data_3E17
# 
_entry.id   3E17 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3E17         
RCSB  RCSB048745   
WWPDB D_1000048745 
# 
_pdbx_database_status.entry_id                        3E17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-01 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, H.'   1 
'Tong, S.L.' 2 
'Teng, M.K.' 3 
'Niu, L.W.'  4 
# 
_citation.id                        primary 
_citation.title                     'Structure of the second PDZ domain from human zonula occludens 2' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            65 
_citation.page_first                327 
_citation.page_last                 330 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19342771 
_citation.pdbx_database_id_DOI      10.1107/S1744309109002334 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, H.' 1 
primary 'Tong, S.' 2 
primary 'Li, X.'   3 
primary 'Wu, J.'   4 
primary 'Zhu, Z.'  5 
primary 'Niu, L.'  6 
primary 'Teng, M.' 7 
# 
_cell.length_a           30.177 
_cell.length_b           41.325 
_cell.length_c           41.292 
_cell.angle_alpha        80.050 
_cell.angle_beta         68.630 
_cell.angle_gamma        68.520 
_cell.entry_id           3E17 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         3E17 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tight junction protein ZO-2' 10014.645 2   ? ? 'UNP residues 306-384' ? 
2 water   nat water                         18.015    203 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Zonula occludens protein 2, Zona occludens protein 2, Tight junction protein 2, The second PDZ domain from human Zona Occludens-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRD
LEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRD
LEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ILE n 
1 3  GLY n 
1 4  VAL n 
1 5  LEU n 
1 6  LEU n 
1 7  MET n 
1 8  LYS n 
1 9  SER n 
1 10 ARG n 
1 11 ALA n 
1 12 ASN n 
1 13 GLU n 
1 14 GLU n 
1 15 TYR n 
1 16 GLY n 
1 17 LEU n 
1 18 ARG n 
1 19 LEU n 
1 20 GLY n 
1 21 SER n 
1 22 GLN n 
1 23 ILE n 
1 24 PHE n 
1 25 VAL n 
1 26 LYS n 
1 27 GLU n 
1 28 MET n 
1 29 THR n 
1 30 ARG n 
1 31 THR n 
1 32 GLY n 
1 33 LEU n 
1 34 ALA n 
1 35 THR n 
1 36 LYS n 
1 37 ASP n 
1 38 GLY n 
1 39 ASN n 
1 40 LEU n 
1 41 HIS n 
1 42 GLU n 
1 43 GLY n 
1 44 ASP n 
1 45 ILE n 
1 46 ILE n 
1 47 LEU n 
1 48 LYS n 
1 49 ILE n 
1 50 ASN n 
1 51 GLY n 
1 52 THR n 
1 53 VAL n 
1 54 THR n 
1 55 GLU n 
1 56 ASN n 
1 57 MET n 
1 58 SER n 
1 59 LEU n 
1 60 THR n 
1 61 ASP n 
1 62 ALA n 
1 63 ARG n 
1 64 LYS n 
1 65 LEU n 
1 66 ILE n 
1 67 GLU n 
1 68 LYS n 
1 69 SER n 
1 70 ARG n 
1 71 GLY n 
1 72 LYS n 
1 73 LEU n 
1 74 GLN n 
1 75 LEU n 
1 76 VAL n 
1 77 VAL n 
1 78 LEU n 
1 79 ARG n 
1 80 ASP n 
1 81 LEU n 
1 82 GLU n 
1 83 HIS n 
1 84 HIS n 
1 85 HIS n 
1 86 HIS n 
1 87 HIS n 
1 88 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TJP2, X104, ZO2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ZO2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UDY2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRD 
_struct_ref.pdbx_align_begin           306 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3E17 A 2 ? 80 ? Q9UDY2 306 ? 384 ? 2 80 
2 1 3E17 B 2 ? 80 ? Q9UDY2 306 ? 384 ? 2 80 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3E17 MET A 1  ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 1  1  
1 3E17 LEU A 81 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 81 2  
1 3E17 GLU A 82 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 82 3  
1 3E17 HIS A 83 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 83 4  
1 3E17 HIS A 84 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 84 5  
1 3E17 HIS A 85 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 85 6  
1 3E17 HIS A 86 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 86 7  
1 3E17 HIS A 87 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 87 8  
1 3E17 HIS A 88 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 88 9  
2 3E17 MET B 1  ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 1  10 
2 3E17 LEU B 81 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 81 11 
2 3E17 GLU B 82 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 82 12 
2 3E17 HIS B 83 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 83 13 
2 3E17 HIS B 84 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 84 14 
2 3E17 HIS B 85 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 85 15 
2 3E17 HIS B 86 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 86 16 
2 3E17 HIS B 87 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 87 17 
2 3E17 HIS B 88 ? UNP Q9UDY2 ? ? 'EXPRESSION TAG' 88 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3E17 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   44.73 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.temp            283 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '12% PEG8000, 0.1M Tris-HCl, pH8.3, VAPOR DIFFUSION, HANGING DROP, temperature 283K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2006-10-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3E17 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.75 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   15928 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3E17 
_refine.ls_d_res_high                            1.750 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    91.470 
_refine.ls_number_reflns_obs                     15928 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  804 
_refine.B_iso_mean                               27.367 
_refine.aniso_B[1][1]                            0.420 
_refine.aniso_B[2][2]                            -0.060 
_refine.aniso_B[3][3]                            -0.130 
_refine.aniso_B[1][2]                            -0.720 
_refine.aniso_B[1][3]                            -0.170 
_refine.aniso_B[2][3]                            1.200 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.pdbx_overall_ESU_R                       0.147 
_refine.pdbx_overall_ESU_R_Free                  0.134 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                60.43 
_refine.B_iso_min                                15.46 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2FNE' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1224 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             203 
_refine_hist.number_atoms_total               1427 
_refine_hist.d_res_high                       1.750 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1228 0.014  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1639 1.498  2.003  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 157  6.317  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 47   35.479 24.043 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 264  12.369 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 11   18.205 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         201  0.093  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   845  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            777  0.854  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1244 1.544  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            451  2.511  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           395  4.213  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.750 
_refine_ls_shell.d_res_low                        1.795 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               89.010 
_refine_ls_shell.number_reflns_R_work             1122 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.352 
_refine_ls_shell.R_factor_R_free                  0.345 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             52 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1174 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3E17 
_struct.title                     'Crystal structure of the second PDZ domain from human Zona Occludens-2' 
_struct.pdbx_descriptor           'Tight junction protein ZO-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3E17 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;domain swapping, Alternative promoter usage, Alternative splicing, Cell junction, Cell membrane, Disease mutation, Membrane, Nucleus, Phosphoprotein, Polymorphism, SH3 domain, Tight junction, CELL ADHESION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 32 ? GLY A 38 ? GLY A 32 GLY A 38 1 ? 7  
HELX_P HELX_P2 2 SER A 58 ? SER A 69 ? SER A 58 SER A 69 1 ? 12 
HELX_P HELX_P3 3 GLY B 32 ? GLY B 38 ? GLY B 32 GLY B 38 1 ? 7  
HELX_P HELX_P4 4 SER B 58 ? SER B 69 ? SER B 58 SER B 69 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 2  ? MET A 7  ? ILE A 2  MET A 7  
A 2 LYS B 72 ? VAL B 77 ? LYS B 72 VAL B 77 
A 3 ILE B 45 ? ILE B 49 ? ILE B 45 ILE B 49 
A 4 LEU B 17 ? MET B 28 ? LEU B 17 MET B 28 
A 5 LEU A 17 ? MET A 28 ? LEU A 17 MET A 28 
A 6 ILE A 45 ? ILE A 49 ? ILE A 45 ILE A 49 
A 7 LYS A 72 ? VAL A 77 ? LYS A 72 VAL A 77 
A 8 ILE B 2  ? MET B 7  ? ILE B 2  MET B 7  
B 1 THR A 52 ? VAL A 53 ? THR A 52 VAL A 53 
B 2 ILE A 45 ? ILE A 49 ? ILE A 45 ILE A 49 
B 3 LEU A 17 ? MET A 28 ? LEU A 17 MET A 28 
B 4 LEU B 17 ? MET B 28 ? LEU B 17 MET B 28 
B 5 ILE B 45 ? ILE B 49 ? ILE B 45 ILE B 49 
B 6 THR B 52 ? VAL B 53 ? THR B 52 VAL B 53 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 4  ? N VAL A 4  O LEU B 75 ? O LEU B 75 
A 2 3 O VAL B 76 ? O VAL B 76 N LEU B 47 ? N LEU B 47 
A 3 4 O ILE B 46 ? O ILE B 46 N ILE B 23 ? N ILE B 23 
A 4 5 O GLU B 27 ? O GLU B 27 N ARG A 18 ? N ARG A 18 
A 5 6 N ILE A 23 ? N ILE A 23 O ILE A 46 ? O ILE A 46 
A 6 7 N LEU A 47 ? N LEU A 47 O VAL A 76 ? O VAL A 76 
A 7 8 N LEU A 75 ? N LEU A 75 O VAL B 4  ? O VAL B 4  
B 1 2 O THR A 52 ? O THR A 52 N ILE A 49 ? N ILE A 49 
B 2 3 O ILE A 46 ? O ILE A 46 N ILE A 23 ? N ILE A 23 
B 3 4 N ARG A 18 ? N ARG A 18 O GLU B 27 ? O GLU B 27 
B 4 5 N ILE B 23 ? N ILE B 23 O ILE B 46 ? O ILE B 46 
B 5 6 N ILE B 49 ? N ILE B 49 O THR B 52 ? O THR B 52 
# 
_atom_sites.entry_id                    3E17 
_atom_sites.fract_transf_matrix[1][1]   0.033138 
_atom_sites.fract_transf_matrix[1][2]   -0.013043 
_atom_sites.fract_transf_matrix[1][3]   -0.012386 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026005 
_atom_sites.fract_transf_matrix[2][3]   -0.001183 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026032 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1  ? -3.358  19.904  -4.773  1.00 34.51 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1  ? -2.588  19.226  -5.857  1.00 34.28 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1  ? -1.673  20.200  -6.549  1.00 33.29 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1  ? -2.060  21.338  -6.823  1.00 33.91 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1  ? -3.495  18.663  -6.933  1.00 34.03 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1  ? -4.590  17.746  -6.478  1.00 35.73 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1  ? -5.363  17.105  -7.949  1.00 36.77 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1  ? -6.329  18.487  -8.590  1.00 34.52 ? 1   MET A CE  1 
ATOM   9    N N   . ILE A 1 2  ? -0.464  19.750  -6.849  1.00 31.50 ? 2   ILE A N   1 
ATOM   10   C CA  . ILE A 1 2  ? 0.458   20.563  -7.607  1.00 30.26 ? 2   ILE A CA  1 
ATOM   11   C C   . ILE A 1 2  ? 1.024   19.759  -8.751  1.00 28.99 ? 2   ILE A C   1 
ATOM   12   O O   . ILE A 1 2  ? 1.187   18.527  -8.654  1.00 28.05 ? 2   ILE A O   1 
ATOM   13   C CB  . ILE A 1 2  ? 1.617   21.130  -6.745  1.00 31.23 ? 2   ILE A CB  1 
ATOM   14   C CG1 . ILE A 1 2  ? 2.530   20.007  -6.249  1.00 30.94 ? 2   ILE A CG1 1 
ATOM   15   C CG2 . ILE A 1 2  ? 1.083   22.032  -5.606  1.00 31.50 ? 2   ILE A CG2 1 
ATOM   16   C CD1 . ILE A 1 2  ? 3.977   20.442  -6.109  1.00 34.39 ? 2   ILE A CD1 1 
ATOM   17   N N   . GLY A 1 3  ? 1.309   20.459  -9.847  1.00 27.34 ? 3   GLY A N   1 
ATOM   18   C CA  . GLY A 1 3  ? 1.885   19.835  -11.019 1.00 25.34 ? 3   GLY A CA  1 
ATOM   19   C C   . GLY A 1 3  ? 3.391   20.028  -11.031 1.00 24.92 ? 3   GLY A C   1 
ATOM   20   O O   . GLY A 1 3  ? 3.902   21.072  -10.607 1.00 24.95 ? 3   GLY A O   1 
ATOM   21   N N   . VAL A 1 4  ? 4.105   19.014  -11.485 1.00 22.97 ? 4   VAL A N   1 
ATOM   22   C CA  . VAL A 1 4  ? 5.554   19.082  -11.621 1.00 22.33 ? 4   VAL A CA  1 
ATOM   23   C C   . VAL A 1 4  ? 5.873   18.603  -13.015 1.00 22.38 ? 4   VAL A C   1 
ATOM   24   O O   . VAL A 1 4  ? 5.412   17.539  -13.435 1.00 22.56 ? 4   VAL A O   1 
ATOM   25   C CB  . VAL A 1 4  ? 6.274   18.201  -10.554 1.00 22.11 ? 4   VAL A CB  1 
ATOM   26   C CG1 . VAL A 1 4  ? 7.807   18.167  -10.791 1.00 21.11 ? 4   VAL A CG1 1 
ATOM   27   C CG2 . VAL A 1 4  ? 5.922   18.685  -9.146  1.00 21.60 ? 4   VAL A CG2 1 
ATOM   28   N N   . LEU A 1 5  ? 6.674   19.381  -13.736 1.00 21.85 ? 5   LEU A N   1 
ATOM   29   C CA  . LEU A 1 5  ? 7.055   19.031  -15.085 1.00 23.03 ? 5   LEU A CA  1 
ATOM   30   C C   . LEU A 1 5  ? 8.567   18.881  -15.189 1.00 22.92 ? 5   LEU A C   1 
ATOM   31   O O   . LEU A 1 5  ? 9.328   19.841  -14.952 1.00 22.95 ? 5   LEU A O   1 
ATOM   32   C CB  . LEU A 1 5  ? 6.536   20.098  -16.067 1.00 23.07 ? 5   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 5  ? 6.927   19.941  -17.536 1.00 24.33 ? 5   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 5  ? 6.410   18.667  -18.179 1.00 25.10 ? 5   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 5  ? 6.459   21.189  -18.334 1.00 25.74 ? 5   LEU A CD2 1 
ATOM   36   N N   . LEU A 1 6  ? 9.006   17.681  -15.528 1.00 22.22 ? 6   LEU A N   1 
ATOM   37   C CA  . LEU A 1 6  ? 10.434  17.405  -15.682 1.00 22.16 ? 6   LEU A CA  1 
ATOM   38   C C   . LEU A 1 6  ? 10.723  17.221  -17.156 1.00 22.98 ? 6   LEU A C   1 
ATOM   39   O O   . LEU A 1 6  ? 10.006  16.515  -17.839 1.00 22.35 ? 6   LEU A O   1 
ATOM   40   C CB  . LEU A 1 6  ? 10.822  16.142  -14.895 1.00 22.12 ? 6   LEU A CB  1 
ATOM   41   C CG  . LEU A 1 6  ? 10.490  16.179  -13.391 1.00 20.73 ? 6   LEU A CG  1 
ATOM   42   C CD1 . LEU A 1 6  ? 11.080  14.914  -12.720 1.00 20.13 ? 6   LEU A CD1 1 
ATOM   43   C CD2 . LEU A 1 6  ? 10.992  17.511  -12.725 1.00 21.61 ? 6   LEU A CD2 1 
ATOM   44   N N   . MET A 1 7  ? 11.807  17.820  -17.644 1.00 23.64 ? 7   MET A N   1 
ATOM   45   C CA  . MET A 1 7  ? 12.047  17.844  -19.078 1.00 24.73 ? 7   MET A CA  1 
ATOM   46   C C   . MET A 1 7  ? 13.519  17.536  -19.349 1.00 24.44 ? 7   MET A C   1 
ATOM   47   O O   . MET A 1 7  ? 14.392  18.248  -18.871 1.00 24.58 ? 7   MET A O   1 
ATOM   48   C CB  . MET A 1 7  ? 11.684  19.251  -19.606 1.00 25.55 ? 7   MET A CB  1 
ATOM   49   C CG  . MET A 1 7  ? 11.464  19.340  -21.087 1.00 31.12 ? 7   MET A CG  1 
ATOM   50   S SD  . MET A 1 7  ? 9.730   19.108  -21.500 1.00 40.33 ? 7   MET A SD  1 
ATOM   51   C CE  . MET A 1 7  ? 9.017   20.575  -20.758 1.00 36.63 ? 7   MET A CE  1 
ATOM   52   N N   . LYS A 1 8  ? 13.786  16.490  -20.119 1.00 24.46 ? 8   LYS A N   1 
ATOM   53   C CA  . LYS A 1 8  ? 15.163  16.068  -20.410 1.00 25.42 ? 8   LYS A CA  1 
ATOM   54   C C   . LYS A 1 8  ? 15.772  16.960  -21.492 1.00 27.32 ? 8   LYS A C   1 
ATOM   55   O O   . LYS A 1 8  ? 15.041  17.594  -22.248 1.00 26.90 ? 8   LYS A O   1 
ATOM   56   C CB  . LYS A 1 8  ? 15.218  14.617  -20.849 1.00 25.78 ? 8   LYS A CB  1 
ATOM   57   C CG  . LYS A 1 8  ? 14.906  13.621  -19.705 1.00 25.74 ? 8   LYS A CG  1 
ATOM   58   C CD  . LYS A 1 8  ? 15.136  12.188  -20.129 1.00 25.24 ? 8   LYS A CD  1 
ATOM   59   C CE  . LYS A 1 8  ? 14.989  11.250  -18.917 1.00 25.45 ? 8   LYS A CE  1 
ATOM   60   N NZ  . LYS A 1 8  ? 15.158  9.816   -19.293 1.00 26.07 ? 8   LYS A NZ  1 
ATOM   61   N N   . SER A 1 9  ? 17.102  17.020  -21.487 1.00 28.45 ? 9   SER A N   1 
ATOM   62   C CA  . SER A 1 9  ? 17.907  17.629  -22.554 1.00 30.93 ? 9   SER A CA  1 
ATOM   63   C C   . SER A 1 9  ? 19.318  17.059  -22.449 1.00 32.13 ? 9   SER A C   1 
ATOM   64   O O   . SER A 1 9  ? 19.612  16.262  -21.548 1.00 31.64 ? 9   SER A O   1 
ATOM   65   C CB  . SER A 1 9  ? 17.973  19.119  -22.348 1.00 30.44 ? 9   SER A CB  1 
ATOM   66   O OG  . SER A 1 9  ? 18.885  19.369  -21.294 1.00 34.20 ? 9   SER A OG  1 
ATOM   67   N N   . ARG A 1 10 ? 20.216  17.485  -23.341 1.00 32.82 ? 10  ARG A N   1 
ATOM   68   C CA  . ARG A 1 10 ? 21.607  17.048  -23.253 1.00 33.91 ? 10  ARG A CA  1 
ATOM   69   C C   . ARG A 1 10 ? 22.324  17.548  -21.969 1.00 33.33 ? 10  ARG A C   1 
ATOM   70   O O   . ARG A 1 10 ? 23.381  17.023  -21.612 1.00 34.16 ? 10  ARG A O   1 
ATOM   71   C CB  . ARG A 1 10 ? 22.359  17.427  -24.554 1.00 33.81 ? 10  ARG A CB  1 
ATOM   72   C CG  . ARG A 1 10 ? 21.748  16.752  -25.798 1.00 35.49 ? 10  ARG A CG  1 
ATOM   73   C CD  . ARG A 1 10 ? 22.615  16.827  -27.059 1.00 36.11 ? 10  ARG A CD  1 
ATOM   74   N NE  . ARG A 1 10 ? 24.043  16.691  -26.760 1.00 41.57 ? 10  ARG A NE  1 
ATOM   75   C CZ  . ARG A 1 10 ? 25.028  16.942  -27.616 1.00 42.62 ? 10  ARG A CZ  1 
ATOM   76   N NH1 . ARG A 1 10 ? 24.761  17.343  -28.856 1.00 43.41 ? 10  ARG A NH1 1 
ATOM   77   N NH2 . ARG A 1 10 ? 26.292  16.798  -27.220 1.00 44.58 ? 10  ARG A NH2 1 
ATOM   78   N N   . ALA A 1 11 ? 21.742  18.543  -21.307 1.00 32.81 ? 11  ALA A N   1 
ATOM   79   C CA  . ALA A 1 11 ? 22.273  19.035  -20.042 1.00 32.83 ? 11  ALA A CA  1 
ATOM   80   C C   . ALA A 1 11 ? 22.044  18.029  -18.919 1.00 32.78 ? 11  ALA A C   1 
ATOM   81   O O   . ALA A 1 11 ? 22.888  17.865  -18.037 1.00 33.20 ? 11  ALA A O   1 
ATOM   82   C CB  . ALA A 1 11 ? 21.648  20.376  -19.690 1.00 32.89 ? 11  ALA A CB  1 
ATOM   83   N N   . ASN A 1 12 ? 20.898  17.357  -18.958 1.00 32.57 ? 12  ASN A N   1 
ATOM   84   C CA  . ASN A 1 12 ? 20.577  16.332  -17.971 1.00 31.77 ? 12  ASN A CA  1 
ATOM   85   C C   . ASN A 1 12 ? 19.541  15.339  -18.488 1.00 31.84 ? 12  ASN A C   1 
ATOM   86   O O   . ASN A 1 12 ? 18.398  15.706  -18.760 1.00 32.86 ? 12  ASN A O   1 
ATOM   87   C CB  . ASN A 1 12 ? 20.088  16.974  -16.672 1.00 31.78 ? 12  ASN A CB  1 
ATOM   88   C CG  . ASN A 1 12 ? 20.175  16.032  -15.487 1.00 30.36 ? 12  ASN A CG  1 
ATOM   89   O OD1 . ASN A 1 12 ? 20.354  14.825  -15.652 1.00 31.00 ? 12  ASN A OD1 1 
ATOM   90   N ND2 . ASN A 1 12 ? 20.049  16.580  -14.284 1.00 27.41 ? 12  ASN A ND2 1 
ATOM   91   N N   . GLU A 1 13 ? 19.949  14.082  -18.621 1.00 30.16 ? 13  GLU A N   1 
ATOM   92   C CA  . GLU A 1 13 ? 19.089  13.055  -19.197 1.00 30.65 ? 13  GLU A CA  1 
ATOM   93   C C   . GLU A 1 13 ? 18.527  12.137  -18.117 1.00 28.72 ? 13  GLU A C   1 
ATOM   94   O O   . GLU A 1 13 ? 17.916  11.111  -18.418 1.00 30.57 ? 13  GLU A O   1 
ATOM   95   C CB  . GLU A 1 13 ? 19.856  12.235  -20.237 1.00 30.37 ? 13  GLU A CB  1 
ATOM   96   C CG  . GLU A 1 13 ? 20.392  13.054  -21.401 1.00 34.96 ? 13  GLU A CG  1 
ATOM   97   C CD  . GLU A 1 13 ? 19.445  13.072  -22.585 1.00 38.51 ? 13  GLU A CD  1 
ATOM   98   O OE1 . GLU A 1 13 ? 18.237  13.314  -22.378 1.00 40.17 ? 13  GLU A OE1 1 
ATOM   99   O OE2 . GLU A 1 13 ? 19.909  12.843  -23.722 1.00 42.56 ? 13  GLU A OE2 1 
ATOM   100  N N   . GLU A 1 14 ? 18.737  12.512  -16.860 1.00 26.65 ? 14  GLU A N   1 
ATOM   101  C CA  . GLU A 1 14 ? 18.396  11.637  -15.723 1.00 24.77 ? 14  GLU A CA  1 
ATOM   102  C C   . GLU A 1 14 ? 17.220  12.237  -14.950 1.00 22.20 ? 14  GLU A C   1 
ATOM   103  O O   . GLU A 1 14 ? 17.392  13.256  -14.306 1.00 20.82 ? 14  GLU A O   1 
ATOM   104  C CB  . GLU A 1 14 ? 19.623  11.513  -14.800 1.00 25.33 ? 14  GLU A CB  1 
ATOM   105  C CG  . GLU A 1 14 ? 19.386  10.719  -13.484 1.00 26.68 ? 14  GLU A CG  1 
ATOM   106  C CD  . GLU A 1 14 ? 20.333  11.092  -12.345 1.00 28.49 ? 14  GLU A CD  1 
ATOM   107  O OE1 . GLU A 1 14 ? 21.264  11.909  -12.523 1.00 27.64 ? 14  GLU A OE1 1 
ATOM   108  O OE2 . GLU A 1 14 ? 20.152  10.553  -11.230 1.00 28.73 ? 14  GLU A OE2 1 
ATOM   109  N N   . TYR A 1 15 ? 16.029  11.634  -15.003 1.00 21.60 ? 15  TYR A N   1 
ATOM   110  C CA  . TYR A 1 15 ? 14.963  12.110  -14.061 1.00 21.62 ? 15  TYR A CA  1 
ATOM   111  C C   . TYR A 1 15 ? 15.440  12.021  -12.606 1.00 21.41 ? 15  TYR A C   1 
ATOM   112  O O   . TYR A 1 15 ? 15.152  12.897  -11.790 1.00 22.15 ? 15  TYR A O   1 
ATOM   113  C CB  . TYR A 1 15 ? 13.648  11.346  -14.208 1.00 21.14 ? 15  TYR A CB  1 
ATOM   114  C CG  . TYR A 1 15 ? 12.850  11.599  -15.475 1.00 20.67 ? 15  TYR A CG  1 
ATOM   115  C CD1 . TYR A 1 15 ? 12.584  12.913  -15.938 1.00 21.99 ? 15  TYR A CD1 1 
ATOM   116  C CD2 . TYR A 1 15 ? 12.341  10.535  -16.198 1.00 23.70 ? 15  TYR A CD2 1 
ATOM   117  C CE1 . TYR A 1 15 ? 11.837  13.141  -17.140 1.00 19.80 ? 15  TYR A CE1 1 
ATOM   118  C CE2 . TYR A 1 15 ? 11.591  10.743  -17.401 1.00 23.89 ? 15  TYR A CE2 1 
ATOM   119  C CZ  . TYR A 1 15 ? 11.352  12.040  -17.859 1.00 23.24 ? 15  TYR A CZ  1 
ATOM   120  O OH  . TYR A 1 15 ? 10.594  12.234  -19.021 1.00 23.40 ? 15  TYR A OH  1 
ATOM   121  N N   . GLY A 1 16 ? 16.127  10.923  -12.266 1.00 22.14 ? 16  GLY A N   1 
ATOM   122  C CA  . GLY A 1 16 ? 16.619  10.744  -10.898 1.00 20.92 ? 16  GLY A CA  1 
ATOM   123  C C   . GLY A 1 16 ? 15.451  10.622  -9.926  1.00 20.85 ? 16  GLY A C   1 
ATOM   124  O O   . GLY A 1 16 ? 15.440  11.289  -8.897  1.00 19.80 ? 16  GLY A O   1 
ATOM   125  N N   . LEU A 1 17 ? 14.454  9.826   -10.323 1.00 20.95 ? 17  LEU A N   1 
ATOM   126  C CA  . LEU A 1 17 ? 13.176  9.654   -9.582  1.00 21.27 ? 17  LEU A CA  1 
ATOM   127  C C   . LEU A 1 17 ? 12.929  8.155   -9.413  1.00 21.90 ? 17  LEU A C   1 
ATOM   128  O O   . LEU A 1 17 ? 12.710  7.458   -10.402 1.00 22.78 ? 17  LEU A O   1 
ATOM   129  C CB  . LEU A 1 17 ? 12.017  10.287  -10.382 1.00 21.41 ? 17  LEU A CB  1 
ATOM   130  C CG  . LEU A 1 17 ? 10.575  10.248  -9.851  1.00 22.77 ? 17  LEU A CG  1 
ATOM   131  C CD1 . LEU A 1 17 ? 10.572  10.831  -8.471  1.00 22.91 ? 17  LEU A CD1 1 
ATOM   132  C CD2 . LEU A 1 17 ? 9.565   11.035  -10.741 1.00 25.81 ? 17  LEU A CD2 1 
ATOM   133  N N   . ARG A 1 18 ? 13.012  7.656   -8.183  1.00 20.36 ? 18  ARG A N   1 
ATOM   134  C CA  . ARG A 1 18 ? 12.685  6.265   -7.918  1.00 20.99 ? 18  ARG A CA  1 
ATOM   135  C C   . ARG A 1 18 ? 11.307  6.198   -7.275  1.00 19.69 ? 18  ARG A C   1 
ATOM   136  O O   . ARG A 1 18 ? 11.039  6.893   -6.304  1.00 19.82 ? 18  ARG A O   1 
ATOM   137  C CB  . ARG A 1 18 ? 13.713  5.643   -6.974  1.00 22.15 ? 18  ARG A CB  1 
ATOM   138  C CG  . ARG A 1 18 ? 13.446  4.153   -6.767  1.00 27.71 ? 18  ARG A CG  1 
ATOM   139  C CD  . ARG A 1 18 ? 14.736  3.486   -6.357  1.00 35.68 ? 18  ARG A CD  1 
ATOM   140  N NE  . ARG A 1 18 ? 15.232  4.037   -5.108  1.00 39.36 ? 18  ARG A NE  1 
ATOM   141  C CZ  . ARG A 1 18 ? 15.166  3.392   -3.954  1.00 40.88 ? 18  ARG A CZ  1 
ATOM   142  N NH1 . ARG A 1 18 ? 14.624  2.178   -3.926  1.00 41.16 ? 18  ARG A NH1 1 
ATOM   143  N NH2 . ARG A 1 18 ? 15.640  3.957   -2.852  1.00 42.07 ? 18  ARG A NH2 1 
ATOM   144  N N   . LEU A 1 19 ? 10.426  5.422   -7.868  1.00 19.95 ? 19  LEU A N   1 
ATOM   145  C CA  . LEU A 1 19 ? 9.080   5.297   -7.363  1.00 20.32 ? 19  LEU A CA  1 
ATOM   146  C C   . LEU A 1 19 ? 8.962   4.062   -6.487  1.00 19.52 ? 19  LEU A C   1 
ATOM   147  O O   . LEU A 1 19 ? 9.712   3.110   -6.659  1.00 19.58 ? 19  LEU A O   1 
ATOM   148  C CB  . LEU A 1 19 ? 8.119   5.112   -8.528  1.00 21.44 ? 19  LEU A CB  1 
ATOM   149  C CG  . LEU A 1 19 ? 7.401   6.281   -9.221  1.00 25.94 ? 19  LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 19 ? 7.961   7.645   -8.986  1.00 26.71 ? 19  LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 19 ? 7.240   5.920   -10.689 1.00 27.35 ? 19  LEU A CD2 1 
ATOM   152  N N   . GLY A 1 20 ? 8.015   4.096   -5.560  1.00 18.67 ? 20  GLY A N   1 
ATOM   153  C CA  . GLY A 1 20 ? 7.568   2.877   -4.847  1.00 17.32 ? 20  GLY A CA  1 
ATOM   154  C C   . GLY A 1 20 ? 6.054   2.801   -4.861  1.00 18.22 ? 20  GLY A C   1 
ATOM   155  O O   . GLY A 1 20 ? 5.387   3.706   -5.341  1.00 16.46 ? 20  GLY A O   1 
ATOM   156  N N   . SER A 1 21 ? 5.496   1.688   -4.358  1.00 18.21 ? 21  SER A N   1 
ATOM   157  C CA  . SER A 1 21 ? 4.070   1.657   -4.089  1.00 17.83 ? 21  SER A CA  1 
ATOM   158  C C   . SER A 1 21 ? 3.841   1.219   -2.638  1.00 17.39 ? 21  SER A C   1 
ATOM   159  O O   . SER A 1 21 ? 4.671   0.526   -2.033  1.00 17.32 ? 21  SER A O   1 
ATOM   160  C CB  . SER A 1 21 ? 3.302   0.739   -5.059  1.00 18.16 ? 21  SER A CB  1 
ATOM   161  O OG  . SER A 1 21 ? 3.560   -0.648  -4.835  1.00 18.31 ? 21  SER A OG  1 
ATOM   162  N N   . GLN A 1 22 ? 2.738   1.686   -2.088  1.00 17.05 ? 22  GLN A N   1 
ATOM   163  C CA  . GLN A 1 22 ? 2.320   1.225   -0.746  1.00 16.27 ? 22  GLN A CA  1 
ATOM   164  C C   . GLN A 1 22 ? 0.857   0.849   -0.792  1.00 16.73 ? 22  GLN A C   1 
ATOM   165  O O   . GLN A 1 22 ? 0.064   1.412   -1.539  1.00 15.98 ? 22  GLN A O   1 
ATOM   166  C CB  . GLN A 1 22 ? 2.613   2.249   0.359   1.00 17.48 ? 22  GLN A CB  1 
ATOM   167  C CG  . GLN A 1 22 ? 1.869   3.577   0.229   1.00 20.52 ? 22  GLN A CG  1 
ATOM   168  C CD  . GLN A 1 22 ? 2.559   4.724   0.990   1.00 22.59 ? 22  GLN A CD  1 
ATOM   169  O OE1 . GLN A 1 22 ? 3.612   4.557   1.597   1.00 29.98 ? 22  GLN A OE1 1 
ATOM   170  N NE2 . GLN A 1 22 ? 1.961   5.879   0.936   1.00 26.26 ? 22  GLN A NE2 1 
ATOM   171  N N   . ILE A 1 23 ? 0.522   -0.116  0.054   1.00 15.75 ? 23  ILE A N   1 
ATOM   172  C CA  . ILE A 1 23 ? -0.842  -0.594  0.206   1.00 16.07 ? 23  ILE A CA  1 
ATOM   173  C C   . ILE A 1 23 ? -1.447  0.179   1.384   1.00 16.17 ? 23  ILE A C   1 
ATOM   174  O O   . ILE A 1 23 ? -0.784  0.355   2.415   1.00 15.89 ? 23  ILE A O   1 
ATOM   175  C CB  . ILE A 1 23 ? -0.850  -2.109  0.535   1.00 15.76 ? 23  ILE A CB  1 
ATOM   176  C CG1 . ILE A 1 23 ? -0.237  -2.964  -0.612  1.00 16.32 ? 23  ILE A CG1 1 
ATOM   177  C CG2 . ILE A 1 23 ? -2.257  -2.531  0.944   1.00 17.06 ? 23  ILE A CG2 1 
ATOM   178  C CD1 . ILE A 1 23 ? -0.946  -2.799  -1.988  1.00 17.63 ? 23  ILE A CD1 1 
ATOM   179  N N   . PHE A 1 24 ? -2.674  0.670   1.221   1.00 16.26 ? 24  PHE A N   1 
ATOM   180  C CA  . PHE A 1 24 ? -3.326  1.439   2.287   1.00 16.54 ? 24  PHE A CA  1 
ATOM   181  C C   . PHE A 1 24 ? -4.789  1.060   2.507   1.00 16.36 ? 24  PHE A C   1 
ATOM   182  O O   . PHE A 1 24 ? -5.405  0.406   1.653   1.00 15.46 ? 24  PHE A O   1 
ATOM   183  C CB  . PHE A 1 24 ? -3.164  2.947   2.044   1.00 15.91 ? 24  PHE A CB  1 
ATOM   184  C CG  . PHE A 1 24 ? -4.038  3.487   0.933   1.00 16.81 ? 24  PHE A CG  1 
ATOM   185  C CD1 . PHE A 1 24 ? -3.653  3.354   -0.423  1.00 18.55 ? 24  PHE A CD1 1 
ATOM   186  C CD2 . PHE A 1 24 ? -5.242  4.104   1.241   1.00 17.59 ? 24  PHE A CD2 1 
ATOM   187  C CE1 . PHE A 1 24 ? -4.479  3.867   -1.445  1.00 18.85 ? 24  PHE A CE1 1 
ATOM   188  C CE2 . PHE A 1 24 ? -6.070  4.620   0.239   1.00 18.88 ? 24  PHE A CE2 1 
ATOM   189  C CZ  . PHE A 1 24 ? -5.687  4.473   -1.103  1.00 17.30 ? 24  PHE A CZ  1 
ATOM   190  N N   . VAL A 1 25 ? -5.322  1.447   3.668   1.00 15.99 ? 25  VAL A N   1 
ATOM   191  C CA  . VAL A 1 25 ? -6.720  1.162   4.003   1.00 16.92 ? 25  VAL A CA  1 
ATOM   192  C C   . VAL A 1 25 ? -7.607  2.195   3.299   1.00 17.44 ? 25  VAL A C   1 
ATOM   193  O O   . VAL A 1 25 ? -7.654  3.359   3.717   1.00 18.62 ? 25  VAL A O   1 
ATOM   194  C CB  . VAL A 1 25 ? -6.964  1.190   5.533   1.00 16.42 ? 25  VAL A CB  1 
ATOM   195  C CG1 . VAL A 1 25 ? -8.422  0.973   5.842   1.00 17.74 ? 25  VAL A CG1 1 
ATOM   196  C CG2 . VAL A 1 25 ? -6.124  0.121   6.206   1.00 16.11 ? 25  VAL A CG2 1 
ATOM   197  N N   . LYS A 1 26 ? -8.283  1.754   2.234   1.00 18.64 ? 26  LYS A N   1 
ATOM   198  C CA  . LYS A 1 26 ? -9.200  2.650   1.495   1.00 19.37 ? 26  LYS A CA  1 
ATOM   199  C C   . LYS A 1 26 ? -10.477 2.888   2.285   1.00 21.21 ? 26  LYS A C   1 
ATOM   200  O O   . LYS A 1 26 ? -10.889 4.030   2.481   1.00 20.93 ? 26  LYS A O   1 
ATOM   201  C CB  . LYS A 1 26 ? -9.501  2.124   0.103   1.00 20.36 ? 26  LYS A CB  1 
ATOM   202  C CG  . LYS A 1 26 ? -10.348 3.046   -0.766  1.00 19.58 ? 26  LYS A CG  1 
ATOM   203  C CD  . LYS A 1 26 ? -9.582  4.253   -1.215  1.00 23.38 ? 26  LYS A CD  1 
ATOM   204  C CE  . LYS A 1 26 ? -10.359 4.975   -2.353  1.00 25.02 ? 26  LYS A CE  1 
ATOM   205  N NZ  . LYS A 1 26 ? -9.692  6.291   -2.614  1.00 26.02 ? 26  LYS A NZ  1 
ATOM   206  N N   . GLU A 1 27 ? -11.093 1.816   2.766   1.00 21.20 ? 27  GLU A N   1 
ATOM   207  C CA  . GLU A 1 27 ? -12.349 1.952   3.469   1.00 21.80 ? 27  GLU A CA  1 
ATOM   208  C C   . GLU A 1 27 ? -12.502 0.799   4.443   1.00 21.91 ? 27  GLU A C   1 
ATOM   209  O O   . GLU A 1 27 ? -12.027 -0.310  4.167   1.00 21.50 ? 27  GLU A O   1 
ATOM   210  C CB  . GLU A 1 27 ? -13.510 1.878   2.469   1.00 22.12 ? 27  GLU A CB  1 
ATOM   211  C CG  . GLU A 1 27 ? -14.856 2.021   3.144   1.00 25.41 ? 27  GLU A CG  1 
ATOM   212  C CD  . GLU A 1 27 ? -16.025 1.548   2.286   1.00 29.68 ? 27  GLU A CD  1 
ATOM   213  O OE1 . GLU A 1 27 ? -15.808 1.120   1.110   1.00 30.12 ? 27  GLU A OE1 1 
ATOM   214  O OE2 . GLU A 1 27 ? -17.157 1.618   2.825   1.00 31.97 ? 27  GLU A OE2 1 
ATOM   215  N N   . MET A 1 28 ? -13.147 1.079   5.572   1.00 22.77 ? 28  MET A N   1 
ATOM   216  C CA  . MET A 1 28 ? -13.616 0.006   6.445   1.00 23.64 ? 28  MET A CA  1 
ATOM   217  C C   . MET A 1 28 ? -15.141 0.068   6.479   1.00 23.58 ? 28  MET A C   1 
ATOM   218  O O   . MET A 1 28 ? -15.732 1.132   6.726   1.00 24.79 ? 28  MET A O   1 
ATOM   219  C CB  . MET A 1 28 ? -13.017 0.153   7.838   1.00 24.33 ? 28  MET A CB  1 
ATOM   220  C CG  . MET A 1 28 ? -11.504 0.112   7.854   1.00 25.81 ? 28  MET A CG  1 
ATOM   221  S SD  . MET A 1 28 ? -10.819 0.404   9.477   1.00 29.90 ? 28  MET A SD  1 
ATOM   222  C CE  . MET A 1 28 ? -11.457 2.029   9.915   1.00 31.00 ? 28  MET A CE  1 
ATOM   223  N N   . THR A 1 29 ? -15.798 -1.054  6.219   1.00 23.61 ? 29  THR A N   1 
ATOM   224  C CA  . THR A 1 29 ? -17.256 -1.043  6.180   1.00 24.19 ? 29  THR A CA  1 
ATOM   225  C C   . THR A 1 29 ? -17.814 -0.931  7.615   1.00 23.94 ? 29  THR A C   1 
ATOM   226  O O   . THR A 1 29 ? -17.153 -1.282  8.605   1.00 21.74 ? 29  THR A O   1 
ATOM   227  C CB  . THR A 1 29 ? -17.796 -2.305  5.484   1.00 24.51 ? 29  THR A CB  1 
ATOM   228  O OG1 . THR A 1 29 ? -17.556 -3.439  6.342   1.00 22.61 ? 29  THR A OG1 1 
ATOM   229  C CG2 . THR A 1 29 ? -17.121 -2.525  4.123   1.00 27.15 ? 29  THR A CG2 1 
ATOM   230  N N   . ARG A 1 30 ? -19.025 -0.403  7.739   1.00 22.56 ? 30  ARG A N   1 
ATOM   231  C CA  . ARG A 1 30 ? -19.621 -0.210  9.047   1.00 23.56 ? 30  ARG A CA  1 
ATOM   232  C C   . ARG A 1 30 ? -19.808 -1.544  9.806   1.00 22.70 ? 30  ARG A C   1 
ATOM   233  O O   . ARG A 1 30 ? -19.688 -1.567  11.024  1.00 22.17 ? 30  ARG A O   1 
ATOM   234  C CB  . ARG A 1 30 ? -20.966 0.511   8.912   1.00 24.11 ? 30  ARG A CB  1 
ATOM   235  C CG  . ARG A 1 30 ? -20.821 2.012   8.732   1.00 27.05 ? 30  ARG A CG  1 
ATOM   236  C CD  . ARG A 1 30 ? -22.079 2.708   9.252   1.00 35.31 ? 30  ARG A CD  1 
ATOM   237  N NE  . ARG A 1 30 ? -22.127 4.159   9.007   1.00 36.54 ? 30  ARG A NE  1 
ATOM   238  C CZ  . ARG A 1 30 ? -22.119 4.725   7.800   1.00 39.31 ? 30  ARG A CZ  1 
ATOM   239  N NH1 . ARG A 1 30 ? -22.042 3.976   6.703   1.00 37.09 ? 30  ARG A NH1 1 
ATOM   240  N NH2 . ARG A 1 30 ? -22.193 6.052   7.688   1.00 39.65 ? 30  ARG A NH2 1 
ATOM   241  N N   . THR A 1 31 ? -20.033 -2.617  9.044   1.00 22.49 ? 31  THR A N   1 
ATOM   242  C CA  . THR A 1 31 ? -20.448 -3.923  9.584   1.00 23.57 ? 31  THR A CA  1 
ATOM   243  C C   . THR A 1 31 ? -19.281 -4.927  9.749   1.00 23.06 ? 31  THR A C   1 
ATOM   244  O O   . THR A 1 31 ? -19.462 -6.007  10.318  1.00 21.96 ? 31  THR A O   1 
ATOM   245  C CB  . THR A 1 31 ? -21.549 -4.570  8.712   1.00 24.32 ? 31  THR A CB  1 
ATOM   246  O OG1 . THR A 1 31 ? -21.099 -4.717  7.361   1.00 24.22 ? 31  THR A OG1 1 
ATOM   247  C CG2 . THR A 1 31 ? -22.813 -3.722  8.724   1.00 24.99 ? 31  THR A CG2 1 
ATOM   248  N N   . GLY A 1 32 ? -18.095 -4.560  9.249   1.00 21.19 ? 32  GLY A N   1 
ATOM   249  C CA  . GLY A 1 32 ? -16.973 -5.474  9.204   1.00 21.32 ? 32  GLY A CA  1 
ATOM   250  C C   . GLY A 1 32 ? -16.162 -5.623  10.473  1.00 19.79 ? 32  GLY A C   1 
ATOM   251  O O   . GLY A 1 32 ? -16.257 -4.825  11.403  1.00 20.28 ? 32  GLY A O   1 
ATOM   252  N N   . LEU A 1 33 ? -15.311 -6.647  10.485  1.00 20.59 ? 33  LEU A N   1 
ATOM   253  C CA  . LEU A 1 33 ? -14.411 -6.881  11.622  1.00 19.83 ? 33  LEU A CA  1 
ATOM   254  C C   . LEU A 1 33 ? -13.372 -5.797  11.803  1.00 20.19 ? 33  LEU A C   1 
ATOM   255  O O   . LEU A 1 33 ? -12.936 -5.540  12.902  1.00 20.24 ? 33  LEU A O   1 
ATOM   256  C CB  . LEU A 1 33 ? -13.702 -8.235  11.459  1.00 20.36 ? 33  LEU A CB  1 
ATOM   257  C CG  . LEU A 1 33 ? -14.610 -9.450  11.574  1.00 21.57 ? 33  LEU A CG  1 
ATOM   258  C CD1 . LEU A 1 33 ? -13.873 -10.639 11.051  1.00 22.38 ? 33  LEU A CD1 1 
ATOM   259  C CD2 . LEU A 1 33 ? -15.047 -9.652  13.059  1.00 24.44 ? 33  LEU A CD2 1 
ATOM   260  N N   . ALA A 1 34 ? -12.954 -5.162  10.705  1.00 20.03 ? 34  ALA A N   1 
ATOM   261  C CA  . ALA A 1 34 ? -12.003 -4.064  10.803  1.00 20.02 ? 34  ALA A CA  1 
ATOM   262  C C   . ALA A 1 34 ? -12.563 -2.953  11.668  1.00 20.13 ? 34  ALA A C   1 
ATOM   263  O O   . ALA A 1 34 ? -11.893 -2.455  12.575  1.00 20.52 ? 34  ALA A O   1 
ATOM   264  C CB  . ALA A 1 34 ? -11.627 -3.550  9.416   1.00 18.72 ? 34  ALA A CB  1 
ATOM   265  N N   . THR A 1 35 ? -13.807 -2.570  11.412  1.00 20.53 ? 35  THR A N   1 
ATOM   266  C CA  . THR A 1 35 ? -14.457 -1.540  12.212  1.00 21.42 ? 35  THR A CA  1 
ATOM   267  C C   . THR A 1 35 ? -14.686 -2.029  13.669  1.00 21.95 ? 35  THR A C   1 
ATOM   268  O O   . THR A 1 35 ? -14.376 -1.323  14.641  1.00 22.28 ? 35  THR A O   1 
ATOM   269  C CB  . THR A 1 35 ? -15.779 -1.061  11.538  1.00 21.34 ? 35  THR A CB  1 
ATOM   270  O OG1 . THR A 1 35 ? -15.466 -0.305  10.345  1.00 20.99 ? 35  THR A OG1 1 
ATOM   271  C CG2 . THR A 1 35 ? -16.600 -0.193  12.505  1.00 22.97 ? 35  THR A CG2 1 
ATOM   272  N N   . LYS A 1 36 ? -15.204 -3.239  13.805  1.00 22.20 ? 36  LYS A N   1 
ATOM   273  C CA  . LYS A 1 36 ? -15.554 -3.785  15.128  1.00 23.17 ? 36  LYS A CA  1 
ATOM   274  C C   . LYS A 1 36 ? -14.308 -3.842  16.030  1.00 23.49 ? 36  LYS A C   1 
ATOM   275  O O   . LYS A 1 36 ? -14.385 -3.455  17.201  1.00 23.60 ? 36  LYS A O   1 
ATOM   276  C CB  . LYS A 1 36 ? -16.230 -5.154  14.977  1.00 22.99 ? 36  LYS A CB  1 
ATOM   277  C CG  . LYS A 1 36 ? -16.534 -5.925  16.311  1.00 24.55 ? 36  LYS A CG  1 
ATOM   278  C CD  . LYS A 1 36 ? -16.962 -7.360  15.977  1.00 29.32 ? 36  LYS A CD  1 
ATOM   279  C CE  . LYS A 1 36 ? -16.738 -8.361  17.113  1.00 32.91 ? 36  LYS A CE  1 
ATOM   280  N NZ  . LYS A 1 36 ? -16.767 -9.796  16.597  1.00 33.66 ? 36  LYS A NZ  1 
ATOM   281  N N   . ASP A 1 37 ? -13.161 -4.234  15.466  1.00 22.64 ? 37  ASP A N   1 
ATOM   282  C CA  . ASP A 1 37 ? -11.893 -4.313  16.234  1.00 22.61 ? 37  ASP A CA  1 
ATOM   283  C C   . ASP A 1 37 ? -11.387 -2.931  16.718  1.00 22.94 ? 37  ASP A C   1 
ATOM   284  O O   . ASP A 1 37 ? -10.782 -2.828  17.796  1.00 23.25 ? 37  ASP A O   1 
ATOM   285  C CB  . ASP A 1 37 ? -10.810 -5.020  15.408  1.00 22.57 ? 37  ASP A CB  1 
ATOM   286  C CG  . ASP A 1 37 ? -9.429  -4.915  16.035  1.00 22.84 ? 37  ASP A CG  1 
ATOM   287  O OD1 . ASP A 1 37 ? -9.143  -5.699  16.963  1.00 21.05 ? 37  ASP A OD1 1 
ATOM   288  O OD2 . ASP A 1 37 ? -8.639  -4.048  15.620  1.00 23.06 ? 37  ASP A OD2 1 
ATOM   289  N N   . GLY A 1 38 ? -11.599 -1.909  15.881  1.00 21.38 ? 38  GLY A N   1 
ATOM   290  C CA  . GLY A 1 38 ? -11.435 -0.513  16.252  1.00 22.61 ? 38  GLY A CA  1 
ATOM   291  C C   . GLY A 1 38 ? -10.027 0.052   16.225  1.00 23.09 ? 38  GLY A C   1 
ATOM   292  O O   . GLY A 1 38 ? -9.831  1.239   16.531  1.00 23.17 ? 38  GLY A O   1 
ATOM   293  N N   . ASN A 1 39 ? -9.049  -0.796  15.888  1.00 22.91 ? 39  ASN A N   1 
ATOM   294  C CA  . ASN A 1 39 ? -7.640  -0.398  15.888  1.00 23.51 ? 39  ASN A CA  1 
ATOM   295  C C   . ASN A 1 39 ? -7.175  0.242   14.582  1.00 23.81 ? 39  ASN A C   1 
ATOM   296  O O   . ASN A 1 39 ? -6.433  1.233   14.607  1.00 23.23 ? 39  ASN A O   1 
ATOM   297  C CB  . ASN A 1 39 ? -6.719  -1.558  16.308  1.00 23.55 ? 39  ASN A CB  1 
ATOM   298  C CG  . ASN A 1 39 ? -6.886  -1.923  17.785  1.00 23.61 ? 39  ASN A CG  1 
ATOM   299  O OD1 . ASN A 1 39 ? -6.577  -1.126  18.672  1.00 27.32 ? 39  ASN A OD1 1 
ATOM   300  N ND2 . ASN A 1 39 ? -7.380  -3.113  18.047  1.00 24.56 ? 39  ASN A ND2 1 
ATOM   301  N N   . LEU A 1 40 ? -7.621  -0.327  13.462  1.00 23.96 ? 40  LEU A N   1 
ATOM   302  C CA  . LEU A 1 40 ? -7.291  0.184   12.117  1.00 24.44 ? 40  LEU A CA  1 
ATOM   303  C C   . LEU A 1 40 ? -7.964  1.516   11.810  1.00 24.66 ? 40  LEU A C   1 
ATOM   304  O O   . LEU A 1 40 ? -9.093  1.775   12.257  1.00 24.42 ? 40  LEU A O   1 
ATOM   305  C CB  . LEU A 1 40 ? -7.716  -0.832  11.048  1.00 24.92 ? 40  LEU A CB  1 
ATOM   306  C CG  . LEU A 1 40 ? -6.769  -1.771  10.327  1.00 27.88 ? 40  LEU A CG  1 
ATOM   307  C CD1 . LEU A 1 40 ? -7.494  -2.301  9.051   1.00 27.47 ? 40  LEU A CD1 1 
ATOM   308  C CD2 . LEU A 1 40 ? -5.490  -1.076  9.978   1.00 22.80 ? 40  LEU A CD2 1 
ATOM   309  N N   . HIS A 1 41 ? -7.269  2.369   11.048  1.00 24.68 ? 41  HIS A N   1 
ATOM   310  C CA  . HIS A 1 41 ? -7.827  3.632   10.591  1.00 25.79 ? 41  HIS A CA  1 
ATOM   311  C C   . HIS A 1 41 ? -7.831  3.717   9.066   1.00 25.17 ? 41  HIS A C   1 
ATOM   312  O O   . HIS A 1 41 ? -6.895  3.243   8.399   1.00 23.81 ? 41  HIS A O   1 
ATOM   313  C CB  . HIS A 1 41 ? -7.016  4.810   11.133  1.00 26.84 ? 41  HIS A CB  1 
ATOM   314  C CG  . HIS A 1 41 ? -6.980  4.893   12.623  1.00 30.72 ? 41  HIS A CG  1 
ATOM   315  N ND1 . HIS A 1 41 ? -5.983  5.563   13.303  1.00 35.06 ? 41  HIS A ND1 1 
ATOM   316  C CD2 . HIS A 1 41 ? -7.812  4.392   13.570  1.00 33.67 ? 41  HIS A CD2 1 
ATOM   317  C CE1 . HIS A 1 41 ? -6.204  5.474   14.603  1.00 36.27 ? 41  HIS A CE1 1 
ATOM   318  N NE2 . HIS A 1 41 ? -7.311  4.775   14.791  1.00 36.81 ? 41  HIS A NE2 1 
ATOM   319  N N   . GLU A 1 42 ? -8.885  4.316   8.517   1.00 24.29 ? 42  GLU A N   1 
ATOM   320  C CA  . GLU A 1 42 ? -8.906  4.623   7.105   1.00 25.64 ? 42  GLU A CA  1 
ATOM   321  C C   . GLU A 1 42 ? -7.653  5.443   6.786   1.00 23.97 ? 42  GLU A C   1 
ATOM   322  O O   . GLU A 1 42 ? -7.265  6.330   7.568   1.00 23.58 ? 42  GLU A O   1 
ATOM   323  C CB  . GLU A 1 42 ? -10.178 5.413   6.779   1.00 26.93 ? 42  GLU A CB  1 
ATOM   324  C CG  . GLU A 1 42 ? -10.496 5.498   5.327   1.00 31.55 ? 42  GLU A CG  1 
ATOM   325  C CD  . GLU A 1 42 ? -11.732 6.334   5.048   1.00 38.04 ? 42  GLU A CD  1 
ATOM   326  O OE1 . GLU A 1 42 ? -12.857 5.882   5.385   1.00 38.55 ? 42  GLU A OE1 1 
ATOM   327  O OE2 . GLU A 1 42 ? -11.572 7.448   4.483   1.00 40.48 ? 42  GLU A OE2 1 
ATOM   328  N N   . GLY A 1 43 ? -7.008  5.125   5.669   1.00 22.94 ? 43  GLY A N   1 
ATOM   329  C CA  . GLY A 1 43 ? -5.770  5.795   5.280   1.00 22.01 ? 43  GLY A CA  1 
ATOM   330  C C   . GLY A 1 43 ? -4.505  5.211   5.906   1.00 21.66 ? 43  GLY A C   1 
ATOM   331  O O   . GLY A 1 43 ? -3.386  5.584   5.502   1.00 22.40 ? 43  GLY A O   1 
ATOM   332  N N   . ASP A 1 44 ? -4.644  4.296   6.865   1.00 20.89 ? 44  ASP A N   1 
ATOM   333  C CA  . ASP A 1 44 ? -3.454  3.574   7.408   1.00 19.90 ? 44  ASP A CA  1 
ATOM   334  C C   . ASP A 1 44 ? -2.658  2.884   6.313   1.00 19.98 ? 44  ASP A C   1 
ATOM   335  O O   . ASP A 1 44 ? -3.228  2.267   5.423   1.00 18.95 ? 44  ASP A O   1 
ATOM   336  C CB  . ASP A 1 44 ? -3.847  2.482   8.413   1.00 19.77 ? 44  ASP A CB  1 
ATOM   337  C CG  . ASP A 1 44 ? -4.046  3.016   9.816   1.00 22.24 ? 44  ASP A CG  1 
ATOM   338  O OD1 . ASP A 1 44 ? -3.591  4.125   10.098  1.00 24.39 ? 44  ASP A OD1 1 
ATOM   339  O OD2 . ASP A 1 44 ? -4.648  2.313   10.644  1.00 23.74 ? 44  ASP A OD2 1 
ATOM   340  N N   . ILE A 1 45 ? -1.340  2.946   6.409   1.00 19.44 ? 45  ILE A N   1 
ATOM   341  C CA  . ILE A 1 45 ? -0.484  2.214   5.482   1.00 20.19 ? 45  ILE A CA  1 
ATOM   342  C C   . ILE A 1 45 ? -0.210  0.847   6.051   1.00 19.97 ? 45  ILE A C   1 
ATOM   343  O O   . ILE A 1 45 ? 0.249   0.723   7.208   1.00 19.98 ? 45  ILE A O   1 
ATOM   344  C CB  . ILE A 1 45 ? 0.869   2.917   5.241   1.00 19.96 ? 45  ILE A CB  1 
ATOM   345  C CG1 . ILE A 1 45 ? 0.658   4.392   4.860   1.00 22.32 ? 45  ILE A CG1 1 
ATOM   346  C CG2 . ILE A 1 45 ? 1.694   2.113   4.192   1.00 21.55 ? 45  ILE A CG2 1 
ATOM   347  C CD1 . ILE A 1 45 ? -0.051  4.587   3.534   1.00 23.65 ? 45  ILE A CD1 1 
ATOM   348  N N   . ILE A 1 46 ? -0.533  -0.179  5.262   1.00 18.97 ? 46  ILE A N   1 
ATOM   349  C CA  . ILE A 1 46 ? -0.271  -1.550  5.654   1.00 20.10 ? 46  ILE A CA  1 
ATOM   350  C C   . ILE A 1 46 ? 1.184   -1.839  5.335   1.00 20.61 ? 46  ILE A C   1 
ATOM   351  O O   . ILE A 1 46 ? 1.624   -1.632  4.201   1.00 22.51 ? 46  ILE A O   1 
ATOM   352  C CB  . ILE A 1 46 ? -1.165  -2.561  4.860   1.00 19.40 ? 46  ILE A CB  1 
ATOM   353  C CG1 . ILE A 1 46 ? -2.663  -2.237  5.013   1.00 19.71 ? 46  ILE A CG1 1 
ATOM   354  C CG2 . ILE A 1 46 ? -0.847  -4.011  5.260   1.00 21.69 ? 46  ILE A CG2 1 
ATOM   355  C CD1 . ILE A 1 46 ? -3.149  -2.186  6.414   1.00 21.96 ? 46  ILE A CD1 1 
ATOM   356  N N   . LEU A 1 47 ? 1.922   -2.359  6.306   1.00 19.04 ? 47  LEU A N   1 
ATOM   357  C CA  . LEU A 1 47 ? 3.323   -2.749  6.075   1.00 20.03 ? 47  LEU A CA  1 
ATOM   358  C C   . LEU A 1 47 ? 3.530   -4.238  5.817   1.00 19.94 ? 47  LEU A C   1 
ATOM   359  O O   . LEU A 1 47 ? 4.435   -4.631  5.066   1.00 19.82 ? 47  LEU A O   1 
ATOM   360  C CB  . LEU A 1 47 ? 4.203   -2.323  7.266   1.00 19.82 ? 47  LEU A CB  1 
ATOM   361  C CG  . LEU A 1 47 ? 4.258   -0.821  7.533   1.00 20.36 ? 47  LEU A CG  1 
ATOM   362  C CD1 . LEU A 1 47 ? 5.011   -0.539  8.865   1.00 23.12 ? 47  LEU A CD1 1 
ATOM   363  C CD2 . LEU A 1 47 ? 4.840   -0.017  6.320   1.00 22.41 ? 47  LEU A CD2 1 
ATOM   364  N N   . LYS A 1 48 ? 2.718   -5.065  6.475   1.00 19.59 ? 48  LYS A N   1 
ATOM   365  C CA  . LYS A 1 48 ? 2.756   -6.501  6.298   1.00 20.46 ? 48  LYS A CA  1 
ATOM   366  C C   . LYS A 1 48 ? 1.369   -7.122  6.422   1.00 20.39 ? 48  LYS A C   1 
ATOM   367  O O   . LYS A 1 48 ? 0.502   -6.642  7.158   1.00 19.69 ? 48  LYS A O   1 
ATOM   368  C CB  . LYS A 1 48 ? 3.693   -7.174  7.323   1.00 21.03 ? 48  LYS A CB  1 
ATOM   369  C CG  . LYS A 1 48 ? 5.123   -6.656  7.338   1.00 25.39 ? 48  LYS A CG  1 
ATOM   370  C CD  . LYS A 1 48 ? 5.889   -7.103  8.586   1.00 29.66 ? 48  LYS A CD  1 
ATOM   371  C CE  . LYS A 1 48 ? 6.227   -8.563  8.586   1.00 31.32 ? 48  LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 48 ? 6.915   -8.888  9.915   1.00 31.66 ? 48  LYS A NZ  1 
ATOM   373  N N   . ILE A 1 49 ? 1.175   -8.180  5.656   1.00 20.59 ? 49  ILE A N   1 
ATOM   374  C CA  . ILE A 1 49 ? -0.026  -8.997  5.736   1.00 22.60 ? 49  ILE A CA  1 
ATOM   375  C C   . ILE A 1 49 ? 0.415   -10.418 6.014   1.00 23.45 ? 49  ILE A C   1 
ATOM   376  O O   . ILE A 1 49 ? 1.065   -11.065 5.165   1.00 23.74 ? 49  ILE A O   1 
ATOM   377  C CB  . ILE A 1 49 ? -0.879  -8.956  4.443   1.00 22.45 ? 49  ILE A CB  1 
ATOM   378  C CG1 . ILE A 1 49 ? -1.336  -7.528  4.146   1.00 22.89 ? 49  ILE A CG1 1 
ATOM   379  C CG2 . ILE A 1 49 ? -2.095  -9.889  4.580   1.00 22.76 ? 49  ILE A CG2 1 
ATOM   380  C CD1 . ILE A 1 49 ? -1.939  -7.347  2.748   1.00 25.57 ? 49  ILE A CD1 1 
ATOM   381  N N   . ASN A 1 50 ? 0.048   -10.912 7.197   1.00 24.21 ? 50  ASN A N   1 
ATOM   382  C CA  . ASN A 1 50 ? 0.411   -12.279 7.603   1.00 25.83 ? 50  ASN A CA  1 
ATOM   383  C C   . ASN A 1 50 ? 1.887   -12.618 7.346   1.00 25.48 ? 50  ASN A C   1 
ATOM   384  O O   . ASN A 1 50 ? 2.214   -13.686 6.814   1.00 25.63 ? 50  ASN A O   1 
ATOM   385  C CB  . ASN A 1 50 ? -0.553  -13.277 6.944   1.00 25.68 ? 50  ASN A CB  1 
ATOM   386  C CG  . ASN A 1 50 ? -1.905  -13.328 7.661   1.00 27.59 ? 50  ASN A CG  1 
ATOM   387  O OD1 . ASN A 1 50 ? -2.007  -12.919 8.815   1.00 31.17 ? 50  ASN A OD1 1 
ATOM   388  N ND2 . ASN A 1 50 ? -2.927  -13.833 6.995   1.00 31.86 ? 50  ASN A ND2 1 
ATOM   389  N N   . GLY A 1 51 ? 2.758   -11.694 7.730   1.00 26.42 ? 51  GLY A N   1 
ATOM   390  C CA  . GLY A 1 51 ? 4.204   -11.885 7.664   1.00 26.74 ? 51  GLY A CA  1 
ATOM   391  C C   . GLY A 1 51 ? 4.869   -11.384 6.385   1.00 26.52 ? 51  GLY A C   1 
ATOM   392  O O   . GLY A 1 51 ? 6.093   -11.187 6.364   1.00 27.23 ? 51  GLY A O   1 
ATOM   393  N N   . THR A 1 52 ? 4.077   -11.167 5.335   1.00 25.59 ? 52  THR A N   1 
ATOM   394  C CA  . THR A 1 52 ? 4.614   -10.740 4.014   1.00 24.90 ? 52  THR A CA  1 
ATOM   395  C C   . THR A 1 52 ? 4.604   -9.222  3.847   1.00 24.09 ? 52  THR A C   1 
ATOM   396  O O   . THR A 1 52 ? 3.564   -8.598  3.932   1.00 22.89 ? 52  THR A O   1 
ATOM   397  C CB  . THR A 1 52 ? 3.832   -11.373 2.877   1.00 24.81 ? 52  THR A CB  1 
ATOM   398  O OG1 . THR A 1 52 ? 3.951   -12.785 2.987   1.00 26.66 ? 52  THR A OG1 1 
ATOM   399  C CG2 . THR A 1 52 ? 4.382   -10.955 1.521   1.00 26.09 ? 52  THR A CG2 1 
ATOM   400  N N   . VAL A 1 53 ? 5.773   -8.660  3.574   1.00 23.44 ? 53  VAL A N   1 
ATOM   401  C CA  . VAL A 1 53 ? 5.957   -7.214  3.426   1.00 23.65 ? 53  VAL A CA  1 
ATOM   402  C C   . VAL A 1 53 ? 5.230   -6.750  2.169   1.00 23.44 ? 53  VAL A C   1 
ATOM   403  O O   . VAL A 1 53 ? 5.319   -7.414  1.125   1.00 24.15 ? 53  VAL A O   1 
ATOM   404  C CB  . VAL A 1 53 ? 7.464   -6.906  3.321   1.00 24.54 ? 53  VAL A CB  1 
ATOM   405  C CG1 . VAL A 1 53 ? 7.734   -5.518  2.705   1.00 27.33 ? 53  VAL A CG1 1 
ATOM   406  C CG2 . VAL A 1 53 ? 8.149   -7.115  4.686   1.00 25.29 ? 53  VAL A CG2 1 
ATOM   407  N N   . THR A 1 54 ? 4.568   -5.602  2.263   1.00 21.80 ? 54  THR A N   1 
ATOM   408  C CA  . THR A 1 54 ? 3.708   -5.117  1.180   1.00 21.92 ? 54  THR A CA  1 
ATOM   409  C C   . THR A 1 54 ? 4.277   -3.959  0.351   1.00 21.29 ? 54  THR A C   1 
ATOM   410  O O   . THR A 1 54 ? 3.695   -3.620  -0.694  1.00 20.41 ? 54  THR A O   1 
ATOM   411  C CB  . THR A 1 54 ? 2.287   -4.791  1.651   1.00 22.41 ? 54  THR A CB  1 
ATOM   412  O OG1 . THR A 1 54 ? 2.337   -3.850  2.721   1.00 24.05 ? 54  THR A OG1 1 
ATOM   413  C CG2 . THR A 1 54 ? 1.560   -6.096  2.099   1.00 21.00 ? 54  THR A CG2 1 
ATOM   414  N N   . GLU A 1 55 ? 5.380   -3.349  0.796   1.00 20.63 ? 55  GLU A N   1 
ATOM   415  C CA  . GLU A 1 55 ? 5.988   -2.268  -0.034  1.00 21.91 ? 55  GLU A CA  1 
ATOM   416  C C   . GLU A 1 55 ? 6.253   -2.801  -1.441  1.00 21.17 ? 55  GLU A C   1 
ATOM   417  O O   . GLU A 1 55 ? 6.775   -3.884  -1.598  1.00 20.46 ? 55  GLU A O   1 
ATOM   418  C CB  . GLU A 1 55 ? 7.275   -1.733  0.583   1.00 21.69 ? 55  GLU A CB  1 
ATOM   419  C CG  . GLU A 1 55 ? 7.635   -0.333  0.053   1.00 26.13 ? 55  GLU A CG  1 
ATOM   420  C CD  . GLU A 1 55 ? 8.932   0.219   0.638   1.00 30.42 ? 55  GLU A CD  1 
ATOM   421  O OE1 . GLU A 1 55 ? 9.535   -0.440  1.530   1.00 31.28 ? 55  GLU A OE1 1 
ATOM   422  O OE2 . GLU A 1 55 ? 9.357   1.305   0.193   1.00 28.09 ? 55  GLU A OE2 1 
ATOM   423  N N   . ASN A 1 56 ? 5.851   -2.020  -2.451  1.00 21.43 ? 56  ASN A N   1 
ATOM   424  C CA  . ASN A 1 56 ? 5.979   -2.353  -3.849  1.00 21.22 ? 56  ASN A CA  1 
ATOM   425  C C   . ASN A 1 56 ? 5.162   -3.542  -4.336  1.00 20.72 ? 56  ASN A C   1 
ATOM   426  O O   . ASN A 1 56 ? 5.319   -3.950  -5.469  1.00 21.44 ? 56  ASN A O   1 
ATOM   427  C CB  . ASN A 1 56 ? 7.451   -2.500  -4.269  1.00 21.43 ? 56  ASN A CB  1 
ATOM   428  C CG  . ASN A 1 56 ? 8.252   -1.237  -4.026  1.00 22.13 ? 56  ASN A CG  1 
ATOM   429  O OD1 . ASN A 1 56 ? 7.696   -0.159  -3.770  1.00 21.53 ? 56  ASN A OD1 1 
ATOM   430  N ND2 . ASN A 1 56 ? 9.569   -1.357  -4.131  1.00 25.88 ? 56  ASN A ND2 1 
ATOM   431  N N   . MET A 1 57 ? 4.307   -4.109  -3.480  1.00 20.23 ? 57  MET A N   1 
ATOM   432  C CA  . MET A 1 57 ? 3.408   -5.175  -3.912  1.00 20.35 ? 57  MET A CA  1 
ATOM   433  C C   . MET A 1 57 ? 2.167   -4.602  -4.613  1.00 20.04 ? 57  MET A C   1 
ATOM   434  O O   . MET A 1 57 ? 1.581   -3.610  -4.161  1.00 20.00 ? 57  MET A O   1 
ATOM   435  C CB  . MET A 1 57 ? 2.992   -6.052  -2.716  1.00 20.50 ? 57  MET A CB  1 
ATOM   436  C CG  . MET A 1 57 ? 1.999   -7.103  -3.082  1.00 22.44 ? 57  MET A CG  1 
ATOM   437  S SD  . MET A 1 57 ? 1.620   -8.220  -1.724  1.00 26.30 ? 57  MET A SD  1 
ATOM   438  C CE  . MET A 1 57 ? 3.248   -8.893  -1.353  1.00 26.94 ? 57  MET A CE  1 
ATOM   439  N N   . SER A 1 58 ? 1.743   -5.252  -5.695  1.00 20.06 ? 58  SER A N   1 
ATOM   440  C CA  . SER A 1 58 ? 0.527   -4.810  -6.380  1.00 20.11 ? 58  SER A CA  1 
ATOM   441  C C   . SER A 1 58 ? -0.701  -5.031  -5.489  1.00 20.67 ? 58  SER A C   1 
ATOM   442  O O   . SER A 1 58 ? -0.731  -5.964  -4.669  1.00 20.82 ? 58  SER A O   1 
ATOM   443  C CB  . SER A 1 58 ? 0.365   -5.542  -7.713  1.00 21.13 ? 58  SER A CB  1 
ATOM   444  O OG  . SER A 1 58 ? -0.031  -6.897  -7.516  1.00 21.62 ? 58  SER A OG  1 
ATOM   445  N N   . LEU A 1 59 ? -1.698  -4.174  -5.654  1.00 20.43 ? 59  LEU A N   1 
ATOM   446  C CA  . LEU A 1 59 ? -2.998  -4.330  -5.008  1.00 20.25 ? 59  LEU A CA  1 
ATOM   447  C C   . LEU A 1 59 ? -3.584  -5.727  -5.241  1.00 20.60 ? 59  LEU A C   1 
ATOM   448  O O   . LEU A 1 59 ? -4.104  -6.335  -4.313  1.00 19.81 ? 59  LEU A O   1 
ATOM   449  C CB  . LEU A 1 59 ? -3.981  -3.306  -5.562  1.00 20.69 ? 59  LEU A CB  1 
ATOM   450  C CG  . LEU A 1 59 ? -5.331  -3.218  -4.826  1.00 20.29 ? 59  LEU A CG  1 
ATOM   451  C CD1 . LEU A 1 59 ? -5.173  -3.262  -3.294  1.00 22.11 ? 59  LEU A CD1 1 
ATOM   452  C CD2 . LEU A 1 59 ? -6.153  -1.992  -5.274  1.00 22.50 ? 59  LEU A CD2 1 
ATOM   453  N N   . THR A 1 60 ? -3.545  -6.207  -6.494  1.00 21.42 ? 60  THR A N   1 
ATOM   454  C CA  . THR A 1 60 ? -3.992  -7.564  -6.811  1.00 22.30 ? 60  THR A CA  1 
ATOM   455  C C   . THR A 1 60 ? -3.281  -8.620  -5.955  1.00 22.47 ? 60  THR A C   1 
ATOM   456  O O   . THR A 1 60 ? -3.931  -9.493  -5.364  1.00 22.99 ? 60  THR A O   1 
ATOM   457  C CB  . THR A 1 60 ? -3.815  -7.869  -8.331  1.00 22.45 ? 60  THR A CB  1 
ATOM   458  O OG1 . THR A 1 60 ? -4.567  -6.906  -9.076  1.00 26.19 ? 60  THR A OG1 1 
ATOM   459  C CG2 . THR A 1 60 ? -4.318  -9.263  -8.685  1.00 23.26 ? 60  THR A CG2 1 
ATOM   460  N N   . ASP A 1 61 ? -1.954  -8.563  -5.886  1.00 22.17 ? 61  ASP A N   1 
ATOM   461  C CA  . ASP A 1 61 ? -1.240  -9.496  -5.029  1.00 22.48 ? 61  ASP A CA  1 
ATOM   462  C C   . ASP A 1 61 ? -1.577  -9.349  -3.537  1.00 22.20 ? 61  ASP A C   1 
ATOM   463  O O   . ASP A 1 61 ? -1.783  -10.365 -2.849  1.00 22.72 ? 61  ASP A O   1 
ATOM   464  C CB  . ASP A 1 61 ? 0.256   -9.411  -5.278  1.00 22.92 ? 61  ASP A CB  1 
ATOM   465  C CG  . ASP A 1 61 ? 0.658   -10.041 -6.618  1.00 25.43 ? 61  ASP A CG  1 
ATOM   466  O OD1 . ASP A 1 61 ? -0.214  -10.626 -7.308  1.00 28.18 ? 61  ASP A OD1 1 
ATOM   467  O OD2 . ASP A 1 61 ? 1.850   -9.960  -6.967  1.00 26.59 ? 61  ASP A OD2 1 
ATOM   468  N N   . ALA A 1 62 ? -1.654  -8.103  -3.041  1.00 21.07 ? 62  ALA A N   1 
ATOM   469  C CA  . ALA A 1 62 ? -2.032  -7.876  -1.638  1.00 20.99 ? 62  ALA A CA  1 
ATOM   470  C C   . ALA A 1 62 ? -3.417  -8.488  -1.342  1.00 21.38 ? 62  ALA A C   1 
ATOM   471  O O   . ALA A 1 62 ? -3.607  -9.134  -0.301  1.00 21.88 ? 62  ALA A O   1 
ATOM   472  C CB  . ALA A 1 62 ? -2.013  -6.400  -1.289  1.00 20.64 ? 62  ALA A CB  1 
ATOM   473  N N   . ARG A 1 63 ? -4.365  -8.306  -2.264  1.00 21.18 ? 63  ARG A N   1 
ATOM   474  C CA  . ARG A 1 63 ? -5.725  -8.857  -2.101  1.00 22.44 ? 63  ARG A CA  1 
ATOM   475  C C   . ARG A 1 63 ? -5.701  -10.395 -2.057  1.00 23.49 ? 63  ARG A C   1 
ATOM   476  O O   . ARG A 1 63 ? -6.464  -11.027 -1.313  1.00 23.16 ? 63  ARG A O   1 
ATOM   477  C CB  . ARG A 1 63 ? -6.661  -8.340  -3.186  1.00 22.28 ? 63  ARG A CB  1 
ATOM   478  C CG  . ARG A 1 63 ? -6.959  -6.871  -3.004  1.00 24.50 ? 63  ARG A CG  1 
ATOM   479  C CD  . ARG A 1 63 ? -7.846  -6.352  -4.100  1.00 25.74 ? 63  ARG A CD  1 
ATOM   480  N NE  . ARG A 1 63 ? -8.460  -5.104  -3.678  1.00 28.24 ? 63  ARG A NE  1 
ATOM   481  C CZ  . ARG A 1 63 ? -8.940  -4.193  -4.508  1.00 29.19 ? 63  ARG A CZ  1 
ATOM   482  N NH1 . ARG A 1 63 ? -8.852  -4.385  -5.827  1.00 30.71 ? 63  ARG A NH1 1 
ATOM   483  N NH2 . ARG A 1 63 ? -9.488  -3.089  -4.023  1.00 28.83 ? 63  ARG A NH2 1 
ATOM   484  N N   . LYS A 1 64 ? -4.810  -10.994 -2.840  1.00 23.79 ? 64  LYS A N   1 
ATOM   485  C CA  . LYS A 1 64 ? -4.666  -12.446 -2.810  1.00 24.97 ? 64  LYS A CA  1 
ATOM   486  C C   . LYS A 1 64 ? -4.217  -12.910 -1.428  1.00 25.36 ? 64  LYS A C   1 
ATOM   487  O O   . LYS A 1 64 ? -4.669  -13.946 -0.954  1.00 25.45 ? 64  LYS A O   1 
ATOM   488  C CB  . LYS A 1 64 ? -3.725  -12.936 -3.912  1.00 24.81 ? 64  LYS A CB  1 
ATOM   489  C CG  . LYS A 1 64 ? -4.319  -12.795 -5.327  1.00 27.60 ? 64  LYS A CG  1 
ATOM   490  C CD  . LYS A 1 64 ? -3.286  -13.147 -6.405  1.00 29.78 ? 64  LYS A CD  1 
ATOM   491  C CE  . LYS A 1 64 ? -3.764  -12.665 -7.757  1.00 30.87 ? 64  LYS A CE  1 
ATOM   492  N NZ  . LYS A 1 64 ? -2.797  -12.903 -8.884  1.00 29.03 ? 64  LYS A NZ  1 
ATOM   493  N N   . LEU A 1 65 ? -3.357  -12.131 -0.779  1.00 26.01 ? 65  LEU A N   1 
ATOM   494  C CA  . LEU A 1 65 ? -2.835  -12.491 0.556   1.00 27.07 ? 65  LEU A CA  1 
ATOM   495  C C   . LEU A 1 65 ? -3.924  -12.436 1.621   1.00 27.84 ? 65  LEU A C   1 
ATOM   496  O O   . LEU A 1 65 ? -3.893  -13.234 2.565   1.00 27.26 ? 65  LEU A O   1 
ATOM   497  C CB  . LEU A 1 65 ? -1.682  -11.593 0.976   1.00 27.23 ? 65  LEU A CB  1 
ATOM   498  C CG  . LEU A 1 65 ? -0.287  -11.641 0.354   1.00 29.84 ? 65  LEU A CG  1 
ATOM   499  C CD1 . LEU A 1 65 ? 0.568   -10.543 0.940   1.00 31.10 ? 65  LEU A CD1 1 
ATOM   500  C CD2 . LEU A 1 65 ? 0.351   -13.005 0.573   1.00 33.95 ? 65  LEU A CD2 1 
ATOM   501  N N   . ILE A 1 66 ? -4.860  -11.488 1.481   1.00 27.66 ? 66  ILE A N   1 
ATOM   502  C CA  . ILE A 1 66 ? -6.038  -11.405 2.369   1.00 28.33 ? 66  ILE A CA  1 
ATOM   503  C C   . ILE A 1 66 ? -6.985  -12.612 2.147   1.00 29.46 ? 66  ILE A C   1 
ATOM   504  O O   . ILE A 1 66 ? -7.488  -13.213 3.102   1.00 28.79 ? 66  ILE A O   1 
ATOM   505  C CB  . ILE A 1 66 ? -6.808  -10.069 2.186   1.00 28.16 ? 66  ILE A CB  1 
ATOM   506  C CG1 . ILE A 1 66 ? -5.870  -8.886  2.516   1.00 27.50 ? 66  ILE A CG1 1 
ATOM   507  C CG2 . ILE A 1 66 ? -8.118  -10.065 3.016   1.00 27.71 ? 66  ILE A CG2 1 
ATOM   508  C CD1 . ILE A 1 66 ? -6.548  -7.610  2.939   1.00 30.17 ? 66  ILE A CD1 1 
ATOM   509  N N   . GLU A 1 67 ? -7.207  -12.981 0.890   1.00 30.20 ? 67  GLU A N   1 
ATOM   510  C CA  . GLU A 1 67 ? -7.958  -14.211 0.613   1.00 32.73 ? 67  GLU A CA  1 
ATOM   511  C C   . GLU A 1 67 ? -7.287  -15.495 1.147   1.00 33.18 ? 67  GLU A C   1 
ATOM   512  O O   . GLU A 1 67 ? -7.990  -16.449 1.476   1.00 34.33 ? 67  GLU A O   1 
ATOM   513  C CB  . GLU A 1 67 ? -8.311  -14.336 -0.873  1.00 33.13 ? 67  GLU A CB  1 
ATOM   514  C CG  . GLU A 1 67 ? -9.112  -13.154 -1.441  1.00 35.27 ? 67  GLU A CG  1 
ATOM   515  C CD  . GLU A 1 67 ? -10.549 -13.033 -0.895  1.00 39.32 ? 67  GLU A CD  1 
ATOM   516  O OE1 . GLU A 1 67 ? -10.949 -13.802 0.005   1.00 41.18 ? 67  GLU A OE1 1 
ATOM   517  O OE2 . GLU A 1 67 ? -11.291 -12.147 -1.370  1.00 41.39 ? 67  GLU A OE2 1 
ATOM   518  N N   . LYS A 1 68 ? -5.955  -15.512 1.274   1.00 33.78 ? 68  LYS A N   1 
ATOM   519  C CA  . LYS A 1 68 ? -5.216  -16.710 1.762   1.00 34.32 ? 68  LYS A CA  1 
ATOM   520  C C   . LYS A 1 68 ? -5.117  -16.841 3.293   1.00 34.74 ? 68  LYS A C   1 
ATOM   521  O O   . LYS A 1 68 ? -4.710  -17.898 3.819   1.00 34.68 ? 68  LYS A O   1 
ATOM   522  C CB  . LYS A 1 68 ? -3.794  -16.748 1.194   1.00 34.53 ? 68  LYS A CB  1 
ATOM   523  C CG  . LYS A 1 68 ? -3.668  -16.944 -0.318  1.00 35.17 ? 68  LYS A CG  1 
ATOM   524  N N   . SER A 1 69 ? -5.462  -15.759 3.994   1.00 34.37 ? 69  SER A N   1 
ATOM   525  C CA  . SER A 1 69 ? -5.408  -15.673 5.465   1.00 33.83 ? 69  SER A CA  1 
ATOM   526  C C   . SER A 1 69 ? -6.311  -16.697 6.177   1.00 33.99 ? 69  SER A C   1 
ATOM   527  O O   . SER A 1 69 ? -6.099  -16.997 7.353   1.00 34.19 ? 69  SER A O   1 
ATOM   528  C CB  . SER A 1 69 ? -5.831  -14.266 5.904   1.00 32.74 ? 69  SER A CB  1 
ATOM   529  O OG  . SER A 1 69 ? -7.180  -14.046 5.543   1.00 31.91 ? 69  SER A OG  1 
ATOM   530  N N   . ARG A 1 70 ? -7.333  -17.182 5.471   1.00 34.33 ? 70  ARG A N   1 
ATOM   531  C CA  . ARG A 1 70 ? -8.289  -18.164 5.994   1.00 35.29 ? 70  ARG A CA  1 
ATOM   532  C C   . ARG A 1 70 ? -8.831  -17.817 7.400   1.00 34.65 ? 70  ARG A C   1 
ATOM   533  O O   . ARG A 1 70 ? -8.743  -18.622 8.343   1.00 35.29 ? 70  ARG A O   1 
ATOM   534  C CB  . ARG A 1 70 ? -7.707  -19.581 5.950   1.00 35.95 ? 70  ARG A CB  1 
ATOM   535  C CG  . ARG A 1 70 ? -7.599  -20.179 4.530   1.00 38.71 ? 70  ARG A CG  1 
ATOM   536  C CD  . ARG A 1 70 ? -6.694  -21.426 4.497   1.00 43.90 ? 70  ARG A CD  1 
ATOM   537  N NE  . ARG A 1 70 ? -5.430  -21.218 5.216   1.00 46.34 ? 70  ARG A NE  1 
ATOM   538  C CZ  . ARG A 1 70 ? -5.149  -21.722 6.417   1.00 48.01 ? 70  ARG A CZ  1 
ATOM   539  N NH1 . ARG A 1 70 ? -6.042  -22.481 7.053   1.00 48.23 ? 70  ARG A NH1 1 
ATOM   540  N NH2 . ARG A 1 70 ? -3.976  -21.464 6.989   1.00 48.84 ? 70  ARG A NH2 1 
ATOM   541  N N   . GLY A 1 71 ? -9.362  -16.597 7.513   1.00 33.58 ? 71  GLY A N   1 
ATOM   542  C CA  . GLY A 1 71 ? -10.056 -16.132 8.718   1.00 31.91 ? 71  GLY A CA  1 
ATOM   543  C C   . GLY A 1 71 ? -9.182  -15.629 9.851   1.00 30.40 ? 71  GLY A C   1 
ATOM   544  O O   . GLY A 1 71 ? -9.696  -15.261 10.911  1.00 30.86 ? 71  GLY A O   1 
ATOM   545  N N   . LYS A 1 72 ? -7.865  -15.634 9.654   1.00 28.13 ? 72  LYS A N   1 
ATOM   546  C CA  . LYS A 1 72 ? -6.953  -15.023 10.606  1.00 27.39 ? 72  LYS A CA  1 
ATOM   547  C C   . LYS A 1 72 ? -6.073  -14.035 9.846   1.00 26.62 ? 72  LYS A C   1 
ATOM   548  O O   . LYS A 1 72 ? -5.220  -14.450 9.045   1.00 26.95 ? 72  LYS A O   1 
ATOM   549  C CB  . LYS A 1 72 ? -6.074  -16.066 11.305  1.00 27.62 ? 72  LYS A CB  1 
ATOM   550  C CG  . LYS A 1 72 ? -5.141  -15.470 12.349  1.00 29.57 ? 72  LYS A CG  1 
ATOM   551  C CD  . LYS A 1 72 ? -4.340  -16.543 13.097  1.00 33.53 ? 72  LYS A CD  1 
ATOM   552  C CE  . LYS A 1 72 ? -3.179  -15.911 13.840  1.00 34.79 ? 72  LYS A CE  1 
ATOM   553  N NZ  . LYS A 1 72 ? -2.423  -16.901 14.684  1.00 37.47 ? 72  LYS A NZ  1 
ATOM   554  N N   . LEU A 1 73 ? -6.285  -12.749 10.107  1.00 23.68 ? 73  LEU A N   1 
ATOM   555  C CA  . LEU A 1 73 ? -5.543  -11.695 9.412   1.00 22.27 ? 73  LEU A CA  1 
ATOM   556  C C   . LEU A 1 73 ? -4.699  -10.884 10.356  1.00 21.57 ? 73  LEU A C   1 
ATOM   557  O O   . LEU A 1 73 ? -5.204  -10.041 11.095  1.00 22.31 ? 73  LEU A O   1 
ATOM   558  C CB  . LEU A 1 73 ? -6.515  -10.763 8.676   1.00 21.69 ? 73  LEU A CB  1 
ATOM   559  C CG  . LEU A 1 73 ? -5.907  -9.702  7.751   1.00 19.42 ? 73  LEU A CG  1 
ATOM   560  C CD1 . LEU A 1 73 ? -5.104  -10.403 6.658   1.00 21.00 ? 73  LEU A CD1 1 
ATOM   561  C CD2 . LEU A 1 73 ? -7.071  -8.890  7.159   1.00 18.61 ? 73  LEU A CD2 1 
ATOM   562  N N   . GLN A 1 74 ? -3.401  -11.126 10.321  1.00 21.45 ? 74  GLN A N   1 
ATOM   563  C CA  . GLN A 1 74 ? -2.481  -10.335 11.087  1.00 21.88 ? 74  GLN A CA  1 
ATOM   564  C C   . GLN A 1 74 ? -1.846  -9.257  10.213  1.00 21.72 ? 74  GLN A C   1 
ATOM   565  O O   . GLN A 1 74 ? -1.093  -9.575  9.293   1.00 21.73 ? 74  GLN A O   1 
ATOM   566  C CB  . GLN A 1 74 ? -1.377  -11.207 11.669  1.00 22.61 ? 74  GLN A CB  1 
ATOM   567  C CG  . GLN A 1 74 ? -0.358  -10.406 12.461  1.00 24.57 ? 74  GLN A CG  1 
ATOM   568  C CD  . GLN A 1 74 ? -0.903  -9.873  13.774  1.00 29.47 ? 74  GLN A CD  1 
ATOM   569  O OE1 . GLN A 1 74 ? -1.030  -8.660  13.975  1.00 30.07 ? 74  GLN A OE1 1 
ATOM   570  N NE2 . GLN A 1 74 ? -1.213  -10.777 14.678  1.00 29.05 ? 74  GLN A NE2 1 
ATOM   571  N N   . LEU A 1 75 ? -2.151  -8.006  10.535  1.00 21.25 ? 75  LEU A N   1 
ATOM   572  C CA  . LEU A 1 75 ? -1.614  -6.842  9.863   1.00 21.02 ? 75  LEU A CA  1 
ATOM   573  C C   . LEU A 1 75 ? -0.555  -6.167  10.711  1.00 21.21 ? 75  LEU A C   1 
ATOM   574  O O   . LEU A 1 75 ? -0.630  -6.141  11.959  1.00 21.22 ? 75  LEU A O   1 
ATOM   575  C CB  . LEU A 1 75 ? -2.729  -5.825  9.613   1.00 19.58 ? 75  LEU A CB  1 
ATOM   576  C CG  . LEU A 1 75 ? -3.905  -6.320  8.784   1.00 20.33 ? 75  LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 75 ? -4.990  -5.231  8.689   1.00 23.06 ? 75  LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 75 ? -3.456  -6.770  7.374   1.00 21.60 ? 75  LEU A CD2 1 
ATOM   579  N N   . VAL A 1 76 ? 0.430   -5.598  10.038  1.00 20.67 ? 76  VAL A N   1 
ATOM   580  C CA  . VAL A 1 76 ? 1.284   -4.629  10.678  1.00 21.71 ? 76  VAL A CA  1 
ATOM   581  C C   . VAL A 1 76 ? 1.098   -3.319  9.922   1.00 22.25 ? 76  VAL A C   1 
ATOM   582  O O   . VAL A 1 76 ? 1.127   -3.297  8.689   1.00 21.51 ? 76  VAL A O   1 
ATOM   583  C CB  . VAL A 1 76 ? 2.764   -5.058  10.706  1.00 21.49 ? 76  VAL A CB  1 
ATOM   584  C CG1 . VAL A 1 76 ? 3.597   -3.971  11.390  1.00 22.01 ? 76  VAL A CG1 1 
ATOM   585  C CG2 . VAL A 1 76 ? 2.905   -6.418  11.415  1.00 22.76 ? 76  VAL A CG2 1 
ATOM   586  N N   . VAL A 1 77 ? 0.926   -2.234  10.674  1.00 23.16 ? 77  VAL A N   1 
ATOM   587  C CA  . VAL A 1 77 ? 0.402   -0.988  10.144  1.00 25.05 ? 77  VAL A CA  1 
ATOM   588  C C   . VAL A 1 77 ? 1.350   0.135   10.569  1.00 25.34 ? 77  VAL A C   1 
ATOM   589  O O   . VAL A 1 77 ? 1.885   0.102   11.674  1.00 26.01 ? 77  VAL A O   1 
ATOM   590  C CB  . VAL A 1 77 ? -1.045  -0.807  10.669  1.00 25.55 ? 77  VAL A CB  1 
ATOM   591  C CG1 . VAL A 1 77 ? -1.515  0.632   10.656  1.00 27.40 ? 77  VAL A CG1 1 
ATOM   592  C CG2 . VAL A 1 77 ? -2.001  -1.701  9.845   1.00 26.99 ? 77  VAL A CG2 1 
ATOM   593  N N   . LEU A 1 78 ? 1.582   1.107   9.695   1.00 26.58 ? 78  LEU A N   1 
ATOM   594  C CA  . LEU A 1 78 ? 2.468   2.221   10.047  1.00 28.62 ? 78  LEU A CA  1 
ATOM   595  C C   . LEU A 1 78 ? 1.833   3.171   11.087  1.00 29.96 ? 78  LEU A C   1 
ATOM   596  O O   . LEU A 1 78 ? 0.724   3.679   10.897  1.00 30.89 ? 78  LEU A O   1 
ATOM   597  C CB  . LEU A 1 78 ? 2.948   2.958   8.781   1.00 28.21 ? 78  LEU A CB  1 
ATOM   598  C CG  . LEU A 1 78 ? 3.760   4.268   8.764   1.00 29.48 ? 78  LEU A CG  1 
ATOM   599  C CD1 . LEU A 1 78 ? 4.666   4.414   9.949   1.00 33.28 ? 78  LEU A CD1 1 
ATOM   600  C CD2 . LEU A 1 78 ? 4.576   4.340   7.475   1.00 29.30 ? 78  LEU A CD2 1 
ATOM   601  N N   . ARG A 1 79 ? 2.534   3.373   12.206  1.00 31.66 ? 79  ARG A N   1 
ATOM   602  C CA  . ARG A 1 79 ? 2.196   4.427   13.180  1.00 32.74 ? 79  ARG A CA  1 
ATOM   603  C C   . ARG A 1 79 ? 3.525   5.032   13.668  1.00 33.53 ? 79  ARG A C   1 
ATOM   604  O O   . ARG A 1 79 ? 4.135   4.532   14.642  1.00 34.81 ? 79  ARG A O   1 
ATOM   605  C CB  . ARG A 1 79 ? 1.363   3.871   14.349  1.00 33.40 ? 79  ARG A CB  1 
ATOM   606  C CG  . ARG A 1 79 ? -0.019  3.295   13.993  1.00 34.26 ? 79  ARG A CG  1 
ATOM   607  C CD  . ARG A 1 79 ? -1.053  4.369   13.578  1.00 34.24 ? 79  ARG A CD  1 
ATOM   608  N NE  . ARG A 1 79 ? -2.308  3.769   13.092  1.00 34.57 ? 79  ARG A NE  1 
ATOM   609  C CZ  . ARG A 1 79 ? -3.344  3.422   13.866  1.00 35.26 ? 79  ARG A CZ  1 
ATOM   610  N NH1 . ARG A 1 79 ? -3.299  3.621   15.184  1.00 33.45 ? 79  ARG A NH1 1 
ATOM   611  N NH2 . ARG A 1 79 ? -4.435  2.872   13.330  1.00 31.00 ? 79  ARG A NH2 1 
ATOM   612  N N   . ASP A 1 80 ? 3.957   6.096   12.974  1.00 33.62 ? 80  ASP A N   1 
ATOM   613  C CA  . ASP A 1 80 ? 5.355   6.593   12.944  1.00 33.20 ? 80  ASP A CA  1 
ATOM   614  C C   . ASP A 1 80 ? 5.539   7.419   11.666  1.00 33.46 ? 80  ASP A C   1 
ATOM   615  O O   . ASP A 1 80 ? 6.454   7.170   10.851  1.00 33.71 ? 80  ASP A O   1 
ATOM   616  C CB  . ASP A 1 80 ? 6.384   5.449   12.968  1.00 33.80 ? 80  ASP A CB  1 
ATOM   617  N N   . MET B 1 1  ? 4.968   1.308   14.591  1.00 33.68 ? 1   MET B N   1 
ATOM   618  C CA  . MET B 1 1  ? 4.198   0.180   13.999  1.00 33.11 ? 1   MET B CA  1 
ATOM   619  C C   . MET B 1 1  ? 3.233   -0.367  15.022  1.00 32.58 ? 1   MET B C   1 
ATOM   620  O O   . MET B 1 1  ? 3.535   -0.422  16.207  1.00 33.19 ? 1   MET B O   1 
ATOM   621  C CB  . MET B 1 1  ? 5.113   -0.958  13.576  1.00 33.18 ? 1   MET B CB  1 
ATOM   622  C CG  . MET B 1 1  ? 6.149   -0.586  12.543  1.00 34.91 ? 1   MET B CG  1 
ATOM   623  S SD  . MET B 1 1  ? 7.000   -2.042  11.989  1.00 37.25 ? 1   MET B SD  1 
ATOM   624  C CE  . MET B 1 1  ? 7.991   -2.541  13.413  1.00 34.95 ? 1   MET B CE  1 
ATOM   625  N N   . ILE B 1 2  ? 2.054   -0.752  14.577  1.00 31.18 ? 2   ILE B N   1 
ATOM   626  C CA  . ILE B 1 2  ? 1.155   -1.469  15.461  1.00 30.01 ? 2   ILE B CA  1 
ATOM   627  C C   . ILE B 1 2  ? 0.632   -2.673  14.728  1.00 28.81 ? 2   ILE B C   1 
ATOM   628  O O   . ILE B 1 2  ? 0.511   -2.656  13.486  1.00 28.21 ? 2   ILE B O   1 
ATOM   629  C CB  . ILE B 1 2  ? -0.026  -0.602  15.959  1.00 30.83 ? 2   ILE B CB  1 
ATOM   630  C CG1 . ILE B 1 2  ? -0.948  -0.203  14.798  1.00 30.64 ? 2   ILE B CG1 1 
ATOM   631  C CG2 . ILE B 1 2  ? 0.471   0.616   16.768  1.00 31.75 ? 2   ILE B CG2 1 
ATOM   632  C CD1 . ILE B 1 2  ? -2.362  0.078   15.231  1.00 34.38 ? 2   ILE B CD1 1 
ATOM   633  N N   . GLY B 1 3  ? 0.324   -3.715  15.499  1.00 26.97 ? 3   GLY B N   1 
ATOM   634  C CA  . GLY B 1 3  ? -0.249  -4.937  14.967  1.00 25.08 ? 3   GLY B CA  1 
ATOM   635  C C   . GLY B 1 3  ? -1.756  -4.942  15.140  1.00 24.49 ? 3   GLY B C   1 
ATOM   636  O O   . GLY B 1 3  ? -2.281  -4.456  16.149  1.00 24.34 ? 3   GLY B O   1 
ATOM   637  N N   . VAL B 1 4  ? -2.460  -5.456  14.140  1.00 22.81 ? 4   VAL B N   1 
ATOM   638  C CA  . VAL B 1 4  ? -3.904  -5.548  14.195  1.00 21.87 ? 4   VAL B CA  1 
ATOM   639  C C   . VAL B 1 4  ? -4.260  -6.957  13.760  1.00 22.13 ? 4   VAL B C   1 
ATOM   640  O O   . VAL B 1 4  ? -3.813  -7.429  12.717  1.00 21.99 ? 4   VAL B O   1 
ATOM   641  C CB  . VAL B 1 4  ? -4.590  -4.493  13.258  1.00 21.76 ? 4   VAL B CB  1 
ATOM   642  C CG1 . VAL B 1 4  ? -6.133  -4.730  13.191  1.00 21.88 ? 4   VAL B CG1 1 
ATOM   643  C CG2 . VAL B 1 4  ? -4.265  -3.068  13.712  1.00 20.63 ? 4   VAL B CG2 1 
ATOM   644  N N   . LEU B 1 5  ? -5.069  -7.642  14.557  1.00 21.87 ? 5   LEU B N   1 
ATOM   645  C CA  . LEU B 1 5  ? -5.451  -9.014  14.250  1.00 22.24 ? 5   LEU B CA  1 
ATOM   646  C C   . LEU B 1 5  ? -6.965  -9.113  14.110  1.00 22.68 ? 5   LEU B C   1 
ATOM   647  O O   . LEU B 1 5  ? -7.713  -8.815  15.046  1.00 23.12 ? 5   LEU B O   1 
ATOM   648  C CB  . LEU B 1 5  ? -4.935  -9.972  15.335  1.00 23.32 ? 5   LEU B CB  1 
ATOM   649  C CG  . LEU B 1 5  ? -5.373  -11.432 15.251  1.00 24.01 ? 5   LEU B CG  1 
ATOM   650  C CD1 . LEU B 1 5  ? -4.727  -12.177 14.082  1.00 23.78 ? 5   LEU B CD1 1 
ATOM   651  C CD2 . LEU B 1 5  ? -5.062  -12.143 16.593  1.00 29.24 ? 5   LEU B CD2 1 
ATOM   652  N N   . LEU B 1 6  ? -7.408  -9.535  12.938  1.00 22.26 ? 6   LEU B N   1 
ATOM   653  C CA  . LEU B 1 6  ? -8.825  -9.730  12.656  1.00 22.30 ? 6   LEU B CA  1 
ATOM   654  C C   . LEU B 1 6  ? -9.130  -11.218 12.523  1.00 23.21 ? 6   LEU B C   1 
ATOM   655  O O   . LEU B 1 6  ? -8.475  -11.932 11.774  1.00 23.00 ? 6   LEU B O   1 
ATOM   656  C CB  . LEU B 1 6  ? -9.220  -8.975  11.371  1.00 21.62 ? 6   LEU B CB  1 
ATOM   657  C CG  . LEU B 1 6  ? -8.826  -7.486  11.335  1.00 19.57 ? 6   LEU B CG  1 
ATOM   658  C CD1 . LEU B 1 6  ? -9.435  -6.840  10.089  1.00 19.72 ? 6   LEU B CD1 1 
ATOM   659  C CD2 . LEU B 1 6  ? -9.279  -6.741  12.580  1.00 19.72 ? 6   LEU B CD2 1 
ATOM   660  N N   . MET B 1 7  ? -10.178 -11.662 13.206  1.00 23.97 ? 7   MET B N   1 
ATOM   661  C CA  . MET B 1 7  ? -10.476 -13.084 13.294  1.00 25.48 ? 7   MET B CA  1 
ATOM   662  C C   . MET B 1 7  ? -11.943 -13.360 12.940  1.00 24.96 ? 7   MET B C   1 
ATOM   663  O O   . MET B 1 7  ? -12.851 -12.822 13.585  1.00 24.89 ? 7   MET B O   1 
ATOM   664  C CB  . MET B 1 7  ? -10.193 -13.550 14.729  1.00 27.03 ? 7   MET B CB  1 
ATOM   665  C CG  . MET B 1 7  ? -10.016 -15.035 14.877  1.00 31.12 ? 7   MET B CG  1 
ATOM   666  S SD  . MET B 1 7  ? -8.315  -15.528 14.572  1.00 40.55 ? 7   MET B SD  1 
ATOM   667  C CE  . MET B 1 7  ? -7.443  -14.662 15.865  1.00 37.39 ? 7   MET B CE  1 
ATOM   668  N N   . LYS B 1 8  ? -12.171 -14.204 11.946  1.00 24.78 ? 8   LYS B N   1 
ATOM   669  C CA  . LYS B 1 8  ? -13.542 -14.514 11.520  1.00 26.17 ? 8   LYS B CA  1 
ATOM   670  C C   . LYS B 1 8  ? -14.140 -15.542 12.474  1.00 27.99 ? 8   LYS B C   1 
ATOM   671  O O   . LYS B 1 8  ? -13.408 -16.246 13.164  1.00 28.21 ? 8   LYS B O   1 
ATOM   672  C CB  . LYS B 1 8  ? -13.603 -15.015 10.090  1.00 27.08 ? 8   LYS B CB  1 
ATOM   673  C CG  . LYS B 1 8  ? -13.280 -13.930 9.073   1.00 26.98 ? 8   LYS B CG  1 
ATOM   674  C CD  . LYS B 1 8  ? -13.415 -14.437 7.660   1.00 24.58 ? 8   LYS B CD  1 
ATOM   675  C CE  . LYS B 1 8  ? -13.169 -13.272 6.709   1.00 25.19 ? 8   LYS B CE  1 
ATOM   676  N NZ  . LYS B 1 8  ? -13.441 -13.577 5.288   1.00 26.46 ? 8   LYS B NZ  1 
ATOM   677  N N   . SER B 1 9  ? -15.467 -15.529 12.547  1.00 29.28 ? 9   SER B N   1 
ATOM   678  C CA  . SER B 1 9  ? -16.268 -16.563 13.223  1.00 31.00 ? 9   SER B CA  1 
ATOM   679  C C   . SER B 1 9  ? -17.687 -16.397 12.706  1.00 32.05 ? 9   SER B C   1 
ATOM   680  O O   . SER B 1 9  ? -17.982 -15.435 11.991  1.00 31.77 ? 9   SER B O   1 
ATOM   681  C CB  . SER B 1 9  ? -16.261 -16.330 14.720  1.00 30.69 ? 9   SER B CB  1 
ATOM   682  O OG  . SER B 1 9  ? -16.915 -15.112 14.992  1.00 33.89 ? 9   SER B OG  1 
ATOM   683  N N   . ARG B 1 10 ? -18.592 -17.297 13.097  1.00 32.99 ? 10  ARG B N   1 
ATOM   684  C CA  . ARG B 1 10 ? -19.984 -17.192 12.647  1.00 33.54 ? 10  ARG B CA  1 
ATOM   685  C C   . ARG B 1 10 ? -20.713 -15.899 13.102  1.00 33.47 ? 10  ARG B C   1 
ATOM   686  O O   . ARG B 1 10 ? -21.775 -15.566 12.556  1.00 34.35 ? 10  ARG B O   1 
ATOM   687  C CB  . ARG B 1 10 ? -20.757 -18.462 13.059  1.00 33.79 ? 10  ARG B CB  1 
ATOM   688  C CG  . ARG B 1 10 ? -20.172 -19.729 12.419  1.00 35.89 ? 10  ARG B CG  1 
ATOM   689  C CD  . ARG B 1 10 ? -20.987 -20.976 12.719  1.00 38.45 ? 10  ARG B CD  1 
ATOM   690  N NE  . ARG B 1 10 ? -22.419 -20.764 12.505  1.00 41.42 ? 10  ARG B NE  1 
ATOM   691  C CZ  . ARG B 1 10 ? -23.362 -21.654 12.799  1.00 42.60 ? 10  ARG B CZ  1 
ATOM   692  N NH1 . ARG B 1 10 ? -23.034 -22.832 13.329  1.00 42.56 ? 10  ARG B NH1 1 
ATOM   693  N NH2 . ARG B 1 10 ? -24.638 -21.357 12.578  1.00 42.46 ? 10  ARG B NH2 1 
ATOM   694  N N   . ALA B 1 11 ? -20.180 -15.180 14.078  1.00 33.17 ? 11  ALA B N   1 
ATOM   695  C CA  . ALA B 1 11 ? -20.687 -13.842 14.448  1.00 33.28 ? 11  ALA B CA  1 
ATOM   696  C C   . ALA B 1 11 ? -20.442 -12.783 13.369  1.00 33.51 ? 11  ALA B C   1 
ATOM   697  O O   . ALA B 1 11 ? -21.181 -11.852 13.221  1.00 33.99 ? 11  ALA B O   1 
ATOM   698  C CB  . ALA B 1 11 ? -20.083 -13.382 15.734  1.00 33.32 ? 11  ALA B CB  1 
ATOM   699  N N   . ASN B 1 12 ? -19.365 -12.965 12.627  1.00 33.10 ? 12  ASN B N   1 
ATOM   700  C CA  . ASN B 1 12 ? -18.962 -12.034 11.589  1.00 31.63 ? 12  ASN B CA  1 
ATOM   701  C C   . ASN B 1 12 ? -17.907 -12.633 10.675  1.00 31.31 ? 12  ASN B C   1 
ATOM   702  O O   . ASN B 1 12 ? -16.836 -12.894 11.088  1.00 31.66 ? 12  ASN B O   1 
ATOM   703  C CB  . ASN B 1 12 ? -18.496 -10.725 12.198  1.00 31.44 ? 12  ASN B CB  1 
ATOM   704  C CG  . ASN B 1 12 ? -18.552 -9.560  11.221  1.00 29.93 ? 12  ASN B CG  1 
ATOM   705  O OD1 . ASN B 1 12 ? -18.667 -9.733  10.020  1.00 30.88 ? 12  ASN B OD1 1 
ATOM   706  N ND2 . ASN B 1 12 ? -18.491 -8.382  11.753  1.00 27.62 ? 12  ASN B ND2 1 
ATOM   707  N N   . GLU B 1 13 ? -18.284 -12.852 9.436   1.00 30.05 ? 13  GLU B N   1 
ATOM   708  C CA  . GLU B 1 13 ? -17.442 -13.432 8.427   1.00 30.29 ? 13  GLU B CA  1 
ATOM   709  C C   . GLU B 1 13 ? -16.829 -12.373 7.488   1.00 28.41 ? 13  GLU B C   1 
ATOM   710  O O   . GLU B 1 13 ? -16.184 -12.688 6.536   1.00 30.12 ? 13  GLU B O   1 
ATOM   711  C CB  . GLU B 1 13 ? -18.263 -14.412 7.618   1.00 30.10 ? 13  GLU B CB  1 
ATOM   712  C CG  . GLU B 1 13 ? -18.604 -15.642 8.379   1.00 34.58 ? 13  GLU B CG  1 
ATOM   713  C CD  . GLU B 1 13 ? -17.544 -16.666 8.230   1.00 38.98 ? 13  GLU B CD  1 
ATOM   714  O OE1 . GLU B 1 13 ? -16.705 -16.707 9.076   1.00 39.98 ? 13  GLU B OE1 1 
ATOM   715  O OE2 . GLU B 1 13 ? -17.509 -17.373 7.224   1.00 41.89 ? 13  GLU B OE2 1 
ATOM   716  N N   . GLU B 1 14 ? -17.091 -11.121 7.755   1.00 25.93 ? 14  GLU B N   1 
ATOM   717  C CA  . GLU B 1 14 ? -16.687 -10.023 6.865   1.00 24.42 ? 14  GLU B CA  1 
ATOM   718  C C   . GLU B 1 14 ? -15.517 -9.222  7.448   1.00 21.85 ? 14  GLU B C   1 
ATOM   719  O O   . GLU B 1 14 ? -15.699 -8.560  8.449   1.00 20.46 ? 14  GLU B O   1 
ATOM   720  C CB  . GLU B 1 14 ? -17.900 -9.087  6.708   1.00 25.17 ? 14  GLU B CB  1 
ATOM   721  C CG  . GLU B 1 14 ? -17.674 -7.809  5.870   1.00 27.40 ? 14  GLU B CG  1 
ATOM   722  C CD  . GLU B 1 14 ? -18.645 -6.670  6.200   1.00 29.44 ? 14  GLU B CD  1 
ATOM   723  O OE1 . GLU B 1 14 ? -19.547 -6.827  7.059   1.00 27.87 ? 14  GLU B OE1 1 
ATOM   724  O OE2 . GLU B 1 14 ? -18.496 -5.586  5.586   1.00 29.32 ? 14  GLU B OE2 1 
ATOM   725  N N   . TYR B 1 15 ? -14.325 -9.272  6.849   1.00 20.67 ? 15  TYR B N   1 
ATOM   726  C CA  . TYR B 1 15 ? -13.274 -8.302  7.287   1.00 21.25 ? 15  TYR B CA  1 
ATOM   727  C C   . TYR B 1 15 ? -13.757 -6.864  7.098   1.00 21.16 ? 15  TYR B C   1 
ATOM   728  O O   . TYR B 1 15 ? -13.510 -6.006  7.933   1.00 21.30 ? 15  TYR B O   1 
ATOM   729  C CB  . TYR B 1 15 ? -11.928 -8.493  6.579   1.00 21.19 ? 15  TYR B CB  1 
ATOM   730  C CG  . TYR B 1 15 ? -11.159 -9.758  6.879   1.00 21.46 ? 15  TYR B CG  1 
ATOM   731  C CD1 . TYR B 1 15 ? -10.951 -10.201 8.211   1.00 23.54 ? 15  TYR B CD1 1 
ATOM   732  C CD2 . TYR B 1 15 ? -10.593 -10.499 5.840   1.00 24.21 ? 15  TYR B CD2 1 
ATOM   733  C CE1 . TYR B 1 15 ? -10.224 -11.395 8.480   1.00 20.84 ? 15  TYR B CE1 1 
ATOM   734  C CE2 . TYR B 1 15 ? -9.859  -11.699 6.095   1.00 24.35 ? 15  TYR B CE2 1 
ATOM   735  C CZ  . TYR B 1 15 ? -9.691  -12.134 7.406   1.00 24.34 ? 15  TYR B CZ  1 
ATOM   736  O OH  . TYR B 1 15 ? -8.941  -13.289 7.646   1.00 25.31 ? 15  TYR B OH  1 
ATOM   737  N N   . GLY B 1 16 ? -14.425 -6.570  5.978   1.00 21.55 ? 16  GLY B N   1 
ATOM   738  C CA  . GLY B 1 16 ? -14.963 -5.220  5.831   1.00 21.04 ? 16  GLY B CA  1 
ATOM   739  C C   . GLY B 1 16 ? -13.801 -4.243  5.645   1.00 20.41 ? 16  GLY B C   1 
ATOM   740  O O   . GLY B 1 16 ? -13.777 -3.184  6.255   1.00 19.80 ? 16  GLY B O   1 
ATOM   741  N N   . LEU B 1 17 ? -12.818 -4.682  4.858   1.00 20.51 ? 17  LEU B N   1 
ATOM   742  C CA  . LEU B 1 17 ? -11.555 -3.945  4.637   1.00 21.44 ? 17  LEU B CA  1 
ATOM   743  C C   . LEU B 1 17 ? -11.334 -3.857  3.126   1.00 22.19 ? 17  LEU B C   1 
ATOM   744  O O   . LEU B 1 17 ? -11.188 -4.896  2.467   1.00 22.84 ? 17  LEU B O   1 
ATOM   745  C CB  . LEU B 1 17 ? -10.391 -4.690  5.330   1.00 21.81 ? 17  LEU B CB  1 
ATOM   746  C CG  . LEU B 1 17 ? -8.937  -4.213  5.247   1.00 23.38 ? 17  LEU B CG  1 
ATOM   747  C CD1 . LEU B 1 17 ? -8.839  -2.803  5.800   1.00 22.57 ? 17  LEU B CD1 1 
ATOM   748  C CD2 . LEU B 1 17 ? -7.985  -5.131  6.039   1.00 24.48 ? 17  LEU B CD2 1 
ATOM   749  N N   . ARG B 1 18 ? -11.379 -2.634  2.587   1.00 20.50 ? 18  ARG B N   1 
ATOM   750  C CA  . ARG B 1 18 ? -11.084 -2.398  1.182   1.00 21.16 ? 18  ARG B CA  1 
ATOM   751  C C   . ARG B 1 18 ? -9.685  -1.774  1.101   1.00 19.56 ? 18  ARG B C   1 
ATOM   752  O O   . ARG B 1 18 ? -9.414  -0.786  1.772   1.00 19.27 ? 18  ARG B O   1 
ATOM   753  C CB  . ARG B 1 18 ? -12.131 -1.452  0.567   1.00 21.85 ? 18  ARG B CB  1 
ATOM   754  C CG  . ARG B 1 18 ? -12.006 -1.308  -0.942  1.00 27.83 ? 18  ARG B CG  1 
ATOM   755  C CD  . ARG B 1 18 ? -13.056 -0.330  -1.491  1.00 33.71 ? 18  ARG B CD  1 
ATOM   756  N NE  . ARG B 1 18 ? -12.639 0.344   -2.731  1.00 38.07 ? 18  ARG B NE  1 
ATOM   757  C CZ  . ARG B 1 18 ? -12.394 -0.275  -3.888  1.00 41.59 ? 18  ARG B CZ  1 
ATOM   758  N NH1 . ARG B 1 18 ? -12.498 -1.603  -3.978  1.00 43.30 ? 18  ARG B NH1 1 
ATOM   759  N NH2 . ARG B 1 18 ? -12.028 0.432   -4.959  1.00 42.55 ? 18  ARG B NH2 1 
ATOM   760  N N   . LEU B 1 19 ? -8.807  -2.407  0.342   1.00 19.90 ? 19  LEU B N   1 
ATOM   761  C CA  . LEU B 1 19 ? -7.456  -1.903  0.183   1.00 19.79 ? 19  LEU B CA  1 
ATOM   762  C C   . LEU B 1 19 ? -7.320  -1.117  -1.101  1.00 19.23 ? 19  LEU B C   1 
ATOM   763  O O   . LEU B 1 19 ? -8.047  -1.359  -2.057  1.00 18.66 ? 19  LEU B O   1 
ATOM   764  C CB  . LEU B 1 19 ? -6.452  -3.041  0.144   1.00 20.35 ? 19  LEU B CB  1 
ATOM   765  C CG  . LEU B 1 19 ? -6.357  -3.980  1.357   1.00 21.35 ? 19  LEU B CG  1 
ATOM   766  C CD1 . LEU B 1 19 ? -5.227  -4.947  1.090   1.00 25.35 ? 19  LEU B CD1 1 
ATOM   767  C CD2 . LEU B 1 19 ? -6.175  -3.206  2.638   1.00 22.29 ? 19  LEU B CD2 1 
ATOM   768  N N   . GLY B 1 20 ? -6.379  -0.175  -1.099  1.00 18.33 ? 20  GLY B N   1 
ATOM   769  C CA  . GLY B 1 20 ? -5.907  0.447   -2.350  1.00 17.55 ? 20  GLY B CA  1 
ATOM   770  C C   . GLY B 1 20 ? -4.397  0.434   -2.425  1.00 17.95 ? 20  GLY B C   1 
ATOM   771  O O   . GLY B 1 20 ? -3.731  0.022   -1.477  1.00 17.36 ? 20  GLY B O   1 
ATOM   772  N N   . SER B 1 21 ? -3.835  0.861   -3.575  1.00 17.90 ? 21  SER B N   1 
ATOM   773  C CA  . SER B 1 21 ? -2.405  1.164   -3.603  1.00 17.33 ? 21  SER B CA  1 
ATOM   774  C C   . SER B 1 21 ? -2.184  2.596   -4.080  1.00 17.07 ? 21  SER B C   1 
ATOM   775  O O   . SER B 1 21 ? -3.013  3.165   -4.804  1.00 15.63 ? 21  SER B O   1 
ATOM   776  C CB  . SER B 1 21 ? -1.578  0.206   -4.483  1.00 17.36 ? 21  SER B CB  1 
ATOM   777  O OG  . SER B 1 21 ? -1.882  0.308   -5.877  1.00 17.92 ? 21  SER B OG  1 
ATOM   778  N N   . GLN B 1 22 ? -1.072  3.156   -3.631  1.00 16.94 ? 22  GLN B N   1 
ATOM   779  C CA  . GLN B 1 22 ? -0.644  4.466   -4.147  1.00 16.41 ? 22  GLN B CA  1 
ATOM   780  C C   . GLN B 1 22 ? 0.814   4.408   -4.525  1.00 16.97 ? 22  GLN B C   1 
ATOM   781  O O   . GLN B 1 22 ? 1.608   3.683   -3.938  1.00 16.23 ? 22  GLN B O   1 
ATOM   782  C CB  . GLN B 1 22 ? -0.934  5.599   -3.161  1.00 17.73 ? 22  GLN B CB  1 
ATOM   783  C CG  . GLN B 1 22 ? -0.174  5.507   -1.853  1.00 20.42 ? 22  GLN B CG  1 
ATOM   784  C CD  . GLN B 1 22 ? -0.838  6.321   -0.728  1.00 23.80 ? 22  GLN B CD  1 
ATOM   785  O OE1 . GLN B 1 22 ? -1.902  6.905   -0.899  1.00 28.43 ? 22  GLN B OE1 1 
ATOM   786  N NE2 . GLN B 1 22 ? -0.189  6.359   0.416   1.00 27.29 ? 22  GLN B NE2 1 
ATOM   787  N N   . ILE B 1 23 ? 1.145   5.197   -5.537  1.00 15.92 ? 23  ILE B N   1 
ATOM   788  C CA  . ILE B 1 23 ? 2.514   5.350   -6.001  1.00 16.32 ? 23  ILE B CA  1 
ATOM   789  C C   . ILE B 1 23 ? 3.100   6.569   -5.298  1.00 16.39 ? 23  ILE B C   1 
ATOM   790  O O   . ILE B 1 23 ? 2.432   7.602   -5.208  1.00 16.18 ? 23  ILE B O   1 
ATOM   791  C CB  . ILE B 1 23 ? 2.532   5.620   -7.541  1.00 16.31 ? 23  ILE B CB  1 
ATOM   792  C CG1 . ILE B 1 23 ? 1.874   4.477   -8.354  1.00 18.43 ? 23  ILE B CG1 1 
ATOM   793  C CG2 . ILE B 1 23 ? 3.964   5.938   -7.985  1.00 17.00 ? 23  ILE B CG2 1 
ATOM   794  C CD1 . ILE B 1 23 ? 2.507   3.094   -8.162  1.00 20.52 ? 23  ILE B CD1 1 
ATOM   795  N N   . PHE B 1 24 ? 4.328   6.440   -4.799  1.00 16.20 ? 24  PHE B N   1 
ATOM   796  C CA  . PHE B 1 24 ? 4.963   7.542   -4.087  1.00 17.03 ? 24  PHE B CA  1 
ATOM   797  C C   . PHE B 1 24 ? 6.428   7.736   -4.477  1.00 16.80 ? 24  PHE B C   1 
ATOM   798  O O   . PHE B 1 24 ? 7.041   6.859   -5.072  1.00 16.93 ? 24  PHE B O   1 
ATOM   799  C CB  . PHE B 1 24 ? 4.789   7.369   -2.577  1.00 16.43 ? 24  PHE B CB  1 
ATOM   800  C CG  . PHE B 1 24 ? 5.660   6.297   -1.981  1.00 16.75 ? 24  PHE B CG  1 
ATOM   801  C CD1 . PHE B 1 24 ? 5.277   4.938   -2.026  1.00 19.10 ? 24  PHE B CD1 1 
ATOM   802  C CD2 . PHE B 1 24 ? 6.862   6.641   -1.372  1.00 17.78 ? 24  PHE B CD2 1 
ATOM   803  C CE1 . PHE B 1 24 ? 6.105   3.944   -1.458  1.00 19.61 ? 24  PHE B CE1 1 
ATOM   804  C CE2 . PHE B 1 24 ? 7.697   5.656   -0.804  1.00 18.85 ? 24  PHE B CE2 1 
ATOM   805  C CZ  . PHE B 1 24 ? 7.321   4.318   -0.870  1.00 17.70 ? 24  PHE B CZ  1 
ATOM   806  N N   . VAL B 1 25 ? 6.963   8.900   -4.135  1.00 16.60 ? 25  VAL B N   1 
ATOM   807  C CA  . VAL B 1 25 ? 8.357   9.238   -4.424  1.00 17.47 ? 25  VAL B CA  1 
ATOM   808  C C   . VAL B 1 25 ? 9.248   8.579   -3.367  1.00 17.61 ? 25  VAL B C   1 
ATOM   809  O O   . VAL B 1 25 ? 9.301   9.037   -2.228  1.00 18.19 ? 25  VAL B O   1 
ATOM   810  C CB  . VAL B 1 25 ? 8.571   10.772  -4.449  1.00 18.04 ? 25  VAL B CB  1 
ATOM   811  C CG1 . VAL B 1 25 ? 10.030  11.094  -4.662  1.00 18.71 ? 25  VAL B CG1 1 
ATOM   812  C CG2 . VAL B 1 25 ? 7.721   11.402  -5.561  1.00 17.45 ? 25  VAL B CG2 1 
ATOM   813  N N   . LYS B 1 26 ? 9.921   7.508   -3.767  1.00 18.10 ? 26  LYS B N   1 
ATOM   814  C CA  . LYS B 1 26 ? 10.814  6.788   -2.839  1.00 19.35 ? 26  LYS B CA  1 
ATOM   815  C C   . LYS B 1 26 ? 12.096  7.577   -2.654  1.00 20.81 ? 26  LYS B C   1 
ATOM   816  O O   . LYS B 1 26 ? 12.508  7.843   -1.524  1.00 20.87 ? 26  LYS B O   1 
ATOM   817  C CB  . LYS B 1 26 ? 11.089  5.381   -3.344  1.00 19.83 ? 26  LYS B CB  1 
ATOM   818  C CG  . LYS B 1 26 ? 11.967  4.531   -2.436  1.00 20.51 ? 26  LYS B CG  1 
ATOM   819  C CD  . LYS B 1 26 ? 11.224  4.058   -1.211  1.00 23.49 ? 26  LYS B CD  1 
ATOM   820  C CE  . LYS B 1 26 ? 12.130  3.115   -0.350  1.00 22.91 ? 26  LYS B CE  1 
ATOM   821  N NZ  . LYS B 1 26 ? 11.429  2.879   0.936   1.00 25.49 ? 26  LYS B NZ  1 
ATOM   822  N N   . GLU B 1 27 ? 12.717  7.985   -3.759  1.00 21.09 ? 27  GLU B N   1 
ATOM   823  C CA  . GLU B 1 27 ? 13.990  8.699   -3.670  1.00 22.18 ? 27  GLU B CA  1 
ATOM   824  C C   . GLU B 1 27 ? 14.131  9.614   -4.875  1.00 22.21 ? 27  GLU B C   1 
ATOM   825  O O   . GLU B 1 27 ? 13.640  9.288   -5.963  1.00 21.60 ? 27  GLU B O   1 
ATOM   826  C CB  . GLU B 1 27 ? 15.171  7.717   -3.690  1.00 22.27 ? 27  GLU B CB  1 
ATOM   827  C CG  . GLU B 1 27 ? 16.523  8.437   -3.633  1.00 25.94 ? 27  GLU B CG  1 
ATOM   828  C CD  . GLU B 1 27 ? 17.716  7.565   -4.006  1.00 28.72 ? 27  GLU B CD  1 
ATOM   829  O OE1 . GLU B 1 27 ? 17.534  6.367   -4.354  1.00 29.55 ? 27  GLU B OE1 1 
ATOM   830  O OE2 . GLU B 1 27 ? 18.837  8.119   -3.946  1.00 31.91 ? 27  GLU B OE2 1 
ATOM   831  N N   . MET B 1 28 ? 14.813  10.738  -4.654  1.00 22.89 ? 28  MET B N   1 
ATOM   832  C CA  . MET B 1 28 ? 15.265  11.591  -5.760  1.00 24.27 ? 28  MET B CA  1 
ATOM   833  C C   . MET B 1 28 ? 16.786  11.652  -5.685  1.00 24.43 ? 28  MET B C   1 
ATOM   834  O O   . MET B 1 28 ? 17.359  11.965  -4.613  1.00 25.42 ? 28  MET B O   1 
ATOM   835  C CB  . MET B 1 28 ? 14.666  12.986  -5.616  1.00 24.23 ? 28  MET B CB  1 
ATOM   836  C CG  . MET B 1 28 ? 13.138  13.024  -5.762  1.00 26.28 ? 28  MET B CG  1 
ATOM   837  S SD  . MET B 1 28 ? 12.445  14.653  -5.443  1.00 28.74 ? 28  MET B SD  1 
ATOM   838  C CE  . MET B 1 28 ? 13.126  15.054  -3.824  1.00 29.27 ? 28  MET B CE  1 
ATOM   839  N N   . THR B 1 29 ? 17.462  11.340  -6.786  1.00 23.81 ? 29  THR B N   1 
ATOM   840  C CA  . THR B 1 29 ? 18.923  11.330  -6.760  1.00 24.58 ? 29  THR B CA  1 
ATOM   841  C C   . THR B 1 29 ? 19.456  12.767  -6.702  1.00 24.29 ? 29  THR B C   1 
ATOM   842  O O   . THR B 1 29 ? 18.765  13.735  -7.079  1.00 22.00 ? 29  THR B O   1 
ATOM   843  C CB  . THR B 1 29 ? 19.523  10.595  -7.979  1.00 24.95 ? 29  THR B CB  1 
ATOM   844  O OG1 . THR B 1 29 ? 19.221  11.350  -9.172  1.00 24.21 ? 29  THR B OG1 1 
ATOM   845  C CG2 . THR B 1 29 ? 18.979  9.181   -8.110  1.00 27.54 ? 29  THR B CG2 1 
ATOM   846  N N   . ARG B 1 30 ? 20.669  12.925  -6.185  1.00 23.53 ? 30  ARG B N   1 
ATOM   847  C CA  . ARG B 1 30 ? 21.259  14.251  -6.053  1.00 24.51 ? 30  ARG B CA  1 
ATOM   848  C C   . ARG B 1 30 ? 21.441  14.928  -7.421  1.00 23.98 ? 30  ARG B C   1 
ATOM   849  O O   . ARG B 1 30 ? 21.350  16.144  -7.512  1.00 23.73 ? 30  ARG B O   1 
ATOM   850  C CB  . ARG B 1 30 ? 22.600  14.179  -5.329  1.00 24.97 ? 30  ARG B CB  1 
ATOM   851  C CG  . ARG B 1 30 ? 22.468  13.980  -3.813  1.00 27.95 ? 30  ARG B CG  1 
ATOM   852  C CD  . ARG B 1 30 ? 23.652  14.654  -3.116  1.00 35.99 ? 30  ARG B CD  1 
ATOM   853  N NE  . ARG B 1 30 ? 23.698  14.469  -1.663  1.00 35.85 ? 30  ARG B NE  1 
ATOM   854  C CZ  . ARG B 1 30 ? 23.833  13.299  -1.052  1.00 37.73 ? 30  ARG B CZ  1 
ATOM   855  N NH1 . ARG B 1 30 ? 23.911  12.173  -1.756  1.00 35.93 ? 30  ARG B NH1 1 
ATOM   856  N NH2 . ARG B 1 30 ? 23.888  13.253  0.276   1.00 38.78 ? 30  ARG B NH2 1 
ATOM   857  N N   . THR B 1 31 ? 21.644  14.111  -8.454  1.00 23.44 ? 31  THR B N   1 
ATOM   858  C CA  . THR B 1 31 ? 22.068  14.590  -9.792  1.00 23.97 ? 31  THR B CA  1 
ATOM   859  C C   . THR B 1 31 ? 20.906  14.715  -10.809 1.00 23.29 ? 31  THR B C   1 
ATOM   860  O O   . THR B 1 31 ? 21.081  15.251  -11.921 1.00 22.46 ? 31  THR B O   1 
ATOM   861  C CB  . THR B 1 31 ? 23.141  13.659  -10.403 1.00 24.48 ? 31  THR B CB  1 
ATOM   862  O OG1 . THR B 1 31 ? 22.675  12.302  -10.384 1.00 24.39 ? 31  THR B OG1 1 
ATOM   863  C CG2 . THR B 1 31 ? 24.467  13.765  -9.623  1.00 24.97 ? 31  THR B CG2 1 
ATOM   864  N N   . GLY B 1 32 ? 19.739  14.190  -10.439 1.00 21.08 ? 32  GLY B N   1 
ATOM   865  C CA  . GLY B 1 32 ? 18.619  14.102  -11.356 1.00 21.17 ? 32  GLY B CA  1 
ATOM   866  C C   . GLY B 1 32 ? 17.807  15.360  -11.546 1.00 19.98 ? 32  GLY B C   1 
ATOM   867  O O   . GLY B 1 32 ? 17.907  16.318  -10.786 1.00 19.98 ? 32  GLY B O   1 
ATOM   868  N N   . LEU B 1 33 ? 16.977  15.352  -12.580 1.00 21.03 ? 33  LEU B N   1 
ATOM   869  C CA  . LEU B 1 33 ? 16.082  16.494  -12.849 1.00 20.03 ? 33  LEU B CA  1 
ATOM   870  C C   . LEU B 1 33 ? 15.054  16.732  -11.759 1.00 20.36 ? 33  LEU B C   1 
ATOM   871  O O   . LEU B 1 33 ? 14.663  17.859  -11.510 1.00 20.51 ? 33  LEU B O   1 
ATOM   872  C CB  . LEU B 1 33 ? 15.366  16.292  -14.189 1.00 21.24 ? 33  LEU B CB  1 
ATOM   873  C CG  . LEU B 1 33 ? 16.245  16.285  -15.440 1.00 22.98 ? 33  LEU B CG  1 
ATOM   874  C CD1 . LEU B 1 33 ? 15.455  15.786  -16.601 1.00 23.04 ? 33  LEU B CD1 1 
ATOM   875  C CD2 . LEU B 1 33 ? 16.771  17.713  -15.710 1.00 23.90 ? 33  LEU B CD2 1 
ATOM   876  N N   . ALA B 1 34 ? 14.580  15.666  -11.111 1.00 19.88 ? 34  ALA B N   1 
ATOM   877  C CA  . ALA B 1 34 ? 13.648  15.836  -9.994  1.00 19.56 ? 34  ALA B CA  1 
ATOM   878  C C   . ALA B 1 34 ? 14.228  16.747  -8.916  1.00 19.95 ? 34  ALA B C   1 
ATOM   879  O O   . ALA B 1 34 ? 13.595  17.691  -8.474  1.00 20.60 ? 34  ALA B O   1 
ATOM   880  C CB  . ALA B 1 34 ? 13.270  14.461  -9.392  1.00 18.20 ? 34  ALA B CB  1 
ATOM   881  N N   . THR B 1 35 ? 15.451  16.464  -8.488  1.00 20.08 ? 35  THR B N   1 
ATOM   882  C CA  . THR B 1 35 ? 16.101  17.306  -7.501  1.00 21.49 ? 35  THR B CA  1 
ATOM   883  C C   . THR B 1 35 ? 16.336  18.737  -8.038  1.00 21.65 ? 35  THR B C   1 
ATOM   884  O O   . THR B 1 35 ? 16.010  19.711  -7.375  1.00 22.07 ? 35  THR B O   1 
ATOM   885  C CB  . THR B 1 35 ? 17.437  16.679  -7.015  1.00 21.70 ? 35  THR B CB  1 
ATOM   886  O OG1 . THR B 1 35 ? 17.160  15.506  -6.226  1.00 23.20 ? 35  THR B OG1 1 
ATOM   887  C CG2 . THR B 1 35 ? 18.223  17.694  -6.192  1.00 23.34 ? 35  THR B CG2 1 
ATOM   888  N N   . LYS B 1 36 ? 16.903  18.847  -9.235  1.00 22.16 ? 36  LYS B N   1 
ATOM   889  C CA  . LYS B 1 36 ? 17.224  20.166  -9.842  1.00 22.81 ? 36  LYS B CA  1 
ATOM   890  C C   . LYS B 1 36 ? 15.949  21.029  -9.961  1.00 23.54 ? 36  LYS B C   1 
ATOM   891  O O   . LYS B 1 36 ? 15.977  22.231  -9.667  1.00 23.83 ? 36  LYS B O   1 
ATOM   892  C CB  . LYS B 1 36 ? 17.915  19.948  -11.197 1.00 22.84 ? 36  LYS B CB  1 
ATOM   893  C CG  . LYS B 1 36 ? 18.205  21.209  -12.070 1.00 23.10 ? 36  LYS B CG  1 
ATOM   894  C CD  . LYS B 1 36 ? 18.522  20.720  -13.494 1.00 27.50 ? 36  LYS B CD  1 
ATOM   895  C CE  . LYS B 1 36 ? 18.458  21.799  -14.577 1.00 31.46 ? 36  LYS B CE  1 
ATOM   896  N NZ  . LYS B 1 36 ? 18.628  21.212  -15.983 1.00 33.92 ? 36  LYS B NZ  1 
ATOM   897  N N   . ASP B 1 37 ? 14.820  20.411  -10.321 1.00 22.95 ? 37  ASP B N   1 
ATOM   898  C CA  . ASP B 1 37 ? 13.563  21.172  -10.448 1.00 22.88 ? 37  ASP B CA  1 
ATOM   899  C C   . ASP B 1 37 ? 13.050  21.716  -9.095  1.00 23.08 ? 37  ASP B C   1 
ATOM   900  O O   . ASP B 1 37 ? 12.473  22.814  -9.019  1.00 23.51 ? 37  ASP B O   1 
ATOM   901  C CB  . ASP B 1 37 ? 12.492  20.329  -11.133 1.00 22.42 ? 37  ASP B CB  1 
ATOM   902  C CG  . ASP B 1 37 ? 11.117  20.961  -11.051 1.00 23.70 ? 37  ASP B CG  1 
ATOM   903  O OD1 . ASP B 1 37 ? 10.828  21.832  -11.884 1.00 21.92 ? 37  ASP B OD1 1 
ATOM   904  O OD2 . ASP B 1 37 ? 10.338  20.611  -10.151 1.00 23.52 ? 37  ASP B OD2 1 
ATOM   905  N N   . GLY B 1 38 ? 13.230  20.916  -8.046  1.00 22.74 ? 38  GLY B N   1 
ATOM   906  C CA  . GLY B 1 38 ? 13.077  21.380  -6.685  1.00 23.58 ? 38  GLY B CA  1 
ATOM   907  C C   . GLY B 1 38 ? 11.673  21.378  -6.131  1.00 24.60 ? 38  GLY B C   1 
ATOM   908  O O   . GLY B 1 38 ? 11.471  21.736  -4.955  1.00 25.19 ? 38  GLY B O   1 
ATOM   909  N N   . ASN B 1 39 ? 10.700  20.973  -6.954  1.00 24.08 ? 39  ASN B N   1 
ATOM   910  C CA  . ASN B 1 39 ? 9.302   21.008  -6.530  1.00 25.22 ? 39  ASN B CA  1 
ATOM   911  C C   . ASN B 1 39 ? 8.842   19.735  -5.832  1.00 25.41 ? 39  ASN B C   1 
ATOM   912  O O   . ASN B 1 39 ? 8.103   19.808  -4.841  1.00 25.28 ? 39  ASN B O   1 
ATOM   913  C CB  . ASN B 1 39 ? 8.366   21.379  -7.679  1.00 24.78 ? 39  ASN B CB  1 
ATOM   914  C CG  . ASN B 1 39 ? 8.597   22.804  -8.179  1.00 26.50 ? 39  ASN B CG  1 
ATOM   915  O OD1 . ASN B 1 39 ? 9.099   23.022  -9.292  1.00 27.91 ? 39  ASN B OD1 1 
ATOM   916  N ND2 . ASN B 1 39 ? 8.253   23.785  -7.345  1.00 25.70 ? 39  ASN B ND2 1 
ATOM   917  N N   . LEU B 1 40 ? 9.297   18.592  -6.344  1.00 24.59 ? 40  LEU B N   1 
ATOM   918  C CA  . LEU B 1 40 ? 8.982   17.270  -5.754  1.00 25.24 ? 40  LEU B CA  1 
ATOM   919  C C   . LEU B 1 40 ? 9.652   17.033  -4.411  1.00 25.03 ? 40  LEU B C   1 
ATOM   920  O O   . LEU B 1 40 ? 10.784  17.469  -4.206  1.00 25.22 ? 40  LEU B O   1 
ATOM   921  C CB  . LEU B 1 40 ? 9.451   16.176  -6.707  1.00 25.51 ? 40  LEU B CB  1 
ATOM   922  C CG  . LEU B 1 40 ? 8.488   15.564  -7.694  1.00 27.61 ? 40  LEU B CG  1 
ATOM   923  C CD1 . LEU B 1 40 ? 9.209   14.316  -8.333  1.00 28.50 ? 40  LEU B CD1 1 
ATOM   924  C CD2 . LEU B 1 40 ? 7.195   15.156  -7.023  1.00 21.42 ? 40  LEU B CD2 1 
ATOM   925  N N   . HIS B 1 41 ? 8.962   16.341  -3.498  1.00 24.56 ? 41  HIS B N   1 
ATOM   926  C CA  . HIS B 1 41 ? 9.541   15.920  -2.223  1.00 25.45 ? 41  HIS B CA  1 
ATOM   927  C C   . HIS B 1 41 ? 9.540   14.400  -2.069  1.00 24.97 ? 41  HIS B C   1 
ATOM   928  O O   . HIS B 1 41 ? 8.595   13.727  -2.525  1.00 23.60 ? 41  HIS B O   1 
ATOM   929  C CB  . HIS B 1 41 ? 8.745   16.494  -1.049  1.00 26.80 ? 41  HIS B CB  1 
ATOM   930  C CG  . HIS B 1 41 ? 8.589   17.981  -1.080  1.00 30.99 ? 41  HIS B CG  1 
ATOM   931  N ND1 . HIS B 1 41 ? 7.510   18.623  -0.508  1.00 34.99 ? 41  HIS B ND1 1 
ATOM   932  C CD2 . HIS B 1 41 ? 9.373   18.954  -1.604  1.00 34.18 ? 41  HIS B CD2 1 
ATOM   933  C CE1 . HIS B 1 41 ? 7.640   19.928  -0.671  1.00 36.14 ? 41  HIS B CE1 1 
ATOM   934  N NE2 . HIS B 1 41 ? 8.763   20.155  -1.332  1.00 36.62 ? 41  HIS B NE2 1 
ATOM   935  N N   . GLU B 1 42 ? 10.565  13.859  -1.409  1.00 23.72 ? 42  GLU B N   1 
ATOM   936  C CA  . GLU B 1 42 ? 10.542  12.440  -1.097  1.00 25.26 ? 42  GLU B CA  1 
ATOM   937  C C   . GLU B 1 42 ? 9.281   12.190  -0.250  1.00 23.74 ? 42  GLU B C   1 
ATOM   938  O O   . GLU B 1 42 ? 8.902   13.027  0.586   1.00 23.50 ? 42  GLU B O   1 
ATOM   939  C CB  . GLU B 1 42 ? 11.869  11.953  -0.441  1.00 26.06 ? 42  GLU B CB  1 
ATOM   940  C CG  . GLU B 1 42 ? 13.050  11.887  -1.486  1.00 29.66 ? 42  GLU B CG  1 
ATOM   941  C CD  . GLU B 1 42 ? 14.393  11.299  -0.974  1.00 33.43 ? 42  GLU B CD  1 
ATOM   942  O OE1 . GLU B 1 42 ? 14.450  10.792  0.182   1.00 33.35 ? 42  GLU B OE1 1 
ATOM   943  O OE2 . GLU B 1 42 ? 15.392  11.329  -1.762  1.00 29.23 ? 42  GLU B OE2 1 
ATOM   944  N N   . GLY B 1 43 ? 8.607   11.074  -0.520  1.00 23.06 ? 43  GLY B N   1 
ATOM   945  C CA  . GLY B 1 43 ? 7.367   10.738  0.163   1.00 22.20 ? 43  GLY B CA  1 
ATOM   946  C C   . GLY B 1 43 ? 6.116   11.324  -0.484  1.00 22.30 ? 43  GLY B C   1 
ATOM   947  O O   . GLY B 1 43 ? 5.006   10.963  -0.097  1.00 22.46 ? 43  GLY B O   1 
ATOM   948  N N   . ASP B 1 44 ? 6.274   12.218  -1.462  1.00 21.29 ? 44  ASP B N   1 
ATOM   949  C CA  . ASP B 1 44 ? 5.092   12.743  -2.201  1.00 20.64 ? 44  ASP B CA  1 
ATOM   950  C C   . ASP B 1 44 ? 4.309   11.606  -2.837  1.00 19.96 ? 44  ASP B C   1 
ATOM   951  O O   . ASP B 1 44 ? 4.897   10.683  -3.371  1.00 19.31 ? 44  ASP B O   1 
ATOM   952  C CB  . ASP B 1 44 ? 5.486   13.726  -3.302  1.00 20.63 ? 44  ASP B CB  1 
ATOM   953  C CG  . ASP B 1 44 ? 5.658   15.153  -2.792  1.00 21.25 ? 44  ASP B CG  1 
ATOM   954  O OD1 . ASP B 1 44 ? 5.192   15.470  -1.693  1.00 23.76 ? 44  ASP B OD1 1 
ATOM   955  O OD2 . ASP B 1 44 ? 6.246   15.960  -3.525  1.00 22.82 ? 44  ASP B OD2 1 
ATOM   956  N N   . ILE B 1 45 ? 2.984   11.697  -2.787  1.00 19.92 ? 45  ILE B N   1 
ATOM   957  C CA  . ILE B 1 45 ? 2.113   10.750  -3.472  1.00 20.21 ? 45  ILE B CA  1 
ATOM   958  C C   . ILE B 1 45 ? 1.816   11.245  -4.859  1.00 20.19 ? 45  ILE B C   1 
ATOM   959  O O   . ILE B 1 45 ? 1.339   12.389  -5.025  1.00 20.32 ? 45  ILE B O   1 
ATOM   960  C CB  . ILE B 1 45 ? 0.747   10.547  -2.750  1.00 19.82 ? 45  ILE B CB  1 
ATOM   961  C CG1 . ILE B 1 45 ? 0.959   10.197  -1.275  1.00 21.78 ? 45  ILE B CG1 1 
ATOM   962  C CG2 . ILE B 1 45 ? -0.088  9.486   -3.493  1.00 20.42 ? 45  ILE B CG2 1 
ATOM   963  C CD1 . ILE B 1 45 ? 1.655   8.869   -1.065  1.00 22.39 ? 45  ILE B CD1 1 
ATOM   964  N N   . ILE B 1 46 ? 2.152   10.413  -5.848  1.00 19.19 ? 46  ILE B N   1 
ATOM   965  C CA  . ILE B 1 46 ? 1.946   10.748  -7.237  1.00 19.73 ? 46  ILE B CA  1 
ATOM   966  C C   . ILE B 1 46 ? 0.492   10.400  -7.538  1.00 20.70 ? 46  ILE B C   1 
ATOM   967  O O   . ILE B 1 46 ? 0.069   9.249   -7.362  1.00 22.43 ? 46  ILE B O   1 
ATOM   968  C CB  . ILE B 1 46 ? 2.880   9.935   -8.191  1.00 19.39 ? 46  ILE B CB  1 
ATOM   969  C CG1 . ILE B 1 46 ? 4.389   10.126  -7.875  1.00 19.53 ? 46  ILE B CG1 1 
ATOM   970  C CG2 . ILE B 1 46 ? 2.531   10.217  -9.679  1.00 21.29 ? 46  ILE B CG2 1 
ATOM   971  C CD1 . ILE B 1 46 ? 4.885   11.531  -7.899  1.00 22.67 ? 46  ILE B CD1 1 
ATOM   972  N N   . LEU B 1 47 ? -0.256  11.377  -8.028  1.00 19.06 ? 47  LEU B N   1 
ATOM   973  C CA  . LEU B 1 47 ? -1.660  11.160  -8.409  1.00 20.25 ? 47  LEU B CA  1 
ATOM   974  C C   . LEU B 1 47 ? -1.863  10.804  -9.871  1.00 20.06 ? 47  LEU B C   1 
ATOM   975  O O   . LEU B 1 47 ? -2.752  10.010  -10.209 1.00 20.35 ? 47  LEU B O   1 
ATOM   976  C CB  . LEU B 1 47 ? -2.498  12.390  -8.036  1.00 19.92 ? 47  LEU B CB  1 
ATOM   977  C CG  . LEU B 1 47 ? -2.577  12.651  -6.535  1.00 22.25 ? 47  LEU B CG  1 
ATOM   978  C CD1 . LEU B 1 47 ? -3.285  13.987  -6.289  1.00 24.16 ? 47  LEU B CD1 1 
ATOM   979  C CD2 . LEU B 1 47 ? -3.282  11.462  -5.786  1.00 23.18 ? 47  LEU B CD2 1 
ATOM   980  N N   . LYS B 1 48 ? -1.065  11.423  -10.743 1.00 19.71 ? 48  LYS B N   1 
ATOM   981  C CA  . LYS B 1 48 ? -1.112  11.183  -12.175 1.00 20.25 ? 48  LYS B CA  1 
ATOM   982  C C   . LYS B 1 48 ? 0.266   11.260  -12.812 1.00 20.81 ? 48  LYS B C   1 
ATOM   983  O O   . LYS B 1 48 ? 1.126   12.028  -12.383 1.00 19.47 ? 48  LYS B O   1 
ATOM   984  C CB  . LYS B 1 48 ? -2.031  12.207  -12.886 1.00 21.67 ? 48  LYS B CB  1 
ATOM   985  C CG  . LYS B 1 48 ? -3.442  12.276  -12.348 1.00 24.75 ? 48  LYS B CG  1 
ATOM   986  C CD  . LYS B 1 48 ? -4.240  13.456  -12.957 1.00 28.16 ? 48  LYS B CD  1 
ATOM   987  C CE  . LYS B 1 48 ? -4.437  13.305  -14.432 1.00 30.73 ? 48  LYS B CE  1 
ATOM   988  N NZ  . LYS B 1 48 ? -5.322  14.423  -14.949 1.00 33.37 ? 48  LYS B NZ  1 
ATOM   989  N N   . ILE B 1 49 ? 0.467   10.444  -13.834 1.00 20.81 ? 49  ILE B N   1 
ATOM   990  C CA  . ILE B 1 49 ? 1.677   10.510  -14.634 1.00 22.26 ? 49  ILE B CA  1 
ATOM   991  C C   . ILE B 1 49 ? 1.251   10.699  -16.072 1.00 23.31 ? 49  ILE B C   1 
ATOM   992  O O   . ILE B 1 49 ? 0.669   9.788   -16.675 1.00 23.00 ? 49  ILE B O   1 
ATOM   993  C CB  . ILE B 1 49 ? 2.542   9.228   -14.529 1.00 22.29 ? 49  ILE B CB  1 
ATOM   994  C CG1 . ILE B 1 49 ? 2.988   8.988   -13.091 1.00 22.36 ? 49  ILE B CG1 1 
ATOM   995  C CG2 . ILE B 1 49 ? 3.745   9.339   -15.484 1.00 22.36 ? 49  ILE B CG2 1 
ATOM   996  C CD1 . ILE B 1 49 ? 3.589   7.609   -12.822 1.00 24.56 ? 49  ILE B CD1 1 
ATOM   997  N N   . ASN B 1 50 ? 1.553   11.878  -16.618 1.00 23.79 ? 50  ASN B N   1 
ATOM   998  C CA  . ASN B 1 50 ? 1.249   12.185  -18.023 1.00 25.88 ? 50  ASN B CA  1 
ATOM   999  C C   . ASN B 1 50 ? -0.213  11.926  -18.382 1.00 25.99 ? 50  ASN B C   1 
ATOM   1000 O O   . ASN B 1 50 ? -0.520  11.392  -19.442 1.00 26.40 ? 50  ASN B O   1 
ATOM   1001 C CB  . ASN B 1 50 ? 2.215   11.440  -18.954 1.00 26.14 ? 50  ASN B CB  1 
ATOM   1002 C CG  . ASN B 1 50 ? 3.561   12.142  -19.072 1.00 26.93 ? 50  ASN B CG  1 
ATOM   1003 O OD1 . ASN B 1 50 ? 4.548   11.565  -19.515 1.00 33.36 ? 50  ASN B OD1 1 
ATOM   1004 N ND2 . ASN B 1 50 ? 3.590   13.401  -18.698 1.00 27.93 ? 50  ASN B ND2 1 
ATOM   1005 N N   . GLY B 1 51 ? -1.097  12.300  -17.470 1.00 26.85 ? 51  GLY B N   1 
ATOM   1006 C CA  . GLY B 1 51 ? -2.525  12.266  -17.706 1.00 27.09 ? 51  GLY B CA  1 
ATOM   1007 C C   . GLY B 1 51 ? -3.226  11.056  -17.110 1.00 26.70 ? 51  GLY B C   1 
ATOM   1008 O O   . GLY B 1 51 ? -4.454  11.096  -16.901 1.00 27.69 ? 51  GLY B O   1 
ATOM   1009 N N   . THR B 1 52 ? -2.452  10.015  -16.802 1.00 25.63 ? 52  THR B N   1 
ATOM   1010 C CA  . THR B 1 52 ? -2.999  8.710   -16.342 1.00 24.31 ? 52  THR B CA  1 
ATOM   1011 C C   . THR B 1 52 ? -3.001  8.635   -14.816 1.00 24.00 ? 52  THR B C   1 
ATOM   1012 O O   . THR B 1 52 ? -1.974  8.795   -14.196 1.00 22.77 ? 52  THR B O   1 
ATOM   1013 C CB  . THR B 1 52 ? -2.176  7.513   -16.861 1.00 24.52 ? 52  THR B CB  1 
ATOM   1014 O OG1 . THR B 1 52 ? -2.213  7.478   -18.286 1.00 24.97 ? 52  THR B OG1 1 
ATOM   1015 C CG2 . THR B 1 52 ? -2.760  6.193   -16.341 1.00 23.80 ? 52  THR B CG2 1 
ATOM   1016 N N   . VAL B 1 53 ? -4.163  8.352   -14.246 1.00 23.57 ? 53  VAL B N   1 
ATOM   1017 C CA  . VAL B 1 53 ? -4.351  8.238   -12.803 1.00 23.96 ? 53  VAL B CA  1 
ATOM   1018 C C   . VAL B 1 53 ? -3.574  7.017   -12.297 1.00 23.55 ? 53  VAL B C   1 
ATOM   1019 O O   . VAL B 1 53 ? -3.642  5.927   -12.906 1.00 23.09 ? 53  VAL B O   1 
ATOM   1020 C CB  . VAL B 1 53 ? -5.876  8.065   -12.513 1.00 24.93 ? 53  VAL B CB  1 
ATOM   1021 C CG1 . VAL B 1 53 ? -6.126  7.511   -11.116 1.00 26.48 ? 53  VAL B CG1 1 
ATOM   1022 C CG2 . VAL B 1 53 ? -6.626  9.384   -12.744 1.00 25.74 ? 53  VAL B CG2 1 
ATOM   1023 N N   . THR B 1 54 ? -2.871  7.180   -11.181 1.00 21.49 ? 54  THR B N   1 
ATOM   1024 C CA  . THR B 1 54 ? -2.044  6.086   -10.650 1.00 22.52 ? 54  THR B CA  1 
ATOM   1025 C C   . THR B 1 54 ? -2.635  5.334   -9.438  1.00 21.84 ? 54  THR B C   1 
ATOM   1026 O O   . THR B 1 54 ? -2.066  4.308   -9.017  1.00 21.43 ? 54  THR B O   1 
ATOM   1027 C CB  . THR B 1 54 ? -0.604  6.537   -10.345 1.00 22.66 ? 54  THR B CB  1 
ATOM   1028 O OG1 . THR B 1 54 ? -0.628  7.662   -9.462  1.00 23.10 ? 54  THR B OG1 1 
ATOM   1029 C CG2 . THR B 1 54 ? 0.111   6.926   -11.657 1.00 22.03 ? 54  THR B CG2 1 
ATOM   1030 N N   . GLU B 1 55 ? -3.746  5.820   -8.870  1.00 21.63 ? 55  GLU B N   1 
ATOM   1031 C CA  . GLU B 1 55 ? -4.350  5.053   -7.765  1.00 22.50 ? 55  GLU B CA  1 
ATOM   1032 C C   . GLU B 1 55 ? -4.614  3.623   -8.218  1.00 22.07 ? 55  GLU B C   1 
ATOM   1033 O O   . GLU B 1 55 ? -5.145  3.395   -9.290  1.00 21.45 ? 55  GLU B O   1 
ATOM   1034 C CB  . GLU B 1 55 ? -5.621  5.684   -7.210  1.00 22.38 ? 55  GLU B CB  1 
ATOM   1035 C CG  . GLU B 1 55 ? -6.028  5.076   -5.846  1.00 26.30 ? 55  GLU B CG  1 
ATOM   1036 C CD  . GLU B 1 55 ? -7.192  5.806   -5.193  1.00 30.11 ? 55  GLU B CD  1 
ATOM   1037 O OE1 . GLU B 1 55 ? -7.784  6.719   -5.824  1.00 32.50 ? 55  GLU B OE1 1 
ATOM   1038 O OE2 . GLU B 1 55 ? -7.556  5.439   -4.065  1.00 28.98 ? 55  GLU B OE2 1 
ATOM   1039 N N   . ASN B 1 56 ? -4.202  2.671   -7.374  1.00 21.56 ? 56  ASN B N   1 
ATOM   1040 C CA  . ASN B 1 56 ? -4.318  1.251   -7.609  1.00 21.94 ? 56  ASN B CA  1 
ATOM   1041 C C   . ASN B 1 56 ? -3.489  0.702   -8.762  1.00 21.38 ? 56  ASN B C   1 
ATOM   1042 O O   . ASN B 1 56 ? -3.579  -0.466  -9.065  1.00 22.47 ? 56  ASN B O   1 
ATOM   1043 C CB  . ASN B 1 56 ? -5.788  0.830   -7.735  1.00 21.54 ? 56  ASN B CB  1 
ATOM   1044 C CG  . ASN B 1 56 ? -6.573  1.142   -6.488  1.00 23.78 ? 56  ASN B CG  1 
ATOM   1045 O OD1 . ASN B 1 56 ? -5.994  1.391   -5.412  1.00 22.67 ? 56  ASN B OD1 1 
ATOM   1046 N ND2 . ASN B 1 56 ? -7.898  1.116   -6.603  1.00 25.66 ? 56  ASN B ND2 1 
ATOM   1047 N N   . MET B 1 57 ? -2.673  1.540   -9.394  1.00 21.25 ? 57  MET B N   1 
ATOM   1048 C CA  . MET B 1 57 ? -1.776  1.057   -10.434 1.00 20.61 ? 57  MET B CA  1 
ATOM   1049 C C   . MET B 1 57 ? -0.545  0.378   -9.837  1.00 20.33 ? 57  MET B C   1 
ATOM   1050 O O   . MET B 1 57 ? 0.030   0.852   -8.858  1.00 20.37 ? 57  MET B O   1 
ATOM   1051 C CB  . MET B 1 57 ? -1.344  2.210   -11.346 1.00 21.06 ? 57  MET B CB  1 
ATOM   1052 C CG  . MET B 1 57 ? -0.352  1.766   -12.381 1.00 23.00 ? 57  MET B CG  1 
ATOM   1053 S SD  . MET B 1 57 ? 0.049   3.083   -13.540 1.00 26.63 ? 57  MET B SD  1 
ATOM   1054 C CE  . MET B 1 57 ? -1.570  3.393   -14.258 1.00 29.16 ? 57  MET B CE  1 
ATOM   1055 N N   . SER B 1 58 ? -0.115  -0.722  -10.441 1.00 20.40 ? 58  SER B N   1 
ATOM   1056 C CA  . SER B 1 58 ? 1.088   -1.401  -9.933  1.00 20.41 ? 58  SER B CA  1 
ATOM   1057 C C   . SER B 1 58 ? 2.329   -0.543  -10.182 1.00 20.57 ? 58  SER B C   1 
ATOM   1058 O O   . SER B 1 58 ? 2.376   0.210   -11.165 1.00 20.58 ? 58  SER B O   1 
ATOM   1059 C CB  . SER B 1 58 ? 1.246   -2.786  -10.557 1.00 21.35 ? 58  SER B CB  1 
ATOM   1060 O OG  . SER B 1 58 ? 1.721   -2.697  -11.902 1.00 22.24 ? 58  SER B OG  1 
ATOM   1061 N N   . LEU B 1 59 ? 3.315   -0.655  -9.296  1.00 20.45 ? 59  LEU B N   1 
ATOM   1062 C CA  . LEU B 1 59 ? 4.637   -0.038  -9.498  1.00 20.04 ? 59  LEU B CA  1 
ATOM   1063 C C   . LEU B 1 59 ? 5.222   -0.331  -10.886 1.00 20.61 ? 59  LEU B C   1 
ATOM   1064 O O   . LEU B 1 59 ? 5.739   0.582   -11.550 1.00 19.78 ? 59  LEU B O   1 
ATOM   1065 C CB  . LEU B 1 59 ? 5.626   -0.549  -8.462  1.00 20.71 ? 59  LEU B CB  1 
ATOM   1066 C CG  . LEU B 1 59 ? 6.984   0.162   -8.411  1.00 20.39 ? 59  LEU B CG  1 
ATOM   1067 C CD1 . LEU B 1 59 ? 6.845   1.695   -8.410  1.00 22.99 ? 59  LEU B CD1 1 
ATOM   1068 C CD2 . LEU B 1 59 ? 7.835   -0.307  -7.207  1.00 23.48 ? 59  LEU B CD2 1 
ATOM   1069 N N   . THR B 1 60 ? 5.177   -1.611  -11.301 1.00 21.25 ? 60  THR B N   1 
ATOM   1070 C CA  . THR B 1 60 ? 5.634   -1.986  -12.647 1.00 22.00 ? 60  THR B CA  1 
ATOM   1071 C C   . THR B 1 60 ? 4.943   -1.175  -13.753 1.00 22.01 ? 60  THR B C   1 
ATOM   1072 O O   . THR B 1 60 ? 5.609   -0.648  -14.663 1.00 23.01 ? 60  THR B O   1 
ATOM   1073 C CB  . THR B 1 60 ? 5.473   -3.521  -12.894 1.00 21.87 ? 60  THR B CB  1 
ATOM   1074 O OG1 . THR B 1 60 ? 6.236   -4.242  -11.907 1.00 26.10 ? 60  THR B OG1 1 
ATOM   1075 C CG2 . THR B 1 60 ? 5.972   -3.908  -14.271 1.00 22.39 ? 60  THR B CG2 1 
ATOM   1076 N N   . ASP B 1 61 ? 3.621   -1.078  -13.694 1.00 21.28 ? 61  ASP B N   1 
ATOM   1077 C CA  . ASP B 1 61 ? 2.875   -0.280  -14.673 1.00 21.73 ? 61  ASP B CA  1 
ATOM   1078 C C   . ASP B 1 61 ? 3.171   1.212   -14.595 1.00 21.51 ? 61  ASP B C   1 
ATOM   1079 O O   . ASP B 1 61 ? 3.283   1.873   -15.639 1.00 22.38 ? 61  ASP B O   1 
ATOM   1080 C CB  . ASP B 1 61 ? 1.380   -0.529  -14.535 1.00 21.74 ? 61  ASP B CB  1 
ATOM   1081 C CG  . ASP B 1 61 ? 0.953   -1.916  -15.077 1.00 24.99 ? 61  ASP B CG  1 
ATOM   1082 O OD1 . ASP B 1 61 ? 1.786   -2.651  -15.653 1.00 26.91 ? 61  ASP B OD1 1 
ATOM   1083 O OD2 . ASP B 1 61 ? -0.239  -2.227  -14.941 1.00 25.78 ? 61  ASP B OD2 1 
ATOM   1084 N N   . ALA B 1 62 ? 3.318   1.751   -13.375 1.00 20.37 ? 62  ALA B N   1 
ATOM   1085 C CA  . ALA B 1 62 ? 3.685   3.160   -13.233 1.00 20.15 ? 62  ALA B CA  1 
ATOM   1086 C C   . ALA B 1 62 ? 5.071   3.441   -13.843 1.00 20.74 ? 62  ALA B C   1 
ATOM   1087 O O   . ALA B 1 62 ? 5.262   4.471   -14.506 1.00 21.25 ? 62  ALA B O   1 
ATOM   1088 C CB  . ALA B 1 62 ? 3.640   3.583   -11.764 1.00 19.54 ? 62  ALA B CB  1 
ATOM   1089 N N   . ARG B 1 63 ? 6.022   2.524   -13.627 1.00 20.79 ? 63  ARG B N   1 
ATOM   1090 C CA  . ARG B 1 63 ? 7.389   2.660   -14.183 1.00 22.01 ? 63  ARG B CA  1 
ATOM   1091 C C   . ARG B 1 63 ? 7.364   2.651   -15.723 1.00 23.39 ? 63  ARG B C   1 
ATOM   1092 O O   . ARG B 1 63 ? 8.081   3.422   -16.379 1.00 22.95 ? 63  ARG B O   1 
ATOM   1093 C CB  . ARG B 1 63 ? 8.338   1.609   -13.605 1.00 21.76 ? 63  ARG B CB  1 
ATOM   1094 C CG  . ARG B 1 63 ? 8.670   1.908   -12.143 1.00 22.90 ? 63  ARG B CG  1 
ATOM   1095 C CD  . ARG B 1 63 ? 9.453   0.789   -11.524 1.00 24.97 ? 63  ARG B CD  1 
ATOM   1096 N NE  . ARG B 1 63 ? 10.105  1.243   -10.311 1.00 28.03 ? 63  ARG B NE  1 
ATOM   1097 C CZ  . ARG B 1 63 ? 10.635  0.430   -9.408  1.00 29.91 ? 63  ARG B CZ  1 
ATOM   1098 N NH1 . ARG B 1 63 ? 10.571  -0.893  -9.591  1.00 29.35 ? 63  ARG B NH1 1 
ATOM   1099 N NH2 . ARG B 1 63 ? 11.215  0.938   -8.321  1.00 28.53 ? 63  ARG B NH2 1 
ATOM   1100 N N   . LYS B 1 64 ? 6.493   1.819   -16.299 1.00 23.38 ? 64  LYS B N   1 
ATOM   1101 C CA  . LYS B 1 64 ? 6.343   1.806   -17.749 1.00 25.18 ? 64  LYS B CA  1 
ATOM   1102 C C   . LYS B 1 64 ? 5.892   3.169   -18.268 1.00 25.67 ? 64  LYS B C   1 
ATOM   1103 O O   . LYS B 1 64 ? 6.367   3.599   -19.298 1.00 26.29 ? 64  LYS B O   1 
ATOM   1104 C CB  . LYS B 1 64 ? 5.405   0.684   -18.207 1.00 23.94 ? 64  LYS B CB  1 
ATOM   1105 C CG  . LYS B 1 64 ? 5.986   -0.713  -17.985 1.00 26.13 ? 64  LYS B CG  1 
ATOM   1106 C CD  . LYS B 1 64 ? 4.938   -1.791  -18.258 1.00 28.90 ? 64  LYS B CD  1 
ATOM   1107 C CE  . LYS B 1 64 ? 5.377   -3.096  -17.651 1.00 29.69 ? 64  LYS B CE  1 
ATOM   1108 N NZ  . LYS B 1 64 ? 4.462   -4.258  -17.926 1.00 29.75 ? 64  LYS B NZ  1 
ATOM   1109 N N   . LEU B 1 65 ? 4.975   3.831   -17.560 1.00 26.62 ? 65  LEU B N   1 
ATOM   1110 C CA  . LEU B 1 65 ? 4.479   5.168   -17.960 1.00 27.53 ? 65  LEU B CA  1 
ATOM   1111 C C   . LEU B 1 65 ? 5.610   6.206   -17.935 1.00 28.98 ? 65  LEU B C   1 
ATOM   1112 O O   . LEU B 1 65 ? 5.663   7.075   -18.814 1.00 29.81 ? 65  LEU B O   1 
ATOM   1113 C CB  . LEU B 1 65 ? 3.333   5.638   -17.069 1.00 27.29 ? 65  LEU B CB  1 
ATOM   1114 C CG  . LEU B 1 65 ? 1.910   5.103   -17.202 1.00 28.98 ? 65  LEU B CG  1 
ATOM   1115 C CD1 . LEU B 1 65 ? 1.060   5.604   -16.038 1.00 29.49 ? 65  LEU B CD1 1 
ATOM   1116 C CD2 . LEU B 1 65 ? 1.330   5.576   -18.527 1.00 31.52 ? 65  LEU B CD2 1 
ATOM   1117 N N   . ILE B 1 66 ? 6.497   6.123   -16.940 1.00 28.48 ? 66  ILE B N   1 
ATOM   1118 C CA  . ILE B 1 66 ? 7.708   6.971   -16.907 1.00 29.59 ? 66  ILE B CA  1 
ATOM   1119 C C   . ILE B 1 66 ? 8.642   6.711   -18.120 1.00 30.54 ? 66  ILE B C   1 
ATOM   1120 O O   . ILE B 1 66 ? 9.083   7.653   -18.785 1.00 30.56 ? 66  ILE B O   1 
ATOM   1121 C CB  . ILE B 1 66 ? 8.453   6.867   -15.569 1.00 29.27 ? 66  ILE B CB  1 
ATOM   1122 C CG1 . ILE B 1 66 ? 7.548   7.435   -14.453 1.00 29.20 ? 66  ILE B CG1 1 
ATOM   1123 C CG2 . ILE B 1 66 ? 9.824   7.595   -15.630 1.00 28.15 ? 66  ILE B CG2 1 
ATOM   1124 C CD1 . ILE B 1 66 ? 8.237   7.838   -13.213 1.00 31.71 ? 66  ILE B CD1 1 
ATOM   1125 N N   . GLU B 1 67 ? 8.913   5.448   -18.437 1.00 31.44 ? 67  GLU B N   1 
ATOM   1126 C CA  . GLU B 1 67 ? 9.683   5.143   -19.656 1.00 33.58 ? 67  GLU B CA  1 
ATOM   1127 C C   . GLU B 1 67 ? 8.990   5.670   -20.927 1.00 34.22 ? 67  GLU B C   1 
ATOM   1128 O O   . GLU B 1 67 ? 9.659   6.099   -21.867 1.00 35.61 ? 67  GLU B O   1 
ATOM   1129 C CB  . GLU B 1 67 ? 10.008  3.652   -19.764 1.00 33.98 ? 67  GLU B CB  1 
ATOM   1130 C CG  . GLU B 1 67 ? 10.750  3.044   -18.547 1.00 35.38 ? 67  GLU B CG  1 
ATOM   1131 C CD  . GLU B 1 67 ? 12.170  3.601   -18.312 1.00 39.30 ? 67  GLU B CD  1 
ATOM   1132 O OE1 . GLU B 1 67 ? 12.571  4.584   -18.969 1.00 40.94 ? 67  GLU B OE1 1 
ATOM   1133 O OE2 . GLU B 1 67 ? 12.898  3.050   -17.450 1.00 41.58 ? 67  GLU B OE2 1 
ATOM   1134 N N   . LYS B 1 68 ? 7.657   5.687   -20.929 1.00 34.56 ? 68  LYS B N   1 
ATOM   1135 C CA  . LYS B 1 68 ? 6.841   6.125   -22.090 1.00 35.46 ? 68  LYS B CA  1 
ATOM   1136 C C   . LYS B 1 68 ? 6.831   7.652   -22.338 1.00 35.35 ? 68  LYS B C   1 
ATOM   1137 O O   . LYS B 1 68 ? 6.532   8.113   -23.459 1.00 35.58 ? 68  LYS B O   1 
ATOM   1138 C CB  . LYS B 1 68 ? 5.409   5.590   -21.908 1.00 36.08 ? 68  LYS B CB  1 
ATOM   1139 C CG  . LYS B 1 68 ? 4.389   5.918   -23.007 1.00 38.57 ? 68  LYS B CG  1 
ATOM   1140 C CD  . LYS B 1 68 ? 3.048   5.211   -22.748 1.00 42.05 ? 68  LYS B CD  1 
ATOM   1141 C CE  . LYS B 1 68 ? 1.886   5.860   -23.523 1.00 43.96 ? 68  LYS B CE  1 
ATOM   1142 N NZ  . LYS B 1 68 ? 1.991   5.750   -25.014 1.00 45.32 ? 68  LYS B NZ  1 
ATOM   1143 N N   . SER B 1 69 ? 7.159   8.419   -21.289 1.00 34.16 ? 69  SER B N   1 
ATOM   1144 C CA  . SER B 1 69 ? 7.100   9.900   -21.272 1.00 33.12 ? 69  SER B CA  1 
ATOM   1145 C C   . SER B 1 69 ? 7.923   10.607  -22.368 1.00 32.53 ? 69  SER B C   1 
ATOM   1146 O O   . SER B 1 69 ? 7.651   11.760  -22.699 1.00 32.94 ? 69  SER B O   1 
ATOM   1147 C CB  . SER B 1 69 ? 7.578   10.397  -19.908 1.00 31.95 ? 69  SER B CB  1 
ATOM   1148 O OG  . SER B 1 69 ? 8.946   10.077  -19.725 1.00 32.07 ? 69  SER B OG  1 
ATOM   1149 N N   . ARG B 1 70 ? 8.939   9.922   -22.890 1.00 31.75 ? 70  ARG B N   1 
ATOM   1150 C CA  . ARG B 1 70 ? 9.832   10.465  -23.928 1.00 32.43 ? 70  ARG B CA  1 
ATOM   1151 C C   . ARG B 1 70 ? 10.395  11.858  -23.571 1.00 31.93 ? 70  ARG B C   1 
ATOM   1152 O O   . ARG B 1 70 ? 10.253  12.831  -24.339 1.00 32.80 ? 70  ARG B O   1 
ATOM   1153 C CB  . ARG B 1 70 ? 9.153   10.464  -25.303 1.00 32.40 ? 70  ARG B CB  1 
ATOM   1154 N N   . GLY B 1 71 ? 11.001  11.923  -22.382 1.00 31.56 ? 71  GLY B N   1 
ATOM   1155 C CA  . GLY B 1 71 ? 11.701  13.109  -21.909 1.00 30.39 ? 71  GLY B CA  1 
ATOM   1156 C C   . GLY B 1 71 ? 10.833  14.269  -21.487 1.00 29.03 ? 71  GLY B C   1 
ATOM   1157 O O   . GLY B 1 71 ? 11.354  15.339  -21.193 1.00 30.77 ? 71  GLY B O   1 
ATOM   1158 N N   . LYS B 1 72 ? 9.515   14.086  -21.492 1.00 27.50 ? 72  LYS B N   1 
ATOM   1159 C CA  . LYS B 1 72 ? 8.596   15.051  -20.924 1.00 27.17 ? 72  LYS B CA  1 
ATOM   1160 C C   . LYS B 1 72 ? 7.703   14.356  -19.891 1.00 26.41 ? 72  LYS B C   1 
ATOM   1161 O O   . LYS B 1 72 ? 6.842   13.543  -20.252 1.00 26.61 ? 72  LYS B O   1 
ATOM   1162 C CB  . LYS B 1 72 ? 7.705   15.676  -21.998 1.00 27.40 ? 72  LYS B CB  1 
ATOM   1163 C CG  . LYS B 1 72 ? 6.738   16.708  -21.448 1.00 29.87 ? 72  LYS B CG  1 
ATOM   1164 C CD  . LYS B 1 72 ? 5.978   17.412  -22.569 1.00 35.13 ? 72  LYS B CD  1 
ATOM   1165 C CE  . LYS B 1 72 ? 4.853   18.237  -21.993 1.00 34.52 ? 72  LYS B CE  1 
ATOM   1166 N NZ  . LYS B 1 72 ? 4.257   19.148  -23.005 1.00 36.17 ? 72  LYS B NZ  1 
ATOM   1167 N N   . LEU B 1 73 ? 7.900   14.711  -18.624 1.00 24.13 ? 73  LEU B N   1 
ATOM   1168 C CA  . LEU B 1 73 ? 7.202   14.047  -17.519 1.00 22.23 ? 73  LEU B CA  1 
ATOM   1169 C C   . LEU B 1 73 ? 6.366   15.016  -16.732 1.00 22.05 ? 73  LEU B C   1 
ATOM   1170 O O   . LEU B 1 73 ? 6.859   15.813  -15.922 1.00 22.68 ? 73  LEU B O   1 
ATOM   1171 C CB  . LEU B 1 73 ? 8.194   13.299  -16.618 1.00 22.12 ? 73  LEU B CB  1 
ATOM   1172 C CG  . LEU B 1 73 ? 7.569   12.451  -15.498 1.00 20.01 ? 73  LEU B CG  1 
ATOM   1173 C CD1 . LEU B 1 73 ? 6.787   11.317  -16.112 1.00 20.27 ? 73  LEU B CD1 1 
ATOM   1174 C CD2 . LEU B 1 73 ? 8.693   11.912  -14.630 1.00 19.90 ? 73  LEU B CD2 1 
ATOM   1175 N N   . GLN B 1 74 ? 5.073   14.974  -17.002 1.00 22.12 ? 74  GLN B N   1 
ATOM   1176 C CA  . GLN B 1 74 ? 4.143   15.774  -16.262 1.00 22.51 ? 74  GLN B CA  1 
ATOM   1177 C C   . GLN B 1 74 ? 3.516   14.959  -15.136 1.00 22.35 ? 74  GLN B C   1 
ATOM   1178 O O   . GLN B 1 74 ? 2.799   13.988  -15.401 1.00 22.42 ? 74  GLN B O   1 
ATOM   1179 C CB  . GLN B 1 74 ? 3.048   16.288  -17.183 1.00 22.93 ? 74  GLN B CB  1 
ATOM   1180 C CG  . GLN B 1 74 ? 1.967   17.050  -16.439 1.00 25.74 ? 74  GLN B CG  1 
ATOM   1181 C CD  . GLN B 1 74 ? 2.437   18.399  -15.910 1.00 29.96 ? 74  GLN B CD  1 
ATOM   1182 O OE1 . GLN B 1 74 ? 2.484   18.628  -14.699 1.00 29.93 ? 74  GLN B OE1 1 
ATOM   1183 N NE2 . GLN B 1 74 ? 2.794   19.293  -16.817 1.00 30.64 ? 74  GLN B NE2 1 
ATOM   1184 N N   . LEU B 1 75 ? 3.768   15.386  -13.905 1.00 21.60 ? 75  LEU B N   1 
ATOM   1185 C CA  . LEU B 1 75 ? 3.238   14.766  -12.709 1.00 21.02 ? 75  LEU B CA  1 
ATOM   1186 C C   . LEU B 1 75 ? 2.195   15.648  -12.055 1.00 22.18 ? 75  LEU B C   1 
ATOM   1187 O O   . LEU B 1 75 ? 2.237   16.892  -12.120 1.00 21.59 ? 75  LEU B O   1 
ATOM   1188 C CB  . LEU B 1 75 ? 4.359   14.523  -11.687 1.00 19.82 ? 75  LEU B CB  1 
ATOM   1189 C CG  . LEU B 1 75 ? 5.559   13.715  -12.133 1.00 19.51 ? 75  LEU B CG  1 
ATOM   1190 C CD1 . LEU B 1 75 ? 6.597   13.708  -11.005 1.00 22.91 ? 75  LEU B CD1 1 
ATOM   1191 C CD2 . LEU B 1 75 ? 5.128   12.276  -12.515 1.00 21.41 ? 75  LEU B CD2 1 
ATOM   1192 N N   . VAL B 1 76 ? 1.247   14.990  -11.407 1.00 21.73 ? 76  VAL B N   1 
ATOM   1193 C CA  . VAL B 1 76 ? 0.372   15.659  -10.489 1.00 22.37 ? 76  VAL B CA  1 
ATOM   1194 C C   . VAL B 1 76 ? 0.577   14.959  -9.149  1.00 23.22 ? 76  VAL B C   1 
ATOM   1195 O O   . VAL B 1 76 ? 0.595   13.723  -9.073  1.00 22.39 ? 76  VAL B O   1 
ATOM   1196 C CB  . VAL B 1 76 ? -1.109  15.597  -10.925 1.00 22.66 ? 76  VAL B CB  1 
ATOM   1197 C CG1 . VAL B 1 76 ? -1.979  16.311  -9.912  1.00 23.63 ? 76  VAL B CG1 1 
ATOM   1198 C CG2 . VAL B 1 76 ? -1.285  16.189  -12.337 1.00 22.58 ? 76  VAL B CG2 1 
ATOM   1199 N N   . VAL B 1 77 ? 0.720   15.764  -8.106  1.00 23.69 ? 77  VAL B N   1 
ATOM   1200 C CA  . VAL B 1 77 ? 1.241   15.319  -6.836  1.00 25.34 ? 77  VAL B CA  1 
ATOM   1201 C C   . VAL B 1 77 ? 0.281   15.788  -5.747  1.00 26.01 ? 77  VAL B C   1 
ATOM   1202 O O   . VAL B 1 77 ? -0.235  16.893  -5.820  1.00 25.75 ? 77  VAL B O   1 
ATOM   1203 C CB  . VAL B 1 77 ? 2.697   15.885  -6.681  1.00 25.67 ? 77  VAL B CB  1 
ATOM   1204 C CG1 . VAL B 1 77 ? 3.188   15.831  -5.265  1.00 27.68 ? 77  VAL B CG1 1 
ATOM   1205 C CG2 . VAL B 1 77 ? 3.658   15.092  -7.615  1.00 27.46 ? 77  VAL B CG2 1 
ATOM   1206 N N   . LEU B 1 78 ? 0.025   14.948  -4.751  1.00 27.55 ? 78  LEU B N   1 
ATOM   1207 C CA  . LEU B 1 78 ? -0.884  15.322  -3.665  1.00 29.98 ? 78  LEU B CA  1 
ATOM   1208 C C   . LEU B 1 78 ? -0.304  16.399  -2.731  1.00 31.86 ? 78  LEU B C   1 
ATOM   1209 O O   . LEU B 1 78 ? 0.809   16.254  -2.208  1.00 31.83 ? 78  LEU B O   1 
ATOM   1210 C CB  . LEU B 1 78 ? -1.326  14.082  -2.873  1.00 29.33 ? 78  LEU B CB  1 
ATOM   1211 C CG  . LEU B 1 78 ? -2.288  14.246  -1.688  1.00 30.95 ? 78  LEU B CG  1 
ATOM   1212 C CD1 . LEU B 1 78 ? -2.993  12.927  -1.436  1.00 31.49 ? 78  LEU B CD1 1 
ATOM   1213 C CD2 . LEU B 1 78 ? -1.558  14.701  -0.425  1.00 35.19 ? 78  LEU B CD2 1 
ATOM   1214 N N   . ARG B 1 79 ? -0.976  17.520  -2.574  1.00 34.45 ? 79  ARG B N   1 
ATOM   1215 C CA  . ARG B 1 79 ? -0.548  18.487  -1.580  1.00 37.13 ? 79  ARG B CA  1 
ATOM   1216 C C   . ARG B 1 79 ? -1.752  19.122  -0.925  1.00 38.56 ? 79  ARG B C   1 
ATOM   1217 O O   . ARG B 1 79 ? -2.435  19.897  -1.564  1.00 39.31 ? 79  ARG B O   1 
ATOM   1218 C CB  . ARG B 1 79 ? 0.331   19.576  -2.193  1.00 37.14 ? 79  ARG B CB  1 
ATOM   1219 C CG  . ARG B 1 79 ? 1.679   19.153  -2.713  1.00 37.82 ? 79  ARG B CG  1 
ATOM   1220 C CD  . ARG B 1 79 ? 2.764   19.058  -1.676  1.00 37.20 ? 79  ARG B CD  1 
ATOM   1221 N NE  . ARG B 1 79 ? 4.003   18.493  -2.206  1.00 36.97 ? 79  ARG B NE  1 
ATOM   1222 C CZ  . ARG B 1 79 ? 5.041   19.198  -2.662  1.00 37.17 ? 79  ARG B CZ  1 
ATOM   1223 N NH1 . ARG B 1 79 ? 5.008   20.524  -2.639  1.00 34.77 ? 79  ARG B NH1 1 
ATOM   1224 N NH2 . ARG B 1 79 ? 6.106   18.582  -3.147  1.00 31.69 ? 79  ARG B NH2 1 
HETATM 1225 O O   . HOH C 2 .  ? 2.351   -1.575  -2.621  1.00 19.04 ? 89  HOH A O   1 
HETATM 1226 O O   . HOH C 2 .  ? -14.979 -3.058  8.828   1.00 18.80 ? 90  HOH A O   1 
HETATM 1227 O O   . HOH C 2 .  ? -9.285  -2.682  13.208  1.00 20.36 ? 91  HOH A O   1 
HETATM 1228 O O   . HOH C 2 .  ? 12.345  17.156  -23.352 1.00 34.05 ? 92  HOH A O   1 
HETATM 1229 O O   . HOH C 2 .  ? 9.439   1.502   -2.492  1.00 25.60 ? 93  HOH A O   1 
HETATM 1230 O O   . HOH C 2 .  ? 2.837   -2.293  -6.976  1.00 18.94 ? 94  HOH A O   1 
HETATM 1231 O O   . HOH C 2 .  ? -6.440  -10.143 -6.221  1.00 32.34 ? 95  HOH A O   1 
HETATM 1232 O O   . HOH C 2 .  ? 1.882   -9.324  9.172   1.00 25.72 ? 96  HOH A O   1 
HETATM 1233 O O   . HOH C 2 .  ? 13.227  19.718  -15.934 1.00 26.56 ? 97  HOH A O   1 
HETATM 1234 O O   . HOH C 2 .  ? 6.033   -2.727  3.775   1.00 20.95 ? 98  HOH A O   1 
HETATM 1235 O O   . HOH C 2 .  ? -11.275 5.480   9.670   1.00 36.27 ? 99  HOH A O   1 
HETATM 1236 O O   . HOH C 2 .  ? -4.118  17.471  -3.578  1.00 45.65 ? 100 HOH A O   1 
HETATM 1237 O O   . HOH C 2 .  ? -14.423 2.404   -0.603  1.00 40.97 ? 101 HOH A O   1 
HETATM 1238 O O   . HOH C 2 .  ? -4.822  -12.542 -11.243 1.00 54.89 ? 102 HOH A O   1 
HETATM 1239 O O   . HOH C 2 .  ? 16.754  8.465   -13.573 1.00 34.22 ? 103 HOH A O   1 
HETATM 1240 O O   . HOH C 2 .  ? -0.443  4.055   8.810   1.00 28.57 ? 104 HOH A O   1 
HETATM 1241 O O   . HOH C 2 .  ? 5.528   2.275   2.642   1.00 33.48 ? 105 HOH A O   1 
HETATM 1242 O O   . HOH C 2 .  ? 4.991   -0.339  2.463   1.00 22.10 ? 106 HOH A O   1 
HETATM 1243 O O   . HOH C 2 .  ? -2.773  -4.533  -8.916  1.00 32.22 ? 107 HOH A O   1 
HETATM 1244 O O   . HOH C 2 .  ? 2.325   -1.211  1.722   1.00 19.73 ? 108 HOH A O   1 
HETATM 1245 O O   . HOH C 2 .  ? -2.601  -14.992 10.392  1.00 46.00 ? 109 HOH A O   1 
HETATM 1246 O O   . HOH C 2 .  ? -11.110 0.232   13.259  1.00 28.69 ? 110 HOH A O   1 
HETATM 1247 O O   . HOH C 2 .  ? -20.331 0.776   12.439  1.00 33.59 ? 111 HOH A O   1 
HETATM 1248 O O   . HOH C 2 .  ? 10.992  1.597   -4.853  1.00 23.12 ? 112 HOH A O   1 
HETATM 1249 O O   . HOH C 2 .  ? -18.539 -3.664  12.597  1.00 26.66 ? 113 HOH A O   1 
HETATM 1250 O O   . HOH C 2 .  ? 15.806  9.081   -16.243 1.00 25.76 ? 114 HOH A O   1 
HETATM 1251 O O   . HOH C 2 .  ? 22.485  13.421  -14.233 1.00 35.81 ? 115 HOH A O   1 
HETATM 1252 O O   . HOH C 2 .  ? 6.865   -4.344  -7.679  1.00 32.63 ? 116 HOH A O   1 
HETATM 1253 O O   . HOH C 2 .  ? -14.989 2.472   10.590  1.00 31.09 ? 117 HOH A O   1 
HETATM 1254 O O   . HOH C 2 .  ? -13.817 3.883   6.048   1.00 26.55 ? 118 HOH A O   1 
HETATM 1255 O O   . HOH C 2 .  ? -0.243  -12.695 -3.518  1.00 29.50 ? 119 HOH A O   1 
HETATM 1256 O O   . HOH C 2 .  ? -9.451  -4.915  -1.046  1.00 26.83 ? 120 HOH A O   1 
HETATM 1257 O O   . HOH C 2 .  ? -10.567 -6.254  19.302  1.00 44.30 ? 121 HOH A O   1 
HETATM 1258 O O   . HOH C 2 .  ? -10.094 -1.746  -6.794  1.00 45.02 ? 122 HOH A O   1 
HETATM 1259 O O   . HOH C 2 .  ? -7.884  -11.551 -4.290  1.00 31.68 ? 123 HOH A O   1 
HETATM 1260 O O   . HOH C 2 .  ? -21.495 -2.734  5.512   1.00 37.50 ? 124 HOH A O   1 
HETATM 1261 O O   . HOH C 2 .  ? -14.119 3.930   8.739   1.00 37.55 ? 125 HOH A O   1 
HETATM 1262 O O   . HOH C 2 .  ? -12.308 -4.771  -1.721  1.00 34.55 ? 126 HOH A O   1 
HETATM 1263 O O   . HOH C 2 .  ? 3.100   21.680  -13.603 1.00 39.91 ? 127 HOH A O   1 
HETATM 1264 O O   . HOH C 2 .  ? 3.242   -7.444  -6.840  1.00 23.98 ? 128 HOH A O   1 
HETATM 1265 O O   . HOH C 2 .  ? -9.979  6.552   2.077   1.00 34.13 ? 129 HOH A O   1 
HETATM 1266 O O   . HOH C 2 .  ? -7.815  3.409   17.024  1.00 31.58 ? 130 HOH A O   1 
HETATM 1267 O O   . HOH C 2 .  ? -13.169 -7.411  14.920  1.00 31.34 ? 131 HOH A O   1 
HETATM 1268 O O   . HOH C 2 .  ? -2.845  7.455   3.753   1.00 44.44 ? 132 HOH A O   1 
HETATM 1269 O O   . HOH C 2 .  ? -2.390  -14.434 4.347   1.00 37.04 ? 133 HOH A O   1 
HETATM 1270 O O   . HOH C 2 .  ? -16.683 4.644   4.518   1.00 47.29 ? 134 HOH A O   1 
HETATM 1271 O O   . HOH C 2 .  ? -20.925 -0.043  5.660   1.00 35.03 ? 135 HOH A O   1 
HETATM 1272 O O   . HOH C 2 .  ? 8.093   -10.469 3.031   1.00 29.75 ? 136 HOH A O   1 
HETATM 1273 O O   . HOH C 2 .  ? -9.339  -9.735  -0.841  1.00 31.81 ? 137 HOH A O   1 
HETATM 1274 O O   . HOH C 2 .  ? 2.214   -11.818 -8.753  1.00 41.51 ? 138 HOH A O   1 
HETATM 1275 O O   . HOH C 2 .  ? 18.802  7.767   -11.960 1.00 43.78 ? 139 HOH A O   1 
HETATM 1276 O O   . HOH C 2 .  ? 8.496   -6.989  11.512  1.00 39.18 ? 140 HOH A O   1 
HETATM 1277 O O   . HOH C 2 .  ? 17.615  18.810  -18.605 1.00 45.49 ? 141 HOH A O   1 
HETATM 1278 O O   . HOH C 2 .  ? 2.573   -9.026  13.968  1.00 42.98 ? 142 HOH A O   1 
HETATM 1279 O O   . HOH C 2 .  ? 3.037   -10.192 11.726  1.00 32.47 ? 143 HOH A O   1 
HETATM 1280 O O   . HOH C 2 .  ? 0.664   -7.791  -10.272 1.00 41.81 ? 144 HOH A O   1 
HETATM 1281 O O   . HOH C 2 .  ? 7.340   -13.060 2.921   1.00 51.90 ? 145 HOH A O   1 
HETATM 1282 O O   . HOH C 2 .  ? 9.376   -8.481  8.731   1.00 39.01 ? 146 HOH A O   1 
HETATM 1283 O O   . HOH C 2 .  ? 2.045   -12.550 -2.844  1.00 44.31 ? 147 HOH A O   1 
HETATM 1284 O O   . HOH C 2 .  ? -17.907 3.048   11.102  1.00 41.00 ? 148 HOH A O   1 
HETATM 1285 O O   . HOH C 2 .  ? -5.702  1.531   18.684  1.00 41.46 ? 149 HOH A O   1 
HETATM 1286 O O   . HOH C 2 .  ? -8.303  8.166   9.319   1.00 43.92 ? 150 HOH A O   1 
HETATM 1287 O O   . HOH C 2 .  ? -8.263  8.334   4.285   1.00 47.14 ? 151 HOH A O   1 
HETATM 1288 O O   . HOH C 2 .  ? 9.231   -4.757  -0.648  1.00 33.89 ? 152 HOH A O   1 
HETATM 1289 O O   . HOH C 2 .  ? -13.682 -5.112  19.867  1.00 49.96 ? 153 HOH A O   1 
HETATM 1290 O O   . HOH C 2 .  ? -13.411 -7.208  17.723  1.00 47.06 ? 154 HOH A O   1 
HETATM 1291 O O   . HOH C 2 .  ? 16.746  6.894   -9.996  1.00 38.44 ? 155 HOH A O   1 
HETATM 1292 O O   . HOH C 2 .  ? 9.394   -7.651  -0.433  1.00 35.83 ? 156 HOH A O   1 
HETATM 1293 O O   . HOH C 2 .  ? 6.899   -8.711  -0.557  1.00 34.99 ? 157 HOH A O   1 
HETATM 1294 O O   . HOH C 2 .  ? -4.463  6.871   8.731   1.00 41.87 ? 158 HOH A O   1 
HETATM 1295 O O   . HOH C 2 .  ? -0.545  -13.444 14.507  1.00 39.36 ? 159 HOH A O   1 
HETATM 1296 O O   . HOH C 2 .  ? 14.326  7.834   -12.882 1.00 37.02 ? 160 HOH A O   1 
HETATM 1297 O O   . HOH C 2 .  ? 1.395   -16.251 -0.271  1.00 50.52 ? 161 HOH A O   1 
HETATM 1298 O O   . HOH C 2 .  ? 10.482  21.948  -16.828 1.00 55.80 ? 162 HOH A O   1 
HETATM 1299 O O   . HOH C 2 .  ? -0.417  -14.615 11.719  1.00 50.24 ? 163 HOH A O   1 
HETATM 1300 O O   . HOH C 2 .  ? 19.453  19.341  -25.829 1.00 33.26 ? 164 HOH A O   1 
HETATM 1301 O O   . HOH C 2 .  ? 25.571  15.508  -24.805 1.00 39.04 ? 165 HOH A O   1 
HETATM 1302 O O   . HOH C 2 .  ? 2.362   7.873   2.874   1.00 40.11 ? 166 HOH A O   1 
HETATM 1303 O O   . HOH C 2 .  ? -19.861 1.120   3.612   1.00 44.63 ? 167 HOH A O   1 
HETATM 1304 O O   . HOH C 2 .  ? 3.307   7.853   5.829   1.00 42.48 ? 168 HOH A O   1 
HETATM 1305 O O   . HOH C 2 .  ? -1.526  -10.171 17.604  1.00 44.52 ? 169 HOH A O   1 
HETATM 1306 O O   . HOH C 2 .  ? -5.235  2.542   16.717  1.00 35.33 ? 170 HOH A O   1 
HETATM 1307 O O   . HOH C 2 .  ? -2.658  8.223   7.103   1.00 51.31 ? 171 HOH A O   1 
HETATM 1308 O O   . HOH C 2 .  ? 5.421   -8.676  12.667  1.00 41.31 ? 172 HOH A O   1 
HETATM 1309 O O   . HOH C 2 .  ? 3.392   -14.555 0.246   1.00 51.92 ? 173 HOH A O   1 
HETATM 1310 O O   . HOH C 2 .  ? -7.812  6.132   2.659   1.00 43.74 ? 174 HOH A O   1 
HETATM 1311 O O   . HOH C 2 .  ? -13.416 1.994   13.713  1.00 41.46 ? 175 HOH A O   1 
HETATM 1312 O O   . HOH C 2 .  ? -3.989  9.393   5.119   1.00 53.16 ? 176 HOH A O   1 
HETATM 1313 O O   . HOH C 2 .  ? -0.673  6.708   8.022   1.00 46.42 ? 177 HOH A O   1 
HETATM 1314 O O   . HOH C 2 .  ? 1.711   7.833   11.476  1.00 49.74 ? 178 HOH A O   1 
HETATM 1315 O O   . HOH C 2 .  ? -10.019 -8.431  16.769  1.00 47.16 ? 179 HOH A O   1 
HETATM 1316 O O   . HOH C 2 .  ? 10.068  -2.898  2.677   1.00 43.41 ? 180 HOH A O   1 
HETATM 1317 O O   . HOH C 2 .  ? 10.439  -4.311  -5.083  1.00 50.35 ? 181 HOH A O   1 
HETATM 1318 O O   . HOH C 2 .  ? -3.517  -17.162 8.515   1.00 41.20 ? 182 HOH A O   1 
HETATM 1319 O O   . HOH C 2 .  ? 4.334   8.383   15.310  1.00 48.44 ? 183 HOH A O   1 
HETATM 1320 O O   . HOH C 2 .  ? -3.949  6.482   11.356  1.00 43.89 ? 184 HOH A O   1 
HETATM 1321 O O   . HOH C 2 .  ? -9.311  7.518   -0.261  1.00 43.62 ? 185 HOH A O   1 
HETATM 1322 O O   . HOH C 2 .  ? -1.586  6.008   16.486  1.00 40.25 ? 186 HOH A O   1 
HETATM 1323 O O   . HOH C 2 .  ? -9.056  -7.116  0.351   1.00 32.22 ? 187 HOH A O   1 
HETATM 1324 O O   . HOH C 2 .  ? -1.919  -4.724  -11.365 1.00 38.18 ? 188 HOH A O   1 
HETATM 1325 O O   . HOH C 2 .  ? 2.603   8.712   9.179   1.00 60.43 ? 189 HOH A O   1 
HETATM 1326 O O   . HOH C 2 .  ? -11.579 -9.868  15.061  1.00 25.96 ? 190 HOH A O   1 
HETATM 1327 O O   . HOH C 2 .  ? 1.146   -16.266 8.329   1.00 47.82 ? 191 HOH A O   1 
HETATM 1328 O O   . HOH D 2 .  ? -0.786  2.489   -6.897  1.00 17.80 ? 89  HOH B O   1 
HETATM 1329 O O   . HOH D 2 .  ? -7.877  2.729   -3.831  1.00 22.80 ? 90  HOH B O   1 
HETATM 1330 O O   . HOH D 2 .  ? 16.617  13.885  -8.880  1.00 18.56 ? 91  HOH B O   1 
HETATM 1331 O O   . HOH D 2 .  ? -4.365  8.806   -8.408  1.00 21.35 ? 92  HOH B O   1 
HETATM 1332 O O   . HOH D 2 .  ? -0.715  6.818   -6.709  1.00 18.92 ? 93  HOH B O   1 
HETATM 1333 O O   . HOH D 2 .  ? -0.267  13.931  -15.236 1.00 25.96 ? 94  HOH B O   1 
HETATM 1334 O O   . HOH D 2 .  ? -9.307  0.392   -3.585  1.00 25.36 ? 96  HOH B O   1 
HETATM 1335 O O   . HOH D 2 .  ? -3.269  7.639   -5.858  1.00 23.37 ? 97  HOH B O   1 
HETATM 1336 O O   . HOH D 2 .  ? -1.130  -1.910  -7.348  1.00 21.51 ? 98  HOH B O   1 
HETATM 1337 O O   . HOH D 2 .  ? 10.925  18.272  -8.693  1.00 21.22 ? 99  HOH B O   1 
HETATM 1338 O O   . HOH D 2 .  ? -3.818  7.877   -3.240  1.00 33.33 ? 100 HOH B O   1 
HETATM 1339 O O   . HOH D 2 .  ? 8.311   -1.607  -15.093 1.00 35.69 ? 101 HOH B O   1 
HETATM 1340 O O   . HOH D 2 .  ? 12.815  18.475  -5.712  1.00 25.90 ? 102 HOH B O   1 
HETATM 1341 O O   . HOH D 2 .  ? 4.469   -3.956  -9.577  1.00 29.87 ? 103 HOH B O   1 
HETATM 1342 O O   . HOH D 2 .  ? 7.015   -6.119  -17.685 1.00 44.59 ? 104 HOH B O   1 
HETATM 1343 O O   . HOH D 2 .  ? -2.860  20.900  1.979   1.00 46.22 ? 105 HOH B O   1 
HETATM 1344 O O   . HOH D 2 .  ? 8.006   21.773  -12.537 1.00 28.26 ? 106 HOH B O   1 
HETATM 1345 O O   . HOH D 2 .  ? 21.955  17.716  -5.307  1.00 40.96 ? 107 HOH B O   1 
HETATM 1346 O O   . HOH D 2 .  ? 11.181  7.529   0.934   1.00 33.44 ? 108 HOH B O   1 
HETATM 1347 O O   . HOH D 2 .  ? -5.240  -2.612  -9.377  1.00 34.27 ? 109 HOH B O   1 
HETATM 1348 O O   . HOH D 2 .  ? 4.122   8.820   -20.061 1.00 35.25 ? 110 HOH B O   1 
HETATM 1349 O O   . HOH D 2 .  ? 15.776  14.251  -1.857  1.00 39.45 ? 111 HOH B O   1 
HETATM 1350 O O   . HOH D 2 .  ? 5.572   2.547   12.285  1.00 37.63 ? 112 HOH B O   1 
HETATM 1351 O O   . HOH D 2 .  ? 3.358   -4.624  -15.282 1.00 42.81 ? 113 HOH B O   1 
HETATM 1352 O O   . HOH D 2 .  ? 1.863   1.086   -17.936 1.00 30.08 ? 114 HOH B O   1 
HETATM 1353 O O   . HOH D 2 .  ? -6.248  -6.311  16.913  1.00 25.94 ? 115 HOH B O   1 
HETATM 1354 O O   . HOH D 2 .  ? -13.985 -10.684 4.434   1.00 28.64 ? 116 HOH B O   1 
HETATM 1355 O O   . HOH D 2 .  ? 20.128  17.646  -9.645  1.00 26.10 ? 117 HOH B O   1 
HETATM 1356 O O   . HOH D 2 .  ? 11.088  3.878   -10.271 1.00 23.90 ? 118 HOH B O   1 
HETATM 1357 O O   . HOH D 2 .  ? -1.654  -1.905  -12.585 1.00 26.68 ? 119 HOH B O   1 
HETATM 1358 O O   . HOH D 2 .  ? -1.411  16.427  -16.048 1.00 31.34 ? 120 HOH B O   1 
HETATM 1359 O O   . HOH D 2 .  ? 9.608   0.264   -16.709 1.00 31.67 ? 121 HOH B O   1 
HETATM 1360 O O   . HOH D 2 .  ? -1.508  -7.394  16.875  1.00 37.21 ? 122 HOH B O   1 
HETATM 1361 O O   . HOH D 2 .  ? 6.248   14.051  1.136   1.00 40.77 ? 123 HOH B O   1 
HETATM 1362 O O   . HOH D 2 .  ? 23.238  10.494  -8.531  1.00 35.34 ? 124 HOH B O   1 
HETATM 1363 O O   . HOH D 2 .  ? 18.199  10.135  -0.895  1.00 48.76 ? 125 HOH B O   1 
HETATM 1364 O O   . HOH D 2 .  ? -4.708  15.442  -17.101 1.00 44.61 ? 126 HOH B O   1 
HETATM 1365 O O   . HOH D 2 .  ? -14.891 -8.058  3.620   1.00 35.20 ? 127 HOH B O   1 
HETATM 1366 O O   . HOH D 2 .  ? -12.483 -7.385  2.946   1.00 44.28 ? 128 HOH B O   1 
HETATM 1367 O O   . HOH D 2 .  ? -0.553  8.449   2.536   1.00 41.45 ? 129 HOH B O   1 
HETATM 1368 O O   . HOH D 2 .  ? -5.144  4.203   -14.149 1.00 37.16 ? 130 HOH B O   1 
HETATM 1369 O O   . HOH D 2 .  ? 23.439  16.215  -12.817 1.00 42.02 ? 131 HOH B O   1 
HETATM 1370 O O   . HOH D 2 .  ? 14.772  19.709  -13.577 1.00 32.12 ? 132 HOH B O   1 
HETATM 1371 O O   . HOH D 2 .  ? 10.912  3.816   -15.126 1.00 30.75 ? 133 HOH B O   1 
HETATM 1372 O O   . HOH D 2 .  ? 22.461  10.909  -5.661  1.00 29.89 ? 134 HOH B O   1 
HETATM 1373 O O   . HOH D 2 .  ? 11.954  -1.592  -6.802  1.00 42.43 ? 135 HOH B O   1 
HETATM 1374 O O   . HOH D 2 .  ? 12.879  15.099  -0.471  1.00 38.57 ? 136 HOH B O   1 
HETATM 1375 O O   . HOH D 2 .  ? 9.385   22.321  -2.873  1.00 31.46 ? 137 HOH B O   1 
HETATM 1376 O O   . HOH D 2 .  ? 3.382   15.307  -20.875 1.00 50.03 ? 138 HOH B O   1 
HETATM 1377 O O   . HOH D 2 .  ? 2.655   13.275  1.156   1.00 49.14 ? 139 HOH B O   1 
HETATM 1378 O O   . HOH D 2 .  ? -11.214 -15.339 5.192   1.00 47.96 ? 140 HOH B O   1 
HETATM 1379 O O   . HOH D 2 .  ? 4.877   13.264  -22.870 1.00 42.99 ? 141 HOH B O   1 
HETATM 1380 O O   . HOH D 2 .  ? 21.346  8.750   -4.634  1.00 52.71 ? 142 HOH B O   1 
HETATM 1381 O O   . HOH D 2 .  ? 3.361   -6.456  -9.661  1.00 39.11 ? 143 HOH B O   1 
HETATM 1382 O O   . HOH D 2 .  ? 14.924  3.974   -15.026 1.00 53.74 ? 144 HOH B O   1 
HETATM 1383 O O   . HOH D 2 .  ? 0.660   -6.627  18.076  1.00 49.94 ? 145 HOH B O   1 
HETATM 1384 O O   . HOH D 2 .  ? 6.939   22.274  -3.820  1.00 36.12 ? 146 HOH B O   1 
HETATM 1385 O O   . HOH D 2 .  ? 13.789  3.371   -10.229 1.00 42.12 ? 147 HOH B O   1 
HETATM 1386 O O   . HOH D 2 .  ? 20.488  20.152  -8.479  1.00 33.86 ? 148 HOH B O   1 
HETATM 1387 O O   . HOH D 2 .  ? -0.429  1.517   -17.728 1.00 41.28 ? 149 HOH B O   1 
HETATM 1388 O O   . HOH D 2 .  ? 15.064  22.586  -13.619 1.00 50.53 ? 150 HOH B O   1 
HETATM 1389 O O   . HOH D 2 .  ? 10.812  5.210   -12.515 1.00 32.97 ? 151 HOH B O   1 
HETATM 1390 O O   . HOH D 2 .  ? 1.999   14.149  -1.816  1.00 29.56 ? 152 HOH B O   1 
HETATM 1391 O O   . HOH D 2 .  ? 16.713  15.752  -3.498  1.00 34.36 ? 153 HOH B O   1 
HETATM 1392 O O   . HOH D 2 .  ? 14.984  18.760  -3.807  1.00 45.02 ? 154 HOH B O   1 
HETATM 1393 O O   . HOH D 2 .  ? -24.081 -18.856 11.302  1.00 44.93 ? 155 HOH B O   1 
HETATM 1394 O O   . HOH D 2 .  ? -1.053  18.670  -15.260 1.00 46.10 ? 156 HOH B O   1 
HETATM 1395 O O   . HOH D 2 .  ? -6.465  7.695   -15.994 1.00 32.52 ? 157 HOH B O   1 
HETATM 1396 O O   . HOH D 2 .  ? 2.064   7.845   -20.964 1.00 39.60 ? 158 HOH B O   1 
HETATM 1397 O O   . HOH D 2 .  ? 1.052   -5.231  -13.057 1.00 45.45 ? 159 HOH B O   1 
HETATM 1398 O O   . HOH D 2 .  ? -7.563  4.219   -10.151 1.00 38.26 ? 160 HOH B O   1 
HETATM 1399 O O   . HOH D 2 .  ? -3.880  17.239  -14.647 1.00 41.31 ? 161 HOH B O   1 
HETATM 1400 O O   . HOH D 2 .  ? 11.711  21.391  -14.493 1.00 50.14 ? 162 HOH B O   1 
HETATM 1401 O O   . HOH D 2 .  ? 13.869  2.166   -20.181 1.00 45.78 ? 163 HOH B O   1 
HETATM 1402 O O   . HOH D 2 .  ? -7.436  8.530   -7.613  1.00 43.19 ? 164 HOH B O   1 
HETATM 1403 O O   . HOH D 2 .  ? 4.061   9.775   2.190   1.00 41.30 ? 165 HOH B O   1 
HETATM 1404 O O   . HOH D 2 .  ? -7.892  4.428   -13.150 1.00 39.51 ? 166 HOH B O   1 
HETATM 1405 O O   . HOH D 2 .  ? -1.089  20.191  -12.769 1.00 44.79 ? 168 HOH B O   1 
HETATM 1406 O O   . HOH D 2 .  ? -8.958  -0.497  -8.906  1.00 54.52 ? 169 HOH B O   1 
HETATM 1407 O O   . HOH D 2 .  ? -7.766  0.657   -11.043 1.00 43.12 ? 170 HOH B O   1 
HETATM 1408 O O   . HOH D 2 .  ? -13.781 -1.723  -6.388  1.00 50.60 ? 171 HOH B O   1 
HETATM 1409 O O   . HOH D 2 .  ? 3.457   22.253  -16.735 1.00 50.01 ? 172 HOH B O   1 
HETATM 1410 O O   . HOH D 2 .  ? 6.596   7.501   2.364   1.00 39.63 ? 173 HOH B O   1 
HETATM 1411 O O   . HOH D 2 .  ? -11.654 -12.775 3.070   1.00 47.08 ? 174 HOH B O   1 
HETATM 1412 O O   . HOH D 2 .  ? -1.591  11.106  2.074   1.00 47.32 ? 175 HOH B O   1 
HETATM 1413 O O   . HOH D 2 .  ? 8.202   26.495  -8.144  1.00 37.93 ? 176 HOH B O   1 
HETATM 1414 O O   . HOH D 2 .  ? 1.667   18.994  -19.226 1.00 40.54 ? 177 HOH B O   1 
HETATM 1415 O O   . HOH D 2 .  ? 2.853   20.905  -21.399 1.00 51.44 ? 178 HOH B O   1 
HETATM 1416 O O   . HOH D 2 .  ? 17.955  23.343  -7.590  1.00 45.87 ? 179 HOH B O   1 
HETATM 1417 O O   . HOH D 2 .  ? -8.548  7.025   -9.065  1.00 46.15 ? 180 HOH B O   1 
HETATM 1418 O O   . HOH D 2 .  ? 19.509  13.008  -2.866  1.00 53.32 ? 181 HOH B O   1 
HETATM 1419 O O   . HOH D 2 .  ? 21.925  14.452  1.376   1.00 49.00 ? 182 HOH B O   1 
HETATM 1420 O O   . HOH D 2 .  ? 0.159   14.888  -19.791 1.00 48.94 ? 183 HOH B O   1 
HETATM 1421 O O   . HOH D 2 .  ? 0.839   -3.655  18.183  1.00 38.67 ? 184 HOH B O   1 
HETATM 1422 O O   . HOH D 2 .  ? -12.201 -10.518 2.214   1.00 39.84 ? 185 HOH B O   1 
HETATM 1423 O O   . HOH D 2 .  ? 3.283   22.230  -0.592  1.00 39.37 ? 186 HOH B O   1 
HETATM 1424 O O   . HOH D 2 .  ? 19.108  5.529   -6.571  1.00 38.39 ? 187 HOH B O   1 
HETATM 1425 O O   . HOH D 2 .  ? -15.322 -4.720  1.690   1.00 36.36 ? 188 HOH B O   1 
HETATM 1426 O O   . HOH D 2 .  ? 10.905  5.266   2.186   1.00 34.66 ? 189 HOH B O   1 
HETATM 1427 O O   . HOH D 2 .  ? -16.856 -6.412  2.616   1.00 30.00 ? 190 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  GLY 3  3  3  GLY GLY A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  LEU 6  6  6  LEU LEU A . n 
A 1 7  MET 7  7  7  MET MET A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ARG 10 10 10 ARG ARG A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 ASN 12 12 12 ASN ASN A . n 
A 1 13 GLU 13 13 13 GLU GLU A . n 
A 1 14 GLU 14 14 14 GLU GLU A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 GLY 16 16 16 GLY GLY A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 ARG 18 18 18 ARG ARG A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 GLY 20 20 20 GLY GLY A . n 
A 1 21 SER 21 21 21 SER SER A . n 
A 1 22 GLN 22 22 22 GLN GLN A . n 
A 1 23 ILE 23 23 23 ILE ILE A . n 
A 1 24 PHE 24 24 24 PHE PHE A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 LYS 26 26 26 LYS LYS A . n 
A 1 27 GLU 27 27 27 GLU GLU A . n 
A 1 28 MET 28 28 28 MET MET A . n 
A 1 29 THR 29 29 29 THR THR A . n 
A 1 30 ARG 30 30 30 ARG ARG A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 ALA 34 34 34 ALA ALA A . n 
A 1 35 THR 35 35 35 THR THR A . n 
A 1 36 LYS 36 36 36 LYS LYS A . n 
A 1 37 ASP 37 37 37 ASP ASP A . n 
A 1 38 GLY 38 38 38 GLY GLY A . n 
A 1 39 ASN 39 39 39 ASN ASN A . n 
A 1 40 LEU 40 40 40 LEU LEU A . n 
A 1 41 HIS 41 41 41 HIS HIS A . n 
A 1 42 GLU 42 42 42 GLU GLU A . n 
A 1 43 GLY 43 43 43 GLY GLY A . n 
A 1 44 ASP 44 44 44 ASP ASP A . n 
A 1 45 ILE 45 45 45 ILE ILE A . n 
A 1 46 ILE 46 46 46 ILE ILE A . n 
A 1 47 LEU 47 47 47 LEU LEU A . n 
A 1 48 LYS 48 48 48 LYS LYS A . n 
A 1 49 ILE 49 49 49 ILE ILE A . n 
A 1 50 ASN 50 50 50 ASN ASN A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 THR 52 52 52 THR THR A . n 
A 1 53 VAL 53 53 53 VAL VAL A . n 
A 1 54 THR 54 54 54 THR THR A . n 
A 1 55 GLU 55 55 55 GLU GLU A . n 
A 1 56 ASN 56 56 56 ASN ASN A . n 
A 1 57 MET 57 57 57 MET MET A . n 
A 1 58 SER 58 58 58 SER SER A . n 
A 1 59 LEU 59 59 59 LEU LEU A . n 
A 1 60 THR 60 60 60 THR THR A . n 
A 1 61 ASP 61 61 61 ASP ASP A . n 
A 1 62 ALA 62 62 62 ALA ALA A . n 
A 1 63 ARG 63 63 63 ARG ARG A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 LEU 65 65 65 LEU LEU A . n 
A 1 66 ILE 66 66 66 ILE ILE A . n 
A 1 67 GLU 67 67 67 GLU GLU A . n 
A 1 68 LYS 68 68 68 LYS LYS A . n 
A 1 69 SER 69 69 69 SER SER A . n 
A 1 70 ARG 70 70 70 ARG ARG A . n 
A 1 71 GLY 71 71 71 GLY GLY A . n 
A 1 72 LYS 72 72 72 LYS LYS A . n 
A 1 73 LEU 73 73 73 LEU LEU A . n 
A 1 74 GLN 74 74 74 GLN GLN A . n 
A 1 75 LEU 75 75 75 LEU LEU A . n 
A 1 76 VAL 76 76 76 VAL VAL A . n 
A 1 77 VAL 77 77 77 VAL VAL A . n 
A 1 78 LEU 78 78 78 LEU LEU A . n 
A 1 79 ARG 79 79 79 ARG ARG A . n 
A 1 80 ASP 80 80 80 ASP ASP A . n 
A 1 81 LEU 81 81 ?  ?   ?   A . n 
A 1 82 GLU 82 82 ?  ?   ?   A . n 
A 1 83 HIS 83 83 ?  ?   ?   A . n 
A 1 84 HIS 84 84 ?  ?   ?   A . n 
A 1 85 HIS 85 85 ?  ?   ?   A . n 
A 1 86 HIS 86 86 ?  ?   ?   A . n 
A 1 87 HIS 87 87 ?  ?   ?   A . n 
A 1 88 HIS 88 88 ?  ?   ?   A . n 
B 1 1  MET 1  1  1  MET MET B . n 
B 1 2  ILE 2  2  2  ILE ILE B . n 
B 1 3  GLY 3  3  3  GLY GLY B . n 
B 1 4  VAL 4  4  4  VAL VAL B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  LEU 6  6  6  LEU LEU B . n 
B 1 7  MET 7  7  7  MET MET B . n 
B 1 8  LYS 8  8  8  LYS LYS B . n 
B 1 9  SER 9  9  9  SER SER B . n 
B 1 10 ARG 10 10 10 ARG ARG B . n 
B 1 11 ALA 11 11 11 ALA ALA B . n 
B 1 12 ASN 12 12 12 ASN ASN B . n 
B 1 13 GLU 13 13 13 GLU GLU B . n 
B 1 14 GLU 14 14 14 GLU GLU B . n 
B 1 15 TYR 15 15 15 TYR TYR B . n 
B 1 16 GLY 16 16 16 GLY GLY B . n 
B 1 17 LEU 17 17 17 LEU LEU B . n 
B 1 18 ARG 18 18 18 ARG ARG B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 GLY 20 20 20 GLY GLY B . n 
B 1 21 SER 21 21 21 SER SER B . n 
B 1 22 GLN 22 22 22 GLN GLN B . n 
B 1 23 ILE 23 23 23 ILE ILE B . n 
B 1 24 PHE 24 24 24 PHE PHE B . n 
B 1 25 VAL 25 25 25 VAL VAL B . n 
B 1 26 LYS 26 26 26 LYS LYS B . n 
B 1 27 GLU 27 27 27 GLU GLU B . n 
B 1 28 MET 28 28 28 MET MET B . n 
B 1 29 THR 29 29 29 THR THR B . n 
B 1 30 ARG 30 30 30 ARG ARG B . n 
B 1 31 THR 31 31 31 THR THR B . n 
B 1 32 GLY 32 32 32 GLY GLY B . n 
B 1 33 LEU 33 33 33 LEU LEU B . n 
B 1 34 ALA 34 34 34 ALA ALA B . n 
B 1 35 THR 35 35 35 THR THR B . n 
B 1 36 LYS 36 36 36 LYS LYS B . n 
B 1 37 ASP 37 37 37 ASP ASP B . n 
B 1 38 GLY 38 38 38 GLY GLY B . n 
B 1 39 ASN 39 39 39 ASN ASN B . n 
B 1 40 LEU 40 40 40 LEU LEU B . n 
B 1 41 HIS 41 41 41 HIS HIS B . n 
B 1 42 GLU 42 42 42 GLU GLU B . n 
B 1 43 GLY 43 43 43 GLY GLY B . n 
B 1 44 ASP 44 44 44 ASP ASP B . n 
B 1 45 ILE 45 45 45 ILE ILE B . n 
B 1 46 ILE 46 46 46 ILE ILE B . n 
B 1 47 LEU 47 47 47 LEU LEU B . n 
B 1 48 LYS 48 48 48 LYS LYS B . n 
B 1 49 ILE 49 49 49 ILE ILE B . n 
B 1 50 ASN 50 50 50 ASN ASN B . n 
B 1 51 GLY 51 51 51 GLY GLY B . n 
B 1 52 THR 52 52 52 THR THR B . n 
B 1 53 VAL 53 53 53 VAL VAL B . n 
B 1 54 THR 54 54 54 THR THR B . n 
B 1 55 GLU 55 55 55 GLU GLU B . n 
B 1 56 ASN 56 56 56 ASN ASN B . n 
B 1 57 MET 57 57 57 MET MET B . n 
B 1 58 SER 58 58 58 SER SER B . n 
B 1 59 LEU 59 59 59 LEU LEU B . n 
B 1 60 THR 60 60 60 THR THR B . n 
B 1 61 ASP 61 61 61 ASP ASP B . n 
B 1 62 ALA 62 62 62 ALA ALA B . n 
B 1 63 ARG 63 63 63 ARG ARG B . n 
B 1 64 LYS 64 64 64 LYS LYS B . n 
B 1 65 LEU 65 65 65 LEU LEU B . n 
B 1 66 ILE 66 66 66 ILE ILE B . n 
B 1 67 GLU 67 67 67 GLU GLU B . n 
B 1 68 LYS 68 68 68 LYS LYS B . n 
B 1 69 SER 69 69 69 SER SER B . n 
B 1 70 ARG 70 70 70 ARG ARG B . n 
B 1 71 GLY 71 71 71 GLY GLY B . n 
B 1 72 LYS 72 72 72 LYS LYS B . n 
B 1 73 LEU 73 73 73 LEU LEU B . n 
B 1 74 GLN 74 74 74 GLN GLN B . n 
B 1 75 LEU 75 75 75 LEU LEU B . n 
B 1 76 VAL 76 76 76 VAL VAL B . n 
B 1 77 VAL 77 77 77 VAL VAL B . n 
B 1 78 LEU 78 78 78 LEU LEU B . n 
B 1 79 ARG 79 79 79 ARG ARG B . n 
B 1 80 ASP 80 80 ?  ?   ?   B . n 
B 1 81 LEU 81 81 ?  ?   ?   B . n 
B 1 82 GLU 82 82 ?  ?   ?   B . n 
B 1 83 HIS 83 83 ?  ?   ?   B . n 
B 1 84 HIS 84 84 ?  ?   ?   B . n 
B 1 85 HIS 85 85 ?  ?   ?   B . n 
B 1 86 HIS 86 86 ?  ?   ?   B . n 
B 1 87 HIS 87 87 ?  ?   ?   B . n 
B 1 88 HIS 88 88 ?  ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   89  1   HOH HOH A . 
C 2 HOH 2   90  3   HOH HOH A . 
C 2 HOH 3   91  4   HOH HOH A . 
C 2 HOH 4   92  7   HOH HOH A . 
C 2 HOH 5   93  9   HOH HOH A . 
C 2 HOH 6   94  10  HOH HOH A . 
C 2 HOH 7   95  12  HOH HOH A . 
C 2 HOH 8   96  13  HOH HOH A . 
C 2 HOH 9   97  14  HOH HOH A . 
C 2 HOH 10  98  16  HOH HOH A . 
C 2 HOH 11  99  20  HOH HOH A . 
C 2 HOH 12  100 21  HOH HOH A . 
C 2 HOH 13  101 23  HOH HOH A . 
C 2 HOH 14  102 24  HOH HOH A . 
C 2 HOH 15  103 25  HOH HOH A . 
C 2 HOH 16  104 26  HOH HOH A . 
C 2 HOH 17  105 27  HOH HOH A . 
C 2 HOH 18  106 28  HOH HOH A . 
C 2 HOH 19  107 29  HOH HOH A . 
C 2 HOH 20  108 30  HOH HOH A . 
C 2 HOH 21  109 33  HOH HOH A . 
C 2 HOH 22  110 35  HOH HOH A . 
C 2 HOH 23  111 37  HOH HOH A . 
C 2 HOH 24  112 38  HOH HOH A . 
C 2 HOH 25  113 39  HOH HOH A . 
C 2 HOH 26  114 43  HOH HOH A . 
C 2 HOH 27  115 47  HOH HOH A . 
C 2 HOH 28  116 49  HOH HOH A . 
C 2 HOH 29  117 51  HOH HOH A . 
C 2 HOH 30  118 52  HOH HOH A . 
C 2 HOH 31  119 53  HOH HOH A . 
C 2 HOH 32  120 54  HOH HOH A . 
C 2 HOH 33  121 56  HOH HOH A . 
C 2 HOH 34  122 59  HOH HOH A . 
C 2 HOH 35  123 60  HOH HOH A . 
C 2 HOH 36  124 61  HOH HOH A . 
C 2 HOH 37  125 65  HOH HOH A . 
C 2 HOH 38  126 66  HOH HOH A . 
C 2 HOH 39  127 69  HOH HOH A . 
C 2 HOH 40  128 70  HOH HOH A . 
C 2 HOH 41  129 73  HOH HOH A . 
C 2 HOH 42  130 75  HOH HOH A . 
C 2 HOH 43  131 76  HOH HOH A . 
C 2 HOH 44  132 77  HOH HOH A . 
C 2 HOH 45  133 78  HOH HOH A . 
C 2 HOH 46  134 82  HOH HOH A . 
C 2 HOH 47  135 83  HOH HOH A . 
C 2 HOH 48  136 84  HOH HOH A . 
C 2 HOH 49  137 89  HOH HOH A . 
C 2 HOH 50  138 93  HOH HOH A . 
C 2 HOH 51  139 94  HOH HOH A . 
C 2 HOH 52  140 96  HOH HOH A . 
C 2 HOH 53  141 97  HOH HOH A . 
C 2 HOH 54  142 99  HOH HOH A . 
C 2 HOH 55  143 100 HOH HOH A . 
C 2 HOH 56  144 102 HOH HOH A . 
C 2 HOH 57  145 104 HOH HOH A . 
C 2 HOH 58  146 113 HOH HOH A . 
C 2 HOH 59  147 114 HOH HOH A . 
C 2 HOH 60  148 115 HOH HOH A . 
C 2 HOH 61  149 116 HOH HOH A . 
C 2 HOH 62  150 117 HOH HOH A . 
C 2 HOH 63  151 119 HOH HOH A . 
C 2 HOH 64  152 120 HOH HOH A . 
C 2 HOH 65  153 121 HOH HOH A . 
C 2 HOH 66  154 124 HOH HOH A . 
C 2 HOH 67  155 129 HOH HOH A . 
C 2 HOH 68  156 130 HOH HOH A . 
C 2 HOH 69  157 132 HOH HOH A . 
C 2 HOH 70  158 134 HOH HOH A . 
C 2 HOH 71  159 136 HOH HOH A . 
C 2 HOH 72  160 139 HOH HOH A . 
C 2 HOH 73  161 140 HOH HOH A . 
C 2 HOH 74  162 142 HOH HOH A . 
C 2 HOH 75  163 144 HOH HOH A . 
C 2 HOH 76  164 145 HOH HOH A . 
C 2 HOH 77  165 148 HOH HOH A . 
C 2 HOH 78  166 151 HOH HOH A . 
C 2 HOH 79  167 153 HOH HOH A . 
C 2 HOH 80  168 154 HOH HOH A . 
C 2 HOH 81  169 158 HOH HOH A . 
C 2 HOH 82  170 160 HOH HOH A . 
C 2 HOH 83  171 163 HOH HOH A . 
C 2 HOH 84  172 164 HOH HOH A . 
C 2 HOH 85  173 166 HOH HOH A . 
C 2 HOH 86  174 167 HOH HOH A . 
C 2 HOH 87  175 168 HOH HOH A . 
C 2 HOH 88  176 169 HOH HOH A . 
C 2 HOH 89  177 170 HOH HOH A . 
C 2 HOH 90  178 172 HOH HOH A . 
C 2 HOH 91  179 175 HOH HOH A . 
C 2 HOH 92  180 176 HOH HOH A . 
C 2 HOH 93  181 179 HOH HOH A . 
C 2 HOH 94  182 180 HOH HOH A . 
C 2 HOH 95  183 181 HOH HOH A . 
C 2 HOH 96  184 183 HOH HOH A . 
C 2 HOH 97  185 184 HOH HOH A . 
C 2 HOH 98  186 191 HOH HOH A . 
C 2 HOH 99  187 192 HOH HOH A . 
C 2 HOH 100 188 195 HOH HOH A . 
C 2 HOH 101 189 196 HOH HOH A . 
C 2 HOH 102 190 17  HOH HOH A . 
C 2 HOH 103 191 161 HOH HOH A . 
D 2 HOH 1   89  2   HOH HOH B . 
D 2 HOH 2   90  5   HOH HOH B . 
D 2 HOH 3   91  6   HOH HOH B . 
D 2 HOH 4   92  8   HOH HOH B . 
D 2 HOH 5   93  11  HOH HOH B . 
D 2 HOH 6   94  15  HOH HOH B . 
D 2 HOH 7   96  18  HOH HOH B . 
D 2 HOH 8   97  19  HOH HOH B . 
D 2 HOH 9   98  22  HOH HOH B . 
D 2 HOH 10  99  31  HOH HOH B . 
D 2 HOH 11  100 32  HOH HOH B . 
D 2 HOH 12  101 34  HOH HOH B . 
D 2 HOH 13  102 36  HOH HOH B . 
D 2 HOH 14  103 40  HOH HOH B . 
D 2 HOH 15  104 41  HOH HOH B . 
D 2 HOH 16  105 42  HOH HOH B . 
D 2 HOH 17  106 44  HOH HOH B . 
D 2 HOH 18  107 45  HOH HOH B . 
D 2 HOH 19  108 46  HOH HOH B . 
D 2 HOH 20  109 48  HOH HOH B . 
D 2 HOH 21  110 50  HOH HOH B . 
D 2 HOH 22  111 55  HOH HOH B . 
D 2 HOH 23  112 57  HOH HOH B . 
D 2 HOH 24  113 58  HOH HOH B . 
D 2 HOH 25  114 62  HOH HOH B . 
D 2 HOH 26  115 63  HOH HOH B . 
D 2 HOH 27  116 64  HOH HOH B . 
D 2 HOH 28  117 67  HOH HOH B . 
D 2 HOH 29  118 68  HOH HOH B . 
D 2 HOH 30  119 71  HOH HOH B . 
D 2 HOH 31  120 72  HOH HOH B . 
D 2 HOH 32  121 74  HOH HOH B . 
D 2 HOH 33  122 79  HOH HOH B . 
D 2 HOH 34  123 80  HOH HOH B . 
D 2 HOH 35  124 81  HOH HOH B . 
D 2 HOH 36  125 85  HOH HOH B . 
D 2 HOH 37  126 86  HOH HOH B . 
D 2 HOH 38  127 87  HOH HOH B . 
D 2 HOH 39  128 88  HOH HOH B . 
D 2 HOH 40  129 90  HOH HOH B . 
D 2 HOH 41  130 91  HOH HOH B . 
D 2 HOH 42  131 92  HOH HOH B . 
D 2 HOH 43  132 95  HOH HOH B . 
D 2 HOH 44  133 98  HOH HOH B . 
D 2 HOH 45  134 101 HOH HOH B . 
D 2 HOH 46  135 103 HOH HOH B . 
D 2 HOH 47  136 105 HOH HOH B . 
D 2 HOH 48  137 106 HOH HOH B . 
D 2 HOH 49  138 107 HOH HOH B . 
D 2 HOH 50  139 108 HOH HOH B . 
D 2 HOH 51  140 109 HOH HOH B . 
D 2 HOH 52  141 110 HOH HOH B . 
D 2 HOH 53  142 111 HOH HOH B . 
D 2 HOH 54  143 112 HOH HOH B . 
D 2 HOH 55  144 118 HOH HOH B . 
D 2 HOH 56  145 122 HOH HOH B . 
D 2 HOH 57  146 123 HOH HOH B . 
D 2 HOH 58  147 125 HOH HOH B . 
D 2 HOH 59  148 126 HOH HOH B . 
D 2 HOH 60  149 127 HOH HOH B . 
D 2 HOH 61  150 128 HOH HOH B . 
D 2 HOH 62  151 131 HOH HOH B . 
D 2 HOH 63  152 133 HOH HOH B . 
D 2 HOH 64  153 135 HOH HOH B . 
D 2 HOH 65  154 137 HOH HOH B . 
D 2 HOH 66  155 138 HOH HOH B . 
D 2 HOH 67  156 141 HOH HOH B . 
D 2 HOH 68  157 143 HOH HOH B . 
D 2 HOH 69  158 146 HOH HOH B . 
D 2 HOH 70  159 147 HOH HOH B . 
D 2 HOH 71  160 149 HOH HOH B . 
D 2 HOH 72  161 150 HOH HOH B . 
D 2 HOH 73  162 152 HOH HOH B . 
D 2 HOH 74  163 155 HOH HOH B . 
D 2 HOH 75  164 156 HOH HOH B . 
D 2 HOH 76  165 157 HOH HOH B . 
D 2 HOH 77  166 159 HOH HOH B . 
D 2 HOH 78  168 162 HOH HOH B . 
D 2 HOH 79  169 165 HOH HOH B . 
D 2 HOH 80  170 171 HOH HOH B . 
D 2 HOH 81  171 173 HOH HOH B . 
D 2 HOH 82  172 174 HOH HOH B . 
D 2 HOH 83  173 177 HOH HOH B . 
D 2 HOH 84  174 178 HOH HOH B . 
D 2 HOH 85  175 182 HOH HOH B . 
D 2 HOH 86  176 185 HOH HOH B . 
D 2 HOH 87  177 186 HOH HOH B . 
D 2 HOH 88  178 187 HOH HOH B . 
D 2 HOH 89  179 188 HOH HOH B . 
D 2 HOH 90  180 189 HOH HOH B . 
D 2 HOH 91  181 190 HOH HOH B . 
D 2 HOH 92  182 193 HOH HOH B . 
D 2 HOH 93  183 194 HOH HOH B . 
D 2 HOH 94  184 197 HOH HOH B . 
D 2 HOH 95  185 198 HOH HOH B . 
D 2 HOH 96  186 199 HOH HOH B . 
D 2 HOH 97  187 200 HOH HOH B . 
D 2 HOH 98  188 201 HOH HOH B . 
D 2 HOH 99  189 202 HOH HOH B . 
D 2 HOH 100 190 203 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5480  ? 
1 MORE         -33.2 ? 
1 'SSA (A^2)'  9070  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-21 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com       'data reduction'  
http://www.hkl-xray.com/                     ?          ? 1 
SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com       'data scaling'    
http://www.hkl-xray.com/                     ?          ? 2 
MOLREP      .        ?               program 'Alexei Vaguine'     alexei@ysbl.york.ac.uk phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html  Fortran_77 ? 3 
REFMAC      5.4.0067 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk  refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org  'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 5 
MAR345dtb   .        ?               ?       ?                    ?                      'data collection' ? ?          ? 6 
AUTOMAR     .        ?               ?       ?                    ?                      'data reduction'  ? ?          ? 7 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     12 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -166.12 
_pdbx_validate_torsion.psi             113.02 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 68 ? CD  ? A LYS 68 CD  
2  1 Y 1 A LYS 68 ? CE  ? A LYS 68 CE  
3  1 Y 1 A LYS 68 ? NZ  ? A LYS 68 NZ  
4  1 Y 1 A ASP 80 ? CG  ? A ASP 80 CG  
5  1 Y 1 A ASP 80 ? OD1 ? A ASP 80 OD1 
6  1 Y 1 A ASP 80 ? OD2 ? A ASP 80 OD2 
7  1 Y 1 B ARG 70 ? CG  ? B ARG 70 CG  
8  1 Y 1 B ARG 70 ? CD  ? B ARG 70 CD  
9  1 Y 1 B ARG 70 ? NE  ? B ARG 70 NE  
10 1 Y 1 B ARG 70 ? CZ  ? B ARG 70 CZ  
11 1 Y 1 B ARG 70 ? NH1 ? B ARG 70 NH1 
12 1 Y 1 B ARG 70 ? NH2 ? B ARG 70 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LEU 81 ? A LEU 81 
2  1 Y 1 A GLU 82 ? A GLU 82 
3  1 Y 1 A HIS 83 ? A HIS 83 
4  1 Y 1 A HIS 84 ? A HIS 84 
5  1 Y 1 A HIS 85 ? A HIS 85 
6  1 Y 1 A HIS 86 ? A HIS 86 
7  1 Y 1 A HIS 87 ? A HIS 87 
8  1 Y 1 A HIS 88 ? A HIS 88 
9  1 Y 1 B ASP 80 ? B ASP 80 
10 1 Y 1 B LEU 81 ? B LEU 81 
11 1 Y 1 B GLU 82 ? B GLU 82 
12 1 Y 1 B HIS 83 ? B HIS 83 
13 1 Y 1 B HIS 84 ? B HIS 84 
14 1 Y 1 B HIS 85 ? B HIS 85 
15 1 Y 1 B HIS 86 ? B HIS 86 
16 1 Y 1 B HIS 87 ? B HIS 87 
17 1 Y 1 B HIS 88 ? B HIS 88 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#