data_3E5A
# 
_entry.id   3E5A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3E5A         
RCSB  RCSB048892   
WWPDB D_1000048892 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3E5A 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhao, B.'      1 
'Smallwood, A.' 2 
'Lai, Z.'       3 
# 
_citation.id                        primary 
_citation.title                     
;Modulation of kinase-inhibitor interactions by auxiliary protein binding: crystallography studies on Aurora A interactions with VX-680 and with TPX2.
;
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            17 
_citation.page_first                1791 
_citation.page_last                 1797 
_citation.year                      2008 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18662907 
_citation.pdbx_database_id_DOI      10.1110/ps.036590.108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhao, B.'          1 
primary 'Smallwood, A.'     2 
primary 'Yang, J.'          3 
primary 'Koretke, K.'       4 
primary 'Nurse, K.'         5 
primary 'Calamari, A.'      6 
primary 'Kirkpatrick, R.B.' 7 
primary 'Lai, Z.'           8 
# 
_cell.entry_id           3E5A 
_cell.length_a           87.186 
_cell.length_b           89.097 
_cell.length_c           88.499 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3E5A 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase 6' 31173.727 1  2.7.11.1 ? 'Residues 122-403' ? 
2 polymer     man 'Targeting protein for Xklp2' 4984.162  1  ?        ? 'Residues 1-43'    ? 
3 non-polymer syn 
'CYCLOPROPANECARBOXYLIC ACID {4-[4-(4-METHYL-PIPERAZIN-1-YL)-6-(5-METHYL-2H-PYRAZOL-3-YLAMINO)-PYRIMIDIN-2-YLSULFANYL]-PHENYL}-AMIDE' 
464.586   1  ?        ? ?                  ? 
4 non-polymer syn 'SULFATE ION' 96.063    1  ?        ? ?                  ? 
5 water       nat water 18.015    58 ?        ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Aurora kinase A, Aurora-A, Serine/threonine kinase 15, Aurora/IPL1-related kinase 1, Aurora-related kinase 1, hARK1, Breast tumor-amplified kinase
;
2 
;TPX2, Restricted expression proliferation-associated protein 100, p100, Differentially expressed in cancerous and non-cancerous lung cells 2, DIL-2, Protein fls353, Hepatocellular carcinoma-associated antigen 519
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;GKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA
TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS
SRRT(TPO)LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL
ISRLLKHNPSQRPMLREVLEHPWITANSSKPS
;
;GKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA
TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS
SRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRL
LKHNPSQRPMLREVLEHPWITANSSKPS
;
A ? 
2 'polypeptide(L)' no no  GMSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN GMSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   LYS n 
1 3   ARG n 
1 4   GLN n 
1 5   TRP n 
1 6   ALA n 
1 7   LEU n 
1 8   GLU n 
1 9   ASP n 
1 10  PHE n 
1 11  GLU n 
1 12  ILE n 
1 13  GLY n 
1 14  ARG n 
1 15  PRO n 
1 16  LEU n 
1 17  GLY n 
1 18  LYS n 
1 19  GLY n 
1 20  LYS n 
1 21  PHE n 
1 22  GLY n 
1 23  ASN n 
1 24  VAL n 
1 25  TYR n 
1 26  LEU n 
1 27  ALA n 
1 28  ARG n 
1 29  GLU n 
1 30  LYS n 
1 31  GLN n 
1 32  SER n 
1 33  LYS n 
1 34  PHE n 
1 35  ILE n 
1 36  LEU n 
1 37  ALA n 
1 38  LEU n 
1 39  LYS n 
1 40  VAL n 
1 41  LEU n 
1 42  PHE n 
1 43  LYS n 
1 44  ALA n 
1 45  GLN n 
1 46  LEU n 
1 47  GLU n 
1 48  LYS n 
1 49  ALA n 
1 50  GLY n 
1 51  VAL n 
1 52  GLU n 
1 53  HIS n 
1 54  GLN n 
1 55  LEU n 
1 56  ARG n 
1 57  ARG n 
1 58  GLU n 
1 59  VAL n 
1 60  GLU n 
1 61  ILE n 
1 62  GLN n 
1 63  SER n 
1 64  HIS n 
1 65  LEU n 
1 66  ARG n 
1 67  HIS n 
1 68  PRO n 
1 69  ASN n 
1 70  ILE n 
1 71  LEU n 
1 72  ARG n 
1 73  LEU n 
1 74  TYR n 
1 75  GLY n 
1 76  TYR n 
1 77  PHE n 
1 78  HIS n 
1 79  ASP n 
1 80  ALA n 
1 81  THR n 
1 82  ARG n 
1 83  VAL n 
1 84  TYR n 
1 85  LEU n 
1 86  ILE n 
1 87  LEU n 
1 88  GLU n 
1 89  TYR n 
1 90  ALA n 
1 91  PRO n 
1 92  LEU n 
1 93  GLY n 
1 94  THR n 
1 95  VAL n 
1 96  TYR n 
1 97  ARG n 
1 98  GLU n 
1 99  LEU n 
1 100 GLN n 
1 101 LYS n 
1 102 LEU n 
1 103 SER n 
1 104 LYS n 
1 105 PHE n 
1 106 ASP n 
1 107 GLU n 
1 108 GLN n 
1 109 ARG n 
1 110 THR n 
1 111 ALA n 
1 112 THR n 
1 113 TYR n 
1 114 ILE n 
1 115 THR n 
1 116 GLU n 
1 117 LEU n 
1 118 ALA n 
1 119 ASN n 
1 120 ALA n 
1 121 LEU n 
1 122 SER n 
1 123 TYR n 
1 124 CYS n 
1 125 HIS n 
1 126 SER n 
1 127 LYS n 
1 128 ARG n 
1 129 VAL n 
1 130 ILE n 
1 131 HIS n 
1 132 ARG n 
1 133 ASP n 
1 134 ILE n 
1 135 LYS n 
1 136 PRO n 
1 137 GLU n 
1 138 ASN n 
1 139 LEU n 
1 140 LEU n 
1 141 LEU n 
1 142 GLY n 
1 143 SER n 
1 144 ALA n 
1 145 GLY n 
1 146 GLU n 
1 147 LEU n 
1 148 LYS n 
1 149 ILE n 
1 150 ALA n 
1 151 ASP n 
1 152 PHE n 
1 153 GLY n 
1 154 TRP n 
1 155 SER n 
1 156 VAL n 
1 157 HIS n 
1 158 ALA n 
1 159 PRO n 
1 160 SER n 
1 161 SER n 
1 162 ARG n 
1 163 ARG n 
1 164 THR n 
1 165 TPO n 
1 166 LEU n 
1 167 CYS n 
1 168 GLY n 
1 169 THR n 
1 170 LEU n 
1 171 ASP n 
1 172 TYR n 
1 173 LEU n 
1 174 PRO n 
1 175 PRO n 
1 176 GLU n 
1 177 MET n 
1 178 ILE n 
1 179 GLU n 
1 180 GLY n 
1 181 ARG n 
1 182 MET n 
1 183 HIS n 
1 184 ASP n 
1 185 GLU n 
1 186 LYS n 
1 187 VAL n 
1 188 ASP n 
1 189 LEU n 
1 190 TRP n 
1 191 SER n 
1 192 LEU n 
1 193 GLY n 
1 194 VAL n 
1 195 LEU n 
1 196 CYS n 
1 197 TYR n 
1 198 GLU n 
1 199 PHE n 
1 200 LEU n 
1 201 VAL n 
1 202 GLY n 
1 203 LYS n 
1 204 PRO n 
1 205 PRO n 
1 206 PHE n 
1 207 GLU n 
1 208 ALA n 
1 209 ASN n 
1 210 THR n 
1 211 TYR n 
1 212 GLN n 
1 213 GLU n 
1 214 THR n 
1 215 TYR n 
1 216 LYS n 
1 217 ARG n 
1 218 ILE n 
1 219 SER n 
1 220 ARG n 
1 221 VAL n 
1 222 GLU n 
1 223 PHE n 
1 224 THR n 
1 225 PHE n 
1 226 PRO n 
1 227 ASP n 
1 228 PHE n 
1 229 VAL n 
1 230 THR n 
1 231 GLU n 
1 232 GLY n 
1 233 ALA n 
1 234 ARG n 
1 235 ASP n 
1 236 LEU n 
1 237 ILE n 
1 238 SER n 
1 239 ARG n 
1 240 LEU n 
1 241 LEU n 
1 242 LYS n 
1 243 HIS n 
1 244 ASN n 
1 245 PRO n 
1 246 SER n 
1 247 GLN n 
1 248 ARG n 
1 249 PRO n 
1 250 MET n 
1 251 LEU n 
1 252 ARG n 
1 253 GLU n 
1 254 VAL n 
1 255 LEU n 
1 256 GLU n 
1 257 HIS n 
1 258 PRO n 
1 259 TRP n 
1 260 ILE n 
1 261 THR n 
1 262 ALA n 
1 263 ASN n 
1 264 SER n 
1 265 SER n 
1 266 LYS n 
1 267 PRO n 
1 268 SER n 
2 1   GLY n 
2 2   MET n 
2 3   SER n 
2 4   GLN n 
2 5   VAL n 
2 6   LYS n 
2 7   SER n 
2 8   SER n 
2 9   TYR n 
2 10  SER n 
2 11  TYR n 
2 12  ASP n 
2 13  ALA n 
2 14  PRO n 
2 15  SER n 
2 16  ASP n 
2 17  PHE n 
2 18  ILE n 
2 19  ASN n 
2 20  PHE n 
2 21  SER n 
2 22  SER n 
2 23  LEU n 
2 24  ASP n 
2 25  ASP n 
2 26  GLU n 
2 27  GLY n 
2 28  ASP n 
2 29  THR n 
2 30  GLN n 
2 31  ASN n 
2 32  ILE n 
2 33  ASP n 
2 34  SER n 
2 35  TRP n 
2 36  PHE n 
2 37  GLU n 
2 38  GLU n 
2 39  LYS n 
2 40  ALA n 
2 41  ASN n 
2 42  LEU n 
2 43  GLU n 
2 44  ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? 'AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' ? ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? Plasmid ? ? ? 'pDest17 tev Aurora A 125-391' ? ? 
2 1 sample ? ? ? ? ? 'TPX2, C20orf1, C20orf2, DIL2, HCA519'      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' ? ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? Plasmid ? ? ? 'pDest17 tev Aurora A 125-391' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP STK6_HUMAN O14965 1 
;KRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAT
RVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSS
RRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLL
KHNPSQRPMLREVLEHPWITANSSKPS
;
125 ? 
2 UNP TPX2_HUMAN Q9ULW0 2 MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3E5A A 2 ? 268 ? O14965 125 ? 391 ? 125 391 
2 2 3E5A B 2 ? 44  ? Q9ULW0 1   ? 43  ? 1   43  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                  'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION' ?                  'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                  'C5 H11 N O2'    117.146 
VX6 non-polymer         . 
'CYCLOPROPANECARBOXYLIC ACID {4-[4-(4-METHYL-PIPERAZIN-1-YL)-6-(5-METHYL-2H-PYRAZOL-3-YLAMINO)-PYRIMIDIN-2-YLSULFANYL]-PHENYL}-AMIDE' 
?                  'C23 H28 N8 O S' 464.586 
# 
_exptl.entry_id          3E5A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.9 
_exptl_crystal_grow.pdbx_details    
'16% PEG 3350 and 0.2 M Lithium sulfate buffered with 100 mM Bis-Tris, pH 6.9, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2007-02-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     3E5A 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            2.30 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   15823 
_reflns.number_obs                   15365 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              0.062 
_reflns.pdbx_netI_over_sigmaI        25.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   78.2 
_reflns_shell.Rmerge_I_obs           0.409 
_reflns_shell.pdbx_Rsym_value        0.272 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1215 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3E5A 
_refine.ls_number_reflns_obs                     12814 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    87.32 
_refine.ls_R_factor_obs                          0.20628 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20318 
_refine.ls_R_factor_R_free                       0.25585 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.1 
_refine.ls_number_reflns_R_free                  833 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.B_iso_mean                               52.914 
_refine.aniso_B[1][1]                            4.61 
_refine.aniso_B[2][2]                            -4.10 
_refine.aniso_B[3][3]                            -0.51 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1OL5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.487 
_refine.pdbx_overall_ESU_R_Free                  0.280 
_refine.overall_SU_ML                            0.232 
_refine.overall_SU_B                             20.125 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2437 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             58 
_refine_hist.number_atoms_total               2533 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 2541 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.659  1.982  ? 3434 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.756  5.000  ? 293  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.281 23.065 ? 124  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.504 15.000 ? 433  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.967 15.000 ? 21   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.099  0.200  ? 360  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 1971 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.225  0.200  ? 1167 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.316  0.200  ? 1713 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.179  0.200  ? 112  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.172  0.200  ? 26   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.348  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.742  1.500  ? 1524 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.239  2.000  ? 2389 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.150  3.000  ? 1167 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.381  4.500  ? 1042 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.359 
_refine_ls_shell.number_reflns_R_work             709 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.percent_reflns_obs               68.93 
_refine_ls_shell.R_factor_R_free                  0.300 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3E5A 
_struct.title                     'Crystal structure of Aurora A in complex with VX-680 and TPX2' 
_struct.pdbx_descriptor           'Serine/threonine-protein kinase 6 (E.C.2.7.11.1), Targeting protein for Xklp2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3E5A 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;AURORA A, SERINE/THREONINE-PROTEIN KINASE, COFACTOR, TPX2, VX-680, INHIBITOR, PHOSPHORYLATION, ATP-binding, Cell cycle, Nucleotide-binding, Phosphoprotein, Transferase, Nucleus
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 6   ? GLU A 8   ? ALA A 129 GLU A 131 5 ? 3  
HELX_P HELX_P2  2  LYS A 18  ? GLY A 22  ? LYS A 141 GLY A 145 5 ? 5  
HELX_P HELX_P3  3  LYS A 43  ? GLY A 50  ? LYS A 166 GLY A 173 1 ? 8  
HELX_P HELX_P4  4  VAL A 51  ? HIS A 64  ? VAL A 174 HIS A 187 1 ? 14 
HELX_P HELX_P5  5  THR A 94  ? SER A 103 ? THR A 217 SER A 226 1 ? 10 
HELX_P HELX_P6  6  ASP A 106 ? SER A 126 ? ASP A 229 SER A 249 1 ? 21 
HELX_P HELX_P7  7  LYS A 135 ? GLU A 137 ? LYS A 258 GLU A 260 5 ? 3  
HELX_P HELX_P8  8  THR A 169 ? LEU A 173 ? THR A 292 LEU A 296 5 ? 5  
HELX_P HELX_P9  9  PRO A 174 ? GLU A 179 ? PRO A 297 GLU A 302 1 ? 6  
HELX_P HELX_P10 10 LYS A 186 ? GLY A 202 ? LYS A 309 GLY A 325 1 ? 17 
HELX_P HELX_P11 11 THR A 210 ? ARG A 220 ? THR A 333 ARG A 343 1 ? 11 
HELX_P HELX_P12 12 THR A 230 ? LEU A 241 ? THR A 353 LEU A 364 1 ? 12 
HELX_P HELX_P13 13 ASN A 244 ? ARG A 248 ? ASN A 367 ARG A 371 5 ? 5  
HELX_P HELX_P14 14 MET A 250 ? HIS A 257 ? MET A 373 HIS A 380 1 ? 8  
HELX_P HELX_P15 15 HIS A 257 ? SER A 264 ? HIS A 380 SER A 387 1 ? 8  
HELX_P HELX_P16 16 THR B 29  ? ASP B 33  ? THR B 28  ASP B 32  5 ? 5  
HELX_P HELX_P17 17 SER B 34  ? LEU B 42  ? SER B 33  LEU B 41  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A THR 164 C ? ? ? 1_555 A TPO 165 N ? ? A THR 287 A TPO 288 1_555 ? ? ? ? ? ? ? 1.291 ? 
covale2 covale ? ? A TPO 165 C ? ? ? 1_555 A LEU 166 N ? ? A TPO 288 A LEU 289 1_555 ? ? ? ? ? ? ? 1.298 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 10  ? PRO A 15  ? PHE A 133 PRO A 138 
A 2 VAL A 24  ? GLU A 29  ? VAL A 147 GLU A 152 
A 3 ILE A 35  ? PHE A 42  ? ILE A 158 PHE A 165 
A 4 ARG A 82  ? LEU A 87  ? ARG A 205 LEU A 210 
A 5 LEU A 73  ? HIS A 78  ? LEU A 196 HIS A 201 
B 1 VAL A 129 ? ILE A 130 ? VAL A 252 ILE A 253 
B 2 VAL A 156 ? HIS A 157 ? VAL A 279 HIS A 280 
C 1 LEU A 139 ? LEU A 141 ? LEU A 262 LEU A 264 
C 2 LEU A 147 ? ILE A 149 ? LEU A 270 ILE A 272 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 13  ? N GLY A 136 O LEU A 26  ? O LEU A 149 
A 2 3 N TYR A 25  ? N TYR A 148 O LEU A 38  ? O LEU A 161 
A 3 4 N LYS A 39  ? N LYS A 162 O LEU A 85  ? O LEU A 208 
A 4 5 O TYR A 84  ? O TYR A 207 N PHE A 77  ? N PHE A 200 
B 1 2 N ILE A 130 ? N ILE A 253 O VAL A 156 ? O VAL A 279 
C 1 2 N LEU A 140 ? N LEU A 263 O LYS A 148 ? O LYS A 271 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE VX6 A 500' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 600' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 HOH E .   ? HOH A 33  . ? 1_555 ? 
2  AC1 15 HOH E .   ? HOH A 36  . ? 1_555 ? 
3  AC1 15 LEU A 16  ? LEU A 139 . ? 1_555 ? 
4  AC1 15 PHE A 21  ? PHE A 144 . ? 1_555 ? 
5  AC1 15 ALA A 37  ? ALA A 160 . ? 1_555 ? 
6  AC1 15 GLU A 88  ? GLU A 211 . ? 1_555 ? 
7  AC1 15 TYR A 89  ? TYR A 212 . ? 1_555 ? 
8  AC1 15 ALA A 90  ? ALA A 213 . ? 1_555 ? 
9  AC1 15 PRO A 91  ? PRO A 214 . ? 1_555 ? 
10 AC1 15 GLY A 93  ? GLY A 216 . ? 1_555 ? 
11 AC1 15 THR A 94  ? THR A 217 . ? 1_555 ? 
12 AC1 15 LYS A 101 ? LYS A 224 . ? 1_555 ? 
13 AC1 15 LEU A 140 ? LEU A 263 . ? 1_555 ? 
14 AC1 15 ALA A 150 ? ALA A 273 . ? 1_555 ? 
15 AC1 15 ASP A 151 ? ASP A 274 . ? 1_555 ? 
16 AC2 5  HOH E .   ? HOH A 52  . ? 1_555 ? 
17 AC2 5  SER A 122 ? SER A 245 . ? 1_555 ? 
18 AC2 5  MET A 250 ? MET A 373 . ? 1_555 ? 
19 AC2 5  LEU A 251 ? LEU A 374 . ? 1_555 ? 
20 AC2 5  ARG A 252 ? ARG A 375 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3E5A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3E5A 
_atom_sites.fract_transf_matrix[1][1]   0.011470 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011224 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011300 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 2   ? 42.606 35.398  -6.517  1.00 64.21 ? 125 LYS A N   1 
ATOM   2    C CA  . LYS A 1 2   ? 41.355 35.977  -5.887  1.00 62.96 ? 125 LYS A CA  1 
ATOM   3    C C   . LYS A 1 2   ? 41.567 36.499  -4.459  1.00 61.77 ? 125 LYS A C   1 
ATOM   4    O O   . LYS A 1 2   ? 42.497 36.082  -3.765  1.00 61.92 ? 125 LYS A O   1 
ATOM   5    C CB  . LYS A 1 2   ? 40.228 34.944  -5.877  1.00 63.19 ? 125 LYS A CB  1 
ATOM   6    C CG  . LYS A 1 2   ? 39.826 34.524  -7.250  1.00 64.68 ? 125 LYS A CG  1 
ATOM   7    C CD  . LYS A 1 2   ? 39.041 33.209  -7.220  1.00 66.80 ? 125 LYS A CD  1 
ATOM   8    C CE  . LYS A 1 2   ? 39.122 32.513  -8.593  1.00 68.60 ? 125 LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 2   ? 38.893 33.448  -9.790  1.00 67.42 ? 125 LYS A NZ  1 
ATOM   10   N N   . ARG A 1 3   ? 40.669 37.396  -4.045  1.00 60.18 ? 126 ARG A N   1 
ATOM   11   C CA  . ARG A 1 3   ? 40.635 37.999  -2.715  1.00 58.63 ? 126 ARG A CA  1 
ATOM   12   C C   . ARG A 1 3   ? 40.406 36.929  -1.663  1.00 58.01 ? 126 ARG A C   1 
ATOM   13   O O   . ARG A 1 3   ? 39.428 36.155  -1.745  1.00 58.16 ? 126 ARG A O   1 
ATOM   14   C CB  . ARG A 1 3   ? 39.494 39.023  -2.658  1.00 58.51 ? 126 ARG A CB  1 
ATOM   15   C CG  . ARG A 1 3   ? 39.536 39.947  -1.471  1.00 56.85 ? 126 ARG A CG  1 
ATOM   16   C CD  . ARG A 1 3   ? 38.195 40.623  -1.293  1.00 54.16 ? 126 ARG A CD  1 
ATOM   17   N NE  . ARG A 1 3   ? 38.048 41.196  0.046   1.00 52.91 ? 126 ARG A NE  1 
ATOM   18   C CZ  . ARG A 1 3   ? 37.264 42.233  0.317   1.00 52.58 ? 126 ARG A CZ  1 
ATOM   19   N NH1 . ARG A 1 3   ? 36.576 42.789  -0.672  1.00 52.20 ? 126 ARG A NH1 1 
ATOM   20   N NH2 . ARG A 1 3   ? 37.159 42.720  1.557   1.00 52.75 ? 126 ARG A NH2 1 
ATOM   21   N N   . GLN A 1 4   ? 41.303 36.898  -0.674  1.00 56.85 ? 127 GLN A N   1 
ATOM   22   C CA  . GLN A 1 4   ? 41.229 35.946  0.425   1.00 55.59 ? 127 GLN A CA  1 
ATOM   23   C C   . GLN A 1 4   ? 40.632 36.612  1.656   1.00 55.08 ? 127 GLN A C   1 
ATOM   24   O O   . GLN A 1 4   ? 40.747 37.827  1.824   1.00 54.94 ? 127 GLN A O   1 
ATOM   25   C CB  . GLN A 1 4   ? 42.626 35.418  0.758   1.00 55.52 ? 127 GLN A CB  1 
ATOM   26   C CG  . GLN A 1 4   ? 43.335 34.776  -0.409  1.00 56.50 ? 127 GLN A CG  1 
ATOM   27   C CD  . GLN A 1 4   ? 42.757 33.417  -0.739  1.00 58.66 ? 127 GLN A CD  1 
ATOM   28   O OE1 . GLN A 1 4   ? 42.935 32.448  0.022   1.00 58.78 ? 127 GLN A OE1 1 
ATOM   29   N NE2 . GLN A 1 4   ? 42.038 33.336  -1.871  1.00 56.13 ? 127 GLN A NE2 1 
ATOM   30   N N   . TRP A 1 5   ? 40.023 35.812  2.527   1.00 53.76 ? 128 TRP A N   1 
ATOM   31   C CA  . TRP A 1 5   ? 39.458 36.342  3.738   1.00 53.47 ? 128 TRP A CA  1 
ATOM   32   C C   . TRP A 1 5   ? 40.583 36.903  4.575   1.00 53.51 ? 128 TRP A C   1 
ATOM   33   O O   . TRP A 1 5   ? 41.715 36.391  4.512   1.00 53.85 ? 128 TRP A O   1 
ATOM   34   C CB  . TRP A 1 5   ? 38.799 35.254  4.573   1.00 52.09 ? 128 TRP A CB  1 
ATOM   35   C CG  . TRP A 1 5   ? 37.623 34.547  3.967   1.00 51.80 ? 128 TRP A CG  1 
ATOM   36   C CD1 . TRP A 1 5   ? 37.595 33.259  3.496   1.00 50.14 ? 128 TRP A CD1 1 
ATOM   37   C CD2 . TRP A 1 5   ? 36.293 35.051  3.832   1.00 48.68 ? 128 TRP A CD2 1 
ATOM   38   N NE1 . TRP A 1 5   ? 36.338 32.937  3.074   1.00 50.03 ? 128 TRP A NE1 1 
ATOM   39   C CE2 . TRP A 1 5   ? 35.516 34.020  3.254   1.00 49.16 ? 128 TRP A CE2 1 
ATOM   40   C CE3 . TRP A 1 5   ? 35.680 36.266  4.151   1.00 50.49 ? 128 TRP A CE3 1 
ATOM   41   C CZ2 . TRP A 1 5   ? 34.158 34.165  2.976   1.00 49.88 ? 128 TRP A CZ2 1 
ATOM   42   C CZ3 . TRP A 1 5   ? 34.320 36.429  3.850   1.00 51.37 ? 128 TRP A CZ3 1 
ATOM   43   C CH2 . TRP A 1 5   ? 33.574 35.377  3.271   1.00 51.52 ? 128 TRP A CH2 1 
ATOM   44   N N   . ALA A 1 6   ? 40.234 37.900  5.397   1.00 52.78 ? 129 ALA A N   1 
ATOM   45   C CA  . ALA A 1 6   ? 41.112 38.504  6.394   1.00 52.82 ? 129 ALA A CA  1 
ATOM   46   C C   . ALA A 1 6   ? 40.226 38.761  7.605   1.00 52.54 ? 129 ALA A C   1 
ATOM   47   O O   . ALA A 1 6   ? 39.057 39.012  7.449   1.00 53.16 ? 129 ALA A O   1 
ATOM   48   C CB  . ALA A 1 6   ? 41.756 39.830  5.858   1.00 51.42 ? 129 ALA A CB  1 
ATOM   49   N N   . LEU A 1 7   ? 40.756 38.678  8.817   1.00 53.28 ? 130 LEU A N   1 
ATOM   50   C CA  . LEU A 1 7   ? 39.956 38.974  10.029  1.00 53.70 ? 130 LEU A CA  1 
ATOM   51   C C   . LEU A 1 7   ? 39.196 40.330  9.918   1.00 53.84 ? 130 LEU A C   1 
ATOM   52   O O   . LEU A 1 7   ? 37.979 40.446  10.187  1.00 52.30 ? 130 LEU A O   1 
ATOM   53   C CB  . LEU A 1 7   ? 40.893 38.996  11.233  1.00 53.64 ? 130 LEU A CB  1 
ATOM   54   C CG  . LEU A 1 7   ? 40.288 39.070  12.615  1.00 55.39 ? 130 LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 7   ? 39.287 37.899  12.886  1.00 54.86 ? 130 LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 7   ? 41.436 39.074  13.602  1.00 57.45 ? 130 LEU A CD2 1 
ATOM   57   N N   . GLU A 1 8   ? 39.944 41.338  9.471   1.00 53.51 ? 131 GLU A N   1 
ATOM   58   C CA  . GLU A 1 8   ? 39.422 42.670  9.211   1.00 54.11 ? 131 GLU A CA  1 
ATOM   59   C C   . GLU A 1 8   ? 38.105 42.712  8.409   1.00 53.34 ? 131 GLU A C   1 
ATOM   60   O O   . GLU A 1 8   ? 37.472 43.748  8.345   1.00 52.34 ? 131 GLU A O   1 
ATOM   61   C CB  . GLU A 1 8   ? 40.507 43.513  8.517   1.00 54.47 ? 131 GLU A CB  1 
ATOM   62   C CG  . GLU A 1 8   ? 41.779 43.777  9.369   1.00 58.51 ? 131 GLU A CG  1 
ATOM   63   C CD  . GLU A 1 8   ? 42.647 42.512  9.697   1.00 63.50 ? 131 GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 8   ? 42.841 41.621  8.810   1.00 61.27 ? 131 GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 8   ? 43.164 42.437  10.854  1.00 63.30 ? 131 GLU A OE2 1 
ATOM   66   N N   . ASP A 1 9   ? 37.702 41.595  7.804   1.00 53.34 ? 132 ASP A N   1 
ATOM   67   C CA  . ASP A 1 9   ? 36.446 41.517  7.031   1.00 53.06 ? 132 ASP A CA  1 
ATOM   68   C C   . ASP A 1 9   ? 35.234 41.276  7.942   1.00 52.59 ? 132 ASP A C   1 
ATOM   69   O O   . ASP A 1 9   ? 34.081 41.395  7.482   1.00 51.40 ? 132 ASP A O   1 
ATOM   70   C CB  . ASP A 1 9   ? 36.496 40.427  5.944   1.00 53.01 ? 132 ASP A CB  1 
ATOM   71   C CG  . ASP A 1 9   ? 37.417 40.802  4.769   1.00 54.50 ? 132 ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 9   ? 37.669 42.006  4.564   1.00 52.72 ? 132 ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 9   ? 37.894 39.892  4.047   1.00 56.05 ? 132 ASP A OD2 1 
ATOM   74   N N   . PHE A 1 10  ? 35.519 40.989  9.222   1.00 51.58 ? 133 PHE A N   1 
ATOM   75   C CA  . PHE A 1 10  ? 34.506 40.678  10.224  1.00 51.20 ? 133 PHE A CA  1 
ATOM   76   C C   . PHE A 1 10  ? 34.416 41.620  11.408  1.00 51.71 ? 133 PHE A C   1 
ATOM   77   O O   . PHE A 1 10  ? 35.439 42.059  11.986  1.00 51.93 ? 133 PHE A O   1 
ATOM   78   C CB  . PHE A 1 10  ? 34.714 39.249  10.735  1.00 51.90 ? 133 PHE A CB  1 
ATOM   79   C CG  . PHE A 1 10  ? 34.752 38.233  9.622   1.00 51.78 ? 133 PHE A CG  1 
ATOM   80   C CD1 . PHE A 1 10  ? 35.980 37.838  9.067   1.00 50.97 ? 133 PHE A CD1 1 
ATOM   81   C CD2 . PHE A 1 10  ? 33.559 37.749  9.068   1.00 50.49 ? 133 PHE A CD2 1 
ATOM   82   C CE1 . PHE A 1 10  ? 36.029 36.945  7.996   1.00 49.37 ? 133 PHE A CE1 1 
ATOM   83   C CE2 . PHE A 1 10  ? 33.592 36.849  8.013   1.00 49.28 ? 133 PHE A CE2 1 
ATOM   84   C CZ  . PHE A 1 10  ? 34.839 36.454  7.475   1.00 51.41 ? 133 PHE A CZ  1 
ATOM   85   N N   . GLU A 1 11  ? 33.168 41.929  11.763  1.00 51.66 ? 134 GLU A N   1 
ATOM   86   C CA  . GLU A 1 11  ? 32.848 42.455  13.073  1.00 51.19 ? 134 GLU A CA  1 
ATOM   87   C C   . GLU A 1 11  ? 32.558 41.257  13.984  1.00 51.39 ? 134 GLU A C   1 
ATOM   88   O O   . GLU A 1 11  ? 31.749 40.400  13.638  1.00 51.00 ? 134 GLU A O   1 
ATOM   89   C CB  . GLU A 1 11  ? 31.636 43.390  12.988  1.00 51.86 ? 134 GLU A CB  1 
ATOM   90   C CG  . GLU A 1 11  ? 31.933 44.781  12.344  1.00 51.02 ? 134 GLU A CG  1 
ATOM   91   C CD  . GLU A 1 11  ? 30.984 45.884  12.832  1.00 51.64 ? 134 GLU A CD  1 
ATOM   92   O OE1 . GLU A 1 11  ? 29.872 45.558  13.384  1.00 47.66 ? 134 GLU A OE1 1 
ATOM   93   O OE2 . GLU A 1 11  ? 31.370 47.081  12.645  1.00 50.53 ? 134 GLU A OE2 1 
ATOM   94   N N   . ILE A 1 12  ? 33.230 41.201  15.138  1.00 51.33 ? 135 ILE A N   1 
ATOM   95   C CA  . ILE A 1 12  ? 33.023 40.133  16.117  1.00 51.41 ? 135 ILE A CA  1 
ATOM   96   C C   . ILE A 1 12  ? 32.128 40.597  17.283  1.00 51.63 ? 135 ILE A C   1 
ATOM   97   O O   . ILE A 1 12  ? 32.368 41.656  17.899  1.00 50.66 ? 135 ILE A O   1 
ATOM   98   C CB  . ILE A 1 12  ? 34.370 39.607  16.706  1.00 52.11 ? 135 ILE A CB  1 
ATOM   99   C CG1 . ILE A 1 12  ? 35.450 39.488  15.613  1.00 52.46 ? 135 ILE A CG1 1 
ATOM   100  C CG2 . ILE A 1 12  ? 34.161 38.305  17.554  1.00 50.77 ? 135 ILE A CG2 1 
ATOM   101  C CD1 . ILE A 1 12  ? 35.534 38.182  14.935  1.00 55.31 ? 135 ILE A CD1 1 
ATOM   102  N N   . GLY A 1 13  ? 31.083 39.807  17.549  1.00 51.59 ? 136 GLY A N   1 
ATOM   103  C CA  . GLY A 1 13  ? 30.228 40.024  18.700  1.00 52.14 ? 136 GLY A CA  1 
ATOM   104  C C   . GLY A 1 13  ? 30.510 39.053  19.831  1.00 52.90 ? 136 GLY A C   1 
ATOM   105  O O   . GLY A 1 13  ? 31.648 38.659  20.052  1.00 52.59 ? 136 GLY A O   1 
ATOM   106  N N   . ARG A 1 14  ? 29.468 38.662  20.568  1.00 54.56 ? 137 ARG A N   1 
ATOM   107  C CA  . ARG A 1 14  ? 29.663 37.800  21.771  1.00 54.86 ? 137 ARG A CA  1 
ATOM   108  C C   . ARG A 1 14  ? 29.974 36.342  21.415  1.00 53.78 ? 137 ARG A C   1 
ATOM   109  O O   . ARG A 1 14  ? 29.709 35.936  20.282  1.00 54.47 ? 137 ARG A O   1 
ATOM   110  C CB  . ARG A 1 14  ? 28.489 37.927  22.747  1.00 54.39 ? 137 ARG A CB  1 
ATOM   111  C CG  . ARG A 1 14  ? 27.153 37.530  22.163  1.00 59.42 ? 137 ARG A CG  1 
ATOM   112  C CD  . ARG A 1 14  ? 26.539 36.281  22.843  1.00 62.95 ? 137 ARG A CD  1 
ATOM   113  N NE  . ARG A 1 14  ? 25.394 35.769  22.071  1.00 63.95 ? 137 ARG A NE  1 
ATOM   114  C CZ  . ARG A 1 14  ? 24.403 36.554  21.661  1.00 61.55 ? 137 ARG A CZ  1 
ATOM   115  N NH1 . ARG A 1 14  ? 24.454 37.854  21.939  1.00 59.49 ? 137 ARG A NH1 1 
ATOM   116  N NH2 . ARG A 1 14  ? 23.386 36.053  20.971  1.00 59.06 ? 137 ARG A NH2 1 
ATOM   117  N N   . PRO A 1 15  ? 30.575 35.583  22.360  1.00 52.02 ? 138 PRO A N   1 
ATOM   118  C CA  . PRO A 1 15  ? 30.610 34.155  22.229  1.00 51.00 ? 138 PRO A CA  1 
ATOM   119  C C   . PRO A 1 15  ? 29.198 33.643  22.064  1.00 50.62 ? 138 PRO A C   1 
ATOM   120  O O   . PRO A 1 15  ? 28.268 34.144  22.722  1.00 50.27 ? 138 PRO A O   1 
ATOM   121  C CB  . PRO A 1 15  ? 31.149 33.675  23.582  1.00 51.38 ? 138 PRO A CB  1 
ATOM   122  C CG  . PRO A 1 15  ? 31.992 34.785  24.077  1.00 53.02 ? 138 PRO A CG  1 
ATOM   123  C CD  . PRO A 1 15  ? 31.267 36.044  23.584  1.00 52.48 ? 138 PRO A CD  1 
ATOM   124  N N   . LEU A 1 16  ? 29.031 32.646  21.195  1.00 50.01 ? 139 LEU A N   1 
ATOM   125  C CA  . LEU A 1 16  ? 27.744 31.955  21.074  1.00 49.42 ? 139 LEU A CA  1 
ATOM   126  C C   . LEU A 1 16  ? 27.393 31.066  22.299  1.00 50.13 ? 139 LEU A C   1 
ATOM   127  O O   . LEU A 1 16  ? 26.201 30.876  22.617  1.00 48.25 ? 139 LEU A O   1 
ATOM   128  C CB  . LEU A 1 16  ? 27.704 31.155  19.787  1.00 49.20 ? 139 LEU A CB  1 
ATOM   129  C CG  . LEU A 1 16  ? 27.472 32.080  18.585  1.00 50.09 ? 139 LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 16  ? 27.851 31.383  17.303  1.00 48.42 ? 139 LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 16  ? 26.032 32.646  18.547  1.00 48.86 ? 139 LEU A CD2 1 
ATOM   132  N N   . GLY A 1 17  ? 28.431 30.568  22.994  1.00 49.94 ? 140 GLY A N   1 
ATOM   133  C CA  . GLY A 1 17  ? 28.217 29.623  24.047  1.00 50.83 ? 140 GLY A CA  1 
ATOM   134  C C   . GLY A 1 17  ? 29.224 29.657  25.151  1.00 52.32 ? 140 GLY A C   1 
ATOM   135  O O   . GLY A 1 17  ? 30.267 30.284  25.034  1.00 52.47 ? 140 GLY A O   1 
ATOM   136  N N   . LYS A 1 18  ? 28.860 28.996  26.251  1.00 53.81 ? 141 LYS A N   1 
ATOM   137  C CA  . LYS A 1 18  ? 29.733 28.809  27.403  1.00 55.23 ? 141 LYS A CA  1 
ATOM   138  C C   . LYS A 1 18  ? 30.628 27.576  27.154  1.00 54.09 ? 141 LYS A C   1 
ATOM   139  O O   . LYS A 1 18  ? 30.480 26.873  26.145  1.00 54.36 ? 141 LYS A O   1 
ATOM   140  C CB  . LYS A 1 18  ? 28.903 28.635  28.672  1.00 54.65 ? 141 LYS A CB  1 
ATOM   141  C CG  . LYS A 1 18  ? 28.239 27.220  28.739  1.00 58.61 ? 141 LYS A CG  1 
ATOM   142  C CD  . LYS A 1 18  ? 27.805 26.755  30.186  1.00 58.76 ? 141 LYS A CD  1 
ATOM   143  C CE  . LYS A 1 18  ? 28.963 26.029  30.934  1.00 62.59 ? 141 LYS A CE  1 
ATOM   144  N NZ  . LYS A 1 18  ? 29.377 24.721  30.276  1.00 62.05 ? 141 LYS A NZ  1 
ATOM   145  N N   . GLY A 1 19  ? 31.556 27.328  28.067  1.00 52.95 ? 142 GLY A N   1 
ATOM   146  C CA  . GLY A 1 19  ? 32.329 26.090  28.057  1.00 51.98 ? 142 GLY A CA  1 
ATOM   147  C C   . GLY A 1 19  ? 33.059 25.751  26.779  1.00 50.72 ? 142 GLY A C   1 
ATOM   148  O O   . GLY A 1 19  ? 33.742 26.589  26.214  1.00 50.73 ? 142 GLY A O   1 
ATOM   149  N N   . LYS A 1 20  ? 32.911 24.501  26.340  1.00 50.75 ? 143 LYS A N   1 
ATOM   150  C CA  . LYS A 1 20  ? 33.535 23.994  25.100  1.00 50.27 ? 143 LYS A CA  1 
ATOM   151  C C   . LYS A 1 20  ? 33.142 24.784  23.838  1.00 49.83 ? 143 LYS A C   1 
ATOM   152  O O   . LYS A 1 20  ? 33.769 24.653  22.785  1.00 51.13 ? 143 LYS A O   1 
ATOM   153  C CB  . LYS A 1 20  ? 33.173 22.518  24.920  1.00 50.49 ? 143 LYS A CB  1 
ATOM   154  C CG  . LYS A 1 20  ? 31.715 22.276  24.431  1.00 50.02 ? 143 LYS A CG  1 
ATOM   155  C CD  . LYS A 1 20  ? 31.457 20.834  24.078  1.00 50.44 ? 143 LYS A CD  1 
ATOM   156  C CE  . LYS A 1 20  ? 31.369 20.006  25.316  1.00 57.68 ? 143 LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 20  ? 30.376 18.897  25.110  1.00 63.02 ? 143 LYS A NZ  1 
ATOM   158  N N   . PHE A 1 21  ? 32.095 25.592  23.920  1.00 49.13 ? 144 PHE A N   1 
ATOM   159  C CA  . PHE A 1 21  ? 31.720 26.413  22.781  1.00 48.89 ? 144 PHE A CA  1 
ATOM   160  C C   . PHE A 1 21  ? 32.123 27.879  22.947  1.00 49.71 ? 144 PHE A C   1 
ATOM   161  O O   . PHE A 1 21  ? 31.745 28.694  22.139  1.00 50.24 ? 144 PHE A O   1 
ATOM   162  C CB  . PHE A 1 21  ? 30.216 26.296  22.507  1.00 48.83 ? 144 PHE A CB  1 
ATOM   163  C CG  . PHE A 1 21  ? 29.741 24.883  22.208  1.00 47.32 ? 144 PHE A CG  1 
ATOM   164  C CD1 . PHE A 1 21  ? 28.693 24.326  22.931  1.00 46.34 ? 144 PHE A CD1 1 
ATOM   165  C CD2 . PHE A 1 21  ? 30.316 24.122  21.172  1.00 49.52 ? 144 PHE A CD2 1 
ATOM   166  C CE1 . PHE A 1 21  ? 28.202 23.021  22.664  1.00 46.49 ? 144 PHE A CE1 1 
ATOM   167  C CE2 . PHE A 1 21  ? 29.850 22.788  20.893  1.00 48.65 ? 144 PHE A CE2 1 
ATOM   168  C CZ  . PHE A 1 21  ? 28.771 22.246  21.667  1.00 46.91 ? 144 PHE A CZ  1 
ATOM   169  N N   . GLY A 1 22  ? 32.925 28.212  23.967  1.00 50.69 ? 145 GLY A N   1 
ATOM   170  C CA  . GLY A 1 22  ? 33.280 29.614  24.312  1.00 51.28 ? 145 GLY A CA  1 
ATOM   171  C C   . GLY A 1 22  ? 34.052 30.292  23.187  1.00 52.06 ? 145 GLY A C   1 
ATOM   172  O O   . GLY A 1 22  ? 34.331 31.491  23.186  1.00 51.96 ? 145 GLY A O   1 
ATOM   173  N N   . ASN A 1 23  ? 34.219 29.492  22.156  1.00 51.93 ? 146 ASN A N   1 
ATOM   174  C CA  . ASN A 1 23  ? 35.211 29.553  21.154  1.00 51.94 ? 146 ASN A CA  1 
ATOM   175  C C   . ASN A 1 23  ? 34.688 30.131  19.835  1.00 50.73 ? 146 ASN A C   1 
ATOM   176  O O   . ASN A 1 23  ? 35.457 30.375  18.891  1.00 49.36 ? 146 ASN A O   1 
ATOM   177  C CB  . ASN A 1 23  ? 35.496 28.050  20.838  1.00 52.93 ? 146 ASN A CB  1 
ATOM   178  C CG  . ASN A 1 23  ? 36.859 27.878  20.494  1.00 56.09 ? 146 ASN A CG  1 
ATOM   179  O OD1 . ASN A 1 23  ? 37.632 28.784  20.806  1.00 62.60 ? 146 ASN A OD1 1 
ATOM   180  N ND2 . ASN A 1 23  ? 37.211 26.827  19.810  1.00 56.80 ? 146 ASN A ND2 1 
ATOM   181  N N   . VAL A 1 24  ? 33.359 30.223  19.762  1.00 49.21 ? 147 VAL A N   1 
ATOM   182  C CA  . VAL A 1 24  ? 32.653 30.421  18.521  1.00 49.51 ? 147 VAL A CA  1 
ATOM   183  C C   . VAL A 1 24  ? 31.825 31.678  18.791  1.00 50.20 ? 147 VAL A C   1 
ATOM   184  O O   . VAL A 1 24  ? 31.061 31.726  19.764  1.00 49.98 ? 147 VAL A O   1 
ATOM   185  C CB  . VAL A 1 24  ? 31.743 29.166  18.119  1.00 48.28 ? 147 VAL A CB  1 
ATOM   186  C CG1 . VAL A 1 24  ? 31.167 29.343  16.765  1.00 46.99 ? 147 VAL A CG1 1 
ATOM   187  C CG2 . VAL A 1 24  ? 32.520 27.854  18.176  1.00 47.92 ? 147 VAL A CG2 1 
ATOM   188  N N   . TYR A 1 25  ? 32.022 32.686  17.945  1.00 50.32 ? 148 TYR A N   1 
ATOM   189  C CA  . TYR A 1 25  ? 31.447 34.002  18.124  1.00 50.80 ? 148 TYR A CA  1 
ATOM   190  C C   . TYR A 1 25  ? 30.388 34.307  17.117  1.00 52.00 ? 148 TYR A C   1 
ATOM   191  O O   . TYR A 1 25  ? 30.423 33.829  15.972  1.00 52.07 ? 148 TYR A O   1 
ATOM   192  C CB  . TYR A 1 25  ? 32.514 35.063  17.946  1.00 51.71 ? 148 TYR A CB  1 
ATOM   193  C CG  . TYR A 1 25  ? 33.596 34.887  18.915  1.00 51.94 ? 148 TYR A CG  1 
ATOM   194  C CD1 . TYR A 1 25  ? 34.638 33.993  18.656  1.00 51.13 ? 148 TYR A CD1 1 
ATOM   195  C CD2 . TYR A 1 25  ? 33.555 35.552  20.129  1.00 50.67 ? 148 TYR A CD2 1 
ATOM   196  C CE1 . TYR A 1 25  ? 35.647 33.800  19.576  1.00 53.12 ? 148 TYR A CE1 1 
ATOM   197  C CE2 . TYR A 1 25  ? 34.546 35.381  21.058  1.00 54.41 ? 148 TYR A CE2 1 
ATOM   198  C CZ  . TYR A 1 25  ? 35.593 34.495  20.771  1.00 54.49 ? 148 TYR A CZ  1 
ATOM   199  O OH  . TYR A 1 25  ? 36.577 34.313  21.703  1.00 56.98 ? 148 TYR A OH  1 
ATOM   200  N N   . LEU A 1 26  ? 29.444 35.142  17.542  1.00 52.68 ? 149 LEU A N   1 
ATOM   201  C CA  . LEU A 1 26  ? 28.534 35.762  16.601  1.00 52.52 ? 149 LEU A CA  1 
ATOM   202  C C   . LEU A 1 26  ? 29.383 36.751  15.840  1.00 52.00 ? 149 LEU A C   1 
ATOM   203  O O   . LEU A 1 26  ? 30.188 37.482  16.411  1.00 52.43 ? 149 LEU A O   1 
ATOM   204  C CB  . LEU A 1 26  ? 27.381 36.455  17.316  1.00 52.38 ? 149 LEU A CB  1 
ATOM   205  C CG  . LEU A 1 26  ? 26.278 36.905  16.379  1.00 53.25 ? 149 LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 26  ? 25.531 35.708  15.818  1.00 52.35 ? 149 LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 26  ? 25.359 37.843  17.133  1.00 56.59 ? 149 LEU A CD2 1 
ATOM   208  N N   . ALA A 1 27  ? 29.254 36.717  14.532  1.00 52.15 ? 150 ALA A N   1 
ATOM   209  C CA  . ALA A 1 27  ? 30.162 37.481  13.670  1.00 51.54 ? 150 ALA A CA  1 
ATOM   210  C C   . ALA A 1 27  ? 29.354 38.058  12.533  1.00 51.76 ? 150 ALA A C   1 
ATOM   211  O O   . ALA A 1 27  ? 28.211 37.629  12.258  1.00 51.12 ? 150 ALA A O   1 
ATOM   212  C CB  . ALA A 1 27  ? 31.271 36.606  13.151  1.00 50.73 ? 150 ALA A CB  1 
ATOM   213  N N   . ARG A 1 28  ? 29.944 39.065  11.906  1.00 51.61 ? 151 ARG A N   1 
ATOM   214  C CA  . ARG A 1 28  ? 29.283 39.771  10.847  1.00 51.96 ? 151 ARG A CA  1 
ATOM   215  C C   . ARG A 1 28  ? 30.291 40.084  9.759   1.00 51.79 ? 151 ARG A C   1 
ATOM   216  O O   . ARG A 1 28  ? 31.369 40.659  10.015  1.00 51.50 ? 151 ARG A O   1 
ATOM   217  C CB  . ARG A 1 28  ? 28.690 41.078  11.376  1.00 51.90 ? 151 ARG A CB  1 
ATOM   218  C CG  . ARG A 1 28  ? 27.616 41.608  10.514  1.00 52.44 ? 151 ARG A CG  1 
ATOM   219  C CD  . ARG A 1 28  ? 27.256 43.008  10.875  1.00 52.84 ? 151 ARG A CD  1 
ATOM   220  N NE  . ARG A 1 28  ? 26.614 43.134  12.181  1.00 54.34 ? 151 ARG A NE  1 
ATOM   221  C CZ  . ARG A 1 28  ? 25.315 43.013  12.436  1.00 51.91 ? 151 ARG A CZ  1 
ATOM   222  N NH1 . ARG A 1 28  ? 24.455 42.715  11.478  1.00 51.88 ? 151 ARG A NH1 1 
ATOM   223  N NH2 . ARG A 1 28  ? 24.887 43.188  13.677  1.00 51.95 ? 151 ARG A NH2 1 
ATOM   224  N N   . GLU A 1 29  ? 29.937 39.734  8.537   1.00 50.90 ? 152 GLU A N   1 
ATOM   225  C CA  . GLU A 1 29  ? 30.748 40.208  7.446   1.00 50.37 ? 152 GLU A CA  1 
ATOM   226  C C   . GLU A 1 29  ? 30.460 41.695  7.201   1.00 49.54 ? 152 GLU A C   1 
ATOM   227  O O   . GLU A 1 29  ? 29.327 42.068  6.998   1.00 48.44 ? 152 GLU A O   1 
ATOM   228  C CB  . GLU A 1 29  ? 30.561 39.316  6.226   1.00 50.28 ? 152 GLU A CB  1 
ATOM   229  C CG  . GLU A 1 29  ? 31.670 39.453  5.273   1.00 51.24 ? 152 GLU A CG  1 
ATOM   230  C CD  . GLU A 1 29  ? 31.443 40.608  4.340   1.00 52.33 ? 152 GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 29  ? 32.130 41.657  4.465   1.00 52.94 ? 152 GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 29  ? 30.538 40.468  3.491   1.00 55.75 ? 152 GLU A OE2 1 
ATOM   233  N N   . LYS A 1 30  ? 31.514 42.526  7.233   1.00 50.40 ? 153 LYS A N   1 
ATOM   234  C CA  . LYS A 1 30  ? 31.403 43.996  7.296   1.00 51.15 ? 153 LYS A CA  1 
ATOM   235  C C   . LYS A 1 30  ? 30.630 44.697  6.173   1.00 51.44 ? 153 LYS A C   1 
ATOM   236  O O   . LYS A 1 30  ? 29.990 45.717  6.388   1.00 51.11 ? 153 LYS A O   1 
ATOM   237  C CB  . LYS A 1 30  ? 32.777 44.654  7.422   1.00 51.32 ? 153 LYS A CB  1 
ATOM   238  C CG  . LYS A 1 30  ? 33.414 44.471  8.777   1.00 51.97 ? 153 LYS A CG  1 
ATOM   239  C CD  . LYS A 1 30  ? 34.601 45.455  8.958   1.00 52.28 ? 153 LYS A CD  1 
ATOM   240  C CE  . LYS A 1 30  ? 35.568 44.853  10.008  1.00 53.23 ? 153 LYS A CE  1 
ATOM   241  N NZ  . LYS A 1 30  ? 36.863 45.553  10.147  1.00 53.83 ? 153 LYS A NZ  1 
ATOM   242  N N   . GLN A 1 31  ? 30.683 44.142  4.982   1.00 52.52 ? 154 GLN A N   1 
ATOM   243  C CA  . GLN A 1 31  ? 30.134 44.809  3.807   1.00 53.18 ? 154 GLN A CA  1 
ATOM   244  C C   . GLN A 1 31  ? 28.695 44.389  3.591   1.00 52.45 ? 154 GLN A C   1 
ATOM   245  O O   . GLN A 1 31  ? 27.820 45.228  3.361   1.00 51.54 ? 154 GLN A O   1 
ATOM   246  C CB  . GLN A 1 31  ? 30.970 44.430  2.588   1.00 53.78 ? 154 GLN A CB  1 
ATOM   247  C CG  . GLN A 1 31  ? 32.434 44.241  2.956   1.00 58.51 ? 154 GLN A CG  1 
ATOM   248  C CD  . GLN A 1 31  ? 33.284 45.414  2.584   1.00 63.08 ? 154 GLN A CD  1 
ATOM   249  O OE1 . GLN A 1 31  ? 33.185 46.508  3.179   1.00 66.89 ? 154 GLN A OE1 1 
ATOM   250  N NE2 . GLN A 1 31  ? 34.128 45.211  1.566   1.00 64.76 ? 154 GLN A NE2 1 
ATOM   251  N N   . SER A 1 32  ? 28.475 43.079  3.670   1.00 52.00 ? 155 SER A N   1 
ATOM   252  C CA  . SER A 1 32  ? 27.142 42.505  3.490   1.00 51.85 ? 155 SER A CA  1 
ATOM   253  C C   . SER A 1 32  ? 26.249 42.622  4.746   1.00 51.80 ? 155 SER A C   1 
ATOM   254  O O   . SER A 1 32  ? 25.015 42.605  4.631   1.00 51.93 ? 155 SER A O   1 
ATOM   255  C CB  . SER A 1 32  ? 27.249 41.037  3.037   1.00 51.63 ? 155 SER A CB  1 
ATOM   256  O OG  . SER A 1 32  ? 28.014 40.264  3.943   1.00 49.96 ? 155 SER A OG  1 
ATOM   257  N N   . LYS A 1 33  ? 26.873 42.743  5.922   1.00 51.20 ? 156 LYS A N   1 
ATOM   258  C CA  . LYS A 1 33  ? 26.178 42.727  7.203   1.00 50.86 ? 156 LYS A CA  1 
ATOM   259  C C   . LYS A 1 33  ? 25.608 41.348  7.533   1.00 50.54 ? 156 LYS A C   1 
ATOM   260  O O   . LYS A 1 33  ? 24.838 41.196  8.480   1.00 50.73 ? 156 LYS A O   1 
ATOM   261  C CB  . LYS A 1 33  ? 25.078 43.793  7.248   1.00 51.06 ? 156 LYS A CB  1 
ATOM   262  C CG  . LYS A 1 33  ? 25.474 45.118  7.850   1.00 52.50 ? 156 LYS A CG  1 
ATOM   263  C CD  . LYS A 1 33  ? 26.255 45.971  6.909   1.00 55.93 ? 156 LYS A CD  1 
ATOM   264  C CE  . LYS A 1 33  ? 26.411 47.387  7.463   1.00 58.09 ? 156 LYS A CE  1 
ATOM   265  N NZ  . LYS A 1 33  ? 25.427 48.393  6.922   1.00 58.00 ? 156 LYS A NZ  1 
ATOM   266  N N   . PHE A 1 34  ? 25.998 40.355  6.741   1.00 50.53 ? 157 PHE A N   1 
ATOM   267  C CA  . PHE A 1 34  ? 25.610 38.945  6.908   1.00 50.32 ? 157 PHE A CA  1 
ATOM   268  C C   . PHE A 1 34  ? 26.182 38.262  8.162   1.00 50.37 ? 157 PHE A C   1 
ATOM   269  O O   . PHE A 1 34  ? 27.425 38.157  8.344   1.00 50.10 ? 157 PHE A O   1 
ATOM   270  C CB  . PHE A 1 34  ? 26.009 38.183  5.635   1.00 50.58 ? 157 PHE A CB  1 
ATOM   271  C CG  . PHE A 1 34  ? 25.535 36.769  5.593   1.00 50.88 ? 157 PHE A CG  1 
ATOM   272  C CD1 . PHE A 1 34  ? 24.288 36.456  5.044   1.00 54.42 ? 157 PHE A CD1 1 
ATOM   273  C CD2 . PHE A 1 34  ? 26.341 35.737  6.089   1.00 51.39 ? 157 PHE A CD2 1 
ATOM   274  C CE1 . PHE A 1 34  ? 23.827 35.099  5.015   1.00 56.13 ? 157 PHE A CE1 1 
ATOM   275  C CE2 . PHE A 1 34  ? 25.919 34.382  6.049   1.00 52.95 ? 157 PHE A CE2 1 
ATOM   276  C CZ  . PHE A 1 34  ? 24.659 34.055  5.524   1.00 53.36 ? 157 PHE A CZ  1 
ATOM   277  N N   . ILE A 1 35  ? 25.265 37.764  8.997   1.00 49.96 ? 158 ILE A N   1 
ATOM   278  C CA  . ILE A 1 35  ? 25.591 37.171  10.288  1.00 49.90 ? 158 ILE A CA  1 
ATOM   279  C C   . ILE A 1 35  ? 26.049 35.750  10.162  1.00 51.18 ? 158 ILE A C   1 
ATOM   280  O O   . ILE A 1 35  ? 25.421 34.954  9.499   1.00 52.42 ? 158 ILE A O   1 
ATOM   281  C CB  . ILE A 1 35  ? 24.429 37.308  11.284  1.00 50.29 ? 158 ILE A CB  1 
ATOM   282  C CG1 . ILE A 1 35  ? 24.325 38.795  11.700  1.00 51.13 ? 158 ILE A CG1 1 
ATOM   283  C CG2 . ILE A 1 35  ? 24.598 36.392  12.495  1.00 47.88 ? 158 ILE A CG2 1 
ATOM   284  C CD1 . ILE A 1 35  ? 22.998 39.213  12.354  1.00 52.09 ? 158 ILE A CD1 1 
ATOM   285  N N   . LEU A 1 36  ? 27.142 35.435  10.849  1.00 51.98 ? 159 LEU A N   1 
ATOM   286  C CA  . LEU A 1 36  ? 27.872 34.180  10.728  1.00 51.70 ? 159 LEU A CA  1 
ATOM   287  C C   . LEU A 1 36  ? 28.194 33.735  12.146  1.00 51.99 ? 159 LEU A C   1 
ATOM   288  O O   . LEU A 1 36  ? 28.012 34.516  13.108  1.00 52.24 ? 159 LEU A O   1 
ATOM   289  C CB  . LEU A 1 36  ? 29.215 34.459  10.030  1.00 52.79 ? 159 LEU A CB  1 
ATOM   290  C CG  . LEU A 1 36  ? 29.088 34.890  8.591   1.00 52.53 ? 159 LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 36  ? 30.367 35.291  7.938   1.00 52.03 ? 159 LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 36  ? 28.459 33.741  7.861   1.00 56.44 ? 159 LEU A CD2 1 
ATOM   293  N N   . ALA A 1 37  ? 28.674 32.496  12.273  1.00 51.70 ? 160 ALA A N   1 
ATOM   294  C CA  . ALA A 1 37  ? 29.414 32.044  13.450  1.00 51.07 ? 160 ALA A CA  1 
ATOM   295  C C   . ALA A 1 37  ? 30.854 31.978  13.036  1.00 52.02 ? 160 ALA A C   1 
ATOM   296  O O   . ALA A 1 37  ? 31.183 31.470  11.946  1.00 52.20 ? 160 ALA A O   1 
ATOM   297  C CB  . ALA A 1 37  ? 28.949 30.697  13.882  1.00 51.53 ? 160 ALA A CB  1 
ATOM   298  N N   . LEU A 1 38  ? 31.740 32.468  13.896  1.00 51.58 ? 161 LEU A N   1 
ATOM   299  C CA  . LEU A 1 38  ? 33.126 32.439  13.561  1.00 51.28 ? 161 LEU A CA  1 
ATOM   300  C C   . LEU A 1 38  ? 33.882 31.706  14.672  1.00 52.06 ? 161 LEU A C   1 
ATOM   301  O O   . LEU A 1 38  ? 33.965 32.167  15.818  1.00 52.11 ? 161 LEU A O   1 
ATOM   302  C CB  . LEU A 1 38  ? 33.656 33.866  13.312  1.00 51.01 ? 161 LEU A CB  1 
ATOM   303  C CG  . LEU A 1 38  ? 35.112 33.989  12.841  1.00 51.87 ? 161 LEU A CG  1 
ATOM   304  C CD1 . LEU A 1 38  ? 35.235 33.679  11.349  1.00 49.95 ? 161 LEU A CD1 1 
ATOM   305  C CD2 . LEU A 1 38  ? 35.708 35.380  13.166  1.00 52.12 ? 161 LEU A CD2 1 
ATOM   306  N N   . LYS A 1 39  ? 34.424 30.547  14.313  1.00 51.93 ? 162 LYS A N   1 
ATOM   307  C CA  . LYS A 1 39  ? 35.136 29.679  15.235  1.00 51.93 ? 162 LYS A CA  1 
ATOM   308  C C   . LYS A 1 39  ? 36.637 29.964  15.196  1.00 51.15 ? 162 LYS A C   1 
ATOM   309  O O   . LYS A 1 39  ? 37.258 29.857  14.142  1.00 51.35 ? 162 LYS A O   1 
ATOM   310  C CB  . LYS A 1 39  ? 34.870 28.205  14.872  1.00 51.46 ? 162 LYS A CB  1 
ATOM   311  C CG  . LYS A 1 39  ? 35.587 27.167  15.770  1.00 52.34 ? 162 LYS A CG  1 
ATOM   312  C CD  . LYS A 1 39  ? 34.963 25.725  15.563  1.00 53.77 ? 162 LYS A CD  1 
ATOM   313  C CE  . LYS A 1 39  ? 35.631 24.651  16.418  1.00 51.51 ? 162 LYS A CE  1 
ATOM   314  N NZ  . LYS A 1 39  ? 35.273 23.215  16.099  1.00 49.78 ? 162 LYS A NZ  1 
ATOM   315  N N   . VAL A 1 40  ? 37.215 30.261  16.360  1.00 51.13 ? 163 VAL A N   1 
ATOM   316  C CA  . VAL A 1 40  ? 38.625 30.615  16.491  1.00 50.19 ? 163 VAL A CA  1 
ATOM   317  C C   . VAL A 1 40  ? 39.426 29.524  17.215  1.00 51.14 ? 163 VAL A C   1 
ATOM   318  O O   . VAL A 1 40  ? 39.084 29.118  18.333  1.00 50.86 ? 163 VAL A O   1 
ATOM   319  C CB  . VAL A 1 40  ? 38.774 31.976  17.184  1.00 50.42 ? 163 VAL A CB  1 
ATOM   320  C CG1 . VAL A 1 40  ? 40.237 32.456  17.184  1.00 49.71 ? 163 VAL A CG1 1 
ATOM   321  C CG2 . VAL A 1 40  ? 37.885 33.024  16.457  1.00 51.06 ? 163 VAL A CG2 1 
ATOM   322  N N   . LEU A 1 41  ? 40.497 29.049  16.568  1.00 50.76 ? 164 LEU A N   1 
ATOM   323  C CA  . LEU A 1 41  ? 41.359 28.021  17.123  1.00 50.38 ? 164 LEU A CA  1 
ATOM   324  C C   . LEU A 1 41  ? 42.770 28.555  17.146  1.00 51.47 ? 164 LEU A C   1 
ATOM   325  O O   . LEU A 1 41  ? 43.217 29.202  16.191  1.00 52.72 ? 164 LEU A O   1 
ATOM   326  C CB  . LEU A 1 41  ? 41.287 26.745  16.270  1.00 49.34 ? 164 LEU A CB  1 
ATOM   327  C CG  . LEU A 1 41  ? 39.959 25.942  16.275  1.00 50.81 ? 164 LEU A CG  1 
ATOM   328  C CD1 . LEU A 1 41  ? 39.912 24.749  15.278  1.00 46.63 ? 164 LEU A CD1 1 
ATOM   329  C CD2 . LEU A 1 41  ? 39.626 25.468  17.666  1.00 47.91 ? 164 LEU A CD2 1 
ATOM   330  N N   . PHE A 1 42  ? 43.498 28.259  18.217  1.00 52.65 ? 165 PHE A N   1 
ATOM   331  C CA  . PHE A 1 42  ? 44.894 28.667  18.357  1.00 53.49 ? 165 PHE A CA  1 
ATOM   332  C C   . PHE A 1 42  ? 45.846 27.567  17.977  1.00 51.97 ? 165 PHE A C   1 
ATOM   333  O O   . PHE A 1 42  ? 45.813 26.473  18.536  1.00 51.38 ? 165 PHE A O   1 
ATOM   334  C CB  . PHE A 1 42  ? 45.160 29.237  19.743  1.00 55.74 ? 165 PHE A CB  1 
ATOM   335  C CG  . PHE A 1 42  ? 44.236 30.354  20.066  1.00 60.52 ? 165 PHE A CG  1 
ATOM   336  C CD1 . PHE A 1 42  ? 42.921 30.092  20.472  1.00 64.08 ? 165 PHE A CD1 1 
ATOM   337  C CD2 . PHE A 1 42  ? 44.628 31.677  19.875  1.00 65.84 ? 165 PHE A CD2 1 
ATOM   338  C CE1 . PHE A 1 42  ? 41.997 31.146  20.712  1.00 65.07 ? 165 PHE A CE1 1 
ATOM   339  C CE2 . PHE A 1 42  ? 43.712 32.734  20.136  1.00 67.17 ? 165 PHE A CE2 1 
ATOM   340  C CZ  . PHE A 1 42  ? 42.397 32.450  20.550  1.00 63.56 ? 165 PHE A CZ  1 
ATOM   341  N N   . LYS A 1 43  ? 46.666 27.905  16.979  1.00 51.03 ? 166 LYS A N   1 
ATOM   342  C CA  . LYS A 1 43  ? 47.613 27.007  16.309  1.00 49.31 ? 166 LYS A CA  1 
ATOM   343  C C   . LYS A 1 43  ? 48.505 26.278  17.267  1.00 48.41 ? 166 LYS A C   1 
ATOM   344  O O   . LYS A 1 43  ? 48.670 25.076  17.156  1.00 48.79 ? 166 LYS A O   1 
ATOM   345  C CB  . LYS A 1 43  ? 48.491 27.790  15.300  1.00 49.45 ? 166 LYS A CB  1 
ATOM   346  C CG  . LYS A 1 43  ? 47.697 28.420  14.093  1.00 49.53 ? 166 LYS A CG  1 
ATOM   347  C CD  . LYS A 1 43  ? 48.630 28.901  12.979  1.00 47.56 ? 166 LYS A CD  1 
ATOM   348  C CE  . LYS A 1 43  ? 47.876 29.182  11.686  1.00 47.16 ? 166 LYS A CE  1 
ATOM   349  N NZ  . LYS A 1 43  ? 48.698 29.858  10.635  1.00 47.02 ? 166 LYS A NZ  1 
ATOM   350  N N   . ALA A 1 44  ? 49.086 27.001  18.203  1.00 47.71 ? 167 ALA A N   1 
ATOM   351  C CA  . ALA A 1 44  ? 50.131 26.446  19.047  1.00 48.17 ? 167 ALA A CA  1 
ATOM   352  C C   . ALA A 1 44  ? 49.571 25.309  19.943  1.00 48.29 ? 167 ALA A C   1 
ATOM   353  O O   . ALA A 1 44  ? 50.236 24.306  20.191  1.00 47.69 ? 167 ALA A O   1 
ATOM   354  C CB  . ALA A 1 44  ? 50.760 27.563  19.878  1.00 47.45 ? 167 ALA A CB  1 
ATOM   355  N N   . GLN A 1 45  ? 48.323 25.497  20.378  1.00 48.40 ? 168 GLN A N   1 
ATOM   356  C CA  . GLN A 1 45  ? 47.615 24.582  21.243  1.00 49.10 ? 168 GLN A CA  1 
ATOM   357  C C   . GLN A 1 45  ? 47.117 23.374  20.461  1.00 49.47 ? 168 GLN A C   1 
ATOM   358  O O   . GLN A 1 45  ? 47.040 22.259  20.997  1.00 48.48 ? 168 GLN A O   1 
ATOM   359  C CB  . GLN A 1 45  ? 46.439 25.327  21.867  1.00 49.53 ? 168 GLN A CB  1 
ATOM   360  C CG  . GLN A 1 45  ? 45.859 24.731  23.112  1.00 49.26 ? 168 GLN A CG  1 
ATOM   361  C CD  . GLN A 1 45  ? 44.859 25.654  23.761  1.00 50.15 ? 168 GLN A CD  1 
ATOM   362  O OE1 . GLN A 1 45  ? 45.042 26.861  23.762  1.00 48.76 ? 168 GLN A OE1 1 
ATOM   363  N NE2 . GLN A 1 45  ? 43.793 25.094  24.308  1.00 48.30 ? 168 GLN A NE2 1 
ATOM   364  N N   . LEU A 1 46  ? 46.775 23.609  19.194  1.00 50.34 ? 169 LEU A N   1 
ATOM   365  C CA  . LEU A 1 46  ? 46.493 22.525  18.231  1.00 51.00 ? 169 LEU A CA  1 
ATOM   366  C C   . LEU A 1 46  ? 47.675 21.623  17.992  1.00 49.72 ? 169 LEU A C   1 
ATOM   367  O O   . LEU A 1 46  ? 47.560 20.397  18.066  1.00 49.37 ? 169 LEU A O   1 
ATOM   368  C CB  . LEU A 1 46  ? 46.098 23.072  16.858  1.00 51.09 ? 169 LEU A CB  1 
ATOM   369  C CG  . LEU A 1 46  ? 44.818 23.828  16.684  1.00 54.40 ? 169 LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 46  ? 44.682 24.158  15.169  1.00 54.30 ? 169 LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 46  ? 43.634 22.995  17.217  1.00 54.43 ? 169 LEU A CD2 1 
ATOM   372  N N   . GLU A 1 47  ? 48.782 22.260  17.620  1.00 49.41 ? 170 GLU A N   1 
ATOM   373  C CA  . GLU A 1 47  ? 50.065 21.584  17.375  1.00 48.71 ? 170 GLU A CA  1 
ATOM   374  C C   . GLU A 1 47  ? 50.693 20.929  18.592  1.00 48.78 ? 170 GLU A C   1 
ATOM   375  O O   . GLU A 1 47  ? 51.453 19.969  18.445  1.00 49.01 ? 170 GLU A O   1 
ATOM   376  C CB  . GLU A 1 47  ? 51.060 22.571  16.776  1.00 48.31 ? 170 GLU A CB  1 
ATOM   377  C CG  . GLU A 1 47  ? 50.561 23.096  15.422  1.00 49.69 ? 170 GLU A CG  1 
ATOM   378  C CD  . GLU A 1 47  ? 51.471 24.136  14.806  1.00 48.96 ? 170 GLU A CD  1 
ATOM   379  O OE1 . GLU A 1 47  ? 52.727 24.019  14.896  1.00 50.01 ? 170 GLU A OE1 1 
ATOM   380  O OE2 . GLU A 1 47  ? 50.914 25.052  14.187  1.00 49.26 ? 170 GLU A OE2 1 
ATOM   381  N N   . LYS A 1 48  ? 50.430 21.452  19.794  1.00 48.76 ? 171 LYS A N   1 
ATOM   382  C CA  . LYS A 1 48  ? 50.943 20.796  20.975  1.00 48.18 ? 171 LYS A CA  1 
ATOM   383  C C   . LYS A 1 48  ? 50.119 19.541  21.260  1.00 48.25 ? 171 LYS A C   1 
ATOM   384  O O   . LYS A 1 48  ? 50.653 18.536  21.710  1.00 48.11 ? 171 LYS A O   1 
ATOM   385  C CB  . LYS A 1 48  ? 51.021 21.758  22.167  1.00 48.32 ? 171 LYS A CB  1 
ATOM   386  C CG  . LYS A 1 48  ? 51.859 21.236  23.354  1.00 46.50 ? 171 LYS A CG  1 
ATOM   387  C CD  . LYS A 1 48  ? 53.325 21.135  22.981  1.00 49.36 ? 171 LYS A CD  1 
ATOM   388  C CE  . LYS A 1 48  ? 54.198 21.037  24.226  1.00 53.33 ? 171 LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 48  ? 53.744 19.977  25.188  1.00 52.70 ? 171 LYS A NZ  1 
ATOM   390  N N   . ALA A 1 49  ? 48.827 19.616  20.955  1.00 48.85 ? 172 ALA A N   1 
ATOM   391  C CA  . ALA A 1 49  ? 47.840 18.538  21.153  1.00 49.73 ? 172 ALA A CA  1 
ATOM   392  C C   . ALA A 1 49  ? 47.945 17.426  20.100  1.00 50.91 ? 172 ALA A C   1 
ATOM   393  O O   . ALA A 1 49  ? 47.520 16.265  20.370  1.00 51.38 ? 172 ALA A O   1 
ATOM   394  C CB  . ALA A 1 49  ? 46.419 19.116  21.132  1.00 49.63 ? 172 ALA A CB  1 
ATOM   395  N N   . GLY A 1 50  ? 48.471 17.791  18.917  1.00 50.76 ? 173 GLY A N   1 
ATOM   396  C CA  . GLY A 1 50  ? 48.657 16.879  17.794  1.00 52.07 ? 173 GLY A CA  1 
ATOM   397  C C   . GLY A 1 50  ? 47.398 16.724  16.924  1.00 53.09 ? 173 GLY A C   1 
ATOM   398  O O   . GLY A 1 50  ? 47.285 15.770  16.162  1.00 53.84 ? 173 GLY A O   1 
ATOM   399  N N   . VAL A 1 51  ? 46.472 17.676  16.995  1.00 53.36 ? 174 VAL A N   1 
ATOM   400  C CA  . VAL A 1 51  ? 45.152 17.513  16.372  1.00 53.94 ? 174 VAL A CA  1 
ATOM   401  C C   . VAL A 1 51  ? 44.955 18.307  15.064  1.00 55.43 ? 174 VAL A C   1 
ATOM   402  O O   . VAL A 1 51  ? 43.844 18.373  14.526  1.00 56.00 ? 174 VAL A O   1 
ATOM   403  C CB  . VAL A 1 51  ? 44.034 17.857  17.382  1.00 53.23 ? 174 VAL A CB  1 
ATOM   404  C CG1 . VAL A 1 51  ? 44.025 16.850  18.542  1.00 53.13 ? 174 VAL A CG1 1 
ATOM   405  C CG2 . VAL A 1 51  ? 44.190 19.261  17.912  1.00 50.95 ? 174 VAL A CG2 1 
ATOM   406  N N   . GLU A 1 52  ? 46.037 18.899  14.557  1.00 56.59 ? 175 GLU A N   1 
ATOM   407  C CA  . GLU A 1 52  ? 45.994 19.808  13.406  1.00 57.43 ? 175 GLU A CA  1 
ATOM   408  C C   . GLU A 1 52  ? 45.668 19.078  12.087  1.00 57.64 ? 175 GLU A C   1 
ATOM   409  O O   . GLU A 1 52  ? 45.021 19.627  11.183  1.00 56.66 ? 175 GLU A O   1 
ATOM   410  C CB  . GLU A 1 52  ? 47.305 20.592  13.318  1.00 57.39 ? 175 GLU A CB  1 
ATOM   411  C CG  . GLU A 1 52  ? 48.376 20.103  14.311  1.00 60.72 ? 175 GLU A CG  1 
ATOM   412  C CD  . GLU A 1 52  ? 49.527 19.369  13.652  1.00 65.59 ? 175 GLU A CD  1 
ATOM   413  O OE1 . GLU A 1 52  ? 49.459 19.221  12.409  1.00 71.36 ? 175 GLU A OE1 1 
ATOM   414  O OE2 . GLU A 1 52  ? 50.492 18.957  14.346  1.00 62.21 ? 175 GLU A OE2 1 
ATOM   415  N N   . HIS A 1 53  ? 46.084 17.820  11.984  1.00 57.45 ? 176 HIS A N   1 
ATOM   416  C CA  . HIS A 1 53  ? 45.679 17.044  10.824  1.00 57.23 ? 176 HIS A CA  1 
ATOM   417  C C   . HIS A 1 53  ? 44.213 16.652  10.855  1.00 55.84 ? 176 HIS A C   1 
ATOM   418  O O   . HIS A 1 53  ? 43.572 16.570  9.822   1.00 56.23 ? 176 HIS A O   1 
ATOM   419  C CB  . HIS A 1 53  ? 46.604 15.863  10.660  1.00 58.22 ? 176 HIS A CB  1 
ATOM   420  C CG  . HIS A 1 53  ? 48.044 16.239  10.803  1.00 61.95 ? 176 HIS A CG  1 
ATOM   421  N ND1 . HIS A 1 53  ? 48.850 15.738  11.806  1.00 64.91 ? 176 HIS A ND1 1 
ATOM   422  C CD2 . HIS A 1 53  ? 48.803 17.132  10.115  1.00 64.47 ? 176 HIS A CD2 1 
ATOM   423  C CE1 . HIS A 1 53  ? 50.060 16.264  11.695  1.00 66.49 ? 176 HIS A CE1 1 
ATOM   424  N NE2 . HIS A 1 53  ? 50.055 17.121  10.683  1.00 66.35 ? 176 HIS A NE2 1 
ATOM   425  N N   . GLN A 1 54  ? 43.672 16.434  12.041  1.00 54.70 ? 177 GLN A N   1 
ATOM   426  C CA  . GLN A 1 54  ? 42.234 16.208  12.192  1.00 53.79 ? 177 GLN A CA  1 
ATOM   427  C C   . GLN A 1 54  ? 41.420 17.404  11.672  1.00 52.88 ? 177 GLN A C   1 
ATOM   428  O O   . GLN A 1 54  ? 40.354 17.257  11.037  1.00 52.28 ? 177 GLN A O   1 
ATOM   429  C CB  . GLN A 1 54  ? 41.896 15.967  13.675  1.00 53.19 ? 177 GLN A CB  1 
ATOM   430  C CG  . GLN A 1 54  ? 42.442 14.666  14.247  1.00 54.51 ? 177 GLN A CG  1 
ATOM   431  C CD  . GLN A 1 54  ? 42.199 14.521  15.779  1.00 55.30 ? 177 GLN A CD  1 
ATOM   432  O OE1 . GLN A 1 54  ? 41.640 15.416  16.452  1.00 57.49 ? 177 GLN A OE1 1 
ATOM   433  N NE2 . GLN A 1 54  ? 42.621 13.398  16.318  1.00 54.40 ? 177 GLN A NE2 1 
ATOM   434  N N   . LEU A 1 55  ? 41.935 18.592  11.978  1.00 52.23 ? 178 LEU A N   1 
ATOM   435  C CA  . LEU A 1 55  ? 41.308 19.845  11.610  1.00 51.45 ? 178 LEU A CA  1 
ATOM   436  C C   . LEU A 1 55  ? 41.236 19.985  10.103  1.00 51.31 ? 178 LEU A C   1 
ATOM   437  O O   . LEU A 1 55  ? 40.152 20.278  9.540   1.00 51.02 ? 178 LEU A O   1 
ATOM   438  C CB  . LEU A 1 55  ? 42.089 21.022  12.185  1.00 51.56 ? 178 LEU A CB  1 
ATOM   439  C CG  . LEU A 1 55  ? 41.453 22.379  11.881  1.00 50.59 ? 178 LEU A CG  1 
ATOM   440  C CD1 . LEU A 1 55  ? 40.083 22.474  12.567  1.00 47.00 ? 178 LEU A CD1 1 
ATOM   441  C CD2 . LEU A 1 55  ? 42.406 23.435  12.371  1.00 50.67 ? 178 LEU A CD2 1 
ATOM   442  N N   . ARG A 1 56  ? 42.393 19.801  9.468   1.00 49.60 ? 179 ARG A N   1 
ATOM   443  C CA  . ARG A 1 56  ? 42.492 19.748  8.022   1.00 50.29 ? 179 ARG A CA  1 
ATOM   444  C C   . ARG A 1 56  ? 41.365 18.893  7.427   1.00 49.49 ? 179 ARG A C   1 
ATOM   445  O O   . ARG A 1 56  ? 40.593 19.365  6.594   1.00 49.96 ? 179 ARG A O   1 
ATOM   446  C CB  . ARG A 1 56  ? 43.855 19.185  7.593   1.00 49.58 ? 179 ARG A CB  1 
ATOM   447  C CG  . ARG A 1 56  ? 43.878 18.700  6.145   1.00 52.09 ? 179 ARG A CG  1 
ATOM   448  C CD  . ARG A 1 56  ? 45.240 18.197  5.709   1.00 54.17 ? 179 ARG A CD  1 
ATOM   449  N NE  . ARG A 1 56  ? 46.215 19.284  5.685   1.00 60.21 ? 179 ARG A NE  1 
ATOM   450  C CZ  . ARG A 1 56  ? 46.527 19.991  4.593   1.00 66.36 ? 179 ARG A CZ  1 
ATOM   451  N NH1 . ARG A 1 56  ? 45.933 19.718  3.404   1.00 66.90 ? 179 ARG A NH1 1 
ATOM   452  N NH2 . ARG A 1 56  ? 47.456 20.960  4.682   1.00 64.82 ? 179 ARG A NH2 1 
ATOM   453  N N   . ARG A 1 57  ? 41.284 17.636  7.854   1.00 49.09 ? 180 ARG A N   1 
ATOM   454  C CA  . ARG A 1 57  ? 40.251 16.718  7.381   1.00 49.01 ? 180 ARG A CA  1 
ATOM   455  C C   . ARG A 1 57  ? 38.813 17.267  7.606   1.00 49.11 ? 180 ARG A C   1 
ATOM   456  O O   . ARG A 1 57  ? 37.970 17.194  6.727   1.00 48.95 ? 180 ARG A O   1 
ATOM   457  C CB  . ARG A 1 57  ? 40.438 15.359  8.059   1.00 48.55 ? 180 ARG A CB  1 
ATOM   458  C CG  . ARG A 1 57  ? 39.454 14.309  7.602   1.00 49.32 ? 180 ARG A CG  1 
ATOM   459  C CD  . ARG A 1 57  ? 39.170 13.290  8.684   1.00 51.14 ? 180 ARG A CD  1 
ATOM   460  N NE  . ARG A 1 57  ? 40.187 12.250  8.763   1.00 55.35 ? 180 ARG A NE  1 
ATOM   461  C CZ  . ARG A 1 57  ? 40.157 11.226  9.622   1.00 59.41 ? 180 ARG A CZ  1 
ATOM   462  N NH1 . ARG A 1 57  ? 39.147 11.099  10.502  1.00 61.14 ? 180 ARG A NH1 1 
ATOM   463  N NH2 . ARG A 1 57  ? 41.132 10.317  9.598   1.00 58.20 ? 180 ARG A NH2 1 
ATOM   464  N N   . GLU A 1 58  ? 38.559 17.830  8.781   1.00 49.53 ? 181 GLU A N   1 
ATOM   465  C CA  . GLU A 1 58  ? 37.241 18.307  9.121   1.00 51.31 ? 181 GLU A CA  1 
ATOM   466  C C   . GLU A 1 58  ? 36.823 19.458  8.198   1.00 50.61 ? 181 GLU A C   1 
ATOM   467  O O   . GLU A 1 58  ? 35.688 19.509  7.691   1.00 52.31 ? 181 GLU A O   1 
ATOM   468  C CB  . GLU A 1 58  ? 37.238 18.738  10.588  1.00 51.55 ? 181 GLU A CB  1 
ATOM   469  C CG  . GLU A 1 58  ? 35.945 19.340  11.097  1.00 53.21 ? 181 GLU A CG  1 
ATOM   470  C CD  . GLU A 1 58  ? 36.127 20.044  12.448  1.00 54.88 ? 181 GLU A CD  1 
ATOM   471  O OE1 . GLU A 1 58  ? 37.249 19.986  13.022  1.00 56.07 ? 181 GLU A OE1 1 
ATOM   472  O OE2 . GLU A 1 58  ? 35.142 20.667  12.929  1.00 58.31 ? 181 GLU A OE2 1 
ATOM   473  N N   . VAL A 1 59  ? 37.758 20.362  7.945   1.00 50.54 ? 182 VAL A N   1 
ATOM   474  C CA  . VAL A 1 59  ? 37.511 21.532  7.113   1.00 49.14 ? 182 VAL A CA  1 
ATOM   475  C C   . VAL A 1 59  ? 37.293 21.111  5.686   1.00 49.42 ? 182 VAL A C   1 
ATOM   476  O O   . VAL A 1 59  ? 36.325 21.546  5.058   1.00 50.62 ? 182 VAL A O   1 
ATOM   477  C CB  . VAL A 1 59  ? 38.634 22.560  7.281   1.00 48.15 ? 182 VAL A CB  1 
ATOM   478  C CG1 . VAL A 1 59  ? 38.493 23.708  6.317   1.00 48.15 ? 182 VAL A CG1 1 
ATOM   479  C CG2 . VAL A 1 59  ? 38.579 23.102  8.670   1.00 48.12 ? 182 VAL A CG2 1 
ATOM   480  N N   . GLU A 1 60  ? 38.180 20.254  5.184   1.00 49.38 ? 183 GLU A N   1 
ATOM   481  C CA  . GLU A 1 60  ? 38.116 19.766  3.827   1.00 50.06 ? 183 GLU A CA  1 
ATOM   482  C C   . GLU A 1 60  ? 36.800 19.082  3.558   1.00 50.35 ? 183 GLU A C   1 
ATOM   483  O O   . GLU A 1 60  ? 36.137 19.380  2.570   1.00 50.90 ? 183 GLU A O   1 
ATOM   484  C CB  . GLU A 1 60  ? 39.306 18.851  3.525   1.00 50.33 ? 183 GLU A CB  1 
ATOM   485  C CG  . GLU A 1 60  ? 40.486 19.636  2.995   1.00 50.72 ? 183 GLU A CG  1 
ATOM   486  C CD  . GLU A 1 60  ? 41.747 18.836  2.890   1.00 53.16 ? 183 GLU A CD  1 
ATOM   487  O OE1 . GLU A 1 60  ? 41.667 17.602  2.693   1.00 55.27 ? 183 GLU A OE1 1 
ATOM   488  O OE2 . GLU A 1 60  ? 42.836 19.444  3.013   1.00 55.02 ? 183 GLU A OE2 1 
ATOM   489  N N   . ILE A 1 61  ? 36.386 18.210  4.473   1.00 50.72 ? 184 ILE A N   1 
ATOM   490  C CA  . ILE A 1 61  ? 35.100 17.516  4.328   1.00 50.81 ? 184 ILE A CA  1 
ATOM   491  C C   . ILE A 1 61  ? 33.905 18.446  4.360   1.00 50.72 ? 184 ILE A C   1 
ATOM   492  O O   . ILE A 1 61  ? 33.143 18.495  3.389   1.00 51.37 ? 184 ILE A O   1 
ATOM   493  C CB  . ILE A 1 61  ? 34.889 16.424  5.395   1.00 50.54 ? 184 ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 61  ? 35.874 15.286  5.183   1.00 49.60 ? 184 ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 61  ? 33.420 15.911  5.349   1.00 49.87 ? 184 ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 61  ? 35.976 14.336  6.362   1.00 51.11 ? 184 ILE A CD1 1 
ATOM   497  N N   . GLN A 1 62  ? 33.754 19.173  5.471   1.00 50.34 ? 185 GLN A N   1 
ATOM   498  C CA  . GLN A 1 62  ? 32.518 19.917  5.745   1.00 51.08 ? 185 GLN A CA  1 
ATOM   499  C C   . GLN A 1 62  ? 32.380 21.112  4.833   1.00 51.04 ? 185 GLN A C   1 
ATOM   500  O O   . GLN A 1 62  ? 31.253 21.477  4.475   1.00 52.15 ? 185 GLN A O   1 
ATOM   501  C CB  . GLN A 1 62  ? 32.379 20.356  7.236   1.00 51.40 ? 185 GLN A CB  1 
ATOM   502  C CG  . GLN A 1 62  ? 31.114 21.216  7.517   1.00 50.35 ? 185 GLN A CG  1 
ATOM   503  C CD  . GLN A 1 62  ? 30.934 21.648  8.981   1.00 52.24 ? 185 GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 62  ? 31.810 21.456  9.823   1.00 52.27 ? 185 GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 62  ? 29.744 22.189  9.297   1.00 55.16 ? 185 GLN A NE2 1 
ATOM   506  N N   . SER A 1 63  ? 33.496 21.730  4.452   1.00 50.64 ? 186 SER A N   1 
ATOM   507  C CA  . SER A 1 63  ? 33.404 22.817  3.455   1.00 51.09 ? 186 SER A CA  1 
ATOM   508  C C   . SER A 1 63  ? 32.972 22.384  2.056   1.00 51.46 ? 186 SER A C   1 
ATOM   509  O O   . SER A 1 63  ? 32.538 23.253  1.280   1.00 52.60 ? 186 SER A O   1 
ATOM   510  C CB  . SER A 1 63  ? 34.691 23.643  3.346   1.00 50.48 ? 186 SER A CB  1 
ATOM   511  O OG  . SER A 1 63  ? 35.778 22.857  2.859   1.00 51.74 ? 186 SER A OG  1 
ATOM   512  N N   . HIS A 1 64  ? 33.127 21.092  1.707   1.00 50.91 ? 187 HIS A N   1 
ATOM   513  C CA  . HIS A 1 64  ? 32.569 20.574  0.442   1.00 51.19 ? 187 HIS A CA  1 
ATOM   514  C C   . HIS A 1 64  ? 31.159 19.999  0.499   1.00 51.68 ? 187 HIS A C   1 
ATOM   515  O O   . HIS A 1 64  ? 30.697 19.483  -0.505  1.00 52.04 ? 187 HIS A O   1 
ATOM   516  C CB  . HIS A 1 64  ? 33.518 19.585  -0.249  1.00 50.92 ? 187 HIS A CB  1 
ATOM   517  C CG  . HIS A 1 64  ? 34.840 20.195  -0.582  1.00 51.40 ? 187 HIS A CG  1 
ATOM   518  N ND1 . HIS A 1 64  ? 35.919 20.153  0.279   1.00 50.74 ? 187 HIS A ND1 1 
ATOM   519  C CD2 . HIS A 1 64  ? 35.229 20.946  -1.637  1.00 48.87 ? 187 HIS A CD2 1 
ATOM   520  C CE1 . HIS A 1 64  ? 36.932 20.807  -0.253  1.00 47.78 ? 187 HIS A CE1 1 
ATOM   521  N NE2 . HIS A 1 64  ? 36.539 21.299  -1.414  1.00 51.03 ? 187 HIS A NE2 1 
ATOM   522  N N   . LEU A 1 65  ? 30.476 20.059  1.649   1.00 51.74 ? 188 LEU A N   1 
ATOM   523  C CA  . LEU A 1 65  ? 29.147 19.459  1.731   1.00 51.94 ? 188 LEU A CA  1 
ATOM   524  C C   . LEU A 1 65  ? 28.038 20.502  1.638   1.00 52.22 ? 188 LEU A C   1 
ATOM   525  O O   . LEU A 1 65  ? 27.995 21.488  2.403   1.00 51.79 ? 188 LEU A O   1 
ATOM   526  C CB  . LEU A 1 65  ? 28.978 18.588  2.984   1.00 51.70 ? 188 LEU A CB  1 
ATOM   527  C CG  . LEU A 1 65  ? 29.963 17.459  3.220   1.00 51.20 ? 188 LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 65  ? 29.961 17.194  4.696   1.00 52.31 ? 188 LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 65  ? 29.623 16.214  2.420   1.00 50.95 ? 188 LEU A CD2 1 
ATOM   530  N N   . ARG A 1 66  ? 27.144 20.270  0.685   1.00 52.57 ? 189 ARG A N   1 
ATOM   531  C CA  . ARG A 1 66  ? 26.082 21.210  0.390   1.00 52.89 ? 189 ARG A CA  1 
ATOM   532  C C   . ARG A 1 66  ? 24.713 20.561  0.577   1.00 52.35 ? 189 ARG A C   1 
ATOM   533  O O   . ARG A 1 66  ? 24.240 19.825  -0.275  1.00 51.44 ? 189 ARG A O   1 
ATOM   534  C CB  . ARG A 1 66  ? 26.263 21.777  -1.014  1.00 53.47 ? 189 ARG A CB  1 
ATOM   535  C CG  . ARG A 1 66  ? 25.636 23.142  -1.158  1.00 57.46 ? 189 ARG A CG  1 
ATOM   536  C CD  . ARG A 1 66  ? 26.204 24.081  -0.111  1.00 61.88 ? 189 ARG A CD  1 
ATOM   537  N NE  . ARG A 1 66  ? 27.283 24.845  -0.702  1.00 67.04 ? 189 ARG A NE  1 
ATOM   538  C CZ  . ARG A 1 66  ? 28.552 24.445  -0.792  1.00 68.60 ? 189 ARG A CZ  1 
ATOM   539  N NH1 . ARG A 1 66  ? 28.934 23.279  -0.290  1.00 68.87 ? 189 ARG A NH1 1 
ATOM   540  N NH2 . ARG A 1 66  ? 29.445 25.231  -1.382  1.00 67.22 ? 189 ARG A NH2 1 
ATOM   541  N N   . HIS A 1 67  ? 24.115 20.788  1.745   1.00 52.51 ? 190 HIS A N   1 
ATOM   542  C CA  . HIS A 1 67  ? 22.807 20.211  2.053   1.00 52.14 ? 190 HIS A CA  1 
ATOM   543  C C   . HIS A 1 67  ? 22.097 21.121  3.057   1.00 52.43 ? 190 HIS A C   1 
ATOM   544  O O   . HIS A 1 67  ? 22.763 21.766  3.904   1.00 51.58 ? 190 HIS A O   1 
ATOM   545  C CB  . HIS A 1 67  ? 22.925 18.772  2.576   1.00 51.95 ? 190 HIS A CB  1 
ATOM   546  C CG  . HIS A 1 67  ? 21.609 18.052  2.682   1.00 52.16 ? 190 HIS A CG  1 
ATOM   547  N ND1 . HIS A 1 67  ? 20.711 18.275  3.713   1.00 50.09 ? 190 HIS A ND1 1 
ATOM   548  C CD2 . HIS A 1 67  ? 21.041 17.109  1.892   1.00 50.83 ? 190 HIS A CD2 1 
ATOM   549  C CE1 . HIS A 1 67  ? 19.642 17.515  3.540   1.00 49.22 ? 190 HIS A CE1 1 
ATOM   550  N NE2 . HIS A 1 67  ? 19.825 16.781  2.457   1.00 49.81 ? 190 HIS A NE2 1 
ATOM   551  N N   . PRO A 1 68  ? 20.747 21.217  2.920   1.00 52.59 ? 191 PRO A N   1 
ATOM   552  C CA  . PRO A 1 68  ? 19.797 21.959  3.790   1.00 52.75 ? 191 PRO A CA  1 
ATOM   553  C C   . PRO A 1 68  ? 19.917 21.649  5.277   1.00 52.75 ? 191 PRO A C   1 
ATOM   554  O O   . PRO A 1 68  ? 19.745 22.549  6.115   1.00 52.91 ? 191 PRO A O   1 
ATOM   555  C CB  . PRO A 1 68  ? 18.421 21.479  3.281   1.00 52.36 ? 191 PRO A CB  1 
ATOM   556  C CG  . PRO A 1 68  ? 18.666 21.096  1.882   1.00 51.60 ? 191 PRO A CG  1 
ATOM   557  C CD  . PRO A 1 68  ? 20.045 20.598  1.773   1.00 51.89 ? 191 PRO A CD  1 
ATOM   558  N N   . ASN A 1 69  ? 20.194 20.380  5.586   1.00 52.50 ? 192 ASN A N   1 
ATOM   559  C CA  . ASN A 1 69  ? 20.310 19.881  6.945   1.00 51.34 ? 192 ASN A CA  1 
ATOM   560  C C   . ASN A 1 69  ? 21.746 19.621  7.388   1.00 51.07 ? 192 ASN A C   1 
ATOM   561  O O   . ASN A 1 69  ? 21.993 18.792  8.260   1.00 50.88 ? 192 ASN A O   1 
ATOM   562  C CB  . ASN A 1 69  ? 19.457 18.639  7.069   1.00 50.99 ? 192 ASN A CB  1 
ATOM   563  C CG  . ASN A 1 69  ? 18.004 18.906  6.713   1.00 50.25 ? 192 ASN A CG  1 
ATOM   564  O OD1 . ASN A 1 69  ? 17.481 18.351  5.742   1.00 49.90 ? 192 ASN A OD1 1 
ATOM   565  N ND2 . ASN A 1 69  ? 17.350 19.757  7.490   1.00 45.99 ? 192 ASN A ND2 1 
ATOM   566  N N   . ILE A 1 70  ? 22.685 20.354  6.793   1.00 50.20 ? 193 ILE A N   1 
ATOM   567  C CA  . ILE A 1 70  ? 24.099 20.287  7.154   1.00 49.46 ? 193 ILE A CA  1 
ATOM   568  C C   . ILE A 1 70  ? 24.601 21.706  7.181   1.00 50.09 ? 193 ILE A C   1 
ATOM   569  O O   . ILE A 1 70  ? 24.430 22.449  6.206   1.00 50.75 ? 193 ILE A O   1 
ATOM   570  C CB  . ILE A 1 70  ? 24.944 19.436  6.161   1.00 49.15 ? 193 ILE A CB  1 
ATOM   571  C CG1 . ILE A 1 70  ? 24.433 17.975  6.142   1.00 49.38 ? 193 ILE A CG1 1 
ATOM   572  C CG2 . ILE A 1 70  ? 26.439 19.537  6.480   1.00 46.94 ? 193 ILE A CG2 1 
ATOM   573  C CD1 . ILE A 1 70  ? 25.174 17.021  5.232   1.00 49.74 ? 193 ILE A CD1 1 
ATOM   574  N N   . LEU A 1 71  ? 25.202 22.083  8.304   1.00 50.50 ? 194 LEU A N   1 
ATOM   575  C CA  . LEU A 1 71  ? 25.649 23.437  8.530   1.00 50.31 ? 194 LEU A CA  1 
ATOM   576  C C   . LEU A 1 71  ? 26.757 23.748  7.561   1.00 51.10 ? 194 LEU A C   1 
ATOM   577  O O   . LEU A 1 71  ? 27.789 23.015  7.521   1.00 50.81 ? 194 LEU A O   1 
ATOM   578  C CB  . LEU A 1 71  ? 26.171 23.589  9.964   1.00 51.03 ? 194 LEU A CB  1 
ATOM   579  C CG  . LEU A 1 71  ? 26.357 25.005  10.540  1.00 49.64 ? 194 LEU A CG  1 
ATOM   580  C CD1 . LEU A 1 71  ? 25.050 25.492  11.149  1.00 50.42 ? 194 LEU A CD1 1 
ATOM   581  C CD2 . LEU A 1 71  ? 27.397 24.968  11.579  1.00 47.11 ? 194 LEU A CD2 1 
ATOM   582  N N   . ARG A 1 72  ? 26.533 24.802  6.757   1.00 50.16 ? 195 ARG A N   1 
ATOM   583  C CA  . ARG A 1 72  ? 27.563 25.302  5.884   1.00 49.87 ? 195 ARG A CA  1 
ATOM   584  C C   . ARG A 1 72  ? 28.814 25.689  6.691   1.00 49.34 ? 195 ARG A C   1 
ATOM   585  O O   . ARG A 1 72  ? 28.745 26.417  7.694   1.00 48.44 ? 195 ARG A O   1 
ATOM   586  C CB  . ARG A 1 72  ? 27.089 26.539  5.087   1.00 50.20 ? 195 ARG A CB  1 
ATOM   587  C CG  . ARG A 1 72  ? 26.051 26.295  4.006   1.00 52.93 ? 195 ARG A CG  1 
ATOM   588  C CD  . ARG A 1 72  ? 26.613 25.560  2.812   1.00 57.49 ? 195 ARG A CD  1 
ATOM   589  N NE  . ARG A 1 72  ? 27.828 26.206  2.268   1.00 62.42 ? 195 ARG A NE  1 
ATOM   590  C CZ  . ARG A 1 72  ? 27.846 27.222  1.400   1.00 61.54 ? 195 ARG A CZ  1 
ATOM   591  N NH1 . ARG A 1 72  ? 26.708 27.754  0.962   1.00 59.79 ? 195 ARG A NH1 1 
ATOM   592  N NH2 . ARG A 1 72  ? 29.019 27.717  0.983   1.00 62.04 ? 195 ARG A NH2 1 
ATOM   593  N N   . LEU A 1 73  ? 29.947 25.195  6.237   1.00 49.43 ? 196 LEU A N   1 
ATOM   594  C CA  . LEU A 1 73  ? 31.215 25.833  6.554   1.00 50.63 ? 196 LEU A CA  1 
ATOM   595  C C   . LEU A 1 73  ? 31.571 26.637  5.302   1.00 51.45 ? 196 LEU A C   1 
ATOM   596  O O   . LEU A 1 73  ? 31.994 26.058  4.301   1.00 52.89 ? 196 LEU A O   1 
ATOM   597  C CB  . LEU A 1 73  ? 32.305 24.810  6.886   1.00 49.31 ? 196 LEU A CB  1 
ATOM   598  C CG  . LEU A 1 73  ? 33.764 25.244  7.042   1.00 49.62 ? 196 LEU A CG  1 
ATOM   599  C CD1 . LEU A 1 73  ? 33.973 26.448  7.982   1.00 52.32 ? 196 LEU A CD1 1 
ATOM   600  C CD2 . LEU A 1 73  ? 34.625 24.072  7.514   1.00 49.39 ? 196 LEU A CD2 1 
ATOM   601  N N   . TYR A 1 74  ? 31.375 27.948  5.330   1.00 50.38 ? 197 TYR A N   1 
ATOM   602  C CA  . TYR A 1 74  ? 31.535 28.704  4.109   1.00 50.60 ? 197 TYR A CA  1 
ATOM   603  C C   . TYR A 1 74  ? 32.978 28.786  3.656   1.00 50.34 ? 197 TYR A C   1 
ATOM   604  O O   . TYR A 1 74  ? 33.215 29.021  2.499   1.00 50.80 ? 197 TYR A O   1 
ATOM   605  C CB  . TYR A 1 74  ? 30.979 30.121  4.250   1.00 51.19 ? 197 TYR A CB  1 
ATOM   606  C CG  . TYR A 1 74  ? 29.526 30.198  4.605   1.00 50.63 ? 197 TYR A CG  1 
ATOM   607  C CD1 . TYR A 1 74  ? 29.123 30.528  5.883   1.00 51.59 ? 197 TYR A CD1 1 
ATOM   608  C CD2 . TYR A 1 74  ? 28.554 30.044  3.625   1.00 53.16 ? 197 TYR A CD2 1 
ATOM   609  C CE1 . TYR A 1 74  ? 27.742 30.649  6.201   1.00 54.00 ? 197 TYR A CE1 1 
ATOM   610  C CE2 . TYR A 1 74  ? 27.187 30.146  3.918   1.00 53.29 ? 197 TYR A CE2 1 
ATOM   611  C CZ  . TYR A 1 74  ? 26.784 30.430  5.196   1.00 54.17 ? 197 TYR A CZ  1 
ATOM   612  O OH  . TYR A 1 74  ? 25.423 30.521  5.445   1.00 55.56 ? 197 TYR A OH  1 
ATOM   613  N N   . GLY A 1 75  ? 33.939 28.628  4.570   1.00 50.41 ? 198 GLY A N   1 
ATOM   614  C CA  . GLY A 1 75  ? 35.338 28.963  4.284   1.00 50.58 ? 198 GLY A CA  1 
ATOM   615  C C   . GLY A 1 75  ? 36.142 29.011  5.572   1.00 50.61 ? 198 GLY A C   1 
ATOM   616  O O   . GLY A 1 75  ? 35.577 28.888  6.650   1.00 51.31 ? 198 GLY A O   1 
ATOM   617  N N   . TYR A 1 76  ? 37.453 29.147  5.447   1.00 49.68 ? 199 TYR A N   1 
ATOM   618  C CA  . TYR A 1 76  ? 38.364 29.251  6.574   1.00 49.51 ? 199 TYR A CA  1 
ATOM   619  C C   . TYR A 1 76  ? 39.470 30.249  6.145   1.00 49.54 ? 199 TYR A C   1 
ATOM   620  O O   . TYR A 1 76  ? 39.568 30.627  4.972   1.00 49.09 ? 199 TYR A O   1 
ATOM   621  C CB  . TYR A 1 76  ? 38.970 27.878  6.975   1.00 49.26 ? 199 TYR A CB  1 
ATOM   622  C CG  . TYR A 1 76  ? 40.253 27.531  6.179   1.00 50.33 ? 199 TYR A CG  1 
ATOM   623  C CD1 . TYR A 1 76  ? 41.539 27.702  6.745   1.00 49.48 ? 199 TYR A CD1 1 
ATOM   624  C CD2 . TYR A 1 76  ? 40.188 27.088  4.862   1.00 48.64 ? 199 TYR A CD2 1 
ATOM   625  C CE1 . TYR A 1 76  ? 42.698 27.423  6.018   1.00 49.04 ? 199 TYR A CE1 1 
ATOM   626  C CE2 . TYR A 1 76  ? 41.364 26.809  4.122   1.00 47.86 ? 199 TYR A CE2 1 
ATOM   627  C CZ  . TYR A 1 76  ? 42.596 26.979  4.701   1.00 49.94 ? 199 TYR A CZ  1 
ATOM   628  O OH  . TYR A 1 76  ? 43.748 26.715  3.962   1.00 52.38 ? 199 TYR A OH  1 
ATOM   629  N N   . PHE A 1 77  ? 40.267 30.698  7.115   1.00 49.17 ? 200 PHE A N   1 
ATOM   630  C CA  . PHE A 1 77  ? 41.519 31.401  6.848   1.00 49.08 ? 200 PHE A CA  1 
ATOM   631  C C   . PHE A 1 77  ? 42.372 31.334  8.131   1.00 50.40 ? 200 PHE A C   1 
ATOM   632  O O   . PHE A 1 77  ? 41.893 30.894  9.202   1.00 51.83 ? 200 PHE A O   1 
ATOM   633  C CB  . PHE A 1 77  ? 41.254 32.844  6.404   1.00 48.23 ? 200 PHE A CB  1 
ATOM   634  C CG  . PHE A 1 77  ? 40.421 33.639  7.382   1.00 46.46 ? 200 PHE A CG  1 
ATOM   635  C CD1 . PHE A 1 77  ? 41.022 34.559  8.222   1.00 44.44 ? 200 PHE A CD1 1 
ATOM   636  C CD2 . PHE A 1 77  ? 39.023 33.455  7.463   1.00 45.31 ? 200 PHE A CD2 1 
ATOM   637  C CE1 . PHE A 1 77  ? 40.258 35.276  9.149   1.00 46.74 ? 200 PHE A CE1 1 
ATOM   638  C CE2 . PHE A 1 77  ? 38.257 34.169  8.379   1.00 43.53 ? 200 PHE A CE2 1 
ATOM   639  C CZ  . PHE A 1 77  ? 38.862 35.079  9.222   1.00 44.72 ? 200 PHE A CZ  1 
ATOM   640  N N   . HIS A 1 78  ? 43.621 31.761  8.053   1.00 50.12 ? 201 HIS A N   1 
ATOM   641  C CA  . HIS A 1 78  ? 44.446 31.756  9.220   1.00 49.89 ? 201 HIS A CA  1 
ATOM   642  C C   . HIS A 1 78  ? 45.413 32.931  9.263   1.00 50.63 ? 201 HIS A C   1 
ATOM   643  O O   . HIS A 1 78  ? 45.674 33.589  8.257   1.00 50.31 ? 201 HIS A O   1 
ATOM   644  C CB  . HIS A 1 78  ? 45.190 30.403  9.299   1.00 49.92 ? 201 HIS A CB  1 
ATOM   645  C CG  . HIS A 1 78  ? 46.109 30.140  8.152   1.00 48.94 ? 201 HIS A CG  1 
ATOM   646  N ND1 . HIS A 1 78  ? 47.478 30.273  8.253   1.00 49.60 ? 201 HIS A ND1 1 
ATOM   647  C CD2 . HIS A 1 78  ? 45.862 29.740  6.883   1.00 48.69 ? 201 HIS A CD2 1 
ATOM   648  C CE1 . HIS A 1 78  ? 48.037 29.961  7.098   1.00 50.52 ? 201 HIS A CE1 1 
ATOM   649  N NE2 . HIS A 1 78  ? 47.078 29.635  6.248   1.00 51.03 ? 201 HIS A NE2 1 
ATOM   650  N N   . ASP A 1 79  ? 45.932 33.213  10.444  1.00 51.01 ? 202 ASP A N   1 
ATOM   651  C CA  . ASP A 1 79  ? 47.004 34.191  10.587  1.00 51.22 ? 202 ASP A CA  1 
ATOM   652  C C   . ASP A 1 79  ? 48.146 33.538  11.378  1.00 51.03 ? 202 ASP A C   1 
ATOM   653  O O   . ASP A 1 79  ? 48.181 32.316  11.552  1.00 51.84 ? 202 ASP A O   1 
ATOM   654  C CB  . ASP A 1 79  ? 46.505 35.484  11.266  1.00 50.76 ? 202 ASP A CB  1 
ATOM   655  C CG  . ASP A 1 79  ? 45.939 35.237  12.656  1.00 53.66 ? 202 ASP A CG  1 
ATOM   656  O OD1 . ASP A 1 79  ? 46.419 34.295  13.336  1.00 53.72 ? 202 ASP A OD1 1 
ATOM   657  O OD2 . ASP A 1 79  ? 44.994 35.975  13.060  1.00 56.30 ? 202 ASP A OD2 1 
ATOM   658  N N   . ALA A 1 80  ? 49.062 34.364  11.857  1.00 50.78 ? 203 ALA A N   1 
ATOM   659  C CA  . ALA A 1 80  ? 50.260 33.927  12.541  1.00 50.39 ? 203 ALA A CA  1 
ATOM   660  C C   . ALA A 1 80  ? 49.957 32.997  13.709  1.00 49.90 ? 203 ALA A C   1 
ATOM   661  O O   . ALA A 1 80  ? 50.746 32.108  14.015  1.00 50.62 ? 203 ALA A O   1 
ATOM   662  C CB  . ALA A 1 80  ? 51.057 35.141  13.018  1.00 49.60 ? 203 ALA A CB  1 
ATOM   663  N N   . THR A 1 81  ? 48.819 33.184  14.358  1.00 49.80 ? 204 THR A N   1 
ATOM   664  C CA  . THR A 1 81  ? 48.530 32.488  15.628  1.00 48.93 ? 204 THR A CA  1 
ATOM   665  C C   . THR A 1 81  ? 47.261 31.674  15.595  1.00 48.87 ? 204 THR A C   1 
ATOM   666  O O   . THR A 1 81  ? 47.112 30.725  16.361  1.00 48.66 ? 204 THR A O   1 
ATOM   667  C CB  . THR A 1 81  ? 48.441 33.485  16.841  1.00 49.44 ? 204 THR A CB  1 
ATOM   668  O OG1 . THR A 1 81  ? 47.258 34.308  16.741  1.00 50.72 ? 204 THR A OG1 1 
ATOM   669  C CG2 . THR A 1 81  ? 49.720 34.391  16.944  1.00 48.92 ? 204 THR A CG2 1 
ATOM   670  N N   . ARG A 1 82  ? 46.336 32.049  14.718  1.00 49.75 ? 205 ARG A N   1 
ATOM   671  C CA  . ARG A 1 82  ? 45.006 31.457  14.715  1.00 51.21 ? 205 ARG A CA  1 
ATOM   672  C C   . ARG A 1 82  ? 44.547 30.868  13.396  1.00 51.18 ? 205 ARG A C   1 
ATOM   673  O O   . ARG A 1 82  ? 45.026 31.262  12.344  1.00 51.98 ? 205 ARG A O   1 
ATOM   674  C CB  . ARG A 1 82  ? 43.967 32.456  15.260  1.00 51.51 ? 205 ARG A CB  1 
ATOM   675  C CG  . ARG A 1 82  ? 44.250 32.746  16.705  1.00 54.12 ? 205 ARG A CG  1 
ATOM   676  C CD  . ARG A 1 82  ? 43.537 33.972  17.244  1.00 57.73 ? 205 ARG A CD  1 
ATOM   677  N NE  . ARG A 1 82  ? 43.903 35.203  16.568  1.00 62.46 ? 205 ARG A NE  1 
ATOM   678  C CZ  . ARG A 1 82  ? 44.050 36.377  17.181  1.00 66.01 ? 205 ARG A CZ  1 
ATOM   679  N NH1 . ARG A 1 82  ? 43.917 36.448  18.508  1.00 69.71 ? 205 ARG A NH1 1 
ATOM   680  N NH2 . ARG A 1 82  ? 44.354 37.467  16.483  1.00 63.28 ? 205 ARG A NH2 1 
ATOM   681  N N   . VAL A 1 83  ? 43.626 29.902  13.483  1.00 50.75 ? 206 VAL A N   1 
ATOM   682  C CA  . VAL A 1 83  ? 42.844 29.447  12.337  1.00 49.49 ? 206 VAL A CA  1 
ATOM   683  C C   . VAL A 1 83  ? 41.362 29.823  12.609  1.00 49.32 ? 206 VAL A C   1 
ATOM   684  O O   . VAL A 1 83  ? 40.862 29.684  13.720  1.00 46.93 ? 206 VAL A O   1 
ATOM   685  C CB  . VAL A 1 83  ? 43.017 27.910  12.090  1.00 49.91 ? 206 VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 83  ? 42.368 27.477  10.795  1.00 48.36 ? 206 VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 83  ? 44.480 27.536  12.092  1.00 48.21 ? 206 VAL A CG2 1 
ATOM   688  N N   . TYR A 1 84  ? 40.694 30.339  11.575  1.00 49.86 ? 207 TYR A N   1 
ATOM   689  C CA  . TYR A 1 84  ? 39.314 30.781  11.665  1.00 50.75 ? 207 TYR A CA  1 
ATOM   690  C C   . TYR A 1 84  ? 38.415 29.928  10.787  1.00 50.90 ? 207 TYR A C   1 
ATOM   691  O O   . TYR A 1 84  ? 38.714 29.693  9.625   1.00 52.45 ? 207 TYR A O   1 
ATOM   692  C CB  . TYR A 1 84  ? 39.233 32.227  11.234  1.00 49.92 ? 207 TYR A CB  1 
ATOM   693  C CG  . TYR A 1 84  ? 40.134 33.130  12.026  1.00 51.78 ? 207 TYR A CG  1 
ATOM   694  C CD1 . TYR A 1 84  ? 41.504 33.268  11.712  1.00 50.70 ? 207 TYR A CD1 1 
ATOM   695  C CD2 . TYR A 1 84  ? 39.636 33.854  13.099  1.00 51.48 ? 207 TYR A CD2 1 
ATOM   696  C CE1 . TYR A 1 84  ? 42.326 34.108  12.454  1.00 48.63 ? 207 TYR A CE1 1 
ATOM   697  C CE2 . TYR A 1 84  ? 40.453 34.699  13.818  1.00 51.45 ? 207 TYR A CE2 1 
ATOM   698  C CZ  . TYR A 1 84  ? 41.778 34.809  13.503  1.00 49.05 ? 207 TYR A CZ  1 
ATOM   699  O OH  . TYR A 1 84  ? 42.519 35.673  14.252  1.00 52.23 ? 207 TYR A OH  1 
ATOM   700  N N   . LEU A 1 85  ? 37.318 29.458  11.341  1.00 51.23 ? 208 LEU A N   1 
ATOM   701  C CA  . LEU A 1 85  ? 36.310 28.760  10.537  1.00 50.65 ? 208 LEU A CA  1 
ATOM   702  C C   . LEU A 1 85  ? 35.053 29.599  10.465  1.00 50.20 ? 208 LEU A C   1 
ATOM   703  O O   . LEU A 1 85  ? 34.559 30.029  11.501  1.00 50.44 ? 208 LEU A O   1 
ATOM   704  C CB  . LEU A 1 85  ? 35.990 27.391  11.134  1.00 50.64 ? 208 LEU A CB  1 
ATOM   705  C CG  . LEU A 1 85  ? 36.943 26.227  10.773  1.00 50.59 ? 208 LEU A CG  1 
ATOM   706  C CD1 . LEU A 1 85  ? 38.354 26.479  11.210  1.00 50.65 ? 208 LEU A CD1 1 
ATOM   707  C CD2 . LEU A 1 85  ? 36.408 24.925  11.375  1.00 50.22 ? 208 LEU A CD2 1 
ATOM   708  N N   . ILE A 1 86  ? 34.559 29.818  9.240   1.00 49.69 ? 209 ILE A N   1 
ATOM   709  C CA  . ILE A 1 86  ? 33.437 30.707  8.938   1.00 48.38 ? 209 ILE A CA  1 
ATOM   710  C C   . ILE A 1 86  ? 32.253 29.794  8.674   1.00 48.82 ? 209 ILE A C   1 
ATOM   711  O O   . ILE A 1 86  ? 32.113 29.182  7.608   1.00 47.90 ? 209 ILE A O   1 
ATOM   712  C CB  . ILE A 1 86  ? 33.724 31.553  7.670   1.00 49.04 ? 209 ILE A CB  1 
ATOM   713  C CG1 . ILE A 1 86  ? 35.063 32.301  7.769   1.00 47.52 ? 209 ILE A CG1 1 
ATOM   714  C CG2 . ILE A 1 86  ? 32.592 32.528  7.360   1.00 48.55 ? 209 ILE A CG2 1 
ATOM   715  C CD1 . ILE A 1 86  ? 35.511 32.797  6.466   1.00 50.15 ? 209 ILE A CD1 1 
ATOM   716  N N   . LEU A 1 87  ? 31.389 29.705  9.666   1.00 48.76 ? 210 LEU A N   1 
ATOM   717  C CA  . LEU A 1 87  ? 30.343 28.712  9.661   1.00 48.78 ? 210 LEU A CA  1 
ATOM   718  C C   . LEU A 1 87  ? 29.009 29.378  9.589   1.00 48.97 ? 210 LEU A C   1 
ATOM   719  O O   . LEU A 1 87  ? 28.845 30.506  10.057  1.00 48.56 ? 210 LEU A O   1 
ATOM   720  C CB  . LEU A 1 87  ? 30.388 27.964  10.989  1.00 48.30 ? 210 LEU A CB  1 
ATOM   721  C CG  . LEU A 1 87  ? 31.506 26.984  11.226  1.00 49.67 ? 210 LEU A CG  1 
ATOM   722  C CD1 . LEU A 1 87  ? 31.900 27.037  12.726  1.00 50.25 ? 210 LEU A CD1 1 
ATOM   723  C CD2 . LEU A 1 87  ? 31.108 25.557  10.732  1.00 49.98 ? 210 LEU A CD2 1 
ATOM   724  N N   . GLU A 1 88  ? 28.029 28.633  9.086   1.00 50.35 ? 211 GLU A N   1 
ATOM   725  C CA  . GLU A 1 88  ? 26.609 29.051  9.088   1.00 50.59 ? 211 GLU A CA  1 
ATOM   726  C C   . GLU A 1 88  ? 26.150 29.367  10.511  1.00 51.16 ? 211 GLU A C   1 
ATOM   727  O O   . GLU A 1 88  ? 26.499 28.664  11.447  1.00 51.67 ? 211 GLU A O   1 
ATOM   728  C CB  . GLU A 1 88  ? 25.778 27.921  8.496   1.00 50.67 ? 211 GLU A CB  1 
ATOM   729  C CG  . GLU A 1 88  ? 24.324 28.213  8.203   1.00 50.93 ? 211 GLU A CG  1 
ATOM   730  C CD  . GLU A 1 88  ? 23.579 27.006  7.598   1.00 52.51 ? 211 GLU A CD  1 
ATOM   731  O OE1 . GLU A 1 88  ? 22.336 26.996  7.745   1.00 55.42 ? 211 GLU A OE1 1 
ATOM   732  O OE2 . GLU A 1 88  ? 24.196 26.079  6.976   1.00 51.71 ? 211 GLU A OE2 1 
ATOM   733  N N   . TYR A 1 89  ? 25.395 30.438  10.705  1.00 51.42 ? 212 TYR A N   1 
ATOM   734  C CA  . TYR A 1 89  ? 24.796 30.656  12.025  1.00 51.35 ? 212 TYR A CA  1 
ATOM   735  C C   . TYR A 1 89  ? 23.381 30.049  12.110  1.00 51.28 ? 212 TYR A C   1 
ATOM   736  O O   . TYR A 1 89  ? 22.541 30.299  11.239  1.00 50.62 ? 212 TYR A O   1 
ATOM   737  C CB  . TYR A 1 89  ? 24.799 32.135  12.359  1.00 51.53 ? 212 TYR A CB  1 
ATOM   738  C CG  . TYR A 1 89  ? 23.952 32.492  13.559  1.00 53.41 ? 212 TYR A CG  1 
ATOM   739  C CD1 . TYR A 1 89  ? 24.340 32.128  14.867  1.00 53.62 ? 212 TYR A CD1 1 
ATOM   740  C CD2 . TYR A 1 89  ? 22.773 33.261  13.401  1.00 53.92 ? 212 TYR A CD2 1 
ATOM   741  C CE1 . TYR A 1 89  ? 23.563 32.481  15.977  1.00 52.26 ? 212 TYR A CE1 1 
ATOM   742  C CE2 . TYR A 1 89  ? 22.008 33.620  14.512  1.00 55.02 ? 212 TYR A CE2 1 
ATOM   743  C CZ  . TYR A 1 89  ? 22.400 33.201  15.792  1.00 53.19 ? 212 TYR A CZ  1 
ATOM   744  O OH  . TYR A 1 89  ? 21.624 33.562  16.881  1.00 55.12 ? 212 TYR A OH  1 
ATOM   745  N N   . ALA A 1 90  ? 23.144 29.247  13.161  1.00 50.41 ? 213 ALA A N   1 
ATOM   746  C CA  . ALA A 1 90  ? 21.874 28.571  13.408  1.00 48.78 ? 213 ALA A CA  1 
ATOM   747  C C   . ALA A 1 90  ? 21.302 29.171  14.656  1.00 48.87 ? 213 ALA A C   1 
ATOM   748  O O   . ALA A 1 90  ? 21.703 28.805  15.741  1.00 48.79 ? 213 ALA A O   1 
ATOM   749  C CB  . ALA A 1 90  ? 22.078 27.112  13.593  1.00 48.76 ? 213 ALA A CB  1 
ATOM   750  N N   . PRO A 1 91  ? 20.331 30.088  14.512  1.00 48.93 ? 214 PRO A N   1 
ATOM   751  C CA  . PRO A 1 91  ? 19.903 30.899  15.636  1.00 48.72 ? 214 PRO A CA  1 
ATOM   752  C C   . PRO A 1 91  ? 19.127 30.185  16.757  1.00 48.45 ? 214 PRO A C   1 
ATOM   753  O O   . PRO A 1 91  ? 18.945 30.768  17.825  1.00 48.15 ? 214 PRO A O   1 
ATOM   754  C CB  . PRO A 1 91  ? 19.032 31.987  14.977  1.00 48.65 ? 214 PRO A CB  1 
ATOM   755  C CG  . PRO A 1 91  ? 18.511 31.360  13.758  1.00 49.14 ? 214 PRO A CG  1 
ATOM   756  C CD  . PRO A 1 91  ? 19.560 30.389  13.287  1.00 49.17 ? 214 PRO A CD  1 
ATOM   757  N N   . LEU A 1 92  ? 18.670 28.953  16.553  1.00 48.32 ? 215 LEU A N   1 
ATOM   758  C CA  . LEU A 1 92  ? 17.838 28.358  17.588  1.00 48.06 ? 215 LEU A CA  1 
ATOM   759  C C   . LEU A 1 92  ? 18.605 27.414  18.509  1.00 48.40 ? 215 LEU A C   1 
ATOM   760  O O   . LEU A 1 92  ? 18.020 26.816  19.421  1.00 48.47 ? 215 LEU A O   1 
ATOM   761  C CB  . LEU A 1 92  ? 16.552 27.775  17.014  1.00 47.91 ? 215 LEU A CB  1 
ATOM   762  C CG  . LEU A 1 92  ? 15.301 28.671  17.070  1.00 48.79 ? 215 LEU A CG  1 
ATOM   763  C CD1 . LEU A 1 92  ? 15.478 30.054  16.480  1.00 44.82 ? 215 LEU A CD1 1 
ATOM   764  C CD2 . LEU A 1 92  ? 14.109 27.948  16.384  1.00 48.65 ? 215 LEU A CD2 1 
ATOM   765  N N   . GLY A 1 93  ? 19.924 27.323  18.286  1.00 48.39 ? 216 GLY A N   1 
ATOM   766  C CA  . GLY A 1 93  ? 20.852 26.595  19.147  1.00 47.73 ? 216 GLY A CA  1 
ATOM   767  C C   . GLY A 1 93  ? 20.848 25.097  18.936  1.00 47.30 ? 216 GLY A C   1 
ATOM   768  O O   . GLY A 1 93  ? 20.462 24.609  17.904  1.00 48.09 ? 216 GLY A O   1 
ATOM   769  N N   . THR A 1 94  ? 21.312 24.361  19.927  1.00 47.98 ? 217 THR A N   1 
ATOM   770  C CA  . THR A 1 94  ? 21.472 22.911  19.807  1.00 47.69 ? 217 THR A CA  1 
ATOM   771  C C   . THR A 1 94  ? 20.229 22.110  20.203  1.00 48.29 ? 217 THR A C   1 
ATOM   772  O O   . THR A 1 94  ? 19.513 22.425  21.164  1.00 48.63 ? 217 THR A O   1 
ATOM   773  C CB  . THR A 1 94  ? 22.693 22.399  20.626  1.00 48.02 ? 217 THR A CB  1 
ATOM   774  O OG1 . THR A 1 94  ? 22.366 22.367  22.016  1.00 46.15 ? 217 THR A OG1 1 
ATOM   775  C CG2 . THR A 1 94  ? 23.938 23.287  20.389  1.00 44.65 ? 217 THR A CG2 1 
ATOM   776  N N   . VAL A 1 95  ? 19.983 21.072  19.434  1.00 48.59 ? 218 VAL A N   1 
ATOM   777  C CA  . VAL A 1 95  ? 19.012 20.073  19.775  1.00 49.78 ? 218 VAL A CA  1 
ATOM   778  C C   . VAL A 1 95  ? 19.157 19.640  21.262  1.00 50.42 ? 218 VAL A C   1 
ATOM   779  O O   . VAL A 1 95  ? 18.168 19.396  21.963  1.00 50.50 ? 218 VAL A O   1 
ATOM   780  C CB  . VAL A 1 95  ? 19.155 18.871  18.806  1.00 49.22 ? 218 VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 95  ? 18.253 17.746  19.221  1.00 49.86 ? 218 VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 95  ? 18.849 19.332  17.379  1.00 48.43 ? 218 VAL A CG2 1 
ATOM   783  N N   . TYR A 1 96  ? 20.395 19.573  21.728  1.00 51.20 ? 219 TYR A N   1 
ATOM   784  C CA  . TYR A 1 96  ? 20.690 19.113  23.057  1.00 52.44 ? 219 TYR A CA  1 
ATOM   785  C C   . TYR A 1 96  ? 20.076 20.058  24.094  1.00 52.81 ? 219 TYR A C   1 
ATOM   786  O O   . TYR A 1 96  ? 19.521 19.624  25.113  1.00 52.20 ? 219 TYR A O   1 
ATOM   787  C CB  . TYR A 1 96  ? 22.210 19.091  23.221  1.00 54.23 ? 219 TYR A CB  1 
ATOM   788  C CG  . TYR A 1 96  ? 22.653 18.790  24.620  1.00 56.42 ? 219 TYR A CG  1 
ATOM   789  C CD1 . TYR A 1 96  ? 22.351 17.559  25.218  1.00 58.04 ? 219 TYR A CD1 1 
ATOM   790  C CD2 . TYR A 1 96  ? 23.368 19.727  25.358  1.00 58.87 ? 219 TYR A CD2 1 
ATOM   791  C CE1 . TYR A 1 96  ? 22.784 17.254  26.516  1.00 58.31 ? 219 TYR A CE1 1 
ATOM   792  C CE2 . TYR A 1 96  ? 23.804 19.425  26.654  1.00 60.09 ? 219 TYR A CE2 1 
ATOM   793  C CZ  . TYR A 1 96  ? 23.502 18.177  27.210  1.00 58.12 ? 219 TYR A CZ  1 
ATOM   794  O OH  . TYR A 1 96  ? 23.897 17.880  28.486  1.00 60.49 ? 219 TYR A OH  1 
ATOM   795  N N   . ARG A 1 97  ? 20.207 21.355  23.840  1.00 52.15 ? 220 ARG A N   1 
ATOM   796  C CA  . ARG A 1 97  ? 19.574 22.353  24.672  1.00 52.66 ? 220 ARG A CA  1 
ATOM   797  C C   . ARG A 1 97  ? 18.022 22.173  24.676  1.00 52.73 ? 220 ARG A C   1 
ATOM   798  O O   . ARG A 1 97  ? 17.359 22.211  25.721  1.00 51.33 ? 220 ARG A O   1 
ATOM   799  C CB  . ARG A 1 97  ? 19.997 23.729  24.165  1.00 53.26 ? 220 ARG A CB  1 
ATOM   800  C CG  . ARG A 1 97  ? 19.827 24.849  25.159  1.00 56.21 ? 220 ARG A CG  1 
ATOM   801  C CD  . ARG A 1 97  ? 20.440 24.518  26.524  1.00 60.81 ? 220 ARG A CD  1 
ATOM   802  N NE  . ARG A 1 97  ? 19.937 25.482  27.512  1.00 64.18 ? 220 ARG A NE  1 
ATOM   803  C CZ  . ARG A 1 97  ? 18.894 25.280  28.314  1.00 64.67 ? 220 ARG A CZ  1 
ATOM   804  N NH1 . ARG A 1 97  ? 18.233 24.114  28.281  1.00 65.13 ? 220 ARG A NH1 1 
ATOM   805  N NH2 . ARG A 1 97  ? 18.511 26.258  29.144  1.00 63.78 ? 220 ARG A NH2 1 
ATOM   806  N N   . GLU A 1 98  ? 17.462 21.932  23.497  1.00 52.89 ? 221 GLU A N   1 
ATOM   807  C CA  . GLU A 1 98  ? 16.047 21.713  23.380  1.00 53.72 ? 221 GLU A CA  1 
ATOM   808  C C   . GLU A 1 98  ? 15.621 20.497  24.234  1.00 52.91 ? 221 GLU A C   1 
ATOM   809  O O   . GLU A 1 98  ? 14.618 20.535  24.949  1.00 52.95 ? 221 GLU A O   1 
ATOM   810  C CB  . GLU A 1 98  ? 15.670 21.591  21.900  1.00 53.81 ? 221 GLU A CB  1 
ATOM   811  C CG  . GLU A 1 98  ? 14.224 22.019  21.568  1.00 57.79 ? 221 GLU A CG  1 
ATOM   812  C CD  . GLU A 1 98  ? 13.846 23.456  22.028  1.00 60.56 ? 221 GLU A CD  1 
ATOM   813  O OE1 . GLU A 1 98  ? 12.630 23.749  22.071  1.00 62.75 ? 221 GLU A OE1 1 
ATOM   814  O OE2 . GLU A 1 98  ? 14.733 24.291  22.352  1.00 60.01 ? 221 GLU A OE2 1 
ATOM   815  N N   . LEU A 1 99  ? 16.428 19.452  24.223  1.00 53.04 ? 222 LEU A N   1 
ATOM   816  C CA  . LEU A 1 99  ? 16.144 18.256  25.035  1.00 52.93 ? 222 LEU A CA  1 
ATOM   817  C C   . LEU A 1 99  ? 16.234 18.515  26.534  1.00 53.42 ? 222 LEU A C   1 
ATOM   818  O O   . LEU A 1 99  ? 15.346 18.098  27.305  1.00 51.86 ? 222 LEU A O   1 
ATOM   819  C CB  . LEU A 1 99  ? 17.063 17.106  24.652  1.00 52.62 ? 222 LEU A CB  1 
ATOM   820  C CG  . LEU A 1 99  ? 16.597 15.697  25.014  1.00 52.43 ? 222 LEU A CG  1 
ATOM   821  C CD1 . LEU A 1 99  ? 15.285 15.338  24.357  1.00 50.93 ? 222 LEU A CD1 1 
ATOM   822  C CD2 . LEU A 1 99  ? 17.695 14.713  24.579  1.00 53.57 ? 222 LEU A CD2 1 
ATOM   823  N N   . GLN A 1 100 ? 17.301 19.217  26.932  1.00 53.49 ? 223 GLN A N   1 
ATOM   824  C CA  . GLN A 1 100 ? 17.388 19.752  28.270  1.00 54.18 ? 223 GLN A CA  1 
ATOM   825  C C   . GLN A 1 100 ? 16.135 20.526  28.675  1.00 53.94 ? 223 GLN A C   1 
ATOM   826  O O   . GLN A 1 100 ? 15.581 20.269  29.741  1.00 53.84 ? 223 GLN A O   1 
ATOM   827  C CB  . GLN A 1 100 ? 18.587 20.675  28.400  1.00 54.21 ? 223 GLN A CB  1 
ATOM   828  C CG  . GLN A 1 100 ? 19.891 19.945  28.576  1.00 58.24 ? 223 GLN A CG  1 
ATOM   829  C CD  . GLN A 1 100 ? 21.033 20.863  29.034  1.00 61.77 ? 223 GLN A CD  1 
ATOM   830  O OE1 . GLN A 1 100 ? 21.156 22.053  28.624  1.00 61.98 ? 223 GLN A OE1 1 
ATOM   831  N NE2 . GLN A 1 100 ? 21.866 20.319  29.913  1.00 63.13 ? 223 GLN A NE2 1 
ATOM   832  N N   . LYS A 1 101 ? 15.705 21.467  27.830  1.00 54.15 ? 224 LYS A N   1 
ATOM   833  C CA  . LYS A 1 101 ? 14.543 22.329  28.120  1.00 54.10 ? 224 LYS A CA  1 
ATOM   834  C C   . LYS A 1 101 ? 13.288 21.487  28.256  1.00 53.30 ? 224 LYS A C   1 
ATOM   835  O O   . LYS A 1 101 ? 12.535 21.670  29.203  1.00 53.17 ? 224 LYS A O   1 
ATOM   836  C CB  . LYS A 1 101 ? 14.330 23.399  27.037  1.00 53.84 ? 224 LYS A CB  1 
ATOM   837  C CG  . LYS A 1 101 ? 15.189 24.661  27.193  1.00 56.85 ? 224 LYS A CG  1 
ATOM   838  C CD  . LYS A 1 101 ? 15.605 25.324  25.795  1.00 55.90 ? 224 LYS A CD  1 
ATOM   839  C CE  . LYS A 1 101 ? 16.040 26.827  26.024  1.00 57.74 ? 224 LYS A CE  1 
ATOM   840  N NZ  . LYS A 1 101 ? 16.890 27.451  24.927  1.00 57.36 ? 224 LYS A NZ  1 
ATOM   841  N N   . LEU A 1 102 ? 13.100 20.549  27.324  1.00 52.88 ? 225 LEU A N   1 
ATOM   842  C CA  . LEU A 1 102 ? 11.831 19.813  27.179  1.00 52.18 ? 225 LEU A CA  1 
ATOM   843  C C   . LEU A 1 102 ? 11.735 18.481  27.879  1.00 51.90 ? 225 LEU A C   1 
ATOM   844  O O   . LEU A 1 102 ? 10.628 18.004  28.126  1.00 51.75 ? 225 LEU A O   1 
ATOM   845  C CB  . LEU A 1 102 ? 11.489 19.603  25.706  1.00 52.19 ? 225 LEU A CB  1 
ATOM   846  C CG  . LEU A 1 102 ? 11.129 20.776  24.790  1.00 52.25 ? 225 LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 102 ? 10.416 20.227  23.582  1.00 51.62 ? 225 LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 102 ? 10.238 21.762  25.482  1.00 51.85 ? 225 LEU A CD2 1 
ATOM   849  N N   . SER A 1 103 ? 12.880 17.882  28.180  1.00 52.15 ? 226 SER A N   1 
ATOM   850  C CA  . SER A 1 103 ? 12.988 16.547  28.809  1.00 53.30 ? 226 SER A CA  1 
ATOM   851  C C   . SER A 1 103 ? 12.980 15.404  27.803  1.00 52.48 ? 226 SER A C   1 
ATOM   852  O O   . SER A 1 103 ? 13.849 14.527  27.824  1.00 52.97 ? 226 SER A O   1 
ATOM   853  C CB  . SER A 1 103 ? 11.904 16.299  29.861  1.00 53.47 ? 226 SER A CB  1 
ATOM   854  O OG  . SER A 1 103 ? 11.839 17.399  30.734  1.00 56.50 ? 226 SER A OG  1 
ATOM   855  N N   . LYS A 1 104 ? 11.990 15.408  26.931  1.00 51.57 ? 227 LYS A N   1 
ATOM   856  C CA  . LYS A 1 104 ? 11.904 14.385  25.904  1.00 51.40 ? 227 LYS A CA  1 
ATOM   857  C C   . LYS A 1 104 ? 11.024 14.972  24.814  1.00 50.90 ? 227 LYS A C   1 
ATOM   858  O O   . LYS A 1 104 ? 10.346 15.988  25.069  1.00 50.16 ? 227 LYS A O   1 
ATOM   859  C CB  . LYS A 1 104 ? 11.387 13.039  26.470  1.00 51.50 ? 227 LYS A CB  1 
ATOM   860  C CG  . LYS A 1 104 ? 10.178 13.068  27.352  1.00 51.49 ? 227 LYS A CG  1 
ATOM   861  C CD  . LYS A 1 104 ? 9.809  11.637  27.685  1.00 54.80 ? 227 LYS A CD  1 
ATOM   862  C CE  . LYS A 1 104 ? 8.828  11.518  28.834  1.00 56.41 ? 227 LYS A CE  1 
ATOM   863  N NZ  . LYS A 1 104 ? 9.352  12.287  29.998  1.00 63.10 ? 227 LYS A NZ  1 
ATOM   864  N N   . PHE A 1 105 ? 11.078 14.406  23.605  1.00 49.82 ? 228 PHE A N   1 
ATOM   865  C CA  . PHE A 1 105 ? 10.347 15.016  22.498  1.00 50.06 ? 228 PHE A CA  1 
ATOM   866  C C   . PHE A 1 105 ? 9.120  14.193  22.198  1.00 50.64 ? 228 PHE A C   1 
ATOM   867  O O   . PHE A 1 105 ? 9.117  12.986  22.455  1.00 51.28 ? 228 PHE A O   1 
ATOM   868  C CB  . PHE A 1 105 ? 11.210 15.162  21.243  1.00 50.46 ? 228 PHE A CB  1 
ATOM   869  C CG  . PHE A 1 105 ? 12.417 16.052  21.413  1.00 49.46 ? 228 PHE A CG  1 
ATOM   870  C CD1 . PHE A 1 105 ? 13.619 15.713  20.806  1.00 49.72 ? 228 PHE A CD1 1 
ATOM   871  C CD2 . PHE A 1 105 ? 12.348 17.222  22.167  1.00 48.81 ? 228 PHE A CD2 1 
ATOM   872  C CE1 . PHE A 1 105 ? 14.751 16.543  20.924  1.00 48.48 ? 228 PHE A CE1 1 
ATOM   873  C CE2 . PHE A 1 105 ? 13.449 18.046  22.313  1.00 50.11 ? 228 PHE A CE2 1 
ATOM   874  C CZ  . PHE A 1 105 ? 14.676 17.698  21.681  1.00 49.48 ? 228 PHE A CZ  1 
ATOM   875  N N   . ASP A 1 106 ? 8.060  14.834  21.709  1.00 50.47 ? 229 ASP A N   1 
ATOM   876  C CA  . ASP A 1 106 ? 6.843  14.097  21.356  1.00 50.87 ? 229 ASP A CA  1 
ATOM   877  C C   . ASP A 1 106 ? 7.242  13.285  20.124  1.00 50.93 ? 229 ASP A C   1 
ATOM   878  O O   . ASP A 1 106 ? 8.408  13.377  19.664  1.00 50.48 ? 229 ASP A O   1 
ATOM   879  C CB  . ASP A 1 106 ? 5.650  15.047  21.093  1.00 50.50 ? 229 ASP A CB  1 
ATOM   880  C CG  . ASP A 1 106 ? 5.879  15.975  19.907  1.00 51.40 ? 229 ASP A CG  1 
ATOM   881  O OD1 . ASP A 1 106 ? 6.679  15.639  19.022  1.00 54.64 ? 229 ASP A OD1 1 
ATOM   882  O OD2 . ASP A 1 106 ? 5.271  17.056  19.817  1.00 54.57 ? 229 ASP A OD2 1 
ATOM   883  N N   . GLU A 1 107 ? 6.299  12.515  19.579  1.00 50.58 ? 230 GLU A N   1 
ATOM   884  C CA  . GLU A 1 107 ? 6.592  11.669  18.415  1.00 50.54 ? 230 GLU A CA  1 
ATOM   885  C C   . GLU A 1 107 ? 6.769  12.440  17.082  1.00 50.74 ? 230 GLU A C   1 
ATOM   886  O O   . GLU A 1 107 ? 7.573  12.054  16.220  1.00 50.38 ? 230 GLU A O   1 
ATOM   887  C CB  . GLU A 1 107 ? 5.528  10.591  18.274  1.00 50.73 ? 230 GLU A CB  1 
ATOM   888  C CG  . GLU A 1 107 ? 5.399  9.661   19.462  1.00 51.06 ? 230 GLU A CG  1 
ATOM   889  C CD  . GLU A 1 107 ? 4.392  8.549   19.196  1.00 56.68 ? 230 GLU A CD  1 
ATOM   890  O OE1 . GLU A 1 107 ? 3.173  8.829   18.957  1.00 57.49 ? 230 GLU A OE1 1 
ATOM   891  O OE2 . GLU A 1 107 ? 4.826  7.378   19.218  1.00 58.88 ? 230 GLU A OE2 1 
ATOM   892  N N   . GLN A 1 108 ? 6.033  13.533  16.928  1.00 50.48 ? 231 GLN A N   1 
ATOM   893  C CA  . GLN A 1 108 ? 6.073  14.328  15.720  1.00 51.82 ? 231 GLN A CA  1 
ATOM   894  C C   . GLN A 1 108 ? 7.445  14.989  15.545  1.00 52.34 ? 231 GLN A C   1 
ATOM   895  O O   . GLN A 1 108 ? 8.058  14.947  14.454  1.00 52.80 ? 231 GLN A O   1 
ATOM   896  C CB  . GLN A 1 108 ? 4.992  15.402  15.774  1.00 51.90 ? 231 GLN A CB  1 
ATOM   897  C CG  . GLN A 1 108 ? 3.552  14.868  15.879  1.00 55.38 ? 231 GLN A CG  1 
ATOM   898  C CD  . GLN A 1 108 ? 3.373  13.749  16.921  1.00 57.94 ? 231 GLN A CD  1 
ATOM   899  O OE1 . GLN A 1 108 ? 3.795  13.878  18.079  1.00 57.09 ? 231 GLN A OE1 1 
ATOM   900  N NE2 . GLN A 1 108 ? 2.732  12.646  16.503  1.00 58.07 ? 231 GLN A NE2 1 
ATOM   901  N N   . ARG A 1 109 ? 7.917  15.604  16.625  1.00 52.01 ? 232 ARG A N   1 
ATOM   902  C CA  . ARG A 1 109 ? 9.161  16.284  16.611  1.00 51.45 ? 232 ARG A CA  1 
ATOM   903  C C   . ARG A 1 109 ? 10.275 15.295  16.416  1.00 51.22 ? 232 ARG A C   1 
ATOM   904  O O   . ARG A 1 109 ? 11.226 15.576  15.675  1.00 51.83 ? 232 ARG A O   1 
ATOM   905  C CB  . ARG A 1 109 ? 9.377  17.050  17.910  1.00 52.09 ? 232 ARG A CB  1 
ATOM   906  C CG  . ARG A 1 109 ? 10.706 17.774  17.951  1.00 51.64 ? 232 ARG A CG  1 
ATOM   907  C CD  . ARG A 1 109 ? 10.940 18.353  19.306  1.00 53.11 ? 232 ARG A CD  1 
ATOM   908  N NE  . ARG A 1 109 ? 10.127 19.538  19.507  1.00 55.32 ? 232 ARG A NE  1 
ATOM   909  C CZ  . ARG A 1 109 ? 10.596 20.778  19.551  1.00 54.11 ? 232 ARG A CZ  1 
ATOM   910  N NH1 . ARG A 1 109 ? 11.896 21.033  19.437  1.00 53.89 ? 232 ARG A NH1 1 
ATOM   911  N NH2 . ARG A 1 109 ? 9.749  21.764  19.730  1.00 56.98 ? 232 ARG A NH2 1 
ATOM   912  N N   . THR A 1 110 ? 10.199 14.152  17.090  1.00 50.58 ? 233 THR A N   1 
ATOM   913  C CA  . THR A 1 110 ? 11.296 13.179  16.956  1.00 49.71 ? 233 THR A CA  1 
ATOM   914  C C   . THR A 1 110 ? 11.376 12.607  15.535  1.00 49.66 ? 233 THR A C   1 
ATOM   915  O O   . THR A 1 110 ? 12.474 12.481  14.994  1.00 50.02 ? 233 THR A O   1 
ATOM   916  C CB  . THR A 1 110 ? 11.184 12.015  17.952  1.00 49.66 ? 233 THR A CB  1 
ATOM   917  O OG1 . THR A 1 110 ? 11.185 12.526  19.285  1.00 46.86 ? 233 THR A OG1 1 
ATOM   918  C CG2 . THR A 1 110 ? 12.342 11.049  17.759  1.00 49.38 ? 233 THR A CG2 1 
ATOM   919  N N   . ALA A 1 111 ? 10.225 12.287  14.939  1.00 48.27 ? 234 ALA A N   1 
ATOM   920  C CA  . ALA A 1 111 ? 10.181 11.753  13.587  1.00 48.39 ? 234 ALA A CA  1 
ATOM   921  C C   . ALA A 1 111 ? 10.646 12.783  12.573  1.00 48.32 ? 234 ALA A C   1 
ATOM   922  O O   . ALA A 1 111 ? 11.228 12.437  11.551  1.00 48.10 ? 234 ALA A O   1 
ATOM   923  C CB  . ALA A 1 111 ? 8.752  11.283  13.227  1.00 48.95 ? 234 ALA A CB  1 
ATOM   924  N N   . THR A 1 112 ? 10.369 14.047  12.861  1.00 48.76 ? 235 THR A N   1 
ATOM   925  C CA  . THR A 1 112 ? 10.761 15.129  11.980  1.00 49.51 ? 235 THR A CA  1 
ATOM   926  C C   . THR A 1 112 ? 12.251 15.263  12.088  1.00 49.74 ? 235 THR A C   1 
ATOM   927  O O   . THR A 1 112 ? 12.918 15.356  11.060  1.00 50.79 ? 235 THR A O   1 
ATOM   928  C CB  . THR A 1 112 ? 10.108 16.457  12.353  1.00 49.82 ? 235 THR A CB  1 
ATOM   929  O OG1 . THR A 1 112 ? 8.688  16.397  12.116  1.00 49.28 ? 235 THR A OG1 1 
ATOM   930  C CG2 . THR A 1 112 ? 10.716 17.582  11.533  1.00 51.48 ? 235 THR A CG2 1 
ATOM   931  N N   . TYR A 1 113 ? 12.782 15.254  13.311  1.00 49.55 ? 236 TYR A N   1 
ATOM   932  C CA  . TYR A 1 113 ? 14.232 15.296  13.472  1.00 50.09 ? 236 TYR A CA  1 
ATOM   933  C C   . TYR A 1 113 ? 14.865 14.114  12.777  1.00 50.44 ? 236 TYR A C   1 
ATOM   934  O O   . TYR A 1 113 ? 15.852 14.280  12.103  1.00 51.90 ? 236 TYR A O   1 
ATOM   935  C CB  . TYR A 1 113 ? 14.694 15.349  14.948  1.00 49.98 ? 236 TYR A CB  1 
ATOM   936  C CG  . TYR A 1 113 ? 14.443 16.665  15.653  1.00 49.22 ? 236 TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 113 ? 14.418 17.856  14.947  1.00 49.63 ? 236 TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 113 ? 14.273 16.719  17.032  1.00 47.57 ? 236 TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 113 ? 14.174 19.075  15.578  1.00 49.68 ? 236 TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 113 ? 14.053 17.933  17.679  1.00 49.24 ? 236 TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 113 ? 13.996 19.109  16.931  1.00 49.09 ? 236 TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 113 ? 13.757 20.322  17.526  1.00 50.20 ? 236 TYR A OH  1 
ATOM   943  N N   . ILE A 1 114 ? 14.294 12.925  12.927  1.00 50.54 ? 237 ILE A N   1 
ATOM   944  C CA  . ILE A 1 114 ? 14.868 11.738  12.325  1.00 50.00 ? 237 ILE A CA  1 
ATOM   945  C C   . ILE A 1 114 ? 14.791 11.808  10.807  1.00 50.56 ? 237 ILE A C   1 
ATOM   946  O O   . ILE A 1 114 ? 15.735 11.428  10.133  1.00 49.17 ? 237 ILE A O   1 
ATOM   947  C CB  . ILE A 1 114 ? 14.229 10.400  12.870  1.00 50.16 ? 237 ILE A CB  1 
ATOM   948  C CG1 . ILE A 1 114 ? 14.389 10.260  14.376  1.00 48.51 ? 237 ILE A CG1 1 
ATOM   949  C CG2 . ILE A 1 114 ? 14.909 9.179   12.239  1.00 48.11 ? 237 ILE A CG2 1 
ATOM   950  C CD1 . ILE A 1 114 ? 15.901 10.268  14.849  1.00 52.33 ? 237 ILE A CD1 1 
ATOM   951  N N   . THR A 1 115 ? 13.667 12.291  10.260  1.00 52.38 ? 238 THR A N   1 
ATOM   952  C CA  . THR A 1 115 ? 13.596 12.423  8.821   1.00 54.12 ? 238 THR A CA  1 
ATOM   953  C C   . THR A 1 115 ? 14.693 13.338  8.324   1.00 54.76 ? 238 THR A C   1 
ATOM   954  O O   . THR A 1 115 ? 15.514 12.939  7.493   1.00 55.55 ? 238 THR A O   1 
ATOM   955  C CB  . THR A 1 115 ? 12.236 12.834  8.312   1.00 54.72 ? 238 THR A CB  1 
ATOM   956  O OG1 . THR A 1 115 ? 11.411 11.668  8.279   1.00 58.60 ? 238 THR A OG1 1 
ATOM   957  C CG2 . THR A 1 115 ? 12.322 13.362  6.838   1.00 54.76 ? 238 THR A CG2 1 
ATOM   958  N N   . GLU A 1 116 ? 14.738 14.544  8.876   1.00 55.47 ? 239 GLU A N   1 
ATOM   959  C CA  . GLU A 1 116 ? 15.724 15.542  8.487   1.00 55.96 ? 239 GLU A CA  1 
ATOM   960  C C   . GLU A 1 116 ? 17.113 14.989  8.582   1.00 55.83 ? 239 GLU A C   1 
ATOM   961  O O   . GLU A 1 116 ? 17.957 15.207  7.716   1.00 57.02 ? 239 GLU A O   1 
ATOM   962  C CB  . GLU A 1 116 ? 15.591 16.787  9.365   1.00 56.36 ? 239 GLU A CB  1 
ATOM   963  C CG  . GLU A 1 116 ? 14.350 17.543  9.046   1.00 57.02 ? 239 GLU A CG  1 
ATOM   964  C CD  . GLU A 1 116 ? 14.061 18.642  10.028  1.00 62.24 ? 239 GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 116 ? 14.628 18.620  11.150  1.00 63.94 ? 239 GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 116 ? 13.245 19.533  9.667   1.00 64.88 ? 239 GLU A OE2 1 
ATOM   967  N N   . LEU A 1 117 ? 17.368 14.264  9.639   1.00 55.37 ? 240 LEU A N   1 
ATOM   968  C CA  . LEU A 1 117 ? 18.718 13.820  9.859   1.00 54.98 ? 240 LEU A CA  1 
ATOM   969  C C   . LEU A 1 117 ? 19.093 12.708  8.872   1.00 54.11 ? 240 LEU A C   1 
ATOM   970  O O   . LEU A 1 117 ? 20.204 12.724  8.294   1.00 53.59 ? 240 LEU A O   1 
ATOM   971  C CB  . LEU A 1 117 ? 18.853 13.341  11.293  1.00 55.59 ? 240 LEU A CB  1 
ATOM   972  C CG  . LEU A 1 117 ? 20.228 12.948  11.810  1.00 56.14 ? 240 LEU A CG  1 
ATOM   973  C CD1 . LEU A 1 117 ? 21.298 13.918  11.406  1.00 54.00 ? 240 LEU A CD1 1 
ATOM   974  C CD2 . LEU A 1 117 ? 20.049 12.892  13.308  1.00 56.91 ? 240 LEU A CD2 1 
ATOM   975  N N   . ALA A 1 118 ? 18.186 11.741  8.689   1.00 52.22 ? 241 ALA A N   1 
ATOM   976  C CA  . ALA A 1 118 ? 18.441 10.641  7.743   1.00 50.39 ? 241 ALA A CA  1 
ATOM   977  C C   . ALA A 1 118 ? 18.765 11.220  6.353   1.00 49.96 ? 241 ALA A C   1 
ATOM   978  O O   . ALA A 1 118 ? 19.740 10.818  5.709   1.00 50.53 ? 241 ALA A O   1 
ATOM   979  C CB  . ALA A 1 118 ? 17.268 9.713   7.701   1.00 50.20 ? 241 ALA A CB  1 
ATOM   980  N N   . ASN A 1 119 ? 17.985 12.212  5.921   1.00 49.35 ? 242 ASN A N   1 
ATOM   981  C CA  . ASN A 1 119 ? 18.237 12.933  4.678   1.00 48.99 ? 242 ASN A CA  1 
ATOM   982  C C   . ASN A 1 119 ? 19.665 13.515  4.586   1.00 49.42 ? 242 ASN A C   1 
ATOM   983  O O   . ASN A 1 119 ? 20.313 13.417  3.545   1.00 49.52 ? 242 ASN A O   1 
ATOM   984  C CB  . ASN A 1 119 ? 17.191 14.035  4.502   1.00 49.14 ? 242 ASN A CB  1 
ATOM   985  C CG  . ASN A 1 119 ? 15.872 13.530  3.889   1.00 49.15 ? 242 ASN A CG  1 
ATOM   986  O OD1 . ASN A 1 119 ? 15.840 12.583  3.100   1.00 49.33 ? 242 ASN A OD1 1 
ATOM   987  N ND2 . ASN A 1 119 ? 14.785 14.188  4.241   1.00 47.88 ? 242 ASN A ND2 1 
ATOM   988  N N   . ALA A 1 120 ? 20.150 14.114  5.677   1.00 49.33 ? 243 ALA A N   1 
ATOM   989  C CA  . ALA A 1 120 ? 21.521 14.629  5.754   1.00 49.00 ? 243 ALA A CA  1 
ATOM   990  C C   . ALA A 1 120 ? 22.621 13.553  5.664   1.00 49.22 ? 243 ALA A C   1 
ATOM   991  O O   . ALA A 1 120 ? 23.621 13.746  4.988   1.00 48.89 ? 243 ALA A O   1 
ATOM   992  C CB  . ALA A 1 120 ? 21.694 15.465  7.012   1.00 48.76 ? 243 ALA A CB  1 
ATOM   993  N N   . LEU A 1 121 ? 22.427 12.425  6.339   1.00 50.03 ? 244 LEU A N   1 
ATOM   994  C CA  . LEU A 1 121 ? 23.392 11.325  6.348   1.00 49.72 ? 244 LEU A CA  1 
ATOM   995  C C   . LEU A 1 121 ? 23.361 10.500  5.071   1.00 50.24 ? 244 LEU A C   1 
ATOM   996  O O   . LEU A 1 121 ? 24.392 9.968   4.618   1.00 49.71 ? 244 LEU A O   1 
ATOM   997  C CB  . LEU A 1 121 ? 23.093 10.408  7.528   1.00 50.18 ? 244 LEU A CB  1 
ATOM   998  C CG  . LEU A 1 121 ? 23.408 10.872  8.949   1.00 50.33 ? 244 LEU A CG  1 
ATOM   999  C CD1 . LEU A 1 121 ? 22.942 9.794   9.909   1.00 51.37 ? 244 LEU A CD1 1 
ATOM   1000 C CD2 . LEU A 1 121 ? 24.881 11.181  9.172   1.00 49.07 ? 244 LEU A CD2 1 
ATOM   1001 N N   . SER A 1 122 ? 22.150 10.367  4.521   1.00 50.97 ? 245 SER A N   1 
ATOM   1002 C CA  . SER A 1 122 ? 21.920 9.786   3.200   1.00 51.55 ? 245 SER A CA  1 
ATOM   1003 C C   . SER A 1 122 ? 22.793 10.492  2.174   1.00 51.87 ? 245 SER A C   1 
ATOM   1004 O O   . SER A 1 122 ? 23.575 9.852   1.455   1.00 52.74 ? 245 SER A O   1 
ATOM   1005 C CB  . SER A 1 122 ? 20.452 9.966   2.815   1.00 51.17 ? 245 SER A CB  1 
ATOM   1006 O OG  . SER A 1 122 ? 20.151 9.149   1.707   1.00 53.04 ? 245 SER A OG  1 
ATOM   1007 N N   . TYR A 1 123 ? 22.660 11.817  2.123   1.00 52.11 ? 246 TYR A N   1 
ATOM   1008 C CA  . TYR A 1 123 ? 23.483 12.667  1.270   1.00 52.28 ? 246 TYR A CA  1 
ATOM   1009 C C   . TYR A 1 123 ? 24.962 12.528  1.623   1.00 52.46 ? 246 TYR A C   1 
ATOM   1010 O O   . TYR A 1 123 ? 25.804 12.376  0.729   1.00 53.95 ? 246 TYR A O   1 
ATOM   1011 C CB  . TYR A 1 123 ? 23.028 14.132  1.383   1.00 52.55 ? 246 TYR A CB  1 
ATOM   1012 C CG  . TYR A 1 123 ? 23.993 15.164  0.797   1.00 52.01 ? 246 TYR A CG  1 
ATOM   1013 C CD1 . TYR A 1 123 ? 23.863 15.596  -0.523  1.00 50.54 ? 246 TYR A CD1 1 
ATOM   1014 C CD2 . TYR A 1 123 ? 25.022 15.709  1.572   1.00 49.83 ? 246 TYR A CD2 1 
ATOM   1015 C CE1 . TYR A 1 123 ? 24.751 16.535  -1.065  1.00 53.59 ? 246 TYR A CE1 1 
ATOM   1016 C CE2 . TYR A 1 123 ? 25.911 16.654  1.046   1.00 51.26 ? 246 TYR A CE2 1 
ATOM   1017 C CZ  . TYR A 1 123 ? 25.773 17.072  -0.271  1.00 52.94 ? 246 TYR A CZ  1 
ATOM   1018 O OH  . TYR A 1 123 ? 26.650 18.013  -0.813  1.00 54.08 ? 246 TYR A OH  1 
ATOM   1019 N N   . CYS A 1 124 ? 25.288 12.588  2.915   1.00 51.75 ? 247 CYS A N   1 
ATOM   1020 C CA  . CYS A 1 124 ? 26.647 12.324  3.367   1.00 50.77 ? 247 CYS A CA  1 
ATOM   1021 C C   . CYS A 1 124 ? 27.163 11.001  2.827   1.00 50.05 ? 247 CYS A C   1 
ATOM   1022 O O   . CYS A 1 124 ? 28.226 10.954  2.262   1.00 49.64 ? 247 CYS A O   1 
ATOM   1023 C CB  . CYS A 1 124 ? 26.729 12.298  4.886   1.00 51.17 ? 247 CYS A CB  1 
ATOM   1024 S SG  . CYS A 1 124 ? 26.735 13.889  5.694   1.00 52.18 ? 247 CYS A SG  1 
ATOM   1025 N N   . HIS A 1 125 ? 26.409 9.924   3.013   1.00 49.82 ? 248 HIS A N   1 
ATOM   1026 C CA  . HIS A 1 125 ? 26.836 8.613   2.495   1.00 49.63 ? 248 HIS A CA  1 
ATOM   1027 C C   . HIS A 1 125 ? 26.960 8.507   0.958   1.00 48.36 ? 248 HIS A C   1 
ATOM   1028 O O   . HIS A 1 125 ? 27.794 7.766   0.467   1.00 46.79 ? 248 HIS A O   1 
ATOM   1029 C CB  . HIS A 1 125 ? 25.970 7.483   3.072   1.00 50.09 ? 248 HIS A CB  1 
ATOM   1030 C CG  . HIS A 1 125 ? 26.130 7.309   4.550   1.00 49.07 ? 248 HIS A CG  1 
ATOM   1031 N ND1 . HIS A 1 125 ? 25.351 6.442   5.288   1.00 47.94 ? 248 HIS A ND1 1 
ATOM   1032 C CD2 . HIS A 1 125 ? 26.994 7.885   5.422   1.00 48.56 ? 248 HIS A CD2 1 
ATOM   1033 C CE1 . HIS A 1 125 ? 25.712 6.513   6.557   1.00 50.16 ? 248 HIS A CE1 1 
ATOM   1034 N NE2 . HIS A 1 125 ? 26.712 7.376   6.664   1.00 48.97 ? 248 HIS A NE2 1 
ATOM   1035 N N   . SER A 1 126 ? 26.150 9.263   0.222   1.00 48.26 ? 249 SER A N   1 
ATOM   1036 C CA  . SER A 1 126 ? 26.322 9.343   -1.237  1.00 49.46 ? 249 SER A CA  1 
ATOM   1037 C C   . SER A 1 126 ? 27.686 9.921   -1.607  1.00 49.35 ? 249 SER A C   1 
ATOM   1038 O O   . SER A 1 126 ? 28.073 9.898   -2.760  1.00 48.92 ? 249 SER A O   1 
ATOM   1039 C CB  . SER A 1 126 ? 25.252 10.229  -1.882  1.00 49.53 ? 249 SER A CB  1 
ATOM   1040 O OG  . SER A 1 126 ? 25.592 11.607  -1.692  1.00 50.32 ? 249 SER A OG  1 
ATOM   1041 N N   . LYS A 1 127 ? 28.392 10.458  -0.623  1.00 49.72 ? 250 LYS A N   1 
ATOM   1042 C CA  . LYS A 1 127 ? 29.676 11.108  -0.854  1.00 49.88 ? 250 LYS A CA  1 
ATOM   1043 C C   . LYS A 1 127 ? 30.790 10.268  -0.279  1.00 49.38 ? 250 LYS A C   1 
ATOM   1044 O O   . LYS A 1 127 ? 31.954 10.619  -0.407  1.00 49.36 ? 250 LYS A O   1 
ATOM   1045 C CB  . LYS A 1 127 ? 29.693 12.483  -0.189  1.00 50.22 ? 250 LYS A CB  1 
ATOM   1046 C CG  . LYS A 1 127 ? 28.706 13.458  -0.768  1.00 52.37 ? 250 LYS A CG  1 
ATOM   1047 C CD  . LYS A 1 127 ? 29.218 13.954  -2.093  1.00 57.52 ? 250 LYS A CD  1 
ATOM   1048 C CE  . LYS A 1 127 ? 28.150 14.713  -2.843  1.00 62.14 ? 250 LYS A CE  1 
ATOM   1049 N NZ  . LYS A 1 127 ? 27.054 13.811  -3.374  1.00 67.29 ? 250 LYS A NZ  1 
ATOM   1050 N N   . ARG A 1 128 ? 30.423 9.160   0.353   1.00 48.81 ? 251 ARG A N   1 
ATOM   1051 C CA  . ARG A 1 128 ? 31.370 8.239   0.986   1.00 48.86 ? 251 ARG A CA  1 
ATOM   1052 C C   . ARG A 1 128 ? 31.896 8.767   2.312   1.00 48.11 ? 251 ARG A C   1 
ATOM   1053 O O   . ARG A 1 128 ? 32.908 8.295   2.831   1.00 47.36 ? 251 ARG A O   1 
ATOM   1054 C CB  . ARG A 1 128 ? 32.539 7.856   0.046   1.00 49.03 ? 251 ARG A CB  1 
ATOM   1055 C CG  . ARG A 1 128 ? 32.156 7.343   -1.325  1.00 50.06 ? 251 ARG A CG  1 
ATOM   1056 C CD  . ARG A 1 128 ? 31.655 5.930   -1.267  1.00 54.00 ? 251 ARG A CD  1 
ATOM   1057 N NE  . ARG A 1 128 ? 30.269 5.853   -0.812  1.00 56.29 ? 251 ARG A NE  1 
ATOM   1058 C CZ  . ARG A 1 128 ? 29.756 4.805   -0.169  1.00 59.73 ? 251 ARG A CZ  1 
ATOM   1059 N NH1 . ARG A 1 128 ? 30.530 3.750   0.099   1.00 60.53 ? 251 ARG A NH1 1 
ATOM   1060 N NH2 . ARG A 1 128 ? 28.475 4.803   0.217   1.00 59.88 ? 251 ARG A NH2 1 
ATOM   1061 N N   . VAL A 1 129 ? 31.171 9.735   2.857   1.00 48.52 ? 252 VAL A N   1 
ATOM   1062 C CA  . VAL A 1 129 ? 31.467 10.339  4.156   1.00 48.64 ? 252 VAL A CA  1 
ATOM   1063 C C   . VAL A 1 129 ? 30.674 9.631   5.227   1.00 48.35 ? 252 VAL A C   1 
ATOM   1064 O O   . VAL A 1 129 ? 29.480 9.455   5.075   1.00 49.31 ? 252 VAL A O   1 
ATOM   1065 C CB  . VAL A 1 129 ? 31.119 11.846  4.158   1.00 48.80 ? 252 VAL A CB  1 
ATOM   1066 C CG1 . VAL A 1 129 ? 31.343 12.466  5.527   1.00 47.50 ? 252 VAL A CG1 1 
ATOM   1067 C CG2 . VAL A 1 129 ? 31.940 12.574  3.099   1.00 50.38 ? 252 VAL A CG2 1 
ATOM   1068 N N   . ILE A 1 130 ? 31.357 9.196   6.285   1.00 48.63 ? 253 ILE A N   1 
ATOM   1069 C CA  . ILE A 1 130 ? 30.728 8.665   7.507   1.00 48.63 ? 253 ILE A CA  1 
ATOM   1070 C C   . ILE A 1 130 ? 30.899 9.759   8.576   1.00 49.38 ? 253 ILE A C   1 
ATOM   1071 O O   . ILE A 1 130 ? 32.008 10.263  8.753   1.00 48.76 ? 253 ILE A O   1 
ATOM   1072 C CB  . ILE A 1 130 ? 31.426 7.376   8.024   1.00 48.17 ? 253 ILE A CB  1 
ATOM   1073 C CG1 . ILE A 1 130 ? 31.852 6.448   6.886   1.00 47.74 ? 253 ILE A CG1 1 
ATOM   1074 C CG2 . ILE A 1 130 ? 30.524 6.649   9.010   1.00 48.72 ? 253 ILE A CG2 1 
ATOM   1075 C CD1 . ILE A 1 130 ? 32.733 5.319   7.343   1.00 47.04 ? 253 ILE A CD1 1 
ATOM   1076 N N   . HIS A 1 131 ? 29.819 10.128  9.265   1.00 50.46 ? 254 HIS A N   1 
ATOM   1077 C CA  . HIS A 1 131 ? 29.878 11.222  10.253  1.00 51.54 ? 254 HIS A CA  1 
ATOM   1078 C C   . HIS A 1 131 ? 30.630 10.872  11.541  1.00 51.80 ? 254 HIS A C   1 
ATOM   1079 O O   . HIS A 1 131 ? 31.618 11.541  11.926  1.00 51.66 ? 254 HIS A O   1 
ATOM   1080 C CB  . HIS A 1 131 ? 28.479 11.728  10.601  1.00 52.20 ? 254 HIS A CB  1 
ATOM   1081 C CG  . HIS A 1 131 ? 28.496 12.966  11.446  1.00 52.09 ? 254 HIS A CG  1 
ATOM   1082 N ND1 . HIS A 1 131 ? 28.676 12.929  12.809  1.00 53.30 ? 254 HIS A ND1 1 
ATOM   1083 C CD2 . HIS A 1 131 ? 28.384 14.275  11.117  1.00 51.51 ? 254 HIS A CD2 1 
ATOM   1084 C CE1 . HIS A 1 131 ? 28.642 14.160  13.292  1.00 55.39 ? 254 HIS A CE1 1 
ATOM   1085 N NE2 . HIS A 1 131 ? 28.485 14.998  12.280  1.00 53.86 ? 254 HIS A NE2 1 
ATOM   1086 N N   . ARG A 1 132 ? 30.134 9.826   12.214  1.00 52.30 ? 255 ARG A N   1 
ATOM   1087 C CA  . ARG A 1 132 ? 30.860 9.162   13.304  1.00 51.83 ? 255 ARG A CA  1 
ATOM   1088 C C   . ARG A 1 132 ? 30.782 9.929   14.610  1.00 52.37 ? 255 ARG A C   1 
ATOM   1089 O O   . ARG A 1 132 ? 31.514 9.590   15.547  1.00 52.93 ? 255 ARG A O   1 
ATOM   1090 C CB  . ARG A 1 132 ? 32.345 8.905   12.959  1.00 50.72 ? 255 ARG A CB  1 
ATOM   1091 C CG  . ARG A 1 132 ? 32.588 8.117   11.720  1.00 49.28 ? 255 ARG A CG  1 
ATOM   1092 C CD  . ARG A 1 132 ? 33.922 7.375   11.797  1.00 47.61 ? 255 ARG A CD  1 
ATOM   1093 N NE  . ARG A 1 132 ? 35.031 8.301   11.662  1.00 48.77 ? 255 ARG A NE  1 
ATOM   1094 C CZ  . ARG A 1 132 ? 36.313 7.960   11.652  1.00 49.61 ? 255 ARG A CZ  1 
ATOM   1095 N NH1 . ARG A 1 132 ? 36.665 6.683   11.780  1.00 48.64 ? 255 ARG A NH1 1 
ATOM   1096 N NH2 . ARG A 1 132 ? 37.240 8.906   11.529  1.00 46.54 ? 255 ARG A NH2 1 
ATOM   1097 N N   . ASP A 1 133 ? 29.915 10.945  14.686  1.00 51.93 ? 256 ASP A N   1 
ATOM   1098 C CA  . ASP A 1 133 ? 29.658 11.614  15.965  1.00 52.98 ? 256 ASP A CA  1 
ATOM   1099 C C   . ASP A 1 133 ? 28.230 12.219  16.049  1.00 53.37 ? 256 ASP A C   1 
ATOM   1100 O O   . ASP A 1 133 ? 28.042 13.354  16.475  1.00 53.43 ? 256 ASP A O   1 
ATOM   1101 C CB  . ASP A 1 133 ? 30.750 12.657  16.255  1.00 52.17 ? 256 ASP A CB  1 
ATOM   1102 C CG  . ASP A 1 133 ? 30.935 12.943  17.761  1.00 54.65 ? 256 ASP A CG  1 
ATOM   1103 O OD1 . ASP A 1 133 ? 30.482 12.133  18.616  1.00 55.15 ? 256 ASP A OD1 1 
ATOM   1104 O OD2 . ASP A 1 133 ? 31.562 13.989  18.088  1.00 54.38 ? 256 ASP A OD2 1 
ATOM   1105 N N   . ILE A 1 134 ? 27.238 11.443  15.619  1.00 54.24 ? 257 ILE A N   1 
ATOM   1106 C CA  . ILE A 1 134 ? 25.820 11.844  15.702  1.00 54.87 ? 257 ILE A CA  1 
ATOM   1107 C C   . ILE A 1 134 ? 25.396 11.838  17.168  1.00 55.13 ? 257 ILE A C   1 
ATOM   1108 O O   . ILE A 1 134 ? 25.488 10.784  17.839  1.00 55.90 ? 257 ILE A O   1 
ATOM   1109 C CB  . ILE A 1 134 ? 24.928 10.879  14.868  1.00 54.71 ? 257 ILE A CB  1 
ATOM   1110 C CG1 . ILE A 1 134 ? 25.116 11.130  13.375  1.00 56.45 ? 257 ILE A CG1 1 
ATOM   1111 C CG2 . ILE A 1 134 ? 23.466 10.957  15.251  1.00 56.31 ? 257 ILE A CG2 1 
ATOM   1112 C CD1 . ILE A 1 134 ? 25.271 12.645  12.943  1.00 54.92 ? 257 ILE A CD1 1 
ATOM   1113 N N   . LYS A 1 135 ? 24.992 13.005  17.683  1.00 54.15 ? 258 LYS A N   1 
ATOM   1114 C CA  . LYS A 1 135 ? 24.525 13.120  19.059  1.00 53.73 ? 258 LYS A CA  1 
ATOM   1115 C C   . LYS A 1 135 ? 23.925 14.498  19.276  1.00 53.58 ? 258 LYS A C   1 
ATOM   1116 O O   . LYS A 1 135 ? 24.265 15.449  18.561  1.00 53.99 ? 258 LYS A O   1 
ATOM   1117 C CB  . LYS A 1 135 ? 25.675 12.856  20.051  1.00 52.53 ? 258 LYS A CB  1 
ATOM   1118 C CG  . LYS A 1 135 ? 26.633 13.941  20.091  1.00 51.97 ? 258 LYS A CG  1 
ATOM   1119 C CD  . LYS A 1 135 ? 27.700 13.697  21.104  1.00 50.04 ? 258 LYS A CD  1 
ATOM   1120 C CE  . LYS A 1 135 ? 28.672 14.810  21.044  1.00 48.01 ? 258 LYS A CE  1 
ATOM   1121 N NZ  . LYS A 1 135 ? 29.672 14.663  22.124  1.00 50.05 ? 258 LYS A NZ  1 
ATOM   1122 N N   . PRO A 1 136 ? 23.036 14.634  20.274  1.00 53.62 ? 259 PRO A N   1 
ATOM   1123 C CA  . PRO A 1 136 ? 22.253 15.897  20.344  1.00 53.25 ? 259 PRO A CA  1 
ATOM   1124 C C   . PRO A 1 136 ? 23.059 17.227  20.305  1.00 52.91 ? 259 PRO A C   1 
ATOM   1125 O O   . PRO A 1 136 ? 22.552 18.178  19.731  1.00 52.67 ? 259 PRO A O   1 
ATOM   1126 C CB  . PRO A 1 136 ? 21.430 15.746  21.631  1.00 51.68 ? 259 PRO A CB  1 
ATOM   1127 C CG  . PRO A 1 136 ? 21.287 14.259  21.790  1.00 54.36 ? 259 PRO A CG  1 
ATOM   1128 C CD  . PRO A 1 136 ? 22.650 13.705  21.350  1.00 53.94 ? 259 PRO A CD  1 
ATOM   1129 N N   . GLU A 1 137 ? 24.268 17.286  20.877  1.00 52.13 ? 260 GLU A N   1 
ATOM   1130 C CA  . GLU A 1 137 ? 25.064 18.534  20.852  1.00 53.17 ? 260 GLU A CA  1 
ATOM   1131 C C   . GLU A 1 137 ? 25.622 18.876  19.487  1.00 52.43 ? 260 GLU A C   1 
ATOM   1132 O O   . GLU A 1 137 ? 25.807 20.067  19.180  1.00 52.10 ? 260 GLU A O   1 
ATOM   1133 C CB  . GLU A 1 137 ? 26.221 18.530  21.846  1.00 53.44 ? 260 GLU A CB  1 
ATOM   1134 C CG  . GLU A 1 137 ? 25.788 18.057  23.182  1.00 60.58 ? 260 GLU A CG  1 
ATOM   1135 C CD  . GLU A 1 137 ? 26.890 18.020  24.203  1.00 67.76 ? 260 GLU A CD  1 
ATOM   1136 O OE1 . GLU A 1 137 ? 27.718 19.009  24.223  1.00 62.85 ? 260 GLU A OE1 1 
ATOM   1137 O OE2 . GLU A 1 137 ? 26.870 16.982  24.988  1.00 69.26 ? 260 GLU A OE2 1 
ATOM   1138 N N   . ASN A 1 138 ? 25.894 17.849  18.677  1.00 51.63 ? 261 ASN A N   1 
ATOM   1139 C CA  . ASN A 1 138 ? 26.412 18.082  17.336  1.00 51.34 ? 261 ASN A CA  1 
ATOM   1140 C C   . ASN A 1 138 ? 25.304 18.441  16.335  1.00 51.46 ? 261 ASN A C   1 
ATOM   1141 O O   . ASN A 1 138 ? 25.529 18.490  15.111  1.00 52.73 ? 261 ASN A O   1 
ATOM   1142 C CB  . ASN A 1 138 ? 27.307 16.926  16.886  1.00 50.53 ? 261 ASN A CB  1 
ATOM   1143 C CG  . ASN A 1 138 ? 28.549 16.765  17.800  1.00 50.58 ? 261 ASN A CG  1 
ATOM   1144 O OD1 . ASN A 1 138 ? 28.714 17.506  18.773  1.00 45.01 ? 261 ASN A OD1 1 
ATOM   1145 N ND2 . ASN A 1 138 ? 29.401 15.785  17.489  1.00 46.70 ? 261 ASN A ND2 1 
ATOM   1146 N N   . LEU A 1 139 ? 24.117 18.726  16.865  1.00 50.18 ? 262 LEU A N   1 
ATOM   1147 C CA  . LEU A 1 139 ? 22.985 19.061  16.040  1.00 48.84 ? 262 LEU A CA  1 
ATOM   1148 C C   . LEU A 1 139 ? 22.498 20.426  16.435  1.00 48.95 ? 262 LEU A C   1 
ATOM   1149 O O   . LEU A 1 139 ? 22.354 20.734  17.611  1.00 48.29 ? 262 LEU A O   1 
ATOM   1150 C CB  . LEU A 1 139 ? 21.875 18.033  16.202  1.00 48.95 ? 262 LEU A CB  1 
ATOM   1151 C CG  . LEU A 1 139 ? 22.269 16.558  16.063  1.00 48.36 ? 262 LEU A CG  1 
ATOM   1152 C CD1 . LEU A 1 139 ? 21.106 15.645  16.316  1.00 44.36 ? 262 LEU A CD1 1 
ATOM   1153 C CD2 . LEU A 1 139 ? 22.876 16.294  14.690  1.00 49.22 ? 262 LEU A CD2 1 
ATOM   1154 N N   . LEU A 1 140 ? 22.251 21.245  15.417  1.00 48.85 ? 263 LEU A N   1 
ATOM   1155 C CA  . LEU A 1 140 ? 21.808 22.608  15.596  1.00 48.37 ? 263 LEU A CA  1 
ATOM   1156 C C   . LEU A 1 140 ? 20.462 22.842  14.937  1.00 47.85 ? 263 LEU A C   1 
ATOM   1157 O O   . LEU A 1 140 ? 20.043 22.067  14.067  1.00 48.21 ? 263 LEU A O   1 
ATOM   1158 C CB  . LEU A 1 140 ? 22.873 23.547  15.005  1.00 49.10 ? 263 LEU A CB  1 
ATOM   1159 C CG  . LEU A 1 140 ? 24.101 23.928  15.825  1.00 46.99 ? 263 LEU A CG  1 
ATOM   1160 C CD1 . LEU A 1 140 ? 24.996 24.725  14.935  1.00 45.92 ? 263 LEU A CD1 1 
ATOM   1161 C CD2 . LEU A 1 140 ? 23.722 24.751  17.047  1.00 46.64 ? 263 LEU A CD2 1 
ATOM   1162 N N   . LEU A 1 141 ? 19.784 23.899  15.355  1.00 47.23 ? 264 LEU A N   1 
ATOM   1163 C CA  . LEU A 1 141 ? 18.486 24.276  14.777  1.00 47.78 ? 264 LEU A CA  1 
ATOM   1164 C C   . LEU A 1 141 ? 18.524 25.669  14.079  1.00 47.71 ? 264 LEU A C   1 
ATOM   1165 O O   . LEU A 1 141 ? 18.924 26.680  14.667  1.00 47.52 ? 264 LEU A O   1 
ATOM   1166 C CB  . LEU A 1 141 ? 17.380 24.266  15.866  1.00 47.44 ? 264 LEU A CB  1 
ATOM   1167 C CG  . LEU A 1 141 ? 17.111 23.005  16.696  1.00 48.33 ? 264 LEU A CG  1 
ATOM   1168 C CD1 . LEU A 1 141 ? 16.230 23.265  17.938  1.00 48.20 ? 264 LEU A CD1 1 
ATOM   1169 C CD2 . LEU A 1 141 ? 16.489 21.936  15.844  1.00 47.60 ? 264 LEU A CD2 1 
ATOM   1170 N N   . GLY A 1 142 ? 18.077 25.736  12.838  1.00 48.08 ? 265 GLY A N   1 
ATOM   1171 C CA  . GLY A 1 142 ? 17.963 27.043  12.182  1.00 48.25 ? 265 GLY A CA  1 
ATOM   1172 C C   . GLY A 1 142 ? 16.646 27.786  12.416  1.00 48.66 ? 265 GLY A C   1 
ATOM   1173 O O   . GLY A 1 142 ? 15.803 27.362  13.207  1.00 48.85 ? 265 GLY A O   1 
ATOM   1174 N N   . SER A 1 143 ? 16.498 28.905  11.706  1.00 49.18 ? 266 SER A N   1 
ATOM   1175 C CA  . SER A 1 143 ? 15.306 29.767  11.695  1.00 49.51 ? 266 SER A CA  1 
ATOM   1176 C C   . SER A 1 143 ? 13.973 29.074  11.877  1.00 49.14 ? 266 SER A C   1 
ATOM   1177 O O   . SER A 1 143 ? 13.193 29.445  12.754  1.00 49.42 ? 266 SER A O   1 
ATOM   1178 C CB  . SER A 1 143 ? 15.228 30.514  10.368  1.00 49.16 ? 266 SER A CB  1 
ATOM   1179 O OG  . SER A 1 143 ? 16.211 31.517  10.320  1.00 52.51 ? 266 SER A OG  1 
ATOM   1180 N N   . ALA A 1 144 ? 13.704 28.100  11.021  1.00 48.66 ? 267 ALA A N   1 
ATOM   1181 C CA  . ALA A 1 144 ? 12.398 27.463  10.969  1.00 48.54 ? 267 ALA A CA  1 
ATOM   1182 C C   . ALA A 1 144 ? 12.381 26.269  11.907  1.00 49.13 ? 267 ALA A C   1 
ATOM   1183 O O   . ALA A 1 144 ? 11.453 25.492  11.882  1.00 49.68 ? 267 ALA A O   1 
ATOM   1184 C CB  . ALA A 1 144 ? 12.060 27.033  9.537   1.00 47.51 ? 267 ALA A CB  1 
ATOM   1185 N N   . GLY A 1 145 ? 13.412 26.125  12.735  1.00 49.98 ? 268 GLY A N   1 
ATOM   1186 C CA  . GLY A 1 145 ? 13.513 24.981  13.632  1.00 50.52 ? 268 GLY A CA  1 
ATOM   1187 C C   . GLY A 1 145 ? 13.954 23.711  12.920  1.00 51.13 ? 268 GLY A C   1 
ATOM   1188 O O   . GLY A 1 145 ? 13.844 22.612  13.451  1.00 51.02 ? 268 GLY A O   1 
ATOM   1189 N N   . GLU A 1 146 ? 14.468 23.861  11.714  1.00 52.14 ? 269 GLU A N   1 
ATOM   1190 C CA  . GLU A 1 146 ? 14.952 22.718  10.967  1.00 53.32 ? 269 GLU A CA  1 
ATOM   1191 C C   . GLU A 1 146 ? 16.296 22.216  11.549  1.00 53.94 ? 269 GLU A C   1 
ATOM   1192 O O   . GLU A 1 146 ? 17.134 23.021  11.997  1.00 53.87 ? 269 GLU A O   1 
ATOM   1193 C CB  . GLU A 1 146 ? 15.088 23.084  9.483   1.00 53.33 ? 269 GLU A CB  1 
ATOM   1194 C CG  . GLU A 1 146 ? 16.351 23.899  9.111   1.00 54.90 ? 269 GLU A CG  1 
ATOM   1195 C CD  . GLU A 1 146 ? 16.265 25.410  9.351   1.00 57.25 ? 269 GLU A CD  1 
ATOM   1196 O OE1 . GLU A 1 146 ? 15.228 25.940  9.791   1.00 54.36 ? 269 GLU A OE1 1 
ATOM   1197 O OE2 . GLU A 1 146 ? 17.286 26.095  9.084   1.00 62.20 ? 269 GLU A OE2 1 
ATOM   1198 N N   . LEU A 1 147 ? 16.485 20.893  11.533  1.00 53.93 ? 270 LEU A N   1 
ATOM   1199 C CA  . LEU A 1 147 ? 17.726 20.299  11.979  1.00 53.64 ? 270 LEU A CA  1 
ATOM   1200 C C   . LEU A 1 147 ? 18.876 20.517  11.014  1.00 53.67 ? 270 LEU A C   1 
ATOM   1201 O O   . LEU A 1 147 ? 18.736 20.322  9.797   1.00 54.11 ? 270 LEU A O   1 
ATOM   1202 C CB  . LEU A 1 147 ? 17.548 18.804  12.177  1.00 53.79 ? 270 LEU A CB  1 
ATOM   1203 C CG  . LEU A 1 147 ? 18.842 18.075  12.606  1.00 53.61 ? 270 LEU A CG  1 
ATOM   1204 C CD1 . LEU A 1 147 ? 18.512 17.124  13.708  1.00 52.09 ? 270 LEU A CD1 1 
ATOM   1205 C CD2 . LEU A 1 147 ? 19.552 17.369  11.449  1.00 50.92 ? 270 LEU A CD2 1 
ATOM   1206 N N   . LYS A 1 148 ? 20.029 20.886  11.564  1.00 53.60 ? 271 LYS A N   1 
ATOM   1207 C CA  . LYS A 1 148 ? 21.293 20.882  10.801  1.00 53.04 ? 271 LYS A CA  1 
ATOM   1208 C C   . LYS A 1 148 ? 22.413 20.115  11.520  1.00 53.20 ? 271 LYS A C   1 
ATOM   1209 O O   . LYS A 1 148 ? 22.635 20.330  12.712  1.00 53.38 ? 271 LYS A O   1 
ATOM   1210 C CB  . LYS A 1 148 ? 21.747 22.318  10.531  1.00 51.95 ? 271 LYS A CB  1 
ATOM   1211 C CG  . LYS A 1 148 ? 21.079 22.909  9.317   1.00 51.82 ? 271 LYS A CG  1 
ATOM   1212 C CD  . LYS A 1 148 ? 20.948 24.399  9.377   1.00 49.77 ? 271 LYS A CD  1 
ATOM   1213 C CE  . LYS A 1 148 ? 20.068 24.906  8.216   1.00 50.43 ? 271 LYS A CE  1 
ATOM   1214 N NZ  . LYS A 1 148 ? 20.824 24.896  6.934   1.00 51.61 ? 271 LYS A NZ  1 
ATOM   1215 N N   . ILE A 1 149 ? 23.129 19.254  10.799  1.00 52.86 ? 272 ILE A N   1 
ATOM   1216 C CA  . ILE A 1 149 ? 24.308 18.596  11.353  1.00 52.64 ? 272 ILE A CA  1 
ATOM   1217 C C   . ILE A 1 149 ? 25.451 19.580  11.432  1.00 52.32 ? 272 ILE A C   1 
ATOM   1218 O O   . ILE A 1 149 ? 25.820 20.184  10.429  1.00 52.49 ? 272 ILE A O   1 
ATOM   1219 C CB  . ILE A 1 149 ? 24.803 17.422  10.482  1.00 53.04 ? 272 ILE A CB  1 
ATOM   1220 C CG1 . ILE A 1 149 ? 23.644 16.536  10.037  1.00 54.26 ? 272 ILE A CG1 1 
ATOM   1221 C CG2 . ILE A 1 149 ? 25.881 16.608  11.240  1.00 51.33 ? 272 ILE A CG2 1 
ATOM   1222 C CD1 . ILE A 1 149 ? 24.083 15.139  9.635   1.00 58.80 ? 272 ILE A CD1 1 
ATOM   1223 N N   . ALA A 1 150 ? 26.059 19.687  12.611  1.00 52.22 ? 273 ALA A N   1 
ATOM   1224 C CA  . ALA A 1 150 ? 26.994 20.789  12.899  1.00 51.52 ? 273 ALA A CA  1 
ATOM   1225 C C   . ALA A 1 150 ? 28.451 20.386  13.044  1.00 51.41 ? 273 ALA A C   1 
ATOM   1226 O O   . ALA A 1 150 ? 29.342 21.102  12.574  1.00 51.74 ? 273 ALA A O   1 
ATOM   1227 C CB  . ALA A 1 150 ? 26.529 21.551  14.150  1.00 50.69 ? 273 ALA A CB  1 
ATOM   1228 N N   . ASP A 1 151 ? 28.714 19.261  13.706  1.00 51.32 ? 274 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 151 ? 30.096 18.931  14.070  1.00 51.63 ? 274 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 151 ? 30.618 17.782  13.205  1.00 51.85 ? 274 ASP A C   1 
ATOM   1231 O O   . ASP A 1 151 ? 30.085 16.666  13.262  1.00 52.98 ? 274 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 151 ? 30.149 18.564  15.539  1.00 51.49 ? 274 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 151 ? 31.505 18.787  16.156  1.00 54.07 ? 274 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 151 ? 32.559 18.393  15.588  1.00 56.83 ? 274 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 151 ? 31.528 19.375  17.252  1.00 58.57 ? 274 ASP A OD2 1 
ATOM   1236 N N   . PHE A 1 152 ? 31.622 18.061  12.375  1.00 50.73 ? 275 PHE A N   1 
ATOM   1237 C CA  . PHE A 1 152 ? 32.226 17.042  11.504  1.00 49.59 ? 275 PHE A CA  1 
ATOM   1238 C C   . PHE A 1 152 ? 33.638 16.671  11.974  1.00 49.07 ? 275 PHE A C   1 
ATOM   1239 O O   . PHE A 1 152 ? 34.436 16.132  11.213  1.00 48.17 ? 275 PHE A O   1 
ATOM   1240 C CB  . PHE A 1 152 ? 32.208 17.531  10.043  1.00 49.02 ? 275 PHE A CB  1 
ATOM   1241 C CG  . PHE A 1 152 ? 30.845 17.491  9.433   1.00 49.13 ? 275 PHE A CG  1 
ATOM   1242 C CD1 . PHE A 1 152 ? 29.859 18.388  9.850   1.00 47.54 ? 275 PHE A CD1 1 
ATOM   1243 C CD2 . PHE A 1 152 ? 30.514 16.502  8.513   1.00 48.56 ? 275 PHE A CD2 1 
ATOM   1244 C CE1 . PHE A 1 152 ? 28.613 18.325  9.354   1.00 47.40 ? 275 PHE A CE1 1 
ATOM   1245 C CE2 . PHE A 1 152 ? 29.262 16.436  7.992   1.00 49.41 ? 275 PHE A CE2 1 
ATOM   1246 C CZ  . PHE A 1 152 ? 28.299 17.353  8.404   1.00 50.22 ? 275 PHE A CZ  1 
ATOM   1247 N N   . GLY A 1 153 ? 33.918 16.960  13.242  1.00 49.26 ? 276 GLY A N   1 
ATOM   1248 C CA  . GLY A 1 153 ? 35.210 16.665  13.884  1.00 50.34 ? 276 GLY A CA  1 
ATOM   1249 C C   . GLY A 1 153 ? 35.724 15.222  13.911  1.00 51.20 ? 276 GLY A C   1 
ATOM   1250 O O   . GLY A 1 153 ? 36.946 15.007  14.075  1.00 49.83 ? 276 GLY A O   1 
ATOM   1251 N N   . TRP A 1 154 ? 34.812 14.246  13.750  1.00 51.65 ? 277 TRP A N   1 
ATOM   1252 C CA  . TRP A 1 154 ? 35.187 12.812  13.646  1.00 52.99 ? 277 TRP A CA  1 
ATOM   1253 C C   . TRP A 1 154 ? 34.818 12.209  12.294  1.00 52.58 ? 277 TRP A C   1 
ATOM   1254 O O   . TRP A 1 154 ? 35.028 11.030  12.052  1.00 52.27 ? 277 TRP A O   1 
ATOM   1255 C CB  . TRP A 1 154 ? 34.583 11.975  14.793  1.00 54.48 ? 277 TRP A CB  1 
ATOM   1256 C CG  . TRP A 1 154 ? 35.332 12.231  16.093  1.00 57.10 ? 277 TRP A CG  1 
ATOM   1257 C CD1 . TRP A 1 154 ? 34.820 12.764  17.247  1.00 58.86 ? 277 TRP A CD1 1 
ATOM   1258 C CD2 . TRP A 1 154 ? 36.738 12.013  16.341  1.00 58.01 ? 277 TRP A CD2 1 
ATOM   1259 N NE1 . TRP A 1 154 ? 35.820 12.891  18.196  1.00 59.73 ? 277 TRP A NE1 1 
ATOM   1260 C CE2 . TRP A 1 154 ? 37.003 12.445  17.665  1.00 59.36 ? 277 TRP A CE2 1 
ATOM   1261 C CE3 . TRP A 1 154 ? 37.800 11.493  15.572  1.00 59.22 ? 277 TRP A CE3 1 
ATOM   1262 C CZ2 . TRP A 1 154 ? 38.291 12.362  18.247  1.00 59.36 ? 277 TRP A CZ2 1 
ATOM   1263 C CZ3 . TRP A 1 154 ? 39.091 11.420  16.147  1.00 57.93 ? 277 TRP A CZ3 1 
ATOM   1264 C CH2 . TRP A 1 154 ? 39.322 11.856  17.466  1.00 58.09 ? 277 TRP A CH2 1 
ATOM   1265 N N   . SER A 1 155 ? 34.274 13.027  11.404  1.00 51.84 ? 278 SER A N   1 
ATOM   1266 C CA  . SER A 1 155 ? 33.822 12.520  10.140  1.00 50.91 ? 278 SER A CA  1 
ATOM   1267 C C   . SER A 1 155 ? 35.023 12.160  9.269   1.00 50.14 ? 278 SER A C   1 
ATOM   1268 O O   . SER A 1 155 ? 36.102 12.766  9.381   1.00 50.15 ? 278 SER A O   1 
ATOM   1269 C CB  . SER A 1 155 ? 32.870 13.496  9.455   1.00 50.78 ? 278 SER A CB  1 
ATOM   1270 O OG  . SER A 1 155 ? 33.580 14.569  8.836   1.00 54.51 ? 278 SER A OG  1 
ATOM   1271 N N   . VAL A 1 156 ? 34.825 11.173  8.400   1.00 49.37 ? 279 VAL A N   1 
ATOM   1272 C CA  . VAL A 1 156 ? 35.893 10.682  7.513   1.00 48.95 ? 279 VAL A CA  1 
ATOM   1273 C C   . VAL A 1 156 ? 35.322 10.431  6.127   1.00 48.91 ? 279 VAL A C   1 
ATOM   1274 O O   . VAL A 1 156 ? 34.153 10.059  5.986   1.00 48.60 ? 279 VAL A O   1 
ATOM   1275 C CB  . VAL A 1 156 ? 36.581 9.392   8.093   1.00 48.08 ? 279 VAL A CB  1 
ATOM   1276 C CG1 . VAL A 1 156 ? 35.581 8.250   8.180   1.00 47.89 ? 279 VAL A CG1 1 
ATOM   1277 C CG2 . VAL A 1 156 ? 37.892 9.011   7.313   1.00 48.77 ? 279 VAL A CG2 1 
ATOM   1278 N N   . HIS A 1 157 ? 36.134 10.692  5.105   1.00 49.58 ? 280 HIS A N   1 
ATOM   1279 C CA  . HIS A 1 157 ? 35.822 10.263  3.748   1.00 50.18 ? 280 HIS A CA  1 
ATOM   1280 C C   . HIS A 1 157 ? 36.342 8.833   3.536   1.00 51.20 ? 280 HIS A C   1 
ATOM   1281 O O   . HIS A 1 157 ? 37.547 8.607   3.442   1.00 50.90 ? 280 HIS A O   1 
ATOM   1282 C CB  . HIS A 1 157 ? 36.385 11.240  2.708   1.00 49.84 ? 280 HIS A CB  1 
ATOM   1283 C CG  . HIS A 1 157 ? 35.863 11.002  1.324   1.00 49.26 ? 280 HIS A CG  1 
ATOM   1284 N ND1 . HIS A 1 157 ? 36.684 10.925  0.219   1.00 46.14 ? 280 HIS A ND1 1 
ATOM   1285 C CD2 . HIS A 1 157 ? 34.602 10.787  0.874   1.00 48.01 ? 280 HIS A CD2 1 
ATOM   1286 C CE1 . HIS A 1 157 ? 35.948 10.686  -0.852  1.00 46.17 ? 280 HIS A CE1 1 
ATOM   1287 N NE2 . HIS A 1 157 ? 34.682 10.610  -0.484  1.00 47.06 ? 280 HIS A NE2 1 
ATOM   1288 N N   . ALA A 1 158 ? 35.418 7.870   3.508   1.00 52.99 ? 281 ALA A N   1 
ATOM   1289 C CA  . ALA A 1 158 ? 35.761 6.460   3.336   1.00 55.07 ? 281 ALA A CA  1 
ATOM   1290 C C   . ALA A 1 158 ? 35.336 5.983   1.949   1.00 56.42 ? 281 ALA A C   1 
ATOM   1291 O O   . ALA A 1 158 ? 34.273 5.366   1.799   1.00 56.83 ? 281 ALA A O   1 
ATOM   1292 C CB  . ALA A 1 158 ? 35.122 5.616   4.405   1.00 55.06 ? 281 ALA A CB  1 
ATOM   1293 N N   . PRO A 1 159 ? 36.180 6.246   0.932   1.00 57.62 ? 282 PRO A N   1 
ATOM   1294 C CA  . PRO A 1 159 ? 35.736 6.010   -0.442  1.00 58.69 ? 282 PRO A CA  1 
ATOM   1295 C C   . PRO A 1 159 ? 35.809 4.519   -0.796  1.00 59.89 ? 282 PRO A C   1 
ATOM   1296 O O   . PRO A 1 159 ? 34.976 4.015   -1.566  1.00 60.25 ? 282 PRO A O   1 
ATOM   1297 C CB  . PRO A 1 159 ? 36.719 6.842   -1.275  1.00 58.86 ? 282 PRO A CB  1 
ATOM   1298 C CG  . PRO A 1 159 ? 37.996 6.895   -0.441  1.00 58.68 ? 282 PRO A CG  1 
ATOM   1299 C CD  . PRO A 1 159 ? 37.589 6.695   1.009   1.00 57.44 ? 282 PRO A CD  1 
ATOM   1300 N N   . SER A 1 160 ? 36.784 3.818   -0.222  1.00 60.74 ? 283 SER A N   1 
ATOM   1301 C CA  . SER A 1 160 ? 36.947 2.401   -0.501  1.00 62.09 ? 283 SER A CA  1 
ATOM   1302 C C   . SER A 1 160 ? 37.119 1.619   0.803   1.00 62.83 ? 283 SER A C   1 
ATOM   1303 O O   . SER A 1 160 ? 36.202 0.885   1.223   1.00 62.63 ? 283 SER A O   1 
ATOM   1304 C CB  . SER A 1 160 ? 38.112 2.155   -1.489  1.00 61.83 ? 283 SER A CB  1 
ATOM   1305 O OG  . SER A 1 160 ? 39.380 2.406   -0.900  1.00 61.45 ? 283 SER A OG  1 
ATOM   1306 N N   . SER A 1 161 ? 38.283 1.819   1.433   1.00 63.35 ? 284 SER A N   1 
ATOM   1307 C CA  . SER A 1 161 ? 38.674 1.156   2.676   1.00 63.77 ? 284 SER A CA  1 
ATOM   1308 C C   . SER A 1 161 ? 37.789 1.443   3.904   1.00 63.47 ? 284 SER A C   1 
ATOM   1309 O O   . SER A 1 161 ? 37.441 2.606   4.193   1.00 63.82 ? 284 SER A O   1 
ATOM   1310 C CB  . SER A 1 161 ? 40.127 1.512   3.001   1.00 64.02 ? 284 SER A CB  1 
ATOM   1311 O OG  . SER A 1 161 ? 41.002 0.899   2.046   1.00 66.52 ? 284 SER A OG  1 
ATOM   1312 N N   . ARG A 1 162 ? 37.447 0.365   4.614   1.00 62.59 ? 285 ARG A N   1 
ATOM   1313 C CA  . ARG A 1 162 ? 36.915 0.428   5.973   1.00 61.89 ? 285 ARG A CA  1 
ATOM   1314 C C   . ARG A 1 162 ? 37.892 1.056   6.993   1.00 60.63 ? 285 ARG A C   1 
ATOM   1315 O O   . ARG A 1 162 ? 39.118 1.090   6.785   1.00 60.72 ? 285 ARG A O   1 
ATOM   1316 C CB  . ARG A 1 162 ? 36.541 -0.975  6.433   1.00 61.91 ? 285 ARG A CB  1 
ATOM   1317 C CG  . ARG A 1 162 ? 35.116 -1.397  6.026   1.00 64.04 ? 285 ARG A CG  1 
ATOM   1318 C CD  . ARG A 1 162 ? 34.727 -2.755  6.640   1.00 63.01 ? 285 ARG A CD  1 
ATOM   1319 N NE  . ARG A 1 162 ? 35.699 -3.760  6.209   1.00 64.84 ? 285 ARG A NE  1 
ATOM   1320 C CZ  . ARG A 1 162 ? 35.819 -4.973  6.733   1.00 65.56 ? 285 ARG A CZ  1 
ATOM   1321 N NH1 . ARG A 1 162 ? 35.023 -5.352  7.734   1.00 63.59 ? 285 ARG A NH1 1 
ATOM   1322 N NH2 . ARG A 1 162 ? 36.746 -5.801  6.250   1.00 66.12 ? 285 ARG A NH2 1 
ATOM   1323 N N   . ARG A 1 163 ? 37.339 1.513   8.115   1.00 59.02 ? 286 ARG A N   1 
ATOM   1324 C CA  . ARG A 1 163 ? 38.079 2.306   9.106   1.00 57.50 ? 286 ARG A CA  1 
ATOM   1325 C C   . ARG A 1 163 ? 38.383 1.559   10.398  1.00 56.83 ? 286 ARG A C   1 
ATOM   1326 O O   . ARG A 1 163 ? 37.604 0.716   10.859  1.00 56.98 ? 286 ARG A O   1 
ATOM   1327 C CB  . ARG A 1 163 ? 37.295 3.580   9.459   1.00 56.74 ? 286 ARG A CB  1 
ATOM   1328 C CG  . ARG A 1 163 ? 36.566 4.236   8.325   1.00 55.78 ? 286 ARG A CG  1 
ATOM   1329 C CD  . ARG A 1 163 ? 37.513 4.610   7.182   1.00 57.21 ? 286 ARG A CD  1 
ATOM   1330 N NE  . ARG A 1 163 ? 38.765 5.202   7.650   1.00 56.98 ? 286 ARG A NE  1 
ATOM   1331 C CZ  . ARG A 1 163 ? 39.659 5.807   6.867   1.00 56.90 ? 286 ARG A CZ  1 
ATOM   1332 N NH1 . ARG A 1 163 ? 39.457 5.919   5.557   1.00 56.64 ? 286 ARG A NH1 1 
ATOM   1333 N NH2 . ARG A 1 163 ? 40.749 6.321   7.406   1.00 55.52 ? 286 ARG A NH2 1 
ATOM   1334 N N   . THR A 1 164 ? 39.505 1.918   11.000  1.00 56.22 ? 287 THR A N   1 
ATOM   1335 C CA  . THR A 1 164 ? 39.896 1.366   12.274  1.00 56.14 ? 287 THR A CA  1 
ATOM   1336 C C   . THR A 1 164 ? 39.729 2.418   13.384  1.00 55.31 ? 287 THR A C   1 
ATOM   1337 O O   . THR A 1 164 ? 40.130 2.180   14.530  1.00 54.63 ? 287 THR A O   1 
ATOM   1338 C CB  . THR A 1 164 ? 41.357 0.829   12.224  1.00 56.33 ? 287 THR A CB  1 
ATOM   1339 O OG1 . THR A 1 164 ? 42.266 1.903   11.932  1.00 57.95 ? 287 THR A OG1 1 
ATOM   1340 C CG2 . THR A 1 164 ? 41.497 -0.238  11.145  1.00 56.58 ? 287 THR A CG2 1 
HETATM 1341 N N   . TPO A 1 165 ? 39.436 3.675   13.362  1.00 54.19 ? 288 TPO A N   1 
HETATM 1342 C CA  . TPO A 1 165 ? 39.706 4.718   14.362  1.00 53.49 ? 288 TPO A CA  1 
HETATM 1343 C CB  . TPO A 1 165 ? 39.735 6.091   13.698  1.00 53.67 ? 288 TPO A CB  1 
HETATM 1344 C CG2 . TPO A 1 165 ? 40.101 7.146   14.722  1.00 53.08 ? 288 TPO A CG2 1 
HETATM 1345 O OG1 . TPO A 1 165 ? 40.703 6.115   12.644  1.00 52.82 ? 288 TPO A OG1 1 
HETATM 1346 P P   . TPO A 1 165 ? 40.252 6.667   11.168  1.00 50.97 ? 288 TPO A P   1 
HETATM 1347 O O1P . TPO A 1 165 ? 39.951 8.140   11.320  1.00 49.94 ? 288 TPO A O1P 1 
HETATM 1348 O O2P . TPO A 1 165 ? 39.036 5.789   10.993  1.00 51.85 ? 288 TPO A O2P 1 
HETATM 1349 O O3P . TPO A 1 165 ? 41.419 6.372   10.282  1.00 47.86 ? 288 TPO A O3P 1 
HETATM 1350 C C   . TPO A 1 165 ? 38.572 4.632   15.334  1.00 53.93 ? 288 TPO A C   1 
HETATM 1351 O O   . TPO A 1 165 ? 37.395 4.559   14.956  1.00 53.06 ? 288 TPO A O   1 
ATOM   1352 N N   . LEU A 1 166 ? 38.892 4.226   16.525  1.00 55.72 ? 289 LEU A N   1 
ATOM   1353 C CA  . LEU A 1 166 ? 37.800 4.411   17.576  1.00 55.91 ? 289 LEU A CA  1 
ATOM   1354 C C   . LEU A 1 166 ? 37.501 5.890   17.830  1.00 55.44 ? 289 LEU A C   1 
ATOM   1355 O O   . LEU A 1 166 ? 38.337 6.652   18.295  1.00 54.41 ? 289 LEU A O   1 
ATOM   1356 C CB  . LEU A 1 166 ? 38.123 3.703   18.914  1.00 56.43 ? 289 LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 166 ? 37.098 3.939   20.060  1.00 55.97 ? 289 LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 166 ? 35.952 2.965   20.030  1.00 54.80 ? 289 LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 166 ? 37.770 3.905   21.442  1.00 57.98 ? 289 LEU A CD2 1 
ATOM   1360 N N   . CYS A 1 167 ? 36.292 6.299   17.502  1.00 56.08 ? 290 CYS A N   1 
ATOM   1361 C CA  . CYS A 1 167 ? 35.909 7.690   17.769  1.00 56.34 ? 290 CYS A CA  1 
ATOM   1362 C C   . CYS A 1 167 ? 34.414 7.825   17.992  1.00 56.59 ? 290 CYS A C   1 
ATOM   1363 O O   . CYS A 1 167 ? 33.616 6.975   17.549  1.00 56.60 ? 290 CYS A O   1 
ATOM   1364 C CB  . CYS A 1 167 ? 36.369 8.610   16.639  1.00 55.72 ? 290 CYS A CB  1 
ATOM   1365 S SG  . CYS A 1 167 ? 35.700 8.096   15.087  1.00 55.55 ? 290 CYS A SG  1 
ATOM   1366 N N   . GLY A 1 168 ? 34.057 8.908   18.681  1.00 56.53 ? 291 GLY A N   1 
ATOM   1367 C CA  . GLY A 1 168 ? 32.680 9.257   18.960  1.00 55.96 ? 291 GLY A CA  1 
ATOM   1368 C C   . GLY A 1 168 ? 32.536 9.575   20.426  1.00 56.30 ? 291 GLY A C   1 
ATOM   1369 O O   . GLY A 1 168 ? 33.506 9.956   21.082  1.00 57.36 ? 291 GLY A O   1 
ATOM   1370 N N   . THR A 1 169 ? 31.322 9.399   20.942  1.00 56.30 ? 292 THR A N   1 
ATOM   1371 C CA  . THR A 1 169 ? 30.975 9.732   22.308  1.00 55.86 ? 292 THR A CA  1 
ATOM   1372 C C   . THR A 1 169 ? 30.461 8.468   23.002  1.00 55.37 ? 292 THR A C   1 
ATOM   1373 O O   . THR A 1 169 ? 29.636 7.736   22.445  1.00 54.26 ? 292 THR A O   1 
ATOM   1374 C CB  . THR A 1 169 ? 29.936 10.887  22.326  1.00 56.43 ? 292 THR A CB  1 
ATOM   1375 O OG1 . THR A 1 169 ? 30.519 12.051  21.694  1.00 56.70 ? 292 THR A OG1 1 
ATOM   1376 C CG2 . THR A 1 169 ? 29.524 11.245  23.753  1.00 56.12 ? 292 THR A CG2 1 
ATOM   1377 N N   . LEU A 1 170 ? 30.985 8.217   24.205  1.00 55.07 ? 293 LEU A N   1 
ATOM   1378 C CA  . LEU A 1 170 ? 30.676 6.998   24.963  1.00 55.48 ? 293 LEU A CA  1 
ATOM   1379 C C   . LEU A 1 170 ? 29.298 6.363   24.696  1.00 55.31 ? 293 LEU A C   1 
ATOM   1380 O O   . LEU A 1 170 ? 29.225 5.217   24.266  1.00 55.61 ? 293 LEU A O   1 
ATOM   1381 C CB  . LEU A 1 170 ? 30.853 7.210   26.475  1.00 55.58 ? 293 LEU A CB  1 
ATOM   1382 C CG  . LEU A 1 170 ? 30.513 6.022   27.398  1.00 55.40 ? 293 LEU A CG  1 
ATOM   1383 C CD1 . LEU A 1 170 ? 31.316 4.776   27.097  1.00 54.00 ? 293 LEU A CD1 1 
ATOM   1384 C CD2 . LEU A 1 170 ? 30.741 6.425   28.833  1.00 54.85 ? 293 LEU A CD2 1 
ATOM   1385 N N   . ASP A 1 171 ? 28.218 7.098   24.928  1.00 54.62 ? 294 ASP A N   1 
ATOM   1386 C CA  . ASP A 1 171 ? 26.904 6.475   24.943  1.00 54.21 ? 294 ASP A CA  1 
ATOM   1387 C C   . ASP A 1 171 ? 26.411 6.140   23.545  1.00 53.59 ? 294 ASP A C   1 
ATOM   1388 O O   . ASP A 1 171 ? 25.371 5.477   23.371  1.00 53.31 ? 294 ASP A O   1 
ATOM   1389 C CB  . ASP A 1 171 ? 25.909 7.374   25.688  1.00 54.63 ? 294 ASP A CB  1 
ATOM   1390 C CG  . ASP A 1 171 ? 26.074 7.301   27.202  1.00 56.32 ? 294 ASP A CG  1 
ATOM   1391 O OD1 . ASP A 1 171 ? 25.691 6.286   27.830  1.00 57.57 ? 294 ASP A OD1 1 
ATOM   1392 O OD2 . ASP A 1 171 ? 26.594 8.278   27.774  1.00 58.83 ? 294 ASP A OD2 1 
ATOM   1393 N N   . TYR A 1 172 ? 27.176 6.596   22.558  1.00 52.93 ? 295 TYR A N   1 
ATOM   1394 C CA  . TYR A 1 172 ? 26.803 6.494   21.163  1.00 52.23 ? 295 TYR A CA  1 
ATOM   1395 C C   . TYR A 1 172 ? 27.694 5.565   20.345  1.00 51.84 ? 295 TYR A C   1 
ATOM   1396 O O   . TYR A 1 172 ? 27.482 5.389   19.144  1.00 51.67 ? 295 TYR A O   1 
ATOM   1397 C CB  . TYR A 1 172 ? 26.819 7.896   20.557  1.00 53.13 ? 295 TYR A CB  1 
ATOM   1398 C CG  . TYR A 1 172 ? 25.593 8.647   20.894  1.00 52.81 ? 295 TYR A CG  1 
ATOM   1399 C CD1 . TYR A 1 172 ? 25.444 9.296   22.137  1.00 53.44 ? 295 TYR A CD1 1 
ATOM   1400 C CD2 . TYR A 1 172 ? 24.556 8.710   19.977  1.00 53.10 ? 295 TYR A CD2 1 
ATOM   1401 C CE1 . TYR A 1 172 ? 24.254 9.995   22.451  1.00 50.82 ? 295 TYR A CE1 1 
ATOM   1402 C CE2 . TYR A 1 172 ? 23.405 9.388   20.263  1.00 53.58 ? 295 TYR A CE2 1 
ATOM   1403 C CZ  . TYR A 1 172 ? 23.251 10.002  21.504  1.00 52.73 ? 295 TYR A CZ  1 
ATOM   1404 O OH  . TYR A 1 172 ? 22.053 10.627  21.715  1.00 56.50 ? 295 TYR A OH  1 
ATOM   1405 N N   . LEU A 1 173 ? 28.722 5.000   20.973  1.00 51.72 ? 296 LEU A N   1 
ATOM   1406 C CA  . LEU A 1 173 ? 29.660 4.147   20.243  1.00 51.23 ? 296 LEU A CA  1 
ATOM   1407 C C   . LEU A 1 173 ? 28.944 2.897   19.716  1.00 51.30 ? 296 LEU A C   1 
ATOM   1408 O O   . LEU A 1 173 ? 28.235 2.232   20.462  1.00 51.84 ? 296 LEU A O   1 
ATOM   1409 C CB  . LEU A 1 173 ? 30.862 3.785   21.120  1.00 50.72 ? 296 LEU A CB  1 
ATOM   1410 C CG  . LEU A 1 173 ? 31.704 4.990   21.594  1.00 52.17 ? 296 LEU A CG  1 
ATOM   1411 C CD1 . LEU A 1 173 ? 32.678 4.632   22.710  1.00 50.74 ? 296 LEU A CD1 1 
ATOM   1412 C CD2 . LEU A 1 173 ? 32.446 5.663   20.422  1.00 51.96 ? 296 LEU A CD2 1 
ATOM   1413 N N   . PRO A 1 174 ? 29.119 2.580   18.422  1.00 51.54 ? 297 PRO A N   1 
ATOM   1414 C CA  . PRO A 1 174 ? 28.587 1.323   17.881  1.00 50.83 ? 297 PRO A CA  1 
ATOM   1415 C C   . PRO A 1 174 ? 29.356 0.113   18.469  1.00 50.49 ? 297 PRO A C   1 
ATOM   1416 O O   . PRO A 1 174 ? 30.492 0.256   18.940  1.00 50.17 ? 297 PRO A O   1 
ATOM   1417 C CB  . PRO A 1 174 ? 28.841 1.463   16.369  1.00 51.02 ? 297 PRO A CB  1 
ATOM   1418 C CG  . PRO A 1 174 ? 30.135 2.324   16.322  1.00 51.29 ? 297 PRO A CG  1 
ATOM   1419 C CD  . PRO A 1 174 ? 29.870 3.353   17.396  1.00 51.61 ? 297 PRO A CD  1 
ATOM   1420 N N   . PRO A 1 175 ? 28.732 -1.071  18.464  1.00 50.22 ? 298 PRO A N   1 
ATOM   1421 C CA  . PRO A 1 175 ? 29.420 -2.249  18.996  1.00 49.80 ? 298 PRO A CA  1 
ATOM   1422 C C   . PRO A 1 175 ? 30.719 -2.636  18.274  1.00 49.78 ? 298 PRO A C   1 
ATOM   1423 O O   . PRO A 1 175 ? 31.636 -3.158  18.920  1.00 49.41 ? 298 PRO A O   1 
ATOM   1424 C CB  . PRO A 1 175 ? 28.366 -3.367  18.901  1.00 49.47 ? 298 PRO A CB  1 
ATOM   1425 C CG  . PRO A 1 175 ? 27.291 -2.853  18.012  1.00 49.60 ? 298 PRO A CG  1 
ATOM   1426 C CD  . PRO A 1 175 ? 27.350 -1.360  18.026  1.00 49.91 ? 298 PRO A CD  1 
ATOM   1427 N N   . GLU A 1 176 ? 30.806 -2.381  16.968  1.00 49.85 ? 299 GLU A N   1 
ATOM   1428 C CA  . GLU A 1 176 ? 31.987 -2.773  16.178  1.00 50.27 ? 299 GLU A CA  1 
ATOM   1429 C C   . GLU A 1 176 ? 33.254 -2.023  16.592  1.00 50.73 ? 299 GLU A C   1 
ATOM   1430 O O   . GLU A 1 176 ? 34.369 -2.570  16.492  1.00 49.71 ? 299 GLU A O   1 
ATOM   1431 C CB  . GLU A 1 176 ? 31.751 -2.632  14.670  1.00 50.03 ? 299 GLU A CB  1 
ATOM   1432 C CG  . GLU A 1 176 ? 31.142 -1.329  14.202  1.00 51.08 ? 299 GLU A CG  1 
ATOM   1433 C CD  . GLU A 1 176 ? 29.606 -1.346  14.216  1.00 52.41 ? 299 GLU A CD  1 
ATOM   1434 O OE1 . GLU A 1 176 ? 29.023 -1.995  15.105  1.00 51.10 ? 299 GLU A OE1 1 
ATOM   1435 O OE2 . GLU A 1 176 ? 28.973 -0.702  13.341  1.00 54.03 ? 299 GLU A OE2 1 
ATOM   1436 N N   . MET A 1 177 ? 33.056 -0.779  17.068  1.00 51.62 ? 300 MET A N   1 
ATOM   1437 C CA  . MET A 1 177 ? 34.132 0.039   17.657  1.00 51.78 ? 300 MET A CA  1 
ATOM   1438 C C   . MET A 1 177 ? 34.528 -0.466  19.034  1.00 52.29 ? 300 MET A C   1 
ATOM   1439 O O   . MET A 1 177 ? 35.718 -0.712  19.279  1.00 52.64 ? 300 MET A O   1 
ATOM   1440 C CB  . MET A 1 177 ? 33.752 1.523   17.729  1.00 51.87 ? 300 MET A CB  1 
ATOM   1441 C CG  . MET A 1 177 ? 33.895 2.295   16.408  1.00 51.78 ? 300 MET A CG  1 
ATOM   1442 S SD  . MET A 1 177 ? 33.506 4.041   16.641  1.00 52.10 ? 300 MET A SD  1 
ATOM   1443 C CE  . MET A 1 177 ? 33.352 4.696   14.985  1.00 49.24 ? 300 MET A CE  1 
ATOM   1444 N N   . ILE A 1 178 ? 33.544 -0.651  19.925  1.00 52.33 ? 301 ILE A N   1 
ATOM   1445 C CA  . ILE A 1 178 ? 33.823 -1.231  21.252  1.00 52.01 ? 301 ILE A CA  1 
ATOM   1446 C C   . ILE A 1 178 ? 34.694 -2.490  21.161  1.00 52.41 ? 301 ILE A C   1 
ATOM   1447 O O   . ILE A 1 178 ? 35.622 -2.646  21.944  1.00 53.02 ? 301 ILE A O   1 
ATOM   1448 C CB  . ILE A 1 178 ? 32.540 -1.612  22.015  1.00 51.54 ? 301 ILE A CB  1 
ATOM   1449 C CG1 . ILE A 1 178 ? 31.525 -0.470  22.002  1.00 50.31 ? 301 ILE A CG1 1 
ATOM   1450 C CG2 . ILE A 1 178 ? 32.879 -2.105  23.435  1.00 49.59 ? 301 ILE A CG2 1 
ATOM   1451 C CD1 . ILE A 1 178 ? 31.913 0.698   22.830  1.00 48.28 ? 301 ILE A CD1 1 
ATOM   1452 N N   . GLU A 1 179 ? 34.377 -3.386  20.224  1.00 52.96 ? 302 GLU A N   1 
ATOM   1453 C CA  . GLU A 1 179 ? 35.044 -4.704  20.110  1.00 53.43 ? 302 GLU A CA  1 
ATOM   1454 C C   . GLU A 1 179 ? 36.341 -4.656  19.318  1.00 53.38 ? 302 GLU A C   1 
ATOM   1455 O O   . GLU A 1 179 ? 37.008 -5.679  19.159  1.00 53.98 ? 302 GLU A O   1 
ATOM   1456 C CB  . GLU A 1 179 ? 34.106 -5.711  19.449  1.00 53.10 ? 302 GLU A CB  1 
ATOM   1457 C CG  . GLU A 1 179 ? 32.927 -6.117  20.302  1.00 55.24 ? 302 GLU A CG  1 
ATOM   1458 C CD  . GLU A 1 179 ? 31.748 -6.547  19.463  1.00 60.27 ? 302 GLU A CD  1 
ATOM   1459 O OE1 . GLU A 1 179 ? 31.946 -6.819  18.251  1.00 63.92 ? 302 GLU A OE1 1 
ATOM   1460 O OE2 . GLU A 1 179 ? 30.612 -6.593  19.997  1.00 61.10 ? 302 GLU A OE2 1 
ATOM   1461 N N   . GLY A 1 180 ? 36.683 -3.482  18.798  1.00 53.46 ? 303 GLY A N   1 
ATOM   1462 C CA  . GLY A 1 180 ? 37.914 -3.296  18.034  1.00 54.12 ? 303 GLY A CA  1 
ATOM   1463 C C   . GLY A 1 180 ? 37.927 -4.026  16.699  1.00 54.51 ? 303 GLY A C   1 
ATOM   1464 O O   . GLY A 1 180 ? 38.963 -4.522  16.256  1.00 55.11 ? 303 GLY A O   1 
ATOM   1465 N N   . ARG A 1 181 ? 36.771 -4.102  16.063  1.00 54.99 ? 304 ARG A N   1 
ATOM   1466 C CA  . ARG A 1 181 ? 36.656 -4.623  14.709  1.00 55.83 ? 304 ARG A CA  1 
ATOM   1467 C C   . ARG A 1 181 ? 36.716 -3.410  13.779  1.00 55.65 ? 304 ARG A C   1 
ATOM   1468 O O   . ARG A 1 181 ? 36.580 -2.274  14.247  1.00 56.06 ? 304 ARG A O   1 
ATOM   1469 C CB  . ARG A 1 181 ? 35.307 -5.341  14.545  1.00 55.87 ? 304 ARG A CB  1 
ATOM   1470 C CG  . ARG A 1 181 ? 35.077 -6.467  15.539  1.00 57.12 ? 304 ARG A CG  1 
ATOM   1471 C CD  . ARG A 1 181 ? 33.625 -6.942  15.523  1.00 59.19 ? 304 ARG A CD  1 
ATOM   1472 N NE  . ARG A 1 181 ? 33.605 -8.343  15.980  1.00 67.74 ? 304 ARG A NE  1 
ATOM   1473 C CZ  . ARG A 1 181 ? 32.508 -9.093  16.098  1.00 69.70 ? 304 ARG A CZ  1 
ATOM   1474 N NH1 . ARG A 1 181 ? 31.298 -8.578  15.802  1.00 71.18 ? 304 ARG A NH1 1 
ATOM   1475 N NH2 . ARG A 1 181 ? 32.622 -10.360 16.519  1.00 69.65 ? 304 ARG A NH2 1 
ATOM   1476 N N   . MET A 1 182 ? 36.890 -3.626  12.475  1.00 55.12 ? 305 MET A N   1 
ATOM   1477 C CA  . MET A 1 182 ? 36.794 -2.511  11.528  1.00 55.05 ? 305 MET A CA  1 
ATOM   1478 C C   . MET A 1 182 ? 35.340 -2.028  11.395  1.00 53.94 ? 305 MET A C   1 
ATOM   1479 O O   . MET A 1 182 ? 34.386 -2.727  11.777  1.00 53.20 ? 305 MET A O   1 
ATOM   1480 C CB  . MET A 1 182 ? 37.367 -2.880  10.167  1.00 55.45 ? 305 MET A CB  1 
ATOM   1481 C CG  . MET A 1 182 ? 38.847 -3.240  10.210  1.00 56.11 ? 305 MET A CG  1 
ATOM   1482 S SD  . MET A 1 182 ? 39.423 -3.882  8.630   1.00 59.21 ? 305 MET A SD  1 
ATOM   1483 C CE  . MET A 1 182 ? 41.199 -4.148  8.944   1.00 58.44 ? 305 MET A CE  1 
ATOM   1484 N N   . HIS A 1 183 ? 35.168 -0.816  10.878  1.00 52.05 ? 306 HIS A N   1 
ATOM   1485 C CA  . HIS A 1 183 ? 33.837 -0.277  10.793  1.00 49.87 ? 306 HIS A CA  1 
ATOM   1486 C C   . HIS A 1 183 ? 33.626 0.430   9.462   1.00 49.02 ? 306 HIS A C   1 
ATOM   1487 O O   . HIS A 1 183 ? 34.593 0.733   8.765   1.00 47.80 ? 306 HIS A O   1 
ATOM   1488 C CB  . HIS A 1 183 ? 33.568 0.630   12.013  1.00 50.15 ? 306 HIS A CB  1 
ATOM   1489 C CG  . HIS A 1 183 ? 34.272 1.957   11.972  1.00 47.90 ? 306 HIS A CG  1 
ATOM   1490 N ND1 . HIS A 1 183 ? 35.347 2.250   12.782  1.00 45.90 ? 306 HIS A ND1 1 
ATOM   1491 C CD2 . HIS A 1 183 ? 34.035 3.074   11.238  1.00 47.46 ? 306 HIS A CD2 1 
ATOM   1492 C CE1 . HIS A 1 183 ? 35.743 3.488   12.550  1.00 46.81 ? 306 HIS A CE1 1 
ATOM   1493 N NE2 . HIS A 1 183 ? 34.958 4.014   11.627  1.00 47.28 ? 306 HIS A NE2 1 
ATOM   1494 N N   . ASP A 1 184 ? 32.358 0.653   9.115   1.00 48.20 ? 307 ASP A N   1 
ATOM   1495 C CA  . ASP A 1 184 ? 31.970 1.262   7.843   1.00 48.82 ? 307 ASP A CA  1 
ATOM   1496 C C   . ASP A 1 184 ? 30.890 2.271   8.139   1.00 48.44 ? 307 ASP A C   1 
ATOM   1497 O O   . ASP A 1 184 ? 30.703 2.613   9.285   1.00 48.56 ? 307 ASP A O   1 
ATOM   1498 C CB  . ASP A 1 184 ? 31.507 0.210   6.804   1.00 49.45 ? 307 ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 184 ? 30.063 -0.329  7.049   1.00 53.03 ? 307 ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 184 ? 29.436 -0.096  8.135   1.00 55.65 ? 307 ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 184 ? 29.537 -1.012  6.138   1.00 55.71 ? 307 ASP A OD2 1 
ATOM   1502 N N   . GLU A 1 185 ? 30.175 2.730   7.121   1.00 48.69 ? 308 GLU A N   1 
ATOM   1503 C CA  . GLU A 1 185 ? 29.128 3.716   7.290   1.00 50.60 ? 308 GLU A CA  1 
ATOM   1504 C C   . GLU A 1 185 ? 27.954 3.320   8.167   1.00 50.24 ? 308 GLU A C   1 
ATOM   1505 O O   . GLU A 1 185 ? 27.199 4.192   8.557   1.00 50.51 ? 308 GLU A O   1 
ATOM   1506 C CB  . GLU A 1 185 ? 28.600 4.214   5.939   1.00 50.73 ? 308 GLU A CB  1 
ATOM   1507 C CG  . GLU A 1 185 ? 28.374 3.165   4.869   1.00 54.39 ? 308 GLU A CG  1 
ATOM   1508 C CD  . GLU A 1 185 ? 27.468 3.676   3.750   1.00 57.54 ? 308 GLU A CD  1 
ATOM   1509 O OE1 . GLU A 1 185 ? 27.963 3.937   2.628   1.00 63.21 ? 308 GLU A OE1 1 
ATOM   1510 O OE2 . GLU A 1 185 ? 26.244 3.830   3.988   1.00 64.65 ? 308 GLU A OE2 1 
ATOM   1511 N N   . LYS A 1 186 ? 27.800 2.036   8.492   1.00 50.75 ? 309 LYS A N   1 
ATOM   1512 C CA  . LYS A 1 186 ? 26.647 1.529   9.327   1.00 50.98 ? 309 LYS A CA  1 
ATOM   1513 C C   . LYS A 1 186 ? 26.702 1.965   10.786  1.00 50.82 ? 309 LYS A C   1 
ATOM   1514 O O   . LYS A 1 186 ? 25.707 1.862   11.520  1.00 51.66 ? 309 LYS A O   1 
ATOM   1515 C CB  . LYS A 1 186 ? 26.511 -0.007  9.272   1.00 51.07 ? 309 LYS A CB  1 
ATOM   1516 C CG  . LYS A 1 186 ? 26.373 -0.592  7.870   1.00 52.36 ? 309 LYS A CG  1 
ATOM   1517 C CD  . LYS A 1 186 ? 25.285 0.146   7.070   1.00 55.35 ? 309 LYS A CD  1 
ATOM   1518 C CE  . LYS A 1 186 ? 23.863 -0.314  7.454   1.00 56.47 ? 309 LYS A CE  1 
ATOM   1519 N NZ  . LYS A 1 186 ? 23.510 -1.547  6.676   1.00 53.86 ? 309 LYS A NZ  1 
ATOM   1520 N N   . VAL A 1 187 ? 27.864 2.458   11.208  1.00 49.88 ? 310 VAL A N   1 
ATOM   1521 C CA  . VAL A 1 187 ? 27.979 3.099   12.521  1.00 48.73 ? 310 VAL A CA  1 
ATOM   1522 C C   . VAL A 1 187 ? 26.970 4.237   12.712  1.00 48.68 ? 310 VAL A C   1 
ATOM   1523 O O   . VAL A 1 187 ? 26.376 4.339   13.772  1.00 48.49 ? 310 VAL A O   1 
ATOM   1524 C CB  . VAL A 1 187 ? 29.405 3.575   12.773  1.00 48.52 ? 310 VAL A CB  1 
ATOM   1525 C CG1 . VAL A 1 187 ? 30.388 2.360   12.672  1.00 48.45 ? 310 VAL A CG1 1 
ATOM   1526 C CG2 . VAL A 1 187 ? 29.785 4.694   11.783  1.00 47.00 ? 310 VAL A CG2 1 
ATOM   1527 N N   . ASP A 1 188 ? 26.763 5.055   11.670  1.00 48.55 ? 311 ASP A N   1 
ATOM   1528 C CA  . ASP A 1 188 ? 25.840 6.185   11.682  1.00 48.56 ? 311 ASP A CA  1 
ATOM   1529 C C   . ASP A 1 188 ? 24.371 5.720   11.877  1.00 48.98 ? 311 ASP A C   1 
ATOM   1530 O O   . ASP A 1 188 ? 23.534 6.459   12.391  1.00 47.87 ? 311 ASP A O   1 
ATOM   1531 C CB  . ASP A 1 188 ? 25.973 7.017   10.386  1.00 48.31 ? 311 ASP A CB  1 
ATOM   1532 C CG  . ASP A 1 188 ? 27.252 7.904   10.355  1.00 50.29 ? 311 ASP A CG  1 
ATOM   1533 O OD1 . ASP A 1 188 ? 27.839 8.253   11.423  1.00 51.15 ? 311 ASP A OD1 1 
ATOM   1534 O OD2 . ASP A 1 188 ? 27.671 8.275   9.232   1.00 50.60 ? 311 ASP A OD2 1 
ATOM   1535 N N   . LEU A 1 189 ? 24.093 4.478   11.493  1.00 49.67 ? 312 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 189 ? 22.766 3.923   11.628  1.00 50.90 ? 312 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 189 ? 22.541 3.530   13.076  1.00 51.20 ? 312 LEU A C   1 
ATOM   1538 O O   . LEU A 1 189 ? 21.446 3.733   13.640  1.00 51.60 ? 312 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 189 ? 22.574 2.712   10.681  1.00 51.24 ? 312 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 189 ? 22.114 3.017   9.247   1.00 51.65 ? 312 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 189 ? 20.689 3.504   9.228   1.00 52.56 ? 312 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 189 ? 23.049 4.057   8.524   1.00 50.97 ? 312 LEU A CD2 1 
ATOM   1543 N N   . TRP A 1 190 ? 23.591 2.969   13.670  1.00 50.34 ? 313 TRP A N   1 
ATOM   1544 C CA  . TRP A 1 190 ? 23.567 2.628   15.054  1.00 49.50 ? 313 TRP A CA  1 
ATOM   1545 C C   . TRP A 1 190 ? 23.293 3.920   15.856  1.00 49.67 ? 313 TRP A C   1 
ATOM   1546 O O   . TRP A 1 190 ? 22.352 3.995   16.612  1.00 49.13 ? 313 TRP A O   1 
ATOM   1547 C CB  . TRP A 1 190 ? 24.907 2.032   15.469  1.00 48.25 ? 313 TRP A CB  1 
ATOM   1548 C CG  . TRP A 1 190 ? 25.005 1.878   16.972  1.00 47.87 ? 313 TRP A CG  1 
ATOM   1549 C CD1 . TRP A 1 190 ? 25.467 2.798   17.848  1.00 47.98 ? 313 TRP A CD1 1 
ATOM   1550 C CD2 . TRP A 1 190 ? 24.613 0.744   17.747  1.00 46.50 ? 313 TRP A CD2 1 
ATOM   1551 N NE1 . TRP A 1 190 ? 25.422 2.313   19.126  1.00 47.52 ? 313 TRP A NE1 1 
ATOM   1552 C CE2 . TRP A 1 190 ? 24.877 1.057   19.101  1.00 47.02 ? 313 TRP A CE2 1 
ATOM   1553 C CE3 . TRP A 1 190 ? 24.076 -0.521  17.430  1.00 46.83 ? 313 TRP A CE3 1 
ATOM   1554 C CZ2 . TRP A 1 190 ? 24.639 0.144   20.158  1.00 45.93 ? 313 TRP A CZ2 1 
ATOM   1555 C CZ3 . TRP A 1 190 ? 23.824 -1.430  18.488  1.00 46.03 ? 313 TRP A CZ3 1 
ATOM   1556 C CH2 . TRP A 1 190 ? 24.099 -1.078  19.834  1.00 45.95 ? 313 TRP A CH2 1 
ATOM   1557 N N   . SER A 1 191 ? 24.145 4.920   15.695  1.00 50.64 ? 314 SER A N   1 
ATOM   1558 C CA  . SER A 1 191 ? 24.021 6.149   16.499  1.00 51.70 ? 314 SER A CA  1 
ATOM   1559 C C   . SER A 1 191 ? 22.712 6.855   16.282  1.00 52.09 ? 314 SER A C   1 
ATOM   1560 O O   . SER A 1 191 ? 22.225 7.538   17.156  1.00 52.82 ? 314 SER A O   1 
ATOM   1561 C CB  . SER A 1 191 ? 25.185 7.050   16.212  1.00 50.81 ? 314 SER A CB  1 
ATOM   1562 O OG  . SER A 1 191 ? 26.318 6.288   16.553  1.00 51.67 ? 314 SER A OG  1 
ATOM   1563 N N   . LEU A 1 192 ? 22.158 6.690   15.081  1.00 53.52 ? 315 LEU A N   1 
ATOM   1564 C CA  . LEU A 1 192 ? 20.817 7.183   14.747  1.00 52.81 ? 315 LEU A CA  1 
ATOM   1565 C C   . LEU A 1 192 ? 19.748 6.547   15.627  1.00 51.99 ? 315 LEU A C   1 
ATOM   1566 O O   . LEU A 1 192 ? 18.823 7.237   16.100  1.00 51.66 ? 315 LEU A O   1 
ATOM   1567 C CB  . LEU A 1 192 ? 20.506 6.914   13.273  1.00 52.91 ? 315 LEU A CB  1 
ATOM   1568 C CG  . LEU A 1 192 ? 19.206 7.552   12.762  1.00 53.48 ? 315 LEU A CG  1 
ATOM   1569 C CD1 . LEU A 1 192 ? 19.143 9.070   13.046  1.00 52.02 ? 315 LEU A CD1 1 
ATOM   1570 C CD2 . LEU A 1 192 ? 19.059 7.283   11.289  1.00 52.20 ? 315 LEU A CD2 1 
ATOM   1571 N N   . GLY A 1 193 ? 19.878 5.236   15.845  1.00 50.45 ? 316 GLY A N   1 
ATOM   1572 C CA  . GLY A 1 193 ? 18.964 4.530   16.724  1.00 49.73 ? 316 GLY A CA  1 
ATOM   1573 C C   . GLY A 1 193 ? 19.128 4.973   18.168  1.00 49.91 ? 316 GLY A C   1 
ATOM   1574 O O   . GLY A 1 193 ? 18.121 5.145   18.883  1.00 50.91 ? 316 GLY A O   1 
ATOM   1575 N N   . VAL A 1 194 ? 20.378 5.172   18.600  1.00 48.34 ? 317 VAL A N   1 
ATOM   1576 C CA  . VAL A 1 194 ? 20.658 5.635   19.944  1.00 48.32 ? 317 VAL A CA  1 
ATOM   1577 C C   . VAL A 1 194 ? 20.011 7.013   20.149  1.00 48.97 ? 317 VAL A C   1 
ATOM   1578 O O   . VAL A 1 194 ? 19.339 7.286   21.172  1.00 49.34 ? 317 VAL A O   1 
ATOM   1579 C CB  . VAL A 1 194 ? 22.219 5.731   20.220  1.00 48.32 ? 317 VAL A CB  1 
ATOM   1580 C CG1 . VAL A 1 194 ? 22.466 6.496   21.477  1.00 46.96 ? 317 VAL A CG1 1 
ATOM   1581 C CG2 . VAL A 1 194 ? 22.870 4.354   20.326  1.00 45.58 ? 317 VAL A CG2 1 
ATOM   1582 N N   . LEU A 1 195 ? 20.221 7.884   19.168  1.00 49.17 ? 318 LEU A N   1 
ATOM   1583 C CA  . LEU A 1 195 ? 19.644 9.221   19.169  1.00 49.68 ? 318 LEU A CA  1 
ATOM   1584 C C   . LEU A 1 195 ? 18.074 9.221   19.204  1.00 48.80 ? 318 LEU A C   1 
ATOM   1585 O O   . LEU A 1 195 ? 17.460 10.007  19.924  1.00 48.10 ? 318 LEU A O   1 
ATOM   1586 C CB  . LEU A 1 195 ? 20.194 9.993   17.952  1.00 49.92 ? 318 LEU A CB  1 
ATOM   1587 C CG  . LEU A 1 195 ? 19.681 11.427  17.781  1.00 51.20 ? 318 LEU A CG  1 
ATOM   1588 C CD1 . LEU A 1 195 ? 20.547 12.373  18.528  1.00 50.22 ? 318 LEU A CD1 1 
ATOM   1589 C CD2 . LEU A 1 195 ? 19.605 11.835  16.305  1.00 51.92 ? 318 LEU A CD2 1 
ATOM   1590 N N   . CYS A 1 196 ? 17.441 8.341   18.424  1.00 48.69 ? 319 CYS A N   1 
ATOM   1591 C CA  . CYS A 1 196 ? 15.981 8.337   18.302  1.00 48.15 ? 319 CYS A CA  1 
ATOM   1592 C C   . CYS A 1 196 ? 15.394 7.943   19.633  1.00 48.56 ? 319 CYS A C   1 
ATOM   1593 O O   . CYS A 1 196 ? 14.385 8.492   20.059  1.00 48.86 ? 319 CYS A O   1 
ATOM   1594 C CB  . CYS A 1 196 ? 15.512 7.411   17.178  1.00 48.29 ? 319 CYS A CB  1 
ATOM   1595 S SG  . CYS A 1 196 ? 13.731 7.350   16.991  1.00 51.08 ? 319 CYS A SG  1 
ATOM   1596 N N   . TYR A 1 197 ? 16.094 7.036   20.314  1.00 49.12 ? 320 TYR A N   1 
ATOM   1597 C CA  . TYR A 1 197 ? 15.826 6.656   21.701  1.00 49.51 ? 320 TYR A CA  1 
ATOM   1598 C C   . TYR A 1 197 ? 16.007 7.775   22.749  1.00 49.37 ? 320 TYR A C   1 
ATOM   1599 O O   . TYR A 1 197 ? 15.176 7.954   23.615  1.00 50.30 ? 320 TYR A O   1 
ATOM   1600 C CB  . TYR A 1 197 ? 16.684 5.415   22.054  1.00 48.81 ? 320 TYR A CB  1 
ATOM   1601 C CG  . TYR A 1 197 ? 16.422 4.857   23.439  1.00 49.72 ? 320 TYR A CG  1 
ATOM   1602 C CD1 . TYR A 1 197 ? 16.896 5.506   24.572  1.00 48.19 ? 320 TYR A CD1 1 
ATOM   1603 C CD2 . TYR A 1 197 ? 15.700 3.666   23.625  1.00 50.54 ? 320 TYR A CD2 1 
ATOM   1604 C CE1 . TYR A 1 197 ? 16.646 5.011   25.850  1.00 49.50 ? 320 TYR A CE1 1 
ATOM   1605 C CE2 . TYR A 1 197 ? 15.463 3.156   24.910  1.00 48.39 ? 320 TYR A CE2 1 
ATOM   1606 C CZ  . TYR A 1 197 ? 15.924 3.842   26.012  1.00 49.03 ? 320 TYR A CZ  1 
ATOM   1607 O OH  . TYR A 1 197 ? 15.725 3.360   27.278  1.00 48.79 ? 320 TYR A OH  1 
ATOM   1608 N N   . GLU A 1 198 ? 17.112 8.502   22.693  1.00 50.37 ? 321 GLU A N   1 
ATOM   1609 C CA  . GLU A 1 198 ? 17.360 9.604   23.623  1.00 50.58 ? 321 GLU A CA  1 
ATOM   1610 C C   . GLU A 1 198 ? 16.309 10.715  23.420  1.00 51.05 ? 321 GLU A C   1 
ATOM   1611 O O   . GLU A 1 198 ? 15.816 11.306  24.399  1.00 50.52 ? 321 GLU A O   1 
ATOM   1612 C CB  . GLU A 1 198 ? 18.779 10.154  23.441  1.00 50.77 ? 321 GLU A CB  1 
ATOM   1613 C CG  . GLU A 1 198 ? 18.943 11.475  24.087  1.00 51.52 ? 321 GLU A CG  1 
ATOM   1614 C CD  . GLU A 1 198 ? 20.334 11.728  24.598  1.00 56.15 ? 321 GLU A CD  1 
ATOM   1615 O OE1 . GLU A 1 198 ? 21.307 11.344  23.924  1.00 59.02 ? 321 GLU A OE1 1 
ATOM   1616 O OE2 . GLU A 1 198 ? 20.462 12.345  25.680  1.00 58.12 ? 321 GLU A OE2 1 
ATOM   1617 N N   . PHE A 1 199 ? 15.982 10.989  22.148  1.00 51.22 ? 322 PHE A N   1 
ATOM   1618 C CA  . PHE A 1 199 ? 14.886 11.924  21.793  1.00 51.62 ? 322 PHE A CA  1 
ATOM   1619 C C   . PHE A 1 199 ? 13.566 11.644  22.528  1.00 51.66 ? 322 PHE A C   1 
ATOM   1620 O O   . PHE A 1 199 ? 12.941 12.556  23.070  1.00 52.49 ? 322 PHE A O   1 
ATOM   1621 C CB  . PHE A 1 199 ? 14.635 11.941  20.269  1.00 50.51 ? 322 PHE A CB  1 
ATOM   1622 C CG  . PHE A 1 199 ? 15.662 12.735  19.499  1.00 51.93 ? 322 PHE A CG  1 
ATOM   1623 C CD1 . PHE A 1 199 ? 16.636 13.510  20.178  1.00 48.55 ? 322 PHE A CD1 1 
ATOM   1624 C CD2 . PHE A 1 199 ? 15.663 12.737  18.096  1.00 53.32 ? 322 PHE A CD2 1 
ATOM   1625 C CE1 . PHE A 1 199 ? 17.587 14.260  19.494  1.00 46.30 ? 322 PHE A CE1 1 
ATOM   1626 C CE2 . PHE A 1 199 ? 16.630 13.502  17.387  1.00 50.54 ? 322 PHE A CE2 1 
ATOM   1627 C CZ  . PHE A 1 199 ? 17.602 14.272  18.117  1.00 49.19 ? 322 PHE A CZ  1 
ATOM   1628 N N   . LEU A 1 200 ? 13.152 10.384  22.548  1.00 51.35 ? 323 LEU A N   1 
ATOM   1629 C CA  . LEU A 1 200 ? 11.838 10.033  23.077  1.00 51.47 ? 323 LEU A CA  1 
ATOM   1630 C C   . LEU A 1 200 ? 11.873 9.760   24.563  1.00 50.78 ? 323 LEU A C   1 
ATOM   1631 O O   . LEU A 1 200 ? 10.863 9.886   25.226  1.00 52.08 ? 323 LEU A O   1 
ATOM   1632 C CB  . LEU A 1 200 ? 11.271 8.784   22.387  1.00 51.77 ? 323 LEU A CB  1 
ATOM   1633 C CG  . LEU A 1 200 ? 11.023 8.936   20.899  1.00 51.70 ? 323 LEU A CG  1 
ATOM   1634 C CD1 . LEU A 1 200 ? 10.926 7.562   20.248  1.00 50.18 ? 323 LEU A CD1 1 
ATOM   1635 C CD2 . LEU A 1 200 ? 9.765  9.805   20.667  1.00 51.07 ? 323 LEU A CD2 1 
ATOM   1636 N N   . VAL A 1 201 ? 13.020 9.379   25.082  1.00 49.42 ? 324 VAL A N   1 
ATOM   1637 C CA  . VAL A 1 201 ? 13.086 8.992   26.461  1.00 48.67 ? 324 VAL A CA  1 
ATOM   1638 C C   . VAL A 1 201 ? 13.806 10.030  27.330  1.00 49.64 ? 324 VAL A C   1 
ATOM   1639 O O   . VAL A 1 201 ? 13.536 10.135  28.529  1.00 49.00 ? 324 VAL A O   1 
ATOM   1640 C CB  . VAL A 1 201 ? 13.736 7.585   26.595  1.00 48.60 ? 324 VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 201 ? 13.965 7.196   28.068  1.00 46.61 ? 324 VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 201 ? 12.901 6.524   25.842  1.00 47.02 ? 324 VAL A CG2 1 
ATOM   1643 N N   . GLY A 1 202 ? 14.722 10.789  26.733  1.00 49.46 ? 325 GLY A N   1 
ATOM   1644 C CA  . GLY A 1 202 ? 15.432 11.786  27.495  1.00 51.01 ? 325 GLY A CA  1 
ATOM   1645 C C   . GLY A 1 202 ? 16.816 11.341  27.945  1.00 51.12 ? 325 GLY A C   1 
ATOM   1646 O O   . GLY A 1 202 ? 17.610 12.161  28.377  1.00 51.57 ? 325 GLY A O   1 
ATOM   1647 N N   . LYS A 1 203 ? 17.093 10.044  27.861  1.00 51.33 ? 326 LYS A N   1 
ATOM   1648 C CA  . LYS A 1 203 ? 18.439 9.535   28.113  1.00 51.85 ? 326 LYS A CA  1 
ATOM   1649 C C   . LYS A 1 203 ? 18.819 8.430   27.113  1.00 50.91 ? 326 LYS A C   1 
ATOM   1650 O O   . LYS A 1 203 ? 17.945 7.823   26.517  1.00 50.95 ? 326 LYS A O   1 
ATOM   1651 C CB  . LYS A 1 203 ? 18.627 9.133   29.573  1.00 52.13 ? 326 LYS A CB  1 
ATOM   1652 C CG  . LYS A 1 203 ? 17.704 8.076   30.057  1.00 55.59 ? 326 LYS A CG  1 
ATOM   1653 C CD  . LYS A 1 203 ? 17.644 8.076   31.592  1.00 60.78 ? 326 LYS A CD  1 
ATOM   1654 C CE  . LYS A 1 203 ? 16.780 6.941   32.109  1.00 65.64 ? 326 LYS A CE  1 
ATOM   1655 N NZ  . LYS A 1 203 ? 15.377 6.987   31.475  1.00 70.06 ? 326 LYS A NZ  1 
ATOM   1656 N N   . PRO A 1 204 ? 20.119 8.268   26.824  1.00 50.73 ? 327 PRO A N   1 
ATOM   1657 C CA  . PRO A 1 204 ? 20.454 7.212   25.846  1.00 50.30 ? 327 PRO A CA  1 
ATOM   1658 C C   . PRO A 1 204 ? 20.256 5.789   26.428  1.00 49.04 ? 327 PRO A C   1 
ATOM   1659 O O   . PRO A 1 204 ? 20.181 5.635   27.638  1.00 49.11 ? 327 PRO A O   1 
ATOM   1660 C CB  . PRO A 1 204 ? 21.920 7.521   25.486  1.00 50.50 ? 327 PRO A CB  1 
ATOM   1661 C CG  . PRO A 1 204 ? 22.485 8.211   26.710  1.00 49.52 ? 327 PRO A CG  1 
ATOM   1662 C CD  . PRO A 1 204 ? 21.318 9.025   27.257  1.00 50.51 ? 327 PRO A CD  1 
ATOM   1663 N N   . PRO A 1 205 ? 20.124 4.780   25.558  1.00 47.97 ? 328 PRO A N   1 
ATOM   1664 C CA  . PRO A 1 205 ? 19.740 3.439   26.012  1.00 47.84 ? 328 PRO A CA  1 
ATOM   1665 C C   . PRO A 1 205 ? 20.799 2.636   26.783  1.00 47.69 ? 328 PRO A C   1 
ATOM   1666 O O   . PRO A 1 205 ? 20.427 1.717   27.479  1.00 48.16 ? 328 PRO A O   1 
ATOM   1667 C CB  . PRO A 1 205 ? 19.329 2.716   24.723  1.00 46.66 ? 328 PRO A CB  1 
ATOM   1668 C CG  . PRO A 1 205 ? 20.021 3.419   23.654  1.00 47.69 ? 328 PRO A CG  1 
ATOM   1669 C CD  . PRO A 1 205 ? 20.290 4.846   24.094  1.00 47.72 ? 328 PRO A CD  1 
ATOM   1670 N N   . PHE A 1 206 ? 22.080 2.982   26.681  1.00 47.38 ? 329 PHE A N   1 
ATOM   1671 C CA  . PHE A 1 206 ? 23.123 2.160   27.298  1.00 47.36 ? 329 PHE A CA  1 
ATOM   1672 C C   . PHE A 1 206 ? 23.890 2.837   28.448  1.00 48.68 ? 329 PHE A C   1 
ATOM   1673 O O   . PHE A 1 206 ? 25.006 2.444   28.793  1.00 48.26 ? 329 PHE A O   1 
ATOM   1674 C CB  . PHE A 1 206 ? 24.071 1.628   26.248  1.00 46.33 ? 329 PHE A CB  1 
ATOM   1675 C CG  . PHE A 1 206 ? 23.382 0.890   25.118  1.00 44.37 ? 329 PHE A CG  1 
ATOM   1676 C CD1 . PHE A 1 206 ? 22.925 -0.402  25.292  1.00 40.16 ? 329 PHE A CD1 1 
ATOM   1677 C CD2 . PHE A 1 206 ? 23.234 1.488   23.884  1.00 44.69 ? 329 PHE A CD2 1 
ATOM   1678 C CE1 . PHE A 1 206 ? 22.346 -1.069  24.296  1.00 43.17 ? 329 PHE A CE1 1 
ATOM   1679 C CE2 . PHE A 1 206 ? 22.625 0.815   22.850  1.00 47.53 ? 329 PHE A CE2 1 
ATOM   1680 C CZ  . PHE A 1 206 ? 22.188 -0.474  23.046  1.00 46.01 ? 329 PHE A CZ  1 
ATOM   1681 N N   . GLU A 1 207 ? 23.233 3.825   29.060  1.00 49.68 ? 330 GLU A N   1 
ATOM   1682 C CA  . GLU A 1 207 ? 23.784 4.617   30.150  1.00 50.49 ? 330 GLU A CA  1 
ATOM   1683 C C   . GLU A 1 207 ? 24.081 3.790   31.375  1.00 51.19 ? 330 GLU A C   1 
ATOM   1684 O O   . GLU A 1 207 ? 23.278 2.980   31.811  1.00 50.68 ? 330 GLU A O   1 
ATOM   1685 C CB  . GLU A 1 207 ? 22.819 5.744   30.461  1.00 50.50 ? 330 GLU A CB  1 
ATOM   1686 C CG  . GLU A 1 207 ? 23.210 6.550   31.611  1.00 54.20 ? 330 GLU A CG  1 
ATOM   1687 C CD  . GLU A 1 207 ? 22.364 7.783   31.745  1.00 59.04 ? 330 GLU A CD  1 
ATOM   1688 O OE1 . GLU A 1 207 ? 22.796 8.802   31.146  1.00 61.25 ? 330 GLU A OE1 1 
ATOM   1689 O OE2 . GLU A 1 207 ? 21.283 7.730   32.430  1.00 59.46 ? 330 GLU A OE2 1 
ATOM   1690 N N   . ALA A 1 208 ? 25.293 3.955   31.886  1.00 53.62 ? 331 ALA A N   1 
ATOM   1691 C CA  . ALA A 1 208 ? 25.773 3.200   33.057  1.00 54.63 ? 331 ALA A CA  1 
ATOM   1692 C C   . ALA A 1 208 ? 26.588 4.130   33.970  1.00 56.02 ? 331 ALA A C   1 
ATOM   1693 O O   . ALA A 1 208 ? 26.925 5.268   33.602  1.00 55.53 ? 331 ALA A O   1 
ATOM   1694 C CB  . ALA A 1 208 ? 26.613 2.007   32.611  1.00 53.88 ? 331 ALA A CB  1 
ATOM   1695 N N   . ASN A 1 209 ? 26.933 3.634   35.151  1.00 57.83 ? 332 ASN A N   1 
ATOM   1696 C CA  . ASN A 1 209 ? 27.757 4.412   36.068  1.00 59.42 ? 332 ASN A CA  1 
ATOM   1697 C C   . ASN A 1 209 ? 29.180 4.556   35.567  1.00 59.84 ? 332 ASN A C   1 
ATOM   1698 O O   . ASN A 1 209 ? 29.747 5.669   35.578  1.00 60.20 ? 332 ASN A O   1 
ATOM   1699 C CB  . ASN A 1 209 ? 27.733 3.802   37.475  1.00 59.99 ? 332 ASN A CB  1 
ATOM   1700 C CG  . ASN A 1 209 ? 26.378 3.982   38.161  1.00 62.04 ? 332 ASN A CG  1 
ATOM   1701 O OD1 . ASN A 1 209 ? 25.787 5.079   38.141  1.00 63.26 ? 332 ASN A OD1 1 
ATOM   1702 N ND2 . ASN A 1 209 ? 25.874 2.901   38.766  1.00 63.32 ? 332 ASN A ND2 1 
ATOM   1703 N N   . THR A 1 210 ? 29.748 3.434   35.128  1.00 59.60 ? 333 THR A N   1 
ATOM   1704 C CA  . THR A 1 210 ? 31.133 3.397   34.684  1.00 59.34 ? 333 THR A CA  1 
ATOM   1705 C C   . THR A 1 210 ? 31.114 3.125   33.200  1.00 59.22 ? 333 THR A C   1 
ATOM   1706 O O   . THR A 1 210 ? 30.209 2.428   32.724  1.00 60.03 ? 333 THR A O   1 
ATOM   1707 C CB  . THR A 1 210 ? 31.923 2.270   35.385  1.00 59.50 ? 333 THR A CB  1 
ATOM   1708 O OG1 . THR A 1 210 ? 31.499 0.990   34.893  1.00 59.00 ? 333 THR A OG1 1 
ATOM   1709 C CG2 . THR A 1 210 ? 31.734 2.322   36.894  1.00 59.40 ? 333 THR A CG2 1 
ATOM   1710 N N   . TYR A 1 211 ? 32.087 3.663   32.464  1.00 58.51 ? 334 TYR A N   1 
ATOM   1711 C CA  . TYR A 1 211 ? 32.230 3.329   31.042  1.00 57.81 ? 334 TYR A CA  1 
ATOM   1712 C C   . TYR A 1 211 ? 32.410 1.820   30.777  1.00 57.45 ? 334 TYR A C   1 
ATOM   1713 O O   . TYR A 1 211 ? 31.846 1.290   29.827  1.00 56.80 ? 334 TYR A O   1 
ATOM   1714 C CB  . TYR A 1 211 ? 33.353 4.133   30.401  1.00 58.16 ? 334 TYR A CB  1 
ATOM   1715 C CG  . TYR A 1 211 ? 34.751 3.564   30.516  1.00 59.49 ? 334 TYR A CG  1 
ATOM   1716 C CD1 . TYR A 1 211 ? 35.687 4.131   31.387  1.00 60.64 ? 334 TYR A CD1 1 
ATOM   1717 C CD2 . TYR A 1 211 ? 35.165 2.487   29.708  1.00 60.96 ? 334 TYR A CD2 1 
ATOM   1718 C CE1 . TYR A 1 211 ? 37.000 3.634   31.468  1.00 60.19 ? 334 TYR A CE1 1 
ATOM   1719 C CE2 . TYR A 1 211 ? 36.469 1.978   29.789  1.00 60.17 ? 334 TYR A CE2 1 
ATOM   1720 C CZ  . TYR A 1 211 ? 37.376 2.558   30.667  1.00 59.89 ? 334 TYR A CZ  1 
ATOM   1721 O OH  . TYR A 1 211 ? 38.650 2.048   30.751  1.00 58.51 ? 334 TYR A OH  1 
ATOM   1722 N N   . GLN A 1 212 ? 33.175 1.136   31.632  1.00 57.21 ? 335 GLN A N   1 
ATOM   1723 C CA  . GLN A 1 212 ? 33.340 -0.310  31.546  1.00 57.14 ? 335 GLN A CA  1 
ATOM   1724 C C   . GLN A 1 212 ? 31.948 -0.935  31.319  1.00 56.72 ? 335 GLN A C   1 
ATOM   1725 O O   . GLN A 1 212 ? 31.726 -1.697  30.370  1.00 55.98 ? 335 GLN A O   1 
ATOM   1726 C CB  . GLN A 1 212 ? 33.962 -0.855  32.845  1.00 57.65 ? 335 GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 212 ? 35.433 -0.459  33.158  1.00 59.84 ? 335 GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 212 ? 35.655 1.026   33.550  1.00 63.28 ? 335 GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 212 ? 34.764 1.712   34.079  1.00 64.63 ? 335 GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 212 ? 36.868 1.515   33.291  1.00 63.95 ? 335 GLN A NE2 1 
ATOM   1731 N N   . GLU A 1 213 ? 31.004 -0.565  32.179  1.00 56.30 ? 336 GLU A N   1 
ATOM   1732 C CA  . GLU A 1 213 ? 29.690 -1.185  32.186  1.00 56.44 ? 336 GLU A CA  1 
ATOM   1733 C C   . GLU A 1 213 ? 28.836 -0.799  30.959  1.00 55.05 ? 336 GLU A C   1 
ATOM   1734 O O   . GLU A 1 213 ? 28.077 -1.624  30.439  1.00 54.56 ? 336 GLU A O   1 
ATOM   1735 C CB  . GLU A 1 213 ? 28.998 -0.878  33.502  1.00 57.16 ? 336 GLU A CB  1 
ATOM   1736 C CG  . GLU A 1 213 ? 27.731 -1.675  33.746  1.00 62.32 ? 336 GLU A CG  1 
ATOM   1737 C CD  . GLU A 1 213 ? 27.967 -3.187  33.817  1.00 69.26 ? 336 GLU A CD  1 
ATOM   1738 O OE1 . GLU A 1 213 ? 27.096 -3.921  33.276  1.00 72.71 ? 336 GLU A OE1 1 
ATOM   1739 O OE2 . GLU A 1 213 ? 28.992 -3.648  34.413  1.00 71.12 ? 336 GLU A OE2 1 
ATOM   1740 N N   . THR A 1 214 ? 29.012 0.429   30.462  1.00 53.66 ? 337 THR A N   1 
ATOM   1741 C CA  . THR A 1 214 ? 28.330 0.887   29.246  1.00 52.13 ? 337 THR A CA  1 
ATOM   1742 C C   . THR A 1 214 ? 28.856 0.157   28.005  1.00 51.90 ? 337 THR A C   1 
ATOM   1743 O O   . THR A 1 214 ? 28.074 -0.346  27.206  1.00 51.30 ? 337 THR A O   1 
ATOM   1744 C CB  . THR A 1 214 ? 28.412 2.437   29.071  1.00 52.13 ? 337 THR A CB  1 
ATOM   1745 O OG1 . THR A 1 214 ? 27.711 3.100   30.146  1.00 53.10 ? 337 THR A OG1 1 
ATOM   1746 C CG2 . THR A 1 214 ? 27.840 2.879   27.706  1.00 49.47 ? 337 THR A CG2 1 
ATOM   1747 N N   . TYR A 1 215 ? 30.180 0.094   27.839  1.00 51.86 ? 338 TYR A N   1 
ATOM   1748 C CA  . TYR A 1 215 ? 30.784 -0.764  26.802  1.00 51.85 ? 338 TYR A CA  1 
ATOM   1749 C C   . TYR A 1 215 ? 30.104 -2.136  26.702  1.00 51.24 ? 338 TYR A C   1 
ATOM   1750 O O   . TYR A 1 215 ? 29.617 -2.520  25.634  1.00 50.38 ? 338 TYR A O   1 
ATOM   1751 C CB  . TYR A 1 215 ? 32.257 -0.972  27.095  1.00 53.13 ? 338 TYR A CB  1 
ATOM   1752 C CG  . TYR A 1 215 ? 33.156 0.142   26.629  1.00 54.39 ? 338 TYR A CG  1 
ATOM   1753 C CD1 . TYR A 1 215 ? 34.535 -0.038  26.622  1.00 54.64 ? 338 TYR A CD1 1 
ATOM   1754 C CD2 . TYR A 1 215 ? 32.634 1.372   26.172  1.00 54.62 ? 338 TYR A CD2 1 
ATOM   1755 C CE1 . TYR A 1 215 ? 35.403 0.970   26.179  1.00 57.98 ? 338 TYR A CE1 1 
ATOM   1756 C CE2 . TYR A 1 215 ? 33.495 2.399   25.719  1.00 56.60 ? 338 TYR A CE2 1 
ATOM   1757 C CZ  . TYR A 1 215 ? 34.891 2.183   25.729  1.00 56.93 ? 338 TYR A CZ  1 
ATOM   1758 O OH  . TYR A 1 215 ? 35.787 3.150   25.317  1.00 56.20 ? 338 TYR A OH  1 
ATOM   1759 N N   . LYS A 1 216 ? 30.066 -2.836  27.835  1.00 50.37 ? 339 LYS A N   1 
ATOM   1760 C CA  . LYS A 1 216 ? 29.477 -4.166  27.953  1.00 50.87 ? 339 LYS A CA  1 
ATOM   1761 C C   . LYS A 1 216 ? 27.999 -4.211  27.487  1.00 50.33 ? 339 LYS A C   1 
ATOM   1762 O O   . LYS A 1 216 ? 27.592 -5.122  26.759  1.00 49.44 ? 339 LYS A O   1 
ATOM   1763 C CB  . LYS A 1 216 ? 29.659 -4.677  29.395  1.00 50.66 ? 339 LYS A CB  1 
ATOM   1764 C CG  . LYS A 1 216 ? 29.233 -6.121  29.640  1.00 52.46 ? 339 LYS A CG  1 
ATOM   1765 C CD  . LYS A 1 216 ? 29.698 -6.659  31.013  1.00 52.17 ? 339 LYS A CD  1 
ATOM   1766 C CE  . LYS A 1 216 ? 28.691 -6.260  32.104  1.00 55.13 ? 339 LYS A CE  1 
ATOM   1767 N NZ  . LYS A 1 216 ? 29.085 -6.559  33.528  1.00 52.69 ? 339 LYS A NZ  1 
ATOM   1768 N N   . ARG A 1 217 ? 27.213 -3.210  27.871  1.00 50.18 ? 340 ARG A N   1 
ATOM   1769 C CA  . ARG A 1 217 ? 25.815 -3.197  27.500  1.00 50.10 ? 340 ARG A CA  1 
ATOM   1770 C C   . ARG A 1 217 ? 25.619 -2.918  26.024  1.00 49.81 ? 340 ARG A C   1 
ATOM   1771 O O   . ARG A 1 217 ? 24.698 -3.468  25.401  1.00 50.04 ? 340 ARG A O   1 
ATOM   1772 C CB  . ARG A 1 217 ? 25.044 -2.195  28.330  1.00 50.86 ? 340 ARG A CB  1 
ATOM   1773 C CG  . ARG A 1 217 ? 24.910 -2.589  29.771  1.00 54.00 ? 340 ARG A CG  1 
ATOM   1774 C CD  . ARG A 1 217 ? 24.563 -1.364  30.604  1.00 58.37 ? 340 ARG A CD  1 
ATOM   1775 N NE  . ARG A 1 217 ? 24.730 -1.640  32.035  1.00 62.34 ? 340 ARG A NE  1 
ATOM   1776 C CZ  . ARG A 1 217 ? 24.246 -0.876  33.017  1.00 59.67 ? 340 ARG A CZ  1 
ATOM   1777 N NH1 . ARG A 1 217 ? 23.556 0.230   32.727  1.00 55.81 ? 340 ARG A NH1 1 
ATOM   1778 N NH2 . ARG A 1 217 ? 24.465 -1.232  34.280  1.00 56.36 ? 340 ARG A NH2 1 
ATOM   1779 N N   . ILE A 1 218 ? 26.464 -2.053  25.464  1.00 48.79 ? 341 ILE A N   1 
ATOM   1780 C CA  . ILE A 1 218 ? 26.470 -1.796  24.022  1.00 47.36 ? 341 ILE A CA  1 
ATOM   1781 C C   . ILE A 1 218 ? 26.801 -3.081  23.240  1.00 46.85 ? 341 ILE A C   1 
ATOM   1782 O O   . ILE A 1 218 ? 26.114 -3.386  22.271  1.00 46.20 ? 341 ILE A O   1 
ATOM   1783 C CB  . ILE A 1 218 ? 27.482 -0.652  23.613  1.00 48.03 ? 341 ILE A CB  1 
ATOM   1784 C CG1 . ILE A 1 218 ? 27.081 0.710   24.216  1.00 47.95 ? 341 ILE A CG1 1 
ATOM   1785 C CG2 . ILE A 1 218 ? 27.685 -0.593  22.080  1.00 44.74 ? 341 ILE A CG2 1 
ATOM   1786 C CD1 . ILE A 1 218 ? 28.129 1.781   23.994  1.00 46.53 ? 341 ILE A CD1 1 
ATOM   1787 N N   . SER A 1 219 ? 27.841 -3.814  23.650  1.00 46.75 ? 342 SER A N   1 
ATOM   1788 C CA  . SER A 1 219 ? 28.199 -5.090  23.003  1.00 47.88 ? 342 SER A CA  1 
ATOM   1789 C C   . SER A 1 219 ? 27.137 -6.154  23.107  1.00 47.97 ? 342 SER A C   1 
ATOM   1790 O O   . SER A 1 219 ? 26.876 -6.857  22.141  1.00 48.80 ? 342 SER A O   1 
ATOM   1791 C CB  . SER A 1 219 ? 29.513 -5.656  23.524  1.00 47.13 ? 342 SER A CB  1 
ATOM   1792 O OG  . SER A 1 219 ? 30.509 -4.733  23.181  1.00 51.20 ? 342 SER A OG  1 
ATOM   1793 N N   . ARG A 1 220 ? 26.521 -6.289  24.270  1.00 48.70 ? 343 ARG A N   1 
ATOM   1794 C CA  . ARG A 1 220 ? 25.463 -7.279  24.433  1.00 48.91 ? 343 ARG A CA  1 
ATOM   1795 C C   . ARG A 1 220 ? 24.131 -6.719  23.930  1.00 48.96 ? 343 ARG A C   1 
ATOM   1796 O O   . ARG A 1 220 ? 23.129 -7.414  23.912  1.00 49.59 ? 343 ARG A O   1 
ATOM   1797 C CB  . ARG A 1 220 ? 25.357 -7.697  25.880  1.00 48.32 ? 343 ARG A CB  1 
ATOM   1798 C CG  . ARG A 1 220 ? 26.563 -8.464  26.455  1.00 51.50 ? 343 ARG A CG  1 
ATOM   1799 C CD  . ARG A 1 220 ? 26.314 -8.647  27.955  1.00 54.27 ? 343 ARG A CD  1 
ATOM   1800 N NE  . ARG A 1 220 ? 27.288 -9.458  28.679  1.00 57.38 ? 343 ARG A NE  1 
ATOM   1801 C CZ  . ARG A 1 220 ? 27.104 -9.904  29.929  1.00 58.93 ? 343 ARG A CZ  1 
ATOM   1802 N NH1 . ARG A 1 220 ? 25.981 -9.618  30.611  1.00 58.47 ? 343 ARG A NH1 1 
ATOM   1803 N NH2 . ARG A 1 220 ? 28.041 -10.645 30.505  1.00 58.89 ? 343 ARG A NH2 1 
ATOM   1804 N N   . VAL A 1 221 ? 24.131 -5.467  23.503  1.00 49.47 ? 344 VAL A N   1 
ATOM   1805 C CA  . VAL A 1 221 ? 22.895 -4.758  23.127  1.00 50.19 ? 344 VAL A CA  1 
ATOM   1806 C C   . VAL A 1 221 ? 21.834 -4.947  24.210  1.00 50.05 ? 344 VAL A C   1 
ATOM   1807 O O   . VAL A 1 221 ? 20.692 -5.354  23.948  1.00 50.06 ? 344 VAL A O   1 
ATOM   1808 C CB  . VAL A 1 221 ? 22.357 -5.164  21.708  1.00 50.74 ? 344 VAL A CB  1 
ATOM   1809 C CG1 . VAL A 1 221 ? 21.243 -4.215  21.259  1.00 51.81 ? 344 VAL A CG1 1 
ATOM   1810 C CG2 . VAL A 1 221 ? 23.474 -5.140  20.664  1.00 49.77 ? 344 VAL A CG2 1 
ATOM   1811 N N   . GLU A 1 222 ? 22.230 -4.655  25.439  1.00 49.83 ? 345 GLU A N   1 
ATOM   1812 C CA  . GLU A 1 222 ? 21.336 -4.780  26.553  1.00 50.25 ? 345 GLU A CA  1 
ATOM   1813 C C   . GLU A 1 222 ? 20.673 -3.437  26.827  1.00 50.33 ? 345 GLU A C   1 
ATOM   1814 O O   . GLU A 1 222 ? 21.311 -2.536  27.369  1.00 50.42 ? 345 GLU A O   1 
ATOM   1815 C CB  . GLU A 1 222 ? 22.079 -5.309  27.782  1.00 50.39 ? 345 GLU A CB  1 
ATOM   1816 C CG  . GLU A 1 222 ? 22.422 -6.787  27.697  1.00 51.37 ? 345 GLU A CG  1 
ATOM   1817 C CD  . GLU A 1 222 ? 23.439 -7.203  28.740  1.00 55.08 ? 345 GLU A CD  1 
ATOM   1818 O OE1 . GLU A 1 222 ? 24.086 -6.323  29.348  1.00 59.76 ? 345 GLU A OE1 1 
ATOM   1819 O OE2 . GLU A 1 222 ? 23.641 -8.423  28.937  1.00 57.77 ? 345 GLU A OE2 1 
ATOM   1820 N N   . PHE A 1 223 ? 19.404 -3.308  26.428  1.00 50.09 ? 346 PHE A N   1 
ATOM   1821 C CA  . PHE A 1 223 ? 18.616 -2.134  26.722  1.00 50.77 ? 346 PHE A CA  1 
ATOM   1822 C C   . PHE A 1 223 ? 17.121 -2.452  26.722  1.00 50.69 ? 346 PHE A C   1 
ATOM   1823 O O   . PHE A 1 223 ? 16.687 -3.477  26.210  1.00 50.55 ? 346 PHE A O   1 
ATOM   1824 C CB  . PHE A 1 223 ? 18.963 -0.990  25.742  1.00 52.00 ? 346 PHE A CB  1 
ATOM   1825 C CG  . PHE A 1 223 ? 18.259 -1.097  24.428  1.00 52.97 ? 346 PHE A CG  1 
ATOM   1826 C CD1 . PHE A 1 223 ? 17.190 -0.277  24.142  1.00 54.75 ? 346 PHE A CD1 1 
ATOM   1827 C CD2 . PHE A 1 223 ? 18.633 -2.050  23.503  1.00 53.41 ? 346 PHE A CD2 1 
ATOM   1828 C CE1 . PHE A 1 223 ? 16.512 -0.398  22.929  1.00 56.99 ? 346 PHE A CE1 1 
ATOM   1829 C CE2 . PHE A 1 223 ? 17.962 -2.183  22.305  1.00 53.46 ? 346 PHE A CE2 1 
ATOM   1830 C CZ  . PHE A 1 223 ? 16.909 -1.369  22.013  1.00 55.33 ? 346 PHE A CZ  1 
ATOM   1831 N N   . THR A 1 224 ? 16.334 -1.569  27.330  1.00 50.52 ? 347 THR A N   1 
ATOM   1832 C CA  . THR A 1 224 ? 14.888 -1.766  27.481  1.00 49.31 ? 347 THR A CA  1 
ATOM   1833 C C   . THR A 1 224 ? 14.165 -0.452  27.182  1.00 48.80 ? 347 THR A C   1 
ATOM   1834 O O   . THR A 1 224 ? 14.778 0.616   27.213  1.00 48.77 ? 347 THR A O   1 
ATOM   1835 C CB  . THR A 1 224 ? 14.521 -2.302  28.901  1.00 49.89 ? 347 THR A CB  1 
ATOM   1836 O OG1 . THR A 1 224 ? 14.880 -1.348  29.918  1.00 48.47 ? 347 THR A OG1 1 
ATOM   1837 C CG2 . THR A 1 224 ? 15.214 -3.659  29.197  1.00 49.67 ? 347 THR A CG2 1 
ATOM   1838 N N   . PHE A 1 225 ? 12.872 -0.526  26.887  1.00 48.31 ? 348 PHE A N   1 
ATOM   1839 C CA  . PHE A 1 225 ? 12.109 0.665   26.557  1.00 47.65 ? 348 PHE A CA  1 
ATOM   1840 C C   . PHE A 1 225 ? 11.192 0.961   27.727  1.00 48.59 ? 348 PHE A C   1 
ATOM   1841 O O   . PHE A 1 225 ? 10.753 0.025   28.369  1.00 48.59 ? 348 PHE A O   1 
ATOM   1842 C CB  . PHE A 1 225 ? 11.224 0.416   25.355  1.00 45.87 ? 348 PHE A CB  1 
ATOM   1843 C CG  . PHE A 1 225 ? 11.950 0.185   24.071  1.00 45.19 ? 348 PHE A CG  1 
ATOM   1844 C CD1 . PHE A 1 225 ? 12.055 -1.105  23.555  1.00 40.17 ? 348 PHE A CD1 1 
ATOM   1845 C CD2 . PHE A 1 225 ? 12.458 1.270   23.322  1.00 41.79 ? 348 PHE A CD2 1 
ATOM   1846 C CE1 . PHE A 1 225 ? 12.682 -1.320  22.348  1.00 42.74 ? 348 PHE A CE1 1 
ATOM   1847 C CE2 . PHE A 1 225 ? 13.094 1.063   22.115  1.00 42.54 ? 348 PHE A CE2 1 
ATOM   1848 C CZ  . PHE A 1 225 ? 13.211 -0.242  21.616  1.00 41.68 ? 348 PHE A CZ  1 
ATOM   1849 N N   . PRO A 1 226 ? 10.932 2.259   28.036  1.00 49.69 ? 349 PRO A N   1 
ATOM   1850 C CA  . PRO A 1 226 ? 9.855  2.679   28.964  1.00 50.28 ? 349 PRO A CA  1 
ATOM   1851 C C   . PRO A 1 226 ? 8.494  2.427   28.352  1.00 50.82 ? 349 PRO A C   1 
ATOM   1852 O O   . PRO A 1 226 ? 8.361  2.514   27.125  1.00 50.43 ? 349 PRO A O   1 
ATOM   1853 C CB  . PRO A 1 226 ? 10.057 4.193   29.083  1.00 50.08 ? 349 PRO A CB  1 
ATOM   1854 C CG  . PRO A 1 226 ? 11.478 4.426   28.701  1.00 50.45 ? 349 PRO A CG  1 
ATOM   1855 C CD  . PRO A 1 226 ? 11.721 3.421   27.592  1.00 50.48 ? 349 PRO A CD  1 
ATOM   1856 N N   . ASP A 1 227 ? 7.495  2.167   29.203  1.00 51.72 ? 350 ASP A N   1 
ATOM   1857 C CA  . ASP A 1 227 ? 6.146  1.807   28.760  1.00 52.42 ? 350 ASP A CA  1 
ATOM   1858 C C   . ASP A 1 227 ? 5.559  2.771   27.764  1.00 52.17 ? 350 ASP A C   1 
ATOM   1859 O O   . ASP A 1 227 ? 4.828  2.349   26.885  1.00 51.85 ? 350 ASP A O   1 
ATOM   1860 C CB  . ASP A 1 227 ? 5.188  1.673   29.931  1.00 53.82 ? 350 ASP A CB  1 
ATOM   1861 C CG  . ASP A 1 227 ? 5.535  0.499   30.840  1.00 57.98 ? 350 ASP A CG  1 
ATOM   1862 O OD1 . ASP A 1 227 ? 5.404  -0.691  30.427  1.00 63.33 ? 350 ASP A OD1 1 
ATOM   1863 O OD2 . ASP A 1 227 ? 5.931  0.772   31.997  1.00 63.05 ? 350 ASP A OD2 1 
ATOM   1864 N N   . PHE A 1 228 ? 5.897  4.055   27.881  1.00 52.31 ? 351 PHE A N   1 
ATOM   1865 C CA  . PHE A 1 228 ? 5.327  5.072   26.989  1.00 52.65 ? 351 PHE A CA  1 
ATOM   1866 C C   . PHE A 1 228 ? 5.810  4.982   25.549  1.00 52.97 ? 351 PHE A C   1 
ATOM   1867 O O   . PHE A 1 228 ? 5.214  5.616   24.664  1.00 53.58 ? 351 PHE A O   1 
ATOM   1868 C CB  . PHE A 1 228 ? 5.482  6.524   27.520  1.00 52.41 ? 351 PHE A CB  1 
ATOM   1869 C CG  . PHE A 1 228 ? 6.927  7.021   27.681  1.00 51.58 ? 351 PHE A CG  1 
ATOM   1870 C CD1 . PHE A 1 228 ? 7.568  6.953   28.926  1.00 49.48 ? 351 PHE A CD1 1 
ATOM   1871 C CD2 . PHE A 1 228 ? 7.584  7.646   26.629  1.00 50.32 ? 351 PHE A CD2 1 
ATOM   1872 C CE1 . PHE A 1 228 ? 8.838  7.443   29.107  1.00 48.80 ? 351 PHE A CE1 1 
ATOM   1873 C CE2 . PHE A 1 228 ? 8.881  8.145   26.785  1.00 51.45 ? 351 PHE A CE2 1 
ATOM   1874 C CZ  . PHE A 1 228 ? 9.516  8.033   28.033  1.00 52.36 ? 351 PHE A CZ  1 
ATOM   1875 N N   . VAL A 1 229 ? 6.896  4.243   25.304  1.00 52.37 ? 352 VAL A N   1 
ATOM   1876 C CA  . VAL A 1 229 ? 7.433  4.222   23.953  1.00 52.06 ? 352 VAL A CA  1 
ATOM   1877 C C   . VAL A 1 229 ? 6.508  3.371   23.096  1.00 51.90 ? 352 VAL A C   1 
ATOM   1878 O O   . VAL A 1 229 ? 6.160  2.264   23.481  1.00 51.75 ? 352 VAL A O   1 
ATOM   1879 C CB  . VAL A 1 229 ? 8.911  3.824   23.915  1.00 51.76 ? 352 VAL A CB  1 
ATOM   1880 C CG1 . VAL A 1 229 ? 9.353  3.480   22.497  1.00 52.95 ? 352 VAL A CG1 1 
ATOM   1881 C CG2 . VAL A 1 229 ? 9.743  4.971   24.433  1.00 51.30 ? 352 VAL A CG2 1 
ATOM   1882 N N   . THR A 1 230 ? 6.048  3.920   21.975  1.00 52.14 ? 353 THR A N   1 
ATOM   1883 C CA  . THR A 1 230 ? 5.039  3.212   21.179  1.00 52.50 ? 353 THR A CA  1 
ATOM   1884 C C   . THR A 1 230 ? 5.698  2.161   20.284  1.00 52.89 ? 353 THR A C   1 
ATOM   1885 O O   . THR A 1 230 ? 6.865  2.303   19.853  1.00 52.98 ? 353 THR A O   1 
ATOM   1886 C CB  . THR A 1 230 ? 4.145  4.175   20.330  1.00 52.38 ? 353 THR A CB  1 
ATOM   1887 O OG1 . THR A 1 230 ? 4.963  4.840   19.373  1.00 50.85 ? 353 THR A OG1 1 
ATOM   1888 C CG2 . THR A 1 230 ? 3.477  5.226   21.219  1.00 51.78 ? 353 THR A CG2 1 
ATOM   1889 N N   . GLU A 1 231 ? 4.923  1.128   19.997  1.00 52.85 ? 354 GLU A N   1 
ATOM   1890 C CA  . GLU A 1 231 ? 5.350  -0.020  19.200  1.00 53.60 ? 354 GLU A CA  1 
ATOM   1891 C C   . GLU A 1 231 ? 6.158  0.293   17.911  1.00 53.22 ? 354 GLU A C   1 
ATOM   1892 O O   . GLU A 1 231 ? 7.197  -0.358  17.656  1.00 52.71 ? 354 GLU A O   1 
ATOM   1893 C CB  . GLU A 1 231 ? 4.133  -0.891  18.875  1.00 53.59 ? 354 GLU A CB  1 
ATOM   1894 C CG  . GLU A 1 231 ? 4.525  -2.293  18.516  1.00 57.98 ? 354 GLU A CG  1 
ATOM   1895 C CD  . GLU A 1 231 ? 3.551  -2.959  17.572  1.00 64.45 ? 354 GLU A CD  1 
ATOM   1896 O OE1 . GLU A 1 231 ? 4.018  -3.620  16.606  1.00 68.32 ? 354 GLU A OE1 1 
ATOM   1897 O OE2 . GLU A 1 231 ? 2.316  -2.841  17.797  1.00 67.35 ? 354 GLU A OE2 1 
ATOM   1898 N N   . GLY A 1 232 ? 5.670  1.254   17.114  1.00 52.29 ? 355 GLY A N   1 
ATOM   1899 C CA  . GLY A 1 232 ? 6.372  1.725   15.919  1.00 52.47 ? 355 GLY A CA  1 
ATOM   1900 C C   . GLY A 1 232 ? 7.703  2.384   16.214  1.00 53.10 ? 355 GLY A C   1 
ATOM   1901 O O   . GLY A 1 232 ? 8.678  2.192   15.493  1.00 53.18 ? 355 GLY A O   1 
ATOM   1902 N N   . ALA A 1 233 ? 7.764  3.150   17.296  1.00 53.72 ? 356 ALA A N   1 
ATOM   1903 C CA  . ALA A 1 233 ? 9.051  3.675   17.763  1.00 53.59 ? 356 ALA A CA  1 
ATOM   1904 C C   . ALA A 1 233 ? 10.019 2.560   18.235  1.00 53.44 ? 356 ALA A C   1 
ATOM   1905 O O   . ALA A 1 233 ? 11.219 2.616   17.936  1.00 52.32 ? 356 ALA A O   1 
ATOM   1906 C CB  . ALA A 1 233 ? 8.845  4.726   18.850  1.00 52.99 ? 356 ALA A CB  1 
ATOM   1907 N N   . ARG A 1 234 ? 9.494  1.561   18.966  1.00 53.87 ? 357 ARG A N   1 
ATOM   1908 C CA  . ARG A 1 234 ? 10.303 0.394   19.375  1.00 53.73 ? 357 ARG A CA  1 
ATOM   1909 C C   . ARG A 1 234 ? 10.820 -0.341  18.140  1.00 53.83 ? 357 ARG A C   1 
ATOM   1910 O O   . ARG A 1 234 ? 11.999 -0.676  18.053  1.00 54.56 ? 357 ARG A O   1 
ATOM   1911 C CB  . ARG A 1 234 ? 9.510  -0.604  20.212  1.00 53.67 ? 357 ARG A CB  1 
ATOM   1912 C CG  . ARG A 1 234 ? 9.163  -0.220  21.601  1.00 53.19 ? 357 ARG A CG  1 
ATOM   1913 C CD  . ARG A 1 234 ? 8.515  -1.419  22.326  1.00 56.88 ? 357 ARG A CD  1 
ATOM   1914 N NE  . ARG A 1 234 ? 8.545  -1.154  23.762  1.00 63.15 ? 357 ARG A NE  1 
ATOM   1915 C CZ  . ARG A 1 234 ? 7.624  -0.433  24.407  1.00 66.51 ? 357 ARG A CZ  1 
ATOM   1916 N NH1 . ARG A 1 234 ? 6.558  0.034   23.751  1.00 69.02 ? 357 ARG A NH1 1 
ATOM   1917 N NH2 . ARG A 1 234 ? 7.743  -0.195  25.709  1.00 65.76 ? 357 ARG A NH2 1 
ATOM   1918 N N   . ASP A 1 235 ? 9.959  -0.575  17.162  1.00 53.80 ? 358 ASP A N   1 
ATOM   1919 C CA  . ASP A 1 235 ? 10.394 -1.325  15.992  1.00 54.13 ? 358 ASP A CA  1 
ATOM   1920 C C   . ASP A 1 235 ? 11.569 -0.629  15.300  1.00 54.06 ? 358 ASP A C   1 
ATOM   1921 O O   . ASP A 1 235 ? 12.607 -1.229  15.068  1.00 54.03 ? 358 ASP A O   1 
ATOM   1922 C CB  . ASP A 1 235 ? 9.256  -1.532  15.010  1.00 54.43 ? 358 ASP A CB  1 
ATOM   1923 C CG  . ASP A 1 235 ? 9.642  -2.464  13.898  1.00 56.39 ? 358 ASP A CG  1 
ATOM   1924 O OD1 . ASP A 1 235 ? 9.579  -3.678  14.134  1.00 58.27 ? 358 ASP A OD1 1 
ATOM   1925 O OD2 . ASP A 1 235 ? 10.044 -1.984  12.811  1.00 57.47 ? 358 ASP A OD2 1 
ATOM   1926 N N   . LEU A 1 236 ? 11.404 0.654   15.013  1.00 53.59 ? 359 LEU A N   1 
ATOM   1927 C CA  . LEU A 1 236 ? 12.422 1.423   14.366  1.00 52.89 ? 359 LEU A CA  1 
ATOM   1928 C C   . LEU A 1 236 ? 13.728 1.363   15.124  1.00 53.08 ? 359 LEU A C   1 
ATOM   1929 O O   . LEU A 1 236 ? 14.779 1.069   14.515  1.00 53.04 ? 359 LEU A O   1 
ATOM   1930 C CB  . LEU A 1 236 ? 11.972 2.874   14.274  1.00 53.52 ? 359 LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 236 ? 12.929 3.888   13.632  1.00 53.40 ? 359 LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 236 ? 13.414 3.504   12.247  1.00 50.72 ? 359 LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 236 ? 12.152 5.179   13.569  1.00 54.73 ? 359 LEU A CD2 1 
ATOM   1934 N N   . ILE A 1 237 ? 13.670 1.642   16.439  1.00 51.93 ? 360 ILE A N   1 
ATOM   1935 C CA  . ILE A 1 237 ? 14.885 1.667   17.270  1.00 50.77 ? 360 ILE A CA  1 
ATOM   1936 C C   . ILE A 1 237 ? 15.522 0.309   17.282  1.00 50.53 ? 360 ILE A C   1 
ATOM   1937 O O   . ILE A 1 237 ? 16.718 0.197   17.152  1.00 51.38 ? 360 ILE A O   1 
ATOM   1938 C CB  . ILE A 1 237 ? 14.649 2.190   18.715  1.00 50.78 ? 360 ILE A CB  1 
ATOM   1939 C CG1 . ILE A 1 237 ? 14.471 3.716   18.709  1.00 49.51 ? 360 ILE A CG1 1 
ATOM   1940 C CG2 . ILE A 1 237 ? 15.818 1.850   19.599  1.00 48.43 ? 360 ILE A CG2 1 
ATOM   1941 C CD1 . ILE A 1 237 ? 13.527 4.265   19.804  1.00 50.88 ? 360 ILE A CD1 1 
ATOM   1942 N N   . SER A 1 238 ? 14.704 -0.723  17.370  1.00 50.57 ? 361 SER A N   1 
ATOM   1943 C CA  . SER A 1 238 ? 15.201 -2.074  17.417  1.00 50.73 ? 361 SER A CA  1 
ATOM   1944 C C   . SER A 1 238 ? 15.896 -2.464  16.107  1.00 50.41 ? 361 SER A C   1 
ATOM   1945 O O   . SER A 1 238 ? 16.880 -3.197  16.117  1.00 50.50 ? 361 SER A O   1 
ATOM   1946 C CB  . SER A 1 238 ? 14.059 -3.054  17.746  1.00 51.37 ? 361 SER A CB  1 
ATOM   1947 O OG  . SER A 1 238 ? 13.509 -2.836  19.046  1.00 51.42 ? 361 SER A OG  1 
ATOM   1948 N N   . ARG A 1 239 ? 15.371 -1.977  14.988  1.00 50.28 ? 362 ARG A N   1 
ATOM   1949 C CA  . ARG A 1 239 ? 15.939 -2.236  13.657  1.00 49.76 ? 362 ARG A CA  1 
ATOM   1950 C C   . ARG A 1 239 ? 17.314 -1.583  13.525  1.00 48.93 ? 362 ARG A C   1 
ATOM   1951 O O   . ARG A 1 239 ? 18.235 -2.165  12.964  1.00 48.00 ? 362 ARG A O   1 
ATOM   1952 C CB  . ARG A 1 239 ? 15.009 -1.705  12.550  1.00 49.59 ? 362 ARG A CB  1 
ATOM   1953 C CG  . ARG A 1 239 ? 13.640 -2.413  12.493  1.00 52.11 ? 362 ARG A CG  1 
ATOM   1954 C CD  . ARG A 1 239 ? 12.911 -2.217  11.156  1.00 51.77 ? 362 ARG A CD  1 
ATOM   1955 N NE  . ARG A 1 239 ? 11.755 -3.103  11.062  1.00 55.56 ? 362 ARG A NE  1 
ATOM   1956 C CZ  . ARG A 1 239 ? 11.816 -4.398  10.739  1.00 59.31 ? 362 ARG A CZ  1 
ATOM   1957 N NH1 . ARG A 1 239 ? 12.986 -4.979  10.487  1.00 62.66 ? 362 ARG A NH1 1 
ATOM   1958 N NH2 . ARG A 1 239 ? 10.714 -5.133  10.673  1.00 58.92 ? 362 ARG A NH2 1 
ATOM   1959 N N   . LEU A 1 240 ? 17.440 -0.372  14.066  1.00 48.72 ? 363 LEU A N   1 
ATOM   1960 C CA  . LEU A 1 240 ? 18.677 0.404   13.974  1.00 47.91 ? 363 LEU A CA  1 
ATOM   1961 C C   . LEU A 1 240 ? 19.725 -0.148  14.906  1.00 48.63 ? 363 LEU A C   1 
ATOM   1962 O O   . LEU A 1 240 ? 20.909 -0.112  14.619  1.00 49.15 ? 363 LEU A O   1 
ATOM   1963 C CB  . LEU A 1 240 ? 18.406 1.875   14.307  1.00 47.25 ? 363 LEU A CB  1 
ATOM   1964 C CG  . LEU A 1 240 ? 17.571 2.663   13.292  1.00 44.46 ? 363 LEU A CG  1 
ATOM   1965 C CD1 . LEU A 1 240 ? 17.019 3.972   13.845  1.00 41.82 ? 363 LEU A CD1 1 
ATOM   1966 C CD2 . LEU A 1 240 ? 18.375 2.914   12.084  1.00 45.05 ? 363 LEU A CD2 1 
ATOM   1967 N N   . LEU A 1 241 ? 19.280 -0.698  16.018  1.00 50.25 ? 364 LEU A N   1 
ATOM   1968 C CA  . LEU A 1 241 ? 20.199 -1.133  17.073  1.00 51.03 ? 364 LEU A CA  1 
ATOM   1969 C C   . LEU A 1 241 ? 20.528 -2.630  16.985  1.00 51.02 ? 364 LEU A C   1 
ATOM   1970 O O   . LEU A 1 241 ? 20.251 -3.410  17.888  1.00 51.57 ? 364 LEU A O   1 
ATOM   1971 C CB  . LEU A 1 241 ? 19.642 -0.702  18.444  1.00 51.05 ? 364 LEU A CB  1 
ATOM   1972 C CG  . LEU A 1 241 ? 19.585 0.828   18.647  1.00 51.19 ? 364 LEU A CG  1 
ATOM   1973 C CD1 . LEU A 1 241 ? 19.239 1.189   20.085  1.00 51.55 ? 364 LEU A CD1 1 
ATOM   1974 C CD2 . LEU A 1 241 ? 20.935 1.551   18.226  1.00 51.18 ? 364 LEU A CD2 1 
ATOM   1975 N N   . LYS A 1 242 ? 21.100 -3.021  15.855  1.00 51.45 ? 365 LYS A N   1 
ATOM   1976 C CA  . LYS A 1 242 ? 21.435 -4.419  15.567  1.00 50.67 ? 365 LYS A CA  1 
ATOM   1977 C C   . LYS A 1 242 ? 22.934 -4.563  15.780  1.00 51.03 ? 365 LYS A C   1 
ATOM   1978 O O   . LYS A 1 242 ? 23.698 -3.704  15.339  1.00 51.54 ? 365 LYS A O   1 
ATOM   1979 C CB  . LYS A 1 242 ? 21.050 -4.751  14.136  1.00 49.53 ? 365 LYS A CB  1 
ATOM   1980 C CG  . LYS A 1 242 ? 19.576 -5.053  13.968  1.00 50.64 ? 365 LYS A CG  1 
ATOM   1981 C CD  . LYS A 1 242 ? 19.271 -6.552  14.291  1.00 54.74 ? 365 LYS A CD  1 
ATOM   1982 C CE  . LYS A 1 242 ? 17.876 -6.791  14.922  1.00 57.39 ? 365 LYS A CE  1 
ATOM   1983 N NZ  . LYS A 1 242 ? 16.747 -6.854  13.919  1.00 59.03 ? 365 LYS A NZ  1 
ATOM   1984 N N   . HIS A 1 243 ? 23.352 -5.599  16.499  1.00 51.30 ? 366 HIS A N   1 
ATOM   1985 C CA  . HIS A 1 243 ? 24.774 -5.877  16.720  1.00 52.75 ? 366 HIS A CA  1 
ATOM   1986 C C   . HIS A 1 243 ? 25.572 -6.007  15.420  1.00 53.53 ? 366 HIS A C   1 
ATOM   1987 O O   . HIS A 1 243 ? 26.699 -5.527  15.321  1.00 53.80 ? 366 HIS A O   1 
ATOM   1988 C CB  . HIS A 1 243 ? 24.955 -7.175  17.528  1.00 52.18 ? 366 HIS A CB  1 
ATOM   1989 C CG  . HIS A 1 243 ? 26.373 -7.422  17.957  1.00 51.59 ? 366 HIS A CG  1 
ATOM   1990 N ND1 . HIS A 1 243 ? 27.253 -8.197  17.228  1.00 49.83 ? 366 HIS A ND1 1 
ATOM   1991 C CD2 . HIS A 1 243 ? 27.068 -6.978  19.031  1.00 50.89 ? 366 HIS A CD2 1 
ATOM   1992 C CE1 . HIS A 1 243 ? 28.422 -8.223  17.838  1.00 49.16 ? 366 HIS A CE1 1 
ATOM   1993 N NE2 . HIS A 1 243 ? 28.338 -7.492  18.934  1.00 48.63 ? 366 HIS A NE2 1 
ATOM   1994 N N   . ASN A 1 244 ? 24.996 -6.731  14.462  1.00 55.13 ? 367 ASN A N   1 
ATOM   1995 C CA  . ASN A 1 244 ? 25.579 -6.937  13.152  1.00 56.02 ? 367 ASN A CA  1 
ATOM   1996 C C   . ASN A 1 244 ? 25.171 -5.714  12.351  1.00 56.35 ? 367 ASN A C   1 
ATOM   1997 O O   . ASN A 1 244 ? 23.965 -5.466  12.131  1.00 55.83 ? 367 ASN A O   1 
ATOM   1998 C CB  . ASN A 1 244 ? 25.066 -8.240  12.525  1.00 56.53 ? 367 ASN A CB  1 
ATOM   1999 C CG  . ASN A 1 244 ? 25.639 -8.513  11.110  1.00 60.17 ? 367 ASN A CG  1 
ATOM   2000 O OD1 . ASN A 1 244 ? 24.880 -8.796  10.174  1.00 62.61 ? 367 ASN A OD1 1 
ATOM   2001 N ND2 . ASN A 1 244 ? 26.971 -8.451  10.961  1.00 61.12 ? 367 ASN A ND2 1 
ATOM   2002 N N   . PRO A 1 245 ? 26.179 -4.920  11.945  1.00 56.29 ? 368 PRO A N   1 
ATOM   2003 C CA  . PRO A 1 245 ? 26.005 -3.658  11.220  1.00 56.10 ? 368 PRO A CA  1 
ATOM   2004 C C   . PRO A 1 245 ? 25.340 -3.917  9.883   1.00 56.21 ? 368 PRO A C   1 
ATOM   2005 O O   . PRO A 1 245 ? 24.522 -3.131  9.422   1.00 55.27 ? 368 PRO A O   1 
ATOM   2006 C CB  . PRO A 1 245 ? 27.431 -3.145  11.033  1.00 56.39 ? 368 PRO A CB  1 
ATOM   2007 C CG  . PRO A 1 245 ? 28.335 -4.312  11.285  1.00 56.93 ? 368 PRO A CG  1 
ATOM   2008 C CD  . PRO A 1 245 ? 27.591 -5.278  12.159  1.00 56.23 ? 368 PRO A CD  1 
ATOM   2009 N N   . SER A 1 246 ? 25.679 -5.061  9.302   1.00 57.07 ? 369 SER A N   1 
ATOM   2010 C CA  . SER A 1 246 ? 25.084 -5.554  8.068   1.00 57.74 ? 369 SER A CA  1 
ATOM   2011 C C   . SER A 1 246 ? 23.556 -5.714  8.165   1.00 57.45 ? 369 SER A C   1 
ATOM   2012 O O   . SER A 1 246 ? 22.853 -5.632  7.162   1.00 57.20 ? 369 SER A O   1 
ATOM   2013 C CB  . SER A 1 246 ? 25.749 -6.884  7.721   1.00 57.86 ? 369 SER A CB  1 
ATOM   2014 O OG  . SER A 1 246 ? 25.110 -7.512  6.632   1.00 60.83 ? 369 SER A OG  1 
ATOM   2015 N N   . GLN A 1 247 ? 23.054 -5.925  9.382   1.00 57.36 ? 370 GLN A N   1 
ATOM   2016 C CA  . GLN A 1 247 ? 21.631 -6.109  9.632   1.00 56.92 ? 370 GLN A CA  1 
ATOM   2017 C C   . GLN A 1 247 ? 20.874 -4.791  9.753   1.00 56.51 ? 370 GLN A C   1 
ATOM   2018 O O   . GLN A 1 247 ? 19.634 -4.784  9.857   1.00 56.12 ? 370 GLN A O   1 
ATOM   2019 C CB  . GLN A 1 247 ? 21.446 -6.886  10.936  1.00 57.68 ? 370 GLN A CB  1 
ATOM   2020 C CG  . GLN A 1 247 ? 22.022 -8.271  10.914  1.00 60.48 ? 370 GLN A CG  1 
ATOM   2021 C CD  . GLN A 1 247 ? 21.152 -9.177  10.114  1.00 65.23 ? 370 GLN A CD  1 
ATOM   2022 O OE1 . GLN A 1 247 ? 19.933 -9.178  10.297  1.00 69.14 ? 370 GLN A OE1 1 
ATOM   2023 N NE2 . GLN A 1 247 ? 21.747 -9.950  9.205   1.00 67.58 ? 370 GLN A NE2 1 
ATOM   2024 N N   . ARG A 1 248 ? 21.598 -3.673  9.796   1.00 55.35 ? 371 ARG A N   1 
ATOM   2025 C CA  . ARG A 1 248 ? 20.955 -2.395  10.075  1.00 54.47 ? 371 ARG A CA  1 
ATOM   2026 C C   . ARG A 1 248 ? 20.308 -1.936  8.788   1.00 53.68 ? 371 ARG A C   1 
ATOM   2027 O O   . ARG A 1 248 ? 20.834 -2.234  7.748   1.00 53.37 ? 371 ARG A O   1 
ATOM   2028 C CB  . ARG A 1 248 ? 21.979 -1.382  10.576  1.00 54.00 ? 371 ARG A CB  1 
ATOM   2029 C CG  . ARG A 1 248 ? 22.416 -1.670  11.977  1.00 54.31 ? 371 ARG A CG  1 
ATOM   2030 C CD  . ARG A 1 248 ? 23.663 -0.894  12.333  1.00 54.22 ? 371 ARG A CD  1 
ATOM   2031 N NE  . ARG A 1 248 ? 24.398 -1.647  13.327  1.00 53.18 ? 371 ARG A NE  1 
ATOM   2032 C CZ  . ARG A 1 248 ? 25.611 -1.366  13.775  1.00 52.09 ? 371 ARG A CZ  1 
ATOM   2033 N NH1 . ARG A 1 248 ? 26.268 -0.299  13.330  1.00 53.54 ? 371 ARG A NH1 1 
ATOM   2034 N NH2 . ARG A 1 248 ? 26.165 -2.173  14.678  1.00 50.60 ? 371 ARG A NH2 1 
ATOM   2035 N N   . PRO A 1 249 ? 19.181 -1.189  8.859   1.00 53.34 ? 372 PRO A N   1 
ATOM   2036 C CA  . PRO A 1 249 ? 18.491 -0.802  7.623   1.00 53.26 ? 372 PRO A CA  1 
ATOM   2037 C C   . PRO A 1 249 ? 19.277 0.248   6.828   1.00 53.07 ? 372 PRO A C   1 
ATOM   2038 O O   . PRO A 1 249 ? 20.240 0.831   7.349   1.00 53.07 ? 372 PRO A O   1 
ATOM   2039 C CB  . PRO A 1 249 ? 17.180 -0.192  8.121   1.00 52.42 ? 372 PRO A CB  1 
ATOM   2040 C CG  . PRO A 1 249 ? 17.446 0.235   9.480   1.00 52.32 ? 372 PRO A CG  1 
ATOM   2041 C CD  . PRO A 1 249 ? 18.525 -0.614  10.048  1.00 53.24 ? 372 PRO A CD  1 
ATOM   2042 N N   . MET A 1 250 ? 18.867 0.457   5.579   1.00 52.78 ? 373 MET A N   1 
ATOM   2043 C CA  . MET A 1 250 ? 19.365 1.554   4.762   1.00 52.98 ? 373 MET A CA  1 
ATOM   2044 C C   . MET A 1 250 ? 18.605 2.783   5.203   1.00 51.85 ? 373 MET A C   1 
ATOM   2045 O O   . MET A 1 250 ? 17.514 2.671   5.799   1.00 50.65 ? 373 MET A O   1 
ATOM   2046 C CB  . MET A 1 250 ? 19.156 1.297   3.260   1.00 53.87 ? 373 MET A CB  1 
ATOM   2047 C CG  . MET A 1 250 ? 20.098 0.220   2.626   1.00 57.48 ? 373 MET A CG  1 
ATOM   2048 S SD  . MET A 1 250 ? 21.874 0.376   3.043   1.00 65.84 ? 373 MET A SD  1 
ATOM   2049 C CE  . MET A 1 250 ? 22.532 1.477   1.738   1.00 63.39 ? 373 MET A CE  1 
ATOM   2050 N N   . LEU A 1 251 ? 19.198 3.944   4.937   1.00 50.99 ? 374 LEU A N   1 
ATOM   2051 C CA  . LEU A 1 251 ? 18.619 5.202   5.351   1.00 50.96 ? 374 LEU A CA  1 
ATOM   2052 C C   . LEU A 1 251 ? 17.309 5.519   4.626   1.00 51.27 ? 374 LEU A C   1 
ATOM   2053 O O   . LEU A 1 251 ? 16.446 6.181   5.194   1.00 51.08 ? 374 LEU A O   1 
ATOM   2054 C CB  . LEU A 1 251 ? 19.632 6.348   5.221   1.00 50.70 ? 374 LEU A CB  1 
ATOM   2055 C CG  . LEU A 1 251 ? 20.802 6.432   6.224   1.00 50.62 ? 374 LEU A CG  1 
ATOM   2056 C CD1 . LEU A 1 251 ? 21.907 7.303   5.684   1.00 50.68 ? 374 LEU A CD1 1 
ATOM   2057 C CD2 . LEU A 1 251 ? 20.382 6.955   7.586   1.00 52.14 ? 374 LEU A CD2 1 
ATOM   2058 N N   . ARG A 1 252 ? 17.173 5.044   3.389   1.00 51.94 ? 375 ARG A N   1 
ATOM   2059 C CA  . ARG A 1 252 ? 15.936 5.146   2.628   1.00 53.82 ? 375 ARG A CA  1 
ATOM   2060 C C   . ARG A 1 252 ? 14.791 4.382   3.299   1.00 54.11 ? 375 ARG A C   1 
ATOM   2061 O O   . ARG A 1 252 ? 13.624 4.778   3.188   1.00 54.13 ? 375 ARG A O   1 
ATOM   2062 C CB  . ARG A 1 252 ? 16.143 4.615   1.200   1.00 54.19 ? 375 ARG A CB  1 
ATOM   2063 C CG  . ARG A 1 252 ? 16.458 3.102   1.143   1.00 55.94 ? 375 ARG A CG  1 
ATOM   2064 C CD  . ARG A 1 252 ? 16.775 2.564   -0.269  1.00 55.96 ? 375 ARG A CD  1 
ATOM   2065 N NE  . ARG A 1 252 ? 18.119 2.954   -0.725  1.00 57.35 ? 375 ARG A NE  1 
ATOM   2066 C CZ  . ARG A 1 252 ? 18.386 3.496   -1.909  1.00 57.05 ? 375 ARG A CZ  1 
ATOM   2067 N NH1 . ARG A 1 252 ? 17.415 3.695   -2.787  1.00 57.89 ? 375 ARG A NH1 1 
ATOM   2068 N NH2 . ARG A 1 252 ? 19.630 3.820   -2.226  1.00 57.23 ? 375 ARG A NH2 1 
ATOM   2069 N N   . GLU A 1 253 ? 15.145 3.276   3.964   1.00 54.78 ? 376 GLU A N   1 
ATOM   2070 C CA  . GLU A 1 253 ? 14.231 2.450   4.777   1.00 55.11 ? 376 GLU A CA  1 
ATOM   2071 C C   . GLU A 1 253 ? 13.758 3.198   6.025   1.00 54.70 ? 376 GLU A C   1 
ATOM   2072 O O   . GLU A 1 253 ? 12.579 3.225   6.363   1.00 54.20 ? 376 GLU A O   1 
ATOM   2073 C CB  . GLU A 1 253 ? 14.938 1.155   5.200   1.00 55.33 ? 376 GLU A CB  1 
ATOM   2074 C CG  . GLU A 1 253 ? 15.472 0.318   4.009   1.00 58.07 ? 376 GLU A CG  1 
ATOM   2075 C CD  . GLU A 1 253 ? 15.601 -1.168  4.332   1.00 59.51 ? 376 GLU A CD  1 
ATOM   2076 O OE1 . GLU A 1 253 ? 16.239 -1.522  5.354   1.00 59.84 ? 376 GLU A OE1 1 
ATOM   2077 O OE2 . GLU A 1 253 ? 15.044 -1.985  3.558   1.00 60.23 ? 376 GLU A OE2 1 
ATOM   2078 N N   . VAL A 1 254 ? 14.700 3.802   6.730   1.00 54.86 ? 377 VAL A N   1 
ATOM   2079 C CA  . VAL A 1 254 ? 14.319 4.689   7.822   1.00 54.39 ? 377 VAL A CA  1 
ATOM   2080 C C   . VAL A 1 254 ? 13.313 5.722   7.307   1.00 54.17 ? 377 VAL A C   1 
ATOM   2081 O O   . VAL A 1 254 ? 12.276 5.890   7.885   1.00 54.82 ? 377 VAL A O   1 
ATOM   2082 C CB  . VAL A 1 254 ? 15.532 5.382   8.427   1.00 53.61 ? 377 VAL A CB  1 
ATOM   2083 C CG1 . VAL A 1 254 ? 15.087 6.408   9.416   1.00 53.29 ? 377 VAL A CG1 1 
ATOM   2084 C CG2 . VAL A 1 254 ? 16.416 4.363   9.097   1.00 53.77 ? 377 VAL A CG2 1 
ATOM   2085 N N   . LEU A 1 255 ? 13.622 6.384   6.197   1.00 54.63 ? 378 LEU A N   1 
ATOM   2086 C CA  . LEU A 1 255 ? 12.813 7.483   5.692   1.00 54.79 ? 378 LEU A CA  1 
ATOM   2087 C C   . LEU A 1 255 ? 11.434 6.991   5.323   1.00 54.94 ? 378 LEU A C   1 
ATOM   2088 O O   . LEU A 1 255 ? 10.470 7.741   5.397   1.00 55.30 ? 378 LEU A O   1 
ATOM   2089 C CB  . LEU A 1 255 ? 13.479 8.149   4.477   1.00 54.87 ? 378 LEU A CB  1 
ATOM   2090 C CG  . LEU A 1 255 ? 14.695 9.032   4.794   1.00 54.74 ? 378 LEU A CG  1 
ATOM   2091 C CD1 . LEU A 1 255 ? 15.589 9.228   3.566   1.00 54.25 ? 378 LEU A CD1 1 
ATOM   2092 C CD2 . LEU A 1 255 ? 14.268 10.376  5.359   1.00 53.71 ? 378 LEU A CD2 1 
ATOM   2093 N N   . GLU A 1 256 ? 11.347 5.721   4.946   1.00 54.59 ? 379 GLU A N   1 
ATOM   2094 C CA  . GLU A 1 256 ? 10.076 5.123   4.570   1.00 54.56 ? 379 GLU A CA  1 
ATOM   2095 C C   . GLU A 1 256 ? 9.404  4.319   5.702   1.00 53.42 ? 379 GLU A C   1 
ATOM   2096 O O   . GLU A 1 256 ? 8.319  3.771   5.502   1.00 52.85 ? 379 GLU A O   1 
ATOM   2097 C CB  . GLU A 1 256 ? 10.242 4.274   3.307   1.00 55.04 ? 379 GLU A CB  1 
ATOM   2098 C CG  . GLU A 1 256 ? 10.382 5.101   2.056   1.00 58.42 ? 379 GLU A CG  1 
ATOM   2099 C CD  . GLU A 1 256 ? 10.680 4.245   0.825   1.00 64.55 ? 379 GLU A CD  1 
ATOM   2100 O OE1 . GLU A 1 256 ? 11.870 3.853   0.666   1.00 66.28 ? 379 GLU A OE1 1 
ATOM   2101 O OE2 . GLU A 1 256 ? 9.732  3.977   0.015   1.00 64.34 ? 379 GLU A OE2 1 
ATOM   2102 N N   . HIS A 1 257 ? 10.020 4.281   6.889   1.00 51.84 ? 380 HIS A N   1 
ATOM   2103 C CA  . HIS A 1 257 ? 9.413  3.571   8.021   1.00 50.80 ? 380 HIS A CA  1 
ATOM   2104 C C   . HIS A 1 257 ? 8.055  4.193   8.415   1.00 50.19 ? 380 HIS A C   1 
ATOM   2105 O O   . HIS A 1 257 ? 7.968  5.436   8.532   1.00 49.80 ? 380 HIS A O   1 
ATOM   2106 C CB  . HIS A 1 257 ? 10.358 3.563   9.220   1.00 51.08 ? 380 HIS A CB  1 
ATOM   2107 C CG  . HIS A 1 257 ? 9.952  2.608   10.299  1.00 49.75 ? 380 HIS A CG  1 
ATOM   2108 N ND1 . HIS A 1 257 ? 9.024  2.929   11.264  1.00 49.88 ? 380 HIS A ND1 1 
ATOM   2109 C CD2 . HIS A 1 257 ? 10.348 1.345   10.566  1.00 48.95 ? 380 HIS A CD2 1 
ATOM   2110 C CE1 . HIS A 1 257 ? 8.856  1.901   12.075  1.00 49.10 ? 380 HIS A CE1 1 
ATOM   2111 N NE2 . HIS A 1 257 ? 9.649  0.926   11.675  1.00 49.61 ? 380 HIS A NE2 1 
ATOM   2112 N N   . PRO A 1 258 ? 7.011  3.337   8.636   1.00 48.99 ? 381 PRO A N   1 
ATOM   2113 C CA  . PRO A 1 258 ? 5.626  3.791   8.873   1.00 48.60 ? 381 PRO A CA  1 
ATOM   2114 C C   . PRO A 1 258 ? 5.432  4.672   10.115  1.00 49.01 ? 381 PRO A C   1 
ATOM   2115 O O   . PRO A 1 258 ? 4.560  5.551   10.100  1.00 48.94 ? 381 PRO A O   1 
ATOM   2116 C CB  . PRO A 1 258 ? 4.825  2.490   8.987   1.00 48.20 ? 381 PRO A CB  1 
ATOM   2117 C CG  . PRO A 1 258 ? 5.707  1.436   8.404   1.00 47.95 ? 381 PRO A CG  1 
ATOM   2118 C CD  . PRO A 1 258 ? 7.104  1.865   8.667   1.00 48.65 ? 381 PRO A CD  1 
ATOM   2119 N N   . TRP A 1 259 ? 6.252  4.480   11.153  1.00 48.77 ? 382 TRP A N   1 
ATOM   2120 C CA  . TRP A 1 259 ? 6.262  5.413   12.291  1.00 48.84 ? 382 TRP A CA  1 
ATOM   2121 C C   . TRP A 1 259 ? 6.809  6.770   11.882  1.00 48.61 ? 382 TRP A C   1 
ATOM   2122 O O   . TRP A 1 259 ? 6.361  7.819   12.375  1.00 48.38 ? 382 TRP A O   1 
ATOM   2123 C CB  . TRP A 1 259 ? 7.066  4.854   13.461  1.00 48.77 ? 382 TRP A CB  1 
ATOM   2124 C CG  . TRP A 1 259 ? 7.073  5.710   14.686  1.00 49.15 ? 382 TRP A CG  1 
ATOM   2125 C CD1 . TRP A 1 259 ? 6.083  5.820   15.622  1.00 48.84 ? 382 TRP A CD1 1 
ATOM   2126 C CD2 . TRP A 1 259 ? 8.147  6.564   15.139  1.00 51.20 ? 382 TRP A CD2 1 
ATOM   2127 N NE1 . TRP A 1 259 ? 6.452  6.701   16.610  1.00 48.58 ? 382 TRP A NE1 1 
ATOM   2128 C CE2 . TRP A 1 259 ? 7.725  7.159   16.348  1.00 50.96 ? 382 TRP A CE2 1 
ATOM   2129 C CE3 . TRP A 1 259 ? 9.436  6.875   14.640  1.00 51.17 ? 382 TRP A CE3 1 
ATOM   2130 C CZ2 . TRP A 1 259 ? 8.553  8.057   17.077  1.00 51.02 ? 382 TRP A CZ2 1 
ATOM   2131 C CZ3 . TRP A 1 259 ? 10.258 7.765   15.365  1.00 50.45 ? 382 TRP A CZ3 1 
ATOM   2132 C CH2 . TRP A 1 259 ? 9.805  8.350   16.561  1.00 50.72 ? 382 TRP A CH2 1 
ATOM   2133 N N   . ILE A 1 260 ? 7.765  6.761   10.965  1.00 49.10 ? 383 ILE A N   1 
ATOM   2134 C CA  . ILE A 1 260 ? 8.416  8.009   10.557  1.00 49.89 ? 383 ILE A CA  1 
ATOM   2135 C C   . ILE A 1 260 ? 7.439  8.780   9.672   1.00 50.16 ? 383 ILE A C   1 
ATOM   2136 O O   . ILE A 1 260 ? 7.103  9.921   9.949   1.00 50.19 ? 383 ILE A O   1 
ATOM   2137 C CB  . ILE A 1 260 ? 9.789  7.751   9.860   1.00 50.15 ? 383 ILE A CB  1 
ATOM   2138 C CG1 . ILE A 1 260 ? 10.835 7.359   10.878  1.00 49.04 ? 383 ILE A CG1 1 
ATOM   2139 C CG2 . ILE A 1 260 ? 10.284 8.975   9.084   1.00 50.58 ? 383 ILE A CG2 1 
ATOM   2140 C CD1 . ILE A 1 260 ? 11.303 8.533   11.704  1.00 49.33 ? 383 ILE A CD1 1 
ATOM   2141 N N   . THR A 1 261 ? 6.946  8.117   8.642   1.00 51.04 ? 384 THR A N   1 
ATOM   2142 C CA  . THR A 1 261 ? 5.904  8.666   7.788   1.00 51.69 ? 384 THR A CA  1 
ATOM   2143 C C   . THR A 1 261 ? 4.614  9.120   8.500   1.00 51.41 ? 384 THR A C   1 
ATOM   2144 O O   . THR A 1 261 ? 4.032  10.149  8.138   1.00 51.67 ? 384 THR A O   1 
ATOM   2145 C CB  . THR A 1 261 ? 5.570  7.664   6.672   1.00 52.39 ? 384 THR A CB  1 
ATOM   2146 O OG1 . THR A 1 261 ? 5.094  6.443   7.255   1.00 53.29 ? 384 THR A OG1 1 
ATOM   2147 C CG2 . THR A 1 261 ? 6.836  7.362   5.859   1.00 53.18 ? 384 THR A CG2 1 
ATOM   2148 N N   . ALA A 1 262 ? 4.162  8.365   9.492   1.00 51.01 ? 385 ALA A N   1 
ATOM   2149 C CA  . ALA A 1 262 ? 2.926  8.722   10.216  1.00 51.59 ? 385 ALA A CA  1 
ATOM   2150 C C   . ALA A 1 262 ? 3.110  9.946   11.118  1.00 52.00 ? 385 ALA A C   1 
ATOM   2151 O O   . ALA A 1 262 ? 2.139  10.600  11.518  1.00 51.47 ? 385 ALA A O   1 
ATOM   2152 C CB  . ALA A 1 262 ? 2.410  7.527   11.042  1.00 50.88 ? 385 ALA A CB  1 
ATOM   2153 N N   . ASN A 1 263 ? 4.365  10.270  11.416  1.00 53.01 ? 386 ASN A N   1 
ATOM   2154 C CA  . ASN A 1 263 ? 4.655  11.233  12.470  1.00 53.79 ? 386 ASN A CA  1 
ATOM   2155 C C   . ASN A 1 263 ? 5.401  12.478  12.038  1.00 55.16 ? 386 ASN A C   1 
ATOM   2156 O O   . ASN A 1 263 ? 5.272  13.525  12.670  1.00 55.02 ? 386 ASN A O   1 
ATOM   2157 C CB  . ASN A 1 263 ? 5.330  10.536  13.641  1.00 53.19 ? 386 ASN A CB  1 
ATOM   2158 C CG  . ASN A 1 263 ? 4.348  9.747   14.482  1.00 52.90 ? 386 ASN A CG  1 
ATOM   2159 O OD1 . ASN A 1 263 ? 3.690  10.304  15.358  1.00 52.96 ? 386 ASN A OD1 1 
ATOM   2160 N ND2 . ASN A 1 263 ? 4.236  8.451   14.220  1.00 51.31 ? 386 ASN A ND2 1 
ATOM   2161 N N   . SER A 1 264 ? 6.166  12.393  10.959  1.00 57.46 ? 387 SER A N   1 
ATOM   2162 C CA  . SER A 1 264 ? 6.844  13.595  10.463  1.00 60.13 ? 387 SER A CA  1 
ATOM   2163 C C   . SER A 1 264 ? 5.903  14.499  9.633   1.00 61.46 ? 387 SER A C   1 
ATOM   2164 O O   . SER A 1 264 ? 4.878  14.053  9.082   1.00 61.19 ? 387 SER A O   1 
ATOM   2165 C CB  . SER A 1 264 ? 8.165  13.268  9.728   1.00 60.26 ? 387 SER A CB  1 
ATOM   2166 O OG  . SER A 1 264 ? 7.936  12.706  8.434   1.00 61.69 ? 387 SER A OG  1 
ATOM   2167 N N   . SER A 1 265 ? 6.278  15.772  9.551   1.00 63.37 ? 388 SER A N   1 
ATOM   2168 C CA  . SER A 1 265 ? 5.434  16.834  8.998   1.00 65.10 ? 388 SER A CA  1 
ATOM   2169 C C   . SER A 1 265 ? 5.248  16.801  7.460   1.00 65.69 ? 388 SER A C   1 
ATOM   2170 O O   . SER A 1 265 ? 5.885  15.995  6.769   1.00 66.25 ? 388 SER A O   1 
ATOM   2171 C CB  . SER A 1 265 ? 6.118  18.136  9.358   1.00 65.00 ? 388 SER A CB  1 
ATOM   2172 O OG  . SER A 1 265 ? 7.407  18.076  8.786   1.00 66.41 ? 388 SER A OG  1 
ATOM   2173 N N   . LYS A 1 266 ? 4.382  17.681  6.928   1.00 66.34 ? 389 LYS A N   1 
ATOM   2174 C CA  . LYS A 1 266 ? 4.408  18.008  5.484   1.00 66.79 ? 389 LYS A CA  1 
ATOM   2175 C C   . LYS A 1 266 ? 5.878  18.240  5.043   1.00 67.16 ? 389 LYS A C   1 
ATOM   2176 O O   . LYS A 1 266 ? 6.484  17.396  4.349   1.00 67.19 ? 389 LYS A O   1 
ATOM   2177 C CB  . LYS A 1 266 ? 3.569  19.254  5.194   1.00 66.66 ? 389 LYS A CB  1 
ATOM   2178 N N   . SER B 2 7   ? 52.648 25.217  10.191  1.00 56.97 ? 6   SER B N   1 
ATOM   2179 C CA  . SER B 2 7   ? 52.461 23.929  9.461   1.00 56.80 ? 6   SER B CA  1 
ATOM   2180 C C   . SER B 2 7   ? 52.009 24.277  8.070   1.00 56.69 ? 6   SER B C   1 
ATOM   2181 O O   . SER B 2 7   ? 52.135 25.427  7.625   1.00 57.12 ? 6   SER B O   1 
ATOM   2182 C CB  . SER B 2 7   ? 51.354 23.081  10.112  1.00 56.96 ? 6   SER B CB  1 
ATOM   2183 O OG  . SER B 2 7   ? 51.879 22.080  10.965  1.00 56.99 ? 6   SER B OG  1 
ATOM   2184 N N   . SER B 2 8   ? 51.465 23.279  7.387   1.00 55.85 ? 7   SER B N   1 
ATOM   2185 C CA  . SER B 2 8   ? 50.567 23.571  6.314   1.00 55.19 ? 7   SER B CA  1 
ATOM   2186 C C   . SER B 2 8   ? 49.217 23.793  6.989   1.00 54.51 ? 7   SER B C   1 
ATOM   2187 O O   . SER B 2 8   ? 48.535 22.870  7.466   1.00 54.75 ? 7   SER B O   1 
ATOM   2188 C CB  . SER B 2 8   ? 50.522 22.439  5.291   1.00 56.01 ? 7   SER B CB  1 
ATOM   2189 O OG  . SER B 2 8   ? 49.741 22.797  4.162   1.00 56.76 ? 7   SER B OG  1 
ATOM   2190 N N   . TYR B 2 9   ? 48.868 25.060  7.090   1.00 52.77 ? 8   TYR B N   1 
ATOM   2191 C CA  . TYR B 2 9   ? 47.501 25.407  7.351   1.00 50.87 ? 8   TYR B CA  1 
ATOM   2192 C C   . TYR B 2 9   ? 46.912 25.691  5.981   1.00 50.22 ? 8   TYR B C   1 
ATOM   2193 O O   . TYR B 2 9   ? 46.030 26.528  5.822   1.00 49.42 ? 8   TYR B O   1 
ATOM   2194 C CB  . TYR B 2 9   ? 47.478 26.602  8.302   1.00 50.33 ? 8   TYR B CB  1 
ATOM   2195 C CG  . TYR B 2 9   ? 47.708 26.131  9.702   1.00 48.81 ? 8   TYR B CG  1 
ATOM   2196 C CD1 . TYR B 2 9   ? 48.968 26.214  10.287  1.00 45.72 ? 8   TYR B CD1 1 
ATOM   2197 C CD2 . TYR B 2 9   ? 46.668 25.514  10.415  1.00 47.36 ? 8   TYR B CD2 1 
ATOM   2198 C CE1 . TYR B 2 9   ? 49.174 25.743  11.551  1.00 47.24 ? 8   TYR B CE1 1 
ATOM   2199 C CE2 . TYR B 2 9   ? 46.855 25.047  11.694  1.00 47.34 ? 8   TYR B CE2 1 
ATOM   2200 C CZ  . TYR B 2 9   ? 48.114 25.147  12.266  1.00 48.58 ? 8   TYR B CZ  1 
ATOM   2201 O OH  . TYR B 2 9   ? 48.313 24.652  13.552  1.00 48.41 ? 8   TYR B OH  1 
ATOM   2202 N N   . SER B 2 10  ? 47.422 24.959  4.994   1.00 49.59 ? 9   SER B N   1 
ATOM   2203 C CA  . SER B 2 10  ? 47.027 25.152  3.624   1.00 50.00 ? 9   SER B CA  1 
ATOM   2204 C C   . SER B 2 10  ? 46.098 24.036  3.173   1.00 49.67 ? 9   SER B C   1 
ATOM   2205 O O   . SER B 2 10  ? 46.558 22.986  2.756   1.00 50.03 ? 9   SER B O   1 
ATOM   2206 C CB  . SER B 2 10  ? 48.273 25.186  2.748   1.00 50.22 ? 9   SER B CB  1 
ATOM   2207 O OG  . SER B 2 10  ? 47.983 25.813  1.515   1.00 51.27 ? 9   SER B OG  1 
ATOM   2208 N N   . TYR B 2 11  ? 44.799 24.260  3.245   1.00 49.34 ? 10  TYR B N   1 
ATOM   2209 C CA  . TYR B 2 11  ? 43.843 23.161  3.067   1.00 50.31 ? 10  TYR B CA  1 
ATOM   2210 C C   . TYR B 2 11  ? 43.247 23.134  1.671   1.00 50.39 ? 10  TYR B C   1 
ATOM   2211 O O   . TYR B 2 11  ? 43.192 24.176  0.998   1.00 50.38 ? 10  TYR B O   1 
ATOM   2212 C CB  . TYR B 2 11  ? 42.700 23.215  4.107   1.00 50.50 ? 10  TYR B CB  1 
ATOM   2213 C CG  . TYR B 2 11  ? 43.121 23.231  5.570   1.00 52.06 ? 10  TYR B CG  1 
ATOM   2214 C CD1 . TYR B 2 11  ? 42.345 23.890  6.524   1.00 54.96 ? 10  TYR B CD1 1 
ATOM   2215 C CD2 . TYR B 2 11  ? 44.285 22.590  6.002   1.00 52.35 ? 10  TYR B CD2 1 
ATOM   2216 C CE1 . TYR B 2 11  ? 42.714 23.916  7.855   1.00 54.97 ? 10  TYR B CE1 1 
ATOM   2217 C CE2 . TYR B 2 11  ? 44.658 22.598  7.342   1.00 51.22 ? 10  TYR B CE2 1 
ATOM   2218 C CZ  . TYR B 2 11  ? 43.890 23.270  8.255   1.00 53.41 ? 10  TYR B CZ  1 
ATOM   2219 O OH  . TYR B 2 11  ? 44.258 23.287  9.584   1.00 53.28 ? 10  TYR B OH  1 
ATOM   2220 N N   . ASP B 2 12  ? 42.774 21.948  1.256   1.00 50.28 ? 11  ASP B N   1 
ATOM   2221 C CA  . ASP B 2 12  ? 42.056 21.777  -0.014  1.00 50.22 ? 11  ASP B CA  1 
ATOM   2222 C C   . ASP B 2 12  ? 40.632 22.175  0.281   1.00 49.89 ? 11  ASP B C   1 
ATOM   2223 O O   . ASP B 2 12  ? 39.720 21.329  0.334   1.00 50.24 ? 11  ASP B O   1 
ATOM   2224 C CB  . ASP B 2 12  ? 42.158 20.329  -0.538  1.00 50.13 ? 11  ASP B CB  1 
ATOM   2225 C CG  . ASP B 2 12  ? 41.651 20.156  -2.001  1.00 51.79 ? 11  ASP B CG  1 
ATOM   2226 O OD1 . ASP B 2 12  ? 41.241 21.156  -2.644  1.00 53.09 ? 11  ASP B OD1 1 
ATOM   2227 O OD2 . ASP B 2 12  ? 41.678 18.994  -2.513  1.00 52.20 ? 11  ASP B OD2 1 
ATOM   2228 N N   . ALA B 2 13  ? 40.468 23.484  0.481   1.00 49.65 ? 12  ALA B N   1 
ATOM   2229 C CA  . ALA B 2 13  ? 39.256 24.073  1.022   1.00 49.89 ? 12  ALA B CA  1 
ATOM   2230 C C   . ALA B 2 13  ? 39.167 25.614  0.743   1.00 50.17 ? 12  ALA B C   1 
ATOM   2231 O O   . ALA B 2 13  ? 40.202 26.280  0.587   1.00 49.30 ? 12  ALA B O   1 
ATOM   2232 C CB  . ALA B 2 13  ? 39.149 23.743  2.507   1.00 49.13 ? 12  ALA B CB  1 
ATOM   2233 N N   . PRO B 2 14  ? 37.917 26.166  0.625   1.00 50.12 ? 13  PRO B N   1 
ATOM   2234 C CA  . PRO B 2 14  ? 37.602 27.556  0.287   1.00 49.86 ? 13  PRO B CA  1 
ATOM   2235 C C   . PRO B 2 14  ? 38.126 28.587  1.296   1.00 50.63 ? 13  PRO B C   1 
ATOM   2236 O O   . PRO B 2 14  ? 37.829 28.517  2.503   1.00 49.75 ? 13  PRO B O   1 
ATOM   2237 C CB  . PRO B 2 14  ? 36.075 27.602  0.316   1.00 50.29 ? 13  PRO B CB  1 
ATOM   2238 C CG  . PRO B 2 14  ? 35.630 26.274  0.347   1.00 51.02 ? 13  PRO B CG  1 
ATOM   2239 C CD  . PRO B 2 14  ? 36.703 25.371  0.811   1.00 49.81 ? 13  PRO B CD  1 
ATOM   2240 N N   . SER B 2 15  ? 38.884 29.550  0.796   1.00 50.69 ? 14  SER B N   1 
ATOM   2241 C CA  . SER B 2 15  ? 39.320 30.631  1.641   1.00 51.66 ? 14  SER B CA  1 
ATOM   2242 C C   . SER B 2 15  ? 39.184 31.942  0.877   1.00 51.81 ? 14  SER B C   1 
ATOM   2243 O O   . SER B 2 15  ? 39.758 32.957  1.263   1.00 52.32 ? 14  SER B O   1 
ATOM   2244 C CB  . SER B 2 15  ? 40.752 30.376  2.101   1.00 51.48 ? 14  SER B CB  1 
ATOM   2245 O OG  . SER B 2 15  ? 41.523 30.077  0.955   1.00 53.91 ? 14  SER B OG  1 
ATOM   2246 N N   . ASP B 2 16  ? 38.399 31.911  -0.201  1.00 52.37 ? 15  ASP B N   1 
ATOM   2247 C CA  . ASP B 2 16  ? 38.122 33.098  -1.017  1.00 52.75 ? 15  ASP B CA  1 
ATOM   2248 C C   . ASP B 2 16  ? 36.929 33.877  -0.508  1.00 51.88 ? 15  ASP B C   1 
ATOM   2249 O O   . ASP B 2 16  ? 35.911 33.308  -0.154  1.00 51.44 ? 15  ASP B O   1 
ATOM   2250 C CB  . ASP B 2 16  ? 37.885 32.690  -2.466  1.00 53.80 ? 15  ASP B CB  1 
ATOM   2251 C CG  . ASP B 2 16  ? 38.954 31.757  -2.962  1.00 57.32 ? 15  ASP B CG  1 
ATOM   2252 O OD1 . ASP B 2 16  ? 38.800 30.513  -2.776  1.00 63.40 ? 15  ASP B OD1 1 
ATOM   2253 O OD2 . ASP B 2 16  ? 39.993 32.266  -3.431  1.00 59.81 ? 15  ASP B OD2 1 
ATOM   2254 N N   . PHE B 2 17  ? 37.065 35.190  -0.492  1.00 51.53 ? 16  PHE B N   1 
ATOM   2255 C CA  . PHE B 2 17  ? 36.017 36.074  -0.021  1.00 51.06 ? 16  PHE B CA  1 
ATOM   2256 C C   . PHE B 2 17  ? 34.702 35.811  -0.755  1.00 51.12 ? 16  PHE B C   1 
ATOM   2257 O O   . PHE B 2 17  ? 34.683 35.570  -1.961  1.00 52.07 ? 16  PHE B O   1 
ATOM   2258 C CB  . PHE B 2 17  ? 36.501 37.506  -0.202  1.00 50.88 ? 16  PHE B CB  1 
ATOM   2259 C CG  . PHE B 2 17  ? 35.557 38.547  0.296   1.00 50.33 ? 16  PHE B CG  1 
ATOM   2260 C CD1 . PHE B 2 17  ? 35.598 38.955  1.616   1.00 49.38 ? 16  PHE B CD1 1 
ATOM   2261 C CD2 . PHE B 2 17  ? 34.645 39.157  -0.579  1.00 48.66 ? 16  PHE B CD2 1 
ATOM   2262 C CE1 . PHE B 2 17  ? 34.722 39.955  2.077   1.00 52.21 ? 16  PHE B CE1 1 
ATOM   2263 C CE2 . PHE B 2 17  ? 33.762 40.134  -0.131  1.00 49.24 ? 16  PHE B CE2 1 
ATOM   2264 C CZ  . PHE B 2 17  ? 33.802 40.553  1.193   1.00 50.74 ? 16  PHE B CZ  1 
ATOM   2265 N N   . ILE B 2 18  ? 33.603 35.805  -0.014  1.00 51.21 ? 17  ILE B N   1 
ATOM   2266 C CA  . ILE B 2 18  ? 32.290 35.554  -0.597  1.00 50.60 ? 17  ILE B CA  1 
ATOM   2267 C C   . ILE B 2 18  ? 31.412 36.801  -0.471  1.00 50.83 ? 17  ILE B C   1 
ATOM   2268 O O   . ILE B 2 18  ? 31.366 37.426  0.583   1.00 51.05 ? 17  ILE B O   1 
ATOM   2269 C CB  . ILE B 2 18  ? 31.594 34.345  0.078   1.00 50.61 ? 17  ILE B CB  1 
ATOM   2270 C CG1 . ILE B 2 18  ? 32.469 33.082  -0.010  1.00 49.82 ? 17  ILE B CG1 1 
ATOM   2271 C CG2 . ILE B 2 18  ? 30.211 34.102  -0.533  1.00 49.95 ? 17  ILE B CG2 1 
ATOM   2272 C CD1 . ILE B 2 18  ? 31.823 31.856  0.623   1.00 48.74 ? 17  ILE B CD1 1 
ATOM   2273 N N   . ASN B 2 19  ? 30.737 37.160  -1.557  1.00 50.91 ? 18  ASN B N   1 
ATOM   2274 C CA  . ASN B 2 19  ? 29.735 38.221  -1.536  1.00 50.98 ? 18  ASN B CA  1 
ATOM   2275 C C   . ASN B 2 19  ? 28.409 37.643  -1.044  1.00 50.99 ? 18  ASN B C   1 
ATOM   2276 O O   . ASN B 2 19  ? 27.654 37.032  -1.809  1.00 50.05 ? 18  ASN B O   1 
ATOM   2277 C CB  . ASN B 2 19  ? 29.585 38.876  -2.920  1.00 50.60 ? 18  ASN B CB  1 
ATOM   2278 C CG  . ASN B 2 19  ? 28.762 40.159  -2.878  1.00 50.45 ? 18  ASN B CG  1 
ATOM   2279 O OD1 . ASN B 2 19  ? 28.450 40.693  -1.806  1.00 50.99 ? 18  ASN B OD1 1 
ATOM   2280 N ND2 . ASN B 2 19  ? 28.420 40.663  -4.050  1.00 51.24 ? 18  ASN B ND2 1 
ATOM   2281 N N   . PHE B 2 20  ? 28.161 37.817  0.250   1.00 51.66 ? 19  PHE B N   1 
ATOM   2282 C CA  . PHE B 2 20  ? 27.037 37.161  0.924   1.00 52.18 ? 19  PHE B CA  1 
ATOM   2283 C C   . PHE B 2 20  ? 25.741 37.769  0.550   1.00 52.69 ? 19  PHE B C   1 
ATOM   2284 O O   . PHE B 2 20  ? 24.695 37.126  0.628   1.00 53.16 ? 19  PHE B O   1 
ATOM   2285 C CB  . PHE B 2 20  ? 27.190 37.263  2.436   1.00 52.45 ? 19  PHE B CB  1 
ATOM   2286 C CG  . PHE B 2 20  ? 28.168 36.274  3.010   1.00 52.34 ? 19  PHE B CG  1 
ATOM   2287 C CD1 . PHE B 2 20  ? 29.339 36.711  3.596   1.00 52.38 ? 19  PHE B CD1 1 
ATOM   2288 C CD2 . PHE B 2 20  ? 27.908 34.902  2.946   1.00 52.88 ? 19  PHE B CD2 1 
ATOM   2289 C CE1 . PHE B 2 20  ? 30.246 35.799  4.132   1.00 56.64 ? 19  PHE B CE1 1 
ATOM   2290 C CE2 . PHE B 2 20  ? 28.819 33.975  3.473   1.00 54.50 ? 19  PHE B CE2 1 
ATOM   2291 C CZ  . PHE B 2 20  ? 29.992 34.424  4.070   1.00 53.40 ? 19  PHE B CZ  1 
ATOM   2292 N N   . SER B 2 21  ? 25.815 39.039  0.180   1.00 53.48 ? 20  SER B N   1 
ATOM   2293 C CA  . SER B 2 21  ? 24.658 39.783  -0.222  1.00 54.23 ? 20  SER B CA  1 
ATOM   2294 C C   . SER B 2 21  ? 24.333 39.537  -1.685  1.00 54.61 ? 20  SER B C   1 
ATOM   2295 O O   . SER B 2 21  ? 24.018 40.559  -2.381  1.00 55.75 ? 20  SER B O   1 
ATOM   2296 C CB  . SER B 2 21  ? 24.830 41.281  0.079   1.00 54.00 ? 20  SER B CB  1 
ATOM   2297 O OG  . SER B 2 21  ? 26.073 41.773  -0.436  1.00 54.28 ? 20  SER B OG  1 
ATOM   2298 N N   . SER B 2 22  ? 24.603 38.246  -2.340  1.00 54.75 ? 21  SER B N   1 
ATOM   2299 C CA  . SER B 2 22  ? 23.392 37.579  -3.070  1.00 55.40 ? 21  SER B CA  1 
ATOM   2300 C C   . SER B 2 22  ? 23.611 36.054  -2.947  1.00 55.33 ? 21  SER B C   1 
ATOM   2301 O O   . SER B 2 22  ? 24.731 35.576  -3.266  1.00 55.31 ? 21  SER B O   1 
ATOM   2302 C CB  . SER B 2 22  ? 23.339 38.041  -4.593  1.00 55.77 ? 21  SER B CB  1 
ATOM   2303 N N   . GLY B 2 27  ? 20.200 28.571  -4.447  1.00 60.01 ? 26  GLY B N   1 
ATOM   2304 C CA  . GLY B 2 27  ? 20.469 27.327  -3.730  1.00 60.12 ? 26  GLY B CA  1 
ATOM   2305 C C   . GLY B 2 27  ? 21.439 26.404  -4.481  1.00 60.30 ? 26  GLY B C   1 
ATOM   2306 O O   . GLY B 2 27  ? 21.845 25.359  -3.948  1.00 60.48 ? 26  GLY B O   1 
ATOM   2307 N N   . ASP B 2 28  ? 21.828 26.801  -5.698  1.00 60.40 ? 27  ASP B N   1 
ATOM   2308 C CA  . ASP B 2 28  ? 22.690 25.963  -6.555  1.00 60.41 ? 27  ASP B CA  1 
ATOM   2309 C C   . ASP B 2 28  ? 24.079 26.528  -6.942  1.00 60.30 ? 27  ASP B C   1 
ATOM   2310 O O   . ASP B 2 28  ? 24.199 27.351  -7.856  1.00 60.15 ? 27  ASP B O   1 
ATOM   2311 C CB  . ASP B 2 28  ? 21.914 25.508  -7.811  1.00 60.38 ? 27  ASP B CB  1 
ATOM   2312 N N   . THR B 2 29  ? 25.108 26.093  -6.207  1.00 60.27 ? 28  THR B N   1 
ATOM   2313 C CA  . THR B 2 29  ? 26.501 26.070  -6.681  1.00 60.17 ? 28  THR B CA  1 
ATOM   2314 C C   . THR B 2 29  ? 26.869 24.578  -6.732  1.00 60.12 ? 28  THR B C   1 
ATOM   2315 O O   . THR B 2 29  ? 27.578 24.045  -5.858  1.00 60.13 ? 28  THR B O   1 
ATOM   2316 C CB  . THR B 2 29  ? 27.429 26.858  -5.746  1.00 60.05 ? 28  THR B CB  1 
ATOM   2317 N N   . GLN B 2 30  ? 26.349 23.916  -7.768  1.00 59.92 ? 29  GLN B N   1 
ATOM   2318 C CA  . GLN B 2 30  ? 26.181 22.451  -7.809  1.00 59.77 ? 29  GLN B CA  1 
ATOM   2319 C C   . GLN B 2 30  ? 27.479 21.632  -7.887  1.00 59.39 ? 29  GLN B C   1 
ATOM   2320 O O   . GLN B 2 30  ? 27.600 20.575  -7.252  1.00 59.43 ? 29  GLN B O   1 
ATOM   2321 C CB  . GLN B 2 30  ? 25.211 22.078  -8.959  1.00 59.96 ? 29  GLN B CB  1 
ATOM   2322 C CG  . GLN B 2 30  ? 25.013 20.568  -9.246  1.00 60.12 ? 29  GLN B CG  1 
ATOM   2323 C CD  . GLN B 2 30  ? 24.496 19.779  -8.042  1.00 59.50 ? 29  GLN B CD  1 
ATOM   2324 O OE1 . GLN B 2 30  ? 23.624 20.251  -7.296  1.00 58.79 ? 29  GLN B OE1 1 
ATOM   2325 N NE2 . GLN B 2 30  ? 25.032 18.567  -7.857  1.00 59.05 ? 29  GLN B NE2 1 
ATOM   2326 N N   . ASN B 2 31  ? 28.436 22.130  -8.663  1.00 58.83 ? 30  ASN B N   1 
ATOM   2327 C CA  . ASN B 2 31  ? 29.686 21.426  -8.923  1.00 58.35 ? 30  ASN B CA  1 
ATOM   2328 C C   . ASN B 2 31  ? 30.477 21.041  -7.658  1.00 58.20 ? 30  ASN B C   1 
ATOM   2329 O O   . ASN B 2 31  ? 31.002 19.937  -7.579  1.00 58.26 ? 30  ASN B O   1 
ATOM   2330 C CB  . ASN B 2 31  ? 30.552 22.260  -9.876  1.00 58.31 ? 30  ASN B CB  1 
ATOM   2331 C CG  . ASN B 2 31  ? 29.736 22.906  -11.005 1.00 57.93 ? 30  ASN B CG  1 
ATOM   2332 O OD1 . ASN B 2 31  ? 28.594 22.518  -11.272 1.00 56.38 ? 30  ASN B OD1 1 
ATOM   2333 N ND2 . ASN B 2 31  ? 30.326 23.896  -11.668 1.00 57.76 ? 30  ASN B ND2 1 
ATOM   2334 N N   . ILE B 2 32  ? 30.489 21.935  -6.664  1.00 57.84 ? 31  ILE B N   1 
ATOM   2335 C CA  . ILE B 2 32  ? 31.410 21.906  -5.497  1.00 57.15 ? 31  ILE B CA  1 
ATOM   2336 C C   . ILE B 2 32  ? 31.682 20.537  -4.848  1.00 56.51 ? 31  ILE B C   1 
ATOM   2337 O O   . ILE B 2 32  ? 32.845 20.149  -4.686  1.00 56.55 ? 31  ILE B O   1 
ATOM   2338 C CB  . ILE B 2 32  ? 30.977 22.944  -4.401  1.00 57.13 ? 31  ILE B CB  1 
ATOM   2339 C CG1 . ILE B 2 32  ? 30.843 24.375  -4.988  1.00 57.92 ? 31  ILE B CG1 1 
ATOM   2340 C CG2 . ILE B 2 32  ? 31.929 22.902  -3.206  1.00 56.55 ? 31  ILE B CG2 1 
ATOM   2341 C CD1 . ILE B 2 32  ? 32.104 24.953  -5.752  1.00 57.86 ? 31  ILE B CD1 1 
ATOM   2342 N N   . ASP B 2 33  ? 30.621 19.812  -4.491  1.00 55.24 ? 32  ASP B N   1 
ATOM   2343 C CA  . ASP B 2 33  ? 30.766 18.475  -3.897  1.00 54.09 ? 32  ASP B CA  1 
ATOM   2344 C C   . ASP B 2 33  ? 31.294 17.385  -4.856  1.00 53.26 ? 32  ASP B C   1 
ATOM   2345 O O   . ASP B 2 33  ? 31.507 16.234  -4.437  1.00 52.50 ? 32  ASP B O   1 
ATOM   2346 C CB  . ASP B 2 33  ? 29.451 18.030  -3.245  1.00 54.27 ? 32  ASP B CB  1 
ATOM   2347 C CG  . ASP B 2 33  ? 28.323 17.823  -4.251  1.00 53.91 ? 32  ASP B CG  1 
ATOM   2348 O OD1 . ASP B 2 33  ? 28.591 17.545  -5.447  1.00 52.64 ? 32  ASP B OD1 1 
ATOM   2349 O OD2 . ASP B 2 33  ? 27.154 17.924  -3.822  1.00 53.65 ? 32  ASP B OD2 1 
ATOM   2350 N N   . SER B 2 34  ? 31.495 17.745  -6.129  1.00 52.21 ? 33  SER B N   1 
ATOM   2351 C CA  . SER B 2 34  ? 32.081 16.826  -7.112  1.00 51.46 ? 33  SER B CA  1 
ATOM   2352 C C   . SER B 2 34  ? 33.465 16.436  -6.626  1.00 50.70 ? 33  SER B C   1 
ATOM   2353 O O   . SER B 2 34  ? 34.033 15.421  -7.055  1.00 50.61 ? 33  SER B O   1 
ATOM   2354 C CB  . SER B 2 34  ? 32.180 17.480  -8.494  1.00 51.40 ? 33  SER B CB  1 
ATOM   2355 O OG  . SER B 2 34  ? 33.106 18.564  -8.488  1.00 51.91 ? 33  SER B OG  1 
ATOM   2356 N N   . TRP B 2 35  ? 33.973 17.270  -5.718  1.00 49.67 ? 34  TRP B N   1 
ATOM   2357 C CA  . TRP B 2 35  ? 35.292 17.148  -5.103  1.00 49.02 ? 34  TRP B CA  1 
ATOM   2358 C C   . TRP B 2 35  ? 35.501 15.791  -4.438  1.00 48.81 ? 34  TRP B C   1 
ATOM   2359 O O   . TRP B 2 35  ? 36.619 15.312  -4.380  1.00 48.49 ? 34  TRP B O   1 
ATOM   2360 C CB  . TRP B 2 35  ? 35.482 18.282  -4.080  1.00 48.09 ? 34  TRP B CB  1 
ATOM   2361 C CG  . TRP B 2 35  ? 36.778 18.253  -3.321  1.00 47.41 ? 34  TRP B CG  1 
ATOM   2362 C CD1 . TRP B 2 35  ? 37.967 18.798  -3.718  1.00 47.09 ? 34  TRP B CD1 1 
ATOM   2363 C CD2 . TRP B 2 35  ? 37.018 17.669  -2.025  1.00 46.27 ? 34  TRP B CD2 1 
ATOM   2364 N NE1 . TRP B 2 35  ? 38.931 18.597  -2.759  1.00 46.51 ? 34  TRP B NE1 1 
ATOM   2365 C CE2 . TRP B 2 35  ? 38.385 17.904  -1.711  1.00 45.73 ? 34  TRP B CE2 1 
ATOM   2366 C CE3 . TRP B 2 35  ? 36.214 16.970  -1.104  1.00 46.81 ? 34  TRP B CE3 1 
ATOM   2367 C CZ2 . TRP B 2 35  ? 38.974 17.465  -0.529  1.00 44.86 ? 34  TRP B CZ2 1 
ATOM   2368 C CZ3 . TRP B 2 35  ? 36.793 16.530  0.085   1.00 47.79 ? 34  TRP B CZ3 1 
ATOM   2369 C CH2 . TRP B 2 35  ? 38.171 16.797  0.365   1.00 47.88 ? 34  TRP B CH2 1 
ATOM   2370 N N   . PHE B 2 36  ? 34.430 15.188  -3.932  1.00 49.45 ? 35  PHE B N   1 
ATOM   2371 C CA  . PHE B 2 36  ? 34.513 13.881  -3.256  1.00 50.25 ? 35  PHE B CA  1 
ATOM   2372 C C   . PHE B 2 36  ? 34.838 12.732  -4.215  1.00 50.89 ? 35  PHE B C   1 
ATOM   2373 O O   . PHE B 2 36  ? 35.823 12.001  -4.023  1.00 50.36 ? 35  PHE B O   1 
ATOM   2374 C CB  . PHE B 2 36  ? 33.224 13.579  -2.467  1.00 49.84 ? 35  PHE B CB  1 
ATOM   2375 C CG  . PHE B 2 36  ? 33.070 14.421  -1.235  1.00 50.06 ? 35  PHE B CG  1 
ATOM   2376 C CD1 . PHE B 2 36  ? 32.233 15.536  -1.241  1.00 49.71 ? 35  PHE B CD1 1 
ATOM   2377 C CD2 . PHE B 2 36  ? 33.794 14.125  -0.076  1.00 48.63 ? 35  PHE B CD2 1 
ATOM   2378 C CE1 . PHE B 2 36  ? 32.114 16.338  -0.111  1.00 49.25 ? 35  PHE B CE1 1 
ATOM   2379 C CE2 . PHE B 2 36  ? 33.674 14.909  1.056   1.00 48.38 ? 35  PHE B CE2 1 
ATOM   2380 C CZ  . PHE B 2 36  ? 32.837 16.020  1.045   1.00 48.75 ? 35  PHE B CZ  1 
ATOM   2381 N N   . GLU B 2 37  ? 34.012 12.579  -5.246  1.00 52.05 ? 36  GLU B N   1 
ATOM   2382 C CA  . GLU B 2 37  ? 34.215 11.488  -6.187  1.00 53.71 ? 36  GLU B CA  1 
ATOM   2383 C C   . GLU B 2 37  ? 35.521 11.666  -6.961  1.00 54.50 ? 36  GLU B C   1 
ATOM   2384 O O   . GLU B 2 37  ? 36.175 10.680  -7.278  1.00 54.66 ? 36  GLU B O   1 
ATOM   2385 C CB  . GLU B 2 37  ? 33.007 11.281  -7.109  1.00 53.69 ? 36  GLU B CB  1 
ATOM   2386 C CG  . GLU B 2 37  ? 32.787 12.363  -8.157  1.00 54.88 ? 36  GLU B CG  1 
ATOM   2387 C CD  . GLU B 2 37  ? 32.517 11.766  -9.539  1.00 55.96 ? 36  GLU B CD  1 
ATOM   2388 O OE1 . GLU B 2 37  ? 31.822 10.720  -9.631  1.00 56.24 ? 36  GLU B OE1 1 
ATOM   2389 O OE2 . GLU B 2 37  ? 33.011 12.344  -10.534 1.00 56.13 ? 36  GLU B OE2 1 
ATOM   2390 N N   . GLU B 2 38  ? 35.905 12.923  -7.210  1.00 55.50 ? 37  GLU B N   1 
ATOM   2391 C CA  . GLU B 2 38  ? 37.186 13.267  -7.850  1.00 56.55 ? 37  GLU B CA  1 
ATOM   2392 C C   . GLU B 2 38  ? 38.383 12.861  -7.009  1.00 56.71 ? 37  GLU B C   1 
ATOM   2393 O O   . GLU B 2 38  ? 39.347 12.310  -7.528  1.00 56.70 ? 37  GLU B O   1 
ATOM   2394 C CB  . GLU B 2 38  ? 37.238 14.758  -8.188  1.00 56.46 ? 37  GLU B CB  1 
ATOM   2395 C CG  . GLU B 2 38  ? 36.360 15.094  -9.396  1.00 57.83 ? 37  GLU B CG  1 
ATOM   2396 C CD  . GLU B 2 38  ? 36.040 16.581  -9.557  1.00 58.11 ? 37  GLU B CD  1 
ATOM   2397 O OE1 . GLU B 2 38  ? 36.307 17.398  -8.627  1.00 58.53 ? 37  GLU B OE1 1 
ATOM   2398 O OE2 . GLU B 2 38  ? 35.501 16.923  -10.641 1.00 59.14 ? 37  GLU B OE2 1 
ATOM   2399 N N   . LYS B 2 39  ? 38.300 13.129  -5.710  1.00 57.31 ? 38  LYS B N   1 
ATOM   2400 C CA  . LYS B 2 39  ? 39.293 12.681  -4.744  1.00 58.03 ? 38  LYS B CA  1 
ATOM   2401 C C   . LYS B 2 39  ? 39.300 11.151  -4.591  1.00 58.21 ? 38  LYS B C   1 
ATOM   2402 O O   . LYS B 2 39  ? 40.346 10.553  -4.340  1.00 58.07 ? 38  LYS B O   1 
ATOM   2403 C CB  . LYS B 2 39  ? 39.056 13.368  -3.390  1.00 58.59 ? 38  LYS B CB  1 
ATOM   2404 C CG  . LYS B 2 39  ? 39.592 14.819  -3.307  1.00 59.33 ? 38  LYS B CG  1 
ATOM   2405 C CD  . LYS B 2 39  ? 41.078 14.862  -2.929  1.00 61.46 ? 38  LYS B CD  1 
ATOM   2406 C CE  . LYS B 2 39  ? 41.451 13.841  -1.809  1.00 62.67 ? 38  LYS B CE  1 
ATOM   2407 N NZ  . LYS B 2 39  ? 40.616 13.915  -0.551  1.00 60.69 ? 38  LYS B NZ  1 
ATOM   2408 N N   . ALA B 2 40  ? 38.132 10.526  -4.729  1.00 58.41 ? 39  ALA B N   1 
ATOM   2409 C CA  . ALA B 2 40  ? 38.054 9.068   -4.787  1.00 58.79 ? 39  ALA B CA  1 
ATOM   2410 C C   . ALA B 2 40  ? 38.616 8.588   -6.130  1.00 59.04 ? 39  ALA B C   1 
ATOM   2411 O O   . ALA B 2 40  ? 39.318 7.573   -6.195  1.00 58.94 ? 39  ALA B O   1 
ATOM   2412 C CB  . ALA B 2 40  ? 36.607 8.589   -4.600  1.00 58.53 ? 39  ALA B CB  1 
ATOM   2413 N N   . ASN B 2 41  ? 38.316 9.345   -7.188  1.00 59.25 ? 40  ASN B N   1 
ATOM   2414 C CA  . ASN B 2 41  ? 38.710 9.002   -8.550  1.00 59.60 ? 40  ASN B CA  1 
ATOM   2415 C C   . ASN B 2 41  ? 40.196 9.189   -8.822  1.00 59.69 ? 40  ASN B C   1 
ATOM   2416 O O   . ASN B 2 41  ? 40.693 8.751   -9.854  1.00 59.89 ? 40  ASN B O   1 
ATOM   2417 C CB  . ASN B 2 41  ? 37.872 9.777   -9.581  1.00 59.64 ? 40  ASN B CB  1 
ATOM   2418 C CG  . ASN B 2 41  ? 36.462 9.189   -9.776  1.00 60.42 ? 40  ASN B CG  1 
ATOM   2419 O OD1 . ASN B 2 41  ? 36.223 7.995   -9.547  1.00 61.91 ? 40  ASN B OD1 1 
ATOM   2420 N ND2 . ASN B 2 41  ? 35.529 10.033  -10.221 1.00 60.41 ? 40  ASN B ND2 1 
ATOM   2421 N N   . LEU B 2 42  ? 40.896 9.851   -7.901  1.00 60.02 ? 41  LEU B N   1 
ATOM   2422 C CA  . LEU B 2 42  ? 42.356 9.958   -7.953  1.00 60.17 ? 41  LEU B CA  1 
ATOM   2423 C C   . LEU B 2 42  ? 42.962 8.564   -8.097  1.00 60.32 ? 41  LEU B C   1 
ATOM   2424 O O   . LEU B 2 42  ? 42.635 7.653   -7.318  1.00 60.24 ? 41  LEU B O   1 
ATOM   2425 C CB  . LEU B 2 42  ? 42.900 10.665  -6.701  1.00 60.08 ? 41  LEU B CB  1 
ATOM   2426 C CG  . LEU B 2 42  ? 43.369 12.128  -6.785  1.00 60.49 ? 41  LEU B CG  1 
ATOM   2427 C CD1 . LEU B 2 42  ? 42.577 12.990  -7.790  1.00 60.80 ? 41  LEU B CD1 1 
ATOM   2428 C CD2 . LEU B 2 42  ? 43.358 12.766  -5.395  1.00 60.45 ? 41  LEU B CD2 1 
ATOM   2429 N N   . GLU B 2 43  ? 43.831 8.408   -9.102  1.00 60.32 ? 42  GLU B N   1 
ATOM   2430 C CA  . GLU B 2 43  ? 44.359 7.101   -9.494  1.00 60.38 ? 42  GLU B CA  1 
ATOM   2431 C C   . GLU B 2 43  ? 45.764 6.822   -8.957  1.00 60.18 ? 42  GLU B C   1 
ATOM   2432 O O   . GLU B 2 43  ? 46.606 6.224   -9.643  1.00 59.89 ? 42  GLU B O   1 
ATOM   2433 C CB  . GLU B 2 43  ? 44.353 6.965   -11.018 1.00 60.65 ? 42  GLU B CB  1 
ATOM   2434 C CG  . GLU B 2 43  ? 43.063 7.414   -11.692 1.00 61.09 ? 42  GLU B CG  1 
ATOM   2435 C CD  . GLU B 2 43  ? 43.257 7.626   -13.185 1.00 61.80 ? 42  GLU B CD  1 
ATOM   2436 O OE1 . GLU B 2 43  ? 44.431 7.675   -13.653 1.00 61.39 ? 42  GLU B OE1 1 
ATOM   2437 O OE2 . GLU B 2 43  ? 42.232 7.744   -13.894 1.00 62.48 ? 42  GLU B OE2 1 
HETATM 2438 N N1  . VX6 C 3 .   ? 19.620 30.120  22.355  1.00 52.50 ? 500 VX6 A N1  1 
HETATM 2439 C C2  . VX6 C 3 .   ? 19.783 30.582  20.984  1.00 52.99 ? 500 VX6 A C2  1 
HETATM 2440 C C3  . VX6 C 3 .   ? 20.927 29.979  20.199  1.00 54.05 ? 500 VX6 A C3  1 
HETATM 2441 N N4  . VX6 C 3 .   ? 22.099 29.731  21.000  1.00 51.88 ? 500 VX6 A N4  1 
HETATM 2442 C C5  . VX6 C 3 .   ? 22.071 29.512  22.445  1.00 52.04 ? 500 VX6 A C5  1 
HETATM 2443 C C6  . VX6 C 3 .   ? 20.647 29.220  22.903  1.00 52.88 ? 500 VX6 A C6  1 
HETATM 2444 C C7  . VX6 C 3 .   ? 18.372 29.394  22.379  1.00 53.24 ? 500 VX6 A C7  1 
HETATM 2445 C C8  . VX6 C 3 .   ? 23.165 29.172  20.301  1.00 52.91 ? 500 VX6 A C8  1 
HETATM 2446 C C9  . VX6 C 3 .   ? 23.159 29.209  18.925  1.00 53.42 ? 500 VX6 A C9  1 
HETATM 2447 C C10 . VX6 C 3 .   ? 24.254 28.658  18.281  1.00 54.26 ? 500 VX6 A C10 1 
HETATM 2448 N N11 . VX6 C 3 .   ? 25.272 28.106  18.974  1.00 54.07 ? 500 VX6 A N11 1 
HETATM 2449 C C12 . VX6 C 3 .   ? 25.198 28.108  20.302  1.00 50.54 ? 500 VX6 A C12 1 
HETATM 2450 N N13 . VX6 C 3 .   ? 24.192 28.637  20.977  1.00 51.89 ? 500 VX6 A N13 1 
HETATM 2451 N N14 . VX6 C 3 .   ? 24.224 28.718  16.859  1.00 52.35 ? 500 VX6 A N14 1 
HETATM 2452 C C15 . VX6 C 3 .   ? 25.196 28.409  15.944  1.00 51.98 ? 500 VX6 A C15 1 
HETATM 2453 C C17 . VX6 C 3 .   ? 26.466 27.860  16.261  1.00 48.14 ? 500 VX6 A C17 1 
HETATM 2454 C C18 . VX6 C 3 .   ? 27.114 27.686  15.058  1.00 50.42 ? 500 VX6 A C18 1 
HETATM 2455 N N19 . VX6 C 3 .   ? 26.248 28.131  14.096  1.00 51.52 ? 500 VX6 A N19 1 
HETATM 2456 N N20 . VX6 C 3 .   ? 25.083 28.562  14.612  1.00 50.36 ? 500 VX6 A N20 1 
HETATM 2457 C C21 . VX6 C 3 .   ? 28.442 27.146  14.724  1.00 50.40 ? 500 VX6 A C21 1 
HETATM 2458 S S23 . VX6 C 3 .   ? 26.528 27.432  21.280  1.00 54.91 ? 500 VX6 A S23 1 
HETATM 2459 C C24 . VX6 C 3 .   ? 27.263 26.342  20.103  1.00 53.68 ? 500 VX6 A C24 1 
HETATM 2460 C C25 . VX6 C 3 .   ? 28.375 26.752  19.403  1.00 53.65 ? 500 VX6 A C25 1 
HETATM 2461 C C26 . VX6 C 3 .   ? 28.935 25.923  18.464  1.00 52.03 ? 500 VX6 A C26 1 
HETATM 2462 C C27 . VX6 C 3 .   ? 28.387 24.683  18.243  1.00 51.79 ? 500 VX6 A C27 1 
HETATM 2463 C C28 . VX6 C 3 .   ? 27.287 24.259  18.959  1.00 52.80 ? 500 VX6 A C28 1 
HETATM 2464 C C29 . VX6 C 3 .   ? 26.725 25.094  19.891  1.00 52.62 ? 500 VX6 A C29 1 
HETATM 2465 N N30 . VX6 C 3 .   ? 28.916 23.794  17.297  1.00 51.65 ? 500 VX6 A N30 1 
HETATM 2466 C C31 . VX6 C 3 .   ? 30.100 23.953  16.600  1.00 53.74 ? 500 VX6 A C31 1 
HETATM 2467 O O32 . VX6 C 3 .   ? 30.999 24.802  16.742  1.00 52.60 ? 500 VX6 A O32 1 
HETATM 2468 C C33 . VX6 C 3 .   ? 30.204 22.902  15.568  1.00 50.59 ? 500 VX6 A C33 1 
HETATM 2469 C C34 . VX6 C 3 .   ? 31.031 23.219  14.361  1.00 50.77 ? 500 VX6 A C34 1 
HETATM 2470 C C35 . VX6 C 3 .   ? 31.533 22.231  15.376  1.00 51.25 ? 500 VX6 A C35 1 
HETATM 2471 S S   . SO4 D 4 .   ? 20.784 5.021   1.762   1.00 76.98 ? 600 SO4 A S   1 
HETATM 2472 O O1  . SO4 D 4 .   ? 20.845 6.510   1.657   1.00 73.90 ? 600 SO4 A O1  1 
HETATM 2473 O O2  . SO4 D 4 .   ? 21.186 4.410   3.082   1.00 72.50 ? 600 SO4 A O2  1 
HETATM 2474 O O3  . SO4 D 4 .   ? 19.376 4.718   1.413   1.00 76.61 ? 600 SO4 A O3  1 
HETATM 2475 O O4  . SO4 D 4 .   ? 21.669 4.385   0.740   1.00 77.84 ? 600 SO4 A O4  1 
HETATM 2476 O O   . HOH E 5 .   ? 26.061 3.237   21.457  1.00 46.28 ? 1   HOH A O   1 
HETATM 2477 O O   . HOH E 5 .   ? 21.287 -7.363  17.911  1.00 49.68 ? 2   HOH A O   1 
HETATM 2478 O O   . HOH E 5 .   ? 17.971 0.592   28.623  1.00 39.79 ? 3   HOH A O   1 
HETATM 2479 O O   . HOH E 5 .   ? 35.374 30.810  1.458   1.00 43.69 ? 4   HOH A O   1 
HETATM 2480 O O   . HOH E 5 .   ? 23.859 4.948   25.876  1.00 54.82 ? 5   HOH A O   1 
HETATM 2481 O O   . HOH E 5 .   ? 16.065 4.361   29.666  1.00 47.13 ? 6   HOH A O   1 
HETATM 2482 O O   . HOH E 5 .   ? 15.639 27.582  20.674  1.00 46.96 ? 7   HOH A O   1 
HETATM 2483 O O   . HOH E 5 .   ? 28.366 9.786   26.374  1.00 46.64 ? 9   HOH A O   1 
HETATM 2484 O O   . HOH E 5 .   ? 37.200 24.196  19.783  1.00 38.66 ? 10  HOH A O   1 
HETATM 2485 O O   . HOH E 5 .   ? 34.583 24.880  20.165  1.00 43.38 ? 11  HOH A O   1 
HETATM 2486 O O   . HOH E 5 .   ? 31.067 25.754  1.601   1.00 60.81 ? 12  HOH A O   1 
HETATM 2487 O O   . HOH E 5 .   ? 18.944 4.462   29.801  1.00 42.66 ? 13  HOH A O   1 
HETATM 2488 O O   . HOH E 5 .   ? 16.466 15.073  29.260  1.00 44.82 ? 14  HOH A O   1 
HETATM 2489 O O   . HOH E 5 .   ? 32.401 30.305  28.711  1.00 50.63 ? 15  HOH A O   1 
HETATM 2490 O O   . HOH E 5 .   ? 32.603 20.653  12.305  1.00 45.10 ? 16  HOH A O   1 
HETATM 2491 O O   . HOH E 5 .   ? 18.698 28.861  26.613  1.00 56.98 ? 17  HOH A O   1 
HETATM 2492 O O   . HOH E 5 .   ? 31.788 14.249  13.129  1.00 44.83 ? 18  HOH A O   1 
HETATM 2493 O O   . HOH E 5 .   ? 46.029 15.004  13.386  1.00 62.58 ? 19  HOH A O   1 
HETATM 2494 O O   . HOH E 5 .   ? 39.181 14.888  11.786  1.00 47.89 ? 20  HOH A O   1 
HETATM 2495 O O   . HOH E 5 .   ? 25.608 22.106  3.557   1.00 56.42 ? 21  HOH A O   1 
HETATM 2496 O O   . HOH E 5 .   ? 34.622 43.081  4.624   1.00 47.71 ? 22  HOH A O   1 
HETATM 2497 O O   . HOH E 5 .   ? 44.242 32.556  5.074   1.00 46.62 ? 24  HOH A O   1 
HETATM 2498 O O   . HOH E 5 .   ? 29.780 6.508   3.530   1.00 56.57 ? 25  HOH A O   1 
HETATM 2499 O O   . HOH E 5 .   ? 40.626 19.006  14.680  1.00 51.72 ? 26  HOH A O   1 
HETATM 2500 O O   . HOH E 5 .   ? 22.981 24.479  5.695   1.00 46.75 ? 27  HOH A O   1 
HETATM 2501 O O   . HOH E 5 .   ? 24.637 15.503  23.045  1.00 46.68 ? 28  HOH A O   1 
HETATM 2502 O O   . HOH E 5 .   ? 22.609 35.163  9.538   1.00 50.76 ? 29  HOH A O   1 
HETATM 2503 O O   . HOH E 5 .   ? 8.656  10.829  24.008  1.00 43.19 ? 30  HOH A O   1 
HETATM 2504 O O   . HOH E 5 .   ? 49.021 29.906  18.368  1.00 40.46 ? 31  HOH A O   1 
HETATM 2505 O O   . HOH E 5 .   ? 30.236 39.335  1.549   1.00 43.38 ? 32  HOH A O   1 
HETATM 2506 O O   . HOH E 5 .   ? 27.707 21.428  17.463  1.00 42.08 ? 33  HOH A O   1 
HETATM 2507 O O   . HOH E 5 .   ? 22.314 38.149  8.641   1.00 51.46 ? 34  HOH A O   1 
HETATM 2508 O O   . HOH E 5 .   ? 8.128  17.696  21.701  1.00 52.53 ? 35  HOH A O   1 
HETATM 2509 O O   . HOH E 5 .   ? 32.750 23.856  18.070  1.00 46.56 ? 36  HOH A O   1 
HETATM 2510 O O   . HOH E 5 .   ? 28.417 1.224   35.827  1.00 65.52 ? 37  HOH A O   1 
HETATM 2511 O O   . HOH E 5 .   ? 8.601  -1.158  27.753  1.00 55.77 ? 38  HOH A O   1 
HETATM 2512 O O   . HOH E 5 .   ? 37.064 15.171  10.531  1.00 49.77 ? 39  HOH A O   1 
HETATM 2513 O O   . HOH E 5 .   ? 25.963 -5.345  31.218  1.00 53.59 ? 40  HOH A O   1 
HETATM 2514 O O   . HOH E 5 .   ? 27.457 -10.161 33.511  1.00 47.58 ? 41  HOH A O   1 
HETATM 2515 O O   . HOH E 5 .   ? 7.285  14.290  27.814  1.00 52.25 ? 42  HOH A O   1 
HETATM 2516 O O   . HOH E 5 .   ? 6.587  20.048  20.002  1.00 55.88 ? 43  HOH A O   1 
HETATM 2517 O O   . HOH E 5 .   ? 43.549 5.337   13.181  1.00 61.53 ? 44  HOH A O   1 
HETATM 2518 O O   . HOH E 5 .   ? 38.144 21.480  15.456  1.00 47.62 ? 45  HOH A O   1 
HETATM 2519 O O   . HOH E 5 .   ? 8.237  19.606  3.770   1.00 56.59 ? 46  HOH A O   1 
HETATM 2520 O O   . HOH E 5 .   ? 6.954  4.430   31.743  1.00 61.25 ? 47  HOH A O   1 
HETATM 2521 O O   . HOH E 5 .   ? 18.405 24.948  21.580  1.00 50.54 ? 49  HOH A O   1 
HETATM 2522 O O   . HOH E 5 .   ? 4.102  11.997  21.286  1.00 53.71 ? 50  HOH A O   1 
HETATM 2523 O O   . HOH E 5 .   ? 26.755 26.757  25.680  1.00 59.74 ? 51  HOH A O   1 
HETATM 2524 O O   . HOH E 5 .   ? 23.423 4.238   3.841   1.00 56.59 ? 52  HOH A O   1 
HETATM 2525 O O   . HOH E 5 .   ? 6.681  -3.311  19.178  1.00 67.33 ? 53  HOH A O   1 
HETATM 2526 O O   . HOH E 5 .   ? 24.244 25.684  24.779  1.00 53.02 ? 54  HOH A O   1 
HETATM 2527 O O   . HOH E 5 .   ? 26.927 34.269  25.958  1.00 57.11 ? 55  HOH A O   1 
HETATM 2528 O O   . HOH E 5 .   ? 51.672 28.668  10.658  1.00 48.30 ? 56  HOH A O   1 
HETATM 2529 O O   . HOH E 5 .   ? 35.725 7.740   23.140  1.00 53.85 ? 57  HOH A O   1 
HETATM 2530 O O   . HOH E 5 .   ? 21.602 29.750  5.965   1.00 54.70 ? 58  HOH A O   1 
HETATM 2531 O O   . HOH F 5 .   ? 42.367 27.538  0.581   1.00 55.53 ? 44  HOH B O   1 
HETATM 2532 O O   . HOH F 5 .   ? 50.612 27.382  6.203   1.00 54.94 ? 45  HOH B O   1 
HETATM 2533 O O   . HOH F 5 .   ? 25.943 38.459  -4.394  1.00 60.88 ? 46  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   124 ?   ?   ?   A . n 
A 1 2   LYS 2   125 125 LYS LYS A . n 
A 1 3   ARG 3   126 126 ARG ARG A . n 
A 1 4   GLN 4   127 127 GLN GLN A . n 
A 1 5   TRP 5   128 128 TRP TRP A . n 
A 1 6   ALA 6   129 129 ALA ALA A . n 
A 1 7   LEU 7   130 130 LEU LEU A . n 
A 1 8   GLU 8   131 131 GLU GLU A . n 
A 1 9   ASP 9   132 132 ASP ASP A . n 
A 1 10  PHE 10  133 133 PHE PHE A . n 
A 1 11  GLU 11  134 134 GLU GLU A . n 
A 1 12  ILE 12  135 135 ILE ILE A . n 
A 1 13  GLY 13  136 136 GLY GLY A . n 
A 1 14  ARG 14  137 137 ARG ARG A . n 
A 1 15  PRO 15  138 138 PRO PRO A . n 
A 1 16  LEU 16  139 139 LEU LEU A . n 
A 1 17  GLY 17  140 140 GLY GLY A . n 
A 1 18  LYS 18  141 141 LYS LYS A . n 
A 1 19  GLY 19  142 142 GLY GLY A . n 
A 1 20  LYS 20  143 143 LYS LYS A . n 
A 1 21  PHE 21  144 144 PHE PHE A . n 
A 1 22  GLY 22  145 145 GLY GLY A . n 
A 1 23  ASN 23  146 146 ASN ASN A . n 
A 1 24  VAL 24  147 147 VAL VAL A . n 
A 1 25  TYR 25  148 148 TYR TYR A . n 
A 1 26  LEU 26  149 149 LEU LEU A . n 
A 1 27  ALA 27  150 150 ALA ALA A . n 
A 1 28  ARG 28  151 151 ARG ARG A . n 
A 1 29  GLU 29  152 152 GLU GLU A . n 
A 1 30  LYS 30  153 153 LYS LYS A . n 
A 1 31  GLN 31  154 154 GLN GLN A . n 
A 1 32  SER 32  155 155 SER SER A . n 
A 1 33  LYS 33  156 156 LYS LYS A . n 
A 1 34  PHE 34  157 157 PHE PHE A . n 
A 1 35  ILE 35  158 158 ILE ILE A . n 
A 1 36  LEU 36  159 159 LEU LEU A . n 
A 1 37  ALA 37  160 160 ALA ALA A . n 
A 1 38  LEU 38  161 161 LEU LEU A . n 
A 1 39  LYS 39  162 162 LYS LYS A . n 
A 1 40  VAL 40  163 163 VAL VAL A . n 
A 1 41  LEU 41  164 164 LEU LEU A . n 
A 1 42  PHE 42  165 165 PHE PHE A . n 
A 1 43  LYS 43  166 166 LYS LYS A . n 
A 1 44  ALA 44  167 167 ALA ALA A . n 
A 1 45  GLN 45  168 168 GLN GLN A . n 
A 1 46  LEU 46  169 169 LEU LEU A . n 
A 1 47  GLU 47  170 170 GLU GLU A . n 
A 1 48  LYS 48  171 171 LYS LYS A . n 
A 1 49  ALA 49  172 172 ALA ALA A . n 
A 1 50  GLY 50  173 173 GLY GLY A . n 
A 1 51  VAL 51  174 174 VAL VAL A . n 
A 1 52  GLU 52  175 175 GLU GLU A . n 
A 1 53  HIS 53  176 176 HIS HIS A . n 
A 1 54  GLN 54  177 177 GLN GLN A . n 
A 1 55  LEU 55  178 178 LEU LEU A . n 
A 1 56  ARG 56  179 179 ARG ARG A . n 
A 1 57  ARG 57  180 180 ARG ARG A . n 
A 1 58  GLU 58  181 181 GLU GLU A . n 
A 1 59  VAL 59  182 182 VAL VAL A . n 
A 1 60  GLU 60  183 183 GLU GLU A . n 
A 1 61  ILE 61  184 184 ILE ILE A . n 
A 1 62  GLN 62  185 185 GLN GLN A . n 
A 1 63  SER 63  186 186 SER SER A . n 
A 1 64  HIS 64  187 187 HIS HIS A . n 
A 1 65  LEU 65  188 188 LEU LEU A . n 
A 1 66  ARG 66  189 189 ARG ARG A . n 
A 1 67  HIS 67  190 190 HIS HIS A . n 
A 1 68  PRO 68  191 191 PRO PRO A . n 
A 1 69  ASN 69  192 192 ASN ASN A . n 
A 1 70  ILE 70  193 193 ILE ILE A . n 
A 1 71  LEU 71  194 194 LEU LEU A . n 
A 1 72  ARG 72  195 195 ARG ARG A . n 
A 1 73  LEU 73  196 196 LEU LEU A . n 
A 1 74  TYR 74  197 197 TYR TYR A . n 
A 1 75  GLY 75  198 198 GLY GLY A . n 
A 1 76  TYR 76  199 199 TYR TYR A . n 
A 1 77  PHE 77  200 200 PHE PHE A . n 
A 1 78  HIS 78  201 201 HIS HIS A . n 
A 1 79  ASP 79  202 202 ASP ASP A . n 
A 1 80  ALA 80  203 203 ALA ALA A . n 
A 1 81  THR 81  204 204 THR THR A . n 
A 1 82  ARG 82  205 205 ARG ARG A . n 
A 1 83  VAL 83  206 206 VAL VAL A . n 
A 1 84  TYR 84  207 207 TYR TYR A . n 
A 1 85  LEU 85  208 208 LEU LEU A . n 
A 1 86  ILE 86  209 209 ILE ILE A . n 
A 1 87  LEU 87  210 210 LEU LEU A . n 
A 1 88  GLU 88  211 211 GLU GLU A . n 
A 1 89  TYR 89  212 212 TYR TYR A . n 
A 1 90  ALA 90  213 213 ALA ALA A . n 
A 1 91  PRO 91  214 214 PRO PRO A . n 
A 1 92  LEU 92  215 215 LEU LEU A . n 
A 1 93  GLY 93  216 216 GLY GLY A . n 
A 1 94  THR 94  217 217 THR THR A . n 
A 1 95  VAL 95  218 218 VAL VAL A . n 
A 1 96  TYR 96  219 219 TYR TYR A . n 
A 1 97  ARG 97  220 220 ARG ARG A . n 
A 1 98  GLU 98  221 221 GLU GLU A . n 
A 1 99  LEU 99  222 222 LEU LEU A . n 
A 1 100 GLN 100 223 223 GLN GLN A . n 
A 1 101 LYS 101 224 224 LYS LYS A . n 
A 1 102 LEU 102 225 225 LEU LEU A . n 
A 1 103 SER 103 226 226 SER SER A . n 
A 1 104 LYS 104 227 227 LYS LYS A . n 
A 1 105 PHE 105 228 228 PHE PHE A . n 
A 1 106 ASP 106 229 229 ASP ASP A . n 
A 1 107 GLU 107 230 230 GLU GLU A . n 
A 1 108 GLN 108 231 231 GLN GLN A . n 
A 1 109 ARG 109 232 232 ARG ARG A . n 
A 1 110 THR 110 233 233 THR THR A . n 
A 1 111 ALA 111 234 234 ALA ALA A . n 
A 1 112 THR 112 235 235 THR THR A . n 
A 1 113 TYR 113 236 236 TYR TYR A . n 
A 1 114 ILE 114 237 237 ILE ILE A . n 
A 1 115 THR 115 238 238 THR THR A . n 
A 1 116 GLU 116 239 239 GLU GLU A . n 
A 1 117 LEU 117 240 240 LEU LEU A . n 
A 1 118 ALA 118 241 241 ALA ALA A . n 
A 1 119 ASN 119 242 242 ASN ASN A . n 
A 1 120 ALA 120 243 243 ALA ALA A . n 
A 1 121 LEU 121 244 244 LEU LEU A . n 
A 1 122 SER 122 245 245 SER SER A . n 
A 1 123 TYR 123 246 246 TYR TYR A . n 
A 1 124 CYS 124 247 247 CYS CYS A . n 
A 1 125 HIS 125 248 248 HIS HIS A . n 
A 1 126 SER 126 249 249 SER SER A . n 
A 1 127 LYS 127 250 250 LYS LYS A . n 
A 1 128 ARG 128 251 251 ARG ARG A . n 
A 1 129 VAL 129 252 252 VAL VAL A . n 
A 1 130 ILE 130 253 253 ILE ILE A . n 
A 1 131 HIS 131 254 254 HIS HIS A . n 
A 1 132 ARG 132 255 255 ARG ARG A . n 
A 1 133 ASP 133 256 256 ASP ASP A . n 
A 1 134 ILE 134 257 257 ILE ILE A . n 
A 1 135 LYS 135 258 258 LYS LYS A . n 
A 1 136 PRO 136 259 259 PRO PRO A . n 
A 1 137 GLU 137 260 260 GLU GLU A . n 
A 1 138 ASN 138 261 261 ASN ASN A . n 
A 1 139 LEU 139 262 262 LEU LEU A . n 
A 1 140 LEU 140 263 263 LEU LEU A . n 
A 1 141 LEU 141 264 264 LEU LEU A . n 
A 1 142 GLY 142 265 265 GLY GLY A . n 
A 1 143 SER 143 266 266 SER SER A . n 
A 1 144 ALA 144 267 267 ALA ALA A . n 
A 1 145 GLY 145 268 268 GLY GLY A . n 
A 1 146 GLU 146 269 269 GLU GLU A . n 
A 1 147 LEU 147 270 270 LEU LEU A . n 
A 1 148 LYS 148 271 271 LYS LYS A . n 
A 1 149 ILE 149 272 272 ILE ILE A . n 
A 1 150 ALA 150 273 273 ALA ALA A . n 
A 1 151 ASP 151 274 274 ASP ASP A . n 
A 1 152 PHE 152 275 275 PHE PHE A . n 
A 1 153 GLY 153 276 276 GLY GLY A . n 
A 1 154 TRP 154 277 277 TRP TRP A . n 
A 1 155 SER 155 278 278 SER SER A . n 
A 1 156 VAL 156 279 279 VAL VAL A . n 
A 1 157 HIS 157 280 280 HIS HIS A . n 
A 1 158 ALA 158 281 281 ALA ALA A . n 
A 1 159 PRO 159 282 282 PRO PRO A . n 
A 1 160 SER 160 283 283 SER SER A . n 
A 1 161 SER 161 284 284 SER SER A . n 
A 1 162 ARG 162 285 285 ARG ARG A . n 
A 1 163 ARG 163 286 286 ARG ARG A . n 
A 1 164 THR 164 287 287 THR THR A . n 
A 1 165 TPO 165 288 288 TPO TPO A . n 
A 1 166 LEU 166 289 289 LEU LEU A . n 
A 1 167 CYS 167 290 290 CYS CYS A . n 
A 1 168 GLY 168 291 291 GLY GLY A . n 
A 1 169 THR 169 292 292 THR THR A . n 
A 1 170 LEU 170 293 293 LEU LEU A . n 
A 1 171 ASP 171 294 294 ASP ASP A . n 
A 1 172 TYR 172 295 295 TYR TYR A . n 
A 1 173 LEU 173 296 296 LEU LEU A . n 
A 1 174 PRO 174 297 297 PRO PRO A . n 
A 1 175 PRO 175 298 298 PRO PRO A . n 
A 1 176 GLU 176 299 299 GLU GLU A . n 
A 1 177 MET 177 300 300 MET MET A . n 
A 1 178 ILE 178 301 301 ILE ILE A . n 
A 1 179 GLU 179 302 302 GLU GLU A . n 
A 1 180 GLY 180 303 303 GLY GLY A . n 
A 1 181 ARG 181 304 304 ARG ARG A . n 
A 1 182 MET 182 305 305 MET MET A . n 
A 1 183 HIS 183 306 306 HIS HIS A . n 
A 1 184 ASP 184 307 307 ASP ASP A . n 
A 1 185 GLU 185 308 308 GLU GLU A . n 
A 1 186 LYS 186 309 309 LYS LYS A . n 
A 1 187 VAL 187 310 310 VAL VAL A . n 
A 1 188 ASP 188 311 311 ASP ASP A . n 
A 1 189 LEU 189 312 312 LEU LEU A . n 
A 1 190 TRP 190 313 313 TRP TRP A . n 
A 1 191 SER 191 314 314 SER SER A . n 
A 1 192 LEU 192 315 315 LEU LEU A . n 
A 1 193 GLY 193 316 316 GLY GLY A . n 
A 1 194 VAL 194 317 317 VAL VAL A . n 
A 1 195 LEU 195 318 318 LEU LEU A . n 
A 1 196 CYS 196 319 319 CYS CYS A . n 
A 1 197 TYR 197 320 320 TYR TYR A . n 
A 1 198 GLU 198 321 321 GLU GLU A . n 
A 1 199 PHE 199 322 322 PHE PHE A . n 
A 1 200 LEU 200 323 323 LEU LEU A . n 
A 1 201 VAL 201 324 324 VAL VAL A . n 
A 1 202 GLY 202 325 325 GLY GLY A . n 
A 1 203 LYS 203 326 326 LYS LYS A . n 
A 1 204 PRO 204 327 327 PRO PRO A . n 
A 1 205 PRO 205 328 328 PRO PRO A . n 
A 1 206 PHE 206 329 329 PHE PHE A . n 
A 1 207 GLU 207 330 330 GLU GLU A . n 
A 1 208 ALA 208 331 331 ALA ALA A . n 
A 1 209 ASN 209 332 332 ASN ASN A . n 
A 1 210 THR 210 333 333 THR THR A . n 
A 1 211 TYR 211 334 334 TYR TYR A . n 
A 1 212 GLN 212 335 335 GLN GLN A . n 
A 1 213 GLU 213 336 336 GLU GLU A . n 
A 1 214 THR 214 337 337 THR THR A . n 
A 1 215 TYR 215 338 338 TYR TYR A . n 
A 1 216 LYS 216 339 339 LYS LYS A . n 
A 1 217 ARG 217 340 340 ARG ARG A . n 
A 1 218 ILE 218 341 341 ILE ILE A . n 
A 1 219 SER 219 342 342 SER SER A . n 
A 1 220 ARG 220 343 343 ARG ARG A . n 
A 1 221 VAL 221 344 344 VAL VAL A . n 
A 1 222 GLU 222 345 345 GLU GLU A . n 
A 1 223 PHE 223 346 346 PHE PHE A . n 
A 1 224 THR 224 347 347 THR THR A . n 
A 1 225 PHE 225 348 348 PHE PHE A . n 
A 1 226 PRO 226 349 349 PRO PRO A . n 
A 1 227 ASP 227 350 350 ASP ASP A . n 
A 1 228 PHE 228 351 351 PHE PHE A . n 
A 1 229 VAL 229 352 352 VAL VAL A . n 
A 1 230 THR 230 353 353 THR THR A . n 
A 1 231 GLU 231 354 354 GLU GLU A . n 
A 1 232 GLY 232 355 355 GLY GLY A . n 
A 1 233 ALA 233 356 356 ALA ALA A . n 
A 1 234 ARG 234 357 357 ARG ARG A . n 
A 1 235 ASP 235 358 358 ASP ASP A . n 
A 1 236 LEU 236 359 359 LEU LEU A . n 
A 1 237 ILE 237 360 360 ILE ILE A . n 
A 1 238 SER 238 361 361 SER SER A . n 
A 1 239 ARG 239 362 362 ARG ARG A . n 
A 1 240 LEU 240 363 363 LEU LEU A . n 
A 1 241 LEU 241 364 364 LEU LEU A . n 
A 1 242 LYS 242 365 365 LYS LYS A . n 
A 1 243 HIS 243 366 366 HIS HIS A . n 
A 1 244 ASN 244 367 367 ASN ASN A . n 
A 1 245 PRO 245 368 368 PRO PRO A . n 
A 1 246 SER 246 369 369 SER SER A . n 
A 1 247 GLN 247 370 370 GLN GLN A . n 
A 1 248 ARG 248 371 371 ARG ARG A . n 
A 1 249 PRO 249 372 372 PRO PRO A . n 
A 1 250 MET 250 373 373 MET MET A . n 
A 1 251 LEU 251 374 374 LEU LEU A . n 
A 1 252 ARG 252 375 375 ARG ARG A . n 
A 1 253 GLU 253 376 376 GLU GLU A . n 
A 1 254 VAL 254 377 377 VAL VAL A . n 
A 1 255 LEU 255 378 378 LEU LEU A . n 
A 1 256 GLU 256 379 379 GLU GLU A . n 
A 1 257 HIS 257 380 380 HIS HIS A . n 
A 1 258 PRO 258 381 381 PRO PRO A . n 
A 1 259 TRP 259 382 382 TRP TRP A . n 
A 1 260 ILE 260 383 383 ILE ILE A . n 
A 1 261 THR 261 384 384 THR THR A . n 
A 1 262 ALA 262 385 385 ALA ALA A . n 
A 1 263 ASN 263 386 386 ASN ASN A . n 
A 1 264 SER 264 387 387 SER SER A . n 
A 1 265 SER 265 388 388 SER SER A . n 
A 1 266 LYS 266 389 389 LYS LYS A . n 
A 1 267 PRO 267 390 ?   ?   ?   A . n 
A 1 268 SER 268 391 ?   ?   ?   A . n 
B 2 1   GLY 1   0   ?   ?   ?   B . n 
B 2 2   MET 2   1   ?   ?   ?   B . n 
B 2 3   SER 3   2   ?   ?   ?   B . n 
B 2 4   GLN 4   3   ?   ?   ?   B . n 
B 2 5   VAL 5   4   ?   ?   ?   B . n 
B 2 6   LYS 6   5   ?   ?   ?   B . n 
B 2 7   SER 7   6   6   SER SER B . n 
B 2 8   SER 8   7   7   SER SER B . n 
B 2 9   TYR 9   8   8   TYR TYR B . n 
B 2 10  SER 10  9   9   SER SER B . n 
B 2 11  TYR 11  10  10  TYR TYR B . n 
B 2 12  ASP 12  11  11  ASP ASP B . n 
B 2 13  ALA 13  12  12  ALA ALA B . n 
B 2 14  PRO 14  13  13  PRO PRO B . n 
B 2 15  SER 15  14  14  SER SER B . n 
B 2 16  ASP 16  15  15  ASP ASP B . n 
B 2 17  PHE 17  16  16  PHE PHE B . n 
B 2 18  ILE 18  17  17  ILE ILE B . n 
B 2 19  ASN 19  18  18  ASN ASN B . n 
B 2 20  PHE 20  19  19  PHE PHE B . n 
B 2 21  SER 21  20  20  SER SER B . n 
B 2 22  SER 22  21  21  SER SER B . n 
B 2 23  LEU 23  22  ?   ?   ?   B . n 
B 2 24  ASP 24  23  ?   ?   ?   B . n 
B 2 25  ASP 25  24  ?   ?   ?   B . n 
B 2 26  GLU 26  25  ?   ?   ?   B . n 
B 2 27  GLY 27  26  26  GLY GLY B . n 
B 2 28  ASP 28  27  27  ASP ASP B . n 
B 2 29  THR 29  28  28  THR THR B . n 
B 2 30  GLN 30  29  29  GLN GLN B . n 
B 2 31  ASN 31  30  30  ASN ASN B . n 
B 2 32  ILE 32  31  31  ILE ILE B . n 
B 2 33  ASP 33  32  32  ASP ASP B . n 
B 2 34  SER 34  33  33  SER SER B . n 
B 2 35  TRP 35  34  34  TRP TRP B . n 
B 2 36  PHE 36  35  35  PHE PHE B . n 
B 2 37  GLU 37  36  36  GLU GLU B . n 
B 2 38  GLU 38  37  37  GLU GLU B . n 
B 2 39  LYS 39  38  38  LYS LYS B . n 
B 2 40  ALA 40  39  39  ALA ALA B . n 
B 2 41  ASN 41  40  40  ASN ASN B . n 
B 2 42  LEU 42  41  41  LEU LEU B . n 
B 2 43  GLU 43  42  42  GLU GLU B . n 
B 2 44  ASN 44  43  ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 VX6 1  500 500 VX6 VX6 A . 
D 4 SO4 1  600 600 SO4 SO4 A . 
E 5 HOH 1  1   1   HOH HOH A . 
E 5 HOH 2  2   2   HOH HOH A . 
E 5 HOH 3  3   3   HOH HOH A . 
E 5 HOH 4  4   4   HOH HOH A . 
E 5 HOH 5  5   5   HOH HOH A . 
E 5 HOH 6  6   6   HOH HOH A . 
E 5 HOH 7  7   7   HOH HOH A . 
E 5 HOH 8  9   9   HOH HOH A . 
E 5 HOH 9  10  10  HOH HOH A . 
E 5 HOH 10 11  11  HOH HOH A . 
E 5 HOH 11 12  12  HOH HOH A . 
E 5 HOH 12 13  13  HOH HOH A . 
E 5 HOH 13 14  14  HOH HOH A . 
E 5 HOH 14 15  15  HOH HOH A . 
E 5 HOH 15 16  16  HOH HOH A . 
E 5 HOH 16 17  17  HOH HOH A . 
E 5 HOH 17 18  18  HOH HOH A . 
E 5 HOH 18 19  19  HOH HOH A . 
E 5 HOH 19 20  20  HOH HOH A . 
E 5 HOH 20 21  21  HOH HOH A . 
E 5 HOH 21 22  22  HOH HOH A . 
E 5 HOH 22 24  24  HOH HOH A . 
E 5 HOH 23 25  25  HOH HOH A . 
E 5 HOH 24 26  26  HOH HOH A . 
E 5 HOH 25 27  27  HOH HOH A . 
E 5 HOH 26 28  28  HOH HOH A . 
E 5 HOH 27 29  29  HOH HOH A . 
E 5 HOH 28 30  30  HOH HOH A . 
E 5 HOH 29 31  31  HOH HOH A . 
E 5 HOH 30 32  32  HOH HOH A . 
E 5 HOH 31 33  33  HOH HOH A . 
E 5 HOH 32 34  34  HOH HOH A . 
E 5 HOH 33 35  35  HOH HOH A . 
E 5 HOH 34 36  36  HOH HOH A . 
E 5 HOH 35 37  37  HOH HOH A . 
E 5 HOH 36 38  38  HOH HOH A . 
E 5 HOH 37 39  39  HOH HOH A . 
E 5 HOH 38 40  40  HOH HOH A . 
E 5 HOH 39 41  41  HOH HOH A . 
E 5 HOH 40 42  42  HOH HOH A . 
E 5 HOH 41 43  43  HOH HOH A . 
E 5 HOH 42 44  44  HOH HOH A . 
E 5 HOH 43 45  45  HOH HOH A . 
E 5 HOH 44 46  46  HOH HOH A . 
E 5 HOH 45 47  47  HOH HOH A . 
E 5 HOH 46 49  49  HOH HOH A . 
E 5 HOH 47 50  50  HOH HOH A . 
E 5 HOH 48 51  51  HOH HOH A . 
E 5 HOH 49 52  52  HOH HOH A . 
E 5 HOH 50 53  53  HOH HOH A . 
E 5 HOH 51 54  54  HOH HOH A . 
E 5 HOH 52 55  55  HOH HOH A . 
E 5 HOH 53 56  56  HOH HOH A . 
E 5 HOH 54 57  57  HOH HOH A . 
E 5 HOH 55 58  58  HOH HOH A . 
F 5 HOH 1  44  8   HOH HOH B . 
F 5 HOH 2  45  23  HOH HOH B . 
F 5 HOH 3  46  48  HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    TPO 
_pdbx_struct_mod_residue.label_seq_id     165 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     TPO 
_pdbx_struct_mod_residue.auth_seq_id      288 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   THR 
_pdbx_struct_mod_residue.details          PHOSPHOTHREONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2660  ? 
1 MORE         -16.1 ? 
1 'SSA (A^2)'  14820 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-10-28 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 35.5811 29.4496 11.1252 -0.1169 -0.1452 -0.1043 -0.0248 0.0408  0.0429  2.6118  1.2795  2.2720  -0.0388  0.4147   
0.0570  -0.0033 0.1186  0.1066  -0.1306 0.0089  -0.0564 -0.0614 0.0592  -0.0057 'X-RAY DIFFRACTION' 
2 ? refined 21.7390 7.7395  16.2842 -0.1340 -0.1080 -0.0606 -0.0366 -0.0337 -0.0331 2.6404  3.1352  2.3875  0.7602   -1.1917  
-0.7063 -0.0675 0.1450  -0.2026 -0.2145 0.0506  0.0207  0.2305  -0.0544 0.0169  'X-RAY DIFFRACTION' 
3 ? refined 38.2143 30.2471 2.2321  -0.1101 -0.0406 -0.0530 -0.1204 0.0377  0.0813  1.1103  7.6331  6.0362  -2.7150  -0.9702  
0.1016  0.1185  1.0543  0.3923  -0.3527 -0.3477 -0.3617 -0.0715 0.3416  0.2292  'X-RAY DIFFRACTION' 
4 ? refined 34.0936 16.2306 -6.2667 0.3617  0.4312  0.2413  -0.0784 0.1938  0.0966  8.9388  3.4299  9.6128  3.7035   3.7875   
5.4652  0.5565  1.5795  -0.1900 -1.1112 -0.1585 0.3550  0.4492  -0.3386 -0.3980 'X-RAY DIFFRACTION' 
5 ? refined 25.7203 27.2155 18.4512 -0.2962 -0.1655 -0.0560 -0.0671 -0.1385 0.0067  45.0880 28.9026 26.4852 -28.1176 -28.9360 
8.5594  0.0256  -0.9327 0.3793  0.1253  0.5374  -0.0699 0.0847  -0.0826 -0.5630 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 125 A 4  A 212 A 91  ? 'X-RAY DIFFRACTION' ? 
2 2 A 213 A 92 A 389 A 268 ? 'X-RAY DIFFRACTION' ? 
3 3 B 6   B 6  B 21  B 21  ? 'X-RAY DIFFRACTION' ? 
4 4 B 26  B 26 B 42  B 42  ? 'X-RAY DIFFRACTION' ? 
5 5 A 500 C .  A 500 C .   ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.3.0006 ? 1 
ADSC      'data collection' Quantum  ? 2 
HKL-2000  'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
PHASER    phasing           .        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A THR 287 ? ? C A THR 287 ? ? N A TPO 288 ? ? 132.70 117.20 15.50  2.20 Y 
2 1 O  A THR 287 ? ? C A THR 287 ? ? N A TPO 288 ? ? 106.06 122.70 -16.64 1.60 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 131 ? ? -46.67  -13.00  
2  1 ASP A 202 ? ? -128.05 -165.32 
3  1 SER A 226 ? ? 86.97   -51.65  
4  1 ASP A 229 ? ? -69.58  -179.52 
5  1 ASP A 256 ? ? -151.58 44.81   
6  1 SER A 283 ? ? -132.21 -70.39  
7  1 LEU A 293 ? ? -28.17  -59.24  
8  1 LEU A 364 ? ? -96.35  59.81   
9  1 TYR B 8   ? ? -96.04  32.92   
10 1 SER B 20  ? ? -83.56  32.22   
11 1 THR B 28  ? ? -115.11 75.84   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    20 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    21 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            126.36 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             TPO 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              288 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   10.89 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 389 ? CG  ? A LYS 266 CG  
2  1 Y 1 A LYS 389 ? CD  ? A LYS 266 CD  
3  1 Y 1 A LYS 389 ? CE  ? A LYS 266 CE  
4  1 Y 1 A LYS 389 ? NZ  ? A LYS 266 NZ  
5  1 Y 1 B SER 21  ? OG  ? B SER 22  OG  
6  1 Y 1 B ASP 27  ? CG  ? B ASP 28  CG  
7  1 Y 1 B ASP 27  ? OD1 ? B ASP 28  OD1 
8  1 Y 1 B ASP 27  ? OD2 ? B ASP 28  OD2 
9  1 Y 1 B THR 28  ? OG1 ? B THR 29  OG1 
10 1 Y 1 B THR 28  ? CG2 ? B THR 29  CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 124 ? A GLY 1   
2  1 Y 1 A PRO 390 ? A PRO 267 
3  1 Y 1 A SER 391 ? A SER 268 
4  1 Y 1 B GLY 0   ? B GLY 1   
5  1 Y 1 B MET 1   ? B MET 2   
6  1 Y 1 B SER 2   ? B SER 3   
7  1 Y 1 B GLN 3   ? B GLN 4   
8  1 Y 1 B VAL 4   ? B VAL 5   
9  1 Y 1 B LYS 5   ? B LYS 6   
10 1 Y 1 B LEU 22  ? B LEU 23  
11 1 Y 1 B ASP 23  ? B ASP 24  
12 1 Y 1 B ASP 24  ? B ASP 25  
13 1 Y 1 B GLU 25  ? B GLU 26  
14 1 Y 1 B ASN 43  ? B ASN 44  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
'CYCLOPROPANECARBOXYLIC ACID {4-[4-(4-METHYL-PIPERAZIN-1-YL)-6-(5-METHYL-2H-PYRAZOL-3-YLAMINO)-PYRIMIDIN-2-YLSULFANYL]-PHENYL}-AMIDE' 
VX6 
4 'SULFATE ION' SO4 
5 water HOH 
#