55  ? 235  LEU A O     1 
ATOM   477  C  CB    . LEU A 1 58  ? 102.144 39.702 53.141  1.00 41.06  ? 235  LEU A CB    1 
ATOM   478  C  CG    . LEU A 1 58  ? 100.695 40.066 53.485  1.00 39.90  ? 235  LEU A CG    1 
ATOM   479  C  CD1   . LEU A 1 58  ? 99.723  39.748 52.343  1.00 38.27  ? 235  LEU A CD1   1 
ATOM   480  C  CD2   . LEU A 1 58  ? 100.240 39.379 54.757  1.00 34.70  ? 235  LEU A CD2   1 
ATOM   481  N  N     . ARG A 1 59  ? 103.435 42.515 52.753  1.00 42.47  ? 236  ARG A N     1 
ATOM   482  C  CA    . ARG A 1 59  ? 103.413 43.963 52.918  1.00 43.40  ? 236  ARG A CA    1 
ATOM   483  C  C     . ARG A 1 59  ? 103.862 44.724 51.674  1.00 43.34  ? 236  ARG A C     1 
ATOM   484  O  O     . ARG A 1 59  ? 103.239 45.717 51.293  1.00 43.19  ? 236  ARG A O     1 
ATOM   485  C  CB    . ARG A 1 59  ? 104.350 44.363 54.026  1.00 44.50  ? 236  ARG A CB    1 
ATOM   486  C  CG    . ARG A 1 59  ? 103.995 43.879 55.405  1.00 46.97  ? 236  ARG A CG    1 
ATOM   487  C  CD    . ARG A 1 59  ? 104.277 45.024 56.384  1.00 49.22  ? 236  ARG A CD    1 
ATOM   488  N  NE    . ARG A 1 59  ? 104.628 44.501 57.676  1.00 52.14  ? 236  ARG A NE    1 
ATOM   489  C  CZ    . ARG A 1 59  ? 105.675 44.876 58.390  1.00 57.31  ? 236  ARG A CZ    1 
ATOM   490  N  NH1   . ARG A 1 59  ? 106.502 45.810 57.969  1.00 61.04  ? 236  ARG A NH1   1 
ATOM   491  N  NH2   . ARG A 1 59  ? 105.878 44.319 59.565  1.00 63.14  ? 236  ARG A NH2   1 
ATOM   492  N  N     . ARG A 1 60  ? 104.982 44.306 51.091  1.00 42.91  ? 237  ARG A N     1 
ATOM   493  C  CA    . ARG A 1 60  ? 105.439 44.908 49.849  1.00 43.81  ? 237  ARG A CA    1 
ATOM   494  C  C     . ARG A 1 60  ? 104.311 44.855 48.823  1.00 43.65  ? 237  ARG A C     1 
ATOM   495  O  O     . ARG A 1 60  ? 103.934 45.884 48.246  1.00 43.27  ? 237  ARG A O     1 
ATOM   496  C  CB    . ARG A 1 60  ? 106.736 44.256 49.332  1.00 43.21  ? 237  ARG A CB    1 
ATOM   497  C  CG    . ARG A 1 60  ? 107.992 44.749 50.047  1.00 44.25  ? 237  ARG A CG    1 
ATOM   498  C  CD    . ARG A 1 60  ? 109.353 44.149 49.578  1.00 48.14  ? 237  ARG A CD    1 
ATOM   499  N  NE    . ARG A 1 60  ? 109.476 42.703 49.807  1.00 52.08  ? 237  ARG A NE    1 
ATOM   500  C  CZ    . ARG A 1 60  ? 110.456 42.107 50.480  1.00 55.66  ? 237  ARG A CZ    1 
ATOM   501  N  NH1   . ARG A 1 60  ? 111.421 42.811 51.026  1.00 56.39  ? 237  ARG A NH1   1 
ATOM   502  N  NH2   . ARG A 1 60  ? 110.460 40.781 50.637  1.00 61.09  ? 237  ARG A NH2   1 
ATOM   503  N  N     . TRP A 1 61  ? 103.692 43.690 48.705  1.00 43.16  ? 238  TRP A N     1 
ATOM   504  C  CA    . TRP A 1 61  ? 102.621 43.509 47.734  1.00 43.72  ? 238  TRP A CA    1 
ATOM   505  C  C     . TRP A 1 61  ? 101.441 44.458 47.960  1.00 43.21  ? 238  TRP A C     1 
ATOM   506  O  O     . TRP A 1 61  ? 100.977 45.118 47.028  1.00 42.95  ? 238  TRP A O     1 
ATOM   507  C  CB    . TRP A 1 61  ? 102.171 42.054 47.731  1.00 45.23  ? 238  TRP A CB    1 
ATOM   508  C  CG    . TRP A 1 61  ? 100.928 41.808 46.984  1.00 45.65  ? 238  TRP A CG    1 
ATOM   509  C  CD1   . TRP A 1 61  ? 100.764 41.828 45.639  1.00 47.99  ? 238  TRP A CD1   1 
ATOM   510  C  CD2   . TRP A 1 61  ? 99.667  41.484 47.536  1.00 44.98  ? 238  TRP A CD2   1 
ATOM   511  N  NE1   . TRP A 1 61  ? 99.458  41.565 45.313  1.00 46.26  ? 238  TRP A NE1   1 
ATOM   512  C  CE2   . TRP A 1 61  ? 98.765  41.344 46.466  1.00 45.58  ? 238  TRP A CE2   1 
ATOM   513  C  CE3   . TRP A 1 61  ? 99.194  41.372 48.830  1.00 45.47  ? 238  TRP A CE3   1 
ATOM   514  C  CZ2   . TRP A 1 61  ? 97.429  41.055 46.651  1.00 45.19  ? 238  TRP A CZ2   1 
ATOM   515  C  CZ3   . TRP A 1 61  ? 97.877  41.064 49.015  1.00 46.56  ? 238  TRP A CZ3   1 
ATOM   516  C  CH2   . TRP A 1 61  ? 97.001  40.917 47.927  1.00 47.68  ? 238  TRP A CH2   1 
ATOM   517  N  N     . LEU A 1 62  ? 100.963 44.545 49.194  1.00 43.16  ? 239  LEU A N     1 
ATOM   518  C  CA    . LEU A 1 62  ? 99.849  45.452 49.496  1.00 42.53  ? 239  LEU A CA    1 
ATOM   519  C  C     . LEU A 1 62  ? 100.262 46.891 49.216  1.00 42.18  ? 239  LEU A C     1 
ATOM   520  O  O     . LEU A 1 62  ? 99.457  47.713 48.765  1.00 41.43  ? 239  LEU A O     1 
ATOM   521  C  CB    . LEU A 1 62  ? 99.372  45.307 50.949  1.00 41.64  ? 239  LEU A CB    1 
ATOM   522  C  CG    . LEU A 1 62  ? 98.650  44.003 51.307  1.00 42.47  ? 239  LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1 62  ? 98.512  43.857 52.815  1.00 42.54  ? 239  LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1 62  ? 97.301  43.885 50.626  1.00 39.74  ? 239  LEU A CD2   1 
ATOM   525  N  N     . PHE A 1 63  ? 101.505 47.223 49.520  1.00 42.41  ? 240  PHE A N     1 
ATOM   526  C  CA    . PHE A 1 63  ? 101.924 48.600 49.348  1.00 43.12  ? 240  PHE A CA    1 
ATOM   527  C  C     . PHE A 1 63  ? 101.906 48.910 47.872  1.00 43.10  ? 240  PHE A C     1 
ATOM   528  O  O     . PHE A 1 63  ? 101.506 49.986 47.451  1.00 42.72  ? 240  PHE A O     1 
ATOM   529  C  CB    . PHE A 1 63  ? 103.322 48.789 49.889  1.00 43.82  ? 240  PHE A CB    1 
ATOM   530  C  CG    . PHE A 1 63  ? 103.824 50.184 49.789  1.00 43.26  ? 240  PHE A CG    1 
ATOM   531  C  CD1   . PHE A 1 63  ? 103.602 51.092 50.822  1.00 43.94  ? 240  PHE A CD1   1 
ATOM   532  C  CD2   . PHE A 1 63  ? 104.567 50.587 48.688  1.00 45.42  ? 240  PHE A CD2   1 
ATOM   533  C  CE1   . PHE A 1 63  ? 104.116 52.402 50.749  1.00 45.04  ? 240  PHE A CE1   1 
ATOM   534  C  CE2   . PHE A 1 63  ? 105.086 51.905 48.605  1.00 45.37  ? 240  PHE A CE2   1 
ATOM   535  C  CZ    . PHE A 1 63  ? 104.870 52.794 49.633  1.00 43.56  ? 240  PHE A CZ    1 
ATOM   536  N  N     . CYS A 1 64  ? 102.302 47.918 47.090  1.00 43.50  ? 241  CYS A N     1 
ATOM   537  C  CA    . CYS A 1 64  ? 102.366 48.061 45.659  1.00 43.57  ? 241  CYS A CA    1 
ATOM   538  C  C     . CYS A 1 64  ? 100.960 48.118 45.047  1.00 43.54  ? 241  CYS A C     1 
ATOM   539  O  O     . CYS A 1 64  ? 100.701 48.895 44.136  1.00 43.05  ? 241  CYS A O     1 
ATOM   540  C  CB    . CYS A 1 64  ? 103.166 46.910 45.091  1.00 43.19  ? 241  CYS A CB    1 
ATOM   541  S  SG    . CYS A 1 64  ? 103.241 46.937 43.312  1.00 47.04  ? 241  CYS A SG    1 
ATOM   542  N  N     . VAL A 1 65  ? 100.047 47.303 45.556  1.00 43.66  ? 242  VAL A N     1 
ATOM   543  C  CA    . VAL A 1 65  ? 98.649  47.407 45.146  1.00 43.99  ? 242  VAL A CA    1 
ATOM   544  C  C     . VAL A 1 65  ? 98.153  48.820 45.427  1.00 44.95  ? 242  VAL A C     1 
ATOM   545  O  O     . VAL A 1 65  ? 97.547  49.482 44.589  1.00 45.46  ? 242  VAL A O     1 
ATOM   546  C  CB    . VAL A 1 65  ? 97.760  46.384 45.887  1.00 42.93  ? 242  VAL A CB    1 
ATOM   547  C  CG1   . VAL A 1 65  ? 96.289  46.634 45.578  1.00 42.70  ? 242  VAL A CG1   1 
ATOM   548  C  CG2   . VAL A 1 65  ? 98.170  44.960 45.502  1.00 40.80  ? 242  VAL A CG2   1 
ATOM   549  N  N     . HIS A 1 66  ? 98.422  49.286 46.621  1.00 45.57  ? 243  HIS A N     1 
ATOM   550  C  CA    . HIS A 1 66  ? 97.984  50.607 46.971  1.00 46.89  ? 243  HIS A CA    1 
ATOM   551  C  C     . HIS A 1 66  ? 98.511  51.641 45.942  1.00 46.93  ? 243  HIS A C     1 
ATOM   552  O  O     . HIS A 1 66  ? 97.817  52.593 45.538  1.00 46.90  ? 243  HIS A O     1 
ATOM   553  C  CB    . HIS A 1 66  ? 98.471  50.965 48.377  1.00 47.60  ? 243  HIS A CB    1 
ATOM   554  C  CG    . HIS A 1 66  ? 98.392  52.424 48.666  1.00 48.77  ? 243  HIS A CG    1 
ATOM   555  N  ND1   . HIS A 1 66  ? 99.495  53.243 48.624  1.00 50.35  ? 243  HIS A ND1   1 
ATOM   556  C  CD2   . HIS A 1 66  ? 97.323  53.233 48.864  1.00 51.01  ? 243  HIS A CD2   1 
ATOM   557  C  CE1   . HIS A 1 66  ? 99.115  54.493 48.823  1.00 52.05  ? 243  HIS A CE1   1 
ATOM   558  N  NE2   . HIS A 1 66  ? 97.801  54.511 48.983  1.00 51.63  ? 243  HIS A NE2   1 
ATOM   559  N  N     . ASP A 1 67  ? 99.754  51.480 45.536  1.00 46.25  ? 244  ASP A N     1 
ATOM   560  C  CA    . ASP A 1 67  ? 100.347 52.477 44.663  1.00 46.29  ? 244  ASP A CA    1 
ATOM   561  C  C     . ASP A 1 67  ? 99.674  52.484 43.308  1.00 46.12  ? 244  ASP A C     1 
ATOM   562  O  O     . ASP A 1 67  ? 99.680  53.485 42.615  1.00 46.45  ? 244  ASP A O     1 
ATOM   563  C  CB    . ASP A 1 67  ? 101.827 52.203 44.460  1.00 46.29  ? 244  ASP A CB    1 
ATOM   564  C  CG    . ASP A 1 67  ? 102.525 53.346 43.774  1.00 47.38  ? 244  ASP A CG    1 
ATOM   565  O  OD1   . ASP A 1 67  ? 102.569 54.432 44.372  1.00 46.75  ? 244  ASP A OD1   1 
ATOM   566  O  OD2   . ASP A 1 67  ? 103.037 53.170 42.649  1.00 50.46  ? 244  ASP A OD2   1 
ATOM   567  N  N     . ASN A 1 68  ? 99.099  51.350 42.932  1.00 46.29  ? 245  ASN A N     1 
ATOM   568  C  CA    . ASN A 1 68  ? 98.534  51.189 41.614  1.00 45.34  ? 245  ASN A CA    1 
ATOM   569  C  C     . ASN A 1 68  ? 97.044  51.445 41.598  1.00 45.73  ? 245  ASN A C     1 
ATOM   570  O  O     . ASN A 1 68  ? 96.443  51.370 40.542  1.00 46.21  ? 245  ASN A O     1 
ATOM   571  C  CB    . ASN A 1 68  ? 98.867  49.807 41.064  1.00 44.44  ? 245  ASN A CB    1 
ATOM   572  C  CG    . ASN A 1 68  ? 100.306 49.720 40.521  1.00 42.95  ? 245  ASN A CG    1 
ATOM   573  O  OD1   . ASN A 1 68  ? 100.593 50.121 39.406  1.00 42.36  ? 245  ASN A OD1   1 
ATOM   574  N  ND2   . ASN A 1 68  ? 101.185 49.158 41.297  1.00 39.42  ? 245  ASN A ND2   1 
ATOM   575  N  N     . TYR A 1 69  ? 96.448  51.812 42.728  1.00 45.70  ? 246  TYR A N     1 
ATOM   576  C  CA    . TYR A 1 69  ? 95.103  52.378 42.672  1.00 46.30  ? 246  TYR A CA    1 
ATOM   577  C  C     . TYR A 1 69  ? 95.279  53.862 42.400  1.00 47.62  ? 246  TYR A C     1 
ATOM   578  O  O     . TYR A 1 69  ? 96.275  54.449 42.820  1.00 48.73  ? 246  TYR A O     1 
ATOM   579  C  CB    . TYR A 1 69  ? 94.290  52.093 43.958  1.00 45.68  ? 246  TYR A CB    1 
ATOM   580  C  CG    . TYR A 1 69  ? 93.548  50.761 43.908  1.00 45.14  ? 246  TYR A CG    1 
ATOM   581  C  CD1   . TYR A 1 69  ? 94.189  49.575 44.197  1.00 43.94  ? 246  TYR A CD1   1 
ATOM   582  C  CD2   . TYR A 1 69  ? 92.217  50.696 43.512  1.00 44.53  ? 246  TYR A CD2   1 
ATOM   583  C  CE1   . TYR A 1 69  ? 93.524  48.380 44.131  1.00 44.06  ? 246  TYR A CE1   1 
ATOM   584  C  CE2   . TYR A 1 69  ? 91.564  49.511 43.396  1.00 39.23  ? 246  TYR A CE2   1 
ATOM   585  C  CZ    . TYR A 1 69  ? 92.207  48.343 43.727  1.00 43.30  ? 246  TYR A CZ    1 
ATOM   586  O  OH    . TYR A 1 69  ? 91.545  47.114 43.612  1.00 42.76  ? 246  TYR A OH    1 
ATOM   587  N  N     . ARG A 1 70  ? 94.349  54.455 41.655  1.00 48.96  ? 247  ARG A N     1 
ATOM   588  C  CA    . ARG A 1 70  ? 94.365  55.901 41.408  1.00 50.31  ? 247  ARG A CA    1 
ATOM   589  C  C     . ARG A 1 70  ? 93.447  56.700 42.322  1.00 50.46  ? 247  ARG A C     1 
ATOM   590  O  O     . ARG A 1 70  ? 92.475  56.172 42.865  1.00 49.23  ? 247  ARG A O     1 
ATOM   591  C  CB    . ARG A 1 70  ? 93.962  56.199 39.976  1.00 51.25  ? 247  ARG A CB    1 
ATOM   592  C  CG    . ARG A 1 70  ? 94.852  55.569 38.957  1.00 53.87  ? 247  ARG A CG    1 
ATOM   593  C  CD    . ARG A 1 70  ? 94.651  56.250 37.627  1.00 60.22  ? 247  ARG A CD    1 
ATOM   594  N  NE    . ARG A 1 70  ? 94.711  55.291 36.524  1.00 66.48  ? 247  ARG A NE    1 
ATOM   595  C  CZ    . ARG A 1 70  ? 94.749  55.641 35.244  1.00 70.38  ? 247  ARG A CZ    1 
ATOM   596  N  NH1   . ARG A 1 70  ? 94.700  56.924 34.909  1.00 72.80  ? 247  ARG A NH1   1 
ATOM   597  N  NH2   . ARG A 1 70  ? 94.810  54.713 34.299  1.00 71.15  ? 247  ARG A NH2   1 
ATOM   598  N  N     . ASN A 1 71  ? 93.717  58.005 42.386  1.00 51.43  ? 248  ASN A N     1 
ATOM   599  C  CA    . ASN A 1 71  ? 92.940  58.921 43.218  1.00 52.56  ? 248  ASN A CA    1 
ATOM   600  C  C     . ASN A 1 71  ? 91.659  59.320 42.539  1.00 50.66  ? 248  ASN A C     1 
ATOM   601  O  O     . ASN A 1 71  ? 91.438  60.497 42.288  1.00 51.22  ? 248  ASN A O     1 
ATOM   602  C  CB    . ASN A 1 71  ? 93.693  60.236 43.486  1.00 53.98  ? 248  ASN A CB    1 
ATOM   603  C  CG    . ASN A 1 71  ? 94.985  60.045 44.261  1.00 58.95  ? 248  ASN A CG    1 
ATOM   604  O  OD1   . ASN A 1 71  ? 95.251  58.978 44.838  1.00 62.62  ? 248  ASN A OD1   1 
ATOM   605  N  ND2   . ASN A 1 71  ? 95.801  61.111 44.294  1.00 65.91  ? 248  ASN A ND2   1 
ATOM   606  N  N     . ASN A 1 72  ? 90.815  58.357 42.245  1.00 48.85  ? 249  ASN A N     1 
ATOM   607  C  CA    . ASN A 1 72  ? 89.489  58.664 41.767  1.00 47.99  ? 249  ASN A CA    1 
ATOM   608  C  C     . ASN A 1 72  ? 88.582  58.998 42.953  1.00 47.04  ? 249  ASN A C     1 
ATOM   609  O  O     . ASN A 1 72  ? 88.847  58.569 44.083  1.00 46.58  ? 249  ASN A O     1 
ATOM   610  C  CB    . ASN A 1 72  ? 88.921  57.467 41.003  1.00 48.02  ? 249  ASN A CB    1 
ATOM   611  C  CG    . ASN A 1 72  ? 89.696  57.154 39.753  1.00 47.84  ? 249  ASN A CG    1 
ATOM   612  O  OD1   . ASN A 1 72  ? 89.975  58.034 38.956  1.00 51.68  ? 249  ASN A OD1   1 
ATOM   613  N  ND2   . ASN A 1 72  ? 90.002  55.894 39.548  1.00 49.17  ? 249  ASN A ND2   1 
ATOM   614  N  N     . PRO A 1 73  ? 87.494  59.726 42.694  1.00 46.06  ? 250  PRO A N     1 
ATOM   615  C  CA    . PRO A 1 73  ? 86.497  60.022 43.692  1.00 45.99  ? 250  PRO A CA    1 
ATOM   616  C  C     . PRO A 1 73  ? 85.876  58.774 44.277  1.00 46.42  ? 250  PRO A C     1 
ATOM   617  O  O     . PRO A 1 73  ? 85.600  58.747 45.462  1.00 46.17  ? 250  PRO A O     1 
ATOM   618  C  CB    . PRO A 1 73  ? 85.441  60.819 42.916  1.00 46.32  ? 250  PRO A CB    1 
ATOM   619  C  CG    . PRO A 1 73  ? 86.148  61.348 41.741  1.00 46.57  ? 250  PRO A CG    1 
ATOM   620  C  CD    . PRO A 1 73  ? 87.135  60.292 41.389  1.00 46.05  ? 250  PRO A CD    1 
ATOM   621  N  N     . PHE A 1 74  ? 85.688  57.740 43.464  1.00 46.47  ? 251  PHE A N     1 
ATOM   622  C  CA    . PHE A 1 74  ? 85.060  56.520 43.933  1.00 47.25  ? 251  PHE A CA    1 
ATOM   623  C  C     . PHE A 1 74  ? 85.951  55.299 43.792  1.00 47.17  ? 251  PHE A C     1 
ATOM   624  O  O     . PHE A 1 74  ? 86.180  54.575 44.756  1.00 47.38  ? 251  PHE A O     1 
ATOM   625  C  CB    . PHE A 1 74  ? 83.751  56.278 43.164  1.00 48.25  ? 251  PHE A CB    1 
ATOM   626  C  CG    . PHE A 1 74  ? 82.927  55.119 43.698  1.00 48.57  ? 251  PHE A CG    1 
ATOM   627  C  CD1   . PHE A 1 74  ? 81.964  55.327 44.659  1.00 48.01  ? 251  PHE A CD1   1 
ATOM   628  C  CD2   . PHE A 1 74  ? 83.110  53.833 43.212  1.00 49.27  ? 251  PHE A CD2   1 
ATOM   629  C  CE1   . PHE A 1 74  ? 81.214  54.274 45.136  1.00 48.15  ? 251  PHE A CE1   1 
ATOM   630  C  CE2   . PHE A 1 74  ? 82.372  52.774 43.698  1.00 48.92  ? 251  PHE A CE2   1 
ATOM   631  C  CZ    . PHE A 1 74  ? 81.418  52.990 44.651  1.00 47.82  ? 251  PHE A CZ    1 
ATOM   632  N  N     . HIS A 1 75  ? 86.375  55.024 42.562  1.00 47.64  ? 252  HIS A N     1 
ATOM   633  C  CA    . HIS A 1 75  ? 87.185  53.843 42.249  1.00 47.29  ? 252  HIS A CA    1 
ATOM   634  C  C     . HIS A 1 75  ? 88.617  54.034 42.675  1.00 47.61  ? 252  HIS A C     1 
ATOM   635  O  O     . HIS A 1 75  ? 89.489  54.271 41.854  1.00 47.02  ? 252  HIS A O     1 
ATOM   636  C  CB    . HIS A 1 75  ? 87.093  53.552 40.762  1.00 47.39  ? 252  HIS A CB    1 
ATOM   637  C  CG    . HIS A 1 75  ? 85.784  52.957 40.381  1.00 47.69  ? 252  HIS A CG    1 
ATOM   638  N  ND1   . HIS A 1 75  ? 84.785  53.689 39.775  1.00 46.86  ? 252  HIS A ND1   1 
ATOM   639  C  CD2   . HIS A 1 75  ? 85.242  51.753 40.685  1.00 47.59  ? 252  HIS A CD2   1 
ATOM   640  C  CE1   . HIS A 1 75  ? 83.708  52.931 39.649  1.00 46.30  ? 252  HIS A CE1   1 
ATOM   641  N  NE2   . HIS A 1 75  ? 83.951  51.761 40.213  1.00 48.65  ? 252  HIS A NE2   1 
ATOM   642  N  N     . ASN A 1 76  ? 88.820  54.005 43.992  1.00 48.76  ? 253  ASN A N     1 
ATOM   643  C  CA    . ASN A 1 76  ? 90.105  54.327 44.608  1.00 48.33  ? 253  ASN A CA    1 
ATOM   644  C  C     . ASN A 1 76  ? 90.495  53.247 45.619  1.00 48.53  ? 253  ASN A C     1 
ATOM   645  O  O     . ASN A 1 76  ? 89.787  52.240 45.792  1.00 48.87  ? 253  ASN A O     1 
ATOM   646  C  CB    . ASN A 1 76  ? 90.032  55.695 45.267  1.00 47.89  ? 253  ASN A CB    1 
ATOM   647  C  CG    . ASN A 1 76  ? 88.898  55.799 46.225  1.00 46.76  ? 253  ASN A CG    1 
ATOM   648  O  OD1   . ASN A 1 76  ? 88.730  54.924 47.077  1.00 43.49  ? 253  ASN A OD1   1 
ATOM   649  N  ND2   . ASN A 1 76  ? 88.099  56.867 46.104  1.00 42.71  ? 253  ASN A ND2   1 
ATOM   650  N  N     . PHE A 1 77  ? 91.613  53.462 46.299  1.00 48.32  ? 254  PHE A N     1 
ATOM   651  C  CA    . PHE A 1 77  ? 92.123  52.448 47.209  1.00 47.59  ? 254  PHE A CA    1 
ATOM   652  C  C     . PHE A 1 77  ? 91.169  52.146 48.362  1.00 46.87  ? 254  PHE A C     1 
ATOM   653  O  O     . PHE A 1 77  ? 91.041  50.987 48.808  1.00 46.25  ? 254  PHE A O     1 
ATOM   654  C  CB    . PHE A 1 77  ? 93.484  52.837 47.774  1.00 47.68  ? 254  PHE A CB    1 
ATOM   655  C  CG    . PHE A 1 77  ? 93.987  51.862 48.787  1.00 47.79  ? 254  PHE A CG    1 
ATOM   656  C  CD1   . PHE A 1 77  ? 94.276  50.563 48.412  1.00 47.66  ? 254  PHE A CD1   1 
ATOM   657  C  CD2   . PHE A 1 77  ? 94.066  52.203 50.110  1.00 48.72  ? 254  PHE A CD2   1 
ATOM   658  C  CE1   . PHE A 1 77  ? 94.667  49.640 49.327  1.00 47.66  ? 254  PHE A CE1   1 
ATOM   659  C  CE2   . PHE A 1 77  ? 94.495  51.290 51.035  1.00 49.71  ? 254  PHE A CE2   1 
ATOM   660  C  CZ    . PHE A 1 77  ? 94.788  49.999 50.640  1.00 49.07  ? 254  PHE A CZ    1 
ATOM   661  N  N     . ARG A 1 78  ? 90.498  53.180 48.838  1.00 46.34  ? 255  ARG A N     1 
ATOM   662  C  CA    . ARG A 1 78  ? 89.559  52.981 49.916  1.00 46.99  ? 255  ARG A CA    1 
ATOM   663  C  C     . ARG A 1 78  ? 88.404  52.088 49.471  1.00 46.58  ? 255  ARG A C     1 
ATOM   664  O  O     . ARG A 1 78  ? 87.978  51.228 50.217  1.00 45.83  ? 255  ARG A O     1 
ATOM   665  C  CB    . ARG A 1 78  ? 89.039  54.308 50.442  1.00 47.10  ? 255  ARG A CB    1 
ATOM   666  C  CG    . ARG A 1 78  ? 88.385  54.200 51.823  1.00 46.46  ? 255  ARG A CG    1 
ATOM   667  C  CD    . ARG A 1 78  ? 87.851  55.555 52.254  1.00 48.24  ? 255  ARG A CD    1 
ATOM   668  N  NE    . ARG A 1 78  ? 88.921  56.528 52.459  1.00 46.76  ? 255  ARG A NE    1 
ATOM   669  C  CZ    . ARG A 1 78  ? 89.702  56.557 53.535  1.00 46.89  ? 255  ARG A CZ    1 
ATOM   670  N  NH1   . ARG A 1 78  ? 89.536  55.679 54.517  1.00 48.58  ? 255  ARG A NH1   1 
ATOM   671  N  NH2   . ARG A 1 78  ? 90.638  57.482 53.645  1.00 42.55  ? 255  ARG A NH2   1 
ATOM   672  N  N     . HIS A 1 79  ? 87.933  52.265 48.245  1.00 46.75  ? 256  HIS A N     1 
ATOM   673  C  CA    . HIS A 1 79  ? 86.865  51.416 47.742  1.00 47.73  ? 256  HIS A CA    1 
ATOM   674  C  C     . HIS A 1 79  ? 87.324  49.973 47.750  1.00 47.39  ? 256  HIS A C     1 
ATOM   675  O  O     . HIS A 1 79  ? 86.594  49.055 48.144  1.00 47.35  ? 256  HIS A O     1 
ATOM   676  C  CB    . HIS A 1 79  ? 86.454  51.784 46.321  1.00 48.06  ? 256  HIS A CB    1 
ATOM   677  C  CG    . HIS A 1 79  ? 85.689  50.699 45.615  1.00 50.13  ? 256  HIS A CG    1 
ATOM   678  N  ND1   . HIS A 1 79  ? 84.407  50.330 45.973  1.00 48.25  ? 256  HIS A ND1   1 
ATOM   679  C  CD2   . HIS A 1 79  ? 86.033  49.903 44.569  1.00 52.44  ? 256  HIS A CD2   1 
ATOM   680  C  CE1   . HIS A 1 79  ? 84.002  49.353 45.178  1.00 51.79  ? 256  HIS A CE1   1 
ATOM   681  N  NE2   . HIS A 1 79  ? 84.965  49.078 44.311  1.00 50.30  ? 256  HIS A NE2   1 
ATOM   682  N  N     . CYS A 1 80  ? 88.559  49.777 47.344  1.00 46.94  ? 257  CYS A N     1 
ATOM   683  C  CA    . CYS A 1 80  ? 89.079  48.436 47.302  1.00 47.01  ? 257  CYS A CA    1 
ATOM   684  C  C     . CYS A 1 80  ? 89.137  47.844 48.691  1.00 46.31  ? 257  CYS A C     1 
ATOM   685  O  O     . CYS A 1 80  ? 88.775  46.690 48.904  1.00 45.51  ? 257  CYS A O     1 
ATOM   686  C  CB    . CYS A 1 80  ? 90.432  48.424 46.595  1.00 48.14  ? 257  CYS A CB    1 
ATOM   687  S  SG    . CYS A 1 80  ? 91.855  47.976 47.508  1.00 48.84  ? 257  CYS A SG    1 
ATOM   688  N  N     . PHE A 1 81  ? 89.512  48.668 49.651  1.00 46.38  ? 258  PHE A N     1 
ATOM   689  C  CA    . PHE A 1 81  ? 89.491  48.249 51.038  1.00 46.82  ? 258  PHE A CA    1 
ATOM   690  C  C     . PHE A 1 81  ? 88.071  47.897 51.504  1.00 45.95  ? 258  PHE A C     1 
ATOM   691  O  O     . PHE A 1 81  ? 87.892  46.897 52.159  1.00 45.89  ? 258  PHE A O     1 
ATOM   692  C  CB    . PHE A 1 81  ? 90.110  49.335 51.927  1.00 47.66  ? 258  PHE A CB    1 
ATOM   693  C  CG    . PHE A 1 81  ? 89.989  49.049 53.382  1.00 47.95  ? 258  PHE A CG    1 
ATOM   694  C  CD1   . PHE A 1 81  ? 89.107  49.765 54.170  1.00 49.47  ? 258  PHE A CD1   1 
ATOM   695  C  CD2   . PHE A 1 81  ? 90.775  48.075 53.971  1.00 48.64  ? 258  PHE A CD2   1 
ATOM   696  C  CE1   . PHE A 1 81  ? 88.974  49.483 55.501  1.00 48.62  ? 258  PHE A CE1   1 
ATOM   697  C  CE2   . PHE A 1 81  ? 90.663  47.798 55.314  1.00 47.99  ? 258  PHE A CE2   1 
ATOM   698  C  CZ    . PHE A 1 81  ? 89.749  48.482 56.074  1.00 48.40  ? 258  PHE A CZ    1 
ATOM   699  N  N     . CYS A 1 82  ? 87.063  48.672 51.128  1.00 45.29  ? 259  CYS A N     1 
ATOM   700  C  CA    . CYS A 1 82  ? 85.695  48.299 51.460  1.00 46.32  ? 259  CYS A CA    1 
ATOM   701  C  C     . CYS A 1 82  ? 85.364  46.930 50.936  1.00 46.25  ? 259  CYS A C     1 
ATOM   702  O  O     . CYS A 1 82  ? 84.750  46.101 51.627  1.00 46.94  ? 259  CYS A O     1 
ATOM   703  C  CB    . CYS A 1 82  ? 84.687  49.261 50.860  1.00 46.52  ? 259  CYS A CB    1 
ATOM   704  S  SG    . CYS A 1 82  ? 84.842  50.858 51.543  1.00 52.33  ? 259  CYS A SG    1 
ATOM   705  N  N     . VAL A 1 83  ? 85.677  46.716 49.671  1.00 45.78  ? 260  VAL A N     1 
ATOM   706  C  CA    . VAL A 1 83  ? 85.307  45.470 49.042  1.00 45.48  ? 260  VAL A CA    1 
ATOM   707  C  C     . VAL A 1 83  ? 85.999  44.307 49.776  1.00 45.39  ? 260  VAL A C     1 
ATOM   708  O  O     . VAL A 1 83  ? 85.360  43.338 50.162  1.00 44.81  ? 260  VAL A O     1 
ATOM   709  C  CB    . VAL A 1 83  ? 85.636  45.502 47.546  1.00 46.36  ? 260  VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 83  ? 85.385  44.119 46.934  1.00 44.97  ? 260  VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 83  ? 84.817  46.648 46.850  1.00 42.21  ? 260  VAL A CG2   1 
ATOM   712  N  N     . ALA A 1 84  ? 87.273  44.484 50.095  1.00 45.25  ? 261  ALA A N     1 
ATOM   713  C  CA    . ALA A 1 84  ? 88.038  43.431 50.753  1.00 44.99  ? 261  ALA A CA    1 
ATOM   714  C  C     . ALA A 1 84  ? 87.536  43.183 52.185  1.00 44.91  ? 261  ALA A C     1 
ATOM   715  O  O     . ALA A 1 84  ? 87.420  42.048 52.640  1.00 44.44  ? 261  ALA A O     1 
ATOM   716  C  CB    . ALA A 1 84  ? 89.529  43.786 50.752  1.00 43.86  ? 261  ALA A CB    1 
ATOM   717  N  N     . GLN A 1 85  ? 87.189  44.252 52.876  1.00 45.02  ? 262  GLN A N     1 
ATOM   718  C  CA    . GLN A 1 85  ? 86.756  44.148 54.253  1.00 44.70  ? 262  GLN A CA    1 
ATOM   719  C  C     . GLN A 1 85  ? 85.343  43.568 54.318  1.00 44.48  ? 262  GLN A C     1 
ATOM   720  O  O     . GLN A 1 85  ? 84.976  42.913 55.280  1.00 43.19  ? 262  GLN A O     1 
ATOM   721  C  CB    . GLN A 1 85  ? 86.823  45.522 54.911  1.00 44.76  ? 262  GLN A CB    1 
ATOM   722  C  CG    . GLN A 1 85  ? 86.642  45.479 56.415  1.00 45.95  ? 262  GLN A CG    1 
ATOM   723  C  CD    . GLN A 1 85  ? 85.176  45.551 56.817  1.00 46.10  ? 262  GLN A CD    1 
ATOM   724  O  OE1   . GLN A 1 85  ? 84.406  46.258 56.172  1.00 44.14  ? 262  GLN A OE1   1 
ATOM   725  N  NE2   . GLN A 1 85  ? 84.783  44.807 57.869  1.00 41.52  ? 262  GLN A NE2   1 
ATOM   726  N  N     . MET A 1 86  ? 84.536  43.802 53.288  1.00 44.90  ? 263  MET A N     1 
ATOM   727  C  CA    . MET A 1 86  ? 83.187  43.209 53.278  1.00 44.67  ? 263  MET A CA    1 
ATOM   728  C  C     . MET A 1 86  ? 83.300  41.719 52.974  1.00 43.56  ? 263  MET A C     1 
ATOM   729  O  O     . MET A 1 86  ? 82.567  40.915 53.508  1.00 42.64  ? 263  MET A O     1 
ATOM   730  C  CB    . MET A 1 86  ? 82.262  43.909 52.280  1.00 44.82  ? 263  MET A CB    1 
ATOM   731  C  CG    . MET A 1 86  ? 80.859  43.356 52.254  1.00 43.63  ? 263  MET A CG    1 
ATOM   732  S  SD    . MET A 1 86  ? 79.981  43.665 53.777  1.00 46.43  ? 263  MET A SD    1 
ATOM   733  C  CE    . MET A 1 86  ? 79.857  45.473 53.743  1.00 39.86  ? 263  MET A CE    1 
ATOM   734  N  N     . MET A 1 87  ? 84.298  41.356 52.195  1.00 43.06  ? 264  MET A N     1 
ATOM   735  C  CA    . MET A 1 87  ? 84.543  39.958 51.926  1.00 43.66  ? 264  MET A CA    1 
ATOM   736  C  C     . MET A 1 87  ? 85.018  39.257 53.205  1.00 43.66  ? 264  MET A C     1 
ATOM   737  O  O     . MET A 1 87  ? 84.581  38.157 53.519  1.00 42.44  ? 264  MET A O     1 
ATOM   738  C  CB    . MET A 1 87  ? 85.565  39.831 50.801  1.00 43.16  ? 264  MET A CB    1 
ATOM   739  C  CG    . MET A 1 87  ? 85.891  38.401 50.415  1.00 44.75  ? 264  MET A CG    1 
ATOM   740  S  SD    . MET A 1 87  ? 84.577  37.557 49.520  1.00 44.39  ? 264  MET A SD    1 
ATOM   741  C  CE    . MET A 1 87  ? 84.331  38.551 48.064  1.00 40.93  ? 264  MET A CE    1 
ATOM   742  N  N     . TYR A 1 88  ? 85.928  39.917 53.927  1.00 43.84  ? 265  TYR A N     1 
ATOM   743  C  CA    . TYR A 1 88  ? 86.380  39.454 55.235  1.00 43.98  ? 265  TYR A CA    1 
ATOM   744  C  C     . TYR A 1 88  ? 85.150  39.231 56.122  1.00 43.83  ? 265  TYR A C     1 
ATOM   745  O  O     . TYR A 1 88  ? 84.992  38.180 56.733  1.00 43.51  ? 265  TYR A O     1 
ATOM   746  C  CB    . TYR A 1 88  ? 87.364  40.487 55.850  1.00 44.18  ? 265  TYR A CB    1 
ATOM   747  C  CG    . TYR A 1 88  ? 88.112  40.092 57.136  1.00 45.10  ? 265  TYR A CG    1 
ATOM   748  C  CD1   . TYR A 1 88  ? 88.944  38.982 57.180  1.00 47.84  ? 265  TYR A CD1   1 
ATOM   749  C  CD2   . TYR A 1 88  ? 88.042  40.887 58.276  1.00 46.01  ? 265  TYR A CD2   1 
ATOM   750  C  CE1   . TYR A 1 88  ? 89.634  38.650 58.337  1.00 48.18  ? 265  TYR A CE1   1 
ATOM   751  C  CE2   . TYR A 1 88  ? 88.707  40.564 59.433  1.00 45.85  ? 265  TYR A CE2   1 
ATOM   752  C  CZ    . TYR A 1 88  ? 89.499  39.440 59.462  1.00 48.28  ? 265  TYR A CZ    1 
ATOM   753  O  OH    . TYR A 1 88  ? 90.197  39.127 60.592  1.00 45.27  ? 265  TYR A OH    1 
ATOM   754  N  N     . SER A 1 89  ? 84.257  40.212 56.143  1.00 43.67  ? 266  SER A N     1 
ATOM   755  C  CA    . SER A 1 89  ? 83.078  40.125 56.984  1.00 43.72  ? 266  SER A CA    1 
ATOM   756  C  C     . SER A 1 89  ? 82.232  38.938 56.586  1.00 43.84  ? 266  SER A C     1 
ATOM   757  O  O     . SER A 1 89  ? 81.691  38.242 57.445  1.00 43.92  ? 266  SER A O     1 
ATOM   758  C  CB    . SER A 1 89  ? 82.235  41.396 56.895  1.00 43.19  ? 266  SER A CB    1 
ATOM   759  O  OG    . SER A 1 89  ? 82.932  42.485 57.454  1.00 42.87  ? 266  SER A OG    1 
ATOM   760  N  N     . MET A 1 90  ? 82.097  38.744 55.282  1.00 44.68  ? 267  MET A N     1 
ATOM   761  C  CA    . MET A 1 90  ? 81.267  37.681 54.742  1.00 46.09  ? 267  MET A CA    1 
ATOM   762  C  C     . MET A 1 90  ? 81.815  36.315 55.119  1.00 45.76  ? 267  MET A C     1 
ATOM   763  O  O     . MET A 1 90  ? 81.042  35.382 55.376  1.00 46.08  ? 267  MET A O     1 
ATOM   764  C  CB    . MET A 1 90  ? 81.191  37.783 53.225  1.00 46.22  ? 267  MET A CB    1 
ATOM   765  C  CG    . MET A 1 90  ? 80.456  39.010 52.733  1.00 51.23  ? 267  MET A CG    1 
ATOM   766  S  SD    . MET A 1 90  ? 78.690  38.866 52.956  1.00 61.08  ? 267  MET A SD    1 
ATOM   767  C  CE    . MET A 1 90  ? 78.265  37.849 51.513  1.00 55.66  ? 267  MET A CE    1 
ATOM   768  N  N     . VAL A 1 91  ? 83.137  36.196 55.160  1.00 44.75  ? 268  VAL A N     1 
ATOM   769  C  CA    . VAL A 1 91  ? 83.737  34.934 55.545  1.00 45.16  ? 268  VAL A CA    1 
ATOM   770  C  C     . VAL A 1 91  ? 83.264  34.527 56.938  1.00 45.64  ? 268  VAL A C     1 
ATOM   771  O  O     . VAL A 1 91  ? 82.876  33.373 57.149  1.00 46.57  ? 268  VAL A O     1 
ATOM   772  C  CB    . VAL A 1 91  ? 85.303  34.934 55.455  1.00 45.10  ? 268  VAL A CB    1 
ATOM   773  C  CG1   . VAL A 1 91  ? 85.868  33.705 56.147  1.00 43.62  ? 268  VAL A CG1   1 
ATOM   774  C  CG2   . VAL A 1 91  ? 85.749  34.972 53.994  1.00 40.82  ? 268  VAL A CG2   1 
ATOM   775  N  N     . TRP A 1 92  ? 83.247  35.477 57.872  1.00 46.38  ? 269  TRP A N     1 
ATOM   776  C  CA    . TRP A 1 92  ? 82.774  35.211 59.247  1.00 46.50  ? 269  TRP A CA    1 
ATOM   777  C  C     . TRP A 1 92  ? 81.266  35.074 59.308  1.00 46.31  ? 269  TRP A C     1 
ATOM   778  O  O     . TRP A 1 92  ? 80.724  34.088 59.834  1.00 46.69  ? 269  TRP A O     1 
ATOM   779  C  CB    . TRP A 1 92  ? 83.236  36.307 60.213  1.00 46.81  ? 269  TRP A CB    1 
ATOM   780  C  CG    . TRP A 1 92  ? 84.723  36.439 60.192  1.00 47.73  ? 269  TRP A CG    1 
ATOM   781  C  CD1   . TRP A 1 92  ? 85.431  37.529 59.823  1.00 48.73  ? 269  TRP A CD1   1 
ATOM   782  C  CD2   . TRP A 1 92  ? 85.680  35.387 60.394  1.00 47.14  ? 269  TRP A CD2   1 
ATOM   783  N  NE1   . TRP A 1 92  ? 86.782  37.249 59.828  1.00 48.49  ? 269  TRP A NE1   1 
ATOM   784  C  CE2   . TRP A 1 92  ? 86.960  35.938 60.169  1.00 46.67  ? 269  TRP A CE2   1 
ATOM   785  C  CE3   . TRP A 1 92  ? 85.577  34.032 60.751  1.00 49.67  ? 269  TRP A CE3   1 
ATOM   786  C  CZ2   . TRP A 1 92  ? 88.137  35.200 60.317  1.00 47.81  ? 269  TRP A CZ2   1 
ATOM   787  C  CZ3   . TRP A 1 92  ? 86.746  33.289 60.905  1.00 48.98  ? 269  TRP A CZ3   1 
ATOM   788  C  CH2   . TRP A 1 92  ? 88.016  33.883 60.691  1.00 49.75  ? 269  TRP A CH2   1 
ATOM   789  N  N     . LEU A 1 93  ? 80.578  36.049 58.747  1.00 46.35  ? 270  LEU A N     1 
ATOM   790  C  CA    . LEU A 1 93  ? 79.142  36.049 58.843  1.00 46.45  ? 270  LEU A CA    1 
ATOM   791  C  C     . LEU A 1 93  ? 78.603  34.722 58.296  1.00 47.15  ? 270  LEU A C     1 
ATOM   792  O  O     . LEU A 1 93  ? 77.760  34.095 58.913  1.00 47.45  ? 270  LEU A O     1 
ATOM   793  C  CB    . LEU A 1 93  ? 78.540  37.242 58.101  1.00 45.66  ? 270  LEU A CB    1 
ATOM   794  C  CG    . LEU A 1 93  ? 77.022  37.169 57.944  1.00 45.92  ? 270  LEU A CG    1 
ATOM   795  C  CD1   . LEU A 1 93  ? 76.337  37.173 59.319  1.00 39.36  ? 270  LEU A CD1   1 
ATOM   796  C  CD2   . LEU A 1 93  ? 76.498  38.282 57.012  1.00 45.70  ? 270  LEU A CD2   1 
ATOM   797  N  N     . CYS A 1 94  ? 79.116  34.282 57.154  1.00 47.63  ? 271  CYS A N     1 
ATOM   798  C  CA    . CYS A 1 94  ? 78.578  33.099 56.496  1.00 47.83  ? 271  CYS A CA    1 
ATOM   799  C  C     . CYS A 1 94  ? 79.396  31.835 56.742  1.00 48.48  ? 271  CYS A C     1 
ATOM   800  O  O     . CYS A 1 94  ? 79.224  30.864 56.017  1.00 49.48  ? 271  CYS A O     1 
ATOM   801  C  CB    . CYS A 1 94  ? 78.528  33.334 54.997  1.00 48.36  ? 271  CYS A CB    1 
ATOM   802  S  SG    . CYS A 1 94  ? 77.516  34.721 54.544  1.00 47.71  ? 271  CYS A SG    1 
ATOM   803  N  N     . SER A 1 95  ? 80.321  31.861 57.706  1.00 48.85  ? 272  SER A N     1 
ATOM   804  C  CA    . SER A 1 95  ? 81.157  30.701 57.995  1.00 48.23  ? 272  SER A CA    1 
ATOM   805  C  C     . SER A 1 95  ? 81.691  30.090 56.716  1.00 48.02  ? 272  SER A C     1 
ATOM   806  O  O     . SER A 1 95  ? 81.567  28.865 56.497  1.00 47.04  ? 272  SER A O     1 
ATOM   807  C  CB    . SER A 1 95  ? 80.325  29.670 58.732  1.00 47.72  ? 272  SER A CB    1 
ATOM   808  O  OG    . SER A 1 95  ? 79.750  30.271 59.859  1.00 47.89  ? 272  SER A OG    1 
ATOM   809  N  N     . LEU A 1 96  ? 82.236  30.941 55.846  1.00 47.76  ? 273  LEU A N     1 
ATOM   810  C  CA    . LEU A 1 96  ? 82.682  30.473 54.550  1.00 48.41  ? 273  LEU A CA    1 
ATOM   811  C  C     . LEU A 1 96  ? 83.849  29.478 54.661  1.00 49.80  ? 273  LEU A C     1 
ATOM   812  O  O     . LEU A 1 96  ? 84.054  28.683 53.750  1.00 49.72  ? 273  LEU A O     1 
ATOM   813  C  CB    . LEU A 1 96  ? 83.050  31.627 53.625  1.00 48.18  ? 273  LEU A CB    1 
ATOM   814  C  CG    . LEU A 1 96  ? 81.931  32.554 53.147  1.00 46.87  ? 273  LEU A CG    1 
ATOM   815  C  CD1   . LEU A 1 96  ? 82.478  33.546 52.139  1.00 38.71  ? 273  LEU A CD1   1 
ATOM   816  C  CD2   . LEU A 1 96  ? 80.799  31.732 52.566  1.00 44.81  ? 273  LEU A CD2   1 
ATOM   817  N  N     . GLN A 1 97  ? 84.558  29.450 55.793  1.00 51.33  ? 274  GLN A N     1 
ATOM   818  C  CA    . GLN A 1 97  ? 85.662  28.476 55.952  1.00 52.84  ? 274  GLN A CA    1 
ATOM   819  C  C     . GLN A 1 97  ? 85.188  27.055 56.144  1.00 52.69  ? 274  GLN A C     1 
ATOM   820  O  O     . GLN A 1 97  ? 85.957  26.122 55.974  1.00 52.93  ? 274  GLN A O     1 
ATOM   821  C  CB    . GLN A 1 97  ? 86.675  28.922 57.027  1.00 53.59  ? 274  GLN A CB    1 
ATOM   822  C  CG    . GLN A 1 97  ? 87.480  30.178 56.502  1.00 56.91  ? 274  GLN A CG    1 
ATOM   823  C  CD    . GLN A 1 97  ? 88.537  30.715 57.453  1.00 59.77  ? 274  GLN A CD    1 
ATOM   824  O  OE1   . GLN A 1 97  ? 88.287  30.849 58.644  1.00 59.54  ? 274  GLN A OE1   1 
ATOM   825  N  NE2   . GLN A 1 97  ? 89.721  31.068 56.910  1.00 62.75  ? 274  GLN A NE2   1 
ATOM   826  N  N     . GLU A 1 98  ? 83.900  26.888 56.419  1.00 53.26  ? 275  GLU A N     1 
ATOM   827  C  CA    . GLU A 1 98  ? 83.307  25.552 56.491  1.00 53.96  ? 275  GLU A CA    1 
ATOM   828  C  C     . GLU A 1 98  ? 83.039  24.998 55.098  1.00 53.87  ? 275  GLU A C     1 
ATOM   829  O  O     . GLU A 1 98  ? 83.022  23.798 54.900  1.00 54.38  ? 275  GLU A O     1 
ATOM   830  C  CB    . GLU A 1 98  ? 82.011  25.574 57.313  1.00 53.95  ? 275  GLU A CB    1 
ATOM   831  C  CG    . GLU A 1 98  ? 82.247  25.901 58.799  1.00 56.76  ? 275  GLU A CG    1 
ATOM   832  C  CD    . GLU A 1 98  ? 80.952  26.030 59.616  1.00 60.50  ? 275  GLU A CD    1 
ATOM   833  O  OE1   . GLU A 1 98  ? 79.853  26.009 59.008  1.00 61.53  ? 275  GLU A OE1   1 
ATOM   834  O  OE2   . GLU A 1 98  ? 81.040  26.171 60.867  1.00 61.94  ? 275  GLU A OE2   1 
ATOM   835  N  N     . LYS A 1 99  ? 82.901  25.889 54.129  1.00 54.01  ? 276  LYS A N     1 
ATOM   836  C  CA    . LYS A 1 99  ? 82.328  25.573 52.819  1.00 53.83  ? 276  LYS A CA    1 
ATOM   837  C  C     . LYS A 1 99  ? 83.396  25.566 51.707  1.00 52.22  ? 276  LYS A C     1 
ATOM   838  O  O     . LYS A 1 99  ? 83.288  24.827 50.718  1.00 51.36  ? 276  LYS A O     1 
ATOM   839  C  CB    . LYS A 1 99  ? 81.250  26.662 52.484  1.00 55.49  ? 276  LYS A CB    1 
ATOM   840  C  CG    . LYS A 1 99  ? 79.962  26.660 53.390  1.00 57.39  ? 276  LYS A CG    1 
ATOM   841  C  CD    . LYS A 1 99  ? 79.516  25.180 53.654  1.00 62.10  ? 276  LYS A CD    1 
ATOM   842  C  CE    . LYS A 1 99  ? 78.017  24.978 53.987  1.00 62.48  ? 276  LYS A CE    1 
ATOM   843  N  NZ    . LYS A 1 99  ? 77.663  23.502 53.880  1.00 61.37  ? 276  LYS A NZ    1 
ATOM   844  N  N     . PHE A 1 100 ? 84.384  26.449 51.857  1.00 50.72  ? 277  PHE A N     1 
ATOM   845  C  CA    . PHE A 1 100 ? 85.351  26.752 50.825  1.00 49.28  ? 277  PHE A CA    1 
ATOM   846  C  C     . PHE A 1 100 ? 86.709  26.307 51.312  1.00 46.71  ? 277  PHE A C     1 
ATOM   847  O  O     . PHE A 1 100 ? 87.002  26.380 52.491  1.00 46.31  ? 277  PHE A O     1 
ATOM   848  C  CB    . PHE A 1 100 ? 85.384  28.263 50.552  1.00 50.90  ? 277  PHE A CB    1 
ATOM   849  C  CG    . PHE A 1 100 ? 84.186  28.788 49.747  1.00 54.28  ? 277  PHE A CG    1 
ATOM   850  C  CD1   . PHE A 1 100 ? 84.084  28.547 48.369  1.00 57.76  ? 277  PHE A CD1   1 
ATOM   851  C  CD2   . PHE A 1 100 ? 83.159  29.490 50.369  1.00 54.27  ? 277  PHE A CD2   1 
ATOM   852  C  CE1   . PHE A 1 100 ? 82.983  29.011 47.639  1.00 58.56  ? 277  PHE A CE1   1 
ATOM   853  C  CE2   . PHE A 1 100 ? 82.062  29.962 49.652  1.00 55.52  ? 277  PHE A CE2   1 
ATOM   854  C  CZ    . PHE A 1 100 ? 81.980  29.755 48.287  1.00 57.50  ? 277  PHE A CZ    1 
ATOM   855  N  N     . SER A 1 101 ? 87.540  25.859 50.386  1.00 44.65  ? 278  SER A N     1 
ATOM   856  C  CA    . SER A 1 101 ? 88.936  25.597 50.667  1.00 43.00  ? 278  SER A CA    1 
ATOM   857  C  C     . SER A 1 101 ? 89.704  26.910 50.898  1.00 42.71  ? 278  SER A C     1 
ATOM   858  O  O     . SER A 1 101 ? 89.253  27.983 50.518  1.00 41.99  ? 278  SER A O     1 
ATOM   859  C  CB    . SER A 1 101 ? 89.554  24.882 49.478  1.00 42.09  ? 278  SER A CB    1 
ATOM   860  O  OG    . SER A 1 101 ? 89.627  25.745 48.364  1.00 41.37  ? 278  SER A OG    1 
ATOM   861  N  N     . GLN A 1 102 ? 90.910  26.799 51.444  1.00 42.24  ? 279  GLN A N     1 
ATOM   862  C  CA    . GLN A 1 102 ? 91.738  27.971 51.710  1.00 41.56  ? 279  GLN A CA    1 
ATOM   863  C  C     . GLN A 1 102 ? 92.160  28.585 50.391  1.00 41.36  ? 279  GLN A C     1 
ATOM   864  O  O     . GLN A 1 102 ? 92.180  29.807 50.233  1.00 40.31  ? 279  GLN A O     1 
ATOM   865  C  CB    . GLN A 1 102 ? 92.944  27.594 52.570  1.00 41.59  ? 279  GLN A CB    1 
ATOM   866  C  CG    . GLN A 1 102 ? 92.609  27.322 54.078  1.00 40.92  ? 279  GLN A CG    1 
ATOM   867  C  CD    . GLN A 1 102 ? 92.239  28.586 54.841  1.00 43.54  ? 279  GLN A CD    1 
ATOM   868  O  OE1   . GLN A 1 102 ? 91.069  28.990 54.856  1.00 46.44  ? 279  GLN A OE1   1 
ATOM   869  N  NE2   . GLN A 1 102 ? 93.243  29.237 55.462  1.00 41.89  ? 279  GLN A NE2   1 
ATOM   870  N  N     . THR A 1 103 ? 92.376  27.735 49.400  1.00 41.83  ? 280  THR A N     1 
ATOM   871  C  CA    . THR A 1 103 ? 92.609  28.220 48.056  1.00 42.36  ? 280  THR A CA    1 
ATOM   872  C  C     . THR A 1 103 ? 91.445  29.113 47.601  1.00 42.72  ? 280  THR A C     1 
ATOM   873  O  O     . THR A 1 103 ? 91.682  30.232 47.205  1.00 43.14  ? 280  THR A O     1 
ATOM   874  C  CB    . THR A 1 103 ? 92.827  27.071 47.105  1.00 42.41  ? 280  THR A CB    1 
ATOM   875  O  OG1   . THR A 1 103 ? 93.978  26.350 47.528  1.00 43.37  ? 280  THR A OG1   1 
ATOM   876  C  CG2   . THR A 1 103 ? 93.048  27.569 45.702  1.00 42.75  ? 280  THR A CG2   1 
ATOM   877  N  N     . ASP A 1 104 ? 90.194  28.681 47.760  1.00 43.00  ? 281  ASP A N     1 
ATOM   878  C  CA    . ASP A 1 104 ? 89.056  29.537 47.402  1.00 43.70  ? 281  ASP A CA    1 
ATOM   879  C  C     . ASP A 1 104 ? 89.007  30.858 48.186  1.00 43.69  ? 281  ASP A C     1 
ATOM   880  O  O     . ASP A 1 104 ? 88.677  31.929 47.632  1.00 43.86  ? 281  ASP A O     1 
ATOM   881  C  CB    . ASP A 1 104 ? 87.733  28.805 47.614  1.00 44.26  ? 281  ASP A CB    1 
ATOM   882  C  CG    . ASP A 1 104 ? 87.418  27.812 46.495  1.00 47.39  ? 281  ASP A CG    1 
ATOM   883  O  OD1   . ASP A 1 104 ? 87.819  28.068 45.331  1.00 48.03  ? 281  ASP A OD1   1 
ATOM   884  O  OD2   . ASP A 1 104 ? 86.787  26.766 46.800  1.00 53.12  ? 281  ASP A OD2   1 
ATOM   885  N  N     . ILE A 1 105 ? 89.314  30.791 49.478  1.00 43.08  ? 282  ILE A N     1 
ATOM   886  C  CA    . ILE A 1 105 ? 89.347  32.013 50.279  1.00 43.06  ? 282  ILE A CA    1 
ATOM   887  C  C     . ILE A 1 105 ? 90.463  32.950 49.798  1.00 42.30  ? 282  ILE A C     1 
ATOM   888  O  O     . ILE A 1 105 ? 90.263  34.148 49.716  1.00 43.82  ? 282  ILE A O     1 
ATOM   889  C  CB    . ILE A 1 105 ? 89.512  31.741 51.794  1.00 43.52  ? 282  ILE A CB    1 
ATOM   890  C  CG1   . ILE A 1 105 ? 88.324  30.905 52.331  1.00 43.70  ? 282  ILE A CG1   1 
ATOM   891  C  CG2   . ILE A 1 105 ? 89.652  33.074 52.530  1.00 40.27  ? 282  ILE A CG2   1 
ATOM   892  C  CD1   . ILE A 1 105 ? 86.966  31.592 52.310  1.00 41.18  ? 282  ILE A CD1   1 
ATOM   893  N  N     . LEU A 1 106 ? 91.623  32.401 49.464  1.00 41.15  ? 283  LEU A N     1 
ATOM   894  C  CA    . LEU A 1 106 ? 92.701  33.186 48.897  1.00 40.63  ? 283  LEU A CA    1 
ATOM   895  C  C     . LEU A 1 106 ? 92.214  33.887 47.635  1.00 40.73  ? 283  LEU A C     1 
ATOM   896  O  O     . LEU A 1 106 ? 92.414  35.094 47.458  1.00 40.65  ? 283  LEU A O     1 
ATOM   897  C  CB    . LEU A 1 106 ? 93.890  32.285 48.567  1.00 40.24  ? 283  LEU A CB    1 
ATOM   898  C  CG    . LEU A 1 106 ? 95.205  32.897 48.066  1.00 40.27  ? 283  LEU A CG    1 
ATOM   899  C  CD1   . LEU A 1 106 ? 95.774  33.913 49.044  1.00 39.16  ? 283  LEU A CD1   1 
ATOM   900  C  CD2   . LEU A 1 106 ? 96.210  31.775 47.855  1.00 39.85  ? 283  LEU A CD2   1 
ATOM   901  N  N     . ILE A 1 107 ? 91.509  33.141 46.790  1.00 41.02  ? 284  ILE A N     1 
ATOM   902  C  CA    . ILE A 1 107 ? 91.014  33.695 45.540  1.00 41.08  ? 284  ILE A CA    1 
ATOM   903  C  C     . ILE A 1 107 ? 90.045  34.848 45.812  1.00 41.09  ? 284  ILE A C     1 
ATOM   904  O  O     . ILE A 1 107 ? 90.141  35.924 45.196  1.00 40.51  ? 284  ILE A O     1 
ATOM   905  C  CB    . ILE A 1 107 ? 90.319  32.616 44.652  1.00 41.31  ? 284  ILE A CB    1 
ATOM   906  C  CG1   . ILE A 1 107 ? 91.360  31.606 44.115  1.00 41.40  ? 284  ILE A CG1   1 
ATOM   907  C  CG2   . ILE A 1 107 ? 89.565  33.292 43.490  1.00 38.91  ? 284  ILE A CG2   1 
ATOM   908  C  CD1   . ILE A 1 107 ? 90.776  30.281 43.535  1.00 35.83  ? 284  ILE A CD1   1 
ATOM   909  N  N     . LEU A 1 108 ? 89.106  34.621 46.722  1.00 41.38  ? 285  LEU A N     1 
ATOM   910  C  CA    . LEU A 1 108 ? 88.106  35.645 46.997  1.00 42.26  ? 285  LEU A CA    1 
ATOM   911  C  C     . LEU A 1 108 ? 88.795  36.908 47.475  1.00 41.73  ? 285  LEU A C     1 
ATOM   912  O  O     . LEU A 1 108 ? 88.485  38.008 47.054  1.00 41.04  ? 285  LEU A O     1 
ATOM   913  C  CB    . LEU A 1 108 ? 87.073  35.159 48.014  1.00 42.28  ? 285  LEU A CB    1 
ATOM   914  C  CG    . LEU A 1 108 ? 86.059  34.160 47.445  1.00 43.04  ? 285  LEU A CG    1 
ATOM   915  C  CD1   . LEU A 1 108 ? 85.627  33.144 48.497  1.00 38.71  ? 285  LEU A CD1   1 
ATOM   916  C  CD2   . LEU A 1 108 ? 84.840  34.861 46.831  1.00 39.94  ? 285  LEU A CD2   1 
ATOM   917  N  N     . MET A 1 109 ? 89.721  36.737 48.396  1.00 42.48  ? 286  MET A N     1 
ATOM   918  C  CA    . MET A 1 109 ? 90.299  37.878 49.075  1.00 42.99  ? 286  MET A CA    1 
ATOM   919  C  C     . MET A 1 109 ? 91.206  38.602 48.101  1.00 43.13  ? 286  MET A C     1 
ATOM   920  O  O     . MET A 1 109 ? 91.119  39.820 47.961  1.00 43.42  ? 286  MET A O     1 
ATOM   921  C  CB    . MET A 1 109 ? 91.059  37.445 50.338  1.00 43.68  ? 286  MET A CB    1 
ATOM   922  C  CG    . MET A 1 109 ? 90.149  37.055 51.510  1.00 42.55  ? 286  MET A CG    1 
ATOM   923  S  SD    . MET A 1 109 ? 89.080  38.402 52.130  1.00 42.00  ? 286  MET A SD    1 
ATOM   924  C  CE    . MET A 1 109 ? 90.236  39.777 52.265  1.00 38.92  ? 286  MET A CE    1 
ATOM   925  N  N     . THR A 1 110 ? 92.019  37.861 47.358  1.00 42.47  ? 287  THR A N     1 
ATOM   926  C  CA    . THR A 1 110 ? 92.964  38.533 46.496  1.00 42.19  ? 287  THR A CA    1 
ATOM   927  C  C     . THR A 1 110 ? 92.246  39.185 45.317  1.00 42.16  ? 287  THR A C     1 
ATOM   928  O  O     . THR A 1 110 ? 92.615  40.278 44.873  1.00 41.98  ? 287  THR A O     1 
ATOM   929  C  CB    . THR A 1 110 ? 94.095  37.602 46.047  1.00 41.66  ? 287  THR A CB    1 
ATOM   930  O  OG1   . THR A 1 110 ? 94.570  36.864 47.181  1.00 41.76  ? 287  THR A OG1   1 
ATOM   931  C  CG2   . THR A 1 110 ? 95.239  38.414 45.408  1.00 37.10  ? 287  THR A CG2   1 
ATOM   932  N  N     . ALA A 1 111 ? 91.206  38.526 44.826  1.00 42.60  ? 288  ALA A N     1 
ATOM   933  C  CA    . ALA A 1 111 ? 90.398  39.112 43.745  1.00 43.59  ? 288  ALA A CA    1 
ATOM   934  C  C     . ALA A 1 111 ? 89.763  40.430 44.254  1.00 43.79  ? 288  ALA A C     1 
ATOM   935  O  O     . ALA A 1 111 ? 89.815  41.459 43.572  1.00 44.80  ? 288  ALA A O     1 
ATOM   936  C  CB    . ALA A 1 111 ? 89.332  38.128 43.247  1.00 42.80  ? 288  ALA A CB    1 
ATOM   937  N  N     . ALA A 1 112 ? 89.284  40.412 45.497  1.00 43.09  ? 289  ALA A N     1 
ATOM   938  C  CA    . ALA A 1 112 ? 88.610  41.554 46.059  1.00 42.81  ? 289  ALA A CA    1 
ATOM   939  C  C     . ALA A 1 112 ? 89.574  42.742 46.151  1.00 42.91  ? 289  ALA A C     1 
ATOM   940  O  O     . ALA A 1 112 ? 89.228  43.862 45.755  1.00 43.65  ? 289  ALA A O     1 
ATOM   941  C  CB    . ALA A 1 112 ? 88.032  41.185 47.398  1.00 41.73  ? 289  ALA A CB    1 
ATOM   942  N  N     . ILE A 1 113 ? 90.802  42.480 46.593  1.00 43.34  ? 290  ILE A N     1 
ATOM   943  C  CA    . ILE A 1 113 ? 91.813  43.525 46.762  1.00 43.88  ? 290  ILE A CA    1 
ATOM   944  C  C     . ILE A 1 113 ? 92.221  44.114 45.411  1.00 45.10  ? 290  ILE A C     1 
ATOM   945  O  O     . ILE A 1 113 ? 92.437  45.331 45.299  1.00 45.34  ? 290  ILE A O     1 
ATOM   946  C  CB    . ILE A 1 113 ? 93.068  43.008 47.586  1.00 44.50  ? 290  ILE A CB    1 
ATOM   947  C  CG1   . ILE A 1 113 ? 92.687  42.868 49.079  1.00 44.38  ? 290  ILE A CG1   1 
ATOM   948  C  CG2   . ILE A 1 113 ? 94.326  43.951 47.464  1.00 41.15  ? 290  ILE A CG2   1 
ATOM   949  C  CD1   . ILE A 1 113 ? 93.672  42.021 49.899  1.00 41.05  ? 290  ILE A CD1   1 
ATOM   950  N  N     . CYS A 1 114 ? 92.249  43.265 44.378  1.00 45.90  ? 291  CYS A N     1 
ATOM   951  C  CA    . CYS A 1 114 ? 92.730  43.679 43.052  1.00 46.25  ? 291  CYS A CA    1 
ATOM   952  C  C     . CYS A 1 114 ? 91.672  44.100 42.063  1.00 46.50  ? 291  CYS A C     1 
ATOM   953  O  O     . CYS A 1 114 ? 92.030  44.538 40.967  1.00 46.76  ? 291  CYS A O     1 
ATOM   954  C  CB    . CYS A 1 114 ? 93.483  42.549 42.394  1.00 46.81  ? 291  CYS A CB    1 
ATOM   955  S  SG    . CYS A 1 114 ? 94.832  41.988 43.390  1.00 49.84  ? 291  CYS A SG    1 
ATOM   956  N  N     . HIS A 1 115 ? 90.394  43.975 42.418  1.00 46.13  ? 292  HIS A N     1 
ATOM   957  C  CA    . HIS A 1 115 ? 89.341  44.022 41.420  1.00 47.01  ? 292  HIS A CA    1 
ATOM   958  C  C     . HIS A 1 115 ? 89.207  45.350 40.633  1.00 46.42  ? 292  HIS A C     1 
ATOM   959  O  O     . HIS A 1 115 ? 88.611  45.357 39.573  1.00 47.47  ? 292  HIS A O     1 
ATOM   960  C  CB    . HIS A 1 115 ? 88.007  43.634 42.066  1.00 48.04  ? 292  HIS A CB    1 
ATOM   961  C  CG    . HIS A 1 115 ? 87.269  44.787 42.644  1.00 49.85  ? 292  HIS A CG    1 
ATOM   962  N  ND1   . HIS A 1 115 ? 87.555  45.301 43.888  1.00 53.23  ? 292  HIS A ND1   1 
ATOM   963  C  CD2   . HIS A 1 115 ? 86.305  45.577 42.116  1.00 54.18  ? 292  HIS A CD2   1 
ATOM   964  C  CE1   . HIS A 1 115 ? 86.814  46.379 44.090  1.00 57.50  ? 292  HIS A CE1   1 
ATOM   965  N  NE2   . HIS A 1 115 ? 86.041  46.567 43.032  1.00 55.77  ? 292  HIS A NE2   1 
ATOM   966  N  N     . ASP A 1 116 ? 89.773  46.452 41.117  1.00 45.67  ? 293  ASP A N     1 
ATOM   967  C  CA    . ASP A 1 116 ? 89.661  47.738 40.413  1.00 45.81  ? 293  ASP A CA    1 
ATOM   968  C  C     . ASP A 1 116 ? 91.042  48.403 40.206  1.00 45.14  ? 293  ASP A C     1 
ATOM   969  O  O     . ASP A 1 116 ? 91.164  49.638 40.152  1.00 44.56  ? 293  ASP A O     1 
ATOM   970  C  CB    . ASP A 1 116 ? 88.739  48.713 41.194  1.00 46.09  ? 293  ASP A CB    1 
ATOM   971  C  CG    . ASP A 1 116 ? 87.266  48.577 40.828  1.00 47.22  ? 293  ASP A CG    1 
ATOM   972  O  OD1   . ASP A 1 116 ? 86.961  48.271 39.642  1.00 48.08  ? 293  ASP A OD1   1 
ATOM   973  O  OD2   . ASP A 1 116 ? 86.415  48.748 41.747  1.00 47.91  ? 293  ASP A OD2   1 
ATOM   974  N  N     . LEU A 1 117 ? 92.093  47.604 40.117  1.00 44.21  ? 294  LEU A N     1 
ATOM   975  C  CA    . LEU A 1 117 ? 93.430  48.185 39.949  1.00 43.71  ? 294  LEU A CA    1 
ATOM   976  C  C     . LEU A 1 117 ? 93.509  49.135 38.759  1.00 43.91  ? 294  LEU A C     1 
ATOM   977  O  O     . LEU A 1 117 ? 93.016  48.824 37.666  1.00 45.02  ? 294  LEU A O     1 
ATOM   978  C  CB    . LEU A 1 117 ? 94.481  47.086 39.796  1.00 43.14  ? 294  LEU A CB    1 
ATOM   979  C  CG    . LEU A 1 117 ? 95.071  46.609 41.114  1.00 43.47  ? 294  LEU A CG    1 
ATOM   980  C  CD1   . LEU A 1 117 ? 95.688  45.177 40.998  1.00 42.70  ? 294  LEU A CD1   1 
ATOM   981  C  CD2   . LEU A 1 117 ? 96.066  47.642 41.659  1.00 39.45  ? 294  LEU A CD2   1 
ATOM   982  N  N     . ASP A 1 118 ? 94.117  50.297 38.978  1.00 43.56  ? 295  ASP A N     1 
ATOM   983  C  CA    . ASP A 1 118 ? 94.387  51.276 37.920  1.00 43.65  ? 295  ASP A CA    1 
ATOM   984  C  C     . ASP A 1 118 ? 93.158  51.689 37.140  1.00 44.10  ? 295  ASP A C     1 
ATOM   985  O  O     . ASP A 1 118 ? 93.215  51.899 35.940  1.00 45.56  ? 295  ASP A O     1 
ATOM   986  C  CB    . ASP A 1 118 ? 95.447  50.749 36.949  1.00 43.37  ? 295  ASP A CB    1 
ATOM   987  C  CG    . ASP A 1 118 ? 96.138  51.864 36.160  1.00 42.18  ? 295  ASP A CG    1 
ATOM   988  O  OD1   . ASP A 1 118 ? 96.335  52.991 36.659  1.00 42.48  ? 295  ASP A OD1   1 
ATOM   989  O  OD2   . ASP A 1 118 ? 96.509  51.613 35.009  1.00 43.31  ? 295  ASP A OD2   1 
ATOM   990  N  N     . HIS A 1 119 ? 92.040  51.806 37.817  1.00 44.26  ? 296  HIS A N     1 
ATOM   991  C  CA    . HIS A 1 119 ? 90.829  52.290 37.187  1.00 44.71  ? 296  HIS A CA    1 
ATOM   992  C  C     . HIS A 1 119 ? 90.992  53.758 36.788  1.00 45.28  ? 296  HIS A C     1 
ATOM   993  O  O     . HIS A 1 119 ? 91.413  54.591 37.575  1.00 45.81  ? 296  HIS A O     1 
ATOM   994  C  CB    . HIS A 1 119 ? 89.701  52.121 38.175  1.00 44.06  ? 296  HIS A CB    1 
ATOM   995  C  CG    . HIS A 1 119 ? 88.337  52.170 37.585  1.00 43.92  ? 296  HIS A CG    1 
ATOM   996  N  ND1   . HIS A 1 119 ? 87.750  53.347 37.180  1.00 43.34  ? 296  HIS A ND1   1 
ATOM   997  C  CD2   . HIS A 1 119 ? 87.370  51.220 37.511  1.00 44.85  ? 296  HIS A CD2   1 
ATOM   998  C  CE1   . HIS A 1 119 ? 86.498  53.109 36.833  1.00 46.18  ? 296  HIS A CE1   1 
ATOM   999  N  NE2   . HIS A 1 119 ? 86.245  51.824 37.015  1.00 42.24  ? 296  HIS A NE2   1 
ATOM   1000 N  N     . PRO A 1 120 ? 90.654  54.090 35.546  1.00 46.20  ? 297  PRO A N     1 
ATOM   1001 C  CA    . PRO A 1 120 ? 90.780  55.468 35.081  1.00 46.02  ? 297  PRO A CA    1 
ATOM   1002 C  C     . PRO A 1 120 ? 89.662  56.406 35.511  1.00 46.47  ? 297  PRO A C     1 
ATOM   1003 O  O     . PRO A 1 120 ? 89.729  57.592 35.223  1.00 47.25  ? 297  PRO A O     1 
ATOM   1004 C  CB    . PRO A 1 120 ? 90.733  55.319 33.574  1.00 45.68  ? 297  PRO A CB    1 
ATOM   1005 C  CG    . PRO A 1 120 ? 89.938  54.094 33.344  1.00 45.41  ? 297  PRO A CG    1 
ATOM   1006 C  CD    . PRO A 1 120 ? 90.161  53.189 34.494  1.00 45.58  ? 297  PRO A CD    1 
ATOM   1007 N  N     . GLY A 1 121 ? 88.611  55.885 36.115  1.00 46.44  ? 298  GLY A N     1 
ATOM   1008 C  CA    . GLY A 1 121 ? 87.509  56.726 36.559  1.00 46.67  ? 298  GLY A CA    1 
ATOM   1009 C  C     . GLY A 1 121 ? 86.520  57.094 35.463  1.00 46.59  ? 298  GLY A C     1 
ATOM   1010 O  O     . GLY A 1 121 ? 85.699  57.992 35.650  1.00 46.48  ? 298  GLY A O     1 
ATOM   1011 N  N     . TYR A 1 122 ? 86.584  56.416 34.317  1.00 45.41  ? 299  TYR A N     1 
ATOM   1012 C  CA    . TYR A 1 122 ? 85.460  56.426 33.366  1.00 44.59  ? 299  TYR A CA    1 
ATOM   1013 C  C     . TYR A 1 122 ? 85.171  54.972 32.988  1.00 43.92  ? 299  TYR A C     1 
ATOM   1014 O  O     . TYR A 1 122 ? 86.098  54.166 32.852  1.00 44.54  ? 299  TYR A O     1 
ATOM   1015 C  CB    . TYR A 1 122 ? 85.757  57.293 32.131  1.00 44.46  ? 299  TYR A CB    1 
ATOM   1016 C  CG    . TYR A 1 122 ? 86.258  58.684 32.451  1.00 44.84  ? 299  TYR A CG    1 
ATOM   1017 C  CD1   . TYR A 1 122 ? 87.534  58.872 32.929  1.00 46.28  ? 299  TYR A CD1   1 
ATOM   1018 C  CD2   . TYR A 1 122 ? 85.467  59.808 32.243  1.00 45.62  ? 299  TYR A CD2   1 
ATOM   1019 C  CE1   . TYR A 1 122 ? 88.011  60.113 33.249  1.00 44.02  ? 299  TYR A CE1   1 
ATOM   1020 C  CE2   . TYR A 1 122 ? 85.936  61.078 32.561  1.00 46.80  ? 299  TYR A CE2   1 
ATOM   1021 C  CZ    . TYR A 1 122 ? 87.228  61.216 33.068  1.00 47.13  ? 299  TYR A CZ    1 
ATOM   1022 O  OH    . TYR A 1 122 ? 87.769  62.448 33.400  1.00 47.36  ? 299  TYR A OH    1 
ATOM   1023 N  N     . ASN A 1 123 ? 83.901  54.626 32.820  1.00 42.69  ? 300  ASN A N     1 
ATOM   1024 C  CA    . ASN A 1 123 ? 83.536  53.213 32.725  1.00 41.97  ? 300  ASN A CA    1 
ATOM   1025 C  C     . ASN A 1 123 ? 83.748  52.632 31.318  1.00 41.96  ? 300  ASN A C     1 
ATOM   1026 O  O     . ASN A 1 123 ? 84.312  53.290 30.434  1.00 41.54  ? 300  ASN A O     1 
ATOM   1027 C  CB    . ASN A 1 123 ? 82.101  53.006 33.190  1.00 41.64  ? 300  ASN A CB    1 
ATOM   1028 C  CG    . ASN A 1 123 ? 81.078  53.604 32.248  1.00 44.81  ? 300  ASN A CG    1 
ATOM   1029 O  OD1   . ASN A 1 123 ? 79.936  53.782 32.637  1.00 52.62  ? 300  ASN A OD1   1 
ATOM   1030 N  ND2   . ASN A 1 123 ? 81.473  53.936 31.020  1.00 46.30  ? 300  ASN A ND2   1 
ATOM   1031 N  N     . ASN A 1 124 ? 83.294  51.395 31.121  1.00 42.05  ? 301  ASN A N     1 
ATOM   1032 C  CA    . ASN A 1 124 ? 83.539  50.659 29.898  1.00 41.95  ? 301  ASN A CA    1 
ATOM   1033 C  C     . ASN A 1 124 ? 82.828  51.300 28.719  1.00 42.39  ? 301  ASN A C     1 
ATOM   1034 O  O     . ASN A 1 124 ? 83.352  51.317 27.598  1.00 43.63  ? 301  ASN A O     1 
ATOM   1035 C  CB    . ASN A 1 124 ? 83.083  49.203 30.058  1.00 42.16  ? 301  ASN A CB    1 
ATOM   1036 C  CG    . ASN A 1 124 ? 84.078  48.342 30.834  1.00 43.72  ? 301  ASN A CG    1 
ATOM   1037 O  OD1   . ASN A 1 124 ? 85.311  48.559 30.786  1.00 43.15  ? 301  ASN A OD1   1 
ATOM   1038 N  ND2   . ASN A 1 124 ? 83.545  47.324 31.532  1.00 43.83  ? 301  ASN A ND2   1 
ATOM   1039 N  N     . THR A 1 125 ? 81.641  51.839 28.972  1.00 41.94  ? 302  THR A N     1 
ATOM   1040 C  CA    . THR A 1 125 ? 80.901  52.552 27.947  1.00 41.51  ? 302  THR A CA    1 
ATOM   1041 C  C     . THR A 1 125 ? 81.680  53.774 27.463  1.00 41.17  ? 302  THR A C     1 
ATOM   1042 O  O     . THR A 1 125 ? 81.762  54.036 26.260  1.00 41.57  ? 302  THR A O     1 
ATOM   1043 C  CB    . THR A 1 125 ? 79.504  52.935 28.483  1.00 42.34  ? 302  THR A CB    1 
ATOM   1044 O  OG1   . THR A 1 125 ? 78.834  51.733 28.867  1.00 43.79  ? 302  THR A OG1   1 
ATOM   1045 C  CG2   . THR A 1 125 ? 78.646  53.638 27.427  1.00 40.15  ? 302  THR A CG2   1 
ATOM   1046 N  N     . TYR A 1 126 ? 82.307  54.501 28.367  1.00 39.97  ? 303  TYR A N     1 
ATOM   1047 C  CA    . TYR A 1 126 ? 83.179  55.549 27.894  1.00 40.17  ? 303  TYR A CA    1 
ATOM   1048 C  C     . TYR A 1 126 ? 84.332  54.988 27.062  1.00 40.17  ? 303  TYR A C     1 
ATOM   1049 O  O     . TYR A 1 126 ? 84.647  55.507 25.989  1.00 40.36  ? 303  TYR A O     1 
ATOM   1050 C  CB    . TYR A 1 126 ? 83.722  56.424 29.023  1.00 40.27  ? 303  TYR A CB    1 
ATOM   1051 C  CG    . TYR A 1 126 ? 84.568  57.494 28.437  1.00 39.87  ? 303  TYR A CG    1 
ATOM   1052 C  CD1   . TYR A 1 126 ? 83.984  58.580 27.807  1.00 41.23  ? 303  TYR A CD1   1 
ATOM   1053 C  CD2   . TYR A 1 126 ? 85.938  57.342 28.350  1.00 41.08  ? 303  TYR A CD2   1 
ATOM   1054 C  CE1   . TYR A 1 126 ? 84.756  59.548 27.177  1.00 43.48  ? 303  TYR A CE1   1 
ATOM   1055 C  CE2   . TYR A 1 126 ? 86.723  58.290 27.725  1.00 43.09  ? 303  TYR A CE2   1 
ATOM   1056 C  CZ    . TYR A 1 126 ? 86.128  59.387 27.120  1.00 44.36  ? 303  TYR A CZ    1 
ATOM   1057 O  OH    . TYR A 1 126 ? 86.902  60.317 26.461  1.00 43.63  ? 303  TYR A OH    1 
ATOM   1058 N  N     . GLN A 1 127 ? 84.969  53.935 27.551  1.00 40.34  ? 304  GLN A N     1 
ATOM   1059 C  CA    . GLN A 1 127 ? 86.124  53.374 26.846  1.00 41.11  ? 304  GLN A CA    1 
ATOM   1060 C  C     . GLN A 1 127 ? 85.758  53.015 25.419  1.00 41.17  ? 304  GLN A C     1 
ATOM   1061 O  O     . GLN A 1 127 ? 86.430  53.437 24.467  1.00 41.13  ? 304  GLN A O     1 
ATOM   1062 C  CB    . GLN A 1 127 ? 86.655  52.147 27.571  1.00 40.81  ? 304  GLN A CB    1 
ATOM   1063 C  CG    . GLN A 1 127 ? 87.052  52.386 29.045  1.00 41.98  ? 304  GLN A CG    1 
ATOM   1064 C  CD    . GLN A 1 127 ? 88.099  53.494 29.262  1.00 42.76  ? 304  GLN A CD    1 
ATOM   1065 O  OE1   . GLN A 1 127 ? 88.007  54.272 30.236  1.00 46.52  ? 304  GLN A OE1   1 
ATOM   1066 N  NE2   . GLN A 1 127 ? 89.087  53.567 28.378  1.00 38.11  ? 304  GLN A NE2   1 
ATOM   1067 N  N     . ILE A 1 128 ? 84.631  52.321 25.281  1.00 40.68  ? 305  ILE A N     1 
ATOM   1068 C  CA    . ILE A 1 128 ? 84.211  51.784 24.006  1.00 40.29  ? 305  ILE A CA    1 
ATOM   1069 C  C     . ILE A 1 128 ? 83.779  52.902 23.065  1.00 40.42  ? 305  ILE A C     1 
ATOM   1070 O  O     . ILE A 1 128 ? 84.222  52.978 21.910  1.00 41.28  ? 305  ILE A O     1 
ATOM   1071 C  CB    . ILE A 1 128 ? 83.078  50.754 24.177  1.00 39.66  ? 305  ILE A CB    1 
ATOM   1072 C  CG1   . ILE A 1 128 ? 83.575  49.590 25.032  1.00 39.90  ? 305  ILE A CG1   1 
ATOM   1073 C  CG2   . ILE A 1 128 ? 82.616  50.269 22.836  1.00 35.56  ? 305  ILE A CG2   1 
ATOM   1074 C  CD1   . ILE A 1 128 ? 82.485  48.616 25.532  1.00 39.49  ? 305  ILE A CD1   1 
ATOM   1075 N  N     . ASN A 1 129 ? 82.948  53.798 23.563  1.00 40.91  ? 306  ASN A N     1 
ATOM   1076 C  CA    . ASN A 1 129 ? 82.446  54.900 22.735  1.00 41.48  ? 306  ASN A CA    1 
ATOM   1077 C  C     . ASN A 1 129 ? 83.556  55.886 22.311  1.00 41.52  ? 306  ASN A C     1 
ATOM   1078 O  O     . ASN A 1 129 ? 83.561  56.366 21.181  1.00 41.91  ? 306  ASN A O     1 
ATOM   1079 C  CB    . ASN A 1 129 ? 81.262  55.600 23.448  1.00 41.86  ? 306  ASN A CB    1 
ATOM   1080 C  CG    . ASN A 1 129 ? 80.000  54.687 23.558  1.00 41.88  ? 306  ASN A CG    1 
ATOM   1081 O  OD1   . ASN A 1 129 ? 79.872  53.702 22.822  1.00 44.49  ? 306  ASN A OD1   1 
ATOM   1082 N  ND2   . ASN A 1 129 ? 79.079  55.027 24.460  1.00 40.82  ? 306  ASN A ND2   1 
ATOM   1083 N  N     . ALA A 1 130 ? 84.517  56.142 23.199  1.00 41.62  ? 307  ALA A N     1 
ATOM   1084 C  CA    . ALA A 1 130 ? 85.655  57.015 22.893  1.00 41.45  ? 307  ALA A CA    1 
ATOM   1085 C  C     . ALA A 1 130 ? 86.753  56.291 22.102  1.00 41.34  ? 307  ALA A C     1 
ATOM   1086 O  O     . ALA A 1 130 ? 87.715  56.923 21.675  1.00 41.15  ? 307  ALA A O     1 
ATOM   1087 C  CB    . ALA A 1 130 ? 86.227  57.580 24.197  1.00 41.50  ? 307  ALA A CB    1 
ATOM   1088 N  N     . ARG A 1 131 ? 86.614  54.976 21.931  1.00 41.11  ? 308  ARG A N     1 
ATOM   1089 C  CA    . ARG A 1 131 ? 87.598  54.148 21.247  1.00 40.77  ? 308  ARG A CA    1 
ATOM   1090 C  C     . ARG A 1 131 ? 88.969  54.383 21.831  1.00 40.86  ? 308  ARG A C     1 
ATOM   1091 O  O     . ARG A 1 131 ? 89.932  54.589 21.129  1.00 40.22  ? 308  ARG A O     1 
ATOM   1092 C  CB    . ARG A 1 131 ? 87.576  54.406 19.751  1.00 40.94  ? 308  ARG A CB    1 
ATOM   1093 C  CG    . ARG A 1 131 ? 86.187  54.241 19.153  1.00 40.97  ? 308  ARG A CG    1 
ATOM   1094 C  CD    . ARG A 1 131 ? 86.134  54.489 17.652  1.00 40.71  ? 308  ARG A CD    1 
ATOM   1095 N  NE    . ARG A 1 131 ? 84.768  54.836 17.203  1.00 43.78  ? 308  ARG A NE    1 
ATOM   1096 C  CZ    . ARG A 1 131 ? 84.410  55.088 15.936  1.00 43.90  ? 308  ARG A CZ    1 
ATOM   1097 N  NH1   . ARG A 1 131 ? 85.286  55.006 14.955  1.00 46.29  ? 308  ARG A NH1   1 
ATOM   1098 N  NH2   . ARG A 1 131 ? 83.156  55.369 15.626  1.00 43.92  ? 308  ARG A NH2   1 
ATOM   1099 N  N     . THR A 1 132 ? 89.038  54.291 23.147  1.00 41.78  ? 309  THR A N     1 
ATOM   1100 C  CA    . THR A 1 132 ? 90.267  54.488 23.889  1.00 42.04  ? 309  THR A CA    1 
ATOM   1101 C  C     . THR A 1 132 ? 91.214  53.351 23.627  1.00 43.98  ? 309  THR A C     1 
ATOM   1102 O  O     . THR A 1 132 ? 90.829  52.315 23.078  1.00 43.87  ? 309  THR A O     1 
ATOM   1103 C  CB    . THR A 1 132 ? 89.994  54.555 25.422  1.00 41.89  ? 309  THR A CB    1 
ATOM   1104 O  OG1   . THR A 1 132 ? 89.499  53.288 25.888  1.00 38.39  ? 309  THR A OG1   1 
ATOM   1105 C  CG2   . THR A 1 132 ? 88.981  55.668 25.765  1.00 39.00  ? 309  THR A CG2   1 
ATOM   1106 N  N     . GLU A 1 133 ? 92.439  53.522 24.100  1.00 45.47  ? 310  GLU A N     1 
ATOM   1107 C  CA    . GLU A 1 133 ? 93.462  52.528 23.909  1.00 47.21  ? 310  GLU A CA    1 
ATOM   1108 C  C     . GLU A 1 133 ? 93.089  51.220 24.559  1.00 46.19  ? 310  GLU A C     1 
ATOM   1109 O  O     . GLU A 1 133 ? 93.374  50.175 24.010  1.00 46.72  ? 310  GLU A O     1 
ATOM   1110 C  CB    . GLU A 1 133 ? 94.778  53.064 24.435  1.00 48.62  ? 310  GLU A CB    1 
ATOM   1111 C  CG    . GLU A 1 133 ? 95.274  54.249 23.568  1.00 55.36  ? 310  GLU A CG    1 
ATOM   1112 C  CD    . GLU A 1 133 ? 96.780  54.433 23.604  1.00 61.28  ? 310  GLU A CD    1 
ATOM   1113 O  OE1   . GLU A 1 133 ? 97.290  55.187 22.743  1.00 59.74  ? 310  GLU A OE1   1 
ATOM   1114 O  OE2   . GLU A 1 133 ? 97.429  53.821 24.504  1.00 67.87  ? 310  GLU A OE2   1 
ATOM   1115 N  N     . LEU A 1 134 ? 92.463  51.291 25.722  1.00 45.19  ? 311  LEU A N     1 
ATOM   1116 C  CA    . LEU A 1 134 ? 92.020  50.097 26.419  1.00 45.63  ? 311  LEU A CA    1 
ATOM   1117 C  C     . LEU A 1 134 ? 90.935  49.375 25.634  1.00 44.44  ? 311  LEU A C     1 
ATOM   1118 O  O     . LEU A 1 134 ? 90.958  48.159 25.537  1.00 44.37  ? 311  LEU A O     1 
ATOM   1119 C  CB    . LEU A 1 134 ? 91.470  50.445 27.816  1.00 46.13  ? 311  LEU A CB    1 
ATOM   1120 C  CG    . LEU A 1 134 ? 92.455  50.442 28.974  1.00 46.03  ? 311  LEU A CG    1 
ATOM   1121 C  CD1   . LEU A 1 134 ? 91.716  50.766 30.255  1.00 47.12  ? 311  LEU A CD1   1 
ATOM   1122 C  CD2   . LEU A 1 134 ? 93.168  49.125 29.070  1.00 46.93  ? 311  LEU A CD2   1 
ATOM   1123 N  N     . ALA A 1 135 ? 89.943  50.121 25.152  1.00 43.08  ? 312  ALA A N     1 
ATOM   1124 C  CA    . ALA A 1 135 ? 88.858  49.523 24.406  1.00 41.81  ? 312  ALA A CA    1 
ATOM   1125 C  C     . ALA A 1 135 ? 89.437  48.775 23.193  1.00 40.85  ? 312  ALA A C     1 
ATOM   1126 O  O     . ALA A 1 135 ? 89.061  47.628 22.942  1.00 40.55  ? 312  ALA A O     1 
ATOM   1127 C  CB    . ALA A 1 135 ? 87.817  50.586 24.002  1.00 41.30  ? 312  ALA A CB    1 
ATOM   1128 N  N     . VAL A 1 136 ? 90.416  49.386 22.518  1.00 39.74  ? 313  VAL A N     1 
ATOM   1129 C  CA    . VAL A 1 136 ? 91.066  48.784 21.360  1.00 38.31  ? 313  VAL A CA    1 
ATOM   1130 C  C     . VAL A 1 136 ? 91.928  47.587 21.776  1.00 38.76  ? 313  VAL A C     1 
ATOM   1131 O  O     . VAL A 1 136 ? 91.898  46.548 21.145  1.00 39.55  ? 313  VAL A O     1 
ATOM   1132 C  CB    . VAL A 1 136 ? 91.913  49.835 20.593  1.00 38.60  ? 313  VAL A CB    1 
ATOM   1133 C  CG1   . VAL A 1 136 ? 92.863  49.172 19.564  1.00 35.31  ? 313  VAL A CG1   1 
ATOM   1134 C  CG2   . VAL A 1 136 ? 91.007  50.859 19.920  1.00 32.80  ? 313  VAL A CG2   1 
ATOM   1135 N  N     . ARG A 1 137 ? 92.639  47.709 22.880  1.00 38.78  ? 314  ARG A N     1 
ATOM   1136 C  CA    . ARG A 1 137 ? 93.483  46.627 23.365  1.00 39.09  ? 314  ARG A CA    1 
ATOM   1137 C  C     . ARG A 1 137 ? 92.652  45.372 23.614  1.00 38.77  ? 314  ARG A C     1 
ATOM   1138 O  O     . ARG A 1 137 ? 93.080  44.286 23.299  1.00 38.39  ? 314  ARG A O     1 
ATOM   1139 C  CB    . ARG A 1 137 ? 94.223  47.028 24.658  1.00 38.73  ? 314  ARG A CB    1 
ATOM   1140 C  CG    . ARG A 1 137 ? 94.656  45.809 25.448  1.00 42.24  ? 314  ARG A CG    1 
ATOM   1141 C  CD    . ARG A 1 137 ? 95.892  45.960 26.319  1.00 45.95  ? 314  ARG A CD    1 
ATOM   1142 N  NE    . ARG A 1 137 ? 96.697  47.109 25.969  1.00 50.39  ? 314  ARG A NE    1 
ATOM   1143 C  CZ    . ARG A 1 137 ? 96.908  48.131 26.795  1.00 54.52  ? 314  ARG A CZ    1 
ATOM   1144 N  NH1   . ARG A 1 137 ? 96.433  48.107 28.037  1.00 57.60  ? 314  ARG A NH1   1 
ATOM   1145 N  NH2   . ARG A 1 137 ? 97.576  49.192 26.382  1.00 55.89  ? 314  ARG A NH2   1 
ATOM   1146 N  N     . TYR A 1 138 ? 91.465  45.540 24.183  1.00 38.66  ? 315  TYR A N     1 
ATOM   1147 C  CA    . TYR A 1 138 ? 90.658  44.425 24.661  1.00 38.51  ? 315  TYR A CA    1 
ATOM   1148 C  C     . TYR A 1 138 ? 89.409  44.193 23.789  1.00 38.59  ? 315  TYR A C     1 
ATOM   1149 O  O     . TYR A 1 138 ? 88.516  43.405 24.142  1.00 38.55  ? 315  TYR A O     1 
ATOM   1150 C  CB    . TYR A 1 138 ? 90.262  44.642 26.125  1.00 38.12  ? 315  TYR A CB    1 
ATOM   1151 C  CG    . TYR A 1 138 ? 91.441  44.483 27.064  1.00 38.40  ? 315  TYR A CG    1 
ATOM   1152 C  CD1   . TYR A 1 138 ? 92.144  43.305 27.106  1.00 39.43  ? 315  TYR A CD1   1 
ATOM   1153 C  CD2   . TYR A 1 138 ? 91.874  45.520 27.867  1.00 38.99  ? 315  TYR A CD2   1 
ATOM   1154 C  CE1   . TYR A 1 138 ? 93.234  43.147 27.928  1.00 38.57  ? 315  TYR A CE1   1 
ATOM   1155 C  CE2   . TYR A 1 138 ? 92.958  45.362 28.690  1.00 40.60  ? 315  TYR A CE2   1 
ATOM   1156 C  CZ    . TYR A 1 138 ? 93.641  44.169 28.704  1.00 37.74  ? 315  TYR A CZ    1 
ATOM   1157 O  OH    . TYR A 1 138 ? 94.712  43.980 29.526  1.00 35.95  ? 315  TYR A OH    1 
ATOM   1158 N  N     . ASN A 1 139 ? 89.373  44.814 22.619  1.00 38.23  ? 316  ASN A N     1 
ATOM   1159 C  CA    . ASN A 1 139 ? 88.316  44.499 21.674  1.00 38.66  ? 316  ASN A CA    1 
ATOM   1160 C  C     . ASN A 1 139 ? 86.876  44.673 22.256  1.00 38.92  ? 316  ASN A C     1 
ATOM   1161 O  O     . ASN A 1 139 ? 85.946  43.956 21.903  1.00 39.64  ? 316  ASN A O     1 
ATOM   1162 C  CB    . ASN A 1 139 ? 88.526  43.089 21.146  1.00 38.30  ? 316  ASN A CB    1 
ATOM   1163 C  CG    . ASN A 1 139 ? 89.897  42.894 20.563  1.00 37.44  ? 316  ASN A CG    1 
ATOM   1164 O  OD1   . ASN A 1 139 ? 90.261  43.554 19.587  1.00 36.72  ? 316  ASN A OD1   1 
ATOM   1165 N  ND2   . ASN A 1 139 ? 90.676  41.980 21.154  1.00 33.62  ? 316  ASN A ND2   1 
ATOM   1166 N  N     . ASP A 1 140 ? 86.708  45.689 23.086  1.00 39.22  ? 317  ASP A N     1 
ATOM   1167 C  CA    . ASP A 1 140 ? 85.405  46.078 23.632  1.00 40.70  ? 317  ASP A CA    1 
ATOM   1168 C  C     . ASP A 1 140 ? 84.858  45.061 24.632  1.00 41.25  ? 317  ASP A C     1 
ATOM   1169 O  O     . ASP A 1 140 ? 83.714  45.189 25.081  1.00 41.91  ? 317  ASP A O     1 
ATOM   1170 C  CB    . ASP A 1 140 ? 84.352  46.334 22.531  1.00 40.69  ? 317  ASP A CB    1 
ATOM   1171 C  CG    . ASP A 1 140 ? 84.619  47.592 21.749  1.00 40.63  ? 317  ASP A CG    1 
ATOM   1172 O  OD1   . ASP A 1 140 ? 85.516  48.352 22.164  1.00 42.64  ? 317  ASP A OD1   1 
ATOM   1173 O  OD2   . ASP A 1 140 ? 83.964  47.801 20.702  1.00 37.82  ? 317  ASP A OD2   1 
ATOM   1174 N  N     . ILE A 1 141 ? 85.675  44.076 24.999  1.00 41.03  ? 318  ILE A N     1 
ATOM   1175 C  CA    . ILE A 1 141 ? 85.282  43.084 26.015  1.00 40.72  ? 318  ILE A CA    1 
ATOM   1176 C  C     . ILE A 1 141 ? 85.792  43.412 27.437  1.00 41.39  ? 318  ILE A C     1 
ATOM   1177 O  O     . ILE A 1 141 ? 86.970  43.245 27.735  1.00 42.85  ? 318  ILE A O     1 
ATOM   1178 C  CB    . ILE A 1 141 ? 85.798  41.702 25.651  1.00 40.27  ? 318  ILE A CB    1 
ATOM   1179 C  CG1   . ILE A 1 141 ? 85.352  41.331 24.229  1.00 41.12  ? 318  ILE A CG1   1 
ATOM   1180 C  CG2   . ILE A 1 141 ? 85.360  40.691 26.685  1.00 36.67  ? 318  ILE A CG2   1 
ATOM   1181 C  CD1   . ILE A 1 141 ? 86.175  40.182 23.608  1.00 37.44  ? 318  ILE A CD1   1 
ATOM   1182 N  N     . SER A 1 142 ? 84.884  43.842 28.314  1.00 41.93  ? 319  SER A N     1 
ATOM   1183 C  CA    . SER A 1 142 ? 85.192  44.172 29.715  1.00 41.29  ? 319  SER A CA    1 
ATOM   1184 C  C     . SER A 1 142 ? 86.579  44.747 29.824  1.00 41.65  ? 319  SER A C     1 
ATOM   1185 O  O     . SER A 1 142 ? 87.462  44.166 30.468  1.00 41.11  ? 319  SER A O     1 
ATOM   1186 C  CB    . SER A 1 142 ? 85.103  42.926 30.584  1.00 41.98  ? 319  SER A CB    1 
ATOM   1187 O  OG    . SER A 1 142 ? 83.783  42.450 30.654  1.00 42.68  ? 319  SER A OG    1 
ATOM   1188 N  N     . PRO A 1 143 ? 86.812  45.843 29.108  1.00 41.93  ? 320  PRO A N     1 
ATOM   1189 C  CA    . PRO A 1 143 ? 88.162  46.371 29.034  1.00 42.28  ? 320  PRO A CA    1 
ATOM   1190 C  C     . PRO A 1 143 ? 88.728  46.722 30.401  1.00 41.83  ? 320  PRO A C     1 
ATOM   1191 O  O     . PRO A 1 143 ? 89.884  46.403 30.691  1.00 41.75  ? 320  PRO A O     1 
ATOM   1192 C  CB    . PRO A 1 143 ? 88.000  47.621 28.150  1.00 42.39  ? 320  PRO A CB    1 
ATOM   1193 C  CG    . PRO A 1 143 ? 86.801  47.344 27.346  1.00 42.84  ? 320  PRO A CG    1 
ATOM   1194 C  CD    . PRO A 1 143 ? 85.882  46.591 28.253  1.00 41.88  ? 320  PRO A CD    1 
ATOM   1195 N  N     . LEU A 1 144 ? 87.944  47.414 31.219  1.00 41.53  ? 321  LEU A N     1 
ATOM   1196 C  CA    . LEU A 1 144 ? 88.466  47.821 32.515  1.00 41.49  ? 321  LEU A CA    1 
ATOM   1197 C  C     . LEU A 1 144 ? 88.812  46.582 33.311  1.00 40.79  ? 321  LEU A C     1 
ATOM   1198 O  O     . LEU A 1 144 ? 89.868  46.472 33.913  1.00 40.49  ? 321  LEU A O     1 
ATOM   1199 C  CB    . LEU A 1 144 ? 87.463  48.693 33.269  1.00 42.07  ? 321  LEU A CB    1 
ATOM   1200 C  CG    . LEU A 1 144 ? 87.346  50.159 32.829  1.00 41.79  ? 321  LEU A CG    1 
ATOM   1201 C  CD1   . LEU A 1 144 ? 86.355  50.910 33.718  1.00 42.00  ? 321  LEU A CD1   1 
ATOM   1202 C  CD2   . LEU A 1 144 ? 88.696  50.796 32.864  1.00 40.78  ? 321  LEU A CD2   1 
ATOM   1203 N  N     . GLU A 1 145 ? 87.924  45.621 33.294  1.00 40.34  ? 322  GLU A N     1 
ATOM   1204 C  CA    . GLU A 1 145 ? 88.117  44.514 34.178  1.00 41.58  ? 322  GLU A CA    1 
ATOM   1205 C  C     . GLU A 1 145 ? 89.291  43.631 33.742  1.00 41.67  ? 322  GLU A C     1 
ATOM   1206 O  O     . GLU A 1 145 ? 90.005  43.090 34.561  1.00 41.27  ? 322  GLU A O     1 
ATOM   1207 C  CB    . GLU A 1 145 ? 86.829  43.722 34.304  1.00 41.59  ? 322  GLU A CB    1 
ATOM   1208 C  CG    . GLU A 1 145 ? 85.792  44.474 35.065  1.00 42.52  ? 322  GLU A CG    1 
ATOM   1209 C  CD    . GLU A 1 145 ? 85.010  45.456 34.224  1.00 43.73  ? 322  GLU A CD    1 
ATOM   1210 O  OE1   . GLU A 1 145 ? 85.102  45.424 32.976  1.00 43.08  ? 322  GLU A OE1   1 
ATOM   1211 O  OE2   . GLU A 1 145 ? 84.257  46.228 34.842  1.00 45.74  ? 322  GLU A OE2   1 
ATOM   1212 N  N     . ASN A 1 146 ? 89.457  43.467 32.444  1.00 42.37  ? 323  ASN A N     1 
ATOM   1213 C  CA    . ASN A 1 146 ? 90.637  42.807 31.908  1.00 42.74  ? 323  ASN A CA    1 
ATOM   1214 C  C     . ASN A 1 146 ? 91.912  43.540 32.318  1.00 43.27  ? 323  ASN A C     1 
ATOM   1215 O  O     . ASN A 1 146 ? 92.933  42.912 32.608  1.00 43.07  ? 323  ASN A O     1 
ATOM   1216 C  CB    . ASN A 1 146 ? 90.575  42.737 30.367  1.00 43.21  ? 323  ASN A CB    1 
ATOM   1217 C  CG    . ASN A 1 146 ? 89.841  41.487 29.849  1.00 39.91  ? 323  ASN A CG    1 
ATOM   1218 O  OD1   . ASN A 1 146 ? 90.304  40.364 30.015  1.00 37.55  ? 323  ASN A OD1   1 
ATOM   1219 N  ND2   . ASN A 1 146 ? 88.716  41.702 29.195  1.00 35.70  ? 323  ASN A ND2   1 
ATOM   1220 N  N     . HIS A 1 147 ? 91.850  44.871 32.324  1.00 43.33  ? 324  HIS A N     1 
ATOM   1221 C  CA    . HIS A 1 147 ? 92.999  45.688 32.690  1.00 43.00  ? 324  HIS A CA    1 
ATOM   1222 C  C     . HIS A 1 147 ? 93.345  45.558 34.173  1.00 44.08  ? 324  HIS A C     1 
ATOM   1223 O  O     . HIS A 1 147 ? 94.506  45.284 34.517  1.00 44.69  ? 324  HIS A O     1 
ATOM   1224 C  CB    . HIS A 1 147 ? 92.735  47.135 32.362  1.00 43.36  ? 324  HIS A CB    1 
ATOM   1225 C  CG    . HIS A 1 147 ? 93.859  48.036 32.733  1.00 42.21  ? 324  HIS A CG    1 
ATOM   1226 N  ND1   . HIS A 1 147 ? 95.065  48.034 32.068  1.00 41.05  ? 324  HIS A ND1   1 
ATOM   1227 C  CD2   . HIS A 1 147 ? 93.963  48.971 33.701  1.00 41.84  ? 324  HIS A CD2   1 
ATOM   1228 C  CE1   . HIS A 1 147 ? 95.873  48.911 32.632  1.00 40.46  ? 324  HIS A CE1   1 
ATOM   1229 N  NE2   . HIS A 1 147 ? 95.226  49.499 33.622  1.00 40.67  ? 324  HIS A NE2   1 
ATOM   1230 N  N     . HIS A 1 148 ? 92.336  45.673 35.049  1.00 44.21  ? 325  HIS A N     1 
ATOM   1231 C  CA    . HIS A 1 148 ? 92.547  45.489 36.499  1.00 43.85  ? 325  HIS A CA    1 
ATOM   1232 C  C     . HIS A 1 148 ? 93.311  44.199 36.702  1.00 44.22  ? 325  HIS A C     1 
ATOM   1233 O  O     . HIS A 1 148 ? 94.238  44.084 37.510  1.00 43.30  ? 325  HIS A O     1 
ATOM   1234 C  CB    . HIS A 1 148 ? 91.218  45.367 37.240  1.00 43.26  ? 325  HIS A CB    1 
ATOM   1235 C  CG    . HIS A 1 148 ? 90.288  46.507 37.003  1.00 44.22  ? 325  HIS A CG    1 
ATOM   1236 N  ND1   . HIS A 1 148 ? 90.730  47.801 36.812  1.00 43.02  ? 325  HIS A ND1   1 
ATOM   1237 C  CD2   . HIS A 1 148 ? 88.934  46.553 36.946  1.00 44.99  ? 325  HIS A CD2   1 
ATOM   1238 C  CE1   . HIS A 1 148 ? 89.687  48.596 36.642  1.00 44.97  ? 325  HIS A CE1   1 
ATOM   1239 N  NE2   . HIS A 1 148 ? 88.582  47.863 36.712  1.00 47.41  ? 325  HIS A NE2   1 
ATOM   1240 N  N     . CYS A 1 149 ? 92.843  43.198 35.991  1.00 45.45  ? 326  CYS A N     1 
ATOM   1241 C  CA    . CYS A 1 149 ? 93.265  41.839 36.205  1.00 46.80  ? 326  CYS A CA    1 
ATOM   1242 C  C     . CYS A 1 149 ? 94.704  41.645 35.702  1.00 45.32  ? 326  CYS A C     1 
ATOM   1243 O  O     . CYS A 1 149 ? 95.545  41.111 36.397  1.00 45.31  ? 326  CYS A O     1 
ATOM   1244 C  CB    . CYS A 1 149 ? 92.277  40.943 35.472  1.00 47.22  ? 326  CYS A CB    1 
ATOM   1245 S  SG    . CYS A 1 149 ? 92.459  39.318 35.946  1.00 57.66  ? 326  CYS A SG    1 
ATOM   1246 N  N     . ALA A 1 150 ? 94.981  42.159 34.514  1.00 44.87  ? 327  ALA A N     1 
ATOM   1247 C  CA    . ALA A 1 150 ? 96.316  42.191 33.975  1.00 44.38  ? 327  ALA A CA    1 
ATOM   1248 C  C     . ALA A 1 150 ? 97.243  42.946 34.924  1.00 44.16  ? 327  ALA A C     1 
ATOM   1249 O  O     . ALA A 1 150 ? 98.372  42.516 35.160  1.00 44.29  ? 327  ALA A O     1 
ATOM   1250 C  CB    . ALA A 1 150 ? 96.319  42.857 32.598  1.00 43.37  ? 327  ALA A CB    1 
ATOM   1251 N  N     . VAL A 1 151 ? 96.796  44.074 35.466  1.00 43.26  ? 328  VAL A N     1 
ATOM   1252 C  CA    . VAL A 1 151 ? 97.698  44.844 36.332  1.00 42.68  ? 328  VAL A CA    1 
ATOM   1253 C  C     . VAL A 1 151 ? 97.983  44.022 37.585  1.00 42.65  ? 328  VAL A C     1 
ATOM   1254 O  O     . VAL A 1 151 ? 99.118  43.959 38.041  1.00 42.68  ? 328  VAL A O     1 
ATOM   1255 C  CB    . VAL A 1 151 ? 97.156  46.237 36.710  1.00 42.33  ? 328  VAL A CB    1 
ATOM   1256 C  CG1   . VAL A 1 151 ? 98.003  46.817 37.791  1.00 40.26  ? 328  VAL A CG1   1 
ATOM   1257 C  CG2   . VAL A 1 151 ? 97.113  47.166 35.498  1.00 39.40  ? 328  VAL A CG2   1 
ATOM   1258 N  N     . ALA A 1 152 ? 96.966  43.334 38.092  1.00 42.36  ? 329  ALA A N     1 
ATOM   1259 C  CA    . ALA A 1 152 ? 97.154  42.402 39.209  1.00 41.78  ? 329  ALA A CA    1 
ATOM   1260 C  C     . ALA A 1 152 ? 98.330  41.475 38.963  1.00 41.37  ? 329  ALA A C     1 
ATOM   1261 O  O     . ALA A 1 152 ? 99.178  41.271 39.846  1.00 42.48  ? 329  ALA A O     1 
ATOM   1262 C  CB    . ALA A 1 152 ? 95.906  41.590 39.453  1.00 40.61  ? 329  ALA A CB    1 
ATOM   1263 N  N     . PHE A 1 153 ? 98.390  40.862 37.794  1.00 41.03  ? 330  PHE A N     1 
ATOM   1264 C  CA    . PHE A 1 153 ? 99.367  39.801 37.632  1.00 41.20  ? 330  PHE A CA    1 
ATOM   1265 C  C     . PHE A 1 153 ? 100.700 40.347 37.242  1.00 41.51  ? 330  PHE A C     1 
ATOM   1266 O  O     . PHE A 1 153 ? 101.712 39.746 37.554  1.00 41.83  ? 330  PHE A O     1 
ATOM   1267 C  CB    . PHE A 1 153 ? 98.886  38.686 36.717  1.00 41.13  ? 330  PHE A CB    1 
ATOM   1268 C  CG    . PHE A 1 153 ? 97.917  37.759 37.398  1.00 42.39  ? 330  PHE A CG    1 
ATOM   1269 C  CD1   . PHE A 1 153 ? 98.377  36.704 38.181  1.00 42.07  ? 330  PHE A CD1   1 
ATOM   1270 C  CD2   . PHE A 1 153 ? 96.543  38.026 37.375  1.00 42.27  ? 330  PHE A CD2   1 
ATOM   1271 C  CE1   . PHE A 1 153 ? 97.481  35.893 38.893  1.00 40.42  ? 330  PHE A CE1   1 
ATOM   1272 C  CE2   . PHE A 1 153 ? 95.650  37.220 38.077  1.00 42.17  ? 330  PHE A CE2   1 
ATOM   1273 C  CZ    . PHE A 1 153 ? 96.118  36.141 38.826  1.00 40.95  ? 330  PHE A CZ    1 
ATOM   1274 N  N     . GLN A 1 154 ? 100.716 41.555 36.691  1.00 42.02  ? 331  GLN A N     1 
ATOM   1275 C  CA    . GLN A 1 154 ? 101.971 42.278 36.511  1.00 42.03  ? 331  GLN A CA    1 
ATOM   1276 C  C     . GLN A 1 154 ? 102.624 42.578 37.850  1.00 42.02  ? 331  GLN A C     1 
ATOM   1277 O  O     . GLN A 1 154 ? 103.848 42.378 38.002  1.00 41.96  ? 331  GLN A O     1 
ATOM   1278 C  CB    . GLN A 1 154 ? 101.769 43.566 35.748  1.00 41.97  ? 331  GLN A CB    1 
ATOM   1279 C  CG    . GLN A 1 154 ? 101.385 43.375 34.273  1.00 44.23  ? 331  GLN A CG    1 
ATOM   1280 C  CD    . GLN A 1 154 ? 100.708 44.613 33.680  1.00 47.31  ? 331  GLN A CD    1 
ATOM   1281 O  OE1   . GLN A 1 154 ? 100.512 45.629 34.360  1.00 50.01  ? 331  GLN A OE1   1 
ATOM   1282 N  NE2   . GLN A 1 154 ? 100.369 44.536 32.406  1.00 51.14  ? 331  GLN A NE2   1 
ATOM   1283 N  N     . ILE A 1 155 ? 101.815 43.020 38.819  1.00 41.34  ? 332  ILE A N     1 
ATOM   1284 C  CA    . ILE A 1 155 ? 102.314 43.245 40.172  1.00 41.06  ? 332  ILE A CA    1 
ATOM   1285 C  C     . ILE A 1 155 ? 102.836 41.953 40.780  1.00 40.88  ? 332  ILE A C     1 
ATOM   1286 O  O     . ILE A 1 155 ? 103.960 41.914 41.259  1.00 41.18  ? 332  ILE A O     1 
ATOM   1287 C  CB    . ILE A 1 155 ? 101.264 43.899 41.124  1.00 42.02  ? 332  ILE A CB    1 
ATOM   1288 C  CG1   . ILE A 1 155 ? 100.946 45.344 40.663  1.00 41.46  ? 332  ILE A CG1   1 
ATOM   1289 C  CG2   . ILE A 1 155 ? 101.815 43.904 42.601  1.00 38.09  ? 332  ILE A CG2   1 
ATOM   1290 C  CD1   . ILE A 1 155 ? 99.639  45.961 41.206  1.00 41.75  ? 332  ILE A CD1   1 
ATOM   1291 N  N     . LEU A 1 156 ? 102.039 40.887 40.729  1.00 41.27  ? 333  LEU A N     1 
ATOM   1292 C  CA    . LEU A 1 156 ? 102.447 39.611 41.319  1.00 41.44  ? 333  LEU A CA    1 
ATOM   1293 C  C     . LEU A 1 156 ? 103.688 39.030 40.620  1.00 42.50  ? 333  LEU A C     1 
ATOM   1294 O  O     . LEU A 1 156 ? 104.356 38.156 41.160  1.00 43.41  ? 333  LEU A O     1 
ATOM   1295 C  CB    . LEU A 1 156 ? 101.292 38.597 41.305  1.00 41.64  ? 333  LEU A CB    1 
ATOM   1296 C  CG    . LEU A 1 156 ? 100.141 38.821 42.327  1.00 41.29  ? 333  LEU A CG    1 
ATOM   1297 C  CD1   . LEU A 1 156 ? 98.840  38.238 41.825  1.00 39.57  ? 333  LEU A CD1   1 
ATOM   1298 C  CD2   . LEU A 1 156 ? 100.443 38.235 43.700  1.00 39.10  ? 333  LEU A CD2   1 
ATOM   1299 N  N     . ALA A 1 157 ? 103.996 39.495 39.418  1.00 43.18  ? 334  ALA A N     1 
ATOM   1300 C  CA    . ALA A 1 157 ? 105.155 38.982 38.707  1.00 44.19  ? 334  ALA A CA    1 
ATOM   1301 C  C     . ALA A 1 157 ? 106.442 39.636 39.198  1.00 45.80  ? 334  ALA A C     1 
ATOM   1302 O  O     . ALA A 1 157 ? 107.534 39.131 38.955  1.00 47.43  ? 334  ALA A O     1 
ATOM   1303 C  CB    . ALA A 1 157 ? 105.011 39.201 37.249  1.00 42.38  ? 334  ALA A CB    1 
ATOM   1304 N  N     . GLU A 1 158 ? 106.339 40.792 39.831  1.00 47.12  ? 335  GLU A N     1 
ATOM   1305 C  CA    . GLU A 1 158 ? 107.517 41.382 40.436  1.00 48.21  ? 335  GLU A CA    1 
ATOM   1306 C  C     . GLU A 1 158 ? 107.862 40.526 41.640  1.00 47.93  ? 335  GLU A C     1 
ATOM   1307 O  O     . GLU A 1 158 ? 107.019 40.330 42.506  1.00 48.60  ? 335  GLU A O     1 
ATOM   1308 C  CB    . GLU A 1 158 ? 107.240 42.797 40.925  1.00 48.87  ? 335  GLU A CB    1 
ATOM   1309 C  CG    . GLU A 1 158 ? 106.883 43.777 39.834  1.00 52.22  ? 335  GLU A CG    1 
ATOM   1310 C  CD    . GLU A 1 158 ? 107.970 43.895 38.795  1.00 53.68  ? 335  GLU A CD    1 
ATOM   1311 O  OE1   . GLU A 1 158 ? 107.599 44.148 37.643  1.00 56.37  ? 335  GLU A OE1   1 
ATOM   1312 O  OE2   . GLU A 1 158 ? 109.171 43.699 39.112  1.00 54.66  ? 335  GLU A OE2   1 
ATOM   1313 N  N     . PRO A 1 159 ? 109.099 40.012 41.704  1.00 47.31  ? 336  PRO A N     1 
ATOM   1314 C  CA    . PRO A 1 159 ? 109.426 38.964 42.684  1.00 46.57  ? 336  PRO A CA    1 
ATOM   1315 C  C     . PRO A 1 159 ? 109.276 39.416 44.128  1.00 45.42  ? 336  PRO A C     1 
ATOM   1316 O  O     . PRO A 1 159 ? 108.937 38.633 44.990  1.00 44.12  ? 336  PRO A O     1 
ATOM   1317 C  CB    . PRO A 1 159 ? 110.907 38.657 42.401  1.00 46.18  ? 336  PRO A CB    1 
ATOM   1318 C  CG    . PRO A 1 159 ? 111.438 39.873 41.756  1.00 46.80  ? 336  PRO A CG    1 
ATOM   1319 C  CD    . PRO A 1 159 ? 110.281 40.397 40.911  1.00 47.94  ? 336  PRO A CD    1 
ATOM   1320 N  N     . GLU A 1 160 ? 109.538 40.684 44.390  1.00 44.59  ? 337  GLU A N     1 
ATOM   1321 C  CA    . GLU A 1 160 ? 109.441 41.149 45.755  1.00 43.28  ? 337  GLU A CA    1 
ATOM   1322 C  C     . GLU A 1 160 ? 107.988 41.312 46.180  1.00 42.51  ? 337  GLU A C     1 
ATOM   1323 O  O     . GLU A 1 160 ? 107.738 41.516 47.356  1.00 42.33  ? 337  GLU A O     1 
ATOM   1324 C  CB    . GLU A 1 160 ? 110.264 42.438 45.995  1.00 43.02  ? 337  GLU A CB    1 
ATOM   1325 C  CG    . GLU A 1 160 ? 109.592 43.751 45.593  1.00 44.91  ? 337  GLU A CG    1 
ATOM   1326 C  CD    . GLU A 1 160 ? 109.642 44.029 44.086  1.00 48.68  ? 337  GLU A CD    1 
ATOM   1327 O  OE1   . GLU A 1 160 ? 110.058 43.102 43.312  1.00 46.30  ? 337  GLU A OE1   1 
ATOM   1328 O  OE2   . GLU A 1 160 ? 109.261 45.175 43.697  1.00 48.75  ? 337  GLU A OE2   1 
ATOM   1329 N  N     . CYS A 1 161 ? 107.036 41.235 45.250  1.00 41.85  ? 338  CYS A N     1 
ATOM   1330 C  CA    . CYS A 1 161 ? 105.613 41.331 45.606  1.00 42.33  ? 338  CYS A CA    1 
ATOM   1331 C  C     . CYS A 1 161 ? 104.864 40.023 45.461  1.00 42.15  ? 338  CYS A C     1 
ATOM   1332 O  O     . CYS A 1 161 ? 103.636 39.980 45.611  1.00 42.37  ? 338  CYS A O     1 
ATOM   1333 C  CB    . CYS A 1 161 ? 104.909 42.370 44.747  1.00 42.52  ? 338  CYS A CB    1 
ATOM   1334 S  SG    . CYS A 1 161 ? 105.629 44.003 44.845  1.00 45.86  ? 338  CYS A SG    1 
ATOM   1335 N  N     . ASN A 1 162 ? 105.580 38.966 45.132  1.00 41.14  ? 339  ASN A N     1 
ATOM   1336 C  CA    . ASN A 1 162 ? 104.899 37.783 44.718  1.00 41.82  ? 339  ASN A CA    1 
ATOM   1337 C  C     . ASN A 1 162 ? 104.518 36.919 45.903  1.00 42.35  ? 339  ASN A C     1 
ATOM   1338 O  O     . ASN A 1 162 ? 105.242 35.973 46.250  1.00 40.84  ? 339  ASN A O     1 
ATOM   1339 C  CB    . ASN A 1 162 ? 105.720 36.992 43.728  1.00 41.76  ? 339  ASN A CB    1 
ATOM   1340 C  CG    . ASN A 1 162 ? 105.041 35.712 43.329  1.00 40.81  ? 339  ASN A CG    1 
ATOM   1341 O  OD1   . ASN A 1 162 ? 103.914 35.432 43.738  1.00 43.29  ? 339  ASN A OD1   1 
ATOM   1342 N  ND2   . ASN A 1 162 ? 105.731 34.910 42.543  1.00 37.15  ? 339  ASN A ND2   1 
ATOM   1343 N  N     . ILE A 1 163 ? 103.340 37.217 46.471  1.00 43.07  ? 340  ILE A N     1 
ATOM   1344 C  CA    . ILE A 1 163 ? 102.839 36.498 47.638  1.00 43.54  ? 340  ILE A CA    1 
ATOM   1345 C  C     . ILE A 1 163 ? 102.568 35.039 47.305  1.00 44.19  ? 340  ILE A C     1 
ATOM   1346 O  O     . ILE A 1 163 ? 102.406 34.238 48.211  1.00 45.32  ? 340  ILE A O     1 
ATOM   1347 C  CB    . ILE A 1 163 ? 101.572 37.160 48.264  1.00 43.78  ? 340  ILE A CB    1 
ATOM   1348 C  CG1   . ILE A 1 163 ? 100.430 37.270 47.234  1.00 43.10  ? 340  ILE A CG1   1 
ATOM   1349 C  CG2   . ILE A 1 163 ? 101.930 38.545 48.825  1.00 44.98  ? 340  ILE A CG2   1 
ATOM   1350 C  CD1   . ILE A 1 163 ? 99.126  37.912 47.741  1.00 41.52  ? 340  ILE A CD1   1 
ATOM   1351 N  N     . PHE A 1 164 ? 102.562 34.671 46.027  1.00 44.58  ? 341  PHE A N     1 
ATOM   1352 C  CA    . PHE A 1 164 ? 102.345 33.279 45.640  1.00 44.85  ? 341  PHE A CA    1 
ATOM   1353 C  C     . PHE A 1 164 ? 103.619 32.520 45.347  1.00 45.48  ? 341  PHE A C     1 
ATOM   1354 O  O     . PHE A 1 164 ? 103.551 31.365 44.909  1.00 45.64  ? 341  PHE A O     1 
ATOM   1355 C  CB    . PHE A 1 164 ? 101.465 33.180 44.410  1.00 44.98  ? 341  PHE A CB    1 
ATOM   1356 C  CG    . PHE A 1 164 ? 100.150 33.886 44.544  1.00 44.81  ? 341  PHE A CG    1 
ATOM   1357 C  CD1   . PHE A 1 164 ? 99.538  34.019 45.771  1.00 44.78  ? 341  PHE A CD1   1 
ATOM   1358 C  CD2   . PHE A 1 164 ? 99.507  34.363 43.439  1.00 42.22  ? 341  PHE A CD2   1 
ATOM   1359 C  CE1   . PHE A 1 164 ? 98.328  34.635 45.887  1.00 45.13  ? 341  PHE A CE1   1 
ATOM   1360 C  CE2   . PHE A 1 164 ? 98.297  34.990 43.558  1.00 45.99  ? 341  PHE A CE2   1 
ATOM   1361 C  CZ    . PHE A 1 164 ? 97.707  35.125 44.792  1.00 45.47  ? 341  PHE A CZ    1 
ATOM   1362 N  N     . SER A 1 165 ? 104.770 33.126 45.631  1.00 45.33  ? 342  SER A N     1 
ATOM   1363 C  CA    . SER A 1 165 ? 106.062 32.564 45.209  1.00 45.19  ? 342  SER A CA    1 
ATOM   1364 C  C     . SER A 1 165 ? 106.363 31.197 45.820  1.00 45.30  ? 342  SER A C     1 
ATOM   1365 O  O     . SER A 1 165 ? 107.216 30.482 45.315  1.00 45.84  ? 342  SER A O     1 
ATOM   1366 C  CB    . SER A 1 165 ? 107.210 33.518 45.539  1.00 44.65  ? 342  SER A CB    1 
ATOM   1367 O  OG    . SER A 1 165 ? 107.343 33.661 46.950  1.00 46.76  ? 342  SER A OG    1 
ATOM   1368 N  N     . ASN A 1 166 ? 105.699 30.853 46.919  1.00 46.03  ? 343  ASN A N     1 
ATOM   1369 C  CA    . ASN A 1 166 ? 105.877 29.549 47.556  1.00 46.18  ? 343  ASN A CA    1 
ATOM   1370 C  C     . ASN A 1 166 ? 104.718 28.591 47.324  1.00 46.80  ? 343  ASN A C     1 
ATOM   1371 O  O     . ASN A 1 166 ? 104.645 27.548 47.950  1.00 48.32  ? 343  ASN A O     1 
ATOM   1372 C  CB    . ASN A 1 166 ? 106.119 29.724 49.059  1.00 46.59  ? 343  ASN A CB    1 
ATOM   1373 C  CG    . ASN A 1 166 ? 107.445 30.438 49.358  1.00 47.06  ? 343  ASN A CG    1 
ATOM   1374 O  OD1   . ASN A 1 166 ? 108.436 30.273 48.639  1.00 48.34  ? 343  ASN A OD1   1 
ATOM   1375 N  ND2   . ASN A 1 166 ? 107.457 31.233 50.401  1.00 43.15  ? 343  ASN A ND2   1 
ATOM   1376 N  N     . ILE A 1 167 ? 103.819 28.928 46.414  1.00 46.88  ? 344  ILE A N     1 
ATOM   1377 C  CA    . ILE A 1 167 ? 102.750 28.016 46.039  1.00 47.02  ? 344  ILE A CA    1 
ATOM   1378 C  C     . ILE A 1 167 ? 103.258 27.296 44.790  1.00 47.89  ? 344  ILE A C     1 
ATOM   1379 O  O     . ILE A 1 167 ? 103.804 27.933 43.901  1.00 48.04  ? 344  ILE A O     1 
ATOM   1380 C  CB    . ILE A 1 167 ? 101.400 28.778 45.732  1.00 46.39  ? 344  ILE A CB    1 
ATOM   1381 C  CG1   . ILE A 1 167 ? 100.863 29.482 46.974  1.00 45.17  ? 344  ILE A CG1   1 
ATOM   1382 C  CG2   . ILE A 1 167 ? 100.335 27.833 45.237  1.00 46.26  ? 344  ILE A CG2   1 
ATOM   1383 C  CD1   . ILE A 1 167 ? 100.080 30.757 46.678  1.00 43.18  ? 344  ILE A CD1   1 
ATOM   1384 N  N     . PRO A 1 168 ? 103.066 25.972 44.709  1.00 48.19  ? 345  PRO A N     1 
ATOM   1385 C  CA    . PRO A 1 168 ? 103.488 25.263 43.490  1.00 48.85  ? 345  PRO A CA    1 
ATOM   1386 C  C     . PRO A 1 168 ? 102.724 25.727 42.244  1.00 49.72  ? 345  PRO A C     1 
ATOM   1387 O  O     . PRO A 1 168 ? 101.603 26.225 42.349  1.00 50.89  ? 345  PRO A O     1 
ATOM   1388 C  CB    . PRO A 1 168 ? 103.159 23.795 43.789  1.00 48.38  ? 345  PRO A CB    1 
ATOM   1389 C  CG    . PRO A 1 168 ? 102.893 23.712 45.265  1.00 47.73  ? 345  PRO A CG    1 
ATOM   1390 C  CD    . PRO A 1 168 ? 102.424 25.082 45.688  1.00 47.75  ? 345  PRO A CD    1 
ATOM   1391 N  N     . PRO A 1 169 ? 103.306 25.528 41.062  1.00 50.07  ? 346  PRO A N     1 
ATOM   1392 C  CA    . PRO A 1 169 ? 102.666 25.982 39.836  1.00 50.48  ? 346  PRO A CA    1 
ATOM   1393 C  C     . PRO A 1 169 ? 101.200 25.555 39.652  1.00 50.39  ? 346  PRO A C     1 
ATOM   1394 O  O     . PRO A 1 169 ? 100.400 26.361 39.180  1.00 51.38  ? 346  PRO A O     1 
ATOM   1395 C  CB    . PRO A 1 169 ? 103.554 25.372 38.759  1.00 51.07  ? 346  PRO A CB    1 
ATOM   1396 C  CG    . PRO A 1 169 ? 104.900 25.270 39.427  1.00 49.60  ? 346  PRO A CG    1 
ATOM   1397 C  CD    . PRO A 1 169 ? 104.583 24.846 40.793  1.00 49.28  ? 346  PRO A CD    1 
ATOM   1398 N  N     . ASP A 1 170 ? 100.842 24.325 39.998  1.00 49.20  ? 347  ASP A N     1 
ATOM   1399 C  CA    . ASP A 1 170 ? 99.450  23.908 39.878  1.00 49.36  ? 347  ASP A CA    1 
ATOM   1400 C  C     . ASP A 1 170 ? 98.515  24.797 40.701  1.00 48.30  ? 347  ASP A C     1 
ATOM   1401 O  O     . ASP A 1 170 ? 97.444  25.223 40.234  1.00 48.48  ? 347  ASP A O     1 
ATOM   1402 C  CB    . ASP A 1 170 ? 99.292  22.440 40.281  1.00 50.50  ? 347  ASP A CB    1 
ATOM   1403 C  CG    . ASP A 1 170 ? 99.714  21.484 39.160  1.00 54.64  ? 347  ASP A CG    1 
ATOM   1404 O  OD1   . ASP A 1 170 ? 99.660  20.247 39.373  1.00 59.07  ? 347  ASP A OD1   1 
ATOM   1405 O  OD2   . ASP A 1 170 ? 100.084 21.977 38.059  1.00 56.12  ? 347  ASP A OD2   1 
ATOM   1406 N  N     . GLY A 1 171 ? 98.923  25.091 41.922  1.00 46.75  ? 348  GLY A N     1 
ATOM   1407 C  CA    . GLY A 1 171 ? 98.173  25.993 42.755  1.00 45.88  ? 348  GLY A CA    1 
ATOM   1408 C  C     . GLY A 1 171 ? 98.142  27.378 42.155  1.00 46.21  ? 348  GLY A C     1 
ATOM   1409 O  O     . GLY A 1 171 ? 97.087  28.024 42.118  1.00 45.08  ? 348  GLY A O     1 
ATOM   1410 N  N     . PHE A 1 172 ? 99.285  27.828 41.642  1.00 46.28  ? 349  PHE A N     1 
ATOM   1411 C  CA    . PHE A 1 172 ? 99.341  29.153 41.031  1.00 46.69  ? 349  PHE A CA    1 
ATOM   1412 C  C     . PHE A 1 172 ? 98.309  29.248 39.910  1.00 47.17  ? 349  PHE A C     1 
ATOM   1413 O  O     . PHE A 1 172 ? 97.494  30.190 39.862  1.00 47.00  ? 349  PHE A O     1 
ATOM   1414 C  CB    . PHE A 1 172 ? 100.741 29.501 40.494  1.00 46.45  ? 349  PHE A CB    1 
ATOM   1415 C  CG    . PHE A 1 172 ? 100.791 30.842 39.824  1.00 46.35  ? 349  PHE A CG    1 
ATOM   1416 C  CD1   . PHE A 1 172 ? 100.903 32.003 40.579  1.00 48.05  ? 349  PHE A CD1   1 
ATOM   1417 C  CD2   . PHE A 1 172 ? 100.581 30.959 38.469  1.00 46.93  ? 349  PHE A CD2   1 
ATOM   1418 C  CE1   . PHE A 1 172 ? 100.849 33.264 39.990  1.00 49.64  ? 349  PHE A CE1   1 
ATOM   1419 C  CE2   . PHE A 1 172 ? 100.533 32.229 37.856  1.00 48.90  ? 349  PHE A CE2   1 
ATOM   1420 C  CZ    . PHE A 1 172 ? 100.665 33.379 38.619  1.00 48.49  ? 349  PHE A CZ    1 
ATOM   1421 N  N     . LYS A 1 173 ? 98.339  28.261 39.021  1.00 47.44  ? 350  LYS A N     1 
ATOM   1422 C  CA    . LYS A 1 173 ? 97.397  28.211 37.911  1.00 48.56  ? 350  LYS A CA    1 
ATOM   1423 C  C     . LYS A 1 173 ? 95.938  28.183 38.386  1.00 47.96  ? 350  LYS A C     1 
ATOM   1424 O  O     . LYS A 1 173 ? 95.079  28.819 37.778  1.00 47.57  ? 350  LYS A O     1 
ATOM   1425 C  CB    . LYS A 1 173 ? 97.674  27.006 37.036  1.00 49.28  ? 350  LYS A CB    1 
ATOM   1426 C  CG    . LYS A 1 173 ? 98.889  27.151 36.133  1.00 54.75  ? 350  LYS A CG    1 
ATOM   1427 C  CD    . LYS A 1 173 ? 98.894  26.015 35.047  1.00 62.70  ? 350  LYS A CD    1 
ATOM   1428 C  CE    . LYS A 1 173 ? 100.260 25.818 34.310  1.00 65.10  ? 350  LYS A CE    1 
ATOM   1429 N  NZ    . LYS A 1 173 ? 101.251 25.063 35.157  1.00 67.20  ? 350  LYS A NZ    1 
ATOM   1430 N  N     . GLN A 1 174 ? 95.666  27.478 39.485  1.00 47.83  ? 351  GLN A N     1 
ATOM   1431 C  CA    . GLN A 1 174 ? 94.307  27.386 40.015  1.00 48.05  ? 351  GLN A CA    1 
ATOM   1432 C  C     . GLN A 1 174 ? 93.827  28.735 40.546  1.00 47.60  ? 351  GLN A C     1 
ATOM   1433 O  O     . GLN A 1 174 ? 92.701  29.166 40.275  1.00 47.79  ? 351  GLN A O     1 
ATOM   1434 C  CB    . GLN A 1 174 ? 94.280  26.357 41.130  1.00 48.90  ? 351  GLN A CB    1 
ATOM   1435 C  CG    . GLN A 1 174 ? 92.900  25.907 41.551  1.00 52.57  ? 351  GLN A CG    1 
ATOM   1436 C  CD    . GLN A 1 174 ? 92.954  24.889 42.663  1.00 56.31  ? 351  GLN A CD    1 
ATOM   1437 O  OE1   . GLN A 1 174 ? 92.114  24.901 43.560  1.00 59.73  ? 351  GLN A OE1   1 
ATOM   1438 N  NE2   . GLN A 1 174 ? 93.984  24.035 42.648  1.00 59.59  ? 351  GLN A NE2   1 
ATOM   1439 N  N     . ILE A 1 175 ? 94.716  29.416 41.262  1.00 46.70  ? 352  ILE A N     1 
ATOM   1440 C  CA    . ILE A 1 175 ? 94.435  30.720 41.831  1.00 45.84  ? 352  ILE A CA    1 
ATOM   1441 C  C     . ILE A 1 175 ? 94.261  31.753 40.718  1.00 45.78  ? 352  ILE A C     1 
ATOM   1442 O  O     . ILE A 1 175 ? 93.326  32.582 40.721  1.00 44.93  ? 352  ILE A O     1 
ATOM   1443 C  CB    . ILE A 1 175 ? 95.605  31.145 42.747  1.00 46.11  ? 352  ILE A CB    1 
ATOM   1444 C  CG1   . ILE A 1 175 ? 95.629  30.270 44.013  1.00 45.21  ? 352  ILE A CG1   1 
ATOM   1445 C  CG2   . ILE A 1 175 ? 95.541  32.634 43.073  1.00 43.41  ? 352  ILE A CG2   1 
ATOM   1446 C  CD1   . ILE A 1 175 ? 97.033  30.046 44.597  1.00 43.80  ? 352  ILE A CD1   1 
ATOM   1447 N  N     . ARG A 1 176 ? 95.166  31.687 39.750  1.00 45.93  ? 353  ARG A N     1 
ATOM   1448 C  CA    . ARG A 1 176 ? 95.147  32.652 38.642  1.00 45.87  ? 353  ARG A CA    1 
ATOM   1449 C  C     . ARG A 1 176 ? 93.817  32.599 37.902  1.00 44.54  ? 353  ARG A C     1 
ATOM   1450 O  O     . ARG A 1 176 ? 93.143  33.624 37.717  1.00 43.79  ? 353  ARG A O     1 
ATOM   1451 C  CB    . ARG A 1 176 ? 96.307  32.395 37.679  1.00 45.98  ? 353  ARG A CB    1 
ATOM   1452 C  CG    . ARG A 1 176 ? 96.257  33.276 36.419  1.00 46.62  ? 353  ARG A CG    1 
ATOM   1453 C  CD    . ARG A 1 176 ? 97.552  33.172 35.657  1.00 46.39  ? 353  ARG A CD    1 
ATOM   1454 N  NE    . ARG A 1 176 ? 97.467  33.671 34.296  1.00 45.49  ? 353  ARG A NE    1 
ATOM   1455 C  CZ    . ARG A 1 176 ? 97.467  34.961 33.990  1.00 47.48  ? 353  ARG A CZ    1 
ATOM   1456 N  NH1   . ARG A 1 176 ? 97.504  35.870 34.950  1.00 48.96  ? 353  ARG A NH1   1 
ATOM   1457 N  NH2   . ARG A 1 176 ? 97.410  35.351 32.728  1.00 47.64  ? 353  ARG A NH2   1 
ATOM   1458 N  N     . GLN A 1 177 ? 93.423  31.382 37.557  1.00 44.27  ? 354  GLN A N     1 
ATOM   1459 C  CA    . GLN A 1 177 ? 92.156  31.145 36.873  1.00 45.37  ? 354  GLN A CA    1 
ATOM   1460 C  C     . GLN A 1 177 ? 90.988  31.686 37.699  1.00 43.61  ? 354  GLN A C     1 
ATOM   1461 O  O     . GLN A 1 177 ? 90.155  32.435 37.183  1.00 43.27  ? 354  GLN A O     1 
ATOM   1462 C  CB    . GLN A 1 177 ? 91.958  29.639 36.548  1.00 46.48  ? 354  GLN A CB    1 
ATOM   1463 C  CG    . GLN A 1 177 ? 90.497  29.254 36.085  1.00 53.05  ? 354  GLN A CG    1 
ATOM   1464 C  CD    . GLN A 1 177 ? 90.023  30.008 34.784  1.00 61.26  ? 354  GLN A CD    1 
ATOM   1465 O  OE1   . GLN A 1 177 ? 90.135  29.477 33.682  1.00 66.78  ? 354  GLN A OE1   1 
ATOM   1466 N  NE2   . GLN A 1 177 ? 89.484  31.232 34.932  1.00 65.99  ? 354  GLN A NE2   1 
ATOM   1467 N  N     . GLY A 1 178 ? 90.957  31.347 38.988  1.00 42.41  ? 355  GLY A N     1 
ATOM   1468 C  CA    . GLY A 1 178 ? 89.885  31.802 39.864  1.00 41.85  ? 355  GLY A CA    1 
ATOM   1469 C  C     . GLY A 1 178 ? 89.799  33.316 39.886  1.00 41.87  ? 355  GLY A C     1 
ATOM   1470 O  O     . GLY A 1 178 ? 88.714  33.908 39.774  1.00 40.97  ? 355  GLY A O     1 
ATOM   1471 N  N     . MET A 1 179 ? 90.954  33.954 40.011  1.00 42.14  ? 356  MET A N     1 
ATOM   1472 C  CA    . MET A 1 179 ? 90.962  35.406 40.177  1.00 42.66  ? 356  MET A CA    1 
ATOM   1473 C  C     . MET A 1 179 ? 90.496  36.051 38.894  1.00 43.05  ? 356  MET A C     1 
ATOM   1474 O  O     . MET A 1 179 ? 89.756  37.034 38.930  1.00 43.34  ? 356  MET A O     1 
ATOM   1475 C  CB    . MET A 1 179 ? 92.345  35.926 40.528  1.00 42.45  ? 356  MET A CB    1 
ATOM   1476 C  CG    . MET A 1 179 ? 92.771  35.496 41.902  1.00 44.20  ? 356  MET A CG    1 
ATOM   1477 S  SD    . MET A 1 179 ? 94.403  36.093 42.371  1.00 45.90  ? 356  MET A SD    1 
ATOM   1478 C  CE    . MET A 1 179 ? 94.311  37.815 41.867  1.00 37.89  ? 356  MET A CE    1 
ATOM   1479 N  N     . ILE A 1 180 ? 90.928  35.504 37.763  1.00 42.90  ? 357  ILE A N     1 
ATOM   1480 C  CA    . ILE A 1 180 ? 90.544  36.081 36.476  1.00 42.56  ? 357  ILE A CA    1 
ATOM   1481 C  C     . ILE A 1 180 ? 89.013  35.992 36.379  1.00 42.04  ? 357  ILE A C     1 
ATOM   1482 O  O     . ILE A 1 180 ? 88.334  36.994 36.120  1.00 41.61  ? 357  ILE A O     1 
ATOM   1483 C  CB    . ILE A 1 180 ? 91.294  35.370 35.292  1.00 43.41  ? 357  ILE A CB    1 
ATOM   1484 C  CG1   . ILE A 1 180 ? 92.792  35.742 35.321  1.00 44.20  ? 357  ILE A CG1   1 
ATOM   1485 C  CG2   . ILE A 1 180 ? 90.693  35.717 33.930  1.00 42.68  ? 357  ILE A CG2   1 
ATOM   1486 C  CD1   . ILE A 1 180 ? 93.694  34.861 34.494  1.00 40.56  ? 357  ILE A CD1   1 
ATOM   1487 N  N     . THR A 1 181 ? 88.451  34.827 36.692  1.00 40.72  ? 358  THR A N     1 
ATOM   1488 C  CA    . THR A 1 181 ? 86.998  34.673 36.590  1.00 39.83  ? 358  THR A CA    1 
ATOM   1489 C  C     . THR A 1 181 ? 86.304  35.700 37.468  1.00 40.68  ? 358  THR A C     1 
ATOM   1490 O  O     . THR A 1 181 ? 85.307  36.318 37.070  1.00 40.51  ? 358  THR A O     1 
ATOM   1491 C  CB    . THR A 1 181 ? 86.540  33.279 37.040  1.00 39.59  ? 358  THR A CB    1 
ATOM   1492 O  OG1   . THR A 1 181 ? 87.165  32.276 36.228  1.00 37.83  ? 358  THR A OG1   1 
ATOM   1493 C  CG2   . THR A 1 181 ? 85.028  33.143 36.936  1.00 37.16  ? 358  THR A CG2   1 
ATOM   1494 N  N     . LEU A 1 182 ? 86.811  35.851 38.689  1.00 41.08  ? 359  LEU A N     1 
ATOM   1495 C  CA    . LEU A 1 182 ? 86.121  36.649 39.678  1.00 41.63  ? 359  LEU A CA    1 
ATOM   1496 C  C     . LEU A 1 182 ? 86.222  38.144 39.339  1.00 42.10  ? 359  LEU A C     1 
ATOM   1497 O  O     . LEU A 1 182 ? 85.191  38.817 39.269  1.00 42.48  ? 359  LEU A O     1 
ATOM   1498 C  CB    . LEU A 1 182 ? 86.644  36.362 41.097  1.00 42.21  ? 359  LEU A CB    1 
ATOM   1499 C  CG    . LEU A 1 182 ? 86.334  35.014 41.774  1.00 40.76  ? 359  LEU A CG    1 
ATOM   1500 C  CD1   . LEU A 1 182 ? 86.334  35.193 43.293  1.00 33.74  ? 359  LEU A CD1   1 
ATOM   1501 C  CD2   . LEU A 1 182 ? 85.036  34.394 41.276  1.00 36.24  ? 359  LEU A CD2   1 
ATOM   1502 N  N     . ILE A 1 183 ? 87.432  38.639 39.065  1.00 42.10  ? 360  ILE A N     1 
ATOM   1503 C  CA    . ILE A 1 183 ? 87.604  40.020 38.671  1.00 42.55  ? 360  ILE A CA    1 
ATOM   1504 C  C     . ILE A 1 183 ? 86.771  40.374 37.426  1.00 43.91  ? 360  ILE A C     1 
ATOM   1505 O  O     . ILE A 1 183 ? 86.075  41.424 37.397  1.00 44.48  ? 360  ILE A O     1 
ATOM   1506 C  CB    . ILE A 1 183 ? 89.069  40.410 38.424  1.00 42.16  ? 360  ILE A CB    1 
ATOM   1507 C  CG1   . ILE A 1 183 ? 89.866  40.350 39.733  1.00 42.66  ? 360  ILE A CG1   1 
ATOM   1508 C  CG2   . ILE A 1 183 ? 89.127  41.867 37.881  1.00 41.72  ? 360  ILE A CG2   1 
ATOM   1509 C  CD1   . ILE A 1 183 ? 91.362  40.131 39.600  1.00 38.90  ? 360  ILE A CD1   1 
ATOM   1510 N  N     . LEU A 1 184 ? 86.788  39.494 36.424  1.00 43.42  ? 361  LEU A N     1 
ATOM   1511 C  CA    . LEU A 1 184 ? 85.979  39.729 35.227  1.00 43.97  ? 361  LEU A CA    1 
ATOM   1512 C  C     . LEU A 1 184 ? 84.490  39.732 35.556  1.00 43.79  ? 361  LEU A C     1 
ATOM   1513 O  O     . LEU A 1 184 ? 83.709  40.364 34.838  1.00 44.62  ? 361  LEU A O     1 
ATOM   1514 C  CB    . LEU A 1 184 ? 86.251  38.689 34.121  1.00 43.58  ? 361  LEU A CB    1 
ATOM   1515 C  CG    . LEU A 1 184 ? 87.616  38.801 33.450  1.00 42.88  ? 361  LEU A CG    1 
ATOM   1516 C  CD1   . LEU A 1 184 ? 87.753  37.699 32.459  1.00 40.21  ? 361  LEU A CD1   1 
ATOM   1517 C  CD2   . LEU A 1 184 ? 87.812  40.152 32.804  1.00 39.18  ? 361  LEU A CD2   1 
ATOM   1518 N  N     . ALA A 1 185 ? 84.093  38.997 36.592  1.00 42.89  ? 362  ALA A N     1 
ATOM   1519 C  CA    . ALA A 1 185 ? 82.685  38.870 36.924  1.00 43.14  ? 362  ALA A CA    1 
ATOM   1520 C  C     . ALA A 1 185 ? 82.127  40.189 37.514  1.00 43.37  ? 362  ALA A C     1 
ATOM   1521 O  O     . ALA A 1 185 ? 80.908  40.383 37.586  1.00 42.97  ? 362  ALA A O     1 
ATOM   1522 C  CB    . ALA A 1 185 ? 82.467  37.680 37.866  1.00 41.82  ? 362  ALA A CB    1 
ATOM   1523 N  N     . THR A 1 186 ? 83.008  41.134 37.843  1.00 43.97  ? 363  THR A N     1 
ATOM   1524 C  CA    . THR A 1 186 ? 82.563  42.376 38.479  1.00 44.08  ? 363  THR A CA    1 
ATOM   1525 C  C     . THR A 1 186 ? 82.057  43.388 37.468  1.00 44.90  ? 363  THR A C     1 
ATOM   1526 O  O     . THR A 1 186 ? 81.523  44.432 37.847  1.00 45.59  ? 363  THR A O     1 
ATOM   1527 C  CB    . THR A 1 186 ? 83.658  43.019 39.369  1.00 44.05  ? 363  THR A CB    1 
ATOM   1528 O  OG1   . THR A 1 186 ? 84.747  43.433 38.558  1.00 40.94  ? 363  THR A OG1   1 
ATOM   1529 C  CG2   . THR A 1 186 ? 84.172  42.029 40.403  1.00 44.14  ? 363  THR A CG2   1 
ATOM   1530 N  N     . ASP A 1 187 ? 82.200  43.086 36.183  1.00 45.36  ? 364  ASP A N     1 
ATOM   1531 C  CA    . ASP A 1 187 ? 81.645  43.933 35.135  1.00 45.07  ? 364  ASP A CA    1 
ATOM   1532 C  C     . ASP A 1 187 ? 80.113  43.917 35.184  1.00 45.26  ? 364  ASP A C     1 
ATOM   1533 O  O     . ASP A 1 187 ? 79.480  42.905 34.889  1.00 44.72  ? 364  ASP A O     1 
ATOM   1534 C  CB    . ASP A 1 187 ? 82.139  43.451 33.763  1.00 45.67  ? 364  ASP A CB    1 
ATOM   1535 C  CG    . ASP A 1 187 ? 81.554  44.261 32.623  1.00 47.38  ? 364  ASP A CG    1 
ATOM   1536 O  OD1   . ASP A 1 187 ? 80.751  45.178 32.937  1.00 47.05  ? 364  ASP A OD1   1 
ATOM   1537 O  OD2   . ASP A 1 187 ? 81.885  43.986 31.439  1.00 42.63  ? 364  ASP A OD2   1 
ATOM   1538 N  N     . MET A 1 188 ? 79.511  45.044 35.550  1.00 45.78  ? 365  MET A N     1 
ATOM   1539 C  CA    . MET A 1 188 ? 78.063  45.094 35.742  1.00 46.12  ? 365  MET A CA    1 
ATOM   1540 C  C     . MET A 1 188 ? 77.285  44.867 34.483  1.00 45.29  ? 365  MET A C     1 
ATOM   1541 O  O     . MET A 1 188 ? 76.110  44.569 34.556  1.00 45.74  ? 365  MET A O     1 
ATOM   1542 C  CB    . MET A 1 188 ? 77.624  46.411 36.346  1.00 46.40  ? 365  MET A CB    1 
ATOM   1543 C  CG    . MET A 1 188 ? 77.789  46.454 37.847  1.00 50.26  ? 365  MET A CG    1 
ATOM   1544 S  SD    . MET A 1 188 ? 76.670  45.426 38.841  1.00 53.48  ? 365  MET A SD    1 
ATOM   1545 C  CE    . MET A 1 188 ? 75.050  45.975 38.334  1.00 52.34  ? 365  MET A CE    1 
ATOM   1546 N  N     . ALA A 1 189 ? 77.922  44.987 33.326  1.00 45.11  ? 366  ALA A N     1 
ATOM   1547 C  CA    . ALA A 1 189 ? 77.267  44.618 32.063  1.00 44.56  ? 366  ALA A CA    1 
ATOM   1548 C  C     . ALA A 1 189 ? 76.721  43.206 32.167  1.00 44.50  ? 366  ALA A C     1 
ATOM   1549 O  O     . ALA A 1 189 ? 75.720  42.890 31.579  1.00 45.39  ? 366  ALA A O     1 
ATOM   1550 C  CB    . ALA A 1 189 ? 78.238  44.712 30.894  1.00 43.18  ? 366  ALA A CB    1 
ATOM   1551 N  N     . ARG A 1 190 ? 77.366  42.366 32.951  1.00 44.98  ? 367  ARG A N     1 
ATOM   1552 C  CA    . ARG A 1 190 ? 77.015  40.947 32.997  1.00 44.67  ? 367  ARG A CA    1 
ATOM   1553 C  C     . ARG A 1 190 ? 76.142  40.601 34.199  1.00 44.94  ? 367  ARG A C     1 
ATOM   1554 O  O     . ARG A 1 190 ? 75.879  39.417 34.456  1.00 44.16  ? 367  ARG A O     1 
ATOM   1555 C  CB    . ARG A 1 190 ? 78.276  40.099 33.073  1.00 44.38  ? 367  ARG A CB    1 
ATOM   1556 C  CG    . ARG A 1 190 ? 79.238  40.362 31.964  1.00 43.58  ? 367  ARG A CG    1 
ATOM   1557 C  CD    . ARG A 1 190 ? 80.487  39.540 32.130  1.00 44.09  ? 367  ARG A CD    1 
ATOM   1558 N  NE    . ARG A 1 190 ? 80.192  38.126 32.368  1.00 44.38  ? 367  ARG A NE    1 
ATOM   1559 C  CZ    . ARG A 1 190 ? 81.071  37.276 32.880  1.00 46.98  ? 367  ARG A CZ    1 
ATOM   1560 N  NH1   . ARG A 1 190 ? 82.286  37.696 33.229  1.00 49.56  ? 367  ARG A NH1   1 
ATOM   1561 N  NH2   . ARG A 1 190 ? 80.736  36.019 33.079  1.00 46.21  ? 367  ARG A NH2   1 
ATOM   1562 N  N     . HIS A 1 191 ? 75.684  41.619 34.936  1.00 44.61  ? 368  HIS A N     1 
ATOM   1563 C  CA    . HIS A 1 191 ? 74.967  41.361 36.192  1.00 44.72  ? 368  HIS A CA    1 
ATOM   1564 C  C     . HIS A 1 191 ? 73.779  40.423 35.984  1.00 45.29  ? 368  HIS A C     1 
ATOM   1565 O  O     . HIS A 1 191 ? 73.695  39.379 36.613  1.00 46.55  ? 368  HIS A O     1 
ATOM   1566 C  CB    . HIS A 1 191 ? 74.506  42.649 36.851  1.00 44.85  ? 368  HIS A CB    1 
ATOM   1567 C  CG    . HIS A 1 191 ? 73.720  42.435 38.104  1.00 43.64  ? 368  HIS A CG    1 
ATOM   1568 N  ND1   . HIS A 1 191 ? 74.308  42.071 39.297  1.00 40.94  ? 368  HIS A ND1   1 
ATOM   1569 C  CD2   . HIS A 1 191 ? 72.390  42.529 38.350  1.00 41.11  ? 368  HIS A CD2   1 
ATOM   1570 C  CE1   . HIS A 1 191 ? 73.373  41.960 40.227  1.00 41.42  ? 368  HIS A CE1   1 
ATOM   1571 N  NE2   . HIS A 1 191 ? 72.199  42.233 39.680  1.00 38.93  ? 368  HIS A NE2   1 
ATOM   1572 N  N     . ALA A 1 192 ? 72.905  40.746 35.044  1.00 45.48  ? 369  ALA A N     1 
ATOM   1573 C  CA    . ALA A 1 192 ? 71.689  39.944 34.840  1.00 45.62  ? 369  ALA A CA    1 
ATOM   1574 C  C     . ALA A 1 192 ? 72.037  38.503 34.409  1.00 46.51  ? 369  ALA A C     1 
ATOM   1575 O  O     . ALA A 1 192 ? 71.408  37.550 34.876  1.00 46.43  ? 369  ALA A O     1 
ATOM   1576 C  CB    . ALA A 1 192 ? 70.741  40.631 33.820  1.00 44.11  ? 369  ALA A CB    1 
ATOM   1577 N  N     . GLU A 1 193 ? 73.044  38.368 33.541  1.00 47.25  ? 370  GLU A N     1 
ATOM   1578 C  CA    . GLU A 1 193 ? 73.529  37.063 33.051  1.00 48.17  ? 370  GLU A CA    1 
ATOM   1579 C  C     . GLU A 1 193 ? 74.039  36.225 34.233  1.00 47.22  ? 370  GLU A C     1 
ATOM   1580 O  O     . GLU A 1 193 ? 73.713  35.045 34.359  1.00 47.34  ? 370  GLU A O     1 
ATOM   1581 C  CB    . GLU A 1 193 ? 74.646  37.286 31.978  1.00 49.54  ? 370  GLU A CB    1 
ATOM   1582 C  CG    . GLU A 1 193 ? 75.527  36.032 31.539  1.00 54.38  ? 370  GLU A CG    1 
ATOM   1583 C  CD    . GLU A 1 193 ? 77.103  36.278 31.458  1.00 59.56  ? 370  GLU A CD    1 
ATOM   1584 O  OE1   . GLU A 1 193 ? 77.556  37.253 30.772  1.00 57.09  ? 370  GLU A OE1   1 
ATOM   1585 O  OE2   . GLU A 1 193 ? 77.871  35.427 32.031  1.00 56.85  ? 370  GLU A OE2   1 
ATOM   1586 N  N     . ILE A 1 194 ? 74.849  36.834 35.091  1.00 46.46  ? 371  ILE A N     1 
ATOM   1587 C  CA    . ILE A 1 194 ? 75.472  36.086 36.185  1.00 46.08  ? 371  ILE A CA    1 
ATOM   1588 C  C     . ILE A 1 194 ? 74.388  35.693 37.210  1.00 46.28  ? 371  ILE A C     1 
ATOM   1589 O  O     . ILE A 1 194 ? 74.310  34.554 37.665  1.00 45.06  ? 371  ILE A O     1 
ATOM   1590 C  CB    . ILE A 1 194 ? 76.611  36.902 36.844  1.00 45.10  ? 371  ILE A CB    1 
ATOM   1591 C  CG1   . ILE A 1 194 ? 77.761  37.111 35.849  1.00 45.29  ? 371  ILE A CG1   1 
ATOM   1592 C  CG2   . ILE A 1 194 ? 77.131  36.214 38.080  1.00 42.44  ? 371  ILE A CG2   1 
ATOM   1593 C  CD1   . ILE A 1 194 ? 78.918  37.984 36.381  1.00 44.24  ? 371  ILE A CD1   1 
ATOM   1594 N  N     . MET A 1 195 ? 73.511  36.640 37.512  1.00 46.70  ? 372  MET A N     1 
ATOM   1595 C  CA    . MET A 1 195 ? 72.414  36.382 38.417  1.00 47.64  ? 372  MET A CA    1 
ATOM   1596 C  C     . MET A 1 195 ? 71.528  35.241 37.923  1.00 47.74  ? 372  MET A C     1 
ATOM   1597 O  O     . MET A 1 195 ? 71.067  34.435 38.712  1.00 47.87  ? 372  MET A O     1 
ATOM   1598 C  CB    . MET A 1 195 ? 71.579  37.655 38.580  1.00 48.37  ? 372  MET A CB    1 
ATOM   1599 C  CG    . MET A 1 195 ? 72.187  38.682 39.515  1.00 50.68  ? 372  MET A CG    1 
ATOM   1600 S  SD    . MET A 1 195 ? 72.377  37.961 41.162  1.00 57.77  ? 372  MET A SD    1 
ATOM   1601 C  CE    . MET A 1 195 ? 70.646  37.812 41.635  1.00 54.91  ? 372  MET A CE    1 
ATOM   1602 N  N     . ASP A 1 196 ? 71.279  35.186 36.620  1.00 48.21  ? 373  ASP A N     1 
ATOM   1603 C  CA    . ASP A 1 196 ? 70.489  34.105 36.035  1.00 49.53  ? 373  ASP A CA    1 
ATOM   1604 C  C     . ASP A 1 196 ? 71.185  32.762 36.173  1.00 49.89  ? 373  ASP A C     1 
ATOM   1605 O  O     . ASP A 1 196 ? 70.546  31.792 36.572  1.00 49.98  ? 373  ASP A O     1 
ATOM   1606 C  CB    . ASP A 1 196 ? 70.186  34.357 34.552  1.00 50.20  ? 373  ASP A CB    1 
ATOM   1607 C  CG    . ASP A 1 196 ? 69.068  35.396 34.336  1.00 52.62  ? 373  ASP A CG    1 
ATOM   1608 O  OD1   . ASP A 1 196 ? 68.428  35.858 35.310  1.00 55.78  ? 373  ASP A OD1   1 
ATOM   1609 O  OD2   . ASP A 1 196 ? 68.836  35.763 33.170  1.00 55.90  ? 373  ASP A OD2   1 
ATOM   1610 N  N     . SER A 1 197 ? 72.480  32.698 35.855  1.00 49.71  ? 374  SER A N     1 
ATOM   1611 C  CA    . SER A 1 197 ? 73.192  31.441 35.955  1.00 50.20  ? 374  SER A CA    1 
ATOM   1612 C  C     . SER A 1 197 ? 73.169  30.987 37.395  1.00 50.79  ? 374  SER A C     1 
ATOM   1613 O  O     . SER A 1 197 ? 72.960  29.800 37.674  1.00 51.29  ? 374  SER A O     1 
ATOM   1614 C  CB    . SER A 1 197 ? 74.634  31.552 35.496  1.00 50.18  ? 374  SER A CB    1 
ATOM   1615 O  OG    . SER A 1 197 ? 74.719  32.109 34.212  1.00 51.87  ? 374  SER A OG    1 
ATOM   1616 N  N     . PHE A 1 198 ? 73.330  31.930 38.315  1.00 50.24  ? 375  PHE A N     1 
ATOM   1617 C  CA    . PHE A 1 198 ? 73.314  31.574 39.709  1.00 50.49  ? 375  PHE A CA    1 
ATOM   1618 C  C     . PHE A 1 198 ? 71.967  30.995 40.110  1.00 51.30  ? 375  PHE A C     1 
ATOM   1619 O  O     . PHE A 1 198 ? 71.914  29.925 40.683  1.00 50.50  ? 375  PHE A O     1 
ATOM   1620 C  CB    . PHE A 1 198 ? 73.621  32.766 40.587  1.00 49.86  ? 375  PHE A CB    1 
ATOM   1621 C  CG    . PHE A 1 198 ? 73.783  32.407 42.030  1.00 49.16  ? 375  PHE A CG    1 
ATOM   1622 C  CD1   . PHE A 1 198 ? 74.586  31.325 42.404  1.00 47.87  ? 375  PHE A CD1   1 
ATOM   1623 C  CD2   . PHE A 1 198 ? 73.164  33.150 43.017  1.00 48.03  ? 375  PHE A CD2   1 
ATOM   1624 C  CE1   . PHE A 1 198 ? 74.746  30.996 43.723  1.00 46.56  ? 375  PHE A CE1   1 
ATOM   1625 C  CE2   . PHE A 1 198 ? 73.323  32.817 44.353  1.00 48.04  ? 375  PHE A CE2   1 
ATOM   1626 C  CZ    . PHE A 1 198 ? 74.102  31.739 44.707  1.00 45.45  ? 375  PHE A CZ    1 
ATOM   1627 N  N     . LYS A 1 199 ? 70.882  31.697 39.786  1.00 52.71  ? 376  LYS A N     1 
ATOM   1628 C  CA    . LYS A 1 199 ? 69.549  31.254 40.181  1.00 53.91  ? 376  LYS A CA    1 
ATOM   1629 C  C     . LYS A 1 199 ? 69.230  29.845 39.656  1.00 54.59  ? 376  LYS A C     1 
ATOM   1630 O  O     . LYS A 1 199 ? 68.587  29.048 40.340  1.00 53.99  ? 376  LYS A O     1 
ATOM   1631 C  CB    . LYS A 1 199 ? 68.489  32.254 39.732  1.00 54.05  ? 376  LYS A CB    1 
ATOM   1632 C  CG    . LYS A 1 199 ? 68.581  33.604 40.474  1.00 57.13  ? 376  LYS A CG    1 
ATOM   1633 C  CD    . LYS A 1 199 ? 67.254  34.413 40.419  1.00 61.23  ? 376  LYS A CD    1 
ATOM   1634 C  CE    . LYS A 1 199 ? 67.463  35.934 40.100  1.00 63.80  ? 376  LYS A CE    1 
ATOM   1635 N  NZ    . LYS A 1 199 ? 66.997  36.369 38.713  1.00 63.47  ? 376  LYS A NZ    1 
ATOM   1636 N  N     . GLU A 1 200 ? 69.720  29.546 38.460  1.00 55.50  ? 377  GLU A N     1 
ATOM   1637 C  CA    . GLU A 1 200 ? 69.589  28.233 37.856  1.00 56.93  ? 377  GLU A CA    1 
ATOM   1638 C  C     . GLU A 1 200 ? 70.199  27.172 38.761  1.00 56.44  ? 377  GLU A C     1 
ATOM   1639 O  O     . GLU A 1 200 ? 69.577  26.160 39.051  1.00 56.29  ? 377  GLU A O     1 
ATOM   1640 C  CB    . GLU A 1 200 ? 70.329  28.238 36.516  1.00 58.48  ? 377  GLU A CB    1 
ATOM   1641 C  CG    . GLU A 1 200 ? 69.813  27.287 35.438  1.00 62.01  ? 377  GLU A CG    1 
ATOM   1642 C  CD    . GLU A 1 200 ? 69.937  27.887 34.024  1.00 68.14  ? 377  GLU A CD    1 
ATOM   1643 O  OE1   . GLU A 1 200 ? 70.659  28.909 33.850  1.00 69.20  ? 377  GLU A OE1   1 
ATOM   1644 O  OE2   . GLU A 1 200 ? 69.270  27.361 33.092  1.00 72.53  ? 377  GLU A OE2   1 
ATOM   1645 N  N     . LYS A 1 201 ? 71.418  27.419 39.215  1.00 56.15  ? 378  LYS A N     1 
ATOM   1646 C  CA    . LYS A 1 201 ? 72.085  26.503 40.107  1.00 56.32  ? 378  LYS A CA    1 
ATOM   1647 C  C     . LYS A 1 201 ? 71.349  26.452 41.447  1.00 56.43  ? 378  LYS A C     1 
ATOM   1648 O  O     . LYS A 1 201 ? 71.249  25.403 42.077  1.00 56.17  ? 378  LYS A O     1 
ATOM   1649 C  CB    . LYS A 1 201 ? 73.535  26.930 40.307  1.00 56.43  ? 378  LYS A CB    1 
ATOM   1650 C  CG    . LYS A 1 201 ? 74.316  27.179 39.029  1.00 58.10  ? 378  LYS A CG    1 
ATOM   1651 C  CD    . LYS A 1 201 ? 73.991  26.143 37.940  1.00 60.95  ? 378  LYS A CD    1 
ATOM   1652 C  CE    . LYS A 1 201 ? 74.977  26.169 36.756  1.00 61.85  ? 378  LYS A CE    1 
ATOM   1653 N  NZ    . LYS A 1 201 ? 75.139  24.790 36.179  1.00 63.26  ? 378  LYS A NZ    1 
ATOM   1654 N  N     . MET A 1 202 ? 70.816  27.586 41.873  1.00 56.86  ? 379  MET A N     1 
ATOM   1655 C  CA    . MET A 1 202 ? 70.123  27.660 43.145  1.00 57.69  ? 379  MET A CA    1 
ATOM   1656 C  C     . MET A 1 202 ? 68.862  26.784 43.163  1.00 58.38  ? 379  MET A C     1 
ATOM   1657 O  O     . MET A 1 202 ? 68.360  26.462 44.232  1.00 58.42  ? 379  MET A O     1 
ATOM   1658 C  CB    . MET A 1 202 ? 69.744  29.113 43.444  1.00 58.37  ? 379  MET A CB    1 
ATOM   1659 C  CG    . MET A 1 202 ? 69.776  29.515 44.946  1.00 59.63  ? 379  MET A CG    1 
ATOM   1660 S  SD    . MET A 1 202 ? 71.321  29.050 45.715  1.00 54.92  ? 379  MET A SD    1 
ATOM   1661 C  CE    . MET A 1 202 ? 72.334  29.449 44.310  1.00 55.90  ? 379  MET A CE    1 
ATOM   1662 N  N     . GLU A 1 203 ? 68.338  26.425 41.989  1.00 58.39  ? 380  GLU A N     1 
ATOM   1663 C  CA    . GLU A 1 203 ? 67.263  25.439 41.899  1.00 59.29  ? 380  GLU A CA    1 
ATOM   1664 C  C     . GLU A 1 203 ? 67.589  24.122 42.630  1.00 58.04  ? 380  GLU A C     1 
ATOM   1665 O  O     . GLU A 1 203 ? 66.688  23.416 43.057  1.00 57.25  ? 380  GLU A O     1 
ATOM   1666 C  CB    . GLU A 1 203 ? 66.938  25.106 40.424  1.00 60.31  ? 380  GLU A CB    1 
ATOM   1667 C  CG    . GLU A 1 203 ? 65.877  26.004 39.717  1.00 63.23  ? 380  GLU A CG    1 
ATOM   1668 C  CD    . GLU A 1 203 ? 66.113  26.099 38.175  1.00 69.27  ? 380  GLU A CD    1 
ATOM   1669 O  OE1   . GLU A 1 203 ? 65.987  27.214 37.598  1.00 72.27  ? 380  GLU A OE1   1 
ATOM   1670 O  OE2   . GLU A 1 203 ? 66.478  25.072 37.546  1.00 70.21  ? 380  GLU A OE2   1 
ATOM   1671 N  N     . ASN A 1 204 ? 68.878  23.797 42.734  1.00 57.16  ? 381  ASN A N     1 
ATOM   1672 C  CA    . ASN A 1 204 ? 69.349  22.575 43.384  1.00 55.57  ? 381  ASN A CA    1 
ATOM   1673 C  C     . ASN A 1 204 ? 70.845  22.680 43.722  1.00 54.42  ? 381  ASN A C     1 
ATOM   1674 O  O     . ASN A 1 204 ? 71.658  21.914 43.209  1.00 54.26  ? 381  ASN A O     1 
ATOM   1675 C  CB    . ASN A 1 204 ? 69.108  21.406 42.427  1.00 55.93  ? 381  ASN A CB    1 
ATOM   1676 C  CG    . ASN A 1 204 ? 69.365  20.055 43.058  1.00 55.12  ? 381  ASN A CG    1 
ATOM   1677 O  OD1   . ASN A 1 204 ? 69.585  19.935 44.264  1.00 55.96  ? 381  ASN A OD1   1 
ATOM   1678 N  ND2   . ASN A 1 204 ? 69.324  19.028 42.240  1.00 53.07  ? 381  ASN A ND2   1 
ATOM   1679 N  N     . PHE A 1 205 ? 71.199  23.624 44.594  1.00 52.87  ? 382  PHE A N     1 
ATOM   1680 C  CA    . PHE A 1 205 ? 72.596  24.025 44.786  1.00 51.68  ? 382  PHE A CA    1 
ATOM   1681 C  C     . PHE A 1 205 ? 73.443  22.956 45.422  1.00 50.36  ? 382  PHE A C     1 
ATOM   1682 O  O     . PHE A 1 205 ? 73.001  22.328 46.332  1.00 50.85  ? 382  PHE A O     1 
ATOM   1683 C  CB    . PHE A 1 205 ? 72.710  25.318 45.610  1.00 51.01  ? 382  PHE A CB    1 
ATOM   1684 C  CG    . PHE A 1 205 ? 74.087  25.937 45.544  1.00 51.15  ? 382  PHE A CG    1 
ATOM   1685 C  CD1   . PHE A 1 205 ? 74.450  26.748 44.465  1.00 48.56  ? 382  PHE A CD1   1 
ATOM   1686 C  CD2   . PHE A 1 205 ? 75.057  25.614 46.492  1.00 48.00  ? 382  PHE A CD2   1 
ATOM   1687 C  CE1   . PHE A 1 205 ? 75.732  27.278 44.375  1.00 49.23  ? 382  PHE A CE1   1 
ATOM   1688 C  CE2   . PHE A 1 205 ? 76.330  26.163 46.422  1.00 49.09  ? 382  PHE A CE2   1 
ATOM   1689 C  CZ    . PHE A 1 205 ? 76.684  26.983 45.354  1.00 48.94  ? 382  PHE A CZ    1 
ATOM   1690 N  N     . ASP A 1 206 ? 74.694  22.835 44.999  1.00 49.95  ? 383  ASP A N     1 
ATOM   1691 C  CA    . ASP A 1 206 ? 75.554  21.698 45.347  1.00 49.92  ? 383  ASP A CA    1 
ATOM   1692 C  C     . ASP A 1 206 ? 76.964  22.184 45.664  1.00 50.11  ? 383  ASP A C     1 
ATOM   1693 O  O     . ASP A 1 206 ? 77.709  22.553 44.753  1.00 49.26  ? 383  ASP A O     1 
ATOM   1694 C  CB    . ASP A 1 206 ? 75.645  20.700 44.178  1.00 49.64  ? 383  ASP A CB    1 
ATOM   1695 C  CG    . ASP A 1 206 ? 76.564  19.491 44.493  1.00 49.93  ? 383  ASP A CG    1 
ATOM   1696 O  OD1   . ASP A 1 206 ? 76.495  18.464 43.751  1.00 47.24  ? 383  ASP A OD1   1 
ATOM   1697 O  OD2   . ASP A 1 206 ? 77.343  19.579 45.485  1.00 45.88  ? 383  ASP A OD2   1 
ATOM   1698 N  N     . TYR A 1 207 ? 77.349  22.126 46.939  1.00 50.68  ? 384  TYR A N     1 
ATOM   1699 C  CA    . TYR A 1 207 ? 78.639  22.677 47.370  1.00 50.99  ? 384  TYR A CA    1 
ATOM   1700 C  C     . TYR A 1 207 ? 79.838  21.898 46.872  1.00 51.12  ? 384  TYR A C     1 
ATOM   1701 O  O     . TYR A 1 207 ? 80.964  22.372 46.951  1.00 51.45  ? 384  TYR A O     1 
ATOM   1702 C  CB    . TYR A 1 207 ? 78.724  22.764 48.887  1.00 51.07  ? 384  TYR A CB    1 
ATOM   1703 C  CG    . TYR A 1 207 ? 77.975  23.935 49.460  1.00 51.30  ? 384  TYR A CG    1 
ATOM   1704 C  CD1   . TYR A 1 207 ? 76.685  23.784 49.957  1.00 49.59  ? 384  TYR A CD1   1 
ATOM   1705 C  CD2   . TYR A 1 207 ? 78.555  25.200 49.508  1.00 50.02  ? 384  TYR A CD2   1 
ATOM   1706 C  CE1   . TYR A 1 207 ? 75.999  24.863 50.478  1.00 49.96  ? 384  TYR A CE1   1 
ATOM   1707 C  CE2   . TYR A 1 207 ? 77.863  26.294 50.023  1.00 48.59  ? 384  TYR A CE2   1 
ATOM   1708 C  CZ    . TYR A 1 207 ? 76.592  26.123 50.496  1.00 49.89  ? 384  TYR A CZ    1 
ATOM   1709 O  OH    . TYR A 1 207 ? 75.895  27.197 51.003  1.00 53.04  ? 384  TYR A OH    1 
ATOM   1710 N  N     . SER A 1 208 ? 79.620  20.703 46.353  1.00 51.94  ? 385  SER A N     1 
ATOM   1711 C  CA    . SER A 1 208 ? 80.744  19.949 45.792  1.00 52.52  ? 385  SER A CA    1 
ATOM   1712 C  C     . SER A 1 208 ? 80.820  20.033 44.249  1.00 52.68  ? 385  SER A C     1 
ATOM   1713 O  O     . SER A 1 208 ? 81.668  19.390 43.630  1.00 53.26  ? 385  SER A O     1 
ATOM   1714 C  CB    . SER A 1 208 ? 80.689  18.507 46.263  1.00 51.79  ? 385  SER A CB    1 
ATOM   1715 O  OG    . SER A 1 208 ? 79.438  18.001 45.953  1.00 50.70  ? 385  SER A OG    1 
ATOM   1716 N  N     . ASN A 1 209 ? 79.959  20.848 43.644  1.00 52.23  ? 386  ASN A N     1 
ATOM   1717 C  CA    . ASN A 1 209 ? 80.000  21.087 42.212  1.00 52.00  ? 386  ASN A CA    1 
ATOM   1718 C  C     . ASN A 1 209 ? 80.810  22.368 41.947  1.00 52.39  ? 386  ASN A C     1 
ATOM   1719 O  O     . ASN A 1 209 ? 80.378  23.457 42.292  1.00 52.30  ? 386  ASN A O     1 
ATOM   1720 C  CB    . ASN A 1 209 ? 78.560  21.210 41.690  1.00 51.36  ? 386  ASN A CB    1 
ATOM   1721 C  CG    . ASN A 1 209 ? 78.464  21.328 40.166  1.00 49.88  ? 386  ASN A CG    1 
ATOM   1722 O  OD1   . ASN A 1 209 ? 77.525  20.820 39.580  1.00 47.87  ? 386  ASN A OD1   1 
ATOM   1723 N  ND2   . ASN A 1 209 ? 79.377  22.051 39.539  1.00 46.27  ? 386  ASN A ND2   1 
ATOM   1724 N  N     . GLU A 1 210 ? 81.975  22.214 41.324  1.00 53.16  ? 387  GLU A N     1 
ATOM   1725 C  CA    . GLU A 1 210 ? 82.884  23.330 40.984  1.00 54.47  ? 387  GLU A CA    1 
ATOM   1726 C  C     . GLU A 1 210 ? 82.179  24.479 40.261  1.00 53.50  ? 387  GLU A C     1 
ATOM   1727 O  O     . GLU A 1 210 ? 82.497  25.648 40.467  1.00 52.87  ? 387  GLU A O     1 
ATOM   1728 C  CB    . GLU A 1 210 ? 84.004  22.851 40.057  1.00 54.74  ? 387  GLU A CB    1 
ATOM   1729 C  CG    . GLU A 1 210 ? 85.348  22.531 40.682  1.00 59.44  ? 387  GLU A CG    1 
ATOM   1730 C  CD    . GLU A 1 210 ? 86.307  21.931 39.612  1.00 68.77  ? 387  GLU A CD    1 
ATOM   1731 O  OE1   . GLU A 1 210 ? 86.614  22.672 38.641  1.00 73.59  ? 387  GLU A OE1   1 
ATOM   1732 O  OE2   . GLU A 1 210 ? 86.693  20.720 39.688  1.00 69.73  ? 387  GLU A OE2   1 
ATOM   1733 N  N     . GLU A 1 211 ? 81.277  24.133 39.358  1.00 53.01  ? 388  GLU A N     1 
ATOM   1734 C  CA    . GLU A 1 211 ? 80.551  25.139 38.623  1.00 53.47  ? 388  GLU A CA    1 
ATOM   1735 C  C     . GLU A 1 211 ? 79.601  25.948 39.495  1.00 51.80  ? 388  GLU A C     1 
ATOM   1736 O  O     . GLU A 1 211 ? 79.458  27.150 39.279  1.00 50.90  ? 388  GLU A O     1 
ATOM   1737 C  CB    . GLU A 1 211 ? 79.775  24.503 37.479  1.00 54.25  ? 388  GLU A CB    1 
ATOM   1738 C  CG    . GLU A 1 211 ? 80.648  23.971 36.363  1.00 57.57  ? 388  GLU A CG    1 
ATOM   1739 C  CD    . GLU A 1 211 ? 79.820  23.462 35.190  1.00 63.10  ? 388  GLU A CD    1 
ATOM   1740 O  OE1   . GLU A 1 211 ? 78.561  23.565 35.237  1.00 65.53  ? 388  GLU A OE1   1 
ATOM   1741 O  OE2   . GLU A 1 211 ? 80.439  22.963 34.223  1.00 66.24  ? 388  GLU A OE2   1 
ATOM   1742 N  N     . HIS A 1 212 ? 78.935  25.279 40.439  1.00 50.18  ? 389  HIS A N     1 
ATOM   1743 C  CA    . HIS A 1 212 ? 78.085  25.963 41.417  1.00 49.51  ? 389  HIS A CA    1 
ATOM   1744 C  C     . HIS A 1 212 ? 78.941  26.926 42.263  1.00 48.58  ? 389  HIS A C     1 
ATOM   1745 O  O     . HIS A 1 212 ? 78.605  28.109 42.476  1.00 47.30  ? 389  HIS A O     1 
ATOM   1746 C  CB    . HIS A 1 212 ? 77.377  24.947 42.311  1.00 49.65  ? 389  HIS A CB    1 
ATOM   1747 C  CG    . HIS A 1 212 ? 76.295  24.167 41.614  1.00 51.21  ? 389  HIS A CG    1 
ATOM   1748 N  ND1   . HIS A 1 212 ? 76.433  23.666 40.337  1.00 51.69  ? 389  HIS A ND1   1 
ATOM   1749 C  CD2   . HIS A 1 212 ? 75.080  23.749 42.042  1.00 50.89  ? 389  HIS A CD2   1 
ATOM   1750 C  CE1   . HIS A 1 212 ? 75.324  23.041 39.984  1.00 48.19  ? 389  HIS A CE1   1 
ATOM   1751 N  NE2   . HIS A 1 212 ? 74.500  23.049 41.013  1.00 47.44  ? 389  HIS A NE2   1 
ATOM   1752 N  N     . MET A 1 213 ? 80.108  26.438 42.651  1.00 47.45  ? 390  MET A N     1 
ATOM   1753 C  CA    . MET A 1 213 ? 80.971  27.178 43.539  1.00 47.30  ? 390  MET A CA    1 
ATOM   1754 C  C     . MET A 1 213 ? 81.668  28.370 42.889  1.00 46.17  ? 390  MET A C     1 
ATOM   1755 O  O     . MET A 1 213 ? 81.911  29.383 43.536  1.00 45.15  ? 390  MET A O     1 
ATOM   1756 C  CB    . MET A 1 213 ? 81.959  26.214 44.152  1.00 47.66  ? 390  MET A CB    1 
ATOM   1757 C  CG    . MET A 1 213 ? 81.264  25.270 45.126  1.00 49.40  ? 390  MET A CG    1 
ATOM   1758 S  SD    . MET A 1 213 ? 80.996  26.024 46.749  1.00 53.55  ? 390  MET A SD    1 
ATOM   1759 C  CE    . MET A 1 213 ? 82.159  25.057 47.744  1.00 57.58  ? 390  MET A CE    1 
ATOM   1760 N  N     . THR A 1 214 ? 81.951  28.260 41.600  1.00 45.05  ? 391  THR A N     1 
ATOM   1761 C  CA    . THR A 1 214 ? 82.456  29.398 40.836  1.00 44.24  ? 391  THR A CA    1 
ATOM   1762 C  C     . THR A 1 214 ? 81.392  30.494 40.774  1.00 44.47  ? 391  THR A C     1 
ATOM   1763 O  O     . THR A 1 214 ? 81.657  31.695 40.976  1.00 43.94  ? 391  THR A O     1 
ATOM   1764 C  CB    . THR A 1 214 ? 82.828  28.933 39.431  1.00 43.96  ? 391  THR A CB    1 
ATOM   1765 O  OG1   . THR A 1 214 ? 83.894  27.993 39.546  1.00 44.55  ? 391  THR A OG1   1 
ATOM   1766 C  CG2   . THR A 1 214 ? 83.259  30.066 38.552  1.00 41.11  ? 391  THR A CG2   1 
ATOM   1767 N  N     . LEU A 1 215 ? 80.168  30.072 40.520  1.00 44.24  ? 392  LEU A N     1 
ATOM   1768 C  CA    . LEU A 1 215 ? 79.078  31.016 40.461  1.00 44.42  ? 392  LEU A CA    1 
ATOM   1769 C  C     . LEU A 1 215 ? 78.815  31.649 41.847  1.00 43.99  ? 392  LEU A C     1 
ATOM   1770 O  O     . LEU A 1 215 ? 78.564  32.847 41.952  1.00 42.92  ? 392  LEU A O     1 
ATOM   1771 C  CB    . LEU A 1 215 ? 77.857  30.326 39.866  1.00 44.36  ? 392  LEU A CB    1 
ATOM   1772 C  CG    . LEU A 1 215 ? 77.796  30.538 38.349  1.00 44.37  ? 392  LEU A CG    1 
ATOM   1773 C  CD1   . LEU A 1 215 ? 77.001  29.426 37.742  1.00 44.06  ? 392  LEU A CD1   1 
ATOM   1774 C  CD2   . LEU A 1 215 ? 77.172  31.902 38.038  1.00 42.92  ? 392  LEU A CD2   1 
ATOM   1775 N  N     . LEU A 1 216 ? 78.958  30.862 42.916  1.00 43.88  ? 393  LEU A N     1 
ATOM   1776 C  CA    . LEU A 1 216 ? 78.806  31.434 44.247  1.00 43.19  ? 393  LEU A CA    1 
ATOM   1777 C  C     . LEU A 1 216 ? 79.903  32.446 44.510  1.00 42.40  ? 393  LEU A C     1 
ATOM   1778 O  O     . LEU A 1 216 ? 79.631  33.532 44.981  1.00 42.44  ? 393  LEU A O     1 
ATOM   1779 C  CB    . LEU A 1 216 ? 78.802  30.363 45.340  1.00 43.10  ? 393  LEU A CB    1 
ATOM   1780 C  CG    . LEU A 1 216 ? 78.640  30.894 46.772  1.00 42.16  ? 393  LEU A CG    1 
ATOM   1781 C  CD1   . LEU A 1 216 ? 77.521  31.906 46.791  1.00 40.28  ? 393  LEU A CD1   1 
ATOM   1782 C  CD2   . LEU A 1 216 ? 78.364  29.760 47.763  1.00 38.33  ? 393  LEU A CD2   1 
ATOM   1783 N  N     . LYS A 1 217 ? 81.136  32.096 44.181  1.00 41.57  ? 394  LYS A N     1 
ATOM   1784 C  CA    . LYS A 1 217 ? 82.240  33.029 44.363  1.00 42.21  ? 394  LYS A CA    1 
ATOM   1785 C  C     . LYS A 1 217 ? 82.053  34.302 43.510  1.00 41.75  ? 394  LYS A C     1 
ATOM   1786 O  O     . LYS A 1 217 ? 82.286  35.406 43.972  1.00 41.34  ? 394  LYS A O     1 
ATOM   1787 C  CB    . LYS A 1 217 ? 83.578  32.356 44.055  1.00 41.90  ? 394  LYS A CB    1 
ATOM   1788 C  CG    . LYS A 1 217 ? 83.948  31.329 45.084  1.00 44.04  ? 394  LYS A CG    1 
ATOM   1789 C  CD    . LYS A 1 217 ? 85.289  30.685 44.793  1.00 46.21  ? 394  LYS A CD    1 
ATOM   1790 C  CE    . LYS A 1 217 ? 85.156  29.519 43.826  1.00 47.02  ? 394  LYS A CE    1 
ATOM   1791 N  NZ    . LYS A 1 217 ? 86.480  29.149 43.219  1.00 47.53  ? 394  LYS A NZ    1 
ATOM   1792 N  N     . MET A 1 218 ? 81.562  34.143 42.292  1.00 41.65  ? 395  MET A N     1 
ATOM   1793 C  CA    . MET A 1 218 ? 81.222  35.300 41.485  1.00 42.39  ? 395  MET A CA    1 
ATOM   1794 C  C     . MET A 1 218 ? 80.147  36.183 42.188  1.00 42.49  ? 395  MET A C     1 
ATOM   1795 O  O     . MET A 1 218 ? 80.294  37.418 42.259  1.00 41.75  ? 395  MET A O     1 
ATOM   1796 C  CB    . MET A 1 218 ? 80.759  34.858 40.096  1.00 42.37  ? 395  MET A CB    1 
ATOM   1797 C  CG    . MET A 1 218 ? 81.859  34.249 39.231  1.00 43.82  ? 395  MET A CG    1 
ATOM   1798 S  SD    . MET A 1 218 ? 81.242  33.271 37.847  1.00 45.97  ? 395  MET A SD    1 
ATOM   1799 C  CE    . MET A 1 218 ? 80.455  34.529 36.840  1.00 40.12  ? 395  MET A CE    1 
ATOM   1800 N  N     . ILE A 1 219 ? 79.104  35.561 42.735  1.00 41.76  ? 396  ILE A N     1 
ATOM   1801 C  CA    . ILE A 1 219 ? 78.103  36.337 43.453  1.00 42.27  ? 396  ILE A CA    1 
ATOM   1802 C  C     . ILE A 1 219 ? 78.721  36.965 44.683  1.00 42.36  ? 396  ILE A C     1 
ATOM   1803 O  O     . ILE A 1 219 ? 78.510  38.166 44.947  1.00 42.09  ? 396  ILE A O     1 
ATOM   1804 C  CB    . ILE A 1 219 ? 76.866  35.517 43.842  1.00 42.43  ? 396  ILE A CB    1 
ATOM   1805 C  CG1   . ILE A 1 219 ? 76.077  35.100 42.573  1.00 43.95  ? 396  ILE A CG1   1 
ATOM   1806 C  CG2   . ILE A 1 219 ? 76.017  36.270 44.836  1.00 39.41  ? 396  ILE A CG2   1 
ATOM   1807 C  CD1   . ILE A 1 219 ? 75.570  36.248 41.680  1.00 45.59  ? 396  ILE A CD1   1 
ATOM   1808 N  N     . LEU A 1 220 ? 79.567  36.217 45.378  1.00 41.94  ? 397  LEU A N     1 
ATOM   1809 C  CA    . LEU A 1 220 ? 80.188  36.795 46.572  1.00 43.27  ? 397  LEU A CA    1 
ATOM   1810 C  C     . LEU A 1 220 ? 80.984  38.062 46.234  1.00 42.99  ? 397  LEU A C     1 
ATOM   1811 O  O     . LEU A 1 220 ? 80.773  39.110 46.855  1.00 42.75  ? 397  LEU A O     1 
ATOM   1812 C  CB    . LEU A 1 220 ? 81.057  35.792 47.332  1.00 42.88  ? 397  LEU A CB    1 
ATOM   1813 C  CG    . LEU A 1 220 ? 80.283  34.723 48.123  1.00 43.68  ? 397  LEU A CG    1 
ATOM   1814 C  CD1   . LEU A 1 220 ? 81.211  33.558 48.581  1.00 45.28  ? 397  LEU A CD1   1 
ATOM   1815 C  CD2   . LEU A 1 220 ? 79.601  35.366 49.285  1.00 39.73  ? 397  LEU A CD2   1 
ATOM   1816 N  N     . ILE A 1 221 ? 81.825  38.005 45.208  1.00 42.44  ? 398  ILE A N     1 
ATOM   1817 C  CA    . ILE A 1 221 ? 82.626  39.198 44.884  1.00 42.37  ? 398  ILE A CA    1 
ATOM   1818 C  C     . ILE A 1 221 ? 81.737  40.347 44.382  1.00 41.88  ? 398  ILE A C     1 
ATOM   1819 O  O     . ILE A 1 221 ? 81.961  41.505 44.714  1.00 41.04  ? 398  ILE A O     1 
ATOM   1820 C  CB    . ILE A 1 221 ? 83.832  38.904 43.934  1.00 42.05  ? 398  ILE A CB    1 
ATOM   1821 C  CG1   . ILE A 1 221 ? 84.820  40.082 43.961  1.00 41.36  ? 398  ILE A CG1   1 
ATOM   1822 C  CG2   . ILE A 1 221 ? 83.364  38.634 42.522  1.00 41.32  ? 398  ILE A CG2   1 
ATOM   1823 C  CD1   . ILE A 1 221 ? 86.111  39.862 43.167  1.00 40.96  ? 398  ILE A CD1   1 
ATOM   1824 N  N     . LYS A 1 222 ? 80.671  40.015 43.670  1.00 42.72  ? 399  LYS A N     1 
ATOM   1825 C  CA    . LYS A 1 222 ? 79.758  41.037 43.169  1.00 42.84  ? 399  LYS A CA    1 
ATOM   1826 C  C     . LYS A 1 222 ? 79.044  41.726 44.321  1.00 43.43  ? 399  LYS A C     1 
ATOM   1827 O  O     . LYS A 1 222 ? 78.967  42.947 44.354  1.00 44.48  ? 399  LYS A O     1 
ATOM   1828 C  CB    . LYS A 1 222 ? 78.760  40.421 42.204  1.00 43.02  ? 399  LYS A CB    1 
ATOM   1829 C  CG    . LYS A 1 222 ? 79.297  40.246 40.787  1.00 41.77  ? 399  LYS A CG    1 
ATOM   1830 C  CD    . LYS A 1 222 ? 78.297  39.510 39.879  1.00 41.24  ? 399  LYS A CD    1 
ATOM   1831 C  CE    . LYS A 1 222 ? 76.961  40.231 39.726  1.00 36.00  ? 399  LYS A CE    1 
ATOM   1832 N  NZ    . LYS A 1 222 ? 77.198  41.594 39.395  1.00 38.62  ? 399  LYS A NZ    1 
ATOM   1833 N  N     . CYS A 1 223 ? 78.574  40.942 45.285  1.00 44.13  ? 400  CYS A N     1 
ATOM   1834 C  CA    . CYS A 1 223 ? 78.019  41.481 46.540  1.00 44.95  ? 400  CYS A CA    1 
ATOM   1835 C  C     . CYS A 1 223 ? 78.941  42.467 47.222  1.00 44.85  ? 400  CYS A C     1 
ATOM   1836 O  O     . CYS A 1 223 ? 78.518  43.557 47.627  1.00 45.83  ? 400  CYS A O     1 
ATOM   1837 C  CB    . CYS A 1 223 ? 77.724  40.355 47.526  1.00 44.07  ? 400  CYS A CB    1 
ATOM   1838 S  SG    . CYS A 1 223 ? 76.185  39.556 47.142  1.00 49.19  ? 400  CYS A SG    1 
ATOM   1839 N  N     . CYS A 1 224 ? 80.181  42.061 47.412  1.00 44.31  ? 401  CYS A N     1 
ATOM   1840 C  CA    . CYS A 1 224 ? 81.102  42.896 48.132  1.00 45.31  ? 401  CYS A CA    1 
ATOM   1841 C  C     . CYS A 1 224 ? 81.372  44.206 47.378  1.00 45.87  ? 401  CYS A C     1 
ATOM   1842 O  O     . CYS A 1 224 ? 81.417  45.269 47.983  1.00 45.56  ? 401  CYS A O     1 
ATOM   1843 C  CB    . CYS A 1 224 ? 82.402  42.149 48.357  1.00 45.91  ? 401  CYS A CB    1 
ATOM   1844 S  SG    . CYS A 1 224 ? 82.260  40.732 49.472  1.00 45.09  ? 401  CYS A SG    1 
ATOM   1845 N  N     . ASP A 1 225 ? 81.486  44.118 46.050  1.00 46.45  ? 402  ASP A N     1 
ATOM   1846 C  CA    . ASP A 1 225 ? 81.811  45.275 45.199  1.00 46.30  ? 402  ASP A CA    1 
ATOM   1847 C  C     . ASP A 1 225 ? 80.772  46.359 45.356  1.00 46.50  ? 402  ASP A C     1 
ATOM   1848 O  O     . ASP A 1 225 ? 81.105  47.540 45.407  1.00 46.80  ? 402  ASP A O     1 
ATOM   1849 C  CB    . ASP A 1 225 ? 81.882  44.862 43.696  1.00 47.10  ? 402  ASP A CB    1 
ATOM   1850 C  CG    . ASP A 1 225 ? 82.525  45.944 42.786  1.00 46.14  ? 402  ASP A CG    1 
ATOM   1851 O  OD1   . ASP A 1 225 ? 83.362  46.755 43.248  1.00 48.41  ? 402  ASP A OD1   1 
ATOM   1852 O  OD2   . ASP A 1 225 ? 82.235  45.957 41.578  1.00 47.99  ? 402  ASP A OD2   1 
ATOM   1853 N  N     . ILE A 1 226 ? 79.501  45.973 45.369  1.00 46.47  ? 403  ILE A N     1 
ATOM   1854 C  CA    . ILE A 1 226 ? 78.425  46.968 45.356  1.00 46.54  ? 403  ILE A CA    1 
ATOM   1855 C  C     . ILE A 1 226 ? 77.759  47.062 46.738  1.00 46.31  ? 403  ILE A C     1 
ATOM   1856 O  O     . ILE A 1 226 ? 76.621  47.486 46.873  1.00 47.60  ? 403  ILE A O     1 
ATOM   1857 C  CB    . ILE A 1 226 ? 77.406  46.651 44.227  1.00 46.93  ? 403  ILE A CB    1 
ATOM   1858 C  CG1   . ILE A 1 226 ? 76.722  45.294 44.454  1.00 47.04  ? 403  ILE A CG1   1 
ATOM   1859 C  CG2   . ILE A 1 226 ? 78.118  46.624 42.874  1.00 45.25  ? 403  ILE A CG2   1 
ATOM   1860 C  CD1   . ILE A 1 226 ? 75.441  45.143 43.667  1.00 48.55  ? 403  ILE A CD1   1 
ATOM   1861 N  N     . SER A 1 227 ? 78.512  46.744 47.777  1.00 45.78  ? 404  SER A N     1 
ATOM   1862 C  CA    . SER A 1 227 ? 77.937  46.575 49.114  1.00 45.56  ? 404  SER A CA    1 
ATOM   1863 C  C     . SER A 1 227 ? 77.808  47.871 49.930  1.00 44.49  ? 404  SER A C     1 
ATOM   1864 O  O     . SER A 1 227 ? 77.410  47.811 51.082  1.00 44.84  ? 404  SER A O     1 
ATOM   1865 C  CB    . SER A 1 227 ? 78.776  45.561 49.929  1.00 45.78  ? 404  SER A CB    1 
ATOM   1866 O  OG    . SER A 1 227 ? 80.061  46.093 50.270  1.00 44.95  ? 404  SER A OG    1 
ATOM   1867 N  N     . ASN A 1 228 ? 78.184  49.030 49.402  1.00 44.61  ? 405  ASN A N     1 
ATOM   1868 C  CA    . ASN A 1 228 ? 78.330  50.196 50.296  1.00 44.48  ? 405  ASN A CA    1 
ATOM   1869 C  C     . ASN A 1 228 ? 77.062  50.381 51.118  1.00 44.16  ? 405  ASN A C     1 
ATOM   1870 O  O     . ASN A 1 228 ? 77.136  50.583 52.325  1.00 43.62  ? 405  ASN A O     1 
ATOM   1871 C  CB    . ASN A 1 228 ? 78.648  51.508 49.571  1.00 44.35  ? 405  ASN A CB    1 
ATOM   1872 C  CG    . ASN A 1 228 ? 80.105  51.595 49.062  1.00 46.01  ? 405  ASN A CG    1 
ATOM   1873 O  OD1   . ASN A 1 228 ? 81.046  50.995 49.609  1.00 45.44  ? 405  ASN A OD1   1 
ATOM   1874 N  ND2   . ASN A 1 228 ? 80.285  52.389 48.014  1.00 45.64  ? 405  ASN A ND2   1 
ATOM   1875 N  N     . GLU A 1 229 ? 75.898  50.272 50.480  1.00 44.01  ? 406  GLU A N     1 
ATOM   1876 C  CA    . GLU A 1 229 ? 74.639  50.532 51.196  1.00 44.83  ? 406  GLU A CA    1 
ATOM   1877 C  C     . GLU A 1 229 ? 74.276  49.483 52.263  1.00 44.89  ? 406  GLU A C     1 
ATOM   1878 O  O     . GLU A 1 229 ? 73.315  49.663 53.000  1.00 45.07  ? 406  GLU A O     1 
ATOM   1879 C  CB    . GLU A 1 229 ? 73.469  50.679 50.224  1.00 44.66  ? 406  GLU A CB    1 
ATOM   1880 C  CG    . GLU A 1 229 ? 73.461  51.968 49.428  1.00 46.27  ? 406  GLU A CG    1 
ATOM   1881 C  CD    . GLU A 1 229 ? 73.272  53.194 50.277  1.00 46.44  ? 406  GLU A CD    1 
ATOM   1882 O  OE1   . GLU A 1 229 ? 73.743  54.261 49.848  1.00 46.64  ? 406  GLU A OE1   1 
ATOM   1883 O  OE2   . GLU A 1 229 ? 72.655  53.090 51.357  1.00 46.96  ? 406  GLU A OE2   1 
ATOM   1884 N  N     . VAL A 1 230 ? 75.005  48.375 52.320  1.00 45.53  ? 407  VAL A N     1 
ATOM   1885 C  CA    . VAL A 1 230 ? 74.823  47.399 53.407  1.00 46.24  ? 407  VAL A CA    1 
ATOM   1886 C  C     . VAL A 1 230 ? 75.322  47.997 54.735  1.00 45.76  ? 407  VAL A C     1 
ATOM   1887 O  O     . VAL A 1 230 ? 74.860  47.633 55.811  1.00 46.01  ? 407  VAL A O     1 
ATOM   1888 C  CB    . VAL A 1 230 ? 75.543  46.047 53.085  1.00 46.35  ? 407  VAL A CB    1 
ATOM   1889 C  CG1   . VAL A 1 230 ? 76.028  45.403 54.345  1.00 46.74  ? 407  VAL A CG1   1 
ATOM   1890 C  CG2   . VAL A 1 230 ? 74.606  45.119 52.320  1.00 46.34  ? 407  VAL A CG2   1 
ATOM   1891 N  N     . ARG A 1 231 ? 76.233  48.950 54.636  1.00 45.72  ? 408  ARG A N     1 
ATOM   1892 C  CA    . ARG A 1 231 ? 76.917  49.473 55.788  1.00 46.30  ? 408  ARG A CA    1 
ATOM   1893 C  C     . ARG A 1 231 ? 76.057  50.478 56.519  1.00 46.89  ? 408  ARG A C     1 
ATOM   1894 O  O     . ARG A 1 231 ? 75.073  50.966 55.984  1.00 47.76  ? 408  ARG A O     1 
ATOM   1895 C  CB    . ARG A 1 231 ? 78.227  50.136 55.369  1.00 46.94  ? 408  ARG A CB    1 
ATOM   1896 C  CG    . ARG A 1 231 ? 79.232  49.161 54.734  1.00 47.09  ? 408  ARG A CG    1 
ATOM   1897 C  CD    . ARG A 1 231 ? 80.512  49.872 54.316  1.00 47.92  ? 408  ARG A CD    1 
ATOM   1898 N  NE    . ARG A 1 231 ? 81.442  48.966 53.646  1.00 47.69  ? 408  ARG A NE    1 
ATOM   1899 C  CZ    . ARG A 1 231 ? 82.288  48.176 54.285  1.00 46.99  ? 408  ARG A CZ    1 
ATOM   1900 N  NH1   . ARG A 1 231 ? 82.349  48.231 55.591  1.00 50.24  ? 408  ARG A NH1   1 
ATOM   1901 N  NH2   . ARG A 1 231 ? 83.089  47.359 53.624  1.00 47.16  ? 408  ARG A NH2   1 
ATOM   1902 N  N     . PRO A 1 232 ? 76.411  50.782 57.770  1.00 47.17  ? 409  PRO A N     1 
ATOM   1903 C  CA    . PRO A 1 232 ? 75.684  51.807 58.495  1.00 47.35  ? 409  PRO A CA    1 
ATOM   1904 C  C     . PRO A 1 232 ? 75.574  53.086 57.707  1.00 47.96  ? 409  PRO A C     1 
ATOM   1905 O  O     . PRO A 1 232 ? 76.499  53.466 56.995  1.00 48.55  ? 409  PRO A O     1 
ATOM   1906 C  CB    . PRO A 1 232 ? 76.535  52.018 59.744  1.00 46.74  ? 409  PRO A CB    1 
ATOM   1907 C  CG    . PRO A 1 232 ? 77.123  50.666 59.985  1.00 47.79  ? 409  PRO A CG    1 
ATOM   1908 C  CD    . PRO A 1 232 ? 77.458  50.162 58.603  1.00 47.44  ? 409  PRO A CD    1 
ATOM   1909 N  N     . MET A 1 233 ? 74.446  53.752 57.882  1.00 49.19  ? 410  MET A N     1 
ATOM   1910 C  CA    . MET A 1 233 ? 74.065  54.895 57.082  1.00 50.49  ? 410  MET A CA    1 
ATOM   1911 C  C     . MET A 1 233 ? 75.159  55.981 57.067  1.00 49.40  ? 410  MET A C     1 
ATOM   1912 O  O     . MET A 1 233 ? 75.498  56.514 56.032  1.00 48.71  ? 410  MET A O     1 
ATOM   1913 C  CB    . MET A 1 233 ? 72.710  55.408 57.591  1.00 51.01  ? 410  MET A CB    1 
ATOM   1914 C  CG    . MET A 1 233 ? 72.108  56.516 56.759  1.00 58.46  ? 410  MET A CG    1 
ATOM   1915 S  SD    . MET A 1 233 ? 72.838  58.168 57.099  1.00 67.22  ? 410  MET A SD    1 
ATOM   1916 C  CE    . MET A 1 233 ? 71.878  58.682 58.563  1.00 60.25  ? 410  MET A CE    1 
ATOM   1917 N  N     . GLU A 1 234 ? 75.767  56.247 58.203  1.00 50.39  ? 411  GLU A N     1 
ATOM   1918 C  CA    . GLU A 1 234 ? 76.764  57.325 58.291  1.00 52.07  ? 411  GLU A CA    1 
ATOM   1919 C  C     . GLU A 1 234 ? 78.010  56.993 57.517  1.00 50.85  ? 411  GLU A C     1 
ATOM   1920 O  O     . GLU A 1 234 ? 78.733  57.899 57.122  1.00 50.43  ? 411  GLU A O     1 
ATOM   1921 C  CB    . GLU A 1 234 ? 77.188  57.613 59.742  1.00 53.60  ? 411  GLU A CB    1 
ATOM   1922 C  CG    . GLU A 1 234 ? 76.077  58.170 60.653  1.00 59.74  ? 411  GLU A CG    1 
ATOM   1923 C  CD    . GLU A 1 234 ? 75.201  57.055 61.337  1.00 69.49  ? 411  GLU A CD    1 
ATOM   1924 O  OE1   . GLU A 1 234 ? 75.420  55.793 61.139  1.00 65.70  ? 411  GLU A OE1   1 
ATOM   1925 O  OE2   . GLU A 1 234 ? 74.274  57.488 62.089  1.00 74.45  ? 411  GLU A OE2   1 
ATOM   1926 N  N     . VAL A 1 235 ? 78.268  55.694 57.369  1.00 50.05  ? 412  VAL A N     1 
ATOM   1927 C  CA    . VAL A 1 235 ? 79.384  55.156 56.572  1.00 49.62  ? 412  VAL A CA    1 
ATOM   1928 C  C     . VAL A 1 235 ? 79.039  55.048 55.073  1.00 49.99  ? 412  VAL A C     1 
ATOM   1929 O  O     . VAL A 1 235 ? 79.882  55.290 54.218  1.00 49.89  ? 412  VAL A O     1 
ATOM   1930 C  CB    . VAL A 1 235 ? 79.745  53.726 57.072  1.00 49.71  ? 412  VAL A CB    1 
ATOM   1931 C  CG1   . VAL A 1 235 ? 80.867  53.148 56.267  1.00 46.89  ? 412  VAL A CG1   1 
ATOM   1932 C  CG2   . VAL A 1 235 ? 80.082  53.745 58.562  1.00 45.52  ? 412  VAL A CG2   1 
ATOM   1933 N  N     . ALA A 1 236 ? 77.807  54.645 54.763  1.00 50.35  ? 413  ALA A N     1 
ATOM   1934 C  CA    . ALA A 1 236 ? 77.391  54.403 53.380  1.00 50.13  ? 413  ALA A CA    1 
ATOM   1935 C  C     . ALA A 1 236 ? 77.251  55.709 52.625  1.00 50.86  ? 413  ALA A C     1 
ATOM   1936 O  O     . ALA A 1 236 ? 77.681  55.842 51.491  1.00 51.09  ? 413  ALA A O     1 
ATOM   1937 C  CB    . ALA A 1 236 ? 76.084  53.631 53.353  1.00 49.21  ? 413  ALA A CB    1 
ATOM   1938 N  N     . GLU A 1 237 ? 76.661  56.687 53.282  1.00 52.22  ? 414  GLU A N     1 
ATOM   1939 C  CA    . GLU A 1 237 ? 76.150  57.880 52.619  1.00 53.41  ? 414  GLU A CA    1 
ATOM   1940 C  C     . GLU A 1 237 ? 77.206  58.716 51.877  1.00 52.31  ? 414  GLU A C     1 
ATOM   1941 O  O     . GLU A 1 237 ? 76.957  59.194 50.767  1.00 53.21  ? 414  GLU A O     1 
ATOM   1942 C  CB    . GLU A 1 237 ? 75.418  58.726 53.665  1.00 54.58  ? 414  GLU A CB    1 
ATOM   1943 C  CG    . GLU A 1 237 ? 74.222  59.465 53.142  1.00 60.15  ? 414  GLU A CG    1 
ATOM   1944 C  CD    . GLU A 1 237 ? 74.520  60.920 52.878  1.00 68.08  ? 414  GLU A CD    1 
ATOM   1945 O  OE1   . GLU A 1 237 ? 73.714  61.529 52.128  1.00 73.85  ? 414  GLU A OE1   1 
ATOM   1946 O  OE2   . GLU A 1 237 ? 75.538  61.448 53.424  1.00 68.47  ? 414  GLU A OE2   1 
ATOM   1947 N  N     . PRO A 1 238 ? 78.372  58.946 52.492  1.00 51.44  ? 415  PRO A N     1 
ATOM   1948 C  CA    . PRO A 1 238 ? 79.423  59.661 51.753  1.00 50.79  ? 415  PRO A CA    1 
ATOM   1949 C  C     . PRO A 1 238 ? 79.825  59.023 50.418  1.00 50.51  ? 415  PRO A C     1 
ATOM   1950 O  O     . PRO A 1 238 ? 80.292  59.727 49.522  1.00 50.69  ? 415  PRO A O     1 
ATOM   1951 C  CB    . PRO A 1 238 ? 80.609  59.638 52.712  1.00 50.25  ? 415  PRO A CB    1 
ATOM   1952 C  CG    . PRO A 1 238 ? 80.021  59.498 54.033  1.00 50.45  ? 415  PRO A CG    1 
ATOM   1953 C  CD    . PRO A 1 238 ? 78.765  58.685 53.883  1.00 51.08  ? 415  PRO A CD    1 
ATOM   1954 N  N     . TRP A 1 239 ? 79.668  57.710 50.285  1.00 50.14  ? 416  TRP A N     1 
ATOM   1955 C  CA    . TRP A 1 239 ? 80.110  57.044 49.069  1.00 50.07  ? 416  TRP A CA    1 
ATOM   1956 C  C     . TRP A 1 239 ? 79.265  57.483 47.894  1.00 50.03  ? 416  TRP A C     1 
ATOM   1957 O  O     . TRP A 1 239 ? 79.759  57.552 46.784  1.00 50.17  ? 416  TRP A O     1 
ATOM   1958 C  CB    . TRP A 1 239 ? 80.098  55.518 49.200  1.00 49.50  ? 416  TRP A CB    1 
ATOM   1959 C  CG    . TRP A 1 239 ? 81.286  54.992 49.951  1.00 50.19  ? 416  TRP A CG    1 
ATOM   1960 C  CD1   . TRP A 1 239 ? 81.304  54.567 51.240  1.00 49.96  ? 416  TRP A CD1   1 
ATOM   1961 C  CD2   . TRP A 1 239 ? 82.646  54.867 49.473  1.00 49.71  ? 416  TRP A CD2   1 
ATOM   1962 N  NE1   . TRP A 1 239 ? 82.570  54.175 51.588  1.00 49.76  ? 416  TRP A NE1   1 
ATOM   1963 C  CE2   . TRP A 1 239 ? 83.406  54.341 50.517  1.00 47.66  ? 416  TRP A CE2   1 
ATOM   1964 C  CE3   . TRP A 1 239 ? 83.286  55.161 48.265  1.00 51.57  ? 416  TRP A CE3   1 
ATOM   1965 C  CZ2   . TRP A 1 239 ? 84.767  54.112 50.401  1.00 49.33  ? 416  TRP A CZ2   1 
ATOM   1966 C  CZ3   . TRP A 1 239 ? 84.650  54.927 48.155  1.00 49.34  ? 416  TRP A CZ3   1 
ATOM   1967 C  CH2   . TRP A 1 239 ? 85.364  54.399 49.204  1.00 49.70  ? 416  TRP A CH2   1 
ATOM   1968 N  N     . VAL A 1 240 ? 78.002  57.803 48.134  1.00 49.84  ? 417  VAL A N     1 
ATOM   1969 C  CA    . VAL A 1 240 ? 77.119  58.166 47.036  1.00 50.11  ? 417  VAL A CA    1 
ATOM   1970 C  C     . VAL A 1 240 ? 77.606  59.443 46.355  1.00 50.06  ? 417  VAL A C     1 
ATOM   1971 O  O     . VAL A 1 240 ? 77.662  59.529 45.135  1.00 50.31  ? 417  VAL A O     1 
ATOM   1972 C  CB    . VAL A 1 240 ? 75.644  58.316 47.487  1.00 50.43  ? 417  VAL A CB    1 
ATOM   1973 C  CG1   . VAL A 1 240 ? 74.762  58.485 46.274  1.00 49.49  ? 417  VAL A CG1   1 
ATOM   1974 C  CG2   . VAL A 1 240 ? 75.186  57.077 48.272  1.00 49.48  ? 417  VAL A CG2   1 
ATOM   1975 N  N     . ASP A 1 241 ? 78.012  60.425 47.135  1.00 50.48  ? 418  ASP A N     1 
ATOM   1976 C  CA    . ASP A 1 241 ? 78.532  61.635 46.544  1.00 50.87  ? 418  ASP A CA    1 
ATOM   1977 C  C     . ASP A 1 241 ? 79.772  61.329 45.719  1.00 49.21  ? 418  ASP A C     1 
ATOM   1978 O  O     . ASP A 1 241 ? 79.997  61.957 44.703  1.00 48.54  ? 418  ASP A O     1 
ATOM   1979 C  CB    . ASP A 1 241 ? 78.842  62.680 47.622  1.00 52.62  ? 418  ASP A CB    1 
ATOM   1980 C  CG    . ASP A 1 241 ? 77.576  63.205 48.328  1.00 58.84  ? 418  ASP A CG    1 
ATOM   1981 O  OD1   . ASP A 1 241 ? 76.821  63.994 47.696  1.00 62.79  ? 418  ASP A OD1   1 
ATOM   1982 O  OD2   . ASP A 1 241 ? 77.351  62.828 49.516  1.00 66.01  ? 418  ASP A OD2   1 
ATOM   1983 N  N     . CYS A 1 242 ? 80.593  60.386 46.161  1.00 47.87  ? 419  CYS A N     1 
ATOM   1984 C  CA    . CYS A 1 242 ? 81.774  60.035 45.392  1.00 47.40  ? 419  CYS A CA    1 
ATOM   1985 C  C     . CYS A 1 242 ? 81.405  59.406 44.085  1.00 46.85  ? 419  CYS A C     1 
ATOM   1986 O  O     . CYS A 1 242 ? 82.030  59.669 43.079  1.00 46.95  ? 419  CYS A O     1 
ATOM   1987 C  CB    . CYS A 1 242 ? 82.603  59.034 46.146  1.00 48.79  ? 419  CYS A CB    1 
ATOM   1988 S  SG    . CYS A 1 242 ? 83.293  59.734 47.599  1.00 47.51  ? 419  CYS A SG    1 
ATOM   1989 N  N     . LEU A 1 243 ? 80.407  58.534 44.116  1.00 46.69  ? 420  LEU A N     1 
ATOM   1990 C  CA    . LEU A 1 243 ? 79.942  57.865 42.915  1.00 46.77  ? 420  LEU A CA    1 
ATOM   1991 C  C     . LEU A 1 243 ? 79.457  58.882 41.897  1.00 46.33  ? 420  LEU A C     1 
ATOM   1992 O  O     . LEU A 1 243 ? 79.910  58.881 40.757  1.00 45.70  ? 420  LEU A O     1 
ATOM   1993 C  CB    . LEU A 1 243 ? 78.813  56.872 43.233  1.00 47.50  ? 420  LEU A CB    1 
ATOM   1994 C  CG    . LEU A 1 243 ? 78.372  55.948 42.074  1.00 48.56  ? 420  LEU A CG    1 
ATOM   1995 C  CD1   . LEU A 1 243 ? 79.572  55.200 41.443  1.00 45.86  ? 420  LEU A CD1   1 
ATOM   1996 C  CD2   . LEU A 1 243 ? 77.277  54.988 42.532  1.00 47.78  ? 420  LEU A CD2   1 
ATOM   1997 N  N     . LEU A 1 244 ? 78.554  59.761 42.309  1.00 46.19  ? 421  LEU A N     1 
ATOM   1998 C  CA    . LEU A 1 244 ? 78.063  60.792 41.408  1.00 47.27  ? 421  LEU A CA    1 
ATOM   1999 C  C     . LEU A 1 244 ? 79.174  61.724 40.917  1.00 47.56  ? 421  LEU A C     1 
ATOM   2000 O  O     . LEU A 1 244 ? 79.145  62.173 39.777  1.00 48.27  ? 421  LEU A O     1 
ATOM   2001 C  CB    . LEU A 1 244 ? 76.930  61.607 42.046  1.00 47.15  ? 421  LEU A CB    1 
ATOM   2002 C  CG    . LEU A 1 244 ? 75.731  60.752 42.471  1.00 49.46  ? 421  LEU A CG    1 
ATOM   2003 C  CD1   . LEU A 1 244 ? 74.495  61.634 42.787  1.00 48.24  ? 421  LEU A CD1   1 
ATOM   2004 C  CD2   . LEU A 1 244 ? 75.416  59.671 41.430  1.00 44.95  ? 421  LEU A CD2   1 
ATOM   2005 N  N     . GLU A 1 245 ? 80.151  62.019 41.755  1.00 47.90  ? 422  GLU A N     1 
ATOM   2006 C  CA    . GLU A 1 245 ? 81.272  62.827 41.311  1.00 49.53  ? 422  GLU A CA    1 
ATOM   2007 C  C     . GLU A 1 245 ? 81.927  62.240 40.067  1.00 50.28  ? 422  GLU A C     1 
ATOM   2008 O  O     . GLU A 1 245 ? 82.255  62.957 39.113  1.00 52.17  ? 422  GLU A O     1 
ATOM   2009 C  CB    . GLU A 1 245 ? 82.325  62.902 42.400  1.00 50.75  ? 422  GLU A CB    1 
ATOM   2010 C  CG    . GLU A 1 245 ? 83.004  64.237 42.475  1.00 54.39  ? 422  GLU A CG    1 
ATOM   2011 C  CD    . GLU A 1 245 ? 83.969  64.310 43.619  1.00 58.29  ? 422  GLU A CD    1 
ATOM   2012 O  OE1   . GLU A 1 245 ? 83.653  63.782 44.713  1.00 56.20  ? 422  GLU A OE1   1 
ATOM   2013 O  OE2   . GLU A 1 245 ? 85.054  64.887 43.398  1.00 62.42  ? 422  GLU A OE2   1 
ATOM   2014 N  N     . GLU A 1 246 ? 82.125  60.926 40.095  1.00 49.94  ? 423  GLU A N     1 
ATOM   2015 C  CA    . GLU A 1 246 ? 82.757  60.198 39.022  1.00 49.43  ? 423  GLU A CA    1 
ATOM   2016 C  C     . GLU A 1 246 ? 81.791  60.073 37.836  1.00 49.12  ? 423  GLU A C     1 
ATOM   2017 O  O     . GLU A 1 246 ? 82.147  60.325 36.694  1.00 49.34  ? 423  GLU A O     1 
ATOM   2018 C  CB    . GLU A 1 246 ? 83.184  58.819 39.563  1.00 50.00  ? 423  GLU A CB    1 
ATOM   2019 C  CG    . GLU A 1 246 ? 84.352  58.200 38.855  1.00 51.42  ? 423  GLU A CG    1 
ATOM   2020 C  CD    . GLU A 1 246 ? 84.980  57.035 39.603  1.00 52.62  ? 423  GLU A CD    1 
ATOM   2021 O  OE1   . GLU A 1 246 ? 85.595  57.270 40.673  1.00 48.80  ? 423  GLU A OE1   1 
ATOM   2022 O  OE2   . GLU A 1 246 ? 84.917  55.902 39.060  1.00 55.36  ? 423  GLU A OE2   1 
ATOM   2023 N  N     . TYR A 1 247 ? 80.544  59.719 38.098  1.00 48.62  ? 424  TYR A N     1 
ATOM   2024 C  CA    . TYR A 1 247 ? 79.559  59.689 37.030  1.00 48.80  ? 424  TYR A CA    1 
ATOM   2025 C  C     . TYR A 1 247 ? 79.427  61.033 36.301  1.00 49.47  ? 424  TYR A C     1 
ATOM   2026 O  O     . TYR A 1 247 ? 79.179  61.064 35.090  1.00 50.62  ? 424  TYR A O     1 
ATOM   2027 C  CB    . TYR A 1 247 ? 78.187  59.358 37.594  1.00 48.84  ? 424  TYR A CB    1 
ATOM   2028 C  CG    . TYR A 1 247 ? 77.912  57.913 37.911  1.00 48.61  ? 424  TYR A CG    1 
ATOM   2029 C  CD1   . TYR A 1 247 ? 78.901  56.923 37.820  1.00 47.27  ? 424  TYR A CD1   1 
ATOM   2030 C  CD2   . TYR A 1 247 ? 76.639  57.542 38.374  1.00 49.35  ? 424  TYR A CD2   1 
ATOM   2031 C  CE1   . TYR A 1 247 ? 78.598  55.584 38.155  1.00 48.94  ? 424  TYR A CE1   1 
ATOM   2032 C  CE2   . TYR A 1 247 ? 76.328  56.222 38.681  1.00 48.51  ? 424  TYR A CE2   1 
ATOM   2033 C  CZ    . TYR A 1 247 ? 77.299  55.262 38.578  1.00 49.23  ? 424  TYR A CZ    1 
ATOM   2034 O  OH    . TYR A 1 247 ? 76.926  53.994 38.891  1.00 52.77  ? 424  TYR A OH    1 
ATOM   2035 N  N     . PHE A 1 248 ? 79.469  62.135 37.041  1.00 48.79  ? 425  PHE A N     1 
ATOM   2036 C  CA    . PHE A 1 248 ? 79.258  63.425 36.428  1.00 49.31  ? 425  PHE A CA    1 
ATOM   2037 C  C     . PHE A 1 248 ? 80.494  63.864 35.642  1.00 49.41  ? 425  PHE A C     1 
ATOM   2038 O  O     . PHE A 1 248 ? 80.391  64.540 34.602  1.00 49.26  ? 425  PHE A O     1 
ATOM   2039 C  CB    . PHE A 1 248 ? 78.867  64.475 37.478  1.00 49.61  ? 425  PHE A CB    1 
ATOM   2040 C  CG    . PHE A 1 248 ? 77.506  64.248 38.093  1.00 50.35  ? 425  PHE A CG    1 
ATOM   2041 C  CD1   . PHE A 1 248 ? 76.584  63.363 37.507  1.00 49.86  ? 425  PHE A CD1   1 
ATOM   2042 C  CD2   . PHE A 1 248 ? 77.141  64.920 39.270  1.00 48.34  ? 425  PHE A CD2   1 
ATOM   2043 C  CE1   . PHE A 1 248 ? 75.324  63.164 38.088  1.00 50.29  ? 425  PHE A CE1   1 
ATOM   2044 C  CE2   . PHE A 1 248 ? 75.872  64.741 39.857  1.00 46.68  ? 425  PHE A CE2   1 
ATOM   2045 C  CZ    . PHE A 1 248 ? 74.957  63.886 39.261  1.00 48.81  ? 425  PHE A CZ    1 
ATOM   2046 N  N     . MET A 1 249 ? 81.666  63.512 36.144  1.00 49.28  ? 426  MET A N     1 
ATOM   2047 C  CA    . MET A 1 249 ? 82.884  63.768 35.394  1.00 49.70  ? 426  MET A CA    1 
ATOM   2048 C  C     . MET A 1 249 ? 82.798  63.129 34.004  1.00 49.57  ? 426  MET A C     1 
ATOM   2049 O  O     . MET A 1 249 ? 83.074  63.755 32.970  1.00 49.81  ? 426  MET A O     1 
ATOM   2050 C  CB    . MET A 1 249 ? 84.050  63.176 36.144  1.00 50.56  ? 426  MET A CB    1 
ATOM   2051 C  CG    . MET A 1 249 ? 85.366  63.808 35.808  1.00 51.98  ? 426  MET A CG    1 
ATOM   2052 S  SD    . MET A 1 249 ? 86.580  63.434 37.095  1.00 58.58  ? 426  MET A SD    1 
ATOM   2053 C  CE    . MET A 1 249 ? 85.740  63.705 38.657  1.00 47.85  ? 426  MET A CE    1 
ATOM   2054 N  N     . GLN A 1 250 ? 82.366  61.878 33.988  1.00 49.30  ? 427  GLN A N     1 
ATOM   2055 C  CA    . GLN A 1 250 ? 82.255  61.138 32.751  1.00 49.06  ? 427  GLN A CA    1 
ATOM   2056 C  C     . GLN A 1 250 ? 81.169  61.717 31.833  1.00 49.46  ? 427  GLN A C     1 
ATOM   2057 O  O     . GLN A 1 250 ? 81.416  61.967 30.655  1.00 50.17  ? 427  GLN A O     1 
ATOM   2058 C  CB    . GLN A 1 250 ? 81.979  59.662 33.048  1.00 48.52  ? 427  GLN A CB    1 
ATOM   2059 C  CG    . GLN A 1 250 ? 81.720  58.849 31.793  1.00 47.61  ? 427  GLN A CG    1 
ATOM   2060 C  CD    . GLN A 1 250 ? 81.576  57.390 32.073  1.00 46.27  ? 427  GLN A CD    1 
ATOM   2061 O  OE1   . GLN A 1 250 ? 82.153  56.862 33.039  1.00 44.93  ? 427  GLN A OE1   1 
ATOM   2062 N  NE2   . GLN A 1 250 ? 80.799  56.712 31.236  1.00 42.94  ? 427  GLN A NE2   1 
ATOM   2063 N  N     . SER A 1 251 ? 79.971  61.931 32.359  1.00 50.41  ? 428  SER A N     1 
ATOM   2064 C  CA    . SER A 1 251 ? 78.847  62.372 31.519  1.00 51.31  ? 428  SER A CA    1 
ATOM   2065 C  C     . SER A 1 251 ? 79.036  63.783 30.941  1.00 51.36  ? 428  SER A C     1 
ATOM   2066 O  O     . SER A 1 251 ? 78.554  64.082 29.835  1.00 51.43  ? 428  SER A O     1 
ATOM   2067 C  CB    . SER A 1 251 ? 77.540  62.300 32.307  1.00 51.35  ? 428  SER A CB    1 
ATOM   2068 O  OG    . SER A 1 251 ? 77.462  63.377 33.233  1.00 54.87  ? 428  SER A OG    1 
ATOM   2069 N  N     . ASP A 1 252 ? 79.713  64.653 31.695  1.00 51.62  ? 429  ASP A N     1 
ATOM   2070 C  CA    . ASP A 1 252 ? 80.089  65.985 31.189  1.00 51.83  ? 429  ASP A CA    1 
ATOM   2071 C  C     . ASP A 1 252 ? 80.991  65.848 29.974  1.00 52.07  ? 429  ASP A C     1 
ATOM   2072 O  O     . ASP A 1 252 ? 80.791  66.507 28.940  1.00 52.38  ? 429  ASP A O     1 
ATOM   2073 C  CB    . ASP A 1 252 ? 80.858  66.776 32.255  1.00 51.71  ? 429  ASP A CB    1 
ATOM   2074 C  CG    . ASP A 1 252 ? 79.951  67.341 33.371  1.00 52.85  ? 429  ASP A CG    1 
ATOM   2075 O  OD1   . ASP A 1 252 ? 78.700  67.143 33.394  1.00 48.54  ? 429  ASP A OD1   1 
ATOM   2076 O  OD2   . ASP A 1 252 ? 80.533  67.994 34.254  1.00 53.41  ? 429  ASP A OD2   1 
ATOM   2077 N  N     . ARG A 1 253 ? 82.025  65.021 30.140  1.00 52.49  ? 430  ARG A N     1 
ATOM   2078 C  CA    . ARG A 1 253 ? 83.017  64.761 29.091  1.00 51.89  ? 430  ARG A CA    1 
ATOM   2079 C  C     . ARG A 1 253 ? 82.345  64.158 27.861  1.00 51.50  ? 430  ARG A C     1 
ATOM   2080 O  O     . ARG A 1 253 ? 82.497  64.649 26.751  1.00 48.95  ? 430  ARG A O     1 
ATOM   2081 C  CB    . ARG A 1 253 ? 84.084  63.818 29.642  1.00 52.10  ? 430  ARG A CB    1 
ATOM   2082 C  CG    . ARG A 1 253 ? 85.277  63.609 28.748  1.00 51.15  ? 430  ARG A CG    1 
ATOM   2083 C  CD    . ARG A 1 253 ? 86.361  62.840 29.476  1.00 51.02  ? 430  ARG A CD    1 
ATOM   2084 N  NE    . ARG A 1 253 ? 87.421  62.413 28.567  1.00 53.10  ? 430  ARG A NE    1 
ATOM   2085 C  CZ    . ARG A 1 253 ? 88.398  61.573 28.894  1.00 54.22  ? 430  ARG A CZ    1 
ATOM   2086 N  NH1   . ARG A 1 253 ? 88.471  61.049 30.102  1.00 55.48  ? 430  ARG A NH1   1 
ATOM   2087 N  NH2   . ARG A 1 253 ? 89.313  61.253 28.004  1.00 56.05  ? 430  ARG A NH2   1 
ATOM   2088 N  N     . GLU A 1 254 ? 81.552  63.122 28.084  1.00 51.93  ? 431  GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 254 ? 80.714  62.590 27.026  1.00 53.33  ? 431  GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 254 ? 79.945  63.698 26.259  1.00 53.66  ? 431  GLU A C     1 
ATOM   2091 O  O     . GLU A 1 254 ? 79.962  63.726 25.016  1.00 53.44  ? 431  GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 254 ? 79.766  61.520 27.589  1.00 53.54  ? 431  GLU A CB    1 
ATOM   2093 C  CG    . GLU A 1 254 ? 80.430  60.140 27.735  1.00 53.89  ? 431  GLU A CG    1 
ATOM   2094 C  CD    . GLU A 1 254 ? 79.755  59.259 28.762  1.00 54.08  ? 431  GLU A CD    1 
ATOM   2095 O  OE1   . GLU A 1 254 ? 79.022  59.819 29.593  1.00 54.99  ? 431  GLU A OE1   1 
ATOM   2096 O  OE2   . GLU A 1 254 ? 79.997  58.029 28.779  1.00 51.23  ? 431  GLU A OE2   1 
ATOM   2097 N  N     . LYS A 1 255 ? 79.291  64.607 26.983  1.00 53.97  ? 432  LYS A N     1 
ATOM   2098 C  CA    . LYS A 1 255 ? 78.557  65.726 26.331  1.00 54.55  ? 432  LYS A CA    1 
ATOM   2099 C  C     . LYS A 1 255 ? 79.522  66.579 25.521  1.00 53.56  ? 432  LYS A C     1 
ATOM   2100 O  O     . LYS A 1 255 ? 79.291  66.836 24.343  1.00 53.85  ? 432  LYS A O     1 
ATOM   2101 C  CB    . LYS A 1 255 ? 77.798  66.622 27.353  1.00 54.98  ? 432  LYS A CB    1 
ATOM   2102 C  CG    . LYS A 1 255 ? 76.328  66.167 27.676  1.00 57.16  ? 432  LYS A CG    1 
ATOM   2103 C  CD    . LYS A 1 255 ? 75.876  66.436 29.158  1.00 57.34  ? 432  LYS A CD    1 
ATOM   2104 C  CE    . LYS A 1 255 ? 74.464  65.848 29.450  1.00 55.63  ? 432  LYS A CE    1 
ATOM   2105 N  NZ    . LYS A 1 255 ? 73.921  66.178 30.813  1.00 54.09  ? 432  LYS A NZ    1 
ATOM   2106 N  N     . SER A 1 256 ? 80.610  67.009 26.159  1.00 52.60  ? 433  SER A N     1 
ATOM   2107 C  CA    . SER A 1 256 ? 81.613  67.829 25.489  1.00 51.37  ? 433  SER A CA    1 
ATOM   2108 C  C     . SER A 1 256 ? 82.146  67.166 24.210  1.00 51.43  ? 433  SER A C     1 
ATOM   2109 O  O     . SER A 1 256 ? 82.365  67.836 23.231  1.00 52.08  ? 433  SER A O     1 
ATOM   2110 C  CB    . SER A 1 256 ? 82.766  68.115 26.441  1.00 50.58  ? 433  SER A CB    1 
ATOM   2111 O  OG    . SER A 1 256 ? 83.967  68.276 25.716  1.00 51.71  ? 433  SER A OG    1 
ATOM   2112 N  N     . GLU A 1 257 ? 82.356  65.849 24.226  1.00 51.48  ? 434  GLU A N     1 
ATOM   2113 C  CA    . GLU A 1 257 ? 83.028  65.148 23.135  1.00 50.42  ? 434  GLU A CA    1 
ATOM   2114 C  C     . GLU A 1 257 ? 82.037  64.542 22.157  1.00 49.83  ? 434  GLU A C     1 
ATOM   2115 O  O     . GLU A 1 257 ? 82.442  63.855 21.239  1.00 50.06  ? 434  GLU A O     1 
ATOM   2116 C  CB    . GLU A 1 257 ? 83.947  64.035 23.675  1.00 50.33  ? 434  GLU A CB    1 
ATOM   2117 C  CG    . GLU A 1 257 ? 85.045  64.502 24.672  1.00 51.08  ? 434  GLU A CG    1 
ATOM   2118 C  CD    . GLU A 1 257 ? 85.871  63.338 25.211  1.00 51.88  ? 434  GLU A CD    1 
ATOM   2119 O  OE1   . GLU A 1 257 ? 85.485  62.170 24.970  1.00 53.99  ? 434  GLU A OE1   1 
ATOM   2120 O  OE2   . GLU A 1 257 ? 86.915  63.572 25.861  1.00 51.80  ? 434  GLU A OE2   1 
ATOM   2121 N  N     . GLY A 1 258 ? 80.747  64.792 22.336  1.00 49.22  ? 435  GLY A N     1 
ATOM   2122 C  CA    . GLY A 1 258 ? 79.751  64.339 21.364  1.00 49.42  ? 435  GLY A CA    1 
ATOM   2123 C  C     . GLY A 1 258 ? 79.391  62.870 21.501  1.00 50.73  ? 435  GLY A C     1 
ATOM   2124 O  O     . GLY A 1 258 ? 78.770  62.267 20.611  1.00 50.79  ? 435  GLY A O     1 
ATOM   2125 N  N     . LEU A 1 259 ? 79.752  62.290 22.638  1.00 51.55  ? 436  LEU A N     1 
ATOM   2126 C  CA    . LEU A 1 259 ? 79.521  60.869 22.868  1.00 51.76  ? 436  LEU A CA    1 
ATOM   2127 C  C     . LEU A 1 259 ? 78.186  60.687 23.582  1.00 52.18  ? 436  LEU A C     1 
ATOM   2128 O  O     . LEU A 1 259 ? 77.692  61.613 24.224  1.00 52.73  ? 436  LEU A O     1 
ATOM   2129 C  CB    . LEU A 1 259 ? 80.679  60.276 23.684  1.00 51.10  ? 436  LEU A CB    1 
ATOM   2130 C  CG    . LEU A 1 259 ? 82.004  60.310 22.938  1.00 49.54  ? 436  LEU A CG    1 
ATOM   2131 C  CD1   . LEU A 1 259 ? 83.144  59.853 23.808  1.00 47.03  ? 436  LEU A CD1   1 
ATOM   2132 C  CD2   . LEU A 1 259 ? 81.891  59.454 21.679  1.00 47.42  ? 436  LEU A CD2   1 
ATOM   2133 N  N     . PRO A 1 260 ? 77.588  59.502 23.452  1.00 52.90  ? 437  PRO A N     1 
ATOM   2134 C  CA    . PRO A 1 260 ? 76.327  59.251 24.114  1.00 54.57  ? 437  PRO A CA    1 
ATOM   2135 C  C     . PRO A 1 260 ? 76.451  59.350 25.642  1.00 57.03  ? 437  PRO A C     1 
ATOM   2136 O  O     . PRO A 1 260 ? 77.495  58.978 26.219  1.00 56.96  ? 437  PRO A O     1 
ATOM   2137 C  CB    . PRO A 1 260 ? 75.974  57.808 23.696  1.00 54.49  ? 437  PRO A CB    1 
ATOM   2138 C  CG    . PRO A 1 260 ? 76.875  57.454 22.609  1.00 52.94  ? 437  PRO A CG    1 
ATOM   2139 C  CD    . PRO A 1 260 ? 78.079  58.322 22.726  1.00 52.93  ? 437  PRO A CD    1 
ATOM   2140 N  N     . VAL A 1 261 ? 75.403  59.893 26.270  1.00 59.34  ? 438  VAL A N     1 
ATOM   2141 C  CA    . VAL A 1 261 ? 75.353  60.081 27.715  1.00 60.12  ? 438  VAL A CA    1 
ATOM   2142 C  C     . VAL A 1 261 ? 74.370  59.074 28.276  1.00 61.52  ? 438  VAL A C     1 
ATOM   2143 O  O     . VAL A 1 261 ? 73.394  58.733 27.623  1.00 61.92  ? 438  VAL A O     1 
ATOM   2144 C  CB    . VAL A 1 261 ? 74.896  61.474 28.084  1.00 59.49  ? 438  VAL A CB    1 
ATOM   2145 C  CG1   . VAL A 1 261 ? 74.559  61.501 29.531  1.00 60.15  ? 438  VAL A CG1   1 
ATOM   2146 C  CG2   . VAL A 1 261 ? 75.984  62.496 27.767  1.00 58.70  ? 438  VAL A CG2   1 
ATOM   2147 N  N     . ALA A 1 262 ? 74.680  58.517 29.437  1.00 63.19  ? 439  ALA A N     1 
ATOM   2148 C  CA    . ALA A 1 262 ? 73.762  57.586 30.079  1.00 64.66  ? 439  ALA A CA    1 
ATOM   2149 C  C     . ALA A 1 262 ? 72.852  58.411 30.993  1.00 65.80  ? 439  ALA A C     1 
ATOM   2150 O  O     . ALA A 1 262 ? 73.329  59.325 31.689  1.00 66.18  ? 439  ALA A O     1 
ATOM   2151 C  CB    . ALA A 1 262 ? 74.525  56.533 30.867  1.00 64.31  ? 439  ALA A CB    1 
ATOM   2152 N  N     . PRO A 1 263 ? 71.540  58.108 31.002  1.00 66.64  ? 440  PRO A N     1 
ATOM   2153 C  CA    . PRO A 1 263 ? 70.680  59.013 31.789  1.00 66.70  ? 440  PRO A CA    1 
ATOM   2154 C  C     . PRO A 1 263 ? 70.943  58.853 33.303  1.00 65.80  ? 440  PRO A C     1 
ATOM   2155 O  O     . PRO A 1 263 ? 70.932  59.840 34.050  1.00 65.64  ? 440  PRO A O     1 
ATOM   2156 C  CB    . PRO A 1 263 ? 69.244  58.612 31.385  1.00 66.89  ? 440  PRO A CB    1 
ATOM   2157 C  CG    . PRO A 1 263 ? 69.376  57.434 30.424  1.00 67.04  ? 440  PRO A CG    1 
ATOM   2158 C  CD    . PRO A 1 263 ? 70.802  56.948 30.467  1.00 66.87  ? 440  PRO A CD    1 
ATOM   2159 N  N     . PHE A 1 264 ? 71.291  57.641 33.722  1.00 64.41  ? 441  PHE A N     1 
ATOM   2160 C  CA    . PHE A 1 264 ? 71.648  57.414 35.107  1.00 63.76  ? 441  PHE A CA    1 
ATOM   2161 C  C     . PHE A 1 264 ? 72.964  58.060 35.546  1.00 62.96  ? 441  PHE A C     1 
ATOM   2162 O  O     . PHE A 1 264 ? 73.276  58.042 36.738  1.00 62.19  ? 441  PHE A O     1 
ATOM   2163 C  CB    . PHE A 1 264 ? 71.660  55.921 35.416  1.00 64.02  ? 441  PHE A CB    1 
ATOM   2164 C  CG    . PHE A 1 264 ? 72.902  55.209 34.968  1.00 64.41  ? 441  PHE A CG    1 
ATOM   2165 C  CD1   . PHE A 1 264 ? 74.023  55.155 35.787  1.00 67.18  ? 441  PHE A CD1   1 
ATOM   2166 C  CD2   . PHE A 1 264 ? 72.927  54.522 33.764  1.00 65.31  ? 441  PHE A CD2   1 
ATOM   2167 C  CE1   . PHE A 1 264 ? 75.171  54.436 35.397  1.00 67.93  ? 441  PHE A CE1   1 
ATOM   2168 C  CE2   . PHE A 1 264 ? 74.064  53.820 33.357  1.00 65.64  ? 441  PHE A CE2   1 
ATOM   2169 C  CZ    . PHE A 1 264 ? 75.192  53.778 34.173  1.00 65.41  ? 441  PHE A CZ    1 
ATOM   2170 N  N     . MET A 1 265 ? 73.732  58.627 34.613  1.00 62.11  ? 442  MET A N     1 
ATOM   2171 C  CA    . MET A 1 265 ? 74.899  59.442 34.987  1.00 61.71  ? 442  MET A CA    1 
ATOM   2172 C  C     . MET A 1 265 ? 74.706  60.913 34.629  1.00 61.22  ? 442  MET A C     1 
ATOM   2173 O  O     . MET A 1 265 ? 75.632  61.710 34.768  1.00 59.72  ? 442  MET A O     1 
ATOM   2174 C  CB    . MET A 1 265 ? 76.182  58.941 34.321  1.00 61.77  ? 442  MET A CB    1 
ATOM   2175 C  CG    . MET A 1 265 ? 76.462  57.459 34.478  1.00 62.95  ? 442  MET A CG    1 
ATOM   2176 S  SD    . MET A 1 265 ? 78.165  57.042 33.982  1.00 65.58  ? 442  MET A SD    1 
ATOM   2177 C  CE    . MET A 1 265 ? 77.879  55.565 33.019  1.00 61.78  ? 442  MET A CE    1 
ATOM   2178 N  N     . ASP A 1 266 ? 73.501  61.265 34.191  1.00 61.96  ? 443  ASP A N     1 
ATOM   2179 C  CA    . ASP A 1 266 ? 73.204  62.616 33.717  1.00 62.82  ? 443  ASP A CA    1 
ATOM   2180 C  C     . ASP A 1 266 ? 72.941  63.564 34.877  1.00 63.23  ? 443  ASP A C     1 
ATOM   2181 O  O     . ASP A 1 266 ? 71.898  63.506 35.514  1.00 63.78  ? 443  ASP A O     1 
ATOM   2182 C  CB    . ASP A 1 266 ? 71.986  62.610 32.783  1.00 63.18  ? 443  ASP A CB    1 
ATOM   2183 C  CG    . ASP A 1 266 ? 71.799  63.943 32.025  1.00 64.40  ? 443  ASP A CG    1 
ATOM   2184 O  OD1   . ASP A 1 266 ? 72.206  65.025 32.545  1.00 62.54  ? 443  ASP A OD1   1 
ATOM   2185 O  OD2   . ASP A 1 266 ? 71.218  63.888 30.909  1.00 62.70  ? 443  ASP A OD2   1 
ATOM   2186 N  N     . ARG A 1 267 ? 73.917  64.423 35.136  1.00 63.50  ? 444  ARG A N     1 
ATOM   2187 C  CA    . ARG A 1 267 ? 73.801  65.570 36.025  1.00 63.87  ? 444  ARG A CA    1 
ATOM   2188 C  C     . ARG A 1 267 ? 72.410  66.167 36.181  1.00 65.48  ? 444  ARG A C     1 
ATOM   2189 O  O     . ARG A 1 267 ? 72.061  66.692 37.243  1.00 65.41  ? 444  ARG A O     1 
ATOM   2190 C  CB    . ARG A 1 267 ? 74.694  66.655 35.461  1.00 63.59  ? 444  ARG A CB    1 
ATOM   2191 C  CG    . ARG A 1 267 ? 75.101  67.674 36.440  1.00 61.06  ? 444  ARG A CG    1 
ATOM   2192 C  CD    . ARG A 1 267 ? 76.505  68.142 36.139  1.00 56.98  ? 444  ARG A CD    1 
ATOM   2193 N  NE    . ARG A 1 267 ? 77.243  68.192 37.383  1.00 57.04  ? 444  ARG A NE    1 
ATOM   2194 C  CZ    . ARG A 1 267 ? 78.559  68.118 37.478  1.00 57.75  ? 444  ARG A CZ    1 
ATOM   2195 N  NH1   . ARG A 1 267 ? 79.290  67.993 36.389  1.00 56.48  ? 444  ARG A NH1   1 
ATOM   2196 N  NH2   . ARG A 1 267 ? 79.136  68.154 38.676  1.00 59.13  ? 444  ARG A NH2   1 
ATOM   2197 N  N     . ASP A 1 268 ? 71.660  66.175 35.083  1.00 67.45  ? 445  ASP A N     1 
ATOM   2198 C  CA    . ASP A 1 268 ? 70.355  66.836 35.035  1.00 68.55  ? 445  ASP A CA    1 
ATOM   2199 C  C     . ASP A 1 268 ? 69.253  65.945 35.631  1.00 68.81  ? 445  ASP A C     1 
ATOM   2200 O  O     . ASP A 1 268 ? 68.336  66.463 36.259  1.00 69.28  ? 445  ASP A O     1 
ATOM   2201 C  CB    . ASP A 1 268 ? 69.999  67.252 33.579  1.00 68.94  ? 445  ASP A CB    1 
ATOM   2202 C  CG    . ASP A 1 268 ? 70.845  68.455 33.062  1.00 68.97  ? 445  ASP A CG    1 
ATOM   2203 O  OD1   . ASP A 1 268 ? 71.253  69.312 33.889  1.00 67.67  ? 445  ASP A OD1   1 
ATOM   2204 O  OD2   . ASP A 1 268 ? 71.081  68.546 31.825  1.00 66.68  ? 445  ASP A OD2   1 
ATOM   2205 N  N     . LYS A 1 269 ? 69.373  64.619 35.467  1.00 68.82  ? 446  LYS A N     1 
ATOM   2206 C  CA    . LYS A 1 269 ? 68.310  63.649 35.830  1.00 68.08  ? 446  LYS A CA    1 
ATOM   2207 C  C     . LYS A 1 269 ? 68.599  62.799 37.079  1.00 67.50  ? 446  LYS A C     1 
ATOM   2208 O  O     . LYS A 1 269 ? 67.982  61.740 37.270  1.00 67.56  ? 446  LYS A O     1 
ATOM   2209 C  CB    . LYS A 1 269 ? 68.083  62.669 34.675  1.00 67.83  ? 446  LYS A CB    1 
ATOM   2210 C  CG    . LYS A 1 269 ? 68.021  63.296 33.297  1.00 68.94  ? 446  LYS A CG    1 
ATOM   2211 C  CD    . LYS A 1 269 ? 67.718  62.215 32.264  1.00 69.39  ? 446  LYS A CD    1 
ATOM   2212 C  CE    . LYS A 1 269 ? 67.774  62.724 30.839  1.00 68.29  ? 446  LYS A CE    1 
ATOM   2213 N  NZ    . LYS A 1 269 ? 67.651  61.566 29.931  1.00 65.71  ? 446  LYS A NZ    1 
ATOM   2214 N  N     . VAL A 1 270 ? 69.571  63.198 37.892  1.00 66.11  ? 447  VAL A N     1 
ATOM   2215 C  CA    . VAL A 1 270 ? 70.067  62.291 38.916  1.00 64.80  ? 447  VAL A CA    1 
ATOM   2216 C  C     . VAL A 1 270 ? 70.365  63.015 40.221  1.00 63.38  ? 447  VAL A C     1 
ATOM   2217 O  O     . VAL A 1 270 ? 71.025  64.050 40.234  1.00 63.62  ? 447  VAL A O     1 
ATOM   2218 C  CB    . VAL A 1 270 ? 71.290  61.414 38.407  1.00 65.14  ? 447  VAL A CB    1 
ATOM   2219 C  CG1   . VAL A 1 270 ? 72.205  60.993 39.560  1.00 63.46  ? 447  VAL A CG1   1 
ATOM   2220 C  CG2   . VAL A 1 270 ? 70.787  60.157 37.673  1.00 63.76  ? 447  VAL A CG2   1 
ATOM   2221 N  N     . THR A 1 271 ? 69.824  62.461 41.306  1.00 61.48  ? 448  THR A N     1 
ATOM   2222 C  CA    . THR A 1 271 ? 70.150  62.861 42.676  1.00 60.41  ? 448  THR A CA    1 
ATOM   2223 C  C     . THR A 1 271 ? 70.571  61.626 43.457  1.00 59.92  ? 448  THR A C     1 
ATOM   2224 O  O     . THR A 1 271 ? 70.327  60.506 43.015  1.00 59.64  ? 448  THR A O     1 
ATOM   2225 C  CB    . THR A 1 271 ? 68.924  63.425 43.369  1.00 60.45  ? 448  THR A CB    1 
ATOM   2226 O  OG1   . THR A 1 271 ? 67.857  62.469 43.267  1.00 58.83  ? 448  THR A OG1   1 
ATOM   2227 C  CG2   . THR A 1 271 ? 68.518  64.749 42.724  1.00 58.52  ? 448  THR A CG2   1 
ATOM   2228 N  N     . LYS A 1 272 ? 71.138  61.832 44.645  1.00 59.37  ? 449  LYS A N     1 
ATOM   2229 C  CA    . LYS A 1 272 ? 71.491  60.718 45.529  1.00 59.24  ? 449  LYS A CA    1 
ATOM   2230 C  C     . LYS A 1 272 ? 70.320  59.758 45.637  1.00 57.51  ? 449  LYS A C     1 
ATOM   2231 O  O     . LYS A 1 272 ? 70.459  58.574 45.361  1.00 56.94  ? 449  LYS A O     1 
ATOM   2232 C  CB    . LYS A 1 272 ? 71.873  61.202 46.932  1.00 60.03  ? 449  LYS A CB    1 
ATOM   2233 C  CG    . LYS A 1 272 ? 73.181  62.011 47.001  1.00 64.53  ? 449  LYS A CG    1 
ATOM   2234 C  CD    . LYS A 1 272 ? 73.132  63.162 48.044  1.00 69.04  ? 449  LYS A CD    1 
ATOM   2235 C  CE    . LYS A 1 272 ? 74.056  62.949 49.269  1.00 71.07  ? 449  LYS A CE    1 
ATOM   2236 N  NZ    . LYS A 1 272 ? 74.680  61.583 49.334  1.00 72.19  ? 449  LYS A NZ    1 
ATOM   2237 N  N     . ALA A 1 273 ? 69.161  60.308 45.970  1.00 55.92  ? 450  ALA A N     1 
ATOM   2238 C  CA    . ALA A 1 273 ? 67.972  59.543 46.248  1.00 55.16  ? 450  ALA A CA    1 
ATOM   2239 C  C     . ALA A 1 273 ? 67.581  58.690 45.048  1.00 54.49  ? 450  ALA A C     1 
ATOM   2240 O  O     . ALA A 1 273 ? 67.287  57.505 45.182  1.00 53.86  ? 450  ALA A O     1 
ATOM   2241 C  CB    . ALA A 1 273 ? 66.834  60.502 46.645  1.00 54.31  ? 450  ALA A CB    1 
ATOM   2242 N  N     . THR A 1 274 ? 67.576  59.288 43.868  1.00 54.43  ? 451  THR A N     1 
ATOM   2243 C  CA    . THR A 1 274 ? 67.079  58.577 42.700  1.00 54.31  ? 451  THR A CA    1 
ATOM   2244 C  C     . THR A 1 274 ? 68.110  57.548 42.271  1.00 53.07  ? 451  THR A C     1 
ATOM   2245 O  O     . THR A 1 274 ? 67.752  56.421 41.940  1.00 52.72  ? 451  THR A O     1 
ATOM   2246 C  CB    . THR A 1 274 ? 66.723  59.542 41.566  1.00 55.16  ? 451  THR A CB    1 
ATOM   2247 O  OG1   . THR A 1 274 ? 67.885  60.314 41.196  1.00 56.80  ? 451  THR A OG1   1 
ATOM   2248 C  CG2   . THR A 1 274 ? 65.580  60.465 42.027  1.00 53.59  ? 451  THR A CG2   1 
ATOM   2249 N  N     . ALA A 1 275 ? 69.385  57.917 42.346  1.00 51.84  ? 452  ALA A N     1 
ATOM   2250 C  CA    . ALA A 1 275 ? 70.478  56.963 42.179  1.00 51.35  ? 452  ALA A CA    1 
ATOM   2251 C  C     . ALA A 1 275 ? 70.289  55.689 43.056  1.00 51.58  ? 452  ALA A C     1 
ATOM   2252 O  O     . ALA A 1 275 ? 70.385  54.542 42.578  1.00 51.85  ? 452  ALA A O     1 
ATOM   2253 C  CB    . ALA A 1 275 ? 71.814  57.625 42.495  1.00 50.67  ? 452  ALA A CB    1 
ATOM   2254 N  N     . GLN A 1 276 ? 70.017  55.880 44.339  1.00 50.45  ? 453  GLN A N     1 
ATOM   2255 C  CA    . GLN A 1 276 ? 70.084  54.763 45.251  1.00 49.87  ? 453  GLN A CA    1 
ATOM   2256 C  C     . GLN A 1 276 ? 68.794  53.935 45.306  1.00 49.56  ? 453  GLN A C     1 
ATOM   2257 O  O     . GLN A 1 276 ? 68.847  52.720 45.502  1.00 50.03  ? 453  GLN A O     1 
ATOM   2258 C  CB    . GLN A 1 276 ? 70.471  55.244 46.653  1.00 49.82  ? 453  GLN A CB    1 
ATOM   2259 C  CG    . GLN A 1 276 ? 71.878  55.845 46.766  1.00 48.83  ? 453  GLN A CG    1 
ATOM   2260 C  CD    . GLN A 1 276 ? 72.920  54.977 46.121  1.00 48.03  ? 453  GLN A CD    1 
ATOM   2261 O  OE1   . GLN A 1 276 ? 72.959  54.883 44.907  1.00 45.87  ? 453  GLN A OE1   1 
ATOM   2262 N  NE2   . GLN A 1 276 ? 73.738  54.289 46.928  1.00 48.13  ? 453  GLN A NE2   1 
ATOM   2263 N  N     . ILE A 1 277 ? 67.642  54.573 45.135  1.00 48.68  ? 454  ILE A N     1 
ATOM   2264 C  CA    . ILE A 1 277 ? 66.368  53.871 45.311  1.00 47.41  ? 454  ILE A CA    1 
ATOM   2265 C  C     . ILE A 1 277 ? 66.276  52.702 44.325  1.00 47.40  ? 454  ILE A C     1 
ATOM   2266 O  O     . ILE A 1 277 ? 66.078  51.553 44.737  1.00 46.78  ? 454  ILE A O     1 
ATOM   2267 C  CB    . ILE A 1 277 ? 65.147  54.830 45.174  1.00 46.54  ? 454  ILE A CB    1 
ATOM   2268 C  CG1   . ILE A 1 277 ? 65.056  55.738 46.400  1.00 45.94  ? 454  ILE A CG1   1 
ATOM   2269 C  CG2   . ILE A 1 277 ? 63.873  54.050 45.044  1.00 44.06  ? 454  ILE A CG2   1 
ATOM   2270 C  CD1   . ILE A 1 277 ? 64.338  57.036 46.162  1.00 44.38  ? 454  ILE A CD1   1 
ATOM   2271 N  N     . GLY A 1 278 ? 66.497  52.989 43.036  1.00 47.20  ? 455  GLY A N     1 
ATOM   2272 C  CA    . GLY A 1 278 ? 66.397  51.967 41.998  1.00 46.33  ? 455  GLY A CA    1 
ATOM   2273 C  C     . GLY A 1 278 ? 67.456  50.912 42.209  1.00 46.05  ? 455  GLY A C     1 
ATOM   2274 O  O     . GLY A 1 278 ? 67.188  49.702 42.153  1.00 46.33  ? 455  GLY A O     1 
ATOM   2275 N  N     . PHE A 1 279 ? 68.662  51.365 42.507  1.00 45.07  ? 456  PHE A N     1 
ATOM   2276 C  CA    . PHE A 1 279 ? 69.770  50.438 42.672  1.00 45.29  ? 456  PHE A CA    1 
ATOM   2277 C  C     . PHE A 1 279 ? 69.522  49.475 43.814  1.00 45.97  ? 456  PHE A C     1 
ATOM   2278 O  O     . PHE A 1 279 ? 69.856  48.285 43.712  1.00 45.73  ? 456  PHE A O     1 
ATOM   2279 C  CB    . PHE A 1 279 ? 71.042  51.201 42.974  1.00 44.99  ? 456  PHE A CB    1 
ATOM   2280 C  CG    . PHE A 1 279 ? 72.281  50.383 42.851  1.00 45.26  ? 456  PHE A CG    1 
ATOM   2281 C  CD1   . PHE A 1 279 ? 72.707  49.943 41.629  1.00 44.84  ? 456  PHE A CD1   1 
ATOM   2282 C  CD2   . PHE A 1 279 ? 73.081  50.145 43.955  1.00 44.81  ? 456  PHE A CD2   1 
ATOM   2283 C  CE1   . PHE A 1 279 ? 73.894  49.238 41.516  1.00 46.58  ? 456  PHE A CE1   1 
ATOM   2284 C  CE2   . PHE A 1 279 ? 74.260  49.453 43.831  1.00 45.02  ? 456  PHE A CE2   1 
ATOM   2285 C  CZ    . PHE A 1 279 ? 74.670  49.006 42.621  1.00 43.39  ? 456  PHE A CZ    1 
ATOM   2286 N  N     . ILE A 1 280 ? 68.995  50.008 44.920  1.00 45.92  ? 457  ILE A N     1 
ATOM   2287 C  CA    . ILE A 1 280 ? 68.719  49.190 46.105  1.00 45.95  ? 457  ILE A CA    1 
ATOM   2288 C  C     . ILE A 1 280 ? 67.596  48.184 45.822  1.00 45.98  ? 457  ILE A C     1 
ATOM   2289 O  O     . ILE A 1 280 ? 67.728  46.992 46.109  1.00 45.87  ? 457  ILE A O     1 
ATOM   2290 C  CB    . ILE A 1 280 ? 68.331  50.044 47.358  1.00 45.48  ? 457  ILE A CB    1 
ATOM   2291 C  CG1   . ILE A 1 280 ? 69.552  50.807 47.904  1.00 45.44  ? 457  ILE A CG1   1 
ATOM   2292 C  CG2   . ILE A 1 280 ? 67.765  49.150 48.456  1.00 44.17  ? 457  ILE A CG2   1 
ATOM   2293 C  CD1   . ILE A 1 280 ? 69.252  51.919 48.965  1.00 43.58  ? 457  ILE A CD1   1 
ATOM   2294 N  N     . LYS A 1 281 ? 66.497  48.671 45.254  1.00 46.46  ? 458  LYS A N     1 
ATOM   2295 C  CA    . LYS A 1 281 ? 65.311  47.847 45.064  1.00 46.96  ? 458  LYS A CA    1 
ATOM   2296 C  C     . LYS A 1 281 ? 65.534  46.767 44.025  1.00 46.97  ? 458  LYS A C     1 
ATOM   2297 O  O     . LYS A 1 281 ? 65.028  45.657 44.177  1.00 46.58  ? 458  LYS A O     1 
ATOM   2298 C  CB    . LYS A 1 281 ? 64.116  48.697 44.638  1.00 47.47  ? 458  LYS A CB    1 
ATOM   2299 C  CG    . LYS A 1 281 ? 63.702  49.727 45.691  1.00 50.20  ? 458  LYS A CG    1 
ATOM   2300 C  CD    . LYS A 1 281 ? 62.542  50.635 45.231  1.00 50.24  ? 458  LYS A CD    1 
ATOM   2301 C  CE    . LYS A 1 281 ? 61.232  50.225 45.899  1.00 51.59  ? 458  LYS A CE    1 
ATOM   2302 N  NZ    . LYS A 1 281 ? 60.085  50.421 44.987  1.00 54.06  ? 458  LYS A NZ    1 
ATOM   2303 N  N     . PHE A 1 282 ? 66.273  47.095 42.969  1.00 47.05  ? 459  PHE A N     1 
ATOM   2304 C  CA    . PHE A 1 282 ? 66.282  46.262 41.780  1.00 47.47  ? 459  PHE A CA    1 
ATOM   2305 C  C     . PHE A 1 282 ? 67.606  45.541 41.547  1.00 47.41  ? 459  PHE A C     1 
ATOM   2306 O  O     . PHE A 1 282 ? 67.621  44.518 40.875  1.00 48.63  ? 459  PHE A O     1 
ATOM   2307 C  CB    . PHE A 1 282 ? 65.872  47.083 40.556  1.00 47.83  ? 459  PHE A CB    1 
ATOM   2308 C  CG    . PHE A 1 282 ? 64.506  47.676 40.681  1.00 50.24  ? 459  PHE A CG    1 
ATOM   2309 C  CD1   . PHE A 1 282 ? 64.329  49.038 40.749  1.00 52.51  ? 459  PHE A CD1   1 
ATOM   2310 C  CD2   . PHE A 1 282 ? 63.397  46.857 40.814  1.00 53.67  ? 459  PHE A CD2   1 
ATOM   2311 C  CE1   . PHE A 1 282 ? 63.069  49.585 40.925  1.00 53.10  ? 459  PHE A CE1   1 
ATOM   2312 C  CE2   . PHE A 1 282 ? 62.133  47.390 40.996  1.00 53.65  ? 459  PHE A CE2   1 
ATOM   2313 C  CZ    . PHE A 1 282 ? 61.969  48.761 41.048  1.00 54.25  ? 459  PHE A CZ    1 
ATOM   2314 N  N     . VAL A 1 283 ? 68.705  46.044 42.102  1.00 46.78  ? 460  VAL A N     1 
ATOM   2315 C  CA    . VAL A 1 283 ? 69.985  45.309 42.051  1.00 45.83  ? 460  VAL A CA    1 
ATOM   2316 C  C     . VAL A 1 283 ? 70.367  44.658 43.389  1.00 45.65  ? 460  VAL A C     1 
ATOM   2317 O  O     . VAL A 1 283 ? 70.595  43.463 43.456  1.00 45.75  ? 460  VAL A O     1 
ATOM   2318 C  CB    . VAL A 1 283 ? 71.141  46.232 41.635  1.00 45.93  ? 460  VAL A CB    1 
ATOM   2319 C  CG1   . VAL A 1 283 ? 72.419  45.446 41.571  1.00 42.73  ? 460  VAL A CG1   1 
ATOM   2320 C  CG2   . VAL A 1 283 ? 70.804  46.948 40.313  1.00 43.07  ? 460  VAL A CG2   1 
ATOM   2321 N  N     . LEU A 1 284 ? 70.442  45.451 44.453  1.00 46.08  ? 461  LEU A N     1 
ATOM   2322 C  CA    . LEU A 1 284 ? 71.035  44.976 45.715  1.00 46.42  ? 461  LEU A CA    1 
ATOM   2323 C  C     . LEU A 1 284 ? 70.129  44.026 46.497  1.00 46.58  ? 461  LEU A C     1 
ATOM   2324 O  O     . LEU A 1 284 ? 70.530  42.929 46.870  1.00 46.79  ? 461  LEU A O     1 
ATOM   2325 C  CB    . LEU A 1 284 ? 71.441  46.133 46.622  1.00 46.36  ? 461  LEU A CB    1 
ATOM   2326 C  CG    . LEU A 1 284 ? 72.765  46.852 46.326  1.00 47.48  ? 461  LEU A CG    1 
ATOM   2327 C  CD1   . LEU A 1 284 ? 72.887  48.142 47.167  1.00 43.69  ? 461  LEU A CD1   1 
ATOM   2328 C  CD2   . LEU A 1 284 ? 73.944  45.934 46.569  1.00 47.86  ? 461  LEU A CD2   1 
ATOM   2329 N  N     . ILE A 1 285 ? 68.905  44.444 46.764  1.00 46.58  ? 462  ILE A N     1 
ATOM   2330 C  CA    . ILE A 1 285 ? 67.999  43.586 47.516  1.00 46.45  ? 462  ILE A CA    1 
ATOM   2331 C  C     . ILE A 1 285 ? 67.868  42.195 46.863  1.00 47.71  ? 462  ILE A C     1 
ATOM   2332 O  O     . ILE A 1 285 ? 68.180  41.179 47.470  1.00 47.80  ? 462  ILE A O     1 
ATOM   2333 C  CB    . ILE A 1 285 ? 66.628  44.300 47.733  1.00 46.21  ? 462  ILE A CB    1 
ATOM   2334 C  CG1   . ILE A 1 285 ? 66.825  45.381 48.792  1.00 44.09  ? 462  ILE A CG1   1 
ATOM   2335 C  CG2   . ILE A 1 285 ? 65.542  43.336 48.124  1.00 40.81  ? 462  ILE A CG2   1 
ATOM   2336 C  CD1   . ILE A 1 285 ? 65.581  45.953 49.317  1.00 42.99  ? 462  ILE A CD1   1 
ATOM   2337 N  N     . PRO A 1 286 ? 67.490  42.150 45.592  1.00 48.81  ? 463  PRO A N     1 
ATOM   2338 C  CA    . PRO A 1 286 ? 67.346  40.856 44.937  1.00 48.96  ? 463  PRO A CA    1 
ATOM   2339 C  C     . PRO A 1 286 ? 68.602  40.007 45.040  1.00 49.44  ? 463  PRO A C     1 
ATOM   2340 O  O     . PRO A 1 286 ? 68.511  38.806 45.306  1.00 50.02  ? 463  PRO A O     1 
ATOM   2341 C  CB    . PRO A 1 286 ? 67.103  41.234 43.480  1.00 48.56  ? 463  PRO A CB    1 
ATOM   2342 C  CG    . PRO A 1 286 ? 66.530  42.591 43.531  1.00 49.21  ? 463  PRO A CG    1 
ATOM   2343 C  CD    . PRO A 1 286 ? 67.184  43.270 44.688  1.00 49.41  ? 463  PRO A CD    1 
ATOM   2344 N  N     . MET A 1 287 ? 69.765  40.606 44.832  1.00 48.95  ? 464  MET A N     1 
ATOM   2345 C  CA    . MET A 1 287 ? 70.973  39.800 44.863  1.00 49.77  ? 464  MET A CA    1 
ATOM   2346 C  C     . MET A 1 287 ? 71.134  39.172 46.255  1.00 49.93  ? 464  MET A C     1 
ATOM   2347 O  O     . MET A 1 287 ? 71.280  37.951 46.409  1.00 49.73  ? 464  MET A O     1 
ATOM   2348 C  CB    . MET A 1 287 ? 72.195  40.635 44.530  1.00 49.69  ? 464  MET A CB    1 
ATOM   2349 C  CG    . MET A 1 287 ? 73.441  39.813 44.516  1.00 50.69  ? 464  MET A CG    1 
ATOM   2350 S  SD    . MET A 1 287 ? 74.777  40.660 43.677  1.00 56.50  ? 464  MET A SD    1 
ATOM   2351 C  CE    . MET A 1 287 ? 74.767  42.279 44.462  1.00 50.59  ? 464  MET A CE    1 
ATOM   2352 N  N     . PHE A 1 288 ? 71.041  40.021 47.267  1.00 49.82  ? 465  PHE A N     1 
ATOM   2353 C  CA    . PHE A 1 288 ? 71.241  39.593 48.631  1.00 50.01  ? 465  PHE A CA    1 
ATOM   2354 C  C     . PHE A 1 288 ? 70.122  38.686 49.095  1.00 50.67  ? 465  PHE A C     1 
ATOM   2355 O  O     . PHE A 1 288 ? 70.324  37.902 50.017  1.00 51.55  ? 465  PHE A O     1 
ATOM   2356 C  CB    . PHE A 1 288 ? 71.381  40.805 49.561  1.00 49.63  ? 465  PHE A CB    1 
ATOM   2357 C  CG    . PHE A 1 288 ? 72.767  41.377 49.581  1.00 49.69  ? 465  PHE A CG    1 
ATOM   2358 C  CD1   . PHE A 1 288 ? 73.094  42.462 48.799  1.00 51.74  ? 465  PHE A CD1   1 
ATOM   2359 C  CD2   . PHE A 1 288 ? 73.777  40.759 50.315  1.00 51.98  ? 465  PHE A CD2   1 
ATOM   2360 C  CE1   . PHE A 1 288 ? 74.403  42.974 48.787  1.00 54.18  ? 465  PHE A CE1   1 
ATOM   2361 C  CE2   . PHE A 1 288 ? 75.072  41.257 50.314  1.00 53.25  ? 465  PHE A CE2   1 
ATOM   2362 C  CZ    . PHE A 1 288 ? 75.388  42.375 49.541  1.00 52.51  ? 465  PHE A CZ    1 
ATOM   2363 N  N     . GLU A 1 289 ? 68.952  38.779 48.459  1.00 51.45  ? 466  GLU A N     1 
ATOM   2364 C  CA    . GLU A 1 289 ? 67.825  37.886 48.766  1.00 51.50  ? 466  GLU A CA    1 
ATOM   2365 C  C     . GLU A 1 289 ? 68.154  36.462 48.382  1.00 52.05  ? 466  GLU A C     1 
ATOM   2366 O  O     . GLU A 1 289 ? 67.811  35.529 49.113  1.00 52.54  ? 466  GLU A O     1 
ATOM   2367 C  CB    . GLU A 1 289 ? 66.545  38.313 48.044  1.00 50.95  ? 466  GLU A CB    1 
ATOM   2368 C  CG    . GLU A 1 289 ? 65.597  39.184 48.882  1.00 51.84  ? 466  GLU A CG    1 
ATOM   2369 C  CD    . GLU A 1 289 ? 64.479  39.816 48.059  1.00 52.89  ? 466  GLU A CD    1 
ATOM   2370 O  OE1   . GLU A 1 289 ? 64.343  39.447 46.880  1.00 56.20  ? 466  GLU A OE1   1 
ATOM   2371 O  OE2   . GLU A 1 289 ? 63.722  40.666 48.581  1.00 52.49  ? 466  GLU A OE2   1 
ATOM   2372 N  N     . THR A 1 290 ? 68.812  36.294 47.240  1.00 52.43  ? 467  THR A N     1 
ATOM   2373 C  CA    . THR A 1 290 ? 69.181  34.962 46.813  1.00 53.34  ? 467  THR A CA    1 
ATOM   2374 C  C     . THR A 1 290 ? 70.378  34.481 47.623  1.00 52.54  ? 467  THR A C     1 
ATOM   2375 O  O     . THR A 1 290 ? 70.391  33.344 48.043  1.00 53.75  ? 467  THR A O     1 
ATOM   2376 C  CB    . THR A 1 290 ? 69.450  34.831 45.277  1.00 54.34  ? 467  THR A CB    1 
ATOM   2377 O  OG1   . THR A 1 290 ? 70.581  35.622 44.900  1.00 53.51  ? 467  THR A OG1   1 
ATOM   2378 C  CG2   . THR A 1 290 ? 68.209  35.249 44.466  1.00 54.07  ? 467  THR A CG2   1 
ATOM   2379 N  N     . VAL A 1 291 ? 71.339  35.339 47.930  1.00 51.10  ? 468  VAL A N     1 
ATOM   2380 C  CA    . VAL A 1 291 ? 72.451  34.887 48.754  1.00 50.36  ? 468  VAL A CA    1 
ATOM   2381 C  C     . VAL A 1 291 ? 71.872  34.348 50.061  1.00 51.02  ? 468  VAL A C     1 
ATOM   2382 O  O     . VAL A 1 291 ? 72.365  33.357 50.621  1.00 49.72  ? 468  VAL A O     1 
ATOM   2383 C  CB    . VAL A 1 291 ? 73.494  36.018 48.998  1.00 50.20  ? 468  VAL A CB    1 
ATOM   2384 C  CG1   . VAL A 1 291 ? 74.317  35.761 50.249  1.00 47.81  ? 468  VAL A CG1   1 
ATOM   2385 C  CG2   . VAL A 1 291 ? 74.412  36.172 47.777  1.00 48.83  ? 468  VAL A CG2   1 
ATOM   2386 N  N     . THR A 1 292 ? 70.782  34.966 50.510  1.00 50.93  ? 469  THR A N     1 
ATOM   2387 C  CA    . THR A 1 292 ? 70.226  34.625 51.805  1.00 51.10  ? 469  THR A CA    1 
ATOM   2388 C  C     . THR A 1 292 ? 69.625  33.247 51.825  1.00 50.57  ? 469  THR A C     1 
ATOM   2389 O  O     . THR A 1 292 ? 69.564  32.615 52.874  1.00 50.51  ? 469  THR A O     1 
ATOM   2390 C  CB    . THR A 1 292 ? 69.180  35.621 52.252  1.00 51.58  ? 469  THR A CB    1 
ATOM   2391 O  OG1   . THR A 1 292 ? 69.810  36.895 52.446  1.00 53.12  ? 469  THR A OG1   1 
ATOM   2392 C  CG2   . THR A 1 292 ? 68.518  35.147 53.566  1.00 51.23  ? 469  THR A CG2   1 
ATOM   2393 N  N     . LYS A 1 293 ? 69.212  32.765 50.666  1.00 50.43  ? 470  LYS A N     1 
ATOM   2394 C  CA    . LYS A 1 293 ? 68.729  31.393 50.565  1.00 51.27  ? 470  LYS A CA    1 
ATOM   2395 C  C     . LYS A 1 293 ? 69.777  30.362 50.955  1.00 49.51  ? 470  LYS A C     1 
ATOM   2396 O  O     . LYS A 1 293 ? 69.440  29.316 51.471  1.00 49.46  ? 470  LYS A O     1 
ATOM   2397 C  CB    . LYS A 1 293 ? 68.253  31.111 49.151  1.00 52.86  ? 470  LYS A CB    1 
ATOM   2398 C  CG    . LYS A 1 293 ? 66.980  31.884 48.744  1.00 57.26  ? 470  LYS A CG    1 
ATOM   2399 C  CD    . LYS A 1 293 ? 66.581  31.554 47.280  1.00 63.34  ? 470  LYS A CD    1 
ATOM   2400 C  CE    . LYS A 1 293 ? 65.327  32.317 46.850  1.00 66.14  ? 470  LYS A CE    1 
ATOM   2401 N  NZ    . LYS A 1 293 ? 64.193  32.049 47.801  1.00 66.60  ? 470  LYS A NZ    1 
ATOM   2402 N  N     . LEU A 1 294 ? 71.044  30.673 50.713  1.00 48.39  ? 471  LEU A N     1 
ATOM   2403 C  CA    . LEU A 1 294 ? 72.171  29.834 51.121  1.00 47.53  ? 471  LEU A CA    1 
ATOM   2404 C  C     . LEU A 1 294 ? 72.671  30.156 52.528  1.00 47.02  ? 471  LEU A C     1 
ATOM   2405 O  O     . LEU A 1 294 ? 73.105  29.257 53.251  1.00 46.59  ? 471  LEU A O     1 
ATOM   2406 C  CB    . LEU A 1 294 ? 73.340  30.058 50.152  1.00 47.19  ? 471  LEU A CB    1 
ATOM   2407 C  CG    . LEU A 1 294 ? 73.641  29.011 49.081  1.00 47.24  ? 471  LEU A CG    1 
ATOM   2408 C  CD1   . LEU A 1 294 ? 72.453  28.138 48.753  1.00 42.49  ? 471  LEU A CD1   1 
ATOM   2409 C  CD2   . LEU A 1 294 ? 74.176  29.718 47.854  1.00 45.81  ? 471  LEU A CD2   1 
ATOM   2410 N  N     . PHE A 1 295 ? 72.653  31.442 52.874  1.00 46.57  ? 472  PHE A N     1 
ATOM   2411 C  CA    . PHE A 1 295 ? 73.153  31.943 54.145  1.00 46.69  ? 472  PHE A CA    1 
ATOM   2412 C  C     . PHE A 1 295 ? 72.100  32.855 54.786  1.00 46.88  ? 472  PHE A C     1 
ATOM   2413 O  O     . PHE A 1 295 ? 72.066  34.050 54.517  1.00 47.78  ? 472  PHE A O     1 
ATOM   2414 C  CB    . PHE A 1 295 ? 74.452  32.723 53.920  1.00 46.23  ? 472  PHE A CB    1 
ATOM   2415 C  CG    . PHE A 1 295 ? 75.468  31.968 53.133  1.00 46.45  ? 472  PHE A CG    1 
ATOM   2416 C  CD1   . PHE A 1 295 ? 75.741  32.308 51.811  1.00 47.48  ? 472  PHE A CD1   1 
ATOM   2417 C  CD2   . PHE A 1 295 ? 76.153  30.901 53.704  1.00 44.68  ? 472  PHE A CD2   1 
ATOM   2418 C  CE1   . PHE A 1 295 ? 76.688  31.587 51.069  1.00 47.10  ? 472  PHE A CE1   1 
ATOM   2419 C  CE2   . PHE A 1 295 ? 77.090  30.177 52.974  1.00 45.48  ? 472  PHE A CE2   1 
ATOM   2420 C  CZ    . PHE A 1 295 ? 77.352  30.510 51.655  1.00 46.14  ? 472  PHE A CZ    1 
ATOM   2421 N  N     . PRO A 1 296 ? 71.230  32.293 55.627  1.00 47.33  ? 473  PRO A N     1 
ATOM   2422 C  CA    . PRO A 1 296 ? 70.119  33.023 56.235  1.00 47.61  ? 473  PRO A CA    1 
ATOM   2423 C  C     . PRO A 1 296 ? 70.534  34.170 57.152  1.00 47.89  ? 473  PRO A C     1 
ATOM   2424 O  O     . PRO A 1 296 ? 69.820  35.167 57.272  1.00 48.04  ? 473  PRO A O     1 
ATOM   2425 C  CB    . PRO A 1 296 ? 69.419  31.952 57.063  1.00 46.45  ? 473  PRO A CB    1 
ATOM   2426 C  CG    . PRO A 1 296 ? 69.843  30.709 56.479  1.00 46.80  ? 473  PRO A CG    1 
ATOM   2427 C  CD    . PRO A 1 296 ? 71.214  30.881 56.022  1.00 47.09  ? 473  PRO A CD    1 
ATOM   2428 N  N     . MET A 1 297 ? 71.665  34.019 57.818  1.00 47.89  ? 474  MET A N     1 
ATOM   2429 C  CA    . MET A 1 297 ? 72.149  35.069 58.679  1.00 48.58  ? 474  MET A CA    1 
ATOM   2430 C  C     . MET A 1 297 ? 72.386  36.350 57.878  1.00 48.59  ? 474  MET A C     1 
ATOM   2431 O  O     . MET A 1 297 ? 72.422  37.450 58.439  1.00 49.62  ? 474  MET A O     1 
ATOM   2432 C  CB    . MET A 1 297 ? 73.416  34.622 59.368  1.00 48.78  ? 474  MET A CB    1 
ATOM   2433 C  CG    . MET A 1 297 ? 74.501  34.138 58.394  1.00 52.35  ? 474  MET A CG    1 
ATOM   2434 S  SD    . MET A 1 297 ? 74.241  32.487 57.662  1.00 57.14  ? 474  MET A SD    1 
ATOM   2435 C  CE    . MET A 1 297 ? 74.555  31.415 59.069  1.00 52.47  ? 474  MET A CE    1 
ATOM   2436 N  N     . VAL A 1 298 ? 72.482  36.236 56.559  1.00 48.32  ? 475  VAL A N     1 
ATOM   2437 C  CA    . VAL A 1 298 ? 72.611  37.428 55.739  1.00 48.09  ? 475  VAL A CA    1 
ATOM   2438 C  C     . VAL A 1 298 ? 71.386  38.340 55.818  1.00 49.27  ? 475  VAL A C     1 
ATOM   2439 O  O     . VAL A 1 298 ? 71.480  39.545 55.632  1.00 49.13  ? 475  VAL A O     1 
ATOM   2440 C  CB    . VAL A 1 298 ? 72.940  37.082 54.292  1.00 47.85  ? 475  VAL A CB    1 
ATOM   2441 C  CG1   . VAL A 1 298 ? 72.624  38.267 53.374  1.00 43.97  ? 475  VAL A CG1   1 
ATOM   2442 C  CG2   . VAL A 1 298 ? 74.426  36.657 54.190  1.00 46.05  ? 475  VAL A CG2   1 
ATOM   2443 N  N     . GLU A 1 299 ? 70.223  37.781 56.102  1.00 50.51  ? 476  GLU A N     1 
ATOM   2444 C  CA    . GLU A 1 299 ? 69.012  38.600 56.034  1.00 51.16  ? 476  GLU A CA    1 
ATOM   2445 C  C     . GLU A 1 299 ? 69.075  39.695 57.080  1.00 51.42  ? 476  GLU A C     1 
ATOM   2446 O  O     . GLU A 1 299 ? 68.838  40.853 56.793  1.00 51.73  ? 476  GLU A O     1 
ATOM   2447 C  CB    . GLU A 1 299 ? 67.733  37.777 56.226  1.00 50.63  ? 476  GLU A CB    1 
ATOM   2448 C  CG    . GLU A 1 299 ? 66.524  38.659 56.308  1.00 50.37  ? 476  GLU A CG    1 
ATOM   2449 C  CD    . GLU A 1 299 ? 65.234  37.917 56.295  1.00 49.67  ? 476  GLU A CD    1 
ATOM   2450 O  OE1   . GLU A 1 299 ? 65.218  36.716 56.565  1.00 54.77  ? 476  GLU A OE1   1 
ATOM   2451 O  OE2   . GLU A 1 299 ? 64.211  38.534 56.014  1.00 51.24  ? 476  GLU A OE2   1 
ATOM   2452 N  N     . GLU A 1 300 ? 69.403  39.317 58.299  1.00 51.80  ? 477  GLU A N     1 
ATOM   2453 C  CA    . GLU A 1 300 ? 69.377  40.254 59.402  1.00 52.69  ? 477  GLU A CA    1 
ATOM   2454 C  C     . GLU A 1 300 ? 70.497  41.271 59.275  1.00 51.74  ? 477  GLU A C     1 
ATOM   2455 O  O     . GLU A 1 300 ? 70.284  42.448 59.551  1.00 51.71  ? 477  GLU A O     1 
ATOM   2456 C  CB    . GLU A 1 300 ? 69.463  39.481 60.719  1.00 53.82  ? 477  GLU A CB    1 
ATOM   2457 C  CG    . GLU A 1 300 ? 69.456  40.287 62.008  1.00 57.33  ? 477  GLU A CG    1 
ATOM   2458 C  CD    . GLU A 1 300 ? 69.549  39.356 63.221  1.00 61.27  ? 477  GLU A CD    1 
ATOM   2459 O  OE1   . GLU A 1 300 ? 68.530  38.687 63.522  1.00 65.33  ? 477  GLU A OE1   1 
ATOM   2460 O  OE2   . GLU A 1 300 ? 70.644  39.248 63.821  1.00 58.46  ? 477  GLU A OE2   1 
ATOM   2461 N  N     . ILE A 1 301 ? 71.679  40.826 58.857  1.00 51.03  ? 478  ILE A N     1 
ATOM   2462 C  CA    . ILE A 1 301 ? 72.860  41.686 58.914  1.00 50.59  ? 478  ILE A CA    1 
ATOM   2463 C  C     . ILE A 1 301 ? 72.903  42.635 57.736  1.00 51.70  ? 478  ILE A C     1 
ATOM   2464 O  O     . ILE A 1 301 ? 73.398  43.760 57.863  1.00 52.98  ? 478  ILE A O     1 
ATOM   2465 C  CB    . ILE A 1 301 ? 74.163  40.885 58.935  1.00 50.12  ? 478  ILE A CB    1 
ATOM   2466 C  CG1   . ILE A 1 301 ? 74.200  40.008 60.182  1.00 49.25  ? 478  ILE A CG1   1 
ATOM   2467 C  CG2   . ILE A 1 301 ? 75.369  41.811 58.842  1.00 45.66  ? 478  ILE A CG2   1 
ATOM   2468 C  CD1   . ILE A 1 301 ? 73.462  40.590 61.379  1.00 46.38  ? 478  ILE A CD1   1 
ATOM   2469 N  N     . MET A 1 302 ? 72.377  42.194 56.598  1.00 51.80  ? 479  MET A N     1 
ATOM   2470 C  CA    . MET A 1 302 ? 72.574  42.916 55.341  1.00 52.05  ? 479  MET A CA    1 
ATOM   2471 C  C     . MET A 1 302 ? 71.322  43.308 54.572  1.00 51.22  ? 479  MET A C     1 
ATOM   2472 O  O     . MET A 1 302 ? 71.289  44.377 53.990  1.00 50.88  ? 479  MET A O     1 
ATOM   2473 C  CB    . MET A 1 302 ? 73.540  42.134 54.473  1.00 52.63  ? 479  MET A CB    1 
ATOM   2474 C  CG    . MET A 1 302 ? 74.850  42.047 55.200  1.00 54.77  ? 479  MET A CG    1 
ATOM   2475 S  SD    . MET A 1 302 ? 75.938  40.883 54.505  1.00 64.22  ? 479  MET A SD    1 
ATOM   2476 C  CE    . MET A 1 302 ? 76.815  41.863 53.249  1.00 56.07  ? 479  MET A CE    1 
ATOM   2477 N  N     . LEU A 1 303 ? 70.278  42.490 54.601  1.00 50.77  ? 480  LEU A N     1 
ATOM   2478 C  CA    . LEU A 1 303 ? 69.031  42.897 53.995  1.00 50.06  ? 480  LEU A CA    1 
ATOM   2479 C  C     . LEU A 1 303 ? 68.372  44.002 54.831  1.00 50.12  ? 480  LEU A C     1 
ATOM   2480 O  O     . LEU A 1 303 ? 67.767  44.933 54.274  1.00 50.38  ? 480  LEU A O     1 
ATOM   2481 C  CB    . LEU A 1 303 ? 68.112  41.701 53.816  1.00 50.09  ? 480  LEU A CB    1 
ATOM   2482 C  CG    . LEU A 1 303 ? 67.730  41.171 52.421  1.00 50.68  ? 480  LEU A CG    1 
ATOM   2483 C  CD1   . LEU A 1 303 ? 68.629  41.664 51.301  1.00 49.36  ? 480  LEU A CD1   1 
ATOM   2484 C  CD2   . LEU A 1 303 ? 67.640  39.612 52.428  1.00 48.94  ? 480  LEU A CD2   1 
ATOM   2485 N  N     . GLN A 1 304 ? 68.509  43.946 56.155  1.00 49.50  ? 481  GLN A N     1 
ATOM   2486 C  CA    . GLN A 1 304 ? 67.822  44.938 56.989  1.00 50.28  ? 481  GLN A CA    1 
ATOM   2487 C  C     . GLN A 1 304 ? 68.323  46.363 56.714  1.00 49.16  ? 481  GLN A C     1 
ATOM   2488 O  O     . GLN A 1 304 ? 67.528  47.254 56.434  1.00 48.82  ? 481  GLN A O     1 
ATOM   2489 C  CB    . GLN A 1 304 ? 67.915  44.610 58.483  1.00 51.41  ? 481  GLN A CB    1 
ATOM   2490 C  CG    . GLN A 1 304 ? 66.668  43.911 59.075  1.00 55.70  ? 481  GLN A CG    1 
ATOM   2491 C  CD    . GLN A 1 304 ? 66.924  43.297 60.471  1.00 61.66  ? 481  GLN A CD    1 
ATOM   2492 O  OE1   . GLN A 1 304 ? 67.526  43.942 61.331  1.00 65.15  ? 481  GLN A OE1   1 
ATOM   2493 N  NE2   . GLN A 1 304 ? 66.476  42.047 60.685  1.00 61.36  ? 481  GLN A NE2   1 
ATOM   2494 N  N     . PRO A 1 305 ? 69.641  46.581 56.781  1.00 47.84  ? 482  PRO A N     1 
ATOM   2495 C  CA    . PRO A 1 305 ? 70.148  47.899 56.448  1.00 47.55  ? 482  PRO A CA    1 
ATOM   2496 C  C     . PRO A 1 305 ? 69.698  48.363 55.058  1.00 47.67  ? 482  PRO A C     1 
ATOM   2497 O  O     . PRO A 1 305 ? 69.389  49.546 54.879  1.00 47.74  ? 482  PRO A O     1 
ATOM   2498 C  CB    . PRO A 1 305 ? 71.673  47.731 56.472  1.00 47.63  ? 482  PRO A CB    1 
ATOM   2499 C  CG    . PRO A 1 305 ? 71.956  46.477 57.129  1.00 47.64  ? 482  PRO A CG    1 
ATOM   2500 C  CD    . PRO A 1 305 ? 70.699  45.649 57.191  1.00 47.98  ? 482  PRO A CD    1 
ATOM   2501 N  N     . LEU A 1 306 ? 69.659  47.442 54.090  1.00 46.75  ? 483  LEU A N     1 
ATOM   2502 C  CA    . LEU A 1 306 ? 69.186  47.772 52.758  1.00 46.45  ? 483  LEU A CA    1 
ATOM   2503 C  C     . LEU A 1 306 ? 67.728  48.224 52.791  1.00 47.41  ? 483  LEU A C     1 
ATOM   2504 O  O     . LEU A 1 306 ? 67.363  49.202 52.127  1.00 48.48  ? 483  LEU A O     1 
ATOM   2505 C  CB    . LEU A 1 306 ? 69.348  46.602 51.800  1.00 45.60  ? 483  LEU A CB    1 
ATOM   2506 C  CG    . LEU A 1 306 ? 70.801  46.302 51.456  1.00 44.03  ? 483  LEU A CG    1 
ATOM   2507 C  CD1   . LEU A 1 306 ? 70.807  45.081 50.587  1.00 40.89  ? 483  LEU A CD1   1 
ATOM   2508 C  CD2   . LEU A 1 306 ? 71.498  47.492 50.777  1.00 42.41  ? 483  LEU A CD2   1 
ATOM   2509 N  N     . TRP A 1 307 ? 66.888  47.541 53.562  1.00 47.22  ? 484  TRP A N     1 
ATOM   2510 C  CA    . TRP A 1 307 ? 65.500  47.978 53.674  1.00 47.39  ? 484  TRP A CA    1 
ATOM   2511 C  C     . TRP A 1 307 ? 65.419  49.362 54.261  1.00 47.40  ? 484  TRP A C     1 
ATOM   2512 O  O     . TRP A 1 307 ? 64.648  50.193 53.783  1.00 47.48  ? 484  TRP A O     1 
ATOM   2513 C  CB    . TRP A 1 307 ? 64.680  47.036 54.548  1.00 47.70  ? 484  TRP A CB    1 
ATOM   2514 C  CG    . TRP A 1 307 ? 64.605  45.618 54.020  1.00 48.74  ? 484  TRP A CG    1 
ATOM   2515 C  CD1   . TRP A 1 307 ? 64.672  45.218 52.714  1.00 48.07  ? 484  TRP A CD1   1 
ATOM   2516 C  CD2   . TRP A 1 307 ? 64.401  44.431 54.789  1.00 47.23  ? 484  TRP A CD2   1 
ATOM   2517 N  NE1   . TRP A 1 307 ? 64.561  43.857 52.626  1.00 47.62  ? 484  TRP A NE1   1 
ATOM   2518 C  CE2   . TRP A 1 307 ? 64.372  43.347 53.881  1.00 48.06  ? 484  TRP A CE2   1 
ATOM   2519 C  CE3   . TRP A 1 307 ? 64.240  44.178 56.157  1.00 47.37  ? 484  TRP A CE3   1 
ATOM   2520 C  CZ2   . TRP A 1 307 ? 64.190  42.022 54.295  1.00 49.84  ? 484  TRP A CZ2   1 
ATOM   2521 C  CZ3   . TRP A 1 307 ? 64.065  42.864 56.578  1.00 48.42  ? 484  TRP A CZ3   1 
ATOM   2522 C  CH2   . TRP A 1 307 ? 64.036  41.798 55.647  1.00 49.03  ? 484  TRP A CH2   1 
ATOM   2523 N  N     . GLU A 1 308 ? 66.194  49.592 55.311  1.00 47.44  ? 485  GLU A N     1 
ATOM   2524 C  CA    . GLU A 1 308 ? 66.209  50.890 55.976  1.00 48.83  ? 485  GLU A CA    1 
ATOM   2525 C  C     . GLU A 1 308 ? 66.704  52.006 55.062  1.00 48.51  ? 485  GLU A C     1 
ATOM   2526 O  O     . GLU A 1 308 ? 66.163  53.113 55.085  1.00 48.50  ? 485  GLU A O     1 
ATOM   2527 C  CB    . GLU A 1 308 ? 67.089  50.853 57.209  1.00 49.62  ? 485  GLU A CB    1 
ATOM   2528 C  CG    . GLU A 1 308 ? 66.540  49.964 58.298  1.00 54.13  ? 485  GLU A CG    1 
ATOM   2529 C  CD    . GLU A 1 308 ? 67.427  49.928 59.524  1.00 59.27  ? 485  GLU A CD    1 
ATOM   2530 O  OE1   . GLU A 1 308 ? 68.053  50.973 59.830  1.00 62.93  ? 485  GLU A OE1   1 
ATOM   2531 O  OE2   . GLU A 1 308 ? 67.467  48.864 60.185  1.00 61.55  ? 485  GLU A OE2   1 
ATOM   2532 N  N     . SER A 1 309 ? 67.711  51.703 54.247  1.00 47.69  ? 486  SER A N     1 
ATOM   2533 C  CA    . SER A 1 309 ? 68.273  52.687 53.344  1.00 47.35  ? 486  SER A CA    1 
ATOM   2534 C  C     . SER A 1 309 ? 67.291  53.019 52.239  1.00 47.28  ? 486  SER A C     1 
ATOM   2535 O  O     . SER A 1 309 ? 67.025  54.201 51.965  1.00 47.28  ? 486  SER A O     1 
ATOM   2536 C  CB    . SER A 1 309 ? 69.586  52.194 52.745  1.00 47.55  ? 486  SER A CB    1 
ATOM   2537 O  OG    . SER A 1 309 ? 70.306  53.281 52.205  1.00 47.39  ? 486  SER A OG    1 
ATOM   2538 N  N     . ARG A 1 310 ? 66.714  51.981 51.641  1.00 46.40  ? 487  ARG A N     1 
ATOM   2539 C  CA    . ARG A 1 310 ? 65.665  52.175 50.654  1.00 45.97  ? 487  ARG A CA    1 
ATOM   2540 C  C     . ARG A 1 310 ? 64.633  53.196 51.170  1.00 45.89  ? 487  ARG A C     1 
ATOM   2541 O  O     . ARG A 1 310 ? 64.300  54.188 50.499  1.00 45.66  ? 487  ARG A O     1 
ATOM   2542 C  CB    . ARG A 1 310 ? 64.999  50.833 50.354  1.00 45.59  ? 487  ARG A CB    1 
ATOM   2543 C  CG    . ARG A 1 310 ? 63.766  50.927 49.472  1.00 46.82  ? 487  ARG A CG    1 
ATOM   2544 C  CD    . ARG A 1 310 ? 62.819  49.772 49.700  1.00 46.71  ? 487  ARG A CD    1 
ATOM   2545 N  NE    . ARG A 1 310 ? 62.405  49.650 51.100  1.00 46.55  ? 487  ARG A NE    1 
ATOM   2546 C  CZ    . ARG A 1 310 ? 62.134  48.491 51.698  1.00 48.66  ? 487  ARG A CZ    1 
ATOM   2547 N  NH1   . ARG A 1 310 ? 62.270  47.342 51.049  1.00 49.92  ? 487  ARG A NH1   1 
ATOM   2548 N  NH2   . ARG A 1 310 ? 61.776  48.467 52.967  1.00 49.32  ? 487  ARG A NH2   1 
ATOM   2549 N  N     . ASP A 1 311 ? 64.161  52.966 52.389  1.00 45.85  ? 488  ASP A N     1 
ATOM   2550 C  CA    . ASP A 1 311 ? 63.063  53.760 52.944  1.00 45.32  ? 488  ASP A CA    1 
ATOM   2551 C  C     . ASP A 1 311 ? 63.467  55.200 53.221  1.00 45.22  ? 488  ASP A C     1 
ATOM   2552 O  O     . ASP A 1 311 ? 62.668  56.133 53.064  1.00 44.60  ? 488  ASP A O     1 
ATOM   2553 C  CB    . ASP A 1 311 ? 62.561  53.123 54.249  1.00 45.47  ? 488  ASP A CB    1 
ATOM   2554 C  CG    . ASP A 1 311 ? 61.761  51.836 54.017  1.00 43.75  ? 488  ASP A CG    1 
ATOM   2555 O  OD1   . ASP A 1 311 ? 61.362  51.514 52.868  1.00 43.89  ? 488  ASP A OD1   1 
ATOM   2556 O  OD2   . ASP A 1 311 ? 61.510  51.159 55.011  1.00 42.00  ? 488  ASP A OD2   1 
ATOM   2557 N  N     . ARG A 1 312 ? 64.706  55.373 53.672  1.00 45.43  ? 489  ARG A N     1 
ATOM   2558 C  CA    . ARG A 1 312 ? 65.259  56.702 53.927  1.00 45.54  ? 489  ARG A CA    1 
ATOM   2559 C  C     . ARG A 1 312 ? 65.459  57.491 52.625  1.00 44.88  ? 489  ARG A C     1 
ATOM   2560 O  O     . ARG A 1 312 ? 65.165  58.683 52.549  1.00 43.69  ? 489  ARG A O     1 
ATOM   2561 C  CB    . ARG A 1 312 ? 66.576  56.598 54.711  1.00 45.60  ? 489  ARG A CB    1 
ATOM   2562 C  CG    . ARG A 1 312 ? 67.472  57.844 54.620  1.00 49.00  ? 489  ARG A CG    1 
ATOM   2563 C  CD    . ARG A 1 312 ? 68.621  57.814 55.628  1.00 51.57  ? 489  ARG A CD    1 
ATOM   2564 N  NE    . ARG A 1 312 ? 69.407  59.057 55.611  1.00 57.50  ? 489  ARG A NE    1 
ATOM   2565 C  CZ    . ARG A 1 312 ? 70.274  59.402 54.651  1.00 59.61  ? 489  ARG A CZ    1 
ATOM   2566 N  NH1   . ARG A 1 312 ? 70.487  58.607 53.601  1.00 60.77  ? 489  ARG A NH1   1 
ATOM   2567 N  NH2   . ARG A 1 312 ? 70.951  60.543 54.746  1.00 59.45  ? 489  ARG A NH2   1 
ATOM   2568 N  N     . TYR A 1 313 ? 65.938  56.829 51.587  1.00 44.95  ? 490  TYR A N     1 
ATOM   2569 C  CA    . TYR A 1 313 ? 66.107  57.531 50.331  1.00 45.10  ? 490  TYR A CA    1 
ATOM   2570 C  C     . TYR A 1 313 ? 64.763  57.914 49.746  1.00 46.02  ? 490  TYR A C     1 
ATOM   2571 O  O     . TYR A 1 313 ? 64.599  59.001 49.209  1.00 46.62  ? 490  TYR A O     1 
ATOM   2572 C  CB    . TYR A 1 313 ? 66.983  56.741 49.368  1.00 44.35  ? 490  TYR A CB    1 
ATOM   2573 C  CG    . TYR A 1 313 ? 68.458  56.928 49.692  1.00 43.20  ? 490  TYR A CG    1 
ATOM   2574 C  CD1   . TYR A 1 313 ? 69.009  58.203 49.724  1.00 43.38  ? 490  TYR A CD1   1 
ATOM   2575 C  CD2   . TYR A 1 313 ? 69.282  55.853 50.007  1.00 41.83  ? 490  TYR A CD2   1 
ATOM   2576 C  CE1   . TYR A 1 313 ? 70.324  58.406 50.040  1.00 43.23  ? 490  TYR A CE1   1 
ATOM   2577 C  CE2   . TYR A 1 313 ? 70.611  56.038 50.317  1.00 42.99  ? 490  TYR A CE2   1 
ATOM   2578 C  CZ    . TYR A 1 313 ? 71.131  57.326 50.323  1.00 46.25  ? 490  TYR A CZ    1 
ATOM   2579 O  OH    . TYR A 1 313 ? 72.451  57.576 50.635  1.00 48.61  ? 490  TYR A OH    1 
ATOM   2580 N  N     . GLU A 1 314 ? 63.768  57.068 49.959  1.00 47.27  ? 491  GLU A N     1 
ATOM   2581 C  CA    . GLU A 1 314 ? 62.402  57.405 49.555  1.00 47.57  ? 491  GLU A CA    1 
ATOM   2582 C  C     . GLU A 1 314 ? 61.882  58.647 50.257  1.00 46.07  ? 491  GLU A C     1 
ATOM   2583 O  O     . GLU A 1 314 ? 61.258  59.493 49.630  1.00 44.64  ? 491  GLU A O     1 
ATOM   2584 C  CB    . GLU A 1 314 ? 61.454  56.201 49.726  1.00 48.01  ? 491  GLU A CB    1 
ATOM   2585 C  CG    . GLU A 1 314 ? 61.349  55.368 48.409  1.00 52.69  ? 491  GLU A CG    1 
ATOM   2586 C  CD    . GLU A 1 314 ? 60.852  53.921 48.586  1.00 57.12  ? 491  GLU A CD    1 
ATOM   2587 O  OE1   . GLU A 1 314 ? 60.815  53.208 47.554  1.00 60.49  ? 491  GLU A OE1   1 
ATOM   2588 O  OE2   . GLU A 1 314 ? 60.495  53.504 49.723  1.00 59.96  ? 491  GLU A OE2   1 
ATOM   2589 N  N     . GLU A 1 315 ? 62.153  58.755 51.553  1.00 45.76  ? 492  GLU A N     1 
ATOM   2590 C  CA    . GLU A 1 315 ? 61.817  59.968 52.305  1.00 45.57  ? 492  GLU A CA    1 
ATOM   2591 C  C     . GLU A 1 315 ? 62.533  61.197 51.733  1.00 44.63  ? 492  GLU A C     1 
ATOM   2592 O  O     . GLU A 1 315 ? 61.915  62.240 51.500  1.00 43.44  ? 492  GLU A O     1 
ATOM   2593 C  CB    . GLU A 1 315 ? 62.194  59.811 53.781  1.00 45.80  ? 492  GLU A CB    1 
ATOM   2594 C  CG    . GLU A 1 315 ? 61.159  59.086 54.638  1.00 48.12  ? 492  GLU A CG    1 
ATOM   2595 C  CD    . GLU A 1 315 ? 61.707  58.669 56.023  1.00 50.36  ? 492  GLU A CD    1 
ATOM   2596 O  OE1   . GLU A 1 315 ? 61.951  57.454 56.235  1.00 52.97  ? 492  GLU A OE1   1 
ATOM   2597 O  OE2   . GLU A 1 315 ? 61.889  59.542 56.899  1.00 48.73  ? 492  GLU A OE2   1 
ATOM   2598 N  N     . LEU A 1 316 ? 63.839  61.056 51.527  1.00 44.24  ? 493  LEU A N     1 
ATOM   2599 C  CA    . LEU A 1 316 ? 64.687  62.150 51.068  1.00 44.20  ? 493  LEU A CA    1 
ATOM   2600 C  C     . LEU A 1 316 ? 64.237  62.679 49.724  1.00 43.75  ? 493  LEU A C     1 
ATOM   2601 O  O     . LEU A 1 316 ? 64.281  63.890 49.471  1.00 43.67  ? 493  LEU A O     1 
ATOM   2602 C  CB    . LEU A 1 316 ? 66.126  61.671 50.923  1.00 44.86  ? 493  LEU A CB    1 
ATOM   2603 C  CG    . LEU A 1 316 ? 67.117  62.703 50.379  1.00 44.67  ? 493  LEU A CG    1 
ATOM   2604 C  CD1   . LEU A 1 316 ? 67.097  63.968 51.231  1.00 37.57  ? 493  LEU A CD1   1 
ATOM   2605 C  CD2   . LEU A 1 316 ? 68.521  62.058 50.311  1.00 44.37  ? 493  LEU A CD2   1 
ATOM   2606 N  N     . LYS A 1 317 ? 63.857  61.750 48.854  1.00 42.85  ? 494  LYS A N     1 
ATOM   2607 C  CA    . LYS A 1 317 ? 63.289  62.096 47.581  1.00 42.58  ? 494  LYS A CA    1 
ATOM   2608 C  C     . LYS A 1 317 ? 62.025  62.907 47.732  1.00 42.26  ? 494  LYS A C     1 
ATOM   2609 O  O     . LYS A 1 317 ? 61.834  63.851 47.002  1.00 41.10  ? 494  LYS A O     1 
ATOM   2610 C  CB    . LYS A 1 317 ? 62.973  60.852 46.756  1.00 42.66  ? 494  LYS A CB    1 
ATOM   2611 C  CG    . LYS A 1 317 ? 62.497  61.203 45.344  1.00 44.18  ? 494  LYS A CG    1 
ATOM   2612 C  CD    . LYS A 1 317 ? 62.088  59.988 44.534  1.00 46.26  ? 494  LYS A CD    1 
ATOM   2613 C  CE    . LYS A 1 317 ? 61.802  60.347 43.076  1.00 46.46  ? 494  LYS A CE    1 
ATOM   2614 N  NZ    . LYS A 1 317 ? 60.803  61.455 42.959  1.00 47.61  ? 494  LYS A NZ    1 
ATOM   2615 N  N     . ARG A 1 318 ? 61.136  62.515 48.636  1.00 43.38  ? 495  ARG A N     1 
ATOM   2616 C  CA    . ARG A 1 318 ? 59.898  63.262 48.825  1.00 45.44  ? 495  ARG A CA    1 
ATOM   2617 C  C     . ARG A 1 318 ? 60.272  64.749 49.054  1.00 45.71  ? 495  ARG A C     1 
ATOM   2618 O  O     . ARG A 1 318 ? 59.655  65.662 48.492  1.00 45.25  ? 495  ARG A O     1 
ATOM   2619 C  CB    . ARG A 1 318 ? 59.092  62.683 49.997  1.00 46.65  ? 495  ARG A CB    1 
ATOM   2620 C  CG    . ARG A 1 318 ? 57.546  62.567 49.792  1.00 52.83  ? 495  ARG A CG    1 
ATOM   2621 C  CD    . ARG A 1 318 ? 56.828  61.742 50.921  1.00 59.41  ? 495  ARG A CD    1 
ATOM   2622 N  NE    . ARG A 1 318 ? 57.135  60.297 50.798  1.00 66.76  ? 495  ARG A NE    1 
ATOM   2623 C  CZ    . ARG A 1 318 ? 57.707  59.512 51.738  1.00 70.05  ? 495  ARG A CZ    1 
ATOM   2624 N  NH1   . ARG A 1 318 ? 57.996  59.970 52.967  1.00 68.60  ? 495  ARG A NH1   1 
ATOM   2625 N  NH2   . ARG A 1 318 ? 57.976  58.229 51.451  1.00 68.87  ? 495  ARG A NH2   1 
ATOM   2626 N  N     . ILE A 1 319 ? 61.356  64.983 49.789  1.00 46.52  ? 496  ILE A N     1 
ATOM   2627 C  CA    . ILE A 1 319 ? 61.725  66.345 50.180  1.00 47.21  ? 496  ILE A CA    1 
ATOM   2628 C  C     . ILE A 1 319 ? 62.569  67.058 49.115  1.00 46.09  ? 496  ILE A C     1 
ATOM   2629 O  O     . ILE A 1 319 ? 62.408  68.264 48.921  1.00 45.49  ? 496  ILE A O     1 
ATOM   2630 C  CB    . ILE A 1 319 ? 62.394  66.411 51.606  1.00 47.47  ? 496  ILE A CB    1 
ATOM   2631 C  CG1   . ILE A 1 319 ? 61.486  67.153 52.620  1.00 50.92  ? 496  ILE A CG1   1 
ATOM   2632 C  CG2   . ILE A 1 319 ? 63.649  67.220 51.547  1.00 49.38  ? 496  ILE A CG2   1 
ATOM   2633 C  CD1   . ILE A 1 319 ? 60.088  66.464 52.981  1.00 52.78  ? 496  ILE A CD1   1 
ATOM   2634 N  N     . ASP A 1 320 ? 63.433  66.325 48.415  1.00 45.16  ? 497  ASP A N     1 
ATOM   2635 C  CA    . ASP A 1 320 ? 64.135  66.883 47.240  1.00 45.81  ? 497  ASP A CA    1 
ATOM   2636 C  C     . ASP A 1 320 ? 63.183  67.430 46.188  1.00 45.52  ? 497  ASP A C     1 
ATOM   2637 O  O     . ASP A 1 320 ? 63.477  68.434 45.530  1.00 44.73  ? 497  ASP A O     1 
ATOM   2638 C  CB    . ASP A 1 320 ? 64.986  65.831 46.535  1.00 46.07  ? 497  ASP A CB    1 
ATOM   2639 C  CG    . ASP A 1 320 ? 66.360  65.676 47.137  1.00 49.81  ? 497  ASP A CG    1 
ATOM   2640 O  OD1   . ASP A 1 320 ? 66.756  66.535 47.958  1.00 56.20  ? 497  ASP A OD1   1 
ATOM   2641 O  OD2   . ASP A 1 320 ? 67.053  64.685 46.780  1.00 55.65  ? 497  ASP A OD2   1 
ATOM   2642 N  N     . ASP A 1 321 ? 62.103  66.682 45.975  1.00 45.67  ? 498  ASP A N     1 
ATOM   2643 C  CA    . ASP A 1 321 ? 61.135  66.955 44.940  1.00 45.93  ? 498  ASP A CA    1 
ATOM   2644 C  C     . ASP A 1 321 ? 60.390  68.225 45.325  1.00 46.79  ? 498  ASP A C     1 
ATOM   2645 O  O     . ASP A 1 321 ? 60.247  69.137 44.503  1.00 46.28  ? 498  ASP A O     1 
ATOM   2646 C  CB    . ASP A 1 321 ? 60.142  65.784 44.799  1.00 45.49  ? 498  ASP A CB    1 
ATOM   2647 C  CG    . ASP A 1 321 ? 60.697  64.595 43.989  1.00 46.35  ? 498  ASP A CG    1 
ATOM   2648 O  OD1   . ASP A 1 321 ? 61.832  64.614 43.441  1.00 44.10  ? 498  ASP A OD1   1 
ATOM   2649 O  OD2   . ASP A 1 321 ? 59.970  63.585 43.953  1.00 47.89  ? 498  ASP A OD2   1 
ATOM   2650 N  N     . ALA A 1 322 ? 59.921  68.270 46.573  1.00 47.97  ? 499  ALA A N     1 
ATOM   2651 C  CA    . ALA A 1 322 ? 59.297  69.464 47.129  1.00 49.54  ? 499  ALA A CA    1 
ATOM   2652 C  C     . ALA A 1 322 ? 60.218  70.635 46.868  1.00 51.68  ? 499  ALA A C     1 
ATOM   2653 O  O     . ALA A 1 322 ? 59.804  71.693 46.379  1.00 52.54  ? 499  ALA A O     1 
ATOM   2654 C  CB    . ALA A 1 322 ? 59.066  69.310 48.619  1.00 48.63  ? 499  ALA A CB    1 
ATOM   2655 N  N     . MET A 1 323 ? 61.491  70.427 47.152  1.00 53.91  ? 500  MET A N     1 
ATOM   2656 C  CA    . MET A 1 323 ? 62.419  71.524 47.176  1.00 55.93  ? 500  MET A CA    1 
ATOM   2657 C  C     . MET A 1 323 ? 62.526  72.087 45.764  1.00 55.69  ? 500  MET A C     1 
ATOM   2658 O  O     . MET A 1 323 ? 62.438  73.295 45.597  1.00 56.72  ? 500  MET A O     1 
ATOM   2659 C  CB    . MET A 1 323 ? 63.762  71.097 47.810  1.00 57.10  ? 500  MET A CB    1 
ATOM   2660 C  CG    . MET A 1 323 ? 64.528  72.234 48.520  1.00 62.09  ? 500  MET A CG    1 
ATOM   2661 S  SD    . MET A 1 323 ? 64.120  72.719 50.246  1.00 70.02  ? 500  MET A SD    1 
ATOM   2662 C  CE    . MET A 1 323 ? 62.596  71.832 50.604  1.00 69.13  ? 500  MET A CE    1 
ATOM   2663 N  N     . LYS A 1 324 ? 62.520  71.224 44.753  1.00 56.02  ? 501  LYS A N     1 
ATOM   2664 C  CA    . LYS A 1 324 ? 62.480  71.678 43.348  1.00 57.04  ? 501  LYS A CA    1 
ATOM   2665 C  C     . LYS A 1 324 ? 61.101  72.145 42.864  1.00 56.75  ? 501  LYS A C     1 
ATOM   2666 O  O     . LYS A 1 324 ? 60.954  72.521 41.715  1.00 56.72  ? 501  LYS A O     1 
ATOM   2667 C  CB    . LYS A 1 324 ? 62.996  70.583 42.426  1.00 57.25  ? 501  LYS A CB    1 
ATOM   2668 C  CG    . LYS A 1 324 ? 64.449  70.216 42.699  1.00 60.64  ? 501  LYS A CG    1 
ATOM   2669 C  CD    . LYS A 1 324 ? 65.067  69.469 41.500  1.00 64.43  ? 501  LYS A CD    1 
ATOM   2670 C  CE    . LYS A 1 324 ? 66.372  68.700 41.868  1.00 65.13  ? 501  LYS A CE    1 
ATOM   2671 N  NZ    . LYS A 1 324 ? 66.210  67.519 42.803  1.00 60.94  ? 501  LYS A NZ    1 
ATOM   2672 N  N     . GLU A 1 325 ? 60.118  72.151 43.761  1.00 57.62  ? 502  GLU A N     1 
ATOM   2673 C  CA    . GLU A 1 325 ? 58.732  72.594 43.496  1.00 58.69  ? 502  GLU A CA    1 
ATOM   2674 C  C     . GLU A 1 325 ? 58.555  74.111 43.815  1.00 59.62  ? 502  GLU A C     1 
ATOM   2675 O  O     . GLU A 1 325 ? 57.529  74.747 43.488  1.00 59.09  ? 502  GLU A O     1 
ATOM   2676 C  CB    . GLU A 1 325 ? 57.785  71.774 44.393  1.00 59.10  ? 502  GLU A CB    1 
ATOM   2677 C  CG    . GLU A 1 325 ? 56.362  71.599 43.874  1.00 60.31  ? 502  GLU A CG    1 
ATOM   2678 C  CD    . GLU A 1 325 ? 56.192  70.386 42.976  1.00 60.67  ? 502  GLU A CD    1 
ATOM   2679 O  OE1   . GLU A 1 325 ? 56.736  69.302 43.312  1.00 62.31  ? 502  GLU A OE1   1 
ATOM   2680 O  OE2   . GLU A 1 325 ? 55.484  70.522 41.956  1.00 59.32  ? 502  GLU A OE2   1 
ATOM   2681 N  N     . LEU A 1 326 ? 59.503  74.612 44.616  1.00 59.97  ? 503  LEU A N     1 
ATOM   2682 C  CA    . LEU A 1 326 ? 60.065  75.953 44.496  1.00 58.79  ? 503  LEU A CA    1 
ATOM   2683 C  C     . LEU A 1 326 ? 60.938  75.857 43.213  1.00 60.53  ? 503  LEU A C     1 
ATOM   2684 O  O     . LEU A 1 326 ? 60.949  74.806 42.550  1.00 61.82  ? 503  LEU A O     1 
ATOM   2685 C  CB    . LEU A 1 326 ? 60.856  76.240 45.779  1.00 57.44  ? 503  LEU A CB    1 
ATOM   2686 C  CG    . LEU A 1 326 ? 60.234  75.610 47.064  1.00 54.84  ? 503  LEU A CG    1 
ATOM   2687 C  CD1   . LEU A 1 326 ? 61.129  75.607 48.293  1.00 49.23  ? 503  LEU A CD1   1 
ATOM   2688 C  CD2   . LEU A 1 326 ? 58.897  76.243 47.434  1.00 49.70  ? 503  LEU A CD2   1 
ATOM   2689 N  N     . GLN A 1 327 ? 61.604  76.918 42.779  1.00 61.50  ? 504  GLN A N     1 
ATOM   2690 C  CA    . GLN A 1 327 ? 62.474  76.792 41.567  1.00 62.03  ? 504  GLN A CA    1 
ATOM   2691 C  C     . GLN A 1 327 ? 61.736  76.580 40.211  1.00 63.42  ? 504  GLN A C     1 
ATOM   2692 O  O     . GLN A 1 327 ? 60.507  76.535 40.147  1.00 62.81  ? 504  GLN A O     1 
ATOM   2693 C  CB    . GLN A 1 327 ? 63.501  75.649 41.750  1.00 60.70  ? 504  GLN A CB    1 
ATOM   2694 C  CG    . GLN A 1 327 ? 64.177  75.647 43.095  1.00 58.14  ? 504  GLN A CG    1 
ATOM   2695 C  CD    . GLN A 1 327 ? 65.148  74.509 43.286  1.00 55.06  ? 504  GLN A CD    1 
ATOM   2696 O  OE1   . GLN A 1 327 ? 65.481  73.798 42.357  1.00 58.49  ? 504  GLN A OE1   1 
ATOM   2697 N  NE2   . GLN A 1 327 ? 65.586  74.319 44.507  1.00 51.75  ? 504  GLN A NE2   1 
ATOM   2698 N  N     . LYS A 1 328 ? 62.514  76.460 39.129  1.00 65.34  ? 505  LYS A N     1 
ATOM   2699 C  CA    . LYS A 1 328 ? 62.071  75.737 37.930  1.00 66.58  ? 505  LYS A CA    1 
ATOM   2700 C  C     . LYS A 1 328 ? 60.895  76.461 37.248  1.00 66.38  ? 505  LYS A C     1 
ATOM   2701 O  O     . LYS A 1 328 ? 60.573  77.611 37.579  1.00 65.92  ? 505  LYS A O     1 
ATOM   2702 C  CB    . LYS A 1 328 ? 61.684  74.285 38.333  1.00 67.68  ? 505  LYS A CB    1 
ATOM   2703 C  CG    . LYS A 1 328 ? 61.570  73.262 37.180  1.00 69.51  ? 505  LYS A CG    1 
ATOM   2704 C  CD    . LYS A 1 328 ? 60.235  73.366 36.401  1.00 69.84  ? 505  LYS A CD    1 
ATOM   2705 C  CE    . LYS A 1 328 ? 60.489  73.583 34.908  1.00 68.89  ? 505  LYS A CE    1 
ATOM   2706 N  NZ    . LYS A 1 328 ? 61.086  74.929 34.668  1.00 67.76  ? 505  LYS A NZ    1 
ATOM   2707 N  N     . GLY B 1 1   ? 97.331  37.363 -24.559 1.00 71.73  ? 178  GLY B N     1 
ATOM   2708 C  CA    . GLY B 1 1   ? 96.633  38.685 -24.420 1.00 70.96  ? 178  GLY B CA    1 
ATOM   2709 C  C     . GLY B 1 1   ? 97.373  39.858 -25.081 1.00 69.99  ? 178  GLY B C     1 
ATOM   2710 O  O     . GLY B 1 1   ? 97.295  40.033 -26.312 1.00 70.75  ? 178  GLY B O     1 
ATOM   2711 N  N     . SER B 1 2   ? 98.123  40.632 -24.281 1.00 67.44  ? 179  SER B N     1 
ATOM   2712 C  CA    . SER B 1 2   ? 98.170  42.103 -24.467 1.00 65.77  ? 179  SER B CA    1 
ATOM   2713 C  C     . SER B 1 2   ? 99.261  42.648 -25.400 1.00 64.04  ? 179  SER B C     1 
ATOM   2714 O  O     . SER B 1 2   ? 100.307 42.016 -25.610 1.00 64.11  ? 179  SER B O     1 
ATOM   2715 C  CB    . SER B 1 2   ? 98.221  42.848 -23.127 1.00 65.48  ? 179  SER B CB    1 
ATOM   2716 O  OG    . SER B 1 2   ? 96.921  42.962 -22.578 1.00 63.91  ? 179  SER B OG    1 
ATOM   2717 N  N     . HIS B 1 3   ? 98.982  43.831 -25.951 1.00 61.10  ? 180  HIS B N     1 
ATOM   2718 C  CA    . HIS B 1 3   ? 99.781  44.430 -27.028 1.00 59.49  ? 180  HIS B CA    1 
ATOM   2719 C  C     . HIS B 1 3   ? 101.098 45.079 -26.536 1.00 58.35  ? 180  HIS B C     1 
ATOM   2720 O  O     . HIS B 1 3   ? 101.943 45.516 -27.333 1.00 58.03  ? 180  HIS B O     1 
ATOM   2721 C  CB    . HIS B 1 3   ? 98.937  45.490 -27.773 1.00 59.23  ? 180  HIS B CB    1 
ATOM   2722 C  CG    . HIS B 1 3   ? 98.996  46.864 -27.160 1.00 58.49  ? 180  HIS B CG    1 
ATOM   2723 N  ND1   . HIS B 1 3   ? 98.359  47.189 -25.978 1.00 57.39  ? 180  HIS B ND1   1 
ATOM   2724 C  CD2   . HIS B 1 3   ? 99.634  47.987 -27.561 1.00 56.00  ? 180  HIS B CD2   1 
ATOM   2725 C  CE1   . HIS B 1 3   ? 98.620  48.444 -25.670 1.00 55.92  ? 180  HIS B CE1   1 
ATOM   2726 N  NE2   . HIS B 1 3   ? 99.385  48.954 -26.618 1.00 56.28  ? 180  HIS B NE2   1 
ATOM   2727 N  N     . MET B 1 4   ? 101.240 45.192 -25.221 1.00 56.62  ? 181  MET B N     1 
ATOM   2728 C  CA    . MET B 1 4   ? 102.469 45.708 -24.609 1.00 55.13  ? 181  MET B CA    1 
ATOM   2729 C  C     . MET B 1 4   ? 102.585 45.073 -23.227 1.00 54.46  ? 181  MET B C     1 
ATOM   2730 O  O     . MET B 1 4   ? 101.665 44.388 -22.765 1.00 54.39  ? 181  MET B O     1 
ATOM   2731 C  CB    . MET B 1 4   ? 102.472 47.261 -24.526 1.00 54.20  ? 181  MET B CB    1 
ATOM   2732 C  CG    . MET B 1 4   ? 101.907 47.866 -23.204 1.00 53.02  ? 181  MET B CG    1 
ATOM   2733 S  SD    . MET B 1 4   ? 101.800 49.688 -23.041 1.00 44.48  ? 181  MET B SD    1 
ATOM   2734 C  CE    . MET B 1 4   ? 103.464 50.176 -23.440 1.00 46.90  ? 181  MET B CE    1 
ATOM   2735 N  N     . THR B 1 5   ? 103.725 45.269 -22.582 1.00 53.93  ? 182  THR B N     1 
ATOM   2736 C  CA    . THR B 1 5   ? 103.972 44.657 -21.287 1.00 53.27  ? 182  THR B CA    1 
ATOM   2737 C  C     . THR B 1 5   ? 103.624 45.631 -20.186 1.00 53.50  ? 182  THR B C     1 
ATOM   2738 O  O     . THR B 1 5   ? 104.014 46.802 -20.238 1.00 53.28  ? 182  THR B O     1 
ATOM   2739 C  CB    . THR B 1 5   ? 105.437 44.289 -21.111 1.00 52.69  ? 182  THR B CB    1 
ATOM   2740 O  OG1   . THR B 1 5   ? 105.772 43.272 -22.047 1.00 52.44  ? 182  THR B OG1   1 
ATOM   2741 C  CG2   . THR B 1 5   ? 105.706 43.787 -19.686 1.00 51.57  ? 182  THR B CG2   1 
ATOM   2742 N  N     . TYR B 1 6   ? 102.951 45.138 -19.156 1.00 53.09  ? 183  TYR B N     1 
ATOM   2743 C  CA    . TYR B 1 6   ? 102.664 45.987 -18.024 1.00 53.92  ? 183  TYR B CA    1 
ATOM   2744 C  C     . TYR B 1 6   ? 103.379 45.465 -16.772 1.00 55.12  ? 183  TYR B C     1 
ATOM   2745 O  O     . TYR B 1 6   ? 103.621 44.274 -16.641 1.00 55.86  ? 183  TYR B O     1 
ATOM   2746 C  CB    . TYR B 1 6   ? 101.145 46.142 -17.806 1.00 52.64  ? 183  TYR B CB    1 
ATOM   2747 C  CG    . TYR B 1 6   ? 100.374 46.672 -19.024 1.00 51.59  ? 183  TYR B CG    1 
ATOM   2748 C  CD1   . TYR B 1 6   ? 99.973  45.824 -20.041 1.00 47.40  ? 183  TYR B CD1   1 
ATOM   2749 C  CD2   . TYR B 1 6   ? 100.045 48.019 -19.139 1.00 50.28  ? 183  TYR B CD2   1 
ATOM   2750 C  CE1   . TYR B 1 6   ? 99.288  46.299 -21.139 1.00 48.27  ? 183  TYR B CE1   1 
ATOM   2751 C  CE2   . TYR B 1 6   ? 99.346  48.502 -20.237 1.00 48.85  ? 183  TYR B CE2   1 
ATOM   2752 C  CZ    . TYR B 1 6   ? 98.969  47.638 -21.238 1.00 48.09  ? 183  TYR B CZ    1 
ATOM   2753 O  OH    . TYR B 1 6   ? 98.296  48.108 -22.355 1.00 44.83  ? 183  TYR B OH    1 
ATOM   2754 N  N     . PRO B 1 7   ? 103.778 46.375 -15.879 1.00 56.41  ? 184  PRO B N     1 
ATOM   2755 C  CA    . PRO B 1 7   ? 104.238 46.029 -14.544 1.00 57.25  ? 184  PRO B CA    1 
ATOM   2756 C  C     . PRO B 1 7   ? 103.386 44.965 -13.853 1.00 57.81  ? 184  PRO B C     1 
ATOM   2757 O  O     . PRO B 1 7   ? 102.165 44.952 -13.990 1.00 57.47  ? 184  PRO B O     1 
ATOM   2758 C  CB    . PRO B 1 7   ? 104.121 47.363 -13.766 1.00 57.32  ? 184  PRO B CB    1 
ATOM   2759 C  CG    . PRO B 1 7   ? 103.614 48.400 -14.746 1.00 56.64  ? 184  PRO B CG    1 
ATOM   2760 C  CD    . PRO B 1 7   ? 103.807 47.832 -16.105 1.00 56.90  ? 184  PRO B CD    1 
ATOM   2761 N  N     . LYS B 1 8   ? 104.044 44.149 -13.042 1.00 58.31  ? 185  LYS B N     1 
ATOM   2762 C  CA    . LYS B 1 8   ? 103.432 42.995 -12.423 1.00 58.88  ? 185  LYS B CA    1 
ATOM   2763 C  C     . LYS B 1 8   ? 102.291 43.394 -11.475 1.00 57.91  ? 185  LYS B C     1 
ATOM   2764 O  O     . LYS B 1 8   ? 101.341 42.627 -11.251 1.00 57.60  ? 185  LYS B O     1 
ATOM   2765 C  CB    . LYS B 1 8   ? 104.511 42.217 -11.664 1.00 59.96  ? 185  LYS B CB    1 
ATOM   2766 C  CG    . LYS B 1 8   ? 105.840 42.023 -12.439 1.00 63.77  ? 185  LYS B CG    1 
ATOM   2767 C  CD    . LYS B 1 8   ? 106.379 40.570 -12.285 1.00 70.01  ? 185  LYS B CD    1 
ATOM   2768 C  CE    . LYS B 1 8   ? 107.878 40.493 -11.908 1.00 72.46  ? 185  LYS B CE    1 
ATOM   2769 N  NZ    . LYS B 1 8   ? 108.079 39.747 -10.608 1.00 73.39  ? 185  LYS B NZ    1 
ATOM   2770 N  N     . TYR B 1 9   ? 102.386 44.600 -10.922 1.00 57.08  ? 186  TYR B N     1 
ATOM   2771 C  CA    . TYR B 1 9   ? 101.348 45.107 -10.008 1.00 56.34  ? 186  TYR B CA    1 
ATOM   2772 C  C     . TYR B 1 9   ? 100.141 45.685 -10.731 1.00 54.18  ? 186  TYR B C     1 
ATOM   2773 O  O     . TYR B 1 9   ? 99.188  46.117 -10.084 1.00 53.96  ? 186  TYR B O     1 
ATOM   2774 C  CB    . TYR B 1 9   ? 101.904 46.161 -9.045  1.00 57.09  ? 186  TYR B CB    1 
ATOM   2775 C  CG    . TYR B 1 9   ? 102.500 47.366 -9.727  1.00 58.50  ? 186  TYR B CG    1 
ATOM   2776 C  CD1   . TYR B 1 9   ? 101.692 48.421 -10.151 1.00 58.49  ? 186  TYR B CD1   1 
ATOM   2777 C  CD2   . TYR B 1 9   ? 103.880 47.454 -9.936  1.00 60.62  ? 186  TYR B CD2   1 
ATOM   2778 C  CE1   . TYR B 1 9   ? 102.230 49.506 -10.783 1.00 60.20  ? 186  TYR B CE1   1 
ATOM   2779 C  CE2   . TYR B 1 9   ? 104.436 48.548 -10.558 1.00 61.56  ? 186  TYR B CE2   1 
ATOM   2780 C  CZ    . TYR B 1 9   ? 103.605 49.566 -10.989 1.00 62.14  ? 186  TYR B CZ    1 
ATOM   2781 O  OH    . TYR B 1 9   ? 104.150 50.647 -11.633 1.00 62.55  ? 186  TYR B OH    1 
ATOM   2782 N  N     . LEU B 1 10  ? 100.195 45.738 -12.058 1.00 51.81  ? 187  LEU B N     1 
ATOM   2783 C  CA    . LEU B 1 10  ? 98.982  45.807 -12.849 1.00 49.81  ? 187  LEU B CA    1 
ATOM   2784 C  C     . LEU B 1 10  ? 98.622  44.385 -13.176 1.00 49.21  ? 187  LEU B C     1 
ATOM   2785 O  O     . LEU B 1 10  ? 99.322  43.737 -13.944 1.00 49.84  ? 187  LEU B O     1 
ATOM   2786 C  CB    . LEU B 1 10  ? 99.194  46.634 -14.108 1.00 48.54  ? 187  LEU B CB    1 
ATOM   2787 C  CG    . LEU B 1 10  ? 99.651  48.063 -13.820 1.00 46.86  ? 187  LEU B CG    1 
ATOM   2788 C  CD1   . LEU B 1 10  ? 99.627  48.954 -15.065 1.00 44.82  ? 187  LEU B CD1   1 
ATOM   2789 C  CD2   . LEU B 1 10  ? 98.802  48.653 -12.719 1.00 42.90  ? 187  LEU B CD2   1 
ATOM   2790 N  N     . LEU B 1 11  ? 97.611  43.861 -12.492 1.00 48.30  ? 188  LEU B N     1 
ATOM   2791 C  CA    . LEU B 1 11  ? 97.194  42.466 -12.669 1.00 48.01  ? 188  LEU B CA    1 
ATOM   2792 C  C     . LEU B 1 11  ? 96.654  42.307 -14.062 1.00 47.65  ? 188  LEU B C     1 
ATOM   2793 O  O     . LEU B 1 11  ? 95.884  43.131 -14.497 1.00 48.65  ? 188  LEU B O     1 
ATOM   2794 C  CB    . LEU B 1 11  ? 96.094  42.076 -11.686 1.00 47.19  ? 188  LEU B CB    1 
ATOM   2795 C  CG    . LEU B 1 11  ? 96.472  42.186 -10.212 1.00 47.54  ? 188  LEU B CG    1 
ATOM   2796 C  CD1   . LEU B 1 11  ? 95.265  41.860 -9.338  1.00 46.74  ? 188  LEU B CD1   1 
ATOM   2797 C  CD2   . LEU B 1 11  ? 97.666  41.304 -9.889  1.00 42.97  ? 188  LEU B CD2   1 
ATOM   2798 N  N     . SER B 1 12  ? 97.024  41.233 -14.746 1.00 46.89  ? 189  SER B N     1 
ATOM   2799 C  CA    . SER B 1 12  ? 96.459  40.954 -16.065 1.00 46.43  ? 189  SER B CA    1 
ATOM   2800 C  C     . SER B 1 12  ? 95.002  40.478 -15.969 1.00 45.32  ? 189  SER B C     1 
ATOM   2801 O  O     . SER B 1 12  ? 94.548  40.035 -14.927 1.00 45.59  ? 189  SER B O     1 
ATOM   2802 C  CB    . SER B 1 12  ? 97.304  39.915 -16.791 1.00 46.03  ? 189  SER B CB    1 
ATOM   2803 O  OG    . SER B 1 12  ? 97.234  38.696 -16.097 1.00 46.80  ? 189  SER B OG    1 
ATOM   2804 N  N     . PRO B 1 13  ? 94.250  40.600 -17.061 1.00 44.95  ? 190  PRO B N     1 
ATOM   2805 C  CA    . PRO B 1 13  ? 92.905  40.056 -17.076 1.00 45.11  ? 190  PRO B CA    1 
ATOM   2806 C  C     . PRO B 1 13  ? 92.843  38.613 -16.663 1.00 45.38  ? 190  PRO B C     1 
ATOM   2807 O  O     . PRO B 1 13  ? 91.947  38.243 -15.937 1.00 45.69  ? 190  PRO B O     1 
ATOM   2808 C  CB    . PRO B 1 13  ? 92.490  40.222 -18.529 1.00 44.42  ? 190  PRO B CB    1 
ATOM   2809 C  CG    . PRO B 1 13  ? 93.191  41.442 -18.933 1.00 43.95  ? 190  PRO B CG    1 
ATOM   2810 C  CD    . PRO B 1 13  ? 94.544  41.305 -18.313 1.00 44.84  ? 190  PRO B CD    1 
ATOM   2811 N  N     . GLU B 1 14  ? 93.821  37.825 -17.076 1.00 46.29  ? 191  GLU B N     1 
ATOM   2812 C  CA    . GLU B 1 14  ? 93.834  36.406 -16.764 1.00 47.11  ? 191  GLU B CA    1 
ATOM   2813 C  C     . GLU B 1 14  ? 93.965  36.230 -15.238 1.00 46.29  ? 191  GLU B C     1 
ATOM   2814 O  O     . GLU B 1 14  ? 93.262  35.409 -14.649 1.00 46.23  ? 191  GLU B O     1 
ATOM   2815 C  CB    . GLU B 1 14  ? 94.953  35.688 -17.549 1.00 47.48  ? 191  GLU B CB    1 
ATOM   2816 C  CG    . GLU B 1 14  ? 94.929  35.892 -19.112 1.00 53.51  ? 191  GLU B CG    1 
ATOM   2817 C  CD    . GLU B 1 14  ? 95.422  37.300 -19.599 1.00 60.70  ? 191  GLU B CD    1 
ATOM   2818 O  OE1   . GLU B 1 14  ? 96.478  37.787 -19.134 1.00 65.86  ? 191  GLU B OE1   1 
ATOM   2819 O  OE2   . GLU B 1 14  ? 94.772  37.920 -20.475 1.00 65.00  ? 191  GLU B OE2   1 
ATOM   2820 N  N     . THR B 1 15  ? 94.808  37.033 -14.593 1.00 45.10  ? 192  THR B N     1 
ATOM   2821 C  CA    . THR B 1 15  ? 94.973  36.926 -13.144 1.00 44.55  ? 192  THR B CA    1 
ATOM   2822 C  C     . THR B 1 15  ? 93.671  37.274 -12.458 1.00 44.57  ? 192  THR B C     1 
ATOM   2823 O  O     . THR B 1 15  ? 93.184  36.507 -11.625 1.00 44.28  ? 192  THR B O     1 
ATOM   2824 C  CB    . THR B 1 15  ? 96.085  37.854 -12.633 1.00 44.47  ? 192  THR B CB    1 
ATOM   2825 O  OG1   . THR B 1 15  ? 97.307  37.453 -13.235 1.00 43.22  ? 192  THR B OG1   1 
ATOM   2826 C  CG2   . THR B 1 15  ? 96.237  37.798 -11.110 1.00 42.08  ? 192  THR B CG2   1 
ATOM   2827 N  N     . ILE B 1 16  ? 93.086  38.403 -12.847 1.00 44.93  ? 193  ILE B N     1 
ATOM   2828 C  CA    . ILE B 1 16  ? 91.794  38.853 -12.290 1.00 45.51  ? 193  ILE B CA    1 
ATOM   2829 C  C     . ILE B 1 16  ? 90.722  37.758 -12.338 1.00 45.91  ? 193  ILE B C     1 
ATOM   2830 O  O     . ILE B 1 16  ? 90.034  37.504 -11.366 1.00 46.30  ? 193  ILE B O     1 
ATOM   2831 C  CB    . ILE B 1 16  ? 91.269  40.124 -13.024 1.00 45.81  ? 193  ILE B CB    1 
ATOM   2832 C  CG1   . ILE B 1 16  ? 92.079  41.348 -12.610 1.00 45.17  ? 193  ILE B CG1   1 
ATOM   2833 C  CG2   . ILE B 1 16  ? 89.777  40.369 -12.751 1.00 42.93  ? 193  ILE B CG2   1 
ATOM   2834 C  CD1   . ILE B 1 16  ? 92.075  42.412 -13.622 1.00 44.50  ? 193  ILE B CD1   1 
ATOM   2835 N  N     . GLU B 1 17  ? 90.627  37.076 -13.459 1.00 47.05  ? 194  GLU B N     1 
ATOM   2836 C  CA    . GLU B 1 17  ? 89.729  35.933 -13.582 1.00 48.99  ? 194  GLU B CA    1 
ATOM   2837 C  C     . GLU B 1 17  ? 90.087  34.782 -12.618 1.00 48.00  ? 194  GLU B C     1 
ATOM   2838 O  O     . GLU B 1 17  ? 89.195  34.258 -11.926 1.00 48.60  ? 194  GLU B O     1 
ATOM   2839 C  CB    . GLU B 1 17  ? 89.698  35.428 -15.052 1.00 50.64  ? 194  GLU B CB    1 
ATOM   2840 C  CG    . GLU B 1 17  ? 88.379  34.726 -15.513 1.00 56.74  ? 194  GLU B CG    1 
ATOM   2841 C  CD    . GLU B 1 17  ? 87.070  35.540 -15.184 1.00 66.48  ? 194  GLU B CD    1 
ATOM   2842 O  OE1   . GLU B 1 17  ? 85.981  34.902 -15.103 1.00 71.15  ? 194  GLU B OE1   1 
ATOM   2843 O  OE2   . GLU B 1 17  ? 87.123  36.804 -15.001 1.00 68.64  ? 194  GLU B OE2   1 
ATOM   2844 N  N     . ALA B 1 18  ? 91.373  34.414 -12.568 1.00 45.81  ? 195  ALA B N     1 
ATOM   2845 C  CA    . ALA B 1 18  ? 91.837  33.271 -11.796 1.00 44.98  ? 195  ALA B CA    1 
ATOM   2846 C  C     . ALA B 1 18  ? 91.657  33.510 -10.289 1.00 45.36  ? 195  ALA B C     1 
ATOM   2847 O  O     . ALA B 1 18  ? 91.444  32.583 -9.508  1.00 45.34  ? 195  ALA B O     1 
ATOM   2848 C  CB    . ALA B 1 18  ? 93.294  33.007 -12.120 1.00 43.49  ? 195  ALA B CB    1 
ATOM   2849 N  N     . LEU B 1 19  ? 91.716  34.776 -9.884  1.00 45.55  ? 196  LEU B N     1 
ATOM   2850 C  CA    . LEU B 1 19  ? 91.646  35.138 -8.466  1.00 45.25  ? 196  LEU B CA    1 
ATOM   2851 C  C     . LEU B 1 19  ? 90.331  34.697 -7.846  1.00 45.21  ? 196  LEU B C     1 
ATOM   2852 O  O     . LEU B 1 19  ? 90.243  34.567 -6.639  1.00 44.84  ? 196  LEU B O     1 
ATOM   2853 C  CB    . LEU B 1 19  ? 91.791  36.657 -8.317  1.00 45.45  ? 196  LEU B CB    1 
ATOM   2854 C  CG    . LEU B 1 19  ? 92.285  37.308 -7.027  1.00 45.04  ? 196  LEU B CG    1 
ATOM   2855 C  CD1   . LEU B 1 19  ? 93.677  36.788 -6.640  1.00 42.13  ? 196  LEU B CD1   1 
ATOM   2856 C  CD2   . LEU B 1 19  ? 92.317  38.817 -7.308  1.00 44.23  ? 196  LEU B CD2   1 
ATOM   2857 N  N     . ARG B 1 20  ? 89.306  34.486 -8.666  1.00 46.00  ? 197  ARG B N     1 
ATOM   2858 C  CA    . ARG B 1 20  ? 87.960  34.202 -8.156  1.00 47.18  ? 197  ARG B CA    1 
ATOM   2859 C  C     . ARG B 1 20  ? 87.782  32.755 -7.766  1.00 46.59  ? 197  ARG B C     1 
ATOM   2860 O  O     . ARG B 1 20  ? 86.735  32.377 -7.266  1.00 45.78  ? 197  ARG B O     1 
ATOM   2861 C  CB    . ARG B 1 20  ? 86.901  34.568 -9.191  1.00 48.03  ? 197  ARG B CB    1 
ATOM   2862 C  CG    . ARG B 1 20  ? 86.830  36.054 -9.422  1.00 53.11  ? 197  ARG B CG    1 
ATOM   2863 C  CD    . ARG B 1 20  ? 86.327  36.443 -10.814 1.00 59.19  ? 197  ARG B CD    1 
ATOM   2864 N  NE    . ARG B 1 20  ? 85.434  37.588 -10.668 1.00 64.40  ? 197  ARG B NE    1 
ATOM   2865 C  CZ    . ARG B 1 20  ? 84.161  37.470 -10.308 1.00 69.60  ? 197  ARG B CZ    1 
ATOM   2866 N  NH1   . ARG B 1 20  ? 83.628  36.266 -10.136 1.00 72.73  ? 197  ARG B NH1   1 
ATOM   2867 N  NH2   . ARG B 1 20  ? 83.401  38.544 -10.174 1.00 72.46  ? 197  ARG B NH2   1 
ATOM   2868 N  N     . LYS B 1 21  ? 88.802  31.944 -7.986  1.00 46.52  ? 198  LYS B N     1 
ATOM   2869 C  CA    . LYS B 1 21  ? 88.643  30.524 -7.793  1.00 47.58  ? 198  LYS B CA    1 
ATOM   2870 C  C     . LYS B 1 21  ? 89.702  29.998 -6.850  1.00 46.60  ? 198  LYS B C     1 
ATOM   2871 O  O     . LYS B 1 21  ? 90.804  30.527 -6.796  1.00 46.24  ? 198  LYS B O     1 
ATOM   2872 C  CB    . LYS B 1 21  ? 88.690  29.791 -9.147  1.00 49.78  ? 198  LYS B CB    1 
ATOM   2873 C  CG    . LYS B 1 21  ? 87.372  29.898 -9.938  1.00 51.95  ? 198  LYS B CG    1 
ATOM   2874 C  CD    . LYS B 1 21  ? 87.485  29.270 -11.323 1.00 58.82  ? 198  LYS B CD    1 
ATOM   2875 C  CE    . LYS B 1 21  ? 87.836  30.305 -12.417 1.00 62.39  ? 198  LYS B CE    1 
ATOM   2876 N  NZ    . LYS B 1 21  ? 88.345  29.666 -13.701 1.00 61.52  ? 198  LYS B NZ    1 
ATOM   2877 N  N     . PRO B 1 22  ? 89.349  28.961 -6.078  1.00 46.36  ? 199  PRO B N     1 
ATOM   2878 C  CA    . PRO B 1 22  ? 90.204  28.353 -5.055  1.00 45.50  ? 199  PRO B CA    1 
ATOM   2879 C  C     . PRO B 1 22  ? 91.411  27.614 -5.611  1.00 44.71  ? 199  PRO B C     1 
ATOM   2880 O  O     . PRO B 1 22  ? 92.265  27.188 -4.829  1.00 45.48  ? 199  PRO B O     1 
ATOM   2881 C  CB    . PRO B 1 22  ? 89.264  27.359 -4.358  1.00 45.45  ? 199  PRO B CB    1 
ATOM   2882 C  CG    . PRO B 1 22  ? 88.222  27.056 -5.333  1.00 45.80  ? 199  PRO B CG    1 
ATOM   2883 C  CD    . PRO B 1 22  ? 88.040  28.288 -6.173  1.00 46.15  ? 199  PRO B CD    1 
ATOM   2884 N  N     . THR B 1 23  ? 91.474  27.455 -6.932  1.00 43.51  ? 200  THR B N     1 
ATOM   2885 C  CA    . THR B 1 23  ? 92.649  26.911 -7.610  1.00 43.29  ? 200  THR B CA    1 
ATOM   2886 C  C     . THR B 1 23  ? 93.826  27.893 -7.768  1.00 43.49  ? 200  THR B C     1 
ATOM   2887 O  O     . THR B 1 23  ? 94.908  27.499 -8.203  1.00 43.08  ? 200  THR B O     1 
ATOM   2888 C  CB    . THR B 1 23  ? 92.275  26.477 -9.042  1.00 42.98  ? 200  THR B CB    1 
ATOM   2889 O  OG1   . THR B 1 23  ? 91.496  27.515 -9.658  1.00 44.39  ? 200  THR B OG1   1 
ATOM   2890 C  CG2   . THR B 1 23  ? 91.488  25.187 -9.014  1.00 40.53  ? 200  THR B CG2   1 
ATOM   2891 N  N     . PHE B 1 24  ? 93.601  29.170 -7.479  1.00 44.06  ? 201  PHE B N     1 
ATOM   2892 C  CA    . PHE B 1 24  ? 94.633  30.210 -7.664  1.00 44.49  ? 201  PHE B CA    1 
ATOM   2893 C  C     . PHE B 1 24  ? 95.972  29.830 -7.023  1.00 44.45  ? 201  PHE B C     1 
ATOM   2894 O  O     . PHE B 1 24  ? 95.999  29.413 -5.880  1.00 44.67  ? 201  PHE B O     1 
ATOM   2895 C  CB    . PHE B 1 24  ? 94.145  31.512 -7.048  1.00 44.35  ? 201  PHE B CB    1 
ATOM   2896 C  CG    . PHE B 1 24  ? 94.905  32.720 -7.490  1.00 44.88  ? 201  PHE B CG    1 
ATOM   2897 C  CD1   . PHE B 1 24  ? 94.693  33.272 -8.740  1.00 45.19  ? 201  PHE B CD1   1 
ATOM   2898 C  CD2   . PHE B 1 24  ? 95.786  33.353 -6.631  1.00 44.47  ? 201  PHE B CD2   1 
ATOM   2899 C  CE1   . PHE B 1 24  ? 95.372  34.424 -9.125  1.00 44.81  ? 201  PHE B CE1   1 
ATOM   2900 C  CE2   . PHE B 1 24  ? 96.473  34.507 -7.018  1.00 43.76  ? 201  PHE B CE2   1 
ATOM   2901 C  CZ    . PHE B 1 24  ? 96.248  35.052 -8.249  1.00 43.88  ? 201  PHE B CZ    1 
ATOM   2902 N  N     . ASP B 1 25  ? 97.076  29.986 -7.751  1.00 45.24  ? 202  ASP B N     1 
ATOM   2903 C  CA    . ASP B 1 25  ? 98.395  29.640 -7.215  1.00 45.80  ? 202  ASP B CA    1 
ATOM   2904 C  C     . ASP B 1 25  ? 98.975  30.783 -6.394  1.00 45.50  ? 202  ASP B C     1 
ATOM   2905 O  O     . ASP B 1 25  ? 99.639  31.693 -6.889  1.00 44.23  ? 202  ASP B O     1 
ATOM   2906 C  CB    . ASP B 1 25  ? 99.364  29.253 -8.324  1.00 46.69  ? 202  ASP B CB    1 
ATOM   2907 C  CG    . ASP B 1 25  ? 100.584 28.555 -7.797  1.00 48.89  ? 202  ASP B CG    1 
ATOM   2908 O  OD1   . ASP B 1 25  ? 101.158 27.695 -8.529  1.00 52.01  ? 202  ASP B OD1   1 
ATOM   2909 O  OD2   . ASP B 1 25  ? 100.919 28.824 -6.616  1.00 49.12  ? 202  ASP B OD2   1 
ATOM   2910 N  N     . VAL B 1 26  ? 98.743  30.679 -5.098  1.00 46.27  ? 203  VAL B N     1 
ATOM   2911 C  CA    . VAL B 1 26  ? 99.145  31.690 -4.138  1.00 46.09  ? 203  VAL B CA    1 
ATOM   2912 C  C     . VAL B 1 26  ? 100.674 31.867 -4.065  1.00 47.48  ? 203  VAL B C     1 
ATOM   2913 O  O     . VAL B 1 26  ? 101.131 32.786 -3.414  1.00 49.06  ? 203  VAL B O     1 
ATOM   2914 C  CB    . VAL B 1 26  ? 98.622  31.309 -2.751  1.00 45.55  ? 203  VAL B CB    1 
ATOM   2915 C  CG1   . VAL B 1 26  ? 97.114  31.303 -2.765  1.00 43.94  ? 203  VAL B CG1   1 
ATOM   2916 C  CG2   . VAL B 1 26  ? 99.175  29.931 -2.332  1.00 42.21  ? 203  VAL B CG2   1 
ATOM   2917 N  N     . TRP B 1 27  ? 101.446 30.973 -4.689  1.00 47.58  ? 204  TRP B N     1 
ATOM   2918 C  CA    . TRP B 1 27  ? 102.913 31.025 -4.657  1.00 47.79  ? 204  TRP B CA    1 
ATOM   2919 C  C     . TRP B 1 27  ? 103.536 31.815 -5.822  1.00 48.49  ? 204  TRP B C     1 
ATOM   2920 O  O     . TRP B 1 27  ? 104.711 32.125 -5.792  1.00 48.14  ? 204  TRP B O     1 
ATOM   2921 C  CB    . TRP B 1 27  ? 103.486 29.616 -4.690  1.00 46.73  ? 204  TRP B CB    1 
ATOM   2922 C  CG    . TRP B 1 27  ? 103.101 28.789 -3.527  1.00 47.53  ? 204  TRP B CG    1 
ATOM   2923 C  CD1   . TRP B 1 27  ? 102.181 27.777 -3.504  1.00 46.59  ? 204  TRP B CD1   1 
ATOM   2924 C  CD2   . TRP B 1 27  ? 103.626 28.884 -2.195  1.00 46.56  ? 204  TRP B CD2   1 
ATOM   2925 N  NE1   . TRP B 1 27  ? 102.108 27.239 -2.247  1.00 45.98  ? 204  TRP B NE1   1 
ATOM   2926 C  CE2   . TRP B 1 27  ? 102.980 27.898 -1.423  1.00 45.66  ? 204  TRP B CE2   1 
ATOM   2927 C  CE3   . TRP B 1 27  ? 104.541 29.740 -1.572  1.00 44.41  ? 204  TRP B CE3   1 
ATOM   2928 C  CZ2   . TRP B 1 27  ? 103.229 27.734 -0.063  1.00 47.27  ? 204  TRP B CZ2   1 
ATOM   2929 C  CZ3   . TRP B 1 27  ? 104.804 29.566 -0.237  1.00 44.55  ? 204  TRP B CZ3   1 
ATOM   2930 C  CH2   . TRP B 1 27  ? 104.146 28.570 0.510   1.00 46.73  ? 204  TRP B CH2   1 
ATOM   2931 N  N     . LEU B 1 28  ? 102.752 32.147 -6.837  1.00 49.44  ? 205  LEU B N     1 
ATOM   2932 C  CA    . LEU B 1 28  ? 103.306 32.802 -8.002  1.00 50.32  ? 205  LEU B CA    1 
ATOM   2933 C  C     . LEU B 1 28  ? 103.688 34.249 -7.760  1.00 50.11  ? 205  LEU B C     1 
ATOM   2934 O  O     . LEU B 1 28  ? 104.415 34.834 -8.550  1.00 50.91  ? 205  LEU B O     1 
ATOM   2935 C  CB    . LEU B 1 28  ? 102.328 32.752 -9.171  1.00 51.41  ? 205  LEU B CB    1 
ATOM   2936 C  CG    . LEU B 1 28  ? 102.058 31.379 -9.799  1.00 53.22  ? 205  LEU B CG    1 
ATOM   2937 C  CD1   . LEU B 1 28  ? 101.339 31.628 -11.121 1.00 53.26  ? 205  LEU B CD1   1 
ATOM   2938 C  CD2   . LEU B 1 28  ? 103.324 30.549 -9.979  1.00 51.27  ? 205  LEU B CD2   1 
ATOM   2939 N  N     . TRP B 1 29  ? 103.230 34.822 -6.668  1.00 49.93  ? 206  TRP B N     1 
ATOM   2940 C  CA    . TRP B 1 29  ? 103.152 36.251 -6.576  1.00 51.11  ? 206  TRP B CA    1 
ATOM   2941 C  C     . TRP B 1 29  ? 104.033 36.835 -5.511  1.00 51.21  ? 206  TRP B C     1 
ATOM   2942 O  O     . TRP B 1 29  ? 104.141 36.290 -4.419  1.00 51.05  ? 206  TRP B O     1 
ATOM   2943 C  CB    . TRP B 1 29  ? 101.721 36.603 -6.248  1.00 53.28  ? 206  TRP B CB    1 
ATOM   2944 C  CG    . TRP B 1 29  ? 100.815 35.927 -7.157  1.00 54.19  ? 206  TRP B CG    1 
ATOM   2945 C  CD1   . TRP B 1 29  ? 100.038 34.850 -6.889  1.00 55.83  ? 206  TRP B CD1   1 
ATOM   2946 C  CD2   . TRP B 1 29  ? 100.655 36.220 -8.536  1.00 53.76  ? 206  TRP B CD2   1 
ATOM   2947 N  NE1   . TRP B 1 29  ? 99.364  34.470 -8.022  1.00 56.42  ? 206  TRP B NE1   1 
ATOM   2948 C  CE2   . TRP B 1 29  ? 99.719  35.303 -9.048  1.00 55.91  ? 206  TRP B CE2   1 
ATOM   2949 C  CE3   . TRP B 1 29  ? 101.184 37.197 -9.378  1.00 55.29  ? 206  TRP B CE3   1 
ATOM   2950 C  CZ2   . TRP B 1 29  ? 99.303  35.320 -10.380 1.00 56.47  ? 206  TRP B CZ2   1 
ATOM   2951 C  CZ3   . TRP B 1 29  ? 100.784 37.219 -10.704 1.00 57.00  ? 206  TRP B CZ3   1 
ATOM   2952 C  CH2   . TRP B 1 29  ? 99.845  36.286 -11.192 1.00 56.49  ? 206  TRP B CH2   1 
ATOM   2953 N  N     . GLU B 1 30  ? 104.567 38.014 -5.788  1.00 51.44  ? 207  GLU B N     1 
ATOM   2954 C  CA    . GLU B 1 30  ? 105.242 38.790 -4.764  1.00 52.35  ? 207  GLU B CA    1 
ATOM   2955 C  C     . GLU B 1 30  ? 104.294 39.655 -3.937  1.00 51.09  ? 207  GLU B C     1 
ATOM   2956 O  O     . GLU B 1 30  ? 103.155 39.875 -4.313  1.00 51.22  ? 207  GLU B O     1 
ATOM   2957 C  CB    . GLU B 1 30  ? 106.329 39.641 -5.417  1.00 53.56  ? 207  GLU B CB    1 
ATOM   2958 C  CG    . GLU B 1 30  ? 107.705 38.987 -5.274  1.00 57.16  ? 207  GLU B CG    1 
ATOM   2959 C  CD    . GLU B 1 30  ? 108.347 38.778 -6.580  1.00 63.76  ? 207  GLU B CD    1 
ATOM   2960 O  OE1   . GLU B 1 30  ? 108.056 39.566 -7.507  1.00 70.60  ? 207  GLU B OE1   1 
ATOM   2961 O  OE2   . GLU B 1 30  ? 109.104 37.800 -6.707  1.00 70.60  ? 207  GLU B OE2   1 
ATOM   2962 N  N     . PRO B 1 31  ? 104.761 40.139 -2.791  1.00 50.22  ? 208  PRO B N     1 
ATOM   2963 C  CA    . PRO B 1 31  ? 103.863 40.879 -1.927  1.00 49.79  ? 208  PRO B CA    1 
ATOM   2964 C  C     . PRO B 1 31  ? 103.050 41.944 -2.652  1.00 49.55  ? 208  PRO B C     1 
ATOM   2965 O  O     . PRO B 1 31  ? 101.827 42.090 -2.418  1.00 49.20  ? 208  PRO B O     1 
ATOM   2966 C  CB    . PRO B 1 31  ? 104.819 41.519 -0.918  1.00 49.80  ? 208  PRO B CB    1 
ATOM   2967 C  CG    . PRO B 1 31  ? 105.954 40.531 -0.823  1.00 49.38  ? 208  PRO B CG    1 
ATOM   2968 C  CD    . PRO B 1 31  ? 106.106 39.989 -2.208  1.00 49.83  ? 208  PRO B CD    1 
ATOM   2969 N  N     . ASN B 1 32  ? 103.718 42.723 -3.492  1.00 49.24  ? 209  ASN B N     1 
ATOM   2970 C  CA    . ASN B 1 32  ? 103.036 43.863 -4.109  1.00 49.68  ? 209  ASN B CA    1 
ATOM   2971 C  C     . ASN B 1 32  ? 101.933 43.364 -5.049  1.00 48.25  ? 209  ASN B C     1 
ATOM   2972 O  O     . ASN B 1 32  ? 100.857 43.947 -5.136  1.00 48.05  ? 209  ASN B O     1 
ATOM   2973 C  CB    . ASN B 1 32  ? 104.024 44.844 -4.784  1.00 49.97  ? 209  ASN B CB    1 
ATOM   2974 C  CG    . ASN B 1 32  ? 104.680 44.281 -6.053  1.00 55.14  ? 209  ASN B CG    1 
ATOM   2975 O  OD1   . ASN B 1 32  ? 105.031 43.080 -6.135  1.00 61.73  ? 209  ASN B OD1   1 
ATOM   2976 N  ND2   . ASN B 1 32  ? 104.872 45.165 -7.052  1.00 55.64  ? 209  ASN B ND2   1 
ATOM   2977 N  N     . GLU B 1 33  ? 102.162 42.219 -5.673  1.00 47.16  ? 210  GLU B N     1 
ATOM   2978 C  CA    . GLU B 1 33  ? 101.140 41.641 -6.522  1.00 46.71  ? 210  GLU B CA    1 
ATOM   2979 C  C     . GLU B 1 33  ? 99.964  41.160 -5.685  1.00 44.79  ? 210  GLU B C     1 
ATOM   2980 O  O     . GLU B 1 33  ? 98.799  41.390 -6.039  1.00 43.52  ? 210  GLU B O     1 
ATOM   2981 C  CB    . GLU B 1 33  ? 101.695 40.511 -7.384  1.00 47.28  ? 210  GLU B CB    1 
ATOM   2982 C  CG    . GLU B 1 33  ? 102.861 40.922 -8.313  1.00 51.21  ? 210  GLU B CG    1 
ATOM   2983 C  CD    . GLU B 1 33  ? 103.611 39.700 -8.905  1.00 56.90  ? 210  GLU B CD    1 
ATOM   2984 O  OE1   . GLU B 1 33  ? 103.335 39.313 -10.092 1.00 55.97  ? 210  GLU B OE1   1 
ATOM   2985 O  OE2   . GLU B 1 33  ? 104.456 39.123 -8.152  1.00 59.40  ? 210  GLU B OE2   1 
ATOM   2986 N  N     . MET B 1 34  ? 100.273 40.524 -4.565  1.00 43.68  ? 211  MET B N     1 
ATOM   2987 C  CA    . MET B 1 34  ? 99.235  40.043 -3.643  1.00 43.95  ? 211  MET B CA    1 
ATOM   2988 C  C     . MET B 1 34  ? 98.423  41.219 -3.086  1.00 43.45  ? 211  MET B C     1 
ATOM   2989 O  O     . MET B 1 34  ? 97.207  41.123 -2.956  1.00 43.19  ? 211  MET B O     1 
ATOM   2990 C  CB    . MET B 1 34  ? 99.871  39.239 -2.499  1.00 44.12  ? 211  MET B CB    1 
ATOM   2991 C  CG    . MET B 1 34  ? 100.395 37.870 -2.919  1.00 43.02  ? 211  MET B CG    1 
ATOM   2992 S  SD    . MET B 1 34  ? 100.867 36.791 -1.557  1.00 42.72  ? 211  MET B SD    1 
ATOM   2993 C  CE    . MET B 1 34  ? 102.594 37.208 -1.364  1.00 36.49  ? 211  MET B CE    1 
ATOM   2994 N  N     . LEU B 1 35  ? 99.102  42.341 -2.817  1.00 43.03  ? 212  LEU B N     1 
ATOM   2995 C  CA    . LEU B 1 35  ? 98.422  43.566 -2.372  1.00 42.26  ? 212  LEU B CA    1 
ATOM   2996 C  C     . LEU B 1 35  ? 97.455  44.095 -3.427  1.00 42.39  ? 212  LEU B C     1 
ATOM   2997 O  O     . LEU B 1 35  ? 96.343  44.561 -3.094  1.00 43.19  ? 212  LEU B O     1 
ATOM   2998 C  CB    . LEU B 1 35  ? 99.429  44.653 -1.971  1.00 41.53  ? 212  LEU B CB    1 
ATOM   2999 C  CG    . LEU B 1 35  ? 100.191 44.403 -0.658  1.00 40.35  ? 212  LEU B CG    1 
ATOM   3000 C  CD1   . LEU B 1 35  ? 101.342 45.388 -0.477  1.00 35.31  ? 212  LEU B CD1   1 
ATOM   3001 C  CD2   . LEU B 1 35  ? 99.220  44.406 0.526   1.00 37.34  ? 212  LEU B CD2   1 
ATOM   3002 N  N     . SER B 1 36  ? 97.870  44.020 -4.690  1.00 41.97  ? 213  SER B N     1 
ATOM   3003 C  CA    . SER B 1 36  ? 97.019  44.469 -5.792  1.00 41.84  ? 213  SER B CA    1 
ATOM   3004 C  C     . SER B 1 36  ? 95.822  43.557 -5.911  1.00 40.98  ? 213  SER B C     1 
ATOM   3005 O  O     . SER B 1 36  ? 94.717  44.007 -6.180  1.00 40.59  ? 213  SER B O     1 
ATOM   3006 C  CB    . SER B 1 36  ? 97.789  44.477 -7.118  1.00 42.66  ? 213  SER B CB    1 
ATOM   3007 O  OG    . SER B 1 36  ? 98.563  45.652 -7.237  1.00 42.50  ? 213  SER B OG    1 
ATOM   3008 N  N     . CYS B 1 37  ? 96.037  42.277 -5.667  1.00 40.92  ? 214  CYS B N     1 
ATOM   3009 C  CA    . CYS B 1 37  ? 94.915  41.342 -5.568  1.00 41.91  ? 214  CYS B CA    1 
ATOM   3010 C  C     . CYS B 1 37  ? 93.946  41.699 -4.476  1.00 42.19  ? 214  CYS B C     1 
ATOM   3011 O  O     . CYS B 1 37  ? 92.743  41.683 -4.708  1.00 43.12  ? 214  CYS B O     1 
ATOM   3012 C  CB    . CYS B 1 37  ? 95.398  39.923 -5.328  1.00 42.33  ? 214  CYS B CB    1 
ATOM   3013 S  SG    . CYS B 1 37  ? 96.245  39.300 -6.726  1.00 40.26  ? 214  CYS B SG    1 
ATOM   3014 N  N     . LEU B 1 38  ? 94.438  42.008 -3.285  1.00 42.05  ? 215  LEU B N     1 
ATOM   3015 C  CA    . LEU B 1 38  ? 93.503  42.254 -2.193  1.00 42.96  ? 215  LEU B CA    1 
ATOM   3016 C  C     . LEU B 1 38  ? 92.697  43.501 -2.539  1.00 43.10  ? 215  LEU B C     1 
ATOM   3017 O  O     . LEU B 1 38  ? 91.462  43.511 -2.438  1.00 42.19  ? 215  LEU B O     1 
ATOM   3018 C  CB    . LEU B 1 38  ? 94.225  42.390 -0.847  1.00 42.77  ? 215  LEU B CB    1 
ATOM   3019 C  CG    . LEU B 1 38  ? 94.863  41.058 -0.419  1.00 43.80  ? 215  LEU B CG    1 
ATOM   3020 C  CD1   . LEU B 1 38  ? 95.948  41.210 0.693   1.00 37.51  ? 215  LEU B CD1   1 
ATOM   3021 C  CD2   . LEU B 1 38  ? 93.732  40.087 -0.003  1.00 40.15  ? 215  LEU B CD2   1 
ATOM   3022 N  N     . GLU B 1 39  ? 93.411  44.517 -3.028  1.00 43.44  ? 216  GLU B N     1 
ATOM   3023 C  CA    . GLU B 1 39  ? 92.800  45.778 -3.491  1.00 43.06  ? 216  GLU B CA    1 
ATOM   3024 C  C     . GLU B 1 39  ? 91.669  45.521 -4.508  1.00 42.70  ? 216  GLU B C     1 
ATOM   3025 O  O     . GLU B 1 39  ? 90.555  46.046 -4.389  1.00 41.60  ? 216  GLU B O     1 
ATOM   3026 C  CB    . GLU B 1 39  ? 93.884  46.660 -4.107  1.00 42.29  ? 216  GLU B CB    1 
ATOM   3027 C  CG    . GLU B 1 39  ? 93.328  47.877 -4.848  1.00 45.51  ? 216  GLU B CG    1 
ATOM   3028 C  CD    . GLU B 1 39  ? 94.408  48.837 -5.293  1.00 44.98  ? 216  GLU B CD    1 
ATOM   3029 O  OE1   . GLU B 1 39  ? 94.088  49.878 -5.872  1.00 44.46  ? 216  GLU B OE1   1 
ATOM   3030 O  OE2   . GLU B 1 39  ? 95.586  48.549 -5.050  1.00 50.65  ? 216  GLU B OE2   1 
ATOM   3031 N  N     . HIS B 1 40  ? 91.953  44.681 -5.496  1.00 43.02  ? 217  HIS B N     1 
ATOM   3032 C  CA    . HIS B 1 40  ? 90.975  44.425 -6.538  1.00 43.68  ? 217  HIS B CA    1 
ATOM   3033 C  C     . HIS B 1 40  ? 89.729  43.794 -5.924  1.00 43.34  ? 217  HIS B C     1 
ATOM   3034 O  O     . HIS B 1 40  ? 88.604  44.195 -6.243  1.00 43.30  ? 217  HIS B O     1 
ATOM   3035 C  CB    . HIS B 1 40  ? 91.544  43.524 -7.631  1.00 44.13  ? 217  HIS B CB    1 
ATOM   3036 C  CG    . HIS B 1 40  ? 90.492  42.889 -8.487  1.00 46.63  ? 217  HIS B CG    1 
ATOM   3037 N  ND1   . HIS B 1 40  ? 89.941  43.517 -9.583  1.00 48.46  ? 217  HIS B ND1   1 
ATOM   3038 C  CD2   . HIS B 1 40  ? 89.862  41.696 -8.380  1.00 49.37  ? 217  HIS B CD2   1 
ATOM   3039 C  CE1   . HIS B 1 40  ? 89.032  42.727 -10.123 1.00 49.57  ? 217  HIS B CE1   1 
ATOM   3040 N  NE2   . HIS B 1 40  ? 88.980  41.606 -9.425  1.00 49.36  ? 217  HIS B NE2   1 
ATOM   3041 N  N     . MET B 1 41  ? 89.932  42.873 -4.982  1.00 42.23  ? 218  MET B N     1 
ATOM   3042 C  CA    . MET B 1 41  ? 88.793  42.264 -4.291  1.00 41.96  ? 218  MET B CA    1 
ATOM   3043 C  C     . MET B 1 41  ? 87.873  43.338 -3.693  1.00 41.11  ? 218  MET B C     1 
ATOM   3044 O  O     . MET B 1 41  ? 86.651  43.230 -3.771  1.00 41.95  ? 218  MET B O     1 
ATOM   3045 C  CB    . MET B 1 41  ? 89.247  41.286 -3.205  1.00 41.94  ? 218  MET B CB    1 
ATOM   3046 C  CG    . MET B 1 41  ? 90.181  40.177 -3.700  1.00 41.68  ? 218  MET B CG    1 
ATOM   3047 S  SD    . MET B 1 41  ? 90.730  39.113 -2.354  1.00 45.92  ? 218  MET B SD    1 
ATOM   3048 C  CE    . MET B 1 41  ? 92.029  38.123 -3.136  1.00 38.89  ? 218  MET B CE    1 
ATOM   3049 N  N     . TYR B 1 42  ? 88.426  44.384 -3.110  1.00 40.67  ? 219  TYR B N     1 
ATOM   3050 C  CA    . TYR B 1 42  ? 87.552  45.347 -2.419  1.00 41.24  ? 219  TYR B CA    1 
ATOM   3051 C  C     . TYR B 1 42  ? 86.735  46.107 -3.463  1.00 41.29  ? 219  TYR B C     1 
ATOM   3052 O  O     . TYR B 1 42  ? 85.533  46.370 -3.253  1.00 40.95  ? 219  TYR B O     1 
ATOM   3053 C  CB    . TYR B 1 42  ? 88.315  46.307 -1.462  1.00 41.06  ? 219  TYR B CB    1 
ATOM   3054 C  CG    . TYR B 1 42  ? 88.466  45.727 -0.082  1.00 40.24  ? 219  TYR B CG    1 
ATOM   3055 C  CD1   . TYR B 1 42  ? 89.184  44.565 0.114   1.00 39.75  ? 219  TYR B CD1   1 
ATOM   3056 C  CD2   . TYR B 1 42  ? 87.790  46.264 1.009   1.00 43.60  ? 219  TYR B CD2   1 
ATOM   3057 C  CE1   . TYR B 1 42  ? 89.284  43.980 1.352   1.00 40.60  ? 219  TYR B CE1   1 
ATOM   3058 C  CE2   . TYR B 1 42  ? 87.900  45.691 2.285   1.00 42.96  ? 219  TYR B CE2   1 
ATOM   3059 C  CZ    . TYR B 1 42  ? 88.645  44.530 2.446   1.00 42.86  ? 219  TYR B CZ    1 
ATOM   3060 O  OH    . TYR B 1 42  ? 88.754  43.898 3.693   1.00 44.09  ? 219  TYR B OH    1 
ATOM   3061 N  N     . HIS B 1 43  ? 87.354  46.373 -4.617  1.00 40.74  ? 220  HIS B N     1 
ATOM   3062 C  CA    . HIS B 1 43  ? 86.643  47.082 -5.676  1.00 40.55  ? 220  HIS B CA    1 
ATOM   3063 C  C     . HIS B 1 43  ? 85.638  46.152 -6.295  1.00 40.63  ? 220  HIS B C     1 
ATOM   3064 O  O     . HIS B 1 43  ? 84.466  46.484 -6.393  1.00 39.65  ? 220  HIS B O     1 
ATOM   3065 C  CB    . HIS B 1 43  ? 87.598  47.608 -6.735  1.00 40.64  ? 220  HIS B CB    1 
ATOM   3066 C  CG    . HIS B 1 43  ? 88.330  48.856 -6.328  1.00 41.12  ? 220  HIS B CG    1 
ATOM   3067 N  ND1   . HIS B 1 43  ? 87.782  50.114 -6.455  1.00 36.87  ? 220  HIS B ND1   1 
ATOM   3068 C  CD2   . HIS B 1 43  ? 89.582  49.039 -5.835  1.00 40.40  ? 220  HIS B CD2   1 
ATOM   3069 C  CE1   . HIS B 1 43  ? 88.657  51.017 -6.042  1.00 38.70  ? 220  HIS B CE1   1 
ATOM   3070 N  NE2   . HIS B 1 43  ? 89.758  50.392 -5.663  1.00 39.49  ? 220  HIS B NE2   1 
ATOM   3071 N  N     . ASP B 1 44  ? 86.080  44.938 -6.601  1.00 41.16  ? 221  ASP B N     1 
ATOM   3072 C  CA    . ASP B 1 44  ? 85.257  43.994 -7.316  1.00 41.91  ? 221  ASP B CA    1 
ATOM   3073 C  C     . ASP B 1 44  ? 84.028  43.539 -6.531  1.00 42.25  ? 221  ASP B C     1 
ATOM   3074 O  O     . ASP B 1 44  ? 83.003  43.212 -7.118  1.00 41.30  ? 221  ASP B O     1 
ATOM   3075 C  CB    . ASP B 1 44  ? 86.082  42.779 -7.708  1.00 43.05  ? 221  ASP B CB    1 
ATOM   3076 C  CG    . ASP B 1 44  ? 85.297  41.789 -8.551  1.00 43.80  ? 221  ASP B CG    1 
ATOM   3077 O  OD1   . ASP B 1 44  ? 85.328  40.580 -8.230  1.00 47.02  ? 221  ASP B OD1   1 
ATOM   3078 O  OD2   . ASP B 1 44  ? 84.675  42.220 -9.545  1.00 45.38  ? 221  ASP B OD2   1 
ATOM   3079 N  N     . LEU B 1 45  ? 84.117  43.508 -5.209  1.00 42.75  ? 222  LEU B N     1 
ATOM   3080 C  CA    . LEU B 1 45  ? 82.961  43.084 -4.410  1.00 42.65  ? 222  LEU B CA    1 
ATOM   3081 C  C     . LEU B 1 45  ? 82.011  44.218 -4.110  1.00 42.99  ? 222  LEU B C     1 
ATOM   3082 O  O     . LEU B 1 45  ? 81.031  44.005 -3.390  1.00 43.10  ? 222  LEU B O     1 
ATOM   3083 C  CB    . LEU B 1 45  ? 83.415  42.454 -3.117  1.00 42.45  ? 222  LEU B CB    1 
ATOM   3084 C  CG    . LEU B 1 45  ? 84.142  41.123 -3.295  1.00 42.65  ? 222  LEU B CG    1 
ATOM   3085 C  CD1   . LEU B 1 45  ? 84.915  40.815 -2.000  1.00 36.71  ? 222  LEU B CD1   1 
ATOM   3086 C  CD2   . LEU B 1 45  ? 83.123  40.005 -3.689  1.00 38.99  ? 222  LEU B CD2   1 
ATOM   3087 N  N     . GLY B 1 46  ? 82.322  45.415 -4.639  1.00 42.98  ? 223  GLY B N     1 
ATOM   3088 C  CA    . GLY B 1 46  ? 81.510  46.619 -4.447  1.00 42.17  ? 223  GLY B CA    1 
ATOM   3089 C  C     . GLY B 1 46  ? 81.753  47.309 -3.118  1.00 42.39  ? 223  GLY B C     1 
ATOM   3090 O  O     . GLY B 1 46  ? 81.066  48.255 -2.768  1.00 43.77  ? 223  GLY B O     1 
ATOM   3091 N  N     . LEU B 1 47  ? 82.726  46.852 -2.354  1.00 42.47  ? 224  LEU B N     1 
ATOM   3092 C  CA    . LEU B 1 47  ? 82.906  47.389 -1.014  1.00 43.13  ? 224  LEU B CA    1 
ATOM   3093 C  C     . LEU B 1 47  ? 83.459  48.837 -1.082  1.00 43.80  ? 224  LEU B C     1 
ATOM   3094 O  O     . LEU B 1 47  ? 83.081  49.704 -0.271  1.00 44.10  ? 224  LEU B O     1 
ATOM   3095 C  CB    . LEU B 1 47  ? 83.811  46.471 -0.181  1.00 43.47  ? 224  LEU B CB    1 
ATOM   3096 C  CG    . LEU B 1 47  ? 83.439  44.968 -0.004  1.00 43.42  ? 224  LEU B CG    1 
ATOM   3097 C  CD1   . LEU B 1 47  ? 84.543  44.192 0.735   1.00 36.22  ? 224  LEU B CD1   1 
ATOM   3098 C  CD2   . LEU B 1 47  ? 82.096  44.779 0.707   1.00 41.39  ? 224  LEU B CD2   1 
ATOM   3099 N  N     . VAL B 1 48  ? 84.329  49.107 -2.058  1.00 43.03  ? 225  VAL B N     1 
ATOM   3100 C  CA    . VAL B 1 48  ? 84.817  50.463 -2.243  1.00 43.06  ? 225  VAL B CA    1 
ATOM   3101 C  C     . VAL B 1 48  ? 83.613  51.345 -2.590  1.00 43.22  ? 225  VAL B C     1 
ATOM   3102 O  O     . VAL B 1 48  ? 83.410  52.404 -2.002  1.00 41.99  ? 225  VAL B O     1 
ATOM   3103 C  CB    . VAL B 1 48  ? 85.930  50.565 -3.342  1.00 43.18  ? 225  VAL B CB    1 
ATOM   3104 C  CG1   . VAL B 1 48  ? 86.311  52.048 -3.587  1.00 41.28  ? 225  VAL B CG1   1 
ATOM   3105 C  CG2   . VAL B 1 48  ? 87.165  49.740 -2.955  1.00 41.39  ? 225  VAL B CG2   1 
ATOM   3106 N  N     . ARG B 1 49  ? 82.755  50.837 -3.459  1.00 43.41  ? 226  ARG B N     1 
ATOM   3107 C  CA    . ARG B 1 49  ? 81.567  51.570 -3.820  1.00 44.76  ? 226  ARG B CA    1 
ATOM   3108 C  C     . ARG B 1 49  ? 80.612  51.785 -2.630  1.00 43.98  ? 226  ARG B C     1 
ATOM   3109 O  O     . ARG B 1 49  ? 80.177  52.904 -2.374  1.00 43.70  ? 226  ARG B O     1 
ATOM   3110 C  CB    . ARG B 1 49  ? 80.845  50.894 -4.977  1.00 45.44  ? 226  ARG B CB    1 
ATOM   3111 C  CG    . ARG B 1 49  ? 79.521  51.582 -5.282  1.00 50.94  ? 226  ARG B CG    1 
ATOM   3112 C  CD    . ARG B 1 49  ? 78.653  50.808 -6.257  1.00 56.10  ? 226  ARG B CD    1 
ATOM   3113 N  NE    . ARG B 1 49  ? 78.182  49.516 -5.739  1.00 59.68  ? 226  ARG B NE    1 
ATOM   3114 C  CZ    . ARG B 1 49  ? 78.648  48.335 -6.146  1.00 61.71  ? 226  ARG B CZ    1 
ATOM   3115 N  NH1   . ARG B 1 49  ? 79.651  48.279 -7.042  1.00 63.59  ? 226  ARG B NH1   1 
ATOM   3116 N  NH2   . ARG B 1 49  ? 78.132  47.216 -5.639  1.00 59.20  ? 226  ARG B NH2   1 
ATOM   3117 N  N     . ASP B 1 50  ? 80.279  50.723 -1.909  1.00 43.68  ? 227  ASP B N     1 
ATOM   3118 C  CA    . ASP B 1 50  ? 79.164  50.800 -0.973  1.00 44.01  ? 227  ASP B CA    1 
ATOM   3119 C  C     . ASP B 1 50  ? 79.551  51.373 0.385   1.00 44.07  ? 227  ASP B C     1 
ATOM   3120 O  O     . ASP B 1 50  ? 78.694  51.773 1.160   1.00 45.09  ? 227  ASP B O     1 
ATOM   3121 C  CB    . ASP B 1 50  ? 78.478  49.442 -0.822  1.00 43.94  ? 227  ASP B CB    1 
ATOM   3122 C  CG    . ASP B 1 50  ? 77.754  49.015 -2.074  1.00 43.73  ? 227  ASP B CG    1 
ATOM   3123 O  OD1   . ASP B 1 50  ? 77.487  49.896 -2.914  1.00 46.43  ? 227  ASP B OD1   1 
ATOM   3124 O  OD2   . ASP B 1 50  ? 77.439  47.809 -2.218  1.00 43.84  ? 227  ASP B OD2   1 
ATOM   3125 N  N     . PHE B 1 51  ? 80.835  51.511 0.643   1.00 43.81  ? 228  PHE B N     1 
ATOM   3126 C  CA    . PHE B 1 51  ? 81.249  52.101 1.913   1.00 43.06  ? 228  PHE B CA    1 
ATOM   3127 C  C     . PHE B 1 51  ? 82.143  53.336 1.732   1.00 41.56  ? 228  PHE B C     1 
ATOM   3128 O  O     . PHE B 1 51  ? 82.754  53.839 2.684   1.00 40.41  ? 228  PHE B O     1 
ATOM   3129 C  CB    . PHE B 1 51  ? 81.878  51.025 2.795   1.00 42.86  ? 228  PHE B CB    1 
ATOM   3130 C  CG    . PHE B 1 51  ? 80.927  49.897 3.132   1.00 43.00  ? 228  PHE B CG    1 
ATOM   3131 C  CD1   . PHE B 1 51  ? 79.947  50.069 4.102   1.00 40.59  ? 228  PHE B CD1   1 
ATOM   3132 C  CD2   . PHE B 1 51  ? 81.017  48.668 2.481   1.00 44.52  ? 228  PHE B CD2   1 
ATOM   3133 C  CE1   . PHE B 1 51  ? 79.088  49.028 4.438   1.00 41.67  ? 228  PHE B CE1   1 
ATOM   3134 C  CE2   . PHE B 1 51  ? 80.135  47.620 2.784   1.00 43.23  ? 228  PHE B CE2   1 
ATOM   3135 C  CZ    . PHE B 1 51  ? 79.184  47.791 3.779   1.00 43.11  ? 228  PHE B CZ    1 
ATOM   3136 N  N     . SER B 1 52  ? 82.141  53.854 0.509   1.00 40.34  ? 229  SER B N     1 
ATOM   3137 C  CA    . SER B 1 52  ? 82.869  55.064 0.169   1.00 40.03  ? 229  SER B CA    1 
ATOM   3138 C  C     . SER B 1 52  ? 84.300  54.994 0.615   1.00 39.70  ? 229  SER B C     1 
ATOM   3139 O  O     . SER B 1 52  ? 84.782  55.939 1.209   1.00 39.75  ? 229  SER B O     1 
ATOM   3140 C  CB    . SER B 1 52  ? 82.215  56.275 0.833   1.00 39.75  ? 229  SER B CB    1 
ATOM   3141 O  OG    . SER B 1 52  ? 80.897  56.408 0.376   1.00 40.06  ? 229  SER B OG    1 
ATOM   3142 N  N     . ILE B 1 53  ? 84.961  53.861 0.409   1.00 40.17  ? 230  ILE B N     1 
ATOM   3143 C  CA    . ILE B 1 53  ? 86.309  53.697 0.905   1.00 40.31  ? 230  ILE B CA    1 
ATOM   3144 C  C     . ILE B 1 53  ? 87.142  54.523 -0.027  1.00 40.50  ? 230  ILE B C     1 
ATOM   3145 O  O     . ILE B 1 53  ? 86.983  54.412 -1.229  1.00 40.75  ? 230  ILE B O     1 
ATOM   3146 C  CB    . ILE B 1 53  ? 86.764  52.253 0.822   1.00 40.75  ? 230  ILE B CB    1 
ATOM   3147 C  CG1   . ILE B 1 53  ? 85.850  51.356 1.673   1.00 41.21  ? 230  ILE B CG1   1 
ATOM   3148 C  CG2   . ILE B 1 53  ? 88.243  52.147 1.225   1.00 40.89  ? 230  ILE B CG2   1 
ATOM   3149 C  CD1   . ILE B 1 53  ? 86.090  49.823 1.510   1.00 36.65  ? 230  ILE B CD1   1 
ATOM   3150 N  N     . ASN B 1 54  ? 87.952  55.419 0.512   1.00 41.69  ? 231  ASN B N     1 
ATOM   3151 C  CA    . ASN B 1 54  ? 88.846  56.219 -0.310  1.00 43.37  ? 231  ASN B CA    1 
ATOM   3152 C  C     . ASN B 1 54  ? 89.950  55.258 -0.864  1.00 42.62  ? 231  ASN B C     1 
ATOM   3153 O  O     . ASN B 1 54  ? 90.580  54.507 -0.103  1.00 42.41  ? 231  ASN B O     1 
ATOM   3154 C  CB    . ASN B 1 54  ? 89.348  57.466 0.476   1.00 44.52  ? 231  ASN B CB    1 
ATOM   3155 C  CG    . ASN B 1 54  ? 90.454  58.244 -0.282  1.00 53.50  ? 231  ASN B CG    1 
ATOM   3156 O  OD1   . ASN B 1 54  ? 90.226  59.336 -0.849  1.00 59.85  ? 231  ASN B OD1   1 
ATOM   3157 N  ND2   . ASN B 1 54  ? 91.654  57.649 -0.335  1.00 62.26  ? 231  ASN B ND2   1 
ATOM   3158 N  N     . PRO B 1 55  ? 90.026  55.131 -2.201  1.00 41.62  ? 232  PRO B N     1 
ATOM   3159 C  CA    . PRO B 1 55  ? 90.885  54.173 -2.872  1.00 41.86  ? 232  PRO B CA    1 
ATOM   3160 C  C     . PRO B 1 55  ? 92.355  54.249 -2.525  1.00 41.94  ? 232  PRO B C     1 
ATOM   3161 O  O     . PRO B 1 55  ? 93.035  53.218 -2.543  1.00 42.21  ? 232  PRO B O     1 
ATOM   3162 C  CB    . PRO B 1 55  ? 90.694  54.499 -4.350  1.00 41.57  ? 232  PRO B CB    1 
ATOM   3163 C  CG    . PRO B 1 55  ? 89.408  55.139 -4.428  1.00 40.81  ? 232  PRO B CG    1 
ATOM   3164 C  CD    . PRO B 1 55  ? 89.181  55.848 -3.164  1.00 41.50  ? 232  PRO B CD    1 
ATOM   3165 N  N     . VAL B 1 56  ? 92.858  55.441 -2.238  1.00 41.96  ? 233  VAL B N     1 
ATOM   3166 C  CA    . VAL B 1 56  ? 94.251  55.545 -1.768  1.00 42.41  ? 233  VAL B CA    1 
ATOM   3167 C  C     . VAL B 1 56  ? 94.366  55.028 -0.345  1.00 41.82  ? 233  VAL B C     1 
ATOM   3168 O  O     . VAL B 1 56  ? 95.358  54.406 0.026   1.00 43.23  ? 233  VAL B O     1 
ATOM   3169 C  CB    . VAL B 1 56  ? 94.851  57.009 -1.842  1.00 42.35  ? 233  VAL B CB    1 
ATOM   3170 C  CG1   . VAL B 1 56  ? 96.283  57.003 -1.356  1.00 41.17  ? 233  VAL B CG1   1 
ATOM   3171 C  CG2   . VAL B 1 56  ? 94.781  57.557 -3.275  1.00 39.24  ? 233  VAL B CG2   1 
ATOM   3172 N  N     . THR B 1 57  ? 93.384  55.330 0.481   1.00 41.59  ? 234  THR B N     1 
ATOM   3173 C  CA    . THR B 1 57  ? 93.404  54.787 1.823   1.00 41.53  ? 234  THR B CA    1 
ATOM   3174 C  C     . THR B 1 57  ? 93.363  53.268 1.800   1.00 41.83  ? 234  THR B C     1 
ATOM   3175 O  O     . THR B 1 57  ? 94.123  52.628 2.503   1.00 42.24  ? 234  THR B O     1 
ATOM   3176 C  CB    . THR B 1 57  ? 92.273  55.341 2.633   1.00 41.75  ? 234  THR B CB    1 
ATOM   3177 O  OG1   . THR B 1 57  ? 92.426  56.754 2.643   1.00 42.80  ? 234  THR B OG1   1 
ATOM   3178 C  CG2   . THR B 1 57  ? 92.287  54.798 4.091   1.00 40.11  ? 234  THR B CG2   1 
ATOM   3179 N  N     . LEU B 1 58  ? 92.529  52.691 0.942   1.00 42.00  ? 235  LEU B N     1 
ATOM   3180 C  CA    . LEU B 1 58  ? 92.493  51.234 0.795   1.00 41.54  ? 235  LEU B CA    1 
ATOM   3181 C  C     . LEU B 1 58  ? 93.893  50.665 0.558   1.00 41.99  ? 235  LEU B C     1 
ATOM   3182 O  O     . LEU B 1 58  ? 94.253  49.620 1.121   1.00 41.81  ? 235  LEU B O     1 
ATOM   3183 C  CB    . LEU B 1 58  ? 91.576  50.853 -0.350  1.00 41.25  ? 235  LEU B CB    1 
ATOM   3184 C  CG    . LEU B 1 58  ? 91.531  49.373 -0.692  1.00 41.61  ? 235  LEU B CG    1 
ATOM   3185 C  CD1   . LEU B 1 58  ? 91.040  48.569 0.496   1.00 41.03  ? 235  LEU B CD1   1 
ATOM   3186 C  CD2   . LEU B 1 58  ? 90.654  49.156 -1.929  1.00 40.01  ? 235  LEU B CD2   1 
ATOM   3187 N  N     . ARG B 1 59  ? 94.688  51.353 -0.262  1.00 42.38  ? 236  ARG B N     1 
ATOM   3188 C  CA    . ARG B 1 59  ? 96.054  50.909 -0.539  1.00 43.35  ? 236  ARG B CA    1 
ATOM   3189 C  C     . ARG B 1 59  ? 96.972  51.114 0.637   1.00 43.78  ? 236  ARG B C     1 
ATOM   3190 O  O     . ARG B 1 59  ? 97.799  50.231 0.922   1.00 43.26  ? 236  ARG B O     1 
ATOM   3191 C  CB    . ARG B 1 59  ? 96.684  51.674 -1.675  1.00 44.17  ? 236  ARG B CB    1 
ATOM   3192 C  CG    . ARG B 1 59  ? 96.227  51.302 -3.041  1.00 46.51  ? 236  ARG B CG    1 
ATOM   3193 C  CD    . ARG B 1 59  ? 97.381  51.466 -4.039  1.00 49.90  ? 236  ARG B CD    1 
ATOM   3194 N  NE    . ARG B 1 59  ? 96.819  51.592 -5.360  1.00 51.45  ? 236  ARG B NE    1 
ATOM   3195 C  CZ    . ARG B 1 59  ? 97.035  52.606 -6.172  1.00 56.39  ? 236  ARG B CZ    1 
ATOM   3196 N  NH1   . ARG B 1 59  ? 97.894  53.552 -5.847  1.00 57.63  ? 236  ARG B NH1   1 
ATOM   3197 N  NH2   . ARG B 1 59  ? 96.428  52.634 -7.346  1.00 59.94  ? 236  ARG B NH2   1 
ATOM   3198 N  N     . ARG B 1 60  ? 96.902  52.298 1.264   1.00 43.55  ? 237  ARG B N     1 
ATOM   3199 C  CA    . ARG B 1 60  ? 97.743  52.541 2.456   1.00 44.07  ? 237  ARG B CA    1 
ATOM   3200 C  C     . ARG B 1 60  ? 97.451  51.480 3.490   1.00 43.90  ? 237  ARG B C     1 
ATOM   3201 O  O     . ARG B 1 60  ? 98.361  50.854 4.044   1.00 44.60  ? 237  ARG B O     1 
ATOM   3202 C  CB    . ARG B 1 60  ? 97.559  53.941 3.055   1.00 43.98  ? 237  ARG B CB    1 
ATOM   3203 C  CG    . ARG B 1 60  ? 98.531  54.974 2.463   1.00 46.73  ? 237  ARG B CG    1 
ATOM   3204 C  CD    . ARG B 1 60  ? 98.427  56.383 3.030   1.00 47.92  ? 237  ARG B CD    1 
ATOM   3205 N  NE    . ARG B 1 60  ? 97.057  56.826 2.936   1.00 52.27  ? 237  ARG B NE    1 
ATOM   3206 C  CZ    . ARG B 1 60  ? 96.639  57.851 2.233   1.00 54.87  ? 237  ARG B CZ    1 
ATOM   3207 N  NH1   . ARG B 1 60  ? 97.491  58.629 1.591   1.00 56.39  ? 237  ARG B NH1   1 
ATOM   3208 N  NH2   . ARG B 1 60  ? 95.348  58.107 2.205   1.00 58.45  ? 237  ARG B NH2   1 
ATOM   3209 N  N     . TRP B 1 61  ? 96.167  51.229 3.692   1.00 43.78  ? 238  TRP B N     1 
ATOM   3210 C  CA    . TRP B 1 61  ? 95.729  50.293 4.702   1.00 43.59  ? 238  TRP B CA    1 
ATOM   3211 C  C     . TRP B 1 61  ? 96.323  48.926 4.402   1.00 43.07  ? 238  TRP B C     1 
ATOM   3212 O  O     . TRP B 1 61  ? 96.910  48.310 5.268   1.00 43.05  ? 238  TRP B O     1 
ATOM   3213 C  CB    . TRP B 1 61  ? 94.191  50.237 4.739   1.00 43.65  ? 238  TRP B CB    1 
ATOM   3214 C  CG    . TRP B 1 61  ? 93.664  49.157 5.596   1.00 43.54  ? 238  TRP B CG    1 
ATOM   3215 C  CD1   . TRP B 1 61  ? 93.746  49.088 6.940   1.00 44.52  ? 238  TRP B CD1   1 
ATOM   3216 C  CD2   . TRP B 1 61  ? 92.995  47.965 5.172   1.00 43.51  ? 238  TRP B CD2   1 
ATOM   3217 N  NE1   . TRP B 1 61  ? 93.186  47.918 7.389   1.00 44.70  ? 238  TRP B NE1   1 
ATOM   3218 C  CE2   . TRP B 1 61  ? 92.712  47.215 6.320   1.00 43.02  ? 238  TRP B CE2   1 
ATOM   3219 C  CE3   . TRP B 1 61  ? 92.616  47.459 3.936   1.00 45.19  ? 238  TRP B CE3   1 
ATOM   3220 C  CZ2   . TRP B 1 61  ? 92.070  45.995 6.272   1.00 43.06  ? 238  TRP B CZ2   1 
ATOM   3221 C  CZ3   . TRP B 1 61  ? 91.966  46.230 3.893   1.00 44.35  ? 238  TRP B CZ3   1 
ATOM   3222 C  CH2   . TRP B 1 61  ? 91.708  45.519 5.045   1.00 43.06  ? 238  TRP B CH2   1 
ATOM   3223 N  N     . LEU B 1 62  ? 96.159  48.443 3.175   1.00 42.93  ? 239  LEU B N     1 
ATOM   3224 C  CA    . LEU B 1 62  ? 96.702  47.120 2.814   1.00 42.76  ? 239  LEU B CA    1 
ATOM   3225 C  C     . LEU B 1 62  ? 98.227  47.035 2.974   1.00 42.29  ? 239  LEU B C     1 
ATOM   3226 O  O     . LEU B 1 62  ? 98.745  46.045 3.454   1.00 41.52  ? 239  LEU B O     1 
ATOM   3227 C  CB    . LEU B 1 62  ? 96.318  46.749 1.388   1.00 42.69  ? 239  LEU B CB    1 
ATOM   3228 C  CG    . LEU B 1 62  ? 94.865  46.337 1.189   1.00 42.37  ? 239  LEU B CG    1 
ATOM   3229 C  CD1   . LEU B 1 62  ? 94.510  46.262 -0.301  1.00 41.78  ? 239  LEU B CD1   1 
ATOM   3230 C  CD2   . LEU B 1 62  ? 94.639  45.026 1.870   1.00 40.13  ? 239  LEU B CD2   1 
ATOM   3231 N  N     . PHE B 1 63  ? 98.926  48.117 2.657   1.00 42.66  ? 240  PHE B N     1 
ATOM   3232 C  CA    . PHE B 1 63  ? 100.373 48.157 2.813   1.00 43.08  ? 240  PHE B CA    1 
ATOM   3233 C  C     . PHE B 1 63  ? 100.732 48.089 4.279   1.00 43.27  ? 240  PHE B C     1 
ATOM   3234 O  O     . PHE B 1 63  ? 101.665 47.394 4.695   1.00 43.21  ? 240  PHE B O     1 
ATOM   3235 C  CB    . PHE B 1 63  ? 100.936 49.445 2.232   1.00 43.78  ? 240  PHE B CB    1 
ATOM   3236 C  CG    . PHE B 1 63  ? 102.439 49.490 2.203   1.00 44.67  ? 240  PHE B CG    1 
ATOM   3237 C  CD1   . PHE B 1 63  ? 103.138 48.991 1.100   1.00 45.87  ? 240  PHE B CD1   1 
ATOM   3238 C  CD2   . PHE B 1 63  ? 103.151 50.027 3.274   1.00 44.55  ? 240  PHE B CD2   1 
ATOM   3239 C  CE1   . PHE B 1 63  ? 104.537 49.016 1.076   1.00 45.70  ? 240  PHE B CE1   1 
ATOM   3240 C  CE2   . PHE B 1 63  ? 104.552 50.076 3.266   1.00 46.31  ? 240  PHE B CE2   1 
ATOM   3241 C  CZ    . PHE B 1 63  ? 105.255 49.570 2.173   1.00 44.33  ? 240  PHE B CZ    1 
ATOM   3242 N  N     . CYS B 1 64  ? 99.985  48.834 5.074   1.00 43.73  ? 241  CYS B N     1 
ATOM   3243 C  CA    . CYS B 1 64  ? 100.219 48.839 6.505   1.00 43.77  ? 241  CYS B CA    1 
ATOM   3244 C  C     . CYS B 1 64  ? 99.930  47.466 7.109   1.00 43.26  ? 241  CYS B C     1 
ATOM   3245 O  O     . CYS B 1 64  ? 100.708 46.971 7.916   1.00 42.40  ? 241  CYS B O     1 
ATOM   3246 C  CB    . CYS B 1 64  ? 99.364  49.906 7.172   1.00 43.80  ? 241  CYS B CB    1 
ATOM   3247 S  SG    . CYS B 1 64  ? 99.729  50.025 8.908   1.00 45.41  ? 241  CYS B SG    1 
ATOM   3248 N  N     . VAL B 1 65  ? 98.824  46.847 6.710   1.00 43.34  ? 242  VAL B N     1 
ATOM   3249 C  CA    . VAL B 1 65  ? 98.526  45.492 7.176   1.00 43.78  ? 242  VAL B CA    1 
ATOM   3250 C  C     . VAL B 1 65  ? 99.678  44.573 6.793   1.00 45.17  ? 242  VAL B C     1 
ATOM   3251 O  O     . VAL B 1 65  ? 100.208 43.813 7.616   1.00 46.54  ? 242  VAL B O     1 
ATOM   3252 C  CB    . VAL B 1 65  ? 97.229  44.917 6.551   1.00 43.80  ? 242  VAL B CB    1 
ATOM   3253 C  CG1   . VAL B 1 65  ? 97.155  43.402 6.781   1.00 40.09  ? 242  VAL B CG1   1 
ATOM   3254 C  CG2   . VAL B 1 65  ? 95.957  45.653 7.084   1.00 40.69  ? 242  VAL B CG2   1 
ATOM   3255 N  N     . HIS B 1 66  ? 100.090 44.657 5.542   1.00 45.80  ? 243  HIS B N     1 
ATOM   3256 C  CA    . HIS B 1 66  ? 101.231 43.872 5.099   1.00 46.81  ? 243  HIS B CA    1 
ATOM   3257 C  C     . HIS B 1 66  ? 102.448 44.080 6.010   1.00 46.66  ? 243  HIS B C     1 
ATOM   3258 O  O     . HIS B 1 66  ? 103.114 43.118 6.367   1.00 47.18  ? 243  HIS B O     1 
ATOM   3259 C  CB    . HIS B 1 66  ? 101.580 44.175 3.634   1.00 46.78  ? 243  HIS B CB    1 
ATOM   3260 C  CG    . HIS B 1 66  ? 102.992 43.848 3.286   1.00 49.50  ? 243  HIS B CG    1 
ATOM   3261 N  ND1   . HIS B 1 66  ? 104.002 44.785 3.335   1.00 50.68  ? 243  HIS B ND1   1 
ATOM   3262 C  CD2   . HIS B 1 66  ? 103.587 42.664 2.997   1.00 51.53  ? 243  HIS B CD2   1 
ATOM   3263 C  CE1   . HIS B 1 66  ? 105.150 44.200 3.037   1.00 51.83  ? 243  HIS B CE1   1 
ATOM   3264 N  NE2   . HIS B 1 66  ? 104.924 42.917 2.814   1.00 50.79  ? 243  HIS B NE2   1 
ATOM   3265 N  N     . ASP B 1 67  ? 102.728 45.314 6.412   1.00 46.28  ? 244  ASP B N     1 
ATOM   3266 C  CA    . ASP B 1 67  ? 103.909 45.564 7.231   1.00 46.24  ? 244  ASP B CA    1 
ATOM   3267 C  C     . ASP B 1 67  ? 103.793 44.947 8.620   1.00 45.92  ? 244  ASP B C     1 
ATOM   3268 O  O     . ASP B 1 67  ? 104.805 44.597 9.232   1.00 46.27  ? 244  ASP B O     1 
ATOM   3269 C  CB    . ASP B 1 67  ? 104.174 47.058 7.361   1.00 47.01  ? 244  ASP B CB    1 
ATOM   3270 C  CG    . ASP B 1 67  ? 105.593 47.359 7.831   1.00 47.34  ? 244  ASP B CG    1 
ATOM   3271 O  OD1   . ASP B 1 67  ? 106.538 46.961 7.120   1.00 46.13  ? 244  ASP B OD1   1 
ATOM   3272 O  OD2   . ASP B 1 67  ? 105.752 48.027 8.886   1.00 49.81  ? 244  ASP B OD2   1 
ATOM   3273 N  N     . ASN B 1 68  ? 102.568 44.775 9.103   1.00 45.72  ? 245  ASN B N     1 
ATOM   3274 C  CA    . ASN B 1 68  ? 102.347 44.250 10.453  1.00 45.33  ? 245  ASN B CA    1 
ATOM   3275 C  C     . ASN B 1 68  ? 102.139 42.759 10.502  1.00 45.57  ? 245  ASN B C     1 
ATOM   3276 O  O     . ASN B 1 68  ? 101.879 42.202 11.568  1.00 45.49  ? 245  ASN B O     1 
ATOM   3277 C  CB    . ASN B 1 68  ? 101.148 44.930 11.103  1.00 45.32  ? 245  ASN B CB    1 
ATOM   3278 C  CG    . ASN B 1 68  ? 101.456 46.327 11.528  1.00 44.91  ? 245  ASN B CG    1 
ATOM   3279 O  OD1   . ASN B 1 68  ? 102.157 46.517 12.506  1.00 49.07  ? 245  ASN B OD1   1 
ATOM   3280 N  ND2   . ASN B 1 68  ? 100.998 47.315 10.767  1.00 39.29  ? 245  ASN B ND2   1 
ATOM   3281 N  N     . TYR B 1 69  ? 102.242 42.089 9.360   1.00 46.01  ? 246  TYR B N     1 
ATOM   3282 C  CA    . TYR B 1 69  ? 102.485 40.648 9.404   1.00 46.24  ? 246  TYR B CA    1 
ATOM   3283 C  C     . TYR B 1 69  ? 103.977 40.408 9.567   1.00 47.39  ? 246  TYR B C     1 
ATOM   3284 O  O     . TYR B 1 69  ? 104.774 41.200 9.113   1.00 48.47  ? 246  TYR B O     1 
ATOM   3285 C  CB    . TYR B 1 69  ? 101.920 39.934 8.183   1.00 45.89  ? 246  TYR B CB    1 
ATOM   3286 C  CG    . TYR B 1 69  ? 100.436 39.603 8.318   1.00 44.98  ? 246  TYR B CG    1 
ATOM   3287 C  CD1   . TYR B 1 69  ? 99.459  40.529 7.979   1.00 46.30  ? 246  TYR B CD1   1 
ATOM   3288 C  CD2   . TYR B 1 69  ? 100.019 38.392 8.830   1.00 42.47  ? 246  TYR B CD2   1 
ATOM   3289 C  CE1   . TYR B 1 69  ? 98.105  40.235 8.129   1.00 45.38  ? 246  TYR B CE1   1 
ATOM   3290 C  CE2   . TYR B 1 69  ? 98.686  38.094 8.971   1.00 42.01  ? 246  TYR B CE2   1 
ATOM   3291 C  CZ    . TYR B 1 69  ? 97.725  39.015 8.625   1.00 46.05  ? 246  TYR B CZ    1 
ATOM   3292 O  OH    . TYR B 1 69  ? 96.374  38.717 8.782   1.00 47.56  ? 246  TYR B OH    1 
ATOM   3293 N  N     . ARG B 1 70  ? 104.338 39.393 10.336  1.00 48.62  ? 247  ARG B N     1 
ATOM   3294 C  CA    . ARG B 1 70  ? 105.727 39.035 10.538  1.00 49.85  ? 247  ARG B CA    1 
ATOM   3295 C  C     . ARG B 1 70  ? 106.189 37.963 9.604   1.00 49.95  ? 247  ARG B C     1 
ATOM   3296 O  O     . ARG B 1 70  ? 105.395 37.209 9.091   1.00 49.19  ? 247  ARG B O     1 
ATOM   3297 C  CB    . ARG B 1 70  ? 105.954 38.530 11.958  1.00 50.81  ? 247  ARG B CB    1 
ATOM   3298 C  CG    . ARG B 1 70  ? 105.625 39.558 13.018  1.00 54.84  ? 247  ARG B CG    1 
ATOM   3299 C  CD    . ARG B 1 70  ? 106.455 39.380 14.259  1.00 59.49  ? 247  ARG B CD    1 
ATOM   3300 N  NE    . ARG B 1 70  ? 105.665 39.591 15.467  1.00 65.30  ? 247  ARG B NE    1 
ATOM   3301 C  CZ    . ARG B 1 70  ? 106.083 39.276 16.694  1.00 71.16  ? 247  ARG B CZ    1 
ATOM   3302 N  NH1   . ARG B 1 70  ? 107.291 38.729 16.873  1.00 72.48  ? 247  ARG B NH1   1 
ATOM   3303 N  NH2   . ARG B 1 70  ? 105.281 39.474 17.742  1.00 71.31  ? 247  ARG B NH2   1 
ATOM   3304 N  N     . ASN B 1 71  ? 107.507 37.836 9.484   1.00 51.48  ? 248  ASN B N     1 
ATOM   3305 C  CA    . ASN B 1 71  ? 108.126 36.896 8.544   1.00 52.49  ? 248  ASN B CA    1 
ATOM   3306 C  C     . ASN B 1 71  ? 108.319 35.560 9.201   1.00 50.62  ? 248  ASN B C     1 
ATOM   3307 O  O     . ASN B 1 71  ? 109.443 35.129 9.387   1.00 50.62  ? 248  ASN B O     1 
ATOM   3308 C  CB    . ASN B 1 71  ? 109.481 37.436 8.033   1.00 53.80  ? 248  ASN B CB    1 
ATOM   3309 C  CG    . ASN B 1 71  ? 109.334 38.775 7.230   1.00 58.59  ? 248  ASN B CG    1 
ATOM   3310 O  OD1   . ASN B 1 71  ? 108.348 39.002 6.497   1.00 60.54  ? 248  ASN B OD1   1 
ATOM   3311 N  ND2   . ASN B 1 71  ? 110.322 39.661 7.389   1.00 64.07  ? 248  ASN B ND2   1 
ATOM   3312 N  N     . ASN B 1 72  ? 107.200 34.963 9.600   1.00 48.97  ? 249  ASN B N     1 
ATOM   3313 C  CA    . ASN B 1 72  ? 107.144 33.606 10.120  1.00 47.93  ? 249  ASN B CA    1 
ATOM   3314 C  C     . ASN B 1 72  ? 107.104 32.587 8.982   1.00 47.13  ? 249  ASN B C     1 
ATOM   3315 O  O     . ASN B 1 72  ? 106.637 32.886 7.890   1.00 46.46  ? 249  ASN B O     1 
ATOM   3316 C  CB    . ASN B 1 72  ? 105.871 33.411 10.962  1.00 48.06  ? 249  ASN B CB    1 
ATOM   3317 C  CG    . ASN B 1 72  ? 105.798 34.329 12.171  1.00 47.30  ? 249  ASN B CG    1 
ATOM   3318 O  OD1   . ASN B 1 72  ? 106.767 34.490 12.906  1.00 47.16  ? 249  ASN B OD1   1 
ATOM   3319 N  ND2   . ASN B 1 72  ? 104.612 34.869 12.426  1.00 46.58  ? 249  ASN B ND2   1 
ATOM   3320 N  N     . PRO B 1 73  ? 107.481 31.333 9.272   1.00 47.13  ? 250  PRO B N     1 
ATOM   3321 C  CA    . PRO B 1 73  ? 107.374 30.264 8.254   1.00 46.54  ? 250  PRO B CA    1 
ATOM   3322 C  C     . PRO B 1 73  ? 105.949 30.043 7.764   1.00 46.84  ? 250  PRO B C     1 
ATOM   3323 O  O     . PRO B 1 73  ? 105.736 29.776 6.579   1.00 46.96  ? 250  PRO B O     1 
ATOM   3324 C  CB    . PRO B 1 73  ? 107.863 29.011 8.995   1.00 46.35  ? 250  PRO B CB    1 
ATOM   3325 C  CG    . PRO B 1 73  ? 108.625 29.521 10.178  1.00 46.37  ? 250  PRO B CG    1 
ATOM   3326 C  CD    . PRO B 1 73  ? 108.008 30.824 10.554  1.00 46.98  ? 250  PRO B CD    1 
ATOM   3327 N  N     . PHE B 1 74  ? 104.981 30.119 8.666   1.00 46.47  ? 251  PHE B N     1 
ATOM   3328 C  CA    . PHE B 1 74  ? 103.612 29.841 8.286   1.00 47.22  ? 251  PHE B CA    1 
ATOM   3329 C  C     . PHE B 1 74  ? 102.667 31.050 8.441   1.00 47.29  ? 251  PHE B C     1 
ATOM   3330 O  O     . PHE B 1 74  ? 102.011 31.441 7.481   1.00 47.30  ? 251  PHE B O     1 
ATOM   3331 C  CB    . PHE B 1 74  ? 103.094 28.651 9.069   1.00 47.03  ? 251  PHE B CB    1 
ATOM   3332 C  CG    . PHE B 1 74  ? 101.704 28.258 8.691   1.00 48.30  ? 251  PHE B CG    1 
ATOM   3333 C  CD1   . PHE B 1 74  ? 101.482 27.271 7.757   1.00 46.49  ? 251  PHE B CD1   1 
ATOM   3334 C  CD2   . PHE B 1 74  ? 100.609 28.914 9.235   1.00 49.83  ? 251  PHE B CD2   1 
ATOM   3335 C  CE1   . PHE B 1 74  ? 100.206 26.926 7.402   1.00 46.87  ? 251  PHE B CE1   1 
ATOM   3336 C  CE2   . PHE B 1 74  ? 99.326  28.560 8.870   1.00 48.47  ? 251  PHE B CE2   1 
ATOM   3337 C  CZ    . PHE B 1 74  ? 99.137  27.555 7.965   1.00 47.51  ? 251  PHE B CZ    1 
ATOM   3338 N  N     . HIS B 1 75  ? 102.616 31.628 9.641   1.00 47.51  ? 252  HIS B N     1 
ATOM   3339 C  CA    . HIS B 1 75  ? 101.711 32.746 9.956   1.00 47.64  ? 252  HIS B CA    1 
ATOM   3340 C  C     . HIS B 1 75  ? 102.268 34.094 9.497   1.00 47.96  ? 252  HIS B C     1 
ATOM   3341 O  O     . HIS B 1 75  ? 102.670 34.948 10.296  1.00 47.83  ? 252  HIS B O     1 
ATOM   3342 C  CB    . HIS B 1 75  ? 101.397 32.761 11.445  1.00 47.03  ? 252  HIS B CB    1 
ATOM   3343 C  CG    . HIS B 1 75  ? 100.545 31.621 11.860  1.00 46.84  ? 252  HIS B CG    1 
ATOM   3344 N  ND1   . HIS B 1 75  ? 101.059 30.480 12.433  1.00 46.79  ? 252  HIS B ND1   1 
ATOM   3345 C  CD2   . HIS B 1 75  ? 99.224  31.396 11.686  1.00 48.14  ? 252  HIS B CD2   1 
ATOM   3346 C  CE1   . HIS B 1 75  ? 100.077 29.632 12.666  1.00 46.78  ? 252  HIS B CE1   1 
ATOM   3347 N  NE2   . HIS B 1 75  ? 98.951  30.165 12.224  1.00 48.46  ? 252  HIS B NE2   1 
ATOM   3348 N  N     . ASN B 1 76  ? 102.230 34.268 8.181   1.00 48.83  ? 253  ASN B N     1 
ATOM   3349 C  CA    . ASN B 1 76  ? 102.890 35.363 7.486   1.00 48.10  ? 253  ASN B CA    1 
ATOM   3350 C  C     . ASN B 1 76  ? 101.913 36.013 6.494   1.00 48.21  ? 253  ASN B C     1 
ATOM   3351 O  O     . ASN B 1 76  ? 100.755 35.596 6.357   1.00 48.70  ? 253  ASN B O     1 
ATOM   3352 C  CB    . ASN B 1 76  ? 104.130 34.823 6.759   1.00 47.19  ? 253  ASN B CB    1 
ATOM   3353 C  CG    . ASN B 1 76  ? 103.802 33.645 5.836   1.00 45.87  ? 253  ASN B CG    1 
ATOM   3354 O  OD1   . ASN B 1 76  ? 102.723 33.576 5.259   1.00 41.06  ? 253  ASN B OD1   1 
ATOM   3355 N  ND2   . ASN B 1 76  ? 104.717 32.702 5.737   1.00 42.66  ? 253  ASN B ND2   1 
ATOM   3356 N  N     . PHE B 1 77  ? 102.380 37.028 5.781   1.00 48.03  ? 254  PHE B N     1 
ATOM   3357 C  CA    . PHE B 1 77  ? 101.486 37.781 4.941   1.00 47.01  ? 254  PHE B CA    1 
ATOM   3358 C  C     . PHE B 1 77  ? 100.872 36.899 3.867   1.00 46.63  ? 254  PHE B C     1 
ATOM   3359 O  O     . PHE B 1 77  ? 99.713  37.079 3.500   1.00 45.65  ? 254  PHE B O     1 
ATOM   3360 C  CB    . PHE B 1 77  ? 102.199 38.956 4.308   1.00 46.17  ? 254  PHE B CB    1 
ATOM   3361 C  CG    . PHE B 1 77  ? 101.339 39.707 3.365   1.00 46.93  ? 254  PHE B CG    1 
ATOM   3362 C  CD1   . PHE B 1 77  ? 100.171 40.287 3.809   1.00 48.19  ? 254  PHE B CD1   1 
ATOM   3363 C  CD2   . PHE B 1 77  ? 101.633 39.758 2.031   1.00 46.56  ? 254  PHE B CD2   1 
ATOM   3364 C  CE1   . PHE B 1 77  ? 99.339  40.919 2.944   1.00 47.16  ? 254  PHE B CE1   1 
ATOM   3365 C  CE2   . PHE B 1 77  ? 100.806 40.410 1.171   1.00 48.00  ? 254  PHE B CE2   1 
ATOM   3366 C  CZ    . PHE B 1 77  ? 99.648  40.984 1.629   1.00 46.94  ? 254  PHE B CZ    1 
ATOM   3367 N  N     . ARG B 1 78  ? 101.643 35.941 3.366   1.00 46.40  ? 255  ARG B N     1 
ATOM   3368 C  CA    . ARG B 1 78  ? 101.123 35.076 2.313   1.00 47.11  ? 255  ARG B CA    1 
ATOM   3369 C  C     . ARG B 1 78  ? 99.977  34.193 2.818   1.00 47.08  ? 255  ARG B C     1 
ATOM   3370 O  O     . ARG B 1 78  ? 98.998  33.955 2.087   1.00 46.76  ? 255  ARG B O     1 
ATOM   3371 C  CB    . ARG B 1 78  ? 102.212 34.217 1.663   1.00 47.15  ? 255  ARG B CB    1 
ATOM   3372 C  CG    . ARG B 1 78  ? 101.734 33.579 0.347   1.00 47.99  ? 255  ARG B CG    1 
ATOM   3373 C  CD    . ARG B 1 78  ? 102.777 32.689 -0.369  1.00 48.65  ? 255  ARG B CD    1 
ATOM   3374 N  NE    . ARG B 1 78  ? 104.029 33.408 -0.566  1.00 47.20  ? 255  ARG B NE    1 
ATOM   3375 C  CZ    . ARG B 1 78  ? 104.300 34.167 -1.615  1.00 44.43  ? 255  ARG B CZ    1 
ATOM   3376 N  NH1   . ARG B 1 78  ? 103.480 34.224 -2.646  1.00 42.43  ? 255  ARG B NH1   1 
ATOM   3377 N  NH2   . ARG B 1 78  ? 105.442 34.826 -1.652  1.00 44.88  ? 255  ARG B NH2   1 
ATOM   3378 N  N     . HIS B 1 79  ? 100.061 33.750 4.068   1.00 47.02  ? 256  HIS B N     1 
ATOM   3379 C  CA    . HIS B 1 79  ? 98.967  32.973 4.634   1.00 47.88  ? 256  HIS B CA    1 
ATOM   3380 C  C     . HIS B 1 79  ? 97.726  33.849 4.687   1.00 47.51  ? 256  HIS B C     1 
ATOM   3381 O  O     . HIS B 1 79  ? 96.626  33.440 4.290   1.00 47.80  ? 256  HIS B O     1 
ATOM   3382 C  CB    . HIS B 1 79  ? 99.310  32.451 6.017   1.00 48.11  ? 256  HIS B CB    1 
ATOM   3383 C  CG    . HIS B 1 79  ? 98.127  31.940 6.769   1.00 51.75  ? 256  HIS B CG    1 
ATOM   3384 N  ND1   . HIS B 1 79  ? 97.417  30.826 6.367   1.00 51.06  ? 256  HIS B ND1   1 
ATOM   3385 C  CD2   . HIS B 1 79  ? 97.495  32.421 7.873   1.00 54.68  ? 256  HIS B CD2   1 
ATOM   3386 C  CE1   . HIS B 1 79  ? 96.413  30.629 7.207   1.00 56.33  ? 256  HIS B CE1   1 
ATOM   3387 N  NE2   . HIS B 1 79  ? 96.437  31.582 8.131   1.00 56.44  ? 256  HIS B NE2   1 
ATOM   3388 N  N     . CYS B 1 80  ? 97.923  35.083 5.116   1.00 47.01  ? 257  CYS B N     1 
ATOM   3389 C  CA    . CYS B 1 80  ? 96.820  36.017 5.210   1.00 46.81  ? 257  CYS B CA    1 
ATOM   3390 C  C     . CYS B 1 80  ? 96.184  36.175 3.853   1.00 46.48  ? 257  CYS B C     1 
ATOM   3391 O  O     . CYS B 1 80  ? 94.962  36.130 3.724   1.00 46.16  ? 257  CYS B O     1 
ATOM   3392 C  CB    . CYS B 1 80  ? 97.324  37.341 5.775   1.00 47.14  ? 257  CYS B CB    1 
ATOM   3393 S  SG    . CYS B 1 80  ? 96.848  38.849 4.964   1.00 47.72  ? 257  CYS B SG    1 
ATOM   3394 N  N     . PHE B 1 81  ? 97.024  36.266 2.828   1.00 46.43  ? 258  PHE B N     1 
ATOM   3395 C  CA    . PHE B 1 81  ? 96.539  36.319 1.453   1.00 46.79  ? 258  PHE B CA    1 
ATOM   3396 C  C     . PHE B 1 81  ? 95.690  35.072 1.093   1.00 46.14  ? 258  PHE B C     1 
ATOM   3397 O  O     . PHE B 1 81  ? 94.617  35.218 0.516   1.00 46.21  ? 258  PHE B O     1 
ATOM   3398 C  CB    . PHE B 1 81  ? 97.708  36.520 0.459   1.00 46.74  ? 258  PHE B CB    1 
ATOM   3399 C  CG    . PHE B 1 81  ? 97.270  36.547 -0.985  1.00 47.93  ? 258  PHE B CG    1 
ATOM   3400 C  CD1   . PHE B 1 81  ? 97.547  35.484 -1.828  1.00 46.94  ? 258  PHE B CD1   1 
ATOM   3401 C  CD2   . PHE B 1 81  ? 96.506  37.599 -1.470  1.00 47.53  ? 258  PHE B CD2   1 
ATOM   3402 C  CE1   . PHE B 1 81  ? 97.083  35.466 -3.112  1.00 46.19  ? 258  PHE B CE1   1 
ATOM   3403 C  CE2   . PHE B 1 81  ? 96.043  37.585 -2.754  1.00 48.41  ? 258  PHE B CE2   1 
ATOM   3404 C  CZ    . PHE B 1 81  ? 96.312  36.500 -3.574  1.00 48.12  ? 258  PHE B CZ    1 
ATOM   3405 N  N     . CYS B 1 82  ? 96.128  33.876 1.482   1.00 45.58  ? 259  CYS B N     1 
ATOM   3406 C  CA    . CYS B 1 82  ? 95.349  32.662 1.211   1.00 46.52  ? 259  CYS B CA    1 
ATOM   3407 C  C     . CYS B 1 82  ? 93.982  32.727 1.836   1.00 46.46  ? 259  CYS B C     1 
ATOM   3408 O  O     . CYS B 1 82  ? 92.971  32.410 1.201   1.00 46.73  ? 259  CYS B O     1 
ATOM   3409 C  CB    . CYS B 1 82  ? 96.021  31.415 1.778   1.00 47.32  ? 259  CYS B CB    1 
ATOM   3410 S  SG    . CYS B 1 82  ? 97.630  31.094 1.090   1.00 49.03  ? 259  CYS B SG    1 
ATOM   3411 N  N     . VAL B 1 83  ? 93.951  33.113 3.104   1.00 45.87  ? 260  VAL B N     1 
ATOM   3412 C  CA    . VAL B 1 83  ? 92.704  33.090 3.831   1.00 45.19  ? 260  VAL B CA    1 
ATOM   3413 C  C     . VAL B 1 83  ? 91.718  34.082 3.189   1.00 45.66  ? 260  VAL B C     1 
ATOM   3414 O  O     . VAL B 1 83  ? 90.535  33.754 2.942   1.00 45.38  ? 260  VAL B O     1 
ATOM   3415 C  CB    . VAL B 1 83  ? 92.935  33.371 5.321   1.00 45.58  ? 260  VAL B CB    1 
ATOM   3416 C  CG1   . VAL B 1 83  ? 91.594  33.433 6.050   1.00 43.74  ? 260  VAL B CG1   1 
ATOM   3417 C  CG2   . VAL B 1 83  ? 93.896  32.289 5.941   1.00 41.60  ? 260  VAL B CG2   1 
ATOM   3418 N  N     . ALA B 1 84  ? 92.227  35.256 2.829   1.00 45.38  ? 261  ALA B N     1 
ATOM   3419 C  CA    . ALA B 1 84  ? 91.400  36.273 2.172   1.00 45.38  ? 261  ALA B CA    1 
ATOM   3420 C  C     . ALA B 1 84  ? 90.950  35.789 0.792   1.00 45.36  ? 261  ALA B C     1 
ATOM   3421 O  O     . ALA B 1 84  ? 89.793  35.961 0.393   1.00 44.45  ? 261  ALA B O     1 
ATOM   3422 C  CB    . ALA B 1 84  ? 92.184  37.589 2.044   1.00 45.18  ? 261  ALA B CB    1 
ATOM   3423 N  N     . GLN B 1 85  ? 91.875  35.176 0.062   1.00 45.11  ? 262  GLN B N     1 
ATOM   3424 C  CA    . GLN B 1 85  ? 91.578  34.759 -1.299  1.00 45.16  ? 262  GLN B CA    1 
ATOM   3425 C  C     . GLN B 1 85  ? 90.566  33.613 -1.292  1.00 44.87  ? 262  GLN B C     1 
ATOM   3426 O  O     . GLN B 1 85  ? 89.702  33.502 -2.186  1.00 44.30  ? 262  GLN B O     1 
ATOM   3427 C  CB    . GLN B 1 85  ? 92.864  34.380 -2.054  1.00 44.57  ? 262  GLN B CB    1 
ATOM   3428 C  CG    . GLN B 1 85  ? 92.651  34.218 -3.562  1.00 43.66  ? 262  GLN B CG    1 
ATOM   3429 C  CD    . GLN B 1 85  ? 92.294  32.794 -3.958  1.00 42.42  ? 262  GLN B CD    1 
ATOM   3430 O  OE1   . GLN B 1 85  ? 92.727  31.850 -3.304  1.00 41.07  ? 262  GLN B OE1   1 
ATOM   3431 N  NE2   . GLN B 1 85  ? 91.530  32.634 -5.047  1.00 37.86  ? 262  GLN B NE2   1 
ATOM   3432 N  N     . MET B 1 86  ? 90.637  32.792 -0.256  1.00 44.67  ? 263  MET B N     1 
ATOM   3433 C  CA    . MET B 1 86  ? 89.700  31.704 -0.147  1.00 44.40  ? 263  MET B CA    1 
ATOM   3434 C  C     . MET B 1 86  ? 88.326  32.259 0.215   1.00 43.64  ? 263  MET B C     1 
ATOM   3435 O  O     . MET B 1 86  ? 87.318  31.714 -0.167  1.00 43.10  ? 263  MET B O     1 
ATOM   3436 C  CB    . MET B 1 86  ? 90.172  30.652 0.868   1.00 44.11  ? 263  MET B CB    1 
ATOM   3437 C  CG    . MET B 1 86  ? 89.299  29.401 0.868   1.00 42.15  ? 263  MET B CG    1 
ATOM   3438 S  SD    . MET B 1 86  ? 89.365  28.500 -0.705  1.00 41.95  ? 263  MET B SD    1 
ATOM   3439 C  CE    . MET B 1 86  ? 91.015  27.795 -0.625  1.00 37.13  ? 263  MET B CE    1 
ATOM   3440 N  N     . MET B 1 87  ? 88.289  33.356 0.942   1.00 43.35  ? 264  MET B N     1 
ATOM   3441 C  CA    . MET B 1 87  ? 86.999  33.962 1.306   1.00 43.74  ? 264  MET B CA    1 
ATOM   3442 C  C     . MET B 1 87  ? 86.353  34.597 0.074   1.00 43.70  ? 264  MET B C     1 
ATOM   3443 O  O     . MET B 1 87  ? 85.136  34.497 -0.173  1.00 43.28  ? 264  MET B O     1 
ATOM   3444 C  CB    . MET B 1 87  ? 87.224  35.015 2.388   1.00 42.99  ? 264  MET B CB    1 
ATOM   3445 C  CG    . MET B 1 87  ? 85.972  35.641 2.904   1.00 45.56  ? 264  MET B CG    1 
ATOM   3446 S  SD    . MET B 1 87  ? 84.982  34.516 3.921   1.00 46.85  ? 264  MET B SD    1 
ATOM   3447 C  CE    . MET B 1 87  ? 85.918  34.449 5.462   1.00 38.15  ? 264  MET B CE    1 
ATOM   3448 N  N     . TYR B 1 88  ? 87.194  35.245 -0.709  1.00 43.40  ? 265  TYR B N     1 
ATOM   3449 C  CA    . TYR B 1 88  ? 86.787  35.777 -1.970  1.00 43.82  ? 265  TYR B CA    1 
ATOM   3450 C  C     . TYR B 1 88  ? 86.253  34.638 -2.849  1.00 43.95  ? 265  TYR B C     1 
ATOM   3451 O  O     . TYR B 1 88  ? 85.167  34.760 -3.419  1.00 43.91  ? 265  TYR B O     1 
ATOM   3452 C  CB    . TYR B 1 88  ? 87.971  36.521 -2.596  1.00 44.99  ? 265  TYR B CB    1 
ATOM   3453 C  CG    . TYR B 1 88  ? 87.757  37.193 -3.927  1.00 44.68  ? 265  TYR B CG    1 
ATOM   3454 C  CD1   . TYR B 1 88  ? 86.968  38.336 -4.041  1.00 48.17  ? 265  TYR B CD1   1 
ATOM   3455 C  CD2   . TYR B 1 88  ? 88.419  36.738 -5.055  1.00 44.97  ? 265  TYR B CD2   1 
ATOM   3456 C  CE1   . TYR B 1 88  ? 86.828  38.988 -5.272  1.00 49.09  ? 265  TYR B CE1   1 
ATOM   3457 C  CE2   . TYR B 1 88  ? 88.299  37.377 -6.274  1.00 45.04  ? 265  TYR B CE2   1 
ATOM   3458 C  CZ    . TYR B 1 88  ? 87.509  38.496 -6.393  1.00 48.73  ? 265  TYR B CZ    1 
ATOM   3459 O  OH    . TYR B 1 88  ? 87.397  39.122 -7.635  1.00 49.93  ? 265  TYR B OH    1 
ATOM   3460 N  N     . SER B 1 89  ? 86.958  33.512 -2.905  1.00 43.84  ? 266  SER B N     1 
ATOM   3461 C  CA    . SER B 1 89  ? 86.480  32.368 -3.715  1.00 43.87  ? 266  SER B CA    1 
ATOM   3462 C  C     . SER B 1 89  ? 85.119  31.873 -3.225  1.00 43.90  ? 266  SER B C     1 
ATOM   3463 O  O     . SER B 1 89  ? 84.205  31.592 -4.011  1.00 43.39  ? 266  SER B O     1 
ATOM   3464 C  CB    . SER B 1 89  ? 87.486  31.211 -3.687  1.00 43.79  ? 266  SER B CB    1 
ATOM   3465 O  OG    . SER B 1 89  ? 88.739  31.584 -4.255  1.00 44.36  ? 266  SER B OG    1 
ATOM   3466 N  N     . MET B 1 90  ? 84.979  31.821 -1.912  1.00 44.87  ? 267  MET B N     1 
ATOM   3467 C  CA    . MET B 1 90  ? 83.752  31.356 -1.289  1.00 46.44  ? 267  MET B CA    1 
ATOM   3468 C  C     . MET B 1 90  ? 82.568  32.281 -1.551  1.00 46.38  ? 267  MET B C     1 
ATOM   3469 O  O     . MET B 1 90  ? 81.432  31.804 -1.726  1.00 46.46  ? 267  MET B O     1 
ATOM   3470 C  CB    . MET B 1 90  ? 83.981  31.207 0.190   1.00 47.00  ? 267  MET B CB    1 
ATOM   3471 C  CG    . MET B 1 90  ? 84.983  30.111 0.446   1.00 52.66  ? 267  MET B CG    1 
ATOM   3472 S  SD    . MET B 1 90  ? 84.169  28.620 0.978   1.00 62.92  ? 267  MET B SD    1 
ATOM   3473 C  CE    . MET B 1 90  ? 84.567  28.832 2.716   1.00 53.61  ? 267  MET B CE    1 
ATOM   3474 N  N     . VAL B 1 91  ? 82.835  33.587 -1.636  1.00 45.39  ? 268  VAL B N     1 
ATOM   3475 C  CA    . VAL B 1 91  ? 81.776  34.518 -1.949  1.00 45.11  ? 268  VAL B CA    1 
ATOM   3476 C  C     . VAL B 1 91  ? 81.127  34.189 -3.277  1.00 45.31  ? 268  VAL B C     1 
ATOM   3477 O  O     . VAL B 1 91  ? 79.907  34.141 -3.370  1.00 46.01  ? 268  VAL B O     1 
ATOM   3478 C  CB    . VAL B 1 91  ? 82.242  35.972 -1.921  1.00 45.15  ? 268  VAL B CB    1 
ATOM   3479 C  CG1   . VAL B 1 91  ? 81.212  36.875 -2.639  1.00 43.90  ? 268  VAL B CG1   1 
ATOM   3480 C  CG2   . VAL B 1 91  ? 82.473  36.423 -0.458  1.00 42.58  ? 268  VAL B CG2   1 
ATOM   3481 N  N     . TRP B 1 92  ? 81.940  33.898 -4.280  1.00 46.17  ? 269  TRP B N     1 
ATOM   3482 C  CA    . TRP B 1 92  ? 81.437  33.537 -5.615  1.00 46.35  ? 269  TRP B CA    1 
ATOM   3483 C  C     . TRP B 1 92  ? 80.896  32.133 -5.629  1.00 46.12  ? 269  TRP B C     1 
ATOM   3484 O  O     . TRP B 1 92  ? 79.795  31.906 -6.066  1.00 46.35  ? 269  TRP B O     1 
ATOM   3485 C  CB    . TRP B 1 92  ? 82.558  33.617 -6.643  1.00 46.97  ? 269  TRP B CB    1 
ATOM   3486 C  CG    . TRP B 1 92  ? 83.180  34.933 -6.670  1.00 47.77  ? 269  TRP B CG    1 
ATOM   3487 C  CD1   . TRP B 1 92  ? 84.481  35.243 -6.386  1.00 48.54  ? 269  TRP B CD1   1 
ATOM   3488 C  CD2   . TRP B 1 92  ? 82.512  36.172 -6.914  1.00 48.99  ? 269  TRP B CD2   1 
ATOM   3489 N  NE1   . TRP B 1 92  ? 84.667  36.609 -6.474  1.00 47.52  ? 269  TRP B NE1   1 
ATOM   3490 C  CE2   . TRP B 1 92  ? 83.467  37.198 -6.774  1.00 47.33  ? 269  TRP B CE2   1 
ATOM   3491 C  CE3   . TRP B 1 92  ? 81.188  36.515 -7.209  1.00 49.46  ? 269  TRP B CE3   1 
ATOM   3492 C  CZ2   . TRP B 1 92  ? 83.146  38.535 -6.943  1.00 49.33  ? 269  TRP B CZ2   1 
ATOM   3493 C  CZ3   . TRP B 1 92  ? 80.871  37.835 -7.374  1.00 48.86  ? 269  TRP B CZ3   1 
ATOM   3494 C  CH2   . TRP B 1 92  ? 81.850  38.834 -7.266  1.00 49.23  ? 269  TRP B CH2   1 
ATOM   3495 N  N     . LEU B 1 93  ? 81.691  31.183 -5.158  1.00 46.72  ? 270  LEU B N     1 
ATOM   3496 C  CA    . LEU B 1 93  ? 81.286  29.784 -5.172  1.00 46.64  ? 270  LEU B CA    1 
ATOM   3497 C  C     . LEU B 1 93  ? 79.902  29.627 -4.528  1.00 47.06  ? 270  LEU B C     1 
ATOM   3498 O  O     . LEU B 1 93  ? 79.023  29.022 -5.107  1.00 47.56  ? 270  LEU B O     1 
ATOM   3499 C  CB    . LEU B 1 93  ? 82.321  28.938 -4.441  1.00 46.06  ? 270  LEU B CB    1 
ATOM   3500 C  CG    . LEU B 1 93  ? 81.948  27.480 -4.206  1.00 46.22  ? 270  LEU B CG    1 
ATOM   3501 C  CD1   . LEU B 1 93  ? 81.596  26.740 -5.518  1.00 39.83  ? 270  LEU B CD1   1 
ATOM   3502 C  CD2   . LEU B 1 93  ? 83.124  26.837 -3.500  1.00 44.52  ? 270  LEU B CD2   1 
ATOM   3503 N  N     . CYS B 1 94  ? 79.696  30.253 -3.376  1.00 47.48  ? 271  CYS B N     1 
ATOM   3504 C  CA    . CYS B 1 94  ? 78.460  30.096 -2.619  1.00 47.39  ? 271  CYS B CA    1 
ATOM   3505 C  C     . CYS B 1 94  ? 77.437  31.177 -2.854  1.00 47.97  ? 271  CYS B C     1 
ATOM   3506 O  O     . CYS B 1 94  ? 76.435  31.222 -2.153  1.00 48.96  ? 271  CYS B O     1 
ATOM   3507 C  CB    . CYS B 1 94  ? 78.780  30.083 -1.136  1.00 47.55  ? 271  CYS B CB    1 
ATOM   3508 S  SG    . CYS B 1 94  ? 79.757  28.669 -0.738  1.00 45.30  ? 271  CYS B SG    1 
ATOM   3509 N  N     . SER B 1 95  ? 77.692  32.064 -3.808  1.00 48.49  ? 272  SER B N     1 
ATOM   3510 C  CA    . SER B 1 95  ? 76.803  33.196 -4.065  1.00 48.37  ? 272  SER B CA    1 
ATOM   3511 C  C     . SER B 1 95  ? 76.435  33.895 -2.759  1.00 48.19  ? 272  SER B C     1 
ATOM   3512 O  O     . SER B 1 95  ? 75.261  34.103 -2.424  1.00 47.06  ? 272  SER B O     1 
ATOM   3513 C  CB    . SER B 1 95  ? 75.564  32.715 -4.811  1.00 48.84  ? 272  SER B CB    1 
ATOM   3514 O  OG    . SER B 1 95  ? 75.966  31.985 -5.960  1.00 50.13  ? 272  SER B OG    1 
ATOM   3515 N  N     . LEU B 1 96  ? 77.466  34.235 -1.999  1.00 48.35  ? 273  LEU B N     1 
ATOM   3516 C  CA    . LEU B 1 96  ? 77.231  34.784 -0.694  1.00 48.70  ? 273  LEU B CA    1 
ATOM   3517 C  C     . LEU B 1 96  ? 76.569  36.154 -0.793  1.00 49.99  ? 273  LEU B C     1 
ATOM   3518 O  O     . LEU B 1 96  ? 75.945  36.590 0.168   1.00 50.64  ? 273  LEU B O     1 
ATOM   3519 C  CB    . LEU B 1 96  ? 78.522  34.830 0.114   1.00 47.89  ? 273  LEU B CB    1 
ATOM   3520 C  CG    . LEU B 1 96  ? 79.057  33.463 0.575   1.00 47.83  ? 273  LEU B CG    1 
ATOM   3521 C  CD1   . LEU B 1 96  ? 80.097  33.662 1.665   1.00 44.84  ? 273  LEU B CD1   1 
ATOM   3522 C  CD2   . LEU B 1 96  ? 77.953  32.492 1.070   1.00 46.38  ? 273  LEU B CD2   1 
ATOM   3523 N  N     . GLN B 1 97  ? 76.653  36.818 -1.947  1.00 51.18  ? 274  GLN B N     1 
ATOM   3524 C  CA    . GLN B 1 97  ? 76.082  38.168 -2.071  1.00 52.35  ? 274  GLN B CA    1 
ATOM   3525 C  C     . GLN B 1 97  ? 74.558  38.143 -2.095  1.00 52.83  ? 274  GLN B C     1 
ATOM   3526 O  O     . GLN B 1 97  ? 73.909  39.147 -1.783  1.00 53.11  ? 274  GLN B O     1 
ATOM   3527 C  CB    . GLN B 1 97  ? 76.654  38.907 -3.286  1.00 52.14  ? 274  GLN B CB    1 
ATOM   3528 C  CG    . GLN B 1 97  ? 78.147  39.204 -3.119  1.00 54.32  ? 274  GLN B CG    1 
ATOM   3529 C  CD    . GLN B 1 97  ? 78.693  40.247 -4.089  1.00 56.20  ? 274  GLN B CD    1 
ATOM   3530 O  OE1   . GLN B 1 97  ? 78.512  40.122 -5.304  1.00 53.81  ? 274  GLN B OE1   1 
ATOM   3531 N  NE2   . GLN B 1 97  ? 79.407  41.271 -3.548  1.00 56.29  ? 274  GLN B NE2   1 
ATOM   3532 N  N     . GLU B 1 98  ? 73.995  36.963 -2.367  1.00 53.63  ? 275  GLU B N     1 
ATOM   3533 C  CA    . GLU B 1 98  ? 72.552  36.743 -2.280  1.00 53.89  ? 275  GLU B CA    1 
ATOM   3534 C  C     . GLU B 1 98  ? 72.064  36.597 -0.844  1.00 53.59  ? 275  GLU B C     1 
ATOM   3535 O  O     . GLU B 1 98  ? 70.933  36.875 -0.555  1.00 54.22  ? 275  GLU B O     1 
ATOM   3536 C  CB    . GLU B 1 98  ? 72.158  35.504 -3.089  1.00 54.65  ? 275  GLU B CB    1 
ATOM   3537 C  CG    . GLU B 1 98  ? 72.256  35.700 -4.629  1.00 56.94  ? 275  GLU B CG    1 
ATOM   3538 C  CD    . GLU B 1 98  ? 72.140  34.392 -5.446  1.00 60.28  ? 275  GLU B CD    1 
ATOM   3539 O  OE1   . GLU B 1 98  ? 71.903  33.293 -4.867  1.00 62.21  ? 275  GLU B OE1   1 
ATOM   3540 O  OE2   . GLU B 1 98  ? 72.293  34.476 -6.685  1.00 61.01  ? 275  GLU B OE2   1 
ATOM   3541 N  N     . LYS B 1 99  ? 72.936  36.205 0.065   1.00 53.94  ? 276  LYS B N     1 
ATOM   3542 C  CA    . LYS B 1 99  ? 72.533  35.797 1.410   1.00 53.51  ? 276  LYS B CA    1 
ATOM   3543 C  C     . LYS B 1 99  ? 72.922  36.847 2.452   1.00 51.76  ? 276  LYS B C     1 
ATOM   3544 O  O     . LYS B 1 99  ? 72.270  37.011 3.471   1.00 50.80  ? 276  LYS B O     1 
ATOM   3545 C  CB    . LYS B 1 99  ? 73.217  34.450 1.737   1.00 54.80  ? 276  LYS B CB    1 
ATOM   3546 C  CG    . LYS B 1 99  ? 72.648  33.227 0.983   1.00 56.44  ? 276  LYS B CG    1 
ATOM   3547 C  CD    . LYS B 1 99  ? 71.120  33.298 1.016   1.00 60.64  ? 276  LYS B CD    1 
ATOM   3548 C  CE    . LYS B 1 99  ? 70.420  31.984 0.713   1.00 61.91  ? 276  LYS B CE    1 
ATOM   3549 N  NZ    . LYS B 1 99  ? 68.943  32.118 1.036   1.00 62.15  ? 276  LYS B NZ    1 
ATOM   3550 N  N     . PHE B 1 100 ? 74.008  37.549 2.183   1.00 50.17  ? 277  PHE B N     1 
ATOM   3551 C  CA    . PHE B 1 100 ? 74.635  38.415 3.160   1.00 49.26  ? 277  PHE B CA    1 
ATOM   3552 C  C     . PHE B 1 100 ? 74.579  39.856 2.701   1.00 46.48  ? 277  PHE B C     1 
ATOM   3553 O  O     . PHE B 1 100 ? 74.643  40.129 1.527   1.00 46.29  ? 277  PHE B O     1 
ATOM   3554 C  CB    . PHE B 1 100 ? 76.102  37.996 3.322   1.00 50.93  ? 277  PHE B CB    1 
ATOM   3555 C  CG    . PHE B 1 100 ? 76.292  36.724 4.113   1.00 52.37  ? 277  PHE B CG    1 
ATOM   3556 C  CD1   . PHE B 1 100 ? 76.126  36.722 5.498   1.00 55.71  ? 277  PHE B CD1   1 
ATOM   3557 C  CD2   . PHE B 1 100 ? 76.640  35.545 3.478   1.00 53.24  ? 277  PHE B CD2   1 
ATOM   3558 C  CE1   . PHE B 1 100 ? 76.299  35.548 6.236   1.00 58.03  ? 277  PHE B CE1   1 
ATOM   3559 C  CE2   . PHE B 1 100 ? 76.808  34.370 4.192   1.00 55.69  ? 277  PHE B CE2   1 
ATOM   3560 C  CZ    . PHE B 1 100 ? 76.647  34.363 5.575   1.00 58.12  ? 277  PHE B CZ    1 
ATOM   3561 N  N     . SER B 1 101 ? 74.493  40.784 3.633   1.00 44.62  ? 278  SER B N     1 
ATOM   3562 C  CA    . SER B 1 101 ? 74.584  42.190 3.285   1.00 43.09  ? 278  SER B CA    1 
ATOM   3563 C  C     . SER B 1 101 ? 76.003  42.497 2.888   1.00 42.70  ? 278  SER B C     1 
ATOM   3564 O  O     . SER B 1 101 ? 76.933  41.729 3.176   1.00 42.11  ? 278  SER B O     1 
ATOM   3565 C  CB    . SER B 1 101 ? 74.219  43.074 4.474   1.00 42.69  ? 278  SER B CB    1 
ATOM   3566 O  OG    . SER B 1 101 ? 75.137  42.888 5.547   1.00 42.50  ? 278  SER B OG    1 
ATOM   3567 N  N     . GLN B 1 102 ? 76.190  43.668 2.310   1.00 41.86  ? 279  GLN B N     1 
ATOM   3568 C  CA    . GLN B 1 102 ? 77.532  44.117 2.003   1.00 41.71  ? 279  GLN B CA    1 
ATOM   3569 C  C     . GLN B 1 102 ? 78.306  44.363 3.299   1.00 41.31  ? 279  GLN B C     1 
ATOM   3570 O  O     . GLN B 1 102 ? 79.486  44.038 3.393   1.00 40.74  ? 279  GLN B O     1 
ATOM   3571 C  CB    . GLN B 1 102 ? 77.475  45.371 1.139   1.00 41.89  ? 279  GLN B CB    1 
ATOM   3572 C  CG    . GLN B 1 102 ? 76.975  45.125 -0.288  1.00 40.50  ? 279  GLN B CG    1 
ATOM   3573 C  CD    . GLN B 1 102 ? 77.957  44.325 -1.082  1.00 39.15  ? 279  GLN B CD    1 
ATOM   3574 O  OE1   . GLN B 1 102 ? 78.048  43.103 -0.945  1.00 43.41  ? 279  GLN B OE1   1 
ATOM   3575 N  NE2   . GLN B 1 102 ? 78.754  45.013 -1.861  1.00 32.94  ? 279  GLN B NE2   1 
ATOM   3576 N  N     . THR B 1 103 ? 77.632  44.879 4.319   1.00 41.74  ? 280  THR B N     1 
ATOM   3577 C  CA    . THR B 1 103 ? 78.280  45.019 5.623   1.00 42.44  ? 280  THR B CA    1 
ATOM   3578 C  C     . THR B 1 103 ? 78.858  43.685 6.057   1.00 42.48  ? 280  THR B C     1 
ATOM   3579 O  O     . THR B 1 103 ? 80.014  43.629 6.412   1.00 42.53  ? 280  THR B O     1 
ATOM   3580 C  CB    . THR B 1 103 ? 77.352  45.571 6.711   1.00 42.30  ? 280  THR B CB    1 
ATOM   3581 O  OG1   . THR B 1 103 ? 76.776  46.800 6.264   1.00 42.83  ? 280  THR B OG1   1 
ATOM   3582 C  CG2   . THR B 1 103 ? 78.126  45.819 8.005   1.00 41.42  ? 280  THR B CG2   1 
ATOM   3583 N  N     . ASP B 1 104 ? 78.099  42.602 5.934   1.00 42.86  ? 281  ASP B N     1 
ATOM   3584 C  CA    . ASP B 1 104 ? 78.636  41.284 6.282   1.00 43.85  ? 281  ASP B CA    1 
ATOM   3585 C  C     . ASP B 1 104 ? 79.805  40.850 5.410   1.00 43.36  ? 281  ASP B C     1 
ATOM   3586 O  O     . ASP B 1 104 ? 80.711  40.144 5.871   1.00 43.84  ? 281  ASP B O     1 
ATOM   3587 C  CB    . ASP B 1 104 ? 77.565  40.206 6.184   1.00 44.43  ? 281  ASP B CB    1 
ATOM   3588 C  CG    . ASP B 1 104 ? 76.664  40.169 7.383   1.00 47.69  ? 281  ASP B CG    1 
ATOM   3589 O  OD1   . ASP B 1 104 ? 77.164  40.430 8.506   1.00 47.32  ? 281  ASP B OD1   1 
ATOM   3590 O  OD2   . ASP B 1 104 ? 75.457  39.866 7.181   1.00 53.10  ? 281  ASP B OD2   1 
ATOM   3591 N  N     . ILE B 1 105 ? 79.726  41.147 4.122   1.00 42.98  ? 282  ILE B N     1 
ATOM   3592 C  CA    . ILE B 1 105 ? 80.808  40.774 3.225   1.00 42.84  ? 282  ILE B CA    1 
ATOM   3593 C  C     . ILE B 1 105 ? 82.078  41.547 3.640   1.00 42.59  ? 282  ILE B C     1 
ATOM   3594 O  O     . ILE B 1 105 ? 83.188  41.001 3.618   1.00 43.73  ? 282  ILE B O     1 
ATOM   3595 C  CB    . ILE B 1 105 ? 80.452  41.085 1.743   1.00 42.99  ? 282  ILE B CB    1 
ATOM   3596 C  CG1   . ILE B 1 105 ? 79.319  40.183 1.255   1.00 43.44  ? 282  ILE B CG1   1 
ATOM   3597 C  CG2   . ILE B 1 105 ? 81.684  40.921 0.827   1.00 41.70  ? 282  ILE B CG2   1 
ATOM   3598 C  CD1   . ILE B 1 105 ? 79.676  38.708 1.218   1.00 43.66  ? 282  ILE B CD1   1 
ATOM   3599 N  N     . LEU B 1 106 ? 81.891  42.800 4.044   1.00 41.06  ? 283  LEU B N     1 
ATOM   3600 C  CA    . LEU B 1 106 ? 82.997  43.647 4.455   1.00 40.96  ? 283  LEU B CA    1 
ATOM   3601 C  C     . LEU B 1 106 ? 83.657  43.051 5.702   1.00 40.59  ? 283  LEU B C     1 
ATOM   3602 O  O     . LEU B 1 106 ? 84.888  42.946 5.773   1.00 40.22  ? 283  LEU B O     1 
ATOM   3603 C  CB    . LEU B 1 106 ? 82.495  45.101 4.676   1.00 40.38  ? 283  LEU B CB    1 
ATOM   3604 C  CG    . LEU B 1 106 ? 83.497  46.157 5.176   1.00 39.79  ? 283  LEU B CG    1 
ATOM   3605 C  CD1   . LEU B 1 106 ? 84.678  46.362 4.222   1.00 33.21  ? 283  LEU B CD1   1 
ATOM   3606 C  CD2   . LEU B 1 106 ? 82.775  47.494 5.466   1.00 38.96  ? 283  LEU B CD2   1 
ATOM   3607 N  N     . ILE B 1 107 ? 82.818  42.601 6.638   1.00 40.86  ? 284  ILE B N     1 
ATOM   3608 C  CA    . ILE B 1 107 ? 83.271  41.959 7.861   1.00 40.91  ? 284  ILE B CA    1 
ATOM   3609 C  C     . ILE B 1 107 ? 84.073  40.697 7.502   1.00 41.00  ? 284  ILE B C     1 
ATOM   3610 O  O     . ILE B 1 107 ? 85.209  40.544 7.918   1.00 40.92  ? 284  ILE B O     1 
ATOM   3611 C  CB    . ILE B 1 107 ? 82.094  41.578 8.795   1.00 40.66  ? 284  ILE B CB    1 
ATOM   3612 C  CG1   . ILE B 1 107 ? 81.459  42.823 9.419   1.00 42.09  ? 284  ILE B CG1   1 
ATOM   3613 C  CG2   . ILE B 1 107 ? 82.569  40.643 9.946   1.00 39.62  ? 284  ILE B CG2   1 
ATOM   3614 C  CD1   . ILE B 1 107 ? 80.093  42.553 10.182  1.00 39.92  ? 284  ILE B CD1   1 
ATOM   3615 N  N     . LEU B 1 108 ? 83.507  39.828 6.680   1.00 41.31  ? 285  LEU B N     1 
ATOM   3616 C  CA    . LEU B 1 108 ? 84.173  38.568 6.390   1.00 42.17  ? 285  LEU B CA    1 
ATOM   3617 C  C     . LEU B 1 108 ? 85.548  38.858 5.805   1.00 42.35  ? 285  LEU B C     1 
ATOM   3618 O  O     . LEU B 1 108 ? 86.553  38.303 6.262   1.00 41.44  ? 285  LEU B O     1 
ATOM   3619 C  CB    . LEU B 1 108 ? 83.361  37.731 5.413   1.00 42.38  ? 285  LEU B CB    1 
ATOM   3620 C  CG    . LEU B 1 108 ? 82.111  37.040 5.968   1.00 42.60  ? 285  LEU B CG    1 
ATOM   3621 C  CD1   . LEU B 1 108 ? 81.124  36.706 4.847   1.00 37.45  ? 285  LEU B CD1   1 
ATOM   3622 C  CD2   . LEU B 1 108 ? 82.493  35.780 6.777   1.00 38.02  ? 285  LEU B CD2   1 
ATOM   3623 N  N     . MET B 1 109 ? 85.599  39.783 4.844   1.00 42.30  ? 286  MET B N     1 
ATOM   3624 C  CA    . MET B 1 109 ? 86.842  40.031 4.111   1.00 42.66  ? 286  MET B CA    1 
ATOM   3625 C  C     . MET B 1 109 ? 87.911  40.709 4.989   1.00 42.98  ? 286  MET B C     1 
ATOM   3626 O  O     . MET B 1 109 ? 89.084  40.282 5.013   1.00 43.16  ? 286  MET B O     1 
ATOM   3627 C  CB    . MET B 1 109 ? 86.579  40.858 2.846   1.00 42.66  ? 286  MET B CB    1 
ATOM   3628 C  CG    . MET B 1 109 ? 85.899  40.096 1.692   1.00 43.25  ? 286  MET B CG    1 
ATOM   3629 S  SD    . MET B 1 109 ? 86.861  38.689 1.043   1.00 43.34  ? 286  MET B SD    1 
ATOM   3630 C  CE    . MET B 1 109 ? 88.481  39.385 0.807   1.00 39.12  ? 286  MET B CE    1 
ATOM   3631 N  N     . THR B 1 110 ? 87.506  41.746 5.715   1.00 42.58  ? 287  THR B N     1 
ATOM   3632 C  CA    . THR B 1 110 ? 88.446  42.491 6.530   1.00 42.33  ? 287  THR B CA    1 
ATOM   3633 C  C     . THR B 1 110 ? 88.931  41.615 7.717   1.00 42.82  ? 287  THR B C     1 
ATOM   3634 O  O     . THR B 1 110 ? 90.120  41.643 8.067   1.00 42.11  ? 287  THR B O     1 
ATOM   3635 C  CB    . THR B 1 110 ? 87.824  43.810 7.019   1.00 41.99  ? 287  THR B CB    1 
ATOM   3636 O  OG1   . THR B 1 110 ? 87.049  44.374 5.969   1.00 40.40  ? 287  THR B OG1   1 
ATOM   3637 C  CG2   . THR B 1 110 ? 88.881  44.808 7.385   1.00 42.16  ? 287  THR B CG2   1 
ATOM   3638 N  N     . ALA B 1 111 ? 88.031  40.803 8.294   1.00 43.09  ? 288  ALA B N     1 
ATOM   3639 C  CA    . ALA B 1 111 ? 88.426  39.846 9.343   1.00 43.38  ? 288  ALA B CA    1 
ATOM   3640 C  C     . ALA B 1 111 ? 89.450  38.916 8.767   1.00 43.40  ? 288  ALA B C     1 
ATOM   3641 O  O     . ALA B 1 111 ? 90.474  38.632 9.394   1.00 44.16  ? 288  ALA B O     1 
ATOM   3642 C  CB    . ALA B 1 111 ? 87.251  39.033 9.852   1.00 43.59  ? 288  ALA B CB    1 
ATOM   3643 N  N     . ALA B 1 112 ? 89.169  38.459 7.552   1.00 43.19  ? 289  ALA B N     1 
ATOM   3644 C  CA    . ALA B 1 112 ? 90.017  37.470 6.884   1.00 43.16  ? 289  ALA B CA    1 
ATOM   3645 C  C     . ALA B 1 112 ? 91.432  38.017 6.660   1.00 42.96  ? 289  ALA B C     1 
ATOM   3646 O  O     . ALA B 1 112 ? 92.407  37.324 6.910   1.00 43.10  ? 289  ALA B O     1 
ATOM   3647 C  CB    . ALA B 1 112 ? 89.372  37.017 5.579   1.00 41.99  ? 289  ALA B CB    1 
ATOM   3648 N  N     . ILE B 1 113 ? 91.523  39.291 6.281   1.00 43.71  ? 290  ILE B N     1 
ATOM   3649 C  CA    . ILE B 1 113 ? 92.798  39.935 6.045   1.00 43.62  ? 290  ILE B CA    1 
ATOM   3650 C  C     . ILE B 1 113 ? 93.538  40.170 7.340   1.00 44.90  ? 290  ILE B C     1 
ATOM   3651 O  O     . ILE B 1 113 ? 94.772  40.130 7.365   1.00 46.40  ? 290  ILE B O     1 
ATOM   3652 C  CB    . ILE B 1 113 ? 92.644  41.268 5.298   1.00 42.98  ? 290  ILE B CB    1 
ATOM   3653 C  CG1   . ILE B 1 113 ? 92.233  41.004 3.849   1.00 42.33  ? 290  ILE B CG1   1 
ATOM   3654 C  CG2   . ILE B 1 113 ? 93.982  42.063 5.310   1.00 43.21  ? 290  ILE B CG2   1 
ATOM   3655 C  CD1   . ILE B 1 113 ? 91.547  42.162 3.170   1.00 39.93  ? 290  ILE B CD1   1 
ATOM   3656 N  N     . CYS B 1 114 ? 92.812  40.426 8.415   1.00 45.20  ? 291  CYS B N     1 
ATOM   3657 C  CA    . CYS B 1 114 ? 93.465  40.857 9.640   1.00 46.21  ? 291  CYS B CA    1 
ATOM   3658 C  C     . CYS B 1 114 ? 93.679  39.759 10.677  1.00 46.23  ? 291  CYS B C     1 
ATOM   3659 O  O     . CYS B 1 114 ? 94.334  39.982 11.695  1.00 45.82  ? 291  CYS B O     1 
ATOM   3660 C  CB    . CYS B 1 114 ? 92.664  41.991 10.267  1.00 46.20  ? 291  CYS B CB    1 
ATOM   3661 S  SG    . CYS B 1 114 ? 92.561  43.434 9.214   1.00 48.33  ? 291  CYS B SG    1 
ATOM   3662 N  N     . HIS B 1 115 ? 93.136  38.578 10.423  1.00 46.52  ? 292  HIS B N     1 
ATOM   3663 C  CA    . HIS B 1 115 ? 92.963  37.584 11.488  1.00 47.38  ? 292  HIS B CA    1 
ATOM   3664 C  C     . HIS B 1 115 ? 94.250  37.087 12.163  1.00 46.87  ? 292  HIS B C     1 
ATOM   3665 O  O     . HIS B 1 115 ? 94.164  36.516 13.246  1.00 48.23  ? 292  HIS B O     1 
ATOM   3666 C  CB    . HIS B 1 115 ? 92.164  36.380 10.971  1.00 48.11  ? 292  HIS B CB    1 
ATOM   3667 C  CG    . HIS B 1 115 ? 93.008  35.330 10.336  1.00 50.15  ? 292  HIS B CG    1 
ATOM   3668 N  ND1   . HIS B 1 115 ? 93.499  35.447 9.052   1.00 54.38  ? 292  HIS B ND1   1 
ATOM   3669 C  CD2   . HIS B 1 115 ? 93.461  34.147 10.812  1.00 52.65  ? 292  HIS B CD2   1 
ATOM   3670 C  CE1   . HIS B 1 115 ? 94.250  34.391 8.781   1.00 57.64  ? 292  HIS B CE1   1 
ATOM   3671 N  NE2   . HIS B 1 115 ? 94.236  33.581 9.827   1.00 53.30  ? 292  HIS B NE2   1 
ATOM   3672 N  N     . ASP B 1 116 ? 95.422  37.267 11.537  1.00 46.20  ? 293  ASP B N     1 
ATOM   3673 C  CA    . ASP B 1 116 ? 96.693  36.779 12.106  1.00 46.12  ? 293  ASP B CA    1 
ATOM   3674 C  C     . ASP B 1 116 ? 97.728  37.905 12.207  1.00 45.04  ? 293  ASP B C     1 
ATOM   3675 O  O     . ASP B 1 116 ? 98.943  37.665 12.181  1.00 44.84  ? 293  ASP B O     1 
ATOM   3676 C  CB    . ASP B 1 116 ? 97.275  35.614 11.273  1.00 46.48  ? 293  ASP B CB    1 
ATOM   3677 C  CG    . ASP B 1 116 ? 96.760  34.247 11.697  1.00 47.83  ? 293  ASP B CG    1 
ATOM   3678 O  OD1   . ASP B 1 116 ? 96.356  34.060 12.859  1.00 51.65  ? 293  ASP B OD1   1 
ATOM   3679 O  OD2   . ASP B 1 116 ? 96.723  33.341 10.833  1.00 52.71  ? 293  ASP B OD2   1 
ATOM   3680 N  N     . LEU B 1 117 ? 97.256  39.134 12.342  1.00 44.42  ? 294  LEU B N     1 
ATOM   3681 C  CA    . LEU B 1 117 ? 98.166  40.288 12.415  1.00 43.98  ? 294  LEU B CA    1 
ATOM   3682 C  C     . LEU B 1 117 ? 99.188  40.116 13.555  1.00 44.03  ? 294  LEU B C     1 
ATOM   3683 O  O     . LEU B 1 117 ? 98.842  39.699 14.668  1.00 44.80  ? 294  LEU B O     1 
ATOM   3684 C  CB    . LEU B 1 117 ? 97.380  41.593 12.596  1.00 43.08  ? 294  LEU B CB    1 
ATOM   3685 C  CG    . LEU B 1 117 ? 96.954  42.265 11.301  1.00 42.45  ? 294  LEU B CG    1 
ATOM   3686 C  CD1   . LEU B 1 117 ? 95.784  43.209 11.517  1.00 35.54  ? 294  LEU B CD1   1 
ATOM   3687 C  CD2   . LEU B 1 117 ? 98.191  42.986 10.680  1.00 41.72  ? 294  LEU B CD2   1 
ATOM   3688 N  N     . ASP B 1 118 ? 100.443 40.409 13.254  1.00 43.44  ? 295  ASP B N     1 
ATOM   3689 C  CA    . ASP B 1 118 ? 101.500 40.412 14.254  1.00 43.89  ? 295  ASP B CA    1 
ATOM   3690 C  C     . ASP B 1 118 ? 101.616 39.139 15.074  1.00 44.77  ? 295  ASP B C     1 
ATOM   3691 O  O     . ASP B 1 118 ? 101.929 39.197 16.269  1.00 45.64  ? 295  ASP B O     1 
ATOM   3692 C  CB    . ASP B 1 118 ? 101.335 41.547 15.236  1.00 43.34  ? 295  ASP B CB    1 
ATOM   3693 C  CG    . ASP B 1 118 ? 102.630 41.885 15.895  1.00 43.16  ? 295  ASP B CG    1 
ATOM   3694 O  OD1   . ASP B 1 118 ? 103.627 41.930 15.162  1.00 43.93  ? 295  ASP B OD1   1 
ATOM   3695 O  OD2   . ASP B 1 118 ? 102.673 42.102 17.117  1.00 42.20  ? 295  ASP B OD2   1 
ATOM   3696 N  N     . HIS B 1 119 ? 101.396 37.999 14.426  1.00 45.00  ? 296  HIS B N     1 
ATOM   3697 C  CA    . HIS B 1 119 ? 101.581 36.715 15.056  1.00 45.11  ? 296  HIS B CA    1 
ATOM   3698 C  C     . HIS B 1 119 ? 103.057 36.541 15.373  1.00 45.65  ? 296  HIS B C     1 
ATOM   3699 O  O     . HIS B 1 119 ? 103.914 36.780 14.540  1.00 46.70  ? 296  HIS B O     1 
ATOM   3700 C  CB    . HIS B 1 119 ? 101.119 35.640 14.077  1.00 45.83  ? 296  HIS B CB    1 
ATOM   3701 C  CG    . HIS B 1 119 ? 100.786 34.317 14.697  1.00 45.85  ? 296  HIS B CG    1 
ATOM   3702 N  ND1   . HIS B 1 119 ? 101.756 33.454 15.181  1.00 45.09  ? 296  HIS B ND1   1 
ATOM   3703 C  CD2   . HIS B 1 119 ? 99.617  33.634 14.740  1.00 43.69  ? 296  HIS B CD2   1 
ATOM   3704 C  CE1   . HIS B 1 119 ? 101.187 32.310 15.524  1.00 46.05  ? 296  HIS B CE1   1 
ATOM   3705 N  NE2   . HIS B 1 119 ? 99.885  32.400 15.290  1.00 44.81  ? 296  HIS B NE2   1 
ATOM   3706 N  N     . PRO B 1 120 ? 103.368 36.124 16.588  1.00 46.19  ? 297  PRO B N     1 
ATOM   3707 C  CA    . PRO B 1 120 ? 104.744 35.886 16.970  1.00 45.99  ? 297  PRO B CA    1 
ATOM   3708 C  C     . PRO B 1 120 ? 105.340 34.562 16.498  1.00 46.59  ? 297  PRO B C     1 
ATOM   3709 O  O     . PRO B 1 120 ? 106.538 34.360 16.640  1.00 47.13  ? 297  PRO B O     1 
ATOM   3710 C  CB    . PRO B 1 120 ? 104.652 35.880 18.477  1.00 47.07  ? 297  PRO B CB    1 
ATOM   3711 C  CG    . PRO B 1 120 ? 103.275 35.355 18.748  1.00 46.55  ? 297  PRO B CG    1 
ATOM   3712 C  CD    . PRO B 1 120 ? 102.420 35.875 17.683  1.00 45.43  ? 297  PRO B CD    1 
ATOM   3713 N  N     . GLY B 1 121 ? 104.516 33.629 16.030  1.00 46.84  ? 298  GLY B N     1 
ATOM   3714 C  CA    . GLY B 1 121 ? 105.017 32.321 15.583  1.00 46.71  ? 298  GLY B CA    1 
ATOM   3715 C  C     . GLY B 1 121 ? 105.076 31.228 16.652  1.00 46.79  ? 298  GLY B C     1 
ATOM   3716 O  O     . GLY B 1 121 ? 105.652 30.132 16.430  1.00 46.53  ? 298  GLY B O     1 
ATOM   3717 N  N     . TYR B 1 122 ? 104.475 31.525 17.806  1.00 45.62  ? 299  TYR B N     1 
ATOM   3718 C  CA    . TYR B 1 122 ? 104.273 30.555 18.866  1.00 44.54  ? 299  TYR B CA    1 
ATOM   3719 C  C     . TYR B 1 122 ? 102.837 30.677 19.391  1.00 44.11  ? 299  TYR B C     1 
ATOM   3720 O  O     . TYR B 1 122 ? 102.342 31.782 19.659  1.00 45.16  ? 299  TYR B O     1 
ATOM   3721 C  CB    . TYR B 1 122 ? 105.248 30.836 19.989  1.00 44.84  ? 299  TYR B CB    1 
ATOM   3722 C  CG    . TYR B 1 122 ? 106.686 30.844 19.550  1.00 46.06  ? 299  TYR B CG    1 
ATOM   3723 C  CD1   . TYR B 1 122 ? 107.232 31.950 18.922  1.00 48.68  ? 299  TYR B CD1   1 
ATOM   3724 C  CD2   . TYR B 1 122 ? 107.489 29.726 19.716  1.00 46.19  ? 299  TYR B CD2   1 
ATOM   3725 C  CE1   . TYR B 1 122 ? 108.558 31.959 18.503  1.00 47.91  ? 299  TYR B CE1   1 
ATOM   3726 C  CE2   . TYR B 1 122 ? 108.810 29.733 19.317  1.00 47.02  ? 299  TYR B CE2   1 
ATOM   3727 C  CZ    . TYR B 1 122 ? 109.342 30.856 18.716  1.00 47.33  ? 299  TYR B CZ    1 
ATOM   3728 O  OH    . TYR B 1 122 ? 110.650 30.856 18.291  1.00 48.58  ? 299  TYR B OH    1 
ATOM   3729 N  N     . ASN B 1 123 ? 102.178 29.542 19.573  1.00 42.93  ? 300  ASN B N     1 
ATOM   3730 C  CA    . ASN B 1 123 ? 100.733 29.530 19.755  1.00 41.77  ? 300  ASN B CA    1 
ATOM   3731 C  C     . ASN B 1 123 ? 100.345 29.922 21.180  1.00 41.97  ? 300  ASN B C     1 
ATOM   3732 O  O     . ASN B 1 123 ? 101.212 30.169 22.022  1.00 41.61  ? 300  ASN B O     1 
ATOM   3733 C  CB    . ASN B 1 123 ? 100.140 28.149 19.361  1.00 40.50  ? 300  ASN B CB    1 
ATOM   3734 C  CG    . ASN B 1 123 ? 100.365 27.088 20.397  1.00 39.12  ? 300  ASN B CG    1 
ATOM   3735 O  OD1   . ASN B 1 123 ? 100.882 27.350 21.479  1.00 44.78  ? 300  ASN B OD1   1 
ATOM   3736 N  ND2   . ASN B 1 123 ? 99.958  25.891 20.091  1.00 37.20  ? 300  ASN B ND2   1 
ATOM   3737 N  N     . ASN B 1 124 ? 99.039  29.930 21.443  1.00 41.73  ? 301  ASN B N     1 
ATOM   3738 C  CA    . ASN B 1 124 ? 98.514  30.350 22.718  1.00 41.52  ? 301  ASN B CA    1 
ATOM   3739 C  C     . ASN B 1 124 ? 99.054  29.521 23.891  1.00 42.58  ? 301  ASN B C     1 
ATOM   3740 O  O     . ASN B 1 124 ? 99.325  30.067 24.993  1.00 43.58  ? 301  ASN B O     1 
ATOM   3741 C  CB    . ASN B 1 124 ? 96.984  30.309 22.694  1.00 40.64  ? 301  ASN B CB    1 
ATOM   3742 C  CG    . ASN B 1 124 ? 96.373  31.491 21.942  1.00 41.62  ? 301  ASN B CG    1 
ATOM   3743 O  OD1   . ASN B 1 124 ? 96.884  32.630 21.987  1.00 45.62  ? 301  ASN B OD1   1 
ATOM   3744 N  ND2   . ASN B 1 124 ? 95.248  31.243 21.294  1.00 34.70  ? 301  ASN B ND2   1 
ATOM   3745 N  N     . THR B 1 125 ? 99.211  28.212 23.684  1.00 41.95  ? 302  THR B N     1 
ATOM   3746 C  CA    . THR B 1 125 ? 99.731  27.376 24.741  1.00 40.92  ? 302  THR B CA    1 
ATOM   3747 C  C     . THR B 1 125 ? 101.117 27.843 25.119  1.00 41.05  ? 302  THR B C     1 
ATOM   3748 O  O     . THR B 1 125 ? 101.446 27.940 26.295  1.00 41.89  ? 302  THR B O     1 
ATOM   3749 C  CB    . THR B 1 125 ? 99.769  25.928 24.338  1.00 41.35  ? 302  THR B CB    1 
ATOM   3750 O  OG1   . THR B 1 125 ? 98.429  25.483 24.115  1.00 42.51  ? 302  THR B OG1   1 
ATOM   3751 C  CG2   . THR B 1 125 ? 100.392 25.087 25.416  1.00 37.08  ? 302  THR B CG2   1 
ATOM   3752 N  N     . TYR B 1 126 ? 101.944 28.183 24.146  1.00 40.87  ? 303  TYR B N     1 
ATOM   3753 C  CA    . TYR B 1 126 ? 103.264 28.717 24.496  1.00 40.34  ? 303  TYR B CA    1 
ATOM   3754 C  C     . TYR B 1 126 ? 103.143 30.015 25.270  1.00 40.27  ? 303  TYR B C     1 
ATOM   3755 O  O     . TYR B 1 126 ? 103.868 30.223 26.252  1.00 39.79  ? 303  TYR B O     1 
ATOM   3756 C  CB    . TYR B 1 126 ? 104.167 28.962 23.276  1.00 41.40  ? 303  TYR B CB    1 
ATOM   3757 C  CG    . TYR B 1 126 ? 105.478 29.568 23.702  1.00 41.41  ? 303  TYR B CG    1 
ATOM   3758 C  CD1   . TYR B 1 126 ? 106.509 28.768 24.145  1.00 43.51  ? 303  TYR B CD1   1 
ATOM   3759 C  CD2   . TYR B 1 126 ? 105.620 30.936 23.824  1.00 43.80  ? 303  TYR B CD2   1 
ATOM   3760 C  CE1   . TYR B 1 126 ? 107.674 29.309 24.604  1.00 44.72  ? 303  TYR B CE1   1 
ATOM   3761 C  CE2   . TYR B 1 126 ? 106.778 31.489 24.314  1.00 44.48  ? 303  TYR B CE2   1 
ATOM   3762 C  CZ    . TYR B 1 126 ? 107.802 30.670 24.698  1.00 44.78  ? 303  TYR B CZ    1 
ATOM   3763 O  OH    . TYR B 1 126 ? 108.957 31.208 25.214  1.00 47.40  ? 303  TYR B OH    1 
ATOM   3764 N  N     . GLN B 1 127 ? 102.270 30.908 24.821  1.00 40.03  ? 304  GLN B N     1 
ATOM   3765 C  CA    . GLN B 1 127 ? 102.111 32.185 25.532  1.00 41.28  ? 304  GLN B CA    1 
ATOM   3766 C  C     . GLN B 1 127 ? 101.698 31.986 27.000  1.00 41.39  ? 304  GLN B C     1 
ATOM   3767 O  O     . GLN B 1 127 ? 102.237 32.642 27.911  1.00 40.70  ? 304  GLN B O     1 
ATOM   3768 C  CB    . GLN B 1 127 ? 101.061 33.069 24.858  1.00 42.31  ? 304  GLN B CB    1 
ATOM   3769 C  CG    . GLN B 1 127 ? 101.294 33.352 23.368  1.00 42.98  ? 304  GLN B CG    1 
ATOM   3770 C  CD    . GLN B 1 127 ? 102.621 34.022 23.088  1.00 44.45  ? 304  GLN B CD    1 
ATOM   3771 O  OE1   . GLN B 1 127 ? 103.280 33.719 22.068  1.00 48.97  ? 304  GLN B OE1   1 
ATOM   3772 N  NE2   . GLN B 1 127 ? 103.045 34.914 23.995  1.00 39.37  ? 304  GLN B NE2   1 
ATOM   3773 N  N     . ILE B 1 128 ? 100.753 31.062 27.214  1.00 40.74  ? 305  ILE B N     1 
ATOM   3774 C  CA    . ILE B 1 128 ? 100.206 30.812 28.545  1.00 40.41  ? 305  ILE B CA    1 
ATOM   3775 C  C     . ILE B 1 128 ? 101.197 30.102 29.413  1.00 40.22  ? 305  ILE B C     1 
ATOM   3776 O  O     . ILE B 1 128 ? 101.380 30.461 30.544  1.00 41.28  ? 305  ILE B O     1 
ATOM   3777 C  CB    . ILE B 1 128 ? 98.903  29.973 28.481  1.00 41.61  ? 305  ILE B CB    1 
ATOM   3778 C  CG1   . ILE B 1 128 ? 97.800  30.800 27.799  1.00 41.52  ? 305  ILE B CG1   1 
ATOM   3779 C  CG2   . ILE B 1 128 ? 98.492  29.478 29.890  1.00 37.33  ? 305  ILE B CG2   1 
ATOM   3780 C  CD1   . ILE B 1 128 ? 96.604  30.020 27.385  1.00 41.15  ? 305  ILE B CD1   1 
ATOM   3781 N  N     . ASN B 1 129 ? 101.842 29.077 28.891  1.00 40.91  ? 306  ASN B N     1 
ATOM   3782 C  CA    . ASN B 1 129 ? 102.850 28.356 29.664  1.00 41.13  ? 306  ASN B CA    1 
ATOM   3783 C  C     . ASN B 1 129 ? 104.080 29.172 30.000  1.00 41.41  ? 306  ASN B C     1 
ATOM   3784 O  O     . ASN B 1 129 ? 104.601 29.072 31.102  1.00 41.89  ? 306  ASN B O     1 
ATOM   3785 C  CB    . ASN B 1 129 ? 103.289 27.108 28.917  1.00 41.25  ? 306  ASN B CB    1 
ATOM   3786 C  CG    . ASN B 1 129 ? 102.200 26.110 28.831  1.00 40.00  ? 306  ASN B CG    1 
ATOM   3787 O  OD1   . ASN B 1 129 ? 101.177 26.277 29.495  1.00 37.63  ? 306  ASN B OD1   1 
ATOM   3788 N  ND2   . ASN B 1 129 ? 102.386 25.068 28.018  1.00 36.95  ? 306  ASN B ND2   1 
ATOM   3789 N  N     . ALA B 1 130 ? 104.565 29.955 29.038  1.00 41.61  ? 307  ALA B N     1 
ATOM   3790 C  CA    . ALA B 1 130 ? 105.736 30.794 29.266  1.00 41.03  ? 307  ALA B CA    1 
ATOM   3791 C  C     . ALA B 1 130 ? 105.334 32.056 30.005  1.00 41.34  ? 307  ALA B C     1 
ATOM   3792 O  O     . ALA B 1 130 ? 106.163 32.889 30.300  1.00 40.30  ? 307  ALA B O     1 
ATOM   3793 C  CB    . ALA B 1 130 ? 106.376 31.166 27.962  1.00 41.14  ? 307  ALA B CB    1 
ATOM   3794 N  N     . ARG B 1 131 ? 104.039 32.246 30.231  1.00 41.64  ? 308  ARG B N     1 
ATOM   3795 C  CA    . ARG B 1 131 ? 103.575 33.443 30.924  1.00 41.87  ? 308  ARG B CA    1 
ATOM   3796 C  C     . ARG B 1 131 ? 104.103 34.708 30.274  1.00 41.56  ? 308  ARG B C     1 
ATOM   3797 O  O     . ARG B 1 131 ? 104.678 35.547 30.935  1.00 41.08  ? 308  ARG B O     1 
ATOM   3798 C  CB    . ARG B 1 131 ? 104.011 33.413 32.380  1.00 42.90  ? 308  ARG B CB    1 
ATOM   3799 C  CG    . ARG B 1 131 ? 103.596 32.132 33.055  1.00 44.28  ? 308  ARG B CG    1 
ATOM   3800 C  CD    . ARG B 1 131 ? 103.794 32.184 34.543  1.00 44.13  ? 308  ARG B CD    1 
ATOM   3801 N  NE    . ARG B 1 131 ? 103.457 30.888 35.125  1.00 46.81  ? 308  ARG B NE    1 
ATOM   3802 C  CZ    . ARG B 1 131 ? 103.642 30.580 36.403  1.00 45.97  ? 308  ARG B CZ    1 
ATOM   3803 N  NH1   . ARG B 1 131 ? 104.099 31.513 37.217  1.00 46.42  ? 308  ARG B NH1   1 
ATOM   3804 N  NH2   . ARG B 1 131 ? 103.346 29.364 36.867  1.00 45.35  ? 308  ARG B NH2   1 
ATOM   3805 N  N     . THR B 1 132 ? 103.881 34.829 28.974  1.00 42.06  ? 309  THR B N     1 
ATOM   3806 C  CA    . THR B 1 132 ? 104.369 35.950 28.211  1.00 42.41  ? 309  THR B CA    1 
ATOM   3807 C  C     . THR B 1 132 ? 103.557 37.220 28.504  1.00 44.51  ? 309  THR B C     1 
ATOM   3808 O  O     . THR B 1 132 ? 102.508 37.176 29.158  1.00 44.40  ? 309  THR B O     1 
ATOM   3809 C  CB    . THR B 1 132 ? 104.274 35.644 26.708  1.00 42.41  ? 309  THR B CB    1 
ATOM   3810 O  OG1   . THR B 1 132 ? 102.890 35.611 26.316  1.00 42.11  ? 309  THR B OG1   1 
ATOM   3811 C  CG2   . THR B 1 132 ? 104.961 34.320 26.386  1.00 39.60  ? 309  THR B CG2   1 
ATOM   3812 N  N     . GLU B 1 133 ? 104.032 38.349 27.988  1.00 45.55  ? 310  GLU B N     1 
ATOM   3813 C  CA    . GLU B 1 133 ? 103.320 39.600 28.154  1.00 47.39  ? 310  GLU B CA    1 
ATOM   3814 C  C     . GLU B 1 133 ? 101.934 39.535 27.586  1.00 46.45  ? 310  GLU B C     1 
ATOM   3815 O  O     . GLU B 1 133 ? 101.017 40.054 28.187  1.00 47.28  ? 310  GLU B O     1 
ATOM   3816 C  CB    . GLU B 1 133 ? 104.027 40.768 27.452  1.00 49.36  ? 310  GLU B CB    1 
ATOM   3817 C  CG    . GLU B 1 133 ? 105.407 41.097 28.060  1.00 57.21  ? 310  GLU B CG    1 
ATOM   3818 C  CD    . GLU B 1 133 ? 105.806 42.580 27.949  1.00 65.44  ? 310  GLU B CD    1 
ATOM   3819 O  OE1   . GLU B 1 133 ? 106.763 42.947 28.699  1.00 66.28  ? 310  GLU B OE1   1 
ATOM   3820 O  OE2   . GLU B 1 133 ? 105.158 43.349 27.149  1.00 69.47  ? 310  GLU B OE2   1 
ATOM   3821 N  N     . LEU B 1 134 ? 101.785 38.966 26.391  1.00 46.21  ? 311  LEU B N     1 
ATOM   3822 C  CA    . LEU B 1 134 ? 100.440 38.727 25.825  1.00 46.06  ? 311  LEU B CA    1 
ATOM   3823 C  C     . LEU B 1 134 ? 99.567  37.870 26.743  1.00 44.54  ? 311  LEU B C     1 
ATOM   3824 O  O     . LEU B 1 134 ? 98.423  38.229 26.975  1.00 44.94  ? 311  LEU B O     1 
ATOM   3825 C  CB    . LEU B 1 134 ? 100.470 38.076 24.426  1.00 46.27  ? 311  LEU B CB    1 
ATOM   3826 C  CG    . LEU B 1 134 ? 100.913 38.960 23.259  1.00 47.80  ? 311  LEU B CG    1 
ATOM   3827 C  CD1   . LEU B 1 134 ? 100.873 38.180 21.951  1.00 46.76  ? 311  LEU B CD1   1 
ATOM   3828 C  CD2   . LEU B 1 134 ? 100.120 40.294 23.143  1.00 47.34  ? 311  LEU B CD2   1 
ATOM   3829 N  N     . ALA B 1 135 ? 100.076 36.741 27.236  1.00 42.95  ? 312  ALA B N     1 
ATOM   3830 C  CA    . ALA B 1 135 ? 99.272  35.895 28.149  1.00 42.24  ? 312  ALA B CA    1 
ATOM   3831 C  C     . ALA B 1 135 ? 98.777  36.737 29.331  1.00 41.20  ? 312  ALA B C     1 
ATOM   3832 O  O     . ALA B 1 135 ? 97.587  36.722 29.693  1.00 41.04  ? 312  ALA B O     1 
ATOM   3833 C  CB    . ALA B 1 135 ? 100.073 34.671 28.658  1.00 41.69  ? 312  ALA B CB    1 
ATOM   3834 N  N     . VAL B 1 136 ? 99.687  37.504 29.911  1.00 40.06  ? 313  VAL B N     1 
ATOM   3835 C  CA    . VAL B 1 136 ? 99.337  38.310 31.075  1.00 38.65  ? 313  VAL B CA    1 
ATOM   3836 C  C     . VAL B 1 136 ? 98.424  39.465 30.700  1.00 39.18  ? 313  VAL B C     1 
ATOM   3837 O  O     . VAL B 1 136 ? 97.544  39.823 31.470  1.00 39.73  ? 313  VAL B O     1 
ATOM   3838 C  CB    . VAL B 1 136 ? 100.571 38.868 31.796  1.00 38.55  ? 313  VAL B CB    1 
ATOM   3839 C  CG1   . VAL B 1 136 ? 100.138 39.938 32.802  1.00 33.59  ? 313  VAL B CG1   1 
ATOM   3840 C  CG2   . VAL B 1 136 ? 101.356 37.709 32.467  1.00 33.13  ? 313  VAL B CG2   1 
ATOM   3841 N  N     . ARG B 1 137 ? 98.618  40.045 29.523  1.00 39.05  ? 314  ARG B N     1 
ATOM   3842 C  CA    . ARG B 1 137 ? 97.786  41.170 29.106  1.00 39.43  ? 314  ARG B CA    1 
ATOM   3843 C  C     . ARG B 1 137 ? 96.328  40.734 28.937  1.00 39.10  ? 314  ARG B C     1 
ATOM   3844 O  O     . ARG B 1 137 ? 95.402  41.505 29.199  1.00 38.71  ? 314  ARG B O     1 
ATOM   3845 C  CB    . ARG B 1 137 ? 98.288  41.757 27.783  1.00 40.15  ? 314  ARG B CB    1 
ATOM   3846 C  CG    . ARG B 1 137 ? 97.268  42.732 27.090  1.00 42.67  ? 314  ARG B CG    1 
ATOM   3847 C  CD    . ARG B 1 137 ? 97.865  43.434 25.895  1.00 45.34  ? 314  ARG B CD    1 
ATOM   3848 N  NE    . ARG B 1 137 ? 99.267  43.742 26.147  1.00 51.54  ? 314  ARG B NE    1 
ATOM   3849 C  CZ    . ARG B 1 137 ? 100.190 43.905 25.206  1.00 55.79  ? 314  ARG B CZ    1 
ATOM   3850 N  NH1   . ARG B 1 137 ? 99.874  43.876 23.922  1.00 58.36  ? 314  ARG B NH1   1 
ATOM   3851 N  NH2   . ARG B 1 137 ? 101.448 44.087 25.554  1.00 58.51  ? 314  ARG B NH2   1 
ATOM   3852 N  N     . TYR B 1 138 ? 96.138  39.514 28.458  1.00 38.61  ? 315  TYR B N     1 
ATOM   3853 C  CA    . TYR B 1 138 ? 94.821  39.032 28.073  1.00 38.64  ? 315  TYR B CA    1 
ATOM   3854 C  C     . TYR B 1 138 ? 94.353  37.937 29.009  1.00 38.21  ? 315  TYR B C     1 
ATOM   3855 O  O     . TYR B 1 138 ? 93.406  37.225 28.705  1.00 38.38  ? 315  TYR B O     1 
ATOM   3856 C  CB    . TYR B 1 138 ? 94.805  38.544 26.595  1.00 38.78  ? 315  TYR B CB    1 
ATOM   3857 C  CG    . TYR B 1 138 ? 94.920  39.693 25.598  1.00 38.52  ? 315  TYR B CG    1 
ATOM   3858 C  CD1   . TYR B 1 138 ? 93.950  40.693 25.542  1.00 38.41  ? 315  TYR B CD1   1 
ATOM   3859 C  CD2   . TYR B 1 138 ? 96.030  39.812 24.753  1.00 39.03  ? 315  TYR B CD2   1 
ATOM   3860 C  CE1   . TYR B 1 138 ? 94.081  41.789 24.661  1.00 36.94  ? 315  TYR B CE1   1 
ATOM   3861 C  CE2   . TYR B 1 138 ? 96.173  40.894 23.878  1.00 37.22  ? 315  TYR B CE2   1 
ATOM   3862 C  CZ    . TYR B 1 138 ? 95.195  41.882 23.846  1.00 36.76  ? 315  TYR B CZ    1 
ATOM   3863 O  OH    . TYR B 1 138 ? 95.361  42.961 23.034  1.00 35.24  ? 315  TYR B OH    1 
ATOM   3864 N  N     . ASN B 1 139 ? 95.038  37.766 30.132  1.00 38.34  ? 316  ASN B N     1 
ATOM   3865 C  CA    . ASN B 1 139 ? 94.522  36.898 31.171  1.00 38.36  ? 316  ASN B CA    1 
ATOM   3866 C  C     . ASN B 1 139 ? 94.266  35.451 30.666  1.00 38.75  ? 316  ASN B C     1 
ATOM   3867 O  O     . ASN B 1 139 ? 93.292  34.804 31.046  1.00 39.49  ? 316  ASN B O     1 
ATOM   3868 C  CB    . ASN B 1 139 ? 93.253  37.549 31.752  1.00 37.89  ? 316  ASN B CB    1 
ATOM   3869 C  CG    . ASN B 1 139 ? 93.493  39.005 32.238  1.00 38.63  ? 316  ASN B CG    1 
ATOM   3870 O  OD1   . ASN B 1 139 ? 94.244  39.209 33.194  1.00 39.31  ? 316  ASN B OD1   1 
ATOM   3871 N  ND2   . ASN B 1 139 ? 92.827  40.008 31.605  1.00 33.71  ? 316  ASN B ND2   1 
ATOM   3872 N  N     . ASP B 1 140 ? 95.169  34.945 29.825  1.00 39.56  ? 317  ASP B N     1 
ATOM   3873 C  CA    . ASP B 1 140 ? 95.099  33.578 29.283  1.00 40.46  ? 317  ASP B CA    1 
ATOM   3874 C  C     . ASP B 1 140 ? 93.947  33.292 28.324  1.00 41.03  ? 317  ASP B C     1 
ATOM   3875 O  O     . ASP B 1 140 ? 93.746  32.132 27.945  1.00 42.63  ? 317  ASP B O     1 
ATOM   3876 C  CB    . ASP B 1 140 ? 95.067  32.552 30.418  1.00 40.29  ? 317  ASP B CB    1 
ATOM   3877 C  CG    . ASP B 1 140 ? 96.358  32.518 31.200  1.00 42.03  ? 317  ASP B CG    1 
ATOM   3878 O  OD1   . ASP B 1 140 ? 97.300  33.265 30.808  1.00 42.13  ? 317  ASP B OD1   1 
ATOM   3879 O  OD2   . ASP B 1 140 ? 96.412  31.772 32.211  1.00 38.20  ? 317  ASP B OD2   1 
ATOM   3880 N  N     . ILE B 1 141 ? 93.198  34.321 27.937  1.00 40.97  ? 318  ILE B N     1 
ATOM   3881 C  CA    . ILE B 1 141 ? 92.044  34.159 27.046  1.00 40.55  ? 318  ILE B CA    1 
ATOM   3882 C  C     . ILE B 1 141 ? 92.426  34.500 25.611  1.00 41.34  ? 318  ILE B C     1 
ATOM   3883 O  O     . ILE B 1 141 ? 92.658  35.677 25.300  1.00 42.47  ? 318  ILE B O     1 
ATOM   3884 C  CB    . ILE B 1 141 ? 90.903  35.122 27.460  1.00 39.93  ? 318  ILE B CB    1 
ATOM   3885 C  CG1   . ILE B 1 141 ? 90.431  34.825 28.902  1.00 37.39  ? 318  ILE B CG1   1 
ATOM   3886 C  CG2   . ILE B 1 141 ? 89.766  35.059 26.442  1.00 36.02  ? 318  ILE B CG2   1 
ATOM   3887 C  CD1   . ILE B 1 141 ? 89.512  35.912 29.539  1.00 28.48  ? 318  ILE B CD1   1 
ATOM   3888 N  N     . SER B 1 142 ? 92.488  33.488 24.745  1.00 41.39  ? 319  SER B N     1 
ATOM   3889 C  CA    . SER B 1 142 ? 92.825  33.668 23.330  1.00 40.79  ? 319  SER B CA    1 
ATOM   3890 C  C     . SER B 1 142 ? 93.719  34.873 23.131  1.00 41.39  ? 319  SER B C     1 
ATOM   3891 O  O     . SER B 1 142 ? 93.321  35.882 22.543  1.00 40.95  ? 319  SER B O     1 
ATOM   3892 C  CB    . SER B 1 142 ? 91.559  33.788 22.514  1.00 40.99  ? 319  SER B CB    1 
ATOM   3893 O  OG    . SER B 1 142 ? 90.795  32.622 22.688  1.00 38.94  ? 319  SER B OG    1 
ATOM   3894 N  N     . PRO B 1 143 ? 94.912  34.815 23.720  1.00 41.82  ? 320  PRO B N     1 
ATOM   3895 C  CA    . PRO B 1 143 ? 95.750  36.006 23.717  1.00 41.93  ? 320  PRO B CA    1 
ATOM   3896 C  C     . PRO B 1 143 ? 96.146  36.417 22.307  1.00 41.85  ? 320  PRO B C     1 
ATOM   3897 O  O     . PRO B 1 143 ? 96.035  37.606 21.973  1.00 42.26  ? 320  PRO B O     1 
ATOM   3898 C  CB    . PRO B 1 143 ? 96.962  35.606 24.549  1.00 41.61  ? 320  PRO B CB    1 
ATOM   3899 C  CG    . PRO B 1 143 ? 96.534  34.394 25.306  1.00 43.59  ? 320  PRO B CG    1 
ATOM   3900 C  CD    . PRO B 1 143 ? 95.501  33.709 24.483  1.00 42.15  ? 320  PRO B CD    1 
ATOM   3901 N  N     . LEU B 1 144 ? 96.566  35.456 21.484  1.00 41.16  ? 321  LEU B N     1 
ATOM   3902 C  CA    . LEU B 1 144 ? 97.004  35.766 20.131  1.00 41.29  ? 321  LEU B CA    1 
ATOM   3903 C  C     . LEU B 1 144 ? 95.888  36.467 19.383  1.00 41.06  ? 321  LEU B C     1 
ATOM   3904 O  O     . LEU B 1 144 ? 96.079  37.560 18.842  1.00 40.84  ? 321  LEU B O     1 
ATOM   3905 C  CB    . LEU B 1 144 ? 97.401  34.487 19.369  1.00 41.95  ? 321  LEU B CB    1 
ATOM   3906 C  CG    . LEU B 1 144 ? 98.764  33.854 19.694  1.00 41.85  ? 321  LEU B CG    1 
ATOM   3907 C  CD1   . LEU B 1 144 ? 99.205  32.840 18.603  1.00 40.24  ? 321  LEU B CD1   1 
ATOM   3908 C  CD2   . LEU B 1 144 ? 99.789  34.923 19.871  1.00 38.92  ? 321  LEU B CD2   1 
ATOM   3909 N  N     . GLU B 1 145 ? 94.718  35.844 19.381  1.00 40.47  ? 322  GLU B N     1 
ATOM   3910 C  CA    . GLU B 1 145 ? 93.622  36.316 18.579  1.00 41.26  ? 322  GLU B CA    1 
ATOM   3911 C  C     . GLU B 1 145 ? 93.128  37.679 19.068  1.00 41.65  ? 322  GLU B C     1 
ATOM   3912 O  O     . GLU B 1 145 ? 92.813  38.545 18.254  1.00 41.94  ? 322  GLU B O     1 
ATOM   3913 C  CB    . GLU B 1 145 ? 92.476  35.305 18.600  1.00 42.11  ? 322  GLU B CB    1 
ATOM   3914 C  CG    . GLU B 1 145 ? 92.738  34.001 17.824  1.00 43.59  ? 322  GLU B CG    1 
ATOM   3915 C  CD    . GLU B 1 145 ? 93.738  33.063 18.483  1.00 45.38  ? 322  GLU B CD    1 
ATOM   3916 O  OE1   . GLU B 1 145 ? 93.877  33.123 19.718  1.00 49.15  ? 322  GLU B OE1   1 
ATOM   3917 O  OE2   . GLU B 1 145 ? 94.374  32.256 17.762  1.00 51.59  ? 322  GLU B OE2   1 
ATOM   3918 N  N     . ASN B 1 146 ? 93.081  37.886 20.385  1.00 42.16  ? 323  ASN B N     1 
ATOM   3919 C  CA    . ASN B 1 146 ? 92.809  39.207 20.941  1.00 42.73  ? 323  ASN B CA    1 
ATOM   3920 C  C     . ASN B 1 146 ? 93.832  40.214 20.378  1.00 43.48  ? 323  ASN B C     1 
ATOM   3921 O  O     . ASN B 1 146 ? 93.467  41.355 20.035  1.00 43.29  ? 323  ASN B O     1 
ATOM   3922 C  CB    . ASN B 1 146 ? 92.913  39.177 22.475  1.00 42.89  ? 323  ASN B CB    1 
ATOM   3923 C  CG    . ASN B 1 146 ? 91.614  38.824 23.129  1.00 43.46  ? 323  ASN B CG    1 
ATOM   3924 O  OD1   . ASN B 1 146 ? 90.618  39.533 22.969  1.00 45.24  ? 323  ASN B OD1   1 
ATOM   3925 N  ND2   . ASN B 1 146 ? 91.589  37.699 23.831  1.00 41.05  ? 323  ASN B ND2   1 
ATOM   3926 N  N     . HIS B 1 147 ? 95.091  39.773 20.262  1.00 42.48  ? 324  HIS B N     1 
ATOM   3927 C  CA    . HIS B 1 147 ? 96.159  40.639 19.824  1.00 43.01  ? 324  HIS B CA    1 
ATOM   3928 C  C     . HIS B 1 147 ? 96.033  41.008 18.351  1.00 43.67  ? 324  HIS B C     1 
ATOM   3929 O  O     . HIS B 1 147 ? 96.225  42.177 17.953  1.00 43.89  ? 324  HIS B O     1 
ATOM   3930 C  CB    . HIS B 1 147 ? 97.497  39.958 20.030  1.00 43.08  ? 324  HIS B CB    1 
ATOM   3931 C  CG    . HIS B 1 147 ? 98.653  40.806 19.620  1.00 42.94  ? 324  HIS B CG    1 
ATOM   3932 N  ND1   . HIS B 1 147 ? 98.927  42.022 20.215  1.00 42.53  ? 324  HIS B ND1   1 
ATOM   3933 C  CD2   . HIS B 1 147 ? 99.554  40.662 18.624  1.00 40.85  ? 324  HIS B CD2   1 
ATOM   3934 C  CE1   . HIS B 1 147 ? 99.970  42.571 19.628  1.00 39.23  ? 324  HIS B CE1   1 
ATOM   3935 N  NE2   . HIS B 1 147 ? 100.376 41.761 18.665  1.00 41.14  ? 324  HIS B NE2   1 
ATOM   3936 N  N     . HIS B 1 148 ? 95.728  40.005 17.538  1.00 43.46  ? 325  HIS B N     1 
ATOM   3937 C  CA    . HIS B 1 148 ? 95.550  40.230 16.118  1.00 43.61  ? 325  HIS B CA    1 
ATOM   3938 C  C     . HIS B 1 148 ? 94.477  41.287 15.961  1.00 44.48  ? 325  HIS B C     1 
ATOM   3939 O  O     . HIS B 1 148 ? 94.613  42.280 15.230  1.00 43.24  ? 325  HIS B O     1 
ATOM   3940 C  CB    . HIS B 1 148 ? 95.099  38.956 15.411  1.00 43.82  ? 325  HIS B CB    1 
ATOM   3941 C  CG    . HIS B 1 148 ? 95.989  37.771 15.637  1.00 42.49  ? 325  HIS B CG    1 
ATOM   3942 N  ND1   . HIS B 1 148 ? 97.364  37.855 15.655  1.00 43.99  ? 325  HIS B ND1   1 
ATOM   3943 C  CD2   . HIS B 1 148 ? 95.693  36.457 15.762  1.00 42.10  ? 325  HIS B CD2   1 
ATOM   3944 C  CE1   . HIS B 1 148 ? 97.871  36.653 15.871  1.00 44.62  ? 325  HIS B CE1   1 
ATOM   3945 N  NE2   . HIS B 1 148 ? 96.878  35.783 15.929  1.00 42.83  ? 325  HIS B NE2   1 
ATOM   3946 N  N     . CYS B 1 149 ? 93.415  41.102 16.717  1.00 45.44  ? 326  CYS B N     1 
ATOM   3947 C  CA    . CYS B 1 149 ? 92.279  41.982 16.589  1.00 46.66  ? 326  CYS B CA    1 
ATOM   3948 C  C     . CYS B 1 149 ? 92.612  43.399 17.087  1.00 45.93  ? 326  CYS B C     1 
ATOM   3949 O  O     . CYS B 1 149 ? 92.228  44.394 16.453  1.00 46.17  ? 326  CYS B O     1 
ATOM   3950 C  CB    . CYS B 1 149 ? 91.094  41.393 17.330  1.00 46.88  ? 326  CYS B CB    1 
ATOM   3951 S  SG    . CYS B 1 149 ? 89.557  42.103 16.823  1.00 55.90  ? 326  CYS B SG    1 
ATOM   3952 N  N     . ALA B 1 150 ? 93.359  43.503 18.184  1.00 45.03  ? 327  ALA B N     1 
ATOM   3953 C  CA    . ALA B 1 150 ? 93.750  44.809 18.685  1.00 44.63  ? 327  ALA B CA    1 
ATOM   3954 C  C     . ALA B 1 150 ? 94.626  45.492 17.641  1.00 44.14  ? 327  ALA B C     1 
ATOM   3955 O  O     . ALA B 1 150 ? 94.423  46.661 17.310  1.00 44.83  ? 327  ALA B O     1 
ATOM   3956 C  CB    . ALA B 1 150 ? 94.481  44.695 20.032  1.00 43.87  ? 327  ALA B CB    1 
ATOM   3957 N  N     . VAL B 1 151 ? 95.550  44.754 17.056  1.00 43.25  ? 328  VAL B N     1 
ATOM   3958 C  CA    . VAL B 1 151 ? 96.428  45.364 16.064  1.00 42.60  ? 328  VAL B CA    1 
ATOM   3959 C  C     . VAL B 1 151 ? 95.614  45.830 14.840  1.00 43.08  ? 328  VAL B C     1 
ATOM   3960 O  O     . VAL B 1 151 ? 95.817  46.934 14.299  1.00 42.93  ? 328  VAL B O     1 
ATOM   3961 C  CB    . VAL B 1 151 ? 97.568  44.403 15.637  1.00 43.01  ? 328  VAL B CB    1 
ATOM   3962 C  CG1   . VAL B 1 151 ? 98.206  44.882 14.343  1.00 39.41  ? 328  VAL B CG1   1 
ATOM   3963 C  CG2   . VAL B 1 151 ? 98.615  44.273 16.775  1.00 39.54  ? 328  VAL B CG2   1 
ATOM   3964 N  N     . ALA B 1 152 ? 94.625  45.032 14.452  1.00 42.93  ? 329  ALA B N     1 
ATOM   3965 C  CA    . ALA B 1 152 ? 93.744  45.417 13.333  1.00 42.13  ? 329  ALA B CA    1 
ATOM   3966 C  C     . ALA B 1 152 ? 93.150  46.803 13.548  1.00 41.17  ? 329  ALA B C     1 
ATOM   3967 O  O     . ALA B 1 152 ? 93.096  47.611 12.631  1.00 41.25  ? 329  ALA B O     1 
ATOM   3968 C  CB    . ALA B 1 152 ? 92.631  44.375 13.111  1.00 41.18  ? 329  ALA B CB    1 
ATOM   3969 N  N     . PHE B 1 153 ? 92.737  47.083 14.765  1.00 41.02  ? 330  PHE B N     1 
ATOM   3970 C  CA    . PHE B 1 153 ? 91.988  48.281 15.006  1.00 41.55  ? 330  PHE B CA    1 
ATOM   3971 C  C     . PHE B 1 153 ? 92.893  49.427 15.360  1.00 41.44  ? 330  PHE B C     1 
ATOM   3972 O  O     . PHE B 1 153 ? 92.522  50.587 15.161  1.00 41.08  ? 330  PHE B O     1 
ATOM   3973 C  CB    . PHE B 1 153 ? 90.891  48.021 16.028  1.00 41.22  ? 330  PHE B CB    1 
ATOM   3974 C  CG    . PHE B 1 153 ? 89.675  47.405 15.404  1.00 44.72  ? 330  PHE B CG    1 
ATOM   3975 C  CD1   . PHE B 1 153 ? 88.728  48.212 14.759  1.00 45.14  ? 330  PHE B CD1   1 
ATOM   3976 C  CD2   . PHE B 1 153 ? 89.549  46.021 15.305  1.00 43.45  ? 330  PHE B CD2   1 
ATOM   3977 C  CE1   . PHE B 1 153 ? 87.630  47.642 14.124  1.00 42.11  ? 330  PHE B CE1   1 
ATOM   3978 C  CE2   . PHE B 1 153 ? 88.454  45.467 14.672  1.00 42.99  ? 330  PHE B CE2   1 
ATOM   3979 C  CZ    . PHE B 1 153 ? 87.505  46.265 14.089  1.00 42.94  ? 330  PHE B CZ    1 
ATOM   3980 N  N     . GLN B 1 154 ? 94.102  49.090 15.793  1.00 41.16  ? 331  GLN B N     1 
ATOM   3981 C  CA    . GLN B 1 154 ? 95.163  50.073 15.920  1.00 42.00  ? 331  GLN B CA    1 
ATOM   3982 C  C     . GLN B 1 154 ? 95.523  50.665 14.563  1.00 41.91  ? 331  GLN B C     1 
ATOM   3983 O  O     . GLN B 1 154 ? 95.665  51.889 14.413  1.00 42.68  ? 331  GLN B O     1 
ATOM   3984 C  CB    . GLN B 1 154 ? 96.404  49.450 16.575  1.00 42.42  ? 331  GLN B CB    1 
ATOM   3985 C  CG    . GLN B 1 154 ? 96.334  49.420 18.090  1.00 43.15  ? 331  GLN B CG    1 
ATOM   3986 C  CD    . GLN B 1 154 ? 97.143  48.278 18.704  1.00 47.46  ? 331  GLN B CD    1 
ATOM   3987 O  OE1   . GLN B 1 154 ? 98.012  47.690 18.056  1.00 50.59  ? 331  GLN B OE1   1 
ATOM   3988 N  NE2   . GLN B 1 154 ? 96.856  47.967 19.960  1.00 46.73  ? 331  GLN B NE2   1 
ATOM   3989 N  N     . ILE B 1 155 ? 95.662  49.790 13.578  1.00 41.74  ? 332  ILE B N     1 
ATOM   3990 C  CA    . ILE B 1 155 ? 95.887  50.197 12.177  1.00 41.24  ? 332  ILE B CA    1 
ATOM   3991 C  C     . ILE B 1 155 ? 94.738  51.054 11.637  1.00 41.05  ? 332  ILE B C     1 
ATOM   3992 O  O     . ILE B 1 155 ? 94.954  52.185 11.148  1.00 41.88  ? 332  ILE B O     1 
ATOM   3993 C  CB    . ILE B 1 155 ? 96.105  48.965 11.276  1.00 41.26  ? 332  ILE B CB    1 
ATOM   3994 C  CG1   . ILE B 1 155 ? 97.399  48.239 11.722  1.00 42.04  ? 332  ILE B CG1   1 
ATOM   3995 C  CG2   . ILE B 1 155 ? 96.104  49.358 9.807   1.00 37.64  ? 332  ILE B CG2   1 
ATOM   3996 C  CD1   . ILE B 1 155 ? 97.757  46.911 10.968  1.00 39.51  ? 332  ILE B CD1   1 
ATOM   3997 N  N     . LEU B 1 156 ? 93.519  50.572 11.801  1.00 40.82  ? 333  LEU B N     1 
ATOM   3998 C  CA    . LEU B 1 156 ? 92.364  51.306 11.280  1.00 41.21  ? 333  LEU B CA    1 
ATOM   3999 C  C     . LEU B 1 156 ? 92.159  52.634 11.990  1.00 42.20  ? 333  LEU B C     1 
ATOM   4000 O  O     . LEU B 1 156 ? 91.482  53.497 11.463  1.00 43.32  ? 333  LEU B O     1 
ATOM   4001 C  CB    . LEU B 1 156 ? 91.094  50.467 11.378  1.00 40.53  ? 333  LEU B CB    1 
ATOM   4002 C  CG    . LEU B 1 156 ? 91.038  49.250 10.460  1.00 39.97  ? 333  LEU B CG    1 
ATOM   4003 C  CD1   . LEU B 1 156 ? 89.986  48.283 10.916  1.00 37.96  ? 333  LEU B CD1   1 
ATOM   4004 C  CD2   . LEU B 1 156 ? 90.792  49.664 8.996   1.00 38.82  ? 333  LEU B CD2   1 
ATOM   4005 N  N     . ALA B 1 157 ? 92.722  52.807 13.183  1.00 42.95  ? 334  ALA B N     1 
ATOM   4006 C  CA    . ALA B 1 157 ? 92.591  54.071 13.876  1.00 43.98  ? 334  ALA B CA    1 
ATOM   4007 C  C     . ALA B 1 157 ? 93.603  55.111 13.377  1.00 45.07  ? 334  ALA B C     1 
ATOM   4008 O  O     . ALA B 1 157 ? 93.431  56.286 13.623  1.00 46.43  ? 334  ALA B O     1 
ATOM   4009 C  CB    . ALA B 1 157 ? 92.714  53.872 15.352  1.00 43.07  ? 334  ALA B CB    1 
ATOM   4010 N  N     . GLU B 1 158 ? 94.644  54.697 12.666  1.00 46.71  ? 335  GLU B N     1 
ATOM   4011 C  CA    . GLU B 1 158 ? 95.524  55.674 12.022  1.00 48.18  ? 335  GLU B CA    1 
ATOM   4012 C  C     . GLU B 1 158 ? 94.770  56.253 10.827  1.00 47.47  ? 335  GLU B C     1 
ATOM   4013 O  O     . GLU B 1 158 ? 94.380  55.520 9.930   1.00 48.68  ? 335  GLU B O     1 
ATOM   4014 C  CB    . GLU B 1 158 ? 96.834  55.039 11.548  1.00 48.74  ? 335  GLU B CB    1 
ATOM   4015 C  CG    . GLU B 1 158 ? 97.626  54.338 12.642  1.00 51.85  ? 335  GLU B CG    1 
ATOM   4016 C  CD    . GLU B 1 158 ? 98.262  55.293 13.643  1.00 51.10  ? 335  GLU B CD    1 
ATOM   4017 O  OE1   . GLU B 1 158 ? 98.671  54.817 14.715  1.00 51.92  ? 335  GLU B OE1   1 
ATOM   4018 O  OE2   . GLU B 1 158 ? 98.374  56.497 13.361  1.00 51.34  ? 335  GLU B OE2   1 
ATOM   4019 N  N     . PRO B 1 159 ? 94.552  57.564 10.823  1.00 46.24  ? 336  PRO B N     1 
ATOM   4020 C  CA    . PRO B 1 159 ? 93.609  58.166 9.874   1.00 46.01  ? 336  PRO B CA    1 
ATOM   4021 C  C     . PRO B 1 159 ? 93.950  57.866 8.406   1.00 45.00  ? 336  PRO B C     1 
ATOM   4022 O  O     . PRO B 1 159 ? 93.060  57.678 7.589   1.00 43.92  ? 336  PRO B O     1 
ATOM   4023 C  CB    . PRO B 1 159 ? 93.707  59.671 10.178  1.00 45.62  ? 336  PRO B CB    1 
ATOM   4024 C  CG    . PRO B 1 159 ? 94.967  59.841 10.969  1.00 45.85  ? 336  PRO B CG    1 
ATOM   4025 C  CD    . PRO B 1 159 ? 95.228  58.559 11.670  1.00 45.94  ? 336  PRO B CD    1 
ATOM   4026 N  N     . GLU B 1 160 ? 95.232  57.762 8.092   1.00 44.03  ? 337  GLU B N     1 
ATOM   4027 C  CA    . GLU B 1 160 ? 95.627  57.511 6.732   1.00 43.25  ? 337  GLU B CA    1 
ATOM   4028 C  C     . GLU B 1 160 ? 95.329  56.097 6.315   1.00 42.80  ? 337  GLU B C     1 
ATOM   4029 O  O     . GLU B 1 160 ? 95.358  55.815 5.120   1.00 42.00  ? 337  GLU B O     1 
ATOM   4030 C  CB    . GLU B 1 160 ? 97.112  57.836 6.531   1.00 43.80  ? 337  GLU B CB    1 
ATOM   4031 C  CG    . GLU B 1 160 ? 98.097  56.713 6.830   1.00 45.46  ? 337  GLU B CG    1 
ATOM   4032 C  CD    . GLU B 1 160 ? 98.650  56.714 8.250   1.00 47.34  ? 337  GLU B CD    1 
ATOM   4033 O  OE1   . GLU B 1 160 ? 98.237  57.566 9.074   1.00 44.40  ? 337  GLU B OE1   1 
ATOM   4034 O  OE2   . GLU B 1 160 ? 99.480  55.812 8.538   1.00 49.81  ? 337  GLU B OE2   1 
ATOM   4035 N  N     . CYS B 1 161 ? 95.044  55.212 7.282   1.00 41.88  ? 338  CYS B N     1 
ATOM   4036 C  CA    . CYS B 1 161 ? 94.667  53.826 6.968   1.00 42.15  ? 338  CYS B CA    1 
ATOM   4037 C  C     . CYS B 1 161 ? 93.193  53.494 7.249   1.00 42.18  ? 338  CYS B C     1 
ATOM   4038 O  O     . CYS B 1 161 ? 92.774  52.330 7.114   1.00 42.24  ? 338  CYS B O     1 
ATOM   4039 C  CB    . CYS B 1 161 ? 95.540  52.820 7.720   1.00 42.45  ? 338  CYS B CB    1 
ATOM   4040 S  SG    . CYS B 1 161 ? 97.319  53.005 7.501   1.00 44.13  ? 338  CYS B SG    1 
ATOM   4041 N  N     . ASN B 1 162 ? 92.383  54.486 7.599   1.00 41.65  ? 339  ASN B N     1 
ATOM   4042 C  CA    . ASN B 1 162 ? 91.048  54.160 8.071   1.00 41.91  ? 339  ASN B CA    1 
ATOM   4043 C  C     . ASN B 1 162 ? 90.075  53.990 6.925   1.00 41.96  ? 339  ASN B C     1 
ATOM   4044 O  O     . ASN B 1 162 ? 89.372  54.909 6.563   1.00 40.82  ? 339  ASN B O     1 
ATOM   4045 C  CB    . ASN B 1 162 ? 90.545  55.204 9.068   1.00 42.27  ? 339  ASN B CB    1 
ATOM   4046 C  CG    . ASN B 1 162 ? 89.176  54.842 9.667   1.00 42.08  ? 339  ASN B CG    1 
ATOM   4047 O  OD1   . ASN B 1 162 ? 88.663  53.734 9.487   1.00 46.17  ? 339  ASN B OD1   1 
ATOM   4048 N  ND2   . ASN B 1 162 ? 88.597  55.780 10.389  1.00 39.44  ? 339  ASN B ND2   1 
ATOM   4049 N  N     . ILE B 1 163 ? 90.037  52.793 6.362   1.00 42.93  ? 340  ILE B N     1 
ATOM   4050 C  CA    . ILE B 1 163 ? 89.126  52.499 5.259   1.00 43.40  ? 340  ILE B CA    1 
ATOM   4051 C  C     . ILE B 1 163 ? 87.654  52.628 5.671   1.00 44.00  ? 340  ILE B C     1 
ATOM   4052 O  O     . ILE B 1 163 ? 86.762  52.634 4.825   1.00 44.79  ? 340  ILE B O     1 
ATOM   4053 C  CB    . ILE B 1 163 ? 89.388  51.092 4.671   1.00 43.52  ? 340  ILE B CB    1 
ATOM   4054 C  CG1   . ILE B 1 163 ? 89.365  50.033 5.777   1.00 42.25  ? 340  ILE B CG1   1 
ATOM   4055 C  CG2   . ILE B 1 163 ? 90.743  51.076 3.946   1.00 41.79  ? 340  ILE B CG2   1 
ATOM   4056 C  CD1   . ILE B 1 163 ? 89.137  48.640 5.291   1.00 40.37  ? 340  ILE B CD1   1 
ATOM   4057 N  N     . PHE B 1 164 ? 87.395  52.756 6.964   1.00 44.63  ? 341  PHE B N     1 
ATOM   4058 C  CA    . PHE B 1 164 ? 86.022  52.943 7.445   1.00 44.92  ? 341  PHE B CA    1 
ATOM   4059 C  C     . PHE B 1 164 ? 85.676  54.399 7.723   1.00 45.22  ? 341  PHE B C     1 
ATOM   4060 O  O     . PHE B 1 164 ? 84.599  54.686 8.208   1.00 45.17  ? 341  PHE B O     1 
ATOM   4061 C  CB    . PHE B 1 164 ? 85.815  52.138 8.713   1.00 44.41  ? 341  PHE B CB    1 
ATOM   4062 C  CG    . PHE B 1 164 ? 86.053  50.688 8.543   1.00 44.00  ? 341  PHE B CG    1 
ATOM   4063 C  CD1   . PHE B 1 164 ? 85.890  50.080 7.316   1.00 45.10  ? 341  PHE B CD1   1 
ATOM   4064 C  CD2   . PHE B 1 164 ? 86.393  49.903 9.630   1.00 45.28  ? 341  PHE B CD2   1 
ATOM   4065 C  CE1   . PHE B 1 164 ? 86.097  48.700 7.170   1.00 46.24  ? 341  PHE B CE1   1 
ATOM   4066 C  CE2   . PHE B 1 164 ? 86.610  48.543 9.488   1.00 45.87  ? 341  PHE B CE2   1 
ATOM   4067 C  CZ    . PHE B 1 164 ? 86.435  47.940 8.254   1.00 45.66  ? 341  PHE B CZ    1 
ATOM   4068 N  N     . SER B 1 165 ? 86.557  55.318 7.342   1.00 45.52  ? 342  SER B N     1 
ATOM   4069 C  CA    . SER B 1 165 ? 86.394  56.736 7.687   1.00 45.50  ? 342  SER B CA    1 
ATOM   4070 C  C     . SER B 1 165 ? 85.104  57.382 7.161   1.00 45.12  ? 342  SER B C     1 
ATOM   4071 O  O     . SER B 1 165 ? 84.654  58.380 7.698   1.00 45.32  ? 342  SER B O     1 
ATOM   4072 C  CB    . SER B 1 165 ? 87.606  57.556 7.212   1.00 44.70  ? 342  SER B CB    1 
ATOM   4073 O  OG    . SER B 1 165 ? 87.686  57.572 5.800   1.00 45.50  ? 342  SER B OG    1 
ATOM   4074 N  N     . ASN B 1 166 ? 84.520  56.825 6.113   1.00 45.79  ? 343  ASN B N     1 
ATOM   4075 C  CA    . ASN B 1 166 ? 83.262  57.354 5.592   1.00 46.51  ? 343  ASN B CA    1 
ATOM   4076 C  C     . ASN B 1 166 ? 82.038  56.540 5.958   1.00 46.96  ? 343  ASN B C     1 
ATOM   4077 O  O     . ASN B 1 166 ? 80.963  56.800 5.430   1.00 48.19  ? 343  ASN B O     1 
ATOM   4078 C  CB    . ASN B 1 166 ? 83.342  57.495 4.083   1.00 46.24  ? 343  ASN B CB    1 
ATOM   4079 C  CG    . ASN B 1 166 ? 84.374  58.492 3.676   1.00 48.15  ? 343  ASN B CG    1 
ATOM   4080 O  OD1   . ASN B 1 166 ? 84.635  59.475 4.389   1.00 51.89  ? 343  ASN B OD1   1 
ATOM   4081 N  ND2   . ASN B 1 166 ? 85.001  58.243 2.553   1.00 48.95  ? 343  ASN B ND2   1 
ATOM   4082 N  N     . ILE B 1 167 ? 82.196  55.580 6.867   1.00 46.55  ? 344  ILE B N     1 
ATOM   4083 C  CA    . ILE B 1 167 ? 81.072  54.854 7.407   1.00 46.43  ? 344  ILE B CA    1 
ATOM   4084 C  C     . ILE B 1 167 ? 80.606  55.615 8.658   1.00 47.63  ? 344  ILE B C     1 
ATOM   4085 O  O     . ILE B 1 167 ? 81.425  56.046 9.444   1.00 47.81  ? 344  ILE B O     1 
ATOM   4086 C  CB    . ILE B 1 167 ? 81.469  53.424 7.800   1.00 44.98  ? 344  ILE B CB    1 
ATOM   4087 C  CG1   . ILE B 1 167 ? 81.973  52.640 6.599   1.00 43.49  ? 344  ILE B CG1   1 
ATOM   4088 C  CG2   . ILE B 1 167 ? 80.323  52.722 8.394   1.00 43.25  ? 344  ILE B CG2   1 
ATOM   4089 C  CD1   . ILE B 1 167 ? 82.787  51.450 6.986   1.00 40.51  ? 344  ILE B CD1   1 
ATOM   4090 N  N     . PRO B 1 168 ? 79.288  55.788 8.845   1.00 48.48  ? 345  PRO B N     1 
ATOM   4091 C  CA    . PRO B 1 168 ? 78.789  56.375 10.102  1.00 48.98  ? 345  PRO B CA    1 
ATOM   4092 C  C     . PRO B 1 168 ? 79.070  55.496 11.312  1.00 49.70  ? 345  PRO B C     1 
ATOM   4093 O  O     . PRO B 1 168 ? 79.281  54.297 11.153  1.00 50.93  ? 345  PRO B O     1 
ATOM   4094 C  CB    . PRO B 1 168 ? 77.278  56.454 9.892   1.00 48.67  ? 345  PRO B CB    1 
ATOM   4095 C  CG    . PRO B 1 168 ? 77.072  56.299 8.400   1.00 49.26  ? 345  PRO B CG    1 
ATOM   4096 C  CD    . PRO B 1 168 ? 78.198  55.451 7.916   1.00 48.87  ? 345  PRO B CD    1 
ATOM   4097 N  N     . PRO B 1 169 ? 79.035  56.075 12.521  1.00 50.03  ? 346  PRO B N     1 
ATOM   4098 C  CA    . PRO B 1 169 ? 79.403  55.332 13.734  1.00 50.29  ? 346  PRO B CA    1 
ATOM   4099 C  C     . PRO B 1 169 ? 78.598  54.052 13.956  1.00 50.43  ? 346  PRO B C     1 
ATOM   4100 O  O     . PRO B 1 169 ? 79.171  53.020 14.352  1.00 51.29  ? 346  PRO B O     1 
ATOM   4101 C  CB    . PRO B 1 169 ? 79.118  56.320 14.864  1.00 49.82  ? 346  PRO B CB    1 
ATOM   4102 C  CG    . PRO B 1 169 ? 79.218  57.664 14.216  1.00 50.28  ? 346  PRO B CG    1 
ATOM   4103 C  CD    . PRO B 1 169 ? 78.698  57.478 12.815  1.00 49.96  ? 346  PRO B CD    1 
ATOM   4104 N  N     . ASP B 1 170 ? 77.295  54.098 13.695  1.00 49.48  ? 347  ASP B N     1 
ATOM   4105 C  CA    . ASP B 1 170 ? 76.479  52.895 13.830  1.00 49.17  ? 347  ASP B CA    1 
ATOM   4106 C  C     . ASP B 1 170 ? 77.000  51.774 12.939  1.00 48.32  ? 347  ASP B C     1 
ATOM   4107 O  O     . ASP B 1 170 ? 77.150  50.649 13.403  1.00 48.63  ? 347  ASP B O     1 
ATOM   4108 C  CB    . ASP B 1 170 ? 75.009  53.154 13.512  1.00 49.32  ? 347  ASP B CB    1 
ATOM   4109 C  CG    . ASP B 1 170 ? 74.276  53.934 14.626  1.00 52.79  ? 347  ASP B CG    1 
ATOM   4110 O  OD1   . ASP B 1 170 ? 73.132  54.391 14.338  1.00 55.00  ? 347  ASP B OD1   1 
ATOM   4111 O  OD2   . ASP B 1 170 ? 74.818  54.076 15.765  1.00 50.82  ? 347  ASP B OD2   1 
ATOM   4112 N  N     . GLY B 1 171 ? 77.305  52.080 11.678  1.00 46.88  ? 348  GLY B N     1 
ATOM   4113 C  CA    . GLY B 1 171 ? 77.983  51.118 10.800  1.00 46.08  ? 348  GLY B CA    1 
ATOM   4114 C  C     . GLY B 1 171 ? 79.315  50.638 11.366  1.00 46.16  ? 348  GLY B C     1 
ATOM   4115 O  O     . GLY B 1 171 ? 79.595  49.434 11.418  1.00 44.75  ? 348  GLY B O     1 
ATOM   4116 N  N     . PHE B 1 172 ? 80.136  51.580 11.823  1.00 46.50  ? 349  PHE B N     1 
ATOM   4117 C  CA    . PHE B 1 172 ? 81.424  51.219 12.352  1.00 46.60  ? 349  PHE B CA    1 
ATOM   4118 C  C     . PHE B 1 172 ? 81.291  50.246 13.487  1.00 47.48  ? 349  PHE B C     1 
ATOM   4119 O  O     . PHE B 1 172 ? 81.961  49.212 13.517  1.00 47.35  ? 349  PHE B O     1 
ATOM   4120 C  CB    . PHE B 1 172 ? 82.145  52.411 12.888  1.00 46.86  ? 349  PHE B CB    1 
ATOM   4121 C  CG    . PHE B 1 172 ? 83.466  52.062 13.498  1.00 44.38  ? 349  PHE B CG    1 
ATOM   4122 C  CD1   . PHE B 1 172 ? 84.548  51.780 12.691  1.00 42.39  ? 349  PHE B CD1   1 
ATOM   4123 C  CD2   . PHE B 1 172 ? 83.609  51.997 14.872  1.00 46.18  ? 349  PHE B CD2   1 
ATOM   4124 C  CE1   . PHE B 1 172 ? 85.784  51.494 13.224  1.00 46.40  ? 349  PHE B CE1   1 
ATOM   4125 C  CE2   . PHE B 1 172 ? 84.838  51.692 15.436  1.00 49.73  ? 349  PHE B CE2   1 
ATOM   4126 C  CZ    . PHE B 1 172 ? 85.943  51.436 14.600  1.00 48.54  ? 349  PHE B CZ    1 
ATOM   4127 N  N     . LYS B 1 173 ? 80.449  50.602 14.446  1.00 47.51  ? 350  LYS B N     1 
ATOM   4128 C  CA    . LYS B 1 173 ? 80.210  49.715 15.573  1.00 48.96  ? 350  LYS B CA    1 
ATOM   4129 C  C     . LYS B 1 173 ? 79.785  48.306 15.130  1.00 47.79  ? 350  LYS B C     1 
ATOM   4130 O  O     . LYS B 1 173 ? 80.238  47.292 15.680  1.00 47.30  ? 350  LYS B O     1 
ATOM   4131 C  CB    . LYS B 1 173 ? 79.163  50.317 16.524  1.00 49.52  ? 350  LYS B CB    1 
ATOM   4132 C  CG    . LYS B 1 173 ? 79.712  51.456 17.382  1.00 54.11  ? 350  LYS B CG    1 
ATOM   4133 C  CD    . LYS B 1 173 ? 78.951  51.640 18.688  1.00 59.92  ? 350  LYS B CD    1 
ATOM   4134 C  CE    . LYS B 1 173 ? 79.296  52.982 19.345  1.00 63.81  ? 350  LYS B CE    1 
ATOM   4135 N  NZ    . LYS B 1 173 ? 78.715  54.149 18.598  1.00 67.04  ? 350  LYS B NZ    1 
ATOM   4136 N  N     . GLN B 1 174 ? 78.940  48.250 14.119  1.00 47.28  ? 351  GLN B N     1 
ATOM   4137 C  CA    . GLN B 1 174 ? 78.444  46.978 13.639  1.00 48.09  ? 351  GLN B CA    1 
ATOM   4138 C  C     . GLN B 1 174 ? 79.556  46.138 13.012  1.00 47.48  ? 351  GLN B C     1 
ATOM   4139 O  O     . GLN B 1 174 ? 79.619  44.919 13.223  1.00 47.05  ? 351  GLN B O     1 
ATOM   4140 C  CB    . GLN B 1 174 ? 77.332  47.191 12.623  1.00 48.85  ? 351  GLN B CB    1 
ATOM   4141 C  CG    . GLN B 1 174 ? 76.576  45.920 12.258  1.00 52.44  ? 351  GLN B CG    1 
ATOM   4142 C  CD    . GLN B 1 174 ? 75.571  46.150 11.141  1.00 56.79  ? 351  GLN B CD    1 
ATOM   4143 O  OE1   . GLN B 1 174 ? 75.387  45.297 10.283  1.00 60.33  ? 351  GLN B OE1   1 
ATOM   4144 N  NE2   . GLN B 1 174 ? 74.929  47.320 11.135  1.00 61.25  ? 351  GLN B NE2   1 
ATOM   4145 N  N     . ILE B 1 175 ? 80.422  46.802 12.243  1.00 46.76  ? 352  ILE B N     1 
ATOM   4146 C  CA    . ILE B 1 175 ? 81.532  46.131 11.555  1.00 45.88  ? 352  ILE B CA    1 
ATOM   4147 C  C     . ILE B 1 175 ? 82.544  45.681 12.593  1.00 45.66  ? 352  ILE B C     1 
ATOM   4148 O  O     . ILE B 1 175 ? 83.026  44.554 12.544  1.00 45.25  ? 352  ILE B O     1 
ATOM   4149 C  CB    . ILE B 1 175 ? 82.209  47.063 10.497  1.00 45.83  ? 352  ILE B CB    1 
ATOM   4150 C  CG1   . ILE B 1 175 ? 81.227  47.422 9.376   1.00 45.60  ? 352  ILE B CG1   1 
ATOM   4151 C  CG2   . ILE B 1 175 ? 83.443  46.412 9.908   1.00 41.57  ? 352  ILE B CG2   1 
ATOM   4152 C  CD1   . ILE B 1 175 ? 81.549  48.734 8.693   1.00 46.01  ? 352  ILE B CD1   1 
ATOM   4153 N  N     . ARG B 1 176 ? 82.825  46.554 13.559  1.00 45.52  ? 353  ARG B N     1 
ATOM   4154 C  CA    . ARG B 1 176 ? 83.847  46.278 14.561  1.00 45.35  ? 353  ARG B CA    1 
ATOM   4155 C  C     . ARG B 1 176 ? 83.449  45.043 15.349  1.00 44.26  ? 353  ARG B C     1 
ATOM   4156 O  O     . ARG B 1 176 ? 84.206  44.097 15.437  1.00 43.80  ? 353  ARG B O     1 
ATOM   4157 C  CB    . ARG B 1 176 ? 84.029  47.480 15.467  1.00 45.63  ? 353  ARG B CB    1 
ATOM   4158 C  CG    . ARG B 1 176 ? 85.015  47.267 16.586  1.00 47.84  ? 353  ARG B CG    1 
ATOM   4159 C  CD    . ARG B 1 176 ? 85.153  48.501 17.490  1.00 47.38  ? 353  ARG B CD    1 
ATOM   4160 N  NE    . ARG B 1 176 ? 85.758  48.187 18.785  1.00 47.34  ? 353  ARG B NE    1 
ATOM   4161 C  CZ    . ARG B 1 176 ? 87.023  47.806 18.956  1.00 45.51  ? 353  ARG B CZ    1 
ATOM   4162 N  NH1   . ARG B 1 176 ? 87.847  47.718 17.930  1.00 44.28  ? 353  ARG B NH1   1 
ATOM   4163 N  NH2   . ARG B 1 176 ? 87.473  47.545 20.175  1.00 46.40  ? 353  ARG B NH2   1 
ATOM   4164 N  N     . GLN B 1 177 ? 82.220  45.029 15.828  1.00 44.21  ? 354  GLN B N     1 
ATOM   4165 C  CA    . GLN B 1 177 ? 81.695  43.904 16.578  1.00 45.31  ? 354  GLN B CA    1 
ATOM   4166 C  C     . GLN B 1 177 ? 81.828  42.607 15.809  1.00 43.41  ? 354  GLN B C     1 
ATOM   4167 O  O     . GLN B 1 177 ? 82.280  41.601 16.352  1.00 43.48  ? 354  GLN B O     1 
ATOM   4168 C  CB    . GLN B 1 177 ? 80.218  44.141 16.915  1.00 47.09  ? 354  GLN B CB    1 
ATOM   4169 C  CG    . GLN B 1 177 ? 79.505  42.967 17.688  1.00 54.42  ? 354  GLN B CG    1 
ATOM   4170 C  CD    . GLN B 1 177 ? 80.163  42.657 19.090  1.00 64.68  ? 354  GLN B CD    1 
ATOM   4171 O  OE1   . GLN B 1 177 ? 79.931  43.372 20.093  1.00 69.47  ? 354  GLN B OE1   1 
ATOM   4172 N  NE2   . GLN B 1 177 ? 80.993  41.594 19.139  1.00 65.97  ? 354  GLN B NE2   1 
ATOM   4173 N  N     . GLY B 1 178 ? 81.448  42.635 14.545  1.00 41.99  ? 355  GLY B N     1 
ATOM   4174 C  CA    . GLY B 1 178 ? 81.529  41.452 13.709  1.00 41.63  ? 355  GLY B CA    1 
ATOM   4175 C  C     . GLY B 1 178 ? 82.953  40.975 13.533  1.00 41.60  ? 355  GLY B C     1 
ATOM   4176 O  O     . GLY B 1 178 ? 83.234  39.776 13.620  1.00 41.32  ? 355  GLY B O     1 
ATOM   4177 N  N     . MET B 1 179 ? 83.866  41.909 13.314  1.00 41.18  ? 356  MET B N     1 
ATOM   4178 C  CA    . MET B 1 179 ? 85.225  41.535 13.041  1.00 41.85  ? 356  MET B CA    1 
ATOM   4179 C  C     . MET B 1 179 ? 85.852  40.946 14.281  1.00 42.93  ? 356  MET B C     1 
ATOM   4180 O  O     . MET B 1 179 ? 86.637  39.981 14.203  1.00 43.30  ? 356  MET B O     1 
ATOM   4181 C  CB    . MET B 1 179 ? 86.041  42.738 12.581  1.00 43.38  ? 356  MET B CB    1 
ATOM   4182 C  CG    . MET B 1 179 ? 85.782  43.173 11.147  1.00 42.45  ? 356  MET B CG    1 
ATOM   4183 S  SD    . MET B 1 179 ? 86.738  44.624 10.700  1.00 47.04  ? 356  MET B SD    1 
ATOM   4184 C  CE    . MET B 1 179 ? 88.450  44.073 10.796  1.00 41.99  ? 356  MET B CE    1 
ATOM   4185 N  N     . ILE B 1 180 ? 85.507  41.510 15.440  1.00 42.97  ? 357  ILE B N     1 
ATOM   4186 C  CA    . ILE B 1 180 ? 86.026  40.974 16.685  1.00 42.62  ? 357  ILE B CA    1 
ATOM   4187 C  C     . ILE B 1 180 ? 85.533  39.543 16.839  1.00 41.93  ? 357  ILE B C     1 
ATOM   4188 O  O     . ILE B 1 180 ? 86.332  38.635 16.996  1.00 42.12  ? 357  ILE B O     1 
ATOM   4189 C  CB    . ILE B 1 180 ? 85.638  41.821 17.910  1.00 43.91  ? 357  ILE B CB    1 
ATOM   4190 C  CG1   . ILE B 1 180 ? 86.268  43.225 17.836  1.00 44.40  ? 357  ILE B CG1   1 
ATOM   4191 C  CG2   . ILE B 1 180 ? 86.103  41.142 19.173  1.00 41.94  ? 357  ILE B CG2   1 
ATOM   4192 C  CD1   . ILE B 1 180 ? 85.662  44.171 18.869  1.00 45.54  ? 357  ILE B CD1   1 
ATOM   4193 N  N     . THR B 1 181 ? 84.230  39.321 16.731  1.00 40.88  ? 358  THR B N     1 
ATOM   4194 C  CA    . THR B 1 181 ? 83.697  37.961 16.882  1.00 39.90  ? 358  THR B CA    1 
ATOM   4195 C  C     . THR B 1 181 ? 84.401  36.985 15.937  1.00 40.64  ? 358  THR B C     1 
ATOM   4196 O  O     . THR B 1 181 ? 84.728  35.863 16.316  1.00 39.90  ? 358  THR B O     1 
ATOM   4197 C  CB    . THR B 1 181 ? 82.191  37.903 16.545  1.00 39.97  ? 358  THR B CB    1 
ATOM   4198 O  OG1   . THR B 1 181 ? 81.473  38.816 17.371  1.00 37.03  ? 358  THR B OG1   1 
ATOM   4199 C  CG2   . THR B 1 181 ? 81.657  36.482 16.684  1.00 37.58  ? 358  THR B CG2   1 
ATOM   4200 N  N     . LEU B 1 182 ? 84.615  37.414 14.692  1.00 41.10  ? 359  LEU B N     1 
ATOM   4201 C  CA    . LEU B 1 182 ? 85.145  36.501 13.698  1.00 41.68  ? 359  LEU B CA    1 
ATOM   4202 C  C     . LEU B 1 182 ? 86.630  36.250 13.923  1.00 41.83  ? 359  LEU B C     1 
ATOM   4203 O  O     . LEU B 1 182 ? 87.068  35.114 13.894  1.00 41.49  ? 359  LEU B O     1 
ATOM   4204 C  CB    . LEU B 1 182 ? 84.876  36.992 12.272  1.00 42.07  ? 359  LEU B CB    1 
ATOM   4205 C  CG    . LEU B 1 182 ? 83.426  37.030 11.751  1.00 40.33  ? 359  LEU B CG    1 
ATOM   4206 C  CD1   . LEU B 1 182 ? 83.461  37.294 10.253  1.00 39.11  ? 359  LEU B CD1   1 
ATOM   4207 C  CD2   . LEU B 1 182 ? 82.673  35.758 12.022  1.00 38.30  ? 359  LEU B CD2   1 
ATOM   4208 N  N     . ILE B 1 183 ? 87.411  37.295 14.186  1.00 42.42  ? 360  ILE B N     1 
ATOM   4209 C  CA    . ILE B 1 183 ? 88.817  37.061 14.464  1.00 42.89  ? 360  ILE B CA    1 
ATOM   4210 C  C     . ILE B 1 183 ? 88.979  36.195 15.720  1.00 43.57  ? 360  ILE B C     1 
ATOM   4211 O  O     . ILE B 1 183 ? 89.816  35.266 15.746  1.00 43.59  ? 360  ILE B O     1 
ATOM   4212 C  CB    . ILE B 1 183 ? 89.629  38.346 14.603  1.00 43.50  ? 360  ILE B CB    1 
ATOM   4213 C  CG1   . ILE B 1 183 ? 89.639  39.097 13.270  1.00 42.45  ? 360  ILE B CG1   1 
ATOM   4214 C  CG2   . ILE B 1 183 ? 91.109  37.994 15.053  1.00 44.26  ? 360  ILE B CG2   1 
ATOM   4215 C  CD1   . ILE B 1 183 ? 89.976  40.591 13.372  1.00 43.61  ? 360  ILE B CD1   1 
ATOM   4216 N  N     . LEU B 1 184 ? 88.158  36.446 16.737  1.00 42.82  ? 361  LEU B N     1 
ATOM   4217 C  CA    . LEU B 1 184 ? 88.272  35.629 17.961  1.00 44.17  ? 361  LEU B CA    1 
ATOM   4218 C  C     . LEU B 1 184 ? 87.904  34.191 17.713  1.00 44.13  ? 361  LEU B C     1 
ATOM   4219 O  O     . LEU B 1 184 ? 88.425  33.304 18.396  1.00 44.75  ? 361  LEU B O     1 
ATOM   4220 C  CB    . LEU B 1 184 ? 87.431  36.150 19.121  1.00 43.23  ? 361  LEU B CB    1 
ATOM   4221 C  CG    . LEU B 1 184 ? 87.945  37.447 19.738  1.00 42.89  ? 361  LEU B CG    1 
ATOM   4222 C  CD1   . LEU B 1 184 ? 87.024  37.872 20.888  1.00 39.89  ? 361  LEU B CD1   1 
ATOM   4223 C  CD2   . LEU B 1 184 ? 89.429  37.340 20.159  1.00 39.09  ? 361  LEU B CD2   1 
ATOM   4224 N  N     . ALA B 1 185 ? 87.025  33.970 16.732  1.00 43.47  ? 362  ALA B N     1 
ATOM   4225 C  CA    . ALA B 1 185 ? 86.536  32.619 16.407  1.00 43.33  ? 362  ALA B CA    1 
ATOM   4226 C  C     . ALA B 1 185 ? 87.632  31.737 15.807  1.00 43.42  ? 362  ALA B C     1 
ATOM   4227 O  O     . ALA B 1 185 ? 87.480  30.532 15.705  1.00 43.36  ? 362  ALA B O     1 
ATOM   4228 C  CB    . ALA B 1 185 ? 85.351  32.708 15.447  1.00 42.54  ? 362  ALA B CB    1 
ATOM   4229 N  N     . THR B 1 186 ? 88.728  32.349 15.381  1.00 43.98  ? 363  THR B N     1 
ATOM   4230 C  CA    . THR B 1 186 ? 89.759  31.623 14.695  1.00 44.15  ? 363  THR B CA    1 
ATOM   4231 C  C     . THR B 1 186 ? 90.636  30.830 15.669  1.00 44.72  ? 363  THR B C     1 
ATOM   4232 O  O     . THR B 1 186 ? 91.359  29.974 15.242  1.00 45.96  ? 363  THR B O     1 
ATOM   4233 C  CB    . THR B 1 186 ? 90.646  32.556 13.776  1.00 44.54  ? 363  THR B CB    1 
ATOM   4234 O  OG1   . THR B 1 186 ? 91.343  33.537 14.550  1.00 44.15  ? 363  THR B OG1   1 
ATOM   4235 C  CG2   . THR B 1 186 ? 89.816  33.284 12.748  1.00 44.66  ? 363  THR B CG2   1 
ATOM   4236 N  N     . ASP B 1 187 ? 90.544  31.058 16.970  1.00 45.00  ? 364  ASP B N     1 
ATOM   4237 C  CA    . ASP B 1 187 ? 91.315  30.265 17.932  1.00 44.76  ? 364  ASP B CA    1 
ATOM   4238 C  C     . ASP B 1 187 ? 90.870  28.795 17.923  1.00 45.27  ? 364  ASP B C     1 
ATOM   4239 O  O     . ASP B 1 187 ? 89.725  28.465 18.237  1.00 45.53  ? 364  ASP B O     1 
ATOM   4240 C  CB    . ASP B 1 187 ? 91.187  30.870 19.334  1.00 45.82  ? 364  ASP B CB    1 
ATOM   4241 C  CG    . ASP B 1 187 ? 91.913  30.069 20.400  1.00 45.31  ? 364  ASP B CG    1 
ATOM   4242 O  OD1   . ASP B 1 187 ? 92.294  28.929 20.132  1.00 49.75  ? 364  ASP B OD1   1 
ATOM   4243 O  OD2   . ASP B 1 187 ? 92.098  30.569 21.522  1.00 41.83  ? 364  ASP B OD2   1 
ATOM   4244 N  N     . MET B 1 188 ? 91.756  27.893 17.527  1.00 45.54  ? 365  MET B N     1 
ATOM   4245 C  CA    . MET B 1 188 ? 91.347  26.503 17.384  1.00 46.19  ? 365  MET B CA    1 
ATOM   4246 C  C     . MET B 1 188 ? 90.998  25.824 18.697  1.00 45.53  ? 365  MET B C     1 
ATOM   4247 O  O     . MET B 1 188 ? 90.339  24.799 18.695  1.00 45.42  ? 365  MET B O     1 
ATOM   4248 C  CB    . MET B 1 188 ? 92.377  25.687 16.624  1.00 46.82  ? 365  MET B CB    1 
ATOM   4249 C  CG    . MET B 1 188 ? 92.354  25.949 15.131  1.00 49.32  ? 365  MET B CG    1 
ATOM   4250 S  SD    . MET B 1 188 ? 90.951  25.194 14.326  1.00 53.67  ? 365  MET B SD    1 
ATOM   4251 C  CE    . MET B 1 188 ? 91.277  23.441 14.531  1.00 51.42  ? 365  MET B CE    1 
ATOM   4252 N  N     . ALA B 1 189 ? 91.346  26.432 19.823  1.00 44.91  ? 366  ALA B N     1 
ATOM   4253 C  CA    . ALA B 1 189 ? 90.880  25.908 21.107  1.00 44.58  ? 366  ALA B CA    1 
ATOM   4254 C  C     . ALA B 1 189 ? 89.344  25.898 21.178  1.00 44.89  ? 366  ALA B C     1 
ATOM   4255 O  O     . ALA B 1 189 ? 88.763  25.179 21.977  1.00 46.12  ? 366  ALA B O     1 
ATOM   4256 C  CB    . ALA B 1 189 ? 91.471  26.688 22.258  1.00 42.84  ? 366  ALA B CB    1 
ATOM   4257 N  N     . ARG B 1 190 ? 88.684  26.685 20.333  1.00 45.64  ? 367  ARG B N     1 
ATOM   4258 C  CA    . ARG B 1 190 ? 87.240  26.828 20.382  1.00 44.83  ? 367  ARG B CA    1 
ATOM   4259 C  C     . ARG B 1 190 ? 86.532  26.057 19.288  1.00 44.99  ? 367  ARG B C     1 
ATOM   4260 O  O     . ARG B 1 190 ? 85.307  26.136 19.146  1.00 44.73  ? 367  ARG B O     1 
ATOM   4261 C  CB    . ARG B 1 190 ? 86.913  28.295 20.276  1.00 45.77  ? 367  ARG B CB    1 
ATOM   4262 C  CG    . ARG B 1 190 ? 87.140  29.032 21.600  1.00 45.95  ? 367  ARG B CG    1 
ATOM   4263 C  CD    . ARG B 1 190 ? 86.775  30.473 21.515  1.00 43.35  ? 367  ARG B CD    1 
ATOM   4264 N  NE    . ARG B 1 190 ? 85.355  30.651 21.233  1.00 42.89  ? 367  ARG B NE    1 
ATOM   4265 C  CZ    . ARG B 1 190 ? 84.882  31.722 20.615  1.00 44.69  ? 367  ARG B CZ    1 
ATOM   4266 N  NH1   . ARG B 1 190 ? 85.712  32.687 20.210  1.00 47.04  ? 367  ARG B NH1   1 
ATOM   4267 N  NH2   . ARG B 1 190 ? 83.599  31.818 20.366  1.00 43.86  ? 367  ARG B NH2   1 
ATOM   4268 N  N     . HIS B 1 191 ? 87.293  25.256 18.557  1.00 44.62  ? 368  HIS B N     1 
ATOM   4269 C  CA    . HIS B 1 191 ? 86.767  24.599 17.387  1.00 44.44  ? 368  HIS B CA    1 
ATOM   4270 C  C     . HIS B 1 191 ? 85.516  23.782 17.696  1.00 45.18  ? 368  HIS B C     1 
ATOM   4271 O  O     . HIS B 1 191 ? 84.446  24.041 17.148  1.00 46.36  ? 368  HIS B O     1 
ATOM   4272 C  CB    . HIS B 1 191 ? 87.834  23.713 16.777  1.00 43.90  ? 368  HIS B CB    1 
ATOM   4273 C  CG    . HIS B 1 191 ? 87.391  23.052 15.525  1.00 43.08  ? 368  HIS B CG    1 
ATOM   4274 N  ND1   . HIS B 1 191 ? 87.213  23.748 14.348  1.00 42.20  ? 368  HIS B ND1   1 
ATOM   4275 C  CD2   . HIS B 1 191 ? 87.007  21.777 15.279  1.00 41.58  ? 368  HIS B CD2   1 
ATOM   4276 C  CE1   . HIS B 1 191 ? 86.747  22.923 13.424  1.00 44.89  ? 368  HIS B CE1   1 
ATOM   4277 N  NE2   . HIS B 1 191 ? 86.622  21.718 13.961  1.00 45.08  ? 368  HIS B NE2   1 
ATOM   4278 N  N     . ALA B 1 192 ? 85.654  22.804 18.581  1.00 45.34  ? 369  ALA B N     1 
ATOM   4279 C  CA    . ALA B 1 192 ? 84.580  21.865 18.890  1.00 45.15  ? 369  ALA B CA    1 
ATOM   4280 C  C     . ALA B 1 192 ? 83.334  22.609 19.377  1.00 46.08  ? 369  ALA B C     1 
ATOM   4281 O  O     . ALA B 1 192 ? 82.213  22.276 18.961  1.00 46.16  ? 369  ALA B O     1 
ATOM   4282 C  CB    . ALA B 1 192 ? 85.059  20.866 19.917  1.00 42.50  ? 369  ALA B CB    1 
ATOM   4283 N  N     . GLU B 1 193 ? 83.542  23.632 20.221  1.00 46.78  ? 370  GLU B N     1 
ATOM   4284 C  CA    . GLU B 1 193 ? 82.455  24.490 20.743  1.00 48.00  ? 370  GLU B CA    1 
ATOM   4285 C  C     . GLU B 1 193 ? 81.705  25.161 19.584  1.00 47.76  ? 370  GLU B C     1 
ATOM   4286 O  O     . GLU B 1 193 ? 80.470  25.084 19.490  1.00 48.01  ? 370  GLU B O     1 
ATOM   4287 C  CB    . GLU B 1 193 ? 83.008  25.579 21.696  1.00 48.54  ? 370  GLU B CB    1 
ATOM   4288 C  CG    . GLU B 1 193 ? 82.046  26.823 21.991  1.00 54.05  ? 370  GLU B CG    1 
ATOM   4289 C  CD    . GLU B 1 193 ? 82.748  28.275 22.078  1.00 59.71  ? 370  GLU B CD    1 
ATOM   4290 O  OE1   . GLU B 1 193 ? 83.915  28.385 22.544  1.00 61.46  ? 370  GLU B OE1   1 
ATOM   4291 O  OE2   . GLU B 1 193 ? 82.102  29.310 21.711  1.00 54.80  ? 370  GLU B OE2   1 
ATOM   4292 N  N     . ILE B 1 194 ? 82.456  25.819 18.701  1.00 46.66  ? 371  ILE B N     1 
ATOM   4293 C  CA    . ILE B 1 194 ? 81.855  26.589 17.626  1.00 45.92  ? 371  ILE B CA    1 
ATOM   4294 C  C     . ILE B 1 194 ? 81.134  25.645 16.678  1.00 45.76  ? 371  ILE B C     1 
ATOM   4295 O  O     . ILE B 1 194 ? 79.988  25.854 16.329  1.00 45.07  ? 371  ILE B O     1 
ATOM   4296 C  CB    . ILE B 1 194 ? 82.911  27.428 16.887  1.00 45.03  ? 371  ILE B CB    1 
ATOM   4297 C  CG1   . ILE B 1 194 ? 83.422  28.555 17.797  1.00 45.96  ? 371  ILE B CG1   1 
ATOM   4298 C  CG2   . ILE B 1 194 ? 82.327  28.016 15.679  1.00 43.53  ? 371  ILE B CG2   1 
ATOM   4299 C  CD1   . ILE B 1 194 ? 84.573  29.402 17.202  1.00 46.73  ? 371  ILE B CD1   1 
ATOM   4300 N  N     . MET B 1 195 ? 81.785  24.550 16.341  1.00 46.77  ? 372  MET B N     1 
ATOM   4301 C  CA    . MET B 1 195 ? 81.166  23.523 15.506  1.00 48.05  ? 372  MET B CA    1 
ATOM   4302 C  C     . MET B 1 195 ? 79.860  22.996 16.075  1.00 48.00  ? 372  MET B C     1 
ATOM   4303 O  O     . MET B 1 195 ? 78.875  22.849 15.337  1.00 47.81  ? 372  MET B O     1 
ATOM   4304 C  CB    . MET B 1 195 ? 82.134  22.368 15.266  1.00 48.06  ? 372  MET B CB    1 
ATOM   4305 C  CG    . MET B 1 195 ? 83.153  22.678 14.197  1.00 51.06  ? 372  MET B CG    1 
ATOM   4306 S  SD    . MET B 1 195 ? 82.394  22.870 12.551  1.00 59.19  ? 372  MET B SD    1 
ATOM   4307 C  CE    . MET B 1 195 ? 81.774  21.167 12.346  1.00 56.62  ? 372  MET B CE    1 
ATOM   4308 N  N     . ASP B 1 196 ? 79.834  22.755 17.382  1.00 48.47  ? 373  ASP B N     1 
ATOM   4309 C  CA    . ASP B 1 196 ? 78.601  22.277 18.024  1.00 49.58  ? 373  ASP B CA    1 
ATOM   4310 C  C     . ASP B 1 196 ? 77.490  23.305 17.934  1.00 49.73  ? 373  ASP B C     1 
ATOM   4311 O  O     . ASP B 1 196 ? 76.362  22.954 17.563  1.00 49.70  ? 373  ASP B O     1 
ATOM   4312 C  CB    . ASP B 1 196 ? 78.837  21.892 19.484  1.00 50.01  ? 373  ASP B CB    1 
ATOM   4313 C  CG    . ASP B 1 196 ? 79.452  20.513 19.639  1.00 52.68  ? 373  ASP B CG    1 
ATOM   4314 O  OD1   . ASP B 1 196 ? 79.683  19.789 18.637  1.00 56.71  ? 373  ASP B OD1   1 
ATOM   4315 O  OD2   . ASP B 1 196 ? 79.713  20.147 20.791  1.00 58.12  ? 373  ASP B OD2   1 
ATOM   4316 N  N     . SER B 1 197 ? 77.809  24.573 18.215  1.00 49.70  ? 374  SER B N     1 
ATOM   4317 C  CA    . SER B 1 197 ? 76.788  25.612 18.164  1.00 50.90  ? 374  SER B CA    1 
ATOM   4318 C  C     . SER B 1 197 ? 76.229  25.695 16.760  1.00 51.24  ? 374  SER B C     1 
ATOM   4319 O  O     . SER B 1 197 ? 75.007  25.828 16.568  1.00 51.81  ? 374  SER B O     1 
ATOM   4320 C  CB    . SER B 1 197 ? 77.328  26.984 18.554  1.00 50.97  ? 374  SER B CB    1 
ATOM   4321 O  OG    . SER B 1 197 ? 78.130  26.896 19.705  1.00 53.79  ? 374  SER B OG    1 
ATOM   4322 N  N     . PHE B 1 198 ? 77.120  25.622 15.780  1.00 50.41  ? 375  PHE B N     1 
ATOM   4323 C  CA    . PHE B 1 198 ? 76.674  25.712 14.414  1.00 50.84  ? 375  PHE B CA    1 
ATOM   4324 C  C     . PHE B 1 198 ? 75.748  24.530 14.098  1.00 51.78  ? 375  PHE B C     1 
ATOM   4325 O  O     . PHE B 1 198 ? 74.648  24.730 13.567  1.00 51.00  ? 375  PHE B O     1 
ATOM   4326 C  CB    . PHE B 1 198 ? 77.864  25.760 13.454  1.00 50.97  ? 375  PHE B CB    1 
ATOM   4327 C  CG    . PHE B 1 198 ? 77.477  25.965 12.018  1.00 48.35  ? 375  PHE B CG    1 
ATOM   4328 C  CD1   . PHE B 1 198 ? 76.621  26.980 11.658  1.00 47.36  ? 375  PHE B CD1   1 
ATOM   4329 C  CD2   . PHE B 1 198 ? 77.992  25.152 11.030  1.00 48.31  ? 375  PHE B CD2   1 
ATOM   4330 C  CE1   . PHE B 1 198 ? 76.263  27.166 10.341  1.00 47.10  ? 375  PHE B CE1   1 
ATOM   4331 C  CE2   . PHE B 1 198 ? 77.645  25.335 9.707   1.00 48.66  ? 375  PHE B CE2   1 
ATOM   4332 C  CZ    . PHE B 1 198 ? 76.774  26.343 9.362   1.00 46.66  ? 375  PHE B CZ    1 
ATOM   4333 N  N     . LYS B 1 199 ? 76.170  23.318 14.463  1.00 52.64  ? 376  LYS B N     1 
ATOM   4334 C  CA    . LYS B 1 199 ? 75.380  22.130 14.160  1.00 54.13  ? 376  LYS B CA    1 
ATOM   4335 C  C     . LYS B 1 199 ? 73.977  22.215 14.762  1.00 54.68  ? 376  LYS B C     1 
ATOM   4336 O  O     . LYS B 1 199 ? 73.007  21.746 14.171  1.00 54.17  ? 376  LYS B O     1 
ATOM   4337 C  CB    . LYS B 1 199 ? 76.089  20.859 14.640  1.00 54.76  ? 376  LYS B CB    1 
ATOM   4338 C  CG    . LYS B 1 199 ? 77.406  20.542 13.897  1.00 57.13  ? 376  LYS B CG    1 
ATOM   4339 C  CD    . LYS B 1 199 ? 77.692  19.027 13.824  1.00 60.70  ? 376  LYS B CD    1 
ATOM   4340 C  CE    . LYS B 1 199 ? 79.104  18.675 14.284  1.00 62.54  ? 376  LYS B CE    1 
ATOM   4341 N  NZ    . LYS B 1 199 ? 79.240  18.696 15.777  1.00 63.11  ? 376  LYS B NZ    1 
ATOM   4342 N  N     . GLU B 1 200 ? 73.874  22.847 15.922  1.00 55.79  ? 377  GLU B N     1 
ATOM   4343 C  CA    . GLU B 1 200 ? 72.581  23.085 16.576  1.00 57.10  ? 377  GLU B CA    1 
ATOM   4344 C  C     . GLU B 1 200 ? 71.691  23.956 15.689  1.00 56.36  ? 377  GLU B C     1 
ATOM   4345 O  O     . GLU B 1 200 ? 70.521  23.667 15.485  1.00 55.99  ? 377  GLU B O     1 
ATOM   4346 C  CB    . GLU B 1 200 ? 72.825  23.800 17.921  1.00 58.56  ? 377  GLU B CB    1 
ATOM   4347 C  CG    . GLU B 1 200 ? 71.928  23.403 19.106  1.00 62.15  ? 377  GLU B CG    1 
ATOM   4348 C  CD    . GLU B 1 200 ? 72.578  23.729 20.472  1.00 66.66  ? 377  GLU B CD    1 
ATOM   4349 O  OE1   . GLU B 1 200 ? 73.681  24.321 20.502  1.00 67.15  ? 377  GLU B OE1   1 
ATOM   4350 O  OE2   . GLU B 1 200 ? 71.986  23.380 21.520  1.00 70.11  ? 377  GLU B OE2   1 
ATOM   4351 N  N     . LYS B 1 201 ? 72.254  25.044 15.179  1.00 56.25  ? 378  LYS B N     1 
ATOM   4352 C  CA    . LYS B 1 201 ? 71.492  25.958 14.341  1.00 56.51  ? 378  LYS B CA    1 
ATOM   4353 C  C     . LYS B 1 201 ? 71.135  25.296 13.037  1.00 56.50  ? 378  LYS B C     1 
ATOM   4354 O  O     . LYS B 1 201 ? 70.084  25.579 12.477  1.00 56.69  ? 378  LYS B O     1 
ATOM   4355 C  CB    . LYS B 1 201 ? 72.270  27.243 14.039  1.00 56.70  ? 378  LYS B CB    1 
ATOM   4356 C  CG    . LYS B 1 201 ? 72.869  27.952 15.252  1.00 58.48  ? 378  LYS B CG    1 
ATOM   4357 C  CD    . LYS B 1 201 ? 71.887  28.057 16.421  1.00 60.51  ? 378  LYS B CD    1 
ATOM   4358 C  CE    . LYS B 1 201 ? 72.427  28.951 17.544  1.00 61.83  ? 378  LYS B CE    1 
ATOM   4359 N  NZ    . LYS B 1 201 ? 71.355  29.262 18.539  1.00 62.61  ? 378  LYS B NZ    1 
ATOM   4360 N  N     . MET B 1 202 ? 72.020  24.427 12.554  1.00 57.12  ? 379  MET B N     1 
ATOM   4361 C  CA    . MET B 1 202 ? 71.822  23.725 11.286  1.00 57.84  ? 379  MET B CA    1 
ATOM   4362 C  C     . MET B 1 202 ? 70.582  22.812 11.307  1.00 58.49  ? 379  MET B C     1 
ATOM   4363 O  O     . MET B 1 202 ? 69.939  22.603 10.269  1.00 58.24  ? 379  MET B O     1 
ATOM   4364 C  CB    . MET B 1 202 ? 73.072  22.907 10.930  1.00 58.08  ? 379  MET B CB    1 
ATOM   4365 C  CG    . MET B 1 202 ? 73.296  22.735 9.422   1.00 59.65  ? 379  MET B CG    1 
ATOM   4366 S  SD    . MET B 1 202 ? 73.348  24.324 8.568   1.00 57.87  ? 379  MET B SD    1 
ATOM   4367 C  CE    . MET B 1 202 ? 74.287  25.149 9.831   1.00 58.06  ? 379  MET B CE    1 
ATOM   4368 N  N     . GLU B 1 203 ? 70.214  22.319 12.491  1.00 58.80  ? 380  GLU B N     1 
ATOM   4369 C  CA    . GLU B 1 203 ? 68.997  21.525 12.631  1.00 59.53  ? 380  GLU B CA    1 
ATOM   4370 C  C     . GLU B 1 203 ? 67.773  22.229 12.025  1.00 58.33  ? 380  GLU B C     1 
ATOM   4371 O  O     . GLU B 1 203 ? 66.789  21.579 11.717  1.00 57.74  ? 380  GLU B O     1 
ATOM   4372 C  CB    . GLU B 1 203 ? 68.700  21.245 14.099  1.00 60.74  ? 380  GLU B CB    1 
ATOM   4373 C  CG    . GLU B 1 203 ? 69.465  20.100 14.727  1.00 63.93  ? 380  GLU B CG    1 
ATOM   4374 C  CD    . GLU B 1 203 ? 69.347  20.152 16.251  1.00 69.87  ? 380  GLU B CD    1 
ATOM   4375 O  OE1   . GLU B 1 203 ? 70.363  19.919 16.950  1.00 74.65  ? 380  GLU B OE1   1 
ATOM   4376 O  OE2   . GLU B 1 203 ? 68.249  20.505 16.748  1.00 71.15  ? 380  GLU B OE2   1 
ATOM   4377 N  N     . ASN B 1 204 ? 67.804  23.560 11.953  1.00 57.25  ? 381  ASN B N     1 
ATOM   4378 C  CA    . ASN B 1 204 ? 66.745  24.330 11.305  1.00 55.80  ? 381  ASN B CA    1 
ATOM   4379 C  C     . ASN B 1 204 ? 67.232  25.742 10.945  1.00 54.80  ? 381  ASN B C     1 
ATOM   4380 O  O     . ASN B 1 204 ? 66.712  26.761 11.432  1.00 54.44  ? 381  ASN B O     1 
ATOM   4381 C  CB    . ASN B 1 204 ? 65.501  24.397 12.186  1.00 56.03  ? 381  ASN B CB    1 
ATOM   4382 C  CG    . ASN B 1 204 ? 64.237  24.594 11.376  1.00 56.87  ? 381  ASN B CG    1 
ATOM   4383 O  OD1   . ASN B 1 204 ? 64.289  24.974 10.209  1.00 59.48  ? 381  ASN B OD1   1 
ATOM   4384 N  ND2   . ASN B 1 204 ? 63.099  24.299 11.974  1.00 56.06  ? 381  ASN B ND2   1 
ATOM   4385 N  N     . PHE B 1 205 ? 68.232  25.788 10.072  1.00 52.93  ? 382  PHE B N     1 
ATOM   4386 C  CA    . PHE B 1 205 ? 68.940  27.027 9.813   1.00 51.65  ? 382  PHE B CA    1 
ATOM   4387 C  C     . PHE B 1 205 ? 67.997  28.066 9.269   1.00 50.56  ? 382  PHE B C     1 
ATOM   4388 O  O     . PHE B 1 205 ? 67.104  27.721 8.535   1.00 51.02  ? 382  PHE B O     1 
ATOM   4389 C  CB    . PHE B 1 205 ? 70.077  26.824 8.811   1.00 51.16  ? 382  PHE B CB    1 
ATOM   4390 C  CG    . PHE B 1 205 ? 71.013  27.995 8.736   1.00 49.92  ? 382  PHE B CG    1 
ATOM   4391 C  CD1   . PHE B 1 205 ? 72.066  28.115 9.636   1.00 49.72  ? 382  PHE B CD1   1 
ATOM   4392 C  CD2   . PHE B 1 205 ? 70.797  29.008 7.831   1.00 47.15  ? 382  PHE B CD2   1 
ATOM   4393 C  CE1   . PHE B 1 205 ? 72.922  29.203 9.602   1.00 49.19  ? 382  PHE B CE1   1 
ATOM   4394 C  CE2   . PHE B 1 205 ? 71.635  30.089 7.789   1.00 48.56  ? 382  PHE B CE2   1 
ATOM   4395 C  CZ    . PHE B 1 205 ? 72.705  30.192 8.684   1.00 50.02  ? 382  PHE B CZ    1 
ATOM   4396 N  N     . ASP B 1 206 ? 68.264  29.333 9.552   1.00 49.91  ? 383  ASP B N     1 
ATOM   4397 C  CA    . ASP B 1 206 ? 67.362  30.431 9.244   1.00 49.84  ? 383  ASP B CA    1 
ATOM   4398 C  C     . ASP B 1 206 ? 68.212  31.648 8.908   1.00 50.04  ? 383  ASP B C     1 
ATOM   4399 O  O     . ASP B 1 206 ? 68.779  32.268 9.808   1.00 49.75  ? 383  ASP B O     1 
ATOM   4400 C  CB    . ASP B 1 206 ? 66.454  30.684 10.469  1.00 50.04  ? 383  ASP B CB    1 
ATOM   4401 C  CG    . ASP B 1 206 ? 65.561  31.942 10.343  1.00 50.83  ? 383  ASP B CG    1 
ATOM   4402 O  OD1   . ASP B 1 206 ? 64.731  32.136 11.263  1.00 50.78  ? 383  ASP B OD1   1 
ATOM   4403 O  OD2   . ASP B 1 206 ? 65.698  32.749 9.390   1.00 46.24  ? 383  ASP B OD2   1 
ATOM   4404 N  N     . TYR B 1 207 ? 68.299  31.989 7.621   1.00 50.46  ? 384  TYR B N     1 
ATOM   4405 C  CA    . TYR B 1 207 ? 69.173  33.087 7.150   1.00 51.11  ? 384  TYR B CA    1 
ATOM   4406 C  C     . TYR B 1 207 ? 68.774  34.483 7.658   1.00 51.46  ? 384  TYR B C     1 
ATOM   4407 O  O     . TYR B 1 207 ? 69.529  35.461 7.493   1.00 51.69  ? 384  TYR B O     1 
ATOM   4408 C  CB    . TYR B 1 207 ? 69.246  33.131 5.608   1.00 51.21  ? 384  TYR B CB    1 
ATOM   4409 C  CG    . TYR B 1 207 ? 70.141  32.075 4.983   1.00 51.14  ? 384  TYR B CG    1 
ATOM   4410 C  CD1   . TYR B 1 207 ? 69.625  30.828 4.619   1.00 50.72  ? 384  TYR B CD1   1 
ATOM   4411 C  CD2   . TYR B 1 207 ? 71.490  32.319 4.746   1.00 49.97  ? 384  TYR B CD2   1 
ATOM   4412 C  CE1   . TYR B 1 207 ? 70.422  29.853 4.034   1.00 49.96  ? 384  TYR B CE1   1 
ATOM   4413 C  CE2   . TYR B 1 207 ? 72.303  31.340 4.158   1.00 51.17  ? 384  TYR B CE2   1 
ATOM   4414 C  CZ    . TYR B 1 207 ? 71.756  30.110 3.802   1.00 51.69  ? 384  TYR B CZ    1 
ATOM   4415 O  OH    . TYR B 1 207 ? 72.528  29.120 3.225   1.00 55.05  ? 384  TYR B OH    1 
ATOM   4416 N  N     . SER B 1 208 ? 67.582  34.597 8.228   1.00 51.93  ? 385  SER B N     1 
ATOM   4417 C  CA    . SER B 1 208 ? 67.133  35.876 8.769   1.00 52.94  ? 385  SER B CA    1 
ATOM   4418 C  C     . SER B 1 208 ? 67.426  36.015 10.264  1.00 52.99  ? 385  SER B C     1 
ATOM   4419 O  O     . SER B 1 208 ? 67.108  37.043 10.861  1.00 53.92  ? 385  SER B O     1 
ATOM   4420 C  CB    . SER B 1 208 ? 65.630  36.019 8.549   1.00 53.38  ? 385  SER B CB    1 
ATOM   4421 O  OG    . SER B 1 208 ? 64.943  34.997 9.270   1.00 55.88  ? 385  SER B OG    1 
ATOM   4422 N  N     . ASN B 1 209 ? 67.990  34.979 10.878  1.00 52.74  ? 386  ASN B N     1 
ATOM   4423 C  CA    . ASN B 1 209 ? 68.278  35.001 12.300  1.00 52.35  ? 386  ASN B CA    1 
ATOM   4424 C  C     . ASN B 1 209 ? 69.766  35.341 12.536  1.00 52.90  ? 386  ASN B C     1 
ATOM   4425 O  O     . ASN B 1 209 ? 70.665  34.561 12.193  1.00 52.98  ? 386  ASN B O     1 
ATOM   4426 C  CB    . ASN B 1 209 ? 67.849  33.666 12.906  1.00 52.28  ? 386  ASN B CB    1 
ATOM   4427 C  CG    . ASN B 1 209 ? 68.218  33.540 14.350  1.00 51.80  ? 386  ASN B CG    1 
ATOM   4428 O  OD1   . ASN B 1 209 ? 69.090  34.265 14.838  1.00 51.60  ? 386  ASN B OD1   1 
ATOM   4429 N  ND2   . ASN B 1 209 ? 67.603  32.577 15.037  1.00 45.37  ? 386  ASN B ND2   1 
ATOM   4430 N  N     . GLU B 1 210 ? 69.999  36.541 13.077  1.00 53.60  ? 387  GLU B N     1 
ATOM   4431 C  CA    . GLU B 1 210 ? 71.343  37.105 13.314  1.00 54.57  ? 387  GLU B CA    1 
ATOM   4432 C  C     . GLU B 1 210 ? 72.294  36.141 14.008  1.00 53.46  ? 387  GLU B C     1 
ATOM   4433 O  O     . GLU B 1 210 ? 73.461  36.123 13.692  1.00 52.96  ? 387  GLU B O     1 
ATOM   4434 C  CB    . GLU B 1 210 ? 71.249  38.387 14.162  1.00 55.57  ? 387  GLU B CB    1 
ATOM   4435 C  CG    . GLU B 1 210 ? 71.522  39.717 13.414  1.00 60.48  ? 387  GLU B CG    1 
ATOM   4436 C  CD    . GLU B 1 210 ? 71.263  40.987 14.300  1.00 68.44  ? 387  GLU B CD    1 
ATOM   4437 O  OE1   . GLU B 1 210 ? 71.218  40.885 15.559  1.00 70.97  ? 387  GLU B OE1   1 
ATOM   4438 O  OE2   . GLU B 1 210 ? 71.088  42.094 13.727  1.00 71.74  ? 387  GLU B OE2   1 
ATOM   4439 N  N     . GLU B 1 211 ? 71.798  35.372 14.971  1.00 52.97  ? 388  GLU B N     1 
ATOM   4440 C  CA    . GLU B 1 211 ? 72.635  34.381 15.661  1.00 53.59  ? 388  GLU B CA    1 
ATOM   4441 C  C     . GLU B 1 211 ? 73.042  33.243 14.741  1.00 52.04  ? 388  GLU B C     1 
ATOM   4442 O  O     . GLU B 1 211 ? 74.158  32.752 14.821  1.00 51.64  ? 388  GLU B O     1 
ATOM   4443 C  CB    . GLU B 1 211 ? 71.933  33.779 16.883  1.00 54.07  ? 388  GLU B CB    1 
ATOM   4444 C  CG    . GLU B 1 211 ? 71.781  34.752 18.053  1.00 58.75  ? 388  GLU B CG    1 
ATOM   4445 C  CD    . GLU B 1 211 ? 70.989  34.165 19.235  1.00 63.54  ? 388  GLU B CD    1 
ATOM   4446 O  OE1   . GLU B 1 211 ? 70.535  32.989 19.154  1.00 66.33  ? 388  GLU B OE1   1 
ATOM   4447 O  OE2   . GLU B 1 211 ? 70.844  34.888 20.251  1.00 63.59  ? 388  GLU B OE2   1 
ATOM   4448 N  N     . HIS B 1 212 ? 72.115  32.803 13.899  1.00 50.58  ? 389  HIS B N     1 
ATOM   4449 C  CA    . HIS B 1 212 ? 72.434  31.819 12.894  1.00 49.54  ? 389  HIS B CA    1 
ATOM   4450 C  C     . HIS B 1 212 ? 73.531  32.374 11.978  1.00 48.41  ? 389  HIS B C     1 
ATOM   4451 O  O     . HIS B 1 212 ? 74.488  31.697 11.683  1.00 47.81  ? 389  HIS B O     1 
ATOM   4452 C  CB    . HIS B 1 212 ? 71.176  31.451 12.110  1.00 49.41  ? 389  HIS B CB    1 
ATOM   4453 C  CG    . HIS B 1 212 ? 70.216  30.585 12.874  1.00 51.33  ? 389  HIS B CG    1 
ATOM   4454 N  ND1   . HIS B 1 212 ? 69.881  30.816 14.192  1.00 52.95  ? 389  HIS B ND1   1 
ATOM   4455 C  CD2   . HIS B 1 212 ? 69.516  29.483 12.502  1.00 51.83  ? 389  HIS B CD2   1 
ATOM   4456 C  CE1   . HIS B 1 212 ? 69.046  29.875 14.604  1.00 50.43  ? 389  HIS B CE1   1 
ATOM   4457 N  NE2   . HIS B 1 212 ? 68.799  29.061 13.595  1.00 48.88  ? 389  HIS B NE2   1 
ATOM   4458 N  N     . MET B 1 213 ? 73.430  33.635 11.595  1.00 47.37  ? 390  MET B N     1 
ATOM   4459 C  CA    . MET B 1 213 ? 74.371  34.190 10.630  1.00 47.06  ? 390  MET B CA    1 
ATOM   4460 C  C     . MET B 1 213 ? 75.758  34.454 11.207  1.00 46.04  ? 390  MET B C     1 
ATOM   4461 O  O     . MET B 1 213 ? 76.769  34.266 10.513  1.00 45.20  ? 390  MET B O     1 
ATOM   4462 C  CB    . MET B 1 213 ? 73.818  35.461 9.995   1.00 47.13  ? 390  MET B CB    1 
ATOM   4463 C  CG    . MET B 1 213 ? 72.530  35.242 9.191   1.00 48.83  ? 390  MET B CG    1 
ATOM   4464 S  SD    . MET B 1 213 ? 72.691  34.410 7.586   1.00 51.84  ? 390  MET B SD    1 
ATOM   4465 C  CE    . MET B 1 213 ? 73.488  35.688 6.624   1.00 51.53  ? 390  MET B CE    1 
ATOM   4466 N  N     . THR B 1 214 ? 75.809  34.848 12.477  1.00 44.95  ? 391  THR B N     1 
ATOM   4467 C  CA    . THR B 1 214 ? 77.081  35.036 13.155  1.00 43.92  ? 391  THR B CA    1 
ATOM   4468 C  C     . THR B 1 214 ? 77.821  33.715 13.125  1.00 44.35  ? 391  THR B C     1 
ATOM   4469 O  O     . THR B 1 214 ? 79.016  33.649 12.783  1.00 43.71  ? 391  THR B O     1 
ATOM   4470 C  CB    . THR B 1 214 ? 76.887  35.541 14.613  1.00 43.56  ? 391  THR B CB    1 
ATOM   4471 O  OG1   . THR B 1 214 ? 76.200  36.791 14.553  1.00 45.48  ? 391  THR B OG1   1 
ATOM   4472 C  CG2   . THR B 1 214 ? 78.246  35.774 15.368  1.00 38.16  ? 391  THR B CG2   1 
ATOM   4473 N  N     . LEU B 1 215 ? 77.101  32.656 13.467  1.00 44.11  ? 392  LEU B N     1 
ATOM   4474 C  CA    . LEU B 1 215 ? 77.711  31.342 13.487  1.00 44.37  ? 392  LEU B CA    1 
ATOM   4475 C  C     . LEU B 1 215 ? 78.172  30.908 12.114  1.00 43.45  ? 392  LEU B C     1 
ATOM   4476 O  O     . LEU B 1 215 ? 79.288  30.434 11.960  1.00 42.98  ? 392  LEU B O     1 
ATOM   4477 C  CB    . LEU B 1 215 ? 76.770  30.318 14.121  1.00 44.93  ? 392  LEU B CB    1 
ATOM   4478 C  CG    . LEU B 1 215 ? 76.890  30.397 15.662  1.00 44.99  ? 392  LEU B CG    1 
ATOM   4479 C  CD1   . LEU B 1 215 ? 75.711  29.735 16.338  1.00 45.48  ? 392  LEU B CD1   1 
ATOM   4480 C  CD2   . LEU B 1 215 ? 78.235  29.807 16.144  1.00 41.41  ? 392  LEU B CD2   1 
ATOM   4481 N  N     . LEU B 1 216 ? 77.360  31.155 11.101  1.00 43.47  ? 393  LEU B N     1 
ATOM   4482 C  CA    . LEU B 1 216 ? 77.779  30.856 9.733   1.00 43.26  ? 393  LEU B CA    1 
ATOM   4483 C  C     . LEU B 1 216 ? 79.063  31.627 9.375   1.00 42.78  ? 393  LEU B C     1 
ATOM   4484 O  O     . LEU B 1 216 ? 80.020  31.052 8.844   1.00 42.11  ? 393  LEU B O     1 
ATOM   4485 C  CB    . LEU B 1 216 ? 76.667  31.165 8.717   1.00 42.74  ? 393  LEU B CB    1 
ATOM   4486 C  CG    . LEU B 1 216 ? 76.989  30.775 7.263   1.00 42.46  ? 393  LEU B CG    1 
ATOM   4487 C  CD1   . LEU B 1 216 ? 77.380  29.283 7.161   1.00 42.43  ? 393  LEU B CD1   1 
ATOM   4488 C  CD2   . LEU B 1 216 ? 75.798  31.052 6.338   1.00 42.44  ? 393  LEU B CD2   1 
ATOM   4489 N  N     . LYS B 1 217 ? 79.072  32.925 9.661   1.00 41.90  ? 394  LYS B N     1 
ATOM   4490 C  CA    . LYS B 1 217 ? 80.235  33.732 9.354   1.00 41.87  ? 394  LYS B CA    1 
ATOM   4491 C  C     . LYS B 1 217 ? 81.442  33.192 10.102  1.00 41.64  ? 394  LYS B C     1 
ATOM   4492 O  O     . LYS B 1 217 ? 82.543  33.123 9.560   1.00 41.57  ? 394  LYS B O     1 
ATOM   4493 C  CB    . LYS B 1 217 ? 79.972  35.192 9.718   1.00 41.44  ? 394  LYS B CB    1 
ATOM   4494 C  CG    . LYS B 1 217 ? 79.019  35.865 8.744   1.00 43.59  ? 394  LYS B CG    1 
ATOM   4495 C  CD    . LYS B 1 217 ? 78.733  37.314 9.095   1.00 44.77  ? 394  LYS B CD    1 
ATOM   4496 C  CE    . LYS B 1 217 ? 77.553  37.460 9.995   1.00 43.18  ? 394  LYS B CE    1 
ATOM   4497 N  NZ    . LYS B 1 217 ? 77.683  38.727 10.691  1.00 44.36  ? 394  LYS B NZ    1 
ATOM   4498 N  N     . MET B 1 218 ? 81.235  32.801 11.352  1.00 41.94  ? 395  MET B N     1 
ATOM   4499 C  CA    . MET B 1 218 ? 82.304  32.189 12.126  1.00 42.60  ? 395  MET B CA    1 
ATOM   4500 C  C     . MET B 1 218 ? 82.826  30.934 11.426  1.00 42.41  ? 395  MET B C     1 
ATOM   4501 O  O     . MET B 1 218 ? 84.044  30.754 11.251  1.00 42.08  ? 395  MET B O     1 
ATOM   4502 C  CB    . MET B 1 218 ? 81.839  31.873 13.546  1.00 42.56  ? 395  MET B CB    1 
ATOM   4503 C  CG    . MET B 1 218 ? 81.674  33.096 14.381  1.00 43.07  ? 395  MET B CG    1 
ATOM   4504 S  SD    . MET B 1 218 ? 80.624  32.862 15.817  1.00 44.03  ? 395  MET B SD    1 
ATOM   4505 C  CE    . MET B 1 218 ? 81.751  31.884 16.831  1.00 38.35  ? 395  MET B CE    1 
ATOM   4506 N  N     . ILE B 1 219 ? 81.911  30.089 10.985  1.00 41.75  ? 396  ILE B N     1 
ATOM   4507 C  CA    . ILE B 1 219 ? 82.350  28.915 10.269  1.00 42.48  ? 396  ILE B CA    1 
ATOM   4508 C  C     . ILE B 1 219 ? 83.113  29.294 8.993   1.00 42.20  ? 396  ILE B C     1 
ATOM   4509 O  O     . ILE B 1 219 ? 84.161  28.745 8.697   1.00 41.96  ? 396  ILE B O     1 
ATOM   4510 C  CB    . ILE B 1 219 ? 81.183  27.990 9.961   1.00 42.51  ? 396  ILE B CB    1 
ATOM   4511 C  CG1   . ILE B 1 219 ? 80.705  27.363 11.274  1.00 44.46  ? 396  ILE B CG1   1 
ATOM   4512 C  CG2   . ILE B 1 219 ? 81.600  26.945 8.970   1.00 40.33  ? 396  ILE B CG2   1 
ATOM   4513 C  CD1   . ILE B 1 219 ? 81.683  26.332 11.879  1.00 44.87  ? 396  ILE B CD1   1 
ATOM   4514 N  N     . LEU B 1 220 ? 82.609  30.263 8.256   1.00 42.63  ? 397  LEU B N     1 
ATOM   4515 C  CA    . LEU B 1 220 ? 83.259  30.632 7.009   1.00 43.22  ? 397  LEU B CA    1 
ATOM   4516 C  C     . LEU B 1 220 ? 84.687  31.090 7.241   1.00 43.12  ? 397  LEU B C     1 
ATOM   4517 O  O     . LEU B 1 220 ? 85.600  30.659 6.520   1.00 42.96  ? 397  LEU B O     1 
ATOM   4518 C  CB    . LEU B 1 220 ? 82.470  31.710 6.276   1.00 43.46  ? 397  LEU B CB    1 
ATOM   4519 C  CG    . LEU B 1 220 ? 81.182  31.152 5.662   1.00 44.11  ? 397  LEU B CG    1 
ATOM   4520 C  CD1   . LEU B 1 220 ? 80.319  32.327 5.114   1.00 42.83  ? 397  LEU B CD1   1 
ATOM   4521 C  CD2   . LEU B 1 220 ? 81.524  30.102 4.590   1.00 38.63  ? 397  LEU B CD2   1 
ATOM   4522 N  N     . ILE B 1 221 ? 84.911  31.926 8.258   1.00 42.56  ? 398  ILE B N     1 
ATOM   4523 C  CA    . ILE B 1 221 ? 86.272  32.356 8.495   1.00 41.93  ? 398  ILE B CA    1 
ATOM   4524 C  C     . ILE B 1 221 ? 87.133  31.174 8.953   1.00 41.72  ? 398  ILE B C     1 
ATOM   4525 O  O     . ILE B 1 221 ? 88.291  31.051 8.582   1.00 40.37  ? 398  ILE B O     1 
ATOM   4526 C  CB    . ILE B 1 221 ? 86.388  33.593 9.408   1.00 41.29  ? 398  ILE B CB    1 
ATOM   4527 C  CG1   . ILE B 1 221 ? 87.789  34.203 9.218   1.00 42.02  ? 398  ILE B CG1   1 
ATOM   4528 C  CG2   . ILE B 1 221 ? 86.122  33.256 10.843  1.00 39.43  ? 398  ILE B CG2   1 
ATOM   4529 C  CD1   . ILE B 1 221 ? 87.996  35.641 9.736   1.00 40.41  ? 398  ILE B CD1   1 
ATOM   4530 N  N     . LYS B 1 222 ? 86.548  30.273 9.722   1.00 42.27  ? 399  LYS B N     1 
ATOM   4531 C  CA    . LYS B 1 222 ? 87.317  29.134 10.199  1.00 42.89  ? 399  LYS B CA    1 
ATOM   4532 C  C     . LYS B 1 222 ? 87.695  28.247 9.024   1.00 43.40  ? 399  LYS B C     1 
ATOM   4533 O  O     . LYS B 1 222 ? 88.856  27.869 8.890   1.00 44.26  ? 399  LYS B O     1 
ATOM   4534 C  CB    . LYS B 1 222 ? 86.548  28.364 11.267  1.00 43.34  ? 399  LYS B CB    1 
ATOM   4535 C  CG    . LYS B 1 222 ? 86.619  29.022 12.636  1.00 41.79  ? 399  LYS B CG    1 
ATOM   4536 C  CD    . LYS B 1 222 ? 85.887  28.237 13.720  1.00 42.56  ? 399  LYS B CD    1 
ATOM   4537 C  CE    . LYS B 1 222 ? 86.062  26.702 13.623  1.00 39.91  ? 399  LYS B CE    1 
ATOM   4538 N  NZ    . LYS B 1 222 ? 87.456  26.251 13.759  1.00 37.89  ? 399  LYS B NZ    1 
ATOM   4539 N  N     . CYS B 1 223 ? 86.746  28.017 8.120   1.00 43.97  ? 400  CYS B N     1 
ATOM   4540 C  CA    . CYS B 1 223 ? 87.045  27.352 6.846   1.00 45.43  ? 400  CYS B CA    1 
ATOM   4541 C  C     . CYS B 1 223 ? 88.196  27.951 6.106   1.00 44.71  ? 400  CYS B C     1 
ATOM   4542 O  O     . CYS B 1 223 ? 89.102  27.243 5.731   1.00 45.79  ? 400  CYS B O     1 
ATOM   4543 C  CB    . CYS B 1 223 ? 85.863  27.395 5.912   1.00 45.21  ? 400  CYS B CB    1 
ATOM   4544 S  SG    . CYS B 1 223 ? 84.638  26.279 6.462   1.00 53.01  ? 400  CYS B SG    1 
ATOM   4545 N  N     . CYS B 1 224 ? 88.137  29.245 5.845   1.00 44.63  ? 401  CYS B N     1 
ATOM   4546 C  CA    . CYS B 1 224 ? 89.161  29.876 5.023   1.00 44.78  ? 401  CYS B CA    1 
ATOM   4547 C  C     . CYS B 1 224 ? 90.513  29.825 5.690   1.00 45.30  ? 401  CYS B C     1 
ATOM   4548 O  O     . CYS B 1 224 ? 91.509  29.567 5.034   1.00 45.27  ? 401  CYS B O     1 
ATOM   4549 C  CB    . CYS B 1 224 ? 88.815  31.317 4.744   1.00 44.97  ? 401  CYS B CB    1 
ATOM   4550 S  SG    . CYS B 1 224 ? 87.307  31.521 3.775   1.00 43.45  ? 401  CYS B SG    1 
ATOM   4551 N  N     . ASP B 1 225 ? 90.533  30.014 7.006   1.00 45.63  ? 402  ASP B N     1 
ATOM   4552 C  CA    . ASP B 1 225 ? 91.766  29.960 7.766   1.00 45.70  ? 402  ASP B CA    1 
ATOM   4553 C  C     . ASP B 1 225 ? 92.529  28.648 7.566   1.00 46.10  ? 402  ASP B C     1 
ATOM   4554 O  O     . ASP B 1 225 ? 93.740  28.671 7.353   1.00 45.57  ? 402  ASP B O     1 
ATOM   4555 C  CB    . ASP B 1 225 ? 91.490  30.170 9.251   1.00 45.26  ? 402  ASP B CB    1 
ATOM   4556 C  CG    . ASP B 1 225 ? 92.756  30.478 10.054  1.00 45.63  ? 402  ASP B CG    1 
ATOM   4557 O  OD1   . ASP B 1 225 ? 93.839  30.756 9.476   1.00 46.39  ? 402  ASP B OD1   1 
ATOM   4558 O  OD2   . ASP B 1 225 ? 92.672  30.464 11.295  1.00 51.25  ? 402  ASP B OD2   1 
ATOM   4559 N  N     . ILE B 1 226 ? 91.832  27.518 7.679   1.00 46.05  ? 403  ILE B N     1 
ATOM   4560 C  CA    . ILE B 1 226 ? 92.504  26.234 7.650   1.00 46.54  ? 403  ILE B CA    1 
ATOM   4561 C  C     . ILE B 1 226 ? 92.335  25.550 6.280   1.00 46.64  ? 403  ILE B C     1 
ATOM   4562 O  O     . ILE B 1 226 ? 92.427  24.312 6.148   1.00 47.02  ? 403  ILE B O     1 
ATOM   4563 C  CB    . ILE B 1 226 ? 92.071  25.310 8.837   1.00 47.70  ? 403  ILE B CB    1 
ATOM   4564 C  CG1   . ILE B 1 226 ? 90.570  25.006 8.823   1.00 48.72  ? 403  ILE B CG1   1 
ATOM   4565 C  CG2   . ILE B 1 226 ? 92.421  25.923 10.189  1.00 45.04  ? 403  ILE B CG2   1 
ATOM   4566 C  CD1   . ILE B 1 226 ? 90.177  24.015 9.920   1.00 49.58  ? 403  ILE B CD1   1 
ATOM   4567 N  N     . SER B 1 227 ? 92.190  26.377 5.246   1.00 45.65  ? 404  SER B N     1 
ATOM   4568 C  CA    . SER B 1 227 ? 91.732  25.905 3.943   1.00 45.01  ? 404  SER B CA    1 
ATOM   4569 C  C     . SER B 1 227 ? 92.851  25.389 3.065   1.00 44.05  ? 404  SER B C     1 
ATOM   4570 O  O     . SER B 1 227 ? 92.619  25.045 1.918   1.00 43.76  ? 404  SER B O     1 
ATOM   4571 C  CB    . SER B 1 227 ? 90.962  27.021 3.194   1.00 44.84  ? 404  SER B CB    1 
ATOM   4572 O  OG    . SER B 1 227 ? 91.816  28.050 2.697   1.00 42.44  ? 404  SER B OG    1 
ATOM   4573 N  N     . ASN B 1 228 ? 94.069  25.338 3.579   1.00 44.31  ? 405  ASN B N     1 
ATOM   4574 C  CA    . ASN B 1 228 ? 95.211  25.056 2.701   1.00 44.40  ? 405  ASN B CA    1 
ATOM   4575 C  C     . ASN B 1 228 ? 94.999  23.782 1.917   1.00 43.92  ? 405  ASN B C     1 
ATOM   4576 O  O     . ASN B 1 228 ? 95.100  23.800 0.700   1.00 43.92  ? 405  ASN B O     1 
ATOM   4577 C  CB    . ASN B 1 228 ? 96.558  25.049 3.464   1.00 44.62  ? 405  ASN B CB    1 
ATOM   4578 C  CG    . ASN B 1 228 ? 97.089  26.487 3.761   1.00 45.75  ? 405  ASN B CG    1 
ATOM   4579 O  OD1   . ASN B 1 228 ? 96.650  27.486 3.160   1.00 42.01  ? 405  ASN B OD1   1 
ATOM   4580 N  ND2   . ASN B 1 228 ? 98.034  26.577 4.685   1.00 47.47  ? 405  ASN B ND2   1 
ATOM   4581 N  N     . GLU B 1 229 ? 94.572  22.710 2.573   1.00 44.03  ? 406  GLU B N     1 
ATOM   4582 C  CA    . GLU B 1 229 ? 94.384  21.432 1.864   1.00 44.67  ? 406  GLU B CA    1 
ATOM   4583 C  C     . GLU B 1 229 ? 93.245  21.375 0.856   1.00 44.43  ? 406  GLU B C     1 
ATOM   4584 O  O     . GLU B 1 229 ? 93.109  20.399 0.146   1.00 44.71  ? 406  GLU B O     1 
ATOM   4585 C  CB    . GLU B 1 229 ? 94.228  20.283 2.853   1.00 44.56  ? 406  GLU B CB    1 
ATOM   4586 C  CG    . GLU B 1 229 ? 95.499  19.938 3.570   1.00 45.28  ? 406  GLU B CG    1 
ATOM   4587 C  CD    . GLU B 1 229 ? 96.587  19.384 2.671   1.00 46.48  ? 406  GLU B CD    1 
ATOM   4588 O  OE1   . GLU B 1 229 ? 97.755  19.434 3.095   1.00 48.68  ? 406  GLU B OE1   1 
ATOM   4589 O  OE2   . GLU B 1 229 ? 96.292  18.847 1.586   1.00 48.44  ? 406  GLU B OE2   1 
ATOM   4590 N  N     . VAL B 1 230 ? 92.423  22.408 0.809   1.00 45.27  ? 407  VAL B N     1 
ATOM   4591 C  CA    . VAL B 1 230 ? 91.367  22.523 -0.194  1.00 46.26  ? 407  VAL B CA    1 
ATOM   4592 C  C     . VAL B 1 230 ? 91.931  22.864 -1.574  1.00 45.92  ? 407  VAL B C     1 
ATOM   4593 O  O     . VAL B 1 230 ? 91.329  22.581 -2.609  1.00 46.17  ? 407  VAL B O     1 
ATOM   4594 C  CB    . VAL B 1 230 ? 90.354  23.595 0.239   1.00 46.67  ? 407  VAL B CB    1 
ATOM   4595 C  CG1   . VAL B 1 230 ? 90.009  24.531 -0.906  1.00 46.93  ? 407  VAL B CG1   1 
ATOM   4596 C  CG2   . VAL B 1 230 ? 89.122  22.919 0.822   1.00 49.33  ? 407  VAL B CG2   1 
ATOM   4597 N  N     . ARG B 1 231 ? 93.131  23.420 -1.567  1.00 46.13  ? 408  ARG B N     1 
ATOM   4598 C  CA    . ARG B 1 231 ? 93.783  23.887 -2.765  1.00 46.38  ? 408  ARG B CA    1 
ATOM   4599 C  C     . ARG B 1 231 ? 94.408  22.734 -3.523  1.00 46.76  ? 408  ARG B C     1 
ATOM   4600 O  O     . ARG B 1 231 ? 94.681  21.682 -2.945  1.00 47.00  ? 408  ARG B O     1 
ATOM   4601 C  CB    . ARG B 1 231 ? 94.856  24.920 -2.385  1.00 46.66  ? 408  ARG B CB    1 
ATOM   4602 C  CG    . ARG B 1 231 ? 94.261  26.208 -1.781  1.00 46.11  ? 408  ARG B CG    1 
ATOM   4603 C  CD    . ARG B 1 231 ? 95.317  27.258 -1.429  1.00 46.59  ? 408  ARG B CD    1 
ATOM   4604 N  NE    . ARG B 1 231 ? 94.703  28.418 -0.776  1.00 48.08  ? 408  ARG B NE    1 
ATOM   4605 C  CZ    . ARG B 1 231 ? 94.083  29.406 -1.417  1.00 47.98  ? 408  ARG B CZ    1 
ATOM   4606 N  NH1   . ARG B 1 231 ? 94.075  29.448 -2.745  1.00 49.89  ? 408  ARG B NH1   1 
ATOM   4607 N  NH2   . ARG B 1 231 ? 93.487  30.366 -0.727  1.00 47.31  ? 408  ARG B NH2   1 
ATOM   4608 N  N     . PRO B 1 232 ? 94.649  22.934 -4.821  1.00 46.86  ? 409  PRO B N     1 
ATOM   4609 C  CA    . PRO B 1 232 ? 95.409  21.985 -5.604  1.00 47.26  ? 409  PRO B CA    1 
ATOM   4610 C  C     . PRO B 1 232 ? 96.699  21.524 -4.913  1.00 47.78  ? 409  PRO B C     1 
ATOM   4611 O  O     . PRO B 1 232 ? 97.381  22.304 -4.256  1.00 47.83  ? 409  PRO B O     1 
ATOM   4612 C  CB    . PRO B 1 232 ? 95.712  22.760 -6.881  1.00 46.86  ? 409  PRO B CB    1 
ATOM   4613 C  CG    . PRO B 1 232 ? 94.559  23.687 -7.021  1.00 47.64  ? 409  PRO B CG    1 
ATOM   4614 C  CD    . PRO B 1 232 ? 94.205  24.086 -5.621  1.00 47.15  ? 409  PRO B CD    1 
ATOM   4615 N  N     . MET B 1 233 ? 97.033  20.255 -5.096  1.00 48.98  ? 410  MET B N     1 
ATOM   4616 C  CA    . MET B 1 233 ? 98.067  19.619 -4.306  1.00 50.44  ? 410  MET B CA    1 
ATOM   4617 C  C     . MET B 1 233 ? 99.384  20.357 -4.349  1.00 49.65  ? 410  MET B C     1 
ATOM   4618 O  O     . MET B 1 233 ? 100.047 20.517 -3.328  1.00 49.29  ? 410  MET B O     1 
ATOM   4619 C  CB    . MET B 1 233 ? 98.278  18.185 -4.770  1.00 51.59  ? 410  MET B CB    1 
ATOM   4620 C  CG    . MET B 1 233 ? 99.261  17.405 -3.886  1.00 57.80  ? 410  MET B CG    1 
ATOM   4621 S  SD    . MET B 1 233 ? 100.992 17.438 -4.469  1.00 67.90  ? 410  MET B SD    1 
ATOM   4622 C  CE    . MET B 1 233 ? 100.912 16.381 -5.936  1.00 62.28  ? 410  MET B CE    1 
ATOM   4623 N  N     . GLU B 1 234 ? 99.767  20.797 -5.531  1.00 50.05  ? 411  GLU B N     1 
ATOM   4624 C  CA    . GLU B 1 234 ? 101.050 21.431 -5.706  1.00 51.52  ? 411  GLU B CA    1 
ATOM   4625 C  C     . GLU B 1 234 ? 101.090 22.776 -4.989  1.00 50.99  ? 411  GLU B C     1 
ATOM   4626 O  O     . GLU B 1 234 ? 102.180 23.211 -4.605  1.00 51.06  ? 411  GLU B O     1 
ATOM   4627 C  CB    . GLU B 1 234 ? 101.354 21.620 -7.184  1.00 53.04  ? 411  GLU B CB    1 
ATOM   4628 C  CG    . GLU B 1 234 ? 101.403 20.310 -8.008  1.00 58.98  ? 411  GLU B CG    1 
ATOM   4629 C  CD    . GLU B 1 234 ? 99.990  19.765 -8.445  1.00 66.85  ? 411  GLU B CD    1 
ATOM   4630 O  OE1   . GLU B 1 234 ? 98.928  20.460 -8.249  1.00 62.08  ? 411  GLU B OE1   1 
ATOM   4631 O  OE2   . GLU B 1 234 ? 99.977  18.621 -9.004  1.00 70.78  ? 411  GLU B OE2   1 
ATOM   4632 N  N     . VAL B 1 235 ? 99.924  23.427 -4.826  1.00 49.79  ? 412  VAL B N     1 
ATOM   4633 C  CA    . VAL B 1 235 ? 99.808  24.664 -4.047  1.00 49.39  ? 412  VAL B CA    1 
ATOM   4634 C  C     . VAL B 1 235 ? 99.684  24.354 -2.548  1.00 50.26  ? 412  VAL B C     1 
ATOM   4635 O  O     . VAL B 1 235 ? 100.226 25.088 -1.723  1.00 50.21  ? 412  VAL B O     1 
ATOM   4636 C  CB    . VAL B 1 235 ? 98.571  25.548 -4.458  1.00 49.84  ? 412  VAL B CB    1 
ATOM   4637 C  CG1   . VAL B 1 235 ? 98.514  26.831 -3.623  1.00 46.89  ? 412  VAL B CG1   1 
ATOM   4638 C  CG2   . VAL B 1 235 ? 98.578  25.899 -5.940  1.00 46.71  ? 412  VAL B CG2   1 
ATOM   4639 N  N     . ALA B 1 236 ? 98.959  23.283 -2.196  1.00 50.69  ? 413  ALA B N     1 
ATOM   4640 C  CA    . ALA B 1 236 ? 98.749  22.890 -0.784  1.00 50.56  ? 413  ALA B CA    1 
ATOM   4641 C  C     . ALA B 1 236 ? 100.028 22.400 -0.095  1.00 50.97  ? 413  ALA B C     1 
ATOM   4642 O  O     . ALA B 1 236 ? 100.350 22.799 1.021   1.00 50.69  ? 413  ALA B O     1 
ATOM   4643 C  CB    . ALA B 1 236 ? 97.673  21.793 -0.690  1.00 50.06  ? 413  ALA B CB    1 
ATOM   4644 N  N     . GLU B 1 237 ? 100.761 21.531 -0.766  1.00 51.79  ? 414  GLU B N     1 
ATOM   4645 C  CA    . GLU B 1 237 ? 101.820 20.786 -0.093  1.00 53.12  ? 414  GLU B CA    1 
ATOM   4646 C  C     . GLU B 1 237 ? 102.936 21.616 0.545   1.00 51.91  ? 414  GLU B C     1 
ATOM   4647 O  O     . GLU B 1 237 ? 103.317 21.351 1.664   1.00 52.53  ? 414  GLU B O     1 
ATOM   4648 C  CB    . GLU B 1 237 ? 102.413 19.732 -1.023  1.00 54.07  ? 414  GLU B CB    1 
ATOM   4649 C  CG    . GLU B 1 237 ? 103.175 18.642 -0.279  1.00 60.04  ? 414  GLU B CG    1 
ATOM   4650 C  CD    . GLU B 1 237 ? 104.691 18.814 -0.364  1.00 67.50  ? 414  GLU B CD    1 
ATOM   4651 O  OE1   . GLU B 1 237 ? 105.422 17.869 0.044   1.00 71.83  ? 414  GLU B OE1   1 
ATOM   4652 O  OE2   . GLU B 1 237 ? 105.143 19.880 -0.855  1.00 68.99  ? 414  GLU B OE2   1 
ATOM   4653 N  N     . PRO B 1 238 ? 103.473 22.620 -0.162  1.00 51.30  ? 415  PRO B N     1 
ATOM   4654 C  CA    . PRO B 1 238 ? 104.537 23.417 0.456   1.00 50.64  ? 415  PRO B CA    1 
ATOM   4655 C  C     . PRO B 1 238 ? 104.158 24.019 1.811   1.00 50.52  ? 415  PRO B C     1 
ATOM   4656 O  O     . PRO B 1 238 ? 105.044 24.217 2.643   1.00 50.56  ? 415  PRO B O     1 
ATOM   4657 C  CB    . PRO B 1 238 ? 104.789 24.534 -0.563  1.00 50.51  ? 415  PRO B CB    1 
ATOM   4658 C  CG    . PRO B 1 238 ? 104.224 24.076 -1.824  1.00 49.85  ? 415  PRO B CG    1 
ATOM   4659 C  CD    . PRO B 1 238 ? 103.152 23.084 -1.523  1.00 51.10  ? 415  PRO B CD    1 
ATOM   4660 N  N     . TRP B 1 239 ? 102.870 24.293 2.032   1.00 49.74  ? 416  TRP B N     1 
ATOM   4661 C  CA    . TRP B 1 239 ? 102.419 24.874 3.290   1.00 50.00  ? 416  TRP B CA    1 
ATOM   4662 C  C     . TRP B 1 239 ? 102.602 23.952 4.494   1.00 50.20  ? 416  TRP B C     1 
ATOM   4663 O  O     . TRP B 1 239 ? 102.742 24.439 5.628   1.00 50.14  ? 416  TRP B O     1 
ATOM   4664 C  CB    . TRP B 1 239 ? 100.942 25.272 3.212   1.00 50.77  ? 416  TRP B CB    1 
ATOM   4665 C  CG    . TRP B 1 239 ? 100.696 26.540 2.485   1.00 50.82  ? 416  TRP B CG    1 
ATOM   4666 C  CD1   . TRP B 1 239 ? 100.148 26.673 1.253   1.00 50.58  ? 416  TRP B CD1   1 
ATOM   4667 C  CD2   . TRP B 1 239 ? 101.020 27.867 2.933   1.00 52.13  ? 416  TRP B CD2   1 
ATOM   4668 N  NE1   . TRP B 1 239 ? 100.082 28.002 0.905   1.00 51.99  ? 416  TRP B NE1   1 
ATOM   4669 C  CE2   . TRP B 1 239 ? 100.607 28.758 1.919   1.00 52.08  ? 416  TRP B CE2   1 
ATOM   4670 C  CE3   . TRP B 1 239 ? 101.618 28.385 4.087   1.00 50.98  ? 416  TRP B CE3   1 
ATOM   4671 C  CZ2   . TRP B 1 239 ? 100.726 30.143 2.042   1.00 51.39  ? 416  TRP B CZ2   1 
ATOM   4672 C  CZ3   . TRP B 1 239 ? 101.748 29.769 4.207   1.00 50.67  ? 416  TRP B CZ3   1 
ATOM   4673 C  CH2   . TRP B 1 239 ? 101.305 30.631 3.189   1.00 51.25  ? 416  TRP B CH2   1 
ATOM   4674 N  N     . VAL B 1 240 ? 102.569 22.630 4.269   1.00 49.99  ? 417  VAL B N     1 
ATOM   4675 C  CA    . VAL B 1 240 ? 102.805 21.685 5.368   1.00 49.83  ? 417  VAL B CA    1 
ATOM   4676 C  C     . VAL B 1 240 ? 104.214 21.847 5.936   1.00 49.74  ? 417  VAL B C     1 
ATOM   4677 O  O     . VAL B 1 240 ? 104.397 21.874 7.142   1.00 49.64  ? 417  VAL B O     1 
ATOM   4678 C  CB    . VAL B 1 240 ? 102.576 20.194 4.990   1.00 49.88  ? 417  VAL B CB    1 
ATOM   4679 C  CG1   . VAL B 1 240 ? 102.953 19.277 6.170   1.00 46.46  ? 417  VAL B CG1   1 
ATOM   4680 C  CG2   . VAL B 1 240 ? 101.135 19.955 4.548   1.00 48.36  ? 417  VAL B CG2   1 
ATOM   4681 N  N     . ASP B 1 241 ? 105.203 22.009 5.077   1.00 50.09  ? 418  ASP B N     1 
ATOM   4682 C  CA    . ASP B 1 241 ? 106.563 22.196 5.577   1.00 50.68  ? 418  ASP B CA    1 
ATOM   4683 C  C     . ASP B 1 241 ? 106.670 23.484 6.369   1.00 49.13  ? 418  ASP B C     1 
ATOM   4684 O  O     . ASP B 1 241 ? 107.379 23.529 7.354   1.00 48.88  ? 418  ASP B O     1 
ATOM   4685 C  CB    . ASP B 1 241 ? 107.592 22.217 4.441   1.00 52.04  ? 418  ASP B CB    1 
ATOM   4686 C  CG    . ASP B 1 241 ? 107.614 20.922 3.635   1.00 56.40  ? 418  ASP B CG    1 
ATOM   4687 O  OD1   . ASP B 1 241 ? 108.362 19.996 4.031   1.00 59.74  ? 418  ASP B OD1   1 
ATOM   4688 O  OD2   . ASP B 1 241 ? 106.881 20.837 2.609   1.00 62.20  ? 418  ASP B OD2   1 
ATOM   4689 N  N     . CYS B 1 242 ? 105.961 24.534 5.957   1.00 47.92  ? 419  CYS B N     1 
ATOM   4690 C  CA    . CYS B 1 242 ? 105.959 25.770 6.734   1.00 47.36  ? 419  CYS B CA    1 
ATOM   4691 C  C     . CYS B 1 242 ? 105.321 25.588 8.092   1.00 47.16  ? 419  CYS B C     1 
ATOM   4692 O  O     . CYS B 1 242 ? 105.738 26.200 9.062   1.00 47.70  ? 419  CYS B O     1 
ATOM   4693 C  CB    . CYS B 1 242 ? 105.142 26.842 6.063   1.00 47.62  ? 419  CYS B CB    1 
ATOM   4694 S  SG    . CYS B 1 242 ? 105.551 27.120 4.425   1.00 48.75  ? 419  CYS B SG    1 
ATOM   4695 N  N     . LEU B 1 243 ? 104.211 24.869 8.133   1.00 46.82  ? 420  LEU B N     1 
ATOM   4696 C  CA    . LEU B 1 243 ? 103.499 24.723 9.375   1.00 46.77  ? 420  LEU B CA    1 
ATOM   4697 C  C     . LEU B 1 243 ? 104.404 24.005 10.375  1.00 46.76  ? 420  LEU B C     1 
ATOM   4698 O  O     . LEU B 1 243 ? 104.627 24.496 11.483  1.00 45.66  ? 420  LEU B O     1 
ATOM   4699 C  CB    . LEU B 1 243 ? 102.210 23.949 9.142   1.00 47.14  ? 420  LEU B CB    1 
ATOM   4700 C  CG    . LEU B 1 243 ? 101.317 23.892 10.387  1.00 47.33  ? 420  LEU B CG    1 
ATOM   4701 C  CD1   . LEU B 1 243 ? 100.952 25.300 10.886  1.00 44.72  ? 420  LEU B CD1   1 
ATOM   4702 C  CD2   . LEU B 1 243 ? 100.097 23.030 10.093  1.00 45.99  ? 420  LEU B CD2   1 
ATOM   4703 N  N     . LEU B 1 244 ? 104.948 22.864 9.951   1.00 46.71  ? 421  LEU B N     1 
ATOM   4704 C  CA    . LEU B 1 244 ? 105.846 22.080 10.782  1.00 47.31  ? 421  LEU B CA    1 
ATOM   4705 C  C     . LEU B 1 244 ? 107.073 22.901 11.153  1.00 47.78  ? 421  LEU B C     1 
ATOM   4706 O  O     . LEU B 1 244 ? 107.557 22.836 12.275  1.00 48.35  ? 421  LEU B O     1 
ATOM   4707 C  CB    . LEU B 1 244 ? 106.267 20.788 10.059  1.00 46.94  ? 421  LEU B CB    1 
ATOM   4708 C  CG    . LEU B 1 244 ? 105.200 19.702 9.829   1.00 46.90  ? 421  LEU B CG    1 
ATOM   4709 C  CD1   . LEU B 1 244 ? 105.839 18.408 9.274   1.00 46.34  ? 421  LEU B CD1   1 
ATOM   4710 C  CD2   . LEU B 1 244 ? 104.423 19.395 11.091  1.00 45.54  ? 421  LEU B CD2   1 
ATOM   4711 N  N     . GLU B 1 245 ? 107.568 23.707 10.235  1.00 48.38  ? 422  GLU B N     1 
ATOM   4712 C  CA    . GLU B 1 245 ? 108.724 24.515 10.564  1.00 50.05  ? 422  GLU B CA    1 
ATOM   4713 C  C     . GLU B 1 245 ? 108.443 25.395 11.792  1.00 50.31  ? 422  GLU B C     1 
ATOM   4714 O  O     . GLU B 1 245 ? 109.287 25.529 12.675  1.00 51.77  ? 422  GLU B O     1 
ATOM   4715 C  CB    . GLU B 1 245 ? 109.116 25.366 9.363   1.00 51.47  ? 422  GLU B CB    1 
ATOM   4716 C  CG    . GLU B 1 245 ? 110.613 25.537 9.176   1.00 54.22  ? 422  GLU B CG    1 
ATOM   4717 C  CD    . GLU B 1 245 ? 110.940 26.843 8.463   1.00 59.02  ? 422  GLU B CD    1 
ATOM   4718 O  OE1   . GLU B 1 245 ? 110.489 27.018 7.296   1.00 54.62  ? 422  GLU B OE1   1 
ATOM   4719 O  OE2   . GLU B 1 245 ? 111.617 27.697 9.105   1.00 63.23  ? 422  GLU B OE2   1 
ATOM   4720 N  N     . GLU B 1 246 ? 107.241 25.965 11.856  1.00 49.95  ? 423  GLU B N     1 
ATOM   4721 C  CA    . GLU B 1 246 ? 106.818 26.811 12.984  1.00 49.53  ? 423  GLU B CA    1 
ATOM   4722 C  C     . GLU B 1 246 ? 106.571 25.945 14.246  1.00 49.20  ? 423  GLU B C     1 
ATOM   4723 O  O     . GLU B 1 246 ? 107.087 26.235 15.327  1.00 49.73  ? 423  GLU B O     1 
ATOM   4724 C  CB    . GLU B 1 246 ? 105.564 27.616 12.569  1.00 49.00  ? 423  GLU B CB    1 
ATOM   4725 C  CG    . GLU B 1 246 ? 105.354 28.932 13.264  1.00 50.10  ? 423  GLU B CG    1 
ATOM   4726 C  CD    . GLU B 1 246 ? 104.227 29.803 12.612  1.00 50.86  ? 423  GLU B CD    1 
ATOM   4727 O  OE1   . GLU B 1 246 ? 104.407 30.275 11.464  1.00 48.10  ? 423  GLU B OE1   1 
ATOM   4728 O  OE2   . GLU B 1 246 ? 103.187 30.052 13.278  1.00 48.66  ? 423  GLU B OE2   1 
ATOM   4729 N  N     . TYR B 1 247 ? 105.823 24.857 14.098  1.00 48.61  ? 424  TYR B N     1 
ATOM   4730 C  CA    . TYR B 1 247 ? 105.583 23.955 15.199  1.00 48.43  ? 424  TYR B CA    1 
ATOM   4731 C  C     . TYR B 1 247 ? 106.918 23.499 15.837  1.00 49.21  ? 424  TYR B C     1 
ATOM   4732 O  O     . TYR B 1 247 ? 107.074 23.512 17.065  1.00 49.80  ? 424  TYR B O     1 
ATOM   4733 C  CB    . TYR B 1 247 ? 104.762 22.754 14.703  1.00 48.75  ? 424  TYR B CB    1 
ATOM   4734 C  CG    . TYR B 1 247 ? 103.278 23.008 14.468  1.00 47.47  ? 424  TYR B CG    1 
ATOM   4735 C  CD1   . TYR B 1 247 ? 102.726 24.267 14.621  1.00 47.94  ? 424  TYR B CD1   1 
ATOM   4736 C  CD2   . TYR B 1 247 ? 102.435 21.977 14.077  1.00 48.13  ? 424  TYR B CD2   1 
ATOM   4737 C  CE1   . TYR B 1 247 ? 101.368 24.493 14.429  1.00 47.33  ? 424  TYR B CE1   1 
ATOM   4738 C  CE2   . TYR B 1 247 ? 101.071 22.188 13.872  1.00 49.20  ? 424  TYR B CE2   1 
ATOM   4739 C  CZ    . TYR B 1 247 ? 100.544 23.455 14.062  1.00 50.05  ? 424  TYR B CZ    1 
ATOM   4740 O  OH    . TYR B 1 247 ? 99.200  23.702 13.862  1.00 52.40  ? 424  TYR B OH    1 
ATOM   4741 N  N     . PHE B 1 248 ? 107.886 23.113 15.007  1.00 49.06  ? 425  PHE B N     1 
ATOM   4742 C  CA    . PHE B 1 248 ? 109.148 22.557 15.510  1.00 49.07  ? 425  PHE B CA    1 
ATOM   4743 C  C     . PHE B 1 248 ? 110.008 23.615 16.190  1.00 48.91  ? 425  PHE B C     1 
ATOM   4744 O  O     . PHE B 1 248 ? 110.743 23.341 17.147  1.00 48.26  ? 425  PHE B O     1 
ATOM   4745 C  CB    . PHE B 1 248 ? 109.954 21.932 14.367  1.00 49.04  ? 425  PHE B CB    1 
ATOM   4746 C  CG    . PHE B 1 248 ? 109.326 20.713 13.773  1.00 48.09  ? 425  PHE B CG    1 
ATOM   4747 C  CD1   . PHE B 1 248 ? 108.343 20.006 14.458  1.00 48.26  ? 425  PHE B CD1   1 
ATOM   4748 C  CD2   . PHE B 1 248 ? 109.762 20.235 12.545  1.00 48.40  ? 425  PHE B CD2   1 
ATOM   4749 C  CE1   . PHE B 1 248 ? 107.775 18.859 13.905  1.00 49.47  ? 425  PHE B CE1   1 
ATOM   4750 C  CE2   . PHE B 1 248 ? 109.213 19.077 11.989  1.00 48.21  ? 425  PHE B CE2   1 
ATOM   4751 C  CZ    . PHE B 1 248 ? 108.206 18.397 12.664  1.00 50.06  ? 425  PHE B CZ    1 
ATOM   4752 N  N     . MET B 1 249 ? 109.906 24.833 15.682  1.00 48.93  ? 426  MET B N     1 
ATOM   4753 C  CA    . MET B 1 249 ? 110.499 25.981 16.341  1.00 49.51  ? 426  MET B CA    1 
ATOM   4754 C  C     . MET B 1 249 ? 109.962 26.145 17.756  1.00 49.38  ? 426  MET B C     1 
ATOM   4755 O  O     . MET B 1 249 ? 110.734 26.320 18.697  1.00 49.84  ? 426  MET B O     1 
ATOM   4756 C  CB    . MET B 1 249 ? 110.213 27.224 15.526  1.00 49.64  ? 426  MET B CB    1 
ATOM   4757 C  CG    . MET B 1 249 ? 111.280 28.289 15.667  1.00 53.05  ? 426  MET B CG    1 
ATOM   4758 S  SD    . MET B 1 249 ? 111.000 29.678 14.533  1.00 55.38  ? 426  MET B SD    1 
ATOM   4759 C  CE    . MET B 1 249 ? 111.392 29.009 12.901  1.00 49.51  ? 426  MET B CE    1 
ATOM   4760 N  N     . GLN B 1 250 ? 108.642 26.013 17.905  1.00 48.85  ? 427  GLN B N     1 
ATOM   4761 C  CA    . GLN B 1 250 ? 108.017 26.104 19.205  1.00 48.35  ? 427  GLN B CA    1 
ATOM   4762 C  C     . GLN B 1 250 ? 108.401 24.945 20.121  1.00 48.41  ? 427  GLN B C     1 
ATOM   4763 O  O     . GLN B 1 250 ? 108.826 25.157 21.249  1.00 48.83  ? 427  GLN B O     1 
ATOM   4764 C  CB    . GLN B 1 250 ? 106.494 26.217 19.066  1.00 48.16  ? 427  GLN B CB    1 
ATOM   4765 C  CG    . GLN B 1 250 ? 105.754 26.264 20.397  1.00 45.86  ? 427  GLN B CG    1 
ATOM   4766 C  CD    . GLN B 1 250 ? 104.284 26.533 20.246  1.00 46.25  ? 427  GLN B CD    1 
ATOM   4767 O  OE1   . GLN B 1 250 ? 103.828 27.087 19.235  1.00 46.81  ? 427  GLN B OE1   1 
ATOM   4768 N  NE2   . GLN B 1 250 ? 103.530 26.205 21.278  1.00 42.56  ? 427  GLN B NE2   1 
ATOM   4769 N  N     . SER B 1 251 ? 108.255 23.714 19.661  1.00 48.04  ? 428  SER B N     1 
ATOM   4770 C  CA    . SER B 1 251 ? 108.572 22.587 20.532  1.00 48.17  ? 428  SER B CA    1 
ATOM   4771 C  C     . SER B 1 251 ? 110.061 22.547 20.887  1.00 48.89  ? 428  SER B C     1 
ATOM   4772 O  O     . SER B 1 251 ? 110.428 22.172 22.016  1.00 49.87  ? 428  SER B O     1 
ATOM   4773 C  CB    . SER B 1 251 ? 108.129 21.277 19.906  1.00 47.53  ? 428  SER B CB    1 
ATOM   4774 O  OG    . SER B 1 251 ? 108.638 21.187 18.602  1.00 48.48  ? 428  SER B OG    1 
ATOM   4775 N  N     . ASP B 1 252 ? 110.926 22.943 19.954  1.00 49.15  ? 429  ASP B N     1 
ATOM   4776 C  CA    . ASP B 1 252 ? 112.356 23.086 20.280  1.00 49.68  ? 429  ASP B CA    1 
ATOM   4777 C  C     . ASP B 1 252 ? 112.586 24.063 21.433  1.00 49.84  ? 429  ASP B C     1 
ATOM   4778 O  O     . ASP B 1 252 ? 113.347 23.778 22.369  1.00 50.48  ? 429  ASP B O     1 
ATOM   4779 C  CB    . ASP B 1 252 ? 113.122 23.611 19.085  1.00 50.11  ? 429  ASP B CB    1 
ATOM   4780 C  CG    . ASP B 1 252 ? 113.483 22.532 18.109  1.00 51.32  ? 429  ASP B CG    1 
ATOM   4781 O  OD1   . ASP B 1 252 ? 113.108 21.341 18.313  1.00 52.79  ? 429  ASP B OD1   1 
ATOM   4782 O  OD2   . ASP B 1 252 ? 114.142 22.903 17.123  1.00 49.47  ? 429  ASP B OD2   1 
ATOM   4783 N  N     . ARG B 1 253 ? 111.933 25.220 21.345  1.00 48.78  ? 430  ARG B N     1 
ATOM   4784 C  CA    . ARG B 1 253 ? 112.047 26.242 22.365  1.00 48.49  ? 430  ARG B CA    1 
ATOM   4785 C  C     . ARG B 1 253 ? 111.450 25.794 23.691  1.00 48.33  ? 430  ARG B C     1 
ATOM   4786 O  O     . ARG B 1 253 ? 112.004 26.069 24.762  1.00 48.64  ? 430  ARG B O     1 
ATOM   4787 C  CB    . ARG B 1 253 ? 111.353 27.509 21.896  1.00 48.45  ? 430  ARG B CB    1 
ATOM   4788 C  CG    . ARG B 1 253 ? 111.384 28.631 22.906  1.00 48.48  ? 430  ARG B CG    1 
ATOM   4789 C  CD    . ARG B 1 253 ? 110.871 29.889 22.267  1.00 49.64  ? 430  ARG B CD    1 
ATOM   4790 N  NE    . ARG B 1 253 ? 111.013 31.037 23.145  1.00 50.64  ? 430  ARG B NE    1 
ATOM   4791 C  CZ    . ARG B 1 253 ? 110.388 32.196 22.969  1.00 50.12  ? 430  ARG B CZ    1 
ATOM   4792 N  NH1   . ARG B 1 253 ? 109.573 32.387 21.934  1.00 50.59  ? 430  ARG B NH1   1 
ATOM   4793 N  NH2   . ARG B 1 253 ? 110.572 33.160 23.855  1.00 51.28  ? 430  ARG B NH2   1 
ATOM   4794 N  N     . GLU B 1 254 ? 110.313 25.116 23.627  1.00 47.78  ? 431  GLU B N     1 
ATOM   4795 C  CA    . GLU B 1 254 ? 109.736 24.549 24.828  1.00 47.87  ? 431  GLU B CA    1 
ATOM   4796 C  C     . GLU B 1 254 ? 110.698 23.546 25.429  1.00 47.60  ? 431  GLU B C     1 
ATOM   4797 O  O     . GLU B 1 254 ? 111.005 23.620 26.616  1.00 46.52  ? 431  GLU B O     1 
ATOM   4798 C  CB    . GLU B 1 254 ? 108.386 23.906 24.534  1.00 48.26  ? 431  GLU B CB    1 
ATOM   4799 C  CG    . GLU B 1 254 ? 107.268 24.939 24.341  1.00 48.23  ? 431  GLU B CG    1 
ATOM   4800 C  CD    . GLU B 1 254 ? 106.120 24.423 23.497  1.00 47.00  ? 431  GLU B CD    1 
ATOM   4801 O  OE1   . GLU B 1 254 ? 106.274 23.364 22.837  1.00 49.15  ? 431  GLU B OE1   1 
ATOM   4802 O  OE2   . GLU B 1 254 ? 105.069 25.089 23.480  1.00 43.57  ? 431  GLU B OE2   1 
ATOM   4803 N  N     . LYS B 1 255 ? 111.206 22.637 24.601  1.00 48.14  ? 432  LYS B N     1 
ATOM   4804 C  CA    . LYS B 1 255 ? 112.187 21.662 25.076  1.00 49.09  ? 432  LYS B CA    1 
ATOM   4805 C  C     . LYS B 1 255 ? 113.299 22.417 25.789  1.00 49.11  ? 432  LYS B C     1 
ATOM   4806 O  O     . LYS B 1 255 ? 113.640 22.103 26.919  1.00 48.61  ? 432  LYS B O     1 
ATOM   4807 C  CB    . LYS B 1 255 ? 112.770 20.817 23.927  1.00 49.47  ? 432  LYS B CB    1 
ATOM   4808 C  CG    . LYS B 1 255 ? 112.072 19.452 23.652  1.00 50.08  ? 432  LYS B CG    1 
ATOM   4809 C  CD    . LYS B 1 255 ? 112.035 19.134 22.121  1.00 52.12  ? 432  LYS B CD    1 
ATOM   4810 C  CE    . LYS B 1 255 ? 111.505 17.718 21.776  1.00 52.74  ? 432  LYS B CE    1 
ATOM   4811 N  NZ    . LYS B 1 255 ? 111.856 17.284 20.371  1.00 51.59  ? 432  LYS B NZ    1 
ATOM   4812 N  N     . SER B 1 256 ? 113.831 23.449 25.151  1.00 49.56  ? 433  SER B N     1 
ATOM   4813 C  CA    . SER B 1 256 ? 114.954 24.179 25.748  1.00 50.25  ? 433  SER B CA    1 
ATOM   4814 C  C     . SER B 1 256 ? 114.566 24.864 27.063  1.00 49.83  ? 433  SER B C     1 
ATOM   4815 O  O     . SER B 1 256 ? 115.295 24.784 28.042  1.00 49.77  ? 433  SER B O     1 
ATOM   4816 C  CB    . SER B 1 256 ? 115.515 25.238 24.787  1.00 50.42  ? 433  SER B CB    1 
ATOM   4817 O  OG    . SER B 1 256 ? 116.292 26.185 25.512  1.00 50.21  ? 433  SER B OG    1 
ATOM   4818 N  N     . GLU B 1 257 ? 113.431 25.566 27.061  1.00 48.95  ? 434  GLU B N     1 
ATOM   4819 C  CA    . GLU B 1 257 ? 113.012 26.359 28.214  1.00 47.23  ? 434  GLU B CA    1 
ATOM   4820 C  C     . GLU B 1 257 ? 112.467 25.516 29.369  1.00 45.88  ? 434  GLU B C     1 
ATOM   4821 O  O     . GLU B 1 257 ? 112.221 26.031 30.447  1.00 46.28  ? 434  GLU B O     1 
ATOM   4822 C  CB    . GLU B 1 257 ? 111.984 27.406 27.772  1.00 47.28  ? 434  GLU B CB    1 
ATOM   4823 C  CG    . GLU B 1 257 ? 112.579 28.511 26.906  1.00 46.71  ? 434  GLU B CG    1 
ATOM   4824 C  CD    . GLU B 1 257 ? 111.548 29.505 26.407  1.00 47.11  ? 434  GLU B CD    1 
ATOM   4825 O  OE1   . GLU B 1 257 ? 110.342 29.322 26.642  1.00 47.26  ? 434  GLU B OE1   1 
ATOM   4826 O  OE2   . GLU B 1 257 ? 111.950 30.496 25.782  1.00 49.77  ? 434  GLU B OE2   1 
ATOM   4827 N  N     . GLY B 1 258 ? 112.285 24.225 29.156  1.00 44.91  ? 435  GLY B N     1 
ATOM   4828 C  CA    . GLY B 1 258 ? 111.704 23.362 30.182  1.00 44.47  ? 435  GLY B CA    1 
ATOM   4829 C  C     . GLY B 1 258 ? 110.186 23.416 30.245  1.00 44.22  ? 435  GLY B C     1 
ATOM   4830 O  O     . GLY B 1 258 ? 109.581 23.055 31.244  1.00 43.30  ? 435  GLY B O     1 
ATOM   4831 N  N     . LEU B 1 259 ? 109.555 23.865 29.175  1.00 44.27  ? 436  LEU B N     1 
ATOM   4832 C  CA    . LEU B 1 259 ? 108.113 23.973 29.170  1.00 44.65  ? 436  LEU B CA    1 
ATOM   4833 C  C     . LEU B 1 259 ? 107.529 22.725 28.495  1.00 45.27  ? 436  LEU B C     1 
ATOM   4834 O  O     . LEU B 1 259 ? 108.215 22.070 27.729  1.00 45.19  ? 436  LEU B O     1 
ATOM   4835 C  CB    . LEU B 1 259 ? 107.720 25.243 28.411  1.00 44.59  ? 436  LEU B CB    1 
ATOM   4836 C  CG    . LEU B 1 259 ? 108.007 26.569 29.120  1.00 43.04  ? 436  LEU B CG    1 
ATOM   4837 C  CD1   . LEU B 1 259 ? 107.657 27.767 28.230  1.00 40.88  ? 436  LEU B CD1   1 
ATOM   4838 C  CD2   . LEU B 1 259 ? 107.228 26.633 30.391  1.00 38.26  ? 436  LEU B CD2   1 
ATOM   4839 N  N     . PRO B 1 260 ? 106.231 22.455 28.682  1.00 45.97  ? 437  PRO B N     1 
ATOM   4840 C  CA    . PRO B 1 260 ? 105.651 21.255 28.103  1.00 46.48  ? 437  PRO B CA    1 
ATOM   4841 C  C     . PRO B 1 260 ? 105.641 21.285 26.579  1.00 47.68  ? 437  PRO B C     1 
ATOM   4842 O  O     . PRO B 1 260 ? 105.438 22.335 25.966  1.00 47.73  ? 437  PRO B O     1 
ATOM   4843 C  CB    . PRO B 1 260 ? 104.207 21.258 28.617  1.00 46.09  ? 437  PRO B CB    1 
ATOM   4844 C  CG    . PRO B 1 260 ? 104.138 22.288 29.637  1.00 46.47  ? 437  PRO B CG    1 
ATOM   4845 C  CD    . PRO B 1 260 ? 105.204 23.286 29.317  1.00 46.56  ? 437  PRO B CD    1 
ATOM   4846 N  N     . VAL B 1 261 ? 105.821 20.109 25.983  1.00 49.08  ? 438  VAL B N     1 
ATOM   4847 C  CA    . VAL B 1 261 ? 105.867 19.960 24.538  1.00 48.91  ? 438  VAL B CA    1 
ATOM   4848 C  C     . VAL B 1 261 ? 104.620 19.201 24.079  1.00 49.16  ? 438  VAL B C     1 
ATOM   4849 O  O     . VAL B 1 261 ? 104.320 18.146 24.610  1.00 50.26  ? 438  VAL B O     1 
ATOM   4850 C  CB    . VAL B 1 261 ? 107.154 19.206 24.126  1.00 48.70  ? 438  VAL B CB    1 
ATOM   4851 C  CG1   . VAL B 1 261 ? 107.099 18.813 22.649  1.00 47.81  ? 438  VAL B CG1   1 
ATOM   4852 C  CG2   . VAL B 1 261 ? 108.385 20.077 24.435  1.00 45.86  ? 438  VAL B CG2   1 
ATOM   4853 N  N     . ALA B 1 262 ? 103.865 19.794 23.152  1.00 48.93  ? 439  ALA B N     1 
ATOM   4854 C  CA    . ALA B 1 262 ? 102.705 19.147 22.534  1.00 48.50  ? 439  ALA B CA    1 
ATOM   4855 C  C     . ALA B 1 262 ? 103.179 18.102 21.510  1.00 48.38  ? 439  ALA B C     1 
ATOM   4856 O  O     . ALA B 1 262 ? 103.932 18.428 20.595  1.00 48.54  ? 439  ALA B O     1 
ATOM   4857 C  CB    . ALA B 1 262 ? 101.830 20.196 21.848  1.00 47.29  ? 439  ALA B CB    1 
ATOM   4858 N  N     . PRO B 1 263 ? 102.760 16.841 21.664  1.00 48.23  ? 440  PRO B N     1 
ATOM   4859 C  CA    . PRO B 1 263 ? 103.223 15.810 20.714  1.00 48.10  ? 440  PRO B CA    1 
ATOM   4860 C  C     . PRO B 1 263 ? 102.998 16.130 19.254  1.00 47.16  ? 440  PRO B C     1 
ATOM   4861 O  O     . PRO B 1 263 ? 103.784 15.716 18.408  1.00 47.19  ? 440  PRO B O     1 
ATOM   4862 C  CB    . PRO B 1 263 ? 102.432 14.564 21.122  1.00 47.26  ? 440  PRO B CB    1 
ATOM   4863 C  CG    . PRO B 1 263 ? 102.215 14.748 22.571  1.00 48.04  ? 440  PRO B CG    1 
ATOM   4864 C  CD    . PRO B 1 263 ? 101.970 16.249 22.754  1.00 48.86  ? 440  PRO B CD    1 
ATOM   4865 N  N     . PHE B 1 264 ? 101.946 16.872 18.946  1.00 47.52  ? 441  PHE B N     1 
ATOM   4866 C  CA    . PHE B 1 264 ? 101.689 17.179 17.558  1.00 47.21  ? 441  PHE B CA    1 
ATOM   4867 C  C     . PHE B 1 264 ? 102.707 18.130 16.972  1.00 48.02  ? 441  PHE B C     1 
ATOM   4868 O  O     . PHE B 1 264 ? 102.801 18.234 15.758  1.00 49.21  ? 441  PHE B O     1 
ATOM   4869 C  CB    . PHE B 1 264 ? 100.241 17.607 17.317  1.00 47.46  ? 441  PHE B CB    1 
ATOM   4870 C  CG    . PHE B 1 264 ? 99.929  19.019 17.674  1.00 46.77  ? 441  PHE B CG    1 
ATOM   4871 C  CD1   . PHE B 1 264 ? 100.054 20.022 16.739  1.00 47.90  ? 441  PHE B CD1   1 
ATOM   4872 C  CD2   . PHE B 1 264 ? 99.394  19.323 18.903  1.00 49.06  ? 441  PHE B CD2   1 
ATOM   4873 C  CE1   . PHE B 1 264 ? 99.744  21.324 17.054  1.00 50.05  ? 441  PHE B CE1   1 
ATOM   4874 C  CE2   . PHE B 1 264 ? 99.079  20.623 19.237  1.00 50.50  ? 441  PHE B CE2   1 
ATOM   4875 C  CZ    . PHE B 1 264 ? 99.256  21.632 18.307  1.00 50.04  ? 441  PHE B CZ    1 
ATOM   4876 N  N     . MET B 1 265 ? 103.515 18.773 17.817  1.00 48.79  ? 442  MET B N     1 
ATOM   4877 C  CA    . MET B 1 265 ? 104.613 19.637 17.337  1.00 48.68  ? 442  MET B CA    1 
ATOM   4878 C  C     . MET B 1 265 ? 105.996 19.067 17.565  1.00 48.71  ? 442  MET B C     1 
ATOM   4879 O  O     . MET B 1 265 ? 106.979 19.749 17.296  1.00 47.55  ? 442  MET B O     1 
ATOM   4880 C  CB    . MET B 1 265 ? 104.589 21.002 18.013  1.00 47.67  ? 442  MET B CB    1 
ATOM   4881 C  CG    . MET B 1 265 ? 103.301 21.740 17.918  1.00 48.35  ? 442  MET B CG    1 
ATOM   4882 S  SD    . MET B 1 265 ? 103.537 23.414 18.544  1.00 48.72  ? 442  MET B SD    1 
ATOM   4883 C  CE    . MET B 1 265 ? 101.850 23.978 18.599  1.00 46.41  ? 442  MET B CE    1 
ATOM   4884 N  N     . ASP B 1 266 ? 106.072 17.859 18.111  1.00 49.69  ? 443  ASP B N     1 
ATOM   4885 C  CA    . ASP B 1 266 ? 107.353 17.283 18.480  1.00 51.23  ? 443  ASP B CA    1 
ATOM   4886 C  C     . ASP B 1 266 ? 108.053 16.742 17.246  1.00 52.39  ? 443  ASP B C     1 
ATOM   4887 O  O     . ASP B 1 266 ? 107.579 15.780 16.623  1.00 51.63  ? 443  ASP B O     1 
ATOM   4888 C  CB    . ASP B 1 266 ? 107.164 16.147 19.486  1.00 51.93  ? 443  ASP B CB    1 
ATOM   4889 C  CG    . ASP B 1 266 ? 108.468 15.739 20.180  1.00 53.06  ? 443  ASP B CG    1 
ATOM   4890 O  OD1   . ASP B 1 266 ? 109.559 15.828 19.562  1.00 55.86  ? 443  ASP B OD1   1 
ATOM   4891 O  OD2   . ASP B 1 266 ? 108.387 15.321 21.352  1.00 52.69  ? 443  ASP B OD2   1 
ATOM   4892 N  N     . ARG B 1 267 ? 109.210 17.319 16.924  1.00 53.92  ? 444  ARG B N     1 
ATOM   4893 C  CA    . ARG B 1 267 ? 109.913 16.912 15.708  1.00 55.49  ? 444  ARG B CA    1 
ATOM   4894 C  C     . ARG B 1 267 ? 110.300 15.437 15.739  1.00 56.17  ? 444  ARG B C     1 
ATOM   4895 O  O     . ARG B 1 267 ? 110.350 14.806 14.699  1.00 57.24  ? 444  ARG B O     1 
ATOM   4896 C  CB    . ARG B 1 267 ? 111.104 17.822 15.381  1.00 54.94  ? 444  ARG B CB    1 
ATOM   4897 C  CG    . ARG B 1 267 ? 112.384 17.549 16.128  1.00 55.62  ? 444  ARG B CG    1 
ATOM   4898 C  CD    . ARG B 1 267 ? 113.376 18.689 15.910  1.00 56.14  ? 444  ARG B CD    1 
ATOM   4899 N  NE    . ARG B 1 267 ? 113.289 19.232 14.549  1.00 56.83  ? 444  ARG B NE    1 
ATOM   4900 C  CZ    . ARG B 1 267 ? 113.355 20.526 14.217  1.00 56.10  ? 444  ARG B CZ    1 
ATOM   4901 N  NH1   . ARG B 1 267 ? 113.515 21.468 15.124  1.00 56.02  ? 444  ARG B NH1   1 
ATOM   4902 N  NH2   . ARG B 1 267 ? 113.220 20.888 12.956  1.00 57.42  ? 444  ARG B NH2   1 
ATOM   4903 N  N     . ASP B 1 268 ? 110.424 14.857 16.928  1.00 57.24  ? 445  ASP B N     1 
ATOM   4904 C  CA    . ASP B 1 268 ? 110.713 13.426 17.042  1.00 57.95  ? 445  ASP B CA    1 
ATOM   4905 C  C     . ASP B 1 268 ? 109.551 12.556 16.608  1.00 58.28  ? 445  ASP B C     1 
ATOM   4906 O  O     . ASP B 1 268 ? 109.757 11.391 16.273  1.00 58.45  ? 445  ASP B O     1 
ATOM   4907 C  CB    . ASP B 1 268 ? 111.085 13.069 18.479  1.00 58.25  ? 445  ASP B CB    1 
ATOM   4908 C  CG    . ASP B 1 268 ? 112.331 13.800 18.955  1.00 59.33  ? 445  ASP B CG    1 
ATOM   4909 O  OD1   . ASP B 1 268 ? 113.270 13.967 18.133  1.00 57.49  ? 445  ASP B OD1   1 
ATOM   4910 O  OD2   . ASP B 1 268 ? 112.355 14.220 20.141  1.00 61.13  ? 445  ASP B OD2   1 
ATOM   4911 N  N     . LYS B 1 269 ? 108.343 13.120 16.581  1.00 58.60  ? 446  LYS B N     1 
ATOM   4912 C  CA    . LYS B 1 269 ? 107.132 12.305 16.483  1.00 59.21  ? 446  LYS B CA    1 
ATOM   4913 C  C     . LYS B 1 269 ? 106.247 12.578 15.274  1.00 59.35  ? 446  LYS B C     1 
ATOM   4914 O  O     . LYS B 1 269 ? 105.254 11.891 15.072  1.00 60.79  ? 446  LYS B O     1 
ATOM   4915 C  CB    . LYS B 1 269 ? 106.283 12.479 17.736  1.00 59.38  ? 446  LYS B CB    1 
ATOM   4916 C  CG    . LYS B 1 269 ? 107.004 12.115 19.024  1.00 60.31  ? 446  LYS B CG    1 
ATOM   4917 C  CD    . LYS B 1 269 ? 106.012 12.044 20.183  1.00 61.24  ? 446  LYS B CD    1 
ATOM   4918 C  CE    . LYS B 1 269 ? 106.675 12.205 21.553  1.00 60.57  ? 446  LYS B CE    1 
ATOM   4919 N  NZ    . LYS B 1 269 ? 105.691 11.944 22.644  1.00 59.82  ? 446  LYS B NZ    1 
ATOM   4920 N  N     . VAL B 1 270 ? 106.583 13.566 14.462  1.00 59.17  ? 447  VAL B N     1 
ATOM   4921 C  CA    . VAL B 1 270 ? 105.624 14.069 13.476  1.00 58.28  ? 447  VAL B CA    1 
ATOM   4922 C  C     . VAL B 1 270 ? 106.167 13.884 12.057  1.00 59.34  ? 447  VAL B C     1 
ATOM   4923 O  O     . VAL B 1 270 ? 107.381 13.912 11.844  1.00 58.86  ? 447  VAL B O     1 
ATOM   4924 C  CB    . VAL B 1 270 ? 105.318 15.561 13.728  1.00 57.18  ? 447  VAL B CB    1 
ATOM   4925 C  CG1   . VAL B 1 270 ? 104.338 16.068 12.723  1.00 54.99  ? 447  VAL B CG1   1 
ATOM   4926 C  CG2   . VAL B 1 270 ? 104.797 15.760 15.137  1.00 54.49  ? 447  VAL B CG2   1 
ATOM   4927 N  N     . THR B 1 271 ? 105.269 13.651 11.099  1.00 60.53  ? 448  THR B N     1 
ATOM   4928 C  CA    . THR B 1 271 ? 105.608 13.783 9.676   1.00 60.41  ? 448  THR B CA    1 
ATOM   4929 C  C     . THR B 1 271 ? 104.491 14.485 8.930   1.00 60.15  ? 448  THR B C     1 
ATOM   4930 O  O     . THR B 1 271 ? 103.368 14.633 9.443   1.00 60.01  ? 448  THR B O     1 
ATOM   4931 C  CB    . THR B 1 271 ? 105.780 12.415 9.019   1.00 61.21  ? 448  THR B CB    1 
ATOM   4932 O  OG1   . THR B 1 271 ? 104.672 11.581 9.408   1.00 62.60  ? 448  THR B OG1   1 
ATOM   4933 C  CG2   . THR B 1 271 ? 107.135 11.757 9.414   1.00 58.90  ? 448  THR B CG2   1 
ATOM   4934 N  N     . LYS B 1 272 ? 104.798 14.925 7.712   1.00 59.70  ? 449  LYS B N     1 
ATOM   4935 C  CA    . LYS B 1 272 ? 103.794 15.573 6.868   1.00 59.41  ? 449  LYS B CA    1 
ATOM   4936 C  C     . LYS B 1 272 ? 102.519 14.716 6.854   1.00 57.73  ? 449  LYS B C     1 
ATOM   4937 O  O     . LYS B 1 272 ? 101.433 15.191 7.177   1.00 57.14  ? 449  LYS B O     1 
ATOM   4938 C  CB    . LYS B 1 272 ? 104.366 15.820 5.463   1.00 60.18  ? 449  LYS B CB    1 
ATOM   4939 C  CG    . LYS B 1 272 ? 105.453 16.935 5.431   1.00 63.85  ? 449  LYS B CG    1 
ATOM   4940 C  CD    . LYS B 1 272 ? 106.565 16.732 4.369   1.00 68.14  ? 449  LYS B CD    1 
ATOM   4941 C  CE    . LYS B 1 272 ? 106.133 17.113 2.925   1.00 71.67  ? 449  LYS B CE    1 
ATOM   4942 N  NZ    . LYS B 1 272 ? 105.615 18.537 2.744   1.00 73.54  ? 449  LYS B NZ    1 
ATOM   4943 N  N     . ALA B 1 273 ? 102.685 13.420 6.627   1.00 56.24  ? 450  ALA B N     1 
ATOM   4944 C  CA    . ALA B 1 273 ? 101.539 12.535 6.516   1.00 55.49  ? 450  ALA B CA    1 
ATOM   4945 C  C     . ALA B 1 273 ? 100.748 12.485 7.816   1.00 54.92  ? 450  ALA B C     1 
ATOM   4946 O  O     . ALA B 1 273 ? 99.525  12.616 7.814   1.00 54.72  ? 450  ALA B O     1 
ATOM   4947 C  CB    . ALA B 1 273 ? 101.960 11.127 6.100   1.00 55.10  ? 450  ALA B CB    1 
ATOM   4948 N  N     . THR B 1 274 ? 101.428 12.283 8.935   1.00 54.68  ? 451  THR B N     1 
ATOM   4949 C  CA    . THR B 1 274 ? 100.689 12.068 10.191  1.00 54.50  ? 451  THR B CA    1 
ATOM   4950 C  C     . THR B 1 274 ? 100.005 13.352 10.624  1.00 53.06  ? 451  THR B C     1 
ATOM   4951 O  O     . THR B 1 274 ? 98.842  13.321 11.028  1.00 52.10  ? 451  THR B O     1 
ATOM   4952 C  CB    . THR B 1 274 ? 101.573 11.538 11.345  1.00 54.86  ? 451  THR B CB    1 
ATOM   4953 O  OG1   . THR B 1 274 ? 102.782 12.321 11.439  1.00 57.12  ? 451  THR B OG1   1 
ATOM   4954 C  CG2   . THR B 1 274 ? 101.901 10.048 11.124  1.00 53.88  ? 451  THR B CG2   1 
ATOM   4955 N  N     . ALA B 1 275 ? 100.724 14.468 10.457  1.00 52.28  ? 452  ALA B N     1 
ATOM   4956 C  CA    . ALA B 1 275 ? 100.179 15.824 10.616  1.00 51.82  ? 452  ALA B CA    1 
ATOM   4957 C  C     . ALA B 1 275 ? 98.836  16.001 9.912   1.00 51.49  ? 452  ALA B C     1 
ATOM   4958 O  O     . ALA B 1 275 ? 97.837  16.368 10.542  1.00 51.92  ? 452  ALA B O     1 
ATOM   4959 C  CB    . ALA B 1 275 ? 101.187 16.868 10.106  1.00 51.73  ? 452  ALA B CB    1 
ATOM   4960 N  N     . GLN B 1 276 ? 98.790  15.649 8.635   1.00 50.73  ? 453  GLN B N     1 
ATOM   4961 C  CA    . GLN B 1 276 ? 97.663  16.029 7.813   1.00 50.40  ? 453  GLN B CA    1 
ATOM   4962 C  C     . GLN B 1 276 ? 96.512  15.025 7.806   1.00 49.62  ? 453  GLN B C     1 
ATOM   4963 O  O     . GLN B 1 276 ? 95.361  15.420 7.651   1.00 50.08  ? 453  GLN B O     1 
ATOM   4964 C  CB    . GLN B 1 276 ? 98.159  16.355 6.406   1.00 51.08  ? 453  GLN B CB    1 
ATOM   4965 C  CG    . GLN B 1 276 ? 99.089  17.584 6.388   1.00 50.39  ? 453  GLN B CG    1 
ATOM   4966 C  CD    . GLN B 1 276 ? 98.395  18.833 6.881   1.00 51.42  ? 453  GLN B CD    1 
ATOM   4967 O  OE1   . GLN B 1 276 ? 98.411  19.132 8.074   1.00 54.03  ? 453  GLN B OE1   1 
ATOM   4968 N  NE2   . GLN B 1 276 ? 97.761  19.563 5.968   1.00 50.50  ? 453  GLN B NE2   1 
ATOM   4969 N  N     . ILE B 1 277 ? 96.794  13.742 7.991   1.00 48.64  ? 454  ILE B N     1 
ATOM   4970 C  CA    . ILE B 1 277 ? 95.736  12.743 7.873   1.00 47.52  ? 454  ILE B CA    1 
ATOM   4971 C  C     . ILE B 1 277 ? 94.644  12.973 8.888   1.00 47.24  ? 454  ILE B C     1 
ATOM   4972 O  O     . ILE B 1 277 ? 93.463  13.083 8.560   1.00 47.19  ? 454  ILE B O     1 
ATOM   4973 C  CB    . ILE B 1 277 ? 96.233  11.334 8.082   1.00 47.53  ? 454  ILE B CB    1 
ATOM   4974 C  CG1   . ILE B 1 277 ? 97.236  10.970 6.985   1.00 48.67  ? 454  ILE B CG1   1 
ATOM   4975 C  CG2   . ILE B 1 277 ? 95.039  10.366 8.029   1.00 46.09  ? 454  ILE B CG2   1 
ATOM   4976 C  CD1   . ILE B 1 277 ? 98.028  9.683  7.255   1.00 49.01  ? 454  ILE B CD1   1 
ATOM   4977 N  N     . GLY B 1 278 ? 95.034  13.038 10.143  1.00 47.00  ? 455  GLY B N     1 
ATOM   4978 C  CA    . GLY B 1 278 ? 94.047  13.209 11.203  1.00 46.51  ? 455  GLY B CA    1 
ATOM   4979 C  C     . GLY B 1 278 ? 93.339  14.534 11.095  1.00 45.61  ? 455  GLY B C     1 
ATOM   4980 O  O     . GLY B 1 278 ? 92.138  14.606 11.276  1.00 45.10  ? 455  GLY B O     1 
ATOM   4981 N  N     . PHE B 1 279 ? 94.100  15.565 10.746  1.00 45.10  ? 456  PHE B N     1 
ATOM   4982 C  CA    . PHE B 1 279 ? 93.590  16.917 10.643  1.00 45.07  ? 456  PHE B CA    1 
ATOM   4983 C  C     . PHE B 1 279 ? 92.566  17.005 9.541   1.00 45.73  ? 456  PHE B C     1 
ATOM   4984 O  O     . PHE B 1 279 ? 91.525  17.658 9.706   1.00 45.41  ? 456  PHE B O     1 
ATOM   4985 C  CB    . PHE B 1 279 ? 94.740  17.890 10.389  1.00 45.07  ? 456  PHE B CB    1 
ATOM   4986 C  CG    . PHE B 1 279 ? 94.317  19.318 10.343  1.00 46.60  ? 456  PHE B CG    1 
ATOM   4987 C  CD1   . PHE B 1 279 ? 93.905  19.969 11.501  1.00 48.57  ? 456  PHE B CD1   1 
ATOM   4988 C  CD2   . PHE B 1 279 ? 94.322  20.018 9.151   1.00 46.24  ? 456  PHE B CD2   1 
ATOM   4989 C  CE1   . PHE B 1 279 ? 93.500  21.297 11.476  1.00 47.37  ? 456  PHE B CE1   1 
ATOM   4990 C  CE2   . PHE B 1 279 ? 93.910  21.335 9.108   1.00 48.43  ? 456  PHE B CE2   1 
ATOM   4991 C  CZ    . PHE B 1 279 ? 93.488  21.983 10.281  1.00 46.85  ? 456  PHE B CZ    1 
ATOM   4992 N  N     . ILE B 1 280 ? 92.839  16.318 8.426   1.00 46.21  ? 457  ILE B N     1 
ATOM   4993 C  CA    . ILE B 1 280 ? 91.906  16.277 7.293   1.00 46.01  ? 457  ILE B CA    1 
ATOM   4994 C  C     . ILE B 1 280 ? 90.628  15.512 7.633   1.00 45.95  ? 457  ILE B C     1 
ATOM   4995 O  O     . ILE B 1 280 ? 89.522  16.024 7.436   1.00 46.40  ? 457  ILE B O     1 
ATOM   4996 C  CB    . ILE B 1 280 ? 92.553  15.676 6.019   1.00 45.62  ? 457  ILE B CB    1 
ATOM   4997 C  CG1   . ILE B 1 280 ? 93.565  16.662 5.406   1.00 45.25  ? 457  ILE B CG1   1 
ATOM   4998 C  CG2   . ILE B 1 280 ? 91.482  15.389 5.004   1.00 45.77  ? 457  ILE B CG2   1 
ATOM   4999 C  CD1   . ILE B 1 280 ? 94.634  16.017 4.525   1.00 44.18  ? 457  ILE B CD1   1 
ATOM   5000 N  N     . LYS B 1 281 ? 90.780  14.294 8.134   1.00 46.35  ? 458  LYS B N     1 
ATOM   5001 C  CA    . LYS B 1 281 ? 89.632  13.405 8.370   1.00 46.65  ? 458  LYS B CA    1 
ATOM   5002 C  C     . LYS B 1 281 ? 88.709  13.972 9.441   1.00 46.63  ? 458  LYS B C     1 
ATOM   5003 O  O     . LYS B 1 281 ? 87.482  13.854 9.372   1.00 46.13  ? 458  LYS B O     1 
ATOM   5004 C  CB    . LYS B 1 281 ? 90.110  12.045 8.847   1.00 45.92  ? 458  LYS B CB    1 
ATOM   5005 C  CG    . LYS B 1 281 ? 90.616  11.131 7.762   1.00 48.33  ? 458  LYS B CG    1 
ATOM   5006 C  CD    . LYS B 1 281 ? 91.478  10.025 8.389   1.00 49.90  ? 458  LYS B CD    1 
ATOM   5007 C  CE    . LYS B 1 281 ? 91.044  8.617  8.016   1.00 48.48  ? 458  LYS B CE    1 
ATOM   5008 N  NZ    . LYS B 1 281 ? 92.004  7.639  8.567   1.00 45.25  ? 458  LYS B NZ    1 
ATOM   5009 N  N     . PHE B 1 282 ? 89.317  14.544 10.468  1.00 46.73  ? 459  PHE B N     1 
ATOM   5010 C  CA    . PHE B 1 282 ? 88.596  14.792 11.691  1.00 47.02  ? 459  PHE B CA    1 
ATOM   5011 C  C     . PHE B 1 282 ? 88.359  16.264 11.994  1.00 47.13  ? 459  PHE B C     1 
ATOM   5012 O  O     . PHE B 1 282 ? 87.474  16.560 12.757  1.00 48.47  ? 459  PHE B O     1 
ATOM   5013 C  CB    . PHE B 1 282 ? 89.296  14.127 12.853  1.00 46.95  ? 459  PHE B CB    1 
ATOM   5014 C  CG    . PHE B 1 282 ? 89.479  12.651 12.679  1.00 48.55  ? 459  PHE B CG    1 
ATOM   5015 C  CD1   . PHE B 1 282 ? 90.751  12.081 12.711  1.00 49.48  ? 459  PHE B CD1   1 
ATOM   5016 C  CD2   . PHE B 1 282 ? 88.383  11.820 12.493  1.00 50.14  ? 459  PHE B CD2   1 
ATOM   5017 C  CE1   . PHE B 1 282 ? 90.927  10.714 12.575  1.00 49.76  ? 459  PHE B CE1   1 
ATOM   5018 C  CE2   . PHE B 1 282 ? 88.552  10.436 12.327  1.00 50.95  ? 459  PHE B CE2   1 
ATOM   5019 C  CZ    . PHE B 1 282 ? 89.828  9.885  12.373  1.00 50.67  ? 459  PHE B CZ    1 
ATOM   5020 N  N     . VAL B 1 283 ? 89.095  17.195 11.391  1.00 46.73  ? 460  VAL B N     1 
ATOM   5021 C  CA    . VAL B 1 283 ? 88.753  18.608 11.542  1.00 45.47  ? 460  VAL B CA    1 
ATOM   5022 C  C     . VAL B 1 283 ? 88.203  19.172 10.245  1.00 45.60  ? 460  VAL B C     1 
ATOM   5023 O  O     . VAL B 1 283 ? 87.133  19.757 10.253  1.00 46.18  ? 460  VAL B O     1 
ATOM   5024 C  CB    . VAL B 1 283 ? 89.957  19.459 12.058  1.00 45.82  ? 460  VAL B CB    1 
ATOM   5025 C  CG1   . VAL B 1 283 ? 89.521  20.873 12.364  1.00 43.69  ? 460  VAL B CG1   1 
ATOM   5026 C  CG2   . VAL B 1 283 ? 90.581  18.810 13.281  1.00 42.61  ? 460  VAL B CG2   1 
ATOM   5027 N  N     . LEU B 1 284 ? 88.898  18.971 9.129   1.00 46.10  ? 461  LEU B N     1 
ATOM   5028 C  CA    . LEU B 1 284 ? 88.544  19.634 7.878   1.00 46.09  ? 461  LEU B CA    1 
ATOM   5029 C  C     . LEU B 1 284 ? 87.333  19.055 7.198   1.00 46.41  ? 461  LEU B C     1 
ATOM   5030 O  O     . LEU B 1 284 ? 86.409  19.803 6.878   1.00 46.79  ? 461  LEU B O     1 
ATOM   5031 C  CB    . LEU B 1 284 ? 89.711  19.588 6.911   1.00 46.56  ? 461  LEU B CB    1 
ATOM   5032 C  CG    . LEU B 1 284 ? 90.797  20.610 7.238   1.00 47.78  ? 461  LEU B CG    1 
ATOM   5033 C  CD1   . LEU B 1 284 ? 91.932  20.515 6.216   1.00 43.69  ? 461  LEU B CD1   1 
ATOM   5034 C  CD2   . LEU B 1 284 ? 90.184  22.033 7.338   1.00 46.60  ? 461  LEU B CD2   1 
ATOM   5035 N  N     . ILE B 1 285 ? 87.350  17.753 6.909   1.00 46.40  ? 462  ILE B N     1 
ATOM   5036 C  CA    . ILE B 1 285 ? 86.230  17.151 6.190   1.00 46.53  ? 462  ILE B CA    1 
ATOM   5037 C  C     . ILE B 1 285 ? 84.903  17.468 6.900   1.00 47.89  ? 462  ILE B C     1 
ATOM   5038 O  O     . ILE B 1 285 ? 84.017  18.116 6.311   1.00 47.89  ? 462  ILE B O     1 
ATOM   5039 C  CB    . ILE B 1 285 ? 86.414  15.633 5.947   1.00 46.21  ? 462  ILE B CB    1 
ATOM   5040 C  CG1   . ILE B 1 285 ? 87.424  15.441 4.807   1.00 45.24  ? 462  ILE B CG1   1 
ATOM   5041 C  CG2   . ILE B 1 285 ? 85.069  14.977 5.628   1.00 41.52  ? 462  ILE B CG2   1 
ATOM   5042 C  CD1   . ILE B 1 285 ? 87.869  14.029 4.578   1.00 43.42  ? 462  ILE B CD1   1 
ATOM   5043 N  N     . PRO B 1 286 ? 84.795  17.100 8.190   1.00 48.88  ? 463  PRO B N     1 
ATOM   5044 C  CA    . PRO B 1 286 ? 83.542  17.318 8.925   1.00 49.06  ? 463  PRO B CA    1 
ATOM   5045 C  C     . PRO B 1 286 ? 83.086  18.778 8.836   1.00 49.78  ? 463  PRO B C     1 
ATOM   5046 O  O     . PRO B 1 286 ? 81.880  19.058 8.661   1.00 50.31  ? 463  PRO B O     1 
ATOM   5047 C  CB    . PRO B 1 286 ? 83.915  16.991 10.366  1.00 48.27  ? 463  PRO B CB    1 
ATOM   5048 C  CG    . PRO B 1 286 ? 85.100  16.098 10.257  1.00 48.88  ? 463  PRO B CG    1 
ATOM   5049 C  CD    . PRO B 1 286 ? 85.848  16.529 9.046   1.00 48.83  ? 463  PRO B CD    1 
ATOM   5050 N  N     . MET B 1 287 ? 84.043  19.701 8.916   1.00 49.16  ? 464  MET B N     1 
ATOM   5051 C  CA    . MET B 1 287 ? 83.688  21.106 8.898   1.00 49.80  ? 464  MET B CA    1 
ATOM   5052 C  C     . MET B 1 287 ? 83.069  21.464 7.543   1.00 49.76  ? 464  MET B C     1 
ATOM   5053 O  O     . MET B 1 287 ? 81.963  22.003 7.470   1.00 50.18  ? 464  MET B O     1 
ATOM   5054 C  CB    . MET B 1 287 ? 84.894  22.007 9.243   1.00 50.17  ? 464  MET B CB    1 
ATOM   5055 C  CG    . MET B 1 287 ? 84.490  23.482 9.415   1.00 50.45  ? 464  MET B CG    1 
ATOM   5056 S  SD    . MET B 1 287 ? 85.741  24.645 9.983   1.00 50.04  ? 464  MET B SD    1 
ATOM   5057 C  CE    . MET B 1 287 ? 87.138  24.242 8.947   1.00 47.80  ? 464  MET B CE    1 
ATOM   5058 N  N     . PHE B 1 288 ? 83.731  21.081 6.468   1.00 49.84  ? 465  PHE B N     1 
ATOM   5059 C  CA    . PHE B 1 288 ? 83.201  21.382 5.150   1.00 50.16  ? 465  PHE B CA    1 
ATOM   5060 C  C     . PHE B 1 288 ? 81.946  20.590 4.827   1.00 50.71  ? 465  PHE B C     1 
ATOM   5061 O  O     . PHE B 1 288 ? 81.119  21.050 4.031   1.00 50.74  ? 465  PHE B O     1 
ATOM   5062 C  CB    . PHE B 1 288 ? 84.275  21.215 4.084   1.00 49.80  ? 465  PHE B CB    1 
ATOM   5063 C  CG    . PHE B 1 288 ? 85.246  22.363 4.044   1.00 49.54  ? 465  PHE B CG    1 
ATOM   5064 C  CD1   . PHE B 1 288 ? 86.466  22.288 4.707   1.00 50.02  ? 465  PHE B CD1   1 
ATOM   5065 C  CD2   . PHE B 1 288 ? 84.917  23.539 3.396   1.00 50.22  ? 465  PHE B CD2   1 
ATOM   5066 C  CE1   . PHE B 1 288 ? 87.369  23.341 4.680   1.00 51.29  ? 465  PHE B CE1   1 
ATOM   5067 C  CE2   . PHE B 1 288 ? 85.817  24.620 3.366   1.00 51.55  ? 465  PHE B CE2   1 
ATOM   5068 C  CZ    . PHE B 1 288 ? 87.045  24.514 4.013   1.00 52.50  ? 465  PHE B CZ    1 
ATOM   5069 N  N     . GLU B 1 289 ? 81.793  19.422 5.459   1.00 51.33  ? 466  GLU B N     1 
ATOM   5070 C  CA    . GLU B 1 289 ? 80.610  18.591 5.238   1.00 51.73  ? 466  GLU B CA    1 
ATOM   5071 C  C     . GLU B 1 289 ? 79.370  19.349 5.692   1.00 52.52  ? 466  GLU B C     1 
ATOM   5072 O  O     . GLU B 1 289 ? 78.289  19.238 5.082   1.00 52.94  ? 466  GLU B O     1 
ATOM   5073 C  CB    . GLU B 1 289 ? 80.696  17.272 6.000   1.00 51.72  ? 466  GLU B CB    1 
ATOM   5074 C  CG    . GLU B 1 289 ? 81.601  16.241 5.359   1.00 52.59  ? 466  GLU B CG    1 
ATOM   5075 C  CD    . GLU B 1 289 ? 81.558  14.881 6.049   1.00 52.28  ? 466  GLU B CD    1 
ATOM   5076 O  OE1   . GLU B 1 289 ? 81.800  13.885 5.349   1.00 53.16  ? 466  GLU B OE1   1 
ATOM   5077 O  OE2   . GLU B 1 289 ? 81.287  14.801 7.271   1.00 51.07  ? 466  GLU B OE2   1 
ATOM   5078 N  N     . THR B 1 290 ? 79.506  20.093 6.786   1.00 52.78  ? 467  THR B N     1 
ATOM   5079 C  CA    . THR B 1 290 ? 78.339  20.766 7.336   1.00 53.61  ? 467  THR B CA    1 
ATOM   5080 C  C     . THR B 1 290 ? 78.079  22.016 6.541   1.00 52.25  ? 467  THR B C     1 
ATOM   5081 O  O     . THR B 1 290 ? 76.940  22.324 6.278   1.00 53.29  ? 467  THR B O     1 
ATOM   5082 C  CB    . THR B 1 290 ? 78.448  21.092 8.857   1.00 54.44  ? 467  THR B CB    1 
ATOM   5083 O  OG1   . THR B 1 290 ? 79.242  22.271 9.052   1.00 56.68  ? 467  THR B OG1   1 
ATOM   5084 C  CG2   . THR B 1 290 ? 79.051  19.901 9.645   1.00 54.81  ? 467  THR B CG2   1 
ATOM   5085 N  N     . VAL B 1 291 ? 79.122  22.683 6.072   1.00 51.04  ? 468  VAL B N     1 
ATOM   5086 C  CA    . VAL B 1 291 ? 78.906  23.842 5.208   1.00 50.40  ? 468  VAL B CA    1 
ATOM   5087 C  C     . VAL B 1 291 ? 78.215  23.432 3.898   1.00 51.20  ? 468  VAL B C     1 
ATOM   5088 O  O     . VAL B 1 291 ? 77.428  24.198 3.336   1.00 51.02  ? 468  VAL B O     1 
ATOM   5089 C  CB    . VAL B 1 291 ? 80.196  24.585 4.885   1.00 50.07  ? 468  VAL B CB    1 
ATOM   5090 C  CG1   . VAL B 1 291 ? 79.887  25.780 4.037   1.00 48.85  ? 468  VAL B CG1   1 
ATOM   5091 C  CG2   . VAL B 1 291 ? 80.881  25.031 6.166   1.00 50.57  ? 468  VAL B CG2   1 
ATOM   5092 N  N     . THR B 1 292 ? 78.480  22.205 3.442   1.00 51.26  ? 469  THR B N     1 
ATOM   5093 C  CA    . THR B 1 292 ? 77.893  21.689 2.211   1.00 50.89  ? 469  THR B CA    1 
ATOM   5094 C  C     . THR B 1 292 ? 76.392  21.511 2.309   1.00 50.54  ? 469  THR B C     1 
ATOM   5095 O  O     . THR B 1 292 ? 75.687  21.599 1.313   1.00 50.26  ? 469  THR B O     1 
ATOM   5096 C  CB    . THR B 1 292 ? 78.501  20.333 1.807   1.00 50.84  ? 469  THR B CB    1 
ATOM   5097 O  OG1   . THR B 1 292 ? 79.842  20.534 1.339   1.00 51.18  ? 469  THR B OG1   1 
ATOM   5098 C  CG2   . THR B 1 292 ? 77.660  19.669 0.706   1.00 49.14  ? 469  THR B CG2   1 
ATOM   5099 N  N     . LYS B 1 293 ? 75.907  21.247 3.508   1.00 50.53  ? 470  LYS B N     1 
ATOM   5100 C  CA    . LYS B 1 293 ? 74.473  21.165 3.728   1.00 51.04  ? 470  LYS B CA    1 
ATOM   5101 C  C     . LYS B 1 293 ? 73.762  22.458 3.294   1.00 49.35  ? 470  LYS B C     1 
ATOM   5102 O  O     . LYS B 1 293 ? 72.656  22.403 2.825   1.00 48.88  ? 470  LYS B O     1 
ATOM   5103 C  CB    . LYS B 1 293 ? 74.174  20.881 5.203   1.00 52.36  ? 470  LYS B CB    1 
ATOM   5104 C  CG    . LYS B 1 293 ? 74.913  19.668 5.801   1.00 56.65  ? 470  LYS B CG    1 
ATOM   5105 C  CD    . LYS B 1 293 ? 74.170  18.335 5.524   1.00 63.02  ? 470  LYS B CD    1 
ATOM   5106 C  CE    . LYS B 1 293 ? 72.859  18.186 6.341   1.00 65.86  ? 470  LYS B CE    1 
ATOM   5107 N  NZ    . LYS B 1 293 ? 72.879  18.968 7.630   1.00 65.82  ? 470  LYS B NZ    1 
ATOM   5108 N  N     . LEU B 1 294 ? 74.401  23.612 3.458   1.00 48.44  ? 471  LEU B N     1 
ATOM   5109 C  CA    . LEU B 1 294 ? 73.832  24.904 3.013   1.00 47.66  ? 471  LEU B CA    1 
ATOM   5110 C  C     . LEU B 1 294 ? 74.247  25.299 1.598   1.00 47.01  ? 471  LEU B C     1 
ATOM   5111 O  O     . LEU B 1 294 ? 73.560  26.071 0.950   1.00 45.89  ? 471  LEU B O     1 
ATOM   5112 C  CB    . LEU B 1 294 ? 74.307  26.041 3.923   1.00 48.03  ? 471  LEU B CB    1 
ATOM   5113 C  CG    . LEU B 1 294 ? 73.771  26.113 5.346   1.00 47.66  ? 471  LEU B CG    1 
ATOM   5114 C  CD1   . LEU B 1 294 ? 74.542  27.191 6.112   1.00 46.10  ? 471  LEU B CD1   1 
ATOM   5115 C  CD2   . LEU B 1 294 ? 72.271  26.387 5.328   1.00 46.52  ? 471  LEU B CD2   1 
ATOM   5116 N  N     . PHE B 1 295 ? 75.471  24.919 1.228   1.00 46.94  ? 472  PHE B N     1 
ATOM   5117 C  CA    . PHE B 1 295 ? 76.075  25.248 -0.064  1.00 46.70  ? 472  PHE B CA    1 
ATOM   5118 C  C     . PHE B 1 295 ? 76.592  23.985 -0.752  1.00 47.14  ? 472  PHE B C     1 
ATOM   5119 O  O     . PHE B 1 295 ? 77.777  23.648 -0.674  1.00 47.40  ? 472  PHE B O     1 
ATOM   5120 C  CB    . PHE B 1 295 ? 77.225  26.225 0.124   1.00 46.05  ? 472  PHE B CB    1 
ATOM   5121 C  CG    . PHE B 1 295 ? 76.834  27.439 0.853   1.00 46.17  ? 472  PHE B CG    1 
ATOM   5122 C  CD1   . PHE B 1 295 ? 77.226  27.634 2.154   1.00 47.68  ? 472  PHE B CD1   1 
ATOM   5123 C  CD2   . PHE B 1 295 ? 75.996  28.364 0.263   1.00 46.47  ? 472  PHE B CD2   1 
ATOM   5124 C  CE1   . PHE B 1 295 ? 76.819  28.743 2.842   1.00 47.53  ? 472  PHE B CE1   1 
ATOM   5125 C  CE2   . PHE B 1 295 ? 75.589  29.483 0.938   1.00 46.55  ? 472  PHE B CE2   1 
ATOM   5126 C  CZ    . PHE B 1 295 ? 75.990  29.673 2.225   1.00 49.35  ? 472  PHE B CZ    1 
ATOM   5127 N  N     . PRO B 1 296 ? 75.695  23.276 -1.441  1.00 47.92  ? 473  PRO B N     1 
ATOM   5128 C  CA    . PRO B 1 296 ? 76.049  21.958 -1.979  1.00 47.93  ? 473  PRO B CA    1 
ATOM   5129 C  C     . PRO B 1 296 ? 77.128  21.993 -3.072  1.00 47.97  ? 473  PRO B C     1 
ATOM   5130 O  O     . PRO B 1 296 ? 77.813  20.988 -3.286  1.00 48.67  ? 473  PRO B O     1 
ATOM   5131 C  CB    . PRO B 1 296 ? 74.713  21.406 -2.487  1.00 48.15  ? 473  PRO B CB    1 
ATOM   5132 C  CG    . PRO B 1 296 ? 73.764  22.591 -2.566  1.00 47.40  ? 473  PRO B CG    1 
ATOM   5133 C  CD    . PRO B 1 296 ? 74.303  23.680 -1.726  1.00 47.67  ? 473  PRO B CD    1 
ATOM   5134 N  N     . MET B 1 297 ? 77.313  23.141 -3.713  1.00 47.93  ? 474  MET B N     1 
ATOM   5135 C  CA    . MET B 1 297 ? 78.437  23.330 -4.635  1.00 48.73  ? 474  MET B CA    1 
ATOM   5136 C  C     . MET B 1 297 ? 79.788  23.187 -3.951  1.00 48.72  ? 474  MET B C     1 
ATOM   5137 O  O     . MET B 1 297 ? 80.779  22.903 -4.608  1.00 49.47  ? 474  MET B O     1 
ATOM   5138 C  CB    . MET B 1 297 ? 78.372  24.703 -5.312  1.00 49.61  ? 474  MET B CB    1 
ATOM   5139 C  CG    . MET B 1 297 ? 78.288  25.921 -4.348  1.00 51.84  ? 474  MET B CG    1 
ATOM   5140 S  SD    . MET B 1 297 ? 76.639  26.258 -3.622  1.00 54.93  ? 474  MET B SD    1 
ATOM   5141 C  CE    . MET B 1 297 ? 75.552  26.116 -5.055  1.00 51.76  ? 474  MET B CE    1 
ATOM   5142 N  N     . VAL B 1 298 ? 79.829  23.351 -2.631  1.00 48.50  ? 475  VAL B N     1 
ATOM   5143 C  CA    . VAL B 1 298 ? 81.077  23.178 -1.896  1.00 48.23  ? 475  VAL B CA    1 
ATOM   5144 C  C     . VAL B 1 298 ? 81.594  21.738 -1.953  1.00 49.57  ? 475  VAL B C     1 
ATOM   5145 O  O     . VAL B 1 298 ? 82.802  21.493 -1.824  1.00 49.35  ? 475  VAL B O     1 
ATOM   5146 C  CB    . VAL B 1 298 ? 80.948  23.642 -0.430  1.00 48.66  ? 475  VAL B CB    1 
ATOM   5147 C  CG1   . VAL B 1 298 ? 82.095  23.093 0.414   1.00 46.48  ? 475  VAL B CG1   1 
ATOM   5148 C  CG2   . VAL B 1 298 ? 80.881  25.191 -0.359  1.00 43.93  ? 475  VAL B CG2   1 
ATOM   5149 N  N     . GLU B 1 299 ? 80.701  20.778 -2.189  1.00 50.81  ? 476  GLU B N     1 
ATOM   5150 C  CA    . GLU B 1 299 ? 81.126  19.376 -2.199  1.00 51.40  ? 476  GLU B CA    1 
ATOM   5151 C  C     . GLU B 1 299 ? 82.115  19.141 -3.334  1.00 51.66  ? 476  GLU B C     1 
ATOM   5152 O  O     . GLU B 1 299 ? 83.218  18.652 -3.108  1.00 52.10  ? 476  GLU B O     1 
ATOM   5153 C  CB    . GLU B 1 299 ? 79.950  18.406 -2.342  1.00 51.12  ? 476  GLU B CB    1 
ATOM   5154 C  CG    . GLU B 1 299 ? 80.402  16.965 -2.337  1.00 50.22  ? 476  GLU B CG    1 
ATOM   5155 C  CD    . GLU B 1 299 ? 79.275  15.986 -2.451  1.00 51.73  ? 476  GLU B CD    1 
ATOM   5156 O  OE1   . GLU B 1 299 ? 78.259  16.147 -1.755  1.00 54.41  ? 476  GLU B OE1   1 
ATOM   5157 O  OE2   . GLU B 1 299 ? 79.421  15.015 -3.215  1.00 54.15  ? 476  GLU B OE2   1 
ATOM   5158 N  N     . GLU B 1 300 ? 81.721  19.502 -4.546  1.00 51.68  ? 477  GLU B N     1 
ATOM   5159 C  CA    . GLU B 1 300 ? 82.539  19.195 -5.696  1.00 52.42  ? 477  GLU B CA    1 
ATOM   5160 C  C     . GLU B 1 300 ? 83.849  20.010 -5.695  1.00 51.77  ? 477  GLU B C     1 
ATOM   5161 O  O     . GLU B 1 300 ? 84.899  19.499 -6.061  1.00 51.57  ? 477  GLU B O     1 
ATOM   5162 C  CB    . GLU B 1 300 ? 81.739  19.437 -6.972  1.00 53.14  ? 477  GLU B CB    1 
ATOM   5163 C  CG    . GLU B 1 300 ? 82.617  19.616 -8.214  1.00 57.35  ? 477  GLU B CG    1 
ATOM   5164 C  CD    . GLU B 1 300 ? 81.824  19.870 -9.494  1.00 60.39  ? 477  GLU B CD    1 
ATOM   5165 O  OE1   . GLU B 1 300 ? 81.403  18.892 -10.138 1.00 63.95  ? 477  GLU B OE1   1 
ATOM   5166 O  OE2   . GLU B 1 300 ? 81.655  21.049 -9.867  1.00 61.79  ? 477  GLU B OE2   1 
ATOM   5167 N  N     . ILE B 1 301 ? 83.781  21.265 -5.263  1.00 51.03  ? 478  ILE B N     1 
ATOM   5168 C  CA    . ILE B 1 301 ? 84.920  22.179 -5.343  1.00 50.57  ? 478  ILE B CA    1 
ATOM   5169 C  C     . ILE B 1 301 ? 85.892  22.032 -4.165  1.00 51.65  ? 478  ILE B C     1 
ATOM   5170 O  O     . ILE B 1 301 ? 87.092  22.236 -4.337  1.00 52.38  ? 478  ILE B O     1 
ATOM   5171 C  CB    . ILE B 1 301 ? 84.447  23.667 -5.419  1.00 50.05  ? 478  ILE B CB    1 
ATOM   5172 C  CG1   . ILE B 1 301 ? 83.604  23.898 -6.681  1.00 48.40  ? 478  ILE B CG1   1 
ATOM   5173 C  CG2   . ILE B 1 301 ? 85.635  24.644 -5.344  1.00 45.99  ? 478  ILE B CG2   1 
ATOM   5174 C  CD1   . ILE B 1 301 ? 84.244  23.392 -7.984  1.00 45.64  ? 478  ILE B CD1   1 
ATOM   5175 N  N     . MET B 1 302 ? 85.391  21.671 -2.982  1.00 51.83  ? 479  MET B N     1 
ATOM   5176 C  CA    . MET B 1 302 ? 86.248  21.610 -1.787  1.00 52.39  ? 479  MET B CA    1 
ATOM   5177 C  C     . MET B 1 302 ? 86.344  20.271 -1.049  1.00 51.56  ? 479  MET B C     1 
ATOM   5178 O  O     . MET B 1 302 ? 87.399  19.935 -0.524  1.00 50.98  ? 479  MET B O     1 
ATOM   5179 C  CB    . MET B 1 302 ? 85.858  22.702 -0.810  1.00 52.79  ? 479  MET B CB    1 
ATOM   5180 C  CG    . MET B 1 302 ? 86.422  24.025 -1.236  1.00 55.99  ? 479  MET B CG    1 
ATOM   5181 S  SD    . MET B 1 302 ? 85.164  25.277 -1.289  1.00 59.72  ? 479  MET B SD    1 
ATOM   5182 C  CE    . MET B 1 302 ? 85.681  26.344 0.055   1.00 50.77  ? 479  MET B CE    1 
ATOM   5183 N  N     . LEU B 1 303 ? 85.276  19.493 -1.018  1.00 50.93  ? 480  LEU B N     1 
ATOM   5184 C  CA    . LEU B 1 303 ? 85.377  18.191 -0.376  1.00 50.56  ? 480  LEU B CA    1 
ATOM   5185 C  C     . LEU B 1 303 ? 86.232  17.242 -1.236  1.00 50.11  ? 480  LEU B C     1 
ATOM   5186 O  O     . LEU B 1 303 ? 87.106  16.543 -0.735  1.00 50.18  ? 480  LEU B O     1 
ATOM   5187 C  CB    . LEU B 1 303 ? 83.981  17.612 -0.049  1.00 50.50  ? 480  LEU B CB    1 
ATOM   5188 C  CG    . LEU B 1 303 ? 83.371  18.088 1.288   1.00 49.88  ? 480  LEU B CG    1 
ATOM   5189 C  CD1   . LEU B 1 303 ? 81.957  17.561 1.495   1.00 47.82  ? 480  LEU B CD1   1 
ATOM   5190 C  CD2   . LEU B 1 303 ? 84.251  17.708 2.483   1.00 49.02  ? 480  LEU B CD2   1 
ATOM   5191 N  N     . GLN B 1 304 ? 86.041  17.289 -2.539  1.00 49.59  ? 481  GLN B N     1 
ATOM   5192 C  CA    . GLN B 1 304 ? 86.731  16.377 -3.423  1.00 49.98  ? 481  GLN B CA    1 
ATOM   5193 C  C     . GLN B 1 304 ? 88.256  16.543 -3.256  1.00 48.71  ? 481  GLN B C     1 
ATOM   5194 O  O     . GLN B 1 304 ? 88.959  15.580 -2.965  1.00 48.47  ? 481  GLN B O     1 
ATOM   5195 C  CB    . GLN B 1 304 ? 86.200  16.565 -4.861  1.00 50.56  ? 481  GLN B CB    1 
ATOM   5196 C  CG    . GLN B 1 304 ? 86.951  15.871 -6.003  1.00 55.76  ? 481  GLN B CG    1 
ATOM   5197 C  CD    . GLN B 1 304 ? 87.046  14.339 -5.846  1.00 62.31  ? 481  GLN B CD    1 
ATOM   5198 O  OE1   . GLN B 1 304 ? 86.047  13.668 -5.547  1.00 65.55  ? 481  GLN B OE1   1 
ATOM   5199 N  NE2   . GLN B 1 304 ? 88.255  13.783 -6.075  1.00 61.70  ? 481  GLN B NE2   1 
ATOM   5200 N  N     . PRO B 1 305 ? 88.761  17.775 -3.314  1.00 47.88  ? 482  PRO B N     1 
ATOM   5201 C  CA    . PRO B 1 305 ? 90.188  17.965 -3.064  1.00 47.56  ? 482  PRO B CA    1 
ATOM   5202 C  C     . PRO B 1 305 ? 90.626  17.416 -1.704  1.00 47.51  ? 482  PRO B C     1 
ATOM   5203 O  O     . PRO B 1 305 ? 91.711  16.836 -1.568  1.00 47.59  ? 482  PRO B O     1 
ATOM   5204 C  CB    . PRO B 1 305 ? 90.349  19.489 -3.051  1.00 47.85  ? 482  PRO B CB    1 
ATOM   5205 C  CG    . PRO B 1 305 ? 89.172  20.031 -3.718  1.00 47.73  ? 482  PRO B CG    1 
ATOM   5206 C  CD    . PRO B 1 305 ? 88.065  19.037 -3.606  1.00 47.94  ? 482  PRO B CD    1 
ATOM   5207 N  N     . LEU B 1 306 ? 89.814  17.651 -0.686  1.00 46.69  ? 483  LEU B N     1 
ATOM   5208 C  CA    . LEU B 1 306 ? 90.136  17.147 0.631   1.00 46.54  ? 483  LEU B CA    1 
ATOM   5209 C  C     . LEU B 1 306 ? 90.155  15.619 0.663   1.00 46.85  ? 483  LEU B C     1 
ATOM   5210 O  O     . LEU B 1 306 ? 91.015  15.057 1.314   1.00 47.53  ? 483  LEU B O     1 
ATOM   5211 C  CB    . LEU B 1 306 ? 89.168  17.703 1.681   1.00 46.59  ? 483  LEU B CB    1 
ATOM   5212 C  CG    . LEU B 1 306 ? 89.228  19.186 2.094   1.00 45.90  ? 483  LEU B CG    1 
ATOM   5213 C  CD1   . LEU B 1 306 ? 88.063  19.513 3.044   1.00 42.36  ? 483  LEU B CD1   1 
ATOM   5214 C  CD2   . LEU B 1 306 ? 90.570  19.559 2.735   1.00 44.35  ? 483  LEU B CD2   1 
ATOM   5215 N  N     . TRP B 1 307 ? 89.255  14.945 -0.057  1.00 46.64  ? 484  TRP B N     1 
ATOM   5216 C  CA    . TRP B 1 307 ? 89.311  13.484 -0.134  1.00 46.94  ? 484  TRP B CA    1 
ATOM   5217 C  C     . TRP B 1 307 ? 90.591  13.009 -0.820  1.00 47.48  ? 484  TRP B C     1 
ATOM   5218 O  O     . TRP B 1 307 ? 91.239  12.073 -0.344  1.00 47.39  ? 484  TRP B O     1 
ATOM   5219 C  CB    . TRP B 1 307 ? 88.097  12.917 -0.862  1.00 46.68  ? 484  TRP B CB    1 
ATOM   5220 C  CG    . TRP B 1 307 ? 86.805  13.242 -0.235  1.00 46.45  ? 484  TRP B CG    1 
ATOM   5221 C  CD1   . TRP B 1 307 ? 86.566  13.393 1.083   1.00 46.77  ? 484  TRP B CD1   1 
ATOM   5222 C  CD2   . TRP B 1 307 ? 85.555  13.453 -0.899  1.00 46.48  ? 484  TRP B CD2   1 
ATOM   5223 N  NE1   . TRP B 1 307 ? 85.249  13.693 1.295   1.00 47.31  ? 484  TRP B NE1   1 
ATOM   5224 C  CE2   . TRP B 1 307 ? 84.601  13.730 0.093   1.00 46.00  ? 484  TRP B CE2   1 
ATOM   5225 C  CE3   . TRP B 1 307 ? 85.144  13.413 -2.236  1.00 48.61  ? 484  TRP B CE3   1 
ATOM   5226 C  CZ2   . TRP B 1 307 ? 83.257  13.958 -0.197  1.00 45.81  ? 484  TRP B CZ2   1 
ATOM   5227 C  CZ3   . TRP B 1 307 ? 83.798  13.647 -2.529  1.00 47.05  ? 484  TRP B CZ3   1 
ATOM   5228 C  CH2   . TRP B 1 307 ? 82.877  13.928 -1.509  1.00 46.41  ? 484  TRP B CH2   1 
ATOM   5229 N  N     . GLU B 1 308 ? 90.917  13.634 -1.956  1.00 47.78  ? 485  GLU B N     1 
ATOM   5230 C  CA    . GLU B 1 308 ? 92.107  13.306 -2.727  1.00 48.74  ? 485  GLU B CA    1 
ATOM   5231 C  C     . GLU B 1 308 ? 93.355  13.419 -1.830  1.00 48.56  ? 485  GLU B C     1 
ATOM   5232 O  O     . GLU B 1 308 ? 94.228  12.534 -1.815  1.00 48.65  ? 485  GLU B O     1 
ATOM   5233 C  CB    . GLU B 1 308 ? 92.240  14.248 -3.944  1.00 49.70  ? 485  GLU B CB    1 
ATOM   5234 C  CG    . GLU B 1 308 ? 91.316  13.943 -5.176  1.00 52.97  ? 485  GLU B CG    1 
ATOM   5235 C  CD    . GLU B 1 308 ? 91.427  14.995 -6.315  1.00 57.18  ? 485  GLU B CD    1 
ATOM   5236 O  OE1   . GLU B 1 308 ? 90.731  16.028 -6.275  1.00 59.69  ? 485  GLU B OE1   1 
ATOM   5237 O  OE2   . GLU B 1 308 ? 92.203  14.793 -7.269  1.00 60.63  ? 485  GLU B OE2   1 
ATOM   5238 N  N     . SER B 1 309 ? 93.420  14.498 -1.062  1.00 47.67  ? 486  SER B N     1 
ATOM   5239 C  CA    . SER B 1 309 ? 94.571  14.756 -0.205  1.00 47.20  ? 486  SER B CA    1 
ATOM   5240 C  C     . SER B 1 309 ? 94.632  13.719 0.915   1.00 47.18  ? 486  SER B C     1 
ATOM   5241 O  O     . SER B 1 309 ? 95.691  13.176 1.222   1.00 47.41  ? 486  SER B O     1 
ATOM   5242 C  CB    . SER B 1 309 ? 94.504  16.174 0.383   1.00 46.94  ? 486  SER B CB    1 
ATOM   5243 O  OG    . SER B 1 309 ? 95.550  16.401 1.295   1.00 44.50  ? 486  SER B OG    1 
ATOM   5244 N  N     . ARG B 1 310 ? 93.491  13.436 1.518   1.00 46.17  ? 487  ARG B N     1 
ATOM   5245 C  CA    . ARG B 1 310 ? 93.442  12.432 2.558   1.00 45.83  ? 487  ARG B CA    1 
ATOM   5246 C  C     . ARG B 1 310 ? 94.041  11.145 2.027   1.00 45.78  ? 487  ARG B C     1 
ATOM   5247 O  O     . ARG B 1 310 ? 94.947  10.581 2.632   1.00 46.04  ? 487  ARG B O     1 
ATOM   5248 C  CB    . ARG B 1 310 ? 91.998  12.217 3.034   1.00 45.61  ? 487  ARG B CB    1 
ATOM   5249 C  CG    . ARG B 1 310 ? 91.733  10.913 3.792   1.00 45.63  ? 487  ARG B CG    1 
ATOM   5250 C  CD    . ARG B 1 310 ? 90.249  10.562 3.772   1.00 44.89  ? 487  ARG B CD    1 
ATOM   5251 N  NE    . ARG B 1 310 ? 89.812  10.179 2.432   1.00 44.36  ? 487  ARG B NE    1 
ATOM   5252 C  CZ    . ARG B 1 310 ? 88.542  10.112 2.048   1.00 45.42  ? 487  ARG B CZ    1 
ATOM   5253 N  NH1   . ARG B 1 310 ? 87.576  10.421 2.891   1.00 47.50  ? 487  ARG B NH1   1 
ATOM   5254 N  NH2   . ARG B 1 310 ? 88.234  9.789  0.805   1.00 44.07  ? 487  ARG B NH2   1 
ATOM   5255 N  N     . ASP B 1 311 ? 93.569  10.712 0.866   1.00 45.79  ? 488  ASP B N     1 
ATOM   5256 C  CA    . ASP B 1 311 ? 93.948  9.411  0.306   1.00 45.27  ? 488  ASP B CA    1 
ATOM   5257 C  C     . ASP B 1 311 ? 95.425  9.401  -0.057  1.00 45.22  ? 488  ASP B C     1 
ATOM   5258 O  O     . ASP B 1 311 ? 96.102  8.386  0.079   1.00 44.30  ? 488  ASP B O     1 
ATOM   5259 C  CB    . ASP B 1 311 ? 93.104  9.117  -0.948  1.00 44.97  ? 488  ASP B CB    1 
ATOM   5260 C  CG    . ASP B 1 311 ? 91.653  8.794  -0.631  1.00 42.80  ? 488  ASP B CG    1 
ATOM   5261 O  OD1   . ASP B 1 311 ? 91.290  8.717  0.548   1.00 43.57  ? 488  ASP B OD1   1 
ATOM   5262 O  OD2   . ASP B 1 311 ? 90.875  8.578  -1.571  1.00 40.54  ? 488  ASP B OD2   1 
ATOM   5263 N  N     . ARG B 1 312 ? 95.900  10.547 -0.529  1.00 46.36  ? 489  ARG B N     1 
ATOM   5264 C  CA    . ARG B 1 312 ? 97.284  10.696 -0.888  1.00 47.94  ? 489  ARG B CA    1 
ATOM   5265 C  C     . ARG B 1 312 ? 98.115  10.525 0.377   1.00 47.34  ? 489  ARG B C     1 
ATOM   5266 O  O     . ARG B 1 312 ? 99.075  9.748  0.406   1.00 46.96  ? 489  ARG B O     1 
ATOM   5267 C  CB    . ARG B 1 312 ? 97.529  12.061 -1.541  1.00 49.27  ? 489  ARG B CB    1 
ATOM   5268 C  CG    . ARG B 1 312 ? 99.015  12.425 -1.637  1.00 54.78  ? 489  ARG B CG    1 
ATOM   5269 C  CD    . ARG B 1 312 ? 99.317  13.667 -2.500  1.00 61.13  ? 489  ARG B CD    1 
ATOM   5270 N  NE    . ARG B 1 312 ? 100.770 13.905 -2.570  1.00 66.36  ? 489  ARG B NE    1 
ATOM   5271 C  CZ    . ARG B 1 312 ? 101.462 14.753 -1.797  1.00 69.55  ? 489  ARG B CZ    1 
ATOM   5272 N  NH1   . ARG B 1 312 ? 100.864 15.534 -0.899  1.00 69.45  ? 489  ARG B NH1   1 
ATOM   5273 N  NH2   . ARG B 1 312 ? 102.779 14.833 -1.945  1.00 71.19  ? 489  ARG B NH2   1 
ATOM   5274 N  N     . TYR B 1 313 ? 97.708  11.208 1.443   1.00 47.18  ? 490  TYR B N     1 
ATOM   5275 C  CA    . TYR B 1 313 ? 98.472  11.190 2.698   1.00 46.73  ? 490  TYR B CA    1 
ATOM   5276 C  C     . TYR B 1 313 ? 98.386  9.858  3.441   1.00 46.47  ? 490  TYR B C     1 
ATOM   5277 O  O     . TYR B 1 313 ? 99.374  9.434  4.025   1.00 46.04  ? 490  TYR B O     1 
ATOM   5278 C  CB    . TYR B 1 313 ? 98.102  12.371 3.613   1.00 46.40  ? 490  TYR B CB    1 
ATOM   5279 C  CG    . TYR B 1 313 ? 98.797  13.681 3.239   1.00 46.50  ? 490  TYR B CG    1 
ATOM   5280 C  CD1   . TYR B 1 313 ? 100.182 13.787 3.259   1.00 47.78  ? 490  TYR B CD1   1 
ATOM   5281 C  CD2   . TYR B 1 313 ? 98.071  14.809 2.874   1.00 48.40  ? 490  TYR B CD2   1 
ATOM   5282 C  CE1   . TYR B 1 313 ? 100.828 14.966 2.913   1.00 46.79  ? 490  TYR B CE1   1 
ATOM   5283 C  CE2   . TYR B 1 313 ? 98.711  16.005 2.545   1.00 47.67  ? 490  TYR B CE2   1 
ATOM   5284 C  CZ    . TYR B 1 313 ? 100.093 16.065 2.553   1.00 47.24  ? 490  TYR B CZ    1 
ATOM   5285 O  OH    . TYR B 1 313 ? 100.750 17.229 2.216   1.00 47.98  ? 490  TYR B OH    1 
ATOM   5286 N  N     . GLU B 1 314 ? 97.242  9.175  3.391   1.00 46.78  ? 491  GLU B N     1 
ATOM   5287 C  CA    . GLU B 1 314 ? 97.161  7.812  3.949   1.00 47.21  ? 491  GLU B CA    1 
ATOM   5288 C  C     . GLU B 1 314 ? 98.159  6.923  3.215   1.00 47.27  ? 491  GLU B C     1 
ATOM   5289 O  O     . GLU B 1 314 ? 98.906  6.151  3.829   1.00 46.31  ? 491  GLU B O     1 
ATOM   5290 C  CB    . GLU B 1 314 ? 95.745  7.212  3.862   1.00 46.97  ? 491  GLU B CB    1 
ATOM   5291 C  CG    . GLU B 1 314 ? 94.651  8.112  4.433   1.00 48.00  ? 491  GLU B CG    1 
ATOM   5292 C  CD    . GLU B 1 314 ? 93.555  7.374  5.171   1.00 48.23  ? 491  GLU B CD    1 
ATOM   5293 O  OE1   . GLU B 1 314 ? 93.737  7.112  6.378   1.00 48.10  ? 491  GLU B OE1   1 
ATOM   5294 O  OE2   . GLU B 1 314 ? 92.485  7.115  4.566   1.00 50.99  ? 491  GLU B OE2   1 
ATOM   5295 N  N     . GLU B 1 315 ? 98.208  7.098  1.898   1.00 47.74  ? 492  GLU B N     1 
ATOM   5296 C  CA    . GLU B 1 315 ? 99.105  6.313  1.057   1.00 48.17  ? 492  GLU B CA    1 
ATOM   5297 C  C     . GLU B 1 315 ? 100.583 6.626  1.360   1.00 48.61  ? 492  GLU B C     1 
ATOM   5298 O  O     . GLU B 1 315 ? 101.392 5.708  1.462   1.00 48.51  ? 492  GLU B O     1 
ATOM   5299 C  CB    . GLU B 1 315 ? 98.776  6.526  -0.429  1.00 47.56  ? 492  GLU B CB    1 
ATOM   5300 C  CG    . GLU B 1 315 ? 99.767  5.887  -1.411  1.00 46.57  ? 492  GLU B CG    1 
ATOM   5301 C  CD    . GLU B 1 315 ? 99.730  4.353  -1.420  1.00 43.85  ? 492  GLU B CD    1 
ATOM   5302 O  OE1   . GLU B 1 315 ? 99.095  3.783  -0.513  1.00 42.43  ? 492  GLU B OE1   1 
ATOM   5303 O  OE2   . GLU B 1 315 ? 100.346 3.726  -2.323  1.00 39.71  ? 492  GLU B OE2   1 
ATOM   5304 N  N     . LEU B 1 316 ? 100.925 7.903  1.548   1.00 48.84  ? 493  LEU B N     1 
ATOM   5305 C  CA    . LEU B 1 316 ? 102.272 8.249  1.990   1.00 49.23  ? 493  LEU B CA    1 
ATOM   5306 C  C     . LEU B 1 316 ? 102.610 7.576  3.325   1.00 49.64  ? 493  LEU B C     1 
ATOM   5307 O  O     . LEU B 1 316 ? 103.718 7.066  3.499   1.00 49.64  ? 493  LEU B O     1 
ATOM   5308 C  CB    . LEU B 1 316 ? 102.452 9.762  2.104   1.00 49.77  ? 493  LEU B CB    1 
ATOM   5309 C  CG    . LEU B 1 316 ? 103.226 10.515 0.999   1.00 51.28  ? 493  LEU B CG    1 
ATOM   5310 C  CD1   . LEU B 1 316 ? 103.367 9.717  -0.318  1.00 51.61  ? 493  LEU B CD1   1 
ATOM   5311 C  CD2   . LEU B 1 316 ? 102.571 11.910 0.737   1.00 53.45  ? 493  LEU B CD2   1 
ATOM   5312 N  N     . LYS B 1 317 ? 101.665 7.545  4.265   1.00 49.74  ? 494  LYS B N     1 
ATOM   5313 C  CA    . LYS B 1 317 ? 101.940 6.902  5.554   1.00 50.06  ? 494  LYS B CA    1 
ATOM   5314 C  C     . LYS B 1 317 ? 102.134 5.406  5.397   1.00 49.46  ? 494  LYS B C     1 
ATOM   5315 O  O     . LYS B 1 317 ? 102.936 4.815  6.098   1.00 49.13  ? 494  LYS B O     1 
ATOM   5316 C  CB    . LYS B 1 317 ? 100.841 7.162  6.589   1.00 50.43  ? 494  LYS B CB    1 
ATOM   5317 C  CG    . LYS B 1 317 ? 101.212 6.686  8.010   1.00 50.87  ? 494  LYS B CG    1 
ATOM   5318 C  CD    . LYS B 1 317 ? 99.995  6.658  8.947   1.00 52.15  ? 494  LYS B CD    1 
ATOM   5319 C  CE    . LYS B 1 317 ? 100.357 6.177  10.357  1.00 52.65  ? 494  LYS B CE    1 
ATOM   5320 N  NZ    . LYS B 1 317 ? 101.083 4.873  10.340  1.00 52.29  ? 494  LYS B NZ    1 
ATOM   5321 N  N     . ARG B 1 318 ? 101.381 4.800  4.494   1.00 48.92  ? 495  ARG B N     1 
ATOM   5322 C  CA    . ARG B 1 318 ? 101.438 3.369  4.315   1.00 49.25  ? 495  ARG B CA    1 
ATOM   5323 C  C     . ARG B 1 318 ? 102.847 3.048  3.827   1.00 47.92  ? 495  ARG B C     1 
ATOM   5324 O  O     . ARG B 1 318 ? 103.455 2.079  4.256   1.00 46.50  ? 495  ARG B O     1 
ATOM   5325 C  CB    . ARG B 1 318 ? 100.351 2.950  3.320   1.00 50.15  ? 495  ARG B CB    1 
ATOM   5326 C  CG    . ARG B 1 318 ? 100.228 1.448  3.006   1.00 55.64  ? 495  ARG B CG    1 
ATOM   5327 C  CD    . ARG B 1 318 ? 98.765  1.021  2.622   1.00 61.64  ? 495  ARG B CD    1 
ATOM   5328 N  NE    . ARG B 1 318 ? 97.997  2.058  1.894   1.00 66.46  ? 495  ARG B NE    1 
ATOM   5329 C  CZ    . ARG B 1 318 ? 97.094  2.907  2.429   1.00 66.53  ? 495  ARG B CZ    1 
ATOM   5330 N  NH1   . ARG B 1 318 ? 96.798  2.875  3.733   1.00 66.26  ? 495  ARG B NH1   1 
ATOM   5331 N  NH2   . ARG B 1 318 ? 96.493  3.817  1.647   1.00 63.50  ? 495  ARG B NH2   1 
ATOM   5332 N  N     . ILE B 1 319 ? 103.395 3.956  3.028   1.00 47.58  ? 496  ILE B N     1 
ATOM   5333 C  CA    . ILE B 1 319 ? 104.745 3.822  2.485   1.00 48.09  ? 496  ILE B CA    1 
ATOM   5334 C  C     . ILE B 1 319 ? 105.830 4.096  3.539   1.00 48.96  ? 496  ILE B C     1 
ATOM   5335 O  O     . ILE B 1 319 ? 106.742 3.281  3.739   1.00 49.37  ? 496  ILE B O     1 
ATOM   5336 C  CB    . ILE B 1 319 ? 104.954 4.792  1.299   1.00 47.56  ? 496  ILE B CB    1 
ATOM   5337 C  CG1   . ILE B 1 319 ? 104.073 4.406  0.111   1.00 46.61  ? 496  ILE B CG1   1 
ATOM   5338 C  CG2   . ILE B 1 319 ? 106.405 4.825  0.871   1.00 47.63  ? 496  ILE B CG2   1 
ATOM   5339 C  CD1   . ILE B 1 319 ? 103.828 5.572  -0.884  1.00 47.28  ? 496  ILE B CD1   1 
ATOM   5340 N  N     . ASP B 1 320 ? 105.757 5.268  4.164   1.00 49.70  ? 497  ASP B N     1 
ATOM   5341 C  CA    . ASP B 1 320 ? 106.609 5.583  5.303   1.00 50.41  ? 497  ASP B CA    1 
ATOM   5342 C  C     . ASP B 1 320 ? 106.709 4.374  6.219   1.00 50.18  ? 497  ASP B C     1 
ATOM   5343 O  O     . ASP B 1 320 ? 107.804 3.930  6.508   1.00 50.07  ? 497  ASP B O     1 
ATOM   5344 C  CB    . ASP B 1 320 ? 106.061 6.780  6.088   1.00 51.09  ? 497  ASP B CB    1 
ATOM   5345 C  CG    . ASP B 1 320 ? 106.327 8.122  5.392   1.00 53.00  ? 497  ASP B CG    1 
ATOM   5346 O  OD1   . ASP B 1 320 ? 106.889 8.106  4.278   1.00 55.49  ? 497  ASP B OD1   1 
ATOM   5347 O  OD2   . ASP B 1 320 ? 105.959 9.190  5.954   1.00 53.11  ? 497  ASP B OD2   1 
ATOM   5348 N  N     . ASP B 1 321 ? 105.567 3.823  6.623   1.00 50.09  ? 498  ASP B N     1 
ATOM   5349 C  CA    . ASP B 1 321 ? 105.522 2.678  7.536   1.00 50.75  ? 498  ASP B CA    1 
ATOM   5350 C  C     . ASP B 1 321 ? 106.239 1.454  6.956   1.00 50.77  ? 498  ASP B C     1 
ATOM   5351 O  O     . ASP B 1 321 ? 106.812 0.653  7.691   1.00 50.74  ? 498  ASP B O     1 
ATOM   5352 C  CB    . ASP B 1 321 ? 104.068 2.266  7.823   1.00 51.32  ? 498  ASP B CB    1 
ATOM   5353 C  CG    . ASP B 1 321 ? 103.347 3.191  8.810   1.00 51.93  ? 498  ASP B CG    1 
ATOM   5354 O  OD1   . ASP B 1 321 ? 103.982 3.992  9.527   1.00 53.20  ? 498  ASP B OD1   1 
ATOM   5355 O  OD2   . ASP B 1 321 ? 102.109 3.082  8.882   1.00 53.02  ? 498  ASP B OD2   1 
ATOM   5356 N  N     . ALA B 1 322 ? 106.147 1.282  5.644   1.00 50.77  ? 499  ALA B N     1 
ATOM   5357 C  CA    . ALA B 1 322 ? 106.827 0.190  4.971   1.00 51.19  ? 499  ALA B CA    1 
ATOM   5358 C  C     . ALA B 1 322 ? 108.347 0.370  4.980   1.00 52.51  ? 499  ALA B C     1 
ATOM   5359 O  O     . ALA B 1 322 ? 109.083 -0.617 5.004   1.00 52.76  ? 499  ALA B O     1 
ATOM   5360 C  CB    . ALA B 1 322 ? 106.317 0.039  3.548   1.00 50.26  ? 499  ALA B CB    1 
ATOM   5361 N  N     . MET B 1 323 ? 108.826 1.611  4.951   1.00 54.00  ? 500  MET B N     1 
ATOM   5362 C  CA    . MET B 1 323 ? 110.246 1.863  5.196   1.00 55.40  ? 500  MET B CA    1 
ATOM   5363 C  C     . MET B 1 323 ? 110.591 1.600  6.652   1.00 56.46  ? 500  MET B C     1 
ATOM   5364 O  O     . MET B 1 323 ? 111.414 0.748  6.943   1.00 56.88  ? 500  MET B O     1 
ATOM   5365 C  CB    . MET B 1 323 ? 110.624 3.292  4.845   1.00 55.55  ? 500  MET B CB    1 
ATOM   5366 C  CG    . MET B 1 323 ? 110.483 3.609  3.379   1.00 57.44  ? 500  MET B CG    1 
ATOM   5367 S  SD    . MET B 1 323 ? 111.747 2.839  2.341   1.00 60.51  ? 500  MET B SD    1 
ATOM   5368 C  CE    . MET B 1 323 ? 111.334 3.445  0.685   1.00 59.47  ? 500  MET B CE    1 
ATOM   5369 N  N     . LYS B 1 324 ? 109.958 2.329  7.567   1.00 58.42  ? 501  LYS B N     1 
ATOM   5370 C  CA    . LYS B 1 324 ? 110.215 2.162  8.998   1.00 59.85  ? 501  LYS B CA    1 
ATOM   5371 C  C     . LYS B 1 324 ? 110.383 0.683  9.254   1.00 60.39  ? 501  LYS B C     1 
ATOM   5372 O  O     . LYS B 1 324 ? 111.446 0.239  9.685   1.00 60.67  ? 501  LYS B O     1 
ATOM   5373 C  CB    . LYS B 1 324 ? 109.072 2.717  9.863   1.00 60.20  ? 501  LYS B CB    1 
ATOM   5374 C  CG    . LYS B 1 324 ? 109.310 4.147  10.405  1.00 63.55  ? 501  LYS B CG    1 
ATOM   5375 C  CD    . LYS B 1 324 ? 108.718 5.275  9.491   1.00 67.67  ? 501  LYS B CD    1 
ATOM   5376 C  CE    . LYS B 1 324 ? 109.642 5.642  8.266   1.00 69.78  ? 501  LYS B CE    1 
ATOM   5377 N  NZ    . LYS B 1 324 ? 108.977 6.437  7.135   1.00 69.02  ? 501  LYS B NZ    1 
ATOM   5378 N  N     . GLU B 1 325 ? 109.348 -0.080 8.915   1.00 61.21  ? 502  GLU B N     1 
ATOM   5379 C  CA    . GLU B 1 325 ? 109.353 -1.524 9.107   1.00 61.91  ? 502  GLU B CA    1 
ATOM   5380 C  C     . GLU B 1 325 ? 110.562 -2.203 8.454   1.00 62.42  ? 502  GLU B C     1 
ATOM   5381 O  O     . GLU B 1 325 ? 111.157 -3.105 9.050   1.00 63.58  ? 502  GLU B O     1 
ATOM   5382 C  CB    . GLU B 1 325 ? 108.054 -2.139 8.570   1.00 61.99  ? 502  GLU B CB    1 
ATOM   5383 C  CG    . GLU B 1 325 ? 107.957 -3.665 8.727   1.00 62.49  ? 502  GLU B CG    1 
ATOM   5384 C  CD    . GLU B 1 325 ? 108.147 -4.116 10.175  1.00 64.35  ? 502  GLU B CD    1 
ATOM   5385 O  OE1   . GLU B 1 325 ? 108.016 -3.259 11.083  1.00 64.60  ? 502  GLU B OE1   1 
ATOM   5386 O  OE2   . GLU B 1 325 ? 108.433 -5.316 10.402  1.00 62.53  ? 502  GLU B OE2   1 
ATOM   5387 N  N     . LEU B 1 326 ? 110.922 -1.769 7.246   1.00 62.60  ? 503  LEU B N     1 
ATOM   5388 C  CA    . LEU B 1 326 ? 111.980 -2.417 6.451   1.00 62.63  ? 503  LEU B CA    1 
ATOM   5389 C  C     . LEU B 1 326 ? 113.370 -2.340 7.089   1.00 64.21  ? 503  LEU B C     1 
ATOM   5390 O  O     . LEU B 1 326 ? 114.192 -3.224 6.872   1.00 64.46  ? 503  LEU B O     1 
ATOM   5391 C  CB    . LEU B 1 326 ? 112.030 -1.804 5.048   1.00 61.64  ? 503  LEU B CB    1 
ATOM   5392 C  CG    . LEU B 1 326 ? 112.883 -2.519 4.017   1.00 57.49  ? 503  LEU B CG    1 
ATOM   5393 C  CD1   . LEU B 1 326 ? 112.416 -3.962 3.895   1.00 54.69  ? 503  LEU B CD1   1 
ATOM   5394 C  CD2   . LEU B 1 326 ? 112.800 -1.785 2.704   1.00 50.49  ? 503  LEU B CD2   1 
ATOM   5395 N  N     . GLN B 1 327 ? 113.630 -1.278 7.853   1.00 66.09  ? 504  GLN B N     1 
ATOM   5396 C  CA    . GLN B 1 327 ? 114.876 -1.148 8.627   1.00 67.64  ? 504  GLN B CA    1 
ATOM   5397 C  C     . GLN B 1 327 ? 114.858 -1.947 9.942   1.00 68.62  ? 504  GLN B C     1 
ATOM   5398 O  O     . GLN B 1 327 ? 115.634 -2.899 10.121  1.00 69.49  ? 504  GLN B O     1 
ATOM   5399 C  CB    . GLN B 1 327 ? 115.170 0.327  8.946   1.00 67.93  ? 504  GLN B CB    1 
ATOM   5400 C  CG    . GLN B 1 327 ? 115.986 1.052  7.882   1.00 67.81  ? 504  GLN B CG    1 
ATOM   5401 C  CD    . GLN B 1 327 ? 115.133 1.939  7.016   1.00 67.74  ? 504  GLN B CD    1 
ATOM   5402 O  OE1   . GLN B 1 327 ? 114.195 2.583  7.499   1.00 68.18  ? 504  GLN B OE1   1 
ATOM   5403 N  NE2   . GLN B 1 327 ? 115.455 1.992  5.727   1.00 66.22  ? 504  GLN B NE2   1 
ATOM   5404 N  N     . LYS B 1 328 ? 113.989 -1.541 10.865  1.00 69.37  ? 505  LYS B N     1 
ATOM   5405 C  CA    . LYS B 1 328 ? 113.939 -2.144 12.197  1.00 70.20  ? 505  LYS B CA    1 
ATOM   5406 C  C     . LYS B 1 328 ? 113.182 -3.479 12.176  1.00 70.09  ? 505  LYS B C     1 
ATOM   5407 O  O     . LYS B 1 328 ? 113.709 -4.505 11.721  1.00 69.68  ? 505  LYS B O     1 
ATOM   5408 C  CB    . LYS B 1 328 ? 113.297 -1.165 13.197  1.00 70.77  ? 505  LYS B CB    1 
ATOM   5409 C  CG    . LYS B 1 328 ? 114.205 0.037  13.594  1.00 71.58  ? 505  LYS B CG    1 
ATOM   5410 C  CD    . LYS B 1 328 ? 113.483 1.400  13.475  1.00 71.56  ? 505  LYS B CD    1 
ATOM   5411 C  CE    . LYS B 1 328 ? 113.372 1.857  11.992  1.00 71.93  ? 505  LYS B CE    1 
ATOM   5412 N  NZ    . LYS B 1 328 ? 112.646 3.157  11.789  1.00 69.33  ? 505  LYS B NZ    1 
HETATM 5413 NA NA    . NA  C 2 .   ? 84.430  48.112 42.056  1.00 34.78  ? 901  NA  A NA    1 
HETATM 5414 NA NA    . NA  D 2 .   ? 84.835  47.470 39.088  1.00 57.59  ? 902  NA  A NA    1 
HETATM 5415 P  PA    . PCG E 3 .   ? 81.919  49.385 39.144  1.00 85.52  ? 900  PCG A PA    1 
HETATM 5416 O  O1A   . PCG E 3 .   ? 82.963  49.356 40.293  1.00 80.82  ? 900  PCG A O1A   1 
HETATM 5417 O  O2A   . PCG E 3 .   ? 82.296  49.417 37.671  1.00 82.13  ? 900  PCG A O2A   1 
HETATM 5418 O  "O5'" . PCG E 3 .   ? 81.028  48.028 39.340  1.00 80.04  ? 900  PCG A "O5'" 1 
HETATM 5419 C  "C5'" . PCG E 3 .   ? 79.813  47.985 40.095  1.00 73.84  ? 900  PCG A "C5'" 1 
HETATM 5420 C  "C4'" . PCG E 3 .   ? 79.017  49.231 39.743  1.00 69.46  ? 900  PCG A "C4'" 1 
HETATM 5421 O  "O4'" . PCG E 3 .   ? 77.787  49.333 40.441  1.00 63.56  ? 900  PCG A "O4'" 1 
HETATM 5422 C  "C3'" . PCG E 3 .   ? 79.779  50.463 40.164  1.00 69.41  ? 900  PCG A "C3'" 1 
HETATM 5423 O  "O3'" . PCG E 3 .   ? 80.877  50.637 39.286  1.00 76.24  ? 900  PCG A "O3'" 1 
HETATM 5424 C  "C2'" . PCG E 3 .   ? 78.692  51.497 40.145  1.00 64.48  ? 900  PCG A "C2'" 1 
HETATM 5425 O  "O2'" . PCG E 3 .   ? 78.414  51.933 38.822  1.00 63.49  ? 900  PCG A "O2'" 1 
HETATM 5426 C  "C1'" . PCG E 3 .   ? 77.510  50.707 40.673  1.00 56.53  ? 900  PCG A "C1'" 1 
HETATM 5427 N  N9    . PCG E 3 .   ? 77.386  50.955 42.127  1.00 54.40  ? 900  PCG A N9    1 
HETATM 5428 C  C8    . PCG E 3 .   ? 78.154  50.500 43.145  1.00 53.56  ? 900  PCG A C8    1 
HETATM 5429 N  N7    . PCG E 3 .   ? 77.690  50.966 44.344  1.00 51.31  ? 900  PCG A N7    1 
HETATM 5430 C  C5    . PCG E 3 .   ? 76.615  51.723 44.074  1.00 50.90  ? 900  PCG A C5    1 
HETATM 5431 C  C6    . PCG E 3 .   ? 75.650  52.515 44.836  1.00 50.91  ? 900  PCG A C6    1 
HETATM 5432 O  O6    . PCG E 3 .   ? 75.684  52.630 46.077  1.00 52.38  ? 900  PCG A O6    1 
HETATM 5433 N  N1    . PCG E 3 .   ? 74.727  53.149 44.140  1.00 52.36  ? 900  PCG A N1    1 
HETATM 5434 C  C2    . PCG E 3 .   ? 74.595  53.072 42.808  1.00 50.76  ? 900  PCG A C2    1 
HETATM 5435 N  N2    . PCG E 3 .   ? 73.575  53.736 42.225  1.00 52.54  ? 900  PCG A N2    1 
HETATM 5436 N  N3    . PCG E 3 .   ? 75.417  52.367 42.036  1.00 48.34  ? 900  PCG A N3    1 
HETATM 5437 C  C4    . PCG E 3 .   ? 76.431  51.715 42.619  1.00 51.76  ? 900  PCG A C4    1 
HETATM 5438 NA NA    . NA  F 2 .   ? 95.406  31.665 10.604  1.00 43.28  ? 901  NA  B NA    1 
HETATM 5439 NA NA    . NA  G 2 .   ? 95.512  32.369 14.139  1.00 55.44  ? 902  NA  B NA    1 
HETATM 5440 N  N9    . IBM H 4 .   ? 97.668  20.013 12.413  1.00 57.75  ? 900  IBM B N9    1 
HETATM 5441 C  C8    . IBM H 4 .   ? 97.985  19.694 11.123  1.00 57.42  ? 900  IBM B C8    1 
HETATM 5442 N  N7    . IBM H 4 .   ? 97.644  20.715 10.280  1.00 55.75  ? 900  IBM B N7    1 
HETATM 5443 C  C5    . IBM H 4 .   ? 97.097  21.685 11.027  1.00 55.73  ? 900  IBM B C5    1 
HETATM 5444 C  C4    . IBM H 4 .   ? 97.129  21.249 12.354  1.00 57.97  ? 900  IBM B C4    1 
HETATM 5445 N  N3    . IBM H 4 .   ? 96.696  22.007 13.391  1.00 59.39  ? 900  IBM B N3    1 
HETATM 5446 C  C2    . IBM H 4 .   ? 96.196  23.259 13.085  1.00 59.67  ? 900  IBM B C2    1 
HETATM 5447 N  N1    . IBM H 4 .   ? 96.163  23.756 11.749  1.00 57.23  ? 900  IBM B N1    1 
HETATM 5448 C  C6    . IBM H 4 .   ? 96.622  22.963 10.725  1.00 58.36  ? 900  IBM B C6    1 
HETATM 5449 O  O6    . IBM H 4 .   ? 96.635  23.297 9.506   1.00 57.97  ? 900  IBM B O6    1 
HETATM 5450 O  O2    . IBM H 4 .   ? 95.721  24.037 13.942  1.00 59.05  ? 900  IBM B O2    1 
HETATM 5451 C  C10   . IBM H 4 .   ? 95.591  25.098 11.592  1.00 55.83  ? 900  IBM B C10   1 
HETATM 5452 C  C11   . IBM H 4 .   ? 96.760  21.474 14.772  1.00 57.16  ? 900  IBM B C11   1 
HETATM 5453 C  C12   . IBM H 4 .   ? 95.466  20.756 15.169  1.00 56.62  ? 900  IBM B C12   1 
HETATM 5454 C  C13   . IBM H 4 .   ? 94.428  21.767 15.632  1.00 57.69  ? 900  IBM B C13   1 
HETATM 5455 C  C14   . IBM H 4 .   ? 95.689  19.773 16.287  1.00 51.20  ? 900  IBM B C14   1 
HETATM 5456 O  O     . HOH I 5 .   ? 61.336  45.297 53.303  1.00 38.72  ? 5    HOH A O     1 
HETATM 5457 O  O     . HOH I 5 .   ? 98.171  32.846 58.734  1.00 35.38  ? 7    HOH A O     1 
HETATM 5458 O  O     . HOH I 5 .   ? 84.514  30.855 58.344  1.00 35.16  ? 9    HOH A O     1 
HETATM 5459 O  O     . HOH I 5 .   ? 69.327  63.689 47.111  1.00 44.68  ? 11   HOH A O     1 
HETATM 5460 O  O     . HOH I 5 .   ? 97.841  30.581 61.461  1.00 40.68  ? 12   HOH A O     1 
HETATM 5461 O  O     . HOH I 5 .   ? 90.162  46.221 19.298  1.00 30.67  ? 13   HOH A O     1 
HETATM 5462 O  O     . HOH I 5 .   ? 86.757  30.978 41.082  1.00 35.82  ? 15   HOH A O     1 
HETATM 5463 O  O     . HOH I 5 .   ? 78.400  41.394 37.112  1.00 35.67  ? 18   HOH A O     1 
HETATM 5464 O  O     . HOH I 5 .   ? 96.005  46.400 30.095  1.00 30.30  ? 20   HOH A O     1 
HETATM 5465 O  O     . HOH I 5 .   ? 96.043  49.549 71.916  1.00 34.15  ? 21   HOH A O     1 
HETATM 5466 O  O     . HOH I 5 .   ? 69.257  36.782 59.556  1.00 42.26  ? 22   HOH A O     1 
HETATM 5467 O  O     . HOH I 5 .   ? 104.709 50.213 59.873  1.00 46.01  ? 23   HOH A O     1 
HETATM 5468 O  O     . HOH I 5 .   ? 106.519 51.411 60.753  1.00 45.05  ? 24   HOH A O     1 
HETATM 5469 O  O     . HOH I 5 .   ? 93.771  55.534 45.857  1.00 40.40  ? 26   HOH A O     1 
HETATM 5470 O  O     . HOH I 5 .   ? 98.451  41.831 42.501  1.00 40.78  ? 27   HOH A O     1 
HETATM 5471 O  O     . HOH I 5 .   ? 77.387  57.889 30.401  1.00 46.63  ? 28   HOH A O     1 
HETATM 5472 O  O     . HOH I 5 .   ? 85.061  50.985 63.339  1.00 37.70  ? 29   HOH A O     1 
HETATM 5473 O  O     . HOH I 5 .   ? 93.195  56.437 24.772  1.00 40.67  ? 31   HOH A O     1 
HETATM 5474 O  O     . HOH I 5 .   ? 96.069  58.869 40.258  1.00 43.04  ? 32   HOH A O     1 
HETATM 5475 O  O     . HOH I 5 .   ? 80.586  47.610 31.715  1.00 49.32  ? 33   HOH A O     1 
HETATM 5476 O  O     . HOH I 5 .   ? 102.556 22.081 40.764  1.00 45.86  ? 36   HOH A O     1 
HETATM 5477 O  O     . HOH I 5 .   ? 93.303  50.868 65.761  1.00 41.08  ? 38   HOH A O     1 
HETATM 5478 O  O     . HOH I 5 .   ? 100.319 34.271 59.919  1.00 37.46  ? 39   HOH A O     1 
HETATM 5479 O  O     . HOH I 5 .   ? 69.054  61.003 57.402  1.00 44.47  ? 41   HOH A O     1 
HETATM 5480 O  O     . HOH I 5 .   ? 103.674 32.054 48.794  1.00 39.85  ? 42   HOH A O     1 
HETATM 5481 O  O     . HOH I 5 .   ? 95.166  49.693 22.171  1.00 44.81  ? 45   HOH A O     1 
HETATM 5482 O  O     . HOH I 5 .   ? 98.332  55.685 42.639  1.00 32.39  ? 46   HOH A O     1 
HETATM 5483 O  O     . HOH I 5 .   ? 100.287 46.318 55.237  1.00 39.72  ? 48   HOH A O     1 
HETATM 5484 O  O     . HOH I 5 .   ? 81.390  48.470 50.834  1.00 39.09  ? 50   HOH A O     1 
HETATM 5485 O  O     . HOH I 5 .   ? 91.223  56.071 48.584  1.00 39.04  ? 52   HOH A O     1 
HETATM 5486 O  O     . HOH I 5 .   ? 96.814  36.444 62.635  1.00 40.94  ? 55   HOH A O     1 
HETATM 5487 O  O     . HOH I 5 .   ? 88.644  27.565 54.626  1.00 48.35  ? 56   HOH A O     1 
HETATM 5488 O  O     . HOH I 5 .   ? 101.639 37.117 38.060  1.00 41.75  ? 57   HOH A O     1 
HETATM 5489 O  O     . HOH I 5 .   ? 75.421  18.721 47.335  1.00 47.90  ? 60   HOH A O     1 
HETATM 5490 O  O     . HOH I 5 .   ? 97.397  39.272 62.363  1.00 34.63  ? 64   HOH A O     1 
HETATM 5491 O  O     . HOH I 5 .   ? 82.210  57.211 35.469  1.00 40.81  ? 67   HOH A O     1 
HETATM 5492 O  O     . HOH I 5 .   ? 82.334  49.890 19.415  1.00 34.17  ? 68   HOH A O     1 
HETATM 5493 O  O     . HOH I 5 .   ? 73.067  51.897 54.582  1.00 37.42  ? 69   HOH A O     1 
HETATM 5494 O  O     . HOH I 5 .   ? 78.391  43.424 41.259  1.00 33.46  ? 71   HOH A O     1 
HETATM 5495 O  O     . HOH I 5 .   ? 90.932  53.988 18.565  1.00 40.21  ? 72   HOH A O     1 
HETATM 5496 O  O     . HOH I 5 .   ? 98.039  54.785 59.868  1.00 51.43  ? 74   HOH A O     1 
HETATM 5497 O  O     . HOH I 5 .   ? 102.967 40.502 57.552  1.00 34.12  ? 75   HOH A O     1 
HETATM 5498 O  O     . HOH I 5 .   ? 89.069  57.848 49.929  1.00 34.19  ? 76   HOH A O     1 
HETATM 5499 O  O     . HOH I 5 .   ? 69.112  24.371 45.590  1.00 42.30  ? 78   HOH A O     1 
HETATM 5500 O  O     . HOH I 5 .   ? 93.133  24.836 49.571  1.00 40.75  ? 79   HOH A O     1 
HETATM 5501 O  O     . HOH I 5 .   ? 63.572  57.449 42.538  1.00 50.57  ? 83   HOH A O     1 
HETATM 5502 O  O     . HOH I 5 .   ? 62.293  46.963 48.006  1.00 43.22  ? 87   HOH A O     1 
HETATM 5503 O  O     . HOH I 5 .   ? 101.873 47.370 53.129  1.00 49.33  ? 88   HOH A O     1 
HETATM 5504 O  O     . HOH I 5 .   ? 102.557 32.394 60.357  1.00 29.99  ? 89   HOH A O     1 
HETATM 5505 O  O     . HOH I 5 .   ? 83.859  51.153 36.336  1.00 47.43  ? 92   HOH A O     1 
HETATM 5506 O  O     . HOH I 5 .   ? 86.098  45.674 38.653  1.00 35.11  ? 93   HOH A O     1 
HETATM 5507 O  O     . HOH I 5 .   ? 83.530  46.390 37.570  1.00 37.37  ? 95   HOH A O     1 
HETATM 5508 O  O     . HOH I 5 .   ? 90.331  28.227 38.799  1.00 45.88  ? 1005 HOH A O     1 
HETATM 5509 O  O     . HOH I 5 .   ? 76.372  54.112 49.701  1.00 42.05  ? 1006 HOH A O     1 
HETATM 5510 O  O     . HOH I 5 .   ? 80.665  44.382 40.355  1.00 36.16  ? 1007 HOH A O     1 
HETATM 5511 O  O     . HOH I 5 .   ? 80.563  49.658 57.663  1.00 38.59  ? 1008 HOH A O     1 
HETATM 5512 O  O     . HOH I 5 .   ? 97.772  47.525 78.573  1.00 37.59  ? 1010 HOH A O     1 
HETATM 5513 O  O     . HOH I 5 .   ? 87.278  29.903 37.375  1.00 45.92  ? 1011 HOH A O     1 
HETATM 5514 O  O     . HOH I 5 .   ? 110.786 44.323 41.132  1.00 48.17  ? 1012 HOH A O     1 
HETATM 5515 O  O     . HOH I 5 .   ? 89.704  56.964 30.581  1.00 36.14  ? 1013 HOH A O     1 
HETATM 5516 O  O     . HOH I 5 .   ? 83.390  51.496 48.299  1.00 44.05  ? 1015 HOH A O     1 
HETATM 5517 O  O     . HOH I 5 .   ? 85.549  50.718 20.983  1.00 32.85  ? 1016 HOH A O     1 
HETATM 5518 O  O     . HOH I 5 .   ? 82.261  49.804 33.245  1.00 44.01  ? 1019 HOH A O     1 
HETATM 5519 O  O     . HOH I 5 .   ? 78.982  49.930 46.846  1.00 45.50  ? 1020 HOH A O     1 
HETATM 5520 O  O     . HOH I 5 .   ? 70.791  51.435 55.899  1.00 42.21  ? 1024 HOH A O     1 
HETATM 5521 O  O     . HOH I 5 .   ? 102.157 56.042 76.040  1.00 58.77  ? 1025 HOH A O     1 
HETATM 5522 O  O     . HOH I 5 .   ? 77.315  31.345 59.293  1.00 62.37  ? 1027 HOH A O     1 
HETATM 5523 O  O     . HOH I 5 .   ? 106.181 53.703 60.793  1.00 52.15  ? 1028 HOH A O     1 
HETATM 5524 O  O     . HOH I 5 .   ? 72.734  54.367 53.713  1.00 40.18  ? 1030 HOH A O     1 
HETATM 5525 O  O     . HOH I 5 .   ? 100.627 56.056 42.867  1.00 48.78  ? 1031 HOH A O     1 
HETATM 5526 O  O     . HOH I 5 .   ? 97.729  52.219 67.761  1.00 40.58  ? 1032 HOH A O     1 
HETATM 5527 O  O     . HOH I 5 .   ? 94.500  36.411 63.940  1.00 49.84  ? 1034 HOH A O     1 
HETATM 5528 O  O     . HOH I 5 .   ? 82.641  46.822 63.230  1.00 41.86  ? 1035 HOH A O     1 
HETATM 5529 O  O     . HOH I 5 .   ? 109.552 31.744 46.884  1.00 56.46  ? 1040 HOH A O     1 
HETATM 5530 O  O     . HOH I 5 .   ? 83.777  35.739 63.823  1.00 47.35  ? 1041 HOH A O     1 
HETATM 5531 O  O     . HOH I 5 .   ? 70.327  55.799 53.633  1.00 42.64  ? 1046 HOH A O     1 
HETATM 5532 O  O     . HOH I 5 .   ? 105.545 34.520 49.404  1.00 38.53  ? 1051 HOH A O     1 
HETATM 5533 O  O     . HOH I 5 .   ? 103.406 30.133 56.994  1.00 52.99  ? 1057 HOH A O     1 
HETATM 5534 O  O     . HOH I 5 .   ? 98.698  56.510 55.302  1.00 59.16  ? 1058 HOH A O     1 
HETATM 5535 O  O     . HOH I 5 .   ? 99.231  46.422 26.837  1.00 64.18  ? 1061 HOH A O     1 
HETATM 5536 O  O     . HOH I 5 .   ? 88.471  53.765 57.770  1.00 78.76  ? 1062 HOH A O     1 
HETATM 5537 O  O     . HOH I 5 .   ? 66.022  63.104 45.020  1.00 68.93  ? 1066 HOH A O     1 
HETATM 5538 O  O     . HOH I 5 .   ? 91.145  31.399 59.854  1.00 49.81  ? 1068 HOH A O     1 
HETATM 5539 O  O     . HOH I 5 .   ? 107.939 35.809 48.555  1.00 45.71  ? 1069 HOH A O     1 
HETATM 5540 O  O     . HOH I 5 .   ? 80.566  30.305 62.688  1.00 60.68  ? 1072 HOH A O     1 
HETATM 5541 O  O     . HOH I 5 .   ? 92.203  28.551 59.056  1.00 43.74  ? 1074 HOH A O     1 
HETATM 5542 O  O     . HOH I 5 .   ? 90.274  24.427 46.310  1.00 45.46  ? 1075 HOH A O     1 
HETATM 5543 O  O     . HOH I 5 .   ? 63.002  79.534 40.090  1.00 43.51  ? 1078 HOH A O     1 
HETATM 5544 O  O     . HOH I 5 .   ? 96.852  58.108 42.336  1.00 47.97  ? 1079 HOH A O     1 
HETATM 5545 O  O     . HOH I 5 .   ? 108.998 33.953 52.802  1.00 60.03  ? 1081 HOH A O     1 
HETATM 5546 O  O     . HOH I 5 .   ? 100.432 57.016 64.855  1.00 59.99  ? 1082 HOH A O     1 
HETATM 5547 O  O     . HOH I 5 .   ? 73.801  55.990 51.234  1.00 58.55  ? 1084 HOH A O     1 
HETATM 5548 O  O     . HOH I 5 .   ? 87.287  51.025 63.643  1.00 55.39  ? 1087 HOH A O     1 
HETATM 5549 O  O     . HOH I 5 .   ? 83.568  67.403 30.204  1.00 52.84  ? 1089 HOH A O     1 
HETATM 5550 O  O     . HOH I 5 .   ? 101.773 52.556 48.406  1.00 51.87  ? 1090 HOH A O     1 
HETATM 5551 O  O     . HOH I 5 .   ? 95.594  50.626 26.907  1.00 55.35  ? 1091 HOH A O     1 
HETATM 5552 O  O     . HOH I 5 .   ? 100.547 33.288 34.143  1.00 50.65  ? 1093 HOH A O     1 
HETATM 5553 O  O     . HOH I 5 .   ? 98.193  55.389 44.891  1.00 52.71  ? 1095 HOH A O     1 
HETATM 5554 O  O     . HOH I 5 .   ? 74.862  48.131 58.517  1.00 50.30  ? 1098 HOH A O     1 
HETATM 5555 O  O     . HOH I 5 .   ? 88.218  54.052 15.236  1.00 55.57  ? 1099 HOH A O     1 
HETATM 5556 O  O     . HOH I 5 .   ? 92.274  62.429 39.750  1.00 54.20  ? 1101 HOH A O     1 
HETATM 5557 O  O     . HOH I 5 .   ? 67.313  34.408 56.639  1.00 55.01  ? 1102 HOH A O     1 
HETATM 5558 O  O     . HOH I 5 .   ? 72.032  25.157 35.099  1.00 66.75  ? 1104 HOH A O     1 
HETATM 5559 O  O     . HOH I 5 .   ? 82.456  53.365 37.067  1.00 50.67  ? 1105 HOH A O     1 
HETATM 5560 O  O     . HOH I 5 .   ? 68.937  68.019 41.472  1.00 68.53  ? 1108 HOH A O     1 
HETATM 5561 O  O     . HOH I 5 .   ? 89.746  41.274 25.192  1.00 49.68  ? 1112 HOH A O     1 
HETATM 5562 O  O     . HOH I 5 .   ? 103.513 36.027 39.536  1.00 42.02  ? 1113 HOH A O     1 
HETATM 5563 O  O     . HOH I 5 .   ? 91.172  42.152 69.289  1.00 48.99  ? 1115 HOH A O     1 
HETATM 5564 O  O     . HOH I 5 .   ? 99.215  50.334 34.757  1.00 44.38  ? 1119 HOH A O     1 
HETATM 5565 O  O     . HOH I 5 .   ? 86.506  61.552 22.574  1.00 46.45  ? 1121 HOH A O     1 
HETATM 5566 O  O     . HOH I 5 .   ? 98.764  55.526 76.790  1.00 74.92  ? 1122 HOH A O     1 
HETATM 5567 O  O     . HOH I 5 .   ? 104.938 32.327 55.693  1.00 48.00  ? 1123 HOH A O     1 
HETATM 5568 O  O     . HOH I 5 .   ? 76.943  33.615 33.733  1.00 49.21  ? 1128 HOH A O     1 
HETATM 5569 O  O     . HOH I 5 .   ? 95.616  55.973 49.049  1.00 57.85  ? 1129 HOH A O     1 
HETATM 5570 O  O     . HOH I 5 .   ? 92.842  52.428 67.964  1.00 52.30  ? 1130 HOH A O     1 
HETATM 5571 O  O     . HOH I 5 .   ? 82.254  33.504 33.913  1.00 52.41  ? 1135 HOH A O     1 
HETATM 5572 O  O     . HOH I 5 .   ? 98.568  55.532 40.467  1.00 46.03  ? 1136 HOH A O     1 
HETATM 5573 O  O     . HOH I 5 .   ? 97.702  53.380 38.958  1.00 50.42  ? 1137 HOH A O     1 
HETATM 5574 O  O     . HOH I 5 .   ? 93.493  55.303 63.833  1.00 56.17  ? 1141 HOH A O     1 
HETATM 5575 O  O     . HOH I 5 .   ? 65.516  55.847 41.939  1.00 64.43  ? 1143 HOH A O     1 
HETATM 5576 O  O     . HOH I 5 .   ? 83.859  40.218 32.032  1.00 49.09  ? 1144 HOH A O     1 
HETATM 5577 O  O     . HOH I 5 .   ? 83.839  35.799 34.984  1.00 51.60  ? 1145 HOH A O     1 
HETATM 5578 O  O     . HOH I 5 .   ? 68.291  59.357 35.318  1.00 65.10  ? 1146 HOH A O     1 
HETATM 5579 O  O     . HOH I 5 .   ? 73.168  42.891 33.407  1.00 57.82  ? 1147 HOH A O     1 
HETATM 5580 O  O     . HOH I 5 .   ? 67.141  37.482 43.351  1.00 84.53  ? 1149 HOH A O     1 
HETATM 5581 O  O     . HOH I 5 .   ? 101.130 57.013 40.618  1.00 54.60  ? 1152 HOH A O     1 
HETATM 5582 O  O     . HOH I 5 .   ? 82.393  45.406 19.643  1.00 54.31  ? 1153 HOH A O     1 
HETATM 5583 O  O     . HOH J 5 .   ? 95.670  28.550 10.130  1.00 44.18  ? 1    HOH B O     1 
HETATM 5584 O  O     . HOH J 5 .   ? 75.668  56.370 12.916  1.00 42.37  ? 2    HOH B O     1 
HETATM 5585 O  O     . HOH J 5 .   ? 95.379  26.561 5.958   1.00 30.19  ? 3    HOH B O     1 
HETATM 5586 O  O     . HOH J 5 .   ? 87.981  27.964 16.250  1.00 36.65  ? 4    HOH B O     1 
HETATM 5587 O  O     . HOH J 5 .   ? 97.719  42.119 -19.623 1.00 34.69  ? 6    HOH B O     1 
HETATM 5588 O  O     . HOH J 5 .   ? 105.003 38.339 6.373   1.00 35.34  ? 8    HOH B O     1 
HETATM 5589 O  O     . HOH J 5 .   ? 84.730  54.502 4.410   1.00 37.87  ? 10   HOH B O     1 
HETATM 5590 O  O     . HOH J 5 .   ? 75.013  46.367 4.299   1.00 42.83  ? 14   HOH B O     1 
HETATM 5591 O  O     . HOH J 5 .   ? 80.183  38.646 12.252  1.00 41.37  ? 16   HOH B O     1 
HETATM 5592 O  O     . HOH J 5 .   ? 97.204  31.908 -11.009 1.00 41.10  ? 17   HOH B O     1 
HETATM 5593 O  O     . HOH J 5 .   ? 104.115 51.098 -8.122  1.00 43.46  ? 19   HOH B O     1 
HETATM 5594 O  O     . HOH J 5 .   ? 102.086 37.614 11.420  1.00 40.66  ? 25   HOH B O     1 
HETATM 5595 O  O     . HOH J 5 .   ? 85.395  10.404 -0.227  1.00 39.93  ? 30   HOH B O     1 
HETATM 5596 O  O     . HOH J 5 .   ? 98.958  23.910 5.395   1.00 46.97  ? 35   HOH B O     1 
HETATM 5597 O  O     . HOH J 5 .   ? 92.481  30.242 -10.320 1.00 44.69  ? 37   HOH B O     1 
HETATM 5598 O  O     . HOH J 5 .   ? 106.290 34.479 21.501  1.00 36.32  ? 40   HOH B O     1 
HETATM 5599 O  O     . HOH J 5 .   ? 79.306  46.553 -2.323  1.00 103.79 ? 43   HOH B O     1 
HETATM 5600 O  O     . HOH J 5 .   ? 100.363 45.065 28.916  1.00 40.55  ? 44   HOH B O     1 
HETATM 5601 O  O     . HOH J 5 .   ? 96.955  38.335 33.494  1.00 37.77  ? 47   HOH B O     1 
HETATM 5602 O  O     . HOH J 5 .   ? 84.140  34.644 18.656  1.00 39.34  ? 49   HOH B O     1 
HETATM 5603 O  O     . HOH J 5 .   ? 94.345  28.607 1.853   1.00 36.29  ? 51   HOH B O     1 
HETATM 5604 O  O     . HOH J 5 .   ? 104.598 24.923 26.165  1.00 45.88  ? 53   HOH B O     1 
HETATM 5605 O  O     . HOH J 5 .   ? 93.652  46.590 9.876   1.00 35.63  ? 54   HOH B O     1 
HETATM 5606 O  O     . HOH J 5 .   ? 99.758  32.691 31.569  1.00 34.17  ? 58   HOH B O     1 
HETATM 5607 O  O     . HOH J 5 .   ? 83.662  48.918 -5.363  1.00 35.68  ? 61   HOH B O     1 
HETATM 5608 O  O     . HOH J 5 .   ? 99.683  16.443 20.662  1.00 50.60  ? 62   HOH B O     1 
HETATM 5609 O  O     . HOH J 5 .   ? 92.389  29.699 29.653  1.00 43.42  ? 63   HOH B O     1 
HETATM 5610 O  O     . HOH J 5 .   ? 73.702  45.123 1.286   1.00 44.39  ? 65   HOH B O     1 
HETATM 5611 O  O     . HOH J 5 .   ? 82.572  33.763 -10.492 1.00 49.19  ? 66   HOH B O     1 
HETATM 5612 O  O     . HOH J 5 .   ? 94.856  22.838 5.468   1.00 51.62  ? 70   HOH B O     1 
HETATM 5613 O  O     . HOH J 5 .   ? 98.866  39.580 -13.550 1.00 41.87  ? 73   HOH B O     1 
HETATM 5614 O  O     . HOH J 5 .   ? 94.690  28.164 12.960  1.00 54.53  ? 77   HOH B O     1 
HETATM 5615 O  O     . HOH J 5 .   ? 106.951 38.263 26.916  1.00 41.81  ? 81   HOH B O     1 
HETATM 5616 O  O     . HOH J 5 .   ? 94.894  19.536 -1.471  1.00 47.08  ? 82   HOH B O     1 
HETATM 5617 O  O     . HOH J 5 .   ? 84.104  16.109 -6.690  1.00 54.27  ? 84   HOH B O     1 
HETATM 5618 O  O     . HOH J 5 .   ? 95.681  39.829 -27.797 1.00 57.95  ? 85   HOH B O     1 
HETATM 5619 O  O     . HOH J 5 .   ? 100.251 52.347 14.878  1.00 46.98  ? 86   HOH B O     1 
HETATM 5620 O  O     . HOH J 5 .   ? 98.794  38.450 -23.105 1.00 45.72  ? 90   HOH B O     1 
HETATM 5621 O  O     . HOH J 5 .   ? 85.390  50.347 -7.103  1.00 33.16  ? 91   HOH B O     1 
HETATM 5622 O  O     . HOH J 5 .   ? 106.606 42.986 8.469   1.00 48.86  ? 1002 HOH B O     1 
HETATM 5623 O  O     . HOH J 5 .   ? 107.294 36.524 5.131   1.00 42.27  ? 1003 HOH B O     1 
HETATM 5624 O  O     . HOH J 5 .   ? 100.770 58.080 1.960   1.00 65.69  ? 1004 HOH B O     1 
HETATM 5625 O  O     . HOH J 5 .   ? 105.686 40.303 2.667   1.00 51.90  ? 1009 HOH B O     1 
HETATM 5626 O  O     . HOH J 5 .   ? 94.924  27.268 -4.819  1.00 46.52  ? 1014 HOH B O     1 
HETATM 5627 O  O     . HOH J 5 .   ? 92.343  51.309 -4.919  1.00 32.13  ? 1017 HOH B O     1 
HETATM 5628 O  O     . HOH J 5 .   ? 94.964  40.890 -23.363 1.00 59.87  ? 1018 HOH B O     1 
HETATM 5629 O  O     . HOH J 5 .   ? 97.803  43.454 22.174  1.00 31.79  ? 1021 HOH B O     1 
HETATM 5630 O  O     . HOH J 5 .   ? 86.021  23.947 21.530  1.00 49.42  ? 1022 HOH B O     1 
HETATM 5631 O  O     . HOH J 5 .   ? 106.993 42.909 -3.703  1.00 44.24  ? 1023 HOH B O     1 
HETATM 5632 O  O     . HOH J 5 .   ? 88.404  33.361 21.166  1.00 41.20  ? 1026 HOH B O     1 
HETATM 5633 O  O     . HOH J 5 .   ? 97.728  15.604 -0.512  1.00 54.62  ? 1029 HOH B O     1 
HETATM 5634 O  O     . HOH J 5 .   ? 105.614 45.589 -3.156  1.00 55.38  ? 1033 HOH B O     1 
HETATM 5635 O  O     . HOH J 5 .   ? 89.336  27.068 11.942  1.00 45.86  ? 1036 HOH B O     1 
HETATM 5636 O  O     . HOH J 5 .   ? 96.968  22.018 7.289   1.00 46.73  ? 1037 HOH B O     1 
HETATM 5637 O  O     . HOH J 5 .   ? 83.448  60.978 6.827   1.00 49.18  ? 1038 HOH B O     1 
HETATM 5638 O  O     . HOH J 5 .   ? 78.885  54.831 1.951   1.00 45.87  ? 1039 HOH B O     1 
HETATM 5639 O  O     . HOH J 5 .   ? 87.610  39.242 -10.520 1.00 52.76  ? 1042 HOH B O     1 
HETATM 5640 O  O     . HOH J 5 .   ? 97.959  29.467 4.513   1.00 50.88  ? 1043 HOH B O     1 
HETATM 5641 O  O     . HOH J 5 .   ? 86.777  46.308 -9.577  1.00 45.10  ? 1045 HOH B O     1 
HETATM 5642 O  O     . HOH J 5 .   ? 94.085  31.133 33.562  1.00 35.57  ? 1047 HOH B O     1 
HETATM 5643 O  O     . HOH J 5 .   ? 78.226  42.977 15.056  1.00 57.86  ? 1048 HOH B O     1 
HETATM 5644 O  O     . HOH J 5 .   ? 96.009  25.706 8.539   1.00 47.06  ? 1049 HOH B O     1 
HETATM 5645 O  O     . HOH J 5 .   ? 91.183  28.746 12.697  1.00 41.12  ? 1050 HOH B O     1 
HETATM 5646 O  O     . HOH J 5 .   ? 104.047 34.071 36.901  1.00 49.78  ? 1053 HOH B O     1 
HETATM 5647 O  O     . HOH J 5 .   ? 104.359 42.980 12.845  1.00 48.11  ? 1054 HOH B O     1 
HETATM 5648 O  O     . HOH J 5 .   ? 96.315  15.749 -3.073  1.00 50.92  ? 1056 HOH B O     1 
HETATM 5649 O  O     . HOH J 5 .   ? 99.663  19.184 1.671   1.00 58.87  ? 1059 HOH B O     1 
HETATM 5650 O  O     . HOH J 5 .   ? 78.216  36.393 -4.645  1.00 58.05  ? 1060 HOH B O     1 
HETATM 5651 O  O     . HOH J 5 .   ? 98.440  22.257 3.230   1.00 49.85  ? 1064 HOH B O     1 
HETATM 5652 O  O     . HOH J 5 .   ? 76.028  29.176 -5.326  1.00 65.72  ? 1065 HOH B O     1 
HETATM 5653 O  O     . HOH J 5 .   ? 104.141 27.310 16.689  1.00 37.52  ? 1067 HOH B O     1 
HETATM 5654 O  O     . HOH J 5 .   ? 104.895 35.802 3.681   1.00 47.29  ? 1070 HOH B O     1 
HETATM 5655 O  O     . HOH J 5 .   ? 104.130 29.298 39.331  1.00 51.12  ? 1071 HOH B O     1 
HETATM 5656 O  O     . HOH J 5 .   ? 79.019  38.507 13.949  1.00 45.60  ? 1073 HOH B O     1 
HETATM 5657 O  O     . HOH J 5 .   ? 89.913  51.416 14.791  1.00 48.41  ? 1076 HOH B O     1 
HETATM 5658 O  O     . HOH J 5 .   ? 96.495  45.991 -10.489 1.00 50.10  ? 1077 HOH B O     1 
HETATM 5659 O  O     . HOH J 5 .   ? 98.030  48.200 -5.893  1.00 44.57  ? 1080 HOH B O     1 
HETATM 5660 O  O     . HOH J 5 .   ? 93.978  17.613 -2.580  1.00 57.02  ? 1083 HOH B O     1 
HETATM 5661 O  O     . HOH J 5 .   ? 84.189  26.507 24.166  1.00 52.64  ? 1085 HOH B O     1 
HETATM 5662 O  O     . HOH J 5 .   ? 76.295  18.701 -2.525  1.00 49.82  ? 1086 HOH B O     1 
HETATM 5663 O  O     . HOH J 5 .   ? 87.443  10.811 5.805   1.00 52.57  ? 1088 HOH B O     1 
HETATM 5664 O  O     . HOH J 5 .   ? 91.247  31.124 25.745  1.00 42.41  ? 1092 HOH B O     1 
HETATM 5665 O  O     . HOH J 5 .   ? 81.730  34.299 20.077  1.00 41.66  ? 1096 HOH B O     1 
HETATM 5666 O  O     . HOH J 5 .   ? 104.653 10.847 6.741   1.00 74.68  ? 1097 HOH B O     1 
HETATM 5667 O  O     . HOH J 5 .   ? 104.233 38.331 24.829  1.00 50.37  ? 1100 HOH B O     1 
HETATM 5668 O  O     . HOH J 5 .   ? 100.556 49.936 -6.004  1.00 73.50  ? 1103 HOH B O     1 
HETATM 5669 O  O     . HOH J 5 .   ? 108.289 35.400 17.933  1.00 48.44  ? 1106 HOH B O     1 
HETATM 5670 O  O     . HOH J 5 .   ? 88.952  53.173 12.689  1.00 54.86  ? 1107 HOH B O     1 
HETATM 5671 O  O     . HOH J 5 .   ? 105.822 42.745 15.825  1.00 47.49  ? 1109 HOH B O     1 
HETATM 5672 O  O     . HOH J 5 .   ? 106.114 15.291 22.690  1.00 57.31  ? 1111 HOH B O     1 
HETATM 5673 O  O     . HOH J 5 .   ? 97.204  18.381 -0.875  1.00 48.17  ? 1114 HOH B O     1 
HETATM 5674 O  O     . HOH J 5 .   ? 85.138  55.448 -2.725  1.00 47.82  ? 1116 HOH B O     1 
HETATM 5675 O  O     . HOH J 5 .   ? 91.804  58.358 -2.672  1.00 82.31  ? 1117 HOH B O     1 
HETATM 5676 O  O     . HOH J 5 .   ? 97.807  29.904 33.576  1.00 49.88  ? 1118 HOH B O     1 
HETATM 5677 O  O     . HOH J 5 .   ? 89.598  46.151 -9.753  1.00 47.91  ? 1120 HOH B O     1 
HETATM 5678 O  O     . HOH J 5 .   ? 105.108 33.517 1.876   1.00 54.40  ? 1124 HOH B O     1 
HETATM 5679 O  O     . HOH J 5 .   ? 85.179  30.695 -6.474  1.00 50.76  ? 1125 HOH B O     1 
HETATM 5680 O  O     . HOH J 5 .   ? 106.923 35.763 -4.118  1.00 54.62  ? 1126 HOH B O     1 
HETATM 5681 O  O     . HOH J 5 .   ? 90.233  22.798 20.229  1.00 74.02  ? 1131 HOH B O     1 
HETATM 5682 O  O     . HOH J 5 .   ? 101.380 43.105 -15.617 1.00 51.57  ? 1132 HOH B O     1 
HETATM 5683 O  O     . HOH J 5 .   ? 77.111  53.213 -2.402  1.00 55.11  ? 1133 HOH B O     1 
HETATM 5684 O  O     . HOH J 5 .   ? 97.716  41.724 -28.058 1.00 52.18  ? 1134 HOH B O     1 
HETATM 5685 O  O     . HOH J 5 .   ? 108.686 33.779 26.452  1.00 41.33  ? 1138 HOH B O     1 
HETATM 5686 O  O     . HOH J 5 .   ? 93.281  59.364 1.040   1.00 48.84  ? 1139 HOH B O     1 
HETATM 5687 O  O     . HOH J 5 .   ? 87.762  55.413 3.516   1.00 41.50  ? 1140 HOH B O     1 
HETATM 5688 O  O     . HOH J 5 .   ? 97.921  30.410 15.616  1.00 47.71  ? 1142 HOH B O     1 
HETATM 5689 O  O     . HOH J 5 .   ? 98.241  15.695 -5.945  1.00 74.25  ? 1148 HOH B O     1 
HETATM 5690 O  O     . HOH J 5 .   ? 105.583 46.174 1.113   1.00 73.66  ? 1150 HOH B O     1 
HETATM 5691 O  O     . HOH J 5 .   ? 80.064  28.936 20.383  1.00 46.14  ? 1151 HOH B O     1 
HETATM 5692 O  O     . HOH J 5 .   ? 91.600  47.556 -8.336  1.00 46.22  ? 1154 HOH B O     1 
HETATM 5693 O  O     . HOH J 5 .   ? 108.846 38.348 -2.796  1.00 69.78  ? 1155 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   178 178 GLY GLY A . n 
A 1 2   SER 2   179 179 SER SER A . n 
A 1 3   HIS 3   180 180 HIS HIS A . n 
A 1 4   MET 4   181 181 MET MET A . n 
A 1 5   THR 5   182 182 THR THR A . n 
A 1 6   TYR 6   183 183 TYR TYR A . n 
A 1 7   PRO 7   184 184 PRO PRO A . n 
A 1 8   LYS 8   185 185 LYS LYS A . n 
A 1 9   TYR 9   186 186 TYR TYR A . n 
A 1 10  LEU 10  187 187 LEU LEU A . n 
A 1 11  LEU 11  188 188 LEU LEU A . n 
A 1 12  SER 12  189 189 SER SER A . n 
A 1 13  PRO 13  190 190 PRO PRO A . n 
A 1 14  GLU 14  191 191 GLU GLU A . n 
A 1 15  THR 15  192 192 THR THR A . n 
A 1 16  ILE 16  193 193 ILE ILE A . n 
A 1 17  GLU 17  194 194 GLU GLU A . n 
A 1 18  ALA 18  195 195 ALA ALA A . n 
A 1 19  LEU 19  196 196 LEU LEU A . n 
A 1 20  ARG 20  197 197 ARG ARG A . n 
A 1 21  LYS 21  198 198 LYS LYS A . n 
A 1 22  PRO 22  199 199 PRO PRO A . n 
A 1 23  THR 23  200 200 THR THR A . n 
A 1 24  PHE 24  201 201 PHE PHE A . n 
A 1 25  ASP 25  202 202 ASP ASP A . n 
A 1 26  VAL 26  203 203 VAL VAL A . n 
A 1 27  TRP 27  204 204 TRP TRP A . n 
A 1 28  LEU 28  205 205 LEU LEU A . n 
A 1 29  TRP 29  206 206 TRP TRP A . n 
A 1 30  GLU 30  207 207 GLU GLU A . n 
A 1 31  PRO 31  208 208 PRO PRO A . n 
A 1 32  ASN 32  209 209 ASN ASN A . n 
A 1 33  GLU 33  210 210 GLU GLU A . n 
A 1 34  MET 34  211 211 MET MET A . n 
A 1 35  LEU 35  212 212 LEU LEU A . n 
A 1 36  SER 36  213 213 SER SER A . n 
A 1 37  CYS 37  214 214 CYS CYS A . n 
A 1 38  LEU 38  215 215 LEU LEU A . n 
A 1 39  GLU 39  216 216 GLU GLU A . n 
A 1 40  HIS 40  217 217 HIS HIS A . n 
A 1 41  MET 41  218 218 MET MET A . n 
A 1 42  TYR 42  219 219 TYR TYR A . n 
A 1 43  HIS 43  220 220 HIS HIS A . n 
A 1 44  ASP 44  221 221 ASP ASP A . n 
A 1 45  LEU 45  222 222 LEU LEU A . n 
A 1 46  GLY 46  223 223 GLY GLY A . n 
A 1 47  LEU 47  224 224 LEU LEU A . n 
A 1 48  VAL 48  225 225 VAL VAL A . n 
A 1 49  ARG 49  226 226 ARG ARG A . n 
A 1 50  ASP 50  227 227 ASP ASP A . n 
A 1 51  PHE 51  228 228 PHE PHE A . n 
A 1 52  SER 52  229 229 SER SER A . n 
A 1 53  ILE 53  230 230 ILE ILE A . n 
A 1 54  ASN 54  231 231 ASN ASN A . n 
A 1 55  PRO 55  232 232 PRO PRO A . n 
A 1 56  VAL 56  233 233 VAL VAL A . n 
A 1 57  THR 57  234 234 THR THR A . n 
A 1 58  LEU 58  235 235 LEU LEU A . n 
A 1 59  ARG 59  236 236 ARG ARG A . n 
A 1 60  ARG 60  237 237 ARG ARG A . n 
A 1 61  TRP 61  238 238 TRP TRP A . n 
A 1 62  LEU 62  239 239 LEU LEU A . n 
A 1 63  PHE 63  240 240 PHE PHE A . n 
A 1 64  CYS 64  241 241 CYS CYS A . n 
A 1 65  VAL 65  242 242 VAL VAL A . n 
A 1 66  HIS 66  243 243 HIS HIS A . n 
A 1 67  ASP 67  244 244 ASP ASP A . n 
A 1 68  ASN 68  245 245 ASN ASN A . n 
A 1 69  TYR 69  246 246 TYR TYR A . n 
A 1 70  ARG 70  247 247 ARG ARG A . n 
A 1 71  ASN 71  248 248 ASN ASN A . n 
A 1 72  ASN 72  249 249 ASN ASN A . n 
A 1 73  PRO 73  250 250 PRO PRO A . n 
A 1 74  PHE 74  251 251 PHE PHE A . n 
A 1 75  HIS 75  252 252 HIS HIS A . n 
A 1 76  ASN 76  253 253 ASN ASN A . n 
A 1 77  PHE 77  254 254 PHE PHE A . n 
A 1 78  ARG 78  255 255 ARG ARG A . n 
A 1 79  HIS 79  256 256 HIS HIS A . n 
A 1 80  CYS 80  257 257 CYS CYS A . n 
A 1 81  PHE 81  258 258 PHE PHE A . n 
A 1 82  CYS 82  259 259 CYS CYS A . n 
A 1 83  VAL 83  260 260 VAL VAL A . n 
A 1 84  ALA 84  261 261 ALA ALA A . n 
A 1 85  GLN 85  262 262 GLN GLN A . n 
A 1 86  MET 86  263 263 MET MET A . n 
A 1 87  MET 87  264 264 MET MET A . n 
A 1 88  TYR 88  265 265 TYR TYR A . n 
A 1 89  SER 89  266 266 SER SER A . n 
A 1 90  MET 90  267 267 MET MET A . n 
A 1 91  VAL 91  268 268 VAL VAL A . n 
A 1 92  TRP 92  269 269 TRP TRP A . n 
A 1 93  LEU 93  270 270 LEU LEU A . n 
A 1 94  CYS 94  271 271 CYS CYS A . n 
A 1 95  SER 95  272 272 SER SER A . n 
A 1 96  LEU 96  273 273 LEU LEU A . n 
A 1 97  GLN 97  274 274 GLN GLN A . n 
A 1 98  GLU 98  275 275 GLU GLU A . n 
A 1 99  LYS 99  276 276 LYS LYS A . n 
A 1 100 PHE 100 277 277 PHE PHE A . n 
A 1 101 SER 101 278 278 SER SER A . n 
A 1 102 GLN 102 279 279 GLN GLN A . n 
A 1 103 THR 103 280 280 THR THR A . n 
A 1 104 ASP 104 281 281 ASP ASP A . n 
A 1 105 ILE 105 282 282 ILE ILE A . n 
A 1 106 LEU 106 283 283 LEU LEU A . n 
A 1 107 ILE 107 284 284 ILE ILE A . n 
A 1 108 LEU 108 285 285 LEU LEU A . n 
A 1 109 MET 109 286 286 MET MET A . n 
A 1 110 THR 110 287 287 THR THR A . n 
A 1 111 ALA 111 288 288 ALA ALA A . n 
A 1 112 ALA 112 289 289 ALA ALA A . n 
A 1 113 ILE 113 290 290 ILE ILE A . n 
A 1 114 CYS 114 291 291 CYS CYS A . n 
A 1 115 HIS 115 292 292 HIS HIS A . n 
A 1 116 ASP 116 293 293 ASP ASP A . n 
A 1 117 LEU 117 294 294 LEU LEU A . n 
A 1 118 ASP 118 295 295 ASP ASP A . n 
A 1 119 HIS 119 296 296 HIS HIS A . n 
A 1 120 PRO 120 297 297 PRO PRO A . n 
A 1 121 GLY 121 298 298 GLY GLY A . n 
A 1 122 TYR 122 299 299 TYR TYR A . n 
A 1 123 ASN 123 300 300 ASN ASN A . n 
A 1 124 ASN 124 301 301 ASN ASN A . n 
A 1 125 THR 125 302 302 THR THR A . n 
A 1 126 TYR 126 303 303 TYR TYR A . n 
A 1 127 GLN 127 304 304 GLN GLN A . n 
A 1 128 ILE 128 305 305 ILE ILE A . n 
A 1 129 ASN 129 306 306 ASN ASN A . n 
A 1 130 ALA 130 307 307 ALA ALA A . n 
A 1 131 ARG 131 308 308 ARG ARG A . n 
A 1 132 THR 132 309 309 THR THR A . n 
A 1 133 GLU 133 310 310 GLU GLU A . n 
A 1 134 LEU 134 311 311 LEU LEU A . n 
A 1 135 ALA 135 312 312 ALA ALA A . n 
A 1 136 VAL 136 313 313 VAL VAL A . n 
A 1 137 ARG 137 314 314 ARG ARG A . n 
A 1 138 TYR 138 315 315 TYR TYR A . n 
A 1 139 ASN 139 316 316 ASN ASN A . n 
A 1 140 ASP 140 317 317 ASP ASP A . n 
A 1 141 ILE 141 318 318 ILE ILE A . n 
A 1 142 SER 142 319 319 SER SER A . n 
A 1 143 PRO 143 320 320 PRO PRO A . n 
A 1 144 LEU 144 321 321 LEU LEU A . n 
A 1 145 GLU 145 322 322 GLU GLU A . n 
A 1 146 ASN 146 323 323 ASN ASN A . n 
A 1 147 HIS 147 324 324 HIS HIS A . n 
A 1 148 HIS 148 325 325 HIS HIS A . n 
A 1 149 CYS 149 326 326 CYS CYS A . n 
A 1 150 ALA 150 327 327 ALA ALA A . n 
A 1 151 VAL 151 328 328 VAL VAL A . n 
A 1 152 ALA 152 329 329 ALA ALA A . n 
A 1 153 PHE 153 330 330 PHE PHE A . n 
A 1 154 GLN 154 331 331 GLN GLN A . n 
A 1 155 ILE 155 332 332 ILE ILE A . n 
A 1 156 LEU 156 333 333 LEU LEU A . n 
A 1 157 ALA 157 334 334 ALA ALA A . n 
A 1 158 GLU 158 335 335 GLU GLU A . n 
A 1 159 PRO 159 336 336 PRO PRO A . n 
A 1 160 GLU 160 337 337 GLU GLU A . n 
A 1 161 CYS 161 338 338 CYS CYS A . n 
A 1 162 ASN 162 339 339 ASN ASN A . n 
A 1 163 ILE 163 340 340 ILE ILE A . n 
A 1 164 PHE 164 341 341 PHE PHE A . n 
A 1 165 SER 165 342 342 SER SER A . n 
A 1 166 ASN 166 343 343 ASN ASN A . n 
A 1 167 ILE 167 344 344 ILE ILE A . n 
A 1 168 PRO 168 345 345 PRO PRO A . n 
A 1 169 PRO 169 346 346 PRO PRO A . n 
A 1 170 ASP 170 347 347 ASP ASP A . n 
A 1 171 GLY 171 348 348 GLY GLY A . n 
A 1 172 PHE 172 349 349 PHE PHE A . n 
A 1 173 LYS 173 350 350 LYS LYS A . n 
A 1 174 GLN 174 351 351 GLN GLN A . n 
A 1 175 ILE 175 352 352 ILE ILE A . n 
A 1 176 ARG 176 353 353 ARG ARG A . n 
A 1 177 GLN 177 354 354 GLN GLN A . n 
A 1 178 GLY 178 355 355 GLY GLY A . n 
A 1 179 MET 179 356 356 MET MET A . n 
A 1 180 ILE 180 357 357 ILE ILE A . n 
A 1 181 THR 181 358 358 THR THR A . n 
A 1 182 LEU 182 359 359 LEU LEU A . n 
A 1 183 ILE 183 360 360 ILE ILE A . n 
A 1 184 LEU 184 361 361 LEU LEU A . n 
A 1 185 ALA 185 362 362 ALA ALA A . n 
A 1 186 THR 186 363 363 THR THR A . n 
A 1 187 ASP 187 364 364 ASP ASP A . n 
A 1 188 MET 188 365 365 MET MET A . n 
A 1 189 ALA 189 366 366 ALA ALA A . n 
A 1 190 ARG 190 367 367 ARG ARG A . n 
A 1 191 HIS 191 368 368 HIS HIS A . n 
A 1 192 ALA 192 369 369 ALA ALA A . n 
A 1 193 GLU 193 370 370 GLU GLU A . n 
A 1 194 ILE 194 371 371 ILE ILE A . n 
A 1 195 MET 195 372 372 MET MET A . n 
A 1 196 ASP 196 373 373 ASP ASP A . n 
A 1 197 SER 197 374 374 SER SER A . n 
A 1 198 PHE 198 375 375 PHE PHE A . n 
A 1 199 LYS 199 376 376 LYS LYS A . n 
A 1 200 GLU 200 377 377 GLU GLU A . n 
A 1 201 LYS 201 378 378 LYS LYS A . n 
A 1 202 MET 202 379 379 MET MET A . n 
A 1 203 GLU 203 380 380 GLU GLU A . n 
A 1 204 ASN 204 381 381 ASN ASN A . n 
A 1 205 PHE 205 382 382 PHE PHE A . n 
A 1 206 ASP 206 383 383 ASP ASP A . n 
A 1 207 TYR 207 384 384 TYR TYR A . n 
A 1 208 SER 208 385 385 SER SER A . n 
A 1 209 ASN 209 386 386 ASN ASN A . n 
A 1 210 GLU 210 387 387 GLU GLU A . n 
A 1 211 GLU 211 388 388 GLU GLU A . n 
A 1 212 HIS 212 389 389 HIS HIS A . n 
A 1 213 MET 213 390 390 MET MET A . n 
A 1 214 THR 214 391 391 THR THR A . n 
A 1 215 LEU 215 392 392 LEU LEU A . n 
A 1 216 LEU 216 393 393 LEU LEU A . n 
A 1 217 LYS 217 394 394 LYS LYS A . n 
A 1 218 MET 218 395 395 MET MET A . n 
A 1 219 ILE 219 396 396 ILE ILE A . n 
A 1 220 LEU 220 397 397 LEU LEU A . n 
A 1 221 ILE 221 398 398 ILE ILE A . n 
A 1 222 LYS 222 399 399 LYS LYS A . n 
A 1 223 CYS 223 400 400 CYS CYS A . n 
A 1 224 CYS 224 401 401 CYS CYS A . n 
A 1 225 ASP 225 402 402 ASP ASP A . n 
A 1 226 ILE 226 403 403 ILE ILE A . n 
A 1 227 SER 227 404 404 SER SER A . n 
A 1 228 ASN 228 405 405 ASN ASN A . n 
A 1 229 GLU 229 406 406 GLU GLU A . n 
A 1 230 VAL 230 407 407 VAL VAL A . n 
A 1 231 ARG 231 408 408 ARG ARG A . n 
A 1 232 PRO 232 409 409 PRO PRO A . n 
A 1 233 MET 233 410 410 MET MET A . n 
A 1 234 GLU 234 411 411 GLU GLU A . n 
A 1 235 VAL 235 412 412 VAL VAL A . n 
A 1 236 ALA 236 413 413 ALA ALA A . n 
A 1 237 GLU 237 414 414 GLU GLU A . n 
A 1 238 PRO 238 415 415 PRO PRO A . n 
A 1 239 TRP 239 416 416 TRP TRP A . n 
A 1 240 VAL 240 417 417 VAL VAL A . n 
A 1 241 ASP 241 418 418 ASP ASP A . n 
A 1 242 CYS 242 419 419 CYS CYS A . n 
A 1 243 LEU 243 420 420 LEU LEU A . n 
A 1 244 LEU 244 421 421 LEU LEU A . n 
A 1 245 GLU 245 422 422 GLU GLU A . n 
A 1 246 GLU 246 423 423 GLU GLU A . n 
A 1 247 TYR 247 424 424 TYR TYR A . n 
A 1 248 PHE 248 425 425 PHE PHE A . n 
A 1 249 MET 249 426 426 MET MET A . n 
A 1 250 GLN 250 427 427 GLN GLN A . n 
A 1 251 SER 251 428 428 SER SER A . n 
A 1 252 ASP 252 429 429 ASP ASP A . n 
A 1 253 ARG 253 430 430 ARG ARG A . n 
A 1 254 GLU 254 431 431 GLU GLU A . n 
A 1 255 LYS 255 432 432 LYS LYS A . n 
A 1 256 SER 256 433 433 SER SER A . n 
A 1 257 GLU 257 434 434 GLU GLU A . n 
A 1 258 GLY 258 435 435 GLY GLY A . n 
A 1 259 LEU 259 436 436 LEU LEU A . n 
A 1 260 PRO 260 437 437 PRO PRO A . n 
A 1 261 VAL 261 438 438 VAL VAL A . n 
A 1 262 ALA 262 439 439 ALA ALA A . n 
A 1 263 PRO 263 440 440 PRO PRO A . n 
A 1 264 PHE 264 441 441 PHE PHE A . n 
A 1 265 MET 265 442 442 MET MET A . n 
A 1 266 ASP 266 443 443 ASP ASP A . n 
A 1 267 ARG 267 444 444 ARG ARG A . n 
A 1 268 ASP 268 445 445 ASP ASP A . n 
A 1 269 LYS 269 446 446 LYS LYS A . n 
A 1 270 VAL 270 447 447 VAL VAL A . n 
A 1 271 THR 271 448 448 THR THR A . n 
A 1 272 LYS 272 449 449 LYS LYS A . n 
A 1 273 ALA 273 450 450 ALA ALA A . n 
A 1 274 THR 274 451 451 THR THR A . n 
A 1 275 ALA 275 452 452 ALA ALA A . n 
A 1 276 GLN 276 453 453 GLN GLN A . n 
A 1 277 ILE 277 454 454 ILE ILE A . n 
A 1 278 GLY 278 455 455 GLY GLY A . n 
A 1 279 PHE 279 456 456 PHE PHE A . n 
A 1 280 ILE 280 457 457 ILE ILE A . n 
A 1 281 LYS 281 458 458 LYS LYS A . n 
A 1 282 PHE 282 459 459 PHE PHE A . n 
A 1 283 VAL 283 460 460 VAL VAL A . n 
A 1 284 LEU 284 461 461 LEU LEU A . n 
A 1 285 ILE 285 462 462 ILE ILE A . n 
A 1 286 PRO 286 463 463 PRO PRO A . n 
A 1 287 MET 287 464 464 MET MET A . n 
A 1 288 PHE 288 465 465 PHE PHE A . n 
A 1 289 GLU 289 466 466 GLU GLU A . n 
A 1 290 THR 290 467 467 THR THR A . n 
A 1 291 VAL 291 468 468 VAL VAL A . n 
A 1 292 THR 292 469 469 THR THR A . n 
A 1 293 LYS 293 470 470 LYS LYS A . n 
A 1 294 LEU 294 471 471 LEU LEU A . n 
A 1 295 PHE 295 472 472 PHE PHE A . n 
A 1 296 PRO 296 473 473 PRO PRO A . n 
A 1 297 MET 297 474 474 MET MET A . n 
A 1 298 VAL 298 475 475 VAL VAL A . n 
A 1 299 GLU 299 476 476 GLU GLU A . n 
A 1 300 GLU 300 477 477 GLU GLU A . n 
A 1 301 ILE 301 478 478 ILE ILE A . n 
A 1 302 MET 302 479 479 MET MET A . n 
A 1 303 LEU 303 480 480 LEU LEU A . n 
A 1 304 GLN 304 481 481 GLN GLN A . n 
A 1 305 PRO 305 482 482 PRO PRO A . n 
A 1 306 LEU 306 483 483 LEU LEU A . n 
A 1 307 TRP 307 484 484 TRP TRP A . n 
A 1 308 GLU 308 485 485 GLU GLU A . n 
A 1 309 SER 309 486 486 SER SER A . n 
A 1 310 ARG 310 487 487 ARG ARG A . n 
A 1 311 ASP 311 488 488 ASP ASP A . n 
A 1 312 ARG 312 489 489 ARG ARG A . n 
A 1 313 TYR 313 490 490 TYR TYR A . n 
A 1 314 GLU 314 491 491 GLU GLU A . n 
A 1 315 GLU 315 492 492 GLU GLU A . n 
A 1 316 LEU 316 493 493 LEU LEU A . n 
A 1 317 LYS 317 494 494 LYS LYS A . n 
A 1 318 ARG 318 495 495 ARG ARG A . n 
A 1 319 ILE 319 496 496 ILE ILE A . n 
A 1 320 ASP 320 497 497 ASP ASP A . n 
A 1 321 ASP 321 498 498 ASP ASP A . n 
A 1 322 ALA 322 499 499 ALA ALA A . n 
A 1 323 MET 323 500 500 MET MET A . n 
A 1 324 LYS 324 501 501 LYS LYS A . n 
A 1 325 GLU 325 502 502 GLU GLU A . n 
A 1 326 LEU 326 503 503 LEU LEU A . n 
A 1 327 GLN 327 504 504 GLN GLN A . n 
A 1 328 LYS 328 505 505 LYS LYS A . n 
A 1 329 LYS 329 506 ?   ?   ?   A . n 
B 1 1   GLY 1   178 178 GLY GLY B . n 
B 1 2   SER 2   179 179 SER SER B . n 
B 1 3   HIS 3   180 180 HIS HIS B . n 
B 1 4   MET 4   181 181 MET MET B . n 
B 1 5   THR 5   182 182 THR THR B . n 
B 1 6   TYR 6   183 183 TYR TYR B . n 
B 1 7   PRO 7   184 184 PRO PRO B . n 
B 1 8   LYS 8   185 185 LYS LYS B . n 
B 1 9   TYR 9   186 186 TYR TYR B . n 
B 1 10  LEU 10  187 187 LEU LEU B . n 
B 1 11  LEU 11  188 188 LEU LEU B . n 
B 1 12  SER 12  189 189 SER SER B . n 
B 1 13  PRO 13  190 190 PRO PRO B . n 
B 1 14  GLU 14  191 191 GLU GLU B . n 
B 1 15  THR 15  192 192 THR THR B . n 
B 1 16  ILE 16  193 193 ILE ILE B . n 
B 1 17  GLU 17  194 194 GLU GLU B . n 
B 1 18  ALA 18  195 195 ALA ALA B . n 
B 1 19  LEU 19  196 196 LEU LEU B . n 
B 1 20  ARG 20  197 197 ARG ARG B . n 
B 1 21  LYS 21  198 198 LYS LYS B . n 
B 1 22  PRO 22  199 199 PRO PRO B . n 
B 1 23  THR 23  200 200 THR THR B . n 
B 1 24  PHE 24  201 201 PHE PHE B . n 
B 1 25  ASP 25  202 202 ASP ASP B . n 
B 1 26  VAL 26  203 203 VAL VAL B . n 
B 1 27  TRP 27  204 204 TRP TRP B . n 
B 1 28  LEU 28  205 205 LEU LEU B . n 
B 1 29  TRP 29  206 206 TRP TRP B . n 
B 1 30  GLU 30  207 207 GLU GLU B . n 
B 1 31  PRO 31  208 208 PRO PRO B . n 
B 1 32  ASN 32  209 209 ASN ASN B . n 
B 1 33  GLU 33  210 210 GLU GLU B . n 
B 1 34  MET 34  211 211 MET MET B . n 
B 1 35  LEU 35  212 212 LEU LEU B . n 
B 1 36  SER 36  213 213 SER SER B . n 
B 1 37  CYS 37  214 214 CYS CYS B . n 
B 1 38  LEU 38  215 215 LEU LEU B . n 
B 1 39  GLU 39  216 216 GLU GLU B . n 
B 1 40  HIS 40  217 217 HIS HIS B . n 
B 1 41  MET 41  218 218 MET MET B . n 
B 1 42  TYR 42  219 219 TYR TYR B . n 
B 1 43  HIS 43  220 220 HIS HIS B . n 
B 1 44  ASP 44  221 221 ASP ASP B . n 
B 1 45  LEU 45  222 222 LEU LEU B . n 
B 1 46  GLY 46  223 223 GLY GLY B . n 
B 1 47  LEU 47  224 224 LEU LEU B . n 
B 1 48  VAL 48  225 225 VAL VAL B . n 
B 1 49  ARG 49  226 226 ARG ARG B . n 
B 1 50  ASP 50  227 227 ASP ASP B . n 
B 1 51  PHE 51  228 228 PHE PHE B . n 
B 1 52  SER 52  229 229 SER SER B . n 
B 1 53  ILE 53  230 230 ILE ILE B . n 
B 1 54  ASN 54  231 231 ASN ASN B . n 
B 1 55  PRO 55  232 232 PRO PRO B . n 
B 1 56  VAL 56  233 233 VAL VAL B . n 
B 1 57  THR 57  234 234 THR THR B . n 
B 1 58  LEU 58  235 235 LEU LEU B . n 
B 1 59  ARG 59  236 236 ARG ARG B . n 
B 1 60  ARG 60  237 237 ARG ARG B . n 
B 1 61  TRP 61  238 238 TRP TRP B . n 
B 1 62  LEU 62  239 239 LEU LEU B . n 
B 1 63  PHE 63  240 240 PHE PHE B . n 
B 1 64  CYS 64  241 241 CYS CYS B . n 
B 1 65  VAL 65  242 242 VAL VAL B . n 
B 1 66  HIS 66  243 243 HIS HIS B . n 
B 1 67  ASP 67  244 244 ASP ASP B . n 
B 1 68  ASN 68  245 245 ASN ASN B . n 
B 1 69  TYR 69  246 246 TYR TYR B . n 
B 1 70  ARG 70  247 247 ARG ARG B . n 
B 1 71  ASN 71  248 248 ASN ASN B . n 
B 1 72  ASN 72  249 249 ASN ASN B . n 
B 1 73  PRO 73  250 250 PRO PRO B . n 
B 1 74  PHE 74  251 251 PHE PHE B . n 
B 1 75  HIS 75  252 252 HIS HIS B . n 
B 1 76  ASN 76  253 253 ASN ASN B . n 
B 1 77  PHE 77  254 254 PHE PHE B . n 
B 1 78  ARG 78  255 255 ARG ARG B . n 
B 1 79  HIS 79  256 256 HIS HIS B . n 
B 1 80  CYS 80  257 257 CYS CYS B . n 
B 1 81  PHE 81  258 258 PHE PHE B . n 
B 1 82  CYS 82  259 259 CYS CYS B . n 
B 1 83  VAL 83  260 260 VAL VAL B . n 
B 1 84  ALA 84  261 261 ALA ALA B . n 
B 1 85  GLN 85  262 262 GLN GLN B . n 
B 1 86  MET 86  263 263 MET MET B . n 
B 1 87  MET 87  264 264 MET MET B . n 
B 1 88  TYR 88  265 265 TYR TYR B . n 
B 1 89  SER 89  266 266 SER SER B . n 
B 1 90  MET 90  267 267 MET MET B . n 
B 1 91  VAL 91  268 268 VAL VAL B . n 
B 1 92  TRP 92  269 269 TRP TRP B . n 
B 1 93  LEU 93  270 270 LEU LEU B . n 
B 1 94  CYS 94  271 271 CYS CYS B . n 
B 1 95  SER 95  272 272 SER SER B . n 
B 1 96  LEU 96  273 273 LEU LEU B . n 
B 1 97  GLN 97  274 274 GLN GLN B . n 
B 1 98  GLU 98  275 275 GLU GLU B . n 
B 1 99  LYS 99  276 276 LYS LYS B . n 
B 1 100 PHE 100 277 277 PHE PHE B . n 
B 1 101 SER 101 278 278 SER SER B . n 
B 1 102 GLN 102 279 279 GLN GLN B . n 
B 1 103 THR 103 280 280 THR THR B . n 
B 1 104 ASP 104 281 281 ASP ASP B . n 
B 1 105 ILE 105 282 282 ILE ILE B . n 
B 1 106 LEU 106 283 283 LEU LEU B . n 
B 1 107 ILE 107 284 284 ILE ILE B . n 
B 1 108 LEU 108 285 285 LEU LEU B . n 
B 1 109 MET 109 286 286 MET MET B . n 
B 1 110 THR 110 287 287 THR THR B . n 
B 1 111 ALA 111 288 288 ALA ALA B . n 
B 1 112 ALA 112 289 289 ALA ALA B . n 
B 1 113 ILE 113 290 290 ILE ILE B . n 
B 1 114 CYS 114 291 291 CYS CYS B . n 
B 1 115 HIS 115 292 292 HIS HIS B . n 
B 1 116 ASP 116 293 293 ASP ASP B . n 
B 1 117 LEU 117 294 294 LEU LEU B . n 
B 1 118 ASP 118 295 295 ASP ASP B . n 
B 1 119 HIS 119 296 296 HIS HIS B . n 
B 1 120 PRO 120 297 297 PRO PRO B . n 
B 1 121 GLY 121 298 298 GLY GLY B . n 
B 1 122 TYR 122 299 299 TYR TYR B . n 
B 1 123 ASN 123 300 300 ASN ASN B . n 
B 1 124 ASN 124 301 301 ASN ASN B . n 
B 1 125 THR 125 302 302 THR THR B . n 
B 1 126 TYR 126 303 303 TYR TYR B . n 
B 1 127 GLN 127 304 304 GLN GLN B . n 
B 1 128 ILE 128 305 305 ILE ILE B . n 
B 1 129 ASN 129 306 306 ASN ASN B . n 
B 1 130 ALA 130 307 307 ALA ALA B . n 
B 1 131 ARG 131 308 308 ARG ARG B . n 
B 1 132 THR 132 309 309 THR THR B . n 
B 1 133 GLU 133 310 310 GLU GLU B . n 
B 1 134 LEU 134 311 311 LEU LEU B . n 
B 1 135 ALA 135 312 312 ALA ALA B . n 
B 1 136 VAL 136 313 313 VAL VAL B . n 
B 1 137 ARG 137 314 314 ARG ARG B . n 
B 1 138 TYR 138 315 315 TYR TYR B . n 
B 1 139 ASN 139 316 316 ASN ASN B . n 
B 1 140 ASP 140 317 317 ASP ASP B . n 
B 1 141 ILE 141 318 318 ILE ILE B . n 
B 1 142 SER 142 319 319 SER SER B . n 
B 1 143 PRO 143 320 320 PRO PRO B . n 
B 1 144 LEU 144 321 321 LEU LEU B . n 
B 1 145 GLU 145 322 322 GLU GLU B . n 
B 1 146 ASN 146 323 323 ASN ASN B . n 
B 1 147 HIS 147 324 324 HIS HIS B . n 
B 1 148 HIS 148 325 325 HIS HIS B . n 
B 1 149 CYS 149 326 326 CYS CYS B . n 
B 1 150 ALA 150 327 327 ALA ALA B . n 
B 1 151 VAL 151 328 328 VAL VAL B . n 
B 1 152 ALA 152 329 329 ALA ALA B . n 
B 1 153 PHE 153 330 330 PHE PHE B . n 
B 1 154 GLN 154 331 331 GLN GLN B . n 
B 1 155 ILE 155 332 332 ILE ILE B . n 
B 1 156 LEU 156 333 333 LEU LEU B . n 
B 1 157 ALA 157 334 334 ALA ALA B . n 
B 1 158 GLU 158 335 335 GLU GLU B . n 
B 1 159 PRO 159 336 336 PRO PRO B . n 
B 1 160 GLU 160 337 337 GLU GLU B . n 
B 1 161 CYS 161 338 338 CYS CYS B . n 
B 1 162 ASN 162 339 339 ASN ASN B . n 
B 1 163 ILE 163 340 340 ILE ILE B . n 
B 1 164 PHE 164 341 341 PHE PHE B . n 
B 1 165 SER 165 342 342 SER SER B . n 
B 1 166 ASN 166 343 343 ASN ASN B . n 
B 1 167 ILE 167 344 344 ILE ILE B . n 
B 1 168 PRO 168 345 345 PRO PRO B . n 
B 1 169 PRO 169 346 346 PRO PRO B . n 
B 1 170 ASP 170 347 347 ASP ASP B . n 
B 1 171 GLY 171 348 348 GLY GLY B . n 
B 1 172 PHE 172 349 349 PHE PHE B . n 
B 1 173 LYS 173 350 350 LYS LYS B . n 
B 1 174 GLN 174 351 351 GLN GLN B . n 
B 1 175 ILE 175 352 352 ILE ILE B . n 
B 1 176 ARG 176 353 353 ARG ARG B . n 
B 1 177 GLN 177 354 354 GLN GLN B . n 
B 1 178 GLY 178 355 355 GLY GLY B . n 
B 1 179 MET 179 356 356 MET MET B . n 
B 1 180 ILE 180 357 357 ILE ILE B . n 
B 1 181 THR 181 358 358 THR THR B . n 
B 1 182 LEU 182 359 359 LEU LEU B . n 
B 1 183 ILE 183 360 360 ILE ILE B . n 
B 1 184 LEU 184 361 361 LEU LEU B . n 
B 1 185 ALA 185 362 362 ALA ALA B . n 
B 1 186 THR 186 363 363 THR THR B . n 
B 1 187 ASP 187 364 364 ASP ASP B . n 
B 1 188 MET 188 365 365 MET MET B . n 
B 1 189 ALA 189 366 366 ALA ALA B . n 
B 1 190 ARG 190 367 367 ARG ARG B . n 
B 1 191 HIS 191 368 368 HIS HIS B . n 
B 1 192 ALA 192 369 369 ALA ALA B . n 
B 1 193 GLU 193 370 370 GLU GLU B . n 
B 1 194 ILE 194 371 371 ILE ILE B . n 
B 1 195 MET 195 372 372 MET MET B . n 
B 1 196 ASP 196 373 373 ASP ASP B . n 
B 1 197 SER 197 374 374 SER SER B . n 
B 1 198 PHE 198 375 375 PHE PHE B . n 
B 1 199 LYS 199 376 376 LYS LYS B . n 
B 1 200 GLU 200 377 377 GLU GLU B . n 
B 1 201 LYS 201 378 378 LYS LYS B . n 
B 1 202 MET 202 379 379 MET MET B . n 
B 1 203 GLU 203 380 380 GLU GLU B . n 
B 1 204 ASN 204 381 381 ASN ASN B . n 
B 1 205 PHE 205 382 382 PHE PHE B . n 
B 1 206 ASP 206 383 383 ASP ASP B . n 
B 1 207 TYR 207 384 384 TYR TYR B . n 
B 1 208 SER 208 385 385 SER SER B . n 
B 1 209 ASN 209 386 386 ASN ASN B . n 
B 1 210 GLU 210 387 387 GLU GLU B . n 
B 1 211 GLU 211 388 388 GLU GLU B . n 
B 1 212 HIS 212 389 389 HIS HIS B . n 
B 1 213 MET 213 390 390 MET MET B . n 
B 1 214 THR 214 391 391 THR THR B . n 
B 1 215 LEU 215 392 392 LEU LEU B . n 
B 1 216 LEU 216 393 393 LEU LEU B . n 
B 1 217 LYS 217 394 394 LYS LYS B . n 
B 1 218 MET 218 395 395 MET MET B . n 
B 1 219 ILE 219 396 396 ILE ILE B . n 
B 1 220 LEU 220 397 397 LEU LEU B . n 
B 1 221 ILE 221 398 398 ILE ILE B . n 
B 1 222 LYS 222 399 399 LYS LYS B . n 
B 1 223 CYS 223 400 400 CYS CYS B . n 
B 1 224 CYS 224 401 401 CYS CYS B . n 
B 1 225 ASP 225 402 402 ASP ASP B . n 
B 1 226 ILE 226 403 403 ILE ILE B . n 
B 1 227 SER 227 404 404 SER SER B . n 
B 1 228 ASN 228 405 405 ASN ASN B . n 
B 1 229 GLU 229 406 406 GLU GLU B . n 
B 1 230 VAL 230 407 407 VAL VAL B . n 
B 1 231 ARG 231 408 408 ARG ARG B . n 
B 1 232 PRO 232 409 409 PRO PRO B . n 
B 1 233 MET 233 410 410 MET MET B . n 
B 1 234 GLU 234 411 411 GLU GLU B . n 
B 1 235 VAL 235 412 412 VAL VAL B . n 
B 1 236 ALA 236 413 413 ALA ALA B . n 
B 1 237 GLU 237 414 414 GLU GLU B . n 
B 1 238 PRO 238 415 415 PRO PRO B . n 
B 1 239 TRP 239 416 416 TRP TRP B . n 
B 1 240 VAL 240 417 417 VAL VAL B . n 
B 1 241 ASP 241 418 418 ASP ASP B . n 
B 1 242 CYS 242 419 419 CYS CYS B . n 
B 1 243 LEU 243 420 420 LEU LEU B . n 
B 1 244 LEU 244 421 421 LEU LEU B . n 
B 1 245 GLU 245 422 422 GLU GLU B . n 
B 1 246 GLU 246 423 423 GLU GLU B . n 
B 1 247 TYR 247 424 424 TYR TYR B . n 
B 1 248 PHE 248 425 425 PHE PHE B . n 
B 1 249 MET 249 426 426 MET MET B . n 
B 1 250 GLN 250 427 427 GLN GLN B . n 
B 1 251 SER 251 428 428 SER SER B . n 
B 1 252 ASP 252 429 429 ASP ASP B . n 
B 1 253 ARG 253 430 430 ARG ARG B . n 
B 1 254 GLU 254 431 431 GLU GLU B . n 
B 1 255 LYS 255 432 432 LYS LYS B . n 
B 1 256 SER 256 433 433 SER SER B . n 
B 1 257 GLU 257 434 434 GLU GLU B . n 
B 1 258 GLY 258 435 435 GLY GLY B . n 
B 1 259 LEU 259 436 436 LEU LEU B . n 
B 1 260 PRO 260 437 437 PRO PRO B . n 
B 1 261 VAL 261 438 438 VAL VAL B . n 
B 1 262 ALA 262 439 439 ALA ALA B . n 
B 1 263 PRO 263 440 440 PRO PRO B . n 
B 1 264 PHE 264 441 441 PHE PHE B . n 
B 1 265 MET 265 442 442 MET MET B . n 
B 1 266 ASP 266 443 443 ASP ASP B . n 
B 1 267 ARG 267 444 444 ARG ARG B . n 
B 1 268 ASP 268 445 445 ASP ASP B . n 
B 1 269 LYS 269 446 446 LYS LYS B . n 
B 1 270 VAL 270 447 447 VAL VAL B . n 
B 1 271 THR 271 448 448 THR THR B . n 
B 1 272 LYS 272 449 449 LYS LYS B . n 
B 1 273 ALA 273 450 450 ALA ALA B . n 
B 1 274 THR 274 451 451 THR THR B . n 
B 1 275 ALA 275 452 452 ALA ALA B . n 
B 1 276 GLN 276 453 453 GLN GLN B . n 
B 1 277 ILE 277 454 454 ILE ILE B . n 
B 1 278 GLY 278 455 455 GLY GLY B . n 
B 1 279 PHE 279 456 456 PHE PHE B . n 
B 1 280 ILE 280 457 457 ILE ILE B . n 
B 1 281 LYS 281 458 458 LYS LYS B . n 
B 1 282 PHE 282 459 459 PHE PHE B . n 
B 1 283 VAL 283 460 460 VAL VAL B . n 
B 1 284 LEU 284 461 461 LEU LEU B . n 
B 1 285 ILE 285 462 462 ILE ILE B . n 
B 1 286 PRO 286 463 463 PRO PRO B . n 
B 1 287 MET 287 464 464 MET MET B . n 
B 1 288 PHE 288 465 465 PHE PHE B . n 
B 1 289 GLU 289 466 466 GLU GLU B . n 
B 1 290 THR 290 467 467 THR THR B . n 
B 1 291 VAL 291 468 468 VAL VAL B . n 
B 1 292 THR 292 469 469 THR THR B . n 
B 1 293 LYS 293 470 470 LYS LYS B . n 
B 1 294 LEU 294 471 471 LEU LEU B . n 
B 1 295 PHE 295 472 472 PHE PHE B . n 
B 1 296 PRO 296 473 473 PRO PRO B . n 
B 1 297 MET 297 474 474 MET MET B . n 
B 1 298 VAL 298 475 475 VAL VAL B . n 
B 1 299 GLU 299 476 476 GLU GLU B . n 
B 1 300 GLU 300 477 477 GLU GLU B . n 
B 1 301 ILE 301 478 478 ILE ILE B . n 
B 1 302 MET 302 479 479 MET MET B . n 
B 1 303 LEU 303 480 480 LEU LEU B . n 
B 1 304 GLN 304 481 481 GLN GLN B . n 
B 1 305 PRO 305 482 482 PRO PRO B . n 
B 1 306 LEU 306 483 483 LEU LEU B . n 
B 1 307 TRP 307 484 484 TRP TRP B . n 
B 1 308 GLU 308 485 485 GLU GLU B . n 
B 1 309 SER 309 486 486 SER SER B . n 
B 1 310 ARG 310 487 487 ARG ARG B . n 
B 1 311 ASP 311 488 488 ASP ASP B . n 
B 1 312 ARG 312 489 489 ARG ARG B . n 
B 1 313 TYR 313 490 490 TYR TYR B . n 
B 1 314 GLU 314 491 491 GLU GLU B . n 
B 1 315 GLU 315 492 492 GLU GLU B . n 
B 1 316 LEU 316 493 493 LEU LEU B . n 
B 1 317 LYS 317 494 494 LYS LYS B . n 
B 1 318 ARG 318 495 495 ARG ARG B . n 
B 1 319 ILE 319 496 496 ILE ILE B . n 
B 1 320 ASP 320 497 497 ASP ASP B . n 
B 1 321 ASP 321 498 498 ASP ASP B . n 
B 1 322 ALA 322 499 499 ALA ALA B . n 
B 1 323 MET 323 500 500 MET MET B . n 
B 1 324 LYS 324 501 501 LYS LYS B . n 
B 1 325 GLU 325 502 502 GLU GLU B . n 
B 1 326 LEU 326 503 503 LEU LEU B . n 
B 1 327 GLN 327 504 504 GLN GLN B . n 
B 1 328 LYS 328 505 505 LYS LYS B . n 
B 1 329 LYS 329 506 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NA  1   901  901  NA  NA  A . 
D 2 NA  1   902  902  NA  NA  A . 
E 3 PCG 1   900  900  PCG PCG A . 
F 2 NA  1   901  901  NA  NA  B . 
G 2 NA  1   902  902  NA  NA  B . 
H 4 IBM 1   900  900  IBM IBM B . 
I 5 HOH 1   5    5    HOH HOH A . 
I 5 HOH 2   7    7    HOH HOH A . 
I 5 HOH 3   9    9    HOH HOH A . 
I 5 HOH 4   11   11   HOH HOH A . 
I 5 HOH 5   12   12   HOH HOH A . 
I 5 HOH 6   13   13   HOH HOH A . 
I 5 HOH 7   15   15   HOH HOH A . 
I 5 HOH 8   18   18   HOH HOH A . 
I 5 HOH 9   20   20   HOH HOH A . 
I 5 HOH 10  21   21   HOH HOH A . 
I 5 HOH 11  22   22   HOH HOH A . 
I 5 HOH 12  23   23   HOH HOH A . 
I 5 HOH 13  24   24   HOH HOH A . 
I 5 HOH 14  26   26   HOH HOH A . 
I 5 HOH 15  27   27   HOH HOH A . 
I 5 HOH 16  28   28   HOH HOH A . 
I 5 HOH 17  29   29   HOH HOH A . 
I 5 HOH 18  31   31   HOH HOH A . 
I 5 HOH 19  32   32   HOH HOH A . 
I 5 HOH 20  33   33   HOH HOH A . 
I 5 HOH 21  36   36   HOH HOH A . 
I 5 HOH 22  38   38   HOH HOH A . 
I 5 HOH 23  39   39   HOH HOH A . 
I 5 HOH 24  41   41   HOH HOH A . 
I 5 HOH 25  42   42   HOH HOH A . 
I 5 HOH 26  45   45   HOH HOH A . 
I 5 HOH 27  46   46   HOH HOH A . 
I 5 HOH 28  48   48   HOH HOH A . 
I 5 HOH 29  50   50   HOH HOH A . 
I 5 HOH 30  52   52   HOH HOH A . 
I 5 HOH 31  55   55   HOH HOH A . 
I 5 HOH 32  56   56   HOH HOH A . 
I 5 HOH 33  57   57   HOH HOH A . 
I 5 HOH 34  60   60   HOH HOH A . 
I 5 HOH 35  64   64   HOH HOH A . 
I 5 HOH 36  67   67   HOH HOH A . 
I 5 HOH 37  68   68   HOH HOH A . 
I 5 HOH 38  69   69   HOH HOH A . 
I 5 HOH 39  71   71   HOH HOH A . 
I 5 HOH 40  72   72   HOH HOH A . 
I 5 HOH 41  74   74   HOH HOH A . 
I 5 HOH 42  75   75   HOH HOH A . 
I 5 HOH 43  76   76   HOH HOH A . 
I 5 HOH 44  78   78   HOH HOH A . 
I 5 HOH 45  79   79   HOH HOH A . 
I 5 HOH 46  83   83   HOH HOH A . 
I 5 HOH 47  87   87   HOH HOH A . 
I 5 HOH 48  88   88   HOH HOH A . 
I 5 HOH 49  89   89   HOH HOH A . 
I 5 HOH 50  92   92   HOH HOH A . 
I 5 HOH 51  93   93   HOH HOH A . 
I 5 HOH 52  95   95   HOH HOH A . 
I 5 HOH 53  1005 1005 HOH HOH A . 
I 5 HOH 54  1006 1006 HOH HOH A . 
I 5 HOH 55  1007 1007 HOH HOH A . 
I 5 HOH 56  1008 1008 HOH HOH A . 
I 5 HOH 57  1010 1010 HOH HOH A . 
I 5 HOH 58  1011 1011 HOH HOH A . 
I 5 HOH 59  1012 1012 HOH HOH A . 
I 5 HOH 60  1013 1013 HOH HOH A . 
I 5 HOH 61  1015 1015 HOH HOH A . 
I 5 HOH 62  1016 1016 HOH HOH A . 
I 5 HOH 63  1019 1019 HOH HOH A . 
I 5 HOH 64  1020 1020 HOH HOH A . 
I 5 HOH 65  1024 1024 HOH HOH A . 
I 5 HOH 66  1025 1025 HOH HOH A . 
I 5 HOH 67  1027 1027 HOH HOH A . 
I 5 HOH 68  1028 1028 HOH HOH A . 
I 5 HOH 69  1030 1030 HOH HOH A . 
I 5 HOH 70  1031 1031 HOH HOH A . 
I 5 HOH 71  1032 1032 HOH HOH A . 
I 5 HOH 72  1034 1034 HOH HOH A . 
I 5 HOH 73  1035 1035 HOH HOH A . 
I 5 HOH 74  1040 1040 HOH HOH A . 
I 5 HOH 75  1041 1041 HOH HOH A . 
I 5 HOH 76  1046 1046 HOH HOH A . 
I 5 HOH 77  1051 1051 HOH HOH A . 
I 5 HOH 78  1057 1057 HOH HOH A . 
I 5 HOH 79  1058 1058 HOH HOH A . 
I 5 HOH 80  1061 1061 HOH HOH A . 
I 5 HOH 81  1062 1062 HOH HOH A . 
I 5 HOH 82  1066 1066 HOH HOH A . 
I 5 HOH 83  1068 1068 HOH HOH A . 
I 5 HOH 84  1069 1069 HOH HOH A . 
I 5 HOH 85  1072 1072 HOH HOH A . 
I 5 HOH 86  1074 1074 HOH HOH A . 
I 5 HOH 87  1075 1075 HOH HOH A . 
I 5 HOH 88  1078 1078 HOH HOH A . 
I 5 HOH 89  1079 1079 HOH HOH A . 
I 5 HOH 90  1081 1081 HOH HOH A . 
I 5 HOH 91  1082 1082 HOH HOH A . 
I 5 HOH 92  1084 1084 HOH HOH A . 
I 5 HOH 93  1087 1087 HOH HOH A . 
I 5 HOH 94  1089 1089 HOH HOH A . 
I 5 HOH 95  1090 1090 HOH HOH A . 
I 5 HOH 96  1091 1091 HOH HOH A . 
I 5 HOH 97  1093 1093 HOH HOH A . 
I 5 HOH 98  1095 1095 HOH HOH A . 
I 5 HOH 99  1098 1098 HOH HOH A . 
I 5 HOH 100 1099 1099 HOH HOH A . 
I 5 HOH 101 1101 1101 HOH HOH A . 
I 5 HOH 102 1102 1102 HOH HOH A . 
I 5 HOH 103 1104 1104 HOH HOH A . 
I 5 HOH 104 1105 1105 HOH HOH A . 
I 5 HOH 105 1108 1108 HOH HOH A . 
I 5 HOH 106 1112 1112 HOH HOH A . 
I 5 HOH 107 1113 1113 HOH HOH A . 
I 5 HOH 108 1115 1115 HOH HOH A . 
I 5 HOH 109 1119 1119 HOH HOH A . 
I 5 HOH 110 1121 1121 HOH HOH A . 
I 5 HOH 111 1122 1122 HOH HOH A . 
I 5 HOH 112 1123 1123 HOH HOH A . 
I 5 HOH 113 1128 1128 HOH HOH A . 
I 5 HOH 114 1129 1129 HOH HOH A . 
I 5 HOH 115 1130 1130 HOH HOH A . 
I 5 HOH 116 1135 1135 HOH HOH A . 
I 5 HOH 117 1136 1136 HOH HOH A . 
I 5 HOH 118 1137 1137 HOH HOH A . 
I 5 HOH 119 1141 1141 HOH HOH A . 
I 5 HOH 120 1143 1143 HOH HOH A . 
I 5 HOH 121 1144 1144 HOH HOH A . 
I 5 HOH 122 1145 1145 HOH HOH A . 
I 5 HOH 123 1146 1146 HOH HOH A . 
I 5 HOH 124 1147 1147 HOH HOH A . 
I 5 HOH 125 1149 1149 HOH HOH A . 
I 5 HOH 126 1152 1152 HOH HOH A . 
I 5 HOH 127 1153 1153 HOH HOH A . 
J 5 HOH 1   1    1    HOH HOH B . 
J 5 HOH 2   2    2    HOH HOH B . 
J 5 HOH 3   3    3    HOH HOH B . 
J 5 HOH 4   4    4    HOH HOH B . 
J 5 HOH 5   6    6    HOH HOH B . 
J 5 HOH 6   8    8    HOH HOH B . 
J 5 HOH 7   10   10   HOH HOH B . 
J 5 HOH 8   14   14   HOH HOH B . 
J 5 HOH 9   16   16   HOH HOH B . 
J 5 HOH 10  17   17   HOH HOH B . 
J 5 HOH 11  19   19   HOH HOH B . 
J 5 HOH 12  25   25   HOH HOH B . 
J 5 HOH 13  30   30   HOH HOH B . 
J 5 HOH 14  35   35   HOH HOH B . 
J 5 HOH 15  37   37   HOH HOH B . 
J 5 HOH 16  40   40   HOH HOH B . 
J 5 HOH 17  43   43   HOH HOH B . 
J 5 HOH 18  44   44   HOH HOH B . 
J 5 HOH 19  47   47   HOH HOH B . 
J 5 HOH 20  49   49   HOH HOH B . 
J 5 HOH 21  51   51   HOH HOH B . 
J 5 HOH 22  53   53   HOH HOH B . 
J 5 HOH 23  54   54   HOH HOH B . 
J 5 HOH 24  58   58   HOH HOH B . 
J 5 HOH 25  61   61   HOH HOH B . 
J 5 HOH 26  62   62   HOH HOH B . 
J 5 HOH 27  63   63   HOH HOH B . 
J 5 HOH 28  65   65   HOH HOH B . 
J 5 HOH 29  66   66   HOH HOH B . 
J 5 HOH 30  70   70   HOH HOH B . 
J 5 HOH 31  73   73   HOH HOH B . 
J 5 HOH 32  77   77   HOH HOH B . 
J 5 HOH 33  81   81   HOH HOH B . 
J 5 HOH 34  82   82   HOH HOH B . 
J 5 HOH 35  84   84   HOH HOH B . 
J 5 HOH 36  85   85   HOH HOH B . 
J 5 HOH 37  86   86   HOH HOH B . 
J 5 HOH 38  90   90   HOH HOH B . 
J 5 HOH 39  91   91   HOH HOH B . 
J 5 HOH 40  1002 1002 HOH HOH B . 
J 5 HOH 41  1003 1003 HOH HOH B . 
J 5 HOH 42  1004 1004 HOH HOH B . 
J 5 HOH 43  1009 1009 HOH HOH B . 
J 5 HOH 44  1014 1014 HOH HOH B . 
J 5 HOH 45  1017 1017 HOH HOH B . 
J 5 HOH 46  1018 1018 HOH HOH B . 
J 5 HOH 47  1021 1021 HOH HOH B . 
J 5 HOH 48  1022 1022 HOH HOH B . 
J 5 HOH 49  1023 1023 HOH HOH B . 
J 5 HOH 50  1026 1026 HOH HOH B . 
J 5 HOH 51  1029 1029 HOH HOH B . 
J 5 HOH 52  1033 1033 HOH HOH B . 
J 5 HOH 53  1036 1036 HOH HOH B . 
J 5 HOH 54  1037 1037 HOH HOH B . 
J 5 HOH 55  1038 1038 HOH HOH B . 
J 5 HOH 56  1039 1039 HOH HOH B . 
J 5 HOH 57  1042 1042 HOH HOH B . 
J 5 HOH 58  1043 1043 HOH HOH B . 
J 5 HOH 59  1045 1045 HOH HOH B . 
J 5 HOH 60  1047 1047 HOH HOH B . 
J 5 HOH 61  1048 1048 HOH HOH B . 
J 5 HOH 62  1049 1049 HOH HOH B . 
J 5 HOH 63  1050 1050 HOH HOH B . 
J 5 HOH 64  1053 1053 HOH HOH B . 
J 5 HOH 65  1054 1054 HOH HOH B . 
J 5 HOH 66  1056 1056 HOH HOH B . 
J 5 HOH 67  1059 1059 HOH HOH B . 
J 5 HOH 68  1060 1060 HOH HOH B . 
J 5 HOH 69  1064 1064 HOH HOH B . 
J 5 HOH 70  1065 1065 HOH HOH B . 
J 5 HOH 71  1067 1067 HOH HOH B . 
J 5 HOH 72  1070 1070 HOH HOH B . 
J 5 HOH 73  1071 1071 HOH HOH B . 
J 5 HOH 74  1073 1073 HOH HOH B . 
J 5 HOH 75  1076 1076 HOH HOH B . 
J 5 HOH 76  1077 1077 HOH HOH B . 
J 5 HOH 77  1080 1080 HOH HOH B . 
J 5 HOH 78  1083 1083 HOH HOH B . 
J 5 HOH 79  1085 1085 HOH HOH B . 
J 5 HOH 80  1086 1086 HOH HOH B . 
J 5 HOH 81  1088 1088 HOH HOH B . 
J 5 HOH 82  1092 1092 HOH HOH B . 
J 5 HOH 83  1096 1096 HOH HOH B . 
J 5 HOH 84  1097 1097 HOH HOH B . 
J 5 HOH 85  1100 1100 HOH HOH B . 
J 5 HOH 86  1103 1103 HOH HOH B . 
J 5 HOH 87  1106 1106 HOH HOH B . 
J 5 HOH 88  1107 1107 HOH HOH B . 
J 5 HOH 89  1109 1109 HOH HOH B . 
J 5 HOH 90  1111 1111 HOH HOH B . 
J 5 HOH 91  1114 1114 HOH HOH B . 
J 5 HOH 92  1116 1116 HOH HOH B . 
J 5 HOH 93  1117 1117 HOH HOH B . 
J 5 HOH 94  1118 1118 HOH HOH B . 
J 5 HOH 95  1120 1120 HOH HOH B . 
J 5 HOH 96  1124 1124 HOH HOH B . 
J 5 HOH 97  1125 1125 HOH HOH B . 
J 5 HOH 98  1126 1126 HOH HOH B . 
J 5 HOH 99  1131 1131 HOH HOH B . 
J 5 HOH 100 1132 1132 HOH HOH B . 
J 5 HOH 101 1133 1133 HOH HOH B . 
J 5 HOH 102 1134 1134 HOH HOH B . 
J 5 HOH 103 1138 1138 HOH HOH B . 
J 5 HOH 104 1139 1139 HOH HOH B . 
J 5 HOH 105 1140 1140 HOH HOH B . 
J 5 HOH 106 1142 1142 HOH HOH B . 
J 5 HOH 107 1148 1148 HOH HOH B . 
J 5 HOH 108 1150 1150 HOH HOH B . 
J 5 HOH 109 1151 1151 HOH HOH B . 
J 5 HOH 110 1154 1154 HOH HOH B . 
J 5 HOH 111 1155 1155 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    dimeric 2 
2 software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J 
2 1 A,C,D,E,I           
2 2 B,F,G,H,J           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 3920  ? 
2 MORE         -170  ? 
2 'SSA (A^2)'  28650 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z              1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 3_645 -y+3/2,x-1/2,z+1/4 0.0000000000 -1.0000000000 0.0000000000 155.4750000000 1.0000000000 
0.0000000000 0.0000000000 -51.8250000000 0.0000000000 0.0000000000 1.0000000000 67.5102500000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 79  ? A HIS 256 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 NE2 ? A HIS 115 ? A HIS 292 ? 1_555 75.1  ? 
2  NE2 ? A HIS 79  ? A HIS 256 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 OD2 ? A ASP 116 ? A ASP 293 ? 1_555 79.3  ? 
3  NE2 ? A HIS 115 ? A HIS 292 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 OD2 ? A ASP 116 ? A ASP 293 ? 1_555 68.1  ? 
4  NE2 ? A HIS 79  ? A HIS 256 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 OD1 ? A ASP 225 ? A ASP 402 ? 1_555 81.2  ? 
5  NE2 ? A HIS 115 ? A HIS 292 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 OD1 ? A ASP 225 ? A ASP 402 ? 1_555 72.5  ? 
6  OD2 ? A ASP 116 ? A ASP 293 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 OD1 ? A ASP 225 ? A ASP 402 ? 1_555 139.3 ? 
7  NE2 ? A HIS 79  ? A HIS 256 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 O1A ? E PCG .   ? A PCG 900 ? 1_555 122.9 ? 
8  NE2 ? A HIS 115 ? A HIS 292 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 O1A ? E PCG .   ? A PCG 900 ? 1_555 160.9 ? 
9  OD2 ? A ASP 116 ? A ASP 293 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 O1A ? E PCG .   ? A PCG 900 ? 1_555 106.7 ? 
10 OD1 ? A ASP 225 ? A ASP 402 ? 1_555 NA ? C NA . ? A NA 901 ? 1_555 O1A ? E PCG .   ? A PCG 900 ? 1_555 114.0 ? 
11 OD1 ? A ASP 116 ? A ASP 293 ? 1_555 NA ? D NA . ? A NA 902 ? 1_555 O   ? I HOH .   ? A HOH 93  ? 1_555 78.9  ? 
12 OD1 ? A ASP 116 ? A ASP 293 ? 1_555 NA ? D NA . ? A NA 902 ? 1_555 O   ? I HOH .   ? A HOH 95  ? 1_555 147.4 ? 
13 O   ? I HOH .   ? A HOH 93  ? 1_555 NA ? D NA . ? A NA 902 ? 1_555 O   ? I HOH .   ? A HOH 95  ? 1_555 79.2  ? 
14 OD1 ? A ASP 116 ? A ASP 293 ? 1_555 NA ? D NA . ? A NA 902 ? 1_555 O1A ? E PCG .   ? A PCG 900 ? 1_555 105.3 ? 
15 O   ? I HOH .   ? A HOH 93  ? 1_555 NA ? D NA . ? A NA 902 ? 1_555 O1A ? E PCG .   ? A PCG 900 ? 1_555 163.9 ? 
16 O   ? I HOH .   ? A HOH 95  ? 1_555 NA ? D NA . ? A NA 902 ? 1_555 O1A ? E PCG .   ? A PCG 900 ? 1_555 102.4 ? 
17 NE2 ? B HIS 79  ? B HIS 256 ? 1_555 NA ? F NA . ? B NA 901 ? 1_555 NE2 ? B HIS 115 ? B HIS 292 ? 1_555 85.0  ? 
18 NE2 ? B HIS 79  ? B HIS 256 ? 1_555 NA ? F NA . ? B NA 901 ? 1_555 OD2 ? B ASP 116 ? B ASP 293 ? 1_555 83.5  ? 
19 NE2 ? B HIS 115 ? B HIS 292 ? 1_555 NA ? F NA . ? B NA 901 ? 1_555 OD2 ? B ASP 116 ? B ASP 293 ? 1_555 73.0  ? 
20 NE2 ? B HIS 79  ? B HIS 256 ? 1_555 NA ? F NA . ? B NA 901 ? 1_555 OD1 ? B ASP 225 ? B ASP 402 ? 1_555 77.4  ? 
21 NE2 ? B HIS 115 ? B HIS 292 ? 1_555 NA ? F NA . ? B NA 901 ? 1_555 OD1 ? B ASP 225 ? B ASP 402 ? 1_555 79.0  ? 
22 OD2 ? B ASP 116 ? B ASP 293 ? 1_555 NA ? F NA . ? B NA 901 ? 1_555 OD1 ? B ASP 225 ? B ASP 402 ? 1_555 147.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-16 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 84.0341 45.6419 45.7999 0.0097  -0.1955 -0.0564 -0.0035 -0.0158 0.0097  1.0896 0.8195 1.0227 
-0.6036 0.0295 0.0048  0.0725 -0.0218 -0.0507 -0.0468 -0.0064 0.1042  -0.0179 -0.0772 -0.0207 
'X-RAY DIFFRACTION' 2 ? refined 92.6988 31.9017 7.1034  -0.0493 -0.0991 -0.0561 0.0369  0.0001  -0.0196 0.5446 1.5557 1.4445 
-0.1195 0.2090 -0.5023 0.0340 -0.0343 0.0003  0.1404  -0.0751 -0.0175 -0.0676 0.1801  0.0269  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 181 A 505 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 181 B 505 ? . . . . ? 
# 
_software.name             REFMAC 
_software.classification   refinement 
_software.version          5.3.0008 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 B GLN 279 ? ? O B HOH 43   ? ? 1.70 
2 1 O   B HOH 16  ? ? O B HOH 1073 ? ? 2.06 
3 1 OH  A TYR 490 ? ? O A HOH 1084 ? ? 2.17 
4 1 O   A HOH 46  ? ? O A HOH 1136 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     23 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     19 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_645 
_pdbx_validate_symm_contact.dist              2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A CYS 326 ? ? SG A CYS 326 ? ? 1.702 1.812 -0.110 0.016 N 
2 1 CG B GLU 370 ? ? CD B GLU 370 ? ? 1.615 1.515 0.100  0.015 N 
3 1 CB B CYS 419 ? ? SG B CYS 419 ? ? 1.711 1.812 -0.101 0.016 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 251 ? ? -120.25 -58.17  
2 1 SER A 319 ? ? 33.57   58.32   
3 1 ASN A 381 ? ? -162.87 63.30   
4 1 ARG A 444 ? ? -27.43  -36.71  
5 1 GLN A 504 ? ? 69.22   -179.64 
6 1 SER B 319 ? ? 28.48   62.80   
7 1 ASN B 381 ? ? -160.91 62.66   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 178 ? ? SER A 179 ? ? -141.23 
2 1 GLU A 502 ? ? LEU A 503 ? ? 143.23  
3 1 GLY B 178 ? ? SER B 179 ? ? -140.89 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 506 ? A LYS 329 
2 1 Y 1 B LYS 506 ? B LYS 329 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'                     NA  
3 'CYCLIC GUANOSINE MONOPHOSPHATE' PCG 
4 3-ISOBUTYL-1-METHYLXANTHINE      IBM 
5 water                            HOH 
#