data_3E5X
# 
_entry.id   3E5X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3E5X         
RCSB  RCSB048915   
WWPDB D_1000048915 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 3E5Q unspecified . 
PDB 3E5U unspecified . 
PDB 3E6B unspecified . 
PDB 3E6C unspecified . 
PDB 3E6D unspecified . 
# 
_pdbx_database_status.entry_id                        3E5X 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Levy, C.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator' 
_citation.journal_abbrev            Mol.Microbiol. 
_citation.journal_volume            70 
_citation.page_first                151 
_citation.page_last                 167 
_citation.year                      2008 
_citation.journal_id_ASTM           MOMIEE 
_citation.country                   UK 
_citation.journal_id_ISSN           0950-382X 
_citation.journal_id_CSD            2007 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18717788 
_citation.pdbx_database_id_DOI      10.1111/j.1365-2958.2008.06399.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Levy, C.'         1 
primary 'Pike, K.'         2 
primary 'Heyes, D.J.'      3 
primary 'Joyce, M.G.'      4 
primary 'Gabor, K.'        5 
primary 'Smidt, H.'        6 
primary 'van der Oost, J.' 7 
primary 'Leys, D.'         8 
# 
_cell.entry_id           3E5X 
_cell.length_a           56.700 
_cell.length_b           118.380 
_cell.length_c           87.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.68 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3E5X 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cyclic nucleotide-binding protein'     28395.684 4   ? ? ? ? 
2 non-polymer syn '(3-CHLORO-4-HYDROXYPHENYL)ACETIC ACID' 186.592   5   ? ? ? ? 
3 water       nat water                                   18.015    553 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CprK 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSYYSDPNSSSV
DKLAAALDHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSYYSDPNSSSV
DKLAAALDHH
;
_entity_poly.pdbx_strand_id                 A,C,B,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   VAL n 
1 4   GLU n 
1 5   GLY n 
1 6   LEU n 
1 7   GLY n 
1 8   LYS n 
1 9   ASP n 
1 10  PHE n 
1 11  CYS n 
1 12  GLY n 
1 13  ALA n 
1 14  ILE n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  ASN n 
1 19  PHE n 
1 20  PHE n 
1 21  PRO n 
1 22  ILE n 
1 23  GLU n 
1 24  LYS n 
1 25  LEU n 
1 26  ARG n 
1 27  ASN n 
1 28  TYR n 
1 29  THR n 
1 30  GLN n 
1 31  MET n 
1 32  GLY n 
1 33  LEU n 
1 34  ILE n 
1 35  ARG n 
1 36  ASP n 
1 37  PHE n 
1 38  ALA n 
1 39  LYS n 
1 40  GLY n 
1 41  SER n 
1 42  ALA n 
1 43  VAL n 
1 44  ILE n 
1 45  MET n 
1 46  PRO n 
1 47  GLY n 
1 48  GLU n 
1 49  GLU n 
1 50  ILE n 
1 51  THR n 
1 52  SER n 
1 53  MET n 
1 54  ILE n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  GLU n 
1 59  GLY n 
1 60  LYS n 
1 61  ILE n 
1 62  LYS n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  ILE n 
1 67  PHE n 
1 68  GLU n 
1 69  ASP n 
1 70  GLY n 
1 71  SER n 
1 72  GLU n 
1 73  LYS n 
1 74  LEU n 
1 75  LEU n 
1 76  TYR n 
1 77  TYR n 
1 78  ALA n 
1 79  GLY n 
1 80  GLY n 
1 81  ASN n 
1 82  SER n 
1 83  LEU n 
1 84  ILE n 
1 85  GLY n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  PRO n 
1 90  THR n 
1 91  GLY n 
1 92  ASN n 
1 93  ASN n 
1 94  ILE n 
1 95  TYR n 
1 96  ALA n 
1 97  THR n 
1 98  ALA n 
1 99  MET n 
1 100 GLU n 
1 101 PRO n 
1 102 THR n 
1 103 ARG n 
1 104 THR n 
1 105 CYS n 
1 106 TRP n 
1 107 PHE n 
1 108 SER n 
1 109 GLU n 
1 110 LYS n 
1 111 SER n 
1 112 LEU n 
1 113 ARG n 
1 114 THR n 
1 115 VAL n 
1 116 PHE n 
1 117 ARG n 
1 118 THR n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 MET n 
1 123 ILE n 
1 124 PHE n 
1 125 GLU n 
1 126 ILE n 
1 127 PHE n 
1 128 LYS n 
1 129 ASN n 
1 130 TYR n 
1 131 LEU n 
1 132 THR n 
1 133 LYS n 
1 134 VAL n 
1 135 ALA n 
1 136 TYR n 
1 137 TYR n 
1 138 ALA n 
1 139 ARG n 
1 140 GLN n 
1 141 VAL n 
1 142 ALA n 
1 143 GLU n 
1 144 MET n 
1 145 ASN n 
1 146 THR n 
1 147 TYR n 
1 148 ASN n 
1 149 PRO n 
1 150 THR n 
1 151 ILE n 
1 152 ARG n 
1 153 ILE n 
1 154 LEU n 
1 155 ARG n 
1 156 LEU n 
1 157 PHE n 
1 158 TYR n 
1 159 GLU n 
1 160 LEU n 
1 161 CYS n 
1 162 SER n 
1 163 SER n 
1 164 GLN n 
1 165 GLY n 
1 166 LYS n 
1 167 ARG n 
1 168 VAL n 
1 169 GLY n 
1 170 ASP n 
1 171 THR n 
1 172 TYR n 
1 173 GLU n 
1 174 ILE n 
1 175 THR n 
1 176 MET n 
1 177 PRO n 
1 178 LEU n 
1 179 SER n 
1 180 GLN n 
1 181 LYS n 
1 182 SER n 
1 183 ILE n 
1 184 GLY n 
1 185 GLU n 
1 186 ILE n 
1 187 THR n 
1 188 GLY n 
1 189 VAL n 
1 190 HIS n 
1 191 HIS n 
1 192 VAL n 
1 193 THR n 
1 194 VAL n 
1 195 SER n 
1 196 ARG n 
1 197 VAL n 
1 198 LEU n 
1 199 ALA n 
1 200 CYS n 
1 201 LEU n 
1 202 LYS n 
1 203 ARG n 
1 204 GLU n 
1 205 ASN n 
1 206 ILE n 
1 207 LEU n 
1 208 ASP n 
1 209 LYS n 
1 210 LYS n 
1 211 LYS n 
1 212 ASN n 
1 213 LYS n 
1 214 ILE n 
1 215 ILE n 
1 216 VAL n 
1 217 TYR n 
1 218 ASN n 
1 219 LEU n 
1 220 GLY n 
1 221 GLU n 
1 222 LEU n 
1 223 LYS n 
1 224 HIS n 
1 225 LEU n 
1 226 SER n 
1 227 GLU n 
1 228 GLN n 
1 229 THR n 
1 230 SER n 
1 231 TYR n 
1 232 TYR n 
1 233 SER n 
1 234 ASP n 
1 235 PRO n 
1 236 ASN n 
1 237 SER n 
1 238 SER n 
1 239 SER n 
1 240 VAL n 
1 241 ASP n 
1 242 LYS n 
1 243 LEU n 
1 244 ALA n 
1 245 ALA n 
1 246 ALA n 
1 247 LEU n 
1 248 ASP n 
1 249 HIS n 
1 250 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Dhaf_0678 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    DCB-2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Desulfitobacterium hafniense' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272564 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTrc99 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q18R04_DESHD 
_struct_ref.pdbx_db_accession          Q18R04 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSYY
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3E5X A 1 ? 232 ? Q18R04 1 ? 232 ? 1 232 
2 1 3E5X C 1 ? 232 ? Q18R04 1 ? 232 ? 1 232 
3 1 3E5X B 1 ? 232 ? Q18R04 1 ? 232 ? 1 232 
4 1 3E5X D 1 ? 232 ? Q18R04 1 ? 232 ? 1 232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3C4 non-polymer         . '(3-CHLORO-4-HYDROXYPHENYL)ACETIC ACID' ? 'C8 H7 Cl O3'    186.592 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3E5X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   52.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pdbx_details    
'100mM sodium chloride, 100mM sodium acetate, 20% PEG 6000, pH 5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
_exptl_crystal_grow.temp_details    ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3E5X 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.999 
_reflns.d_resolution_low             35.94 
_reflns.number_all                   70919 
_reflns.number_obs                   75930 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3E5X 
_refine.ls_number_reflns_obs                     70919 
_refine.ls_number_reflns_all                     70919 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.94 
_refine.ls_d_res_high                            1.999 
_refine.ls_percent_reflns_obs                    96.30 
_refine.ls_R_factor_obs                          0.19517 
_refine.ls_R_factor_all                          0.19517 
_refine.ls_R_factor_R_work                       0.19289 
_refine.ls_R_factor_R_free                       0.23761 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3754 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.B_iso_mean                               25.452 
_refine.aniso_B[1][1]                            0.11 
_refine.aniso_B[2][2]                            0.31 
_refine.aniso_B[3][3]                            -0.46 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.21 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.172 
_refine.pdbx_overall_ESU_R_Free                  0.160 
_refine.overall_SU_ML                            0.123 
_refine.overall_SU_B                             8.238 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6964 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             553 
_refine_hist.number_atoms_total               7577 
_refine_hist.d_res_high                       1.999 
_refine_hist.d_res_low                        35.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.024  0.022  ? 7166  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 4958  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.903  1.983  ? 9669  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.097  3.000  ? 12086 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       9.308  5.000  ? 864   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.498 23.770 ? 313   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.887 15.000 ? 1328  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.288 15.000 ? 44    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.126  0.200  ? 1083  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 7820  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1490  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.212  0.200  ? 1371  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.198  0.200  ? 4993  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.183  0.200  ? 3367  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.090  0.200  ? 3711  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.196  0.200  ? 405   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.184  0.200  ? 14    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.288  0.200  ? 47    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.195  0.200  ? 14    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.211  1.500  ? 4936  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.328  1.500  ? 1762  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.554  2.000  ? 6998  'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.696  3.000  ? 3168  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.708  4.500  ? 2660  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.999 
_refine_ls_shell.d_res_low                        2.051 
_refine_ls_shell.number_reflns_R_work             5238 
_refine_ls_shell.R_factor_R_work                  0.23 
_refine_ls_shell.percent_reflns_obs               96.44 
_refine_ls_shell.R_factor_R_free                  0.269 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             283 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3E5X 
_struct.title                     'OCPA complexed CprK' 
_struct.pdbx_descriptor           'Cyclic nucleotide-binding protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3E5X 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'CprK, Halorespiration, transcriptional regulator, TRANSCRIPTION REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 22  ? GLY A 32  ? ILE A 22  GLY A 32  5 ? 11 
HELX_P HELX_P2  2  SER A 108 ? ASP A 119 ? SER A 108 ASP A 119 1 ? 12 
HELX_P HELX_P3  3  GLU A 120 ? ASN A 145 ? GLU A 120 ASN A 145 1 ? 26 
HELX_P HELX_P4  4  ASN A 148 ? GLY A 165 ? ASN A 148 GLY A 165 1 ? 18 
HELX_P HELX_P5  5  SER A 179 ? GLY A 188 ? SER A 179 GLY A 188 1 ? 10 
HELX_P HELX_P6  6  HIS A 190 ? GLU A 204 ? HIS A 190 GLU A 204 1 ? 15 
HELX_P HELX_P7  7  ILE B 22  ? GLY B 32  ? ILE C 22  GLY C 32  5 ? 11 
HELX_P HELX_P8  8  GLU B 109 ? ASP B 119 ? GLU C 109 ASP C 119 1 ? 11 
HELX_P HELX_P9  9  GLU B 120 ? ASN B 145 ? GLU C 120 ASN C 145 1 ? 26 
HELX_P HELX_P10 10 ASN B 148 ? GLY B 165 ? ASN C 148 GLY C 165 1 ? 18 
HELX_P HELX_P11 11 SER B 179 ? GLY B 188 ? SER C 179 GLY C 188 1 ? 10 
HELX_P HELX_P12 12 HIS B 190 ? GLU B 204 ? HIS C 190 GLU C 204 1 ? 15 
HELX_P HELX_P13 13 ILE C 22  ? GLY C 32  ? ILE B 22  GLY B 32  5 ? 11 
HELX_P HELX_P14 14 SER C 108 ? ASP C 119 ? SER B 108 ASP B 119 1 ? 12 
HELX_P HELX_P15 15 GLU C 120 ? ASN C 145 ? GLU B 120 ASN B 145 1 ? 26 
HELX_P HELX_P16 16 ASN C 148 ? GLY C 165 ? ASN B 148 GLY B 165 1 ? 18 
HELX_P HELX_P17 17 SER C 179 ? GLY C 188 ? SER B 179 GLY B 188 1 ? 10 
HELX_P HELX_P18 18 HIS C 190 ? GLU C 204 ? HIS B 190 GLU B 204 1 ? 15 
HELX_P HELX_P19 19 ASN C 218 ? GLU C 227 ? ASN B 218 GLU B 227 1 ? 10 
HELX_P HELX_P20 20 ILE D 22  ? GLY D 32  ? ILE D 22  GLY D 32  5 ? 11 
HELX_P HELX_P21 21 SER D 108 ? ASP D 119 ? SER D 108 ASP D 119 1 ? 12 
HELX_P HELX_P22 22 GLU D 120 ? TYR D 147 ? GLU D 120 TYR D 147 1 ? 28 
HELX_P HELX_P23 23 ASN D 148 ? GLY D 165 ? ASN D 148 GLY D 165 1 ? 18 
HELX_P HELX_P24 24 SER D 179 ? GLY D 188 ? SER D 179 GLY D 188 1 ? 10 
HELX_P HELX_P25 25 HIS D 190 ? GLU D 204 ? HIS D 190 GLU D 204 1 ? 15 
HELX_P HELX_P26 26 ASN D 218 ? SER D 226 ? ASN D 218 SER D 226 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 4 ? 
L ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 33  ? PHE A 37  ? LEU A 33  PHE A 37  
A 2 THR A 102 ? PHE A 107 ? THR A 102 PHE A 107 
A 3 MET A 53  ? GLU A 58  ? MET A 53  GLU A 58  
A 4 LEU A 83  ? ILE A 84  ? LEU A 83  ILE A 84  
B 1 ALA A 42  ? ILE A 44  ? ALA A 42  ILE A 44  
B 2 ASN A 93  ? ALA A 98  ? ASN A 93  ALA A 98  
B 3 ILE A 61  ? ILE A 66  ? ILE A 61  ILE A 66  
B 4 GLU A 72  ? ALA A 78  ? GLU A 72  ALA A 78  
C 1 LYS A 166 ? VAL A 168 ? LYS A 166 VAL A 168 
C 2 THR A 171 ? THR A 175 ? THR A 171 THR A 175 
C 3 LYS A 213 ? VAL A 216 ? LYS A 213 VAL A 216 
C 4 LEU A 207 ? ASP A 208 ? LEU A 207 ASP A 208 
D 1 LEU B 33  ? PHE B 37  ? LEU C 33  PHE C 37  
D 2 THR B 102 ? SER B 108 ? THR C 102 SER C 108 
D 3 SER B 52  ? GLU B 58  ? SER C 52  GLU C 58  
D 4 LEU B 83  ? ILE B 84  ? LEU C 83  ILE C 84  
E 1 ALA B 42  ? ILE B 44  ? ALA C 42  ILE C 44  
E 2 ASN B 93  ? ALA B 98  ? ASN C 93  ALA C 98  
E 3 ILE B 61  ? ILE B 66  ? ILE C 61  ILE C 66  
E 4 GLU B 72  ? ALA B 78  ? GLU C 72  ALA C 78  
F 1 LYS B 166 ? VAL B 168 ? LYS C 166 VAL C 168 
F 2 THR B 171 ? ILE B 174 ? THR C 171 ILE C 174 
F 3 ILE B 214 ? VAL B 216 ? ILE C 214 VAL C 216 
F 4 LEU B 207 ? LYS B 209 ? LEU C 207 LYS C 209 
G 1 LEU C 33  ? PHE C 37  ? LEU B 33  PHE B 37  
G 2 THR C 102 ? PHE C 107 ? THR B 102 PHE B 107 
G 3 MET C 53  ? GLU C 58  ? MET B 53  GLU B 58  
G 4 LEU C 83  ? ILE C 84  ? LEU B 83  ILE B 84  
H 1 ALA C 42  ? ILE C 44  ? ALA B 42  ILE B 44  
H 2 ASN C 93  ? ALA C 98  ? ASN B 93  ALA B 98  
H 3 LYS C 60  ? ILE C 66  ? LYS B 60  ILE B 66  
H 4 GLU C 72  ? GLY C 79  ? GLU B 72  GLY B 79  
I 1 LYS C 166 ? VAL C 168 ? LYS B 166 VAL B 168 
I 2 THR C 171 ? ILE C 174 ? THR B 171 ILE B 174 
I 3 ILE C 214 ? VAL C 216 ? ILE B 214 VAL B 216 
I 4 LEU C 207 ? LYS C 209 ? LEU B 207 LYS B 209 
J 1 LEU D 33  ? PHE D 37  ? LEU D 33  PHE D 37  
J 2 THR D 102 ? PHE D 107 ? THR D 102 PHE D 107 
J 3 MET D 53  ? GLU D 58  ? MET D 53  GLU D 58  
J 4 LEU D 83  ? ILE D 84  ? LEU D 83  ILE D 84  
K 1 ALA D 42  ? ILE D 44  ? ALA D 42  ILE D 44  
K 2 ASN D 93  ? ALA D 98  ? ASN D 93  ALA D 98  
K 3 LYS D 60  ? ILE D 66  ? LYS D 60  ILE D 66  
K 4 GLU D 72  ? GLY D 79  ? GLU D 72  GLY D 79  
L 1 LYS D 166 ? VAL D 168 ? LYS D 166 VAL D 168 
L 2 THR D 171 ? THR D 175 ? THR D 171 THR D 175 
L 3 LYS D 213 ? VAL D 216 ? LYS D 213 VAL D 216 
L 4 LEU D 207 ? ASP D 208 ? LEU D 207 ASP D 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 33  ? N LEU A 33  O TRP A 106 ? O TRP A 106 
A 2 3 O PHE A 107 ? O PHE A 107 N MET A 53  ? N MET A 53  
A 3 4 N ILE A 54  ? N ILE A 54  O ILE A 84  ? O ILE A 84  
B 1 2 N VAL A 43  ? N VAL A 43  O ALA A 96  ? O ALA A 96  
B 2 3 O TYR A 95  ? O TYR A 95  N ASP A 64  ? N ASP A 64  
B 3 4 N LEU A 63  ? N LEU A 63  O LEU A 75  ? O LEU A 75  
C 1 2 N LYS A 166 ? N LYS A 166 O GLU A 173 ? O GLU A 173 
C 2 3 N TYR A 172 ? N TYR A 172 O VAL A 216 ? O VAL A 216 
C 3 4 O ILE A 215 ? O ILE A 215 N ASP A 208 ? N ASP A 208 
D 1 2 N PHE B 37  ? N PHE C 37  O THR B 102 ? O THR C 102 
D 2 3 O PHE B 107 ? O PHE C 107 N MET B 53  ? N MET C 53  
D 3 4 N ILE B 54  ? N ILE C 54  O ILE B 84  ? O ILE C 84  
E 1 2 N ILE B 44  ? N ILE C 44  O ALA B 96  ? O ALA C 96  
E 2 3 O TYR B 95  ? O TYR C 95  N ASP B 64  ? N ASP C 64  
E 3 4 N LEU B 63  ? N LEU C 63  O TYR B 76  ? O TYR C 76  
F 1 2 N LYS B 166 ? N LYS C 166 O GLU B 173 ? O GLU C 173 
F 2 3 N TYR B 172 ? N TYR C 172 O VAL B 216 ? O VAL C 216 
F 3 4 O ILE B 215 ? O ILE C 215 N ASP B 208 ? N ASP C 208 
G 1 2 N LEU C 33  ? N LEU B 33  O TRP C 106 ? O TRP B 106 
G 2 3 O PHE C 107 ? O PHE B 107 N MET C 53  ? N MET B 53  
G 3 4 N ILE C 54  ? N ILE B 54  O ILE C 84  ? O ILE B 84  
H 1 2 N VAL C 43  ? N VAL B 43  O ALA C 96  ? O ALA B 96  
H 2 3 O TYR C 95  ? O TYR B 95  N ASP C 64  ? N ASP B 64  
H 3 4 N ILE C 65  ? N ILE B 65  O LYS C 73  ? O LYS B 73  
I 1 2 N LYS C 166 ? N LYS B 166 O GLU C 173 ? O GLU B 173 
I 2 3 N ILE C 174 ? N ILE B 174 O ILE C 214 ? O ILE B 214 
I 3 4 O ILE C 215 ? O ILE B 215 N ASP C 208 ? N ASP B 208 
J 1 2 N LEU D 33  ? N LEU D 33  O TRP D 106 ? O TRP D 106 
J 2 3 O PHE D 107 ? O PHE D 107 N MET D 53  ? N MET D 53  
J 3 4 N ILE D 54  ? N ILE D 54  O ILE D 84  ? O ILE D 84  
K 1 2 N VAL D 43  ? N VAL D 43  O ALA D 96  ? O ALA D 96  
K 2 3 O TYR D 95  ? O TYR D 95  N ASP D 64  ? N ASP D 64  
K 3 4 N LEU D 63  ? N LEU D 63  O TYR D 76  ? O TYR D 76  
L 1 2 N VAL D 168 ? N VAL D 168 O THR D 171 ? O THR D 171 
L 2 3 N TYR D 172 ? N TYR D 172 O VAL D 216 ? O VAL D 216 
L 3 4 O ILE D 215 ? O ILE D 215 N ASP D 208 ? N ASP D 208 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 3C4 A 501' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 3C4 C 502' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE 3C4 B 505' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 3C4 B 504' 
AC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 3C4 D 503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 TYR A 76  ? TYR A 76  . ? 1_555 ? 
2  AC1 12 ILE A 84  ? ILE A 84  . ? 1_555 ? 
3  AC1 12 GLY A 85  ? GLY A 85  . ? 1_555 ? 
4  AC1 12 LYS A 86  ? LYS A 86  . ? 1_555 ? 
5  AC1 12 THR A 90  ? THR A 90  . ? 1_555 ? 
6  AC1 12 ASN A 92  ? ASN A 92  . ? 1_555 ? 
7  AC1 12 ILE A 94  ? ILE A 94  . ? 1_555 ? 
8  AC1 12 TYR A 130 ? TYR A 130 . ? 1_555 ? 
9  AC1 12 LYS A 133 ? LYS A 133 . ? 1_555 ? 
10 AC1 12 LEU C 131 ? LEU B 131 . ? 1_555 ? 
11 AC1 12 VAL C 134 ? VAL B 134 . ? 1_555 ? 
12 AC1 12 ALA C 135 ? ALA B 135 . ? 1_555 ? 
13 AC2 11 TYR B 76  ? TYR C 76  . ? 1_555 ? 
14 AC2 11 ILE B 84  ? ILE C 84  . ? 1_555 ? 
15 AC2 11 GLY B 85  ? GLY C 85  . ? 1_555 ? 
16 AC2 11 LYS B 86  ? LYS C 86  . ? 1_555 ? 
17 AC2 11 THR B 90  ? THR C 90  . ? 1_555 ? 
18 AC2 11 ASN B 92  ? ASN C 92  . ? 1_555 ? 
19 AC2 11 ILE B 94  ? ILE C 94  . ? 1_555 ? 
20 AC2 11 TYR B 130 ? TYR C 130 . ? 1_555 ? 
21 AC2 11 LYS B 133 ? LYS C 133 . ? 1_555 ? 
22 AC2 11 VAL D 134 ? VAL D 134 . ? 1_555 ? 
23 AC2 11 ALA D 135 ? ALA D 135 . ? 1_555 ? 
24 AC3 7  ASP C 36  ? ASP B 36  . ? 1_555 ? 
25 AC3 7  PHE C 37  ? PHE B 37  . ? 1_555 ? 
26 AC3 7  ALA C 38  ? ALA B 38  . ? 1_555 ? 
27 AC3 7  GLU C 58  ? GLU B 58  . ? 1_555 ? 
28 AC3 7  PRO C 101 ? PRO B 101 . ? 1_555 ? 
29 AC3 7  THR C 102 ? THR B 102 . ? 1_555 ? 
30 AC3 7  ARG C 103 ? ARG B 103 . ? 1_555 ? 
31 AC4 12 LEU A 131 ? LEU A 131 . ? 1_555 ? 
32 AC4 12 VAL A 134 ? VAL A 134 . ? 1_555 ? 
33 AC4 12 ALA A 135 ? ALA A 135 . ? 1_555 ? 
34 AC4 12 TYR C 76  ? TYR B 76  . ? 1_555 ? 
35 AC4 12 ILE C 84  ? ILE B 84  . ? 1_555 ? 
36 AC4 12 GLY C 85  ? GLY B 85  . ? 1_555 ? 
37 AC4 12 LYS C 86  ? LYS B 86  . ? 1_555 ? 
38 AC4 12 THR C 90  ? THR B 90  . ? 1_555 ? 
39 AC4 12 ASN C 92  ? ASN B 92  . ? 1_555 ? 
40 AC4 12 ILE C 94  ? ILE B 94  . ? 1_555 ? 
41 AC4 12 TYR C 130 ? TYR B 130 . ? 1_555 ? 
42 AC4 12 LYS C 133 ? LYS B 133 . ? 1_555 ? 
43 AC5 12 LEU B 131 ? LEU C 131 . ? 1_555 ? 
44 AC5 12 VAL B 134 ? VAL C 134 . ? 1_555 ? 
45 AC5 12 ALA B 135 ? ALA C 135 . ? 1_555 ? 
46 AC5 12 TYR D 76  ? TYR D 76  . ? 1_555 ? 
47 AC5 12 ILE D 84  ? ILE D 84  . ? 1_555 ? 
48 AC5 12 GLY D 85  ? GLY D 85  . ? 1_555 ? 
49 AC5 12 LYS D 86  ? LYS D 86  . ? 1_555 ? 
50 AC5 12 THR D 90  ? THR D 90  . ? 1_555 ? 
51 AC5 12 ASN D 92  ? ASN D 92  . ? 1_555 ? 
52 AC5 12 ILE D 94  ? ILE D 94  . ? 1_555 ? 
53 AC5 12 TYR D 130 ? TYR D 130 . ? 1_555 ? 
54 AC5 12 LYS D 133 ? LYS D 133 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3E5X 
_atom_sites.fract_transf_matrix[1][1]   0.017637 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001754 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008447 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011490 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 9   ? 4.350   20.693 43.013  1.00 35.01  ? 9    ASP A N   1 
ATOM   2    C  CA  . ASP A 1 9   ? 4.115   19.898 41.747  1.00 34.77  ? 9    ASP A CA  1 
ATOM   3    C  C   . ASP A 1 9   ? 3.339   20.640 40.674  1.00 33.19  ? 9    ASP A C   1 
ATOM   4    O  O   . ASP A 1 9   ? 2.979   20.069 39.635  1.00 33.21  ? 9    ASP A O   1 
ATOM   5    C  CB  . ASP A 1 9   ? 3.440   18.566 42.084  1.00 35.12  ? 9    ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 9   ? 4.275   17.744 43.045  1.00 38.15  ? 9    ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 9   ? 5.396   18.246 43.316  1.00 50.67  ? 9    ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 9   ? 3.873   16.640 43.493  1.00 41.59  ? 9    ASP A OD2 1 
ATOM   9    N  N   . PHE A 1 10  ? 3.123   21.930 40.866  1.00 32.25  ? 10   PHE A N   1 
ATOM   10   C  CA  . PHE A 1 10  ? 2.382   22.689 39.848  1.00 31.75  ? 10   PHE A CA  1 
ATOM   11   C  C   . PHE A 1 10  ? 3.241   22.901 38.600  1.00 29.88  ? 10   PHE A C   1 
ATOM   12   O  O   . PHE A 1 10  ? 4.376   23.431 38.655  1.00 28.75  ? 10   PHE A O   1 
ATOM   13   C  CB  . PHE A 1 10  ? 1.740   23.985 40.360  1.00 30.52  ? 10   PHE A CB  1 
ATOM   14   C  CG  . PHE A 1 10  ? 0.881   24.666 39.324  1.00 32.96  ? 10   PHE A CG  1 
ATOM   15   C  CD1 . PHE A 1 10  ? -0.359  24.128 38.979  1.00 33.24  ? 10   PHE A CD1 1 
ATOM   16   C  CD2 . PHE A 1 10  ? 1.315   25.856 38.686  1.00 31.01  ? 10   PHE A CD2 1 
ATOM   17   C  CE1 . PHE A 1 10  ? -1.157  24.737 38.007  1.00 33.52  ? 10   PHE A CE1 1 
ATOM   18   C  CE2 . PHE A 1 10  ? 0.510   26.501 37.708  1.00 32.53  ? 10   PHE A CE2 1 
ATOM   19   C  CZ  . PHE A 1 10  ? -0.735  25.955 37.369  1.00 32.20  ? 10   PHE A CZ  1 
ATOM   20   N  N   . CYS A 1 11  ? 2.692   22.438 37.477  1.00 30.04  ? 11   CYS A N   1 
ATOM   21   C  CA  . CYS A 1 11  ? 3.401   22.479 36.174  1.00 31.05  ? 11   CYS A CA  1 
ATOM   22   C  C   . CYS A 1 11  ? 2.786   23.502 35.202  1.00 32.43  ? 11   CYS A C   1 
ATOM   23   O  O   . CYS A 1 11  ? 2.735   23.258 33.981  1.00 34.41  ? 11   CYS A O   1 
ATOM   24   C  CB  . CYS A 1 11  ? 3.473   21.073 35.543  1.00 30.42  ? 11   CYS A CB  1 
ATOM   25   S  SG  . CYS A 1 11  ? 4.431   19.923 36.559  1.00 27.97  ? 11   CYS A SG  1 
ATOM   26   N  N   . GLY A 1 12  ? 2.283   24.625 35.732  1.00 32.04  ? 12   GLY A N   1 
ATOM   27   C  CA  . GLY A 1 12  ? 1.879   25.774 34.858  1.00 32.60  ? 12   GLY A CA  1 
ATOM   28   C  C   . GLY A 1 12  ? 3.020   26.781 34.711  1.00 32.01  ? 12   GLY A C   1 
ATOM   29   O  O   . GLY A 1 12  ? 3.951   26.777 35.510  1.00 34.05  ? 12   GLY A O   1 
ATOM   30   N  N   . ALA A 1 13  ? 2.958   27.605 33.677  1.00 31.80  ? 13   ALA A N   1 
ATOM   31   C  CA  . ALA A 1 13  ? 3.924   28.700 33.398  1.00 30.80  ? 13   ALA A CA  1 
ATOM   32   C  C   . ALA A 1 13  ? 3.182   29.683 32.534  1.00 29.75  ? 13   ALA A C   1 
ATOM   33   O  O   . ALA A 1 13  ? 2.429   29.259 31.641  1.00 29.03  ? 13   ALA A O   1 
ATOM   34   C  CB  . ALA A 1 13  ? 5.148   28.162 32.629  1.00 30.55  ? 13   ALA A CB  1 
ATOM   35   N  N   . ILE A 1 14  ? 3.383   30.975 32.790  1.00 30.16  ? 14   ILE A N   1 
ATOM   36   C  CA  . ILE A 1 14  ? 2.757   32.048 32.000  1.00 30.65  ? 14   ILE A CA  1 
ATOM   37   C  C   . ILE A 1 14  ? 3.740   32.606 30.987  1.00 29.78  ? 14   ILE A C   1 
ATOM   38   O  O   . ILE A 1 14  ? 3.343   32.971 29.922  1.00 29.80  ? 14   ILE A O   1 
ATOM   39   C  CB  . ILE A 1 14  ? 2.165   33.200 32.888  1.00 30.36  ? 14   ILE A CB  1 
ATOM   40   C  CG1 . ILE A 1 14  ? 1.039   32.660 33.779  1.00 31.11  ? 14   ILE A CG1 1 
ATOM   41   C  CG2 . ILE A 1 14  ? 1.603   34.398 32.038  1.00 29.61  ? 14   ILE A CG2 1 
ATOM   42   C  CD1 . ILE A 1 14  ? 1.126   33.209 35.118  1.00 32.83  ? 14   ILE A CD1 1 
ATOM   43   N  N   . ILE A 1 15  ? 5.007   32.618 31.376  1.00 30.17  ? 15   ILE A N   1 
ATOM   44   C  CA  . ILE A 1 15  ? 6.132   33.289 30.705  1.00 31.54  ? 15   ILE A CA  1 
ATOM   45   C  C   . ILE A 1 15  ? 7.154   32.159 30.408  1.00 30.82  ? 15   ILE A C   1 
ATOM   46   O  O   . ILE A 1 15  ? 7.347   31.285 31.257  1.00 31.36  ? 15   ILE A O   1 
ATOM   47   C  CB  . ILE A 1 15  ? 6.769   34.359 31.661  1.00 30.89  ? 15   ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 15  ? 5.801   35.500 31.938  1.00 31.95  ? 15   ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 15  ? 8.080   34.900 31.118  1.00 34.26  ? 15   ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 15  ? 5.248   36.136 30.662  1.00 33.93  ? 15   ILE A CD1 1 
ATOM   51   N  N   . PRO A 1 16  ? 7.768   32.143 29.211  1.00 30.27  ? 16   PRO A N   1 
ATOM   52   C  CA  . PRO A 1 16  ? 8.708   31.047 28.911  1.00 30.73  ? 16   PRO A CA  1 
ATOM   53   C  C   . PRO A 1 16  ? 10.087  31.433 29.472  1.00 30.47  ? 16   PRO A C   1 
ATOM   54   O  O   . PRO A 1 16  ? 11.033  31.732 28.731  1.00 29.95  ? 16   PRO A O   1 
ATOM   55   C  CB  . PRO A 1 16  ? 8.685   30.971 27.378  1.00 30.27  ? 16   PRO A CB  1 
ATOM   56   C  CG  . PRO A 1 16  ? 8.320   32.335 26.927  1.00 31.06  ? 16   PRO A CG  1 
ATOM   57   C  CD  . PRO A 1 16  ? 7.659   33.084 28.078  1.00 30.73  ? 16   PRO A CD  1 
ATOM   58   N  N   . ASP A 1 17  ? 10.144  31.479 30.796  1.00 30.90  ? 17   ASP A N   1 
ATOM   59   C  CA  . ASP A 1 17  ? 11.314  31.909 31.499  1.00 31.68  ? 17   ASP A CA  1 
ATOM   60   C  C   . ASP A 1 17  ? 11.310  31.129 32.798  1.00 31.38  ? 17   ASP A C   1 
ATOM   61   O  O   . ASP A 1 17  ? 10.272  30.995 33.447  1.00 32.09  ? 17   ASP A O   1 
ATOM   62   C  CB  . ASP A 1 17  ? 11.348  33.420 31.747  1.00 31.82  ? 17   ASP A CB  1 
ATOM   63   C  CG  . ASP A 1 17  ? 12.624  33.859 32.539  1.00 34.50  ? 17   ASP A CG  1 
ATOM   64   O  OD1 . ASP A 1 17  ? 13.657  33.145 32.518  1.00 39.98  ? 17   ASP A OD1 1 
ATOM   65   O  OD2 . ASP A 1 17  ? 12.591  34.896 33.229  1.00 38.11  ? 17   ASP A OD2 1 
ATOM   66   N  N   . ASN A 1 18  ? 12.461  30.573 33.128  1.00 29.43  ? 18   ASN A N   1 
ATOM   67   C  CA  . ASN A 1 18  ? 12.629  29.739 34.311  1.00 29.57  ? 18   ASN A CA  1 
ATOM   68   C  C   . ASN A 1 18  ? 11.552  28.651 34.525  1.00 28.77  ? 18   ASN A C   1 
ATOM   69   O  O   . ASN A 1 18  ? 10.899  28.585 35.562  1.00 29.02  ? 18   ASN A O   1 
ATOM   70   C  CB  . ASN A 1 18  ? 12.819  30.631 35.542  1.00 29.81  ? 18   ASN A CB  1 
ATOM   71   C  CG  . ASN A 1 18  ? 13.988  31.613 35.369  1.00 33.10  ? 18   ASN A CG  1 
ATOM   72   O  OD1 . ASN A 1 18  ? 14.918  31.356 34.606  1.00 37.84  ? 18   ASN A OD1 1 
ATOM   73   N  ND2 . ASN A 1 18  ? 13.927  32.749 36.059  1.00 34.49  ? 18   ASN A ND2 1 
ATOM   74   N  N   . PHE A 1 19  ? 11.432  27.777 33.544  1.00 26.35  ? 19   PHE A N   1 
ATOM   75   C  CA  . PHE A 1 19  ? 10.470  26.722 33.592  1.00 27.13  ? 19   PHE A CA  1 
ATOM   76   C  C   . PHE A 1 19  ? 10.894  25.853 34.759  1.00 25.97  ? 19   PHE A C   1 
ATOM   77   O  O   . PHE A 1 19  ? 12.098  25.605 34.946  1.00 28.97  ? 19   PHE A O   1 
ATOM   78   C  CB  . PHE A 1 19  ? 10.548  25.876 32.313  1.00 25.12  ? 19   PHE A CB  1 
ATOM   79   C  CG  . PHE A 1 19  ? 9.845   26.446 31.153  1.00 27.58  ? 19   PHE A CG  1 
ATOM   80   C  CD1 . PHE A 1 19  ? 8.509   26.881 31.261  1.00 27.63  ? 19   PHE A CD1 1 
ATOM   81   C  CD2 . PHE A 1 19  ? 10.502  26.491 29.877  1.00 24.02  ? 19   PHE A CD2 1 
ATOM   82   C  CE1 . PHE A 1 19  ? 7.834   27.416 30.159  1.00 25.13  ? 19   PHE A CE1 1 
ATOM   83   C  CE2 . PHE A 1 19  ? 9.805   26.969 28.770  1.00 27.26  ? 19   PHE A CE2 1 
ATOM   84   C  CZ  . PHE A 1 19  ? 8.492   27.450 28.895  1.00 26.03  ? 19   PHE A CZ  1 
ATOM   85   N  N   . PHE A 1 20  ? 9.945   25.414 35.524  1.00 26.01  ? 20   PHE A N   1 
ATOM   86   C  CA  . PHE A 1 20  ? 10.163  24.418 36.606  1.00 26.51  ? 20   PHE A CA  1 
ATOM   87   C  C   . PHE A 1 20  ? 11.613  24.106 37.055  1.00 25.37  ? 20   PHE A C   1 
ATOM   88   O  O   . PHE A 1 20  ? 12.173  23.103 36.669  1.00 25.73  ? 20   PHE A O   1 
ATOM   89   C  CB  . PHE A 1 20  ? 9.417   23.103 36.296  1.00 25.12  ? 20   PHE A CB  1 
ATOM   90   C  CG  . PHE A 1 20  ? 9.082   22.334 37.531  1.00 27.09  ? 20   PHE A CG  1 
ATOM   91   C  CD1 . PHE A 1 20  ? 7.842   22.553 38.178  1.00 26.76  ? 20   PHE A CD1 1 
ATOM   92   C  CD2 . PHE A 1 20  ? 10.009  21.441 38.118  1.00 25.85  ? 20   PHE A CD2 1 
ATOM   93   C  CE1 . PHE A 1 20  ? 7.518   21.886 39.353  1.00 23.70  ? 20   PHE A CE1 1 
ATOM   94   C  CE2 . PHE A 1 20  ? 9.692   20.824 39.367  1.00 25.13  ? 20   PHE A CE2 1 
ATOM   95   C  CZ  . PHE A 1 20  ? 8.468   21.035 39.945  1.00 25.94  ? 20   PHE A CZ  1 
ATOM   96   N  N   . PRO A 1 21  ? 12.198  24.988 37.869  1.00 26.44  ? 21   PRO A N   1 
ATOM   97   C  CA  . PRO A 1 21  ? 13.534  24.827 38.443  1.00 25.91  ? 21   PRO A CA  1 
ATOM   98   C  C   . PRO A 1 21  ? 13.673  23.584 39.299  1.00 24.80  ? 21   PRO A C   1 
ATOM   99   O  O   . PRO A 1 21  ? 12.744  23.215 40.021  1.00 24.70  ? 21   PRO A O   1 
ATOM   100  C  CB  . PRO A 1 21  ? 13.756  26.076 39.285  1.00 25.88  ? 21   PRO A CB  1 
ATOM   101  C  CG  . PRO A 1 21  ? 12.630  26.994 39.012  1.00 28.53  ? 21   PRO A CG  1 
ATOM   102  C  CD  . PRO A 1 21  ? 11.556  26.254 38.270  1.00 27.32  ? 21   PRO A CD  1 
ATOM   103  N  N   . ILE A 1 22  ? 14.821  22.930 39.176  1.00 24.15  ? 22   ILE A N   1 
ATOM   104  C  CA  . ILE A 1 22  ? 15.126  21.775 39.998  1.00 23.49  ? 22   ILE A CA  1 
ATOM   105  C  C   . ILE A 1 22  ? 16.416  22.088 40.737  1.00 23.84  ? 22   ILE A C   1 
ATOM   106  O  O   . ILE A 1 22  ? 17.489  21.616 40.391  1.00 22.76  ? 22   ILE A O   1 
ATOM   107  C  CB  . ILE A 1 22  ? 15.239  20.414 39.195  1.00 23.65  ? 22   ILE A CB  1 
ATOM   108  C  CG1 . ILE A 1 22  ? 14.169  20.278 38.085  1.00 24.46  ? 22   ILE A CG1 1 
ATOM   109  C  CG2 . ILE A 1 22  ? 15.244  19.216 40.212  1.00 24.76  ? 22   ILE A CG2 1 
ATOM   110  C  CD1 . ILE A 1 22  ? 14.523  19.203 36.958  1.00 21.13  ? 22   ILE A CD1 1 
ATOM   111  N  N   . GLU A 1 23  ? 16.268  22.844 41.828  1.00 24.60  ? 23   GLU A N   1 
ATOM   112  C  CA  . GLU A 1 23  ? 17.364  23.206 42.678  1.00 26.30  ? 23   GLU A CA  1 
ATOM   113  C  C   . GLU A 1 23  ? 18.134  21.985 43.213  1.00 25.19  ? 23   GLU A C   1 
ATOM   114  O  O   . GLU A 1 23  ? 19.324  22.040 43.322  1.00 25.73  ? 23   GLU A O   1 
ATOM   115  C  CB  . GLU A 1 23  ? 16.836  24.078 43.838  1.00 26.50  ? 23   GLU A CB  1 
ATOM   116  C  CG  . GLU A 1 23  ? 17.948  24.519 44.842  1.00 33.36  ? 23   GLU A CG  1 
ATOM   117  C  CD  . GLU A 1 23  ? 18.233  23.479 45.927  1.00 37.35  ? 23   GLU A CD  1 
ATOM   118  O  OE1 . GLU A 1 23  ? 17.327  22.665 46.226  1.00 42.91  ? 23   GLU A OE1 1 
ATOM   119  O  OE2 . GLU A 1 23  ? 19.381  23.478 46.458  1.00 43.94  ? 23   GLU A OE2 1 
ATOM   120  N  N   . LYS A 1 24  ? 17.455  20.867 43.455  1.00 26.64  ? 24   LYS A N   1 
ATOM   121  C  CA  . LYS A 1 24  ? 18.113  19.672 43.952  1.00 27.38  ? 24   LYS A CA  1 
ATOM   122  C  C   . LYS A 1 24  ? 19.126  18.984 43.070  1.00 26.28  ? 24   LYS A C   1 
ATOM   123  O  O   . LYS A 1 24  ? 19.949  18.235 43.574  1.00 23.94  ? 24   LYS A O   1 
ATOM   124  C  CB  . LYS A 1 24  ? 17.078  18.672 44.487  1.00 28.75  ? 24   LYS A CB  1 
ATOM   125  C  CG  . LYS A 1 24  ? 17.613  17.965 45.672  1.00 29.93  ? 24   LYS A CG  1 
ATOM   126  C  CD  . LYS A 1 24  ? 16.694  16.943 46.298  1.00 32.46  ? 24   LYS A CD  1 
ATOM   127  C  CE  . LYS A 1 24  ? 17.484  15.957 47.227  1.00 34.02  ? 24   LYS A CE  1 
ATOM   128  N  NZ  . LYS A 1 24  ? 16.635  15.569 48.400  1.00 34.65  ? 24   LYS A NZ  1 
ATOM   129  N  N   . LEU A 1 25  ? 19.113  19.241 41.755  1.00 26.79  ? 25   LEU A N   1 
ATOM   130  C  CA  . LEU A 1 25  ? 20.166  18.721 40.891  1.00 27.36  ? 25   LEU A CA  1 
ATOM   131  C  C   . LEU A 1 25  ? 21.538  19.228 41.258  1.00 27.07  ? 25   LEU A C   1 
ATOM   132  O  O   . LEU A 1 25  ? 22.503  18.597 40.866  1.00 28.14  ? 25   LEU A O   1 
ATOM   133  C  CB  . LEU A 1 25  ? 19.901  19.009 39.390  1.00 28.43  ? 25   LEU A CB  1 
ATOM   134  C  CG  . LEU A 1 25  ? 19.029  18.036 38.655  1.00 27.61  ? 25   LEU A CG  1 
ATOM   135  C  CD1 . LEU A 1 25  ? 18.647  18.512 37.168  1.00 30.44  ? 25   LEU A CD1 1 
ATOM   136  C  CD2 . LEU A 1 25  ? 19.626  16.571 38.728  1.00 25.44  ? 25   LEU A CD2 1 
ATOM   137  N  N   . ARG A 1 26  ? 21.607  20.346 42.008  1.00 27.35  ? 26   ARG A N   1 
ATOM   138  C  CA  . ARG A 1 26  ? 22.838  20.893 42.594  1.00 28.18  ? 26   ARG A CA  1 
ATOM   139  C  C   . ARG A 1 26  ? 23.576  19.820 43.382  1.00 27.59  ? 26   ARG A C   1 
ATOM   140  O  O   . ARG A 1 26  ? 24.780  19.787 43.377  1.00 27.00  ? 26   ARG A O   1 
ATOM   141  C  CB  . ARG A 1 26  ? 22.555  22.109 43.526  1.00 28.75  ? 26   ARG A CB  1 
ATOM   142  C  CG  . ARG A 1 26  ? 22.131  23.369 42.762  1.00 31.24  ? 26   ARG A CG  1 
ATOM   143  C  CD  . ARG A 1 26  ? 21.952  24.620 43.629  1.00 29.43  ? 26   ARG A CD  1 
ATOM   144  N  NE  . ARG A 1 26  ? 23.204  24.982 44.317  1.00 34.91  ? 26   ARG A NE  1 
ATOM   145  C  CZ  . ARG A 1 26  ? 24.100  25.908 43.945  1.00 31.81  ? 26   ARG A CZ  1 
ATOM   146  N  NH1 . ARG A 1 26  ? 23.963  26.603 42.854  1.00 33.40  ? 26   ARG A NH1 1 
ATOM   147  N  NH2 . ARG A 1 26  ? 25.183  26.077 44.658  1.00 33.06  ? 26   ARG A NH2 1 
ATOM   148  N  N   . ASN A 1 27  ? 22.821  18.924 44.022  1.00 27.67  ? 27   ASN A N   1 
ATOM   149  C  CA  . ASN A 1 27  ? 23.386  17.785 44.749  1.00 26.77  ? 27   ASN A CA  1 
ATOM   150  C  C   . ASN A 1 27  ? 24.130  16.728 43.941  1.00 25.87  ? 27   ASN A C   1 
ATOM   151  O  O   . ASN A 1 27  ? 24.826  15.918 44.539  1.00 25.63  ? 27   ASN A O   1 
ATOM   152  C  CB  . ASN A 1 27  ? 22.288  17.081 45.604  1.00 25.40  ? 27   ASN A CB  1 
ATOM   153  C  CG  . ASN A 1 27  ? 21.780  17.952 46.739  1.00 24.68  ? 27   ASN A CG  1 
ATOM   154  O  OD1 . ASN A 1 27  ? 22.062  19.143 46.787  1.00 29.15  ? 27   ASN A OD1 1 
ATOM   155  N  ND2 . ASN A 1 27  ? 21.065  17.366 47.659  1.00 25.47  ? 27   ASN A ND2 1 
ATOM   156  N  N   . TYR A 1 28  ? 23.971  16.710 42.619  1.00 25.85  ? 28   TYR A N   1 
ATOM   157  C  CA  . TYR A 1 28  ? 24.391  15.563 41.746  1.00 26.05  ? 28   TYR A CA  1 
ATOM   158  C  C   . TYR A 1 28  ? 25.280  15.987 40.574  1.00 26.64  ? 28   TYR A C   1 
ATOM   159  O  O   . TYR A 1 28  ? 25.575  15.198 39.672  1.00 25.83  ? 28   TYR A O   1 
ATOM   160  C  CB  . TYR A 1 28  ? 23.150  14.790 41.201  1.00 25.76  ? 28   TYR A CB  1 
ATOM   161  C  CG  . TYR A 1 28  ? 22.243  14.352 42.298  1.00 27.04  ? 28   TYR A CG  1 
ATOM   162  C  CD1 . TYR A 1 28  ? 21.000  14.940 42.509  1.00 26.69  ? 28   TYR A CD1 1 
ATOM   163  C  CD2 . TYR A 1 28  ? 22.683  13.393 43.220  1.00 30.64  ? 28   TYR A CD2 1 
ATOM   164  C  CE1 . TYR A 1 28  ? 20.195  14.532 43.568  1.00 26.90  ? 28   TYR A CE1 1 
ATOM   165  C  CE2 . TYR A 1 28  ? 21.925  13.032 44.289  1.00 26.76  ? 28   TYR A CE2 1 
ATOM   166  C  CZ  . TYR A 1 28  ? 20.667  13.576 44.462  1.00 28.52  ? 28   TYR A CZ  1 
ATOM   167  O  OH  . TYR A 1 28  ? 19.931  13.172 45.599  1.00 28.05  ? 28   TYR A OH  1 
ATOM   168  N  N   . THR A 1 29  ? 25.703  17.246 40.570  1.00 26.79  ? 29   THR A N   1 
ATOM   169  C  CA  . THR A 1 29  ? 26.454  17.773 39.472  1.00 26.77  ? 29   THR A CA  1 
ATOM   170  C  C   . THR A 1 29  ? 27.853  17.114 39.372  1.00 27.44  ? 29   THR A C   1 
ATOM   171  O  O   . THR A 1 29  ? 28.434  17.147 38.330  1.00 28.14  ? 29   THR A O   1 
ATOM   172  C  CB  . THR A 1 29  ? 26.653  19.313 39.599  1.00 26.21  ? 29   THR A CB  1 
ATOM   173  O  OG1 . THR A 1 29  ? 27.281  19.604 40.841  1.00 26.09  ? 29   THR A OG1 1 
ATOM   174  C  CG2 . THR A 1 29  ? 25.378  20.061 39.466  1.00 26.30  ? 29   THR A CG2 1 
ATOM   175  N  N   . GLN A 1 30  ? 28.392  16.535 40.453  1.00 27.49  ? 30   GLN A N   1 
ATOM   176  C  CA  . GLN A 1 30  ? 29.612  15.754 40.361  1.00 28.28  ? 30   GLN A CA  1 
ATOM   177  C  C   . GLN A 1 30  ? 29.429  14.513 39.503  1.00 28.54  ? 30   GLN A C   1 
ATOM   178  O  O   . GLN A 1 30  ? 30.400  13.877 39.108  1.00 29.13  ? 30   GLN A O   1 
ATOM   179  C  CB  . GLN A 1 30  ? 30.149  15.384 41.769  1.00 29.02  ? 30   GLN A CB  1 
ATOM   180  C  CG  . GLN A 1 30  ? 29.347  14.312 42.571  1.00 30.91  ? 30   GLN A CG  1 
ATOM   181  C  CD  . GLN A 1 30  ? 28.036  14.775 43.177  1.00 30.60  ? 30   GLN A CD  1 
ATOM   182  O  OE1 . GLN A 1 30  ? 27.744  15.984 43.237  1.00 29.24  ? 30   GLN A OE1 1 
ATOM   183  N  NE2 . GLN A 1 30  ? 27.209  13.799 43.596  1.00 28.65  ? 30   GLN A NE2 1 
ATOM   184  N  N   . MET A 1 31  ? 28.188  14.176 39.176  1.00 29.14  ? 31   MET A N   1 
ATOM   185  C  CA  . MET A 1 31  ? 27.903  13.013 38.298  1.00 29.56  ? 31   MET A CA  1 
ATOM   186  C  C   . MET A 1 31  ? 27.872  13.404 36.831  1.00 28.08  ? 31   MET A C   1 
ATOM   187  O  O   . MET A 1 31  ? 27.960  12.549 35.956  1.00 27.99  ? 31   MET A O   1 
ATOM   188  C  CB  . MET A 1 31  ? 26.601  12.331 38.720  1.00 28.91  ? 31   MET A CB  1 
ATOM   189  C  CG  . MET A 1 31  ? 26.640  11.926 40.180  1.00 30.95  ? 31   MET A CG  1 
ATOM   190  S  SD  . MET A 1 31  ? 25.185  11.113 40.779  1.00 33.89  ? 31   MET A SD  1 
ATOM   191  C  CE  . MET A 1 31  ? 25.817  10.300 42.239  1.00 34.01  ? 31   MET A CE  1 
ATOM   192  N  N   . GLY A 1 32  ? 27.814  14.703 36.567  1.00 27.13  ? 32   GLY A N   1 
ATOM   193  C  CA  . GLY A 1 32  ? 27.875  15.194 35.220  1.00 27.09  ? 32   GLY A CA  1 
ATOM   194  C  C   . GLY A 1 32  ? 29.192  15.874 34.910  1.00 26.36  ? 32   GLY A C   1 
ATOM   195  O  O   . GLY A 1 32  ? 30.214  15.689 35.604  1.00 26.06  ? 32   GLY A O   1 
ATOM   196  N  N   . LEU A 1 33  ? 29.163  16.646 33.837  1.00 25.40  ? 33   LEU A N   1 
ATOM   197  C  CA  . LEU A 1 33  ? 30.352  17.358 33.358  1.00 26.09  ? 33   LEU A CA  1 
ATOM   198  C  C   . LEU A 1 33  ? 30.120  18.868 33.403  1.00 25.78  ? 33   LEU A C   1 
ATOM   199  O  O   . LEU A 1 33  ? 29.234  19.362 32.744  1.00 24.27  ? 33   LEU A O   1 
ATOM   200  C  CB  . LEU A 1 33  ? 30.758  16.890 31.955  1.00 26.37  ? 33   LEU A CB  1 
ATOM   201  C  CG  . LEU A 1 33  ? 31.309  15.444 31.720  1.00 29.83  ? 33   LEU A CG  1 
ATOM   202  C  CD1 . LEU A 1 33  ? 31.385  15.046 30.179  1.00 29.93  ? 33   LEU A CD1 1 
ATOM   203  C  CD2 . LEU A 1 33  ? 32.663  15.196 32.384  1.00 31.32  ? 33   LEU A CD2 1 
ATOM   204  N  N   . ILE A 1 34  ? 30.919  19.572 34.213  1.00 26.92  ? 34   ILE A N   1 
ATOM   205  C  CA  . ILE A 1 34  ? 30.801  21.046 34.438  1.00 27.52  ? 34   ILE A CA  1 
ATOM   206  C  C   . ILE A 1 34  ? 31.427  21.753 33.259  1.00 28.21  ? 34   ILE A C   1 
ATOM   207  O  O   . ILE A 1 34  ? 32.510  21.431 32.871  1.00 28.80  ? 34   ILE A O   1 
ATOM   208  C  CB  . ILE A 1 34  ? 31.470  21.483 35.776  1.00 28.32  ? 34   ILE A CB  1 
ATOM   209  C  CG1 . ILE A 1 34  ? 30.677  20.875 36.934  1.00 29.31  ? 34   ILE A CG1 1 
ATOM   210  C  CG2 . ILE A 1 34  ? 31.587  23.046 35.954  1.00 26.11  ? 34   ILE A CG2 1 
ATOM   211  C  CD1 . ILE A 1 34  ? 29.296  21.457 37.090  1.00 25.61  ? 34   ILE A CD1 1 
ATOM   212  N  N   . ARG A 1 35  ? 30.683  22.665 32.650  1.00 28.52  ? 35   ARG A N   1 
ATOM   213  C  CA  . ARG A 1 35  ? 31.149  23.449 31.515  1.00 29.13  ? 35   ARG A CA  1 
ATOM   214  C  C   . ARG A 1 35  ? 30.717  24.877 31.772  1.00 27.46  ? 35   ARG A C   1 
ATOM   215  O  O   . ARG A 1 35  ? 29.543  25.126 32.023  1.00 28.49  ? 35   ARG A O   1 
ATOM   216  C  CB  . ARG A 1 35  ? 30.565  22.913 30.230  1.00 28.36  ? 35   ARG A CB  1 
ATOM   217  C  CG  . ARG A 1 35  ? 31.190  21.586 29.823  1.00 30.88  ? 35   ARG A CG  1 
ATOM   218  C  CD  . ARG A 1 35  ? 30.594  20.968 28.619  1.00 34.54  ? 35   ARG A CD  1 
ATOM   219  N  NE  . ARG A 1 35  ? 30.761  21.816 27.427  1.00 41.35  ? 35   ARG A NE  1 
ATOM   220  C  CZ  . ARG A 1 35  ? 30.344  21.489 26.208  1.00 43.42  ? 35   ARG A CZ  1 
ATOM   221  N  NH1 . ARG A 1 35  ? 29.739  20.301 26.015  1.00 44.54  ? 35   ARG A NH1 1 
ATOM   222  N  NH2 . ARG A 1 35  ? 30.537  22.350 25.188  1.00 42.76  ? 35   ARG A NH2 1 
ATOM   223  N  N   . ASP A 1 36  ? 31.670  25.780 31.727  1.00 26.45  ? 36   ASP A N   1 
ATOM   224  C  CA  . ASP A 1 36  ? 31.456  27.220 31.865  1.00 26.62  ? 36   ASP A CA  1 
ATOM   225  C  C   . ASP A 1 36  ? 31.501  27.958 30.533  1.00 26.99  ? 36   ASP A C   1 
ATOM   226  O  O   . ASP A 1 36  ? 32.312  27.670 29.651  1.00 26.24  ? 36   ASP A O   1 
ATOM   227  C  CB  . ASP A 1 36  ? 32.551  27.819 32.725  1.00 27.09  ? 36   ASP A CB  1 
ATOM   228  C  CG  . ASP A 1 36  ? 32.466  27.379 34.148  1.00 26.72  ? 36   ASP A CG  1 
ATOM   229  O  OD1 . ASP A 1 36  ? 31.411  26.831 34.563  1.00 27.00  ? 36   ASP A OD1 1 
ATOM   230  O  OD2 . ASP A 1 36  ? 33.477  27.573 34.839  1.00 27.33  ? 36   ASP A OD2 1 
ATOM   231  N  N   . PHE A 1 37  ? 30.649  28.959 30.431  1.00 27.11  ? 37   PHE A N   1 
ATOM   232  C  CA  . PHE A 1 37  ? 30.562  29.790 29.238  1.00 26.21  ? 37   PHE A CA  1 
ATOM   233  C  C   . PHE A 1 37  ? 30.600  31.271 29.590  1.00 25.90  ? 37   PHE A C   1 
ATOM   234  O  O   . PHE A 1 37  ? 29.862  31.738 30.481  1.00 25.45  ? 37   PHE A O   1 
ATOM   235  C  CB  . PHE A 1 37  ? 29.271  29.432 28.513  1.00 25.74  ? 37   PHE A CB  1 
ATOM   236  C  CG  . PHE A 1 37  ? 29.194  27.974 28.083  1.00 23.59  ? 37   PHE A CG  1 
ATOM   237  C  CD1 . PHE A 1 37  ? 29.611  27.599 26.833  1.00 24.71  ? 37   PHE A CD1 1 
ATOM   238  C  CD2 . PHE A 1 37  ? 28.719  26.984 28.970  1.00 23.15  ? 37   PHE A CD2 1 
ATOM   239  C  CE1 . PHE A 1 37  ? 29.531  26.303 26.429  1.00 22.87  ? 37   PHE A CE1 1 
ATOM   240  C  CE2 . PHE A 1 37  ? 28.684  25.687 28.585  1.00 21.99  ? 37   PHE A CE2 1 
ATOM   241  C  CZ  . PHE A 1 37  ? 29.073  25.350 27.280  1.00 24.50  ? 37   PHE A CZ  1 
ATOM   242  N  N   . ALA A 1 38  ? 31.465  32.007 28.898  1.00 26.62  ? 38   ALA A N   1 
ATOM   243  C  CA  . ALA A 1 38  ? 31.513  33.461 29.000  1.00 26.54  ? 38   ALA A CA  1 
ATOM   244  C  C   . ALA A 1 38  ? 30.244  34.031 28.431  1.00 26.71  ? 38   ALA A C   1 
ATOM   245  O  O   . ALA A 1 38  ? 29.525  33.359 27.673  1.00 27.44  ? 38   ALA A O   1 
ATOM   246  C  CB  . ALA A 1 38  ? 32.704  34.017 28.225  1.00 26.76  ? 38   ALA A CB  1 
ATOM   247  N  N   . LYS A 1 39  ? 29.974  35.285 28.789  1.00 27.15  ? 39   LYS A N   1 
ATOM   248  C  CA  . LYS A 1 39  ? 28.869  36.055 28.217  1.00 26.24  ? 39   LYS A CA  1 
ATOM   249  C  C   . LYS A 1 39  ? 29.042  36.232 26.734  1.00 26.18  ? 39   LYS A C   1 
ATOM   250  O  O   . LYS A 1 39  ? 30.116  36.645 26.257  1.00 24.23  ? 39   LYS A O   1 
ATOM   251  C  CB  . LYS A 1 39  ? 28.722  37.398 28.914  1.00 26.75  ? 39   LYS A CB  1 
ATOM   252  C  CG  . LYS A 1 39  ? 27.842  38.460 28.238  1.00 27.65  ? 39   LYS A CG  1 
ATOM   253  C  CD  . LYS A 1 39  ? 27.416  39.515 29.263  1.00 27.73  ? 39   LYS A CD  1 
ATOM   254  C  CE  . LYS A 1 39  ? 27.316  40.936 28.674  1.00 33.13  ? 39   LYS A CE  1 
ATOM   255  N  NZ  . LYS A 1 39  ? 25.854  41.238 28.508  1.00 33.30  ? 39   LYS A NZ  1 
ATOM   256  N  N   . GLY A 1 40  ? 27.978  35.882 25.997  1.00 25.14  ? 40   GLY A N   1 
ATOM   257  C  CA  . GLY A 1 40  ? 27.997  35.954 24.529  1.00 25.67  ? 40   GLY A CA  1 
ATOM   258  C  C   . GLY A 1 40  ? 28.404  34.646 23.854  1.00 26.00  ? 40   GLY A C   1 
ATOM   259  O  O   . GLY A 1 40  ? 28.259  34.500 22.635  1.00 25.36  ? 40   GLY A O   1 
ATOM   260  N  N   . SER A 1 41  ? 28.946  33.702 24.629  1.00 25.59  ? 41   SER A N   1 
ATOM   261  C  CA  . SER A 1 41  ? 29.288  32.381 24.090  1.00 26.54  ? 41   SER A CA  1 
ATOM   262  C  C   . SER A 1 41  ? 28.098  31.467 23.881  1.00 25.56  ? 41   SER A C   1 
ATOM   263  O  O   . SER A 1 41  ? 27.079  31.546 24.593  1.00 26.62  ? 41   SER A O   1 
ATOM   264  C  CB  . SER A 1 41  ? 30.244  31.670 25.023  1.00 25.65  ? 41   SER A CB  1 
ATOM   265  O  OG  . SER A 1 41  ? 31.378  32.462 25.022  1.00 30.18  ? 41   SER A OG  1 
ATOM   266  N  N   . ALA A 1 42  ? 28.260  30.564 22.918  1.00 25.65  ? 42   ALA A N   1 
ATOM   267  C  CA  . ALA A 1 42  ? 27.253  29.572 22.590  1.00 26.94  ? 42   ALA A CA  1 
ATOM   268  C  C   . ALA A 1 42  ? 27.294  28.359 23.518  1.00 25.98  ? 42   ALA A C   1 
ATOM   269  O  O   . ALA A 1 42  ? 28.255  27.594 23.501  1.00 26.83  ? 42   ALA A O   1 
ATOM   270  C  CB  . ALA A 1 42  ? 27.459  29.123 21.159  1.00 26.93  ? 42   ALA A CB  1 
ATOM   271  N  N   . VAL A 1 43  ? 26.262  28.166 24.316  1.00 26.14  ? 43   VAL A N   1 
ATOM   272  C  CA  . VAL A 1 43  ? 26.063  26.892 25.093  1.00 25.40  ? 43   VAL A CA  1 
ATOM   273  C  C   . VAL A 1 43  ? 25.678  25.747 24.138  1.00 25.70  ? 43   VAL A C   1 
ATOM   274  O  O   . VAL A 1 43  ? 26.248  24.632 24.219  1.00 26.24  ? 43   VAL A O   1 
ATOM   275  C  CB  . VAL A 1 43  ? 24.974  27.063 26.219  1.00 25.81  ? 43   VAL A CB  1 
ATOM   276  C  CG1 . VAL A 1 43  ? 24.687  25.755 26.979  1.00 25.84  ? 43   VAL A CG1 1 
ATOM   277  C  CG2 . VAL A 1 43  ? 25.432  28.153 27.168  1.00 23.08  ? 43   VAL A CG2 1 
ATOM   278  N  N   . ILE A 1 44  ? 24.756  26.061 23.212  1.00 23.79  ? 44   ILE A N   1 
ATOM   279  C  CA  . ILE A 1 44  ? 24.474  25.204 22.096  1.00 24.22  ? 44   ILE A CA  1 
ATOM   280  C  C   . ILE A 1 44  ? 24.701  25.978 20.791  1.00 24.69  ? 44   ILE A C   1 
ATOM   281  O  O   . ILE A 1 44  ? 24.080  26.984 20.547  1.00 26.01  ? 44   ILE A O   1 
ATOM   282  C  CB  . ILE A 1 44  ? 23.053  24.597 22.117  1.00 23.23  ? 44   ILE A CB  1 
ATOM   283  C  CG1 . ILE A 1 44  ? 22.708  24.011 23.525  1.00 21.80  ? 44   ILE A CG1 1 
ATOM   284  C  CG2 . ILE A 1 44  ? 22.884  23.656 20.893  1.00 22.32  ? 44   ILE A CG2 1 
ATOM   285  C  CD1 . ILE A 1 44  ? 21.184  23.693 23.764  1.00 20.43  ? 44   ILE A CD1 1 
ATOM   286  N  N   . MET A 1 45  ? 25.590  25.468 19.963  1.00 26.24  ? 45   MET A N   1 
ATOM   287  C  CA  . MET A 1 45  ? 25.920  26.126 18.713  1.00 28.97  ? 45   MET A CA  1 
ATOM   288  C  C   . MET A 1 45  ? 24.860  25.775 17.724  1.00 27.99  ? 45   MET A C   1 
ATOM   289  O  O   . MET A 1 45  ? 24.299  24.677 17.767  1.00 25.86  ? 45   MET A O   1 
ATOM   290  C  CB  . MET A 1 45  ? 27.253  25.648 18.189  1.00 28.28  ? 45   MET A CB  1 
ATOM   291  C  CG  . MET A 1 45  ? 28.388  26.043 19.107  1.00 31.84  ? 45   MET A CG  1 
ATOM   292  S  SD  . MET A 1 45  ? 30.015  25.472 18.623  1.00 38.39  ? 45   MET A SD  1 
ATOM   293  C  CE  . MET A 1 45  ? 30.059  25.879 16.867  1.00 42.33  ? 45   MET A CE  1 
ATOM   294  N  N   . PRO A 1 46  ? 24.649  26.664 16.761  1.00 27.96  ? 46   PRO A N   1 
ATOM   295  C  CA  . PRO A 1 46  ? 23.674  26.332 15.762  1.00 28.72  ? 46   PRO A CA  1 
ATOM   296  C  C   . PRO A 1 46  ? 24.175  25.113 14.987  1.00 28.04  ? 46   PRO A C   1 
ATOM   297  O  O   . PRO A 1 46  ? 25.364  25.005 14.719  1.00 27.11  ? 46   PRO A O   1 
ATOM   298  C  CB  . PRO A 1 46  ? 23.636  27.578 14.865  1.00 28.97  ? 46   PRO A CB  1 
ATOM   299  C  CG  . PRO A 1 46  ? 24.544  28.552 15.453  1.00 29.09  ? 46   PRO A CG  1 
ATOM   300  C  CD  . PRO A 1 46  ? 25.353  27.926 16.494  1.00 29.32  ? 46   PRO A CD  1 
ATOM   301  N  N   . GLY A 1 47  ? 23.290  24.174 14.740  1.00 28.98  ? 47   GLY A N   1 
ATOM   302  C  CA  . GLY A 1 47  ? 23.669  22.898 14.113  1.00 30.00  ? 47   GLY A CA  1 
ATOM   303  C  C   . GLY A 1 47  ? 24.338  21.842 14.982  1.00 29.91  ? 47   GLY A C   1 
ATOM   304  O  O   . GLY A 1 47  ? 24.702  20.761 14.479  1.00 31.32  ? 47   GLY A O   1 
ATOM   305  N  N   . GLU A 1 48  ? 24.559  22.138 16.263  1.00 29.05  ? 48   GLU A N   1 
ATOM   306  C  CA  . GLU A 1 48  ? 25.149  21.155 17.161  1.00 28.93  ? 48   GLU A CA  1 
ATOM   307  C  C   . GLU A 1 48  ? 24.134  20.083 17.600  1.00 28.88  ? 48   GLU A C   1 
ATOM   308  O  O   . GLU A 1 48  ? 23.042  20.439 18.042  1.00 28.47  ? 48   GLU A O   1 
ATOM   309  C  CB  . GLU A 1 48  ? 25.679  21.883 18.403  1.00 28.74  ? 48   GLU A CB  1 
ATOM   310  C  CG  . GLU A 1 48  ? 26.516  21.051 19.348  1.00 30.20  ? 48   GLU A CG  1 
ATOM   311  C  CD  . GLU A 1 48  ? 27.119  21.882 20.446  1.00 29.32  ? 48   GLU A CD  1 
ATOM   312  O  OE1 . GLU A 1 48  ? 26.918  23.112 20.513  1.00 29.35  ? 48   GLU A OE1 1 
ATOM   313  O  OE2 . GLU A 1 48  ? 27.853  21.305 21.229  1.00 35.98  ? 48   GLU A OE2 1 
ATOM   314  N  N   . GLU A 1 49  ? 24.543  18.800 17.511  1.00 28.61  ? 49   GLU A N   1 
ATOM   315  C  CA  . GLU A 1 49  ? 23.815  17.645 18.003  1.00 29.99  ? 49   GLU A CA  1 
ATOM   316  C  C   . GLU A 1 49  ? 24.025  17.557 19.526  1.00 27.31  ? 49   GLU A C   1 
ATOM   317  O  O   . GLU A 1 49  ? 25.105  17.278 19.976  1.00 28.05  ? 49   GLU A O   1 
ATOM   318  C  CB  . GLU A 1 49  ? 24.312  16.341 17.351  1.00 29.74  ? 49   GLU A CB  1 
ATOM   319  C  CG  . GLU A 1 49  ? 24.156  16.260 15.802  1.00 35.64  ? 49   GLU A CG  1 
ATOM   320  C  CD  . GLU A 1 49  ? 24.979  15.074 15.091  1.00 37.58  ? 49   GLU A CD  1 
ATOM   321  O  OE1 . GLU A 1 49  ? 26.259  14.974 15.231  1.00 46.52  ? 49   GLU A OE1 1 
ATOM   322  O  OE2 . GLU A 1 49  ? 24.347  14.277 14.314  1.00 44.23  ? 49   GLU A OE2 1 
ATOM   323  N  N   . ILE A 1 50  ? 22.995  17.859 20.291  1.00 25.12  ? 50   ILE A N   1 
ATOM   324  C  CA  . ILE A 1 50  ? 23.020  17.787 21.748  1.00 24.42  ? 50   ILE A CA  1 
ATOM   325  C  C   . ILE A 1 50  ? 22.375  16.449 22.156  1.00 23.36  ? 50   ILE A C   1 
ATOM   326  O  O   . ILE A 1 50  ? 21.288  16.113 21.683  1.00 24.03  ? 50   ILE A O   1 
ATOM   327  C  CB  . ILE A 1 50  ? 22.299  19.044 22.355  1.00 25.10  ? 50   ILE A CB  1 
ATOM   328  C  CG1 . ILE A 1 50  ? 22.968  20.331 21.791  1.00 23.01  ? 50   ILE A CG1 1 
ATOM   329  C  CG2 . ILE A 1 50  ? 22.250  19.036 23.887  1.00 22.96  ? 50   ILE A CG2 1 
ATOM   330  C  CD1 . ILE A 1 50  ? 24.425  20.487 22.204  1.00 20.92  ? 50   ILE A CD1 1 
ATOM   331  N  N   . THR A 1 51  ? 23.074  15.688 23.017  1.00 23.87  ? 51   THR A N   1 
ATOM   332  C  CA  . THR A 1 51  ? 22.559  14.443 23.585  1.00 25.27  ? 51   THR A CA  1 
ATOM   333  C  C   . THR A 1 51  ? 22.823  14.385 25.117  1.00 24.96  ? 51   THR A C   1 
ATOM   334  O  O   . THR A 1 51  ? 23.305  13.382 25.667  1.00 24.62  ? 51   THR A O   1 
ATOM   335  C  CB  . THR A 1 51  ? 23.132  13.154 22.889  1.00 25.28  ? 51   THR A CB  1 
ATOM   336  O  OG1 . THR A 1 51  ? 24.528  13.180 23.013  1.00 26.08  ? 51   THR A OG1 1 
ATOM   337  C  CG2 . THR A 1 51  ? 22.792  13.047 21.427  1.00 25.41  ? 51   THR A CG2 1 
ATOM   338  N  N   . SER A 1 52  ? 22.446  15.460 25.775  1.00 23.96  ? 52   SER A N   1 
ATOM   339  C  CA  . SER A 1 52  ? 22.693  15.706 27.154  1.00 25.33  ? 52   SER A CA  1 
ATOM   340  C  C   . SER A 1 52  ? 21.606  16.541 27.677  1.00 25.51  ? 52   SER A C   1 
ATOM   341  O  O   . SER A 1 52  ? 21.204  17.488 26.994  1.00 27.40  ? 52   SER A O   1 
ATOM   342  C  CB  . SER A 1 52  ? 23.964  16.535 27.382  1.00 25.38  ? 52   SER A CB  1 
ATOM   343  O  OG  . SER A 1 52  ? 25.090  15.753 27.134  1.00 29.00  ? 52   SER A OG  1 
ATOM   344  N  N   . MET A 1 53  ? 21.174  16.283 28.916  1.00 25.90  ? 53   MET A N   1 
ATOM   345  C  CA  . MET A 1 53  ? 20.461  17.294 29.641  1.00 26.50  ? 53   MET A CA  1 
ATOM   346  C  C   . MET A 1 53  ? 21.467  18.289 30.198  1.00 28.35  ? 53   MET A C   1 
ATOM   347  O  O   . MET A 1 53  ? 22.575  17.897 30.698  1.00 29.25  ? 53   MET A O   1 
ATOM   348  C  CB  . MET A 1 53  ? 19.597  16.706 30.715  1.00 26.87  ? 53   MET A CB  1 
ATOM   349  C  CG  . MET A 1 53  ? 18.529  15.804 30.108  1.00 25.54  ? 53   MET A CG  1 
ATOM   350  S  SD  . MET A 1 53  ? 17.244  15.646 31.304  1.00 30.06  ? 53   MET A SD  1 
ATOM   351  C  CE  . MET A 1 53  ? 16.302  14.303 30.705  1.00 25.99  ? 53   MET A CE  1 
ATOM   352  N  N   . ILE A 1 54  ? 21.144  19.587 30.053  1.00 27.16  ? 54   ILE A N   1 
ATOM   353  C  CA  . ILE A 1 54  ? 22.048  20.617 30.546  1.00 26.41  ? 54   ILE A CA  1 
ATOM   354  C  C   . ILE A 1 54  ? 21.401  21.389 31.696  1.00 27.12  ? 54   ILE A C   1 
ATOM   355  O  O   . ILE A 1 54  ? 20.423  22.122 31.516  1.00 26.03  ? 54   ILE A O   1 
ATOM   356  C  CB  . ILE A 1 54  ? 22.467  21.616 29.411  1.00 27.49  ? 54   ILE A CB  1 
ATOM   357  C  CG1 . ILE A 1 54  ? 22.934  20.851 28.151  1.00 22.69  ? 54   ILE A CG1 1 
ATOM   358  C  CG2 . ILE A 1 54  ? 23.520  22.618 29.951  1.00 25.50  ? 54   ILE A CG2 1 
ATOM   359  C  CD1 . ILE A 1 54  ? 23.004  21.731 26.838  1.00 22.91  ? 54   ILE A CD1 1 
ATOM   360  N  N   . PHE A 1 55  ? 22.033  21.297 32.864  1.00 27.24  ? 55   PHE A N   1 
ATOM   361  C  CA  . PHE A 1 55  ? 21.535  21.938 34.079  1.00 27.50  ? 55   PHE A CA  1 
ATOM   362  C  C   . PHE A 1 55  ? 22.298  23.251 34.227  1.00 27.48  ? 55   PHE A C   1 
ATOM   363  O  O   . PHE A 1 55  ? 23.547  23.310 34.027  1.00 27.79  ? 55   PHE A O   1 
ATOM   364  C  CB  . PHE A 1 55  ? 21.709  20.984 35.280  1.00 26.79  ? 55   PHE A CB  1 
ATOM   365  C  CG  . PHE A 1 55  ? 21.317  21.568 36.577  1.00 27.14  ? 55   PHE A CG  1 
ATOM   366  C  CD1 . PHE A 1 55  ? 19.979  21.870 36.842  1.00 26.14  ? 55   PHE A CD1 1 
ATOM   367  C  CD2 . PHE A 1 55  ? 22.261  21.771 37.556  1.00 24.20  ? 55   PHE A CD2 1 
ATOM   368  C  CE1 . PHE A 1 55  ? 19.608  22.409 38.060  1.00 31.54  ? 55   PHE A CE1 1 
ATOM   369  C  CE2 . PHE A 1 55  ? 21.908  22.341 38.791  1.00 28.48  ? 55   PHE A CE2 1 
ATOM   370  C  CZ  . PHE A 1 55  ? 20.571  22.641 39.051  1.00 26.50  ? 55   PHE A CZ  1 
ATOM   371  N  N   . LEU A 1 56  ? 21.535  24.317 34.526  1.00 27.47  ? 56   LEU A N   1 
ATOM   372  C  CA  . LEU A 1 56  ? 22.097  25.661 34.730  1.00 27.88  ? 56   LEU A CA  1 
ATOM   373  C  C   . LEU A 1 56  ? 22.338  25.898 36.183  1.00 28.08  ? 56   LEU A C   1 
ATOM   374  O  O   . LEU A 1 56  ? 21.377  26.143 36.934  1.00 27.38  ? 56   LEU A O   1 
ATOM   375  C  CB  . LEU A 1 56  ? 21.162  26.768 34.264  1.00 28.55  ? 56   LEU A CB  1 
ATOM   376  C  CG  . LEU A 1 56  ? 21.259  27.235 32.845  1.00 30.63  ? 56   LEU A CG  1 
ATOM   377  C  CD1 . LEU A 1 56  ? 20.352  26.200 32.197  1.00 37.07  ? 56   LEU A CD1 1 
ATOM   378  C  CD2 . LEU A 1 56  ? 20.789  28.760 32.632  1.00 24.34  ? 56   LEU A CD2 1 
ATOM   379  N  N   . VAL A 1 57  ? 23.607  25.818 36.570  1.00 28.15  ? 57   VAL A N   1 
ATOM   380  C  CA  . VAL A 1 57  ? 24.027  25.967 37.964  1.00 28.26  ? 57   VAL A CA  1 
ATOM   381  C  C   . VAL A 1 57  ? 23.901  27.469 38.399  1.00 29.38  ? 57   VAL A C   1 
ATOM   382  O  O   . VAL A 1 57  ? 23.380  27.774 39.431  1.00 28.47  ? 57   VAL A O   1 
ATOM   383  C  CB  . VAL A 1 57  ? 25.486  25.472 38.181  1.00 27.55  ? 57   VAL A CB  1 
ATOM   384  C  CG1 . VAL A 1 57  ? 25.966  25.760 39.627  1.00 26.23  ? 57   VAL A CG1 1 
ATOM   385  C  CG2 . VAL A 1 57  ? 25.670  23.997 37.799  1.00 27.19  ? 57   VAL A CG2 1 
ATOM   386  N  N   . GLU A 1 58  ? 24.421  28.383 37.591  1.00 30.36  ? 58   GLU A N   1 
ATOM   387  C  CA  . GLU A 1 58  ? 24.225  29.823 37.789  1.00 30.37  ? 58   GLU A CA  1 
ATOM   388  C  C   . GLU A 1 58  ? 24.425  30.531 36.449  1.00 28.15  ? 58   GLU A C   1 
ATOM   389  O  O   . GLU A 1 58  ? 25.206  30.085 35.621  1.00 27.53  ? 58   GLU A O   1 
ATOM   390  C  CB  . GLU A 1 58  ? 25.192  30.379 38.869  1.00 31.64  ? 58   GLU A CB  1 
ATOM   391  C  CG  . GLU A 1 58  ? 26.643  30.136 38.563  1.00 34.19  ? 58   GLU A CG  1 
ATOM   392  C  CD  . GLU A 1 58  ? 27.567  30.600 39.674  1.00 35.72  ? 58   GLU A CD  1 
ATOM   393  O  OE1 . GLU A 1 58  ? 27.678  29.854 40.689  1.00 45.76  ? 58   GLU A OE1 1 
ATOM   394  O  OE2 . GLU A 1 58  ? 28.202  31.681 39.522  1.00 36.85  ? 58   GLU A OE2 1 
ATOM   395  N  N   . GLY A 1 59  ? 23.742  31.650 36.253  1.00 26.92  ? 59   GLY A N   1 
ATOM   396  C  CA  . GLY A 1 59  ? 23.850  32.410 35.027  1.00 26.14  ? 59   GLY A CA  1 
ATOM   397  C  C   . GLY A 1 59  ? 22.530  32.494 34.308  1.00 25.57  ? 59   GLY A C   1 
ATOM   398  O  O   . GLY A 1 59  ? 21.481  32.337 34.914  1.00 24.40  ? 59   GLY A O   1 
ATOM   399  N  N   . LYS A 1 60  ? 22.575  32.765 33.006  1.00 27.10  ? 60   LYS A N   1 
ATOM   400  C  CA  . LYS A 1 60  ? 21.360  32.975 32.221  1.00 26.94  ? 60   LYS A CA  1 
ATOM   401  C  C   . LYS A 1 60  ? 21.615  32.713 30.736  1.00 26.20  ? 60   LYS A C   1 
ATOM   402  O  O   . LYS A 1 60  ? 22.637  33.127 30.197  1.00 26.91  ? 60   LYS A O   1 
ATOM   403  C  CB  . LYS A 1 60  ? 20.832  34.391 32.436  1.00 27.48  ? 60   LYS A CB  1 
ATOM   404  C  CG  . LYS A 1 60  ? 19.434  34.634 31.885  1.00 29.10  ? 60   LYS A CG  1 
ATOM   405  C  CD  . LYS A 1 60  ? 19.063  36.078 32.057  1.00 31.14  ? 60   LYS A CD  1 
ATOM   406  C  CE  . LYS A 1 60  ? 17.648  36.369 31.466  1.00 34.36  ? 60   LYS A CE  1 
ATOM   407  N  NZ  . LYS A 1 60  ? 17.277  37.807 31.647  1.00 35.43  ? 60   LYS A NZ  1 
ATOM   408  N  N   . ILE A 1 61  ? 20.664  32.034 30.100  1.00 26.16  ? 61   ILE A N   1 
ATOM   409  C  CA  . ILE A 1 61  ? 20.762  31.500 28.733  1.00 26.16  ? 61   ILE A CA  1 
ATOM   410  C  C   . ILE A 1 61  ? 19.509  31.840 27.994  1.00 25.34  ? 61   ILE A C   1 
ATOM   411  O  O   . ILE A 1 61  ? 18.433  31.789 28.577  1.00 27.83  ? 61   ILE A O   1 
ATOM   412  C  CB  . ILE A 1 61  ? 20.925  29.963 28.729  1.00 25.82  ? 61   ILE A CB  1 
ATOM   413  C  CG1 . ILE A 1 61  ? 22.355  29.564 29.133  1.00 25.11  ? 61   ILE A CG1 1 
ATOM   414  C  CG2 . ILE A 1 61  ? 20.466  29.349 27.404  1.00 24.99  ? 61   ILE A CG2 1 
ATOM   415  C  CD1 . ILE A 1 61  ? 22.500  27.988 29.458  1.00 27.89  ? 61   ILE A CD1 1 
ATOM   416  N  N   . LYS A 1 62  ? 19.651  32.305 26.759  1.00 25.20  ? 62   LYS A N   1 
ATOM   417  C  CA  . LYS A 1 62  ? 18.550  32.555 25.880  1.00 25.23  ? 62   LYS A CA  1 
ATOM   418  C  C   . LYS A 1 62  ? 18.616  31.441 24.866  1.00 23.98  ? 62   LYS A C   1 
ATOM   419  O  O   . LYS A 1 62  ? 19.636  31.251 24.223  1.00 24.74  ? 62   LYS A O   1 
ATOM   420  C  CB  . LYS A 1 62  ? 18.661  33.918 25.217  1.00 25.78  ? 62   LYS A CB  1 
ATOM   421  C  CG  . LYS A 1 62  ? 17.637  34.252 24.165  1.00 25.48  ? 62   LYS A CG  1 
ATOM   422  C  CD  . LYS A 1 62  ? 17.824  35.691 23.608  1.00 27.01  ? 62   LYS A CD  1 
ATOM   423  C  CE  . LYS A 1 62  ? 16.678  36.154 22.676  1.00 29.28  ? 62   LYS A CE  1 
ATOM   424  N  NZ  . LYS A 1 62  ? 16.623  35.445 21.375  1.00 23.84  ? 62   LYS A NZ  1 
ATOM   425  N  N   . LEU A 1 63  ? 17.520  30.703 24.723  1.00 24.08  ? 63   LEU A N   1 
ATOM   426  C  CA  . LEU A 1 63  ? 17.461  29.516 23.883  1.00 22.40  ? 63   LEU A CA  1 
ATOM   427  C  C   . LEU A 1 63  ? 16.499  29.745 22.721  1.00 22.85  ? 63   LEU A C   1 
ATOM   428  O  O   . LEU A 1 63  ? 15.309  29.986 22.907  1.00 22.69  ? 63   LEU A O   1 
ATOM   429  C  CB  . LEU A 1 63  ? 17.120  28.267 24.743  1.00 23.71  ? 63   LEU A CB  1 
ATOM   430  C  CG  . LEU A 1 63  ? 17.306  26.889 24.061  1.00 22.19  ? 63   LEU A CG  1 
ATOM   431  C  CD1 . LEU A 1 63  ? 17.773  25.824 24.988  1.00 22.89  ? 63   LEU A CD1 1 
ATOM   432  C  CD2 . LEU A 1 63  ? 15.984  26.471 23.351  1.00 19.93  ? 63   LEU A CD2 1 
ATOM   433  N  N   . ASP A 1 64  ? 17.038  29.667 21.495  1.00 22.96  ? 64   ASP A N   1 
ATOM   434  C  CA  . ASP A 1 64  ? 16.252  29.896 20.257  1.00 21.82  ? 64   ASP A CA  1 
ATOM   435  C  C   . ASP A 1 64  ? 16.163  28.662 19.363  1.00 21.36  ? 64   ASP A C   1 
ATOM   436  O  O   . ASP A 1 64  ? 16.981  27.771 19.416  1.00 21.34  ? 64   ASP A O   1 
ATOM   437  C  CB  . ASP A 1 64  ? 16.822  31.084 19.432  1.00 22.19  ? 64   ASP A CB  1 
ATOM   438  C  CG  . ASP A 1 64  ? 16.749  32.431 20.144  1.00 22.75  ? 64   ASP A CG  1 
ATOM   439  O  OD1 . ASP A 1 64  ? 16.232  32.544 21.288  1.00 25.63  ? 64   ASP A OD1 1 
ATOM   440  O  OD2 . ASP A 1 64  ? 17.228  33.400 19.514  1.00 27.47  ? 64   ASP A OD2 1 
ATOM   441  N  N   . ILE A 1 65  ? 15.187  28.674 18.471  1.00 21.08  ? 65   ILE A N   1 
ATOM   442  C  CA  . ILE A 1 65  ? 15.161  27.765 17.319  1.00 21.19  ? 65   ILE A CA  1 
ATOM   443  C  C   . ILE A 1 65  ? 15.557  28.530 16.004  1.00 20.99  ? 65   ILE A C   1 
ATOM   444  O  O   . ILE A 1 65  ? 15.239  29.704 15.784  1.00 21.82  ? 65   ILE A O   1 
ATOM   445  C  CB  . ILE A 1 65  ? 13.758  27.087 17.179  1.00 21.01  ? 65   ILE A CB  1 
ATOM   446  C  CG1 . ILE A 1 65  ? 13.756  25.993 16.145  1.00 21.08  ? 65   ILE A CG1 1 
ATOM   447  C  CG2 . ILE A 1 65  ? 12.646  28.119 16.931  1.00 22.93  ? 65   ILE A CG2 1 
ATOM   448  C  CD1 . ILE A 1 65  ? 12.473  25.085 16.218  1.00 21.56  ? 65   ILE A CD1 1 
ATOM   449  N  N   . ILE A 1 66  ? 16.235  27.816 15.130  1.00 20.42  ? 66   ILE A N   1 
ATOM   450  C  CA  . ILE A 1 66  ? 16.655  28.342 13.844  1.00 20.00  ? 66   ILE A CA  1 
ATOM   451  C  C   . ILE A 1 66  ? 16.082  27.441 12.743  1.00 20.40  ? 66   ILE A C   1 
ATOM   452  O  O   . ILE A 1 66  ? 16.295  26.219 12.678  1.00 21.34  ? 66   ILE A O   1 
ATOM   453  C  CB  . ILE A 1 66  ? 18.189  28.453 13.714  1.00 19.50  ? 66   ILE A CB  1 
ATOM   454  C  CG1 . ILE A 1 66  ? 18.824  29.324 14.824  1.00 20.16  ? 66   ILE A CG1 1 
ATOM   455  C  CG2 . ILE A 1 66  ? 18.633  29.004 12.254  1.00 17.87  ? 66   ILE A CG2 1 
ATOM   456  C  CD1 . ILE A 1 66  ? 20.371  29.116 14.997  1.00 18.89  ? 66   ILE A CD1 1 
ATOM   457  N  N   . PHE A 1 67  ? 15.426  28.089 11.809  1.00 21.41  ? 67   PHE A N   1 
ATOM   458  C  CA  . PHE A 1 67  ? 14.909  27.408 10.664  1.00 22.32  ? 67   PHE A CA  1 
ATOM   459  C  C   . PHE A 1 67  ? 15.903  27.265 9.559   1.00 22.24  ? 67   PHE A C   1 
ATOM   460  O  O   . PHE A 1 67  ? 16.931  27.872 9.577   1.00 23.12  ? 67   PHE A O   1 
ATOM   461  C  CB  . PHE A 1 67  ? 13.631  28.099 10.245  1.00 21.09  ? 67   PHE A CB  1 
ATOM   462  C  CG  . PHE A 1 67  ? 12.488  27.800 11.200  1.00 23.57  ? 67   PHE A CG  1 
ATOM   463  C  CD1 . PHE A 1 67  ? 11.992  26.510 11.304  1.00 25.56  ? 67   PHE A CD1 1 
ATOM   464  C  CD2 . PHE A 1 67  ? 11.977  28.782 12.046  1.00 23.02  ? 67   PHE A CD2 1 
ATOM   465  C  CE1 . PHE A 1 67  ? 10.969  26.163 12.263  1.00 24.12  ? 67   PHE A CE1 1 
ATOM   466  C  CE2 . PHE A 1 67  ? 10.955  28.504 12.932  1.00 25.75  ? 67   PHE A CE2 1 
ATOM   467  C  CZ  . PHE A 1 67  ? 10.408  27.171 13.028  1.00 22.21  ? 67   PHE A CZ  1 
ATOM   468  N  N   . GLU A 1 68  ? 15.558  26.503 8.542   1.00 24.58  ? 68   GLU A N   1 
ATOM   469  C  CA  . GLU A 1 68  ? 16.471  26.222 7.444   1.00 25.05  ? 68   GLU A CA  1 
ATOM   470  C  C   . GLU A 1 68  ? 16.910  27.480 6.639   1.00 24.65  ? 68   GLU A C   1 
ATOM   471  O  O   . GLU A 1 68  ? 18.014  27.514 6.051   1.00 21.71  ? 68   GLU A O   1 
ATOM   472  C  CB  . GLU A 1 68  ? 15.819  25.208 6.499   1.00 27.60  ? 68   GLU A CB  1 
ATOM   473  C  CG  . GLU A 1 68  ? 15.232  23.932 7.242   1.00 33.41  ? 68   GLU A CG  1 
ATOM   474  C  CD  . GLU A 1 68  ? 13.630  23.952 7.515   1.00 33.86  ? 68   GLU A CD  1 
ATOM   475  O  OE1 . GLU A 1 68  ? 13.143  24.538 8.515   1.00 22.25  ? 68   GLU A OE1 1 
ATOM   476  O  OE2 . GLU A 1 68  ? 12.887  23.339 6.675   1.00 42.24  ? 68   GLU A OE2 1 
ATOM   477  N  N   . ASP A 1 69  ? 16.050  28.503 6.604   1.00 22.52  ? 69   ASP A N   1 
ATOM   478  C  CA  . ASP A 1 69  ? 16.410  29.774 5.971   1.00 21.99  ? 69   ASP A CA  1 
ATOM   479  C  C   . ASP A 1 69  ? 17.186  30.719 6.838   1.00 21.76  ? 69   ASP A C   1 
ATOM   480  O  O   . ASP A 1 69  ? 17.384  31.865 6.439   1.00 22.80  ? 69   ASP A O   1 
ATOM   481  C  CB  . ASP A 1 69  ? 15.148  30.509 5.461   1.00 22.28  ? 69   ASP A CB  1 
ATOM   482  C  CG  . ASP A 1 69  ? 14.156  30.824 6.596   1.00 23.57  ? 69   ASP A CG  1 
ATOM   483  O  OD1 . ASP A 1 69  ? 14.494  30.675 7.783   1.00 22.67  ? 69   ASP A OD1 1 
ATOM   484  O  OD2 . ASP A 1 69  ? 13.017  31.158 6.284   1.00 29.71  ? 69   ASP A OD2 1 
ATOM   485  N  N   . GLY A 1 70  ? 17.515  30.282 8.061   1.00 23.46  ? 70   GLY A N   1 
ATOM   486  C  CA  . GLY A 1 70  ? 18.329  31.041 9.017   1.00 24.03  ? 70   GLY A CA  1 
ATOM   487  C  C   . GLY A 1 70  ? 17.533  31.923 9.941   1.00 24.26  ? 70   GLY A C   1 
ATOM   488  O  O   . GLY A 1 70  ? 18.067  32.445 10.872  1.00 22.26  ? 70   GLY A O   1 
ATOM   489  N  N   . SER A 1 71  ? 16.224  32.046 9.706   1.00 26.35  ? 71   SER A N   1 
ATOM   490  C  CA  . SER A 1 71  ? 15.330  32.823 10.603  1.00 26.58  ? 71   SER A CA  1 
ATOM   491  C  C   . SER A 1 71  ? 15.237  32.169 11.973  1.00 25.08  ? 71   SER A C   1 
ATOM   492  O  O   . SER A 1 71  ? 15.376  30.965 12.112  1.00 24.34  ? 71   SER A O   1 
ATOM   493  C  CB  . SER A 1 71  ? 13.916  32.969 9.990   1.00 27.35  ? 71   SER A CB  1 
ATOM   494  O  OG  . SER A 1 71  ? 13.291  31.708 9.890   1.00 31.38  ? 71   SER A OG  1 
ATOM   495  N  N   . GLU A 1 72  ? 15.062  33.003 12.987  1.00 23.40  ? 72   GLU A N   1 
ATOM   496  C  CA  . GLU A 1 72  ? 15.289  32.591 14.308  1.00 24.34  ? 72   GLU A CA  1 
ATOM   497  C  C   . GLU A 1 72  ? 14.175  33.068 15.251  1.00 23.29  ? 72   GLU A C   1 
ATOM   498  O  O   . GLU A 1 72  ? 13.764  34.187 15.156  1.00 23.31  ? 72   GLU A O   1 
ATOM   499  C  CB  . GLU A 1 72  ? 16.621  33.143 14.725  1.00 23.02  ? 72   GLU A CB  1 
ATOM   500  C  CG  . GLU A 1 72  ? 17.077  32.653 16.023  1.00 24.78  ? 72   GLU A CG  1 
ATOM   501  C  CD  . GLU A 1 72  ? 18.514  33.085 16.346  1.00 25.18  ? 72   GLU A CD  1 
ATOM   502  O  OE1 . GLU A 1 72  ? 19.257  33.430 15.419  1.00 29.65  ? 72   GLU A OE1 1 
ATOM   503  O  OE2 . GLU A 1 72  ? 18.894  33.036 17.509  1.00 27.35  ? 72   GLU A OE2 1 
ATOM   504  N  N   . LYS A 1 73  ? 13.731  32.209 16.153  1.00 22.69  ? 73   LYS A N   1 
ATOM   505  C  CA  . LYS A 1 73  ? 12.789  32.626 17.199  1.00 22.62  ? 73   LYS A CA  1 
ATOM   506  C  C   . LYS A 1 73  ? 13.227  32.201 18.615  1.00 22.67  ? 73   LYS A C   1 
ATOM   507  O  O   . LYS A 1 73  ? 13.859  31.192 18.830  1.00 23.22  ? 73   LYS A O   1 
ATOM   508  C  CB  . LYS A 1 73  ? 11.355  32.093 16.933  1.00 21.43  ? 73   LYS A CB  1 
ATOM   509  C  CG  . LYS A 1 73  ? 10.710  32.470 15.635  1.00 22.57  ? 73   LYS A CG  1 
ATOM   510  C  CD  . LYS A 1 73  ? 10.323  34.013 15.609  1.00 23.25  ? 73   LYS A CD  1 
ATOM   511  C  CE  . LYS A 1 73  ? 9.801   34.372 14.266  1.00 28.30  ? 73   LYS A CE  1 
ATOM   512  N  NZ  . LYS A 1 73  ? 9.676   35.827 14.044  1.00 32.82  ? 73   LYS A NZ  1 
ATOM   513  N  N   . LEU A 1 74  ? 12.805  32.963 19.595  1.00 23.96  ? 74   LEU A N   1 
ATOM   514  C  CA  . LEU A 1 74  ? 12.946  32.583 20.972  1.00 24.88  ? 74   LEU A CA  1 
ATOM   515  C  C   . LEU A 1 74  ? 12.125  31.350 21.309  1.00 24.49  ? 74   LEU A C   1 
ATOM   516  O  O   . LEU A 1 74  ? 10.931  31.266 20.947  1.00 24.63  ? 74   LEU A O   1 
ATOM   517  C  CB  . LEU A 1 74  ? 12.470  33.747 21.866  1.00 25.92  ? 74   LEU A CB  1 
ATOM   518  C  CG  . LEU A 1 74  ? 12.442  33.508 23.388  1.00 24.29  ? 74   LEU A CG  1 
ATOM   519  C  CD1 . LEU A 1 74  ? 13.821  33.593 23.958  1.00 23.43  ? 74   LEU A CD1 1 
ATOM   520  C  CD2 . LEU A 1 74  ? 11.557  34.572 24.032  1.00 24.80  ? 74   LEU A CD2 1 
ATOM   521  N  N   . LEU A 1 75  ? 12.739  30.369 21.966  1.00 24.45  ? 75   LEU A N   1 
ATOM   522  C  CA  . LEU A 1 75  ? 11.942  29.355 22.662  1.00 24.41  ? 75   LEU A CA  1 
ATOM   523  C  C   . LEU A 1 75  ? 11.793  29.756 24.116  1.00 25.23  ? 75   LEU A C   1 
ATOM   524  O  O   . LEU A 1 75  ? 10.661  29.911 24.592  1.00 26.22  ? 75   LEU A O   1 
ATOM   525  C  CB  . LEU A 1 75  ? 12.440  27.913 22.500  1.00 24.13  ? 75   LEU A CB  1 
ATOM   526  C  CG  . LEU A 1 75  ? 12.508  27.315 21.092  1.00 24.07  ? 75   LEU A CG  1 
ATOM   527  C  CD1 . LEU A 1 75  ? 12.883  25.792 21.189  1.00 26.72  ? 75   LEU A CD1 1 
ATOM   528  C  CD2 . LEU A 1 75  ? 11.204  27.542 20.334  1.00 20.89  ? 75   LEU A CD2 1 
ATOM   529  N  N   . TYR A 1 76  ? 12.898  29.994 24.810  1.00 25.26  ? 76   TYR A N   1 
ATOM   530  C  CA  . TYR A 1 76  ? 12.808  30.360 26.241  1.00 24.06  ? 76   TYR A CA  1 
ATOM   531  C  C   . TYR A 1 76  ? 14.075  30.980 26.823  1.00 24.79  ? 76   TYR A C   1 
ATOM   532  O  O   . TYR A 1 76  ? 15.158  30.839 26.295  1.00 24.32  ? 76   TYR A O   1 
ATOM   533  C  CB  . TYR A 1 76  ? 12.331  29.171 27.069  1.00 24.24  ? 76   TYR A CB  1 
ATOM   534  C  CG  . TYR A 1 76  ? 13.235  27.944 27.223  1.00 23.96  ? 76   TYR A CG  1 
ATOM   535  C  CD1 . TYR A 1 76  ? 12.848  26.712 26.709  1.00 27.75  ? 76   TYR A CD1 1 
ATOM   536  C  CD2 . TYR A 1 76  ? 14.429  28.004 27.961  1.00 23.47  ? 76   TYR A CD2 1 
ATOM   537  C  CE1 . TYR A 1 76  ? 13.593  25.608 26.894  1.00 23.78  ? 76   TYR A CE1 1 
ATOM   538  C  CE2 . TYR A 1 76  ? 15.226  26.898 28.123  1.00 25.04  ? 76   TYR A CE2 1 
ATOM   539  C  CZ  . TYR A 1 76  ? 14.826  25.695 27.582  1.00 24.43  ? 76   TYR A CZ  1 
ATOM   540  O  OH  . TYR A 1 76  ? 15.594  24.556 27.837  1.00 21.62  ? 76   TYR A OH  1 
ATOM   541  N  N   . TYR A 1 77  ? 13.914  31.673 27.950  1.00 25.39  ? 77   TYR A N   1 
ATOM   542  C  CA  . TYR A 1 77  ? 15.002  32.017 28.815  1.00 25.44  ? 77   TYR A CA  1 
ATOM   543  C  C   . TYR A 1 77  ? 15.150  31.022 30.016  1.00 26.61  ? 77   TYR A C   1 
ATOM   544  O  O   . TYR A 1 77  ? 14.187  30.397 30.524  1.00 25.66  ? 77   TYR A O   1 
ATOM   545  C  CB  . TYR A 1 77  ? 14.850  33.463 29.320  1.00 25.53  ? 77   TYR A CB  1 
ATOM   546  C  CG  . TYR A 1 77  ? 14.888  34.553 28.250  1.00 25.62  ? 77   TYR A CG  1 
ATOM   547  C  CD1 . TYR A 1 77  ? 16.088  35.121 27.840  1.00 26.45  ? 77   TYR A CD1 1 
ATOM   548  C  CD2 . TYR A 1 77  ? 13.735  35.066 27.725  1.00 24.66  ? 77   TYR A CD2 1 
ATOM   549  C  CE1 . TYR A 1 77  ? 16.132  36.148 26.912  1.00 25.66  ? 77   TYR A CE1 1 
ATOM   550  C  CE2 . TYR A 1 77  ? 13.767  36.052 26.781  1.00 23.83  ? 77   TYR A CE2 1 
ATOM   551  C  CZ  . TYR A 1 77  ? 14.964  36.583 26.366  1.00 26.51  ? 77   TYR A CZ  1 
ATOM   552  O  OH  . TYR A 1 77  ? 14.959  37.591 25.411  1.00 28.32  ? 77   TYR A OH  1 
ATOM   553  N  N   . ALA A 1 78  ? 16.374  30.936 30.501  1.00 26.12  ? 78   ALA A N   1 
ATOM   554  C  CA  . ALA A 1 78  ? 16.697  30.013 31.525  1.00 25.98  ? 78   ALA A CA  1 
ATOM   555  C  C   . ALA A 1 78  ? 17.731  30.626 32.468  1.00 25.77  ? 78   ALA A C   1 
ATOM   556  O  O   . ALA A 1 78  ? 18.730  31.183 32.032  1.00 26.28  ? 78   ALA A O   1 
ATOM   557  C  CB  . ALA A 1 78  ? 17.185  28.737 30.937  1.00 24.72  ? 78   ALA A CB  1 
ATOM   558  N  N   . GLY A 1 79  ? 17.482  30.490 33.781  1.00 25.69  ? 79   GLY A N   1 
ATOM   559  C  CA  . GLY A 1 79  ? 18.385  30.911 34.804  1.00 25.80  ? 79   GLY A CA  1 
ATOM   560  C  C   . GLY A 1 79  ? 18.779  29.758 35.709  1.00 26.25  ? 79   GLY A C   1 
ATOM   561  O  O   . GLY A 1 79  ? 18.666  28.599 35.347  1.00 24.77  ? 79   GLY A O   1 
ATOM   562  N  N   . GLY A 1 80  ? 19.320  30.120 36.872  1.00 26.20  ? 80   GLY A N   1 
ATOM   563  C  CA  . GLY A 1 80  ? 19.830  29.161 37.848  1.00 27.51  ? 80   GLY A CA  1 
ATOM   564  C  C   . GLY A 1 80  ? 18.785  28.088 38.137  1.00 27.17  ? 80   GLY A C   1 
ATOM   565  O  O   . GLY A 1 80  ? 17.605  28.402 38.304  1.00 27.36  ? 80   GLY A O   1 
ATOM   566  N  N   . ASN A 1 81  ? 19.227  26.830 38.143  1.00 25.64  ? 81   ASN A N   1 
ATOM   567  C  CA  . ASN A 1 81  ? 18.407  25.669 38.428  1.00 26.34  ? 81   ASN A CA  1 
ATOM   568  C  C   . ASN A 1 81  ? 17.481  25.218 37.310  1.00 25.77  ? 81   ASN A C   1 
ATOM   569  O  O   . ASN A 1 81  ? 16.751  24.229 37.496  1.00 25.79  ? 81   ASN A O   1 
ATOM   570  C  CB  . ASN A 1 81  ? 17.627  25.805 39.782  1.00 26.70  ? 81   ASN A CB  1 
ATOM   571  C  CG  . ASN A 1 81  ? 18.519  26.118 40.940  1.00 26.01  ? 81   ASN A CG  1 
ATOM   572  O  OD1 . ASN A 1 81  ? 19.533  25.463 41.156  1.00 30.47  ? 81   ASN A OD1 1 
ATOM   573  N  ND2 . ASN A 1 81  ? 18.156  27.136 41.690  1.00 20.21  ? 81   ASN A ND2 1 
ATOM   574  N  N   . SER A 1 82  ? 17.508  25.926 36.165  1.00 25.66  ? 82   SER A N   1 
ATOM   575  C  CA  . SER A 1 82  ? 16.838  25.522 34.955  1.00 25.82  ? 82   SER A CA  1 
ATOM   576  C  C   . SER A 1 82  ? 17.510  24.312 34.333  1.00 25.03  ? 82   SER A C   1 
ATOM   577  O  O   . SER A 1 82  ? 18.685  24.030 34.587  1.00 24.08  ? 82   SER A O   1 
ATOM   578  C  CB  . SER A 1 82  ? 16.793  26.641 33.881  1.00 26.82  ? 82   SER A CB  1 
ATOM   579  O  OG  . SER A 1 82  ? 15.853  27.639 34.217  1.00 27.83  ? 82   SER A OG  1 
ATOM   580  N  N   . LEU A 1 83  ? 16.718  23.594 33.540  1.00 24.68  ? 83   LEU A N   1 
ATOM   581  C  CA  . LEU A 1 83  ? 17.131  22.394 32.850  1.00 24.36  ? 83   LEU A CA  1 
ATOM   582  C  C   . LEU A 1 83  ? 16.817  22.484 31.375  1.00 24.97  ? 83   LEU A C   1 
ATOM   583  O  O   . LEU A 1 83  ? 15.690  22.690 30.975  1.00 27.04  ? 83   LEU A O   1 
ATOM   584  C  CB  . LEU A 1 83  ? 16.460  21.143 33.470  1.00 25.90  ? 83   LEU A CB  1 
ATOM   585  C  CG  . LEU A 1 83  ? 16.922  19.747 33.035  1.00 24.19  ? 83   LEU A CG  1 
ATOM   586  C  CD1 . LEU A 1 83  ? 18.415  19.541 33.415  1.00 21.01  ? 83   LEU A CD1 1 
ATOM   587  C  CD2 . LEU A 1 83  ? 16.021  18.711 33.620  1.00 25.29  ? 83   LEU A CD2 1 
ATOM   588  N  N   . ILE A 1 84  ? 17.810  22.220 30.531  1.00 24.73  ? 84   ILE A N   1 
ATOM   589  C  CA  . ILE A 1 84  ? 17.585  22.029 29.088  1.00 24.27  ? 84   ILE A CA  1 
ATOM   590  C  C   . ILE A 1 84  ? 17.483  20.553 28.846  1.00 24.02  ? 84   ILE A C   1 
ATOM   591  O  O   . ILE A 1 84  ? 18.400  19.820 29.155  1.00 24.64  ? 84   ILE A O   1 
ATOM   592  C  CB  . ILE A 1 84  ? 18.735  22.654 28.290  1.00 23.99  ? 84   ILE A CB  1 
ATOM   593  C  CG1 . ILE A 1 84  ? 18.893  24.165 28.644  1.00 26.37  ? 84   ILE A CG1 1 
ATOM   594  C  CG2 . ILE A 1 84  ? 18.568  22.499 26.768  1.00 22.38  ? 84   ILE A CG2 1 
ATOM   595  C  CD1 . ILE A 1 84  ? 20.201  24.855 28.033  1.00 23.29  ? 84   ILE A CD1 1 
ATOM   596  N  N   . GLY A 1 85  ? 16.346  20.098 28.328  1.00 23.44  ? 85   GLY A N   1 
ATOM   597  C  CA  . GLY A 1 85  ? 16.032  18.689 28.257  1.00 22.34  ? 85   GLY A CA  1 
ATOM   598  C  C   . GLY A 1 85  ? 16.421  17.931 26.999  1.00 22.50  ? 85   GLY A C   1 
ATOM   599  O  O   . GLY A 1 85  ? 15.783  16.954 26.642  1.00 21.19  ? 85   GLY A O   1 
ATOM   600  N  N   . LYS A 1 86  ? 17.464  18.380 26.311  1.00 22.80  ? 86   LYS A N   1 
ATOM   601  C  CA  . LYS A 1 86  ? 17.828  17.879 25.008  1.00 23.34  ? 86   LYS A CA  1 
ATOM   602  C  C   . LYS A 1 86  ? 18.709  16.615 25.014  1.00 23.71  ? 86   LYS A C   1 
ATOM   603  O  O   . LYS A 1 86  ? 19.799  16.603 24.463  1.00 22.86  ? 86   LYS A O   1 
ATOM   604  C  CB  . LYS A 1 86  ? 18.446  19.008 24.216  1.00 24.25  ? 86   LYS A CB  1 
ATOM   605  C  CG  . LYS A 1 86  ? 17.394  20.046 23.754  1.00 24.68  ? 86   LYS A CG  1 
ATOM   606  C  CD  . LYS A 1 86  ? 18.043  21.190 23.031  1.00 25.36  ? 86   LYS A CD  1 
ATOM   607  C  CE  . LYS A 1 86  ? 18.873  20.780 21.809  1.00 28.25  ? 86   LYS A CE  1 
ATOM   608  N  NZ  . LYS A 1 86  ? 18.073  19.951 20.818  1.00 26.43  ? 86   LYS A NZ  1 
ATOM   609  N  N   . LEU A 1 87  ? 18.167  15.544 25.609  1.00 23.44  ? 87   LEU A N   1 
ATOM   610  C  CA  . LEU A 1 87  ? 18.857  14.256 25.780  1.00 22.81  ? 87   LEU A CA  1 
ATOM   611  C  C   . LEU A 1 87  ? 19.031  13.465 24.517  1.00 21.60  ? 87   LEU A C   1 
ATOM   612  O  O   . LEU A 1 87  ? 19.939  12.669 24.412  1.00 20.58  ? 87   LEU A O   1 
ATOM   613  C  CB  . LEU A 1 87  ? 18.169  13.418 26.874  1.00 22.67  ? 87   LEU A CB  1 
ATOM   614  C  CG  . LEU A 1 87  ? 18.911  12.229 27.489  1.00 22.53  ? 87   LEU A CG  1 
ATOM   615  C  CD1 . LEU A 1 87  ? 20.298  12.730 27.917  1.00 21.86  ? 87   LEU A CD1 1 
ATOM   616  C  CD2 . LEU A 1 87  ? 18.086  11.518 28.685  1.00 21.43  ? 87   LEU A CD2 1 
ATOM   617  N  N   . TYR A 1 88  ? 18.163  13.713 23.540  1.00 21.51  ? 88   TYR A N   1 
ATOM   618  C  CA  . TYR A 1 88  ? 18.112  12.963 22.334  1.00 23.39  ? 88   TYR A CA  1 
ATOM   619  C  C   . TYR A 1 88  ? 17.871  13.952 21.167  1.00 23.27  ? 88   TYR A C   1 
ATOM   620  O  O   . TYR A 1 88  ? 17.340  15.099 21.387  1.00 20.80  ? 88   TYR A O   1 
ATOM   621  C  CB  . TYR A 1 88  ? 16.947  11.929 22.375  1.00 22.87  ? 88   TYR A CB  1 
ATOM   622  C  CG  . TYR A 1 88  ? 16.999  11.046 23.602  1.00 24.28  ? 88   TYR A CG  1 
ATOM   623  C  CD1 . TYR A 1 88  ? 16.097  11.207 24.652  1.00 23.48  ? 88   TYR A CD1 1 
ATOM   624  C  CD2 . TYR A 1 88  ? 17.977  10.038 23.699  1.00 24.94  ? 88   TYR A CD2 1 
ATOM   625  C  CE1 . TYR A 1 88  ? 16.176  10.404 25.761  1.00 26.17  ? 88   TYR A CE1 1 
ATOM   626  C  CE2 . TYR A 1 88  ? 18.046  9.213  24.789  1.00 24.91  ? 88   TYR A CE2 1 
ATOM   627  C  CZ  . TYR A 1 88  ? 17.157  9.390  25.810  1.00 22.63  ? 88   TYR A CZ  1 
ATOM   628  O  OH  . TYR A 1 88  ? 17.274  8.622  26.917  1.00 24.87  ? 88   TYR A OH  1 
ATOM   629  N  N   . PRO A 1 89  ? 18.242  13.531 19.951  1.00 23.14  ? 89   PRO A N   1 
ATOM   630  C  CA  . PRO A 1 89  ? 17.876  14.401 18.781  1.00 24.29  ? 89   PRO A CA  1 
ATOM   631  C  C   . PRO A 1 89  ? 16.378  14.593 18.541  1.00 23.25  ? 89   PRO A C   1 
ATOM   632  O  O   . PRO A 1 89  ? 15.578  13.648 18.707  1.00 22.10  ? 89   PRO A O   1 
ATOM   633  C  CB  . PRO A 1 89  ? 18.478  13.705 17.569  1.00 25.01  ? 89   PRO A CB  1 
ATOM   634  C  CG  . PRO A 1 89  ? 18.790  12.315 18.039  1.00 26.73  ? 89   PRO A CG  1 
ATOM   635  C  CD  . PRO A 1 89  ? 18.895  12.284 19.542  1.00 23.44  ? 89   PRO A CD  1 
ATOM   636  N  N   . THR A 1 90  ? 16.055  15.812 18.132  1.00 23.67  ? 90   THR A N   1 
ATOM   637  C  CA  . THR A 1 90  ? 14.692  16.280 17.930  1.00 25.71  ? 90   THR A CA  1 
ATOM   638  C  C   . THR A 1 90  ? 14.390  16.699 16.510  1.00 27.16  ? 90   THR A C   1 
ATOM   639  O  O   . THR A 1 90  ? 13.247  16.748 16.117  1.00 27.61  ? 90   THR A O   1 
ATOM   640  C  CB  . THR A 1 90  ? 14.320  17.466 18.826  1.00 25.65  ? 90   THR A CB  1 
ATOM   641  O  OG1 . THR A 1 90  ? 15.113  18.592 18.473  1.00 27.81  ? 90   THR A OG1 1 
ATOM   642  C  CG2 . THR A 1 90  ? 14.517  17.160 20.335  1.00 24.45  ? 90   THR A CG2 1 
ATOM   643  N  N   . GLY A 1 91  ? 15.411  16.965 15.715  1.00 28.33  ? 91   GLY A N   1 
ATOM   644  C  CA  . GLY A 1 91  ? 15.154  17.507 14.392  1.00 29.42  ? 91   GLY A CA  1 
ATOM   645  C  C   . GLY A 1 91  ? 15.105  19.021 14.372  1.00 29.33  ? 91   GLY A C   1 
ATOM   646  O  O   . GLY A 1 91  ? 15.163  19.590 13.314  1.00 30.17  ? 91   GLY A O   1 
ATOM   647  N  N   . ASN A 1 92  ? 15.073  19.677 15.525  1.00 28.77  ? 92   ASN A N   1 
ATOM   648  C  CA  . ASN A 1 92  ? 15.193  21.142 15.574  1.00 27.87  ? 92   ASN A CA  1 
ATOM   649  C  C   . ASN A 1 92  ? 16.610  21.620 15.673  1.00 26.78  ? 92   ASN A C   1 
ATOM   650  O  O   . ASN A 1 92  ? 17.438  21.053 16.389  1.00 28.05  ? 92   ASN A O   1 
ATOM   651  C  CB  . ASN A 1 92  ? 14.330  21.764 16.687  1.00 26.89  ? 92   ASN A CB  1 
ATOM   652  C  CG  . ASN A 1 92  ? 12.848  21.434 16.534  1.00 28.96  ? 92   ASN A CG  1 
ATOM   653  O  OD1 . ASN A 1 92  ? 12.356  21.337 15.410  1.00 27.33  ? 92   ASN A OD1 1 
ATOM   654  N  ND2 . ASN A 1 92  ? 12.161  21.174 17.655  1.00 23.11  ? 92   ASN A ND2 1 
ATOM   655  N  N   . ASN A 1 93  ? 16.876  22.718 14.995  1.00 25.21  ? 93   ASN A N   1 
ATOM   656  C  CA  . ASN A 1 93  ? 18.139  23.434 15.154  1.00 24.45  ? 93   ASN A CA  1 
ATOM   657  C  C   . ASN A 1 93  ? 17.997  24.466 16.272  1.00 23.52  ? 93   ASN A C   1 
ATOM   658  O  O   . ASN A 1 93  ? 17.236  25.379 16.118  1.00 22.38  ? 93   ASN A O   1 
ATOM   659  C  CB  . ASN A 1 93  ? 18.491  24.141 13.823  1.00 25.29  ? 93   ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 93  ? 19.935  24.721 13.796  1.00 26.50  ? 93   ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 93  ? 20.627  24.708 14.818  1.00 30.75  ? 93   ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 93  ? 20.393  25.217 12.593  1.00 26.53  ? 93   ASN A ND2 1 
ATOM   663  N  N   . ILE A 1 94  ? 18.815  24.339 17.324  1.00 21.08  ? 94   ILE A N   1 
ATOM   664  C  CA  . ILE A 1 94  ? 18.705  25.102 18.531  1.00 21.72  ? 94   ILE A CA  1 
ATOM   665  C  C   . ILE A 1 94  ? 19.995  25.873 18.744  1.00 22.34  ? 94   ILE A C   1 
ATOM   666  O  O   . ILE A 1 94  ? 21.086  25.345 18.500  1.00 22.82  ? 94   ILE A O   1 
ATOM   667  C  CB  . ILE A 1 94  ? 18.443  24.192 19.775  1.00 21.35  ? 94   ILE A CB  1 
ATOM   668  C  CG1 . ILE A 1 94  ? 17.130  23.412 19.555  1.00 21.22  ? 94   ILE A CG1 1 
ATOM   669  C  CG2 . ILE A 1 94  ? 18.608  25.057 21.158  1.00 19.90  ? 94   ILE A CG2 1 
ATOM   670  C  CD1 . ILE A 1 94  ? 15.826  24.234 19.547  1.00 14.60  ? 94   ILE A CD1 1 
ATOM   671  N  N   . TYR A 1 95  ? 19.841  27.145 19.104  1.00 23.44  ? 95   TYR A N   1 
ATOM   672  C  CA  . TYR A 1 95  ? 20.950  28.013 19.433  1.00 23.91  ? 95   TYR A CA  1 
ATOM   673  C  C   . TYR A 1 95  ? 20.663  28.588 20.804  1.00 22.94  ? 95   TYR A C   1 
ATOM   674  O  O   . TYR A 1 95  ? 19.680  29.293 21.009  1.00 24.52  ? 95   TYR A O   1 
ATOM   675  C  CB  . TYR A 1 95  ? 21.097  29.082 18.365  1.00 24.20  ? 95   TYR A CB  1 
ATOM   676  C  CG  . TYR A 1 95  ? 22.122  30.158 18.591  1.00 23.97  ? 95   TYR A CG  1 
ATOM   677  C  CD1 . TYR A 1 95  ? 23.433  29.835 18.942  1.00 27.27  ? 95   TYR A CD1 1 
ATOM   678  C  CD2 . TYR A 1 95  ? 21.785  31.504 18.411  1.00 25.58  ? 95   TYR A CD2 1 
ATOM   679  C  CE1 . TYR A 1 95  ? 24.375  30.769 19.136  1.00 27.51  ? 95   TYR A CE1 1 
ATOM   680  C  CE2 . TYR A 1 95  ? 22.694  32.472 18.629  1.00 23.24  ? 95   TYR A CE2 1 
ATOM   681  C  CZ  . TYR A 1 95  ? 24.016  32.107 18.986  1.00 27.76  ? 95   TYR A CZ  1 
ATOM   682  O  OH  . TYR A 1 95  ? 24.973  33.055 19.145  1.00 28.03  ? 95   TYR A OH  1 
ATOM   683  N  N   . ALA A 1 96  ? 21.577  28.332 21.721  1.00 23.48  ? 96   ALA A N   1 
ATOM   684  C  CA  . ALA A 1 96  ? 21.454  28.766 23.117  1.00 24.01  ? 96   ALA A CA  1 
ATOM   685  C  C   . ALA A 1 96  ? 22.678  29.521 23.493  1.00 24.20  ? 96   ALA A C   1 
ATOM   686  O  O   . ALA A 1 96  ? 23.783  28.946 23.415  1.00 24.34  ? 96   ALA A O   1 
ATOM   687  C  CB  . ALA A 1 96  ? 21.260  27.509 24.069  1.00 22.18  ? 96   ALA A CB  1 
ATOM   688  N  N   . THR A 1 97  ? 22.519  30.795 23.900  1.00 25.85  ? 97   THR A N   1 
ATOM   689  C  CA  . THR A 1 97  ? 23.680  31.665 24.292  1.00 26.86  ? 97   THR A CA  1 
ATOM   690  C  C   . THR A 1 97  ? 23.676  32.066 25.758  1.00 26.53  ? 97   THR A C   1 
ATOM   691  O  O   . THR A 1 97  ? 22.615  32.196 26.356  1.00 25.64  ? 97   THR A O   1 
ATOM   692  C  CB  . THR A 1 97  ? 23.815  32.999 23.433  1.00 27.54  ? 97   THR A CB  1 
ATOM   693  O  OG1 . THR A 1 97  ? 22.588  33.768 23.532  1.00 30.65  ? 97   THR A OG1 1 
ATOM   694  C  CG2 . THR A 1 97  ? 24.126  32.672 21.948  1.00 29.86  ? 97   THR A CG2 1 
ATOM   695  N  N   . ALA A 1 98  ? 24.886  32.272 26.324  1.00 27.99  ? 98   ALA A N   1 
ATOM   696  C  CA  . ALA A 1 98  ? 25.051  32.734 27.716  1.00 26.97  ? 98   ALA A CA  1 
ATOM   697  C  C   . ALA A 1 98  ? 24.898  34.260 27.685  1.00 28.07  ? 98   ALA A C   1 
ATOM   698  O  O   . ALA A 1 98  ? 25.617  34.974 26.939  1.00 27.70  ? 98   ALA A O   1 
ATOM   699  C  CB  . ALA A 1 98  ? 26.372  32.316 28.290  1.00 26.19  ? 98   ALA A CB  1 
ATOM   700  N  N   . MET A 1 99  ? 23.875  34.742 28.391  1.00 28.50  ? 99   MET A N   1 
ATOM   701  C  CA  . MET A 1 99  ? 23.579  36.182 28.494  1.00 29.83  ? 99   MET A CA  1 
ATOM   702  C  C   . MET A 1 99  ? 24.417  36.869 29.567  1.00 29.71  ? 99   MET A C   1 
ATOM   703  O  O   . MET A 1 99  ? 24.492  38.099 29.620  1.00 28.75  ? 99   MET A O   1 
ATOM   704  C  CB  . MET A 1 99  ? 22.107  36.393 28.795  1.00 29.95  ? 99   MET A CB  1 
ATOM   705  C  CG  . MET A 1 99  ? 21.211  36.130 27.578  1.00 31.86  ? 99   MET A CG  1 
ATOM   706  S  SD  . MET A 1 99  ? 19.523  36.162 28.137  1.00 33.54  ? 99   MET A SD  1 
ATOM   707  C  CE  . MET A 1 99  ? 19.402  37.887 28.714  1.00 35.60  ? 99   MET A CE  1 
ATOM   708  N  N   . GLU A 1 100 ? 25.029  36.052 30.411  1.00 30.65  ? 100  GLU A N   1 
ATOM   709  C  CA  . GLU A 1 100 ? 25.985  36.484 31.442  1.00 31.71  ? 100  GLU A CA  1 
ATOM   710  C  C   . GLU A 1 100 ? 26.890  35.277 31.659  1.00 30.04  ? 100  GLU A C   1 
ATOM   711  O  O   . GLU A 1 100 ? 26.619  34.228 31.098  1.00 28.52  ? 100  GLU A O   1 
ATOM   712  C  CB  . GLU A 1 100 ? 25.241  36.881 32.724  1.00 31.44  ? 100  GLU A CB  1 
ATOM   713  C  CG  . GLU A 1 100 ? 24.118  36.016 33.079  1.00 33.35  ? 100  GLU A CG  1 
ATOM   714  C  CD  . GLU A 1 100 ? 23.256  36.513 34.254  1.00 35.15  ? 100  GLU A CD  1 
ATOM   715  O  OE1 . GLU A 1 100 ? 22.585  37.566 34.103  1.00 38.75  ? 100  GLU A OE1 1 
ATOM   716  O  OE2 . GLU A 1 100 ? 23.225  35.815 35.307  1.00 38.70  ? 100  GLU A OE2 1 
ATOM   717  N  N   . PRO A 1 101 ? 27.983  35.429 32.426  1.00 30.11  ? 101  PRO A N   1 
ATOM   718  C  CA  . PRO A 1 101 ? 28.781  34.249 32.692  1.00 29.63  ? 101  PRO A CA  1 
ATOM   719  C  C   . PRO A 1 101 ? 27.920  33.136 33.367  1.00 29.81  ? 101  PRO A C   1 
ATOM   720  O  O   . PRO A 1 101 ? 27.173  33.369 34.349  1.00 30.14  ? 101  PRO A O   1 
ATOM   721  C  CB  . PRO A 1 101 ? 29.926  34.780 33.593  1.00 30.54  ? 101  PRO A CB  1 
ATOM   722  C  CG  . PRO A 1 101 ? 29.925  36.227 33.439  1.00 29.09  ? 101  PRO A CG  1 
ATOM   723  C  CD  . PRO A 1 101 ? 28.547  36.634 33.084  1.00 30.01  ? 101  PRO A CD  1 
ATOM   724  N  N   . THR A 1 102 ? 28.033  31.941 32.811  1.00 28.61  ? 102  THR A N   1 
ATOM   725  C  CA  . THR A 1 102 ? 27.141  30.861 33.117  1.00 27.97  ? 102  THR A CA  1 
ATOM   726  C  C   . THR A 1 102 ? 27.898  29.560 33.355  1.00 27.93  ? 102  THR A C   1 
ATOM   727  O  O   . THR A 1 102 ? 28.766  29.190 32.560  1.00 29.32  ? 102  THR A O   1 
ATOM   728  C  CB  . THR A 1 102 ? 26.103  30.708 31.990  1.00 27.93  ? 102  THR A CB  1 
ATOM   729  O  OG1 . THR A 1 102 ? 25.300  31.896 31.946  1.00 24.45  ? 102  THR A OG1 1 
ATOM   730  C  CG2 . THR A 1 102 ? 25.209  29.501 32.218  1.00 25.01  ? 102  THR A CG2 1 
ATOM   731  N  N   . ARG A 1 103 ? 27.568  28.886 34.458  1.00 26.17  ? 103  ARG A N   1 
ATOM   732  C  CA  . ARG A 1 103 ? 28.072  27.554 34.764  1.00 26.22  ? 103  ARG A CA  1 
ATOM   733  C  C   . ARG A 1 103 ? 26.979  26.553 34.454  1.00 24.99  ? 103  ARG A C   1 
ATOM   734  O  O   . ARG A 1 103 ? 25.839  26.737 34.830  1.00 25.44  ? 103  ARG A O   1 
ATOM   735  C  CB  . ARG A 1 103 ? 28.543  27.443 36.236  1.00 23.75  ? 103  ARG A CB  1 
ATOM   736  C  CG  . ARG A 1 103 ? 28.989  26.037 36.667  1.00 24.97  ? 103  ARG A CG  1 
ATOM   737  C  CD  . ARG A 1 103 ? 30.043  26.028 37.825  1.00 26.32  ? 103  ARG A CD  1 
ATOM   738  N  NE  . ARG A 1 103 ? 31.339  26.520 37.360  1.00 24.20  ? 103  ARG A NE  1 
ATOM   739  C  CZ  . ARG A 1 103 ? 32.340  26.883 38.166  1.00 30.25  ? 103  ARG A CZ  1 
ATOM   740  N  NH1 . ARG A 1 103 ? 32.205  26.802 39.473  1.00 29.72  ? 103  ARG A NH1 1 
ATOM   741  N  NH2 . ARG A 1 103 ? 33.475  27.312 37.663  1.00 26.76  ? 103  ARG A NH2 1 
ATOM   742  N  N   . THR A 1 104 ? 27.331  25.532 33.695  1.00 25.52  ? 104  THR A N   1 
ATOM   743  C  CA  . THR A 1 104 ? 26.388  24.527 33.312  1.00 25.34  ? 104  THR A CA  1 
ATOM   744  C  C   . THR A 1 104 ? 26.947  23.173 33.770  1.00 25.68  ? 104  THR A C   1 
ATOM   745  O  O   . THR A 1 104 ? 28.154  23.029 33.964  1.00 24.95  ? 104  THR A O   1 
ATOM   746  C  CB  . THR A 1 104 ? 26.122  24.466 31.827  1.00 25.47  ? 104  THR A CB  1 
ATOM   747  O  OG1 . THR A 1 104 ? 27.320  24.123 31.105  1.00 24.80  ? 104  THR A OG1 1 
ATOM   748  C  CG2 . THR A 1 104 ? 25.416  25.780 31.309  1.00 25.31  ? 104  THR A CG2 1 
ATOM   749  N  N   . CYS A 1 105 ? 26.044  22.199 33.886  1.00 26.38  ? 105  CYS A N   1 
ATOM   750  C  CA  . CYS A 1 105 ? 26.406  20.806 34.139  1.00 25.98  ? 105  CYS A CA  1 
ATOM   751  C  C   . CYS A 1 105 ? 25.692  19.964 33.139  1.00 25.53  ? 105  CYS A C   1 
ATOM   752  O  O   . CYS A 1 105 ? 24.461  20.030 33.042  1.00 25.22  ? 105  CYS A O   1 
ATOM   753  C  CB  . CYS A 1 105 ? 25.981  20.363 35.538  1.00 26.43  ? 105  CYS A CB  1 
ATOM   754  S  SG  . CYS A 1 105 ? 26.502  18.650 35.939  1.00 27.19  ? 105  CYS A SG  1 
ATOM   755  N  N   . TRP A 1 106 ? 26.465  19.201 32.355  1.00 26.05  ? 106  TRP A N   1 
ATOM   756  C  CA  . TRP A 1 106 ? 25.900  18.380 31.263  1.00 25.25  ? 106  TRP A CA  1 
ATOM   757  C  C   . TRP A 1 106 ? 25.755  16.964 31.780  1.00 24.74  ? 106  TRP A C   1 
ATOM   758  O  O   . TRP A 1 106 ? 26.715  16.333 32.235  1.00 24.27  ? 106  TRP A O   1 
ATOM   759  C  CB  . TRP A 1 106 ? 26.829  18.422 30.018  1.00 25.81  ? 106  TRP A CB  1 
ATOM   760  C  CG  . TRP A 1 106 ? 26.851  19.769 29.399  1.00 27.57  ? 106  TRP A CG  1 
ATOM   761  C  CD1 . TRP A 1 106 ? 27.037  20.971 30.039  1.00 26.83  ? 106  TRP A CD1 1 
ATOM   762  C  CD2 . TRP A 1 106 ? 26.666  20.078 28.008  1.00 25.38  ? 106  TRP A CD2 1 
ATOM   763  N  NE1 . TRP A 1 106 ? 26.973  21.997 29.118  1.00 25.53  ? 106  TRP A NE1 1 
ATOM   764  C  CE2 . TRP A 1 106 ? 26.744  21.474 27.875  1.00 26.42  ? 106  TRP A CE2 1 
ATOM   765  C  CE3 . TRP A 1 106 ? 26.422  19.300 26.872  1.00 27.15  ? 106  TRP A CE3 1 
ATOM   766  C  CZ2 . TRP A 1 106 ? 26.596  22.128 26.630  1.00 26.25  ? 106  TRP A CZ2 1 
ATOM   767  C  CZ3 . TRP A 1 106 ? 26.274  19.935 25.644  1.00 28.75  ? 106  TRP A CZ3 1 
ATOM   768  C  CH2 . TRP A 1 106 ? 26.379  21.342 25.531  1.00 27.09  ? 106  TRP A CH2 1 
ATOM   769  N  N   . PHE A 1 107 ? 24.537  16.474 31.716  1.00 25.37  ? 107  PHE A N   1 
ATOM   770  C  CA  . PHE A 1 107 ? 24.228  15.097 32.039  1.00 25.10  ? 107  PHE A CA  1 
ATOM   771  C  C   . PHE A 1 107 ? 23.932  14.240 30.789  1.00 24.38  ? 107  PHE A C   1 
ATOM   772  O  O   . PHE A 1 107 ? 22.852  14.372 30.151  1.00 23.32  ? 107  PHE A O   1 
ATOM   773  C  CB  . PHE A 1 107 ? 23.017  15.079 32.995  1.00 24.83  ? 107  PHE A CB  1 
ATOM   774  C  CG  . PHE A 1 107 ? 23.282  15.688 34.368  1.00 25.93  ? 107  PHE A CG  1 
ATOM   775  C  CD1 . PHE A 1 107 ? 23.851  14.917 35.391  1.00 26.39  ? 107  PHE A CD1 1 
ATOM   776  C  CD2 . PHE A 1 107 ? 22.889  16.963 34.663  1.00 24.55  ? 107  PHE A CD2 1 
ATOM   777  C  CE1 . PHE A 1 107 ? 24.065  15.428 36.632  1.00 27.27  ? 107  PHE A CE1 1 
ATOM   778  C  CE2 . PHE A 1 107 ? 23.010  17.466 35.947  1.00 23.34  ? 107  PHE A CE2 1 
ATOM   779  C  CZ  . PHE A 1 107 ? 23.648  16.713 36.927  1.00 25.18  ? 107  PHE A CZ  1 
ATOM   780  N  N   . SER A 1 108 ? 24.859  13.328 30.492  1.00 23.22  ? 108  SER A N   1 
ATOM   781  C  CA  . SER A 1 108 ? 24.593  12.255 29.495  1.00 24.03  ? 108  SER A CA  1 
ATOM   782  C  C   . SER A 1 108 ? 23.507  11.258 29.966  1.00 23.44  ? 108  SER A C   1 
ATOM   783  O  O   . SER A 1 108 ? 23.138  11.243 31.140  1.00 22.73  ? 108  SER A O   1 
ATOM   784  C  CB  . SER A 1 108 ? 25.841  11.482 29.241  1.00 25.24  ? 108  SER A CB  1 
ATOM   785  O  OG  . SER A 1 108 ? 26.152  10.789 30.408  1.00 24.84  ? 108  SER A OG  1 
ATOM   786  N  N   . GLU A 1 109 ? 22.967  10.441 29.066  1.00 24.03  ? 109  GLU A N   1 
ATOM   787  C  CA  . GLU A 1 109 ? 22.096  9.368  29.491  1.00 24.69  ? 109  GLU A CA  1 
ATOM   788  C  C   . GLU A 1 109 ? 22.770  8.528  30.572  1.00 25.08  ? 109  GLU A C   1 
ATOM   789  O  O   . GLU A 1 109 ? 22.138  8.142  31.530  1.00 26.10  ? 109  GLU A O   1 
ATOM   790  C  CB  . GLU A 1 109 ? 21.670  8.433  28.318  1.00 23.38  ? 109  GLU A CB  1 
ATOM   791  C  CG  . GLU A 1 109 ? 20.502  7.495  28.716  1.00 24.19  ? 109  GLU A CG  1 
ATOM   792  C  CD  . GLU A 1 109 ? 20.108  6.522  27.602  1.00 26.25  ? 109  GLU A CD  1 
ATOM   793  O  OE1 . GLU A 1 109 ? 19.125  6.765  26.834  1.00 29.98  ? 109  GLU A OE1 1 
ATOM   794  O  OE2 . GLU A 1 109 ? 20.808  5.524  27.442  1.00 32.11  ? 109  GLU A OE2 1 
ATOM   795  N  N   . LYS A 1 110 ? 24.039  8.193  30.360  1.00 25.70  ? 110  LYS A N   1 
ATOM   796  C  CA  . LYS A 1 110 ? 24.752  7.378  31.301  1.00 26.42  ? 110  LYS A CA  1 
ATOM   797  C  C   . LYS A 1 110 ? 24.784  7.973  32.717  1.00 25.69  ? 110  LYS A C   1 
ATOM   798  O  O   . LYS A 1 110 ? 24.511  7.300  33.714  1.00 25.11  ? 110  LYS A O   1 
ATOM   799  C  CB  . LYS A 1 110 ? 26.153  7.125  30.815  1.00 26.46  ? 110  LYS A CB  1 
ATOM   800  C  CG  . LYS A 1 110 ? 26.967  6.352  31.776  1.00 30.80  ? 110  LYS A CG  1 
ATOM   801  C  CD  . LYS A 1 110 ? 28.449  6.169  31.361  1.00 30.61  ? 110  LYS A CD  1 
ATOM   802  C  CE  . LYS A 1 110 ? 29.059  4.928  32.111  1.00 33.26  ? 110  LYS A CE  1 
ATOM   803  N  NZ  . LYS A 1 110 ? 30.137  4.186  31.321  1.00 36.07  ? 110  LYS A NZ  1 
ATOM   804  N  N   . SER A 1 111 ? 25.131  9.223  32.792  1.00 24.19  ? 111  SER A N   1 
ATOM   805  C  CA  . SER A 1 111 ? 25.255  9.855  34.061  1.00 25.48  ? 111  SER A CA  1 
ATOM   806  C  C   . SER A 1 111 ? 23.884  10.011 34.734  1.00 23.26  ? 111  SER A C   1 
ATOM   807  O  O   . SER A 1 111 ? 23.798  9.822  35.921  1.00 23.76  ? 111  SER A O   1 
ATOM   808  C  CB  . SER A 1 111 ? 26.070  11.180 33.929  1.00 26.53  ? 111  SER A CB  1 
ATOM   809  O  OG  . SER A 1 111 ? 25.249  12.211 33.474  1.00 32.43  ? 111  SER A OG  1 
ATOM   810  N  N   . LEU A 1 112 ? 22.816  10.316 33.988  1.00 23.35  ? 112  LEU A N   1 
ATOM   811  C  CA  . LEU A 1 112 ? 21.454  10.324 34.511  1.00 23.98  ? 112  LEU A CA  1 
ATOM   812  C  C   . LEU A 1 112 ? 21.067  8.945  35.082  1.00 23.49  ? 112  LEU A C   1 
ATOM   813  O  O   . LEU A 1 112 ? 20.446  8.889  36.067  1.00 22.01  ? 112  LEU A O   1 
ATOM   814  C  CB  . LEU A 1 112 ? 20.423  10.818 33.451  1.00 23.42  ? 112  LEU A CB  1 
ATOM   815  C  CG  . LEU A 1 112 ? 20.509  12.270 32.976  1.00 25.06  ? 112  LEU A CG  1 
ATOM   816  C  CD1 . LEU A 1 112 ? 19.477  12.554 31.813  1.00 25.06  ? 112  LEU A CD1 1 
ATOM   817  C  CD2 . LEU A 1 112 ? 20.204  13.190 34.178  1.00 24.20  ? 112  LEU A CD2 1 
ATOM   818  N  N   . ARG A 1 113 ? 21.486  7.830  34.493  1.00 24.05  ? 113  ARG A N   1 
ATOM   819  C  CA  . ARG A 1 113 ? 21.233  6.541  35.155  1.00 24.70  ? 113  ARG A CA  1 
ATOM   820  C  C   . ARG A 1 113 ? 21.837  6.503  36.517  1.00 25.43  ? 113  ARG A C   1 
ATOM   821  O  O   . ARG A 1 113 ? 21.176  6.083  37.407  1.00 25.38  ? 113  ARG A O   1 
ATOM   822  C  CB  . ARG A 1 113 ? 21.744  5.354  34.365  1.00 23.86  ? 113  ARG A CB  1 
ATOM   823  C  CG  . ARG A 1 113 ? 21.032  5.187  33.074  1.00 24.84  ? 113  ARG A CG  1 
ATOM   824  C  CD  . ARG A 1 113 ? 21.666  4.022  32.230  1.00 26.20  ? 113  ARG A CD  1 
ATOM   825  N  NE  . ARG A 1 113 ? 20.999  3.965  30.908  1.00 23.45  ? 113  ARG A NE  1 
ATOM   826  C  CZ  . ARG A 1 113 ? 19.917  3.265  30.634  1.00 24.30  ? 113  ARG A CZ  1 
ATOM   827  N  NH1 . ARG A 1 113 ? 19.334  2.464  31.519  1.00 21.27  ? 113  ARG A NH1 1 
ATOM   828  N  NH2 . ARG A 1 113 ? 19.439  3.318  29.394  1.00 24.40  ? 113  ARG A NH2 1 
ATOM   829  N  N   . THR A 1 114 ? 23.091  6.974  36.655  1.00 24.91  ? 114  THR A N   1 
ATOM   830  C  CA  . THR A 1 114 ? 23.788  7.054  37.953  1.00 24.46  ? 114  THR A CA  1 
ATOM   831  C  C   . THR A 1 114 ? 23.008  7.918  38.944  1.00 24.02  ? 114  THR A C   1 
ATOM   832  O  O   . THR A 1 114 ? 22.798  7.491  40.093  1.00 23.04  ? 114  THR A O   1 
ATOM   833  C  CB  . THR A 1 114 ? 25.236  7.579  37.806  1.00 23.37  ? 114  THR A CB  1 
ATOM   834  O  OG1 . THR A 1 114 ? 25.943  6.655  36.968  1.00 28.46  ? 114  THR A OG1 1 
ATOM   835  C  CG2 . THR A 1 114 ? 25.958  7.655  39.214  1.00 25.43  ? 114  THR A CG2 1 
ATOM   836  N  N   . VAL A 1 115 ? 22.595  9.107  38.502  1.00 22.86  ? 115  VAL A N   1 
ATOM   837  C  CA  . VAL A 1 115 ? 21.772  9.996  39.314  1.00 23.70  ? 115  VAL A CA  1 
ATOM   838  C  C   . VAL A 1 115 ? 20.515  9.268  39.794  1.00 24.00  ? 115  VAL A C   1 
ATOM   839  O  O   . VAL A 1 115 ? 20.214  9.281  40.979  1.00 26.33  ? 115  VAL A O   1 
ATOM   840  C  CB  . VAL A 1 115 ? 21.337  11.313 38.582  1.00 24.03  ? 115  VAL A CB  1 
ATOM   841  C  CG1 . VAL A 1 115 ? 20.252  12.075 39.390  1.00 22.47  ? 115  VAL A CG1 1 
ATOM   842  C  CG2 . VAL A 1 115 ? 22.535  12.226 38.232  1.00 21.03  ? 115  VAL A CG2 1 
ATOM   843  N  N   . PHE A 1 116 ? 19.782  8.604  38.896  1.00 24.30  ? 116  PHE A N   1 
ATOM   844  C  CA  . PHE A 1 116 ? 18.510  7.938  39.287  1.00 23.76  ? 116  PHE A CA  1 
ATOM   845  C  C   . PHE A 1 116 ? 18.680  6.716  40.184  1.00 23.69  ? 116  PHE A C   1 
ATOM   846  O  O   . PHE A 1 116 ? 17.846  6.502  41.094  1.00 24.62  ? 116  PHE A O   1 
ATOM   847  C  CB  . PHE A 1 116 ? 17.629  7.589  38.052  1.00 24.24  ? 116  PHE A CB  1 
ATOM   848  C  CG  . PHE A 1 116 ? 17.367  8.734  37.166  1.00 23.90  ? 116  PHE A CG  1 
ATOM   849  C  CD1 . PHE A 1 116 ? 17.242  10.063 37.681  1.00 24.40  ? 116  PHE A CD1 1 
ATOM   850  C  CD2 . PHE A 1 116 ? 17.234  8.518  35.812  1.00 24.03  ? 116  PHE A CD2 1 
ATOM   851  C  CE1 . PHE A 1 116 ? 17.001  11.144 36.801  1.00 22.44  ? 116  PHE A CE1 1 
ATOM   852  C  CE2 . PHE A 1 116 ? 17.047  9.588  34.933  1.00 22.49  ? 116  PHE A CE2 1 
ATOM   853  C  CZ  . PHE A 1 116 ? 16.911  10.894 35.441  1.00 24.74  ? 116  PHE A CZ  1 
ATOM   854  N  N   . ARG A 1 117 ? 19.773  5.964  40.008  1.00 23.58  ? 117  ARG A N   1 
ATOM   855  C  CA  . ARG A 1 117 ? 20.146  4.848  40.885  1.00 22.30  ? 117  ARG A CA  1 
ATOM   856  C  C   . ARG A 1 117 ? 20.522  5.333  42.355  1.00 22.18  ? 117  ARG A C   1 
ATOM   857  O  O   . ARG A 1 117 ? 20.539  4.533  43.309  1.00 22.34  ? 117  ARG A O   1 
ATOM   858  C  CB  . ARG A 1 117 ? 21.331  4.090  40.260  1.00 22.17  ? 117  ARG A CB  1 
ATOM   859  C  CG  . ARG A 1 117 ? 20.997  3.284  38.979  1.00 23.37  ? 117  ARG A CG  1 
ATOM   860  C  CD  . ARG A 1 117 ? 22.213  2.722  38.349  1.00 19.99  ? 117  ARG A CD  1 
ATOM   861  N  NE  . ARG A 1 117 ? 21.935  2.298  36.989  1.00 19.35  ? 117  ARG A NE  1 
ATOM   862  C  CZ  . ARG A 1 117 ? 22.850  1.848  36.126  1.00 22.68  ? 117  ARG A CZ  1 
ATOM   863  N  NH1 . ARG A 1 117 ? 24.124  1.725  36.451  1.00 22.83  ? 117  ARG A NH1 1 
ATOM   864  N  NH2 . ARG A 1 117 ? 22.465  1.463  34.938  1.00 22.78  ? 117  ARG A NH2 1 
ATOM   865  N  N   . THR A 1 118 ? 20.871  6.600  42.480  1.00 22.51  ? 118  THR A N   1 
ATOM   866  C  CA  . THR A 1 118 ? 21.200  7.291  43.737  1.00 23.84  ? 118  THR A CA  1 
ATOM   867  C  C   . THR A 1 118 ? 19.954  7.911  44.366  1.00 23.58  ? 118  THR A C   1 
ATOM   868  O  O   . THR A 1 118 ? 19.776  7.823  45.557  1.00 24.42  ? 118  THR A O   1 
ATOM   869  C  CB  . THR A 1 118 ? 22.232  8.400  43.462  1.00 23.81  ? 118  THR A CB  1 
ATOM   870  O  OG1 . THR A 1 118 ? 23.377  7.881  42.758  1.00 28.15  ? 118  THR A OG1 1 
ATOM   871  C  CG2 . THR A 1 118 ? 22.698  9.097  44.691  1.00 27.22  ? 118  THR A CG2 1 
ATOM   872  N  N   . ASP A 1 119 ? 19.105  8.553  43.559  1.00 23.46  ? 119  ASP A N   1 
ATOM   873  C  CA  . ASP A 1 119 ? 17.964  9.346  44.053  1.00 23.25  ? 119  ASP A CA  1 
ATOM   874  C  C   . ASP A 1 119 ? 16.859  9.329  43.015  1.00 22.55  ? 119  ASP A C   1 
ATOM   875  O  O   . ASP A 1 119 ? 16.840  10.087 42.040  1.00 23.42  ? 119  ASP A O   1 
ATOM   876  C  CB  . ASP A 1 119 ? 18.366  10.781 44.405  1.00 23.32  ? 119  ASP A CB  1 
ATOM   877  C  CG  . ASP A 1 119 ? 17.221  11.608 44.963  1.00 22.71  ? 119  ASP A CG  1 
ATOM   878  O  OD1 . ASP A 1 119 ? 16.171  11.062 45.238  1.00 24.01  ? 119  ASP A OD1 1 
ATOM   879  O  OD2 . ASP A 1 119 ? 17.380  12.828 45.167  1.00 23.61  ? 119  ASP A OD2 1 
ATOM   880  N  N   . GLU A 1 120 ? 15.934  8.418  43.240  1.00 23.80  ? 120  GLU A N   1 
ATOM   881  C  CA  . GLU A 1 120 ? 14.786  8.147  42.355  1.00 23.42  ? 120  GLU A CA  1 
ATOM   882  C  C   . GLU A 1 120 ? 13.872  9.390  42.172  1.00 22.40  ? 120  GLU A C   1 
ATOM   883  O  O   . GLU A 1 120 ? 13.227  9.560  41.164  1.00 20.25  ? 120  GLU A O   1 
ATOM   884  C  CB  . GLU A 1 120 ? 13.990  6.969  42.931  1.00 24.04  ? 120  GLU A CB  1 
ATOM   885  C  CG  . GLU A 1 120 ? 12.563  6.715  42.400  1.00 26.42  ? 120  GLU A CG  1 
ATOM   886  C  CD  . GLU A 1 120 ? 11.906  5.623  43.233  1.00 26.02  ? 120  GLU A CD  1 
ATOM   887  O  OE1 . GLU A 1 120 ? 12.322  4.470  43.032  1.00 27.93  ? 120  GLU A OE1 1 
ATOM   888  O  OE2 . GLU A 1 120 ? 11.067  5.909  44.138  1.00 26.94  ? 120  GLU A OE2 1 
ATOM   889  N  N   . ASP A 1 121 ? 13.882  10.277 43.157  1.00 23.38  ? 121  ASP A N   1 
ATOM   890  C  CA  . ASP A 1 121 ? 13.020  11.466 43.121  1.00 23.41  ? 121  ASP A CA  1 
ATOM   891  C  C   . ASP A 1 121 ? 13.359  12.395 41.972  1.00 22.82  ? 121  ASP A C   1 
ATOM   892  O  O   . ASP A 1 121 ? 12.511  13.174 41.502  1.00 22.69  ? 121  ASP A O   1 
ATOM   893  C  CB  . ASP A 1 121 ? 13.107  12.245 44.449  1.00 21.87  ? 121  ASP A CB  1 
ATOM   894  C  CG  . ASP A 1 121 ? 12.303  11.621 45.522  1.00 22.44  ? 121  ASP A CG  1 
ATOM   895  O  OD1 . ASP A 1 121 ? 11.425  10.714 45.298  1.00 18.93  ? 121  ASP A OD1 1 
ATOM   896  O  OD2 . ASP A 1 121 ? 12.556  11.999 46.661  1.00 17.42  ? 121  ASP A OD2 1 
ATOM   897  N  N   . MET A 1 122 ? 14.595  12.321 41.514  1.00 23.02  ? 122  MET A N   1 
ATOM   898  C  CA  . MET A 1 122 ? 15.070  13.233 40.438  1.00 22.19  ? 122  MET A CA  1 
ATOM   899  C  C   . MET A 1 122 ? 14.402  12.923 39.132  1.00 22.29  ? 122  MET A C   1 
ATOM   900  O  O   . MET A 1 122 ? 14.239  13.806 38.334  1.00 20.51  ? 122  MET A O   1 
ATOM   901  C  CB  . MET A 1 122 ? 16.605  13.180 40.247  1.00 21.90  ? 122  MET A CB  1 
ATOM   902  C  CG  . MET A 1 122 ? 17.415  13.875 41.341  1.00 23.37  ? 122  MET A CG  1 
ATOM   903  S  SD  . MET A 1 122 ? 16.858  15.565 41.775  1.00 26.64  ? 122  MET A SD  1 
ATOM   904  C  CE  . MET A 1 122 ? 15.834  15.254 43.239  1.00 22.17  ? 122  MET A CE  1 
ATOM   905  N  N   . ILE A 1 123 ? 13.946  11.685 38.943  1.00 22.01  ? 123  ILE A N   1 
ATOM   906  C  CA  . ILE A 1 123 ? 13.227  11.291 37.687  1.00 21.67  ? 123  ILE A CA  1 
ATOM   907  C  C   . ILE A 1 123 ? 11.901  12.120 37.562  1.00 22.86  ? 123  ILE A C   1 
ATOM   908  O  O   . ILE A 1 123 ? 11.545  12.644 36.511  1.00 21.97  ? 123  ILE A O   1 
ATOM   909  C  CB  . ILE A 1 123 ? 12.729  9.780  37.729  1.00 22.43  ? 123  ILE A CB  1 
ATOM   910  C  CG1 . ILE A 1 123 ? 13.855  8.695  37.771  1.00 20.78  ? 123  ILE A CG1 1 
ATOM   911  C  CG2 . ILE A 1 123 ? 11.706  9.535  36.609  1.00 19.73  ? 123  ILE A CG2 1 
ATOM   912  C  CD1 . ILE A 1 123 ? 13.423  7.437  38.520  1.00 18.69  ? 123  ILE A CD1 1 
ATOM   913  N  N   . PHE A 1 124 ? 11.213  12.266 38.710  1.00 22.36  ? 124  PHE A N   1 
ATOM   914  C  CA  . PHE A 1 124 ? 9.946   12.970 38.781  1.00 21.49  ? 124  PHE A CA  1 
ATOM   915  C  C   . PHE A 1 124 ? 10.003  14.444 38.719  1.00 21.65  ? 124  PHE A C   1 
ATOM   916  O  O   . PHE A 1 124 ? 9.137   15.031 38.100  1.00 22.14  ? 124  PHE A O   1 
ATOM   917  C  CB  . PHE A 1 124 ? 9.152   12.445 40.014  1.00 21.19  ? 124  PHE A CB  1 
ATOM   918  C  CG  . PHE A 1 124 ? 8.866   10.979 39.889  1.00 21.60  ? 124  PHE A CG  1 
ATOM   919  C  CD1 . PHE A 1 124 ? 7.787   10.564 39.126  1.00 19.74  ? 124  PHE A CD1 1 
ATOM   920  C  CD2 . PHE A 1 124 ? 9.687   10.008 40.526  1.00 22.18  ? 124  PHE A CD2 1 
ATOM   921  C  CE1 . PHE A 1 124 ? 7.505   9.233  38.924  1.00 20.55  ? 124  PHE A CE1 1 
ATOM   922  C  CE2 . PHE A 1 124 ? 9.365   8.641  40.373  1.00 19.09  ? 124  PHE A CE2 1 
ATOM   923  C  CZ  . PHE A 1 124 ? 8.265   8.244  39.560  1.00 19.71  ? 124  PHE A CZ  1 
ATOM   924  N  N   . GLU A 1 125 ? 11.080  15.036 39.230  1.00 21.56  ? 125  GLU A N   1 
ATOM   925  C  CA  . GLU A 1 125 ? 11.416  16.429 38.980  1.00 21.54  ? 125  GLU A CA  1 
ATOM   926  C  C   . GLU A 1 125 ? 11.689  16.744 37.533  1.00 21.54  ? 125  GLU A C   1 
ATOM   927  O  O   . GLU A 1 125 ? 11.223  17.776 36.990  1.00 22.42  ? 125  GLU A O   1 
ATOM   928  C  CB  . GLU A 1 125 ? 12.625  16.891 39.866  1.00 20.45  ? 125  GLU A CB  1 
ATOM   929  C  CG  . GLU A 1 125 ? 12.350  16.848 41.332  1.00 23.88  ? 125  GLU A CG  1 
ATOM   930  C  CD  . GLU A 1 125 ? 11.001  17.454 41.745  1.00 23.42  ? 125  GLU A CD  1 
ATOM   931  O  OE1 . GLU A 1 125 ? 10.871  18.681 41.653  1.00 29.26  ? 125  GLU A OE1 1 
ATOM   932  O  OE2 . GLU A 1 125 ? 10.125  16.677 42.197  1.00 25.90  ? 125  GLU A OE2 1 
ATOM   933  N  N   . ILE A 1 126 ? 12.404  15.862 36.850  1.00 22.27  ? 126  ILE A N   1 
ATOM   934  C  CA  . ILE A 1 126 ? 12.568  15.990 35.429  1.00 21.97  ? 126  ILE A CA  1 
ATOM   935  C  C   . ILE A 1 126 ? 11.250  15.879 34.612  1.00 22.15  ? 126  ILE A C   1 
ATOM   936  O  O   . ILE A 1 126 ? 11.002  16.703 33.689  1.00 22.99  ? 126  ILE A O   1 
ATOM   937  C  CB  . ILE A 1 126 ? 13.789  15.081 34.867  1.00 24.18  ? 126  ILE A CB  1 
ATOM   938  C  CG1 . ILE A 1 126 ? 15.153  15.542 35.464  1.00 26.07  ? 126  ILE A CG1 1 
ATOM   939  C  CG2 . ILE A 1 126 ? 13.887  15.163 33.304  1.00 21.22  ? 126  ILE A CG2 1 
ATOM   940  C  CD1 . ILE A 1 126 ? 16.240  14.563 35.384  1.00 23.27  ? 126  ILE A CD1 1 
ATOM   941  N  N   . PHE A 1 127 ? 10.411  14.913 34.959  1.00 23.13  ? 127  PHE A N   1 
ATOM   942  C  CA  . PHE A 1 127 ? 9.026   14.818 34.376  1.00 22.62  ? 127  PHE A CA  1 
ATOM   943  C  C   . PHE A 1 127 ? 8.229   16.127 34.543  1.00 22.67  ? 127  PHE A C   1 
ATOM   944  O  O   . PHE A 1 127 ? 7.560   16.557 33.630  1.00 22.24  ? 127  PHE A O   1 
ATOM   945  C  CB  . PHE A 1 127 ? 8.194   13.720 34.978  1.00 20.31  ? 127  PHE A CB  1 
ATOM   946  C  CG  . PHE A 1 127 ? 8.619   12.299 34.687  1.00 22.39  ? 127  PHE A CG  1 
ATOM   947  C  CD1 . PHE A 1 127 ? 9.442   11.916 33.652  1.00 18.93  ? 127  PHE A CD1 1 
ATOM   948  C  CD2 . PHE A 1 127 ? 8.004   11.276 35.419  1.00 26.72  ? 127  PHE A CD2 1 
ATOM   949  C  CE1 . PHE A 1 127 ? 9.739   10.594 33.430  1.00 21.55  ? 127  PHE A CE1 1 
ATOM   950  C  CE2 . PHE A 1 127 ? 8.323   9.974  35.202  1.00 22.66  ? 127  PHE A CE2 1 
ATOM   951  C  CZ  . PHE A 1 127 ? 9.133   9.612  34.186  1.00 22.85  ? 127  PHE A CZ  1 
ATOM   952  N  N   . LYS A 1 128 ? 8.306   16.716 35.739  1.00 24.12  ? 128  LYS A N   1 
ATOM   953  C  CA  . LYS A 1 128 ? 7.673   18.006 36.065  1.00 23.19  ? 128  LYS A CA  1 
ATOM   954  C  C   . LYS A 1 128 ? 8.144   19.118 35.189  1.00 21.59  ? 128  LYS A C   1 
ATOM   955  O  O   . LYS A 1 128 ? 7.357   19.895 34.684  1.00 23.64  ? 128  LYS A O   1 
ATOM   956  C  CB  . LYS A 1 128 ? 7.832   18.363 37.570  1.00 22.06  ? 128  LYS A CB  1 
ATOM   957  C  CG  . LYS A 1 128 ? 7.051   17.490 38.519  1.00 21.80  ? 128  LYS A CG  1 
ATOM   958  C  CD  . LYS A 1 128 ? 7.438   17.725 39.952  1.00 23.19  ? 128  LYS A CD  1 
ATOM   959  C  CE  . LYS A 1 128 ? 7.074   16.565 40.803  1.00 23.75  ? 128  LYS A CE  1 
ATOM   960  N  NZ  . LYS A 1 128 ? 7.406   16.672 42.209  1.00 23.87  ? 128  LYS A NZ  1 
ATOM   961  N  N   . ASN A 1 129 ? 9.436   19.172 34.982  1.00 22.14  ? 129  ASN A N   1 
ATOM   962  C  CA  . ASN A 1 129 ? 10.074  20.124 34.082  1.00 23.58  ? 129  ASN A CA  1 
ATOM   963  C  C   . ASN A 1 129 ? 9.648   19.938 32.592  1.00 23.49  ? 129  ASN A C   1 
ATOM   964  O  O   . ASN A 1 129 ? 9.298   20.905 31.908  1.00 23.87  ? 129  ASN A O   1 
ATOM   965  C  CB  . ASN A 1 129 ? 11.594  20.019 34.226  1.00 23.97  ? 129  ASN A CB  1 
ATOM   966  C  CG  . ASN A 1 129 ? 12.355  21.090 33.403  1.00 23.24  ? 129  ASN A CG  1 
ATOM   967  O  OD1 . ASN A 1 129 ? 12.713  20.820 32.303  1.00 23.72  ? 129  ASN A OD1 1 
ATOM   968  N  ND2 . ASN A 1 129 ? 12.577  22.280 33.963  1.00 23.95  ? 129  ASN A ND2 1 
ATOM   969  N  N   . TYR A 1 130 ? 9.655   18.709 32.108  1.00 24.66  ? 130  TYR A N   1 
ATOM   970  C  CA  . TYR A 1 130 ? 9.149   18.464 30.778  1.00 23.65  ? 130  TYR A CA  1 
ATOM   971  C  C   . TYR A 1 130 ? 7.670   18.806 30.662  1.00 23.66  ? 130  TYR A C   1 
ATOM   972  O  O   . TYR A 1 130 ? 7.233   19.412 29.702  1.00 22.64  ? 130  TYR A O   1 
ATOM   973  C  CB  . TYR A 1 130 ? 9.340   17.017 30.430  1.00 23.56  ? 130  TYR A CB  1 
ATOM   974  C  CG  . TYR A 1 130 ? 10.652  16.575 29.837  1.00 23.88  ? 130  TYR A CG  1 
ATOM   975  C  CD1 . TYR A 1 130 ? 11.086  17.097 28.613  1.00 24.31  ? 130  TYR A CD1 1 
ATOM   976  C  CD2 . TYR A 1 130 ? 11.398  15.517 30.424  1.00 23.26  ? 130  TYR A CD2 1 
ATOM   977  C  CE1 . TYR A 1 130 ? 12.260  16.659 28.035  1.00 24.77  ? 130  TYR A CE1 1 
ATOM   978  C  CE2 . TYR A 1 130 ? 12.548  15.069 29.838  1.00 25.39  ? 130  TYR A CE2 1 
ATOM   979  C  CZ  . TYR A 1 130 ? 13.004  15.654 28.649  1.00 25.50  ? 130  TYR A CZ  1 
ATOM   980  O  OH  . TYR A 1 130 ? 14.195  15.246 28.015  1.00 22.79  ? 130  TYR A OH  1 
ATOM   981  N  N   . LEU A 1 131 ? 6.880   18.327 31.619  1.00 23.35  ? 131  LEU A N   1 
ATOM   982  C  CA  . LEU A 1 131 ? 5.447   18.586 31.571  1.00 23.25  ? 131  LEU A CA  1 
ATOM   983  C  C   . LEU A 1 131 ? 5.099   20.090 31.494  1.00 21.59  ? 131  LEU A C   1 
ATOM   984  O  O   . LEU A 1 131 ? 4.165   20.494 30.760  1.00 20.22  ? 131  LEU A O   1 
ATOM   985  C  CB  . LEU A 1 131 ? 4.684   17.811 32.678  1.00 21.69  ? 131  LEU A CB  1 
ATOM   986  C  CG  . LEU A 1 131 ? 3.201   18.041 32.814  1.00 22.28  ? 131  LEU A CG  1 
ATOM   987  C  CD1 . LEU A 1 131 ? 2.502   17.634 31.500  1.00 21.21  ? 131  LEU A CD1 1 
ATOM   988  C  CD2 . LEU A 1 131 ? 2.634   17.309 33.991  1.00 23.06  ? 131  LEU A CD2 1 
ATOM   989  N  N   . THR A 1 132 ? 5.858   20.913 32.234  1.00 22.86  ? 132  THR A N   1 
ATOM   990  C  CA  . THR A 1 132 ? 5.644   22.353 32.292  1.00 21.51  ? 132  THR A CA  1 
ATOM   991  C  C   . THR A 1 132 ? 5.895   22.874 30.884  1.00 21.96  ? 132  THR A C   1 
ATOM   992  O  O   . THR A 1 132 ? 5.145   23.687 30.389  1.00 22.36  ? 132  THR A O   1 
ATOM   993  C  CB  . THR A 1 132 ? 6.594   23.090 33.340  1.00 22.55  ? 132  THR A CB  1 
ATOM   994  O  OG1 . THR A 1 132 ? 6.331   22.608 34.647  1.00 23.14  ? 132  THR A OG1 1 
ATOM   995  C  CG2 . THR A 1 132 ? 6.380   24.560 33.341  1.00 19.42  ? 132  THR A CG2 1 
ATOM   996  N  N   . LYS A 1 133 ? 6.928   22.352 30.225  1.00 22.70  ? 133  LYS A N   1 
ATOM   997  C  CA  . LYS A 1 133 ? 7.239   22.778 28.858  1.00 23.24  ? 133  LYS A CA  1 
ATOM   998  C  C   . LYS A 1 133 ? 6.157   22.362 27.835  1.00 23.08  ? 133  LYS A C   1 
ATOM   999  O  O   . LYS A 1 133 ? 5.714   23.182 27.032  1.00 20.18  ? 133  LYS A O   1 
ATOM   1000 C  CB  . LYS A 1 133 ? 8.591   22.249 28.464  1.00 22.60  ? 133  LYS A CB  1 
ATOM   1001 C  CG  . LYS A 1 133 ? 9.685   22.857 29.224  1.00 22.92  ? 133  LYS A CG  1 
ATOM   1002 C  CD  . LYS A 1 133 ? 11.017  22.131 28.843  1.00 23.33  ? 133  LYS A CD  1 
ATOM   1003 C  CE  . LYS A 1 133 ? 12.191  22.801 29.575  1.00 26.44  ? 133  LYS A CE  1 
ATOM   1004 N  NZ  . LYS A 1 133 ? 13.435  21.937 29.441  1.00 24.03  ? 133  LYS A NZ  1 
ATOM   1005 N  N   . VAL A 1 134 ? 5.701   21.106 27.885  1.00 23.49  ? 134  VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 134 ? 4.621   20.696 26.970  1.00 23.21  ? 134  VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 134 ? 3.330   21.549 27.198  1.00 24.88  ? 134  VAL A C   1 
ATOM   1008 O  O   . VAL A 1 134 ? 2.679   22.007 26.210  1.00 24.92  ? 134  VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 134 ? 4.309   19.157 27.056  1.00 24.81  ? 134  VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 134 ? 3.073   18.813 26.206  1.00 22.84  ? 134  VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 134 ? 5.577   18.275 26.676  1.00 19.73  ? 134  VAL A CG2 1 
ATOM   1012 N  N   . ALA A 1 135 ? 2.950   21.765 28.462  1.00 23.56  ? 135  ALA A N   1 
ATOM   1013 C  CA  . ALA A 1 135 ? 1.768   22.516 28.792  1.00 23.89  ? 135  ALA A CA  1 
ATOM   1014 C  C   . ALA A 1 135 ? 1.810   23.938 28.322  1.00 24.45  ? 135  ALA A C   1 
ATOM   1015 O  O   . ALA A 1 135 ? 0.778   24.441 27.926  1.00 24.98  ? 135  ALA A O   1 
ATOM   1016 C  CB  . ALA A 1 135 ? 1.431   22.484 30.362  1.00 22.93  ? 135  ALA A CB  1 
ATOM   1017 N  N   . TYR A 1 136 ? 2.990   24.566 28.412  1.00 23.41  ? 136  TYR A N   1 
ATOM   1018 C  CA  . TYR A 1 136 ? 3.244   25.906 27.934  1.00 22.45  ? 136  TYR A CA  1 
ATOM   1019 C  C   . TYR A 1 136 ? 3.082   26.080 26.380  1.00 23.05  ? 136  TYR A C   1 
ATOM   1020 O  O   . TYR A 1 136 ? 2.258   26.882 25.938  1.00 19.95  ? 136  TYR A O   1 
ATOM   1021 C  CB  . TYR A 1 136 ? 4.634   26.453 28.409  1.00 23.69  ? 136  TYR A CB  1 
ATOM   1022 C  CG  . TYR A 1 136 ? 4.826   27.829 27.863  1.00 19.95  ? 136  TYR A CG  1 
ATOM   1023 C  CD1 . TYR A 1 136 ? 4.207   28.879 28.459  1.00 23.74  ? 136  TYR A CD1 1 
ATOM   1024 C  CD2 . TYR A 1 136 ? 5.469   28.043 26.638  1.00 23.55  ? 136  TYR A CD2 1 
ATOM   1025 C  CE1 . TYR A 1 136 ? 4.265   30.147 27.950  1.00 20.42  ? 136  TYR A CE1 1 
ATOM   1026 C  CE2 . TYR A 1 136 ? 5.540   29.346 26.093  1.00 23.09  ? 136  TYR A CE2 1 
ATOM   1027 C  CZ  . TYR A 1 136 ? 4.960   30.383 26.772  1.00 22.73  ? 136  TYR A CZ  1 
ATOM   1028 O  OH  . TYR A 1 136 ? 4.939   31.657 26.261  1.00 24.58  ? 136  TYR A OH  1 
ATOM   1029 N  N   . TYR A 1 137 ? 3.804   25.264 25.610  1.00 21.09  ? 137  TYR A N   1 
ATOM   1030 C  CA  . TYR A 1 137 ? 3.845   25.366 24.181  1.00 22.91  ? 137  TYR A CA  1 
ATOM   1031 C  C   . TYR A 1 137 ? 2.573   24.889 23.525  1.00 22.65  ? 137  TYR A C   1 
ATOM   1032 O  O   . TYR A 1 137 ? 2.174   25.474 22.513  1.00 23.47  ? 137  TYR A O   1 
ATOM   1033 C  CB  . TYR A 1 137 ? 5.069   24.663 23.604  1.00 21.52  ? 137  TYR A CB  1 
ATOM   1034 C  CG  . TYR A 1 137 ? 6.346   25.405 23.996  1.00 20.99  ? 137  TYR A CG  1 
ATOM   1035 C  CD1 . TYR A 1 137 ? 6.639   26.674 23.472  1.00 21.23  ? 137  TYR A CD1 1 
ATOM   1036 C  CD2 . TYR A 1 137 ? 7.258   24.830 24.893  1.00 22.89  ? 137  TYR A CD2 1 
ATOM   1037 C  CE1 . TYR A 1 137 ? 7.791   27.338 23.825  1.00 20.23  ? 137  TYR A CE1 1 
ATOM   1038 C  CE2 . TYR A 1 137 ? 8.390   25.510 25.317  1.00 20.70  ? 137  TYR A CE2 1 
ATOM   1039 C  CZ  . TYR A 1 137 ? 8.679   26.726 24.766  1.00 18.38  ? 137  TYR A CZ  1 
ATOM   1040 O  OH  . TYR A 1 137 ? 9.848   27.339 25.161  1.00 21.13  ? 137  TYR A OH  1 
ATOM   1041 N  N   . ALA A 1 138 ? 1.958   23.827 24.084  1.00 22.63  ? 138  ALA A N   1 
ATOM   1042 C  CA  . ALA A 1 138 ? 0.714   23.304 23.572  1.00 21.82  ? 138  ALA A CA  1 
ATOM   1043 C  C   . ALA A 1 138 ? -0.419  24.291 23.735  1.00 21.33  ? 138  ALA A C   1 
ATOM   1044 O  O   . ALA A 1 138 ? -1.163  24.525 22.805  1.00 21.09  ? 138  ALA A O   1 
ATOM   1045 C  CB  . ALA A 1 138 ? 0.386   22.008 24.189  1.00 22.76  ? 138  ALA A CB  1 
ATOM   1046 N  N   . ARG A 1 139 ? -0.521  24.894 24.907  1.00 20.72  ? 139  ARG A N   1 
ATOM   1047 C  CA  . ARG A 1 139 ? -1.480  25.974 25.170  1.00 23.13  ? 139  ARG A CA  1 
ATOM   1048 C  C   . ARG A 1 139 ? -1.279  27.125 24.192  1.00 22.16  ? 139  ARG A C   1 
ATOM   1049 O  O   . ARG A 1 139 ? -2.245  27.700 23.696  1.00 22.26  ? 139  ARG A O   1 
ATOM   1050 C  CB  . ARG A 1 139 ? -1.348  26.489 26.618  1.00 21.12  ? 139  ARG A CB  1 
ATOM   1051 C  CG  . ARG A 1 139 ? -2.297  27.597 26.926  1.00 23.84  ? 139  ARG A CG  1 
ATOM   1052 C  CD  . ARG A 1 139 ? -2.038  28.190 28.318  1.00 27.22  ? 139  ARG A CD  1 
ATOM   1053 N  NE  . ARG A 1 139 ? -3.094  29.131 28.669  1.00 33.98  ? 139  ARG A NE  1 
ATOM   1054 C  CZ  . ARG A 1 139 ? -4.274  28.854 29.255  1.00 37.93  ? 139  ARG A CZ  1 
ATOM   1055 N  NH1 . ARG A 1 139 ? -4.679  27.597 29.623  1.00 36.06  ? 139  ARG A NH1 1 
ATOM   1056 N  NH2 . ARG A 1 139 ? -5.094  29.866 29.458  1.00 38.44  ? 139  ARG A NH2 1 
ATOM   1057 N  N   . GLN A 1 140 ? -0.030  27.427 23.909  1.00 23.07  ? 140  GLN A N   1 
ATOM   1058 C  CA  . GLN A 1 140 ? 0.324   28.598 23.116  1.00 24.80  ? 140  GLN A CA  1 
ATOM   1059 C  C   . GLN A 1 140 ? -0.057  28.384 21.695  1.00 24.08  ? 140  GLN A C   1 
ATOM   1060 O  O   . GLN A 1 140 ? -0.585  29.268 21.076  1.00 24.50  ? 140  GLN A O   1 
ATOM   1061 C  CB  . GLN A 1 140 ? 1.818   28.854 23.193  1.00 25.84  ? 140  GLN A CB  1 
ATOM   1062 C  CG  . GLN A 1 140 ? 2.138   30.167 22.559  1.00 32.23  ? 140  GLN A CG  1 
ATOM   1063 C  CD  . GLN A 1 140 ? 3.502   30.616 22.878  1.00 39.04  ? 140  GLN A CD  1 
ATOM   1064 O  OE1 . GLN A 1 140 ? 4.416   29.780 23.041  1.00 43.98  ? 140  GLN A OE1 1 
ATOM   1065 N  NE2 . GLN A 1 140 ? 3.697   31.949 22.941  1.00 43.99  ? 140  GLN A NE2 1 
ATOM   1066 N  N   . VAL A 1 141 ? 0.231   27.200 21.157  1.00 24.99  ? 141  VAL A N   1 
ATOM   1067 C  CA  . VAL A 1 141 ? -0.300  26.821 19.813  1.00 24.21  ? 141  VAL A CA  1 
ATOM   1068 C  C   . VAL A 1 141 ? -1.811  27.038 19.685  1.00 24.68  ? 141  VAL A C   1 
ATOM   1069 O  O   . VAL A 1 141 ? -2.257  27.739 18.772  1.00 24.67  ? 141  VAL A O   1 
ATOM   1070 C  CB  . VAL A 1 141 ? 0.060   25.379 19.411  1.00 24.74  ? 141  VAL A CB  1 
ATOM   1071 C  CG1 . VAL A 1 141 ? -0.694  24.936 18.104  1.00 21.90  ? 141  VAL A CG1 1 
ATOM   1072 C  CG2 . VAL A 1 141 ? 1.604   25.238 19.254  1.00 20.73  ? 141  VAL A CG2 1 
ATOM   1073 N  N   . ALA A 1 142 ? -2.575  26.461 20.615  1.00 24.03  ? 142  ALA A N   1 
ATOM   1074 C  CA  . ALA A 1 142 ? -4.008  26.576 20.634  1.00 23.96  ? 142  ALA A CA  1 
ATOM   1075 C  C   . ALA A 1 142 ? -4.498  28.032 20.786  1.00 24.31  ? 142  ALA A C   1 
ATOM   1076 O  O   . ALA A 1 142 ? -5.432  28.493 20.112  1.00 24.43  ? 142  ALA A O   1 
ATOM   1077 C  CB  . ALA A 1 142 ? -4.608  25.688 21.711  1.00 22.17  ? 142  ALA A CB  1 
ATOM   1078 N  N   . GLU A 1 143 ? -3.844  28.738 21.693  1.00 25.68  ? 143  GLU A N   1 
ATOM   1079 C  CA  . GLU A 1 143 ? -4.082  30.123 21.927  1.00 26.72  ? 143  GLU A CA  1 
ATOM   1080 C  C   . GLU A 1 143 ? -3.903  30.967 20.646  1.00 26.31  ? 143  GLU A C   1 
ATOM   1081 O  O   . GLU A 1 143 ? -4.748  31.821 20.342  1.00 24.76  ? 143  GLU A O   1 
ATOM   1082 C  CB  . GLU A 1 143 ? -3.143  30.600 23.035  1.00 28.57  ? 143  GLU A CB  1 
ATOM   1083 C  CG  . GLU A 1 143 ? -3.723  31.611 23.952  1.00 31.84  ? 143  GLU A CG  1 
ATOM   1084 C  CD  . GLU A 1 143 ? -2.768  32.787 24.266  1.00 35.05  ? 143  GLU A CD  1 
ATOM   1085 O  OE1 . GLU A 1 143 ? -1.533  32.648 24.067  1.00 40.43  ? 143  GLU A OE1 1 
ATOM   1086 O  OE2 . GLU A 1 143 ? -3.280  33.862 24.708  1.00 35.63  ? 143  GLU A OE2 1 
ATOM   1087 N  N   . MET A 1 144 ? -2.840  30.667 19.877  1.00 27.70  ? 144  MET A N   1 
ATOM   1088 C  CA  . MET A 1 144 ? -2.565  31.361 18.646  1.00 29.14  ? 144  MET A CA  1 
ATOM   1089 C  C   . MET A 1 144 ? -3.605  31.058 17.566  1.00 28.83  ? 144  MET A C   1 
ATOM   1090 O  O   . MET A 1 144 ? -3.861  31.882 16.739  1.00 27.57  ? 144  MET A O   1 
ATOM   1091 C  CB  . MET A 1 144 ? -1.158  31.062 18.174  1.00 28.82  ? 144  MET A CB  1 
ATOM   1092 C  CG  . MET A 1 144 ? -0.083  31.754 18.997  1.00 32.15  ? 144  MET A CG  1 
ATOM   1093 S  SD  . MET A 1 144 ? 1.526   30.932 18.772  1.00 32.83  ? 144  MET A SD  1 
ATOM   1094 C  CE  . MET A 1 144 ? 2.024   31.739 17.274  1.00 29.03  ? 144  MET A CE  1 
ATOM   1095 N  N   . ASN A 1 145 ? -4.225  29.874 17.638  1.00 29.11  ? 145  ASN A N   1 
ATOM   1096 C  CA  . ASN A 1 145 ? -5.299  29.473 16.716  1.00 29.44  ? 145  ASN A CA  1 
ATOM   1097 C  C   . ASN A 1 145 ? -6.737  29.909 17.121  1.00 29.15  ? 145  ASN A C   1 
ATOM   1098 O  O   . ASN A 1 145 ? -7.721  29.602 16.418  1.00 27.95  ? 145  ASN A O   1 
ATOM   1099 C  CB  . ASN A 1 145 ? -5.276  27.959 16.560  1.00 28.26  ? 145  ASN A CB  1 
ATOM   1100 C  CG  . ASN A 1 145 ? -4.117  27.488 15.757  1.00 29.55  ? 145  ASN A CG  1 
ATOM   1101 O  OD1 . ASN A 1 145 ? -3.672  28.176 14.829  1.00 31.81  ? 145  ASN A OD1 1 
ATOM   1102 N  ND2 . ASN A 1 145 ? -3.630  26.283 16.071  1.00 28.13  ? 145  ASN A ND2 1 
ATOM   1103 N  N   . THR A 1 146 ? -6.827  30.551 18.282  1.00 29.17  ? 146  THR A N   1 
ATOM   1104 C  CA  . THR A 1 146 ? -8.091  31.008 18.861  1.00 30.36  ? 146  THR A CA  1 
ATOM   1105 C  C   . THR A 1 146 ? -8.202  32.529 18.980  1.00 30.81  ? 146  THR A C   1 
ATOM   1106 O  O   . THR A 1 146 ? -9.281  33.055 18.806  1.00 31.06  ? 146  THR A O   1 
ATOM   1107 C  CB  . THR A 1 146 ? -8.294  30.351 20.265  1.00 29.99  ? 146  THR A CB  1 
ATOM   1108 O  OG1 . THR A 1 146 ? -8.068  28.949 20.150  1.00 29.56  ? 146  THR A OG1 1 
ATOM   1109 C  CG2 . THR A 1 146 ? -9.697  30.620 20.910  1.00 28.40  ? 146  THR A CG2 1 
ATOM   1110 N  N   . TYR A 1 147 ? -7.117  33.223 19.324  1.00 32.17  ? 147  TYR A N   1 
ATOM   1111 C  CA  . TYR A 1 147 ? -7.169  34.640 19.734  1.00 32.96  ? 147  TYR A CA  1 
ATOM   1112 C  C   . TYR A 1 147 ? -6.225  35.468 18.869  1.00 34.38  ? 147  TYR A C   1 
ATOM   1113 O  O   . TYR A 1 147 ? -5.096  35.072 18.594  1.00 34.37  ? 147  TYR A O   1 
ATOM   1114 C  CB  . TYR A 1 147 ? -6.804  34.822 21.230  1.00 33.29  ? 147  TYR A CB  1 
ATOM   1115 C  CG  . TYR A 1 147 ? -7.675  34.052 22.190  1.00 33.28  ? 147  TYR A CG  1 
ATOM   1116 C  CD1 . TYR A 1 147 ? -7.194  32.929 22.882  1.00 33.00  ? 147  TYR A CD1 1 
ATOM   1117 C  CD2 . TYR A 1 147 ? -8.990  34.448 22.415  1.00 33.64  ? 147  TYR A CD2 1 
ATOM   1118 C  CE1 . TYR A 1 147 ? -8.031  32.201 23.760  1.00 32.89  ? 147  TYR A CE1 1 
ATOM   1119 C  CE2 . TYR A 1 147 ? -9.835  33.746 23.301  1.00 34.30  ? 147  TYR A CE2 1 
ATOM   1120 C  CZ  . TYR A 1 147 ? -9.354  32.626 23.955  1.00 35.47  ? 147  TYR A CZ  1 
ATOM   1121 O  OH  . TYR A 1 147 ? -10.220 31.984 24.805  1.00 36.29  ? 147  TYR A OH  1 
ATOM   1122 N  N   . ASN A 1 148 ? -6.706  36.624 18.449  1.00 35.81  ? 148  ASN A N   1 
ATOM   1123 C  CA  . ASN A 1 148 ? -5.921  37.538 17.627  1.00 37.71  ? 148  ASN A CA  1 
ATOM   1124 C  C   . ASN A 1 148 ? -4.795  38.162 18.455  1.00 37.94  ? 148  ASN A C   1 
ATOM   1125 O  O   . ASN A 1 148 ? -4.839  38.097 19.690  1.00 37.52  ? 148  ASN A O   1 
ATOM   1126 C  CB  . ASN A 1 148 ? -6.846  38.599 16.970  1.00 37.42  ? 148  ASN A CB  1 
ATOM   1127 C  CG  . ASN A 1 148 ? -7.541  39.531 17.986  1.00 38.83  ? 148  ASN A CG  1 
ATOM   1128 O  OD1 . ASN A 1 148 ? -6.873  40.219 18.770  1.00 39.96  ? 148  ASN A OD1 1 
ATOM   1129 N  ND2 . ASN A 1 148 ? -8.891  39.591 17.937  1.00 39.27  ? 148  ASN A ND2 1 
ATOM   1130 N  N   . PRO A 1 149 ? -3.786  38.752 17.787  1.00 39.22  ? 149  PRO A N   1 
ATOM   1131 C  CA  . PRO A 1 149 ? -2.584  39.275 18.468  1.00 39.62  ? 149  PRO A CA  1 
ATOM   1132 C  C   . PRO A 1 149 ? -2.792  40.220 19.639  1.00 40.17  ? 149  PRO A C   1 
ATOM   1133 O  O   . PRO A 1 149 ? -2.118  40.097 20.642  1.00 38.83  ? 149  PRO A O   1 
ATOM   1134 C  CB  . PRO A 1 149 ? -1.828  39.982 17.354  1.00 39.84  ? 149  PRO A CB  1 
ATOM   1135 C  CG  . PRO A 1 149 ? -2.267  39.233 16.081  1.00 40.65  ? 149  PRO A CG  1 
ATOM   1136 C  CD  . PRO A 1 149 ? -3.702  38.937 16.317  1.00 40.01  ? 149  PRO A CD  1 
ATOM   1137 N  N   . THR A 1 150 ? -3.697  41.171 19.476  1.00 42.13  ? 150  THR A N   1 
ATOM   1138 C  CA  . THR A 1 150 ? -4.064  42.088 20.544  1.00 43.37  ? 150  THR A CA  1 
ATOM   1139 C  C   . THR A 1 150 ? -4.631  41.320 21.757  1.00 43.87  ? 150  THR A C   1 
ATOM   1140 O  O   . THR A 1 150 ? -4.180  41.514 22.877  1.00 43.98  ? 150  THR A O   1 
ATOM   1141 C  CB  . THR A 1 150 ? -5.080  43.129 20.026  1.00 43.07  ? 150  THR A CB  1 
ATOM   1142 O  OG1 . THR A 1 150 ? -4.527  43.759 18.866  1.00 44.66  ? 150  THR A OG1 1 
ATOM   1143 C  CG2 . THR A 1 150 ? -5.409  44.184 21.085  1.00 43.88  ? 150  THR A CG2 1 
ATOM   1144 N  N   . ILE A 1 151 ? -5.613  40.449 21.532  1.00 43.81  ? 151  ILE A N   1 
ATOM   1145 C  CA  . ILE A 1 151 ? -6.207  39.702 22.640  1.00 44.77  ? 151  ILE A CA  1 
ATOM   1146 C  C   . ILE A 1 151 ? -5.140  38.870 23.365  1.00 44.82  ? 151  ILE A C   1 
ATOM   1147 O  O   . ILE A 1 151 ? -5.228  38.710 24.555  1.00 45.79  ? 151  ILE A O   1 
ATOM   1148 C  CB  . ILE A 1 151 ? -7.420  38.833 22.187  1.00 45.00  ? 151  ILE A CB  1 
ATOM   1149 C  CG1 . ILE A 1 151 ? -8.561  39.766 21.724  1.00 45.30  ? 151  ILE A CG1 1 
ATOM   1150 C  CG2 . ILE A 1 151 ? -7.876  37.866 23.305  1.00 43.02  ? 151  ILE A CG2 1 
ATOM   1151 C  CD1 . ILE A 1 151 ? -9.787  39.039 21.215  1.00 46.12  ? 151  ILE A CD1 1 
ATOM   1152 N  N   . ARG A 1 152 ? -4.091  38.419 22.688  1.00 45.20  ? 152  ARG A N   1 
ATOM   1153 C  CA  . ARG A 1 152 ? -3.067  37.606 23.364  1.00 45.05  ? 152  ARG A CA  1 
ATOM   1154 C  C   . ARG A 1 152 ? -2.203  38.450 24.275  1.00 46.52  ? 152  ARG A C   1 
ATOM   1155 O  O   . ARG A 1 152 ? -1.698  37.948 25.257  1.00 48.37  ? 152  ARG A O   1 
ATOM   1156 C  CB  . ARG A 1 152 ? -2.220  36.791 22.365  1.00 45.10  ? 152  ARG A CB  1 
ATOM   1157 C  CG  . ARG A 1 152 ? -3.062  35.815 21.555  1.00 42.17  ? 152  ARG A CG  1 
ATOM   1158 C  CD  . ARG A 1 152 ? -2.269  34.741 20.812  1.00 44.15  ? 152  ARG A CD  1 
ATOM   1159 N  NE  . ARG A 1 152 ? -1.157  35.249 20.023  1.00 43.74  ? 152  ARG A NE  1 
ATOM   1160 C  CZ  . ARG A 1 152 ? -1.196  35.544 18.724  1.00 45.17  ? 152  ARG A CZ  1 
ATOM   1161 N  NH1 . ARG A 1 152 ? -2.303  35.392 17.995  1.00 45.60  ? 152  ARG A NH1 1 
ATOM   1162 N  NH2 . ARG A 1 152 ? -0.107  36.009 18.136  1.00 45.50  ? 152  ARG A NH2 1 
ATOM   1163 N  N   . ILE A 1 153 ? -1.992  39.714 23.922  1.00 46.22  ? 153  ILE A N   1 
ATOM   1164 C  CA  . ILE A 1 153 ? -1.304  40.658 24.782  1.00 46.80  ? 153  ILE A CA  1 
ATOM   1165 C  C   . ILE A 1 153 ? -2.160  40.913 26.054  1.00 46.79  ? 153  ILE A C   1 
ATOM   1166 O  O   . ILE A 1 153 ? -1.649  40.794 27.170  1.00 46.40  ? 153  ILE A O   1 
ATOM   1167 C  CB  . ILE A 1 153 ? -1.001  42.033 24.007  1.00 47.01  ? 153  ILE A CB  1 
ATOM   1168 C  CG1 . ILE A 1 153 ? 0.006   41.788 22.862  1.00 45.88  ? 153  ILE A CG1 1 
ATOM   1169 C  CG2 . ILE A 1 153 ? -0.525  43.072 24.949  1.00 47.53  ? 153  ILE A CG2 1 
ATOM   1170 C  CD1 . ILE A 1 153 ? 0.006   42.870 21.772  1.00 46.25  ? 153  ILE A CD1 1 
ATOM   1171 N  N   . LEU A 1 154 ? -3.456  41.216 25.870  1.00 45.77  ? 154  LEU A N   1 
ATOM   1172 C  CA  . LEU A 1 154 ? -4.388  41.389 26.994  1.00 46.03  ? 154  LEU A CA  1 
ATOM   1173 C  C   . LEU A 1 154 ? -4.533  40.122 27.891  1.00 46.00  ? 154  LEU A C   1 
ATOM   1174 O  O   . LEU A 1 154 ? -4.756  40.223 29.086  1.00 46.65  ? 154  LEU A O   1 
ATOM   1175 C  CB  . LEU A 1 154 ? -5.772  41.812 26.485  1.00 45.13  ? 154  LEU A CB  1 
ATOM   1176 C  CG  . LEU A 1 154 ? -5.879  43.085 25.630  1.00 44.58  ? 154  LEU A CG  1 
ATOM   1177 C  CD1 . LEU A 1 154 ? -7.334  43.410 25.376  1.00 41.79  ? 154  LEU A CD1 1 
ATOM   1178 C  CD2 . LEU A 1 154 ? -5.177  44.234 26.320  1.00 43.45  ? 154  LEU A CD2 1 
ATOM   1179 N  N   . ARG A 1 155 ? -4.428  38.940 27.311  1.00 46.68  ? 155  ARG A N   1 
ATOM   1180 C  CA  . ARG A 1 155 ? -4.506  37.719 28.107  1.00 46.96  ? 155  ARG A CA  1 
ATOM   1181 C  C   . ARG A 1 155 ? -3.222  37.521 28.909  1.00 47.87  ? 155  ARG A C   1 
ATOM   1182 O  O   . ARG A 1 155 ? -3.243  37.113 30.066  1.00 47.02  ? 155  ARG A O   1 
ATOM   1183 C  CB  . ARG A 1 155 ? -4.747  36.551 27.207  1.00 46.80  ? 155  ARG A CB  1 
ATOM   1184 C  CG  . ARG A 1 155 ? -6.074  36.543 26.594  1.00 44.43  ? 155  ARG A CG  1 
ATOM   1185 C  CD  . ARG A 1 155 ? -6.149  35.357 25.618  1.00 39.79  ? 155  ARG A CD  1 
ATOM   1186 N  NE  . ARG A 1 155 ? -5.889  34.084 26.293  1.00 38.41  ? 155  ARG A NE  1 
ATOM   1187 C  CZ  . ARG A 1 155 ? -6.799  33.298 26.872  1.00 36.28  ? 155  ARG A CZ  1 
ATOM   1188 N  NH1 . ARG A 1 155 ? -8.097  33.623 26.948  1.00 32.80  ? 155  ARG A NH1 1 
ATOM   1189 N  NH2 . ARG A 1 155 ? -6.387  32.162 27.409  1.00 37.40  ? 155  ARG A NH2 1 
ATOM   1190 N  N   . LEU A 1 156 ? -2.095  37.818 28.281  1.00 49.99  ? 156  LEU A N   1 
ATOM   1191 C  CA  . LEU A 1 156 ? -0.822  37.813 28.981  1.00 51.27  ? 156  LEU A CA  1 
ATOM   1192 C  C   . LEU A 1 156 ? -0.892  38.658 30.272  1.00 52.38  ? 156  LEU A C   1 
ATOM   1193 O  O   . LEU A 1 156 ? -0.569  38.177 31.381  1.00 52.58  ? 156  LEU A O   1 
ATOM   1194 C  CB  . LEU A 1 156 ? 0.311   38.264 28.051  1.00 50.85  ? 156  LEU A CB  1 
ATOM   1195 C  CG  . LEU A 1 156 ? 1.758   38.277 28.584  1.00 51.02  ? 156  LEU A CG  1 
ATOM   1196 C  CD1 . LEU A 1 156 ? 2.107   37.123 29.508  1.00 47.84  ? 156  LEU A CD1 1 
ATOM   1197 C  CD2 . LEU A 1 156 ? 2.732   38.361 27.433  1.00 52.38  ? 156  LEU A CD2 1 
ATOM   1198 N  N   . PHE A 1 157 ? -1.347  39.891 30.136  1.00 54.01  ? 157  PHE A N   1 
ATOM   1199 C  CA  . PHE A 1 157 ? -1.415  40.779 31.293  1.00 55.84  ? 157  PHE A CA  1 
ATOM   1200 C  C   . PHE A 1 157 ? -2.405  40.313 32.395  1.00 55.92  ? 157  PHE A C   1 
ATOM   1201 O  O   . PHE A 1 157 ? -2.084  40.390 33.597  1.00 56.40  ? 157  PHE A O   1 
ATOM   1202 C  CB  . PHE A 1 157 ? -1.785  42.192 30.844  1.00 57.94  ? 157  PHE A CB  1 
ATOM   1203 C  CG  . PHE A 1 157 ? -0.681  42.927 30.139  1.00 58.75  ? 157  PHE A CG  1 
ATOM   1204 C  CD1 . PHE A 1 157 ? -0.954  43.642 28.968  1.00 62.68  ? 157  PHE A CD1 1 
ATOM   1205 C  CD2 . PHE A 1 157 ? 0.608   42.944 30.649  1.00 61.14  ? 157  PHE A CD2 1 
ATOM   1206 C  CE1 . PHE A 1 157 ? 0.045   44.387 28.305  1.00 62.72  ? 157  PHE A CE1 1 
ATOM   1207 C  CE2 . PHE A 1 157 ? 1.614   43.679 30.013  1.00 63.68  ? 157  PHE A CE2 1 
ATOM   1208 C  CZ  . PHE A 1 157 ? 1.331   44.403 28.824  1.00 62.78  ? 157  PHE A CZ  1 
ATOM   1209 N  N   . TYR A 1 158 ? -3.584  39.828 31.992  1.00 54.69  ? 158  TYR A N   1 
ATOM   1210 C  CA  . TYR A 1 158 ? -4.580  39.400 32.946  1.00 54.16  ? 158  TYR A CA  1 
ATOM   1211 C  C   . TYR A 1 158 ? -4.110  38.172 33.743  1.00 53.59  ? 158  TYR A C   1 
ATOM   1212 O  O   . TYR A 1 158 ? -4.218  38.113 34.963  1.00 52.64  ? 158  TYR A O   1 
ATOM   1213 C  CB  . TYR A 1 158 ? -5.893  39.099 32.239  1.00 54.34  ? 158  TYR A CB  1 
ATOM   1214 C  CG  . TYR A 1 158 ? -6.872  38.452 33.176  1.00 55.19  ? 158  TYR A CG  1 
ATOM   1215 C  CD1 . TYR A 1 158 ? -7.384  39.175 34.266  1.00 55.54  ? 158  TYR A CD1 1 
ATOM   1216 C  CD2 . TYR A 1 158 ? -7.244  37.126 33.021  1.00 55.22  ? 158  TYR A CD2 1 
ATOM   1217 C  CE1 . TYR A 1 158 ? -8.250  38.607 35.141  1.00 55.62  ? 158  TYR A CE1 1 
ATOM   1218 C  CE2 . TYR A 1 158 ? -8.134  36.547 33.892  1.00 56.32  ? 158  TYR A CE2 1 
ATOM   1219 C  CZ  . TYR A 1 158 ? -8.624  37.294 34.956  1.00 55.72  ? 158  TYR A CZ  1 
ATOM   1220 O  OH  . TYR A 1 158 ? -9.508  36.739 35.845  1.00 56.56  ? 158  TYR A OH  1 
ATOM   1221 N  N   . GLU A 1 159 ? -3.566  37.197 33.030  1.00 53.49  ? 159  GLU A N   1 
ATOM   1222 C  CA  . GLU A 1 159 ? -3.069  35.981 33.648  1.00 53.51  ? 159  GLU A CA  1 
ATOM   1223 C  C   . GLU A 1 159 ? -1.935  36.284 34.644  1.00 53.08  ? 159  GLU A C   1 
ATOM   1224 O  O   . GLU A 1 159 ? -1.834  35.663 35.729  1.00 52.07  ? 159  GLU A O   1 
ATOM   1225 C  CB  . GLU A 1 159 ? -2.604  35.023 32.563  1.00 53.29  ? 159  GLU A CB  1 
ATOM   1226 C  CG  . GLU A 1 159 ? -3.747  34.575 31.640  1.00 54.36  ? 159  GLU A CG  1 
ATOM   1227 C  CD  . GLU A 1 159 ? -3.274  33.821 30.384  1.00 55.58  ? 159  GLU A CD  1 
ATOM   1228 O  OE1 . GLU A 1 159 ? -2.054  33.822 30.084  1.00 58.66  ? 159  GLU A OE1 1 
ATOM   1229 O  OE2 . GLU A 1 159 ? -4.138  33.204 29.709  1.00 60.41  ? 159  GLU A OE2 1 
ATOM   1230 N  N   . LEU A 1 160 ? -1.101  37.248 34.264  1.00 52.29  ? 160  LEU A N   1 
ATOM   1231 C  CA  . LEU A 1 160 ? 0.078   37.637 35.037  1.00 52.36  ? 160  LEU A CA  1 
ATOM   1232 C  C   . LEU A 1 160 ? -0.340  38.271 36.332  1.00 52.26  ? 160  LEU A C   1 
ATOM   1233 O  O   . LEU A 1 160 ? 0.256   37.988 37.357  1.00 52.46  ? 160  LEU A O   1 
ATOM   1234 C  CB  . LEU A 1 160 ? 0.943   38.634 34.242  1.00 51.80  ? 160  LEU A CB  1 
ATOM   1235 C  CG  . LEU A 1 160 ? 2.452   38.392 34.205  1.00 53.19  ? 160  LEU A CG  1 
ATOM   1236 C  CD1 . LEU A 1 160 ? 2.850   36.890 34.435  1.00 49.79  ? 160  LEU A CD1 1 
ATOM   1237 C  CD2 . LEU A 1 160 ? 2.975   38.921 32.871  1.00 52.03  ? 160  LEU A CD2 1 
ATOM   1238 N  N   . CYS A 1 161 ? -1.352  39.141 36.253  1.00 52.29  ? 161  CYS A N   1 
ATOM   1239 C  CA  . CYS A 1 161 ? -1.939  39.821 37.409  1.00 52.51  ? 161  CYS A CA  1 
ATOM   1240 C  C   . CYS A 1 161 ? -2.587  38.874 38.420  1.00 53.44  ? 161  CYS A C   1 
ATOM   1241 O  O   . CYS A 1 161 ? -2.334  38.962 39.616  1.00 52.54  ? 161  CYS A O   1 
ATOM   1242 C  CB  . CYS A 1 161 ? -2.976  40.845 36.921  1.00 52.67  ? 161  CYS A CB  1 
ATOM   1243 S  SG  . CYS A 1 161 ? -3.389  42.139 38.122  1.00 51.66  ? 161  CYS A SG  1 
ATOM   1244 N  N   . SER A 1 162 ? -3.412  37.947 37.942  1.00 54.91  ? 162  SER A N   1 
ATOM   1245 C  CA  . SER A 1 162 ? -4.159  37.084 38.861  1.00 56.05  ? 162  SER A CA  1 
ATOM   1246 C  C   . SER A 1 162 ? -3.360  35.906 39.423  1.00 56.48  ? 162  SER A C   1 
ATOM   1247 O  O   . SER A 1 162 ? -3.854  35.206 40.304  1.00 56.77  ? 162  SER A O   1 
ATOM   1248 C  CB  . SER A 1 162 ? -5.482  36.622 38.239  1.00 56.32  ? 162  SER A CB  1 
ATOM   1249 O  OG  . SER A 1 162 ? -5.307  36.179 36.915  1.00 54.77  ? 162  SER A OG  1 
ATOM   1250 N  N   . SER A 1 163 ? -2.134  35.706 38.947  1.00 57.22  ? 163  SER A N   1 
ATOM   1251 C  CA  . SER A 1 163 ? -1.199  34.731 39.544  1.00 58.03  ? 163  SER A CA  1 
ATOM   1252 C  C   . SER A 1 163 ? -0.119  35.385 40.428  1.00 58.47  ? 163  SER A C   1 
ATOM   1253 O  O   . SER A 1 163 ? 0.271   34.810 41.452  1.00 58.13  ? 163  SER A O   1 
ATOM   1254 C  CB  . SER A 1 163 ? -0.503  33.899 38.452  1.00 58.21  ? 163  SER A CB  1 
ATOM   1255 O  OG  . SER A 1 163 ? 0.381   34.697 37.653  1.00 59.63  ? 163  SER A OG  1 
ATOM   1256 N  N   . GLN A 1 164 ? 0.361   36.566 40.006  1.00 59.20  ? 164  GLN A N   1 
ATOM   1257 C  CA  . GLN A 1 164 ? 1.539   37.246 40.590  1.00 59.67  ? 164  GLN A CA  1 
ATOM   1258 C  C   . GLN A 1 164 ? 1.236   38.651 41.148  1.00 59.88  ? 164  GLN A C   1 
ATOM   1259 O  O   . GLN A 1 164 ? 1.996   39.172 41.971  1.00 59.84  ? 164  GLN A O   1 
ATOM   1260 C  CB  . GLN A 1 164 ? 2.685   37.337 39.551  1.00 59.82  ? 164  GLN A CB  1 
ATOM   1261 C  CG  . GLN A 1 164 ? 3.349   35.988 39.214  1.00 60.80  ? 164  GLN A CG  1 
ATOM   1262 C  CD  . GLN A 1 164 ? 4.535   36.098 38.235  1.00 61.04  ? 164  GLN A CD  1 
ATOM   1263 O  OE1 . GLN A 1 164 ? 4.545   35.459 37.176  1.00 61.48  ? 164  GLN A OE1 1 
ATOM   1264 N  NE2 . GLN A 1 164 ? 5.542   36.895 38.601  1.00 63.20  ? 164  GLN A NE2 1 
ATOM   1265 N  N   . GLY A 1 165 ? 0.136   39.260 40.707  1.00 60.06  ? 165  GLY A N   1 
ATOM   1266 C  CA  . GLY A 1 165 ? -0.229  40.603 41.142  1.00 59.85  ? 165  GLY A CA  1 
ATOM   1267 C  C   . GLY A 1 165 ? -0.609  40.657 42.611  1.00 59.84  ? 165  GLY A C   1 
ATOM   1268 O  O   . GLY A 1 165 ? -1.490  39.912 43.062  1.00 59.79  ? 165  GLY A O   1 
ATOM   1269 N  N   . LYS A 1 166 ? 0.082   41.523 43.354  1.00 59.63  ? 166  LYS A N   1 
ATOM   1270 C  CA  . LYS A 1 166 ? -0.220  41.773 44.768  1.00 59.57  ? 166  LYS A CA  1 
ATOM   1271 C  C   . LYS A 1 166 ? -1.197  42.948 44.854  1.00 59.39  ? 166  LYS A C   1 
ATOM   1272 O  O   . LYS A 1 166 ? -0.979  44.021 44.273  1.00 58.82  ? 166  LYS A O   1 
ATOM   1273 C  CB  . LYS A 1 166 ? 1.043   42.071 45.596  1.00 59.52  ? 166  LYS A CB  1 
ATOM   1274 C  CG  . LYS A 1 166 ? 2.218   41.115 45.384  1.00 59.59  ? 166  LYS A CG  1 
ATOM   1275 C  CD  . LYS A 1 166 ? 1.865   39.643 45.645  1.00 59.83  ? 166  LYS A CD  1 
ATOM   1276 C  CE  . LYS A 1 166 ? 2.919   38.696 45.045  1.00 59.86  ? 166  LYS A CE  1 
ATOM   1277 N  NZ  . LYS A 1 166 ? 2.316   37.504 44.370  1.00 59.21  ? 166  LYS A NZ  1 
ATOM   1278 N  N   . ARG A 1 167 ? -2.288  42.707 45.567  1.00 59.40  ? 167  ARG A N   1 
ATOM   1279 C  CA  . ARG A 1 167 ? -3.346  43.686 45.752  1.00 59.50  ? 167  ARG A CA  1 
ATOM   1280 C  C   . ARG A 1 167 ? -2.828  44.824 46.650  1.00 59.09  ? 167  ARG A C   1 
ATOM   1281 O  O   . ARG A 1 167 ? -2.811  44.697 47.878  1.00 58.72  ? 167  ARG A O   1 
ATOM   1282 C  CB  . ARG A 1 167 ? -4.569  42.975 46.365  1.00 59.81  ? 167  ARG A CB  1 
ATOM   1283 C  CG  . ARG A 1 167 ? -5.721  43.874 46.811  1.00 61.08  ? 167  ARG A CG  1 
ATOM   1284 C  CD  . ARG A 1 167 ? -6.637  44.247 45.657  1.00 62.42  ? 167  ARG A CD  1 
ATOM   1285 N  NE  . ARG A 1 167 ? -7.504  45.358 46.046  1.00 62.59  ? 167  ARG A NE  1 
ATOM   1286 C  CZ  . ARG A 1 167 ? -8.558  45.260 46.860  1.00 63.16  ? 167  ARG A CZ  1 
ATOM   1287 N  NH1 . ARG A 1 167 ? -8.917  44.091 47.383  1.00 63.65  ? 167  ARG A NH1 1 
ATOM   1288 N  NH2 . ARG A 1 167 ? -9.268  46.345 47.154  1.00 62.63  ? 167  ARG A NH2 1 
ATOM   1289 N  N   . VAL A 1 168 ? -2.387  45.918 46.024  1.00 58.68  ? 168  VAL A N   1 
ATOM   1290 C  CA  . VAL A 1 168 ? -1.883  47.098 46.749  1.00 58.26  ? 168  VAL A CA  1 
ATOM   1291 C  C   . VAL A 1 168 ? -2.831  48.286 46.554  1.00 57.83  ? 168  VAL A C   1 
ATOM   1292 O  O   . VAL A 1 168 ? -2.853  48.914 45.494  1.00 57.72  ? 168  VAL A O   1 
ATOM   1293 C  CB  . VAL A 1 168 ? -0.458  47.491 46.277  1.00 58.35  ? 168  VAL A CB  1 
ATOM   1294 C  CG1 . VAL A 1 168 ? 0.194   48.460 47.257  1.00 58.10  ? 168  VAL A CG1 1 
ATOM   1295 C  CG2 . VAL A 1 168 ? 0.407   46.239 46.091  1.00 58.68  ? 168  VAL A CG2 1 
ATOM   1296 N  N   . GLY A 1 169 ? -3.621  48.587 47.582  1.00 57.34  ? 169  GLY A N   1 
ATOM   1297 C  CA  . GLY A 1 169 ? -4.583  49.675 47.509  1.00 57.00  ? 169  GLY A CA  1 
ATOM   1298 C  C   . GLY A 1 169 ? -5.648  49.480 46.443  1.00 56.69  ? 169  GLY A C   1 
ATOM   1299 O  O   . GLY A 1 169 ? -6.219  48.401 46.313  1.00 56.27  ? 169  GLY A O   1 
ATOM   1300 N  N   . ASP A 1 170 ? -5.914  50.541 45.687  1.00 56.62  ? 170  ASP A N   1 
ATOM   1301 C  CA  . ASP A 1 170 ? -6.955  50.543 44.656  1.00 56.50  ? 170  ASP A CA  1 
ATOM   1302 C  C   . ASP A 1 170 ? -6.496  49.790 43.400  1.00 56.44  ? 170  ASP A C   1 
ATOM   1303 O  O   . ASP A 1 170 ? -7.319  49.249 42.651  1.00 56.70  ? 170  ASP A O   1 
ATOM   1304 C  CB  . ASP A 1 170 ? -7.359  52.005 44.327  1.00 56.43  ? 170  ASP A CB  1 
ATOM   1305 C  CG  . ASP A 1 170 ? -8.728  52.115 43.639  1.00 55.93  ? 170  ASP A CG  1 
ATOM   1306 O  OD1 . ASP A 1 170 ? -8.994  51.325 42.698  1.00 56.63  ? 170  ASP A OD1 1 
ATOM   1307 O  OD2 . ASP A 1 170 ? -9.526  52.999 44.028  1.00 50.44  ? 170  ASP A OD2 1 
ATOM   1308 N  N   . THR A 1 171 ? -5.180  49.724 43.193  1.00 56.35  ? 171  THR A N   1 
ATOM   1309 C  CA  . THR A 1 171 ? -4.605  49.136 41.972  1.00 55.78  ? 171  THR A CA  1 
ATOM   1310 C  C   . THR A 1 171 ? -4.111  47.695 42.180  1.00 55.86  ? 171  THR A C   1 
ATOM   1311 O  O   . THR A 1 171 ? -4.318  47.097 43.244  1.00 55.72  ? 171  THR A O   1 
ATOM   1312 C  CB  . THR A 1 171 ? -3.421  49.994 41.455  1.00 55.57  ? 171  THR A CB  1 
ATOM   1313 O  OG1 . THR A 1 171 ? -1.830  49.678 42.192  1.00 56.14  ? 171  THR A OG1 1 
ATOM   1314 C  CG2 . THR A 1 171 ? -3.668  51.807 41.792  1.00 55.24  ? 171  THR A CG2 1 
ATOM   1315 N  N   . TYR A 1 172 ? -3.471  47.146 41.141  1.00 55.53  ? 172  TYR A N   1 
ATOM   1316 C  CA  . TYR A 1 172 ? -2.831  45.837 41.194  1.00 55.66  ? 172  TYR A CA  1 
ATOM   1317 C  C   . TYR A 1 172 ? -1.402  45.934 40.648  1.00 55.12  ? 172  TYR A C   1 
ATOM   1318 O  O   . TYR A 1 172 ? -1.204  46.338 39.508  1.00 54.36  ? 172  TYR A O   1 
ATOM   1319 C  CB  . TYR A 1 172 ? -3.632  44.821 40.362  1.00 56.35  ? 172  TYR A CB  1 
ATOM   1320 C  CG  . TYR A 1 172 ? -4.510  43.899 41.182  1.00 57.03  ? 172  TYR A CG  1 
ATOM   1321 C  CD1 . TYR A 1 172 ? -5.832  44.236 41.477  1.00 57.25  ? 172  TYR A CD1 1 
ATOM   1322 C  CD2 . TYR A 1 172 ? -4.010  42.689 41.670  1.00 57.75  ? 172  TYR A CD2 1 
ATOM   1323 C  CE1 . TYR A 1 172 ? -6.634  43.390 42.239  1.00 57.33  ? 172  TYR A CE1 1 
ATOM   1324 C  CE2 . TYR A 1 172 ? -4.797  41.842 42.435  1.00 57.62  ? 172  TYR A CE2 1 
ATOM   1325 C  CZ  . TYR A 1 172 ? -6.105  42.190 42.714  1.00 57.11  ? 172  TYR A CZ  1 
ATOM   1326 O  OH  . TYR A 1 172 ? -6.872  41.330 43.466  1.00 57.45  ? 172  TYR A OH  1 
ATOM   1327 N  N   . GLU A 1 173 ? -0.421  45.540 41.457  1.00 54.97  ? 173  GLU A N   1 
ATOM   1328 C  CA  . GLU A 1 173 ? 0.996   45.724 41.123  1.00 54.97  ? 173  GLU A CA  1 
ATOM   1329 C  C   . GLU A 1 173 ? 1.713   44.386 40.935  1.00 54.88  ? 173  GLU A C   1 
ATOM   1330 O  O   . GLU A 1 173 ? 1.710   43.544 41.833  1.00 55.03  ? 173  GLU A O   1 
ATOM   1331 C  CB  . GLU A 1 173 ? 1.689   46.534 42.220  1.00 54.74  ? 173  GLU A CB  1 
ATOM   1332 C  CG  . GLU A 1 173 ? 1.066   47.929 42.424  1.00 55.19  ? 173  GLU A CG  1 
ATOM   1333 C  CD  . GLU A 1 173 ? 1.684   48.699 43.575  1.00 54.97  ? 173  GLU A CD  1 
ATOM   1334 O  OE1 . GLU A 1 173 ? 2.786   48.316 44.023  1.00 54.12  ? 173  GLU A OE1 1 
ATOM   1335 O  OE2 . GLU A 1 173 ? 1.068   49.690 44.032  1.00 56.22  ? 173  GLU A OE2 1 
ATOM   1336 N  N   . ILE A 1 174 ? 2.320   44.203 39.764  1.00 54.86  ? 174  ILE A N   1 
ATOM   1337 C  CA  . ILE A 1 174 ? 3.078   42.994 39.443  1.00 54.92  ? 174  ILE A CA  1 
ATOM   1338 C  C   . ILE A 1 174 ? 4.556   43.378 39.383  1.00 55.27  ? 174  ILE A C   1 
ATOM   1339 O  O   . ILE A 1 174 ? 4.970   44.142 38.510  1.00 55.34  ? 174  ILE A O   1 
ATOM   1340 C  CB  . ILE A 1 174 ? 2.640   42.348 38.069  1.00 54.84  ? 174  ILE A CB  1 
ATOM   1341 C  CG1 . ILE A 1 174 ? 1.113   42.395 37.887  1.00 54.81  ? 174  ILE A CG1 1 
ATOM   1342 C  CG2 . ILE A 1 174 ? 3.161   40.923 37.982  1.00 54.00  ? 174  ILE A CG2 1 
ATOM   1343 C  CD1 . ILE A 1 174 ? 0.646   42.508 36.413  1.00 54.18  ? 174  ILE A CD1 1 
ATOM   1344 N  N   . THR A 1 175 ? 5.348   42.865 40.318  1.00 55.90  ? 175  THR A N   1 
ATOM   1345 C  CA  . THR A 1 175 ? 6.767   43.228 40.392  1.00 56.30  ? 175  THR A CA  1 
ATOM   1346 C  C   . THR A 1 175 ? 7.593   42.284 39.485  1.00 56.78  ? 175  THR A C   1 
ATOM   1347 O  O   . THR A 1 175 ? 7.887   41.146 39.866  1.00 57.20  ? 175  THR A O   1 
ATOM   1348 C  CB  . THR A 1 175 ? 7.290   43.326 41.888  1.00 56.11  ? 175  THR A CB  1 
ATOM   1349 O  OG1 . THR A 1 175 ? 8.708   43.150 41.925  1.00 55.51  ? 175  THR A OG1 1 
ATOM   1350 C  CG2 . THR A 1 175 ? 6.623   42.311 42.831  1.00 55.73  ? 175  THR A CG2 1 
ATOM   1351 N  N   . MET A 1 176 ? 7.910   42.755 38.268  1.00 56.90  ? 176  MET A N   1 
ATOM   1352 C  CA  . MET A 1 176 ? 8.791   42.035 37.331  1.00 56.93  ? 176  MET A CA  1 
ATOM   1353 C  C   . MET A 1 176 ? 9.267   42.921 36.167  1.00 56.42  ? 176  MET A C   1 
ATOM   1354 O  O   . MET A 1 176 ? 8.542   43.849 35.765  1.00 56.25  ? 176  MET A O   1 
ATOM   1355 C  CB  . MET A 1 176 ? 8.100   40.780 36.758  1.00 57.26  ? 176  MET A CB  1 
ATOM   1356 C  CG  . MET A 1 176 ? 6.683   40.998 36.252  1.00 57.40  ? 176  MET A CG  1 
ATOM   1357 S  SD  . MET A 1 176 ? 6.130   39.821 35.011  1.00 60.03  ? 176  MET A SD  1 
ATOM   1358 C  CE  . MET A 1 176 ? 6.966   38.282 35.461  1.00 59.58  ? 176  MET A CE  1 
ATOM   1359 N  N   . PRO A 1 177 ? 10.481  42.635 35.622  1.00 55.89  ? 177  PRO A N   1 
ATOM   1360 C  CA  . PRO A 1 177 ? 10.946  43.243 34.359  1.00 55.50  ? 177  PRO A CA  1 
ATOM   1361 C  C   . PRO A 1 177 ? 10.419  42.505 33.111  1.00 55.10  ? 177  PRO A C   1 
ATOM   1362 O  O   . PRO A 1 177 ? 10.905  41.425 32.755  1.00 54.80  ? 177  PRO A O   1 
ATOM   1363 C  CB  . PRO A 1 177 ? 12.480  43.161 34.454  1.00 55.51  ? 177  PRO A CB  1 
ATOM   1364 C  CG  . PRO A 1 177 ? 12.783  42.132 35.514  1.00 55.69  ? 177  PRO A CG  1 
ATOM   1365 C  CD  . PRO A 1 177 ? 11.494  41.720 36.186  1.00 55.85  ? 177  PRO A CD  1 
ATOM   1366 N  N   . LEU A 1 178 ? 9.410   43.092 32.470  1.00 53.99  ? 178  LEU A N   1 
ATOM   1367 C  CA  . LEU A 1 178 ? 8.826   42.544 31.248  1.00 53.11  ? 178  LEU A CA  1 
ATOM   1368 C  C   . LEU A 1 178 ? 8.914   43.657 30.209  1.00 52.33  ? 178  LEU A C   1 
ATOM   1369 O  O   . LEU A 1 178 ? 8.131   44.610 30.232  1.00 52.55  ? 178  LEU A O   1 
ATOM   1370 C  CB  . LEU A 1 178 ? 7.367   42.110 31.473  1.00 52.68  ? 178  LEU A CB  1 
ATOM   1371 C  CG  . LEU A 1 178 ? 6.648   41.376 30.312  1.00 53.14  ? 178  LEU A CG  1 
ATOM   1372 C  CD1 . LEU A 1 178 ? 6.803   39.873 30.406  1.00 50.92  ? 178  LEU A CD1 1 
ATOM   1373 C  CD2 . LEU A 1 178 ? 5.147   41.753 30.262  1.00 52.99  ? 178  LEU A CD2 1 
ATOM   1374 N  N   . SER A 1 179 ? 9.883   43.542 29.308  1.00 51.87  ? 179  SER A N   1 
ATOM   1375 C  CA  . SER A 1 179 ? 10.100  44.554 28.275  1.00 51.31  ? 179  SER A CA  1 
ATOM   1376 C  C   . SER A 1 179 ? 9.088   44.388 27.134  1.00 51.31  ? 179  SER A C   1 
ATOM   1377 O  O   . SER A 1 179 ? 8.527   43.285 26.933  1.00 50.76  ? 179  SER A O   1 
ATOM   1378 C  CB  . SER A 1 179 ? 11.545  44.502 27.766  1.00 51.25  ? 179  SER A CB  1 
ATOM   1379 O  OG  . SER A 1 179 ? 11.744  43.495 26.790  1.00 49.98  ? 179  SER A OG  1 
ATOM   1380 N  N   . GLN A 1 180 ? 8.847   45.481 26.407  1.00 51.22  ? 180  GLN A N   1 
ATOM   1381 C  CA  . GLN A 1 180 ? 8.024   45.475 25.190  1.00 51.33  ? 180  GLN A CA  1 
ATOM   1382 C  C   . GLN A 1 180 ? 8.517   44.461 24.161  1.00 51.62  ? 180  GLN A C   1 
ATOM   1383 O  O   . GLN A 1 180 ? 7.706   43.740 23.586  1.00 51.68  ? 180  GLN A O   1 
ATOM   1384 C  CB  . GLN A 1 180 ? 7.986   46.861 24.529  1.00 51.52  ? 180  GLN A CB  1 
ATOM   1385 C  CG  . GLN A 1 180 ? 7.171   47.884 25.277  1.00 51.25  ? 180  GLN A CG  1 
ATOM   1386 C  CD  . GLN A 1 180 ? 6.795   49.085 24.412  1.00 49.77  ? 180  GLN A CD  1 
ATOM   1387 O  OE1 . GLN A 1 180 ? 5.942   48.985 23.527  1.00 42.24  ? 180  GLN A OE1 1 
ATOM   1388 N  NE2 . GLN A 1 180 ? 7.436   50.226 24.665  1.00 51.92  ? 180  GLN A NE2 1 
ATOM   1389 N  N   . LYS A 1 181 ? 9.836   44.423 23.939  1.00 51.40  ? 181  LYS A N   1 
ATOM   1390 C  CA  . LYS A 1 181 ? 10.465  43.418 23.074  1.00 51.81  ? 181  LYS A CA  1 
ATOM   1391 C  C   . LYS A 1 181 ? 10.043  41.990 23.455  1.00 51.70  ? 181  LYS A C   1 
ATOM   1392 O  O   . LYS A 1 181 ? 9.605   41.207 22.596  1.00 51.63  ? 181  LYS A O   1 
ATOM   1393 C  CB  . LYS A 1 181 ? 12.012  43.518 23.131  1.00 51.64  ? 181  LYS A CB  1 
ATOM   1394 C  CG  . LYS A 1 181 ? 12.760  42.562 22.156  1.00 51.73  ? 181  LYS A CG  1 
ATOM   1395 C  CD  . LYS A 1 181 ? 14.211  42.274 22.581  1.00 51.90  ? 181  LYS A CD  1 
ATOM   1396 C  CE  . LYS A 1 181 ? 14.802  41.122 21.753  1.00 52.40  ? 181  LYS A CE  1 
ATOM   1397 N  NZ  . LYS A 1 181 ? 16.180  40.738 22.148  1.00 51.47  ? 181  LYS A NZ  1 
ATOM   1398 N  N   . SER A 1 182 ? 10.181  41.657 24.734  1.00 51.67  ? 182  SER A N   1 
ATOM   1399 C  CA  . SER A 1 182 ? 9.945   40.292 25.188  1.00 52.46  ? 182  SER A CA  1 
ATOM   1400 C  C   . SER A 1 182 ? 8.441   39.954 25.202  1.00 52.10  ? 182  SER A C   1 
ATOM   1401 O  O   . SER A 1 182 ? 8.058   38.785 24.985  1.00 52.55  ? 182  SER A O   1 
ATOM   1402 C  CB  . SER A 1 182 ? 10.619  40.050 26.557  1.00 52.61  ? 182  SER A CB  1 
ATOM   1403 O  OG  . SER A 1 182 ? 10.037  40.846 27.573  1.00 54.97  ? 182  SER A OG  1 
ATOM   1404 N  N   . ILE A 1 183 ? 7.604   40.965 25.456  1.00 51.64  ? 183  ILE A N   1 
ATOM   1405 C  CA  . ILE A 1 183 ? 6.156   40.840 25.299  1.00 51.84  ? 183  ILE A CA  1 
ATOM   1406 C  C   . ILE A 1 183 ? 5.813   40.392 23.885  1.00 52.29  ? 183  ILE A C   1 
ATOM   1407 O  O   . ILE A 1 183 ? 4.996   39.497 23.714  1.00 51.84  ? 183  ILE A O   1 
ATOM   1408 C  CB  . ILE A 1 183 ? 5.403   42.139 25.609  1.00 51.73  ? 183  ILE A CB  1 
ATOM   1409 C  CG1 . ILE A 1 183 ? 5.424   42.428 27.114  1.00 51.31  ? 183  ILE A CG1 1 
ATOM   1410 C  CG2 . ILE A 1 183 ? 3.919   42.084 25.082  1.00 50.72  ? 183  ILE A CG2 1 
ATOM   1411 C  CD1 . ILE A 1 183 ? 5.035   43.922 27.493  1.00 51.81  ? 183  ILE A CD1 1 
ATOM   1412 N  N   . GLY A 1 184 ? 6.448   41.011 22.886  1.00 51.80  ? 184  GLY A N   1 
ATOM   1413 C  CA  . GLY A 1 184 ? 6.345   40.577 21.482  1.00 51.89  ? 184  GLY A CA  1 
ATOM   1414 C  C   . GLY A 1 184 ? 6.858   39.166 21.221  1.00 52.33  ? 184  GLY A C   1 
ATOM   1415 O  O   . GLY A 1 184 ? 6.157   38.355 20.604  1.00 51.60  ? 184  GLY A O   1 
ATOM   1416 N  N   . GLU A 1 185 ? 8.093   38.883 21.644  1.00 52.76  ? 185  GLU A N   1 
ATOM   1417 C  CA  . GLU A 1 185 ? 8.679   37.531 21.491  1.00 53.15  ? 185  GLU A CA  1 
ATOM   1418 C  C   . GLU A 1 185 ? 7.724   36.471 22.036  1.00 52.61  ? 185  GLU A C   1 
ATOM   1419 O  O   . GLU A 1 185 ? 7.549   35.463 21.375  1.00 52.14  ? 185  GLU A O   1 
ATOM   1420 C  CB  . GLU A 1 185 ? 10.035  37.376 22.202  1.00 53.08  ? 185  GLU A CB  1 
ATOM   1421 C  CG  . GLU A 1 185 ? 11.182  38.131 21.556  1.00 54.89  ? 185  GLU A CG  1 
ATOM   1422 C  CD  . GLU A 1 185 ? 12.475  38.137 22.392  1.00 55.21  ? 185  GLU A CD  1 
ATOM   1423 O  OE1 . GLU A 1 185 ? 12.403  38.177 23.661  1.00 56.67  ? 185  GLU A OE1 1 
ATOM   1424 O  OE2 . GLU A 1 185 ? 13.557  38.121 21.759  1.00 55.44  ? 185  GLU A OE2 1 
ATOM   1425 N  N   . ILE A 1 186 ? 7.116   36.705 23.209  1.00 52.18  ? 186  ILE A N   1 
ATOM   1426 C  CA  . ILE A 1 186 ? 6.220   35.726 23.846  1.00 53.23  ? 186  ILE A CA  1 
ATOM   1427 C  C   . ILE A 1 186 ? 4.890   35.580 23.099  1.00 53.35  ? 186  ILE A C   1 
ATOM   1428 O  O   . ILE A 1 186 ? 4.449   34.474 22.823  1.00 54.15  ? 186  ILE A O   1 
ATOM   1429 C  CB  . ILE A 1 186 ? 5.857   36.066 25.326  1.00 53.60  ? 186  ILE A CB  1 
ATOM   1430 C  CG1 . ILE A 1 186 ? 7.114   36.085 26.198  1.00 53.52  ? 186  ILE A CG1 1 
ATOM   1431 C  CG2 . ILE A 1 186 ? 4.802   35.054 25.850  1.00 51.65  ? 186  ILE A CG2 1 
ATOM   1432 C  CD1 . ILE A 1 186 ? 7.046   37.117 27.293  1.00 54.17  ? 186  ILE A CD1 1 
ATOM   1433 N  N   . THR A 1 187 ? 4.264   36.689 22.772  1.00 52.88  ? 187  THR A N   1 
ATOM   1434 C  CA  . THR A 1 187 ? 2.930   36.640 22.174  1.00 53.50  ? 187  THR A CA  1 
ATOM   1435 C  C   . THR A 1 187 ? 2.961   36.370 20.669  1.00 53.59  ? 187  THR A C   1 
ATOM   1436 O  O   . THR A 1 187 ? 1.918   36.126 20.085  1.00 53.44  ? 187  THR A O   1 
ATOM   1437 C  CB  . THR A 1 187 ? 2.182   38.002 22.378  1.00 52.22  ? 187  THR A CB  1 
ATOM   1438 O  OG1 . THR A 1 187 ? 2.926   39.057 21.771  1.00 52.78  ? 187  THR A OG1 1 
ATOM   1439 C  CG2 . THR A 1 187 ? 2.032   38.274 23.859  1.00 52.61  ? 187  THR A CG2 1 
ATOM   1440 N  N   . GLY A 1 188 ? 4.140   36.492 20.043  1.00 53.86  ? 188  GLY A N   1 
ATOM   1441 C  CA  . GLY A 1 188 ? 4.262   36.420 18.608  1.00 54.07  ? 188  GLY A CA  1 
ATOM   1442 C  C   . GLY A 1 188 ? 3.795   37.663 17.883  1.00 54.50  ? 188  GLY A C   1 
ATOM   1443 O  O   . GLY A 1 188 ? 3.496   37.614 16.693  1.00 54.87  ? 188  GLY A O   1 
ATOM   1444 N  N   . VAL A 1 189 ? 3.752   38.784 18.581  1.00 54.83  ? 189  VAL A N   1 
ATOM   1445 C  CA  . VAL A 1 189 ? 3.224   40.024 18.016  1.00 55.63  ? 189  VAL A CA  1 
ATOM   1446 C  C   . VAL A 1 189 ? 4.319   41.013 17.604  1.00 56.22  ? 189  VAL A C   1 
ATOM   1447 O  O   . VAL A 1 189 ? 5.345   41.141 18.279  1.00 56.50  ? 189  VAL A O   1 
ATOM   1448 C  CB  . VAL A 1 189 ? 2.287   40.689 19.021  1.00 55.21  ? 189  VAL A CB  1 
ATOM   1449 C  CG1 . VAL A 1 189 ? 1.635   41.914 18.427  1.00 55.05  ? 189  VAL A CG1 1 
ATOM   1450 C  CG2 . VAL A 1 189 ? 1.260   39.685 19.463  1.00 54.60  ? 189  VAL A CG2 1 
ATOM   1451 N  N   . HIS A 1 190 ? 4.083   41.709 16.494  1.00 56.99  ? 190  HIS A N   1 
ATOM   1452 C  CA  . HIS A 1 190 ? 5.049   42.664 15.943  1.00 57.79  ? 190  HIS A CA  1 
ATOM   1453 C  C   . HIS A 1 190 ? 5.172   43.852 16.885  1.00 57.25  ? 190  HIS A C   1 
ATOM   1454 O  O   . HIS A 1 190 ? 4.250   44.101 17.671  1.00 57.05  ? 190  HIS A O   1 
ATOM   1455 C  CB  . HIS A 1 190 ? 4.612   43.132 14.567  1.00 58.48  ? 190  HIS A CB  1 
ATOM   1456 C  CG  . HIS A 1 190 ? 4.399   42.016 13.595  1.00 61.33  ? 190  HIS A CG  1 
ATOM   1457 N  ND1 . HIS A 1 190 ? 5.358   41.059 13.337  1.00 64.32  ? 190  HIS A ND1 1 
ATOM   1458 C  CD2 . HIS A 1 190 ? 3.341   41.712 12.803  1.00 64.57  ? 190  HIS A CD2 1 
ATOM   1459 C  CE1 . HIS A 1 190 ? 4.897   40.206 12.437  1.00 64.63  ? 190  HIS A CE1 1 
ATOM   1460 N  NE2 . HIS A 1 190 ? 3.676   40.581 12.095  1.00 64.96  ? 190  HIS A NE2 1 
ATOM   1461 N  N   . HIS A 1 191 ? 6.300   44.565 16.826  1.00 56.17  ? 191  HIS A N   1 
ATOM   1462 C  CA  . HIS A 1 191 ? 6.614   45.574 17.839  1.00 55.78  ? 191  HIS A CA  1 
ATOM   1463 C  C   . HIS A 1 191 ? 5.605   46.717 17.798  1.00 55.21  ? 191  HIS A C   1 
ATOM   1464 O  O   . HIS A 1 191 ? 5.242   47.264 18.844  1.00 55.04  ? 191  HIS A O   1 
ATOM   1465 C  CB  . HIS A 1 191 ? 8.058   46.097 17.671  1.00 56.67  ? 191  HIS A CB  1 
ATOM   1466 C  CG  . HIS A 1 191 ? 8.506   47.063 18.736  1.00 56.81  ? 191  HIS A CG  1 
ATOM   1467 N  ND1 . HIS A 1 191 ? 9.451   48.044 18.498  1.00 61.38  ? 191  HIS A ND1 1 
ATOM   1468 C  CD2 . HIS A 1 191 ? 8.144   47.200 20.036  1.00 57.37  ? 191  HIS A CD2 1 
ATOM   1469 C  CE1 . HIS A 1 191 ? 9.647   48.742 19.604  1.00 60.67  ? 191  HIS A CE1 1 
ATOM   1470 N  NE2 . HIS A 1 191 ? 8.873   48.242 20.554  1.00 59.78  ? 191  HIS A NE2 1 
ATOM   1471 N  N   . VAL A 1 192 ? 5.127   47.039 16.594  1.00 54.47  ? 192  VAL A N   1 
ATOM   1472 C  CA  . VAL A 1 192 ? 4.250   48.207 16.380  1.00 53.90  ? 192  VAL A CA  1 
ATOM   1473 C  C   . VAL A 1 192 ? 2.865   47.956 16.997  1.00 53.32  ? 192  VAL A C   1 
ATOM   1474 O  O   . VAL A 1 192 ? 2.285   48.864 17.583  1.00 52.17  ? 192  VAL A O   1 
ATOM   1475 C  CB  . VAL A 1 192 ? 4.181   48.609 14.864  1.00 53.54  ? 192  VAL A CB  1 
ATOM   1476 C  CG1 . VAL A 1 192 ? 2.870   49.322 14.524  1.00 53.37  ? 192  VAL A CG1 1 
ATOM   1477 C  CG2 . VAL A 1 192 ? 5.369   49.489 14.512  1.00 54.77  ? 192  VAL A CG2 1 
ATOM   1478 N  N   . THR A 1 193 ? 2.375   46.720 16.891  1.00 52.83  ? 193  THR A N   1 
ATOM   1479 C  CA  . THR A 1 193 ? 1.111   46.302 17.530  1.00 52.94  ? 193  THR A CA  1 
ATOM   1480 C  C   . THR A 1 193 ? 1.212   46.349 19.056  1.00 52.39  ? 193  THR A C   1 
ATOM   1481 O  O   . THR A 1 193 ? 0.276   46.749 19.760  1.00 52.38  ? 193  THR A O   1 
ATOM   1482 C  CB  . THR A 1 193 ? 0.713   44.852 17.110  1.00 52.77  ? 193  THR A CB  1 
ATOM   1483 O  OG1 . THR A 1 193 ? 0.524   44.786 15.693  1.00 54.72  ? 193  THR A OG1 1 
ATOM   1484 C  CG2 . THR A 1 193 ? -0.571  44.367 17.823  1.00 53.03  ? 193  THR A CG2 1 
ATOM   1485 N  N   . VAL A 1 194 ? 2.349   45.898 19.565  1.00 52.24  ? 194  VAL A N   1 
ATOM   1486 C  CA  . VAL A 1 194 ? 2.579   45.829 20.992  1.00 51.55  ? 194  VAL A CA  1 
ATOM   1487 C  C   . VAL A 1 194 ? 2.629   47.254 21.578  1.00 51.76  ? 194  VAL A C   1 
ATOM   1488 O  O   . VAL A 1 194 ? 2.034   47.495 22.619  1.00 50.68  ? 194  VAL A O   1 
ATOM   1489 C  CB  . VAL A 1 194 ? 3.855   45.005 21.314  1.00 51.35  ? 194  VAL A CB  1 
ATOM   1490 C  CG1 . VAL A 1 194 ? 4.475   45.474 22.627  1.00 51.68  ? 194  VAL A CG1 1 
ATOM   1491 C  CG2 . VAL A 1 194 ? 3.535   43.444 21.311  1.00 49.79  ? 194  VAL A CG2 1 
ATOM   1492 N  N   . SER A 1 195 ? 3.335   48.168 20.911  1.00 51.65  ? 195  SER A N   1 
ATOM   1493 C  CA  . SER A 1 195 ? 3.326   49.615 21.275  1.00 52.86  ? 195  SER A CA  1 
ATOM   1494 C  C   . SER A 1 195 ? 1.942   50.281 21.237  1.00 53.72  ? 195  SER A C   1 
ATOM   1495 O  O   . SER A 1 195 ? 1.556   51.022 22.150  1.00 54.27  ? 195  SER A O   1 
ATOM   1496 C  CB  . SER A 1 195 ? 4.243   50.405 20.336  1.00 52.46  ? 195  SER A CB  1 
ATOM   1497 O  OG  . SER A 1 195 ? 5.595   50.288 20.720  1.00 52.74  ? 195  SER A OG  1 
ATOM   1498 N  N   . ARG A 1 196 ? 1.227   50.028 20.146  1.00 54.98  ? 196  ARG A N   1 
ATOM   1499 C  CA  . ARG A 1 196 ? -0.089  50.618 19.863  1.00 55.55  ? 196  ARG A CA  1 
ATOM   1500 C  C   . ARG A 1 196 ? -1.188  49.992 20.743  1.00 55.55  ? 196  ARG A C   1 
ATOM   1501 O  O   . ARG A 1 196 ? -2.300  50.511 20.807  1.00 56.02  ? 196  ARG A O   1 
ATOM   1502 C  CB  . ARG A 1 196 ? -0.406  50.408 18.371  1.00 55.40  ? 196  ARG A CB  1 
ATOM   1503 C  CG  . ARG A 1 196 ? -1.619  51.138 17.835  1.00 56.80  ? 196  ARG A CG  1 
ATOM   1504 C  CD  . ARG A 1 196 ? -1.631  51.280 16.287  1.00 57.29  ? 196  ARG A CD  1 
ATOM   1505 N  NE  . ARG A 1 196 ? -0.296  51.406 15.674  1.00 58.44  ? 196  ARG A NE  1 
ATOM   1506 C  CZ  . ARG A 1 196 ? 0.001   52.140 14.596  1.00 58.36  ? 196  ARG A CZ  1 
ATOM   1507 N  NH1 . ARG A 1 196 ? -0.917  52.872 13.953  1.00 58.14  ? 196  ARG A NH1 1 
ATOM   1508 N  NH2 . ARG A 1 196 ? 1.256   52.146 14.159  1.00 58.22  ? 196  ARG A NH2 1 
ATOM   1509 N  N   . VAL A 1 197 ? -0.879  48.870 21.394  1.00 55.62  ? 197  VAL A N   1 
ATOM   1510 C  CA  . VAL A 1 197 ? -1.771  48.257 22.397  1.00 55.56  ? 197  VAL A CA  1 
ATOM   1511 C  C   . VAL A 1 197 ? -1.431  48.765 23.789  1.00 55.72  ? 197  VAL A C   1 
ATOM   1512 O  O   . VAL A 1 197 ? -2.318  49.200 24.520  1.00 55.81  ? 197  VAL A O   1 
ATOM   1513 C  CB  . VAL A 1 197 ? -1.723  46.697 22.393  1.00 54.92  ? 197  VAL A CB  1 
ATOM   1514 C  CG1 . VAL A 1 197 ? -2.448  46.136 23.620  1.00 53.73  ? 197  VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A 1 197 ? -2.353  46.157 21.137  1.00 54.92  ? 197  VAL A CG2 1 
ATOM   1516 N  N   . LEU A 1 198 ? -0.150  48.725 24.137  1.00 56.02  ? 198  LEU A N   1 
ATOM   1517 C  CA  . LEU A 1 198 ? 0.310   49.182 25.444  1.00 56.97  ? 198  LEU A CA  1 
ATOM   1518 C  C   . LEU A 1 198 ? 0.031   50.674 25.681  1.00 57.62  ? 198  LEU A C   1 
ATOM   1519 O  O   . LEU A 1 198 ? -0.535  51.027 26.722  1.00 57.78  ? 198  LEU A O   1 
ATOM   1520 C  CB  . LEU A 1 198 ? 1.797   48.864 25.662  1.00 57.13  ? 198  LEU A CB  1 
ATOM   1521 C  CG  . LEU A 1 198 ? 2.164   47.511 26.316  1.00 56.73  ? 198  LEU A CG  1 
ATOM   1522 C  CD1 . LEU A 1 198 ? 1.421   46.265 25.714  1.00 55.88  ? 198  LEU A CD1 1 
ATOM   1523 C  CD2 . LEU A 1 198 ? 3.699   47.288 26.288  1.00 55.94  ? 198  LEU A CD2 1 
ATOM   1524 N  N   . ALA A 1 199 ? 0.400   51.540 24.725  1.00 58.43  ? 199  ALA A N   1 
ATOM   1525 C  CA  . ALA A 1 199 ? 0.142   52.999 24.848  1.00 58.75  ? 199  ALA A CA  1 
ATOM   1526 C  C   . ALA A 1 199 ? -1.360  53.303 24.896  1.00 59.54  ? 199  ALA A C   1 
ATOM   1527 O  O   . ALA A 1 199 ? -1.772  54.359 25.375  1.00 60.38  ? 199  ALA A O   1 
ATOM   1528 C  CB  . ALA A 1 199 ? 0.803   53.779 23.710  1.00 58.82  ? 199  ALA A CB  1 
ATOM   1529 N  N   . CYS A 1 200 ? -2.172  52.376 24.391  1.00 60.69  ? 200  CYS A N   1 
ATOM   1530 C  CA  . CYS A 1 200 ? -3.617  52.442 24.575  1.00 61.06  ? 200  CYS A CA  1 
ATOM   1531 C  C   . CYS A 1 200 ? -4.037  52.154 26.012  1.00 61.11  ? 200  CYS A C   1 
ATOM   1532 O  O   . CYS A 1 200 ? -4.809  52.914 26.607  1.00 61.06  ? 200  CYS A O   1 
ATOM   1533 C  CB  . CYS A 1 200 ? -4.355  51.465 23.664  1.00 61.05  ? 200  CYS A CB  1 
ATOM   1534 S  SG  . CYS A 1 200 ? -6.076  51.975 23.542  1.00 62.19  ? 200  CYS A SG  1 
ATOM   1535 N  N   . LEU A 1 201 ? -3.524  51.065 26.563  1.00 60.91  ? 201  LEU A N   1 
ATOM   1536 C  CA  . LEU A 1 201 ? -3.911  50.612 27.902  1.00 61.43  ? 201  LEU A CA  1 
ATOM   1537 C  C   . LEU A 1 201 ? -3.522  51.604 29.024  1.00 61.49  ? 201  LEU A C   1 
ATOM   1538 O  O   . LEU A 1 201 ? -4.226  51.721 30.038  1.00 61.31  ? 201  LEU A O   1 
ATOM   1539 C  CB  . LEU A 1 201 ? -3.341  49.203 28.156  1.00 61.61  ? 201  LEU A CB  1 
ATOM   1540 C  CG  . LEU A 1 201 ? -3.981  48.083 27.308  1.00 62.55  ? 201  LEU A CG  1 
ATOM   1541 C  CD1 . LEU A 1 201 ? -3.078  46.864 27.112  1.00 60.64  ? 201  LEU A CD1 1 
ATOM   1542 C  CD2 . LEU A 1 201 ? -5.327  47.672 27.908  1.00 63.65  ? 201  LEU A CD2 1 
ATOM   1543 N  N   . LYS A 1 202 ? -2.415  52.325 28.832  1.00 61.61  ? 202  LYS A N   1 
ATOM   1544 C  CA  . LYS A 1 202 ? -2.042  53.446 29.716  1.00 61.82  ? 202  LYS A CA  1 
ATOM   1545 C  C   . LYS A 1 202 ? -2.993  54.637 29.549  1.00 61.75  ? 202  LYS A C   1 
ATOM   1546 O  O   . LYS A 1 202 ? -3.499  55.171 30.537  1.00 61.47  ? 202  LYS A O   1 
ATOM   1547 C  CB  . LYS A 1 202 ? -0.602  53.913 29.431  1.00 62.15  ? 202  LYS A CB  1 
ATOM   1548 C  CG  . LYS A 1 202 ? -0.148  55.156 30.217  1.00 61.63  ? 202  LYS A CG  1 
ATOM   1549 C  CD  . LYS A 1 202 ? 0.996   55.881 29.522  1.00 61.66  ? 202  LYS A CD  1 
ATOM   1550 C  CE  . LYS A 1 202 ? 1.778   56.734 30.507  1.00 60.94  ? 202  LYS A CE  1 
ATOM   1551 N  NZ  . LYS A 1 202 ? 2.656   55.851 31.339  1.00 59.56  ? 202  LYS A NZ  1 
ATOM   1552 N  N   . ARG A 1 203 ? -3.213  55.043 28.297  1.00 61.90  ? 203  ARG A N   1 
ATOM   1553 C  CA  . ARG A 1 203 ? -4.064  56.197 27.971  1.00 62.17  ? 203  ARG A CA  1 
ATOM   1554 C  C   . ARG A 1 203 ? -5.526  56.022 28.419  1.00 62.30  ? 203  ARG A C   1 
ATOM   1555 O  O   . ARG A 1 203 ? -6.206  57.016 28.720  1.00 62.15  ? 203  ARG A O   1 
ATOM   1556 C  CB  . ARG A 1 203 ? -3.997  56.485 26.461  1.00 62.33  ? 203  ARG A CB  1 
ATOM   1557 C  CG  . ARG A 1 203 ? -4.884  57.649 25.954  1.00 62.06  ? 203  ARG A CG  1 
ATOM   1558 C  CD  . ARG A 1 203 ? -4.808  57.798 24.425  1.00 62.03  ? 203  ARG A CD  1 
ATOM   1559 N  NE  . ARG A 1 203 ? -4.977  56.507 23.736  1.00 63.03  ? 203  ARG A NE  1 
ATOM   1560 C  CZ  . ARG A 1 203 ? -6.131  56.020 23.268  1.00 61.76  ? 203  ARG A CZ  1 
ATOM   1561 N  NH1 . ARG A 1 203 ? -7.272  56.707 23.378  1.00 59.47  ? 203  ARG A NH1 1 
ATOM   1562 N  NH2 . ARG A 1 203 ? -6.139  54.837 22.666  1.00 59.39  ? 203  ARG A NH2 1 
ATOM   1563 N  N   . GLU A 1 204 ? -6.001  54.773 28.453  1.00 62.20  ? 204  GLU A N   1 
ATOM   1564 C  CA  . GLU A 1 204 ? -7.359  54.441 28.936  1.00 62.55  ? 204  GLU A CA  1 
ATOM   1565 C  C   . GLU A 1 204 ? -7.461  54.337 30.481  1.00 62.74  ? 204  GLU A C   1 
ATOM   1566 O  O   . GLU A 1 204 ? -8.585  54.234 31.041  1.00 62.43  ? 204  GLU A O   1 
ATOM   1567 C  CB  . GLU A 1 204 ? -7.856  53.128 28.282  1.00 62.50  ? 204  GLU A CB  1 
ATOM   1568 C  CG  . GLU A 1 204 ? -8.154  53.248 26.781  1.00 62.15  ? 204  GLU A CG  1 
ATOM   1569 C  CD  . GLU A 1 204 ? -9.439  54.006 26.493  1.00 62.16  ? 204  GLU A CD  1 
ATOM   1570 O  OE1 . GLU A 1 204 ? -10.503 53.358 26.416  1.00 62.85  ? 204  GLU A OE1 1 
ATOM   1571 O  OE2 . GLU A 1 204 ? -9.382  55.245 26.339  1.00 59.44  ? 204  GLU A OE2 1 
ATOM   1572 N  N   . ASN A 1 205 ? -6.301  54.403 31.153  1.00 63.21  ? 205  ASN A N   1 
ATOM   1573 C  CA  . ASN A 1 205 ? -6.165  54.104 32.592  1.00 63.72  ? 205  ASN A CA  1 
ATOM   1574 C  C   . ASN A 1 205 ? -6.533  52.647 32.950  1.00 63.80  ? 205  ASN A C   1 
ATOM   1575 O  O   . ASN A 1 205 ? -7.511  52.393 33.666  1.00 63.66  ? 205  ASN A O   1 
ATOM   1576 C  CB  . ASN A 1 205 ? -6.954  55.095 33.448  1.00 63.37  ? 205  ASN A CB  1 
ATOM   1577 C  CG  . ASN A 1 205 ? -6.668  56.546 33.080  1.00 64.50  ? 205  ASN A CG  1 
ATOM   1578 O  OD1 . ASN A 1 205 ? -6.071  56.834 32.042  1.00 66.44  ? 205  ASN A OD1 1 
ATOM   1579 N  ND2 . ASN A 1 205 ? -7.096  57.464 33.931  1.00 62.71  ? 205  ASN A ND2 1 
ATOM   1580 N  N   . ILE A 1 206 ? -5.740  51.704 32.438  1.00 64.39  ? 206  ILE A N   1 
ATOM   1581 C  CA  . ILE A 1 206 ? -5.961  50.258 32.690  1.00 64.66  ? 206  ILE A CA  1 
ATOM   1582 C  C   . ILE A 1 206 ? -4.674  49.552 33.133  1.00 65.21  ? 206  ILE A C   1 
ATOM   1583 O  O   . ILE A 1 206 ? -4.682  48.808 34.122  1.00 64.89  ? 206  ILE A O   1 
ATOM   1584 C  CB  . ILE A 1 206 ? -6.569  49.522 31.458  1.00 64.44  ? 206  ILE A CB  1 
ATOM   1585 C  CG1 . ILE A 1 206 ? -7.949  50.076 31.108  1.00 64.25  ? 206  ILE A CG1 1 
ATOM   1586 C  CG2 . ILE A 1 206 ? -6.691  48.008 31.732  1.00 64.26  ? 206  ILE A CG2 1 
ATOM   1587 C  CD1 . ILE A 1 206 ? -8.396  49.803 29.700  1.00 64.31  ? 206  ILE A CD1 1 
ATOM   1588 N  N   . LEU A 1 207 ? -3.589  49.768 32.381  1.00 66.20  ? 207  LEU A N   1 
ATOM   1589 C  CA  . LEU A 1 207 ? -2.256  49.173 32.663  1.00 66.50  ? 207  LEU A CA  1 
ATOM   1590 C  C   . LEU A 1 207 ? -1.199  50.243 32.492  1.00 66.92  ? 207  LEU A C   1 
ATOM   1591 O  O   . LEU A 1 207 ? -1.354  51.117 31.663  1.00 67.15  ? 207  LEU A O   1 
ATOM   1592 C  CB  . LEU A 1 207 ? -1.915  48.038 31.680  1.00 66.60  ? 207  LEU A CB  1 
ATOM   1593 C  CG  . LEU A 1 207 ? -2.357  46.612 31.959  1.00 67.16  ? 207  LEU A CG  1 
ATOM   1594 C  CD1 . LEU A 1 207 ? -2.818  45.937 30.677  1.00 66.70  ? 207  LEU A CD1 1 
ATOM   1595 C  CD2 . LEU A 1 207 ? -1.218  45.841 32.607  1.00 68.47  ? 207  LEU A CD2 1 
ATOM   1596 N  N   . ASP A 1 208 ? -0.121  50.159 33.258  1.00 67.88  ? 208  ASP A N   1 
ATOM   1597 C  CA  . ASP A 1 208 ? 1.096   50.906 32.944  1.00 68.81  ? 208  ASP A CA  1 
ATOM   1598 C  C   . ASP A 1 208 ? 2.273   49.936 32.941  1.00 69.25  ? 208  ASP A C   1 
ATOM   1599 O  O   . ASP A 1 208 ? 2.626   49.406 33.997  1.00 69.80  ? 208  ASP A O   1 
ATOM   1600 C  CB  . ASP A 1 208 ? 1.333   52.027 33.957  1.00 68.87  ? 208  ASP A CB  1 
ATOM   1601 C  CG  . ASP A 1 208 ? 2.624   52.797 33.692  1.00 69.23  ? 208  ASP A CG  1 
ATOM   1602 O  OD1 . ASP A 1 208 ? 3.084   52.830 32.530  1.00 69.59  ? 208  ASP A OD1 1 
ATOM   1603 O  OD2 . ASP A 1 208 ? 3.185   53.361 34.652  1.00 69.15  ? 208  ASP A OD2 1 
ATOM   1604 N  N   . LYS A 1 209 ? 2.859   49.696 31.761  1.00 69.43  ? 209  LYS A N   1 
ATOM   1605 C  CA  . LYS A 1 209 ? 4.090   48.874 31.639  1.00 69.61  ? 209  LYS A CA  1 
ATOM   1606 C  C   . LYS A 1 209 ? 5.341   49.774 31.751  1.00 69.74  ? 209  LYS A C   1 
ATOM   1607 O  O   . LYS A 1 209 ? 6.019   50.074 30.756  1.00 70.15  ? 209  LYS A O   1 
ATOM   1608 C  CB  . LYS A 1 209 ? 4.090   48.021 30.340  1.00 69.72  ? 209  LYS A CB  1 
ATOM   1609 C  CG  . LYS A 1 209 ? 5.080   46.810 30.317  1.00 69.48  ? 209  LYS A CG  1 
ATOM   1610 C  CD  . LYS A 1 209 ? 6.264   46.964 29.319  1.00 70.01  ? 209  LYS A CD  1 
ATOM   1611 C  CE  . LYS A 1 209 ? 7.567   47.520 29.951  1.00 68.80  ? 209  LYS A CE  1 
ATOM   1612 N  NZ  . LYS A 1 209 ? 8.702   47.733 28.961  1.00 67.95  ? 209  LYS A NZ  1 
ATOM   1613 N  N   . LYS A 1 210 ? 5.620   50.223 32.975  1.00 69.34  ? 210  LYS A N   1 
ATOM   1614 C  CA  . LYS A 1 210 ? 6.864   50.920 33.252  1.00 68.96  ? 210  LYS A CA  1 
ATOM   1615 C  C   . LYS A 1 210 ? 8.019   49.893 33.269  1.00 68.87  ? 210  LYS A C   1 
ATOM   1616 O  O   . LYS A 1 210 ? 7.791   48.675 33.151  1.00 68.30  ? 210  LYS A O   1 
ATOM   1617 C  CB  . LYS A 1 210 ? 6.772   51.753 34.546  1.00 69.01  ? 210  LYS A CB  1 
ATOM   1618 C  CG  . LYS A 1 210 ? 6.361   50.978 35.792  1.00 68.92  ? 210  LYS A CG  1 
ATOM   1619 C  CD  . LYS A 1 210 ? 6.498   51.847 37.044  1.00 68.18  ? 210  LYS A CD  1 
ATOM   1620 C  CE  . LYS A 1 210 ? 5.360   52.842 37.169  1.00 67.35  ? 210  LYS A CE  1 
ATOM   1621 N  NZ  . LYS A 1 210 ? 5.465   53.613 38.425  1.00 64.92  ? 210  LYS A NZ  1 
ATOM   1622 N  N   . LYS A 1 211 ? 9.249   50.403 33.398  1.00 68.68  ? 211  LYS A N   1 
ATOM   1623 C  CA  . LYS A 1 211 ? 10.477  49.599 33.247  1.00 68.61  ? 211  LYS A CA  1 
ATOM   1624 C  C   . LYS A 1 211 ? 10.445  48.330 34.114  1.00 68.15  ? 211  LYS A C   1 
ATOM   1625 O  O   . LYS A 1 211 ? 10.519  47.190 33.619  1.00 67.77  ? 211  LYS A O   1 
ATOM   1626 C  CB  . LYS A 1 211 ? 11.734  50.435 33.612  1.00 68.58  ? 211  LYS A CB  1 
ATOM   1627 C  CG  . LYS A 1 211 ? 11.780  51.879 33.077  1.00 69.25  ? 211  LYS A CG  1 
ATOM   1628 C  CD  . LYS A 1 211 ? 11.607  51.953 31.560  1.00 69.57  ? 211  LYS A CD  1 
ATOM   1629 C  CE  . LYS A 1 211 ? 11.378  53.393 31.089  1.00 69.20  ? 211  LYS A CE  1 
ATOM   1630 N  NZ  . LYS A 1 211 ? 10.809  53.418 29.707  1.00 68.66  ? 211  LYS A NZ  1 
ATOM   1631 N  N   . ASN A 1 212 ? 10.297  48.571 35.415  1.00 67.86  ? 212  ASN A N   1 
ATOM   1632 C  CA  . ASN A 1 212 ? 10.532  47.580 36.460  1.00 67.57  ? 212  ASN A CA  1 
ATOM   1633 C  C   . ASN A 1 212 ? 9.249   46.950 37.021  1.00 67.21  ? 212  ASN A C   1 
ATOM   1634 O  O   . ASN A 1 212 ? 9.291   45.866 37.618  1.00 67.42  ? 212  ASN A O   1 
ATOM   1635 C  CB  . ASN A 1 212 ? 11.342  48.246 37.594  1.00 67.38  ? 212  ASN A CB  1 
ATOM   1636 C  CG  . ASN A 1 212 ? 12.607  48.938 37.085  1.00 67.09  ? 212  ASN A CG  1 
ATOM   1637 O  OD1 . ASN A 1 212 ? 12.988  49.997 37.579  1.00 66.61  ? 212  ASN A OD1 1 
ATOM   1638 N  ND2 . ASN A 1 212 ? 13.252  48.343 36.085  1.00 66.84  ? 212  ASN A ND2 1 
ATOM   1639 N  N   . LYS A 1 213 ? 8.119   47.626 36.810  1.00 66.56  ? 213  LYS A N   1 
ATOM   1640 C  CA  . LYS A 1 213 ? 6.850   47.265 37.428  1.00 65.82  ? 213  LYS A CA  1 
ATOM   1641 C  C   . LYS A 1 213 ? 5.747   47.190 36.362  1.00 65.41  ? 213  LYS A C   1 
ATOM   1642 O  O   . LYS A 1 213 ? 5.945   47.646 35.230  1.00 64.92  ? 213  LYS A O   1 
ATOM   1643 C  CB  . LYS A 1 213 ? 6.505   48.316 38.488  1.00 65.62  ? 213  LYS A CB  1 
ATOM   1644 C  CG  . LYS A 1 213 ? 5.895   47.746 39.757  1.00 65.60  ? 213  LYS A CG  1 
ATOM   1645 C  CD  . LYS A 1 213 ? 5.746   48.816 40.845  1.00 65.31  ? 213  LYS A CD  1 
ATOM   1646 C  CE  . LYS A 1 213 ? 7.033   49.021 41.624  1.00 64.51  ? 213  LYS A CE  1 
ATOM   1647 N  NZ  . LYS A 1 213 ? 7.286   47.868 42.525  1.00 63.89  ? 213  LYS A NZ  1 
ATOM   1648 N  N   . ILE A 1 214 ? 4.609   46.584 36.722  1.00 65.13  ? 214  ILE A N   1 
ATOM   1649 C  CA  . ILE A 1 214 ? 3.350   46.709 35.953  1.00 64.86  ? 214  ILE A CA  1 
ATOM   1650 C  C   . ILE A 1 214 ? 2.182   47.100 36.870  1.00 64.36  ? 214  ILE A C   1 
ATOM   1651 O  O   . ILE A 1 214 ? 1.813   46.332 37.765  1.00 64.48  ? 214  ILE A O   1 
ATOM   1652 C  CB  . ILE A 1 214 ? 2.929   45.421 35.250  1.00 64.83  ? 214  ILE A CB  1 
ATOM   1653 C  CG1 . ILE A 1 214 ? 4.077   44.840 34.418  1.00 65.54  ? 214  ILE A CG1 1 
ATOM   1654 C  CG2 . ILE A 1 214 ? 1.693   45.694 34.370  1.00 64.79  ? 214  ILE A CG2 1 
ATOM   1655 C  CD1 . ILE A 1 214 ? 4.431   45.670 33.215  1.00 64.71  ? 214  ILE A CD1 1 
ATOM   1656 N  N   . ILE A 1 215 ? 1.581   48.262 36.612  1.00 63.43  ? 215  ILE A N   1 
ATOM   1657 C  CA  . ILE A 1 215 ? 0.472   48.756 37.433  1.00 63.13  ? 215  ILE A CA  1 
ATOM   1658 C  C   . ILE A 1 215 ? -0.868  48.635 36.702  1.00 62.66  ? 215  ILE A C   1 
ATOM   1659 O  O   . ILE A 1 215 ? -1.133  49.370 35.743  1.00 62.52  ? 215  ILE A O   1 
ATOM   1660 C  CB  . ILE A 1 215 ? 0.704   50.218 37.871  1.00 62.94  ? 215  ILE A CB  1 
ATOM   1661 C  CG1 . ILE A 1 215 ? 2.134   50.391 38.394  1.00 62.99  ? 215  ILE A CG1 1 
ATOM   1662 C  CG2 . ILE A 1 215 ? -0.324  50.664 38.949  1.00 63.23  ? 215  ILE A CG2 1 
ATOM   1663 C  CD1 . ILE A 1 215 ? 2.539   49.392 39.465  1.00 61.48  ? 215  ILE A CD1 1 
ATOM   1664 N  N   . VAL A 1 216 ? -1.701  47.702 37.173  1.00 62.01  ? 216  VAL A N   1 
ATOM   1665 C  CA  . VAL A 1 216 ? -3.071  47.536 36.675  1.00 61.43  ? 216  VAL A CA  1 
ATOM   1666 C  C   . VAL A 1 216 ? -4.084  48.343 37.520  1.00 61.20  ? 216  VAL A C   1 
ATOM   1667 O  O   . VAL A 1 216 ? -4.397  48.002 38.672  1.00 61.14  ? 216  VAL A O   1 
ATOM   1668 C  CB  . VAL A 1 216 ? -3.464  46.051 36.610  1.00 61.41  ? 216  VAL A CB  1 
ATOM   1669 C  CG1 . VAL A 1 216 ? -4.828  45.871 35.932  1.00 60.84  ? 216  VAL A CG1 1 
ATOM   1670 C  CG2 . VAL A 1 216 ? -2.389  45.279 35.871  1.00 60.27  ? 216  VAL A CG2 1 
ATOM   1671 N  N   . TYR A 1 217 ? -4.584  49.424 36.927  1.00 60.53  ? 217  TYR A N   1 
ATOM   1672 C  CA  . TYR A 1 217 ? -5.550  50.286 37.577  1.00 59.97  ? 217  TYR A CA  1 
ATOM   1673 C  C   . TYR A 1 217 ? -6.946  49.657 37.584  1.00 59.85  ? 217  TYR A C   1 
ATOM   1674 O  O   . TYR A 1 217 ? -7.721  49.914 38.500  1.00 60.03  ? 217  TYR A O   1 
ATOM   1675 C  CB  . TYR A 1 217 ? -5.599  51.640 36.879  1.00 59.81  ? 217  TYR A CB  1 
ATOM   1676 C  CG  . TYR A 1 217 ? -4.259  52.324 36.769  1.00 59.70  ? 217  TYR A CG  1 
ATOM   1677 C  CD1 . TYR A 1 217 ? -3.743  53.051 37.831  1.00 59.82  ? 217  TYR A CD1 1 
ATOM   1678 C  CD2 . TYR A 1 217 ? -3.515  52.258 35.599  1.00 59.47  ? 217  TYR A CD2 1 
ATOM   1679 C  CE1 . TYR A 1 217 ? -2.516  53.696 37.741  1.00 59.58  ? 217  TYR A CE1 1 
ATOM   1680 C  CE2 . TYR A 1 217 ? -2.282  52.902 35.496  1.00 59.90  ? 217  TYR A CE2 1 
ATOM   1681 C  CZ  . TYR A 1 217 ? -1.791  53.624 36.577  1.00 59.29  ? 217  TYR A CZ  1 
ATOM   1682 O  OH  . TYR A 1 217 ? -0.575  54.268 36.500  1.00 58.69  ? 217  TYR A OH  1 
ATOM   1683 N  N   . ASN A 1 218 ? -7.267  48.854 36.566  1.00 59.22  ? 218  ASN A N   1 
ATOM   1684 C  CA  . ASN A 1 218 ? -8.589  48.211 36.448  1.00 59.05  ? 218  ASN A CA  1 
ATOM   1685 C  C   . ASN A 1 218 ? -8.476  46.771 35.914  1.00 58.64  ? 218  ASN A C   1 
ATOM   1686 O  O   . ASN A 1 218 ? -8.370  46.549 34.695  1.00 58.56  ? 218  ASN A O   1 
ATOM   1687 C  CB  . ASN A 1 218 ? -9.522  49.055 35.551  1.00 58.65  ? 218  ASN A CB  1 
ATOM   1688 C  CG  . ASN A 1 218 ? -11.006 48.854 35.865  1.00 58.05  ? 218  ASN A CG  1 
ATOM   1689 O  OD1 . ASN A 1 218 ? -11.393 47.945 36.601  1.00 55.63  ? 218  ASN A OD1 1 
ATOM   1690 N  ND2 . ASN A 1 218 ? -11.845 49.732 35.311  1.00 58.43  ? 218  ASN A ND2 1 
ATOM   1691 N  N   . LEU A 1 219 ? -8.487  45.797 36.829  1.00 58.62  ? 219  LEU A N   1 
ATOM   1692 C  CA  . LEU A 1 219 ? -8.399  44.369 36.449  1.00 58.68  ? 219  LEU A CA  1 
ATOM   1693 C  C   . LEU A 1 219 ? -9.726  43.827 35.892  1.00 58.40  ? 219  LEU A C   1 
ATOM   1694 O  O   . LEU A 1 219 ? -9.721  42.935 35.042  1.00 59.05  ? 219  LEU A O   1 
ATOM   1695 C  CB  . LEU A 1 219 ? -7.933  43.489 37.632  1.00 58.77  ? 219  LEU A CB  1 
ATOM   1696 C  CG  . LEU A 1 219 ? -7.531  42.040 37.263  1.00 58.69  ? 219  LEU A CG  1 
ATOM   1697 C  CD1 . LEU A 1 219 ? -6.416  42.030 36.225  1.00 58.93  ? 219  LEU A CD1 1 
ATOM   1698 C  CD2 . LEU A 1 219 ? -7.124  41.205 38.479  1.00 58.69  ? 219  LEU A CD2 1 
ATOM   1699 N  N   . GLY A 1 220 ? -10.856 44.336 36.389  1.00 58.21  ? 220  GLY A N   1 
ATOM   1700 C  CA  . GLY A 1 220 ? -12.162 43.958 35.854  1.00 57.60  ? 220  GLY A CA  1 
ATOM   1701 C  C   . GLY A 1 220 ? -12.253 44.276 34.370  1.00 57.13  ? 220  GLY A C   1 
ATOM   1702 O  O   . GLY A 1 220 ? -12.730 43.459 33.575  1.00 56.35  ? 220  GLY A O   1 
ATOM   1703 N  N   . GLU A 1 221 ? -11.800 45.479 34.010  1.00 56.80  ? 221  GLU A N   1 
ATOM   1704 C  CA  . GLU A 1 221 ? -11.729 45.920 32.613  1.00 56.48  ? 221  GLU A CA  1 
ATOM   1705 C  C   . GLU A 1 221 ? -10.817 44.991 31.811  1.00 55.96  ? 221  GLU A C   1 
ATOM   1706 O  O   . GLU A 1 221 ? -11.170 44.504 30.730  1.00 56.10  ? 221  GLU A O   1 
ATOM   1707 C  CB  . GLU A 1 221 ? -11.218 47.370 32.558  1.00 56.65  ? 221  GLU A CB  1 
ATOM   1708 C  CG  . GLU A 1 221 ? -11.246 48.026 31.173  1.00 56.77  ? 221  GLU A CG  1 
ATOM   1709 C  CD  . GLU A 1 221 ? -12.648 48.372 30.685  1.00 56.64  ? 221  GLU A CD  1 
ATOM   1710 O  OE1 . GLU A 1 221 ? -13.631 48.115 31.418  1.00 56.49  ? 221  GLU A OE1 1 
ATOM   1711 O  OE2 . GLU A 1 221 ? -12.759 48.914 29.560  1.00 56.61  ? 221  GLU A OE2 1 
ATOM   1712 N  N   . LEU A 1 222 ? -9.646  44.720 32.364  1.00 55.26  ? 222  LEU A N   1 
ATOM   1713 C  CA  . LEU A 1 222 ? -8.756  43.699 31.804  1.00 54.63  ? 222  LEU A CA  1 
ATOM   1714 C  C   . LEU A 1 222 ? -9.341  42.318 32.060  1.00 54.55  ? 222  LEU A C   1 
ATOM   1715 O  O   . LEU A 1 222 ? -10.108 41.790 31.260  1.00 54.52  ? 222  LEU A O   1 
ATOM   1716 C  CB  . LEU A 1 222 ? -7.372  43.827 32.454  1.00 54.99  ? 222  LEU A CB  1 
ATOM   1717 C  CG  . LEU A 1 222 ? -6.179  43.082 31.851  1.00 53.62  ? 222  LEU A CG  1 
ATOM   1718 C  CD1 . LEU A 1 222 ? -5.989  43.553 30.429  1.00 51.05  ? 222  LEU A CD1 1 
ATOM   1719 C  CD2 . LEU A 1 222 ? -4.952  43.371 32.703  1.00 53.07  ? 222  LEU A CD2 1 
ATOM   1720 N  N   . ASP B 1 9   ? 23.353  32.121 47.583  1.00 39.43  ? 9    ASP C N   1 
ATOM   1721 C  CA  . ASP B 1 9   ? 22.968  33.068 48.675  1.00 38.91  ? 9    ASP C CA  1 
ATOM   1722 C  C   . ASP B 1 9   ? 21.813  32.639 49.526  1.00 36.78  ? 9    ASP C C   1 
ATOM   1723 O  O   . ASP B 1 9   ? 21.451  33.407 50.387  1.00 35.53  ? 9    ASP C O   1 
ATOM   1724 C  CB  . ASP B 1 9   ? 22.480  34.408 48.059  1.00 39.37  ? 9    ASP C CB  1 
ATOM   1725 C  CG  . ASP B 1 9   ? 23.298  34.813 46.876  1.00 43.50  ? 9    ASP C CG  1 
ATOM   1726 O  OD1 . ASP B 1 9   ? 24.329  34.057 46.653  1.00 46.89  ? 9    ASP C OD1 1 
ATOM   1727 O  OD2 . ASP B 1 9   ? 22.876  35.806 46.190  1.00 42.88  ? 9    ASP C OD2 1 
ATOM   1728 N  N   . PHE B 1 10  ? 21.370  31.383 49.508  1.00 35.12  ? 10   PHE C N   1 
ATOM   1729 C  CA  . PHE B 1 10  ? 21.220  30.588 50.708  1.00 32.44  ? 10   PHE C CA  1 
ATOM   1730 C  C   . PHE B 1 10  ? 22.149  30.672 51.874  1.00 30.68  ? 10   PHE C C   1 
ATOM   1731 O  O   . PHE B 1 10  ? 23.270  30.174 51.875  1.00 29.65  ? 10   PHE C O   1 
ATOM   1732 C  CB  . PHE B 1 10  ? 20.687  29.162 50.458  1.00 31.73  ? 10   PHE C CB  1 
ATOM   1733 C  CG  . PHE B 1 10  ? 19.674  28.747 51.500  1.00 30.30  ? 10   PHE C CG  1 
ATOM   1734 C  CD1 . PHE B 1 10  ? 18.471  29.459 51.609  1.00 31.19  ? 10   PHE C CD1 1 
ATOM   1735 C  CD2 . PHE B 1 10  ? 19.960  27.753 52.444  1.00 28.88  ? 10   PHE C CD2 1 
ATOM   1736 C  CE1 . PHE B 1 10  ? 17.558  29.140 52.573  1.00 29.74  ? 10   PHE C CE1 1 
ATOM   1737 C  CE2 . PHE B 1 10  ? 19.042  27.404 53.436  1.00 31.53  ? 10   PHE C CE2 1 
ATOM   1738 C  CZ  . PHE B 1 10  ? 17.828  28.105 53.502  1.00 31.15  ? 10   PHE C CZ  1 
ATOM   1739 N  N   . CYS B 1 11  ? 21.615  31.334 52.899  1.00 30.57  ? 11   CYS C N   1 
ATOM   1740 C  CA  . CYS B 1 11  ? 22.306  31.532 54.182  1.00 31.43  ? 11   CYS C CA  1 
ATOM   1741 C  C   . CYS B 1 11  ? 21.701  30.654 55.296  1.00 31.95  ? 11   CYS C C   1 
ATOM   1742 O  O   . CYS B 1 11  ? 21.564  31.044 56.409  1.00 32.22  ? 11   CYS C O   1 
ATOM   1743 C  CB  . CYS B 1 11  ? 22.330  33.048 54.540  1.00 30.61  ? 11   CYS C CB  1 
ATOM   1744 S  SG  . CYS B 1 11  ? 23.268  34.007 53.347  1.00 31.02  ? 11   CYS C SG  1 
ATOM   1745 N  N   . GLY B 1 12  ? 21.252  29.452 54.969  1.00 33.47  ? 12   GLY C N   1 
ATOM   1746 C  CA  . GLY B 1 12  ? 20.878  28.528 56.022  1.00 33.77  ? 12   GLY C CA  1 
ATOM   1747 C  C   . GLY B 1 12  ? 21.873  27.391 56.180  1.00 33.23  ? 12   GLY C C   1 
ATOM   1748 O  O   . GLY B 1 12  ? 22.570  27.003 55.209  1.00 34.96  ? 12   GLY C O   1 
ATOM   1749 N  N   . ALA B 1 13  ? 21.981  26.863 57.396  1.00 30.49  ? 13   ALA C N   1 
ATOM   1750 C  CA  . ALA B 1 13  ? 22.862  25.745 57.618  1.00 29.43  ? 13   ALA C CA  1 
ATOM   1751 C  C   . ALA B 1 13  ? 22.153  24.827 58.617  1.00 28.91  ? 13   ALA C C   1 
ATOM   1752 O  O   . ALA B 1 13  ? 21.498  25.265 59.562  1.00 27.21  ? 13   ALA C O   1 
ATOM   1753 C  CB  . ALA B 1 13  ? 24.257  26.187 58.121  1.00 28.18  ? 13   ALA C CB  1 
ATOM   1754 N  N   . ILE B 1 14  ? 22.307  23.535 58.401  1.00 28.72  ? 14   ILE C N   1 
ATOM   1755 C  CA  . ILE B 1 14  ? 21.781  22.543 59.349  1.00 29.97  ? 14   ILE C CA  1 
ATOM   1756 C  C   . ILE B 1 14  ? 22.898  22.123 60.347  1.00 29.94  ? 14   ILE C C   1 
ATOM   1757 O  O   . ILE B 1 14  ? 22.653  21.877 61.516  1.00 31.98  ? 14   ILE C O   1 
ATOM   1758 C  CB  . ILE B 1 14  ? 21.253  21.321 58.587  1.00 28.09  ? 14   ILE C CB  1 
ATOM   1759 C  CG1 . ILE B 1 14  ? 20.052  21.686 57.737  1.00 31.11  ? 14   ILE C CG1 1 
ATOM   1760 C  CG2 . ILE B 1 14  ? 20.789  20.212 59.513  1.00 33.13  ? 14   ILE C CG2 1 
ATOM   1761 C  CD1 . ILE B 1 14  ? 19.903  20.739 56.486  1.00 27.65  ? 14   ILE C CD1 1 
ATOM   1762 N  N   . ILE B 1 15  ? 24.111  21.956 59.832  1.00 30.77  ? 15   ILE C N   1 
ATOM   1763 C  CA  . ILE B 1 15  ? 25.227  21.475 60.607  1.00 30.93  ? 15   ILE C CA  1 
ATOM   1764 C  C   . ILE B 1 15  ? 26.146  22.640 60.801  1.00 29.95  ? 15   ILE C C   1 
ATOM   1765 O  O   . ILE B 1 15  ? 26.296  23.393 59.897  1.00 29.21  ? 15   ILE C O   1 
ATOM   1766 C  CB  . ILE B 1 15  ? 26.025  20.388 59.858  1.00 30.38  ? 15   ILE C CB  1 
ATOM   1767 C  CG1 . ILE B 1 15  ? 25.150  19.165 59.590  1.00 33.76  ? 15   ILE C CG1 1 
ATOM   1768 C  CG2 . ILE B 1 15  ? 27.284  19.959 60.736  1.00 33.06  ? 15   ILE C CG2 1 
ATOM   1769 C  CD1 . ILE B 1 15  ? 24.193  18.851 60.755  1.00 28.30  ? 15   ILE C CD1 1 
ATOM   1770 N  N   . PRO B 1 16  ? 26.764  22.786 61.992  1.00 29.91  ? 16   PRO C N   1 
ATOM   1771 C  CA  . PRO B 1 16  ? 27.804  23.833 62.158  1.00 29.36  ? 16   PRO C CA  1 
ATOM   1772 C  C   . PRO B 1 16  ? 29.197  23.391 61.689  1.00 29.98  ? 16   PRO C C   1 
ATOM   1773 O  O   . PRO B 1 16  ? 30.147  23.183 62.454  1.00 29.76  ? 16   PRO C O   1 
ATOM   1774 C  CB  . PRO B 1 16  ? 27.757  24.105 63.671  1.00 30.10  ? 16   PRO C CB  1 
ATOM   1775 C  CG  . PRO B 1 16  ? 27.446  22.789 64.298  1.00 28.52  ? 16   PRO C CG  1 
ATOM   1776 C  CD  . PRO B 1 16  ? 26.528  22.058 63.263  1.00 29.55  ? 16   PRO C CD  1 
ATOM   1777 N  N   . ASP B 1 17  ? 29.284  23.263 60.404  1.00 30.72  ? 17   ASP C N   1 
ATOM   1778 C  CA  . ASP B 1 17  ? 30.408  22.713 59.702  1.00 30.83  ? 17   ASP C CA  1 
ATOM   1779 C  C   . ASP B 1 17  ? 30.401  23.384 58.340  1.00 29.59  ? 17   ASP C C   1 
ATOM   1780 O  O   . ASP B 1 17  ? 29.400  23.351 57.679  1.00 29.83  ? 17   ASP C O   1 
ATOM   1781 C  CB  . ASP B 1 17  ? 30.208  21.226 59.453  1.00 31.77  ? 17   ASP C CB  1 
ATOM   1782 C  CG  . ASP B 1 17  ? 31.453  20.563 58.894  1.00 33.96  ? 17   ASP C CG  1 
ATOM   1783 O  OD1 . ASP B 1 17  ? 32.571  21.089 59.053  1.00 40.02  ? 17   ASP C OD1 1 
ATOM   1784 O  OD2 . ASP B 1 17  ? 31.316  19.527 58.267  1.00 36.95  ? 17   ASP C OD2 1 
ATOM   1785 N  N   . ASN B 1 18  ? 31.493  24.020 57.971  1.00 28.90  ? 18   ASN C N   1 
ATOM   1786 C  CA  . ASN B 1 18  ? 31.632  24.697 56.681  1.00 29.70  ? 18   ASN C CA  1 
ATOM   1787 C  C   . ASN B 1 18  ? 30.510  25.685 56.344  1.00 28.13  ? 18   ASN C C   1 
ATOM   1788 O  O   . ASN B 1 18  ? 29.859  25.617 55.320  1.00 29.78  ? 18   ASN C O   1 
ATOM   1789 C  CB  . ASN B 1 18  ? 31.826  23.699 55.539  1.00 29.16  ? 18   ASN C CB  1 
ATOM   1790 C  CG  . ASN B 1 18  ? 33.052  22.823 55.749  1.00 34.45  ? 18   ASN C CG  1 
ATOM   1791 O  OD1 . ASN B 1 18  ? 34.021  23.238 56.395  1.00 41.08  ? 18   ASN C OD1 1 
ATOM   1792 N  ND2 . ASN B 1 18  ? 32.997  21.608 55.258  1.00 28.29  ? 18   ASN C ND2 1 
ATOM   1793 N  N   . PHE B 1 19  ? 30.365  26.634 57.197  1.00 28.91  ? 19   PHE C N   1 
ATOM   1794 C  CA  . PHE B 1 19  ? 29.402  27.685 57.013  1.00 27.65  ? 19   PHE C CA  1 
ATOM   1795 C  C   . PHE B 1 19  ? 29.904  28.472 55.761  1.00 28.20  ? 19   PHE C C   1 
ATOM   1796 O  O   . PHE B 1 19  ? 31.143  28.734 55.632  1.00 28.62  ? 19   PHE C O   1 
ATOM   1797 C  CB  . PHE B 1 19  ? 29.451  28.635 58.193  1.00 27.33  ? 19   PHE C CB  1 
ATOM   1798 C  CG  . PHE B 1 19  ? 28.765  28.173 59.449  1.00 27.50  ? 19   PHE C CG  1 
ATOM   1799 C  CD1 . PHE B 1 19  ? 27.447  27.730 59.445  1.00 25.93  ? 19   PHE C CD1 1 
ATOM   1800 C  CD2 . PHE B 1 19  ? 29.421  28.319 60.692  1.00 23.43  ? 19   PHE C CD2 1 
ATOM   1801 C  CE1 . PHE B 1 19  ? 26.825  27.390 60.684  1.00 25.11  ? 19   PHE C CE1 1 
ATOM   1802 C  CE2 . PHE B 1 19  ? 28.790  28.027 61.856  1.00 25.82  ? 19   PHE C CE2 1 
ATOM   1803 C  CZ  . PHE B 1 19  ? 27.495  27.544 61.857  1.00 22.74  ? 19   PHE C CZ  1 
ATOM   1804 N  N   . PHE B 1 20  ? 28.941  28.891 54.939  1.00 27.56  ? 20   PHE C N   1 
ATOM   1805 C  CA  . PHE B 1 20  ? 29.117  29.723 53.728  1.00 26.72  ? 20   PHE C CA  1 
ATOM   1806 C  C   . PHE B 1 20  ? 30.574  29.948 53.222  1.00 26.62  ? 20   PHE C C   1 
ATOM   1807 O  O   . PHE B 1 20  ? 31.218  30.971 53.513  1.00 27.85  ? 20   PHE C O   1 
ATOM   1808 C  CB  . PHE B 1 20  ? 28.319  31.025 53.874  1.00 25.94  ? 20   PHE C CB  1 
ATOM   1809 C  CG  . PHE B 1 20  ? 27.841  31.551 52.583  1.00 23.96  ? 20   PHE C CG  1 
ATOM   1810 C  CD1 . PHE B 1 20  ? 26.615  31.173 52.086  1.00 23.76  ? 20   PHE C CD1 1 
ATOM   1811 C  CD2 . PHE B 1 20  ? 28.677  32.369 51.790  1.00 19.86  ? 20   PHE C CD2 1 
ATOM   1812 C  CE1 . PHE B 1 20  ? 26.204  31.613 50.848  1.00 26.34  ? 20   PHE C CE1 1 
ATOM   1813 C  CE2 . PHE B 1 20  ? 28.273  32.804 50.559  1.00 25.99  ? 20   PHE C CE2 1 
ATOM   1814 C  CZ  . PHE B 1 20  ? 27.040  32.395 50.041  1.00 24.94  ? 20   PHE C CZ  1 
ATOM   1815 N  N   . PRO B 1 21  ? 31.134  28.942 52.507  1.00 27.80  ? 21   PRO C N   1 
ATOM   1816 C  CA  . PRO B 1 21  ? 32.466  29.141 51.987  1.00 27.39  ? 21   PRO C CA  1 
ATOM   1817 C  C   . PRO B 1 21  ? 32.536  30.298 50.962  1.00 26.97  ? 21   PRO C C   1 
ATOM   1818 O  O   . PRO B 1 21  ? 31.597  30.519 50.180  1.00 28.30  ? 21   PRO C O   1 
ATOM   1819 C  CB  . PRO B 1 21  ? 32.782  27.818 51.279  1.00 26.97  ? 21   PRO C CB  1 
ATOM   1820 C  CG  . PRO B 1 21  ? 31.844  26.855 51.818  1.00 29.07  ? 21   PRO C CG  1 
ATOM   1821 C  CD  . PRO B 1 21  ? 30.615  27.607 52.206  1.00 26.53  ? 21   PRO C CD  1 
ATOM   1822 N  N   . ILE B 1 22  ? 33.649  30.993 50.980  1.00 25.91  ? 22   ILE C N   1 
ATOM   1823 C  CA  . ILE B 1 22  ? 33.955  32.022 50.039  1.00 24.83  ? 22   ILE C CA  1 
ATOM   1824 C  C   . ILE B 1 22  ? 35.238  31.619 49.254  1.00 26.22  ? 22   ILE C C   1 
ATOM   1825 O  O   . ILE B 1 22  ? 36.358  32.068 49.575  1.00 23.92  ? 22   ILE C O   1 
ATOM   1826 C  CB  . ILE B 1 22  ? 34.145  33.397 50.774  1.00 25.09  ? 22   ILE C CB  1 
ATOM   1827 C  CG1 . ILE B 1 22  ? 33.022  33.652 51.823  1.00 22.38  ? 22   ILE C CG1 1 
ATOM   1828 C  CG2 . ILE B 1 22  ? 34.226  34.556 49.712  1.00 22.91  ? 22   ILE C CG2 1 
ATOM   1829 C  CD1 . ILE B 1 22  ? 33.186  34.988 52.712  1.00 21.35  ? 22   ILE C CD1 1 
ATOM   1830 N  N   . GLU B 1 23  ? 35.062  30.825 48.176  1.00 27.91  ? 23   GLU C N   1 
ATOM   1831 C  CA  . GLU B 1 23  ? 36.193  30.346 47.385  1.00 27.76  ? 23   GLU C CA  1 
ATOM   1832 C  C   . GLU B 1 23  ? 36.992  31.544 46.808  1.00 27.70  ? 23   GLU C C   1 
ATOM   1833 O  O   . GLU B 1 23  ? 38.207  31.423 46.638  1.00 26.06  ? 23   GLU C O   1 
ATOM   1834 C  CB  . GLU B 1 23  ? 35.729  29.369 46.289  1.00 29.26  ? 23   GLU C CB  1 
ATOM   1835 C  CG  . GLU B 1 23  ? 36.818  28.733 45.492  1.00 32.88  ? 23   GLU C CG  1 
ATOM   1836 C  CD  . GLU B 1 23  ? 37.277  29.533 44.259  1.00 38.09  ? 23   GLU C CD  1 
ATOM   1837 O  OE1 . GLU B 1 23  ? 36.519  30.432 43.757  1.00 41.91  ? 23   GLU C OE1 1 
ATOM   1838 O  OE2 . GLU B 1 23  ? 38.424  29.244 43.816  1.00 37.96  ? 23   GLU C OE2 1 
ATOM   1839 N  N   . LYS B 1 24  ? 36.339  32.675 46.534  1.00 27.03  ? 24   LYS C N   1 
ATOM   1840 C  CA  . LYS B 1 24  ? 36.991  33.753 45.763  1.00 28.83  ? 24   LYS C CA  1 
ATOM   1841 C  C   . LYS B 1 24  ? 37.978  34.569 46.586  1.00 28.70  ? 24   LYS C C   1 
ATOM   1842 O  O   . LYS B 1 24  ? 38.801  35.253 46.024  1.00 28.79  ? 24   LYS C O   1 
ATOM   1843 C  CB  . LYS B 1 24  ? 35.960  34.643 45.034  1.00 29.14  ? 24   LYS C CB  1 
ATOM   1844 C  CG  . LYS B 1 24  ? 35.638  34.142 43.579  1.00 32.34  ? 24   LYS C CG  1 
ATOM   1845 C  CD  . LYS B 1 24  ? 34.326  34.800 43.016  1.00 33.70  ? 24   LYS C CD  1 
ATOM   1846 C  CE  . LYS B 1 24  ? 33.918  34.247 41.630  1.00 35.37  ? 24   LYS C CE  1 
ATOM   1847 N  NZ  . LYS B 1 24  ? 34.716  34.869 40.488  1.00 40.71  ? 24   LYS C NZ  1 
ATOM   1848 N  N   . LEU B 1 25  ? 37.939  34.462 47.909  1.00 29.35  ? 25   LEU C N   1 
ATOM   1849 C  CA  . LEU B 1 25  ? 38.996  35.038 48.771  1.00 30.63  ? 25   LEU C CA  1 
ATOM   1850 C  C   . LEU B 1 25  ? 40.339  34.426 48.516  1.00 30.77  ? 25   LEU C C   1 
ATOM   1851 O  O   . LEU B 1 25  ? 41.380  35.026 48.802  1.00 32.44  ? 25   LEU C O   1 
ATOM   1852 C  CB  . LEU B 1 25  ? 38.643  34.937 50.276  1.00 30.78  ? 25   LEU C CB  1 
ATOM   1853 C  CG  . LEU B 1 25  ? 37.787  36.067 50.824  1.00 32.68  ? 25   LEU C CG  1 
ATOM   1854 C  CD1 . LEU B 1 25  ? 37.259  35.709 52.239  1.00 32.86  ? 25   LEU C CD1 1 
ATOM   1855 C  CD2 . LEU B 1 25  ? 38.524  37.412 50.869  1.00 30.79  ? 25   LEU C CD2 1 
ATOM   1856 N  N   . ARG B 1 26  ? 40.350  33.243 47.922  1.00 31.00  ? 26   ARG C N   1 
ATOM   1857 C  CA  . ARG B 1 26  ? 41.605  32.686 47.438  1.00 31.22  ? 26   ARG C CA  1 
ATOM   1858 C  C   . ARG B 1 26  ? 42.322  33.613 46.486  1.00 30.54  ? 26   ARG C C   1 
ATOM   1859 O  O   . ARG B 1 26  ? 43.558  33.607 46.432  1.00 29.54  ? 26   ARG C O   1 
ATOM   1860 C  CB  . ARG B 1 26  ? 41.370  31.354 46.765  1.00 31.90  ? 26   ARG C CB  1 
ATOM   1861 C  CG  . ARG B 1 26  ? 40.777  30.328 47.747  1.00 34.08  ? 26   ARG C CG  1 
ATOM   1862 C  CD  . ARG B 1 26  ? 40.322  29.127 46.923  1.00 39.47  ? 26   ARG C CD  1 
ATOM   1863 N  NE  . ARG B 1 26  ? 41.437  28.231 46.805  1.00 42.55  ? 26   ARG C NE  1 
ATOM   1864 C  CZ  . ARG B 1 26  ? 41.879  27.471 47.807  1.00 43.63  ? 26   ARG C CZ  1 
ATOM   1865 N  NH1 . ARG B 1 26  ? 41.281  27.499 49.023  1.00 39.65  ? 26   ARG C NH1 1 
ATOM   1866 N  NH2 . ARG B 1 26  ? 42.950  26.708 47.595  1.00 40.76  ? 26   ARG C NH2 1 
ATOM   1867 N  N   . ASN B 1 27  ? 41.564  34.443 45.771  1.00 30.09  ? 27   ASN C N   1 
ATOM   1868 C  CA  . ASN B 1 27  ? 42.171  35.299 44.786  1.00 30.47  ? 27   ASN C CA  1 
ATOM   1869 C  C   . ASN B 1 27  ? 42.805  36.506 45.431  1.00 29.81  ? 27   ASN C C   1 
ATOM   1870 O  O   . ASN B 1 27  ? 43.460  37.291 44.732  1.00 30.51  ? 27   ASN C O   1 
ATOM   1871 C  CB  . ASN B 1 27  ? 41.190  35.766 43.708  1.00 30.84  ? 27   ASN C CB  1 
ATOM   1872 C  CG  . ASN B 1 27  ? 40.367  34.637 43.082  1.00 31.28  ? 27   ASN C CG  1 
ATOM   1873 O  OD1 . ASN B 1 27  ? 40.824  33.494 42.925  1.00 36.37  ? 27   ASN C OD1 1 
ATOM   1874 N  ND2 . ASN B 1 27  ? 39.130  34.985 42.682  1.00 31.76  ? 27   ASN C ND2 1 
ATOM   1875 N  N   . TYR B 1 28  ? 42.617  36.676 46.750  1.00 29.11  ? 28   TYR C N   1 
ATOM   1876 C  CA  . TYR B 1 28  ? 43.042  37.897 47.432  1.00 27.49  ? 28   TYR C CA  1 
ATOM   1877 C  C   . TYR B 1 28  ? 43.984  37.648 48.608  1.00 28.19  ? 28   TYR C C   1 
ATOM   1878 O  O   . TYR B 1 28  ? 44.265  38.577 49.362  1.00 27.19  ? 28   TYR C O   1 
ATOM   1879 C  CB  . TYR B 1 28  ? 41.815  38.762 47.835  1.00 26.59  ? 28   TYR C CB  1 
ATOM   1880 C  CG  . TYR B 1 28  ? 40.896  39.074 46.676  1.00 24.93  ? 28   TYR C CG  1 
ATOM   1881 C  CD1 . TYR B 1 28  ? 39.688  38.403 46.525  1.00 24.52  ? 28   TYR C CD1 1 
ATOM   1882 C  CD2 . TYR B 1 28  ? 41.249  40.018 45.692  1.00 26.46  ? 28   TYR C CD2 1 
ATOM   1883 C  CE1 . TYR B 1 28  ? 38.862  38.665 45.478  1.00 25.97  ? 28   TYR C CE1 1 
ATOM   1884 C  CE2 . TYR B 1 28  ? 40.438  40.246 44.566  1.00 25.37  ? 28   TYR C CE2 1 
ATOM   1885 C  CZ  . TYR B 1 28  ? 39.263  39.544 44.462  1.00 25.31  ? 28   TYR C CZ  1 
ATOM   1886 O  OH  . TYR B 1 28  ? 38.445  39.707 43.399  1.00 22.09  ? 28   TYR C OH  1 
ATOM   1887 N  N   . THR B 1 29  ? 44.456  36.403 48.780  1.00 28.60  ? 29   THR C N   1 
ATOM   1888 C  CA  . THR B 1 29  ? 45.261  36.038 49.948  1.00 28.70  ? 29   THR C CA  1 
ATOM   1889 C  C   . THR B 1 29  ? 46.606  36.770 49.968  1.00 28.62  ? 29   THR C C   1 
ATOM   1890 O  O   . THR B 1 29  ? 47.150  37.061 51.026  1.00 28.24  ? 29   THR C O   1 
ATOM   1891 C  CB  . THR B 1 29  ? 45.558  34.467 50.045  1.00 29.01  ? 29   THR C CB  1 
ATOM   1892 O  OG1 . THR B 1 29  ? 46.208  34.019 48.864  1.00 30.49  ? 29   THR C OG1 1 
ATOM   1893 C  CG2 . THR B 1 29  ? 44.314  33.660 50.248  1.00 28.59  ? 29   THR C CG2 1 
ATOM   1894 N  N   . GLN B 1 30  ? 47.129  37.097 48.793  1.00 28.47  ? 30   GLN C N   1 
ATOM   1895 C  CA  . GLN B 1 30  ? 48.281  37.979 48.683  1.00 29.09  ? 30   GLN C CA  1 
ATOM   1896 C  C   . GLN B 1 30  ? 48.091  39.341 49.391  1.00 28.55  ? 30   GLN C C   1 
ATOM   1897 O  O   . GLN B 1 30  ? 49.052  39.994 49.686  1.00 29.25  ? 30   GLN C O   1 
ATOM   1898 C  CB  . GLN B 1 30  ? 48.658  38.180 47.197  1.00 29.69  ? 30   GLN C CB  1 
ATOM   1899 C  CG  . GLN B 1 30  ? 47.588  38.917 46.345  1.00 31.55  ? 30   GLN C CG  1 
ATOM   1900 C  CD  . GLN B 1 30  ? 46.429  38.049 45.828  1.00 33.95  ? 30   GLN C CD  1 
ATOM   1901 O  OE1 . GLN B 1 30  ? 46.404  36.795 45.966  1.00 32.93  ? 30   GLN C OE1 1 
ATOM   1902 N  NE2 . GLN B 1 30  ? 45.456  38.731 45.191  1.00 37.18  ? 30   GLN C NE2 1 
ATOM   1903 N  N   . MET B 1 31  ? 46.859  39.737 49.691  1.00 28.97  ? 31   MET C N   1 
ATOM   1904 C  CA  . MET B 1 31  ? 46.585  40.969 50.460  1.00 30.03  ? 31   MET C CA  1 
ATOM   1905 C  C   . MET B 1 31  ? 46.542  40.812 52.013  1.00 29.48  ? 31   MET C C   1 
ATOM   1906 O  O   . MET B 1 31  ? 46.493  41.822 52.743  1.00 30.23  ? 31   MET C O   1 
ATOM   1907 C  CB  . MET B 1 31  ? 45.303  41.592 49.941  1.00 29.32  ? 31   MET C CB  1 
ATOM   1908 C  CG  . MET B 1 31  ? 45.340  41.803 48.413  1.00 31.13  ? 31   MET C CG  1 
ATOM   1909 S  SD  . MET B 1 31  ? 43.836  42.545 47.805  1.00 33.47  ? 31   MET C SD  1 
ATOM   1910 C  CE  . MET B 1 31  ? 44.212  42.642 46.080  1.00 28.63  ? 31   MET C CE  1 
ATOM   1911 N  N   . GLY B 1 32  ? 46.543  39.570 52.497  1.00 28.31  ? 32   GLY C N   1 
ATOM   1912 C  CA  . GLY B 1 32  ? 46.645  39.272 53.896  1.00 27.66  ? 32   GLY C CA  1 
ATOM   1913 C  C   . GLY B 1 32  ? 47.963  38.584 54.180  1.00 27.93  ? 32   GLY C C   1 
ATOM   1914 O  O   . GLY B 1 32  ? 48.931  38.703 53.381  1.00 26.77  ? 32   GLY C O   1 
ATOM   1915 N  N   . LEU B 1 33  ? 48.007  37.893 55.319  1.00 28.23  ? 33   LEU C N   1 
ATOM   1916 C  CA  . LEU B 1 33  ? 49.205  37.242 55.856  1.00 29.49  ? 33   LEU C CA  1 
ATOM   1917 C  C   . LEU B 1 33  ? 48.961  35.753 55.938  1.00 29.21  ? 33   LEU C C   1 
ATOM   1918 O  O   . LEU B 1 33  ? 48.097  35.315 56.693  1.00 28.77  ? 33   LEU C O   1 
ATOM   1919 C  CB  . LEU B 1 33  ? 49.630  37.737 57.270  1.00 30.15  ? 33   LEU C CB  1 
ATOM   1920 C  CG  . LEU B 1 33  ? 49.925  39.237 57.525  1.00 33.51  ? 33   LEU C CG  1 
ATOM   1921 C  CD1 . LEU B 1 33  ? 50.056  39.482 59.021  1.00 35.59  ? 33   LEU C CD1 1 
ATOM   1922 C  CD2 . LEU B 1 33  ? 51.149  39.818 56.818  1.00 34.01  ? 33   LEU C CD2 1 
ATOM   1923 N  N   . ILE B 1 34  ? 49.767  34.998 55.186  1.00 28.47  ? 34   ILE C N   1 
ATOM   1924 C  CA  . ILE B 1 34  ? 49.651  33.552 55.106  1.00 28.66  ? 34   ILE C CA  1 
ATOM   1925 C  C   . ILE B 1 34  ? 50.236  32.932 56.375  1.00 28.73  ? 34   ILE C C   1 
ATOM   1926 O  O   . ILE B 1 34  ? 51.364  33.222 56.724  1.00 27.95  ? 34   ILE C O   1 
ATOM   1927 C  CB  . ILE B 1 34  ? 50.335  32.991 53.810  1.00 27.95  ? 34   ILE C CB  1 
ATOM   1928 C  CG1 . ILE B 1 34  ? 49.539  33.384 52.562  1.00 27.78  ? 34   ILE C CG1 1 
ATOM   1929 C  CG2 . ILE B 1 34  ? 50.468  31.487 53.860  1.00 27.55  ? 34   ILE C CG2 1 
ATOM   1930 C  CD1 . ILE B 1 34  ? 48.182  32.740 52.463  1.00 20.47  ? 34   ILE C CD1 1 
ATOM   1931 N  N   . ARG B 1 35  ? 49.439  32.139 57.099  1.00 29.53  ? 35   ARG C N   1 
ATOM   1932 C  CA  . ARG B 1 35  ? 49.951  31.408 58.251  1.00 30.69  ? 35   ARG C CA  1 
ATOM   1933 C  C   . ARG B 1 35  ? 49.618  29.930 58.223  1.00 30.26  ? 35   ARG C C   1 
ATOM   1934 O  O   . ARG B 1 35  ? 48.463  29.564 58.056  1.00 30.97  ? 35   ARG C O   1 
ATOM   1935 C  CB  . ARG B 1 35  ? 49.376  31.973 59.513  1.00 31.13  ? 35   ARG C CB  1 
ATOM   1936 C  CG  . ARG B 1 35  ? 49.694  33.430 59.729  1.00 34.46  ? 35   ARG C CG  1 
ATOM   1937 C  CD  . ARG B 1 35  ? 50.082  33.574 61.148  1.00 39.47  ? 35   ARG C CD  1 
ATOM   1938 N  NE  . ARG B 1 35  ? 49.552  34.734 61.805  1.00 40.53  ? 35   ARG C NE  1 
ATOM   1939 C  CZ  . ARG B 1 35  ? 49.396  34.787 63.126  1.00 44.79  ? 35   ARG C CZ  1 
ATOM   1940 N  NH1 . ARG B 1 35  ? 49.742  33.725 63.898  1.00 45.48  ? 35   ARG C NH1 1 
ATOM   1941 N  NH2 . ARG B 1 35  ? 48.882  35.890 63.685  1.00 44.33  ? 35   ARG C NH2 1 
ATOM   1942 N  N   . ASP B 1 36  ? 50.618  29.096 58.445  1.00 29.99  ? 36   ASP C N   1 
ATOM   1943 C  CA  . ASP B 1 36  ? 50.462  27.640 58.433  1.00 29.95  ? 36   ASP C CA  1 
ATOM   1944 C  C   . ASP B 1 36  ? 50.502  27.062 59.827  1.00 29.80  ? 36   ASP C C   1 
ATOM   1945 O  O   . ASP B 1 36  ? 51.287  27.511 60.676  1.00 29.33  ? 36   ASP C O   1 
ATOM   1946 C  CB  . ASP B 1 36  ? 51.571  26.978 57.602  1.00 31.00  ? 36   ASP C CB  1 
ATOM   1947 C  CG  . ASP B 1 36  ? 51.531  27.382 56.142  1.00 30.68  ? 36   ASP C CG  1 
ATOM   1948 O  OD1 . ASP B 1 36  ? 50.412  27.541 55.631  1.00 31.56  ? 36   ASP C OD1 1 
ATOM   1949 O  OD2 . ASP B 1 36  ? 52.604  27.515 55.506  1.00 33.48  ? 36   ASP C OD2 1 
ATOM   1950 N  N   . PHE B 1 37  ? 49.662  26.051 60.048  1.00 29.42  ? 37   PHE C N   1 
ATOM   1951 C  CA  . PHE B 1 37  ? 49.537  25.394 61.345  1.00 28.87  ? 37   PHE C CA  1 
ATOM   1952 C  C   . PHE B 1 37  ? 49.651  23.871 61.265  1.00 27.75  ? 37   PHE C C   1 
ATOM   1953 O  O   . PHE B 1 37  ? 48.920  23.263 60.518  1.00 27.98  ? 37   PHE C O   1 
ATOM   1954 C  CB  . PHE B 1 37  ? 48.190  25.790 61.983  1.00 27.76  ? 37   PHE C CB  1 
ATOM   1955 C  CG  . PHE B 1 37  ? 48.095  27.257 62.272  1.00 28.26  ? 37   PHE C CG  1 
ATOM   1956 C  CD1 . PHE B 1 37  ? 48.545  27.764 63.479  1.00 27.78  ? 37   PHE C CD1 1 
ATOM   1957 C  CD2 . PHE B 1 37  ? 47.652  28.136 61.301  1.00 27.67  ? 37   PHE C CD2 1 
ATOM   1958 C  CE1 . PHE B 1 37  ? 48.502  29.127 63.717  1.00 27.38  ? 37   PHE C CE1 1 
ATOM   1959 C  CE2 . PHE B 1 37  ? 47.602  29.503 61.540  1.00 27.34  ? 37   PHE C CE2 1 
ATOM   1960 C  CZ  . PHE B 1 37  ? 48.037  29.990 62.737  1.00 28.93  ? 37   PHE C CZ  1 
ATOM   1961 N  N   . ALA B 1 38  ? 50.513  23.260 62.072  1.00 27.51  ? 38   ALA C N   1 
ATOM   1962 C  CA  . ALA B 1 38  ? 50.578  21.784 62.111  1.00 27.69  ? 38   ALA C CA  1 
ATOM   1963 C  C   . ALA B 1 38  ? 49.342  21.202 62.789  1.00 28.10  ? 38   ALA C C   1 
ATOM   1964 O  O   . ALA B 1 38  ? 48.662  21.882 63.585  1.00 28.21  ? 38   ALA C O   1 
ATOM   1965 C  CB  . ALA B 1 38  ? 51.859  21.281 62.820  1.00 27.14  ? 38   ALA C CB  1 
ATOM   1966 N  N   . LYS B 1 39  ? 49.041  19.955 62.445  1.00 28.54  ? 39   LYS C N   1 
ATOM   1967 C  CA  . LYS B 1 39  ? 48.012  19.186 63.133  1.00 29.11  ? 39   LYS C CA  1 
ATOM   1968 C  C   . LYS B 1 39  ? 48.158  19.274 64.652  1.00 29.05  ? 39   LYS C C   1 
ATOM   1969 O  O   . LYS B 1 39  ? 49.228  19.029 65.192  1.00 27.22  ? 39   LYS C O   1 
ATOM   1970 C  CB  . LYS B 1 39  ? 48.042  17.717 62.712  1.00 28.59  ? 39   LYS C CB  1 
ATOM   1971 C  CG  . LYS B 1 39  ? 46.758  17.008 63.131  1.00 30.15  ? 39   LYS C CG  1 
ATOM   1972 C  CD  . LYS B 1 39  ? 46.740  15.468 62.895  1.00 29.81  ? 39   LYS C CD  1 
ATOM   1973 C  CE  . LYS B 1 39  ? 45.627  14.823 63.768  1.00 31.37  ? 39   LYS C CE  1 
ATOM   1974 N  NZ  . LYS B 1 39  ? 45.292  13.406 63.423  1.00 29.57  ? 39   LYS C NZ  1 
ATOM   1975 N  N   . GLY B 1 40  ? 47.076  19.656 65.329  1.00 29.05  ? 40   GLY C N   1 
ATOM   1976 C  CA  . GLY B 1 40  ? 47.115  19.743 66.798  1.00 29.29  ? 40   GLY C CA  1 
ATOM   1977 C  C   . GLY B 1 40  ? 47.540  21.131 67.293  1.00 28.90  ? 40   GLY C C   1 
ATOM   1978 O  O   . GLY B 1 40  ? 47.446  21.420 68.492  1.00 27.62  ? 40   GLY C O   1 
ATOM   1979 N  N   . SER B 1 41  ? 48.019  21.993 66.394  1.00 27.52  ? 41   SER C N   1 
ATOM   1980 C  CA  . SER B 1 41  ? 48.380  23.338 66.807  1.00 27.80  ? 41   SER C CA  1 
ATOM   1981 C  C   . SER B 1 41  ? 47.141  24.263 66.844  1.00 27.85  ? 41   SER C C   1 
ATOM   1982 O  O   . SER B 1 41  ? 46.134  24.049 66.099  1.00 26.68  ? 41   SER C O   1 
ATOM   1983 C  CB  . SER B 1 41  ? 49.473  23.916 65.907  1.00 29.88  ? 41   SER C CB  1 
ATOM   1984 O  OG  . SER B 1 41  ? 48.963  24.175 64.601  1.00 29.66  ? 41   SER C OG  1 
ATOM   1985 N  N   . ALA B 1 42  ? 47.255  25.278 67.718  1.00 26.39  ? 42   ALA C N   1 
ATOM   1986 C  CA  . ALA B 1 42  ? 46.296  26.308 67.934  1.00 27.55  ? 42   ALA C CA  1 
ATOM   1987 C  C   . ALA B 1 42  ? 46.357  27.417 66.870  1.00 27.05  ? 42   ALA C C   1 
ATOM   1988 O  O   . ALA B 1 42  ? 47.308  28.161 66.781  1.00 27.87  ? 42   ALA C O   1 
ATOM   1989 C  CB  . ALA B 1 42  ? 46.519  26.878 69.418  1.00 28.18  ? 42   ALA C CB  1 
ATOM   1990 N  N   . VAL B 1 43  ? 45.336  27.501 66.035  1.00 26.63  ? 43   VAL C N   1 
ATOM   1991 C  CA  . VAL B 1 43  ? 45.135  28.626 65.170  1.00 26.88  ? 43   VAL C CA  1 
ATOM   1992 C  C   . VAL B 1 43  ? 44.744  29.864 65.985  1.00 26.78  ? 43   VAL C C   1 
ATOM   1993 O  O   . VAL B 1 43  ? 45.279  30.997 65.781  1.00 25.65  ? 43   VAL C O   1 
ATOM   1994 C  CB  . VAL B 1 43  ? 44.054  28.305 64.068  1.00 26.62  ? 43   VAL C CB  1 
ATOM   1995 C  CG1 . VAL B 1 43  ? 43.848  29.526 63.138  1.00 28.15  ? 43   VAL C CG1 1 
ATOM   1996 C  CG2 . VAL B 1 43  ? 44.480  27.002 63.261  1.00 26.07  ? 43   VAL C CG2 1 
ATOM   1997 N  N   . ILE B 1 44  ? 43.819  29.650 66.906  1.00 26.12  ? 44   ILE C N   1 
ATOM   1998 C  CA  . ILE B 1 44  ? 43.535  30.679 67.931  1.00 27.46  ? 44   ILE C CA  1 
ATOM   1999 C  C   . ILE B 1 44  ? 43.750  30.072 69.297  1.00 28.16  ? 44   ILE C C   1 
ATOM   2000 O  O   . ILE B 1 44  ? 43.077  29.104 69.641  1.00 27.33  ? 44   ILE C O   1 
ATOM   2001 C  CB  . ILE B 1 44  ? 42.089  31.242 67.883  1.00 26.96  ? 44   ILE C CB  1 
ATOM   2002 C  CG1 . ILE B 1 44  ? 41.758  31.754 66.488  1.00 25.67  ? 44   ILE C CG1 1 
ATOM   2003 C  CG2 . ILE B 1 44  ? 41.908  32.338 68.942  1.00 24.07  ? 44   ILE C CG2 1 
ATOM   2004 C  CD1 . ILE B 1 44  ? 40.212  32.050 66.308  1.00 24.15  ? 44   ILE C CD1 1 
ATOM   2005 N  N   . MET B 1 45  ? 44.691  30.658 70.044  1.00 29.94  ? 45   MET C N   1 
ATOM   2006 C  CA  . MET B 1 45  ? 44.974  30.263 71.405  1.00 31.74  ? 45   MET C CA  1 
ATOM   2007 C  C   . MET B 1 45  ? 43.946  30.798 72.370  1.00 30.39  ? 45   MET C C   1 
ATOM   2008 O  O   . MET B 1 45  ? 43.351  31.845 72.110  1.00 29.12  ? 45   MET C O   1 
ATOM   2009 C  CB  . MET B 1 45  ? 46.362  30.772 71.844  1.00 31.87  ? 45   MET C CB  1 
ATOM   2010 C  CG  . MET B 1 45  ? 47.516  30.119 71.114  1.00 34.32  ? 45   MET C CG  1 
ATOM   2011 S  SD  . MET B 1 45  ? 49.153  30.927 71.342  1.00 37.22  ? 45   MET C SD  1 
ATOM   2012 C  CE  . MET B 1 45  ? 49.394  30.844 73.142  1.00 37.69  ? 45   MET C CE  1 
ATOM   2013 N  N   . PRO B 1 46  ? 43.759  30.095 73.521  1.00 29.82  ? 46   PRO C N   1 
ATOM   2014 C  CA  . PRO B 1 46  ? 42.807  30.547 74.528  1.00 29.78  ? 46   PRO C CA  1 
ATOM   2015 C  C   . PRO B 1 46  ? 43.260  31.855 75.153  1.00 30.42  ? 46   PRO C C   1 
ATOM   2016 O  O   . PRO B 1 46  ? 44.435  31.981 75.595  1.00 30.33  ? 46   PRO C O   1 
ATOM   2017 C  CB  . PRO B 1 46  ? 42.756  29.368 75.557  1.00 30.02  ? 46   PRO C CB  1 
ATOM   2018 C  CG  . PRO B 1 46  ? 43.409  28.261 74.930  1.00 30.03  ? 46   PRO C CG  1 
ATOM   2019 C  CD  . PRO B 1 46  ? 44.409  28.842 73.938  1.00 30.28  ? 46   PRO C CD  1 
ATOM   2020 N  N   . GLY B 1 47  ? 42.356  32.844 75.139  1.00 30.77  ? 47   GLY C N   1 
ATOM   2021 C  CA  . GLY B 1 47  ? 42.634  34.151 75.675  1.00 31.04  ? 47   GLY C CA  1 
ATOM   2022 C  C   . GLY B 1 47  ? 43.351  35.034 74.675  1.00 31.49  ? 47   GLY C C   1 
ATOM   2023 O  O   . GLY B 1 47  ? 43.690  36.158 74.981  1.00 32.83  ? 47   GLY C O   1 
ATOM   2024 N  N   . GLU B 1 48  ? 43.620  34.519 73.486  1.00 31.03  ? 48   GLU C N   1 
ATOM   2025 C  CA  . GLU B 1 48  ? 44.219  35.337 72.465  1.00 29.94  ? 48   GLU C CA  1 
ATOM   2026 C  C   . GLU B 1 48  ? 43.203  36.336 71.889  1.00 29.09  ? 48   GLU C C   1 
ATOM   2027 O  O   . GLU B 1 48  ? 42.081  35.953 71.495  1.00 28.69  ? 48   GLU C O   1 
ATOM   2028 C  CB  . GLU B 1 48  ? 44.829  34.463 71.355  1.00 29.38  ? 48   GLU C CB  1 
ATOM   2029 C  CG  . GLU B 1 48  ? 45.697  35.264 70.369  1.00 29.39  ? 48   GLU C CG  1 
ATOM   2030 C  CD  . GLU B 1 48  ? 46.226  34.436 69.200  1.00 32.04  ? 48   GLU C CD  1 
ATOM   2031 O  OE1 . GLU B 1 48  ? 45.953  33.227 69.172  1.00 33.78  ? 48   GLU C OE1 1 
ATOM   2032 O  OE2 . GLU B 1 48  ? 46.905  35.016 68.286  1.00 37.43  ? 48   GLU C OE2 1 
ATOM   2033 N  N   . GLU B 1 49  ? 43.654  37.585 71.758  1.00 29.10  ? 49   GLU C N   1 
ATOM   2034 C  CA  . GLU B 1 49  ? 42.880  38.690 71.240  1.00 31.75  ? 49   GLU C CA  1 
ATOM   2035 C  C   . GLU B 1 49  ? 43.046  38.698 69.709  1.00 28.18  ? 49   GLU C C   1 
ATOM   2036 O  O   . GLU B 1 49  ? 44.101  38.951 69.181  1.00 29.59  ? 49   GLU C O   1 
ATOM   2037 C  CB  . GLU B 1 49  ? 43.299  40.007 71.880  1.00 31.68  ? 49   GLU C CB  1 
ATOM   2038 C  CG  . GLU B 1 49  ? 42.928  40.139 73.335  1.00 36.58  ? 49   GLU C CG  1 
ATOM   2039 C  CD  . GLU B 1 49  ? 43.827  41.109 74.140  1.00 39.91  ? 49   GLU C CD  1 
ATOM   2040 O  OE1 . GLU B 1 49  ? 45.056  40.780 74.434  1.00 49.15  ? 49   GLU C OE1 1 
ATOM   2041 O  OE2 . GLU B 1 49  ? 43.285  42.197 74.550  1.00 50.33  ? 49   GLU C OE2 1 
ATOM   2042 N  N   . ILE B 1 50  ? 41.995  38.346 69.020  1.00 26.38  ? 50   ILE C N   1 
ATOM   2043 C  CA  . ILE B 1 50  ? 42.002  38.178 67.545  1.00 25.82  ? 50   ILE C CA  1 
ATOM   2044 C  C   . ILE B 1 50  ? 41.328  39.436 66.982  1.00 25.69  ? 50   ILE C C   1 
ATOM   2045 O  O   . ILE B 1 50  ? 40.230  39.814 67.431  1.00 24.40  ? 50   ILE C O   1 
ATOM   2046 C  CB  . ILE B 1 50  ? 41.308  36.821 67.094  1.00 24.27  ? 50   ILE C CB  1 
ATOM   2047 C  CG1 . ILE B 1 50  ? 42.015  35.553 67.682  1.00 24.28  ? 50   ILE C CG1 1 
ATOM   2048 C  CG2 . ILE B 1 50  ? 41.205  36.654 65.612  1.00 25.44  ? 50   ILE C CG2 1 
ATOM   2049 C  CD1 . ILE B 1 50  ? 43.369  35.213 67.102  1.00 23.57  ? 50   ILE C CD1 1 
ATOM   2050 N  N   . THR B 1 51  ? 41.990  40.077 65.997  1.00 26.73  ? 51   THR C N   1 
ATOM   2051 C  CA  . THR B 1 51  ? 41.435  41.300 65.306  1.00 26.05  ? 51   THR C CA  1 
ATOM   2052 C  C   . THR B 1 51  ? 41.718  41.164 63.819  1.00 26.71  ? 51   THR C C   1 
ATOM   2053 O  O   . THR B 1 51  ? 42.162  42.118 63.147  1.00 28.62  ? 51   THR C O   1 
ATOM   2054 C  CB  . THR B 1 51  ? 42.003  42.640 65.860  1.00 25.57  ? 51   THR C CB  1 
ATOM   2055 O  OG1 . THR B 1 51  ? 43.423  42.591 65.847  1.00 24.00  ? 51   THR C OG1 1 
ATOM   2056 C  CG2 . THR B 1 51  ? 41.532  42.981 67.291  1.00 26.42  ? 51   THR C CG2 1 
ATOM   2057 N  N   . SER B 1 52  ? 41.419  39.970 63.309  1.00 26.83  ? 52   SER C N   1 
ATOM   2058 C  CA  . SER B 1 52  ? 41.609  39.551 61.918  1.00 26.23  ? 52   SER C CA  1 
ATOM   2059 C  C   . SER B 1 52  ? 40.519  38.602 61.532  1.00 26.08  ? 52   SER C C   1 
ATOM   2060 O  O   . SER B 1 52  ? 40.059  37.842 62.371  1.00 25.00  ? 52   SER C O   1 
ATOM   2061 C  CB  . SER B 1 52  ? 42.900  38.781 61.750  1.00 25.97  ? 52   SER C CB  1 
ATOM   2062 O  OG  . SER B 1 52  ? 44.008  39.570 62.049  1.00 29.82  ? 52   SER C OG  1 
ATOM   2063 N  N   . MET B 1 53  ? 40.057  38.698 60.290  1.00 25.83  ? 53   MET C N   1 
ATOM   2064 C  CA  . MET B 1 53  ? 39.314  37.575 59.671  1.00 26.75  ? 53   MET C CA  1 
ATOM   2065 C  C   . MET B 1 53  ? 40.355  36.592 59.204  1.00 26.45  ? 53   MET C C   1 
ATOM   2066 O  O   . MET B 1 53  ? 41.453  36.958 58.764  1.00 27.00  ? 53   MET C O   1 
ATOM   2067 C  CB  . MET B 1 53  ? 38.355  38.005 58.539  1.00 26.41  ? 53   MET C CB  1 
ATOM   2068 C  CG  . MET B 1 53  ? 37.340  39.038 58.964  1.00 25.96  ? 53   MET C CG  1 
ATOM   2069 S  SD  . MET B 1 53  ? 36.025  39.060 57.889  1.00 29.88  ? 53   MET C SD  1 
ATOM   2070 C  CE  . MET B 1 53  ? 35.090  40.372 58.492  1.00 25.16  ? 53   MET C CE  1 
ATOM   2071 N  N   . ILE B 1 54  ? 40.040  35.326 59.379  1.00 26.06  ? 54   ILE C N   1 
ATOM   2072 C  CA  . ILE B 1 54  ? 40.974  34.275 59.093  1.00 25.23  ? 54   ILE C CA  1 
ATOM   2073 C  C   . ILE B 1 54  ? 40.318  33.378 58.078  1.00 25.32  ? 54   ILE C C   1 
ATOM   2074 O  O   . ILE B 1 54  ? 39.364  32.669 58.374  1.00 24.29  ? 54   ILE C O   1 
ATOM   2075 C  CB  . ILE B 1 54  ? 41.383  33.427 60.359  1.00 24.66  ? 54   ILE C CB  1 
ATOM   2076 C  CG1 . ILE B 1 54  ? 41.966  34.314 61.490  1.00 25.42  ? 54   ILE C CG1 1 
ATOM   2077 C  CG2 . ILE B 1 54  ? 42.422  32.329 60.008  1.00 23.15  ? 54   ILE C CG2 1 
ATOM   2078 C  CD1 . ILE B 1 54  ? 41.854  33.682 62.832  1.00 23.69  ? 54   ILE C CD1 1 
ATOM   2079 N  N   . PHE B 1 55  ? 40.900  33.386 56.901  1.00 26.11  ? 55   PHE C N   1 
ATOM   2080 C  CA  . PHE B 1 55  ? 40.409  32.603 55.789  1.00 26.86  ? 55   PHE C CA  1 
ATOM   2081 C  C   . PHE B 1 55  ? 41.159  31.262 55.745  1.00 26.17  ? 55   PHE C C   1 
ATOM   2082 O  O   . PHE B 1 55  ? 42.394  31.226 55.908  1.00 27.47  ? 55   PHE C O   1 
ATOM   2083 C  CB  . PHE B 1 55  ? 40.558  33.408 54.502  1.00 26.55  ? 55   PHE C CB  1 
ATOM   2084 C  CG  . PHE B 1 55  ? 40.120  32.691 53.301  1.00 26.87  ? 55   PHE C CG  1 
ATOM   2085 C  CD1 . PHE B 1 55  ? 38.797  32.398 53.133  1.00 27.32  ? 55   PHE C CD1 1 
ATOM   2086 C  CD2 . PHE B 1 55  ? 41.059  32.232 52.360  1.00 25.70  ? 55   PHE C CD2 1 
ATOM   2087 C  CE1 . PHE B 1 55  ? 38.358  31.728 51.953  1.00 27.11  ? 55   PHE C CE1 1 
ATOM   2088 C  CE2 . PHE B 1 55  ? 40.643  31.562 51.208  1.00 27.81  ? 55   PHE C CE2 1 
ATOM   2089 C  CZ  . PHE B 1 55  ? 39.272  31.318 51.017  1.00 27.00  ? 55   PHE C CZ  1 
ATOM   2090 N  N   . LEU B 1 56  ? 40.400  30.174 55.623  1.00 26.59  ? 56   LEU C N   1 
ATOM   2091 C  CA  . LEU B 1 56  ? 40.953  28.810 55.577  1.00 28.18  ? 56   LEU C CA  1 
ATOM   2092 C  C   . LEU B 1 56  ? 41.219  28.418 54.110  1.00 29.06  ? 56   LEU C C   1 
ATOM   2093 O  O   . LEU B 1 56  ? 40.302  28.139 53.305  1.00 29.16  ? 56   LEU C O   1 
ATOM   2094 C  CB  . LEU B 1 56  ? 40.027  27.832 56.320  1.00 28.44  ? 56   LEU C CB  1 
ATOM   2095 C  CG  . LEU B 1 56  ? 40.609  26.730 57.155  1.00 29.71  ? 56   LEU C CG  1 
ATOM   2096 C  CD1 . LEU B 1 56  ? 39.579  26.086 58.070  1.00 28.41  ? 56   LEU C CD1 1 
ATOM   2097 C  CD2 . LEU B 1 56  ? 41.298  25.678 56.185  1.00 26.58  ? 56   LEU C CD2 1 
ATOM   2098 N  N   . VAL B 1 57  ? 42.492  28.467 53.752  1.00 29.36  ? 57   VAL C N   1 
ATOM   2099 C  CA  . VAL B 1 57  ? 42.919  28.143 52.404  1.00 29.71  ? 57   VAL C CA  1 
ATOM   2100 C  C   . VAL B 1 57  ? 42.826  26.609 52.196  1.00 30.20  ? 57   VAL C C   1 
ATOM   2101 O  O   . VAL B 1 57  ? 42.177  26.148 51.289  1.00 30.47  ? 57   VAL C O   1 
ATOM   2102 C  CB  . VAL B 1 57  ? 44.351  28.673 52.111  1.00 29.83  ? 57   VAL C CB  1 
ATOM   2103 C  CG1 . VAL B 1 57  ? 44.714  28.454 50.606  1.00 27.46  ? 57   VAL C CG1 1 
ATOM   2104 C  CG2 . VAL B 1 57  ? 44.487  30.115 52.526  1.00 28.22  ? 57   VAL C CG2 1 
ATOM   2105 N  N   . GLU B 1 58  ? 43.445  25.838 53.077  1.00 30.29  ? 58   GLU C N   1 
ATOM   2106 C  CA  . GLU B 1 58  ? 43.367  24.390 53.023  1.00 31.47  ? 58   GLU C CA  1 
ATOM   2107 C  C   . GLU B 1 58  ? 43.510  23.858 54.432  1.00 30.88  ? 58   GLU C C   1 
ATOM   2108 O  O   . GLU B 1 58  ? 44.319  24.342 55.200  1.00 30.83  ? 58   GLU C O   1 
ATOM   2109 C  CB  . GLU B 1 58  ? 44.456  23.798 52.081  1.00 30.90  ? 58   GLU C CB  1 
ATOM   2110 C  CG  . GLU B 1 58  ? 45.884  24.131 52.501  1.00 33.53  ? 58   GLU C CG  1 
ATOM   2111 C  CD  . GLU B 1 58  ? 46.918  24.094 51.373  1.00 36.32  ? 58   GLU C CD  1 
ATOM   2112 O  OE1 . GLU B 1 58  ? 47.518  23.013 51.152  1.00 38.38  ? 58   GLU C OE1 1 
ATOM   2113 O  OE2 . GLU B 1 58  ? 47.130  25.167 50.710  1.00 43.75  ? 58   GLU C OE2 1 
ATOM   2114 N  N   . GLY B 1 59  ? 42.712  22.858 54.763  1.00 30.55  ? 59   GLY C N   1 
ATOM   2115 C  CA  . GLY B 1 59  ? 42.801  22.215 56.051  1.00 29.47  ? 59   GLY C CA  1 
ATOM   2116 C  C   . GLY B 1 59  ? 41.486  22.014 56.761  1.00 29.29  ? 59   GLY C C   1 
ATOM   2117 O  O   . GLY B 1 59  ? 40.423  21.867 56.148  1.00 28.42  ? 59   GLY C O   1 
ATOM   2118 N  N   . LYS B 1 60  ? 41.566  22.051 58.079  1.00 28.87  ? 60   LYS C N   1 
ATOM   2119 C  CA  . LYS B 1 60  ? 40.420  21.794 58.910  1.00 29.45  ? 60   LYS C CA  1 
ATOM   2120 C  C   . LYS B 1 60  ? 40.685  22.364 60.321  1.00 28.96  ? 60   LYS C C   1 
ATOM   2121 O  O   . LYS B 1 60  ? 41.740  22.096 60.895  1.00 27.72  ? 60   LYS C O   1 
ATOM   2122 C  CB  . LYS B 1 60  ? 40.134  20.292 58.942  1.00 30.10  ? 60   LYS C CB  1 
ATOM   2123 C  CG  . LYS B 1 60  ? 38.733  19.950 59.335  1.00 32.93  ? 60   LYS C CG  1 
ATOM   2124 C  CD  . LYS B 1 60  ? 38.516  18.502 59.163  1.00 35.79  ? 60   LYS C CD  1 
ATOM   2125 C  CE  . LYS B 1 60  ? 37.392  17.945 60.034  1.00 37.88  ? 60   LYS C CE  1 
ATOM   2126 N  NZ  . LYS B 1 60  ? 36.100  18.643 59.739  1.00 38.27  ? 60   LYS C NZ  1 
ATOM   2127 N  N   . ILE B 1 61  ? 39.746  23.181 60.829  1.00 29.42  ? 61   ILE C N   1 
ATOM   2128 C  CA  . ILE B 1 61  ? 39.829  23.790 62.188  1.00 28.80  ? 61   ILE C CA  1 
ATOM   2129 C  C   . ILE B 1 61  ? 38.594  23.374 63.048  1.00 28.42  ? 61   ILE C C   1 
ATOM   2130 O  O   . ILE B 1 61  ? 37.499  23.327 62.538  1.00 30.59  ? 61   ILE C O   1 
ATOM   2131 C  CB  . ILE B 1 61  ? 39.950  25.372 62.050  1.00 29.88  ? 61   ILE C CB  1 
ATOM   2132 C  CG1 . ILE B 1 61  ? 41.329  25.721 61.455  1.00 28.53  ? 61   ILE C CG1 1 
ATOM   2133 C  CG2 . ILE B 1 61  ? 39.684  26.096 63.432  1.00 30.32  ? 61   ILE C CG2 1 
ATOM   2134 C  CD1 . ILE B 1 61  ? 41.562  27.175 60.972  1.00 29.89  ? 61   ILE C CD1 1 
ATOM   2135 N  N   . LYS B 1 62  ? 38.785  23.043 64.325  1.00 27.02  ? 62   LYS C N   1 
ATOM   2136 C  CA  . LYS B 1 62  ? 37.696  22.928 65.284  1.00 26.08  ? 62   LYS C CA  1 
ATOM   2137 C  C   . LYS B 1 62  ? 37.730  24.234 66.106  1.00 24.86  ? 62   LYS C C   1 
ATOM   2138 O  O   . LYS B 1 62  ? 38.742  24.544 66.672  1.00 23.25  ? 62   LYS C O   1 
ATOM   2139 C  CB  . LYS B 1 62  ? 37.842  21.674 66.172  1.00 26.61  ? 62   LYS C CB  1 
ATOM   2140 C  CG  . LYS B 1 62  ? 36.615  21.409 67.079  1.00 25.61  ? 62   LYS C CG  1 
ATOM   2141 C  CD  . LYS B 1 62  ? 36.823  20.291 68.161  1.00 28.57  ? 62   LYS C CD  1 
ATOM   2142 C  CE  . LYS B 1 62  ? 36.019  20.610 69.456  1.00 29.13  ? 62   LYS C CE  1 
ATOM   2143 N  NZ  . LYS B 1 62  ? 35.303  19.431 69.973  1.00 36.04  ? 62   LYS C NZ  1 
ATOM   2144 N  N   . LEU B 1 63  ? 36.641  25.013 66.091  1.00 23.92  ? 63   LEU C N   1 
ATOM   2145 C  CA  . LEU B 1 63  ? 36.571  26.291 66.842  1.00 24.69  ? 63   LEU C CA  1 
ATOM   2146 C  C   . LEU B 1 63  ? 35.593  26.174 67.998  1.00 23.63  ? 63   LEU C C   1 
ATOM   2147 O  O   . LEU B 1 63  ? 34.429  25.902 67.831  1.00 22.27  ? 63   LEU C O   1 
ATOM   2148 C  CB  . LEU B 1 63  ? 36.250  27.473 65.889  1.00 23.80  ? 63   LEU C CB  1 
ATOM   2149 C  CG  . LEU B 1 63  ? 36.365  28.865 66.483  1.00 26.15  ? 63   LEU C CG  1 
ATOM   2150 C  CD1 . LEU B 1 63  ? 36.772  29.923 65.389  1.00 22.02  ? 63   LEU C CD1 1 
ATOM   2151 C  CD2 . LEU B 1 63  ? 35.064  29.202 67.240  1.00 26.41  ? 63   LEU C CD2 1 
ATOM   2152 N  N   . ASP B 1 64  ? 36.131  26.346 69.205  1.00 23.78  ? 64   ASP C N   1 
ATOM   2153 C  CA  . ASP B 1 64  ? 35.391  26.214 70.422  1.00 23.86  ? 64   ASP C CA  1 
ATOM   2154 C  C   . ASP B 1 64  ? 35.347  27.524 71.217  1.00 24.14  ? 64   ASP C C   1 
ATOM   2155 O  O   . ASP B 1 64  ? 36.171  28.411 71.011  1.00 23.26  ? 64   ASP C O   1 
ATOM   2156 C  CB  . ASP B 1 64  ? 36.084  25.192 71.324  1.00 23.37  ? 64   ASP C CB  1 
ATOM   2157 C  CG  . ASP B 1 64  ? 35.957  23.767 70.825  1.00 23.55  ? 64   ASP C CG  1 
ATOM   2158 O  OD1 . ASP B 1 64  ? 35.286  23.504 69.791  1.00 22.96  ? 64   ASP C OD1 1 
ATOM   2159 O  OD2 . ASP B 1 64  ? 36.512  22.852 71.509  1.00 27.89  ? 64   ASP C OD2 1 
ATOM   2160 N  N   . ILE B 1 65  ? 34.368  27.597 72.128  1.00 23.47  ? 65   ILE C N   1 
ATOM   2161 C  CA  . ILE B 1 65  ? 34.312  28.611 73.145  1.00 22.14  ? 65   ILE C CA  1 
ATOM   2162 C  C   . ILE B 1 65  ? 34.733  28.000 74.523  1.00 22.16  ? 65   ILE C C   1 
ATOM   2163 O  O   . ILE B 1 65  ? 34.410  26.870 74.889  1.00 21.49  ? 65   ILE C O   1 
ATOM   2164 C  CB  . ILE B 1 65  ? 32.918  29.290 73.210  1.00 23.14  ? 65   ILE C CB  1 
ATOM   2165 C  CG1 . ILE B 1 65  ? 32.996  30.531 74.146  1.00 22.82  ? 65   ILE C CG1 1 
ATOM   2166 C  CG2 . ILE B 1 65  ? 31.764  28.270 73.559  1.00 20.02  ? 65   ILE C CG2 1 
ATOM   2167 C  CD1 . ILE B 1 65  ? 31.731  31.497 74.096  1.00 21.97  ? 65   ILE C CD1 1 
ATOM   2168 N  N   . ILE B 1 66  ? 35.448  28.781 75.297  1.00 23.07  ? 66   ILE C N   1 
ATOM   2169 C  CA  . ILE B 1 66  ? 35.875  28.398 76.620  1.00 22.54  ? 66   ILE C CA  1 
ATOM   2170 C  C   . ILE B 1 66  ? 35.255  29.343 77.664  1.00 22.45  ? 66   ILE C C   1 
ATOM   2171 O  O   . ILE B 1 66  ? 35.341  30.529 77.562  1.00 22.30  ? 66   ILE C O   1 
ATOM   2172 C  CB  . ILE B 1 66  ? 37.415  28.430 76.722  1.00 21.46  ? 66   ILE C CB  1 
ATOM   2173 C  CG1 . ILE B 1 66  ? 38.092  27.525 75.682  1.00 24.42  ? 66   ILE C CG1 1 
ATOM   2174 C  CG2 . ILE B 1 66  ? 37.929  28.049 78.162  1.00 20.52  ? 66   ILE C CG2 1 
ATOM   2175 C  CD1 . ILE B 1 66  ? 39.651  27.568 75.750  1.00 23.99  ? 66   ILE C CD1 1 
ATOM   2176 N  N   . PHE B 1 67  ? 34.711  28.767 78.737  1.00 24.46  ? 67   PHE C N   1 
ATOM   2177 C  CA  . PHE B 1 67  ? 34.224  29.537 79.820  1.00 25.82  ? 67   PHE C CA  1 
ATOM   2178 C  C   . PHE B 1 67  ? 35.324  29.639 80.925  1.00 26.59  ? 67   PHE C C   1 
ATOM   2179 O  O   . PHE B 1 67  ? 36.357  28.956 80.899  1.00 26.41  ? 67   PHE C O   1 
ATOM   2180 C  CB  . PHE B 1 67  ? 32.886  28.958 80.294  1.00 26.24  ? 67   PHE C CB  1 
ATOM   2181 C  CG  . PHE B 1 67  ? 31.773  29.140 79.305  1.00 28.08  ? 67   PHE C CG  1 
ATOM   2182 C  CD1 . PHE B 1 67  ? 31.254  30.400 79.041  1.00 27.58  ? 67   PHE C CD1 1 
ATOM   2183 C  CD2 . PHE B 1 67  ? 31.232  28.069 78.655  1.00 29.35  ? 67   PHE C CD2 1 
ATOM   2184 C  CE1 . PHE B 1 67  ? 30.215  30.563 78.073  1.00 28.15  ? 67   PHE C CE1 1 
ATOM   2185 C  CE2 . PHE B 1 67  ? 30.209  28.206 77.750  1.00 28.14  ? 67   PHE C CE2 1 
ATOM   2186 C  CZ  . PHE B 1 67  ? 29.679  29.427 77.437  1.00 26.80  ? 67   PHE C CZ  1 
ATOM   2187 N  N   . GLU B 1 68  ? 35.091  30.544 81.854  1.00 27.05  ? 68   GLU C N   1 
ATOM   2188 C  CA  . GLU B 1 68  ? 36.004  30.906 82.972  1.00 27.49  ? 68   GLU C CA  1 
ATOM   2189 C  C   . GLU B 1 68  ? 36.491  29.727 83.826  1.00 25.95  ? 68   GLU C C   1 
ATOM   2190 O  O   . GLU B 1 68  ? 37.593  29.728 84.369  1.00 24.16  ? 68   GLU C O   1 
ATOM   2191 C  CB  . GLU B 1 68  ? 35.234  31.905 83.871  1.00 28.97  ? 68   GLU C CB  1 
ATOM   2192 C  CG  . GLU B 1 68  ? 34.406  33.048 83.068  1.00 35.12  ? 68   GLU C CG  1 
ATOM   2193 C  CD  . GLU B 1 68  ? 33.051  32.635 82.242  1.00 36.73  ? 68   GLU C CD  1 
ATOM   2194 O  OE1 . GLU B 1 68  ? 32.156  31.981 82.768  1.00 44.52  ? 68   GLU C OE1 1 
ATOM   2195 O  OE2 . GLU B 1 68  ? 32.887  33.017 81.087  1.00 37.11  ? 68   GLU C OE2 1 
ATOM   2196 N  N   . ASP B 1 69  ? 35.657  28.698 83.928  1.00 25.19  ? 69   ASP C N   1 
ATOM   2197 C  CA  . ASP B 1 69  ? 35.983  27.498 84.642  1.00 25.57  ? 69   ASP C CA  1 
ATOM   2198 C  C   . ASP B 1 69  ? 36.717  26.432 83.828  1.00 24.59  ? 69   ASP C C   1 
ATOM   2199 O  O   . ASP B 1 69  ? 36.911  25.287 84.293  1.00 24.45  ? 69   ASP C O   1 
ATOM   2200 C  CB  . ASP B 1 69  ? 34.719  26.915 85.289  1.00 26.09  ? 69   ASP C CB  1 
ATOM   2201 C  CG  . ASP B 1 69  ? 33.676  26.439 84.263  1.00 29.28  ? 69   ASP C CG  1 
ATOM   2202 O  OD1 . ASP B 1 69  ? 33.951  26.321 83.031  1.00 29.97  ? 69   ASP C OD1 1 
ATOM   2203 O  OD2 . ASP B 1 69  ? 32.552  26.173 84.710  1.00 38.05  ? 69   ASP C OD2 1 
ATOM   2204 N  N   . GLY B 1 70  ? 37.092  26.792 82.621  1.00 23.39  ? 70   GLY C N   1 
ATOM   2205 C  CA  . GLY B 1 70  ? 37.805  25.913 81.762  1.00 24.54  ? 70   GLY C CA  1 
ATOM   2206 C  C   . GLY B 1 70  ? 36.978  25.042 80.838  1.00 23.32  ? 70   GLY C C   1 
ATOM   2207 O  O   . GLY B 1 70  ? 37.486  24.485 79.877  1.00 23.70  ? 70   GLY C O   1 
ATOM   2208 N  N   . SER B 1 71  ? 35.715  24.893 81.159  1.00 24.05  ? 71   SER C N   1 
ATOM   2209 C  CA  . SER B 1 71  ? 34.816  24.159 80.298  1.00 25.09  ? 71   SER C CA  1 
ATOM   2210 C  C   . SER B 1 71  ? 34.638  24.830 78.909  1.00 24.20  ? 71   SER C C   1 
ATOM   2211 O  O   . SER B 1 71  ? 34.782  26.024 78.721  1.00 25.23  ? 71   SER C O   1 
ATOM   2212 C  CB  . SER B 1 71  ? 33.485  23.841 81.001  1.00 25.42  ? 71   SER C CB  1 
ATOM   2213 O  OG  . SER B 1 71  ? 32.666  24.959 81.133  1.00 27.65  ? 71   SER C OG  1 
ATOM   2214 N  N   . GLU B 1 72  ? 34.418  23.977 77.931  1.00 23.47  ? 72   GLU C N   1 
ATOM   2215 C  CA  . GLU B 1 72  ? 34.613  24.261 76.550  1.00 24.53  ? 72   GLU C CA  1 
ATOM   2216 C  C   . GLU B 1 72  ? 33.442  23.582 75.757  1.00 23.04  ? 72   GLU C C   1 
ATOM   2217 O  O   . GLU B 1 72  ? 33.026  22.440 76.082  1.00 21.15  ? 72   GLU C O   1 
ATOM   2218 C  CB  . GLU B 1 72  ? 35.939  23.603 76.128  1.00 24.71  ? 72   GLU C CB  1 
ATOM   2219 C  CG  . GLU B 1 72  ? 36.393  24.013 74.790  1.00 26.66  ? 72   GLU C CG  1 
ATOM   2220 C  CD  . GLU B 1 72  ? 37.809  23.533 74.454  1.00 27.27  ? 72   GLU C CD  1 
ATOM   2221 O  OE1 . GLU B 1 72  ? 38.624  23.319 75.380  1.00 26.94  ? 72   GLU C OE1 1 
ATOM   2222 O  OE2 . GLU B 1 72  ? 38.062  23.340 73.237  1.00 29.13  ? 72   GLU C OE2 1 
ATOM   2223 N  N   . LYS B 1 73  ? 32.946  24.294 74.756  1.00 22.99  ? 73   LYS C N   1 
ATOM   2224 C  CA  . LYS B 1 73  ? 31.968  23.745 73.826  1.00 23.36  ? 73   LYS C CA  1 
ATOM   2225 C  C   . LYS B 1 73  ? 32.371  24.048 72.404  1.00 22.71  ? 73   LYS C C   1 
ATOM   2226 O  O   . LYS B 1 73  ? 32.857  25.134 72.115  1.00 23.12  ? 73   LYS C O   1 
ATOM   2227 C  CB  . LYS B 1 73  ? 30.574  24.319 74.100  1.00 23.60  ? 73   LYS C CB  1 
ATOM   2228 C  CG  . LYS B 1 73  ? 29.979  23.976 75.387  1.00 24.05  ? 73   LYS C CG  1 
ATOM   2229 C  CD  . LYS B 1 73  ? 29.729  22.509 75.487  1.00 24.72  ? 73   LYS C CD  1 
ATOM   2230 C  CE  . LYS B 1 73  ? 29.080  22.221 76.765  1.00 28.77  ? 73   LYS C CE  1 
ATOM   2231 N  NZ  . LYS B 1 73  ? 29.293  20.828 77.211  1.00 32.77  ? 73   LYS C NZ  1 
ATOM   2232 N  N   . LEU B 1 74  ? 32.049  23.123 71.496  1.00 24.03  ? 74   LEU C N   1 
ATOM   2233 C  CA  . LEU B 1 74  ? 32.030  23.389 70.033  1.00 23.12  ? 74   LEU C CA  1 
ATOM   2234 C  C   . LEU B 1 74  ? 31.163  24.587 69.635  1.00 23.06  ? 74   LEU C C   1 
ATOM   2235 O  O   . LEU B 1 74  ? 30.037  24.734 70.066  1.00 22.04  ? 74   LEU C O   1 
ATOM   2236 C  CB  . LEU B 1 74  ? 31.514  22.184 69.248  1.00 24.13  ? 74   LEU C CB  1 
ATOM   2237 C  CG  . LEU B 1 74  ? 31.548  22.168 67.706  1.00 22.52  ? 74   LEU C CG  1 
ATOM   2238 C  CD1 . LEU B 1 74  ? 32.962  22.213 67.246  1.00 20.06  ? 74   LEU C CD1 1 
ATOM   2239 C  CD2 . LEU B 1 74  ? 30.901  20.812 67.251  1.00 23.51  ? 74   LEU C CD2 1 
ATOM   2240 N  N   . LEU B 1 75  ? 31.725  25.432 68.826  1.00 22.78  ? 75   LEU C N   1 
ATOM   2241 C  CA  . LEU B 1 75  ? 30.944  26.295 68.011  1.00 24.86  ? 75   LEU C CA  1 
ATOM   2242 C  C   . LEU B 1 75  ? 30.831  25.797 66.538  1.00 25.17  ? 75   LEU C C   1 
ATOM   2243 O  O   . LEU B 1 75  ? 29.716  25.663 65.988  1.00 25.19  ? 75   LEU C O   1 
ATOM   2244 C  CB  . LEU B 1 75  ? 31.487  27.731 68.099  1.00 25.59  ? 75   LEU C CB  1 
ATOM   2245 C  CG  . LEU B 1 75  ? 31.459  28.438 69.470  1.00 25.71  ? 75   LEU C CG  1 
ATOM   2246 C  CD1 . LEU B 1 75  ? 31.941  29.934 69.239  1.00 25.37  ? 75   LEU C CD1 1 
ATOM   2247 C  CD2 . LEU B 1 75  ? 30.083  28.436 70.179  1.00 23.20  ? 75   LEU C CD2 1 
ATOM   2248 N  N   . TYR B 1 76  ? 31.963  25.525 65.905  1.00 24.53  ? 76   TYR C N   1 
ATOM   2249 C  CA  . TYR B 1 76  ? 31.920  24.972 64.608  1.00 24.05  ? 76   TYR C CA  1 
ATOM   2250 C  C   . TYR B 1 76  ? 33.197  24.330 64.139  1.00 24.68  ? 76   TYR C C   1 
ATOM   2251 O  O   . TYR B 1 76  ? 34.254  24.603 64.638  1.00 24.11  ? 76   TYR C O   1 
ATOM   2252 C  CB  . TYR B 1 76  ? 31.431  25.998 63.601  1.00 24.29  ? 76   TYR C CB  1 
ATOM   2253 C  CG  . TYR B 1 76  ? 32.285  27.247 63.354  1.00 22.84  ? 76   TYR C CG  1 
ATOM   2254 C  CD1 . TYR B 1 76  ? 31.869  28.523 63.789  1.00 26.87  ? 76   TYR C CD1 1 
ATOM   2255 C  CD2 . TYR B 1 76  ? 33.469  27.161 62.638  1.00 25.55  ? 76   TYR C CD2 1 
ATOM   2256 C  CE1 . TYR B 1 76  ? 32.615  29.647 63.505  1.00 24.33  ? 76   TYR C CE1 1 
ATOM   2257 C  CE2 . TYR B 1 76  ? 34.261  28.284 62.377  1.00 27.78  ? 76   TYR C CE2 1 
ATOM   2258 C  CZ  . TYR B 1 76  ? 33.817  29.508 62.786  1.00 26.36  ? 76   TYR C CZ  1 
ATOM   2259 O  OH  . TYR B 1 76  ? 34.614  30.586 62.445  1.00 26.59  ? 76   TYR C OH  1 
ATOM   2260 N  N   . TYR B 1 77  ? 33.038  23.556 63.071  1.00 25.98  ? 77   TYR C N   1 
ATOM   2261 C  CA  . TYR B 1 77  ? 34.129  23.095 62.255  1.00 26.85  ? 77   TYR C CA  1 
ATOM   2262 C  C   . TYR B 1 77  ? 34.188  23.913 60.968  1.00 26.15  ? 77   TYR C C   1 
ATOM   2263 O  O   . TYR B 1 77  ? 33.167  24.390 60.454  1.00 26.20  ? 77   TYR C O   1 
ATOM   2264 C  CB  . TYR B 1 77  ? 33.946  21.601 61.912  1.00 27.19  ? 77   TYR C CB  1 
ATOM   2265 C  CG  . TYR B 1 77  ? 34.030  20.686 63.085  1.00 28.98  ? 77   TYR C CG  1 
ATOM   2266 C  CD1 . TYR B 1 77  ? 35.277  20.231 63.564  1.00 29.30  ? 77   TYR C CD1 1 
ATOM   2267 C  CD2 . TYR B 1 77  ? 32.866  20.229 63.715  1.00 29.79  ? 77   TYR C CD2 1 
ATOM   2268 C  CE1 . TYR B 1 77  ? 35.343  19.354 64.686  1.00 30.23  ? 77   TYR C CE1 1 
ATOM   2269 C  CE2 . TYR B 1 77  ? 32.938  19.341 64.813  1.00 32.52  ? 77   TYR C CE2 1 
ATOM   2270 C  CZ  . TYR B 1 77  ? 34.168  18.945 65.297  1.00 27.53  ? 77   TYR C CZ  1 
ATOM   2271 O  OH  . TYR B 1 77  ? 34.186  18.076 66.330  1.00 33.35  ? 77   TYR C OH  1 
ATOM   2272 N  N   . ALA B 1 78  ? 35.387  24.016 60.448  1.00 25.84  ? 78   ALA C N   1 
ATOM   2273 C  CA  . ALA B 1 78  ? 35.693  24.859 59.301  1.00 26.70  ? 78   ALA C CA  1 
ATOM   2274 C  C   . ALA B 1 78  ? 36.665  24.111 58.449  1.00 26.73  ? 78   ALA C C   1 
ATOM   2275 O  O   . ALA B 1 78  ? 37.632  23.542 58.964  1.00 27.64  ? 78   ALA C O   1 
ATOM   2276 C  CB  . ALA B 1 78  ? 36.304  26.143 59.788  1.00 26.63  ? 78   ALA C CB  1 
ATOM   2277 N  N   . GLY B 1 79  ? 36.416  24.092 57.131  1.00 27.51  ? 79   GLY C N   1 
ATOM   2278 C  CA  . GLY B 1 79  ? 37.268  23.464 56.149  1.00 26.60  ? 79   GLY C CA  1 
ATOM   2279 C  C   . GLY B 1 79  ? 37.720  24.477 55.122  1.00 26.72  ? 79   GLY C C   1 
ATOM   2280 O  O   . GLY B 1 79  ? 37.659  25.678 55.352  1.00 26.81  ? 79   GLY C O   1 
ATOM   2281 N  N   . GLY B 1 80  ? 38.179  24.000 53.984  1.00 25.09  ? 80   GLY C N   1 
ATOM   2282 C  CA  . GLY B 1 80  ? 38.742  24.896 52.972  1.00 25.63  ? 80   GLY C CA  1 
ATOM   2283 C  C   . GLY B 1 80  ? 37.692  25.856 52.472  1.00 25.54  ? 80   GLY C C   1 
ATOM   2284 O  O   . GLY B 1 80  ? 36.544  25.446 52.260  1.00 24.79  ? 80   GLY C O   1 
ATOM   2285 N  N   . ASN B 1 81  ? 38.049  27.160 52.392  1.00 26.65  ? 81   ASN C N   1 
ATOM   2286 C  CA  . ASN B 1 81  ? 37.154  28.243 51.996  1.00 25.77  ? 81   ASN C CA  1 
ATOM   2287 C  C   . ASN B 1 81  ? 36.238  28.756 53.104  1.00 27.61  ? 81   ASN C C   1 
ATOM   2288 O  O   . ASN B 1 81  ? 35.420  29.646 52.888  1.00 26.43  ? 81   ASN C O   1 
ATOM   2289 C  CB  . ASN B 1 81  ? 36.383  27.903 50.671  1.00 25.97  ? 81   ASN C CB  1 
ATOM   2290 C  CG  . ASN B 1 81  ? 37.317  27.602 49.544  1.00 25.65  ? 81   ASN C CG  1 
ATOM   2291 O  OD1 . ASN B 1 81  ? 38.341  28.256 49.405  1.00 23.68  ? 81   ASN C OD1 1 
ATOM   2292 N  ND2 . ASN B 1 81  ? 37.052  26.532 48.818  1.00 26.62  ? 81   ASN C ND2 1 
ATOM   2293 N  N   . SER B 1 82  ? 36.395  28.204 54.308  1.00 27.50  ? 82   SER C N   1 
ATOM   2294 C  CA  . SER B 1 82  ? 35.763  28.793 55.464  1.00 27.28  ? 82   SER C CA  1 
ATOM   2295 C  C   . SER B 1 82  ? 36.442  30.093 55.958  1.00 26.30  ? 82   SER C C   1 
ATOM   2296 O  O   . SER B 1 82  ? 37.642  30.326 55.741  1.00 25.99  ? 82   SER C O   1 
ATOM   2297 C  CB  . SER B 1 82  ? 35.715  27.786 56.601  1.00 27.49  ? 82   SER C CB  1 
ATOM   2298 O  OG  . SER B 1 82  ? 34.781  26.797 56.354  1.00 27.25  ? 82   SER C OG  1 
ATOM   2299 N  N   . LEU B 1 83  ? 35.619  30.908 56.628  1.00 25.79  ? 83   LEU C N   1 
ATOM   2300 C  CA  . LEU B 1 83  ? 35.976  32.203 57.146  1.00 26.45  ? 83   LEU C CA  1 
ATOM   2301 C  C   . LEU B 1 83  ? 35.683  32.281 58.639  1.00 25.69  ? 83   LEU C C   1 
ATOM   2302 O  O   . LEU B 1 83  ? 34.568  32.024 59.055  1.00 26.80  ? 83   LEU C O   1 
ATOM   2303 C  CB  . LEU B 1 83  ? 35.204  33.315 56.434  1.00 26.04  ? 83   LEU C CB  1 
ATOM   2304 C  CG  . LEU B 1 83  ? 35.752  34.721 56.752  1.00 27.99  ? 83   LEU C CG  1 
ATOM   2305 C  CD1 . LEU B 1 83  ? 37.280  34.920 56.359  1.00 24.00  ? 83   LEU C CD1 1 
ATOM   2306 C  CD2 . LEU B 1 83  ? 34.829  35.758 56.128  1.00 26.15  ? 83   LEU C CD2 1 
ATOM   2307 N  N   . ILE B 1 84  ? 36.683  32.661 59.409  1.00 24.77  ? 84   ILE C N   1 
ATOM   2308 C  CA  . ILE B 1 84  ? 36.509  33.031 60.810  1.00 25.39  ? 84   ILE C CA  1 
ATOM   2309 C  C   . ILE B 1 84  ? 36.374  34.552 60.843  1.00 25.50  ? 84   ILE C C   1 
ATOM   2310 O  O   . ILE B 1 84  ? 37.215  35.242 60.365  1.00 25.83  ? 84   ILE C O   1 
ATOM   2311 C  CB  . ILE B 1 84  ? 37.659  32.567 61.740  1.00 25.16  ? 84   ILE C CB  1 
ATOM   2312 C  CG1 . ILE B 1 84  ? 37.938  31.066 61.533  1.00 28.08  ? 84   ILE C CG1 1 
ATOM   2313 C  CG2 . ILE B 1 84  ? 37.289  32.788 63.255  1.00 25.07  ? 84   ILE C CG2 1 
ATOM   2314 C  CD1 . ILE B 1 84  ? 39.314  30.522 62.105  1.00 26.74  ? 84   ILE C CD1 1 
ATOM   2315 N  N   . GLY B 1 85  ? 35.297  35.047 61.426  1.00 25.10  ? 85   GLY C N   1 
ATOM   2316 C  CA  . GLY B 1 85  ? 34.912  36.466 61.306  1.00 24.06  ? 85   GLY C CA  1 
ATOM   2317 C  C   . GLY B 1 85  ? 35.197  37.369 62.471  1.00 23.69  ? 85   GLY C C   1 
ATOM   2318 O  O   . GLY B 1 85  ? 34.537  38.379 62.705  1.00 20.61  ? 85   GLY C O   1 
ATOM   2319 N  N   . LYS B 1 86  ? 36.249  36.998 63.177  1.00 24.20  ? 86   LYS C N   1 
ATOM   2320 C  CA  . LYS B 1 86  ? 36.664  37.638 64.417  1.00 24.68  ? 86   LYS C CA  1 
ATOM   2321 C  C   . LYS B 1 86  ? 37.564  38.865 64.238  1.00 23.25  ? 86   LYS C C   1 
ATOM   2322 O  O   . LYS B 1 86  ? 38.645  38.925 64.711  1.00 20.14  ? 86   LYS C O   1 
ATOM   2323 C  CB  . LYS B 1 86  ? 37.311  36.575 65.311  1.00 24.35  ? 86   LYS C CB  1 
ATOM   2324 C  CG  . LYS B 1 86  ? 36.271  35.550 65.844  1.00 22.42  ? 86   LYS C CG  1 
ATOM   2325 C  CD  . LYS B 1 86  ? 36.897  34.476 66.647  1.00 24.64  ? 86   LYS C CD  1 
ATOM   2326 C  CE  . LYS B 1 86  ? 37.733  35.009 67.842  1.00 23.47  ? 86   LYS C CE  1 
ATOM   2327 N  NZ  . LYS B 1 86  ? 37.047  35.989 68.820  1.00 24.45  ? 86   LYS C NZ  1 
ATOM   2328 N  N   . LEU B 1 87  ? 37.018  39.860 63.593  1.00 24.55  ? 87   LEU C N   1 
ATOM   2329 C  CA  . LEU B 1 87  ? 37.738  41.048 63.202  1.00 24.99  ? 87   LEU C CA  1 
ATOM   2330 C  C   . LEU B 1 87  ? 37.903  42.021 64.346  1.00 23.65  ? 87   LEU C C   1 
ATOM   2331 O  O   . LEU B 1 87  ? 38.806  42.846 64.333  1.00 23.33  ? 87   LEU C O   1 
ATOM   2332 C  CB  . LEU B 1 87  ? 37.068  41.680 62.000  1.00 24.88  ? 87   LEU C CB  1 
ATOM   2333 C  CG  . LEU B 1 87  ? 37.865  42.814 61.323  1.00 27.96  ? 87   LEU C CG  1 
ATOM   2334 C  CD1 . LEU B 1 87  ? 39.234  42.367 60.869  1.00 22.07  ? 87   LEU C CD1 1 
ATOM   2335 C  CD2 . LEU B 1 87  ? 37.057  43.432 60.164  1.00 24.93  ? 87   LEU C CD2 1 
ATOM   2336 N  N   . TYR B 1 88  ? 37.032  41.910 65.341  1.00 23.59  ? 88   TYR C N   1 
ATOM   2337 C  CA  . TYR B 1 88  ? 36.975  42.810 66.461  1.00 23.45  ? 88   TYR C CA  1 
ATOM   2338 C  C   . TYR B 1 88  ? 36.746  41.953 67.706  1.00 24.57  ? 88   TYR C C   1 
ATOM   2339 O  O   . TYR B 1 88  ? 36.215  40.835 67.587  1.00 24.14  ? 88   TYR C O   1 
ATOM   2340 C  CB  . TYR B 1 88  ? 35.779  43.747 66.346  1.00 23.73  ? 88   TYR C CB  1 
ATOM   2341 C  CG  . TYR B 1 88  ? 35.803  44.506 65.039  1.00 22.63  ? 88   TYR C CG  1 
ATOM   2342 C  CD1 . TYR B 1 88  ? 36.751  45.526 64.825  1.00 25.08  ? 88   TYR C CD1 1 
ATOM   2343 C  CD2 . TYR B 1 88  ? 34.952  44.183 64.004  1.00 24.46  ? 88   TYR C CD2 1 
ATOM   2344 C  CE1 . TYR B 1 88  ? 36.784  46.239 63.629  1.00 25.71  ? 88   TYR C CE1 1 
ATOM   2345 C  CE2 . TYR B 1 88  ? 34.990  44.913 62.782  1.00 24.61  ? 88   TYR C CE2 1 
ATOM   2346 C  CZ  . TYR B 1 88  ? 35.892  45.921 62.617  1.00 24.73  ? 88   TYR C CZ  1 
ATOM   2347 O  OH  . TYR B 1 88  ? 35.973  46.580 61.417  1.00 25.49  ? 88   TYR C OH  1 
ATOM   2348 N  N   . PRO B 1 89  ? 37.092  42.500 68.870  1.00 25.21  ? 89   PRO C N   1 
ATOM   2349 C  CA  . PRO B 1 89  ? 36.868  41.796 70.155  1.00 25.87  ? 89   PRO C CA  1 
ATOM   2350 C  C   . PRO B 1 89  ? 35.373  41.592 70.467  1.00 26.05  ? 89   PRO C C   1 
ATOM   2351 O  O   . PRO B 1 89  ? 34.507  42.489 70.188  1.00 24.37  ? 89   PRO C O   1 
ATOM   2352 C  CB  . PRO B 1 89  ? 37.532  42.723 71.170  1.00 26.46  ? 89   PRO C CB  1 
ATOM   2353 C  CG  . PRO B 1 89  ? 37.581  44.100 70.475  1.00 28.33  ? 89   PRO C CG  1 
ATOM   2354 C  CD  . PRO B 1 89  ? 37.731  43.834 69.061  1.00 24.52  ? 89   PRO C CD  1 
ATOM   2355 N  N   . THR B 1 90  ? 35.087  40.436 71.060  1.00 24.77  ? 90   THR C N   1 
ATOM   2356 C  CA  . THR B 1 90  ? 33.754  40.028 71.301  1.00 25.63  ? 90   THR C CA  1 
ATOM   2357 C  C   . THR B 1 90  ? 33.458  39.694 72.774  1.00 26.63  ? 90   THR C C   1 
ATOM   2358 O  O   . THR B 1 90  ? 32.313  39.492 73.136  1.00 26.97  ? 90   THR C O   1 
ATOM   2359 C  CB  . THR B 1 90  ? 33.384  38.805 70.442  1.00 24.69  ? 90   THR C CB  1 
ATOM   2360 O  OG1 . THR B 1 90  ? 33.972  37.617 70.972  1.00 23.82  ? 90   THR C OG1 1 
ATOM   2361 C  CG2 . THR B 1 90  ? 33.764  38.930 68.927  1.00 29.35  ? 90   THR C CG2 1 
ATOM   2362 N  N   . GLY B 1 91  ? 34.487  39.566 73.582  1.00 26.15  ? 91   GLY C N   1 
ATOM   2363 C  CA  . GLY B 1 91  ? 34.315  39.158 74.949  1.00 29.10  ? 91   GLY C CA  1 
ATOM   2364 C  C   . GLY B 1 91  ? 34.227  37.664 75.158  1.00 29.10  ? 91   GLY C C   1 
ATOM   2365 O  O   . GLY B 1 91  ? 34.249  37.204 76.317  1.00 29.65  ? 91   GLY C O   1 
ATOM   2366 N  N   . ASN B 1 92  ? 34.181  36.905 74.061  1.00 28.79  ? 92   ASN C N   1 
ATOM   2367 C  CA  . ASN B 1 92  ? 34.267  35.468 74.167  1.00 28.78  ? 92   ASN C CA  1 
ATOM   2368 C  C   . ASN B 1 92  ? 35.698  34.970 74.067  1.00 27.20  ? 92   ASN C C   1 
ATOM   2369 O  O   . ASN B 1 92  ? 36.502  35.455 73.275  1.00 27.42  ? 92   ASN C O   1 
ATOM   2370 C  CB  . ASN B 1 92  ? 33.382  34.718 73.187  1.00 27.36  ? 92   ASN C CB  1 
ATOM   2371 C  CG  . ASN B 1 92  ? 31.907  35.067 73.315  1.00 28.15  ? 92   ASN C CG  1 
ATOM   2372 O  OD1 . ASN B 1 92  ? 31.357  35.267 74.402  1.00 25.30  ? 92   ASN C OD1 1 
ATOM   2373 N  ND2 . ASN B 1 92  ? 31.260  35.126 72.187  1.00 26.95  ? 92   ASN C ND2 1 
ATOM   2374 N  N   . ASN B 1 93  ? 35.961  33.935 74.864  1.00 25.27  ? 93   ASN C N   1 
ATOM   2375 C  CA  . ASN B 1 93  ? 37.195  33.214 74.811  1.00 25.50  ? 93   ASN C CA  1 
ATOM   2376 C  C   . ASN B 1 93  ? 37.124  32.031 73.829  1.00 24.77  ? 93   ASN C C   1 
ATOM   2377 O  O   . ASN B 1 93  ? 36.392  31.055 73.976  1.00 26.19  ? 93   ASN C O   1 
ATOM   2378 C  CB  . ASN B 1 93  ? 37.662  32.832 76.250  1.00 27.19  ? 93   ASN C CB  1 
ATOM   2379 C  CG  . ASN B 1 93  ? 39.021  32.157 76.265  1.00 30.72  ? 93   ASN C CG  1 
ATOM   2380 O  OD1 . ASN B 1 93  ? 39.624  31.919 75.182  1.00 32.42  ? 93   ASN C OD1 1 
ATOM   2381 N  ND2 . ASN B 1 93  ? 39.499  31.779 77.471  1.00 29.04  ? 93   ASN C ND2 1 
ATOM   2382 N  N   . ILE B 1 94  ? 37.868  32.178 72.763  1.00 23.98  ? 94   ILE C N   1 
ATOM   2383 C  CA  . ILE B 1 94  ? 37.862  31.275 71.699  1.00 23.78  ? 94   ILE C CA  1 
ATOM   2384 C  C   . ILE B 1 94  ? 39.152  30.502 71.600  1.00 23.59  ? 94   ILE C C   1 
ATOM   2385 O  O   . ILE B 1 94  ? 40.242  31.063 71.741  1.00 25.50  ? 94   ILE C O   1 
ATOM   2386 C  CB  . ILE B 1 94  ? 37.510  32.040 70.351  1.00 25.20  ? 94   ILE C CB  1 
ATOM   2387 C  CG1 . ILE B 1 94  ? 36.139  32.797 70.447  1.00 20.97  ? 94   ILE C CG1 1 
ATOM   2388 C  CG2 . ILE B 1 94  ? 37.605  31.070 69.124  1.00 24.52  ? 94   ILE C CG2 1 
ATOM   2389 C  CD1 . ILE B 1 94  ? 34.894  31.938 70.740  1.00 19.34  ? 94   ILE C CD1 1 
ATOM   2390 N  N   . TYR B 1 95  ? 39.004  29.200 71.342  1.00 24.56  ? 95   TYR C N   1 
ATOM   2391 C  CA  . TYR B 1 95  ? 40.089  28.256 71.084  1.00 24.53  ? 95   TYR C CA  1 
ATOM   2392 C  C   . TYR B 1 95  ? 39.823  27.533 69.727  1.00 23.90  ? 95   TYR C C   1 
ATOM   2393 O  O   . TYR B 1 95  ? 38.868  26.833 69.594  1.00 24.07  ? 95   TYR C O   1 
ATOM   2394 C  CB  . TYR B 1 95  ? 40.235  27.255 72.240  1.00 25.23  ? 95   TYR C CB  1 
ATOM   2395 C  CG  . TYR B 1 95  ? 41.249  26.141 72.045  1.00 25.17  ? 95   TYR C CG  1 
ATOM   2396 C  CD1 . TYR B 1 95  ? 42.545  26.424 71.719  1.00 28.43  ? 95   TYR C CD1 1 
ATOM   2397 C  CD2 . TYR B 1 95  ? 40.886  24.806 72.189  1.00 25.92  ? 95   TYR C CD2 1 
ATOM   2398 C  CE1 . TYR B 1 95  ? 43.472  25.430 71.523  1.00 28.31  ? 95   TYR C CE1 1 
ATOM   2399 C  CE2 . TYR B 1 95  ? 41.795  23.811 72.037  1.00 26.35  ? 95   TYR C CE2 1 
ATOM   2400 C  CZ  . TYR B 1 95  ? 43.083  24.115 71.679  1.00 26.77  ? 95   TYR C CZ  1 
ATOM   2401 O  OH  . TYR B 1 95  ? 44.013  23.124 71.511  1.00 28.45  ? 95   TYR C OH  1 
ATOM   2402 N  N   . ALA B 1 96  ? 40.727  27.674 68.761  1.00 22.92  ? 96   ALA C N   1 
ATOM   2403 C  CA  . ALA B 1 96  ? 40.530  27.062 67.430  1.00 24.85  ? 96   ALA C CA  1 
ATOM   2404 C  C   . ALA B 1 96  ? 41.788  26.255 67.183  1.00 25.60  ? 96   ALA C C   1 
ATOM   2405 O  O   . ALA B 1 96  ? 42.872  26.803 67.296  1.00 26.91  ? 96   ALA C O   1 
ATOM   2406 C  CB  . ALA B 1 96  ? 40.291  28.158 66.285  1.00 23.37  ? 96   ALA C CB  1 
ATOM   2407 N  N   . THR B 1 97  ? 41.635  24.947 66.947  1.00 25.79  ? 97   THR C N   1 
ATOM   2408 C  CA  . THR B 1 97  ? 42.768  24.048 66.683  1.00 25.35  ? 97   THR C CA  1 
ATOM   2409 C  C   . THR B 1 97  ? 42.764  23.483 65.257  1.00 25.83  ? 97   THR C C   1 
ATOM   2410 O  O   . THR B 1 97  ? 41.681  23.169 64.709  1.00 23.33  ? 97   THR C O   1 
ATOM   2411 C  CB  . THR B 1 97  ? 42.753  22.869 67.651  1.00 25.70  ? 97   THR C CB  1 
ATOM   2412 O  OG1 . THR B 1 97  ? 43.986  22.164 67.521  1.00 30.54  ? 97   THR C OG1 1 
ATOM   2413 C  CG2 . THR B 1 97  ? 41.600  21.926 67.319  1.00 24.05  ? 97   THR C CG2 1 
ATOM   2414 N  N   . ALA B 1 98  ? 43.980  23.297 64.686  1.00 26.85  ? 98   ALA C N   1 
ATOM   2415 C  CA  . ALA B 1 98  ? 44.145  22.611 63.398  1.00 26.56  ? 98   ALA C CA  1 
ATOM   2416 C  C   . ALA B 1 98  ? 43.923  21.120 63.590  1.00 26.89  ? 98   ALA C C   1 
ATOM   2417 O  O   . ALA B 1 98  ? 44.586  20.477 64.383  1.00 25.24  ? 98   ALA C O   1 
ATOM   2418 C  CB  . ALA B 1 98  ? 45.523  22.886 62.764  1.00 26.22  ? 98   ALA C CB  1 
ATOM   2419 N  N   . MET B 1 99  ? 42.943  20.579 62.875  1.00 28.46  ? 99   MET C N   1 
ATOM   2420 C  CA  . MET B 1 99  ? 42.678  19.149 62.900  1.00 30.16  ? 99   MET C CA  1 
ATOM   2421 C  C   . MET B 1 99  ? 43.549  18.371 61.881  1.00 30.31  ? 99   MET C C   1 
ATOM   2422 O  O   . MET B 1 99  ? 43.751  17.184 62.037  1.00 29.06  ? 99   MET C O   1 
ATOM   2423 C  CB  . MET B 1 99  ? 41.207  18.901 62.639  1.00 30.08  ? 99   MET C CB  1 
ATOM   2424 C  CG  . MET B 1 99  ? 40.301  19.223 63.844  1.00 31.60  ? 99   MET C CG  1 
ATOM   2425 S  SD  . MET B 1 99  ? 38.583  19.019 63.301  1.00 31.03  ? 99   MET C SD  1 
ATOM   2426 C  CE  . MET B 1 99  ? 38.343  17.322 63.861  1.00 34.19  ? 99   MET C CE  1 
ATOM   2427 N  N   . GLU B 1 100 ? 44.046  19.108 60.879  1.00 31.15  ? 100  GLU C N   1 
ATOM   2428 C  CA  . GLU B 1 100 ? 44.944  18.678 59.816  1.00 32.61  ? 100  GLU C CA  1 
ATOM   2429 C  C   . GLU B 1 100 ? 46.001  19.759 59.679  1.00 32.27  ? 100  GLU C C   1 
ATOM   2430 O  O   . GLU B 1 100 ? 45.857  20.821 60.261  1.00 33.40  ? 100  GLU C O   1 
ATOM   2431 C  CB  . GLU B 1 100 ? 44.187  18.653 58.495  1.00 32.33  ? 100  GLU C CB  1 
ATOM   2432 C  CG  . GLU B 1 100 ? 43.113  17.605 58.445  1.00 34.72  ? 100  GLU C CG  1 
ATOM   2433 C  CD  . GLU B 1 100 ? 42.128  17.830 57.333  1.00 36.18  ? 100  GLU C CD  1 
ATOM   2434 O  OE1 . GLU B 1 100 ? 42.387  18.664 56.425  1.00 38.82  ? 100  GLU C OE1 1 
ATOM   2435 O  OE2 . GLU B 1 100 ? 41.062  17.182 57.401  1.00 43.86  ? 100  GLU C OE2 1 
ATOM   2436 N  N   . PRO B 1 101 ? 47.057  19.501 58.912  1.00 32.47  ? 101  PRO C N   1 
ATOM   2437 C  CA  . PRO B 1 101 ? 47.871  20.634 58.467  1.00 32.02  ? 101  PRO C CA  1 
ATOM   2438 C  C   . PRO B 1 101 ? 46.979  21.648 57.752  1.00 31.85  ? 101  PRO C C   1 
ATOM   2439 O  O   . PRO B 1 101 ? 46.165  21.286 56.881  1.00 31.99  ? 101  PRO C O   1 
ATOM   2440 C  CB  . PRO B 1 101 ? 48.900  19.984 57.519  1.00 31.96  ? 101  PRO C CB  1 
ATOM   2441 C  CG  . PRO B 1 101 ? 48.889  18.538 57.889  1.00 31.53  ? 101  PRO C CG  1 
ATOM   2442 C  CD  . PRO B 1 101 ? 47.588  18.199 58.425  1.00 32.32  ? 101  PRO C CD  1 
ATOM   2443 N  N   . THR B 1 102 ? 47.063  22.905 58.183  1.00 31.17  ? 102  THR C N   1 
ATOM   2444 C  CA  . THR B 1 102 ? 46.139  23.917 57.741  1.00 30.36  ? 102  THR C CA  1 
ATOM   2445 C  C   . THR B 1 102 ? 46.909  25.149 57.299  1.00 30.39  ? 102  THR C C   1 
ATOM   2446 O  O   . THR B 1 102 ? 47.817  25.598 58.010  1.00 30.63  ? 102  THR C O   1 
ATOM   2447 C  CB  . THR B 1 102 ? 45.103  24.249 58.876  1.00 30.56  ? 102  THR C CB  1 
ATOM   2448 O  OG1 . THR B 1 102 ? 44.283  23.082 59.124  1.00 30.05  ? 102  THR C OG1 1 
ATOM   2449 C  CG2 . THR B 1 102 ? 44.242  25.473 58.526  1.00 27.28  ? 102  THR C CG2 1 
ATOM   2450 N  N   . ARG B 1 103 ? 46.578  25.643 56.110  1.00 30.15  ? 103  ARG C N   1 
ATOM   2451 C  CA  . ARG B 1 103 ? 47.001  26.968 55.641  1.00 30.19  ? 103  ARG C CA  1 
ATOM   2452 C  C   . ARG B 1 103 ? 45.884  28.006 55.858  1.00 29.32  ? 103  ARG C C   1 
ATOM   2453 O  O   . ARG B 1 103 ? 44.719  27.792 55.459  1.00 28.97  ? 103  ARG C O   1 
ATOM   2454 C  CB  . ARG B 1 103 ? 47.421  26.890 54.169  1.00 30.44  ? 103  ARG C CB  1 
ATOM   2455 C  CG  . ARG B 1 103 ? 47.973  28.198 53.603  1.00 30.40  ? 103  ARG C CG  1 
ATOM   2456 C  CD  . ARG B 1 103 ? 48.868  27.979 52.434  1.00 31.05  ? 103  ARG C CD  1 
ATOM   2457 N  NE  . ARG B 1 103 ? 50.236  27.757 52.892  1.00 34.36  ? 103  ARG C NE  1 
ATOM   2458 C  CZ  . ARG B 1 103 ? 51.264  27.502 52.096  1.00 34.28  ? 103  ARG C CZ  1 
ATOM   2459 N  NH1 . ARG B 1 103 ? 51.112  27.459 50.778  1.00 35.40  ? 103  ARG C NH1 1 
ATOM   2460 N  NH2 . ARG B 1 103 ? 52.458  27.320 52.627  1.00 34.58  ? 103  ARG C NH2 1 
ATOM   2461 N  N   . THR B 1 104 ? 46.217  29.090 56.580  1.00 28.55  ? 104  THR C N   1 
ATOM   2462 C  CA  . THR B 1 104 ? 45.314  30.172 56.788  1.00 26.88  ? 104  THR C CA  1 
ATOM   2463 C  C   . THR B 1 104 ? 45.807  31.458 56.110  1.00 26.50  ? 104  THR C C   1 
ATOM   2464 O  O   . THR B 1 104 ? 46.959  31.568 55.738  1.00 26.26  ? 104  THR C O   1 
ATOM   2465 C  CB  . THR B 1 104 ? 44.962  30.422 58.299  1.00 27.60  ? 104  THR C CB  1 
ATOM   2466 O  OG1 . THR B 1 104 ? 46.080  30.950 59.033  1.00 24.66  ? 104  THR C OG1 1 
ATOM   2467 C  CG2 . THR B 1 104 ? 44.429  29.122 58.975  1.00 26.67  ? 104  THR C CG2 1 
ATOM   2468 N  N   . CYS B 1 105 ? 44.886  32.399 55.914  1.00 25.87  ? 105  CYS C N   1 
ATOM   2469 C  CA  . CYS B 1 105 ? 45.236  33.746 55.526  1.00 25.07  ? 105  CYS C CA  1 
ATOM   2470 C  C   . CYS B 1 105 ? 44.493  34.708 56.455  1.00 24.67  ? 105  CYS C C   1 
ATOM   2471 O  O   . CYS B 1 105 ? 43.269  34.681 56.587  1.00 25.45  ? 105  CYS C O   1 
ATOM   2472 C  CB  . CYS B 1 105 ? 44.888  34.024 54.059  1.00 24.81  ? 105  CYS C CB  1 
ATOM   2473 S  SG  . CYS B 1 105 ? 45.487  35.695 53.531  1.00 27.38  ? 105  CYS C SG  1 
ATOM   2474 N  N   . TRP B 1 106 ? 45.264  35.523 57.150  1.00 25.23  ? 106  TRP C N   1 
ATOM   2475 C  CA  . TRP B 1 106 ? 44.723  36.471 58.087  1.00 24.64  ? 106  TRP C CA  1 
ATOM   2476 C  C   . TRP B 1 106 ? 44.570  37.835 57.426  1.00 24.65  ? 106  TRP C C   1 
ATOM   2477 O  O   . TRP B 1 106 ? 45.522  38.370 56.855  1.00 25.43  ? 106  TRP C O   1 
ATOM   2478 C  CB  . TRP B 1 106 ? 45.644  36.571 59.315  1.00 24.96  ? 106  TRP C CB  1 
ATOM   2479 C  CG  . TRP B 1 106 ? 45.691  35.307 60.119  1.00 26.16  ? 106  TRP C CG  1 
ATOM   2480 C  CD1 . TRP B 1 106 ? 45.946  34.028 59.644  1.00 26.06  ? 106  TRP C CD1 1 
ATOM   2481 C  CD2 . TRP B 1 106 ? 45.565  35.192 61.519  1.00 27.01  ? 106  TRP C CD2 1 
ATOM   2482 N  NE1 . TRP B 1 106 ? 45.919  33.137 60.674  1.00 25.89  ? 106  TRP C NE1 1 
ATOM   2483 C  CE2 . TRP B 1 106 ? 45.704  33.814 61.838  1.00 27.14  ? 106  TRP C CE2 1 
ATOM   2484 C  CE3 . TRP B 1 106 ? 45.293  36.117 62.559  1.00 26.87  ? 106  TRP C CE3 1 
ATOM   2485 C  CZ2 . TRP B 1 106 ? 45.599  33.327 63.154  1.00 26.13  ? 106  TRP C CZ2 1 
ATOM   2486 C  CZ3 . TRP B 1 106 ? 45.201  35.655 63.845  1.00 27.04  ? 106  TRP C CZ3 1 
ATOM   2487 C  CH2 . TRP B 1 106 ? 45.363  34.243 64.145  1.00 27.78  ? 106  TRP C CH2 1 
ATOM   2488 N  N   . PHE B 1 107 ? 43.372  38.398 57.519  1.00 24.11  ? 107  PHE C N   1 
ATOM   2489 C  CA  . PHE B 1 107 ? 43.078  39.683 56.979  1.00 23.97  ? 107  PHE C CA  1 
ATOM   2490 C  C   . PHE B 1 107 ? 42.758  40.608 58.133  1.00 23.82  ? 107  PHE C C   1 
ATOM   2491 O  O   . PHE B 1 107 ? 41.732  40.468 58.733  1.00 23.40  ? 107  PHE C O   1 
ATOM   2492 C  CB  . PHE B 1 107 ? 41.863  39.599 56.021  1.00 24.29  ? 107  PHE C CB  1 
ATOM   2493 C  CG  . PHE B 1 107 ? 42.093  38.818 54.770  1.00 25.05  ? 107  PHE C CG  1 
ATOM   2494 C  CD1 . PHE B 1 107 ? 42.616  39.442 53.607  1.00 26.33  ? 107  PHE C CD1 1 
ATOM   2495 C  CD2 . PHE B 1 107 ? 41.743  37.482 54.704  1.00 25.70  ? 107  PHE C CD2 1 
ATOM   2496 C  CE1 . PHE B 1 107 ? 42.783  38.713 52.416  1.00 23.83  ? 107  PHE C CE1 1 
ATOM   2497 C  CE2 . PHE B 1 107 ? 41.889  36.767 53.535  1.00 24.69  ? 107  PHE C CE2 1 
ATOM   2498 C  CZ  . PHE B 1 107 ? 42.429  37.377 52.381  1.00 23.85  ? 107  PHE C CZ  1 
ATOM   2499 N  N   . SER B 1 108 ? 43.638  41.582 58.374  1.00 24.37  ? 108  SER C N   1 
ATOM   2500 C  CA  . SER B 1 108 ? 43.350  42.718 59.227  1.00 24.81  ? 108  SER C CA  1 
ATOM   2501 C  C   . SER B 1 108 ? 42.293  43.620 58.577  1.00 24.51  ? 108  SER C C   1 
ATOM   2502 O  O   . SER B 1 108 ? 42.029  43.510 57.394  1.00 24.61  ? 108  SER C O   1 
ATOM   2503 C  CB  . SER B 1 108 ? 44.621  43.544 59.417  1.00 23.72  ? 108  SER C CB  1 
ATOM   2504 O  OG  . SER B 1 108 ? 45.002  44.063 58.171  1.00 24.16  ? 108  SER C OG  1 
ATOM   2505 N  N   . GLU B 1 109 ? 41.756  44.550 59.348  1.00 25.37  ? 109  GLU C N   1 
ATOM   2506 C  CA  . GLU B 1 109 ? 40.787  45.508 58.810  1.00 25.34  ? 109  GLU C CA  1 
ATOM   2507 C  C   . GLU B 1 109 ? 41.402  46.239 57.646  1.00 25.95  ? 109  GLU C C   1 
ATOM   2508 O  O   . GLU B 1 109 ? 40.771  46.376 56.609  1.00 25.43  ? 109  GLU C O   1 
ATOM   2509 C  CB  . GLU B 1 109 ? 40.350  46.531 59.878  1.00 24.80  ? 109  GLU C CB  1 
ATOM   2510 C  CG  . GLU B 1 109 ? 39.217  47.424 59.395  1.00 23.69  ? 109  GLU C CG  1 
ATOM   2511 C  CD  . GLU B 1 109 ? 38.919  48.517 60.377  1.00 25.45  ? 109  GLU C CD  1 
ATOM   2512 O  OE1 . GLU B 1 109 ? 38.115  48.337 61.280  1.00 30.78  ? 109  GLU C OE1 1 
ATOM   2513 O  OE2 . GLU B 1 109 ? 39.496  49.590 60.236  1.00 30.02  ? 109  GLU C OE2 1 
ATOM   2514 N  N   . LYS B 1 110 ? 42.650  46.676 57.812  1.00 26.90  ? 110  LYS C N   1 
ATOM   2515 C  CA  . LYS B 1 110 ? 43.391  47.361 56.721  1.00 28.03  ? 110  LYS C CA  1 
ATOM   2516 C  C   . LYS B 1 110 ? 43.555  46.506 55.448  1.00 27.30  ? 110  LYS C C   1 
ATOM   2517 O  O   . LYS B 1 110 ? 43.331  46.978 54.332  1.00 24.13  ? 110  LYS C O   1 
ATOM   2518 C  CB  . LYS B 1 110 ? 44.739  47.964 57.220  1.00 29.04  ? 110  LYS C CB  1 
ATOM   2519 C  CG  . LYS B 1 110 ? 44.534  49.260 58.095  1.00 31.12  ? 110  LYS C CG  1 
ATOM   2520 C  CD  . LYS B 1 110 ? 45.821  49.964 58.696  1.00 32.33  ? 110  LYS C CD  1 
ATOM   2521 C  CE  . LYS B 1 110 ? 45.440  50.835 59.943  1.00 32.77  ? 110  LYS C CE  1 
ATOM   2522 N  NZ  . LYS B 1 110 ? 46.606  51.415 60.727  1.00 32.98  ? 110  LYS C NZ  1 
ATOM   2523 N  N   . SER B 1 111 ? 43.913  45.236 55.605  1.00 27.19  ? 111  SER C N   1 
ATOM   2524 C  CA  . SER B 1 111 ? 43.981  44.382 54.438  1.00 27.64  ? 111  SER C CA  1 
ATOM   2525 C  C   . SER B 1 111 ? 42.569  44.217 53.747  1.00 25.77  ? 111  SER C C   1 
ATOM   2526 O  O   . SER B 1 111 ? 42.483  44.161 52.539  1.00 25.79  ? 111  SER C O   1 
ATOM   2527 C  CB  . SER B 1 111 ? 44.629  43.034 54.800  1.00 27.94  ? 111  SER C CB  1 
ATOM   2528 O  OG  . SER B 1 111 ? 43.772  42.264 55.592  1.00 34.58  ? 111  SER C OG  1 
ATOM   2529 N  N   . LEU B 1 112 ? 41.505  44.148 54.527  1.00 24.97  ? 112  LEU C N   1 
ATOM   2530 C  CA  . LEU B 1 112 ? 40.145  43.999 54.007  1.00 24.79  ? 112  LEU C CA  1 
ATOM   2531 C  C   . LEU B 1 112 ? 39.711  45.260 53.208  1.00 24.95  ? 112  LEU C C   1 
ATOM   2532 O  O   . LEU B 1 112 ? 39.177  45.092 52.087  1.00 23.95  ? 112  LEU C O   1 
ATOM   2533 C  CB  . LEU B 1 112 ? 39.125  43.628 55.068  1.00 24.22  ? 112  LEU C CB  1 
ATOM   2534 C  CG  . LEU B 1 112 ? 39.197  42.267 55.742  1.00 24.03  ? 112  LEU C CG  1 
ATOM   2535 C  CD1 . LEU B 1 112 ? 38.275  42.215 56.964  1.00 21.34  ? 112  LEU C CD1 1 
ATOM   2536 C  CD2 . LEU B 1 112 ? 38.889  41.161 54.784  1.00 21.57  ? 112  LEU C CD2 1 
ATOM   2537 N  N   . ARG B 1 113 ? 40.057  46.460 53.703  1.00 23.20  ? 113  ARG C N   1 
ATOM   2538 C  CA  . ARG B 1 113 ? 39.824  47.654 52.930  1.00 24.30  ? 113  ARG C CA  1 
ATOM   2539 C  C   . ARG B 1 113 ? 40.487  47.493 51.579  1.00 23.21  ? 113  ARG C C   1 
ATOM   2540 O  O   . ARG B 1 113 ? 39.888  47.791 50.593  1.00 22.68  ? 113  ARG C O   1 
ATOM   2541 C  CB  . ARG B 1 113 ? 40.405  48.945 53.569  1.00 24.14  ? 113  ARG C CB  1 
ATOM   2542 C  CG  . ARG B 1 113 ? 39.679  49.378 54.764  1.00 25.15  ? 113  ARG C CG  1 
ATOM   2543 C  CD  . ARG B 1 113 ? 40.355  50.491 55.507  1.00 24.78  ? 113  ARG C CD  1 
ATOM   2544 N  NE  . ARG B 1 113 ? 39.718  50.610 56.821  1.00 24.00  ? 113  ARG C NE  1 
ATOM   2545 C  CZ  . ARG B 1 113 ? 38.589  51.273 57.046  1.00 24.10  ? 113  ARG C CZ  1 
ATOM   2546 N  NH1 . ARG B 1 113 ? 37.930  51.908 56.086  1.00 24.28  ? 113  ARG C NH1 1 
ATOM   2547 N  NH2 . ARG B 1 113 ? 38.117  51.330 58.258  1.00 26.76  ? 113  ARG C NH2 1 
ATOM   2548 N  N   . THR B 1 114 ? 41.740  47.027 51.566  1.00 22.99  ? 114  THR C N   1 
ATOM   2549 C  CA  . THR B 1 114 ? 42.454  46.851 50.349  1.00 23.39  ? 114  THR C CA  1 
ATOM   2550 C  C   . THR B 1 114 ? 41.710  45.860 49.434  1.00 22.40  ? 114  THR C C   1 
ATOM   2551 O  O   . THR B 1 114 ? 41.621  46.104 48.255  1.00 21.74  ? 114  THR C O   1 
ATOM   2552 C  CB  . THR B 1 114 ? 43.939  46.447 50.585  1.00 24.27  ? 114  THR C CB  1 
ATOM   2553 O  OG1 . THR B 1 114 ? 44.589  47.477 51.341  1.00 27.77  ? 114  THR C OG1 1 
ATOM   2554 C  CG2 . THR B 1 114 ? 44.658  46.266 49.227  1.00 25.70  ? 114  THR C CG2 1 
ATOM   2555 N  N   . VAL B 1 115 ? 41.190  44.761 49.984  1.00 22.38  ? 115  VAL C N   1 
ATOM   2556 C  CA  . VAL B 1 115 ? 40.397  43.770 49.210  1.00 22.34  ? 115  VAL C CA  1 
ATOM   2557 C  C   . VAL B 1 115 ? 39.166  44.401 48.592  1.00 22.28  ? 115  VAL C C   1 
ATOM   2558 O  O   . VAL B 1 115 ? 38.952  44.234 47.404  1.00 21.27  ? 115  VAL C O   1 
ATOM   2559 C  CB  . VAL B 1 115 ? 39.942  42.575 50.043  1.00 22.11  ? 115  VAL C CB  1 
ATOM   2560 C  CG1 . VAL B 1 115 ? 38.928  41.699 49.311  1.00 23.64  ? 115  VAL C CG1 1 
ATOM   2561 C  CG2 . VAL B 1 115 ? 41.148  41.782 50.532  1.00 24.08  ? 115  VAL C CG2 1 
ATOM   2562 N  N   . PHE B 1 116 ? 38.373  45.135 49.390  1.00 22.16  ? 116  PHE C N   1 
ATOM   2563 C  CA  . PHE B 1 116 ? 37.123  45.681 48.909  1.00 22.44  ? 116  PHE C CA  1 
ATOM   2564 C  C   . PHE B 1 116 ? 37.288  46.832 47.936  1.00 23.82  ? 116  PHE C C   1 
ATOM   2565 O  O   . PHE B 1 116 ? 36.381  47.081 47.150  1.00 23.52  ? 116  PHE C O   1 
ATOM   2566 C  CB  . PHE B 1 116 ? 36.272  46.171 50.070  1.00 22.98  ? 116  PHE C CB  1 
ATOM   2567 C  CG  . PHE B 1 116 ? 36.007  45.118 51.173  1.00 22.20  ? 116  PHE C CG  1 
ATOM   2568 C  CD1 . PHE B 1 116 ? 35.957  43.755 50.890  1.00 20.89  ? 116  PHE C CD1 1 
ATOM   2569 C  CD2 . PHE B 1 116 ? 35.851  45.511 52.466  1.00 21.26  ? 116  PHE C CD2 1 
ATOM   2570 C  CE1 . PHE B 1 116 ? 35.692  42.841 51.896  1.00 21.77  ? 116  PHE C CE1 1 
ATOM   2571 C  CE2 . PHE B 1 116 ? 35.615  44.592 53.490  1.00 19.07  ? 116  PHE C CE2 1 
ATOM   2572 C  CZ  . PHE B 1 116 ? 35.568  43.236 53.171  1.00 21.75  ? 116  PHE C CZ  1 
ATOM   2573 N  N   . ARG B 1 117 ? 38.399  47.585 48.029  1.00 24.46  ? 117  ARG C N   1 
ATOM   2574 C  CA  . ARG B 1 117 ? 38.740  48.567 47.001  1.00 24.68  ? 117  ARG C CA  1 
ATOM   2575 C  C   . ARG B 1 117 ? 39.038  47.878 45.658  1.00 25.44  ? 117  ARG C C   1 
ATOM   2576 O  O   . ARG B 1 117 ? 38.901  48.509 44.642  1.00 25.95  ? 117  ARG C O   1 
ATOM   2577 C  CB  . ARG B 1 117 ? 39.911  49.439 47.429  1.00 24.44  ? 117  ARG C CB  1 
ATOM   2578 C  CG  . ARG B 1 117 ? 39.586  50.303 48.685  1.00 22.60  ? 117  ARG C CG  1 
ATOM   2579 C  CD  . ARG B 1 117 ? 40.817  51.018 49.274  1.00 21.52  ? 117  ARG C CD  1 
ATOM   2580 N  NE  . ARG B 1 117 ? 40.522  51.566 50.577  1.00 18.95  ? 117  ARG C NE  1 
ATOM   2581 C  CZ  . ARG B 1 117 ? 41.406  52.182 51.356  1.00 18.28  ? 117  ARG C CZ  1 
ATOM   2582 N  NH1 . ARG B 1 117 ? 42.653  52.306 50.987  1.00 18.71  ? 117  ARG C NH1 1 
ATOM   2583 N  NH2 . ARG B 1 117 ? 41.039  52.594 52.581  1.00 20.38  ? 117  ARG C NH2 1 
ATOM   2584 N  N   . THR B 1 118 ? 39.421  46.592 45.662  1.00 25.91  ? 118  THR C N   1 
ATOM   2585 C  CA  . THR B 1 118 ? 39.610  45.862 44.406  1.00 26.63  ? 118  THR C CA  1 
ATOM   2586 C  C   . THR B 1 118 ? 38.337  45.156 43.984  1.00 27.40  ? 118  THR C C   1 
ATOM   2587 O  O   . THR B 1 118 ? 38.046  45.136 42.800  1.00 25.84  ? 118  THR C O   1 
ATOM   2588 C  CB  . THR B 1 118 ? 40.680  44.764 44.516  1.00 25.73  ? 118  THR C CB  1 
ATOM   2589 O  OG1 . THR B 1 118 ? 41.870  45.349 45.014  1.00 28.78  ? 118  THR C OG1 1 
ATOM   2590 C  CG2 . THR B 1 118 ? 40.980  44.050 43.097  1.00 27.54  ? 118  THR C CG2 1 
ATOM   2591 N  N   . ASP B 1 119 ? 37.634  44.538 44.965  1.00 26.67  ? 119  ASP C N   1 
ATOM   2592 C  CA  . ASP B 1 119 ? 36.477  43.678 44.704  1.00 27.25  ? 119  ASP C CA  1 
ATOM   2593 C  C   . ASP B 1 119 ? 35.380  43.913 45.737  1.00 27.53  ? 119  ASP C C   1 
ATOM   2594 O  O   . ASP B 1 119 ? 35.374  43.310 46.833  1.00 27.08  ? 119  ASP C O   1 
ATOM   2595 C  CB  . ASP B 1 119 ? 36.854  42.187 44.672  1.00 27.91  ? 119  ASP C CB  1 
ATOM   2596 C  CG  . ASP B 1 119 ? 35.701  41.284 44.112  1.00 28.12  ? 119  ASP C CG  1 
ATOM   2597 O  OD1 . ASP B 1 119 ? 34.573  41.735 43.840  1.00 29.62  ? 119  ASP C OD1 1 
ATOM   2598 O  OD2 . ASP B 1 119 ? 35.943  40.102 43.904  1.00 31.27  ? 119  ASP C OD2 1 
ATOM   2599 N  N   . GLU B 1 120 ? 34.492  44.845 45.375  1.00 26.77  ? 120  GLU C N   1 
ATOM   2600 C  CA  . GLU B 1 120 ? 33.248  45.172 46.080  1.00 26.67  ? 120  GLU C CA  1 
ATOM   2601 C  C   . GLU B 1 120 ? 32.421  43.894 46.439  1.00 25.85  ? 120  GLU C C   1 
ATOM   2602 O  O   . GLU B 1 120 ? 31.786  43.827 47.458  1.00 25.32  ? 120  GLU C O   1 
ATOM   2603 C  CB  . GLU B 1 120 ? 32.436  46.044 45.135  1.00 26.14  ? 120  GLU C CB  1 
ATOM   2604 C  CG  . GLU B 1 120 ? 31.187  46.613 45.727  1.00 31.04  ? 120  GLU C CG  1 
ATOM   2605 C  CD  . GLU B 1 120 ? 30.492  47.534 44.764  1.00 30.10  ? 120  GLU C CD  1 
ATOM   2606 O  OE1 . GLU B 1 120 ? 29.726  47.026 43.925  1.00 34.34  ? 120  GLU C OE1 1 
ATOM   2607 O  OE2 . GLU B 1 120 ? 30.727  48.742 44.846  1.00 30.39  ? 120  GLU C OE2 1 
ATOM   2608 N  N   . ASP B 1 121 ? 32.433  42.895 45.578  1.00 25.69  ? 121  ASP C N   1 
ATOM   2609 C  CA  . ASP B 1 121 ? 31.536  41.736 45.751  1.00 26.09  ? 121  ASP C CA  1 
ATOM   2610 C  C   . ASP B 1 121 ? 31.907  40.952 46.995  1.00 25.92  ? 121  ASP C C   1 
ATOM   2611 O  O   . ASP B 1 121 ? 31.047  40.256 47.579  1.00 25.25  ? 121  ASP C O   1 
ATOM   2612 C  CB  . ASP B 1 121 ? 31.577  40.787 44.582  1.00 25.43  ? 121  ASP C CB  1 
ATOM   2613 C  CG  . ASP B 1 121 ? 30.843  41.282 43.361  1.00 27.54  ? 121  ASP C CG  1 
ATOM   2614 O  OD1 . ASP B 1 121 ? 30.025  42.176 43.447  1.00 26.64  ? 121  ASP C OD1 1 
ATOM   2615 O  OD2 . ASP B 1 121 ? 31.090  40.732 42.256  1.00 27.79  ? 121  ASP C OD2 1 
ATOM   2616 N  N   . MET B 1 122 ? 33.165  41.043 47.395  1.00 25.83  ? 122  MET C N   1 
ATOM   2617 C  CA  . MET B 1 122 ? 33.592  40.290 48.547  1.00 26.30  ? 122  MET C CA  1 
ATOM   2618 C  C   . MET B 1 122 ? 32.892  40.791 49.812  1.00 25.67  ? 122  MET C C   1 
ATOM   2619 O  O   . MET B 1 122 ? 32.833  40.036 50.787  1.00 22.81  ? 122  MET C O   1 
ATOM   2620 C  CB  . MET B 1 122 ? 35.109  40.376 48.773  1.00 28.70  ? 122  MET C CB  1 
ATOM   2621 C  CG  . MET B 1 122 ? 35.919  39.625 47.712  1.00 30.79  ? 122  MET C CG  1 
ATOM   2622 S  SD  . MET B 1 122 ? 35.687  37.796 47.738  1.00 34.76  ? 122  MET C SD  1 
ATOM   2623 C  CE  . MET B 1 122 ? 34.456  37.625 46.368  1.00 31.01  ? 122  MET C CE  1 
ATOM   2624 N  N   . ILE B 1 123 ? 32.434  42.069 49.810  1.00 23.31  ? 123  ILE C N   1 
ATOM   2625 C  CA  . ILE B 1 123 ? 31.717  42.625 50.971  1.00 22.55  ? 123  ILE C CA  1 
ATOM   2626 C  C   . ILE B 1 123 ? 30.494  41.709 51.278  1.00 22.90  ? 123  ILE C C   1 
ATOM   2627 O  O   . ILE B 1 123 ? 30.261  41.207 52.405  1.00 22.62  ? 123  ILE C O   1 
ATOM   2628 C  CB  . ILE B 1 123 ? 31.217  44.117 50.740  1.00 22.68  ? 123  ILE C CB  1 
ATOM   2629 C  CG1 . ILE B 1 123 ? 32.357  45.159 50.568  1.00 21.85  ? 123  ILE C CG1 1 
ATOM   2630 C  CG2 . ILE B 1 123 ? 30.295  44.527 51.844  1.00 21.06  ? 123  ILE C CG2 1 
ATOM   2631 C  CD1 . ILE B 1 123 ? 31.927  46.396 49.750  1.00 18.21  ? 123  ILE C CD1 1 
ATOM   2632 N  N   . PHE B 1 124 ? 29.743  41.457 50.213  1.00 22.90  ? 124  PHE C N   1 
ATOM   2633 C  CA  . PHE B 1 124 ? 28.523  40.678 50.295  1.00 22.90  ? 124  PHE C CA  1 
ATOM   2634 C  C   . PHE B 1 124 ? 28.696  39.213 50.521  1.00 22.25  ? 124  PHE C C   1 
ATOM   2635 O  O   . PHE B 1 124 ? 27.867  38.617 51.161  1.00 22.62  ? 124  PHE C O   1 
ATOM   2636 C  CB  . PHE B 1 124 ? 27.726  41.003 49.026  1.00 21.22  ? 124  PHE C CB  1 
ATOM   2637 C  CG  . PHE B 1 124 ? 27.432  42.436 48.914  1.00 21.35  ? 124  PHE C CG  1 
ATOM   2638 C  CD1 . PHE B 1 124 ? 26.391  42.969 49.645  1.00 20.58  ? 124  PHE C CD1 1 
ATOM   2639 C  CD2 . PHE B 1 124 ? 28.229  43.306 48.107  1.00 21.91  ? 124  PHE C CD2 1 
ATOM   2640 C  CE1 . PHE B 1 124 ? 26.126  44.296 49.609  1.00 21.71  ? 124  PHE C CE1 1 
ATOM   2641 C  CE2 . PHE B 1 124 ? 27.946  44.645 48.054  1.00 23.79  ? 124  PHE C CE2 1 
ATOM   2642 C  CZ  . PHE B 1 124 ? 26.886  45.154 48.846  1.00 22.33  ? 124  PHE C CZ  1 
ATOM   2643 N  N   . GLU B 1 125 ? 29.778  38.612 50.017  1.00 23.31  ? 125  GLU C N   1 
ATOM   2644 C  CA  . GLU B 1 125 ? 30.134  37.241 50.414  1.00 23.63  ? 125  GLU C CA  1 
ATOM   2645 C  C   . GLU B 1 125 ? 30.363  37.090 51.940  1.00 24.00  ? 125  GLU C C   1 
ATOM   2646 O  O   . GLU B 1 125 ? 29.917  36.087 52.594  1.00 23.09  ? 125  GLU C O   1 
ATOM   2647 C  CB  . GLU B 1 125 ? 31.371  36.761 49.611  1.00 22.70  ? 125  GLU C CB  1 
ATOM   2648 C  CG  . GLU B 1 125 ? 31.146  36.641 48.132  1.00 24.22  ? 125  GLU C CG  1 
ATOM   2649 C  CD  . GLU B 1 125 ? 29.842  35.951 47.806  1.00 25.42  ? 125  GLU C CD  1 
ATOM   2650 O  OE1 . GLU B 1 125 ? 29.700  34.760 48.162  1.00 27.44  ? 125  GLU C OE1 1 
ATOM   2651 O  OE2 . GLU B 1 125 ? 28.920  36.612 47.262  1.00 28.14  ? 125  GLU C OE2 1 
ATOM   2652 N  N   . ILE B 1 126 ? 31.094  38.070 52.501  1.00 25.23  ? 126  ILE C N   1 
ATOM   2653 C  CA  . ILE B 1 126 ? 31.339  38.102 53.943  1.00 25.29  ? 126  ILE C CA  1 
ATOM   2654 C  C   . ILE B 1 126 ? 30.020  38.412 54.712  1.00 27.02  ? 126  ILE C C   1 
ATOM   2655 O  O   . ILE B 1 126 ? 29.798  37.785 55.762  1.00 26.49  ? 126  ILE C O   1 
ATOM   2656 C  CB  . ILE B 1 126 ? 32.483  39.061 54.334  1.00 25.22  ? 126  ILE C CB  1 
ATOM   2657 C  CG1 . ILE B 1 126 ? 33.797  38.522 53.764  1.00 25.70  ? 126  ILE C CG1 1 
ATOM   2658 C  CG2 . ILE B 1 126 ? 32.559  39.298 55.879  1.00 23.29  ? 126  ILE C CG2 1 
ATOM   2659 C  CD1 . ILE B 1 126 ? 34.963  39.499 53.727  1.00 23.35  ? 126  ILE C CD1 1 
ATOM   2660 N  N   . PHE B 1 127 ? 29.134  39.269 54.172  1.00 25.38  ? 127  PHE C N   1 
ATOM   2661 C  CA  . PHE B 1 127 ? 27.805  39.430 54.811  1.00 26.27  ? 127  PHE C CA  1 
ATOM   2662 C  C   . PHE B 1 127 ? 26.984  38.061 54.823  1.00 26.36  ? 127  PHE C C   1 
ATOM   2663 O  O   . PHE B 1 127 ? 26.318  37.718 55.797  1.00 25.62  ? 127  PHE C O   1 
ATOM   2664 C  CB  . PHE B 1 127 ? 26.922  40.459 54.134  1.00 25.39  ? 127  PHE C CB  1 
ATOM   2665 C  CG  . PHE B 1 127 ? 27.334  41.891 54.275  1.00 26.03  ? 127  PHE C CG  1 
ATOM   2666 C  CD1 . PHE B 1 127 ? 28.187  42.367 55.288  1.00 23.13  ? 127  PHE C CD1 1 
ATOM   2667 C  CD2 . PHE B 1 127 ? 26.758  42.799 53.435  1.00 24.25  ? 127  PHE C CD2 1 
ATOM   2668 C  CE1 . PHE B 1 127 ? 28.481  43.713 55.375  1.00 20.90  ? 127  PHE C CE1 1 
ATOM   2669 C  CE2 . PHE B 1 127 ? 27.042  44.163 53.517  1.00 25.66  ? 127  PHE C CE2 1 
ATOM   2670 C  CZ  . PHE B 1 127 ? 27.889  44.641 54.518  1.00 21.91  ? 127  PHE C CZ  1 
ATOM   2671 N  N   . LYS B 1 128 ? 27.053  37.315 53.745  1.00 26.02  ? 128  LYS C N   1 
ATOM   2672 C  CA  . LYS B 1 128 ? 26.405  36.016 53.677  1.00 25.21  ? 128  LYS C CA  1 
ATOM   2673 C  C   . LYS B 1 128 ? 26.966  35.072 54.727  1.00 24.90  ? 128  LYS C C   1 
ATOM   2674 O  O   . LYS B 1 128 ? 26.226  34.355 55.390  1.00 24.46  ? 128  LYS C O   1 
ATOM   2675 C  CB  . LYS B 1 128 ? 26.463  35.440 52.266  1.00 26.23  ? 128  LYS C CB  1 
ATOM   2676 C  CG  . LYS B 1 128 ? 25.760  36.258 51.172  1.00 26.31  ? 128  LYS C CG  1 
ATOM   2677 C  CD  . LYS B 1 128 ? 26.229  35.812 49.789  1.00 25.73  ? 128  LYS C CD  1 
ATOM   2678 C  CE  . LYS B 1 128 ? 25.679  36.748 48.698  1.00 26.91  ? 128  LYS C CE  1 
ATOM   2679 N  NZ  . LYS B 1 128 ? 26.201  36.299 47.353  1.00 20.52  ? 128  LYS C NZ  1 
ATOM   2680 N  N   . ASN B 1 129 ? 28.291  35.052 54.867  1.00 24.18  ? 129  ASN C N   1 
ATOM   2681 C  CA  . ASN B 1 129 ? 28.957  34.228 55.820  1.00 24.17  ? 129  ASN C CA  1 
ATOM   2682 C  C   . ASN B 1 129 ? 28.531  34.576 57.258  1.00 24.98  ? 129  ASN C C   1 
ATOM   2683 O  O   . ASN B 1 129 ? 28.133  33.692 58.030  1.00 26.51  ? 129  ASN C O   1 
ATOM   2684 C  CB  . ASN B 1 129 ? 30.481  34.268 55.578  1.00 23.48  ? 129  ASN C CB  1 
ATOM   2685 C  CG  . ASN B 1 129 ? 31.243  33.334 56.478  1.00 24.90  ? 129  ASN C CG  1 
ATOM   2686 O  OD1 . ASN B 1 129 ? 31.601  33.704 57.600  1.00 26.49  ? 129  ASN C OD1 1 
ATOM   2687 N  ND2 . ASN B 1 129 ? 31.480  32.113 56.016  1.00 26.54  ? 129  ASN C ND2 1 
ATOM   2688 N  N   . TYR B 1 130 ? 28.488  35.867 57.569  1.00 24.36  ? 130  TYR C N   1 
ATOM   2689 C  CA  . TYR B 1 130 ? 28.003  36.289 58.854  1.00 25.85  ? 130  TYR C CA  1 
ATOM   2690 C  C   . TYR B 1 130 ? 26.521  35.920 59.031  1.00 25.19  ? 130  TYR C C   1 
ATOM   2691 O  O   . TYR B 1 130 ? 26.147  35.459 60.087  1.00 24.07  ? 130  TYR C O   1 
ATOM   2692 C  CB  . TYR B 1 130 ? 28.136  37.803 58.999  1.00 24.90  ? 130  TYR C CB  1 
ATOM   2693 C  CG  . TYR B 1 130 ? 29.454  38.284 59.564  1.00 24.79  ? 130  TYR C CG  1 
ATOM   2694 C  CD1 . TYR B 1 130 ? 29.931  37.845 60.828  1.00 27.84  ? 130  TYR C CD1 1 
ATOM   2695 C  CD2 . TYR B 1 130 ? 30.209  39.232 58.872  1.00 27.55  ? 130  TYR C CD2 1 
ATOM   2696 C  CE1 . TYR B 1 130 ? 31.165  38.317 61.343  1.00 24.61  ? 130  TYR C CE1 1 
ATOM   2697 C  CE2 . TYR B 1 130 ? 31.355  39.762 59.411  1.00 25.69  ? 130  TYR C CE2 1 
ATOM   2698 C  CZ  . TYR B 1 130 ? 31.868  39.277 60.618  1.00 26.09  ? 130  TYR C CZ  1 
ATOM   2699 O  OH  . TYR B 1 130 ? 33.043  39.846 61.078  1.00 25.54  ? 130  TYR C OH  1 
ATOM   2700 N  N   . LEU B 1 131 ? 25.701  36.233 58.024  1.00 24.06  ? 131  LEU C N   1 
ATOM   2701 C  CA  . LEU B 1 131 ? 24.256  35.981 58.089  1.00 25.06  ? 131  LEU C CA  1 
ATOM   2702 C  C   . LEU B 1 131 ? 23.959  34.490 58.351  1.00 23.97  ? 131  LEU C C   1 
ATOM   2703 O  O   . LEU B 1 131 ? 23.082  34.159 59.155  1.00 24.01  ? 131  LEU C O   1 
ATOM   2704 C  CB  . LEU B 1 131 ? 23.501  36.470 56.843  1.00 24.06  ? 131  LEU C CB  1 
ATOM   2705 C  CG  . LEU B 1 131 ? 21.997  36.376 56.820  1.00 22.49  ? 131  LEU C CG  1 
ATOM   2706 C  CD1 . LEU B 1 131 ? 21.351  36.898 58.177  1.00 22.79  ? 131  LEU C CD1 1 
ATOM   2707 C  CD2 . LEU B 1 131 ? 21.386  36.985 55.522  1.00 23.80  ? 131  LEU C CD2 1 
ATOM   2708 N  N   . THR B 1 132 ? 24.726  33.601 57.718  1.00 24.85  ? 132  THR C N   1 
ATOM   2709 C  CA  . THR B 1 132 ? 24.531  32.131 57.893  1.00 23.50  ? 132  THR C CA  1 
ATOM   2710 C  C   . THR B 1 132 ? 24.755  31.754 59.362  1.00 23.16  ? 132  THR C C   1 
ATOM   2711 O  O   . THR B 1 132 ? 24.011  30.961 59.966  1.00 20.98  ? 132  THR C O   1 
ATOM   2712 C  CB  . THR B 1 132 ? 25.472  31.328 56.974  1.00 24.94  ? 132  THR C CB  1 
ATOM   2713 O  OG1 . THR B 1 132 ? 25.263  31.733 55.618  1.00 21.83  ? 132  THR C OG1 1 
ATOM   2714 C  CG2 . THR B 1 132 ? 25.302  29.781 57.175  1.00 23.13  ? 132  THR C CG2 1 
ATOM   2715 N  N   . LYS B 1 133 ? 25.800  32.323 59.948  1.00 22.97  ? 133  LYS C N   1 
ATOM   2716 C  CA  . LYS B 1 133 ? 26.099  32.110 61.355  1.00 24.18  ? 133  LYS C CA  1 
ATOM   2717 C  C   . LYS B 1 133 ? 25.035  32.649 62.302  1.00 23.44  ? 133  LYS C C   1 
ATOM   2718 O  O   . LYS B 1 133 ? 24.686  31.960 63.267  1.00 22.71  ? 133  LYS C O   1 
ATOM   2719 C  CB  . LYS B 1 133 ? 27.489  32.636 61.716  1.00 24.00  ? 133  LYS C CB  1 
ATOM   2720 C  CG  . LYS B 1 133 ? 28.656  31.850 60.955  1.00 25.78  ? 133  LYS C CG  1 
ATOM   2721 C  CD  . LYS B 1 133 ? 29.943  32.596 61.121  1.00 26.24  ? 133  LYS C CD  1 
ATOM   2722 C  CE  . LYS B 1 133 ? 31.089  31.961 60.349  1.00 24.29  ? 133  LYS C CE  1 
ATOM   2723 N  NZ  . LYS B 1 133 ? 32.302  32.884 60.507  1.00 25.21  ? 133  LYS C NZ  1 
ATOM   2724 N  N   . VAL B 1 134 ? 24.605  33.925 62.110  1.00 23.95  ? 134  VAL C N   1 
ATOM   2725 C  CA  . VAL B 1 134 ? 23.524  34.448 62.964  1.00 23.24  ? 134  VAL C CA  1 
ATOM   2726 C  C   . VAL B 1 134 ? 22.293  33.502 62.904  1.00 23.62  ? 134  VAL C C   1 
ATOM   2727 O  O   . VAL B 1 134 ? 21.711  33.117 63.963  1.00 22.60  ? 134  VAL C O   1 
ATOM   2728 C  CB  . VAL B 1 134 ? 23.113  35.890 62.702  1.00 22.83  ? 134  VAL C CB  1 
ATOM   2729 C  CG1 . VAL B 1 134 ? 22.026  36.282 63.711  1.00 21.68  ? 134  VAL C CG1 1 
ATOM   2730 C  CG2 . VAL B 1 134 ? 24.351  36.879 62.803  1.00 21.76  ? 134  VAL C CG2 1 
ATOM   2731 N  N   . ALA B 1 135 ? 21.912  33.149 61.701  1.00 22.67  ? 135  ALA C N   1 
ATOM   2732 C  CA  . ALA B 1 135 ? 20.705  32.408 61.490  1.00 23.91  ? 135  ALA C CA  1 
ATOM   2733 C  C   . ALA B 1 135 ? 20.803  31.019 62.126  1.00 24.76  ? 135  ALA C C   1 
ATOM   2734 O  O   . ALA B 1 135 ? 19.801  30.549 62.665  1.00 25.68  ? 135  ALA C O   1 
ATOM   2735 C  CB  . ALA B 1 135 ? 20.326  32.294 59.912  1.00 22.19  ? 135  ALA C CB  1 
ATOM   2736 N  N   . TYR B 1 136 ? 22.004  30.424 62.132  1.00 24.40  ? 136  TYR C N   1 
ATOM   2737 C  CA  . TYR B 1 136 ? 22.218  29.130 62.701  1.00 24.63  ? 136  TYR C CA  1 
ATOM   2738 C  C   . TYR B 1 136 ? 22.113  29.196 64.244  1.00 24.69  ? 136  TYR C C   1 
ATOM   2739 O  O   . TYR B 1 136 ? 21.362  28.389 64.855  1.00 22.72  ? 136  TYR C O   1 
ATOM   2740 C  CB  . TYR B 1 136 ? 23.562  28.507 62.279  1.00 24.66  ? 136  TYR C CB  1 
ATOM   2741 C  CG  . TYR B 1 136 ? 23.772  27.183 62.986  1.00 26.45  ? 136  TYR C CG  1 
ATOM   2742 C  CD1 . TYR B 1 136 ? 24.497  27.104 64.188  1.00 24.01  ? 136  TYR C CD1 1 
ATOM   2743 C  CD2 . TYR B 1 136 ? 23.219  26.019 62.478  1.00 28.10  ? 136  TYR C CD2 1 
ATOM   2744 C  CE1 . TYR B 1 136 ? 24.592  25.928 64.869  1.00 25.63  ? 136  TYR C CE1 1 
ATOM   2745 C  CE2 . TYR B 1 136 ? 23.329  24.825 63.151  1.00 27.30  ? 136  TYR C CE2 1 
ATOM   2746 C  CZ  . TYR B 1 136 ? 24.018  24.790 64.329  1.00 26.37  ? 136  TYR C CZ  1 
ATOM   2747 O  OH  . TYR B 1 136 ? 24.146  23.624 64.968  1.00 26.18  ? 136  TYR C OH  1 
ATOM   2748 N  N   . TYR B 1 137 ? 22.861  30.130 64.855  1.00 24.02  ? 137  TYR C N   1 
ATOM   2749 C  CA  . TYR B 1 137 ? 22.925  30.179 66.336  1.00 22.92  ? 137  TYR C CA  1 
ATOM   2750 C  C   . TYR B 1 137 ? 21.665  30.713 66.943  1.00 23.37  ? 137  TYR C C   1 
ATOM   2751 O  O   . TYR B 1 137 ? 21.189  30.212 68.009  1.00 23.87  ? 137  TYR C O   1 
ATOM   2752 C  CB  . TYR B 1 137 ? 24.169  30.898 66.840  1.00 21.28  ? 137  TYR C CB  1 
ATOM   2753 C  CG  . TYR B 1 137 ? 25.479  30.118 66.482  1.00 22.76  ? 137  TYR C CG  1 
ATOM   2754 C  CD1 . TYR B 1 137 ? 25.797  28.930 67.094  1.00 23.61  ? 137  TYR C CD1 1 
ATOM   2755 C  CD2 . TYR B 1 137 ? 26.388  30.633 65.553  1.00 24.01  ? 137  TYR C CD2 1 
ATOM   2756 C  CE1 . TYR B 1 137 ? 26.977  28.233 66.733  1.00 22.98  ? 137  TYR C CE1 1 
ATOM   2757 C  CE2 . TYR B 1 137 ? 27.516  29.920 65.139  1.00 24.93  ? 137  TYR C CE2 1 
ATOM   2758 C  CZ  . TYR B 1 137 ? 27.814  28.748 65.744  1.00 21.20  ? 137  TYR C CZ  1 
ATOM   2759 O  OH  . TYR B 1 137 ? 28.968  28.152 65.409  1.00 24.04  ? 137  TYR C OH  1 
ATOM   2760 N  N   . ALA B 1 138 ? 21.074  31.685 66.271  1.00 23.21  ? 138  ALA C N   1 
ATOM   2761 C  CA  . ALA B 1 138 ? 19.838  32.262 66.783  1.00 23.05  ? 138  ALA C CA  1 
ATOM   2762 C  C   . ALA B 1 138 ? 18.663  31.235 66.794  1.00 23.98  ? 138  ALA C C   1 
ATOM   2763 O  O   . ALA B 1 138 ? 17.967  31.113 67.800  1.00 22.32  ? 138  ALA C O   1 
ATOM   2764 C  CB  . ALA B 1 138 ? 19.481  33.510 66.028  1.00 23.60  ? 138  ALA C CB  1 
ATOM   2765 N  N   . ARG B 1 139 ? 18.508  30.516 65.694  1.00 25.44  ? 139  ARG C N   1 
ATOM   2766 C  CA  . ARG B 1 139 ? 17.610  29.379 65.601  1.00 27.19  ? 139  ARG C CA  1 
ATOM   2767 C  C   . ARG B 1 139 ? 17.877  28.360 66.681  1.00 26.94  ? 139  ARG C C   1 
ATOM   2768 O  O   . ARG B 1 139 ? 16.935  27.889 67.336  1.00 26.79  ? 139  ARG C O   1 
ATOM   2769 C  CB  . ARG B 1 139 ? 17.605  28.750 64.205  1.00 24.60  ? 139  ARG C CB  1 
ATOM   2770 C  CG  . ARG B 1 139 ? 16.666  27.549 64.048  1.00 27.14  ? 139  ARG C CG  1 
ATOM   2771 C  CD  . ARG B 1 139 ? 16.941  26.909 62.693  1.00 30.37  ? 139  ARG C CD  1 
ATOM   2772 N  NE  . ARG B 1 139 ? 15.974  25.869 62.380  1.00 36.82  ? 139  ARG C NE  1 
ATOM   2773 C  CZ  . ARG B 1 139 ? 14.789  25.999 61.756  1.00 38.55  ? 139  ARG C CZ  1 
ATOM   2774 N  NH1 . ARG B 1 139 ? 14.283  27.189 61.268  1.00 35.74  ? 139  ARG C NH1 1 
ATOM   2775 N  NH2 . ARG B 1 139 ? 14.088  24.879 61.604  1.00 38.68  ? 139  ARG C NH2 1 
ATOM   2776 N  N   . GLN B 1 140 ? 19.154  28.005 66.861  1.00 27.70  ? 140  GLN C N   1 
ATOM   2777 C  CA  . GLN B 1 140 ? 19.516  26.980 67.778  1.00 26.22  ? 140  GLN C CA  1 
ATOM   2778 C  C   . GLN B 1 140 ? 19.099  27.319 69.228  1.00 25.73  ? 140  GLN C C   1 
ATOM   2779 O  O   . GLN B 1 140 ? 18.559  26.476 69.909  1.00 24.04  ? 140  GLN C O   1 
ATOM   2780 C  CB  . GLN B 1 140 ? 21.012  26.721 67.646  1.00 28.38  ? 140  GLN C CB  1 
ATOM   2781 C  CG  . GLN B 1 140 ? 21.550  25.577 68.475  1.00 31.47  ? 140  GLN C CG  1 
ATOM   2782 C  CD  . GLN B 1 140 ? 20.906  24.235 68.082  1.00 39.51  ? 140  GLN C CD  1 
ATOM   2783 O  OE1 . GLN B 1 140 ? 20.310  24.110 66.972  1.00 39.53  ? 140  GLN C OE1 1 
ATOM   2784 N  NE2 . GLN B 1 140 ? 20.996  23.214 69.013  1.00 41.81  ? 140  GLN C NE2 1 
ATOM   2785 N  N   . VAL B 1 141 ? 19.282  28.574 69.635  1.00 25.02  ? 141  VAL C N   1 
ATOM   2786 C  CA  . VAL B 1 141 ? 18.846  29.070 70.932  1.00 25.09  ? 141  VAL C CA  1 
ATOM   2787 C  C   . VAL B 1 141 ? 17.319  28.916 71.077  1.00 23.88  ? 141  VAL C C   1 
ATOM   2788 O  O   . VAL B 1 141 ? 16.845  28.459 72.105  1.00 24.70  ? 141  VAL C O   1 
ATOM   2789 C  CB  . VAL B 1 141 ? 19.215  30.558 71.157  1.00 24.87  ? 141  VAL C CB  1 
ATOM   2790 C  CG1 . VAL B 1 141 ? 18.464  31.135 72.337  1.00 24.78  ? 141  VAL C CG1 1 
ATOM   2791 C  CG2 . VAL B 1 141 ? 20.771  30.796 71.244  1.00 21.05  ? 141  VAL C CG2 1 
ATOM   2792 N  N   . ALA B 1 142 ? 16.598  29.396 70.083  1.00 22.51  ? 142  ALA C N   1 
ATOM   2793 C  CA  . ALA B 1 142 ? 15.182  29.324 70.049  1.00 23.98  ? 142  ALA C CA  1 
ATOM   2794 C  C   . ALA B 1 142 ? 14.702  27.884 70.095  1.00 25.20  ? 142  ALA C C   1 
ATOM   2795 O  O   . ALA B 1 142 ? 13.819  27.610 70.854  1.00 23.38  ? 142  ALA C O   1 
ATOM   2796 C  CB  . ALA B 1 142 ? 14.554  30.120 68.862  1.00 23.04  ? 142  ALA C CB  1 
ATOM   2797 N  N   . GLU B 1 143 ? 15.356  26.986 69.352  1.00 26.20  ? 143  GLU C N   1 
ATOM   2798 C  CA  . GLU B 1 143 ? 14.999  25.583 69.292  1.00 28.51  ? 143  GLU C CA  1 
ATOM   2799 C  C   . GLU B 1 143 ? 15.214  24.896 70.657  1.00 27.76  ? 143  GLU C C   1 
ATOM   2800 O  O   . GLU B 1 143 ? 14.369  24.121 71.109  1.00 27.72  ? 143  GLU C O   1 
ATOM   2801 C  CB  . GLU B 1 143 ? 15.859  24.877 68.203  1.00 27.42  ? 143  GLU C CB  1 
ATOM   2802 C  CG  . GLU B 1 143 ? 15.309  23.532 67.730  1.00 34.16  ? 143  GLU C CG  1 
ATOM   2803 C  CD  . GLU B 1 143 ? 16.374  22.525 67.232  1.00 34.64  ? 143  GLU C CD  1 
ATOM   2804 O  OE1 . GLU B 1 143 ? 15.923  21.475 66.764  1.00 39.92  ? 143  GLU C OE1 1 
ATOM   2805 O  OE2 . GLU B 1 143 ? 17.634  22.743 67.373  1.00 41.12  ? 143  GLU C OE2 1 
ATOM   2806 N  N   . MET B 1 144 ? 16.351  25.137 71.286  1.00 27.44  ? 144  MET C N   1 
ATOM   2807 C  CA  . MET B 1 144 ? 16.582  24.662 72.644  1.00 29.49  ? 144  MET C CA  1 
ATOM   2808 C  C   . MET B 1 144 ? 15.542  25.138 73.719  1.00 28.71  ? 144  MET C C   1 
ATOM   2809 O  O   . MET B 1 144 ? 15.246  24.459 74.704  1.00 27.31  ? 144  MET C O   1 
ATOM   2810 C  CB  . MET B 1 144 ? 17.998  25.036 73.072  1.00 29.58  ? 144  MET C CB  1 
ATOM   2811 C  CG  . MET B 1 144 ? 19.131  24.296 72.218  1.00 31.79  ? 144  MET C CG  1 
ATOM   2812 S  SD  . MET B 1 144 ? 20.784  25.046 72.439  1.00 36.94  ? 144  MET C SD  1 
ATOM   2813 C  CE  . MET B 1 144 ? 21.042  24.580 74.120  1.00 33.70  ? 144  MET C CE  1 
ATOM   2814 N  N   . ASN B 1 145 ? 15.028  26.336 73.544  1.00 27.89  ? 145  ASN C N   1 
ATOM   2815 C  CA  . ASN B 1 145 ? 13.919  26.828 74.387  1.00 28.51  ? 145  ASN C CA  1 
ATOM   2816 C  C   . ASN B 1 145 ? 12.533  26.339 73.913  1.00 28.40  ? 145  ASN C C   1 
ATOM   2817 O  O   . ASN B 1 145 ? 11.516  26.698 74.485  1.00 28.18  ? 145  ASN C O   1 
ATOM   2818 C  CB  . ASN B 1 145 ? 13.937  28.351 74.440  1.00 26.83  ? 145  ASN C CB  1 
ATOM   2819 C  CG  . ASN B 1 145 ? 15.143  28.878 75.112  1.00 31.21  ? 145  ASN C CG  1 
ATOM   2820 O  OD1 . ASN B 1 145 ? 15.644  28.256 76.046  1.00 40.61  ? 145  ASN C OD1 1 
ATOM   2821 N  ND2 . ASN B 1 145 ? 15.625  30.033 74.678  1.00 37.85  ? 145  ASN C ND2 1 
ATOM   2822 N  N   . THR B 1 146 ? 12.482  25.537 72.854  1.00 26.98  ? 146  THR C N   1 
ATOM   2823 C  CA  . THR B 1 146 ? 11.191  25.023 72.381  1.00 26.83  ? 146  THR C CA  1 
ATOM   2824 C  C   . THR B 1 146 ? 11.025  23.517 72.438  1.00 26.23  ? 146  THR C C   1 
ATOM   2825 O  O   . THR B 1 146 ? 9.946   23.028 72.784  1.00 25.89  ? 146  THR C O   1 
ATOM   2826 C  CB  . THR B 1 146 ? 10.978  25.524 70.943  1.00 26.29  ? 146  THR C CB  1 
ATOM   2827 O  OG1 . THR B 1 146 ? 11.132  26.924 70.978  1.00 26.07  ? 146  THR C OG1 1 
ATOM   2828 C  CG2 . THR B 1 146 ? 9.588   25.171 70.362  1.00 26.56  ? 146  THR C CG2 1 
ATOM   2829 N  N   . TYR B 1 147 ? 12.088  22.790 72.123  1.00 26.33  ? 147  TYR C N   1 
ATOM   2830 C  CA  . TYR B 1 147 ? 11.995  21.365 71.849  1.00 26.46  ? 147  TYR C CA  1 
ATOM   2831 C  C   . TYR B 1 147 ? 12.914  20.622 72.788  1.00 26.95  ? 147  TYR C C   1 
ATOM   2832 O  O   . TYR B 1 147 ? 14.025  21.056 73.023  1.00 25.55  ? 147  TYR C O   1 
ATOM   2833 C  CB  . TYR B 1 147 ? 12.399  21.084 70.415  1.00 25.82  ? 147  TYR C CB  1 
ATOM   2834 C  CG  . TYR B 1 147 ? 11.452  21.698 69.419  1.00 25.67  ? 147  TYR C CG  1 
ATOM   2835 C  CD1 . TYR B 1 147 ? 11.875  22.747 68.589  1.00 25.43  ? 147  TYR C CD1 1 
ATOM   2836 C  CD2 . TYR B 1 147 ? 10.108  21.281 69.343  1.00 26.95  ? 147  TYR C CD2 1 
ATOM   2837 C  CE1 . TYR B 1 147 ? 11.025  23.332 67.673  1.00 25.59  ? 147  TYR C CE1 1 
ATOM   2838 C  CE2 . TYR B 1 147 ? 9.226   21.882 68.411  1.00 28.95  ? 147  TYR C CE2 1 
ATOM   2839 C  CZ  . TYR B 1 147 ? 9.732   22.928 67.594  1.00 27.04  ? 147  TYR C CZ  1 
ATOM   2840 O  OH  . TYR B 1 147 ? 8.965   23.542 66.666  1.00 29.00  ? 147  TYR C OH  1 
ATOM   2841 N  N   . ASN B 1 148 ? 12.461  19.488 73.299  1.00 28.66  ? 148  ASN C N   1 
ATOM   2842 C  CA  . ASN B 1 148 ? 13.274  18.742 74.305  1.00 30.85  ? 148  ASN C CA  1 
ATOM   2843 C  C   . ASN B 1 148 ? 14.402  18.011 73.582  1.00 31.78  ? 148  ASN C C   1 
ATOM   2844 O  O   . ASN B 1 148 ? 14.401  17.995 72.346  1.00 31.61  ? 148  ASN C O   1 
ATOM   2845 C  CB  . ASN B 1 148 ? 12.380  17.849 75.150  1.00 30.92  ? 148  ASN C CB  1 
ATOM   2846 C  CG  . ASN B 1 148 ? 11.852  16.672 74.412  1.00 31.49  ? 148  ASN C CG  1 
ATOM   2847 O  OD1 . ASN B 1 148 ? 12.567  16.015 73.650  1.00 35.48  ? 148  ASN C OD1 1 
ATOM   2848 N  ND2 . ASN B 1 148 ? 10.588  16.354 74.659  1.00 36.43  ? 148  ASN C ND2 1 
ATOM   2849 N  N   . PRO B 1 149 ? 15.410  17.513 74.325  1.00 32.20  ? 149  PRO C N   1 
ATOM   2850 C  CA  . PRO B 1 149 ? 16.591  16.897 73.739  1.00 32.38  ? 149  PRO C CA  1 
ATOM   2851 C  C   . PRO B 1 149 ? 16.319  15.829 72.664  1.00 31.67  ? 149  PRO C C   1 
ATOM   2852 O  O   . PRO B 1 149 ? 17.000  15.831 71.606  1.00 30.98  ? 149  PRO C O   1 
ATOM   2853 C  CB  . PRO B 1 149 ? 17.264  16.244 74.967  1.00 33.19  ? 149  PRO C CB  1 
ATOM   2854 C  CG  . PRO B 1 149 ? 16.985  17.254 76.031  1.00 32.51  ? 149  PRO C CG  1 
ATOM   2855 C  CD  . PRO B 1 149 ? 15.543  17.583 75.797  1.00 33.41  ? 149  PRO C CD  1 
ATOM   2856 N  N   . THR B 1 150 ? 15.378  14.930 72.954  1.00 30.30  ? 150  THR C N   1 
ATOM   2857 C  CA  . THR B 1 150 ? 14.973  13.905 71.997  1.00 30.80  ? 150  THR C CA  1 
ATOM   2858 C  C   . THR B 1 150 ? 14.470  14.486 70.691  1.00 28.93  ? 150  THR C C   1 
ATOM   2859 O  O   . THR B 1 150 ? 14.958  14.133 69.635  1.00 29.01  ? 150  THR C O   1 
ATOM   2860 C  CB  . THR B 1 150 ? 13.868  13.011 72.570  1.00 30.32  ? 150  THR C CB  1 
ATOM   2861 O  OG1 . THR B 1 150 ? 14.414  12.247 73.650  1.00 34.76  ? 150  THR C OG1 1 
ATOM   2862 C  CG2 . THR B 1 150 ? 13.261  12.098 71.456  1.00 31.94  ? 150  THR C CG2 1 
ATOM   2863 N  N   . ILE B 1 151 ? 13.482  15.360 70.778  1.00 27.87  ? 151  ILE C N   1 
ATOM   2864 C  CA  . ILE B 1 151 ? 12.923  16.003 69.578  1.00 28.69  ? 151  ILE C CA  1 
ATOM   2865 C  C   . ILE B 1 151 ? 14.034  16.741 68.759  1.00 28.44  ? 151  ILE C C   1 
ATOM   2866 O  O   . ILE B 1 151 ? 14.042  16.648 67.533  1.00 28.35  ? 151  ILE C O   1 
ATOM   2867 C  CB  . ILE B 1 151 ? 11.686  16.896 69.930  1.00 27.64  ? 151  ILE C CB  1 
ATOM   2868 C  CG1 . ILE B 1 151 ? 10.590  16.051 70.569  1.00 29.22  ? 151  ILE C CG1 1 
ATOM   2869 C  CG2 . ILE B 1 151 ? 11.086  17.590 68.697  1.00 27.81  ? 151  ILE C CG2 1 
ATOM   2870 C  CD1 . ILE B 1 151 ? 9.540   16.860 71.261  1.00 28.29  ? 151  ILE C CD1 1 
ATOM   2871 N  N   . ARG B 1 152 ? 14.994  17.390 69.440  1.00 28.67  ? 152  ARG C N   1 
ATOM   2872 C  CA  . ARG B 1 152 ? 16.073  18.119 68.749  1.00 29.27  ? 152  ARG C CA  1 
ATOM   2873 C  C   . ARG B 1 152 ? 16.907  17.128 67.904  1.00 31.15  ? 152  ARG C C   1 
ATOM   2874 O  O   . ARG B 1 152 ? 17.283  17.453 66.771  1.00 30.64  ? 152  ARG C O   1 
ATOM   2875 C  CB  . ARG B 1 152 ? 16.927  18.971 69.681  1.00 28.68  ? 152  ARG C CB  1 
ATOM   2876 C  CG  . ARG B 1 152 ? 16.158  20.120 70.299  1.00 28.30  ? 152  ARG C CG  1 
ATOM   2877 C  CD  . ARG B 1 152 ? 17.033  21.221 70.827  1.00 30.57  ? 152  ARG C CD  1 
ATOM   2878 N  NE  . ARG B 1 152 ? 18.057  20.803 71.810  1.00 30.96  ? 152  ARG C NE  1 
ATOM   2879 C  CZ  . ARG B 1 152 ? 17.868  20.668 73.122  1.00 35.71  ? 152  ARG C CZ  1 
ATOM   2880 N  NH1 . ARG B 1 152 ? 16.691  20.899 73.665  1.00 37.39  ? 152  ARG C NH1 1 
ATOM   2881 N  NH2 . ARG B 1 152 ? 18.881  20.334 73.922  1.00 35.52  ? 152  ARG C NH2 1 
ATOM   2882 N  N   . ILE B 1 153 ? 17.085  15.903 68.393  1.00 31.43  ? 153  ILE C N   1 
ATOM   2883 C  CA  . ILE B 1 153 ? 17.768  14.901 67.595  1.00 32.50  ? 153  ILE C CA  1 
ATOM   2884 C  C   . ILE B 1 153 ? 16.962  14.544 66.354  1.00 33.14  ? 153  ILE C C   1 
ATOM   2885 O  O   . ILE B 1 153 ? 17.504  14.521 65.257  1.00 33.18  ? 153  ILE C O   1 
ATOM   2886 C  CB  . ILE B 1 153 ? 18.113  13.598 68.419  1.00 32.58  ? 153  ILE C CB  1 
ATOM   2887 C  CG1 . ILE B 1 153 ? 19.137  13.913 69.494  1.00 33.00  ? 153  ILE C CG1 1 
ATOM   2888 C  CG2 . ILE B 1 153 ? 18.594  12.473 67.466  1.00 32.03  ? 153  ILE C CG2 1 
ATOM   2889 C  CD1 . ILE B 1 153 ? 19.144  12.920 70.692  1.00 31.54  ? 153  ILE C CD1 1 
ATOM   2890 N  N   . LEU B 1 154 ? 15.678  14.224 66.544  1.00 33.82  ? 154  LEU C N   1 
ATOM   2891 C  CA  . LEU B 1 154 ? 14.755  13.927 65.436  1.00 32.54  ? 154  LEU C CA  1 
ATOM   2892 C  C   . LEU B 1 154 ? 14.666  15.062 64.337  1.00 32.95  ? 154  LEU C C   1 
ATOM   2893 O  O   . LEU B 1 154 ? 14.531  14.750 63.141  1.00 31.59  ? 154  LEU C O   1 
ATOM   2894 C  CB  . LEU B 1 154 ? 13.343  13.633 65.992  1.00 32.93  ? 154  LEU C CB  1 
ATOM   2895 C  CG  . LEU B 1 154 ? 12.968  12.238 66.535  1.00 34.29  ? 154  LEU C CG  1 
ATOM   2896 C  CD1 . LEU B 1 154 ? 13.945  11.804 67.527  1.00 35.59  ? 154  LEU C CD1 1 
ATOM   2897 C  CD2 . LEU B 1 154 ? 11.568  12.256 67.142  1.00 32.82  ? 154  LEU C CD2 1 
ATOM   2898 N  N   . ARG B 1 155 ? 14.687  16.323 64.780  1.00 33.03  ? 155  ARG C N   1 
ATOM   2899 C  CA  . ARG B 1 155 ? 14.646  17.509 63.914  1.00 32.26  ? 155  ARG C CA  1 
ATOM   2900 C  C   . ARG B 1 155 ? 15.890  17.597 63.057  1.00 32.50  ? 155  ARG C C   1 
ATOM   2901 O  O   . ARG B 1 155 ? 15.805  17.837 61.845  1.00 30.70  ? 155  ARG C O   1 
ATOM   2902 C  CB  . ARG B 1 155 ? 14.480  18.776 64.762  1.00 32.49  ? 155  ARG C CB  1 
ATOM   2903 C  CG  . ARG B 1 155 ? 13.106  18.949 65.357  1.00 31.15  ? 155  ARG C CG  1 
ATOM   2904 C  CD  . ARG B 1 155 ? 12.954  20.213 66.175  1.00 29.66  ? 155  ARG C CD  1 
ATOM   2905 N  NE  . ARG B 1 155 ? 13.191  21.442 65.402  1.00 31.17  ? 155  ARG C NE  1 
ATOM   2906 C  CZ  . ARG B 1 155 ? 12.289  22.138 64.709  1.00 31.58  ? 155  ARG C CZ  1 
ATOM   2907 N  NH1 . ARG B 1 155 ? 11.041  21.721 64.575  1.00 33.85  ? 155  ARG C NH1 1 
ATOM   2908 N  NH2 . ARG B 1 155 ? 12.658  23.258 64.096  1.00 29.40  ? 155  ARG C NH2 1 
ATOM   2909 N  N   . LEU B 1 156 ? 17.033  17.244 63.647  1.00 33.98  ? 156  LEU C N   1 
ATOM   2910 C  CA  . LEU B 1 156 ? 18.270  17.170 62.879  1.00 34.39  ? 156  LEU C CA  1 
ATOM   2911 C  C   . LEU B 1 156 ? 18.198  16.171 61.712  1.00 35.73  ? 156  LEU C C   1 
ATOM   2912 O  O   . LEU B 1 156 ? 18.589  16.501 60.581  1.00 33.96  ? 156  LEU C O   1 
ATOM   2913 C  CB  . LEU B 1 156 ? 19.465  16.875 63.779  1.00 34.91  ? 156  LEU C CB  1 
ATOM   2914 C  CG  . LEU B 1 156 ? 20.794  16.674 63.038  1.00 33.98  ? 156  LEU C CG  1 
ATOM   2915 C  CD1 . LEU B 1 156 ? 21.240  17.963 62.338  1.00 34.77  ? 156  LEU C CD1 1 
ATOM   2916 C  CD2 . LEU B 1 156 ? 21.772  16.156 64.083  1.00 36.40  ? 156  LEU C CD2 1 
ATOM   2917 N  N   . PHE B 1 157 ? 17.750  14.952 62.020  1.00 36.53  ? 157  PHE C N   1 
ATOM   2918 C  CA  . PHE B 1 157 ? 17.699  13.913 61.041  1.00 36.61  ? 157  PHE C CA  1 
ATOM   2919 C  C   . PHE B 1 157 ? 16.637  14.243 59.952  1.00 36.58  ? 157  PHE C C   1 
ATOM   2920 O  O   . PHE B 1 157 ? 16.876  14.031 58.772  1.00 36.11  ? 157  PHE C O   1 
ATOM   2921 C  CB  . PHE B 1 157 ? 17.312  12.610 61.674  1.00 37.47  ? 157  PHE C CB  1 
ATOM   2922 C  CG  . PHE B 1 157 ? 18.389  11.957 62.510  1.00 39.33  ? 157  PHE C CG  1 
ATOM   2923 C  CD1 . PHE B 1 157 ? 19.687  11.799 62.047  1.00 42.86  ? 157  PHE C CD1 1 
ATOM   2924 C  CD2 . PHE B 1 157 ? 18.049  11.437 63.748  1.00 43.07  ? 157  PHE C CD2 1 
ATOM   2925 C  CE1 . PHE B 1 157 ? 20.670  11.120 62.835  1.00 39.90  ? 157  PHE C CE1 1 
ATOM   2926 C  CE2 . PHE B 1 157 ? 18.989  10.744 64.558  1.00 43.11  ? 157  PHE C CE2 1 
ATOM   2927 C  CZ  . PHE B 1 157 ? 20.309  10.605 64.095  1.00 44.12  ? 157  PHE C CZ  1 
ATOM   2928 N  N   . TYR B 1 158 ? 15.492  14.767 60.361  1.00 35.94  ? 158  TYR C N   1 
ATOM   2929 C  CA  . TYR B 1 158 ? 14.499  15.243 59.417  1.00 36.79  ? 158  TYR C CA  1 
ATOM   2930 C  C   . TYR B 1 158 ? 15.039  16.348 58.477  1.00 36.50  ? 158  TYR C C   1 
ATOM   2931 O  O   . TYR B 1 158 ? 14.910  16.313 57.214  1.00 36.58  ? 158  TYR C O   1 
ATOM   2932 C  CB  . TYR B 1 158 ? 13.244  15.747 60.178  1.00 37.65  ? 158  TYR C CB  1 
ATOM   2933 C  CG  . TYR B 1 158 ? 12.241  16.308 59.207  1.00 38.53  ? 158  TYR C CG  1 
ATOM   2934 C  CD1 . TYR B 1 158 ? 11.555  15.446 58.358  1.00 39.58  ? 158  TYR C CD1 1 
ATOM   2935 C  CD2 . TYR B 1 158 ? 12.051  17.696 59.076  1.00 39.39  ? 158  TYR C CD2 1 
ATOM   2936 C  CE1 . TYR B 1 158 ? 10.641  15.921 57.390  1.00 39.12  ? 158  TYR C CE1 1 
ATOM   2937 C  CE2 . TYR B 1 158 ? 11.123  18.199 58.109  1.00 40.72  ? 158  TYR C CE2 1 
ATOM   2938 C  CZ  . TYR B 1 158 ? 10.439  17.280 57.276  1.00 35.71  ? 158  TYR C CZ  1 
ATOM   2939 O  OH  . TYR B 1 158 ? 9.546   17.715 56.321  1.00 40.88  ? 158  TYR C OH  1 
ATOM   2940 N  N   . GLU B 1 159 ? 15.614  17.360 59.081  1.00 35.16  ? 159  GLU C N   1 
ATOM   2941 C  CA  . GLU B 1 159 ? 16.197  18.438 58.306  1.00 37.39  ? 159  GLU C CA  1 
ATOM   2942 C  C   . GLU B 1 159 ? 17.266  17.947 57.290  1.00 36.63  ? 159  GLU C C   1 
ATOM   2943 O  O   . GLU B 1 159 ? 17.272  18.379 56.112  1.00 35.22  ? 159  GLU C O   1 
ATOM   2944 C  CB  . GLU B 1 159 ? 16.687  19.542 59.251  1.00 38.05  ? 159  GLU C CB  1 
ATOM   2945 C  CG  . GLU B 1 159 ? 15.494  20.224 59.921  1.00 39.90  ? 159  GLU C CG  1 
ATOM   2946 C  CD  . GLU B 1 159 ? 15.800  20.984 61.204  1.00 41.36  ? 159  GLU C CD  1 
ATOM   2947 O  OE1 . GLU B 1 159 ? 16.984  21.108 61.629  1.00 48.27  ? 159  GLU C OE1 1 
ATOM   2948 O  OE2 . GLU B 1 159 ? 14.802  21.489 61.792  1.00 48.10  ? 159  GLU C OE2 1 
ATOM   2949 N  N   . LEU B 1 160 ? 18.129  17.039 57.729  1.00 35.17  ? 160  LEU C N   1 
ATOM   2950 C  CA  . LEU B 1 160 ? 19.139  16.452 56.864  1.00 36.12  ? 160  LEU C CA  1 
ATOM   2951 C  C   . LEU B 1 160 ? 18.474  15.578 55.796  1.00 36.66  ? 160  LEU C C   1 
ATOM   2952 O  O   . LEU B 1 160 ? 18.909  15.524 54.658  1.00 36.11  ? 160  LEU C O   1 
ATOM   2953 C  CB  . LEU B 1 160 ? 20.106  15.572 57.680  1.00 36.48  ? 160  LEU C CB  1 
ATOM   2954 C  CG  . LEU B 1 160 ? 21.167  16.310 58.539  1.00 35.69  ? 160  LEU C CG  1 
ATOM   2955 C  CD1 . LEU B 1 160 ? 21.894  15.262 59.431  1.00 37.21  ? 160  LEU C CD1 1 
ATOM   2956 C  CD2 . LEU B 1 160 ? 22.154  17.155 57.642  1.00 37.12  ? 160  LEU C CD2 1 
ATOM   2957 N  N   . CYS B 1 161 ? 17.416  14.876 56.179  1.00 38.13  ? 161  CYS C N   1 
ATOM   2958 C  CA  . CYS B 1 161 ? 16.703  14.018 55.209  1.00 39.21  ? 161  CYS C CA  1 
ATOM   2959 C  C   . CYS B 1 161 ? 16.035  14.852 54.116  1.00 39.66  ? 161  CYS C C   1 
ATOM   2960 O  O   . CYS B 1 161 ? 16.150  14.529 52.924  1.00 39.12  ? 161  CYS C O   1 
ATOM   2961 C  CB  . CYS B 1 161 ? 15.713  13.087 55.906  1.00 39.75  ? 161  CYS C CB  1 
ATOM   2962 S  SG  . CYS B 1 161 ? 15.063  11.926 54.707  1.00 40.49  ? 161  CYS C SG  1 
ATOM   2963 N  N   . SER B 1 162 ? 15.378  15.929 54.549  1.00 40.11  ? 162  SER C N   1 
ATOM   2964 C  CA  . SER B 1 162 ? 14.731  16.919 53.703  1.00 40.74  ? 162  SER C CA  1 
ATOM   2965 C  C   . SER B 1 162 ? 15.702  17.664 52.782  1.00 40.45  ? 162  SER C C   1 
ATOM   2966 O  O   . SER B 1 162 ? 15.329  18.077 51.705  1.00 40.71  ? 162  SER C O   1 
ATOM   2967 C  CB  . SER B 1 162 ? 13.988  17.958 54.563  1.00 41.74  ? 162  SER C CB  1 
ATOM   2968 O  OG  . SER B 1 162 ? 12.840  17.354 55.162  1.00 45.49  ? 162  SER C OG  1 
ATOM   2969 N  N   . SER B 1 163 ? 16.942  17.843 53.202  1.00 38.94  ? 163  SER C N   1 
ATOM   2970 C  CA  . SER B 1 163 ? 17.889  18.572 52.423  1.00 39.04  ? 163  SER C CA  1 
ATOM   2971 C  C   . SER B 1 163 ? 18.632  17.653 51.442  1.00 39.19  ? 163  SER C C   1 
ATOM   2972 O  O   . SER B 1 163 ? 18.821  17.950 50.257  1.00 36.43  ? 163  SER C O   1 
ATOM   2973 C  CB  . SER B 1 163 ? 18.861  19.283 53.348  1.00 40.23  ? 163  SER C CB  1 
ATOM   2974 O  OG  . SER B 1 163 ? 19.901  19.878 52.599  1.00 39.18  ? 163  SER C OG  1 
ATOM   2975 N  N   . GLN B 1 164 ? 19.122  16.551 51.946  1.00 38.32  ? 164  GLN C N   1 
ATOM   2976 C  CA  . GLN B 1 164 ? 20.080  15.837 51.161  1.00 38.61  ? 164  GLN C CA  1 
ATOM   2977 C  C   . GLN B 1 164 ? 19.816  14.357 51.092  1.00 37.09  ? 164  GLN C C   1 
ATOM   2978 O  O   . GLN B 1 164 ? 20.646  13.618 50.575  1.00 37.25  ? 164  GLN C O   1 
ATOM   2979 C  CB  . GLN B 1 164 ? 21.462  16.167 51.719  1.00 39.05  ? 164  GLN C CB  1 
ATOM   2980 C  CG  . GLN B 1 164 ? 21.820  15.524 52.952  1.00 39.53  ? 164  GLN C CG  1 
ATOM   2981 C  CD  . GLN B 1 164 ? 23.159  16.034 53.478  1.00 42.21  ? 164  GLN C CD  1 
ATOM   2982 O  OE1 . GLN B 1 164 ? 23.400  17.261 53.562  1.00 46.33  ? 164  GLN C OE1 1 
ATOM   2983 N  NE2 . GLN B 1 164 ? 24.062  15.090 53.792  1.00 45.61  ? 164  GLN C NE2 1 
ATOM   2984 N  N   . GLY B 1 165 ? 18.671  13.944 51.627  1.00 34.97  ? 165  GLY C N   1 
ATOM   2985 C  CA  . GLY B 1 165 ? 18.209  12.568 51.503  1.00 35.94  ? 165  GLY C CA  1 
ATOM   2986 C  C   . GLY B 1 165 ? 18.004  12.097 50.049  1.00 34.33  ? 165  GLY C C   1 
ATOM   2987 O  O   . GLY B 1 165 ? 17.548  12.806 49.195  1.00 35.64  ? 165  GLY C O   1 
ATOM   2988 N  N   . LYS B 1 166 ? 18.482  10.916 49.776  1.00 35.02  ? 166  LYS C N   1 
ATOM   2989 C  CA  . LYS B 1 166 ? 18.397  10.255 48.476  1.00 33.22  ? 166  LYS C CA  1 
ATOM   2990 C  C   . LYS B 1 166 ? 17.363  9.132  48.509  1.00 32.10  ? 166  LYS C C   1 
ATOM   2991 O  O   . LYS B 1 166 ? 17.474  8.170  49.307  1.00 33.24  ? 166  LYS C O   1 
ATOM   2992 C  CB  . LYS B 1 166 ? 19.751  9.651  48.148  1.00 33.47  ? 166  LYS C CB  1 
ATOM   2993 C  CG  . LYS B 1 166 ? 20.801  10.642 47.856  1.00 35.51  ? 166  LYS C CG  1 
ATOM   2994 C  CD  . LYS B 1 166 ? 22.172  10.124 48.300  1.00 36.65  ? 166  LYS C CD  1 
ATOM   2995 C  CE  . LYS B 1 166 ? 23.241  11.106 47.939  1.00 38.62  ? 166  LYS C CE  1 
ATOM   2996 N  NZ  . LYS B 1 166 ? 24.626  10.554 48.126  1.00 38.36  ? 166  LYS C NZ  1 
ATOM   2997 N  N   . ARG B 1 167 ? 16.368  9.215  47.623  1.00 31.28  ? 167  ARG C N   1 
ATOM   2998 C  CA  . ARG B 1 167 ? 15.289  8.211  47.574  1.00 27.61  ? 167  ARG C CA  1 
ATOM   2999 C  C   . ARG B 1 167 ? 15.848  6.966  46.890  1.00 28.43  ? 167  ARG C C   1 
ATOM   3000 O  O   . ARG B 1 167 ? 16.132  6.972  45.673  1.00 26.17  ? 167  ARG C O   1 
ATOM   3001 C  CB  . ARG B 1 167 ? 14.126  8.781  46.817  1.00 28.58  ? 167  ARG C CB  1 
ATOM   3002 C  CG  . ARG B 1 167 ? 12.895  7.841  46.670  1.00 28.59  ? 167  ARG C CG  1 
ATOM   3003 C  CD  . ARG B 1 167 ? 12.172  7.842  47.903  1.00 29.76  ? 167  ARG C CD  1 
ATOM   3004 N  NE  . ARG B 1 167 ? 10.949  7.086  47.842  1.00 27.05  ? 167  ARG C NE  1 
ATOM   3005 C  CZ  . ARG B 1 167 ? 9.760   7.614  47.652  1.00 27.59  ? 167  ARG C CZ  1 
ATOM   3006 N  NH1 . ARG B 1 167 ? 9.587   8.913  47.481  1.00 27.96  ? 167  ARG C NH1 1 
ATOM   3007 N  NH2 . ARG B 1 167 ? 8.738   6.817  47.565  1.00 27.20  ? 167  ARG C NH2 1 
ATOM   3008 N  N   . VAL B 1 168 ? 15.917  5.891  47.689  1.00 28.97  ? 168  VAL C N   1 
ATOM   3009 C  CA  . VAL B 1 168 ? 16.229  4.547  47.214  1.00 27.70  ? 168  VAL C CA  1 
ATOM   3010 C  C   . VAL B 1 168 ? 15.082  3.613  47.615  1.00 27.00  ? 168  VAL C C   1 
ATOM   3011 O  O   . VAL B 1 168 ? 14.837  3.350  48.814  1.00 26.79  ? 168  VAL C O   1 
ATOM   3012 C  CB  . VAL B 1 168 ? 17.584  4.090  47.764  1.00 28.57  ? 168  VAL C CB  1 
ATOM   3013 C  CG1 . VAL B 1 168 ? 17.985  2.768  47.153  1.00 29.93  ? 168  VAL C CG1 1 
ATOM   3014 C  CG2 . VAL B 1 168 ? 18.655  5.163  47.460  1.00 31.32  ? 168  VAL C CG2 1 
ATOM   3015 N  N   . GLY B 1 169 ? 14.311  3.194  46.622  1.00 25.89  ? 169  GLY C N   1 
ATOM   3016 C  CA  . GLY B 1 169 ? 13.065  2.532  46.893  1.00 26.64  ? 169  GLY C CA  1 
ATOM   3017 C  C   . GLY B 1 169 ? 12.262  3.400  47.882  1.00 26.70  ? 169  GLY C C   1 
ATOM   3018 O  O   . GLY B 1 169 ? 12.145  4.581  47.725  1.00 25.17  ? 169  GLY C O   1 
ATOM   3019 N  N   . ASP B 1 170 ? 11.692  2.787  48.892  1.00 26.84  ? 170  ASP C N   1 
ATOM   3020 C  CA  . ASP B 1 170 ? 10.801  3.497  49.850  1.00 28.91  ? 170  ASP C CA  1 
ATOM   3021 C  C   . ASP B 1 170 ? 11.560  3.854  51.114  1.00 30.28  ? 170  ASP C C   1 
ATOM   3022 O  O   . ASP B 1 170 ? 11.037  3.769  52.234  1.00 32.80  ? 170  ASP C O   1 
ATOM   3023 C  CB  . ASP B 1 170 ? 9.471   2.680  50.077  1.00 28.98  ? 170  ASP C CB  1 
ATOM   3024 C  CG  . ASP B 1 170 ? 8.547   2.759  48.862  1.00 29.00  ? 170  ASP C CG  1 
ATOM   3025 O  OD1 . ASP B 1 170 ? 8.504   3.872  48.268  1.00 29.84  ? 170  ASP C OD1 1 
ATOM   3026 O  OD2 . ASP B 1 170 ? 7.932   1.739  48.408  1.00 27.57  ? 170  ASP C OD2 1 
ATOM   3027 N  N   . THR B 1 171 ? 12.803  4.323  50.933  1.00 30.37  ? 171  THR C N   1 
ATOM   3028 C  CA  . THR B 1 171 ? 13.635  4.829  52.007  1.00 30.99  ? 171  THR C CA  1 
ATOM   3029 C  C   . THR B 1 171 ? 14.239  6.177  51.524  1.00 32.78  ? 171  THR C C   1 
ATOM   3030 O  O   . THR B 1 171 ? 14.262  6.473  50.289  1.00 32.16  ? 171  THR C O   1 
ATOM   3031 C  CB  . THR B 1 171 ? 14.758  3.799  52.422  1.00 30.69  ? 171  THR C CB  1 
ATOM   3032 O  OG1 . THR B 1 171 ? 15.758  3.764  51.424  1.00 32.10  ? 171  THR C OG1 1 
ATOM   3033 C  CG2 . THR B 1 171 ? 14.227  2.353  52.614  1.00 28.75  ? 171  THR C CG2 1 
ATOM   3034 N  N   . TYR B 1 172 ? 14.678  7.033  52.448  1.00 33.89  ? 172  TYR C N   1 
ATOM   3035 C  CA  . TYR B 1 172 ? 15.545  8.134  52.067  1.00 36.34  ? 172  TYR C CA  1 
ATOM   3036 C  C   . TYR B 1 172 ? 16.938  7.906  52.691  1.00 36.97  ? 172  TYR C C   1 
ATOM   3037 O  O   . TYR B 1 172 ? 17.041  7.541  53.872  1.00 39.11  ? 172  TYR C O   1 
ATOM   3038 C  CB  . TYR B 1 172 ? 14.885  9.441  52.466  1.00 36.47  ? 172  TYR C CB  1 
ATOM   3039 C  CG  . TYR B 1 172 ? 13.847  9.932  51.475  1.00 37.05  ? 172  TYR C CG  1 
ATOM   3040 C  CD1 . TYR B 1 172 ? 14.242  10.627 50.373  1.00 36.65  ? 172  TYR C CD1 1 
ATOM   3041 C  CD2 . TYR B 1 172 ? 12.483  9.668  51.625  1.00 36.91  ? 172  TYR C CD2 1 
ATOM   3042 C  CE1 . TYR B 1 172 ? 13.356  11.106 49.465  1.00 35.37  ? 172  TYR C CE1 1 
ATOM   3043 C  CE2 . TYR B 1 172 ? 11.557  10.147 50.695  1.00 36.30  ? 172  TYR C CE2 1 
ATOM   3044 C  CZ  . TYR B 1 172 ? 12.015  10.908 49.612  1.00 36.03  ? 172  TYR C CZ  1 
ATOM   3045 O  OH  . TYR B 1 172 ? 11.197  11.413 48.598  1.00 35.55  ? 172  TYR C OH  1 
ATOM   3046 N  N   . GLU B 1 173 ? 18.009  7.966  51.899  1.00 37.55  ? 173  GLU C N   1 
ATOM   3047 C  CA  . GLU B 1 173 ? 19.406  7.781  52.457  1.00 37.64  ? 173  GLU C CA  1 
ATOM   3048 C  C   . GLU B 1 173 ? 20.180  9.116  52.579  1.00 38.42  ? 173  GLU C C   1 
ATOM   3049 O  O   . GLU B 1 173 ? 20.168  9.908  51.643  1.00 38.34  ? 173  GLU C O   1 
ATOM   3050 C  CB  . GLU B 1 173 ? 20.226  6.834  51.611  1.00 37.47  ? 173  GLU C CB  1 
ATOM   3051 C  CG  . GLU B 1 173 ? 19.550  5.472  51.419  1.00 39.89  ? 173  GLU C CG  1 
ATOM   3052 C  CD  . GLU B 1 173 ? 20.413  4.411  50.680  1.00 40.88  ? 173  GLU C CD  1 
ATOM   3053 O  OE1 . GLU B 1 173 ? 21.277  4.775  49.807  1.00 43.05  ? 173  GLU C OE1 1 
ATOM   3054 O  OE2 . GLU B 1 173 ? 20.201  3.204  50.987  1.00 42.42  ? 173  GLU C OE2 1 
ATOM   3055 N  N   . ILE B 1 174 ? 20.852  9.336  53.723  1.00 37.23  ? 174  ILE C N   1 
ATOM   3056 C  CA  . ILE B 1 174 ? 21.650  10.514 53.952  1.00 38.02  ? 174  ILE C CA  1 
ATOM   3057 C  C   . ILE B 1 174 ? 23.084  10.008 54.027  1.00 39.34  ? 174  ILE C C   1 
ATOM   3058 O  O   . ILE B 1 174 ? 23.441  9.292  54.999  1.00 39.08  ? 174  ILE C O   1 
ATOM   3059 C  CB  . ILE B 1 174 ? 21.286  11.239 55.328  1.00 37.40  ? 174  ILE C CB  1 
ATOM   3060 C  CG1 . ILE B 1 174 ? 19.805  11.642 55.372  1.00 36.47  ? 174  ILE C CG1 1 
ATOM   3061 C  CG2 . ILE B 1 174 ? 22.268  12.455 55.639  1.00 37.36  ? 174  ILE C CG2 1 
ATOM   3062 C  CD1 . ILE B 1 174 ? 19.222  11.797 56.842  1.00 36.77  ? 174  ILE C CD1 1 
ATOM   3063 N  N   . THR B 1 175 ? 23.902  10.408 53.055  1.00 40.41  ? 175  THR C N   1 
ATOM   3064 C  CA  . THR B 1 175 ? 25.295  9.983  52.998  1.00 42.36  ? 175  THR C CA  1 
ATOM   3065 C  C   . THR B 1 175 ? 26.187  10.942 53.767  1.00 44.01  ? 175  THR C C   1 
ATOM   3066 O  O   . THR B 1 175 ? 26.600  11.991 53.266  1.00 45.11  ? 175  THR C O   1 
ATOM   3067 C  CB  . THR B 1 175 ? 25.831  9.871  51.550  1.00 42.53  ? 175  THR C CB  1 
ATOM   3068 O  OG1 . THR B 1 175 ? 25.011  8.978  50.799  1.00 41.68  ? 175  THR C OG1 1 
ATOM   3069 C  CG2 . THR B 1 175 ? 27.279  9.334  51.560  1.00 41.93  ? 175  THR C CG2 1 
ATOM   3070 N  N   . MET B 1 176 ? 26.531  10.556 54.978  1.00 45.32  ? 176  MET C N   1 
ATOM   3071 C  CA  . MET B 1 176 ? 27.275  11.423 55.869  1.00 46.58  ? 176  MET C CA  1 
ATOM   3072 C  C   . MET B 1 176 ? 27.789  10.587 57.033  1.00 45.19  ? 176  MET C C   1 
ATOM   3073 O  O   . MET B 1 176 ? 27.015  9.805  57.619  1.00 43.90  ? 176  MET C O   1 
ATOM   3074 C  CB  . MET B 1 176 ? 26.331  12.475 56.426  1.00 46.77  ? 176  MET C CB  1 
ATOM   3075 C  CG  . MET B 1 176 ? 26.891  13.435 57.441  1.00 49.47  ? 176  MET C CG  1 
ATOM   3076 S  SD  . MET B 1 176 ? 25.561  14.559 57.895  1.00 53.26  ? 176  MET C SD  1 
ATOM   3077 C  CE  . MET B 1 176 ? 25.999  15.941 56.797  1.00 53.52  ? 176  MET C CE  1 
ATOM   3078 N  N   . PRO B 1 177 ? 29.089  10.732 57.331  1.00 44.56  ? 177  PRO C N   1 
ATOM   3079 C  CA  . PRO B 1 177 ? 29.683  10.311 58.577  1.00 44.56  ? 177  PRO C CA  1 
ATOM   3080 C  C   . PRO B 1 177 ? 29.297  11.217 59.740  1.00 44.00  ? 177  PRO C C   1 
ATOM   3081 O  O   . PRO B 1 177 ? 30.019  12.188 60.043  1.00 43.74  ? 177  PRO C O   1 
ATOM   3082 C  CB  . PRO B 1 177 ? 31.191  10.386 58.278  1.00 45.02  ? 177  PRO C CB  1 
ATOM   3083 C  CG  . PRO B 1 177 ? 31.304  11.404 57.209  1.00 44.82  ? 177  PRO C CG  1 
ATOM   3084 C  CD  . PRO B 1 177 ? 30.103  11.241 56.384  1.00 44.51  ? 177  PRO C CD  1 
ATOM   3085 N  N   . LEU B 1 178 ? 28.189  10.866 60.409  1.00 43.55  ? 178  LEU C N   1 
ATOM   3086 C  CA  . LEU B 1 178 ? 27.665  11.656 61.539  1.00 43.06  ? 178  LEU C CA  1 
ATOM   3087 C  C   . LEU B 1 178 ? 27.655  10.805 62.778  1.00 42.25  ? 178  LEU C C   1 
ATOM   3088 O  O   . LEU B 1 178 ? 26.803  9.939  62.933  1.00 43.59  ? 178  LEU C O   1 
ATOM   3089 C  CB  . LEU B 1 178 ? 26.246  12.228 61.238  1.00 43.84  ? 178  LEU C CB  1 
ATOM   3090 C  CG  . LEU B 1 178 ? 25.690  13.318 62.161  1.00 43.37  ? 178  LEU C CG  1 
ATOM   3091 C  CD1 . LEU B 1 178 ? 26.534  14.566 62.077  1.00 46.21  ? 178  LEU C CD1 1 
ATOM   3092 C  CD2 . LEU B 1 178 ? 24.211  13.601 61.829  1.00 43.32  ? 178  LEU C CD2 1 
ATOM   3093 N  N   . SER B 1 179 ? 28.613  11.068 63.658  1.00 40.31  ? 179  SER C N   1 
ATOM   3094 C  CA  . SER B 1 179 ? 28.854  10.257 64.810  1.00 39.51  ? 179  SER C CA  1 
ATOM   3095 C  C   . SER B 1 179 ? 27.947  10.646 65.966  1.00 38.29  ? 179  SER C C   1 
ATOM   3096 O  O   . SER B 1 179 ? 27.454  11.763 66.061  1.00 37.99  ? 179  SER C O   1 
ATOM   3097 C  CB  . SER B 1 179 ? 30.319  10.387 65.215  1.00 39.26  ? 179  SER C CB  1 
ATOM   3098 O  OG  . SER B 1 179 ? 30.582  11.700 65.674  1.00 39.18  ? 179  SER C OG  1 
ATOM   3099 N  N   . GLN B 1 180 ? 27.742  9.713  66.869  1.00 37.65  ? 180  GLN C N   1 
ATOM   3100 C  CA  . GLN B 1 180 ? 26.953  9.999  68.045  1.00 37.50  ? 180  GLN C CA  1 
ATOM   3101 C  C   . GLN B 1 180 ? 27.566  11.142 68.792  1.00 37.55  ? 180  GLN C C   1 
ATOM   3102 O  O   . GLN B 1 180 ? 26.841  12.031 69.226  1.00 37.19  ? 180  GLN C O   1 
ATOM   3103 C  CB  . GLN B 1 180 ? 26.830  8.798  68.949  1.00 37.60  ? 180  GLN C CB  1 
ATOM   3104 C  CG  . GLN B 1 180 ? 26.189  7.605  68.246  1.00 37.76  ? 180  GLN C CG  1 
ATOM   3105 C  CD  . GLN B 1 180 ? 25.404  6.782  69.225  1.00 41.97  ? 180  GLN C CD  1 
ATOM   3106 O  OE1 . GLN B 1 180 ? 25.483  7.001  70.429  1.00 45.50  ? 180  GLN C OE1 1 
ATOM   3107 N  NE2 . GLN B 1 180 ? 24.646  5.829  68.720  1.00 45.34  ? 180  GLN C NE2 1 
ATOM   3108 N  N   . LYS B 1 181 ? 28.888  11.171 68.902  1.00 37.40  ? 181  LYS C N   1 
ATOM   3109 C  CA  . LYS B 1 181 ? 29.550  12.312 69.557  1.00 37.73  ? 181  LYS C CA  1 
ATOM   3110 C  C   . LYS B 1 181 ? 29.164  13.626 68.823  1.00 37.18  ? 181  LYS C C   1 
ATOM   3111 O  O   . LYS B 1 181 ? 28.851  14.624 69.446  1.00 38.37  ? 181  LYS C O   1 
ATOM   3112 C  CB  . LYS B 1 181 ? 31.074  12.132 69.582  1.00 37.69  ? 181  LYS C CB  1 
ATOM   3113 C  CG  . LYS B 1 181 ? 31.816  13.143 70.443  1.00 38.35  ? 181  LYS C CG  1 
ATOM   3114 C  CD  . LYS B 1 181 ? 32.517  12.483 71.634  1.00 42.51  ? 181  LYS C CD  1 
ATOM   3115 C  CE  . LYS B 1 181 ? 33.303  13.536 72.441  1.00 42.78  ? 181  LYS C CE  1 
ATOM   3116 N  NZ  . LYS B 1 181 ? 33.497  14.782 71.574  1.00 44.95  ? 181  LYS C NZ  1 
ATOM   3117 N  N   . SER B 1 182 ? 29.149  13.607 67.509  1.00 36.94  ? 182  SER C N   1 
ATOM   3118 C  CA  . SER B 1 182 ? 28.826  14.807 66.750  1.00 37.26  ? 182  SER C CA  1 
ATOM   3119 C  C   . SER B 1 182 ? 27.375  15.267 66.903  1.00 37.44  ? 182  SER C C   1 
ATOM   3120 O  O   . SER B 1 182 ? 27.098  16.454 67.111  1.00 37.49  ? 182  SER C O   1 
ATOM   3121 C  CB  . SER B 1 182 ? 29.135  14.565 65.294  1.00 38.21  ? 182  SER C CB  1 
ATOM   3122 O  OG  . SER B 1 182 ? 30.508  14.401 65.157  1.00 37.86  ? 182  SER C OG  1 
ATOM   3123 N  N   . ILE B 1 183 ? 26.460  14.318 66.779  1.00 37.73  ? 183  ILE C N   1 
ATOM   3124 C  CA  . ILE B 1 183 ? 25.047  14.559 67.007  1.00 37.25  ? 183  ILE C CA  1 
ATOM   3125 C  C   . ILE B 1 183 ? 24.931  15.237 68.372  1.00 38.14  ? 183  ILE C C   1 
ATOM   3126 O  O   . ILE B 1 183 ? 24.229  16.262 68.537  1.00 38.06  ? 183  ILE C O   1 
ATOM   3127 C  CB  . ILE B 1 183 ? 24.231  13.218 66.955  1.00 36.53  ? 183  ILE C CB  1 
ATOM   3128 C  CG1 . ILE B 1 183 ? 24.255  12.616 65.536  1.00 36.78  ? 183  ILE C CG1 1 
ATOM   3129 C  CG2 . ILE B 1 183 ? 22.799  13.397 67.464  1.00 35.06  ? 183  ILE C CG2 1 
ATOM   3130 C  CD1 . ILE B 1 183 ? 23.831  11.074 65.469  1.00 34.45  ? 183  ILE C CD1 1 
ATOM   3131 N  N   . GLY B 1 184 ? 25.676  14.708 69.334  1.00 37.79  ? 184  GLY C N   1 
ATOM   3132 C  CA  . GLY B 1 184 ? 25.610  15.199 70.705  1.00 39.28  ? 184  GLY C CA  1 
ATOM   3133 C  C   . GLY B 1 184 ? 26.142  16.639 70.797  1.00 39.71  ? 184  GLY C C   1 
ATOM   3134 O  O   . GLY B 1 184 ? 25.553  17.526 71.447  1.00 39.02  ? 184  GLY C O   1 
ATOM   3135 N  N   . GLU B 1 185 ? 27.249  16.881 70.122  1.00 39.39  ? 185  GLU C N   1 
ATOM   3136 C  CA  . GLU B 1 185 ? 27.832  18.201 70.235  1.00 40.23  ? 185  GLU C CA  1 
ATOM   3137 C  C   . GLU B 1 185 ? 26.984  19.228 69.476  1.00 39.54  ? 185  GLU C C   1 
ATOM   3138 O  O   . GLU B 1 185 ? 26.942  20.366 69.907  1.00 38.92  ? 185  GLU C O   1 
ATOM   3139 C  CB  . GLU B 1 185 ? 29.341  18.228 69.917  1.00 40.45  ? 185  GLU C CB  1 
ATOM   3140 C  CG  . GLU B 1 185 ? 29.875  17.466 68.684  1.00 41.15  ? 185  GLU C CG  1 
ATOM   3141 C  CD  . GLU B 1 185 ? 31.412  17.537 68.580  1.00 41.95  ? 185  GLU C CD  1 
ATOM   3142 O  OE1 . GLU B 1 185 ? 32.088  17.610 69.638  1.00 45.74  ? 185  GLU C OE1 1 
ATOM   3143 O  OE2 . GLU B 1 185 ? 31.931  17.503 67.440  1.00 45.22  ? 185  GLU C OE2 1 
ATOM   3144 N  N   . ILE B 1 186 ? 26.242  18.807 68.420  1.00 39.89  ? 186  ILE C N   1 
ATOM   3145 C  CA  . ILE B 1 186 ? 25.424  19.733 67.601  1.00 38.92  ? 186  ILE C CA  1 
ATOM   3146 C  C   . ILE B 1 186 ? 24.112  20.093 68.290  1.00 39.19  ? 186  ILE C C   1 
ATOM   3147 O  O   . ILE B 1 186 ? 23.595  21.222 68.163  1.00 37.86  ? 186  ILE C O   1 
ATOM   3148 C  CB  . ILE B 1 186 ? 25.003  19.105 66.252  1.00 38.52  ? 186  ILE C CB  1 
ATOM   3149 C  CG1 . ILE B 1 186 ? 26.205  18.888 65.377  1.00 37.62  ? 186  ILE C CG1 1 
ATOM   3150 C  CG2 . ILE B 1 186 ? 23.921  19.973 65.518  1.00 39.55  ? 186  ILE C CG2 1 
ATOM   3151 C  CD1 . ILE B 1 186 ? 25.877  17.960 64.281  1.00 40.55  ? 186  ILE C CD1 1 
ATOM   3152 N  N   . THR B 1 187 ? 23.527  19.086 68.925  1.00 38.51  ? 187  THR C N   1 
ATOM   3153 C  CA  . THR B 1 187 ? 22.151  19.200 69.428  1.00 39.14  ? 187  THR C CA  1 
ATOM   3154 C  C   . THR B 1 187 ? 22.096  19.697 70.868  1.00 39.29  ? 187  THR C C   1 
ATOM   3155 O  O   . THR B 1 187 ? 21.038  20.085 71.355  1.00 40.04  ? 187  THR C O   1 
ATOM   3156 C  CB  . THR B 1 187 ? 21.373  17.828 69.308  1.00 37.70  ? 187  THR C CB  1 
ATOM   3157 O  OG1 . THR B 1 187 ? 22.006  16.826 70.132  1.00 38.72  ? 187  THR C OG1 1 
ATOM   3158 C  CG2 . THR B 1 187 ? 21.328  17.412 67.831  1.00 37.65  ? 187  THR C CG2 1 
ATOM   3159 N  N   . GLY B 1 188 ? 23.223  19.642 71.545  1.00 39.81  ? 188  GLY C N   1 
ATOM   3160 C  CA  . GLY B 1 188 ? 23.247  19.858 72.986  1.00 40.31  ? 188  GLY C CA  1 
ATOM   3161 C  C   . GLY B 1 188 ? 22.612  18.761 73.816  1.00 41.18  ? 188  GLY C C   1 
ATOM   3162 O  O   . GLY B 1 188 ? 21.932  19.049 74.812  1.00 43.37  ? 188  GLY C O   1 
ATOM   3163 N  N   . VAL B 1 189 ? 22.871  17.500 73.469  1.00 39.81  ? 189  VAL C N   1 
ATOM   3164 C  CA  . VAL B 1 189 ? 22.261  16.392 74.139  1.00 38.80  ? 189  VAL C CA  1 
ATOM   3165 C  C   . VAL B 1 189 ? 23.366  15.480 74.657  1.00 39.39  ? 189  VAL C C   1 
ATOM   3166 O  O   . VAL B 1 189 ? 24.366  15.262 73.978  1.00 39.62  ? 189  VAL C O   1 
ATOM   3167 C  CB  . VAL B 1 189 ? 21.285  15.657 73.197  1.00 37.68  ? 189  VAL C CB  1 
ATOM   3168 C  CG1 . VAL B 1 189 ? 20.647  14.459 73.902  1.00 37.61  ? 189  VAL C CG1 1 
ATOM   3169 C  CG2 . VAL B 1 189 ? 20.236  16.620 72.687  1.00 33.41  ? 189  VAL C CG2 1 
ATOM   3170 N  N   . HIS B 1 190 ? 23.190  14.952 75.858  1.00 40.36  ? 190  HIS C N   1 
ATOM   3171 C  CA  . HIS B 1 190 ? 24.193  14.047 76.446  1.00 40.85  ? 190  HIS C CA  1 
ATOM   3172 C  C   . HIS B 1 190 ? 24.207  12.706 75.758  1.00 40.07  ? 190  HIS C C   1 
ATOM   3173 O  O   . HIS B 1 190 ? 23.171  12.271 75.243  1.00 40.79  ? 190  HIS C O   1 
ATOM   3174 C  CB  . HIS B 1 190 ? 23.969  13.870 77.941  1.00 41.68  ? 190  HIS C CB  1 
ATOM   3175 C  CG  . HIS B 1 190 ? 24.057  15.148 78.725  1.00 43.82  ? 190  HIS C CG  1 
ATOM   3176 N  ND1 . HIS B 1 190 ? 24.596  16.312 78.208  1.00 46.30  ? 190  HIS C ND1 1 
ATOM   3177 C  CD2 . HIS B 1 190 ? 23.674  15.441 79.991  1.00 44.39  ? 190  HIS C CD2 1 
ATOM   3178 C  CE1 . HIS B 1 190 ? 24.539  17.265 79.122  1.00 45.84  ? 190  HIS C CE1 1 
ATOM   3179 N  NE2 . HIS B 1 190 ? 23.989  16.762 80.216  1.00 46.33  ? 190  HIS C NE2 1 
ATOM   3180 N  N   . HIS B 1 191 ? 25.367  12.042 75.774  1.00 40.37  ? 191  HIS C N   1 
ATOM   3181 C  CA  . HIS B 1 191 ? 25.584  10.802 75.015  1.00 40.56  ? 191  HIS C CA  1 
ATOM   3182 C  C   . HIS B 1 191 ? 24.558  9.697  75.341  1.00 40.14  ? 191  HIS C C   1 
ATOM   3183 O  O   . HIS B 1 191 ? 24.123  8.988  74.439  1.00 39.44  ? 191  HIS C O   1 
ATOM   3184 C  CB  . HIS B 1 191 ? 27.015  10.241 75.152  1.00 41.05  ? 191  HIS C CB  1 
ATOM   3185 C  CG  . HIS B 1 191 ? 27.311  9.088  74.216  1.00 42.02  ? 191  HIS C CG  1 
ATOM   3186 N  ND1 . HIS B 1 191 ? 27.664  7.832  74.666  1.00 47.46  ? 191  HIS C ND1 1 
ATOM   3187 C  CD2 . HIS B 1 191 ? 27.300  9.003  72.858  1.00 47.75  ? 191  HIS C CD2 1 
ATOM   3188 C  CE1 . HIS B 1 191 ? 27.862  7.029  73.633  1.00 46.89  ? 191  HIS C CE1 1 
ATOM   3189 N  NE2 . HIS B 1 191 ? 27.643  7.714  72.525  1.00 47.94  ? 191  HIS C NE2 1 
ATOM   3190 N  N   . VAL B 1 192 ? 24.183  9.584  76.618  1.00 39.30  ? 192  VAL C N   1 
ATOM   3191 C  CA  . VAL B 1 192 ? 23.192  8.604  77.072  1.00 38.71  ? 192  VAL C CA  1 
ATOM   3192 C  C   . VAL B 1 192 ? 21.866  8.781  76.286  1.00 38.22  ? 192  VAL C C   1 
ATOM   3193 O  O   . VAL B 1 192 ? 21.360  7.823  75.651  1.00 37.12  ? 192  VAL C O   1 
ATOM   3194 C  CB  . VAL B 1 192 ? 23.034  8.680  78.627  1.00 38.70  ? 192  VAL C CB  1 
ATOM   3195 C  CG1 . VAL B 1 192 ? 22.687  10.122 79.094  1.00 38.43  ? 192  VAL C CG1 1 
ATOM   3196 C  CG2 . VAL B 1 192 ? 22.035  7.608  79.174  1.00 40.25  ? 192  VAL C CG2 1 
ATOM   3197 N  N   . THR B 1 193 ? 21.329  9.999  76.250  1.00 37.98  ? 193  THR C N   1 
ATOM   3198 C  CA  . THR B 1 193 ? 20.091  10.234 75.454  1.00 38.31  ? 193  THR C CA  1 
ATOM   3199 C  C   . THR B 1 193 ? 20.270  9.909  73.969  1.00 36.94  ? 193  THR C C   1 
ATOM   3200 O  O   . THR B 1 193 ? 19.384  9.278  73.341  1.00 37.66  ? 193  THR C O   1 
ATOM   3201 C  CB  . THR B 1 193 ? 19.531  11.649 75.633  1.00 38.13  ? 193  THR C CB  1 
ATOM   3202 O  OG1 . THR B 1 193 ? 19.279  11.861 77.008  1.00 40.23  ? 193  THR C OG1 1 
ATOM   3203 C  CG2 . THR B 1 193 ? 18.205  11.831 74.854  1.00 39.24  ? 193  THR C CG2 1 
ATOM   3204 N  N   . VAL B 1 194 ? 21.426  10.282 73.427  1.00 36.54  ? 194  VAL C N   1 
ATOM   3205 C  CA  . VAL B 1 194 ? 21.711  10.110 72.009  1.00 36.86  ? 194  VAL C CA  1 
ATOM   3206 C  C   . VAL B 1 194 ? 21.693  8.617  71.685  1.00 36.23  ? 194  VAL C C   1 
ATOM   3207 O  O   . VAL B 1 194 ? 21.058  8.170  70.757  1.00 36.29  ? 194  VAL C O   1 
ATOM   3208 C  CB  . VAL B 1 194 ? 23.075  10.741 71.526  1.00 36.05  ? 194  VAL C CB  1 
ATOM   3209 C  CG1 . VAL B 1 194 ? 23.329  10.373 70.036  1.00 32.45  ? 194  VAL C CG1 1 
ATOM   3210 C  CG2 . VAL B 1 194 ? 23.107  12.223 71.755  1.00 39.27  ? 194  VAL C CG2 1 
ATOM   3211 N  N   . SER B 1 195 ? 22.409  7.840  72.430  1.00 36.89  ? 195  SER C N   1 
ATOM   3212 C  CA  . SER B 1 195 ? 22.369  6.397  72.229  1.00 37.30  ? 195  SER C CA  1 
ATOM   3213 C  C   . SER B 1 195 ? 21.009  5.706  72.393  1.00 36.96  ? 195  SER C C   1 
ATOM   3214 O  O   . SER B 1 195 ? 20.639  4.772  71.618  1.00 37.06  ? 195  SER C O   1 
ATOM   3215 C  CB  . SER B 1 195 ? 23.450  5.810  73.089  1.00 38.41  ? 195  SER C CB  1 
ATOM   3216 O  OG  . SER B 1 195 ? 24.652  6.569  72.666  1.00 39.63  ? 195  SER C OG  1 
ATOM   3217 N  N   . ARG B 1 196 ? 20.234  6.187  73.352  1.00 37.13  ? 196  ARG C N   1 
ATOM   3218 C  CA  . ARG B 1 196 ? 18.926  5.601  73.576  1.00 37.19  ? 196  ARG C CA  1 
ATOM   3219 C  C   . ARG B 1 196 ? 17.967  5.950  72.417  1.00 36.09  ? 196  ARG C C   1 
ATOM   3220 O  O   . ARG B 1 196 ? 17.203  5.080  71.982  1.00 34.72  ? 196  ARG C O   1 
ATOM   3221 C  CB  . ARG B 1 196 ? 18.350  5.990  74.965  1.00 37.26  ? 196  ARG C CB  1 
ATOM   3222 C  CG  . ARG B 1 196 ? 16.826  5.738  75.101  1.00 39.01  ? 196  ARG C CG  1 
ATOM   3223 C  CD  . ARG B 1 196 ? 16.184  6.149  76.489  1.00 41.82  ? 196  ARG C CD  1 
ATOM   3224 N  NE  . ARG B 1 196 ? 16.269  7.582  76.841  1.00 47.46  ? 196  ARG C NE  1 
ATOM   3225 C  CZ  . ARG B 1 196 ? 15.792  8.627  76.125  1.00 47.72  ? 196  ARG C CZ  1 
ATOM   3226 N  NH1 . ARG B 1 196 ? 15.163  8.494  74.952  1.00 49.59  ? 196  ARG C NH1 1 
ATOM   3227 N  NH2 . ARG B 1 196 ? 15.957  9.855  76.609  1.00 47.83  ? 196  ARG C NH2 1 
ATOM   3228 N  N   . VAL B 1 197 ? 18.029  7.198  71.923  1.00 36.70  ? 197  VAL C N   1 
ATOM   3229 C  CA  . VAL B 1 197 ? 17.155  7.693  70.862  1.00 36.40  ? 197  VAL C CA  1 
ATOM   3230 C  C   . VAL B 1 197 ? 17.455  7.031  69.491  1.00 36.35  ? 197  VAL C C   1 
ATOM   3231 O  O   . VAL B 1 197 ? 16.544  6.593  68.761  1.00 35.78  ? 197  VAL C O   1 
ATOM   3232 C  CB  . VAL B 1 197 ? 17.276  9.276  70.784  1.00 37.01  ? 197  VAL C CB  1 
ATOM   3233 C  CG1 . VAL B 1 197 ? 16.637  9.826  69.571  1.00 36.75  ? 197  VAL C CG1 1 
ATOM   3234 C  CG2 . VAL B 1 197 ? 16.681  9.903  72.047  1.00 35.85  ? 197  VAL C CG2 1 
ATOM   3235 N  N   . LEU B 1 198 ? 18.734  6.942  69.154  1.00 35.49  ? 198  LEU C N   1 
ATOM   3236 C  CA  . LEU B 1 198 ? 19.163  6.181  67.975  1.00 35.49  ? 198  LEU C CA  1 
ATOM   3237 C  C   . LEU B 1 198 ? 18.727  4.728  68.055  1.00 35.78  ? 198  LEU C C   1 
ATOM   3238 O  O   . LEU B 1 198 ? 18.156  4.191  67.062  1.00 34.93  ? 198  LEU C O   1 
ATOM   3239 C  CB  . LEU B 1 198 ? 20.688  6.333  67.755  1.00 36.17  ? 198  LEU C CB  1 
ATOM   3240 C  CG  . LEU B 1 198 ? 21.168  7.596  67.021  1.00 37.18  ? 198  LEU C CG  1 
ATOM   3241 C  CD1 . LEU B 1 198 ? 20.378  8.834  67.417  1.00 36.70  ? 198  LEU C CD1 1 
ATOM   3242 C  CD2 . LEU B 1 198 ? 22.638  7.873  67.201  1.00 37.65  ? 198  LEU C CD2 1 
ATOM   3243 N  N   . ALA B 1 199 ? 18.903  4.096  69.232  1.00 34.59  ? 199  ALA C N   1 
ATOM   3244 C  CA  . ALA B 1 199 ? 18.525  2.671  69.394  1.00 34.55  ? 199  ALA C CA  1 
ATOM   3245 C  C   . ALA B 1 199 ? 17.047  2.506  69.057  1.00 34.21  ? 199  ALA C C   1 
ATOM   3246 O  O   . ALA B 1 199 ? 16.653  1.663  68.241  1.00 35.22  ? 199  ALA C O   1 
ATOM   3247 C  CB  . ALA B 1 199 ? 18.811  2.110  70.856  1.00 33.46  ? 199  ALA C CB  1 
ATOM   3248 N  N   . CYS B 1 200 ? 16.251  3.318  69.726  1.00 34.86  ? 200  CYS C N   1 
ATOM   3249 C  CA  . CYS B 1 200 ? 14.831  3.390  69.550  1.00 36.50  ? 200  CYS C CA  1 
ATOM   3250 C  C   . CYS B 1 200 ? 14.394  3.533  68.113  1.00 36.27  ? 200  CYS C C   1 
ATOM   3251 O  O   . CYS B 1 200 ? 13.502  2.853  67.643  1.00 36.87  ? 200  CYS C O   1 
ATOM   3252 C  CB  . CYS B 1 200 ? 14.438  4.685  70.185  1.00 37.18  ? 200  CYS C CB  1 
ATOM   3253 S  SG  . CYS B 1 200 ? 13.286  4.563  71.322  1.00 47.66  ? 200  CYS C SG  1 
ATOM   3254 N  N   . LEU B 1 201 ? 15.026  4.468  67.420  1.00 35.46  ? 201  LEU C N   1 
ATOM   3255 C  CA  . LEU B 1 201 ? 14.627  4.829  66.092  1.00 35.60  ? 201  LEU C CA  1 
ATOM   3256 C  C   . LEU B 1 201 ? 14.888  3.663  65.202  1.00 35.73  ? 201  LEU C C   1 
ATOM   3257 O  O   . LEU B 1 201 ? 14.092  3.448  64.321  1.00 36.62  ? 201  LEU C O   1 
ATOM   3258 C  CB  . LEU B 1 201 ? 15.375  6.070  65.564  1.00 34.99  ? 201  LEU C CB  1 
ATOM   3259 C  CG  . LEU B 1 201 ? 14.899  7.439  66.038  1.00 36.19  ? 201  LEU C CG  1 
ATOM   3260 C  CD1 . LEU B 1 201 ? 16.007  8.438  65.690  1.00 33.92  ? 201  LEU C CD1 1 
ATOM   3261 C  CD2 . LEU B 1 201 ? 13.555  7.795  65.335  1.00 39.17  ? 201  LEU C CD2 1 
ATOM   3262 N  N   . LYS B 1 202 ? 15.981  2.932  65.432  1.00 36.60  ? 202  LYS C N   1 
ATOM   3263 C  CA  . LYS B 1 202 ? 16.272  1.662  64.736  1.00 39.12  ? 202  LYS C CA  1 
ATOM   3264 C  C   . LYS B 1 202 ? 15.324  0.486  65.019  1.00 39.91  ? 202  LYS C C   1 
ATOM   3265 O  O   . LYS B 1 202 ? 14.790  -0.162 64.081  1.00 40.43  ? 202  LYS C O   1 
ATOM   3266 C  CB  . LYS B 1 202 ? 17.716  1.261  65.026  1.00 38.63  ? 202  LYS C CB  1 
ATOM   3267 C  CG  . LYS B 1 202 ? 18.157  -0.023 64.329  1.00 38.83  ? 202  LYS C CG  1 
ATOM   3268 C  CD  . LYS B 1 202 ? 19.675  -0.183 64.426  1.00 39.57  ? 202  LYS C CD  1 
ATOM   3269 C  CE  . LYS B 1 202 ? 20.164  -1.542 63.861  1.00 42.29  ? 202  LYS C CE  1 
ATOM   3270 N  NZ  . LYS B 1 202 ? 21.660  -1.597 63.881  1.00 42.78  ? 202  LYS C NZ  1 
ATOM   3271 N  N   . ARG B 1 203 ? 15.158  0.182  66.311  1.00 40.66  ? 203  ARG C N   1 
ATOM   3272 C  CA  . ARG B 1 203 ? 14.205  -0.826 66.810  1.00 41.98  ? 203  ARG C CA  1 
ATOM   3273 C  C   . ARG B 1 203 ? 12.776  -0.697 66.264  1.00 42.84  ? 203  ARG C C   1 
ATOM   3274 O  O   . ARG B 1 203 ? 12.087  -1.715 65.952  1.00 42.17  ? 203  ARG C O   1 
ATOM   3275 C  CB  . ARG B 1 203 ? 14.138  -0.786 68.356  1.00 42.23  ? 203  ARG C CB  1 
ATOM   3276 C  CG  . ARG B 1 203 ? 14.562  -2.087 69.035  1.00 43.44  ? 203  ARG C CG  1 
ATOM   3277 C  CD  . ARG B 1 203 ? 14.228  -2.132 70.552  1.00 44.07  ? 203  ARG C CD  1 
ATOM   3278 N  NE  . ARG B 1 203 ? 14.614  -0.914 71.298  1.00 50.61  ? 203  ARG C NE  1 
ATOM   3279 C  CZ  . ARG B 1 203 ? 13.799  0.126  71.544  1.00 50.37  ? 203  ARG C CZ  1 
ATOM   3280 N  NH1 . ARG B 1 203 ? 12.506  0.120  71.150  1.00 52.49  ? 203  ARG C NH1 1 
ATOM   3281 N  NH2 . ARG B 1 203 ? 14.269  1.160  72.192  1.00 46.29  ? 203  ARG C NH2 1 
ATOM   3282 N  N   . GLU B 1 204 ? 12.359  0.562  66.199  1.00 43.54  ? 204  GLU C N   1 
ATOM   3283 C  CA  . GLU B 1 204 ? 11.027  1.008  65.802  1.00 44.62  ? 204  GLU C CA  1 
ATOM   3284 C  C   . GLU B 1 204 ? 10.950  1.232  64.279  1.00 44.30  ? 204  GLU C C   1 
ATOM   3285 O  O   . GLU B 1 204 ? 9.932   1.680  63.755  1.00 45.17  ? 204  GLU C O   1 
ATOM   3286 C  CB  . GLU B 1 204 ? 10.777  2.339  66.523  1.00 44.45  ? 204  GLU C CB  1 
ATOM   3287 C  CG  . GLU B 1 204 ? 9.386   2.666  66.910  1.00 46.10  ? 204  GLU C CG  1 
ATOM   3288 C  CD  . GLU B 1 204 ? 9.378   3.716  68.013  1.00 45.69  ? 204  GLU C CD  1 
ATOM   3289 O  OE1 . GLU B 1 204 ? 8.796   3.461  69.085  1.00 45.52  ? 204  GLU C OE1 1 
ATOM   3290 O  OE2 . GLU B 1 204 ? 9.978   4.786  67.791  1.00 50.33  ? 204  GLU C OE2 1 
ATOM   3291 N  N   . ASN B 1 205 ? 12.044  0.930  63.586  1.00 43.92  ? 205  ASN C N   1 
ATOM   3292 C  CA  . ASN B 1 205 ? 12.135  1.079  62.145  1.00 43.28  ? 205  ASN C CA  1 
ATOM   3293 C  C   . ASN B 1 205 ? 11.690  2.440  61.535  1.00 42.06  ? 205  ASN C C   1 
ATOM   3294 O  O   . ASN B 1 205 ? 11.077  2.497  60.449  1.00 39.83  ? 205  ASN C O   1 
ATOM   3295 C  CB  . ASN B 1 205 ? 11.448  -0.106 61.477  1.00 43.97  ? 205  ASN C CB  1 
ATOM   3296 C  CG  . ASN B 1 205 ? 12.446  -1.191 61.057  1.00 45.85  ? 205  ASN C CG  1 
ATOM   3297 O  OD1 . ASN B 1 205 ? 12.492  -2.287 61.666  1.00 42.38  ? 205  ASN C OD1 1 
ATOM   3298 N  ND2 . ASN B 1 205 ? 13.253  -0.889 59.991  1.00 46.99  ? 205  ASN C ND2 1 
ATOM   3299 N  N   . ILE B 1 206 ? 12.057  3.516  62.214  1.00 39.96  ? 206  ILE C N   1 
ATOM   3300 C  CA  . ILE B 1 206 ? 11.964  4.869  61.697  1.00 40.15  ? 206  ILE C CA  1 
ATOM   3301 C  C   . ILE B 1 206 ? 13.245  5.217  60.921  1.00 40.46  ? 206  ILE C C   1 
ATOM   3302 O  O   . ILE B 1 206 ? 13.181  5.605  59.769  1.00 40.49  ? 206  ILE C O   1 
ATOM   3303 C  CB  . ILE B 1 206 ? 11.759  5.878  62.837  1.00 40.03  ? 206  ILE C CB  1 
ATOM   3304 C  CG1 . ILE B 1 206 ? 10.517  5.495  63.683  1.00 40.26  ? 206  ILE C CG1 1 
ATOM   3305 C  CG2 . ILE B 1 206 ? 11.739  7.285  62.314  1.00 35.85  ? 206  ILE C CG2 1 
ATOM   3306 C  CD1 . ILE B 1 206 ? 9.311   4.996  62.874  1.00 42.67  ? 206  ILE C CD1 1 
ATOM   3307 N  N   . LEU B 1 207 ? 14.405  5.047  61.545  1.00 41.37  ? 207  LEU C N   1 
ATOM   3308 C  CA  . LEU B 1 207 ? 15.703  5.232  60.868  1.00 41.71  ? 207  LEU C CA  1 
ATOM   3309 C  C   . LEU B 1 207 ? 16.792  4.399  61.518  1.00 41.43  ? 207  LEU C C   1 
ATOM   3310 O  O   . LEU B 1 207 ? 16.660  3.907  62.631  1.00 40.94  ? 207  LEU C O   1 
ATOM   3311 C  CB  . LEU B 1 207 ? 16.157  6.728  60.793  1.00 41.80  ? 207  LEU C CB  1 
ATOM   3312 C  CG  . LEU B 1 207 ? 16.703  7.523  61.974  1.00 43.86  ? 207  LEU C CG  1 
ATOM   3313 C  CD1 . LEU B 1 207 ? 18.191  7.258  62.248  1.00 44.60  ? 207  LEU C CD1 1 
ATOM   3314 C  CD2 . LEU B 1 207 ? 16.470  9.003  61.729  1.00 42.55  ? 207  LEU C CD2 1 
ATOM   3315 N  N   . ASP B 1 208 ? 17.883  4.276  60.792  1.00 42.19  ? 208  ASP C N   1 
ATOM   3316 C  CA  . ASP B 1 208 ? 19.036  3.538  61.220  1.00 42.75  ? 208  ASP C CA  1 
ATOM   3317 C  C   . ASP B 1 208 ? 20.225  4.412  60.871  1.00 43.89  ? 208  ASP C C   1 
ATOM   3318 O  O   . ASP B 1 208 ? 20.377  4.852  59.711  1.00 42.97  ? 208  ASP C O   1 
ATOM   3319 C  CB  . ASP B 1 208 ? 19.085  2.227  60.468  1.00 44.27  ? 208  ASP C CB  1 
ATOM   3320 C  CG  . ASP B 1 208 ? 20.082  1.262  61.037  1.00 44.53  ? 208  ASP C CG  1 
ATOM   3321 O  OD1 . ASP B 1 208 ? 20.964  1.685  61.828  1.00 46.63  ? 208  ASP C OD1 1 
ATOM   3322 O  OD2 . ASP B 1 208 ? 19.971  0.075  60.663  1.00 48.83  ? 208  ASP C OD2 1 
ATOM   3323 N  N   . LYS B 1 209 ? 20.999  4.718  61.914  1.00 43.84  ? 209  LYS C N   1 
ATOM   3324 C  CA  . LYS B 1 209 ? 22.151  5.604  61.880  1.00 44.84  ? 209  LYS C CA  1 
ATOM   3325 C  C   . LYS B 1 209 ? 23.387  4.710  61.788  1.00 46.15  ? 209  LYS C C   1 
ATOM   3326 O  O   . LYS B 1 209 ? 23.982  4.305  62.819  1.00 46.53  ? 209  LYS C O   1 
ATOM   3327 C  CB  . LYS B 1 209 ? 22.167  6.481  63.158  1.00 44.13  ? 209  LYS C CB  1 
ATOM   3328 C  CG  . LYS B 1 209 ? 22.731  7.876  63.026  1.00 42.87  ? 209  LYS C CG  1 
ATOM   3329 C  CD  . LYS B 1 209 ? 24.251  7.983  62.682  1.00 41.02  ? 209  LYS C CD  1 
ATOM   3330 C  CE  . LYS B 1 209 ? 25.207  7.244  63.592  1.00 40.32  ? 209  LYS C CE  1 
ATOM   3331 N  NZ  . LYS B 1 209 ? 26.602  7.331  63.029  1.00 40.71  ? 209  LYS C NZ  1 
ATOM   3332 N  N   . LYS B 1 210 ? 23.736  4.359  60.546  1.00 47.45  ? 210  LYS C N   1 
ATOM   3333 C  CA  . LYS B 1 210 ? 24.943  3.561  60.260  1.00 47.69  ? 210  LYS C CA  1 
ATOM   3334 C  C   . LYS B 1 210 ? 26.210  4.433  60.423  1.00 47.58  ? 210  LYS C C   1 
ATOM   3335 O  O   . LYS B 1 210 ? 26.126  5.617  60.806  1.00 46.82  ? 210  LYS C O   1 
ATOM   3336 C  CB  . LYS B 1 210 ? 24.838  2.916  58.857  1.00 48.01  ? 210  LYS C CB  1 
ATOM   3337 C  CG  . LYS B 1 210 ? 23.748  1.832  58.749  1.00 49.01  ? 210  LYS C CG  1 
ATOM   3338 C  CD  . LYS B 1 210 ? 24.316  0.496  59.299  1.00 52.37  ? 210  LYS C CD  1 
ATOM   3339 C  CE  . LYS B 1 210 ? 23.300  -0.392 60.071  1.00 51.85  ? 210  LYS C CE  1 
ATOM   3340 N  NZ  . LYS B 1 210 ? 23.959  -1.169 61.158  1.00 49.71  ? 210  LYS C NZ  1 
ATOM   3341 N  N   . LYS B 1 211 ? 27.367  3.848  60.125  1.00 47.51  ? 211  LYS C N   1 
ATOM   3342 C  CA  . LYS B 1 211 ? 28.671  4.459  60.395  1.00 48.51  ? 211  LYS C CA  1 
ATOM   3343 C  C   . LYS B 1 211 ? 28.920  5.760  59.628  1.00 48.76  ? 211  LYS C C   1 
ATOM   3344 O  O   . LYS B 1 211 ? 29.306  6.770  60.243  1.00 49.59  ? 211  LYS C O   1 
ATOM   3345 C  CB  . LYS B 1 211 ? 29.798  3.461  60.058  1.00 48.19  ? 211  LYS C CB  1 
ATOM   3346 C  CG  . LYS B 1 211 ? 31.176  3.866  60.575  1.00 49.06  ? 211  LYS C CG  1 
ATOM   3347 C  CD  . LYS B 1 211 ? 31.237  3.872  62.119  1.00 50.50  ? 211  LYS C CD  1 
ATOM   3348 C  CE  . LYS B 1 211 ? 32.560  3.296  62.646  1.00 50.01  ? 211  LYS C CE  1 
ATOM   3349 N  NZ  . LYS B 1 211 ? 33.731  3.929  61.983  1.00 49.52  ? 211  LYS C NZ  1 
ATOM   3350 N  N   . ASN B 1 212 ? 28.759  5.676  58.297  1.00 49.14  ? 212  ASN C N   1 
ATOM   3351 C  CA  . ASN B 1 212 ? 28.850  6.805  57.344  1.00 49.10  ? 212  ASN C CA  1 
ATOM   3352 C  C   . ASN B 1 212 ? 27.562  6.916  56.494  1.00 48.91  ? 212  ASN C C   1 
ATOM   3353 O  O   . ASN B 1 212 ? 27.603  7.200  55.294  1.00 49.62  ? 212  ASN C O   1 
ATOM   3354 C  CB  . ASN B 1 212 ? 30.061  6.638  56.401  1.00 49.83  ? 212  ASN C CB  1 
ATOM   3355 C  CG  . ASN B 1 212 ? 31.351  6.232  57.130  1.00 50.79  ? 212  ASN C CG  1 
ATOM   3356 O  OD1 . ASN B 1 212 ? 31.890  6.983  57.961  1.00 53.89  ? 212  ASN C OD1 1 
ATOM   3357 N  ND2 . ASN B 1 212 ? 31.865  5.045  56.798  1.00 52.25  ? 212  ASN C ND2 1 
ATOM   3358 N  N   . LYS B 1 213 ? 26.405  6.729  57.115  1.00 48.39  ? 213  LYS C N   1 
ATOM   3359 C  CA  . LYS B 1 213 ? 25.137  6.708  56.362  1.00 48.15  ? 213  LYS C CA  1 
ATOM   3360 C  C   . LYS B 1 213 ? 23.923  6.606  57.307  1.00 47.22  ? 213  LYS C C   1 
ATOM   3361 O  O   . LYS B 1 213 ? 23.953  5.832  58.300  1.00 46.67  ? 213  LYS C O   1 
ATOM   3362 C  CB  . LYS B 1 213 ? 25.118  5.493  55.438  1.00 47.44  ? 213  LYS C CB  1 
ATOM   3363 C  CG  . LYS B 1 213 ? 23.896  5.340  54.535  1.00 47.96  ? 213  LYS C CG  1 
ATOM   3364 C  CD  . LYS B 1 213 ? 23.889  3.913  53.971  1.00 48.43  ? 213  LYS C CD  1 
ATOM   3365 C  CE  . LYS B 1 213 ? 23.391  3.794  52.529  1.00 49.72  ? 213  LYS C CE  1 
ATOM   3366 N  NZ  . LYS B 1 213 ? 23.824  2.472  51.910  1.00 48.52  ? 213  LYS C NZ  1 
ATOM   3367 N  N   . ILE B 1 214 ? 22.847  7.316  56.973  1.00 44.68  ? 214  ILE C N   1 
ATOM   3368 C  CA  . ILE B 1 214 ? 21.637  7.172  57.742  1.00 43.72  ? 214  ILE C CA  1 
ATOM   3369 C  C   . ILE B 1 214 ? 20.541  6.742  56.789  1.00 42.37  ? 214  ILE C C   1 
ATOM   3370 O  O   . ILE B 1 214 ? 20.343  7.401  55.779  1.00 41.93  ? 214  ILE C O   1 
ATOM   3371 C  CB  . ILE B 1 214 ? 21.271  8.511  58.434  1.00 44.13  ? 214  ILE C CB  1 
ATOM   3372 C  CG1 . ILE B 1 214 ? 22.386  8.939  59.402  1.00 47.57  ? 214  ILE C CG1 1 
ATOM   3373 C  CG2 . ILE B 1 214 ? 19.946  8.395  59.163  1.00 41.83  ? 214  ILE C CG2 1 
ATOM   3374 C  CD1 . ILE B 1 214 ? 22.867  10.403 59.248  1.00 46.66  ? 214  ILE C CD1 1 
ATOM   3375 N  N   . ILE B 1 215 ? 19.830  5.666  57.100  1.00 40.46  ? 215  ILE C N   1 
ATOM   3376 C  CA  . ILE B 1 215 ? 18.625  5.308  56.350  1.00 39.53  ? 215  ILE C CA  1 
ATOM   3377 C  C   . ILE B 1 215 ? 17.345  5.653  57.117  1.00 39.82  ? 215  ILE C C   1 
ATOM   3378 O  O   . ILE B 1 215 ? 17.128  5.195  58.276  1.00 39.09  ? 215  ILE C O   1 
ATOM   3379 C  CB  . ILE B 1 215 ? 18.578  3.830  55.934  1.00 40.23  ? 215  ILE C CB  1 
ATOM   3380 C  CG1 . ILE B 1 215 ? 19.908  3.346  55.373  1.00 39.42  ? 215  ILE C CG1 1 
ATOM   3381 C  CG2 . ILE B 1 215 ? 17.435  3.573  54.888  1.00 39.26  ? 215  ILE C CG2 1 
ATOM   3382 C  CD1 . ILE B 1 215 ? 19.959  1.837  55.330  1.00 39.55  ? 215  ILE C CD1 1 
ATOM   3383 N  N   . VAL B 1 216 ? 16.516  6.473  56.474  1.00 38.93  ? 216  VAL C N   1 
ATOM   3384 C  CA  . VAL B 1 216 ? 15.179  6.795  56.945  1.00 38.53  ? 216  VAL C CA  1 
ATOM   3385 C  C   . VAL B 1 216 ? 14.192  5.836  56.215  1.00 39.70  ? 216  VAL C C   1 
ATOM   3386 O  O   . VAL B 1 216 ? 14.078  5.851  54.978  1.00 38.70  ? 216  VAL C O   1 
ATOM   3387 C  CB  . VAL B 1 216 ? 14.875  8.278  56.727  1.00 37.67  ? 216  VAL C CB  1 
ATOM   3388 C  CG1 . VAL B 1 216 ? 13.571  8.676  57.385  1.00 38.17  ? 216  VAL C CG1 1 
ATOM   3389 C  CG2 . VAL B 1 216 ? 16.056  9.210  57.311  1.00 39.42  ? 216  VAL C CG2 1 
ATOM   3390 N  N   . TYR B 1 217 ? 13.550  4.983  57.015  1.00 39.55  ? 217  TYR C N   1 
ATOM   3391 C  CA  . TYR B 1 217 ? 12.553  4.010  56.593  1.00 39.94  ? 217  TYR C CA  1 
ATOM   3392 C  C   . TYR B 1 217 ? 11.152  4.623  56.654  1.00 40.58  ? 217  TYR C C   1 
ATOM   3393 O  O   . TYR B 1 217 ? 10.327  4.319  55.794  1.00 39.07  ? 217  TYR C O   1 
ATOM   3394 C  CB  . TYR B 1 217 ? 12.659  2.756  57.472  1.00 40.95  ? 217  TYR C CB  1 
ATOM   3395 C  CG  . TYR B 1 217 ? 13.987  2.049  57.302  1.00 40.53  ? 217  TYR C CG  1 
ATOM   3396 C  CD1 . TYR B 1 217 ? 14.276  1.387  56.153  1.00 43.23  ? 217  TYR C CD1 1 
ATOM   3397 C  CD2 . TYR B 1 217 ? 14.966  2.099  58.271  1.00 42.62  ? 217  TYR C CD2 1 
ATOM   3398 C  CE1 . TYR B 1 217 ? 15.475  0.733  55.971  1.00 43.87  ? 217  TYR C CE1 1 
ATOM   3399 C  CE2 . TYR B 1 217 ? 16.184  1.441  58.093  1.00 43.32  ? 217  TYR C CE2 1 
ATOM   3400 C  CZ  . TYR B 1 217 ? 16.434  0.792  56.925  1.00 42.97  ? 217  TYR C CZ  1 
ATOM   3401 O  OH  . TYR B 1 217 ? 17.627  0.134  56.706  1.00 44.15  ? 217  TYR C OH  1 
ATOM   3402 N  N   . ASN B 1 218 ? 10.898  5.536  57.592  1.00 40.58  ? 218  ASN C N   1 
ATOM   3403 C  CA  . ASN B 1 218 ? 9.578   6.147  57.696  1.00 41.64  ? 218  ASN C CA  1 
ATOM   3404 C  C   . ASN B 1 218 ? 9.685   7.661  57.914  1.00 41.19  ? 218  ASN C C   1 
ATOM   3405 O  O   . ASN B 1 218 ? 9.753   8.152  59.031  1.00 41.76  ? 218  ASN C O   1 
ATOM   3406 C  CB  . ASN B 1 218 ? 8.740   5.419  58.776  1.00 42.33  ? 218  ASN C CB  1 
ATOM   3407 C  CG  . ASN B 1 218 ? 7.264   5.857  58.828  1.00 43.12  ? 218  ASN C CG  1 
ATOM   3408 O  OD1 . ASN B 1 218 ? 6.856   6.828  58.190  1.00 46.31  ? 218  ASN C OD1 1 
ATOM   3409 N  ND2 . ASN B 1 218 ? 6.465   5.143  59.633  1.00 43.40  ? 218  ASN C ND2 1 
ATOM   3410 N  N   . LEU B 1 219 ? 9.663   8.412  56.805  1.00 41.04  ? 219  LEU C N   1 
ATOM   3411 C  CA  . LEU B 1 219 ? 9.921   9.839  56.858  1.00 40.44  ? 219  LEU C CA  1 
ATOM   3412 C  C   . LEU B 1 219 ? 8.723   10.579 57.411  1.00 40.55  ? 219  LEU C C   1 
ATOM   3413 O  O   . LEU B 1 219 ? 8.849   11.583 58.111  1.00 39.23  ? 219  LEU C O   1 
ATOM   3414 C  CB  . LEU B 1 219 ? 10.269  10.374 55.474  1.00 40.06  ? 219  LEU C CB  1 
ATOM   3415 C  CG  . LEU B 1 219 ? 10.563  11.879 55.352  1.00 40.82  ? 219  LEU C CG  1 
ATOM   3416 C  CD1 . LEU B 1 219 ? 11.793  12.154 56.239  1.00 38.10  ? 219  LEU C CD1 1 
ATOM   3417 C  CD2 . LEU B 1 219 ? 10.729  12.333 53.865  1.00 42.26  ? 219  LEU C CD2 1 
ATOM   3418 N  N   . GLY B 1 220 ? 7.537   10.115 57.036  1.00 40.14  ? 220  GLY C N   1 
ATOM   3419 C  CA  . GLY B 1 220 ? 6.307   10.616 57.646  1.00 41.20  ? 220  GLY C CA  1 
ATOM   3420 C  C   . GLY B 1 220 ? 6.229   10.476 59.160  1.00 41.02  ? 220  GLY C C   1 
ATOM   3421 O  O   . GLY B 1 220 ? 5.751   11.385 59.829  1.00 41.51  ? 220  GLY C O   1 
ATOM   3422 N  N   . GLU B 1 221 ? 6.709   9.364  59.709  1.00 41.55  ? 221  GLU C N   1 
ATOM   3423 C  CA  . GLU B 1 221 ? 6.705   9.166  61.188  1.00 41.81  ? 221  GLU C CA  1 
ATOM   3424 C  C   . GLU B 1 221 ? 7.857   9.929  61.834  1.00 41.45  ? 221  GLU C C   1 
ATOM   3425 O  O   . GLU B 1 221 ? 7.694   10.497 62.925  1.00 41.75  ? 221  GLU C O   1 
ATOM   3426 C  CB  . GLU B 1 221 ? 6.733   7.671  61.563  1.00 42.48  ? 221  GLU C CB  1 
ATOM   3427 C  CG  . GLU B 1 221 ? 6.607   7.311  63.054  1.00 43.55  ? 221  GLU C CG  1 
ATOM   3428 C  CD  . GLU B 1 221 ? 5.308   7.821  63.734  1.00 49.05  ? 221  GLU C CD  1 
ATOM   3429 O  OE1 . GLU B 1 221 ? 4.803   8.913  63.361  1.00 53.29  ? 221  GLU C OE1 1 
ATOM   3430 O  OE2 . GLU B 1 221 ? 4.797   7.142  64.661  1.00 48.83  ? 221  GLU C OE2 1 
ATOM   3431 N  N   . LEU B 1 222 ? 9.011   9.980  61.142  1.00 41.12  ? 222  LEU C N   1 
ATOM   3432 C  CA  . LEU B 1 222 ? 10.062  10.906 61.538  1.00 40.24  ? 222  LEU C CA  1 
ATOM   3433 C  C   . LEU B 1 222 ? 9.506   12.316 61.493  1.00 41.29  ? 222  LEU C C   1 
ATOM   3434 O  O   . LEU B 1 222 ? 9.615   13.003 62.511  1.00 40.56  ? 222  LEU C O   1 
ATOM   3435 C  CB  . LEU B 1 222 ? 11.343  10.763 60.720  1.00 39.67  ? 222  LEU C CB  1 
ATOM   3436 C  CG  . LEU B 1 222 ? 12.523  11.715 61.029  1.00 39.00  ? 222  LEU C CG  1 
ATOM   3437 C  CD1 . LEU B 1 222 ? 13.160  11.506 62.423  1.00 37.88  ? 222  LEU C CD1 1 
ATOM   3438 C  CD2 . LEU B 1 222 ? 13.559  11.549 59.867  1.00 38.64  ? 222  LEU C CD2 1 
ATOM   3439 N  N   . ASP C 1 9   ? 15.800  6.595  19.013  1.00 34.97  ? 9    ASP B N   1 
ATOM   3440 C  CA  . ASP C 1 9   ? 16.081  7.760  19.898  1.00 35.15  ? 9    ASP B CA  1 
ATOM   3441 C  C   . ASP C 1 9   ? 15.404  9.003  19.393  1.00 33.61  ? 9    ASP B C   1 
ATOM   3442 O  O   . ASP C 1 9   ? 15.677  10.075 20.001  1.00 32.86  ? 9    ASP B O   1 
ATOM   3443 C  CB  . ASP C 1 9   ? 17.573  8.012  20.267  1.00 35.53  ? 9    ASP B CB  1 
ATOM   3444 C  CG  . ASP C 1 9   ? 18.119  6.998  21.302  1.00 38.89  ? 9    ASP B CG  1 
ATOM   3445 O  OD1 . ASP C 1 9   ? 17.333  6.258  21.928  1.00 38.49  ? 9    ASP B OD1 1 
ATOM   3446 O  OD2 . ASP C 1 9   ? 19.380  6.911  21.461  1.00 45.89  ? 9    ASP B OD2 1 
ATOM   3447 N  N   . PHE C 1 10  ? 14.757  8.996  18.200  1.00 30.46  ? 10   PHE B N   1 
ATOM   3448 C  CA  . PHE C 1 10  ? 14.785  10.185 17.374  1.00 28.64  ? 10   PHE B CA  1 
ATOM   3449 C  C   . PHE C 1 10  ? 13.452  10.807 17.944  1.00 27.29  ? 10   PHE B C   1 
ATOM   3450 O  O   . PHE C 1 10  ? 12.416  10.159 18.044  1.00 27.45  ? 10   PHE B O   1 
ATOM   3451 C  CB  . PHE C 1 10  ? 14.732  10.017 15.880  1.00 28.40  ? 10   PHE B CB  1 
ATOM   3452 C  CG  . PHE C 1 10  ? 14.476  11.291 15.172  1.00 28.72  ? 10   PHE B CG  1 
ATOM   3453 C  CD1 . PHE C 1 10  ? 15.429  12.288 15.165  1.00 28.30  ? 10   PHE B CD1 1 
ATOM   3454 C  CD2 . PHE C 1 10  ? 13.283  11.506 14.500  1.00 27.05  ? 10   PHE B CD2 1 
ATOM   3455 C  CE1 . PHE C 1 10  ? 15.193  13.477 14.510  1.00 29.04  ? 10   PHE B CE1 1 
ATOM   3456 C  CE2 . PHE C 1 10  ? 13.033  12.733 13.872  1.00 29.10  ? 10   PHE B CE2 1 
ATOM   3457 C  CZ  . PHE C 1 10  ? 13.974  13.697 13.871  1.00 28.60  ? 10   PHE B CZ  1 
ATOM   3458 N  N   . CYS C 1 11  ? 13.487  12.039 18.364  1.00 26.22  ? 11   CYS B N   1 
ATOM   3459 C  CA  . CYS C 1 11  ? 12.354  12.634 19.086  1.00 27.12  ? 11   CYS B CA  1 
ATOM   3460 C  C   . CYS C 1 11  ? 11.678  13.745 18.244  1.00 27.33  ? 11   CYS B C   1 
ATOM   3461 O  O   . CYS C 1 11  ? 11.216  14.781 18.761  1.00 29.73  ? 11   CYS B O   1 
ATOM   3462 C  CB  . CYS C 1 11  ? 12.844  13.123 20.490  1.00 25.52  ? 11   CYS B CB  1 
ATOM   3463 S  SG  . CYS C 1 11  ? 13.155  11.763 21.635  1.00 25.25  ? 11   CYS B SG  1 
ATOM   3464 N  N   . GLY C 1 12  ? 11.637  13.524 16.933  1.00 29.27  ? 12   GLY B N   1 
ATOM   3465 C  CA  . GLY C 1 12  ? 10.891  14.393 15.973  1.00 29.38  ? 12   GLY B CA  1 
ATOM   3466 C  C   . GLY C 1 12  ? 9.476   13.893 15.713  1.00 29.70  ? 12   GLY B C   1 
ATOM   3467 O  O   . GLY C 1 12  ? 9.137   12.730 15.955  1.00 34.68  ? 12   GLY B O   1 
ATOM   3468 N  N   . ALA C 1 13  ? 8.593   14.800 15.368  1.00 28.46  ? 13   ALA B N   1 
ATOM   3469 C  CA  . ALA C 1 13  ? 7.208   14.494 15.011  1.00 27.40  ? 13   ALA B CA  1 
ATOM   3470 C  C   . ALA C 1 13  ? 6.810   15.589 14.018  1.00 26.71  ? 13   ALA B C   1 
ATOM   3471 O  O   . ALA C 1 13  ? 7.160   16.747 14.176  1.00 25.98  ? 13   ALA B O   1 
ATOM   3472 C  CB  . ALA C 1 13  ? 6.281   14.483 16.249  1.00 26.61  ? 13   ALA B CB  1 
ATOM   3473 N  N   . ILE C 1 14  ? 6.147   15.171 12.952  1.00 26.73  ? 14   ILE B N   1 
ATOM   3474 C  CA  . ILE C 1 14  ? 5.640   16.080 11.955  1.00 27.69  ? 14   ILE B CA  1 
ATOM   3475 C  C   . ILE C 1 14  ? 4.179   16.451 12.203  1.00 27.50  ? 14   ILE B C   1 
ATOM   3476 O  O   . ILE C 1 14  ? 3.772   17.575 11.926  1.00 27.45  ? 14   ILE B O   1 
ATOM   3477 C  CB  . ILE C 1 14  ? 5.884   15.460 10.536  1.00 28.02  ? 14   ILE B CB  1 
ATOM   3478 C  CG1 . ILE C 1 14  ? 7.385   15.260 10.320  1.00 26.65  ? 14   ILE B CG1 1 
ATOM   3479 C  CG2 . ILE C 1 14  ? 5.284   16.307 9.413   1.00 28.44  ? 14   ILE B CG2 1 
ATOM   3480 C  CD1 . ILE C 1 14  ? 7.637   14.285 9.160   1.00 28.14  ? 14   ILE B CD1 1 
ATOM   3481 N  N   . ILE C 1 15  ? 3.401   15.495 12.686  1.00 26.45  ? 15   ILE B N   1 
ATOM   3482 C  CA  . ILE C 1 15  ? 2.028   15.716 12.975  1.00 27.25  ? 15   ILE B CA  1 
ATOM   3483 C  C   . ILE C 1 15  ? 1.813   15.229 14.416  1.00 26.48  ? 15   ILE B C   1 
ATOM   3484 O  O   . ILE C 1 15  ? 2.510   14.323 14.869  1.00 27.03  ? 15   ILE B O   1 
ATOM   3485 C  CB  . ILE C 1 15  ? 1.060   14.974 11.975  1.00 28.22  ? 15   ILE B CB  1 
ATOM   3486 C  CG1 . ILE C 1 15  ? 1.387   13.484 11.884  1.00 29.50  ? 15   ILE B CG1 1 
ATOM   3487 C  CG2 . ILE C 1 15  ? 1.128   15.588 10.585  1.00 26.98  ? 15   ILE B CG2 1 
ATOM   3488 C  CD1 . ILE C 1 15  ? 0.127   12.649 11.730  1.00 30.95  ? 15   ILE B CD1 1 
ATOM   3489 N  N   . PRO C 1 16  ? 0.883   15.850 15.124  1.00 24.24  ? 16   PRO B N   1 
ATOM   3490 C  CA  . PRO C 1 16  ? 0.501   15.577 16.486  1.00 25.15  ? 16   PRO B CA  1 
ATOM   3491 C  C   . PRO C 1 16  ? -0.465  14.372 16.575  1.00 26.14  ? 16   PRO B C   1 
ATOM   3492 O  O   . PRO C 1 16  ? -1.695  14.500 16.895  1.00 24.43  ? 16   PRO B O   1 
ATOM   3493 C  CB  . PRO C 1 16  ? -0.202  16.859 16.895  1.00 23.20  ? 16   PRO B CB  1 
ATOM   3494 C  CG  . PRO C 1 16  ? -0.995  17.227 15.673  1.00 23.19  ? 16   PRO B CG  1 
ATOM   3495 C  CD  . PRO C 1 16  ? 0.073   16.948 14.559  1.00 25.63  ? 16   PRO B CD  1 
ATOM   3496 N  N   . ASP C 1 17  ? 0.127   13.219 16.314  1.00 28.54  ? 17   ASP B N   1 
ATOM   3497 C  CA  . ASP C 1 17  ? -0.560  11.933 16.240  1.00 28.08  ? 17   ASP B CA  1 
ATOM   3498 C  C   . ASP C 1 17  ? 0.507   10.890 16.563  1.00 27.73  ? 17   ASP B C   1 
ATOM   3499 O  O   . ASP C 1 17  ? 1.589   10.909 15.997  1.00 27.23  ? 17   ASP B O   1 
ATOM   3500 C  CB  . ASP C 1 17  ? -1.144  11.726 14.810  1.00 30.16  ? 17   ASP B CB  1 
ATOM   3501 C  CG  . ASP C 1 17  ? -1.981  10.458 14.685  1.00 32.51  ? 17   ASP B CG  1 
ATOM   3502 O  OD1 . ASP C 1 17  ? -2.557  10.024 15.687  1.00 37.84  ? 17   ASP B OD1 1 
ATOM   3503 O  OD2 . ASP C 1 17  ? -1.976  9.839  13.612  1.00 40.82  ? 17   ASP B OD2 1 
ATOM   3504 N  N   . ASN C 1 18  ? 0.173   9.957  17.446  1.00 26.74  ? 18   ASN B N   1 
ATOM   3505 C  CA  . ASN C 1 18  ? 1.042   8.877  17.862  1.00 26.98  ? 18   ASN B CA  1 
ATOM   3506 C  C   . ASN C 1 18  ? 2.436   9.284  18.226  1.00 26.05  ? 18   ASN B C   1 
ATOM   3507 O  O   . ASN C 1 18  ? 3.414   8.714  17.734  1.00 23.84  ? 18   ASN B O   1 
ATOM   3508 C  CB  . ASN C 1 18  ? 1.076   7.753  16.873  1.00 28.68  ? 18   ASN B CB  1 
ATOM   3509 C  CG  . ASN C 1 18  ? -0.286  7.107  16.675  1.00 30.64  ? 18   ASN B CG  1 
ATOM   3510 O  OD1 . ASN C 1 18  ? -1.142  7.041  17.585  1.00 33.27  ? 18   ASN B OD1 1 
ATOM   3511 N  ND2 . ASN C 1 18  ? -0.497  6.648  15.481  1.00 31.35  ? 18   ASN B ND2 1 
ATOM   3512 N  N   . PHE C 1 19  ? 2.497   10.276 19.109  1.00 24.86  ? 19   PHE B N   1 
ATOM   3513 C  CA  . PHE C 1 19  ? 3.778   10.790 19.631  1.00 25.15  ? 19   PHE B CA  1 
ATOM   3514 C  C   . PHE C 1 19  ? 4.570   9.643  20.242  1.00 24.99  ? 19   PHE B C   1 
ATOM   3515 O  O   . PHE C 1 19  ? 3.999   8.791  20.985  1.00 28.18  ? 19   PHE B O   1 
ATOM   3516 C  CB  . PHE C 1 19  ? 3.537   11.866 20.679  1.00 25.36  ? 19   PHE B CB  1 
ATOM   3517 C  CG  . PHE C 1 19  ? 3.250   13.231 20.140  1.00 24.11  ? 19   PHE B CG  1 
ATOM   3518 C  CD1 . PHE C 1 19  ? 4.017   13.800 19.153  1.00 24.14  ? 19   PHE B CD1 1 
ATOM   3519 C  CD2 . PHE C 1 19  ? 2.211   13.987 20.713  1.00 25.14  ? 19   PHE B CD2 1 
ATOM   3520 C  CE1 . PHE C 1 19  ? 3.756   15.121 18.698  1.00 21.50  ? 19   PHE B CE1 1 
ATOM   3521 C  CE2 . PHE C 1 19  ? 1.936   15.253 20.285  1.00 23.01  ? 19   PHE B CE2 1 
ATOM   3522 C  CZ  . PHE C 1 19  ? 2.751   15.842 19.239  1.00 23.68  ? 19   PHE B CZ  1 
ATOM   3523 N  N   . PHE C 1 20  ? 5.823   9.524  19.845  1.00 23.92  ? 20   PHE B N   1 
ATOM   3524 C  CA  . PHE C 1 20  ? 6.717   8.555  20.471  1.00 23.77  ? 20   PHE B CA  1 
ATOM   3525 C  C   . PHE C 1 20  ? 6.051   7.413  21.272  1.00 22.88  ? 20   PHE B C   1 
ATOM   3526 O  O   . PHE C 1 20  ? 6.041   7.396  22.466  1.00 23.54  ? 20   PHE B O   1 
ATOM   3527 C  CB  . PHE C 1 20  ? 7.794   9.236  21.348  1.00 23.32  ? 20   PHE B CB  1 
ATOM   3528 C  CG  . PHE C 1 20  ? 9.018   8.430  21.455  1.00 22.25  ? 20   PHE B CG  1 
ATOM   3529 C  CD1 . PHE C 1 20  ? 10.058  8.587  20.499  1.00 25.22  ? 20   PHE B CD1 1 
ATOM   3530 C  CD2 . PHE C 1 20  ? 9.120   7.456  22.423  1.00 19.61  ? 20   PHE B CD2 1 
ATOM   3531 C  CE1 . PHE C 1 20  ? 11.159  7.776  20.558  1.00 26.41  ? 20   PHE B CE1 1 
ATOM   3532 C  CE2 . PHE C 1 20  ? 10.238  6.672  22.502  1.00 23.94  ? 20   PHE B CE2 1 
ATOM   3533 C  CZ  . PHE C 1 20  ? 11.232  6.794  21.568  1.00 23.48  ? 20   PHE B CZ  1 
ATOM   3534 N  N   . PRO C 1 21  ? 5.564   6.363  20.581  1.00 24.31  ? 21   PRO B N   1 
ATOM   3535 C  CA  . PRO C 1 21  ? 4.924   5.272  21.358  1.00 23.69  ? 21   PRO B CA  1 
ATOM   3536 C  C   . PRO C 1 21  ? 5.904   4.446  22.194  1.00 22.85  ? 21   PRO B C   1 
ATOM   3537 O  O   . PRO C 1 21  ? 7.089   4.392  21.892  1.00 24.40  ? 21   PRO B O   1 
ATOM   3538 C  CB  . PRO C 1 21  ? 4.248   4.411  20.266  1.00 23.48  ? 21   PRO B CB  1 
ATOM   3539 C  CG  . PRO C 1 21  ? 4.469   5.188  18.978  1.00 26.16  ? 21   PRO B CG  1 
ATOM   3540 C  CD  . PRO C 1 21  ? 5.478   6.174  19.129  1.00 22.41  ? 21   PRO B CD  1 
ATOM   3541 N  N   . ILE C 1 22  ? 5.385   3.841  23.258  1.00 23.09  ? 22   ILE B N   1 
ATOM   3542 C  CA  . ILE C 1 22  ? 6.161   3.065  24.199  1.00 22.47  ? 22   ILE B CA  1 
ATOM   3543 C  C   . ILE C 1 22  ? 5.450   1.729  24.398  1.00 21.93  ? 22   ILE B C   1 
ATOM   3544 O  O   . ILE C 1 22  ? 4.782   1.523  25.419  1.00 20.96  ? 22   ILE B O   1 
ATOM   3545 C  CB  . ILE C 1 22  ? 6.408   3.783  25.576  1.00 23.95  ? 22   ILE B CB  1 
ATOM   3546 C  CG1 . ILE C 1 22  ? 6.876   5.232  25.358  1.00 23.38  ? 22   ILE B CG1 1 
ATOM   3547 C  CG2 . ILE C 1 22  ? 7.532   2.997  26.409  1.00 20.06  ? 22   ILE B CG2 1 
ATOM   3548 C  CD1 . ILE C 1 22  ? 6.675   6.126  26.486  1.00 20.75  ? 22   ILE B CD1 1 
ATOM   3549 N  N   . GLU C 1 23  ? 5.583   0.837  23.402  1.00 22.25  ? 23   GLU B N   1 
ATOM   3550 C  CA  . GLU C 1 23  ? 4.972   -0.487 23.456  1.00 21.68  ? 23   GLU B CA  1 
ATOM   3551 C  C   . GLU C 1 23  ? 5.381   -1.252 24.720  1.00 21.87  ? 23   GLU B C   1 
ATOM   3552 O  O   . GLU C 1 23  ? 4.605   -2.042 25.279  1.00 20.63  ? 23   GLU B O   1 
ATOM   3553 C  CB  . GLU C 1 23  ? 5.284   -1.315 22.164  1.00 23.20  ? 23   GLU B CB  1 
ATOM   3554 C  CG  . GLU C 1 23  ? 4.648   -2.715 22.209  1.00 26.14  ? 23   GLU B CG  1 
ATOM   3555 C  CD  . GLU C 1 23  ? 5.479   -3.889 22.907  1.00 36.65  ? 23   GLU B CD  1 
ATOM   3556 O  OE1 . GLU C 1 23  ? 6.721   -4.015 22.650  1.00 44.45  ? 23   GLU B OE1 1 
ATOM   3557 O  OE2 . GLU C 1 23  ? 4.876   -4.728 23.659  1.00 37.24  ? 23   GLU B OE2 1 
ATOM   3558 N  N   . LYS C 1 24  ? 6.576   -1.008 25.247  1.00 23.33  ? 24   LYS B N   1 
ATOM   3559 C  CA  . LYS C 1 24  ? 7.037   -1.792 26.342  1.00 26.73  ? 24   LYS B CA  1 
ATOM   3560 C  C   . LYS C 1 24  ? 6.354   -1.545 27.667  1.00 26.74  ? 24   LYS B C   1 
ATOM   3561 O  O   . LYS C 1 24  ? 6.475   -2.345 28.518  1.00 26.32  ? 24   LYS B O   1 
ATOM   3562 C  CB  . LYS C 1 24  ? 8.551   -1.669 26.492  1.00 28.82  ? 24   LYS B CB  1 
ATOM   3563 C  CG  . LYS C 1 24  ? 9.293   -2.449 25.500  1.00 27.92  ? 24   LYS B CG  1 
ATOM   3564 C  CD  . LYS C 1 24  ? 10.803  -2.482 25.842  1.00 32.43  ? 24   LYS B CD  1 
ATOM   3565 C  CE  . LYS C 1 24  ? 11.557  -3.439 24.860  1.00 37.94  ? 24   LYS B CE  1 
ATOM   3566 N  NZ  . LYS C 1 24  ? 11.484  -4.894 25.294  1.00 42.43  ? 24   LYS B NZ  1 
ATOM   3567 N  N   . LEU C 1 25  ? 5.614   -0.446 27.816  1.00 26.03  ? 25   LEU B N   1 
ATOM   3568 C  CA  . LEU C 1 25  ? 4.720   -0.234 28.961  1.00 26.03  ? 25   LEU B CA  1 
ATOM   3569 C  C   . LEU C 1 25  ? 3.633   -1.304 29.114  1.00 25.73  ? 25   LEU B C   1 
ATOM   3570 O  O   . LEU C 1 25  ? 3.087   -1.567 30.208  1.00 24.73  ? 25   LEU B O   1 
ATOM   3571 C  CB  . LEU C 1 25  ? 4.105   1.177  28.843  1.00 26.05  ? 25   LEU B CB  1 
ATOM   3572 C  CG  . LEU C 1 25  ? 4.514   2.296  29.827  1.00 30.46  ? 25   LEU B CG  1 
ATOM   3573 C  CD1 . LEU C 1 25  ? 5.535   1.943  30.915  1.00 24.04  ? 25   LEU B CD1 1 
ATOM   3574 C  CD2 . LEU C 1 25  ? 4.610   3.723  29.222  1.00 24.53  ? 25   LEU B CD2 1 
ATOM   3575 N  N   . ARG C 1 26  ? 3.351   -1.966 28.007  1.00 25.55  ? 26   ARG B N   1 
ATOM   3576 C  CA  . ARG C 1 26  ? 2.483   -3.141 28.052  1.00 27.01  ? 26   ARG B CA  1 
ATOM   3577 C  C   . ARG C 1 26  ? 2.933   -4.168 29.040  1.00 25.29  ? 26   ARG B C   1 
ATOM   3578 O  O   . ARG C 1 26  ? 2.127   -4.928 29.546  1.00 24.71  ? 26   ARG B O   1 
ATOM   3579 C  CB  . ARG C 1 26  ? 2.452   -3.817 26.687  1.00 27.54  ? 26   ARG B CB  1 
ATOM   3580 C  CG  . ARG C 1 26  ? 1.711   -3.024 25.762  1.00 31.29  ? 26   ARG B CG  1 
ATOM   3581 C  CD  . ARG C 1 26  ? 1.604   -3.752 24.453  1.00 36.43  ? 26   ARG B CD  1 
ATOM   3582 N  NE  . ARG C 1 26  ? 0.810   -2.896 23.621  1.00 41.16  ? 26   ARG B NE  1 
ATOM   3583 C  CZ  . ARG C 1 26  ? -0.471  -3.098 23.335  1.00 43.63  ? 26   ARG B CZ  1 
ATOM   3584 N  NH1 . ARG C 1 26  ? -1.144  -4.212 23.759  1.00 40.82  ? 26   ARG B NH1 1 
ATOM   3585 N  NH2 . ARG C 1 26  ? -1.057  -2.200 22.556  1.00 40.29  ? 26   ARG B NH2 1 
ATOM   3586 N  N   . ASN C 1 27  ? 4.240   -4.212 29.294  1.00 23.39  ? 27   ASN B N   1 
ATOM   3587 C  CA  . ASN C 1 27  ? 4.780   -5.197 30.230  1.00 23.16  ? 27   ASN B CA  1 
ATOM   3588 C  C   . ASN C 1 27  ? 4.549   -4.818 31.714  1.00 21.98  ? 27   ASN B C   1 
ATOM   3589 O  O   . ASN C 1 27  ? 4.980   -5.514 32.585  1.00 20.53  ? 27   ASN B O   1 
ATOM   3590 C  CB  . ASN C 1 27  ? 6.271   -5.387 29.971  1.00 22.80  ? 27   ASN B CB  1 
ATOM   3591 C  CG  . ASN C 1 27  ? 6.558   -5.994 28.631  1.00 21.49  ? 27   ASN B CG  1 
ATOM   3592 O  OD1 . ASN C 1 27  ? 5.780   -6.757 28.098  1.00 24.75  ? 27   ASN B OD1 1 
ATOM   3593 N  ND2 . ASN C 1 27  ? 7.684   -5.654 28.088  1.00 25.54  ? 27   ASN B ND2 1 
ATOM   3594 N  N   . TYR C 1 28  ? 3.931   -3.679 31.990  1.00 23.69  ? 28   TYR B N   1 
ATOM   3595 C  CA  . TYR C 1 28  ? 3.875   -3.101 33.339  1.00 23.69  ? 28   TYR B CA  1 
ATOM   3596 C  C   . TYR C 1 28  ? 2.471   -2.740 33.710  1.00 25.70  ? 28   TYR B C   1 
ATOM   3597 O  O   . TYR C 1 28  ? 2.270   -2.125 34.754  1.00 24.93  ? 28   TYR B O   1 
ATOM   3598 C  CB  . TYR C 1 28  ? 4.787   -1.851 33.460  1.00 24.62  ? 28   TYR B CB  1 
ATOM   3599 C  CG  . TYR C 1 28  ? 6.172   -2.265 33.126  1.00 24.72  ? 28   TYR B CG  1 
ATOM   3600 C  CD1 . TYR C 1 28  ? 6.734   -1.966 31.895  1.00 25.51  ? 28   TYR B CD1 1 
ATOM   3601 C  CD2 . TYR C 1 28  ? 6.901   -3.045 34.026  1.00 23.86  ? 28   TYR B CD2 1 
ATOM   3602 C  CE1 . TYR C 1 28  ? 7.969   -2.446 31.559  1.00 27.63  ? 28   TYR B CE1 1 
ATOM   3603 C  CE2 . TYR C 1 28  ? 8.118   -3.551 33.688  1.00 25.06  ? 28   TYR B CE2 1 
ATOM   3604 C  CZ  . TYR C 1 28  ? 8.656   -3.273 32.467  1.00 24.64  ? 28   TYR B CZ  1 
ATOM   3605 O  OH  . TYR C 1 28  ? 9.920   -3.770 32.192  1.00 26.17  ? 28   TYR B OH  1 
ATOM   3606 N  N   . THR C 1 29  ? 1.499   -3.089 32.868  1.00 23.71  ? 29   THR B N   1 
ATOM   3607 C  CA  . THR C 1 29  ? 0.128   -2.597 33.066  1.00 25.12  ? 29   THR B CA  1 
ATOM   3608 C  C   . THR C 1 29  ? -0.537  -3.187 34.334  1.00 24.56  ? 29   THR B C   1 
ATOM   3609 O  O   . THR C 1 29  ? -1.487  -2.630 34.841  1.00 24.55  ? 29   THR B O   1 
ATOM   3610 C  CB  . THR C 1 29  ? -0.802  -2.860 31.818  1.00 24.55  ? 29   THR B CB  1 
ATOM   3611 O  OG1 . THR C 1 29  ? -0.645  -4.189 31.472  1.00 24.28  ? 29   THR B OG1 1 
ATOM   3612 C  CG2 . THR C 1 29  ? -0.453  -1.942 30.612  1.00 26.32  ? 29   THR B CG2 1 
ATOM   3613 N  N   . GLN C 1 30  ? 0.000   -4.248 34.893  1.00 25.87  ? 30   GLN B N   1 
ATOM   3614 C  CA  . GLN C 1 30  ? -0.585  -4.798 36.124  1.00 27.73  ? 30   GLN B CA  1 
ATOM   3615 C  C   . GLN C 1 30  ? -0.198  -3.966 37.329  1.00 27.08  ? 30   GLN B C   1 
ATOM   3616 O  O   . GLN C 1 30  ? -0.833  -4.067 38.376  1.00 25.45  ? 30   GLN B O   1 
ATOM   3617 C  CB  . GLN C 1 30  ? -0.190  -6.245 36.361  1.00 30.32  ? 30   GLN B CB  1 
ATOM   3618 C  CG  . GLN C 1 30  ? 1.288   -6.498 36.265  1.00 35.09  ? 30   GLN B CG  1 
ATOM   3619 C  CD  . GLN C 1 30  ? 1.716   -7.016 34.886  1.00 41.57  ? 30   GLN B CD  1 
ATOM   3620 O  OE1 . GLN C 1 30  ? 1.308   -8.136 34.463  1.00 46.08  ? 30   GLN B OE1 1 
ATOM   3621 N  NE2 . GLN C 1 30  ? 2.581   -6.249 34.208  1.00 33.18  ? 30   GLN B NE2 1 
ATOM   3622 N  N   . MET C 1 31  ? 0.821   -3.132 37.144  1.00 26.24  ? 31   MET B N   1 
ATOM   3623 C  CA  . MET C 1 31  ? 1.182   -2.075 38.103  1.00 27.06  ? 31   MET B CA  1 
ATOM   3624 C  C   . MET C 1 31  ? 0.315   -0.834 38.113  1.00 26.05  ? 31   MET B C   1 
ATOM   3625 O  O   . MET C 1 31  ? 0.390   -0.044 39.048  1.00 27.12  ? 31   MET B O   1 
ATOM   3626 C  CB  . MET C 1 31  ? 2.642   -1.709 37.933  1.00 26.47  ? 31   MET B CB  1 
ATOM   3627 C  CG  . MET C 1 31  ? 3.528   -2.937 38.243  1.00 29.46  ? 31   MET B CG  1 
ATOM   3628 S  SD  . MET C 1 31  ? 5.179   -2.573 37.680  1.00 30.12  ? 31   MET B SD  1 
ATOM   3629 C  CE  . MET C 1 31  ? 6.033   -4.102 37.956  1.00 25.92  ? 31   MET B CE  1 
ATOM   3630 N  N   . GLY C 1 32  ? -0.485  -0.634 37.061  1.00 26.08  ? 32   GLY B N   1 
ATOM   3631 C  CA  . GLY C 1 32  ? -1.426  0.469  36.970  1.00 24.83  ? 32   GLY B CA  1 
ATOM   3632 C  C   . GLY C 1 32  ? -2.874  -0.029 37.089  1.00 25.78  ? 32   GLY B C   1 
ATOM   3633 O  O   . GLY C 1 32  ? -3.152  -1.183 37.487  1.00 24.96  ? 32   GLY B O   1 
ATOM   3634 N  N   . LEU C 1 33  ? -3.781  0.843  36.678  1.00 24.76  ? 33   LEU B N   1 
ATOM   3635 C  CA  . LEU C 1 33  ? -5.203  0.560  36.701  1.00 25.79  ? 33   LEU B CA  1 
ATOM   3636 C  C   . LEU C 1 33  ? -5.788  0.579  35.289  1.00 23.95  ? 33   LEU B C   1 
ATOM   3637 O  O   . LEU C 1 33  ? -5.666  1.560  34.612  1.00 22.56  ? 33   LEU B O   1 
ATOM   3638 C  CB  . LEU C 1 33  ? -5.974  1.551  37.583  1.00 27.28  ? 33   LEU B CB  1 
ATOM   3639 C  CG  . LEU C 1 33  ? -5.415  1.775  39.011  1.00 29.09  ? 33   LEU B CG  1 
ATOM   3640 C  CD1 . LEU C 1 33  ? -6.235  2.912  39.745  1.00 31.65  ? 33   LEU B CD1 1 
ATOM   3641 C  CD2 . LEU C 1 33  ? -5.409  0.405  39.848  1.00 32.48  ? 33   LEU B CD2 1 
ATOM   3642 N  N   . ILE C 1 34  ? -6.412  -0.536 34.886  1.00 23.58  ? 34   ILE B N   1 
ATOM   3643 C  CA  . ILE C 1 34  ? -7.066  -0.653 33.599  1.00 24.13  ? 34   ILE B CA  1 
ATOM   3644 C  C   . ILE C 1 34  ? -8.383  0.106  33.637  1.00 24.75  ? 34   ILE B C   1 
ATOM   3645 O  O   . ILE C 1 34  ? -9.197  -0.082 34.508  1.00 25.84  ? 34   ILE B O   1 
ATOM   3646 C  CB  . ILE C 1 34  ? -7.249  -2.156 33.130  1.00 24.48  ? 34   ILE B CB  1 
ATOM   3647 C  CG1 . ILE C 1 34  ? -5.891  -2.875 33.051  1.00 26.64  ? 34   ILE B CG1 1 
ATOM   3648 C  CG2 . ILE C 1 34  ? -8.148  -2.265 31.854  1.00 22.81  ? 34   ILE B CG2 1 
ATOM   3649 C  CD1 . ILE C 1 34  ? -4.780  -2.270 32.147  1.00 27.35  ? 34   ILE B CD1 1 
ATOM   3650 N  N   . ARG C 1 35  ? -8.577  1.030  32.716  1.00 23.69  ? 35   ARG B N   1 
ATOM   3651 C  CA  . ARG C 1 35  ? -9.858  1.699  32.615  1.00 24.00  ? 35   ARG B CA  1 
ATOM   3652 C  C   . ARG C 1 35  ? -10.276 1.708  31.192  1.00 22.49  ? 35   ARG B C   1 
ATOM   3653 O  O   . ARG C 1 35  ? -9.464  2.075  30.328  1.00 21.52  ? 35   ARG B O   1 
ATOM   3654 C  CB  . ARG C 1 35  ? -9.750  3.133  33.152  1.00 24.13  ? 35   ARG B CB  1 
ATOM   3655 C  CG  . ARG C 1 35  ? -9.651  3.134  34.697  1.00 26.09  ? 35   ARG B CG  1 
ATOM   3656 C  CD  . ARG C 1 35  ? -9.514  4.467  35.299  1.00 28.20  ? 35   ARG B CD  1 
ATOM   3657 N  NE  . ARG C 1 35  ? -10.694 5.255  35.010  1.00 33.54  ? 35   ARG B NE  1 
ATOM   3658 C  CZ  . ARG C 1 35  ? -10.802 6.551  35.243  1.00 33.93  ? 35   ARG B CZ  1 
ATOM   3659 N  NH1 . ARG C 1 35  ? -9.787  7.231  35.803  1.00 35.26  ? 35   ARG B NH1 1 
ATOM   3660 N  NH2 . ARG C 1 35  ? -11.935 7.146  34.932  1.00 36.67  ? 35   ARG B NH2 1 
ATOM   3661 N  N   . ASP C 1 36  ? -11.531 1.320  30.909  1.00 22.76  ? 36   ASP B N   1 
ATOM   3662 C  CA  . ASP C 1 36  ? -11.983 1.218  29.522  1.00 22.23  ? 36   ASP B CA  1 
ATOM   3663 C  C   . ASP C 1 36  ? -12.955 2.365  29.234  1.00 23.15  ? 36   ASP B C   1 
ATOM   3664 O  O   . ASP C 1 36  ? -13.642 2.810  30.151  1.00 21.26  ? 36   ASP B O   1 
ATOM   3665 C  CB  . ASP C 1 36  ? -12.740 -0.080 29.283  1.00 22.83  ? 36   ASP B CB  1 
ATOM   3666 C  CG  . ASP C 1 36  ? -11.857 -1.344 29.306  1.00 22.21  ? 36   ASP B CG  1 
ATOM   3667 O  OD1 . ASP C 1 36  ? -10.625 -1.297 29.279  1.00 21.30  ? 36   ASP B OD1 1 
ATOM   3668 O  OD2 . ASP C 1 36  ? -12.464 -2.408 29.364  1.00 24.48  ? 36   ASP B OD2 1 
ATOM   3669 N  N   . PHE C 1 37  ? -13.053 2.742  27.955  1.00 22.18  ? 37   PHE B N   1 
ATOM   3670 C  CA  . PHE C 1 37  ? -13.868 3.885  27.502  1.00 23.32  ? 37   PHE B CA  1 
ATOM   3671 C  C   . PHE C 1 37  ? -14.570 3.541  26.174  1.00 23.98  ? 37   PHE B C   1 
ATOM   3672 O  O   . PHE C 1 37  ? -13.932 3.191  25.163  1.00 25.35  ? 37   PHE B O   1 
ATOM   3673 C  CB  . PHE C 1 37  ? -13.031 5.174  27.378  1.00 22.36  ? 37   PHE B CB  1 
ATOM   3674 C  CG  . PHE C 1 37  ? -12.443 5.612  28.682  1.00 21.28  ? 37   PHE B CG  1 
ATOM   3675 C  CD1 . PHE C 1 37  ? -13.154 6.418  29.549  1.00 22.54  ? 37   PHE B CD1 1 
ATOM   3676 C  CD2 . PHE C 1 37  ? -11.230 5.153  29.076  1.00 20.64  ? 37   PHE B CD2 1 
ATOM   3677 C  CE1 . PHE C 1 37  ? -12.625 6.784  30.785  1.00 25.17  ? 37   PHE B CE1 1 
ATOM   3678 C  CE2 . PHE C 1 37  ? -10.678 5.500  30.324  1.00 22.73  ? 37   PHE B CE2 1 
ATOM   3679 C  CZ  . PHE C 1 37  ? -11.367 6.345  31.167  1.00 21.96  ? 37   PHE B CZ  1 
ATOM   3680 N  N   . ALA C 1 38  ? -15.879 3.641  26.196  1.00 26.14  ? 38   ALA B N   1 
ATOM   3681 C  CA  . ALA C 1 38  ? -16.711 3.469  25.020  1.00 25.23  ? 38   ALA B CA  1 
ATOM   3682 C  C   . ALA C 1 38  ? -16.463 4.608  24.073  1.00 25.11  ? 38   ALA B C   1 
ATOM   3683 O  O   . ALA C 1 38  ? -16.076 5.709  24.478  1.00 24.79  ? 38   ALA B O   1 
ATOM   3684 C  CB  . ALA C 1 38  ? -18.232 3.391  25.415  1.00 26.48  ? 38   ALA B CB  1 
ATOM   3685 N  N   . LYS C 1 39  ? -16.668 4.342  22.789  1.00 25.42  ? 39   LYS B N   1 
ATOM   3686 C  CA  . LYS C 1 39  ? -16.677 5.388  21.767  1.00 25.67  ? 39   LYS B CA  1 
ATOM   3687 C  C   . LYS C 1 39  ? -17.503 6.617  22.191  1.00 25.18  ? 39   LYS B C   1 
ATOM   3688 O  O   . LYS C 1 39  ? -18.610 6.492  22.616  1.00 25.61  ? 39   LYS B O   1 
ATOM   3689 C  CB  . LYS C 1 39  ? -17.226 4.842  20.460  1.00 25.75  ? 39   LYS B CB  1 
ATOM   3690 C  CG  . LYS C 1 39  ? -17.031 5.752  19.336  1.00 26.47  ? 39   LYS B CG  1 
ATOM   3691 C  CD  . LYS C 1 39  ? -17.631 5.272  18.037  1.00 27.06  ? 39   LYS B CD  1 
ATOM   3692 C  CE  . LYS C 1 39  ? -17.294 6.334  16.921  1.00 28.82  ? 39   LYS B CE  1 
ATOM   3693 N  NZ  . LYS C 1 39  ? -18.416 7.278  16.779  1.00 30.27  ? 39   LYS B NZ  1 
ATOM   3694 N  N   . GLY C 1 40  ? -16.928 7.805  22.079  1.00 25.31  ? 40   GLY B N   1 
ATOM   3695 C  CA  . GLY C 1 40  ? -17.611 9.030  22.441  1.00 25.46  ? 40   GLY B CA  1 
ATOM   3696 C  C   . GLY C 1 40  ? -17.564 9.413  23.912  1.00 25.69  ? 40   GLY B C   1 
ATOM   3697 O  O   . GLY C 1 40  ? -17.971 10.532 24.281  1.00 25.30  ? 40   GLY B O   1 
ATOM   3698 N  N   . SER C 1 41  ? -17.097 8.502  24.764  1.00 25.00  ? 41   SER B N   1 
ATOM   3699 C  CA  . SER C 1 41  ? -16.964 8.809  26.179  1.00 24.94  ? 41   SER B CA  1 
ATOM   3700 C  C   . SER C 1 41  ? -15.666 9.611  26.520  1.00 23.33  ? 41   SER B C   1 
ATOM   3701 O  O   . SER C 1 41  ? -14.705 9.553  25.798  1.00 23.39  ? 41   SER B O   1 
ATOM   3702 C  CB  . SER C 1 41  ? -17.147 7.524  26.985  1.00 25.46  ? 41   SER B CB  1 
ATOM   3703 O  OG  . SER C 1 41  ? -15.934 6.828  27.182  1.00 27.94  ? 41   SER B OG  1 
ATOM   3704 N  N   . ALA C 1 42  ? -15.678 10.330 27.634  1.00 23.20  ? 42   ALA B N   1 
ATOM   3705 C  CA  . ALA C 1 42  ? -14.632 11.225 28.121  1.00 24.32  ? 42   ALA B CA  1 
ATOM   3706 C  C   . ALA C 1 42  ? -13.514 10.479 28.895  1.00 24.87  ? 42   ALA B C   1 
ATOM   3707 O  O   . ALA C 1 42  ? -13.749 9.946  29.967  1.00 26.10  ? 42   ALA B O   1 
ATOM   3708 C  CB  . ALA C 1 42  ? -15.275 12.303 29.024  1.00 23.19  ? 42   ALA B CB  1 
ATOM   3709 N  N   . VAL C 1 43  ? -12.314 10.377 28.330  1.00 23.97  ? 43   VAL B N   1 
ATOM   3710 C  CA  . VAL C 1 43  ? -11.168 9.851  29.062  1.00 23.05  ? 43   VAL B CA  1 
ATOM   3711 C  C   . VAL C 1 43  ? -10.713 10.873 30.123  1.00 23.76  ? 43   VAL B C   1 
ATOM   3712 O  O   . VAL C 1 43  ? -10.384 10.496 31.266  1.00 22.44  ? 43   VAL B O   1 
ATOM   3713 C  CB  . VAL C 1 43  ? -10.047 9.433  28.110  1.00 23.15  ? 43   VAL B CB  1 
ATOM   3714 C  CG1 . VAL C 1 43  ? -8.835  8.857  28.887  1.00 25.17  ? 43   VAL B CG1 1 
ATOM   3715 C  CG2 . VAL C 1 43  ? -10.630 8.475  27.073  1.00 22.08  ? 43   VAL B CG2 1 
ATOM   3716 N  N   . ILE C 1 44  ? -10.787 12.149 29.745  1.00 22.84  ? 44   ILE B N   1 
ATOM   3717 C  CA  . ILE C 1 44  ? -10.562 13.262 30.630  1.00 24.92  ? 44   ILE B CA  1 
ATOM   3718 C  C   . ILE C 1 44  ? -11.683 14.221 30.430  1.00 25.62  ? 44   ILE B C   1 
ATOM   3719 O  O   . ILE C 1 44  ? -11.870 14.785 29.341  1.00 25.06  ? 44   ILE B O   1 
ATOM   3720 C  CB  . ILE C 1 44  ? -9.190  13.978 30.400  1.00 23.52  ? 44   ILE B CB  1 
ATOM   3721 C  CG1 . ILE C 1 44  ? -8.040  12.963 30.416  1.00 23.66  ? 44   ILE B CG1 1 
ATOM   3722 C  CG2 . ILE C 1 44  ? -8.951  15.018 31.472  1.00 21.97  ? 44   ILE B CG2 1 
ATOM   3723 C  CD1 . ILE C 1 44  ? -6.581  13.630 30.068  1.00 23.67  ? 44   ILE B CD1 1 
ATOM   3724 N  N   . MET C 1 45  ? -12.483 14.343 31.489  1.00 27.97  ? 45   MET B N   1 
ATOM   3725 C  CA  . MET C 1 45  ? -13.613 15.260 31.533  1.00 30.43  ? 45   MET B CA  1 
ATOM   3726 C  C   . MET C 1 45  ? -13.102 16.674 31.647  1.00 29.01  ? 45   MET B C   1 
ATOM   3727 O  O   . MET C 1 45  ? -12.110 16.903 32.316  1.00 28.23  ? 45   MET B O   1 
ATOM   3728 C  CB  . MET C 1 45  ? -14.482 14.966 32.759  1.00 30.20  ? 45   MET B CB  1 
ATOM   3729 C  CG  . MET C 1 45  ? -15.283 13.652 32.651  1.00 33.34  ? 45   MET B CG  1 
ATOM   3730 S  SD  . MET C 1 45  ? -16.182 13.125 34.178  1.00 37.47  ? 45   MET B SD  1 
ATOM   3731 C  CE  . MET C 1 45  ? -14.901 13.115 35.498  1.00 30.37  ? 45   MET B CE  1 
ATOM   3732 N  N   . PRO C 1 46  ? -13.799 17.636 31.015  1.00 30.37  ? 46   PRO B N   1 
ATOM   3733 C  CA  . PRO C 1 46  ? -13.424 19.033 31.214  1.00 30.30  ? 46   PRO B CA  1 
ATOM   3734 C  C   . PRO C 1 46  ? -13.470 19.376 32.709  1.00 29.44  ? 46   PRO B C   1 
ATOM   3735 O  O   . PRO C 1 46  ? -14.340 18.880 33.424  1.00 28.12  ? 46   PRO B O   1 
ATOM   3736 C  CB  . PRO C 1 46  ? -14.493 19.819 30.442  1.00 30.34  ? 46   PRO B CB  1 
ATOM   3737 C  CG  . PRO C 1 46  ? -15.045 18.836 29.397  1.00 31.24  ? 46   PRO B CG  1 
ATOM   3738 C  CD  . PRO C 1 46  ? -14.998 17.493 30.151  1.00 30.26  ? 46   PRO B CD  1 
ATOM   3739 N  N   . GLY C 1 47  ? -12.486 20.146 33.164  1.00 28.97  ? 47   GLY B N   1 
ATOM   3740 C  CA  . GLY C 1 47  ? -12.330 20.458 34.579  1.00 29.49  ? 47   GLY B CA  1 
ATOM   3741 C  C   . GLY C 1 47  ? -11.742 19.362 35.462  1.00 30.13  ? 47   GLY B C   1 
ATOM   3742 O  O   . GLY C 1 47  ? -11.531 19.556 36.655  1.00 30.80  ? 47   GLY B O   1 
ATOM   3743 N  N   . GLU C 1 48  ? -11.505 18.176 34.931  1.00 29.34  ? 48   GLU B N   1 
ATOM   3744 C  CA  . GLU C 1 48  ? -11.066 17.113 35.814  1.00 28.99  ? 48   GLU B CA  1 
ATOM   3745 C  C   . GLU C 1 48  ? -9.583  17.243 35.991  1.00 27.43  ? 48   GLU B C   1 
ATOM   3746 O  O   . GLU C 1 48  ? -8.866  17.506 35.014  1.00 25.63  ? 48   GLU B O   1 
ATOM   3747 C  CB  . GLU C 1 48  ? -11.353 15.739 35.224  1.00 29.67  ? 48   GLU B CB  1 
ATOM   3748 C  CG  . GLU C 1 48  ? -11.087 14.546 36.136  1.00 30.20  ? 48   GLU B CG  1 
ATOM   3749 C  CD  . GLU C 1 48  ? -11.281 13.224 35.386  1.00 29.37  ? 48   GLU B CD  1 
ATOM   3750 O  OE1 . GLU C 1 48  ? -11.504 13.260 34.166  1.00 24.79  ? 48   GLU B OE1 1 
ATOM   3751 O  OE2 . GLU C 1 48  ? -11.211 12.147 36.000  1.00 32.90  ? 48   GLU B OE2 1 
ATOM   3752 N  N   . GLU C 1 49  ? -9.166  17.047 37.226  1.00 26.43  ? 49   GLU B N   1 
ATOM   3753 C  CA  . GLU C 1 49  ? -7.784  17.083 37.631  1.00 28.21  ? 49   GLU B CA  1 
ATOM   3754 C  C   . GLU C 1 49  ? -7.216  15.666 37.527  1.00 26.65  ? 49   GLU B C   1 
ATOM   3755 O  O   . GLU C 1 49  ? -7.701  14.712 38.149  1.00 26.73  ? 49   GLU B O   1 
ATOM   3756 C  CB  . GLU C 1 49  ? -7.613  17.681 39.030  1.00 30.29  ? 49   GLU B CB  1 
ATOM   3757 C  CG  . GLU C 1 49  ? -7.873  19.209 39.065  1.00 36.75  ? 49   GLU B CG  1 
ATOM   3758 C  CD  . GLU C 1 49  ? -6.724  20.122 38.445  1.00 40.61  ? 49   GLU B CD  1 
ATOM   3759 O  OE1 . GLU C 1 49  ? -5.725  19.603 37.905  1.00 43.10  ? 49   GLU B OE1 1 
ATOM   3760 O  OE2 . GLU C 1 49  ? -6.837  21.378 38.534  1.00 45.77  ? 49   GLU B OE2 1 
ATOM   3761 N  N   . ILE C 1 50  ? -6.258  15.543 36.603  1.00 24.68  ? 50   ILE B N   1 
ATOM   3762 C  CA  . ILE C 1 50  ? -5.599  14.302 36.305  1.00 24.27  ? 50   ILE B CA  1 
ATOM   3763 C  C   . ILE C 1 50  ? -4.254  14.329 36.978  1.00 23.82  ? 50   ILE B C   1 
ATOM   3764 O  O   . ILE C 1 50  ? -3.523  15.330 36.848  1.00 25.50  ? 50   ILE B O   1 
ATOM   3765 C  CB  . ILE C 1 50  ? -5.379  14.089 34.754  1.00 22.36  ? 50   ILE B CB  1 
ATOM   3766 C  CG1 . ILE C 1 50  ? -6.694  14.170 34.017  1.00 23.30  ? 50   ILE B CG1 1 
ATOM   3767 C  CG2 . ILE C 1 50  ? -4.659  12.755 34.456  1.00 22.99  ? 50   ILE B CG2 1 
ATOM   3768 C  CD1 . ILE C 1 50  ? -7.673  13.024 34.295  1.00 19.57  ? 50   ILE B CD1 1 
ATOM   3769 N  N   . THR C 1 51  ? -3.893  13.219 37.611  1.00 24.76  ? 51   THR B N   1 
ATOM   3770 C  CA  . THR C 1 51  ? -2.567  13.064 38.255  1.00 25.71  ? 51   THR B CA  1 
ATOM   3771 C  C   . THR C 1 51  ? -2.038  11.642 38.043  1.00 24.36  ? 51   THR B C   1 
ATOM   3772 O  O   . THR C 1 51  ? -1.586  10.989 38.938  1.00 23.23  ? 51   THR B O   1 
ATOM   3773 C  CB  . THR C 1 51  ? -2.606  13.443 39.812  1.00 26.31  ? 51   THR B CB  1 
ATOM   3774 O  OG1 . THR C 1 51  ? -3.554  12.646 40.450  1.00 26.41  ? 51   THR B OG1 1 
ATOM   3775 C  CG2 . THR C 1 51  ? -2.948  14.903 40.057  1.00 26.60  ? 51   THR B CG2 1 
ATOM   3776 N  N   . SER C 1 52  ? -2.149  11.197 36.810  1.00 24.73  ? 52   SER B N   1 
ATOM   3777 C  CA  . SER C 1 52  ? -1.711  9.918  36.333  1.00 26.05  ? 52   SER B CA  1 
ATOM   3778 C  C   . SER C 1 52  ? -1.214  10.080 34.918  1.00 25.77  ? 52   SER B C   1 
ATOM   3779 O  O   . SER C 1 52  ? -1.799  10.872 34.133  1.00 28.34  ? 52   SER B O   1 
ATOM   3780 C  CB  . SER C 1 52  ? -2.897  8.923  36.304  1.00 26.93  ? 52   SER B CB  1 
ATOM   3781 O  OG  . SER C 1 52  ? -3.362  8.658  37.587  1.00 27.97  ? 52   SER B OG  1 
ATOM   3782 N  N   . MET C 1 53  ? -0.181  9.314  34.565  1.00 25.52  ? 53   MET B N   1 
ATOM   3783 C  CA  . MET C 1 53  ? 0.102   8.980  33.135  1.00 25.03  ? 53   MET B CA  1 
ATOM   3784 C  C   . MET C 1 53  ? -0.892  7.974  32.633  1.00 24.86  ? 53   MET B C   1 
ATOM   3785 O  O   . MET C 1 53  ? -1.287  7.046  33.365  1.00 25.50  ? 53   MET B O   1 
ATOM   3786 C  CB  . MET C 1 53  ? 1.551   8.534  32.965  1.00 25.15  ? 53   MET B CB  1 
ATOM   3787 C  CG  . MET C 1 53  ? 2.519   9.658  33.477  1.00 23.84  ? 53   MET B CG  1 
ATOM   3788 S  SD  . MET C 1 53  ? 4.022   9.358  32.600  1.00 28.83  ? 53   MET B SD  1 
ATOM   3789 C  CE  . MET C 1 53  ? 5.092   10.532 33.358  1.00 25.16  ? 53   MET B CE  1 
ATOM   3790 N  N   . ILE C 1 54  ? -1.393  8.230  31.417  1.00 23.37  ? 54   ILE B N   1 
ATOM   3791 C  CA  . ILE C 1 54  ? -2.404  7.425  30.849  1.00 21.72  ? 54   ILE B CA  1 
ATOM   3792 C  C   . ILE C 1 54  ? -1.859  6.767  29.595  1.00 21.74  ? 54   ILE B C   1 
ATOM   3793 O  O   . ILE C 1 54  ? -1.588  7.410  28.543  1.00 21.81  ? 54   ILE B O   1 
ATOM   3794 C  CB  . ILE C 1 54  ? -3.705  8.177  30.547  1.00 21.58  ? 54   ILE B CB  1 
ATOM   3795 C  CG1 . ILE C 1 54  ? -4.278  8.869  31.857  1.00 19.81  ? 54   ILE B CG1 1 
ATOM   3796 C  CG2 . ILE C 1 54  ? -4.747  7.160  29.899  1.00 20.44  ? 54   ILE B CG2 1 
ATOM   3797 C  CD1 . ILE C 1 54  ? -5.174  10.032 31.595  1.00 20.51  ? 54   ILE B CD1 1 
ATOM   3798 N  N   . PHE C 1 55  ? -1.675  5.454  29.732  1.00 21.23  ? 55   PHE B N   1 
ATOM   3799 C  CA  . PHE C 1 55  ? -1.170  4.662  28.658  1.00 20.56  ? 55   PHE B CA  1 
ATOM   3800 C  C   . PHE C 1 55  ? -2.324  4.053  27.869  1.00 20.86  ? 55   PHE B C   1 
ATOM   3801 O  O   . PHE C 1 55  ? -3.218  3.445  28.435  1.00 21.44  ? 55   PHE B O   1 
ATOM   3802 C  CB  . PHE C 1 55  ? -0.222  3.612  29.204  1.00 21.11  ? 55   PHE B CB  1 
ATOM   3803 C  CG  . PHE C 1 55  ? 0.266   2.615  28.156  1.00 20.00  ? 55   PHE B CG  1 
ATOM   3804 C  CD1 . PHE C 1 55  ? 1.153   3.033  27.168  1.00 24.08  ? 55   PHE B CD1 1 
ATOM   3805 C  CD2 . PHE C 1 55  ? -0.088  1.276  28.201  1.00 15.50  ? 55   PHE B CD2 1 
ATOM   3806 C  CE1 . PHE C 1 55  ? 1.658   2.138  26.206  1.00 21.54  ? 55   PHE B CE1 1 
ATOM   3807 C  CE2 . PHE C 1 55  ? 0.463   0.376  27.263  1.00 18.23  ? 55   PHE B CE2 1 
ATOM   3808 C  CZ  . PHE C 1 55  ? 1.348   0.841  26.293  1.00 17.40  ? 55   PHE B CZ  1 
ATOM   3809 N  N   . LEU C 1 56  ? -2.233  4.147  26.551  1.00 21.09  ? 56   LEU B N   1 
ATOM   3810 C  CA  . LEU C 1 56  ? -3.262  3.694  25.664  1.00 23.00  ? 56   LEU B CA  1 
ATOM   3811 C  C   . LEU C 1 56  ? -2.884  2.305  25.184  1.00 24.56  ? 56   LEU B C   1 
ATOM   3812 O  O   . LEU C 1 56  ? -1.981  2.127  24.385  1.00 25.04  ? 56   LEU B O   1 
ATOM   3813 C  CB  . LEU C 1 56  ? -3.485  4.791  24.566  1.00 22.67  ? 56   LEU B CB  1 
ATOM   3814 C  CG  . LEU C 1 56  ? -4.830  4.991  23.908  1.00 23.52  ? 56   LEU B CG  1 
ATOM   3815 C  CD1 . LEU C 1 56  ? -4.930  6.149  22.908  1.00 17.82  ? 56   LEU B CD1 1 
ATOM   3816 C  CD2 . LEU C 1 56  ? -5.183  3.643  23.166  1.00 23.71  ? 56   LEU B CD2 1 
ATOM   3817 N  N   . VAL C 1 57  ? -3.574  1.296  25.727  1.00 25.67  ? 57   VAL B N   1 
ATOM   3818 C  CA  . VAL C 1 57  ? -3.290  -0.091 25.420  1.00 24.82  ? 57   VAL B CA  1 
ATOM   3819 C  C   . VAL C 1 57  ? -3.809  -0.347 23.997  1.00 26.38  ? 57   VAL B C   1 
ATOM   3820 O  O   . VAL C 1 57  ? -3.077  -0.859 23.180  1.00 24.81  ? 57   VAL B O   1 
ATOM   3821 C  CB  . VAL C 1 57  ? -3.895  -1.054 26.468  1.00 24.53  ? 57   VAL B CB  1 
ATOM   3822 C  CG1 . VAL C 1 57  ? -3.824  -2.540 25.967  1.00 24.93  ? 57   VAL B CG1 1 
ATOM   3823 C  CG2 . VAL C 1 57  ? -3.331  -0.783 27.975  1.00 22.88  ? 57   VAL B CG2 1 
ATOM   3824 N  N   . GLU C 1 58  ? -5.060  0.049  23.705  1.00 25.09  ? 58   GLU B N   1 
ATOM   3825 C  CA  . GLU C 1 58  ? -5.627  -0.055 22.376  1.00 25.38  ? 58   GLU B CA  1 
ATOM   3826 C  C   . GLU C 1 58  ? -6.837  0.864  22.280  1.00 23.63  ? 58   GLU B C   1 
ATOM   3827 O  O   . GLU C 1 58  ? -7.508  1.145  23.258  1.00 23.14  ? 58   GLU B O   1 
ATOM   3828 C  CB  . GLU C 1 58  ? -5.989  -1.532 21.962  1.00 26.88  ? 58   GLU B CB  1 
ATOM   3829 C  CG  . GLU C 1 58  ? -7.148  -2.133 22.675  1.00 29.15  ? 58   GLU B CG  1 
ATOM   3830 N  N   . GLY C 1 59  ? -7.052  1.374  21.084  1.00 24.11  ? 59   GLY B N   1 
ATOM   3831 C  CA  . GLY C 1 59  ? -8.069  2.371  20.847  1.00 23.46  ? 59   GLY B CA  1 
ATOM   3832 C  C   . GLY C 1 59  ? -7.541  3.641  20.266  1.00 23.19  ? 59   GLY B C   1 
ATOM   3833 O  O   . GLY C 1 59  ? -6.518  3.641  19.611  1.00 21.68  ? 59   GLY B O   1 
ATOM   3834 N  N   . LYS C 1 60  ? -8.284  4.725  20.488  1.00 24.37  ? 60   LYS B N   1 
ATOM   3835 C  CA  . LYS C 1 60  ? -7.972  6.031  19.912  1.00 25.29  ? 60   LYS B CA  1 
ATOM   3836 C  C   . LYS C 1 60  ? -8.613  7.117  20.716  1.00 25.10  ? 60   LYS B C   1 
ATOM   3837 O  O   . LYS C 1 60  ? -9.775  7.029  21.053  1.00 24.01  ? 60   LYS B O   1 
ATOM   3838 C  CB  . LYS C 1 60  ? -8.407  6.181  18.465  1.00 26.33  ? 60   LYS B CB  1 
ATOM   3839 C  CG  . LYS C 1 60  ? -7.561  7.181  17.676  1.00 26.07  ? 60   LYS B CG  1 
ATOM   3840 C  CD  . LYS C 1 60  ? -7.912  7.127  16.232  1.00 30.11  ? 60   LYS B CD  1 
ATOM   3841 C  CE  . LYS C 1 60  ? -7.153  8.208  15.413  1.00 32.94  ? 60   LYS B CE  1 
ATOM   3842 N  NZ  . LYS C 1 60  ? -8.089  8.854  14.437  1.00 38.58  ? 60   LYS B NZ  1 
ATOM   3843 N  N   . ILE C 1 61  ? -7.812  8.143  21.019  1.00 24.17  ? 61   ILE B N   1 
ATOM   3844 C  CA  . ILE C 1 61  ? -8.271  9.249  21.832  1.00 24.84  ? 61   ILE B CA  1 
ATOM   3845 C  C   . ILE C 1 61  ? -7.957  10.556 21.063  1.00 24.96  ? 61   ILE B C   1 
ATOM   3846 O  O   . ILE C 1 61  ? -6.913  10.650 20.433  1.00 25.48  ? 61   ILE B O   1 
ATOM   3847 C  CB  . ILE C 1 61  ? -7.604  9.219  23.233  1.00 23.74  ? 61   ILE B CB  1 
ATOM   3848 C  CG1 . ILE C 1 61  ? -8.117  8.016  24.059  1.00 23.12  ? 61   ILE B CG1 1 
ATOM   3849 C  CG2 . ILE C 1 61  ? -7.777  10.601 23.941  1.00 25.69  ? 61   ILE B CG2 1 
ATOM   3850 C  CD1 . ILE C 1 61  ? -7.339  7.685  25.418  1.00 23.62  ? 61   ILE B CD1 1 
ATOM   3851 N  N   . LYS C 1 62  ? -8.877  11.525 21.124  1.00 24.51  ? 62   LYS B N   1 
ATOM   3852 C  CA  . LYS C 1 62  ? -8.635  12.905 20.701  1.00 24.26  ? 62   LYS B CA  1 
ATOM   3853 C  C   . LYS C 1 62  ? -8.531  13.761 21.947  1.00 23.96  ? 62   LYS B C   1 
ATOM   3854 O  O   . LYS C 1 62  ? -9.439  13.800 22.760  1.00 23.53  ? 62   LYS B O   1 
ATOM   3855 C  CB  . LYS C 1 62  ? -9.795  13.401 19.812  1.00 25.16  ? 62   LYS B CB  1 
ATOM   3856 C  CG  . LYS C 1 62  ? -9.692  14.814 19.264  1.00 24.51  ? 62   LYS B CG  1 
ATOM   3857 C  CD  . LYS C 1 62  ? -10.926 15.185 18.379  1.00 25.00  ? 62   LYS B CD  1 
ATOM   3858 C  CE  . LYS C 1 62  ? -10.777 16.537 17.711  1.00 29.64  ? 62   LYS B CE  1 
ATOM   3859 N  NZ  . LYS C 1 62  ? -10.978 17.661 18.650  1.00 35.27  ? 62   LYS B NZ  1 
ATOM   3860 N  N   . LEU C 1 63  ? -7.441  14.506 22.057  1.00 24.55  ? 63   LEU B N   1 
ATOM   3861 C  CA  . LEU C 1 63  ? -7.173  15.262 23.266  1.00 24.50  ? 63   LEU B CA  1 
ATOM   3862 C  C   . LEU C 1 63  ? -7.083  16.747 22.865  1.00 23.40  ? 63   LEU B C   1 
ATOM   3863 O  O   . LEU C 1 63  ? -6.274  17.133 22.025  1.00 22.37  ? 63   LEU B O   1 
ATOM   3864 C  CB  . LEU C 1 63  ? -5.935  14.666 23.971  1.00 23.81  ? 63   LEU B CB  1 
ATOM   3865 C  CG  . LEU C 1 63  ? -5.540  15.210 25.380  1.00 24.42  ? 63   LEU B CG  1 
ATOM   3866 C  CD1 . LEU C 1 63  ? -4.757  14.119 26.161  1.00 17.37  ? 63   LEU B CD1 1 
ATOM   3867 C  CD2 . LEU C 1 63  ? -4.670  16.461 25.224  1.00 21.53  ? 63   LEU B CD2 1 
ATOM   3868 N  N   . ASP C 1 64  ? -8.018  17.511 23.427  1.00 23.77  ? 64   ASP B N   1 
ATOM   3869 C  CA  . ASP C 1 64  ? -8.240  18.928 23.196  1.00 24.40  ? 64   ASP B CA  1 
ATOM   3870 C  C   . ASP C 1 64  ? -7.936  19.767 24.447  1.00 25.07  ? 64   ASP B C   1 
ATOM   3871 O  O   . ASP C 1 64  ? -7.845  19.270 25.598  1.00 22.18  ? 64   ASP B O   1 
ATOM   3872 C  CB  . ASP C 1 64  ? -9.714  19.174 22.848  1.00 24.92  ? 64   ASP B CB  1 
ATOM   3873 C  CG  . ASP C 1 64  ? -10.107 18.650 21.526  1.00 26.06  ? 64   ASP B CG  1 
ATOM   3874 O  OD1 . ASP C 1 64  ? -9.283  17.997 20.810  1.00 25.45  ? 64   ASP B OD1 1 
ATOM   3875 O  OD2 . ASP C 1 64  ? -11.307 18.860 21.240  1.00 31.03  ? 64   ASP B OD2 1 
ATOM   3876 N  N   . ILE C 1 65  ? -7.720  21.040 24.191  1.00 25.48  ? 65   ILE B N   1 
ATOM   3877 C  CA  . ILE C 1 65  ? -7.663  22.061 25.217  1.00 25.70  ? 65   ILE B CA  1 
ATOM   3878 C  C   . ILE C 1 65  ? -8.914  22.939 25.136  1.00 25.69  ? 65   ILE B C   1 
ATOM   3879 O  O   . ILE C 1 65  ? -9.439  23.246 24.056  1.00 25.79  ? 65   ILE B O   1 
ATOM   3880 C  CB  . ILE C 1 65  ? -6.316  22.859 25.197  1.00 24.90  ? 65   ILE B CB  1 
ATOM   3881 C  CG1 . ILE C 1 65  ? -6.160  23.730 26.483  1.00 27.51  ? 65   ILE B CG1 1 
ATOM   3882 C  CG2 . ILE C 1 65  ? -6.142  23.654 23.935  1.00 25.62  ? 65   ILE B CG2 1 
ATOM   3883 C  CD1 . ILE C 1 65  ? -4.890  24.691 26.504  1.00 26.73  ? 65   ILE B CD1 1 
ATOM   3884 N  N   . ILE C 1 66  ? -9.424  23.305 26.307  1.00 26.65  ? 66   ILE B N   1 
ATOM   3885 C  CA  . ILE C 1 66  ? -10.569 24.194 26.363  1.00 26.86  ? 66   ILE B CA  1 
ATOM   3886 C  C   . ILE C 1 66  ? -10.216 25.437 27.189  1.00 27.09  ? 66   ILE B C   1 
ATOM   3887 O  O   . ILE C 1 66  ? -9.704  25.325 28.328  1.00 27.35  ? 66   ILE B O   1 
ATOM   3888 C  CB  . ILE C 1 66  ? -11.886 23.426 26.769  1.00 27.40  ? 66   ILE B CB  1 
ATOM   3889 C  CG1 . ILE C 1 66  ? -13.034 24.360 26.992  1.00 27.89  ? 66   ILE B CG1 1 
ATOM   3890 C  CG2 . ILE C 1 66  ? -11.734 22.534 27.937  1.00 29.43  ? 66   ILE B CG2 1 
ATOM   3891 C  CD1 . ILE C 1 66  ? -14.356 23.798 26.346  1.00 32.17  ? 66   ILE B CD1 1 
ATOM   3892 N  N   . PHE C 1 67  ? -10.425 26.595 26.573  1.00 26.52  ? 67   PHE B N   1 
ATOM   3893 C  CA  . PHE C 1 67  ? -10.118 27.891 27.193  1.00 28.25  ? 67   PHE B CA  1 
ATOM   3894 C  C   . PHE C 1 67  ? -11.247 28.354 28.091  1.00 29.35  ? 67   PHE B C   1 
ATOM   3895 O  O   . PHE C 1 67  ? -12.304 27.728 28.153  1.00 30.33  ? 67   PHE B O   1 
ATOM   3896 C  CB  . PHE C 1 67  ? -9.777  28.936 26.129  1.00 28.13  ? 67   PHE B CB  1 
ATOM   3897 C  CG  . PHE C 1 67  ? -8.537  28.629 25.433  1.00 28.81  ? 67   PHE B CG  1 
ATOM   3898 C  CD1 . PHE C 1 67  ? -7.329  28.656 26.130  1.00 28.54  ? 67   PHE B CD1 1 
ATOM   3899 C  CD2 . PHE C 1 67  ? -8.551  28.189 24.115  1.00 29.33  ? 67   PHE B CD2 1 
ATOM   3900 C  CE1 . PHE C 1 67  ? -6.150  28.346 25.491  1.00 28.24  ? 67   PHE B CE1 1 
ATOM   3901 C  CE2 . PHE C 1 67  ? -7.368  27.795 23.480  1.00 26.72  ? 67   PHE B CE2 1 
ATOM   3902 C  CZ  . PHE C 1 67  ? -6.171  27.886 24.163  1.00 27.19  ? 67   PHE B CZ  1 
ATOM   3903 N  N   . GLU C 1 68  ? -10.992 29.445 28.796  1.00 30.80  ? 68   GLU B N   1 
ATOM   3904 C  CA  . GLU C 1 68  ? -11.919 30.032 29.754  1.00 32.50  ? 68   GLU B CA  1 
ATOM   3905 C  C   . GLU C 1 68  ? -13.303 30.260 29.099  1.00 32.94  ? 68   GLU B C   1 
ATOM   3906 O  O   . GLU C 1 68  ? -14.348 29.948 29.688  1.00 33.67  ? 68   GLU B O   1 
ATOM   3907 C  CB  . GLU C 1 68  ? -11.321 31.371 30.280  1.00 34.28  ? 68   GLU B CB  1 
ATOM   3908 C  CG  . GLU C 1 68  ? -9.868  31.365 30.975  1.00 37.48  ? 68   GLU B CG  1 
ATOM   3909 C  CD  . GLU C 1 68  ? -8.607  30.888 30.111  1.00 41.24  ? 68   GLU B CD  1 
ATOM   3910 O  OE1 . GLU C 1 68  ? -8.703  30.540 28.928  1.00 38.79  ? 68   GLU B OE1 1 
ATOM   3911 O  OE2 . GLU C 1 68  ? -7.477  30.866 30.658  1.00 43.07  ? 68   GLU B OE2 1 
ATOM   3912 N  N   . ASP C 1 69  ? -13.332 30.837 27.890  1.00 32.40  ? 69   ASP B N   1 
ATOM   3913 C  CA  . ASP C 1 69  ? -14.624 31.104 27.205  1.00 31.96  ? 69   ASP B CA  1 
ATOM   3914 C  C   . ASP C 1 69  ? -15.372 29.884 26.589  1.00 31.96  ? 69   ASP B C   1 
ATOM   3915 O  O   . ASP C 1 69  ? -16.401 30.075 25.940  1.00 30.49  ? 69   ASP B O   1 
ATOM   3916 C  CB  . ASP C 1 69  ? -14.429 32.151 26.121  1.00 32.20  ? 69   ASP B CB  1 
ATOM   3917 C  CG  . ASP C 1 69  ? -13.519 31.692 24.989  1.00 33.34  ? 69   ASP B CG  1 
ATOM   3918 O  OD1 . ASP C 1 69  ? -13.253 30.490 24.848  1.00 28.99  ? 69   ASP B OD1 1 
ATOM   3919 O  OD2 . ASP C 1 69  ? -13.079 32.576 24.219  1.00 36.04  ? 69   ASP B OD2 1 
ATOM   3920 N  N   . GLY C 1 70  ? -14.842 28.656 26.771  1.00 31.18  ? 70   GLY B N   1 
ATOM   3921 C  CA  . GLY C 1 70  ? -15.440 27.423 26.205  1.00 30.84  ? 70   GLY B CA  1 
ATOM   3922 C  C   . GLY C 1 70  ? -14.899 27.027 24.834  1.00 30.19  ? 70   GLY B C   1 
ATOM   3923 O  O   . GLY C 1 70  ? -15.275 26.009 24.256  1.00 30.24  ? 70   GLY B O   1 
ATOM   3924 N  N   . SER C 1 71  ? -14.027 27.853 24.298  1.00 30.19  ? 71   SER B N   1 
ATOM   3925 C  CA  . SER C 1 71  ? -13.415 27.605 23.012  1.00 30.52  ? 71   SER B CA  1 
ATOM   3926 C  C   . SER C 1 71  ? -12.506 26.350 23.145  1.00 30.15  ? 71   SER B C   1 
ATOM   3927 O  O   . SER C 1 71  ? -11.843 26.174 24.157  1.00 28.62  ? 71   SER B O   1 
ATOM   3928 C  CB  . SER C 1 71  ? -12.665 28.863 22.594  1.00 30.60  ? 71   SER B CB  1 
ATOM   3929 O  OG  . SER C 1 71  ? -11.897 28.654 21.444  1.00 37.72  ? 71   SER B OG  1 
ATOM   3930 N  N   . GLU C 1 72  ? -12.530 25.482 22.139  1.00 28.95  ? 72   GLU B N   1 
ATOM   3931 C  CA  . GLU C 1 72  ? -11.855 24.207 22.194  1.00 29.01  ? 72   GLU B CA  1 
ATOM   3932 C  C   . GLU C 1 72  ? -10.916 24.020 20.995  1.00 27.49  ? 72   GLU B C   1 
ATOM   3933 O  O   . GLU C 1 72  ? -11.256 24.349 19.883  1.00 27.91  ? 72   GLU B O   1 
ATOM   3934 C  CB  . GLU C 1 72  ? -12.891 23.085 22.265  1.00 28.95  ? 72   GLU B CB  1 
ATOM   3935 C  CG  . GLU C 1 72  ? -12.353 21.811 22.697  1.00 28.45  ? 72   GLU B CG  1 
ATOM   3936 C  CD  . GLU C 1 72  ? -13.426 20.727 22.847  1.00 31.30  ? 72   GLU B CD  1 
ATOM   3937 O  OE1 . GLU C 1 72  ? -14.600 21.050 23.185  1.00 32.79  ? 72   GLU B OE1 1 
ATOM   3938 O  OE2 . GLU C 1 72  ? -13.068 19.528 22.685  1.00 33.76  ? 72   GLU B OE2 1 
ATOM   3939 N  N   . LYS C 1 73  ? -9.723  23.476 21.236  1.00 26.37  ? 73   LYS B N   1 
ATOM   3940 C  CA  . LYS C 1 73  ? -8.735  23.222 20.191  1.00 24.74  ? 73   LYS B CA  1 
ATOM   3941 C  C   . LYS C 1 73  ? -8.112  21.866 20.351  1.00 24.92  ? 73   LYS B C   1 
ATOM   3942 O  O   . LYS C 1 73  ? -7.840  21.388 21.483  1.00 23.58  ? 73   LYS B O   1 
ATOM   3943 C  CB  . LYS C 1 73  ? -7.610  24.283 20.184  1.00 24.96  ? 73   LYS B CB  1 
ATOM   3944 C  CG  . LYS C 1 73  ? -7.976  25.652 19.626  1.00 26.50  ? 73   LYS B CG  1 
ATOM   3945 C  CD  . LYS C 1 73  ? -8.559  25.674 18.194  1.00 26.91  ? 73   LYS B CD  1 
ATOM   3946 C  CE  . LYS C 1 73  ? -9.267  26.959 17.944  1.00 25.54  ? 73   LYS B CE  1 
ATOM   3947 N  NZ  . LYS C 1 73  ? -9.685  27.086 16.525  1.00 27.98  ? 73   LYS B NZ  1 
ATOM   3948 N  N   . LEU C 1 74  ? -7.925  21.196 19.227  1.00 25.17  ? 74   LEU B N   1 
ATOM   3949 C  CA  . LEU C 1 74  ? -7.084  19.990 19.179  1.00 24.87  ? 74   LEU B CA  1 
ATOM   3950 C  C   . LEU C 1 74  ? -5.660  20.202 19.718  1.00 24.07  ? 74   LEU B C   1 
ATOM   3951 O  O   . LEU C 1 74  ? -4.953  21.122 19.318  1.00 23.33  ? 74   LEU B O   1 
ATOM   3952 C  CB  . LEU C 1 74  ? -6.994  19.496 17.740  1.00 24.69  ? 74   LEU B CB  1 
ATOM   3953 C  CG  . LEU C 1 74  ? -6.013  18.327 17.508  1.00 25.98  ? 74   LEU B CG  1 
ATOM   3954 C  CD1 . LEU C 1 74  ? -6.619  17.081 18.131  1.00 21.39  ? 74   LEU B CD1 1 
ATOM   3955 C  CD2 . LEU C 1 74  ? -5.589  18.158 16.013  1.00 25.24  ? 74   LEU B CD2 1 
ATOM   3956 N  N   . LEU C 1 75  ? -5.228  19.316 20.624  1.00 24.80  ? 75   LEU B N   1 
ATOM   3957 C  CA  . LEU C 1 75  ? -3.808  19.169 20.961  1.00 24.62  ? 75   LEU B CA  1 
ATOM   3958 C  C   . LEU C 1 75  ? -3.154  17.992 20.207  1.00 23.91  ? 75   LEU B C   1 
ATOM   3959 O  O   . LEU C 1 75  ? -2.207  18.184 19.469  1.00 23.72  ? 75   LEU B O   1 
ATOM   3960 C  CB  . LEU C 1 75  ? -3.558  19.102 22.478  1.00 25.19  ? 75   LEU B CB  1 
ATOM   3961 C  CG  . LEU C 1 75  ? -3.780  20.401 23.276  1.00 26.41  ? 75   LEU B CG  1 
ATOM   3962 C  CD1 . LEU C 1 75  ? -3.241  20.305 24.724  1.00 28.91  ? 75   LEU B CD1 1 
ATOM   3963 C  CD2 . LEU C 1 75  ? -3.230  21.615 22.535  1.00 24.70  ? 75   LEU B CD2 1 
ATOM   3964 N  N   . TYR C 1 76  ? -3.684  16.784 20.367  1.00 22.00  ? 76   TYR B N   1 
ATOM   3965 C  CA  . TYR C 1 76  ? -3.211  15.704 19.589  1.00 21.33  ? 76   TYR B CA  1 
ATOM   3966 C  C   . TYR C 1 76  ? -4.211  14.537 19.523  1.00 21.93  ? 76   TYR B C   1 
ATOM   3967 O  O   . TYR C 1 76  ? -5.148  14.471 20.288  1.00 23.18  ? 76   TYR B O   1 
ATOM   3968 C  CB  . TYR C 1 76  ? -1.841  15.217 20.095  1.00 20.28  ? 76   TYR B CB  1 
ATOM   3969 C  CG  . TYR C 1 76  ? -1.736  14.685 21.507  1.00 21.76  ? 76   TYR B CG  1 
ATOM   3970 C  CD1 . TYR C 1 76  ? -1.123  15.430 22.520  1.00 20.20  ? 76   TYR B CD1 1 
ATOM   3971 C  CD2 . TYR C 1 76  ? -2.285  13.411 21.847  1.00 21.53  ? 76   TYR B CD2 1 
ATOM   3972 C  CE1 . TYR C 1 76  ? -0.932  14.875 23.838  1.00 19.32  ? 76   TYR B CE1 1 
ATOM   3973 C  CE2 . TYR C 1 76  ? -2.187  12.905 23.142  1.00 23.28  ? 76   TYR B CE2 1 
ATOM   3974 C  CZ  . TYR C 1 76  ? -1.455  13.610 24.132  1.00 20.92  ? 76   TYR B CZ  1 
ATOM   3975 O  OH  . TYR C 1 76  ? -1.313  12.984 25.359  1.00 20.57  ? 76   TYR B OH  1 
ATOM   3976 N  N   . TYR C 1 77  ? -3.920  13.612 18.629  1.00 22.25  ? 77   TYR B N   1 
ATOM   3977 C  CA  . TYR C 1 77  ? -4.495  12.295 18.614  1.00 23.60  ? 77   TYR B CA  1 
ATOM   3978 C  C   . TYR C 1 77  ? -3.520  11.285 19.198  1.00 23.00  ? 77   TYR B C   1 
ATOM   3979 O  O   . TYR C 1 77  ? -2.297  11.377 19.060  1.00 23.80  ? 77   TYR B O   1 
ATOM   3980 C  CB  . TYR C 1 77  ? -4.856  11.913 17.195  1.00 24.43  ? 77   TYR B CB  1 
ATOM   3981 C  CG  . TYR C 1 77  ? -6.010  12.745 16.651  1.00 26.71  ? 77   TYR B CG  1 
ATOM   3982 C  CD1 . TYR C 1 77  ? -7.355  12.398 16.935  1.00 30.07  ? 77   TYR B CD1 1 
ATOM   3983 C  CD2 . TYR C 1 77  ? -5.779  13.833 15.837  1.00 26.96  ? 77   TYR B CD2 1 
ATOM   3984 C  CE1 . TYR C 1 77  ? -8.405  13.132 16.433  1.00 31.79  ? 77   TYR B CE1 1 
ATOM   3985 C  CE2 . TYR C 1 77  ? -6.834  14.572 15.317  1.00 27.81  ? 77   TYR B CE2 1 
ATOM   3986 C  CZ  . TYR C 1 77  ? -8.149  14.206 15.629  1.00 30.00  ? 77   TYR B CZ  1 
ATOM   3987 O  OH  . TYR C 1 77  ? -9.224  14.923 15.161  1.00 30.77  ? 77   TYR B OH  1 
ATOM   3988 N  N   . ALA C 1 78  ? -4.076  10.299 19.858  1.00 23.26  ? 78   ALA B N   1 
ATOM   3989 C  CA  . ALA C 1 78  ? -3.283  9.194  20.419  1.00 23.55  ? 78   ALA B CA  1 
ATOM   3990 C  C   . ALA C 1 78  ? -3.941  7.835  20.072  1.00 23.05  ? 78   ALA B C   1 
ATOM   3991 O  O   . ALA C 1 78  ? -5.161  7.685  20.193  1.00 23.40  ? 78   ALA B O   1 
ATOM   3992 C  CB  . ALA C 1 78  ? -3.175  9.350  21.907  1.00 22.11  ? 78   ALA B CB  1 
ATOM   3993 N  N   . GLY C 1 79  ? -3.132  6.844  19.743  1.00 22.50  ? 79   GLY B N   1 
ATOM   3994 C  CA  . GLY C 1 79  ? -3.575  5.470  19.514  1.00 24.38  ? 79   GLY B CA  1 
ATOM   3995 C  C   . GLY C 1 79  ? -2.808  4.441  20.360  1.00 23.88  ? 79   GLY B C   1 
ATOM   3996 O  O   . GLY C 1 79  ? -2.130  4.791  21.288  1.00 22.68  ? 79   GLY B O   1 
ATOM   3997 N  N   . GLY C 1 80  ? -2.859  3.171  19.968  1.00 24.26  ? 80   GLY B N   1 
ATOM   3998 C  CA  . GLY C 1 80  ? -2.175  2.103  20.735  1.00 25.14  ? 80   GLY B CA  1 
ATOM   3999 C  C   . GLY C 1 80  ? -0.737  2.485  21.034  1.00 25.89  ? 80   GLY B C   1 
ATOM   4000 O  O   . GLY C 1 80  ? -0.038  2.921  20.123  1.00 26.75  ? 80   GLY B O   1 
ATOM   4001 N  N   . ASN C 1 81  ? -0.328  2.331  22.305  1.00 25.33  ? 81   ASN B N   1 
ATOM   4002 C  CA  . ASN C 1 81  ? 1.050   2.557  22.803  1.00 25.18  ? 81   ASN B CA  1 
ATOM   4003 C  C   . ASN C 1 81  ? 1.408   4.018  23.019  1.00 24.32  ? 81   ASN B C   1 
ATOM   4004 O  O   . ASN C 1 81  ? 2.485   4.306  23.431  1.00 23.45  ? 81   ASN B O   1 
ATOM   4005 C  CB  . ASN C 1 81  ? 2.105   1.845  21.923  1.00 24.68  ? 81   ASN B CB  1 
ATOM   4006 C  CG  . ASN C 1 81  ? 1.858   0.310  21.818  1.00 27.87  ? 81   ASN B CG  1 
ATOM   4007 O  OD1 . ASN C 1 81  ? 1.523   -0.366 22.811  1.00 24.39  ? 81   ASN B OD1 1 
ATOM   4008 N  ND2 . ASN C 1 81  ? 1.968   -0.200 20.602  1.00 23.10  ? 81   ASN B ND2 1 
ATOM   4009 N  N   . SER C 1 82  ? 0.471   4.932  22.803  1.00 23.68  ? 82   SER B N   1 
ATOM   4010 C  CA  . SER C 1 82  ? 0.615   6.294  23.199  1.00 22.98  ? 82   SER B CA  1 
ATOM   4011 C  C   . SER C 1 82  ? 0.515   6.502  24.709  1.00 20.49  ? 82   SER B C   1 
ATOM   4012 O  O   . SER C 1 82  ? -0.010  5.715  25.440  1.00 19.16  ? 82   SER B O   1 
ATOM   4013 C  CB  . SER C 1 82  ? -0.401  7.228  22.487  1.00 24.05  ? 82   SER B CB  1 
ATOM   4014 O  OG  . SER C 1 82  ? -0.167  7.313  21.055  1.00 27.25  ? 82   SER B OG  1 
ATOM   4015 N  N   . LEU C 1 83  ? 1.053   7.621  25.138  1.00 20.87  ? 83   LEU B N   1 
ATOM   4016 C  CA  . LEU C 1 83  ? 1.125   7.961  26.561  1.00 21.33  ? 83   LEU B CA  1 
ATOM   4017 C  C   . LEU C 1 83  ? 0.629   9.356  26.729  1.00 20.91  ? 83   LEU B C   1 
ATOM   4018 O  O   . LEU C 1 83  ? 1.129   10.244 26.066  1.00 21.81  ? 83   LEU B O   1 
ATOM   4019 C  CB  . LEU C 1 83  ? 2.573   7.855  27.096  1.00 20.51  ? 83   LEU B CB  1 
ATOM   4020 C  CG  . LEU C 1 83  ? 2.735   8.008  28.634  1.00 20.27  ? 83   LEU B CG  1 
ATOM   4021 C  CD1 . LEU C 1 83  ? 2.016   6.894  29.314  1.00 17.00  ? 83   LEU B CD1 1 
ATOM   4022 C  CD2 . LEU C 1 83  ? 4.238   8.043  29.014  1.00 21.28  ? 83   LEU B CD2 1 
ATOM   4023 N  N   . ILE C 1 84  ? -0.268  9.563  27.689  1.00 21.75  ? 84   ILE B N   1 
ATOM   4024 C  CA  . ILE C 1 84  ? -0.727  10.892 28.056  1.00 21.60  ? 84   ILE B CA  1 
ATOM   4025 C  C   . ILE C 1 84  ? 0.033   11.232 29.355  1.00 22.96  ? 84   ILE B C   1 
ATOM   4026 O  O   . ILE C 1 84  ? -0.136  10.548 30.391  1.00 23.16  ? 84   ILE B O   1 
ATOM   4027 C  CB  . ILE C 1 84  ? -2.272  11.018 28.299  1.00 22.82  ? 84   ILE B CB  1 
ATOM   4028 C  CG1 . ILE C 1 84  ? -3.058  10.540 27.043  1.00 25.35  ? 84   ILE B CG1 1 
ATOM   4029 C  CG2 . ILE C 1 84  ? -2.626  12.515 28.822  1.00 19.75  ? 84   ILE B CG2 1 
ATOM   4030 C  CD1 . ILE C 1 84  ? -4.626  10.294 27.256  1.00 21.62  ? 84   ILE B CD1 1 
ATOM   4031 N  N   . GLY C 1 85  ? 0.882   12.253 29.271  1.00 21.33  ? 85   GLY B N   1 
ATOM   4032 C  CA  . GLY C 1 85  ? 1.847   12.540 30.299  1.00 21.27  ? 85   GLY B CA  1 
ATOM   4033 C  C   . GLY C 1 85  ? 1.410   13.443 31.433  1.00 24.15  ? 85   GLY B C   1 
ATOM   4034 O  O   . GLY C 1 85  ? 2.274   14.081 32.076  1.00 22.57  ? 85   GLY B O   1 
ATOM   4035 N  N   . LYS C 1 86  ? 0.090   13.452 31.730  1.00 23.11  ? 86   LYS B N   1 
ATOM   4036 C  CA  . LYS C 1 86  ? -0.488  14.353 32.719  1.00 24.43  ? 86   LYS B CA  1 
ATOM   4037 C  C   . LYS C 1 86  ? -0.415  13.921 34.182  1.00 23.28  ? 86   LYS B C   1 
ATOM   4038 O  O   . LYS C 1 86  ? -1.429  13.755 34.851  1.00 23.18  ? 86   LYS B O   1 
ATOM   4039 C  CB  . LYS C 1 86  ? -1.916  14.748 32.348  1.00 24.23  ? 86   LYS B CB  1 
ATOM   4040 C  CG  . LYS C 1 86  ? -1.975  15.572 31.035  1.00 24.54  ? 86   LYS B CG  1 
ATOM   4041 C  CD  . LYS C 1 86  ? -3.364  15.815 30.544  1.00 22.64  ? 86   LYS B CD  1 
ATOM   4042 C  CE  . LYS C 1 86  ? -4.294  16.510 31.591  1.00 18.90  ? 86   LYS B CE  1 
ATOM   4043 N  NZ  . LYS C 1 86  ? -3.732  17.807 32.172  1.00 20.07  ? 86   LYS B NZ  1 
ATOM   4044 N  N   . LEU C 1 87  ? 0.805   13.733 34.645  1.00 22.96  ? 87   LEU B N   1 
ATOM   4045 C  CA  . LEU C 1 87  ? 1.039   13.187 35.960  1.00 22.14  ? 87   LEU B CA  1 
ATOM   4046 C  C   . LEU C 1 87  ? 0.803   14.262 37.065  1.00 21.35  ? 87   LEU B C   1 
ATOM   4047 O  O   . LEU C 1 87  ? 0.576   13.936 38.217  1.00 17.67  ? 87   LEU B O   1 
ATOM   4048 C  CB  . LEU C 1 87  ? 2.467   12.668 36.066  1.00 22.19  ? 87   LEU B CB  1 
ATOM   4049 C  CG  . LEU C 1 87  ? 2.898   11.900 37.329  1.00 23.46  ? 87   LEU B CG  1 
ATOM   4050 C  CD1 . LEU C 1 87  ? 1.915   10.614 37.579  1.00 22.75  ? 87   LEU B CD1 1 
ATOM   4051 C  CD2 . LEU C 1 87  ? 4.343   11.458 37.184  1.00 20.51  ? 87   LEU B CD2 1 
ATOM   4052 N  N   . TYR C 1 88  ? 0.973   15.522 36.717  1.00 20.42  ? 88   TYR B N   1 
ATOM   4053 C  CA  . TYR C 1 88  ? 0.821   16.630 37.685  1.00 22.53  ? 88   TYR B CA  1 
ATOM   4054 C  C   . TYR C 1 88  ? -0.112  17.635 37.093  1.00 22.49  ? 88   TYR B C   1 
ATOM   4055 O  O   . TYR C 1 88  ? -0.270  17.601 35.875  1.00 22.53  ? 88   TYR B O   1 
ATOM   4056 C  CB  . TYR C 1 88  ? 2.192   17.273 37.940  1.00 21.63  ? 88   TYR B CB  1 
ATOM   4057 C  CG  . TYR C 1 88  ? 3.171   16.253 38.375  1.00 21.58  ? 88   TYR B CG  1 
ATOM   4058 C  CD1 . TYR C 1 88  ? 4.144   15.754 37.509  1.00 22.61  ? 88   TYR B CD1 1 
ATOM   4059 C  CD2 . TYR C 1 88  ? 3.073   15.690 39.650  1.00 22.75  ? 88   TYR B CD2 1 
ATOM   4060 C  CE1 . TYR C 1 88  ? 5.061   14.741 37.945  1.00 22.80  ? 88   TYR B CE1 1 
ATOM   4061 C  CE2 . TYR C 1 88  ? 3.942   14.703 40.070  1.00 25.31  ? 88   TYR B CE2 1 
ATOM   4062 C  CZ  . TYR C 1 88  ? 4.910   14.188 39.206  1.00 21.88  ? 88   TYR B CZ  1 
ATOM   4063 O  OH  . TYR C 1 88  ? 5.791   13.233 39.679  1.00 21.44  ? 88   TYR B OH  1 
ATOM   4064 N  N   . PRO C 1 89  ? -0.684  18.545 37.934  1.00 24.68  ? 89   PRO B N   1 
ATOM   4065 C  CA  . PRO C 1 89  ? -1.510  19.622 37.470  1.00 24.14  ? 89   PRO B CA  1 
ATOM   4066 C  C   . PRO C 1 89  ? -0.746  20.625 36.619  1.00 24.25  ? 89   PRO B C   1 
ATOM   4067 O  O   . PRO C 1 89  ? 0.398   20.953 36.921  1.00 23.87  ? 89   PRO B O   1 
ATOM   4068 C  CB  . PRO C 1 89  ? -1.989  20.290 38.744  1.00 25.43  ? 89   PRO B CB  1 
ATOM   4069 C  CG  . PRO C 1 89  ? -0.962  19.835 39.836  1.00 26.51  ? 89   PRO B CG  1 
ATOM   4070 C  CD  . PRO C 1 89  ? -0.616  18.494 39.418  1.00 24.13  ? 89   PRO B CD  1 
ATOM   4071 N  N   . THR C 1 90  ? -1.394  21.086 35.561  1.00 23.46  ? 90   THR B N   1 
ATOM   4072 C  CA  . THR C 1 90  ? -0.756  21.978 34.613  1.00 24.17  ? 90   THR B CA  1 
ATOM   4073 C  C   . THR C 1 90  ? -1.446  23.328 34.470  1.00 25.66  ? 90   THR B C   1 
ATOM   4074 O  O   . THR C 1 90  ? -0.876  24.228 33.840  1.00 26.97  ? 90   THR B O   1 
ATOM   4075 C  CB  . THR C 1 90  ? -0.653  21.354 33.202  1.00 24.29  ? 90   THR B CB  1 
ATOM   4076 O  OG1 . THR C 1 90  ? -1.942  21.376 32.595  1.00 24.62  ? 90   THR B OG1 1 
ATOM   4077 C  CG2 . THR C 1 90  ? -0.102  19.975 33.265  1.00 22.58  ? 90   THR B CG2 1 
ATOM   4078 N  N   . GLY C 1 91  ? -2.646  23.509 35.012  1.00 25.03  ? 91   GLY B N   1 
ATOM   4079 C  CA  . GLY C 1 91  ? -3.301  24.808 34.738  1.00 26.39  ? 91   GLY B CA  1 
ATOM   4080 C  C   . GLY C 1 91  ? -4.132  24.882 33.458  1.00 26.39  ? 91   GLY B C   1 
ATOM   4081 O  O   . GLY C 1 91  ? -4.961  25.795 33.326  1.00 26.46  ? 91   GLY B O   1 
ATOM   4082 N  N   . ASN C 1 92  ? -3.916  23.932 32.528  1.00 25.41  ? 92   ASN B N   1 
ATOM   4083 C  CA  . ASN C 1 92  ? -4.795  23.696 31.358  1.00 25.40  ? 92   ASN B CA  1 
ATOM   4084 C  C   . ASN C 1 92  ? -5.961  22.732 31.599  1.00 25.45  ? 92   ASN B C   1 
ATOM   4085 O  O   . ASN C 1 92  ? -5.841  21.700 32.263  1.00 26.03  ? 92   ASN B O   1 
ATOM   4086 C  CB  . ASN C 1 92  ? -3.979  23.163 30.158  1.00 25.61  ? 92   ASN B CB  1 
ATOM   4087 C  CG  . ASN C 1 92  ? -2.889  24.117 29.704  1.00 25.10  ? 92   ASN B CG  1 
ATOM   4088 O  OD1 . ASN C 1 92  ? -3.075  25.334 29.704  1.00 22.18  ? 92   ASN B OD1 1 
ATOM   4089 N  ND2 . ASN C 1 92  ? -1.758  23.572 29.312  1.00 23.60  ? 92   ASN B ND2 1 
ATOM   4090 N  N   . ASN C 1 93  ? -7.098  23.098 31.014  1.00 26.58  ? 93   ASN B N   1 
ATOM   4091 C  CA  . ASN C 1 93  ? -8.319  22.326 31.027  1.00 25.97  ? 93   ASN B CA  1 
ATOM   4092 C  C   . ASN C 1 93  ? -8.331  21.423 29.773  1.00 24.60  ? 93   ASN B C   1 
ATOM   4093 O  O   . ASN C 1 93  ? -8.419  21.897 28.664  1.00 24.55  ? 93   ASN B O   1 
ATOM   4094 C  CB  . ASN C 1 93  ? -9.525  23.294 31.074  1.00 27.26  ? 93   ASN B CB  1 
ATOM   4095 C  CG  . ASN C 1 93  ? -10.860 22.590 31.156  1.00 29.13  ? 93   ASN B CG  1 
ATOM   4096 O  OD1 . ASN C 1 93  ? -10.957 21.352 31.373  1.00 29.71  ? 93   ASN B OD1 1 
ATOM   4097 N  ND2 . ASN C 1 93  ? -11.918 23.380 31.021  1.00 28.67  ? 93   ASN B ND2 1 
ATOM   4098 N  N   . ILE C 1 94  ? -8.227  20.112 29.981  1.00 23.74  ? 94   ILE B N   1 
ATOM   4099 C  CA  . ILE C 1 94  ? -8.088  19.138 28.892  1.00 23.23  ? 94   ILE B CA  1 
ATOM   4100 C  C   . ILE C 1 94  ? -9.371  18.359 28.819  1.00 24.10  ? 94   ILE B C   1 
ATOM   4101 O  O   . ILE C 1 94  ? -10.014 18.038 29.856  1.00 24.52  ? 94   ILE B O   1 
ATOM   4102 C  CB  . ILE C 1 94  ? -6.845  18.242 29.089  1.00 22.51  ? 94   ILE B CB  1 
ATOM   4103 C  CG1 . ILE C 1 94  ? -5.556  19.111 29.103  1.00 25.05  ? 94   ILE B CG1 1 
ATOM   4104 C  CG2 . ILE C 1 94  ? -6.842  17.051 28.155  1.00 20.72  ? 94   ILE B CG2 1 
ATOM   4105 C  CD1 . ILE C 1 94  ? -5.192  19.978 27.790  1.00 23.28  ? 94   ILE B CD1 1 
ATOM   4106 N  N   . TYR C 1 95  ? -9.803  18.132 27.585  1.00 24.05  ? 95   TYR B N   1 
ATOM   4107 C  CA  . TYR C 1 95  ? -10.903 17.238 27.322  1.00 24.36  ? 95   TYR B CA  1 
ATOM   4108 C  C   . TYR C 1 95  ? -10.414 16.136 26.377  1.00 22.94  ? 95   TYR B C   1 
ATOM   4109 O  O   . TYR C 1 95  ? -9.951  16.428 25.282  1.00 23.01  ? 95   TYR B O   1 
ATOM   4110 C  CB  . TYR C 1 95  ? -12.054 18.041 26.730  1.00 26.50  ? 95   TYR B CB  1 
ATOM   4111 C  CG  . TYR C 1 95  ? -13.255 17.222 26.346  1.00 27.48  ? 95   TYR B CG  1 
ATOM   4112 C  CD1 . TYR C 1 95  ? -13.790 16.272 27.230  1.00 26.95  ? 95   TYR B CD1 1 
ATOM   4113 C  CD2 . TYR C 1 95  ? -13.866 17.403 25.114  1.00 32.24  ? 95   TYR B CD2 1 
ATOM   4114 C  CE1 . TYR C 1 95  ? -14.860 15.535 26.895  1.00 30.14  ? 95   TYR B CE1 1 
ATOM   4115 C  CE2 . TYR C 1 95  ? -14.975 16.676 24.758  1.00 31.05  ? 95   TYR B CE2 1 
ATOM   4116 C  CZ  . TYR C 1 95  ? -15.488 15.744 25.657  1.00 31.71  ? 95   TYR B CZ  1 
ATOM   4117 O  OH  . TYR C 1 95  ? -16.623 15.037 25.328  1.00 30.24  ? 95   TYR B OH  1 
ATOM   4118 N  N   . ALA C 1 96  ? -10.357 14.898 26.850  1.00 20.95  ? 96   ALA B N   1 
ATOM   4119 C  CA  . ALA C 1 96  ? -9.939  13.779 26.010  1.00 21.10  ? 96   ALA B CA  1 
ATOM   4120 C  C   . ALA C 1 96  ? -11.087 12.813 25.820  1.00 21.24  ? 96   ALA B C   1 
ATOM   4121 O  O   . ALA C 1 96  ? -11.672 12.387 26.802  1.00 21.76  ? 96   ALA B O   1 
ATOM   4122 C  CB  . ALA C 1 96  ? -8.782  13.066 26.618  1.00 20.04  ? 96   ALA B CB  1 
ATOM   4123 N  N   . THR C 1 97  ? -11.400 12.444 24.588  1.00 22.13  ? 97   THR B N   1 
ATOM   4124 C  CA  . THR C 1 97  ? -12.523 11.553 24.319  1.00 22.02  ? 97   THR B CA  1 
ATOM   4125 C  C   . THR C 1 97  ? -12.058 10.303 23.546  1.00 21.88  ? 97   THR B C   1 
ATOM   4126 O  O   . THR C 1 97  ? -11.156 10.364 22.708  1.00 20.91  ? 97   THR B O   1 
ATOM   4127 C  CB  . THR C 1 97  ? -13.713 12.178 23.477  1.00 23.54  ? 97   THR B CB  1 
ATOM   4128 O  OG1 . THR C 1 97  ? -13.180 12.756 22.278  1.00 25.63  ? 97   THR B OG1 1 
ATOM   4129 C  CG2 . THR C 1 97  ? -14.473 13.236 24.223  1.00 26.25  ? 97   THR B CG2 1 
ATOM   4130 N  N   . ALA C 1 98  ? -12.738 9.189  23.799  1.00 22.16  ? 98   ALA B N   1 
ATOM   4131 C  CA  . ALA C 1 98  ? -12.504 7.975  23.092  1.00 22.86  ? 98   ALA B CA  1 
ATOM   4132 C  C   . ALA C 1 98  ? -13.208 8.066  21.732  1.00 24.23  ? 98   ALA B C   1 
ATOM   4133 O  O   . ALA C 1 98  ? -14.424 8.336  21.628  1.00 26.52  ? 98   ALA B O   1 
ATOM   4134 C  CB  . ALA C 1 98  ? -12.952 6.762  23.924  1.00 22.64  ? 98   ALA B CB  1 
ATOM   4135 N  N   . MET C 1 99  ? -12.428 7.888  20.680  1.00 25.33  ? 99   MET B N   1 
ATOM   4136 C  CA  . MET C 1 99  ? -12.956 7.827  19.292  1.00 26.71  ? 99   MET B CA  1 
ATOM   4137 C  C   . MET C 1 99  ? -13.378 6.450  18.858  1.00 25.71  ? 99   MET B C   1 
ATOM   4138 O  O   . MET C 1 99  ? -14.042 6.305  17.813  1.00 24.15  ? 99   MET B O   1 
ATOM   4139 C  CB  . MET C 1 99  ? -11.933 8.332  18.315  1.00 26.28  ? 99   MET B CB  1 
ATOM   4140 C  CG  . MET C 1 99  ? -11.622 9.808  18.539  1.00 29.66  ? 99   MET B CG  1 
ATOM   4141 S  SD  . MET C 1 99  ? -10.278 10.331 17.437  1.00 30.14  ? 99   MET B SD  1 
ATOM   4142 C  CE  . MET C 1 99  ? -11.178 10.803 15.939  1.00 34.54  ? 99   MET B CE  1 
ATOM   4143 N  N   . GLU C 1 100 ? -12.988 5.439  19.624  1.00 25.30  ? 100  GLU B N   1 
ATOM   4144 C  CA  . GLU C 1 100 ? -13.479 4.098  19.410  1.00 26.66  ? 100  GLU B CA  1 
ATOM   4145 C  C   . GLU C 1 100 ? -13.383 3.404  20.753  1.00 25.31  ? 100  GLU B C   1 
ATOM   4146 O  O   . GLU C 1 100 ? -12.881 4.016  21.666  1.00 24.69  ? 100  GLU B O   1 
ATOM   4147 C  CB  . GLU C 1 100 ? -12.656 3.417  18.325  1.00 26.90  ? 100  GLU B CB  1 
ATOM   4148 C  CG  . GLU C 1 100 ? -11.247 3.264  18.689  1.00 29.14  ? 100  GLU B CG  1 
ATOM   4149 C  CD  . GLU C 1 100 ? -10.337 2.881  17.531  1.00 30.71  ? 100  GLU B CD  1 
ATOM   4150 O  OE1 . GLU C 1 100 ? -10.101 3.703  16.616  1.00 32.34  ? 100  GLU B OE1 1 
ATOM   4151 O  OE2 . GLU C 1 100 ? -9.831  1.739  17.568  1.00 38.37  ? 100  GLU B OE2 1 
ATOM   4152 N  N   . PRO C 1 101 ? -13.889 2.149  20.894  1.00 24.92  ? 101  PRO B N   1 
ATOM   4153 C  CA  . PRO C 1 101 ? -13.627 1.494  22.202  1.00 24.86  ? 101  PRO B CA  1 
ATOM   4154 C  C   . PRO C 1 101 ? -12.127 1.471  22.546  1.00 23.76  ? 101  PRO B C   1 
ATOM   4155 O  O   . PRO C 1 101 ? -11.316 1.105  21.731  1.00 23.11  ? 101  PRO B O   1 
ATOM   4156 C  CB  . PRO C 1 101 ? -14.188 0.069  22.052  1.00 23.75  ? 101  PRO B CB  1 
ATOM   4157 C  CG  . PRO C 1 101 ? -14.884 0.033  20.778  1.00 25.58  ? 101  PRO B CG  1 
ATOM   4158 C  CD  . PRO C 1 101 ? -14.708 1.299  20.014  1.00 24.59  ? 101  PRO B CD  1 
ATOM   4159 N  N   . THR C 1 102 ? -11.803 1.894  23.767  1.00 24.32  ? 102  THR B N   1 
ATOM   4160 C  CA  . THR C 1 102 ? -10.407 2.224  24.170  1.00 23.89  ? 102  THR B CA  1 
ATOM   4161 C  C   . THR C 1 102 ? -10.079 1.628  25.546  1.00 23.70  ? 102  THR B C   1 
ATOM   4162 O  O   . THR C 1 102 ? -10.839 1.756  26.479  1.00 25.45  ? 102  THR B O   1 
ATOM   4163 C  CB  . THR C 1 102 ? -10.184 3.746  24.144  1.00 24.45  ? 102  THR B CB  1 
ATOM   4164 O  OG1 . THR C 1 102 ? -10.240 4.173  22.787  1.00 22.99  ? 102  THR B OG1 1 
ATOM   4165 C  CG2 . THR C 1 102 ? -8.807  4.152  24.787  1.00 22.62  ? 102  THR B CG2 1 
ATOM   4166 N  N   . ARG C 1 103 ? -9.003  0.866  25.610  1.00 23.08  ? 103  ARG B N   1 
ATOM   4167 C  CA  . ARG C 1 103 ? -8.473  0.406  26.859  1.00 23.13  ? 103  ARG B CA  1 
ATOM   4168 C  C   . ARG C 1 103 ? -7.207  1.211  27.201  1.00 22.90  ? 103  ARG B C   1 
ATOM   4169 O  O   . ARG C 1 103 ? -6.316  1.389  26.390  1.00 22.49  ? 103  ARG B O   1 
ATOM   4170 C  CB  . ARG C 1 103 ? -8.213  -1.115 26.842  1.00 22.74  ? 103  ARG B CB  1 
ATOM   4171 C  CG  . ARG C 1 103 ? -7.525  -1.679 28.041  1.00 21.82  ? 103  ARG B CG  1 
ATOM   4172 C  CD  . ARG C 1 103 ? -7.729  -3.212 28.121  1.00 25.33  ? 103  ARG B CD  1 
ATOM   4173 N  NE  . ARG C 1 103 ? -9.116  -3.544 28.435  1.00 20.58  ? 103  ARG B NE  1 
ATOM   4174 C  CZ  . ARG C 1 103 ? -9.641  -4.757 28.455  1.00 28.20  ? 103  ARG B CZ  1 
ATOM   4175 N  NH1 . ARG C 1 103 ? -8.904  -5.830 28.220  1.00 27.69  ? 103  ARG B NH1 1 
ATOM   4176 N  NH2 . ARG C 1 103 ? -10.944 -4.893 28.729  1.00 28.93  ? 103  ARG B NH2 1 
ATOM   4177 N  N   . THR C 1 104 ? -7.204  1.722  28.410  1.00 22.12  ? 104  THR B N   1 
ATOM   4178 C  CA  . THR C 1 104 ? -6.135  2.505  28.975  1.00 21.51  ? 104  THR B CA  1 
ATOM   4179 C  C   . THR C 1 104 ? -5.609  1.874  30.271  1.00 22.01  ? 104  THR B C   1 
ATOM   4180 O  O   . THR C 1 104 ? -6.300  1.045  30.951  1.00 22.25  ? 104  THR B O   1 
ATOM   4181 C  CB  . THR C 1 104 ? -6.593  3.955  29.261  1.00 22.56  ? 104  THR B CB  1 
ATOM   4182 O  OG1 . THR C 1 104 ? -7.574  3.956  30.279  1.00 22.54  ? 104  THR B OG1 1 
ATOM   4183 C  CG2 . THR C 1 104 ? -7.131  4.657  27.972  1.00 17.37  ? 104  THR B CG2 1 
ATOM   4184 N  N   . CYS C 1 105 ? -4.398  2.280  30.629  1.00 22.89  ? 105  CYS B N   1 
ATOM   4185 C  CA  . CYS C 1 105 ? -3.791  1.916  31.895  1.00 21.73  ? 105  CYS B CA  1 
ATOM   4186 C  C   . CYS C 1 105 ? -3.295  3.179  32.514  1.00 21.92  ? 105  CYS B C   1 
ATOM   4187 O  O   . CYS C 1 105 ? -2.512  3.892  31.955  1.00 20.75  ? 105  CYS B O   1 
ATOM   4188 C  CB  . CYS C 1 105 ? -2.650  0.920  31.711  1.00 23.06  ? 105  CYS B CB  1 
ATOM   4189 S  SG  . CYS C 1 105 ? -1.951  0.356  33.269  1.00 25.10  ? 105  CYS B SG  1 
ATOM   4190 N  N   . TRP C 1 106 ? -3.820  3.492  33.684  1.00 23.39  ? 106  TRP B N   1 
ATOM   4191 C  CA  . TRP C 1 106 ? -3.510  4.716  34.381  1.00 22.97  ? 106  TRP B CA  1 
ATOM   4192 C  C   . TRP C 1 106 ? -2.435  4.421  35.426  1.00 22.18  ? 106  TRP B C   1 
ATOM   4193 O  O   . TRP C 1 106 ? -2.593  3.538  36.258  1.00 23.07  ? 106  TRP B O   1 
ATOM   4194 C  CB  . TRP C 1 106 ? -4.750  5.251  35.102  1.00 24.13  ? 106  TRP B CB  1 
ATOM   4195 C  CG  . TRP C 1 106 ? -5.814  5.754  34.078  1.00 23.71  ? 106  TRP B CG  1 
ATOM   4196 C  CD1 . TRP C 1 106 ? -6.330  5.060  33.000  1.00 24.79  ? 106  TRP B CD1 1 
ATOM   4197 C  CD2 . TRP C 1 106 ? -6.467  7.013  34.083  1.00 22.68  ? 106  TRP B CD2 1 
ATOM   4198 N  NE1 . TRP C 1 106 ? -7.260  5.833  32.353  1.00 24.95  ? 106  TRP B NE1 1 
ATOM   4199 C  CE2 . TRP C 1 106 ? -7.357  7.034  32.999  1.00 23.69  ? 106  TRP B CE2 1 
ATOM   4200 C  CE3 . TRP C 1 106 ? -6.441  8.132  34.954  1.00 23.54  ? 106  TRP B CE3 1 
ATOM   4201 C  CZ2 . TRP C 1 106 ? -8.184  8.146  32.736  1.00 25.19  ? 106  TRP B CZ2 1 
ATOM   4202 C  CZ3 . TRP C 1 106 ? -7.237  9.189  34.682  1.00 23.87  ? 106  TRP B CZ3 1 
ATOM   4203 C  CH2 . TRP C 1 106 ? -8.067  9.212  33.550  1.00 24.79  ? 106  TRP B CH2 1 
ATOM   4204 N  N   . PHE C 1 107 ? -1.369  5.214  35.366  1.00 21.13  ? 107  PHE B N   1 
ATOM   4205 C  CA  . PHE C 1 107 ? -0.215  5.048  36.235  1.00 21.95  ? 107  PHE B CA  1 
ATOM   4206 C  C   . PHE C 1 107 ? -0.053  6.287  37.099  1.00 22.12  ? 107  PHE B C   1 
ATOM   4207 O  O   . PHE C 1 107 ? 0.252   7.372  36.616  1.00 23.45  ? 107  PHE B O   1 
ATOM   4208 C  CB  . PHE C 1 107 ? 1.042   4.868  35.435  1.00 20.67  ? 107  PHE B CB  1 
ATOM   4209 C  CG  . PHE C 1 107 ? 1.133   3.589  34.629  1.00 20.27  ? 107  PHE B CG  1 
ATOM   4210 C  CD1 . PHE C 1 107 ? 1.625   2.412  35.212  1.00 22.54  ? 107  PHE B CD1 1 
ATOM   4211 C  CD2 . PHE C 1 107 ? 0.874   3.556  33.280  1.00 24.90  ? 107  PHE B CD2 1 
ATOM   4212 C  CE1 . PHE C 1 107 ? 1.819   1.248  34.497  1.00 22.09  ? 107  PHE B CE1 1 
ATOM   4213 C  CE2 . PHE C 1 107 ? 1.014   2.345  32.524  1.00 24.04  ? 107  PHE B CE2 1 
ATOM   4214 C  CZ  . PHE C 1 107 ? 1.516   1.172  33.144  1.00 22.65  ? 107  PHE B CZ  1 
ATOM   4215 N  N   . SER C 1 108 ? -0.319  6.106  38.387  1.00 22.63  ? 108  SER B N   1 
ATOM   4216 C  CA  . SER C 1 108 ? 0.027   7.087  39.423  1.00 22.53  ? 108  SER B CA  1 
ATOM   4217 C  C   . SER C 1 108 ? 1.516   7.254  39.568  1.00 23.56  ? 108  SER B C   1 
ATOM   4218 O  O   . SER C 1 108 ? 2.293   6.413  39.091  1.00 22.20  ? 108  SER B O   1 
ATOM   4219 C  CB  . SER C 1 108 ? -0.488  6.661  40.773  1.00 23.68  ? 108  SER B CB  1 
ATOM   4220 O  OG  . SER C 1 108 ? 0.148   5.484  41.295  1.00 19.96  ? 108  SER B OG  1 
ATOM   4221 N  N   . GLU C 1 109 ? 1.921   8.312  40.306  1.00 23.46  ? 109  GLU B N   1 
ATOM   4222 C  CA  . GLU C 1 109 ? 3.294   8.468  40.622  1.00 22.74  ? 109  GLU B CA  1 
ATOM   4223 C  C   . GLU C 1 109 ? 3.891   7.192  41.343  1.00 23.32  ? 109  GLU B C   1 
ATOM   4224 O  O   . GLU C 1 109 ? 4.988   6.669  40.975  1.00 19.67  ? 109  GLU B O   1 
ATOM   4225 C  CB  . GLU C 1 109 ? 3.525   9.743  41.394  1.00 22.03  ? 109  GLU B CB  1 
ATOM   4226 C  CG  . GLU C 1 109 ? 4.993   10.121 41.422  1.00 24.38  ? 109  GLU B CG  1 
ATOM   4227 C  CD  . GLU C 1 109 ? 5.302   11.276 42.402  1.00 24.94  ? 109  GLU B CD  1 
ATOM   4228 O  OE1 . GLU C 1 109 ? 5.399   12.470 42.023  1.00 30.27  ? 109  GLU B OE1 1 
ATOM   4229 O  OE2 . GLU C 1 109 ? 5.480   10.955 43.543  1.00 26.86  ? 109  GLU B OE2 1 
ATOM   4230 N  N   . LYS C 1 110 ? 3.195   6.740  42.388  1.00 21.86  ? 110  LYS B N   1 
ATOM   4231 C  CA  . LYS C 1 110 ? 3.603   5.552  43.103  1.00 24.44  ? 110  LYS B CA  1 
ATOM   4232 C  C   . LYS C 1 110 ? 3.735   4.311  42.203  1.00 22.73  ? 110  LYS B C   1 
ATOM   4233 O  O   . LYS C 1 110 ? 4.660   3.549  42.380  1.00 21.24  ? 110  LYS B O   1 
ATOM   4234 C  CB  . LYS C 1 110 ? 2.645   5.213  44.265  1.00 23.95  ? 110  LYS B CB  1 
ATOM   4235 C  CG  . LYS C 1 110 ? 3.132   4.143  45.141  1.00 27.61  ? 110  LYS B CG  1 
ATOM   4236 C  CD  . LYS C 1 110 ? 2.277   4.002  46.427  1.00 28.93  ? 110  LYS B CD  1 
ATOM   4237 C  CE  . LYS C 1 110 ? 2.791   2.866  47.373  1.00 34.81  ? 110  LYS B CE  1 
ATOM   4238 N  NZ  . LYS C 1 110 ? 2.634   1.502  46.829  1.00 40.60  ? 110  LYS B NZ  1 
ATOM   4239 N  N   . SER C 1 111 ? 2.819   4.116  41.259  1.00 21.62  ? 111  SER B N   1 
ATOM   4240 C  CA  . SER C 1 111 ? 2.904   2.960  40.423  1.00 21.73  ? 111  SER B CA  1 
ATOM   4241 C  C   . SER C 1 111 ? 4.096   3.041  39.433  1.00 20.44  ? 111  SER B C   1 
ATOM   4242 O  O   . SER C 1 111 ? 4.781   2.046  39.163  1.00 18.79  ? 111  SER B O   1 
ATOM   4243 C  CB  . SER C 1 111 ? 1.531   2.730  39.756  1.00 21.70  ? 111  SER B CB  1 
ATOM   4244 O  OG  . SER C 1 111 ? 1.464   3.502  38.590  1.00 28.60  ? 111  SER B OG  1 
ATOM   4245 N  N   . LEU C 1 112 ? 4.314   4.240  38.902  1.00 20.74  ? 112  LEU B N   1 
ATOM   4246 C  CA  . LEU C 1 112 ? 5.513   4.575  38.170  1.00 20.78  ? 112  LEU B CA  1 
ATOM   4247 C  C   . LEU C 1 112 ? 6.859   4.293  38.912  1.00 21.25  ? 112  LEU B C   1 
ATOM   4248 O  O   . LEU C 1 112 ? 7.783   3.777  38.303  1.00 20.63  ? 112  LEU B O   1 
ATOM   4249 C  CB  . LEU C 1 112 ? 5.460   6.002  37.626  1.00 19.51  ? 112  LEU B CB  1 
ATOM   4250 C  CG  . LEU C 1 112 ? 4.427   6.254  36.503  1.00 20.58  ? 112  LEU B CG  1 
ATOM   4251 C  CD1 . LEU C 1 112 ? 4.333   7.781  36.047  1.00 21.88  ? 112  LEU B CD1 1 
ATOM   4252 C  CD2 . LEU C 1 112 ? 4.715   5.330  35.286  1.00 22.56  ? 112  LEU B CD2 1 
ATOM   4253 N  N   . ARG C 1 113 ? 6.961   4.647  40.169  1.00 20.08  ? 113  ARG B N   1 
ATOM   4254 C  CA  . ARG C 1 113 ? 8.102   4.211  40.997  1.00 21.74  ? 113  ARG B CA  1 
ATOM   4255 C  C   . ARG C 1 113 ? 8.360   2.698  40.912  1.00 22.19  ? 113  ARG B C   1 
ATOM   4256 O  O   . ARG C 1 113 ? 9.483   2.301  40.659  1.00 20.80  ? 113  ARG B O   1 
ATOM   4257 C  CB  . ARG C 1 113 ? 7.983   4.655  42.423  1.00 21.91  ? 113  ARG B CB  1 
ATOM   4258 C  CG  . ARG C 1 113 ? 7.920   6.212  42.596  1.00 21.38  ? 113  ARG B CG  1 
ATOM   4259 C  CD  . ARG C 1 113 ? 7.785   6.614  44.090  1.00 21.95  ? 113  ARG B CD  1 
ATOM   4260 N  NE  . ARG C 1 113 ? 7.708   8.088  44.209  1.00 21.07  ? 113  ARG B NE  1 
ATOM   4261 C  CZ  . ARG C 1 113 ? 8.759   8.898  44.199  1.00 21.94  ? 113  ARG B CZ  1 
ATOM   4262 N  NH1 . ARG C 1 113 ? 10.031  8.450  44.132  1.00 23.84  ? 113  ARG B NH1 1 
ATOM   4263 N  NH2 . ARG C 1 113 ? 8.569   10.201 44.274  1.00 21.41  ? 113  ARG B NH2 1 
ATOM   4264 N  N   . THR C 1 114 ? 7.301   1.901  41.026  1.00 21.33  ? 114  THR B N   1 
ATOM   4265 C  CA  . THR C 1 114 ? 7.405   0.461  40.887  1.00 23.17  ? 114  THR B CA  1 
ATOM   4266 C  C   . THR C 1 114 ? 7.842   0.001  39.490  1.00 21.22  ? 114  THR B C   1 
ATOM   4267 O  O   . THR C 1 114 ? 8.707   -0.901 39.384  1.00 20.76  ? 114  THR B O   1 
ATOM   4268 C  CB  . THR C 1 114 ? 6.129   -0.268 41.348  1.00 21.71  ? 114  THR B CB  1 
ATOM   4269 O  OG1 . THR C 1 114 ? 5.738   0.249  42.634  1.00 26.89  ? 114  THR B OG1 1 
ATOM   4270 C  CG2 . THR C 1 114 ? 6.352   -1.781 41.498  1.00 23.74  ? 114  THR B CG2 1 
ATOM   4271 N  N   . VAL C 1 115 ? 7.320   0.659  38.471  1.00 21.54  ? 115  VAL B N   1 
ATOM   4272 C  CA  . VAL C 1 115 ? 7.786   0.463  37.092  1.00 21.01  ? 115  VAL B CA  1 
ATOM   4273 C  C   . VAL C 1 115 ? 9.324   0.680  36.953  1.00 20.38  ? 115  VAL B C   1 
ATOM   4274 O  O   . VAL C 1 115 ? 10.026  -0.155 36.407  1.00 20.59  ? 115  VAL B O   1 
ATOM   4275 C  CB  . VAL C 1 115 ? 7.025   1.324  36.037  1.00 20.75  ? 115  VAL B CB  1 
ATOM   4276 C  CG1 . VAL C 1 115 ? 7.659   1.120  34.628  1.00 20.04  ? 115  VAL B CG1 1 
ATOM   4277 C  CG2 . VAL C 1 115 ? 5.511   1.002  36.008  1.00 18.30  ? 115  VAL B CG2 1 
ATOM   4278 N  N   . PHE C 1 116 ? 9.817   1.827  37.386  1.00 20.33  ? 116  PHE B N   1 
ATOM   4279 C  CA  . PHE C 1 116 ? 11.202  2.208  37.207  1.00 20.91  ? 116  PHE B CA  1 
ATOM   4280 C  C   . PHE C 1 116 ? 12.119  1.360  38.057  1.00 21.68  ? 116  PHE B C   1 
ATOM   4281 O  O   . PHE C 1 116 ? 13.256  1.114  37.645  1.00 20.10  ? 116  PHE B O   1 
ATOM   4282 C  CB  . PHE C 1 116 ? 11.468  3.693  37.542  1.00 20.43  ? 116  PHE B CB  1 
ATOM   4283 C  CG  . PHE C 1 116 ? 10.575  4.624  36.793  1.00 19.67  ? 116  PHE B CG  1 
ATOM   4284 C  CD1 . PHE C 1 116 ? 10.149  4.272  35.524  1.00 19.06  ? 116  PHE B CD1 1 
ATOM   4285 C  CD2 . PHE C 1 116 ? 10.110  5.834  37.374  1.00 21.20  ? 116  PHE B CD2 1 
ATOM   4286 C  CE1 . PHE C 1 116 ? 9.332   5.035  34.793  1.00 18.66  ? 116  PHE B CE1 1 
ATOM   4287 C  CE2 . PHE C 1 116 ? 9.257   6.659  36.635  1.00 18.50  ? 116  PHE B CE2 1 
ATOM   4288 C  CZ  . PHE C 1 116 ? 8.812   6.206  35.353  1.00 21.75  ? 116  PHE B CZ  1 
ATOM   4289 N  N   . ARG C 1 117 ? 11.639  0.942  39.232  1.00 21.07  ? 117  ARG B N   1 
ATOM   4290 C  CA  . ARG C 1 117 ? 12.395  -0.026 40.067  1.00 20.56  ? 117  ARG B CA  1 
ATOM   4291 C  C   . ARG C 1 117 ? 12.598  -1.383 39.435  1.00 20.67  ? 117  ARG B C   1 
ATOM   4292 O  O   . ARG C 1 117 ? 13.493  -2.074 39.822  1.00 20.73  ? 117  ARG B O   1 
ATOM   4293 C  CB  . ARG C 1 117 ? 11.727  -0.215 41.423  1.00 20.31  ? 117  ARG B CB  1 
ATOM   4294 C  CG  . ARG C 1 117 ? 11.853  1.028  42.297  1.00 21.10  ? 117  ARG B CG  1 
ATOM   4295 C  CD  . ARG C 1 117 ? 10.930  1.029  43.508  1.00 21.59  ? 117  ARG B CD  1 
ATOM   4296 N  NE  . ARG C 1 117 ? 10.754  2.366  44.101  1.00 22.24  ? 117  ARG B NE  1 
ATOM   4297 C  CZ  . ARG C 1 117 ? 9.975   2.579  45.151  1.00 25.61  ? 117  ARG B CZ  1 
ATOM   4298 N  NH1 . ARG C 1 117 ? 9.360   1.557  45.733  1.00 23.93  ? 117  ARG B NH1 1 
ATOM   4299 N  NH2 . ARG C 1 117 ? 9.861   3.790  45.644  1.00 23.54  ? 117  ARG B NH2 1 
ATOM   4300 N  N   . THR C 1 118 ? 11.674  -1.778 38.565  1.00 20.22  ? 118  THR B N   1 
ATOM   4301 C  CA  . THR C 1 118 ? 11.732  -3.019 37.789  1.00 19.63  ? 118  THR B CA  1 
ATOM   4302 C  C   . THR C 1 118 ? 12.555  -2.867 36.487  1.00 17.73  ? 118  THR B C   1 
ATOM   4303 O  O   . THR C 1 118 ? 13.327  -3.769 36.110  1.00 15.82  ? 118  THR B O   1 
ATOM   4304 C  CB  . THR C 1 118 ? 10.293  -3.473 37.410  1.00 18.94  ? 118  THR B CB  1 
ATOM   4305 O  OG1 . THR C 1 118 ? 9.466   -3.449 38.583  1.00 21.48  ? 118  THR B OG1 1 
ATOM   4306 C  CG2 . THR C 1 118 ? 10.280  -4.821 36.772  1.00 19.63  ? 118  THR B CG2 1 
ATOM   4307 N  N   . ASP C 1 119 ? 12.366  -1.736 35.831  1.00 18.03  ? 119  ASP B N   1 
ATOM   4308 C  CA  . ASP C 1 119 ? 12.969  -1.504 34.538  1.00 19.02  ? 119  ASP B CA  1 
ATOM   4309 C  C   . ASP C 1 119 ? 13.330  -0.029 34.356  1.00 19.07  ? 119  ASP B C   1 
ATOM   4310 O  O   . ASP C 1 119 ? 12.524  0.774  34.024  1.00 16.61  ? 119  ASP B O   1 
ATOM   4311 C  CB  . ASP C 1 119 ? 11.993  -1.989 33.463  1.00 20.83  ? 119  ASP B CB  1 
ATOM   4312 C  CG  . ASP C 1 119 ? 12.670  -2.325 32.186  1.00 23.37  ? 119  ASP B CG  1 
ATOM   4313 O  OD1 . ASP C 1 119 ? 13.390  -3.372 32.158  1.00 23.19  ? 119  ASP B OD1 1 
ATOM   4314 O  OD2 . ASP C 1 119 ? 12.480  -1.520 31.254  1.00 26.49  ? 119  ASP B OD2 1 
ATOM   4315 N  N   . GLU C 1 120 ? 14.610  0.277  34.593  1.00 20.63  ? 120  GLU B N   1 
ATOM   4316 C  CA  . GLU C 1 120 ? 15.143  1.629  34.583  1.00 21.16  ? 120  GLU B CA  1 
ATOM   4317 C  C   . GLU C 1 120 ? 15.025  2.259  33.178  1.00 21.28  ? 120  GLU B C   1 
ATOM   4318 O  O   . GLU C 1 120 ? 14.757  3.448  33.064  1.00 20.20  ? 120  GLU B O   1 
ATOM   4319 C  CB  . GLU C 1 120 ? 16.578  1.569  35.053  1.00 22.29  ? 120  GLU B CB  1 
ATOM   4320 C  CG  . GLU C 1 120 ? 17.457  2.716  34.729  1.00 26.51  ? 120  GLU B CG  1 
ATOM   4321 C  CD  . GLU C 1 120 ? 18.887  2.384  35.087  1.00 23.34  ? 120  GLU B CD  1 
ATOM   4322 O  OE1 . GLU C 1 120 ? 19.636  1.854  34.269  1.00 25.09  ? 120  GLU B OE1 1 
ATOM   4323 O  OE2 . GLU C 1 120 ? 19.219  2.590  36.242  1.00 24.44  ? 120  GLU B OE2 1 
ATOM   4324 N  N   . ASP C 1 121 ? 15.053  1.434  32.129  1.00 20.83  ? 121  ASP B N   1 
ATOM   4325 C  CA  . ASP C 1 121 ? 14.862  1.916  30.783  1.00 21.26  ? 121  ASP B CA  1 
ATOM   4326 C  C   . ASP C 1 121 ? 13.538  2.625  30.504  1.00 21.88  ? 121  ASP B C   1 
ATOM   4327 O  O   . ASP C 1 121 ? 13.465  3.440  29.538  1.00 21.26  ? 121  ASP B O   1 
ATOM   4328 C  CB  . ASP C 1 121 ? 15.113  0.784  29.769  1.00 22.51  ? 121  ASP B CB  1 
ATOM   4329 C  CG  . ASP C 1 121 ? 16.615  0.485  29.571  1.00 27.51  ? 121  ASP B CG  1 
ATOM   4330 O  OD1 . ASP C 1 121 ? 17.496  1.254  30.014  1.00 30.31  ? 121  ASP B OD1 1 
ATOM   4331 O  OD2 . ASP C 1 121 ? 16.930  -0.547 28.940  1.00 33.11  ? 121  ASP B OD2 1 
ATOM   4332 N  N   . MET C 1 122 ? 12.467  2.268  31.250  1.00 20.80  ? 122  MET B N   1 
ATOM   4333 C  CA  . MET C 1 122 ? 11.183  2.915  31.078  1.00 20.51  ? 122  MET B CA  1 
ATOM   4334 C  C   . MET C 1 122 ? 11.245  4.419  31.352  1.00 19.28  ? 122  MET B C   1 
ATOM   4335 O  O   . MET C 1 122 ? 10.491  5.221  30.774  1.00 20.39  ? 122  MET B O   1 
ATOM   4336 C  CB  . MET C 1 122 ? 10.061  2.218  31.880  1.00 19.11  ? 122  MET B CB  1 
ATOM   4337 C  CG  . MET C 1 122 ? 9.655   0.822  31.338  1.00 22.18  ? 122  MET B CG  1 
ATOM   4338 S  SD  . MET C 1 122 ? 9.132   0.872  29.609  1.00 25.36  ? 122  MET B SD  1 
ATOM   4339 C  CE  . MET C 1 122 ? 10.565  0.288  28.845  1.00 24.87  ? 122  MET B CE  1 
ATOM   4340 N  N   . ILE C 1 123 ? 12.124  4.799  32.240  1.00 20.61  ? 123  ILE B N   1 
ATOM   4341 C  CA  . ILE C 1 123 ? 12.378  6.210  32.558  1.00 20.28  ? 123  ILE B CA  1 
ATOM   4342 C  C   . ILE C 1 123 ? 12.652  6.950  31.244  1.00 19.75  ? 123  ILE B C   1 
ATOM   4343 O  O   . ILE C 1 123 ? 12.098  8.043  30.974  1.00 17.95  ? 123  ILE B O   1 
ATOM   4344 C  CB  . ILE C 1 123 ? 13.588  6.436  33.532  1.00 20.68  ? 123  ILE B CB  1 
ATOM   4345 C  CG1 . ILE C 1 123 ? 13.383  5.716  34.906  1.00 21.19  ? 123  ILE B CG1 1 
ATOM   4346 C  CG2 . ILE C 1 123 ? 13.852  8.030  33.715  1.00 18.75  ? 123  ILE B CG2 1 
ATOM   4347 C  CD1 . ILE C 1 123 ? 14.693  5.635  35.784  1.00 21.09  ? 123  ILE B CD1 1 
ATOM   4348 N  N   . PHE C 1 124 ? 13.587  6.397  30.485  1.00 19.43  ? 124  PHE B N   1 
ATOM   4349 C  CA  . PHE C 1 124 ? 14.176  7.104  29.335  1.00 20.44  ? 124  PHE B CA  1 
ATOM   4350 C  C   . PHE C 1 124 ? 13.258  7.066  28.147  1.00 19.80  ? 124  PHE B C   1 
ATOM   4351 O  O   . PHE C 1 124 ? 13.221  8.013  27.385  1.00 19.42  ? 124  PHE B O   1 
ATOM   4352 C  CB  . PHE C 1 124 ? 15.567  6.550  29.015  1.00 22.31  ? 124  PHE B CB  1 
ATOM   4353 C  CG  . PHE C 1 124 ? 16.527  6.812  30.079  1.00 18.96  ? 124  PHE B CG  1 
ATOM   4354 C  CD1 . PHE C 1 124 ? 17.088  8.097  30.193  1.00 19.86  ? 124  PHE B CD1 1 
ATOM   4355 C  CD2 . PHE C 1 124 ? 16.808  5.848  31.037  1.00 22.46  ? 124  PHE B CD2 1 
ATOM   4356 C  CE1 . PHE C 1 124 ? 17.932  8.407  31.204  1.00 18.34  ? 124  PHE B CE1 1 
ATOM   4357 C  CE2 . PHE C 1 124 ? 17.675  6.145  32.132  1.00 21.23  ? 124  PHE B CE2 1 
ATOM   4358 C  CZ  . PHE C 1 124 ? 18.256  7.424  32.195  1.00 19.46  ? 124  PHE B CZ  1 
ATOM   4359 N  N   . GLU C 1 125 ? 12.407  6.056  28.072  1.00 19.92  ? 125  GLU B N   1 
ATOM   4360 C  CA  . GLU C 1 125 ? 11.350  6.046  27.030  1.00 18.55  ? 125  GLU B CA  1 
ATOM   4361 C  C   . GLU C 1 125 ? 10.306  7.154  27.285  1.00 20.01  ? 125  GLU B C   1 
ATOM   4362 O  O   . GLU C 1 125 ? 9.859   7.849  26.345  1.00 21.72  ? 125  GLU B O   1 
ATOM   4363 C  CB  . GLU C 1 125 ? 10.697  4.660  26.967  1.00 18.92  ? 125  GLU B CB  1 
ATOM   4364 C  CG  . GLU C 1 125 ? 11.574  3.496  26.431  1.00 19.60  ? 125  GLU B CG  1 
ATOM   4365 C  CD  . GLU C 1 125 ? 12.413  3.869  25.168  1.00 24.76  ? 125  GLU B CD  1 
ATOM   4366 O  OE1 . GLU C 1 125 ? 11.769  4.070  24.128  1.00 23.87  ? 125  GLU B OE1 1 
ATOM   4367 O  OE2 . GLU C 1 125 ? 13.665  4.084  25.259  1.00 26.93  ? 125  GLU B OE2 1 
ATOM   4368 N  N   . ILE C 1 126 ? 9.958   7.366  28.545  1.00 18.39  ? 126  ILE B N   1 
ATOM   4369 C  CA  . ILE C 1 126 ? 9.066   8.447  28.913  1.00 21.00  ? 126  ILE B CA  1 
ATOM   4370 C  C   . ILE C 1 126 ? 9.734   9.851  28.706  1.00 19.12  ? 126  ILE B C   1 
ATOM   4371 O  O   . ILE C 1 126 ? 9.107   10.734 28.249  1.00 21.46  ? 126  ILE B O   1 
ATOM   4372 C  CB  . ILE C 1 126 ? 8.474   8.281  30.320  1.00 19.83  ? 126  ILE B CB  1 
ATOM   4373 C  CG1 . ILE C 1 126 ? 7.677   6.957  30.410  1.00 23.08  ? 126  ILE B CG1 1 
ATOM   4374 C  CG2 . ILE C 1 126 ? 7.602   9.583  30.729  1.00 20.16  ? 126  ILE B CG2 1 
ATOM   4375 C  CD1 . ILE C 1 126 ? 7.248   6.593  31.842  1.00 21.59  ? 126  ILE B CD1 1 
ATOM   4376 N  N   . PHE C 1 127 ? 10.987  10.015 28.990  1.00 20.85  ? 127  PHE B N   1 
ATOM   4377 C  CA  . PHE C 1 127 ? 11.696  11.254 28.622  1.00 21.28  ? 127  PHE B CA  1 
ATOM   4378 C  C   . PHE C 1 127 ? 11.607  11.510 27.094  1.00 21.60  ? 127  PHE B C   1 
ATOM   4379 O  O   . PHE C 1 127 ? 11.308  12.607 26.707  1.00 22.72  ? 127  PHE B O   1 
ATOM   4380 C  CB  . PHE C 1 127 ? 13.173  11.254 28.964  1.00 20.35  ? 127  PHE B CB  1 
ATOM   4381 C  CG  . PHE C 1 127 ? 13.525  11.353 30.419  1.00 21.17  ? 127  PHE B CG  1 
ATOM   4382 C  CD1 . PHE C 1 127 ? 12.650  11.834 31.405  1.00 22.95  ? 127  PHE B CD1 1 
ATOM   4383 C  CD2 . PHE C 1 127 ? 14.780  10.967 30.815  1.00 22.54  ? 127  PHE B CD2 1 
ATOM   4384 C  CE1 . PHE C 1 127 ? 12.967  11.804 32.679  1.00 20.08  ? 127  PHE B CE1 1 
ATOM   4385 C  CE2 . PHE C 1 127 ? 15.143  11.081 32.175  1.00 22.56  ? 127  PHE B CE2 1 
ATOM   4386 C  CZ  . PHE C 1 127 ? 14.245  11.514 33.075  1.00 17.70  ? 127  PHE B CZ  1 
ATOM   4387 N  N   . LYS C 1 128 ? 11.862  10.503 26.277  1.00 21.31  ? 128  LYS B N   1 
ATOM   4388 C  CA  . LYS C 1 128 ? 11.691  10.547 24.802  1.00 21.06  ? 128  LYS B CA  1 
ATOM   4389 C  C   . LYS C 1 128 ? 10.282  11.040 24.371  1.00 21.02  ? 128  LYS B C   1 
ATOM   4390 O  O   . LYS C 1 128 ? 10.160  11.937 23.484  1.00 21.22  ? 128  LYS B O   1 
ATOM   4391 C  CB  . LYS C 1 128 ? 12.089  9.263  24.069  1.00 19.48  ? 128  LYS B CB  1 
ATOM   4392 C  CG  . LYS C 1 128 ? 13.556  8.875  24.184  1.00 21.34  ? 128  LYS B CG  1 
ATOM   4393 C  CD  . LYS C 1 128 ? 13.822  7.430  23.844  1.00 20.39  ? 128  LYS B CD  1 
ATOM   4394 C  CE  . LYS C 1 128 ? 15.219  6.968  24.245  1.00 22.31  ? 128  LYS B CE  1 
ATOM   4395 N  NZ  . LYS C 1 128 ? 15.414  5.562  23.915  1.00 23.80  ? 128  LYS B NZ  1 
ATOM   4396 N  N   . ASN C 1 129 ? 9.251   10.493 25.016  1.00 22.21  ? 129  ASN B N   1 
ATOM   4397 C  CA  . ASN C 1 129 ? 7.897   10.855 24.766  1.00 22.08  ? 129  ASN B CA  1 
ATOM   4398 C  C   . ASN C 1 129 ? 7.633   12.327 25.109  1.00 22.18  ? 129  ASN B C   1 
ATOM   4399 O  O   . ASN C 1 129 ? 7.081   13.056 24.267  1.00 22.71  ? 129  ASN B O   1 
ATOM   4400 C  CB  . ASN C 1 129 ? 6.923   9.830  25.457  1.00 24.04  ? 129  ASN B CB  1 
ATOM   4401 C  CG  . ASN C 1 129 ? 5.481   10.113 25.165  1.00 21.91  ? 129  ASN B CG  1 
ATOM   4402 O  OD1 . ASN C 1 129 ? 4.875   10.933 25.826  1.00 22.66  ? 129  ASN B OD1 1 
ATOM   4403 N  ND2 . ASN C 1 129 ? 4.950   9.470  24.164  1.00 25.09  ? 129  ASN B ND2 1 
ATOM   4404 N  N   . TYR C 1 130 ? 8.077   12.789 26.287  1.00 20.84  ? 130  TYR B N   1 
ATOM   4405 C  CA  . TYR C 1 130 ? 7.959   14.167 26.657  1.00 21.67  ? 130  TYR B CA  1 
ATOM   4406 C  C   . TYR C 1 130 ? 8.699   15.107 25.719  1.00 22.03  ? 130  TYR B C   1 
ATOM   4407 O  O   . TYR C 1 130 ? 8.199   16.156 25.314  1.00 23.00  ? 130  TYR B O   1 
ATOM   4408 C  CB  . TYR C 1 130 ? 8.469   14.460 28.069  1.00 21.11  ? 130  TYR B CB  1 
ATOM   4409 C  CG  . TYR C 1 130 ? 7.484   14.257 29.178  1.00 23.28  ? 130  TYR B CG  1 
ATOM   4410 C  CD1 . TYR C 1 130 ? 6.364   15.022 29.268  1.00 22.29  ? 130  TYR B CD1 1 
ATOM   4411 C  CD2 . TYR C 1 130 ? 7.734   13.337 30.190  1.00 21.86  ? 130  TYR B CD2 1 
ATOM   4412 C  CE1 . TYR C 1 130 ? 5.444   14.855 30.344  1.00 19.60  ? 130  TYR B CE1 1 
ATOM   4413 C  CE2 . TYR C 1 130 ? 6.866   13.182 31.228  1.00 22.06  ? 130  TYR B CE2 1 
ATOM   4414 C  CZ  . TYR C 1 130 ? 5.698   13.901 31.287  1.00 20.86  ? 130  TYR B CZ  1 
ATOM   4415 O  OH  . TYR C 1 130 ? 4.880   13.748 32.384  1.00 22.51  ? 130  TYR B OH  1 
ATOM   4416 N  N   . LEU C 1 131 ? 9.904   14.721 25.389  1.00 21.66  ? 131  LEU B N   1 
ATOM   4417 C  CA  . LEU C 1 131 ? 10.767  15.540 24.538  1.00 21.50  ? 131  LEU B CA  1 
ATOM   4418 C  C   . LEU C 1 131 ? 10.194  15.711 23.127  1.00 20.94  ? 131  LEU B C   1 
ATOM   4419 O  O   . LEU C 1 131 ? 10.245  16.825 22.517  1.00 21.50  ? 131  LEU B O   1 
ATOM   4420 C  CB  . LEU C 1 131 ? 12.224  14.986 24.572  1.00 21.15  ? 131  LEU B CB  1 
ATOM   4421 C  CG  . LEU C 1 131 ? 13.228  15.658 23.659  1.00 20.14  ? 131  LEU B CG  1 
ATOM   4422 C  CD1 . LEU C 1 131 ? 13.413  17.231 24.003  1.00 18.04  ? 131  LEU B CD1 1 
ATOM   4423 C  CD2 . LEU C 1 131 ? 14.586  14.875 23.629  1.00 19.77  ? 131  LEU B CD2 1 
ATOM   4424 N  N   . THR C 1 132 ? 9.611   14.633 22.625  1.00 21.68  ? 132  THR B N   1 
ATOM   4425 C  CA  . THR C 1 132 ? 8.934   14.651 21.341  1.00 19.62  ? 132  THR B CA  1 
ATOM   4426 C  C   . THR C 1 132 ? 7.912   15.734 21.348  1.00 20.43  ? 132  THR B C   1 
ATOM   4427 O  O   . THR C 1 132 ? 7.857   16.527 20.441  1.00 19.14  ? 132  THR B O   1 
ATOM   4428 C  CB  . THR C 1 132 ? 8.353   13.271 20.985  1.00 20.15  ? 132  THR B CB  1 
ATOM   4429 O  OG1 . THR C 1 132 ? 9.440   12.333 20.854  1.00 21.50  ? 132  THR B OG1 1 
ATOM   4430 C  CG2 . THR C 1 132 ? 7.607   13.295 19.649  1.00 18.95  ? 132  THR B CG2 1 
ATOM   4431 N  N   . LYS C 1 133 ? 7.110   15.782 22.420  1.00 21.59  ? 133  LYS B N   1 
ATOM   4432 C  CA  . LYS C 1 133 ? 5.993   16.709 22.531  1.00 22.42  ? 133  LYS B CA  1 
ATOM   4433 C  C   . LYS C 1 133 ? 6.495   18.158 22.661  1.00 21.54  ? 133  LYS B C   1 
ATOM   4434 O  O   . LYS C 1 133 ? 5.986   19.075 21.989  1.00 21.83  ? 133  LYS B O   1 
ATOM   4435 C  CB  . LYS C 1 133 ? 5.104   16.296 23.749  1.00 21.08  ? 133  LYS B CB  1 
ATOM   4436 C  CG  . LYS C 1 133 ? 4.326   15.005 23.536  1.00 22.44  ? 133  LYS B CG  1 
ATOM   4437 C  CD  . LYS C 1 133 ? 3.719   14.590 24.859  1.00 23.52  ? 133  LYS B CD  1 
ATOM   4438 C  CE  . LYS C 1 133 ? 2.989   13.227 24.754  1.00 21.43  ? 133  LYS B CE  1 
ATOM   4439 N  NZ  . LYS C 1 133 ? 2.476   12.748 26.118  1.00 18.17  ? 133  LYS B NZ  1 
ATOM   4440 N  N   . VAL C 1 134 ? 7.526   18.360 23.490  1.00 20.88  ? 134  VAL B N   1 
ATOM   4441 C  CA  . VAL C 1 134 ? 8.064   19.724 23.633  1.00 20.61  ? 134  VAL B CA  1 
ATOM   4442 C  C   . VAL C 1 134 ? 8.548   20.251 22.275  1.00 20.89  ? 134  VAL B C   1 
ATOM   4443 O  O   . VAL C 1 134 ? 8.236   21.408 21.881  1.00 22.15  ? 134  VAL B O   1 
ATOM   4444 C  CB  . VAL C 1 134 ? 9.244   19.827 24.670  1.00 18.58  ? 134  VAL B CB  1 
ATOM   4445 C  CG1 . VAL C 1 134 ? 9.840   21.234 24.637  1.00 19.25  ? 134  VAL B CG1 1 
ATOM   4446 C  CG2 . VAL C 1 134 ? 8.841   19.327 26.112  1.00 19.44  ? 134  VAL B CG2 1 
ATOM   4447 N  N   . ALA C 1 135 ? 9.361   19.439 21.596  1.00 20.11  ? 135  ALA B N   1 
ATOM   4448 C  CA  . ALA C 1 135 ? 9.996   19.787 20.314  1.00 20.38  ? 135  ALA B CA  1 
ATOM   4449 C  C   . ALA C 1 135 ? 8.952   20.087 19.254  1.00 20.10  ? 135  ALA B C   1 
ATOM   4450 O  O   . ALA C 1 135 ? 9.114   21.002 18.479  1.00 19.20  ? 135  ALA B O   1 
ATOM   4451 C  CB  . ALA C 1 135 ? 11.040  18.595 19.804  1.00 19.03  ? 135  ALA B CB  1 
ATOM   4452 N  N   . TYR C 1 136 ? 7.873   19.311 19.246  1.00 19.26  ? 136  TYR B N   1 
ATOM   4453 C  CA  . TYR C 1 136 ? 6.777   19.477 18.310  1.00 19.73  ? 136  TYR B CA  1 
ATOM   4454 C  C   . TYR C 1 136 ? 6.030   20.823 18.552  1.00 20.10  ? 136  TYR B C   1 
ATOM   4455 O  O   . TYR C 1 136 ? 5.958   21.672 17.683  1.00 18.65  ? 136  TYR B O   1 
ATOM   4456 C  CB  . TYR C 1 136 ? 5.781   18.290 18.397  1.00 20.25  ? 136  TYR B CB  1 
ATOM   4457 C  CG  . TYR C 1 136 ? 4.625   18.597 17.471  1.00 20.07  ? 136  TYR B CG  1 
ATOM   4458 C  CD1 . TYR C 1 136 ? 4.746   18.398 16.140  1.00 23.60  ? 136  TYR B CD1 1 
ATOM   4459 C  CD2 . TYR C 1 136 ? 3.496   19.276 17.938  1.00 21.17  ? 136  TYR B CD2 1 
ATOM   4460 C  CE1 . TYR C 1 136 ? 3.731   18.814 15.248  1.00 26.13  ? 136  TYR B CE1 1 
ATOM   4461 C  CE2 . TYR C 1 136 ? 2.503   19.704 17.092  1.00 21.60  ? 136  TYR B CE2 1 
ATOM   4462 C  CZ  . TYR C 1 136 ? 2.602   19.426 15.737  1.00 21.25  ? 136  TYR B CZ  1 
ATOM   4463 O  OH  . TYR C 1 136 ? 1.671   19.845 14.880  1.00 20.69  ? 136  TYR B OH  1 
ATOM   4464 N  N   . TYR C 1 137 ? 5.616   21.093 19.785  1.00 21.02  ? 137  TYR B N   1 
ATOM   4465 C  CA  . TYR C 1 137 ? 4.797   22.310 20.074  1.00 19.34  ? 137  TYR B CA  1 
ATOM   4466 C  C   . TYR C 1 137 ? 5.625   23.615 20.037  1.00 19.99  ? 137  TYR B C   1 
ATOM   4467 O  O   . TYR C 1 137 ? 5.138   24.618 19.586  1.00 18.54  ? 137  TYR B O   1 
ATOM   4468 C  CB  . TYR C 1 137 ? 4.041   22.169 21.410  1.00 19.48  ? 137  TYR B CB  1 
ATOM   4469 C  CG  . TYR C 1 137 ? 2.945   21.192 21.327  1.00 24.09  ? 137  TYR B CG  1 
ATOM   4470 C  CD1 . TYR C 1 137 ? 1.808   21.464 20.587  1.00 20.05  ? 137  TYR B CD1 1 
ATOM   4471 C  CD2 . TYR C 1 137 ? 3.054   19.961 21.915  1.00 23.57  ? 137  TYR B CD2 1 
ATOM   4472 C  CE1 . TYR C 1 137 ? 0.815   20.532 20.478  1.00 23.36  ? 137  TYR B CE1 1 
ATOM   4473 C  CE2 . TYR C 1 137 ? 2.091   19.039 21.774  1.00 23.19  ? 137  TYR B CE2 1 
ATOM   4474 C  CZ  . TYR C 1 137 ? 0.992   19.293 21.049  1.00 24.11  ? 137  TYR B CZ  1 
ATOM   4475 O  OH  . TYR C 1 137 ? 0.002   18.299 20.928  1.00 24.31  ? 137  TYR B OH  1 
ATOM   4476 N  N   . ALA C 1 138 ? 6.839   23.568 20.566  1.00 20.06  ? 138  ALA B N   1 
ATOM   4477 C  CA  . ALA C 1 138 ? 7.775   24.666 20.548  1.00 20.98  ? 138  ALA B CA  1 
ATOM   4478 C  C   . ALA C 1 138 ? 8.123   25.078 19.083  1.00 21.32  ? 138  ALA B C   1 
ATOM   4479 O  O   . ALA C 1 138 ? 8.017   26.245 18.731  1.00 21.47  ? 138  ALA B O   1 
ATOM   4480 C  CB  . ALA C 1 138 ? 9.001   24.371 21.372  1.00 19.46  ? 138  ALA B CB  1 
ATOM   4481 N  N   . ARG C 1 139 ? 8.465   24.117 18.254  1.00 20.68  ? 139  ARG B N   1 
ATOM   4482 C  CA  . ARG C 1 139 ? 8.635   24.335 16.855  1.00 21.28  ? 139  ARG B CA  1 
ATOM   4483 C  C   . ARG C 1 139 ? 7.364   24.926 16.212  1.00 20.52  ? 139  ARG B C   1 
ATOM   4484 O  O   . ARG C 1 139 ? 7.440   25.912 15.469  1.00 18.83  ? 139  ARG B O   1 
ATOM   4485 C  CB  . ARG C 1 139 ? 9.028   23.041 16.176  1.00 21.03  ? 139  ARG B CB  1 
ATOM   4486 C  CG  . ARG C 1 139 ? 9.250   23.227 14.608  1.00 23.48  ? 139  ARG B CG  1 
ATOM   4487 C  CD  . ARG C 1 139 ? 9.697   21.981 13.929  1.00 28.32  ? 139  ARG B CD  1 
ATOM   4488 N  NE  . ARG C 1 139 ? 8.574   21.191 13.435  1.00 39.13  ? 139  ARG B NE  1 
ATOM   4489 C  CZ  . ARG C 1 139 ? 8.134   20.026 13.932  1.00 41.93  ? 139  ARG B CZ  1 
ATOM   4490 N  NH1 . ARG C 1 139 ? 8.758   19.401 14.947  1.00 47.93  ? 139  ARG B NH1 1 
ATOM   4491 N  NH2 . ARG C 1 139 ? 7.050   19.462 13.392  1.00 37.06  ? 139  ARG B NH2 1 
ATOM   4492 N  N   . GLN C 1 140 ? 6.207   24.353 16.491  1.00 21.96  ? 140  GLN B N   1 
ATOM   4493 C  CA  . GLN C 1 140 ? 4.955   24.830 15.928  1.00 21.87  ? 140  GLN B CA  1 
ATOM   4494 C  C   . GLN C 1 140 ? 4.642   26.297 16.259  1.00 21.48  ? 140  GLN B C   1 
ATOM   4495 O  O   . GLN C 1 140 ? 4.279   27.043 15.412  1.00 22.08  ? 140  GLN B O   1 
ATOM   4496 C  CB  . GLN C 1 140 ? 3.861   23.845 16.327  1.00 25.18  ? 140  GLN B CB  1 
ATOM   4497 C  CG  . GLN C 1 140 ? 2.469   23.966 15.674  1.00 25.97  ? 140  GLN B CG  1 
ATOM   4498 C  CD  . GLN C 1 140 ? 2.520   23.620 14.179  1.00 34.98  ? 140  GLN B CD  1 
ATOM   4499 O  OE1 . GLN C 1 140 ? 3.242   22.706 13.773  1.00 39.50  ? 140  GLN B OE1 1 
ATOM   4500 N  NE2 . GLN C 1 140 ? 1.736   24.365 13.354  1.00 39.11  ? 140  GLN B NE2 1 
ATOM   4501 N  N   . VAL C 1 141 ? 4.846   26.721 17.476  1.00 20.86  ? 141  VAL B N   1 
ATOM   4502 C  CA  . VAL C 1 141 ? 4.680   28.111 17.809  1.00 22.21  ? 141  VAL B CA  1 
ATOM   4503 C  C   . VAL C 1 141 ? 5.617   29.011 16.949  1.00 21.42  ? 141  VAL B C   1 
ATOM   4504 O  O   . VAL C 1 141 ? 5.206   30.036 16.427  1.00 17.53  ? 141  VAL B O   1 
ATOM   4505 C  CB  . VAL C 1 141 ? 5.011   28.407 19.295  1.00 21.58  ? 141  VAL B CB  1 
ATOM   4506 C  CG1 . VAL C 1 141 ? 4.990   29.963 19.517  1.00 24.63  ? 141  VAL B CG1 1 
ATOM   4507 C  CG2 . VAL C 1 141 ? 4.078   27.633 20.252  1.00 20.43  ? 141  VAL B CG2 1 
ATOM   4508 N  N   . ALA C 1 142 ? 6.889   28.634 16.915  1.00 20.64  ? 142  ALA B N   1 
ATOM   4509 C  CA  . ALA C 1 142 ? 7.870   29.386 16.166  1.00 20.37  ? 142  ALA B CA  1 
ATOM   4510 C  C   . ALA C 1 142 ? 7.494   29.459 14.684  1.00 20.54  ? 142  ALA B C   1 
ATOM   4511 O  O   . ALA C 1 142 ? 7.517   30.537 14.127  1.00 20.50  ? 142  ALA B O   1 
ATOM   4512 C  CB  . ALA C 1 142 ? 9.239   28.788 16.340  1.00 18.36  ? 142  ALA B CB  1 
ATOM   4513 N  N   . GLU C 1 143 ? 7.142   28.322 14.083  1.00 20.57  ? 143  GLU B N   1 
ATOM   4514 C  CA  . GLU C 1 143 ? 6.726   28.233 12.715  1.00 23.25  ? 143  GLU B CA  1 
ATOM   4515 C  C   . GLU C 1 143 ? 5.458   29.105 12.429  1.00 21.59  ? 143  GLU B C   1 
ATOM   4516 O  O   . GLU C 1 143 ? 5.393   29.819 11.409  1.00 19.36  ? 143  GLU B O   1 
ATOM   4517 C  CB  . GLU C 1 143 ? 6.544   26.775 12.303  1.00 24.25  ? 143  GLU B CB  1 
ATOM   4518 C  CG  . GLU C 1 143 ? 6.265   26.652 10.793  1.00 29.76  ? 143  GLU B CG  1 
ATOM   4519 C  CD  . GLU C 1 143 ? 5.387   25.479 10.376  1.00 31.83  ? 143  GLU B CD  1 
ATOM   4520 O  OE1 . GLU C 1 143 ? 4.505   25.035 11.200  1.00 40.51  ? 143  GLU B OE1 1 
ATOM   4521 O  OE2 . GLU C 1 143 ? 5.563   25.034 9.193   1.00 37.06  ? 143  GLU B OE2 1 
ATOM   4522 N  N   . MET C 1 144 ? 4.489   29.094 13.342  1.00 20.66  ? 144  MET B N   1 
ATOM   4523 C  CA  . MET C 1 144 ? 3.317   29.959 13.196  1.00 22.37  ? 144  MET B CA  1 
ATOM   4524 C  C   . MET C 1 144 ? 3.676   31.455 13.246  1.00 20.76  ? 144  MET B C   1 
ATOM   4525 O  O   . MET C 1 144 ? 3.032   32.278 12.651  1.00 19.16  ? 144  MET B O   1 
ATOM   4526 C  CB  . MET C 1 144 ? 2.306   29.621 14.270  1.00 21.57  ? 144  MET B CB  1 
ATOM   4527 C  CG  . MET C 1 144 ? 1.606   28.286 14.056  1.00 25.58  ? 144  MET B CG  1 
ATOM   4528 S  SD  . MET C 1 144 ? 0.786   27.759 15.617  1.00 29.71  ? 144  MET B SD  1 
ATOM   4529 C  CE  . MET C 1 144 ? -0.700  28.748 15.516  1.00 26.60  ? 144  MET B CE  1 
ATOM   4530 N  N   . ASN C 1 145 ? 4.727   31.797 13.994  1.00 21.69  ? 145  ASN B N   1 
ATOM   4531 C  CA  . ASN C 1 145 ? 5.233   33.156 13.998  1.00 22.24  ? 145  ASN B CA  1 
ATOM   4532 C  C   . ASN C 1 145 ? 6.177   33.561 12.855  1.00 21.37  ? 145  ASN B C   1 
ATOM   4533 O  O   . ASN C 1 145 ? 6.597   34.727 12.796  1.00 22.74  ? 145  ASN B O   1 
ATOM   4534 C  CB  . ASN C 1 145 ? 5.846   33.433 15.350  1.00 22.15  ? 145  ASN B CB  1 
ATOM   4535 C  CG  . ASN C 1 145 ? 4.772   33.538 16.405  1.00 25.93  ? 145  ASN B CG  1 
ATOM   4536 O  OD1 . ASN C 1 145 ? 3.702   34.129 16.156  1.00 28.78  ? 145  ASN B OD1 1 
ATOM   4537 N  ND2 . ASN C 1 145 ? 5.025   32.964 17.572  1.00 28.56  ? 145  ASN B ND2 1 
ATOM   4538 N  N   . THR C 1 146 ? 6.488   32.596 11.973  1.00 19.32  ? 146  THR B N   1 
ATOM   4539 C  CA  . THR C 1 146 ? 7.479   32.758 10.926  1.00 19.16  ? 146  THR B CA  1 
ATOM   4540 C  C   . THR C 1 146 ? 6.865   32.622 9.508   1.00 19.11  ? 146  THR B C   1 
ATOM   4541 O  O   . THR C 1 146 ? 7.145   33.423 8.629   1.00 17.95  ? 146  THR B O   1 
ATOM   4542 C  CB  . THR C 1 146 ? 8.588   31.743 11.130  1.00 18.29  ? 146  THR B CB  1 
ATOM   4543 O  OG1 . THR C 1 146 ? 9.175   31.938 12.445  1.00 16.94  ? 146  THR B OG1 1 
ATOM   4544 C  CG2 . THR C 1 146 ? 9.623   31.866 10.102  1.00 17.23  ? 146  THR B CG2 1 
ATOM   4545 N  N   . TYR C 1 147 ? 6.056   31.597 9.293   1.00 19.21  ? 147  TYR B N   1 
ATOM   4546 C  CA  . TYR C 1 147 ? 5.575   31.313 7.943   1.00 19.89  ? 147  TYR B CA  1 
ATOM   4547 C  C   . TYR C 1 147 ? 4.112   31.560 7.898   1.00 20.08  ? 147  TYR B C   1 
ATOM   4548 O  O   . TYR C 1 147 ? 3.414   31.375 8.889   1.00 21.28  ? 147  TYR B O   1 
ATOM   4549 C  CB  . TYR C 1 147 ? 5.909   29.888 7.543   1.00 20.93  ? 147  TYR B CB  1 
ATOM   4550 C  CG  . TYR C 1 147 ? 7.404   29.675 7.571   1.00 22.18  ? 147  TYR B CG  1 
ATOM   4551 C  CD1 . TYR C 1 147 ? 8.022   28.950 8.613   1.00 21.38  ? 147  TYR B CD1 1 
ATOM   4552 C  CD2 . TYR C 1 147 ? 8.219   30.289 6.610   1.00 22.29  ? 147  TYR B CD2 1 
ATOM   4553 C  CE1 . TYR C 1 147 ? 9.450   28.771 8.631   1.00 21.70  ? 147  TYR B CE1 1 
ATOM   4554 C  CE2 . TYR C 1 147 ? 9.626   30.136 6.652   1.00 24.93  ? 147  TYR B CE2 1 
ATOM   4555 C  CZ  . TYR C 1 147 ? 10.218  29.367 7.656   1.00 22.64  ? 147  TYR B CZ  1 
ATOM   4556 O  OH  . TYR C 1 147 ? 11.614  29.273 7.691   1.00 26.25  ? 147  TYR B OH  1 
ATOM   4557 N  N   . ASN C 1 148 ? 3.659   31.949 6.732   1.00 21.90  ? 148  ASN B N   1 
ATOM   4558 C  CA  . ASN C 1 148 ? 2.285   32.232 6.528   1.00 23.54  ? 148  ASN B CA  1 
ATOM   4559 C  C   . ASN C 1 148 ? 1.507   30.902 6.269   1.00 23.27  ? 148  ASN B C   1 
ATOM   4560 O  O   . ASN C 1 148 ? 2.087   29.826 6.038   1.00 20.28  ? 148  ASN B O   1 
ATOM   4561 C  CB  . ASN C 1 148 ? 2.137   33.328 5.469   1.00 23.78  ? 148  ASN B CB  1 
ATOM   4562 C  CG  . ASN C 1 148 ? 2.425   32.849 4.039   1.00 28.38  ? 148  ASN B CG  1 
ATOM   4563 O  OD1 . ASN C 1 148 ? 2.071   31.717 3.659   1.00 33.01  ? 148  ASN B OD1 1 
ATOM   4564 N  ND2 . ASN C 1 148 ? 3.075   33.709 3.236   1.00 25.48  ? 148  ASN B ND2 1 
ATOM   4565 N  N   . PRO C 1 149 ? 0.187   30.987 6.313   1.00 24.53  ? 149  PRO B N   1 
ATOM   4566 C  CA  . PRO C 1 149 ? -0.638  29.809 6.245   1.00 25.96  ? 149  PRO B CA  1 
ATOM   4567 C  C   . PRO C 1 149 ? -0.381  28.879 5.066   1.00 26.60  ? 149  PRO B C   1 
ATOM   4568 O  O   . PRO C 1 149 ? -0.284  27.693 5.273   1.00 26.57  ? 149  PRO B O   1 
ATOM   4569 C  CB  . PRO C 1 149 ? -2.053  30.381 6.207   1.00 26.00  ? 149  PRO B CB  1 
ATOM   4570 C  CG  . PRO C 1 149 ? -1.943  31.683 6.957   1.00 26.10  ? 149  PRO B CG  1 
ATOM   4571 C  CD  . PRO C 1 149 ? -0.606  32.219 6.542   1.00 24.70  ? 149  PRO B CD  1 
ATOM   4572 N  N   . THR C 1 150 ? -0.282  29.390 3.859   1.00 29.01  ? 150  THR B N   1 
ATOM   4573 C  CA  . THR C 1 150 ? -0.015  28.539 2.711   1.00 31.18  ? 150  THR B CA  1 
ATOM   4574 C  C   . THR C 1 150 ? 1.338   27.846 2.791   1.00 30.17  ? 150  THR B C   1 
ATOM   4575 O  O   . THR C 1 150 ? 1.461   26.678 2.438   1.00 30.34  ? 150  THR B O   1 
ATOM   4576 C  CB  . THR C 1 150 ? -0.247  29.335 1.348   1.00 31.89  ? 150  THR B CB  1 
ATOM   4577 O  OG1 . THR C 1 150 ? 0.422   30.586 1.400   1.00 38.90  ? 150  THR B OG1 1 
ATOM   4578 C  CG2 . THR C 1 150 ? -1.686  29.671 1.207   1.00 31.86  ? 150  THR B CG2 1 
ATOM   4579 N  N   . ILE C 1 151 ? 2.354   28.582 3.270   1.00 30.29  ? 151  ILE B N   1 
ATOM   4580 C  CA  . ILE C 1 151 ? 3.672   28.028 3.476   1.00 29.84  ? 151  ILE B CA  1 
ATOM   4581 C  C   . ILE C 1 151 ? 3.673   26.899 4.501   1.00 29.69  ? 151  ILE B C   1 
ATOM   4582 O  O   . ILE C 1 151 ? 4.272   25.902 4.256   1.00 31.01  ? 151  ILE B O   1 
ATOM   4583 C  CB  . ILE C 1 151 ? 4.705   29.103 3.821   1.00 30.17  ? 151  ILE B CB  1 
ATOM   4584 C  CG1 . ILE C 1 151 ? 4.838   30.048 2.647   1.00 30.91  ? 151  ILE B CG1 1 
ATOM   4585 C  CG2 . ILE C 1 151 ? 6.134   28.473 4.191   1.00 27.14  ? 151  ILE B CG2 1 
ATOM   4586 C  CD1 . ILE C 1 151 ? 5.039   29.361 1.309   1.00 34.78  ? 151  ILE B CD1 1 
ATOM   4587 N  N   . ARG C 1 152 ? 2.959   27.054 5.614   1.00 29.70  ? 152  ARG B N   1 
ATOM   4588 C  CA  . ARG C 1 152 ? 2.869   26.018 6.619   1.00 30.93  ? 152  ARG B CA  1 
ATOM   4589 C  C   . ARG C 1 152 ? 2.299   24.718 6.085   1.00 31.18  ? 152  ARG B C   1 
ATOM   4590 O  O   . ARG C 1 152 ? 2.790   23.661 6.421   1.00 31.77  ? 152  ARG B O   1 
ATOM   4591 C  CB  . ARG C 1 152 ? 2.105   26.500 7.858   1.00 29.99  ? 152  ARG B CB  1 
ATOM   4592 C  CG  . ARG C 1 152 ? 2.841   27.607 8.575   1.00 33.60  ? 152  ARG B CG  1 
ATOM   4593 C  CD  . ARG C 1 152 ? 2.376   27.869 9.994   1.00 31.95  ? 152  ARG B CD  1 
ATOM   4594 N  NE  . ARG C 1 152 ? 0.921   27.957 10.122  1.00 34.28  ? 152  ARG B NE  1 
ATOM   4595 C  CZ  . ARG C 1 152 ? 0.217   29.099 10.216  1.00 37.11  ? 152  ARG B CZ  1 
ATOM   4596 N  NH1 . ARG C 1 152 ? 0.812   30.285 10.190  1.00 38.81  ? 152  ARG B NH1 1 
ATOM   4597 N  NH2 . ARG C 1 152 ? -1.104  29.063 10.347  1.00 36.50  ? 152  ARG B NH2 1 
ATOM   4598 N  N   . ILE C 1 153 ? 1.278   24.800 5.247   1.00 31.41  ? 153  ILE B N   1 
ATOM   4599 C  CA  . ILE C 1 153 ? 0.713   23.639 4.601   1.00 32.19  ? 153  ILE B CA  1 
ATOM   4600 C  C   . ILE C 1 153 ? 1.733   22.977 3.662   1.00 32.38  ? 153  ILE B C   1 
ATOM   4601 O  O   . ILE C 1 153 ? 1.865   21.766 3.653   1.00 31.80  ? 153  ILE B O   1 
ATOM   4602 C  CB  . ILE C 1 153 ? -0.608  23.986 3.773   1.00 32.32  ? 153  ILE B CB  1 
ATOM   4603 C  CG1 . ILE C 1 153 ? -1.706  24.533 4.725   1.00 32.99  ? 153  ILE B CG1 1 
ATOM   4604 C  CG2 . ILE C 1 153 ? -1.105  22.660 2.953   1.00 29.98  ? 153  ILE B CG2 1 
ATOM   4605 C  CD1 . ILE C 1 153 ? -2.780  25.342 4.011   1.00 35.06  ? 153  ILE B CD1 1 
ATOM   4606 N  N   . LEU C 1 154 ? 2.424   23.783 2.866   1.00 32.74  ? 154  LEU B N   1 
ATOM   4607 C  CA  . LEU C 1 154 ? 3.441   23.235 1.985   1.00 32.87  ? 154  LEU B CA  1 
ATOM   4608 C  C   . LEU C 1 154 ? 4.582   22.613 2.777   1.00 32.06  ? 154  LEU B C   1 
ATOM   4609 O  O   . LEU C 1 154 ? 4.981   21.533 2.411   1.00 33.62  ? 154  LEU B O   1 
ATOM   4610 C  CB  . LEU C 1 154 ? 3.950   24.309 1.013   1.00 32.74  ? 154  LEU B CB  1 
ATOM   4611 C  CG  . LEU C 1 154 ? 2.908   24.857 0.016   1.00 33.43  ? 154  LEU B CG  1 
ATOM   4612 C  CD1 . LEU C 1 154 ? 3.532   25.913 -0.857  1.00 34.40  ? 154  LEU B CD1 1 
ATOM   4613 C  CD2 . LEU C 1 154 ? 2.254   23.742 -0.814  1.00 29.27  ? 154  LEU B CD2 1 
ATOM   4614 N  N   . ARG C 1 155 ? 5.088   23.294 3.831   1.00 31.36  ? 155  ARG B N   1 
ATOM   4615 C  CA  . ARG C 1 155 ? 6.128   22.753 4.675   1.00 31.00  ? 155  ARG B CA  1 
ATOM   4616 C  C   . ARG C 1 155 ? 5.677   21.420 5.303   1.00 31.05  ? 155  ARG B C   1 
ATOM   4617 O  O   . ARG C 1 155 ? 6.468   20.474 5.345   1.00 29.05  ? 155  ARG B O   1 
ATOM   4618 C  CB  . ARG C 1 155 ? 6.560   23.732 5.769   1.00 32.01  ? 155  ARG B CB  1 
ATOM   4619 C  CG  . ARG C 1 155 ? 7.280   24.963 5.300   1.00 30.02  ? 155  ARG B CG  1 
ATOM   4620 C  CD  . ARG C 1 155 ? 7.420   26.003 6.444   1.00 29.21  ? 155  ARG B CD  1 
ATOM   4621 N  NE  . ARG C 1 155 ? 8.165   25.477 7.589   1.00 28.09  ? 155  ARG B NE  1 
ATOM   4622 C  CZ  . ARG C 1 155 ? 9.488   25.333 7.707   1.00 27.50  ? 155  ARG B CZ  1 
ATOM   4623 N  NH1 . ARG C 1 155 ? 10.327  25.671 6.742   1.00 29.56  ? 155  ARG B NH1 1 
ATOM   4624 N  NH2 . ARG C 1 155 ? 9.999   24.826 8.833   1.00 26.87  ? 155  ARG B NH2 1 
ATOM   4625 N  N   . LEU C 1 156 ? 4.401   21.326 5.681   1.00 32.15  ? 156  LEU B N   1 
ATOM   4626 C  CA  . LEU C 1 156 ? 3.840   20.052 6.224   1.00 33.18  ? 156  LEU B CA  1 
ATOM   4627 C  C   . LEU C 1 156 ? 3.898   18.877 5.239   1.00 33.60  ? 156  LEU B C   1 
ATOM   4628 O  O   . LEU C 1 156 ? 4.437   17.805 5.593   1.00 33.11  ? 156  LEU B O   1 
ATOM   4629 C  CB  . LEU C 1 156 ? 2.407   20.225 6.742   1.00 32.44  ? 156  LEU B CB  1 
ATOM   4630 C  CG  . LEU C 1 156 ? 1.712   18.920 7.197   1.00 32.71  ? 156  LEU B CG  1 
ATOM   4631 C  CD1 . LEU C 1 156 ? 2.292   18.224 8.412   1.00 30.61  ? 156  LEU B CD1 1 
ATOM   4632 C  CD2 . LEU C 1 156 ? 0.223   19.200 7.468   1.00 34.39  ? 156  LEU B CD2 1 
ATOM   4633 N  N   . PHE C 1 157 ? 3.411   19.094 4.021   1.00 34.65  ? 157  PHE B N   1 
ATOM   4634 C  CA  . PHE C 1 157 ? 3.445   18.054 2.982   1.00 34.94  ? 157  PHE B CA  1 
ATOM   4635 C  C   . PHE C 1 157 ? 4.852   17.650 2.556   1.00 34.79  ? 157  PHE B C   1 
ATOM   4636 O  O   . PHE C 1 157 ? 5.129   16.436 2.377   1.00 34.24  ? 157  PHE B O   1 
ATOM   4637 C  CB  . PHE C 1 157 ? 2.700   18.496 1.743   1.00 37.04  ? 157  PHE B CB  1 
ATOM   4638 C  CG  . PHE C 1 157 ? 1.210   18.481 1.863   1.00 38.75  ? 157  PHE B CG  1 
ATOM   4639 C  CD1 . PHE C 1 157 ? 0.466   19.598 1.469   1.00 41.85  ? 157  PHE B CD1 1 
ATOM   4640 C  CD2 . PHE C 1 157 ? 0.537   17.346 2.258   1.00 41.07  ? 157  PHE B CD2 1 
ATOM   4641 C  CE1 . PHE C 1 157 ? -0.898  19.566 1.565   1.00 44.76  ? 157  PHE B CE1 1 
ATOM   4642 C  CE2 . PHE C 1 157 ? -0.819  17.325 2.352   1.00 40.16  ? 157  PHE B CE2 1 
ATOM   4643 C  CZ  . PHE C 1 157 ? -1.536  18.408 2.027   1.00 42.91  ? 157  PHE B CZ  1 
ATOM   4644 N  N   . TYR C 1 158 ? 5.739   18.652 2.423   1.00 34.63  ? 158  TYR B N   1 
ATOM   4645 C  CA  . TYR C 1 158 ? 7.179   18.413 2.177   1.00 34.32  ? 158  TYR B CA  1 
ATOM   4646 C  C   . TYR C 1 158 ? 7.869   17.582 3.256   1.00 34.78  ? 158  TYR B C   1 
ATOM   4647 O  O   . TYR C 1 158 ? 8.553   16.546 3.001   1.00 33.42  ? 158  TYR B O   1 
ATOM   4648 C  CB  . TYR C 1 158 ? 7.921   19.735 1.958   1.00 35.09  ? 158  TYR B CB  1 
ATOM   4649 C  CG  . TYR C 1 158 ? 9.360   19.464 1.855   1.00 36.20  ? 158  TYR B CG  1 
ATOM   4650 C  CD1 . TYR C 1 158 ? 9.866   18.749 0.769   1.00 34.86  ? 158  TYR B CD1 1 
ATOM   4651 C  CD2 . TYR C 1 158 ? 10.234  19.829 2.873   1.00 37.42  ? 158  TYR B CD2 1 
ATOM   4652 C  CE1 . TYR C 1 158 ? 11.213  18.414 0.703   1.00 37.19  ? 158  TYR B CE1 1 
ATOM   4653 C  CE2 . TYR C 1 158 ? 11.571  19.511 2.795   1.00 36.03  ? 158  TYR B CE2 1 
ATOM   4654 C  CZ  . TYR C 1 158 ? 12.038  18.806 1.704   1.00 34.48  ? 158  TYR B CZ  1 
ATOM   4655 O  OH  . TYR C 1 158 ? 13.337  18.475 1.631   1.00 38.21  ? 158  TYR B OH  1 
ATOM   4656 N  N   . GLU C 1 159 ? 7.730   18.026 4.492   1.00 35.19  ? 159  GLU B N   1 
ATOM   4657 C  CA  . GLU C 1 159 ? 8.275   17.256 5.622   1.00 35.10  ? 159  GLU B CA  1 
ATOM   4658 C  C   . GLU C 1 159 ? 7.707   15.827 5.737   1.00 33.95  ? 159  GLU B C   1 
ATOM   4659 O  O   . GLU C 1 159 ? 8.424   14.872 5.952   1.00 33.21  ? 159  GLU B O   1 
ATOM   4660 C  CB  . GLU C 1 159 ? 8.043   18.011 6.926   1.00 35.12  ? 159  GLU B CB  1 
ATOM   4661 C  CG  . GLU C 1 159 ? 8.891   19.269 7.057   1.00 36.16  ? 159  GLU B CG  1 
ATOM   4662 C  CD  . GLU C 1 159 ? 8.274   20.329 7.966   1.00 37.37  ? 159  GLU B CD  1 
ATOM   4663 O  OE1 . GLU C 1 159 ? 7.235   20.069 8.603   1.00 44.10  ? 159  GLU B OE1 1 
ATOM   4664 O  OE2 . GLU C 1 159 ? 8.811   21.444 8.005   1.00 41.77  ? 159  GLU B OE2 1 
ATOM   4665 N  N   . LEU C 1 160 ? 6.417   15.702 5.599   1.00 34.01  ? 160  LEU B N   1 
ATOM   4666 C  CA  . LEU C 1 160 ? 5.772   14.406 5.550   1.00 35.77  ? 160  LEU B CA  1 
ATOM   4667 C  C   . LEU C 1 160 ? 6.306   13.472 4.433   1.00 36.05  ? 160  LEU B C   1 
ATOM   4668 O  O   . LEU C 1 160 ? 6.598   12.284 4.689   1.00 35.10  ? 160  LEU B O   1 
ATOM   4669 C  CB  . LEU C 1 160 ? 4.278   14.629 5.385   1.00 35.43  ? 160  LEU B CB  1 
ATOM   4670 C  CG  . LEU C 1 160 ? 3.256   13.856 6.223   1.00 37.21  ? 160  LEU B CG  1 
ATOM   4671 C  CD1 . LEU C 1 160 ? 3.680   13.500 7.655   1.00 32.83  ? 160  LEU B CD1 1 
ATOM   4672 C  CD2 . LEU C 1 160 ? 1.927   14.667 6.106   1.00 37.00  ? 160  LEU B CD2 1 
ATOM   4673 N  N   . CYS C 1 161 ? 6.443   13.995 3.205   1.00 36.28  ? 161  CYS B N   1 
ATOM   4674 C  CA  . CYS C 1 161 ? 7.020   13.194 2.088   1.00 37.08  ? 161  CYS B CA  1 
ATOM   4675 C  C   . CYS C 1 161 ? 8.500   12.816 2.312   1.00 37.93  ? 161  CYS B C   1 
ATOM   4676 O  O   . CYS C 1 161 ? 8.965   11.712 1.996   1.00 38.32  ? 161  CYS B O   1 
ATOM   4677 C  CB  . CYS C 1 161 ? 6.893   13.943 0.764   1.00 36.59  ? 161  CYS B CB  1 
ATOM   4678 S  SG  . CYS C 1 161 ? 7.270   12.845 -0.562  1.00 36.84  ? 161  CYS B SG  1 
ATOM   4679 N  N   . SER C 1 162 ? 9.224   13.787 2.831   1.00 38.76  ? 162  SER B N   1 
ATOM   4680 C  CA  . SER C 1 162 ? 10.613  13.673 3.117   1.00 40.70  ? 162  SER B CA  1 
ATOM   4681 C  C   . SER C 1 162 ? 10.814  12.538 4.175   1.00 40.75  ? 162  SER B C   1 
ATOM   4682 O  O   . SER C 1 162 ? 11.787  11.787 4.137   1.00 40.28  ? 162  SER B O   1 
ATOM   4683 C  CB  . SER C 1 162 ? 11.079  15.064 3.592   1.00 39.91  ? 162  SER B CB  1 
ATOM   4684 O  OG  . SER C 1 162 ? 12.468  15.211 3.569   1.00 43.72  ? 162  SER B OG  1 
ATOM   4685 N  N   . SER C 1 163 ? 9.843   12.413 5.079   1.00 41.74  ? 163  SER B N   1 
ATOM   4686 C  CA  . SER C 1 163 ? 9.891   11.522 6.237   1.00 42.71  ? 163  SER B CA  1 
ATOM   4687 C  C   . SER C 1 163 ? 9.310   10.126 5.930   1.00 44.07  ? 163  SER B C   1 
ATOM   4688 O  O   . SER C 1 163 ? 9.873   9.109  6.315   1.00 42.80  ? 163  SER B O   1 
ATOM   4689 C  CB  . SER C 1 163 ? 9.101   12.171 7.393   1.00 42.51  ? 163  SER B CB  1 
ATOM   4690 O  OG  . SER C 1 163 ? 8.741   11.225 8.382   1.00 43.50  ? 163  SER B OG  1 
ATOM   4691 N  N   . GLN C 1 164 ? 8.163   10.117 5.249   1.00 44.87  ? 164  GLN B N   1 
ATOM   4692 C  CA  . GLN C 1 164 ? 7.311   8.948  5.109   1.00 46.00  ? 164  GLN B CA  1 
ATOM   4693 C  C   . GLN C 1 164 ? 7.049   8.563  3.655   1.00 45.35  ? 164  GLN B C   1 
ATOM   4694 O  O   . GLN C 1 164 ? 6.311   7.591  3.389   1.00 45.46  ? 164  GLN B O   1 
ATOM   4695 C  CB  . GLN C 1 164 ? 5.954   9.272  5.748   1.00 46.45  ? 164  GLN B CB  1 
ATOM   4696 C  CG  . GLN C 1 164 ? 5.772   8.845  7.192   1.00 49.31  ? 164  GLN B CG  1 
ATOM   4697 C  CD  . GLN C 1 164 ? 4.351   9.155  7.681   1.00 49.66  ? 164  GLN B CD  1 
ATOM   4698 O  OE1 . GLN C 1 164 ? 3.359   8.797  7.020   1.00 55.96  ? 164  GLN B OE1 1 
ATOM   4699 N  NE2 . GLN C 1 164 ? 4.249   9.838  8.823   1.00 53.61  ? 164  GLN B NE2 1 
ATOM   4700 N  N   . GLY C 1 165 ? 7.605   9.336  2.717   1.00 44.42  ? 165  GLY B N   1 
ATOM   4701 C  CA  . GLY C 1 165 ? 7.380   9.106  1.304   1.00 43.88  ? 165  GLY B CA  1 
ATOM   4702 C  C   . GLY C 1 165 ? 8.108   7.833  0.889   1.00 43.52  ? 165  GLY B C   1 
ATOM   4703 O  O   . GLY C 1 165 ? 9.300   7.684  1.187   1.00 43.12  ? 165  GLY B O   1 
ATOM   4704 N  N   . LYS C 1 166 ? 7.361   6.918  0.267   1.00 42.99  ? 166  LYS B N   1 
ATOM   4705 C  CA  . LYS C 1 166 ? 7.874   5.673  -0.282  1.00 43.55  ? 166  LYS B CA  1 
ATOM   4706 C  C   . LYS C 1 166 ? 7.852   5.810  -1.785  1.00 43.74  ? 166  LYS B C   1 
ATOM   4707 O  O   . LYS C 1 166 ? 6.804   6.094  -2.358  1.00 42.67  ? 166  LYS B O   1 
ATOM   4708 C  CB  . LYS C 1 166 ? 7.017   4.462  0.165   1.00 43.44  ? 166  LYS B CB  1 
ATOM   4709 C  CG  . LYS C 1 166 ? 7.583   3.114  -0.274  1.00 43.80  ? 166  LYS B CG  1 
ATOM   4710 C  CD  . LYS C 1 166 ? 6.698   1.910  0.080   1.00 43.55  ? 166  LYS B CD  1 
ATOM   4711 C  CE  . LYS C 1 166 ? 7.410   0.607  -0.233  1.00 43.35  ? 166  LYS B CE  1 
ATOM   4712 N  NZ  . LYS C 1 166 ? 8.624   0.419  0.614   1.00 41.55  ? 166  LYS B NZ  1 
ATOM   4713 N  N   . ARG C 1 167 ? 9.009   5.617  -2.413  1.00 44.75  ? 167  ARG B N   1 
ATOM   4714 C  CA  . ARG C 1 167 ? 9.127   5.644  -3.876  1.00 46.29  ? 167  ARG B CA  1 
ATOM   4715 C  C   . ARG C 1 167 ? 8.330   4.524  -4.572  1.00 46.26  ? 167  ARG B C   1 
ATOM   4716 O  O   . ARG C 1 167 ? 8.719   3.350  -4.511  1.00 46.95  ? 167  ARG B O   1 
ATOM   4717 C  CB  . ARG C 1 167 ? 10.606  5.586  -4.297  1.00 47.01  ? 167  ARG B CB  1 
ATOM   4718 C  CG  . ARG C 1 167 ? 11.307  6.961  -4.263  1.00 49.50  ? 167  ARG B CG  1 
ATOM   4719 C  CD  . ARG C 1 167 ? 11.213  7.695  -5.628  1.00 50.97  ? 167  ARG B CD  1 
ATOM   4720 N  NE  . ARG C 1 167 ? 12.121  7.092  -6.612  1.00 51.48  ? 167  ARG B NE  1 
ATOM   4721 C  CZ  . ARG C 1 167 ? 12.246  7.475  -7.885  1.00 52.95  ? 167  ARG B CZ  1 
ATOM   4722 N  NH1 . ARG C 1 167 ? 11.503  8.469  -8.370  1.00 53.71  ? 167  ARG B NH1 1 
ATOM   4723 N  NH2 . ARG C 1 167 ? 13.106  6.845  -8.692  1.00 53.05  ? 167  ARG B NH2 1 
ATOM   4724 N  N   . VAL C 1 168 ? 7.202   4.913  -5.188  1.00 46.46  ? 168  VAL B N   1 
ATOM   4725 C  CA  . VAL C 1 168 ? 6.364   4.053  -6.038  1.00 46.42  ? 168  VAL B CA  1 
ATOM   4726 C  C   . VAL C 1 168 ? 6.462   4.608  -7.450  1.00 46.64  ? 168  VAL B C   1 
ATOM   4727 O  O   . VAL C 1 168 ? 5.850   5.639  -7.783  1.00 46.59  ? 168  VAL B O   1 
ATOM   4728 C  CB  . VAL C 1 168 ? 4.853   4.013  -5.611  1.00 46.38  ? 168  VAL B CB  1 
ATOM   4729 C  CG1 . VAL C 1 168 ? 3.998   3.291  -6.659  1.00 46.72  ? 168  VAL B CG1 1 
ATOM   4730 C  CG2 . VAL C 1 168 ? 4.683   3.329  -4.275  1.00 47.21  ? 168  VAL B CG2 1 
ATOM   4731 N  N   . GLY C 1 169 ? 7.220   3.906  -8.284  1.00 46.97  ? 169  GLY B N   1 
ATOM   4732 C  CA  . GLY C 1 169 ? 7.508   4.357  -9.628  1.00 47.16  ? 169  GLY B CA  1 
ATOM   4733 C  C   . GLY C 1 169 ? 8.113   5.747  -9.637  1.00 47.28  ? 169  GLY B C   1 
ATOM   4734 O  O   . GLY C 1 169 ? 9.200   5.979  -9.104  1.00 46.78  ? 169  GLY B O   1 
ATOM   4735 N  N   . ASP C 1 170 ? 7.371   6.678  -10.225 1.00 47.64  ? 170  ASP B N   1 
ATOM   4736 C  CA  . ASP C 1 170 ? 7.870   8.024  -10.517 1.00 47.75  ? 170  ASP B CA  1 
ATOM   4737 C  C   . ASP C 1 170 ? 7.368   9.037  -9.473  1.00 47.23  ? 170  ASP B C   1 
ATOM   4738 O  O   . ASP C 1 170 ? 7.464   10.265 -9.638  1.00 47.50  ? 170  ASP B O   1 
ATOM   4739 C  CB  . ASP C 1 170 ? 7.417   8.406  -11.936 1.00 47.84  ? 170  ASP B CB  1 
ATOM   4740 C  CG  . ASP C 1 170 ? 8.491   9.127  -12.708 1.00 48.79  ? 170  ASP B CG  1 
ATOM   4741 O  OD1 . ASP C 1 170 ? 9.026   10.115 -12.145 1.00 48.12  ? 170  ASP B OD1 1 
ATOM   4742 O  OD2 . ASP C 1 170 ? 8.787   8.710  -13.865 1.00 46.81  ? 170  ASP B OD2 1 
ATOM   4743 N  N   . THR C 1 171 ? 6.847   8.495  -8.378  1.00 46.49  ? 171  THR B N   1 
ATOM   4744 C  CA  . THR C 1 171 ? 6.134   9.260  -7.392  1.00 44.96  ? 171  THR B CA  1 
ATOM   4745 C  C   . THR C 1 171 ? 6.611   8.792  -6.034  1.00 44.85  ? 171  THR B C   1 
ATOM   4746 O  O   . THR C 1 171 ? 7.284   7.750  -5.919  1.00 44.36  ? 171  THR B O   1 
ATOM   4747 C  CB  . THR C 1 171 ? 4.584   9.038  -7.512  1.00 44.94  ? 171  THR B CB  1 
ATOM   4748 O  OG1 . THR C 1 171 ? 4.196   7.781  -6.925  1.00 44.20  ? 171  THR B OG1 1 
ATOM   4749 C  CG2 . THR C 1 171 ? 4.111   9.099  -8.978  1.00 43.02  ? 171  THR B CG2 1 
ATOM   4750 N  N   . TYR C 1 172 ? 6.280   9.587  -5.011  1.00 44.10  ? 172  TYR B N   1 
ATOM   4751 C  CA  . TYR C 1 172 ? 6.329   9.139  -3.617  1.00 43.47  ? 172  TYR B CA  1 
ATOM   4752 C  C   . TYR C 1 172 ? 4.897   8.921  -3.148  1.00 42.98  ? 172  TYR B C   1 
ATOM   4753 O  O   . TYR C 1 172 ? 4.010   9.721  -3.462  1.00 42.61  ? 172  TYR B O   1 
ATOM   4754 C  CB  . TYR C 1 172 ? 7.010   10.175 -2.715  1.00 43.26  ? 172  TYR B CB  1 
ATOM   4755 C  CG  . TYR C 1 172 ? 8.465   10.437 -3.029  1.00 43.88  ? 172  TYR B CG  1 
ATOM   4756 C  CD1 . TYR C 1 172 ? 8.828   11.311 -4.048  1.00 43.89  ? 172  TYR B CD1 1 
ATOM   4757 C  CD2 . TYR C 1 172 ? 9.487   9.814  -2.305  1.00 43.87  ? 172  TYR B CD2 1 
ATOM   4758 C  CE1 . TYR C 1 172 ? 10.165  11.571 -4.349  1.00 43.52  ? 172  TYR B CE1 1 
ATOM   4759 C  CE2 . TYR C 1 172 ? 10.833  10.077 -2.592  1.00 44.59  ? 172  TYR B CE2 1 
ATOM   4760 C  CZ  . TYR C 1 172 ? 11.157  10.967 -3.621  1.00 45.13  ? 172  TYR B CZ  1 
ATOM   4761 O  OH  . TYR C 1 172 ? 12.467  11.245 -3.941  1.00 45.18  ? 172  TYR B OH  1 
ATOM   4762 N  N   . GLU C 1 173 ? 4.654   7.838  -2.414  1.00 42.43  ? 173  GLU B N   1 
ATOM   4763 C  CA  . GLU C 1 173 ? 3.373   7.694  -1.732  1.00 41.67  ? 173  GLU B CA  1 
ATOM   4764 C  C   . GLU C 1 173 ? 3.518   7.865  -0.246  1.00 40.73  ? 173  GLU B C   1 
ATOM   4765 O  O   . GLU C 1 173 ? 4.411   7.310  0.366   1.00 40.65  ? 173  GLU B O   1 
ATOM   4766 C  CB  . GLU C 1 173 ? 2.726   6.368  -2.086  1.00 41.86  ? 173  GLU B CB  1 
ATOM   4767 C  CG  . GLU C 1 173 ? 2.294   6.321  -3.573  1.00 42.88  ? 173  GLU B CG  1 
ATOM   4768 C  CD  . GLU C 1 173 ? 1.403   5.158  -3.898  1.00 42.24  ? 173  GLU B CD  1 
ATOM   4769 O  OE1 . GLU C 1 173 ? 1.333   4.216  -3.084  1.00 45.63  ? 173  GLU B OE1 1 
ATOM   4770 O  OE2 . GLU C 1 173 ? 0.762   5.187  -4.966  1.00 44.42  ? 173  GLU B OE2 1 
ATOM   4771 N  N   . ILE C 1 174 ? 2.667   8.694  0.334   1.00 40.32  ? 174  ILE B N   1 
ATOM   4772 C  CA  . ILE C 1 174 ? 2.529   8.772  1.771   1.00 39.88  ? 174  ILE B CA  1 
ATOM   4773 C  C   . ILE C 1 174 ? 1.248   8.004  2.082   1.00 40.29  ? 174  ILE B C   1 
ATOM   4774 O  O   . ILE C 1 174 ? 0.158   8.392  1.699   1.00 39.96  ? 174  ILE B O   1 
ATOM   4775 C  CB  . ILE C 1 174 ? 2.457   10.216 2.290   1.00 40.24  ? 174  ILE B CB  1 
ATOM   4776 C  CG1 . ILE C 1 174 ? 3.639   11.046 1.776   1.00 38.90  ? 174  ILE B CG1 1 
ATOM   4777 C  CG2 . ILE C 1 174 ? 2.393   10.263 3.825   1.00 38.63  ? 174  ILE B CG2 1 
ATOM   4778 C  CD1 . ILE C 1 174 ? 3.434   12.506 2.053   1.00 38.58  ? 174  ILE B CD1 1 
ATOM   4779 N  N   . THR C 1 175 ? 1.392   6.884  2.766   1.00 40.15  ? 175  THR B N   1 
ATOM   4780 C  CA  . THR C 1 175 ? 0.244   6.066  3.045   1.00 40.55  ? 175  THR B CA  1 
ATOM   4781 C  C   . THR C 1 175 ? -0.286  6.485  4.411   1.00 41.04  ? 175  THR B C   1 
ATOM   4782 O  O   . THR C 1 175 ? 0.135   5.956  5.441   1.00 40.53  ? 175  THR B O   1 
ATOM   4783 C  CB  . THR C 1 175 ? 0.595   4.549  2.941   1.00 40.36  ? 175  THR B CB  1 
ATOM   4784 O  OG1 . THR C 1 175 ? 0.843   4.222  1.560   1.00 39.36  ? 175  THR B OG1 1 
ATOM   4785 C  CG2 . THR C 1 175 ? -0.549  3.679  3.466   1.00 40.36  ? 175  THR B CG2 1 
ATOM   4786 N  N   . MET C 1 176 ? -1.192  7.461  4.398   1.00 41.77  ? 176  MET B N   1 
ATOM   4787 C  CA  . MET C 1 176 ? -1.971  7.874  5.585   1.00 43.03  ? 176  MET B CA  1 
ATOM   4788 C  C   . MET C 1 176 ? -3.280  8.586  5.205   1.00 41.66  ? 176  MET B C   1 
ATOM   4789 O  O   . MET C 1 176 ? -3.310  9.335  4.241   1.00 40.49  ? 176  MET B O   1 
ATOM   4790 C  CB  . MET C 1 176 ? -1.139  8.763  6.533   1.00 42.87  ? 176  MET B CB  1 
ATOM   4791 C  CG  . MET C 1 176 ? -0.820  10.223 6.138   1.00 45.61  ? 176  MET B CG  1 
ATOM   4792 S  SD  . MET C 1 176 ? -0.175  11.250 7.566   1.00 49.96  ? 176  MET B SD  1 
ATOM   4793 C  CE  . MET C 1 176 ? -1.208  10.613 8.930   1.00 48.42  ? 176  MET B CE  1 
ATOM   4794 N  N   . PRO C 1 177 ? -4.353  8.389  5.999   1.00 40.99  ? 177  PRO B N   1 
ATOM   4795 C  CA  . PRO C 1 177 ? -5.493  9.297  5.846   1.00 40.03  ? 177  PRO B CA  1 
ATOM   4796 C  C   . PRO C 1 177 ? -5.249  10.646 6.570   1.00 38.98  ? 177  PRO B C   1 
ATOM   4797 O  O   . PRO C 1 177 ? -5.145  10.702 7.794   1.00 38.71  ? 177  PRO B O   1 
ATOM   4798 C  CB  . PRO C 1 177 ? -6.665  8.506  6.457   1.00 39.97  ? 177  PRO B CB  1 
ATOM   4799 C  CG  . PRO C 1 177 ? -6.031  7.553  7.435   1.00 41.11  ? 177  PRO B CG  1 
ATOM   4800 C  CD  . PRO C 1 177 ? -4.557  7.420  7.090   1.00 40.73  ? 177  PRO B CD  1 
ATOM   4801 N  N   . LEU C 1 178 ? -5.170  11.735 5.816   1.00 37.69  ? 178  LEU B N   1 
ATOM   4802 C  CA  . LEU C 1 178 ? -4.960  13.046 6.412   1.00 36.47  ? 178  LEU B CA  1 
ATOM   4803 C  C   . LEU C 1 178 ? -6.065  13.918 5.813   1.00 35.38  ? 178  LEU B C   1 
ATOM   4804 O  O   . LEU C 1 178 ? -5.927  14.396 4.685   1.00 33.50  ? 178  LEU B O   1 
ATOM   4805 C  CB  . LEU C 1 178 ? -3.543  13.532 6.065   1.00 36.43  ? 178  LEU B CB  1 
ATOM   4806 C  CG  . LEU C 1 178 ? -3.011  14.883 6.541   1.00 37.78  ? 178  LEU B CG  1 
ATOM   4807 C  CD1 . LEU C 1 178 ? -2.759  14.905 8.090   1.00 37.80  ? 178  LEU B CD1 1 
ATOM   4808 C  CD2 . LEU C 1 178 ? -1.747  15.232 5.791   1.00 37.75  ? 178  LEU B CD2 1 
ATOM   4809 N  N   . SER C 1 179 ? -7.178  14.087 6.540   1.00 34.64  ? 179  SER B N   1 
ATOM   4810 C  CA  . SER C 1 179 ? -8.299  14.852 6.009   1.00 34.80  ? 179  SER B CA  1 
ATOM   4811 C  C   . SER C 1 179 ? -7.967  16.325 5.885   1.00 34.40  ? 179  SER B C   1 
ATOM   4812 O  O   . SER C 1 179 ? -7.058  16.810 6.528   1.00 34.16  ? 179  SER B O   1 
ATOM   4813 C  CB  . SER C 1 179 ? -9.558  14.712 6.855   1.00 35.05  ? 179  SER B CB  1 
ATOM   4814 O  OG  . SER C 1 179 ? -9.332  15.194 8.156   1.00 35.31  ? 179  SER B OG  1 
ATOM   4815 N  N   . GLN C 1 180 ? -8.755  17.024 5.092   1.00 33.75  ? 180  GLN B N   1 
ATOM   4816 C  CA  . GLN C 1 180 ? -8.640  18.463 5.037   1.00 35.29  ? 180  GLN B CA  1 
ATOM   4817 C  C   . GLN C 1 180 ? -8.933  19.083 6.410   1.00 35.05  ? 180  GLN B C   1 
ATOM   4818 O  O   . GLN C 1 180 ? -8.251  20.000 6.816   1.00 35.51  ? 180  GLN B O   1 
ATOM   4819 C  CB  . GLN C 1 180 ? -9.505  19.073 3.946   1.00 33.25  ? 180  GLN B CB  1 
ATOM   4820 C  CG  . GLN C 1 180 ? -8.967  18.769 2.528   1.00 35.12  ? 180  GLN B CG  1 
ATOM   4821 C  CD  . GLN C 1 180 ? -9.471  19.756 1.482   1.00 36.03  ? 180  GLN B CD  1 
ATOM   4822 O  OE1 . GLN C 1 180 ? -9.983  20.812 1.841   1.00 38.49  ? 180  GLN B OE1 1 
ATOM   4823 N  NE2 . GLN C 1 180 ? -9.263  19.457 0.190   1.00 36.86  ? 180  GLN B NE2 1 
ATOM   4824 N  N   . LYS C 1 181 ? -9.926  18.558 7.113   1.00 36.47  ? 181  LYS B N   1 
ATOM   4825 C  CA  . LYS C 1 181 ? -10.242 19.029 8.477   1.00 36.47  ? 181  LYS B CA  1 
ATOM   4826 C  C   . LYS C 1 181 ? -9.013  18.949 9.385   1.00 35.98  ? 181  LYS B C   1 
ATOM   4827 O  O   . LYS C 1 181 ? -8.715  19.921 10.097  1.00 35.94  ? 181  LYS B O   1 
ATOM   4828 C  CB  . LYS C 1 181 ? -11.380 18.197 9.043   1.00 36.60  ? 181  LYS B CB  1 
ATOM   4829 C  CG  . LYS C 1 181 ? -11.756 18.415 10.528  1.00 37.13  ? 181  LYS B CG  1 
ATOM   4830 C  CD  . LYS C 1 181 ? -13.169 17.820 10.800  1.00 38.89  ? 181  LYS B CD  1 
ATOM   4831 C  CE  . LYS C 1 181 ? -13.677 18.040 12.235  1.00 40.79  ? 181  LYS B CE  1 
ATOM   4832 N  NZ  . LYS C 1 181 ? -13.359 16.935 13.178  1.00 43.01  ? 181  LYS B NZ  1 
ATOM   4833 N  N   . SER C 1 182 ? -8.305  17.799 9.354   1.00 35.14  ? 182  SER B N   1 
ATOM   4834 C  CA  . SER C 1 182 ? -7.160  17.559 10.241  1.00 34.96  ? 182  SER B CA  1 
ATOM   4835 C  C   . SER C 1 182 ? -5.956  18.467 9.914   1.00 34.70  ? 182  SER B C   1 
ATOM   4836 O  O   . SER C 1 182 ? -5.244  18.899 10.834  1.00 34.00  ? 182  SER B O   1 
ATOM   4837 C  CB  . SER C 1 182 ? -6.720  16.097 10.199  1.00 35.17  ? 182  SER B CB  1 
ATOM   4838 O  OG  . SER C 1 182 ? -7.700  15.258 10.762  1.00 34.40  ? 182  SER B OG  1 
ATOM   4839 N  N   . ILE C 1 183 ? -5.712  18.692 8.625   1.00 33.53  ? 183  ILE B N   1 
ATOM   4840 C  CA  . ILE C 1 183 ? -4.675  19.618 8.141   1.00 33.80  ? 183  ILE B CA  1 
ATOM   4841 C  C   . ILE C 1 183 ? -4.961  21.022 8.652   1.00 33.35  ? 183  ILE B C   1 
ATOM   4842 O  O   . ILE C 1 183 ? -4.050  21.733 9.084   1.00 32.91  ? 183  ILE B O   1 
ATOM   4843 C  CB  . ILE C 1 183 ? -4.629  19.660 6.563   1.00 33.43  ? 183  ILE B CB  1 
ATOM   4844 C  CG1 . ILE C 1 183 ? -4.105  18.343 5.985   1.00 35.43  ? 183  ILE B CG1 1 
ATOM   4845 C  CG2 . ILE C 1 183 ? -3.757  20.830 6.017   1.00 33.43  ? 183  ILE B CG2 1 
ATOM   4846 C  CD1 . ILE C 1 183 ? -4.455  18.129 4.484   1.00 33.74  ? 183  ILE B CD1 1 
ATOM   4847 N  N   . GLY C 1 184 ? -6.225  21.437 8.584   1.00 32.80  ? 184  GLY B N   1 
ATOM   4848 C  CA  . GLY C 1 184 ? -6.645  22.696 9.217   1.00 33.11  ? 184  GLY B CA  1 
ATOM   4849 C  C   . GLY C 1 184 ? -6.380  22.737 10.715  1.00 33.46  ? 184  GLY B C   1 
ATOM   4850 O  O   . GLY C 1 184 ? -5.819  23.686 11.221  1.00 31.37  ? 184  GLY B O   1 
ATOM   4851 N  N   . GLU C 1 185 ? -6.806  21.693 11.430  1.00 34.54  ? 185  GLU B N   1 
ATOM   4852 C  CA  . GLU C 1 185 ? -6.567  21.614 12.871  1.00 35.73  ? 185  GLU B CA  1 
ATOM   4853 C  C   . GLU C 1 185 ? -5.050  21.731 13.162  1.00 35.09  ? 185  GLU B C   1 
ATOM   4854 O  O   . GLU C 1 185 ? -4.651  22.443 14.053  1.00 35.63  ? 185  GLU B O   1 
ATOM   4855 C  CB  . GLU C 1 185 ? -7.197  20.337 13.529  1.00 35.43  ? 185  GLU B CB  1 
ATOM   4856 C  CG  . GLU C 1 185 ? -8.717  20.180 13.405  1.00 36.95  ? 185  GLU B CG  1 
ATOM   4857 C  CD  . GLU C 1 185 ? -9.278  18.773 13.793  1.00 38.25  ? 185  GLU B CD  1 
ATOM   4858 O  OE1 . GLU C 1 185 ? -8.558  17.731 13.684  1.00 43.52  ? 185  GLU B OE1 1 
ATOM   4859 O  OE2 . GLU C 1 185 ? -10.464 18.714 14.200  1.00 39.82  ? 185  GLU B OE2 1 
ATOM   4860 N  N   . ILE C 1 186 ? -4.228  21.071 12.367  1.00 35.52  ? 186  ILE B N   1 
ATOM   4861 C  CA  . ILE C 1 186 ? -2.818  20.945 12.617  1.00 36.13  ? 186  ILE B CA  1 
ATOM   4862 C  C   . ILE C 1 186 ? -2.086  22.243 12.301  1.00 36.39  ? 186  ILE B C   1 
ATOM   4863 O  O   . ILE C 1 186 ? -1.288  22.724 13.111  1.00 34.86  ? 186  ILE B O   1 
ATOM   4864 C  CB  . ILE C 1 186 ? -2.227  19.793 11.764  1.00 36.75  ? 186  ILE B CB  1 
ATOM   4865 C  CG1 . ILE C 1 186 ? -2.553  18.423 12.387  1.00 36.41  ? 186  ILE B CG1 1 
ATOM   4866 C  CG2 . ILE C 1 186 ? -0.734  19.934 11.571  1.00 35.86  ? 186  ILE B CG2 1 
ATOM   4867 C  CD1 . ILE C 1 186 ? -2.200  17.232 11.401  1.00 35.27  ? 186  ILE B CD1 1 
ATOM   4868 N  N   . THR C 1 187 ? -2.377  22.800 11.121  1.00 36.13  ? 187  THR B N   1 
ATOM   4869 C  CA  . THR C 1 187 ? -1.687  23.971 10.610  1.00 35.81  ? 187  THR B CA  1 
ATOM   4870 C  C   . THR C 1 187 ? -2.275  25.262 11.177  1.00 36.50  ? 187  THR B C   1 
ATOM   4871 O  O   . THR C 1 187 ? -1.647  26.296 11.106  1.00 36.77  ? 187  THR B O   1 
ATOM   4872 C  CB  . THR C 1 187 ? -1.761  24.028 9.091   1.00 36.27  ? 187  THR B CB  1 
ATOM   4873 O  OG1 . THR C 1 187 ? -3.140  24.092 8.664   1.00 32.17  ? 187  THR B OG1 1 
ATOM   4874 C  CG2 . THR C 1 187 ? -1.000  22.861 8.474   1.00 36.79  ? 187  THR B CG2 1 
ATOM   4875 N  N   . GLY C 1 188 ? -3.469  25.186 11.763  1.00 36.19  ? 188  GLY B N   1 
ATOM   4876 C  CA  . GLY C 1 188 ? -4.221  26.380 12.135  1.00 36.94  ? 188  GLY B CA  1 
ATOM   4877 C  C   . GLY C 1 188 ? -4.938  27.124 11.013  1.00 36.89  ? 188  GLY B C   1 
ATOM   4878 O  O   . GLY C 1 188 ? -5.688  28.081 11.284  1.00 40.72  ? 188  GLY B O   1 
ATOM   4879 N  N   . VAL C 1 189 ? -4.785  26.662 9.770   1.00 35.54  ? 189  VAL B N   1 
ATOM   4880 C  CA  . VAL C 1 189 ? -5.269  27.357 8.613   1.00 33.61  ? 189  VAL B CA  1 
ATOM   4881 C  C   . VAL C 1 189 ? -6.769  27.072 8.411   1.00 33.66  ? 189  VAL B C   1 
ATOM   4882 O  O   . VAL C 1 189 ? -7.232  25.932 8.569   1.00 32.01  ? 189  VAL B O   1 
ATOM   4883 C  CB  . VAL C 1 189 ? -4.418  26.959 7.333   1.00 34.02  ? 189  VAL B CB  1 
ATOM   4884 C  CG1 . VAL C 1 189 ? -4.880  27.727 6.059   1.00 33.06  ? 189  VAL B CG1 1 
ATOM   4885 C  CG2 . VAL C 1 189 ? -2.908  27.216 7.589   1.00 29.29  ? 189  VAL B CG2 1 
ATOM   4886 N  N   . HIS C 1 190 ? -7.509  28.115 8.017   1.00 32.99  ? 190  HIS B N   1 
ATOM   4887 C  CA  . HIS C 1 190 ? -8.954  28.012 7.796   1.00 33.49  ? 190  HIS B CA  1 
ATOM   4888 C  C   . HIS C 1 190 ? -9.277  27.198 6.560   1.00 31.08  ? 190  HIS B C   1 
ATOM   4889 O  O   . HIS C 1 190 ? -8.441  27.048 5.657   1.00 30.58  ? 190  HIS B O   1 
ATOM   4890 C  CB  . HIS C 1 190 ? -9.618  29.408 7.745   1.00 34.11  ? 190  HIS B CB  1 
ATOM   4891 C  CG  . HIS C 1 190 ? -9.518  30.168 9.039   1.00 40.58  ? 190  HIS B CG  1 
ATOM   4892 N  ND1 . HIS C 1 190 ? -9.102  31.490 9.108   1.00 42.85  ? 190  HIS B ND1 1 
ATOM   4893 C  CD2 . HIS C 1 190 ? -9.789  29.791 10.315  1.00 44.02  ? 190  HIS B CD2 1 
ATOM   4894 C  CE1 . HIS C 1 190 ? -9.136  31.890 10.366  1.00 44.40  ? 190  HIS B CE1 1 
ATOM   4895 N  NE2 . HIS C 1 190 ? -9.560  30.884 11.117  1.00 45.50  ? 190  HIS B NE2 1 
ATOM   4896 N  N   . HIS C 1 191 ? -10.495 26.656 6.531   1.00 30.47  ? 191  HIS B N   1 
ATOM   4897 C  CA  . HIS C 1 191 ? -10.814 25.569 5.580   1.00 30.36  ? 191  HIS B CA  1 
ATOM   4898 C  C   . HIS C 1 191 ? -10.738 26.003 4.088   1.00 29.16  ? 191  HIS B C   1 
ATOM   4899 O  O   . HIS C 1 191 ? -10.259 25.253 3.256   1.00 29.13  ? 191  HIS B O   1 
ATOM   4900 C  CB  . HIS C 1 191 ? -12.166 24.919 5.924   1.00 30.74  ? 191  HIS B CB  1 
ATOM   4901 C  CG  . HIS C 1 191 ? -13.372 25.673 5.422   1.00 34.51  ? 191  HIS B CG  1 
ATOM   4902 N  ND1 . HIS C 1 191 ? -13.955 26.708 6.123   1.00 36.34  ? 191  HIS B ND1 1 
ATOM   4903 C  CD2 . HIS C 1 191 ? -14.100 25.537 4.286   1.00 37.79  ? 191  HIS B CD2 1 
ATOM   4904 C  CE1 . HIS C 1 191 ? -14.984 27.173 5.448   1.00 38.17  ? 191  HIS B CE1 1 
ATOM   4905 N  NE2 . HIS C 1 191 ? -15.086 26.495 4.320   1.00 39.59  ? 191  HIS B NE2 1 
ATOM   4906 N  N   . VAL C 1 192 ? -11.195 27.211 3.758   1.00 28.42  ? 192  VAL B N   1 
ATOM   4907 C  CA  . VAL C 1 192 ? -11.115 27.671 2.348   1.00 29.53  ? 192  VAL B CA  1 
ATOM   4908 C  C   . VAL C 1 192 ? -9.652  27.711 1.837   1.00 29.49  ? 192  VAL B C   1 
ATOM   4909 O  O   . VAL C 1 192 ? -9.365  27.314 0.694   1.00 28.15  ? 192  VAL B O   1 
ATOM   4910 C  CB  . VAL C 1 192 ? -11.824 29.035 2.137   1.00 29.38  ? 192  VAL B CB  1 
ATOM   4911 C  CG1 . VAL C 1 192 ? -11.833 29.455 0.673   1.00 26.14  ? 192  VAL B CG1 1 
ATOM   4912 C  CG2 . VAL C 1 192 ? -13.266 28.910 2.607   1.00 29.31  ? 192  VAL B CG2 1 
ATOM   4913 N  N   . THR C 1 193 ? -8.726  28.198 2.677   1.00 28.73  ? 193  THR B N   1 
ATOM   4914 C  CA  . THR C 1 193 ? -7.321  28.221 2.248   1.00 29.68  ? 193  THR B CA  1 
ATOM   4915 C  C   . THR C 1 193 ? -6.808  26.780 2.088   1.00 29.29  ? 193  THR B C   1 
ATOM   4916 O  O   . THR C 1 193 ? -6.093  26.488 1.130   1.00 30.03  ? 193  THR B O   1 
ATOM   4917 C  CB  . THR C 1 193 ? -6.423  28.984 3.229   1.00 29.69  ? 193  THR B CB  1 
ATOM   4918 O  OG1 . THR C 1 193 ? -6.954  30.296 3.324   1.00 30.27  ? 193  THR B OG1 1 
ATOM   4919 C  CG2 . THR C 1 193 ? -4.949  29.058 2.779   1.00 27.93  ? 193  THR B CG2 1 
ATOM   4920 N  N   . VAL C 1 194 ? -7.234  25.874 2.962   1.00 29.35  ? 194  VAL B N   1 
ATOM   4921 C  CA  . VAL C 1 194 ? -6.775  24.456 2.881   1.00 28.79  ? 194  VAL B CA  1 
ATOM   4922 C  C   . VAL C 1 194 ? -7.256  23.882 1.562   1.00 28.41  ? 194  VAL B C   1 
ATOM   4923 O  O   . VAL C 1 194 ? -6.465  23.341 0.785   1.00 28.13  ? 194  VAL B O   1 
ATOM   4924 C  CB  . VAL C 1 194 ? -7.237  23.580 4.089   1.00 28.49  ? 194  VAL B CB  1 
ATOM   4925 C  CG1 . VAL C 1 194 ? -6.991  22.043 3.823   1.00 29.34  ? 194  VAL B CG1 1 
ATOM   4926 C  CG2 . VAL C 1 194 ? -6.578  24.023 5.414   1.00 30.54  ? 194  VAL B CG2 1 
ATOM   4927 N  N   . SER C 1 195 ? -8.555  24.056 1.287   1.00 29.13  ? 195  SER B N   1 
ATOM   4928 C  CA  . SER C 1 195 ? -9.162  23.659 -0.004  1.00 30.19  ? 195  SER B CA  1 
ATOM   4929 C  C   . SER C 1 195 ? -8.441  24.206 -1.218  1.00 30.60  ? 195  SER B C   1 
ATOM   4930 O  O   . SER C 1 195 ? -8.032  23.438 -2.058  1.00 30.30  ? 195  SER B O   1 
ATOM   4931 C  CB  . SER C 1 195 ? -10.614 24.050 -0.068  1.00 29.87  ? 195  SER B CB  1 
ATOM   4932 O  OG  . SER C 1 195 ? -11.235 23.315 0.958   1.00 37.24  ? 195  SER B OG  1 
ATOM   4933 N  N   . ARG C 1 196 ? -8.225  25.523 -1.232  1.00 31.32  ? 196  ARG B N   1 
ATOM   4934 C  CA  . ARG C 1 196 ? -7.577  26.222 -2.343  1.00 31.28  ? 196  ARG B CA  1 
ATOM   4935 C  C   . ARG C 1 196 ? -6.145  25.694 -2.598  1.00 30.96  ? 196  ARG B C   1 
ATOM   4936 O  O   . ARG C 1 196 ? -5.785  25.447 -3.722  1.00 30.72  ? 196  ARG B O   1 
ATOM   4937 C  CB  . ARG C 1 196 ? -7.531  27.717 -2.072  1.00 30.53  ? 196  ARG B CB  1 
ATOM   4938 C  CG  . ARG C 1 196 ? -7.074  28.487 -3.425  1.00 33.21  ? 196  ARG B CG  1 
ATOM   4939 C  CD  . ARG C 1 196 ? -7.037  29.938 -3.321  1.00 36.11  ? 196  ARG B CD  1 
ATOM   4940 N  NE  . ARG C 1 196 ? -6.449  30.339 -2.058  1.00 43.41  ? 196  ARG B NE  1 
ATOM   4941 C  CZ  . ARG C 1 196 ? -7.146  30.840 -1.031  1.00 45.27  ? 196  ARG B CZ  1 
ATOM   4942 N  NH1 . ARG C 1 196 ? -8.487  31.006 -1.079  1.00 47.01  ? 196  ARG B NH1 1 
ATOM   4943 N  NH2 . ARG C 1 196 ? -6.471  31.205 0.049   1.00 44.90  ? 196  ARG B NH2 1 
ATOM   4944 N  N   . VAL C 1 197 ? -5.354  25.491 -1.537  1.00 30.65  ? 197  VAL B N   1 
ATOM   4945 C  CA  . VAL C 1 197 ? -3.971  25.020 -1.672  1.00 30.29  ? 197  VAL B CA  1 
ATOM   4946 C  C   . VAL C 1 197 ? -3.939  23.578 -2.155  1.00 31.51  ? 197  VAL B C   1 
ATOM   4947 O  O   . VAL C 1 197 ? -3.253  23.231 -3.103  1.00 32.86  ? 197  VAL B O   1 
ATOM   4948 C  CB  . VAL C 1 197 ? -3.118  25.265 -0.341  1.00 31.15  ? 197  VAL B CB  1 
ATOM   4949 C  CG1 . VAL C 1 197 ? -1.737  24.583 -0.421  1.00 28.10  ? 197  VAL B CG1 1 
ATOM   4950 C  CG2 . VAL C 1 197 ? -2.986  26.793 -0.064  1.00 23.77  ? 197  VAL B CG2 1 
ATOM   4951 N  N   . LEU C 1 198 ? -4.745  22.727 -1.562  1.00 31.89  ? 198  LEU B N   1 
ATOM   4952 C  CA  . LEU C 1 198 ? -4.823  21.361 -2.035  1.00 32.30  ? 198  LEU B CA  1 
ATOM   4953 C  C   . LEU C 1 198 ? -5.224  21.255 -3.516  1.00 31.01  ? 198  LEU B C   1 
ATOM   4954 O  O   . LEU C 1 198 ? -4.596  20.512 -4.313  1.00 28.57  ? 198  LEU B O   1 
ATOM   4955 C  CB  . LEU C 1 198 ? -5.698  20.515 -1.082  1.00 32.51  ? 198  LEU B CB  1 
ATOM   4956 C  CG  . LEU C 1 198 ? -4.863  19.947 0.106   1.00 33.94  ? 198  LEU B CG  1 
ATOM   4957 C  CD1 . LEU C 1 198 ? -4.097  21.016 0.964   1.00 37.28  ? 198  LEU B CD1 1 
ATOM   4958 C  CD2 . LEU C 1 198 ? -5.772  19.164 0.986   1.00 33.46  ? 198  LEU B CD2 1 
ATOM   4959 N  N   . ALA C 1 199 ? -6.211  22.051 -3.899  1.00 29.77  ? 199  ALA B N   1 
ATOM   4960 C  CA  . ALA C 1 199 ? -6.643  22.103 -5.252  1.00 30.48  ? 199  ALA B CA  1 
ATOM   4961 C  C   . ALA C 1 199 ? -5.548  22.609 -6.202  1.00 30.30  ? 199  ALA B C   1 
ATOM   4962 O  O   . ALA C 1 199 ? -5.454  22.124 -7.335  1.00 31.25  ? 199  ALA B O   1 
ATOM   4963 C  CB  . ALA C 1 199 ? -7.985  22.928 -5.383  1.00 29.65  ? 199  ALA B CB  1 
ATOM   4964 N  N   . CYS C 1 200 ? -4.742  23.592 -5.795  1.00 30.71  ? 200  CYS B N   1 
ATOM   4965 C  CA  . CYS C 1 200 ? -3.655  24.026 -6.702  1.00 33.54  ? 200  CYS B CA  1 
ATOM   4966 C  C   . CYS C 1 200 ? -2.620  22.980 -6.901  1.00 32.19  ? 200  CYS B C   1 
ATOM   4967 O  O   . CYS C 1 200 ? -2.162  22.851 -8.003  1.00 30.32  ? 200  CYS B O   1 
ATOM   4968 C  CB  . CYS C 1 200 ? -2.868  25.209 -6.225  1.00 34.92  ? 200  CYS B CB  1 
ATOM   4969 S  SG  . CYS C 1 200 ? -3.881  26.390 -5.702  1.00 47.98  ? 200  CYS B SG  1 
ATOM   4970 N  N   . LEU C 1 201 ? -2.203  22.340 -5.798  1.00 30.66  ? 201  LEU B N   1 
ATOM   4971 C  CA  . LEU C 1 201 ? -1.184  21.330 -5.803  1.00 31.00  ? 201  LEU B CA  1 
ATOM   4972 C  C   . LEU C 1 201 ? -1.589  20.213 -6.758  1.00 31.55  ? 201  LEU B C   1 
ATOM   4973 O  O   . LEU C 1 201 ? -0.756  19.645 -7.487  1.00 31.74  ? 201  LEU B O   1 
ATOM   4974 C  CB  . LEU C 1 201 ? -0.944  20.808 -4.370  1.00 30.43  ? 201  LEU B CB  1 
ATOM   4975 C  CG  . LEU C 1 201 ? -0.152  21.655 -3.359  1.00 32.92  ? 201  LEU B CG  1 
ATOM   4976 C  CD1 . LEU C 1 201 ? -0.147  20.909 -1.972  1.00 29.04  ? 201  LEU B CD1 1 
ATOM   4977 C  CD2 . LEU C 1 201 ? 1.362   21.853 -3.808  1.00 28.85  ? 201  LEU B CD2 1 
ATOM   4978 N  N   . LYS C 1 202 ? -2.868  19.901 -6.799  1.00 30.78  ? 202  LYS B N   1 
ATOM   4979 C  CA  . LYS C 1 202 ? -3.322  18.830 -7.669  1.00 30.55  ? 202  LYS B CA  1 
ATOM   4980 C  C   . LYS C 1 202 ? -3.373  19.287 -9.137  1.00 29.83  ? 202  LYS B C   1 
ATOM   4981 O  O   . LYS C 1 202 ? -2.936  18.557 -10.023 1.00 26.88  ? 202  LYS B O   1 
ATOM   4982 C  CB  . LYS C 1 202 ? -4.665  18.304 -7.158  1.00 31.30  ? 202  LYS B CB  1 
ATOM   4983 C  CG  . LYS C 1 202 ? -5.340  17.343 -8.091  1.00 31.31  ? 202  LYS B CG  1 
ATOM   4984 C  CD  . LYS C 1 202 ? -6.698  16.965 -7.518  1.00 33.60  ? 202  LYS B CD  1 
ATOM   4985 C  CE  . LYS C 1 202 ? -7.348  15.798 -8.294  1.00 35.06  ? 202  LYS B CE  1 
ATOM   4986 N  NZ  . LYS C 1 202 ? -8.586  15.416 -7.590  1.00 38.45  ? 202  LYS B NZ  1 
ATOM   4987 N  N   . ARG C 1 203 ? -3.870  20.511 -9.357  1.00 29.96  ? 203  ARG B N   1 
ATOM   4988 C  CA  . ARG C 1 203 ? -3.976  21.160 -10.694 1.00 30.31  ? 203  ARG B CA  1 
ATOM   4989 C  C   . ARG C 1 203 ? -2.573  21.416 -11.301 1.00 30.84  ? 203  ARG B C   1 
ATOM   4990 O  O   . ARG C 1 203 ? -2.394  21.358 -12.496 1.00 30.57  ? 203  ARG B O   1 
ATOM   4991 C  CB  . ARG C 1 203 ? -4.770  22.484 -10.568 1.00 29.90  ? 203  ARG B CB  1 
ATOM   4992 C  CG  . ARG C 1 203 ? -4.902  23.368 -11.767 1.00 30.95  ? 203  ARG B CG  1 
ATOM   4993 C  CD  . ARG C 1 203 ? -5.687  24.715 -11.531 1.00 30.51  ? 203  ARG B CD  1 
ATOM   4994 N  NE  . ARG C 1 203 ? -6.942  24.515 -10.803 1.00 29.12  ? 203  ARG B NE  1 
ATOM   4995 C  CZ  . ARG C 1 203 ? -7.152  24.826 -9.530  1.00 28.50  ? 203  ARG B CZ  1 
ATOM   4996 N  NH1 . ARG C 1 203 ? -6.217  25.405 -8.820  1.00 29.19  ? 203  ARG B NH1 1 
ATOM   4997 N  NH2 . ARG C 1 203 ? -8.312  24.572 -8.959  1.00 29.24  ? 203  ARG B NH2 1 
ATOM   4998 N  N   . GLU C 1 204 ? -1.601  21.708 -10.458 1.00 31.95  ? 204  GLU B N   1 
ATOM   4999 C  CA  . GLU C 1 204 ? -0.216  21.871 -10.886 1.00 35.14  ? 204  GLU B CA  1 
ATOM   5000 C  C   . GLU C 1 204 ? 0.627   20.589 -10.961 1.00 34.75  ? 204  GLU B C   1 
ATOM   5001 O  O   . GLU C 1 204 ? 1.789   20.655 -11.341 1.00 34.76  ? 204  GLU B O   1 
ATOM   5002 C  CB  . GLU C 1 204 ? 0.476   22.896 -10.010 1.00 34.78  ? 204  GLU B CB  1 
ATOM   5003 C  CG  . GLU C 1 204 ? -0.159  24.277 -10.171 1.00 38.21  ? 204  GLU B CG  1 
ATOM   5004 C  CD  . GLU C 1 204 ? 0.452   25.367 -9.257  1.00 41.17  ? 204  GLU B CD  1 
ATOM   5005 O  OE1 . GLU C 1 204 ? 1.131   25.021 -8.216  1.00 47.69  ? 204  GLU B OE1 1 
ATOM   5006 O  OE2 . GLU C 1 204 ? 0.231   26.571 -9.595  1.00 49.25  ? 204  GLU B OE2 1 
ATOM   5007 N  N   . ASN C 1 205 ? 0.024   19.446 -10.617 1.00 35.21  ? 205  ASN B N   1 
ATOM   5008 C  CA  . ASN C 1 205 ? 0.581   18.119 -10.823 1.00 35.27  ? 205  ASN B CA  1 
ATOM   5009 C  C   . ASN C 1 205 ? 1.740   17.950 -9.892  1.00 34.74  ? 205  ASN B C   1 
ATOM   5010 O  O   . ASN C 1 205 ? 2.768   17.403 -10.263 1.00 33.59  ? 205  ASN B O   1 
ATOM   5011 C  CB  . ASN C 1 205 ? 1.011   17.877 -12.278 1.00 35.28  ? 205  ASN B CB  1 
ATOM   5012 C  CG  . ASN C 1 205 ? -0.118  18.162 -13.301 1.00 39.64  ? 205  ASN B CG  1 
ATOM   5013 O  OD1 . ASN C 1 205 ? -1.235  17.604 -13.204 1.00 44.36  ? 205  ASN B OD1 1 
ATOM   5014 N  ND2 . ASN C 1 205 ? 0.182   19.029 -14.307 1.00 37.14  ? 205  ASN B ND2 1 
ATOM   5015 N  N   . ILE C 1 206 ? 1.566   18.456 -8.683  1.00 34.17  ? 206  ILE B N   1 
ATOM   5016 C  CA  . ILE C 1 206 ? 2.586   18.455 -7.653  1.00 34.69  ? 206  ILE B CA  1 
ATOM   5017 C  C   . ILE C 1 206 ? 2.213   17.355 -6.652  1.00 35.69  ? 206  ILE B C   1 
ATOM   5018 O  O   . ILE C 1 206 ? 2.952   16.382 -6.505  1.00 34.61  ? 206  ILE B O   1 
ATOM   5019 C  CB  . ILE C 1 206 ? 2.708   19.829 -6.969  1.00 34.61  ? 206  ILE B CB  1 
ATOM   5020 C  CG1 . ILE C 1 206 ? 3.358   20.841 -7.909  1.00 34.70  ? 206  ILE B CG1 1 
ATOM   5021 C  CG2 . ILE C 1 206 ? 3.565   19.746 -5.696  1.00 33.53  ? 206  ILE B CG2 1 
ATOM   5022 C  CD1 . ILE C 1 206 ? 2.900   22.231 -7.669  1.00 38.05  ? 206  ILE B CD1 1 
ATOM   5023 N  N   . LEU C 1 207 ? 1.057   17.491 -5.990  1.00 35.74  ? 207  LEU B N   1 
ATOM   5024 C  CA  . LEU C 1 207 ? 0.529   16.384 -5.186  1.00 35.82  ? 207  LEU B CA  1 
ATOM   5025 C  C   . LEU C 1 207 ? -0.994  16.281 -5.187  1.00 36.77  ? 207  LEU B C   1 
ATOM   5026 O  O   . LEU C 1 207 ? -1.695  17.254 -5.444  1.00 35.09  ? 207  LEU B O   1 
ATOM   5027 C  CB  . LEU C 1 207 ? 1.083   16.373 -3.755  1.00 35.65  ? 207  LEU B CB  1 
ATOM   5028 C  CG  . LEU C 1 207 ? 0.623   17.366 -2.704  1.00 36.53  ? 207  LEU B CG  1 
ATOM   5029 C  CD1 . LEU C 1 207 ? -0.797  17.214 -2.130  1.00 33.79  ? 207  LEU B CD1 1 
ATOM   5030 C  CD2 . LEU C 1 207 ? 1.627   17.263 -1.553  1.00 33.93  ? 207  LEU B CD2 1 
ATOM   5031 N  N   . ASP C 1 208 ? -1.473  15.088 -4.853  1.00 38.19  ? 208  ASP B N   1 
ATOM   5032 C  CA  . ASP C 1 208 ? -2.886  14.776 -4.888  1.00 40.00  ? 208  ASP B CA  1 
ATOM   5033 C  C   . ASP C 1 208 ? -3.210  14.169 -3.549  1.00 40.93  ? 208  ASP B C   1 
ATOM   5034 O  O   . ASP C 1 208 ? -2.896  13.019 -3.283  1.00 41.34  ? 208  ASP B O   1 
ATOM   5035 C  CB  . ASP C 1 208 ? -3.228  13.818 -6.037  1.00 39.70  ? 208  ASP B CB  1 
ATOM   5036 C  CG  . ASP C 1 208 ? -4.719  13.771 -6.341  1.00 41.48  ? 208  ASP B CG  1 
ATOM   5037 O  OD1 . ASP C 1 208 ? -5.525  14.301 -5.511  1.00 42.81  ? 208  ASP B OD1 1 
ATOM   5038 O  OD2 . ASP C 1 208 ? -5.082  13.206 -7.425  1.00 42.33  ? 208  ASP B OD2 1 
ATOM   5039 N  N   . LYS C 1 209 ? -3.759  15.021 -2.683  1.00 42.64  ? 209  LYS B N   1 
ATOM   5040 C  CA  . LYS C 1 209 ? -4.176  14.674 -1.340  1.00 43.64  ? 209  LYS B CA  1 
ATOM   5041 C  C   . LYS C 1 209 ? -5.534  13.945 -1.447  1.00 44.80  ? 209  LYS B C   1 
ATOM   5042 O  O   . LYS C 1 209 ? -6.610  14.568 -1.548  1.00 44.72  ? 209  LYS B O   1 
ATOM   5043 C  CB  . LYS C 1 209 ? -4.268  15.941 -0.473  1.00 43.76  ? 209  LYS B CB  1 
ATOM   5044 C  CG  . LYS C 1 209 ? -3.931  15.736 1.013   1.00 42.72  ? 209  LYS B CG  1 
ATOM   5045 C  CD  . LYS C 1 209 ? -4.844  14.774 1.733   1.00 42.41  ? 209  LYS B CD  1 
ATOM   5046 C  CE  . LYS C 1 209 ? -6.253  15.272 1.872   1.00 41.48  ? 209  LYS B CE  1 
ATOM   5047 N  NZ  . LYS C 1 209 ? -7.132  14.113 2.178   1.00 43.25  ? 209  LYS B NZ  1 
ATOM   5048 N  N   . LYS C 1 210 ? -5.456  12.624 -1.460  1.00 45.17  ? 210  LYS B N   1 
ATOM   5049 C  CA  . LYS C 1 210 ? -6.626  11.771 -1.581  1.00 46.23  ? 210  LYS B CA  1 
ATOM   5050 C  C   . LYS C 1 210 ? -7.165  11.436 -0.190  1.00 46.18  ? 210  LYS B C   1 
ATOM   5051 O  O   . LYS C 1 210 ? -6.625  11.917 0.805   1.00 44.69  ? 210  LYS B O   1 
ATOM   5052 C  CB  . LYS C 1 210 ? -6.248  10.525 -2.393  1.00 45.95  ? 210  LYS B CB  1 
ATOM   5053 C  CG  . LYS C 1 210 ? -5.904  10.877 -3.867  1.00 47.22  ? 210  LYS B CG  1 
ATOM   5054 C  CD  . LYS C 1 210 ? -4.981  9.853  -4.511  1.00 47.18  ? 210  LYS B CD  1 
ATOM   5055 C  CE  . LYS C 1 210 ? -5.755  8.705  -5.121  1.00 48.09  ? 210  LYS B CE  1 
ATOM   5056 N  NZ  . LYS C 1 210 ? -6.603  9.156  -6.257  1.00 45.09  ? 210  LYS B NZ  1 
ATOM   5057 N  N   . LYS C 1 211 ? -8.208  10.609 -0.108  1.00 46.69  ? 211  LYS B N   1 
ATOM   5058 C  CA  . LYS C 1 211 ? -8.752  10.197 1.206   1.00 47.41  ? 211  LYS B CA  1 
ATOM   5059 C  C   . LYS C 1 211 ? -7.824  9.293  2.035   1.00 48.06  ? 211  LYS B C   1 
ATOM   5060 O  O   . LYS C 1 211 ? -7.599  9.550  3.237   1.00 48.16  ? 211  LYS B O   1 
ATOM   5061 C  CB  . LYS C 1 211 ? -10.122 9.514  1.071   1.00 47.55  ? 211  LYS B CB  1 
ATOM   5062 C  CG  . LYS C 1 211 ? -10.783 9.230  2.434   1.00 46.78  ? 211  LYS B CG  1 
ATOM   5063 C  CD  . LYS C 1 211 ? -12.323 9.309  2.403   1.00 48.36  ? 211  LYS B CD  1 
ATOM   5064 C  CE  . LYS C 1 211 ? -12.961 8.845  3.751   1.00 48.50  ? 211  LYS B CE  1 
ATOM   5065 N  NZ  . LYS C 1 211 ? -12.725 7.393  4.087   1.00 48.21  ? 211  LYS B NZ  1 
ATOM   5066 N  N   . ASN C 1 212 ? -7.341  8.214  1.411   1.00 48.62  ? 212  ASN B N   1 
ATOM   5067 C  CA  . ASN C 1 212 ? -6.494  7.218  2.087   1.00 48.22  ? 212  ASN B CA  1 
ATOM   5068 C  C   . ASN C 1 212 ? -4.972  7.335  1.772   1.00 48.18  ? 212  ASN B C   1 
ATOM   5069 O  O   . ASN C 1 212 ? -4.184  6.451  2.182   1.00 49.17  ? 212  ASN B O   1 
ATOM   5070 C  CB  . ASN C 1 212 ? -6.973  5.791  1.736   1.00 48.58  ? 212  ASN B CB  1 
ATOM   5071 C  CG  . ASN C 1 212 ? -8.454  5.556  2.049   1.00 49.31  ? 212  ASN B CG  1 
ATOM   5072 O  OD1 . ASN C 1 212 ? -8.975  6.041  3.051   1.00 51.48  ? 212  ASN B OD1 1 
ATOM   5073 N  ND2 . ASN C 1 212 ? -9.129  4.798  1.193   1.00 47.38  ? 212  ASN B ND2 1 
ATOM   5074 N  N   . LYS C 1 213 ? -4.558  8.385  1.051   1.00 46.69  ? 213  LYS B N   1 
ATOM   5075 C  CA  . LYS C 1 213 ? -3.211  8.429  0.453   1.00 45.91  ? 213  LYS B CA  1 
ATOM   5076 C  C   . LYS C 1 213 ? -2.859  9.837  -0.072  1.00 44.32  ? 213  LYS B C   1 
ATOM   5077 O  O   . LYS C 1 213 ? -3.732  10.587 -0.555  1.00 42.96  ? 213  LYS B O   1 
ATOM   5078 C  CB  . LYS C 1 213 ? -3.114  7.385  -0.684  1.00 46.28  ? 213  LYS B CB  1 
ATOM   5079 C  CG  . LYS C 1 213 ? -1.705  6.845  -1.028  1.00 46.39  ? 213  LYS B CG  1 
ATOM   5080 C  CD  . LYS C 1 213 ? -1.774  5.602  -1.977  1.00 46.31  ? 213  LYS B CD  1 
ATOM   5081 C  CE  . LYS C 1 213 ? -1.650  4.228  -1.182  1.00 46.80  ? 213  LYS B CE  1 
ATOM   5082 N  NZ  . LYS C 1 213 ? -1.666  2.927  -1.999  1.00 45.62  ? 213  LYS B NZ  1 
ATOM   5083 N  N   . ILE C 1 214 ? -1.584  10.215 0.073   1.00 41.76  ? 214  ILE B N   1 
ATOM   5084 C  CA  . ILE C 1 214 ? -1.068  11.413 -0.579  1.00 40.66  ? 214  ILE B CA  1 
ATOM   5085 C  C   . ILE C 1 214 ? -0.014  10.959 -1.541  1.00 39.58  ? 214  ILE B C   1 
ATOM   5086 O  O   . ILE C 1 214 ? 0.922   10.239 -1.156  1.00 39.23  ? 214  ILE B O   1 
ATOM   5087 C  CB  . ILE C 1 214 ? -0.484  12.437 0.430   1.00 40.67  ? 214  ILE B CB  1 
ATOM   5088 C  CG1 . ILE C 1 214 ? -1.555  12.838 1.473   1.00 42.61  ? 214  ILE B CG1 1 
ATOM   5089 C  CG2 . ILE C 1 214 ? 0.143   13.633 -0.275  1.00 37.99  ? 214  ILE B CG2 1 
ATOM   5090 C  CD1 . ILE C 1 214 ? -0.943  13.265 2.842   1.00 40.47  ? 214  ILE B CD1 1 
ATOM   5091 N  N   . ILE C 1 215 ? -0.207  11.323 -2.798  1.00 38.46  ? 215  ILE B N   1 
ATOM   5092 C  CA  . ILE C 1 215 ? 0.755   11.032 -3.863  1.00 38.58  ? 215  ILE B CA  1 
ATOM   5093 C  C   . ILE C 1 215 ? 1.482   12.314 -4.268  1.00 37.14  ? 215  ILE B C   1 
ATOM   5094 O  O   . ILE C 1 215 ? 0.851   13.299 -4.666  1.00 37.82  ? 215  ILE B O   1 
ATOM   5095 C  CB  . ILE C 1 215 ? 0.116   10.458 -5.132  1.00 38.58  ? 215  ILE B CB  1 
ATOM   5096 C  CG1 . ILE C 1 215 ? -0.563  9.119  -4.849  1.00 39.31  ? 215  ILE B CG1 1 
ATOM   5097 C  CG2 . ILE C 1 215 ? 1.178   10.231 -6.200  1.00 38.57  ? 215  ILE B CG2 1 
ATOM   5098 C  CD1 . ILE C 1 215 ? -1.630  8.793  -5.869  1.00 39.99  ? 215  ILE B CD1 1 
ATOM   5099 N  N   . VAL C 1 216 ? 2.807   12.291 -4.150  1.00 35.44  ? 216  VAL B N   1 
ATOM   5100 C  CA  . VAL C 1 216 ? 3.645   13.419 -4.519  1.00 34.25  ? 216  VAL B CA  1 
ATOM   5101 C  C   . VAL C 1 216 ? 4.310   13.121 -5.858  1.00 34.50  ? 216  VAL B C   1 
ATOM   5102 O  O   . VAL C 1 216 ? 5.169   12.238 -5.992  1.00 33.89  ? 216  VAL B O   1 
ATOM   5103 C  CB  . VAL C 1 216 ? 4.674   13.779 -3.409  1.00 34.33  ? 216  VAL B CB  1 
ATOM   5104 C  CG1 . VAL C 1 216 ? 5.568   14.961 -3.873  1.00 32.24  ? 216  VAL B CG1 1 
ATOM   5105 C  CG2 . VAL C 1 216 ? 3.935   14.110 -2.083  1.00 32.45  ? 216  VAL B CG2 1 
ATOM   5106 N  N   . TYR C 1 217 ? 3.859   13.884 -6.851  1.00 34.52  ? 217  TYR B N   1 
ATOM   5107 C  CA  . TYR C 1 217 ? 4.248   13.754 -8.244  1.00 34.05  ? 217  TYR B CA  1 
ATOM   5108 C  C   . TYR C 1 217 ? 5.586   14.438 -8.494  1.00 33.65  ? 217  TYR B C   1 
ATOM   5109 O  O   . TYR C 1 217 ? 6.362   14.018 -9.360  1.00 33.30  ? 217  TYR B O   1 
ATOM   5110 C  CB  . TYR C 1 217 ? 3.150   14.374 -9.139  1.00 34.27  ? 217  TYR B CB  1 
ATOM   5111 C  CG  . TYR C 1 217 ? 1.882   13.571 -9.091  1.00 35.04  ? 217  TYR B CG  1 
ATOM   5112 C  CD1 . TYR C 1 217 ? 1.856   12.293 -9.652  1.00 37.79  ? 217  TYR B CD1 1 
ATOM   5113 C  CD2 . TYR C 1 217 ? 0.730   14.039 -8.458  1.00 36.50  ? 217  TYR B CD2 1 
ATOM   5114 C  CE1 . TYR C 1 217 ? 0.724   11.486 -9.612  1.00 39.33  ? 217  TYR B CE1 1 
ATOM   5115 C  CE2 . TYR C 1 217 ? -0.438  13.234 -8.400  1.00 39.50  ? 217  TYR B CE2 1 
ATOM   5116 C  CZ  . TYR C 1 217 ? -0.431  11.943 -8.993  1.00 39.35  ? 217  TYR B CZ  1 
ATOM   5117 O  OH  . TYR C 1 217 ? -1.534  11.076 -9.006  1.00 38.79  ? 217  TYR B OH  1 
ATOM   5118 N  N   . ASN C 1 218 ? 5.841   15.501 -7.742  1.00 33.26  ? 218  ASN B N   1 
ATOM   5119 C  CA  . ASN C 1 218 ? 6.961   16.371 -8.021  1.00 33.51  ? 218  ASN B CA  1 
ATOM   5120 C  C   . ASN C 1 218 ? 7.426   16.949 -6.707  1.00 33.89  ? 218  ASN B C   1 
ATOM   5121 O  O   . ASN C 1 218 ? 6.977   18.014 -6.272  1.00 33.27  ? 218  ASN B O   1 
ATOM   5122 C  CB  . ASN C 1 218 ? 6.523   17.457 -8.995  1.00 33.59  ? 218  ASN B CB  1 
ATOM   5123 C  CG  . ASN C 1 218 ? 7.677   18.237 -9.579  1.00 34.25  ? 218  ASN B CG  1 
ATOM   5124 O  OD1 . ASN C 1 218 ? 8.814   18.198 -9.089  1.00 34.71  ? 218  ASN B OD1 1 
ATOM   5125 N  ND2 . ASN C 1 218 ? 7.382   18.984 -10.615 1.00 33.14  ? 218  ASN B ND2 1 
ATOM   5126 N  N   . LEU C 1 219 ? 8.293   16.203 -6.032  1.00 33.72  ? 219  LEU B N   1 
ATOM   5127 C  CA  . LEU C 1 219 ? 8.703   16.581 -4.685  1.00 34.17  ? 219  LEU B CA  1 
ATOM   5128 C  C   . LEU C 1 219 ? 9.625   17.817 -4.737  1.00 33.60  ? 219  LEU B C   1 
ATOM   5129 O  O   . LEU C 1 219 ? 9.648   18.633 -3.826  1.00 32.77  ? 219  LEU B O   1 
ATOM   5130 C  CB  . LEU C 1 219 ? 9.398   15.404 -3.973  1.00 34.23  ? 219  LEU B CB  1 
ATOM   5131 C  CG  . LEU C 1 219 ? 10.203  15.731 -2.728  1.00 34.28  ? 219  LEU B CG  1 
ATOM   5132 C  CD1 . LEU C 1 219 ? 9.229   16.213 -1.558  1.00 36.86  ? 219  LEU B CD1 1 
ATOM   5133 C  CD2 . LEU C 1 219 ? 11.054  14.561 -2.310  1.00 35.40  ? 219  LEU B CD2 1 
ATOM   5134 N  N   . GLY C 1 220 ? 10.417  17.908 -5.800  1.00 32.80  ? 220  GLY B N   1 
ATOM   5135 C  CA  . GLY C 1 220 ? 11.344  19.010 -5.958  1.00 32.28  ? 220  GLY B CA  1 
ATOM   5136 C  C   . GLY C 1 220 ? 10.610  20.334 -6.096  1.00 31.23  ? 220  GLY B C   1 
ATOM   5137 O  O   . GLY C 1 220 ? 11.004  21.326 -5.489  1.00 30.38  ? 220  GLY B O   1 
ATOM   5138 N  N   . GLU C 1 221 ? 9.566   20.366 -6.918  1.00 31.42  ? 221  GLU B N   1 
ATOM   5139 C  CA  . GLU C 1 221 ? 8.770   21.591 -7.029  1.00 31.63  ? 221  GLU B CA  1 
ATOM   5140 C  C   . GLU C 1 221 ? 8.057   21.870 -5.699  1.00 31.73  ? 221  GLU B C   1 
ATOM   5141 O  O   . GLU C 1 221 ? 7.916   23.021 -5.302  1.00 32.00  ? 221  GLU B O   1 
ATOM   5142 C  CB  . GLU C 1 221 ? 7.735   21.496 -8.124  1.00 31.93  ? 221  GLU B CB  1 
ATOM   5143 C  CG  . GLU C 1 221 ? 6.930   22.755 -8.304  1.00 34.75  ? 221  GLU B CG  1 
ATOM   5144 C  CD  . GLU C 1 221 ? 7.728   23.934 -8.902  1.00 39.06  ? 221  GLU B CD  1 
ATOM   5145 O  OE1 . GLU C 1 221 ? 8.966   23.798 -9.105  1.00 39.41  ? 221  GLU B OE1 1 
ATOM   5146 O  OE2 . GLU C 1 221 ? 7.089   24.997 -9.179  1.00 42.48  ? 221  GLU B OE2 1 
ATOM   5147 N  N   . LEU C 1 222 ? 7.307   20.728 -4.916  1.00 31.97  ? 222  LEU B N   1 
ATOM   5148 C  CA  . LEU C 1 222 ? 6.760   20.965 -3.539  1.00 32.60  ? 222  LEU B CA  1 
ATOM   5149 C  C   . LEU C 1 222 ? 7.809   21.672 -2.657  1.00 34.10  ? 222  LEU B C   1 
ATOM   5150 O  O   . LEU C 1 222 ? 7.490   22.679 -2.034  1.00 33.98  ? 222  LEU B O   1 
ATOM   5151 C  CB  . LEU C 1 222 ? 6.305   19.652 -2.922  1.00 32.05  ? 222  LEU B CB  1 
ATOM   5152 C  CG  . LEU C 1 222 ? 5.811   19.659 -1.446  1.00 32.55  ? 222  LEU B CG  1 
ATOM   5153 C  CD1 . LEU C 1 222 ? 4.640   20.599 -1.332  1.00 33.07  ? 222  LEU B CD1 1 
ATOM   5154 C  CD2 . LEU C 1 222 ? 5.427   18.235 -1.115  1.00 29.15  ? 222  LEU B CD2 1 
ATOM   5155 N  N   . LYS C 1 223 ? 9.060   21.169 -2.643  1.00 34.25  ? 223  LYS B N   1 
ATOM   5156 C  CA  . LYS C 1 223 ? 10.116  21.778 -1.848  1.00 34.77  ? 223  LYS B CA  1 
ATOM   5157 C  C   . LYS C 1 223 ? 10.328  23.210 -2.231  1.00 35.57  ? 223  LYS B C   1 
ATOM   5158 O  O   . LYS C 1 223 ? 10.355  24.134 -1.357  1.00 34.07  ? 223  LYS B O   1 
ATOM   5159 C  CB  . LYS C 1 223 ? 11.428  20.965 -1.959  1.00 35.00  ? 223  LYS B CB  1 
ATOM   5160 C  CG  . LYS C 1 223 ? 12.558  21.508 -1.123  1.00 36.91  ? 223  LYS B CG  1 
ATOM   5161 C  CD  . LYS C 1 223 ? 13.759  20.583 -1.183  1.00 38.36  ? 223  LYS B CD  1 
ATOM   5162 C  CE  . LYS C 1 223 ? 15.106  21.358 -0.942  1.00 41.36  ? 223  LYS B CE  1 
ATOM   5163 N  NZ  . LYS C 1 223 ? 15.097  22.134 0.316   1.00 39.75  ? 223  LYS B NZ  1 
ATOM   5164 N  N   . HIS C 1 224 ? 10.487  23.442 -3.546  1.00 35.88  ? 224  HIS B N   1 
ATOM   5165 C  CA  . HIS C 1 224 ? 10.696  24.792 -4.041  1.00 36.66  ? 224  HIS B CA  1 
ATOM   5166 C  C   . HIS C 1 224 ? 9.578   25.821 -3.584  1.00 35.47  ? 224  HIS B C   1 
ATOM   5167 O  O   . HIS C 1 224 ? 9.856   26.901 -3.020  1.00 35.73  ? 224  HIS B O   1 
ATOM   5168 C  CB  . HIS C 1 224 ? 10.817  24.770 -5.584  1.00 38.06  ? 224  HIS B CB  1 
ATOM   5169 C  CG  . HIS C 1 224 ? 10.929  26.133 -6.172  1.00 41.63  ? 224  HIS B CG  1 
ATOM   5170 N  ND1 . HIS C 1 224 ? 12.032  26.926 -5.967  1.00 44.55  ? 224  HIS B ND1 1 
ATOM   5171 C  CD2 . HIS C 1 224 ? 10.042  26.887 -6.876  1.00 46.03  ? 224  HIS B CD2 1 
ATOM   5172 C  CE1 . HIS C 1 224 ? 11.848  28.093 -6.561  1.00 45.48  ? 224  HIS B CE1 1 
ATOM   5173 N  NE2 . HIS C 1 224 ? 10.643  28.100 -7.110  1.00 48.15  ? 224  HIS B NE2 1 
ATOM   5174 N  N   . LEU C 1 225 ? 8.342   25.453 -3.849  1.00 34.97  ? 225  LEU B N   1 
ATOM   5175 C  CA  . LEU C 1 225 ? 7.169   26.207 -3.457  1.00 35.01  ? 225  LEU B CA  1 
ATOM   5176 C  C   . LEU C 1 225 ? 7.091   26.411 -1.926  1.00 34.78  ? 225  LEU B C   1 
ATOM   5177 O  O   . LEU C 1 225 ? 6.723   27.512 -1.445  1.00 33.37  ? 225  LEU B O   1 
ATOM   5178 C  CB  . LEU C 1 225 ? 5.939   25.448 -3.915  1.00 35.15  ? 225  LEU B CB  1 
ATOM   5179 C  CG  . LEU C 1 225 ? 5.665   25.319 -5.425  1.00 35.94  ? 225  LEU B CG  1 
ATOM   5180 C  CD1 . LEU C 1 225 ? 4.481   24.438 -5.634  1.00 32.83  ? 225  LEU B CD1 1 
ATOM   5181 C  CD2 . LEU C 1 225 ? 5.508   26.723 -6.080  1.00 38.25  ? 225  LEU B CD2 1 
ATOM   5182 N  N   . SER C 1 226 ? 7.410   25.355 -1.150  1.00 34.63  ? 226  SER B N   1 
ATOM   5183 C  CA  . SER C 1 226 ? 7.442   25.485 0.341   1.00 34.10  ? 226  SER B CA  1 
ATOM   5184 C  C   . SER C 1 226 ? 8.422   26.554 0.807   1.00 34.52  ? 226  SER B C   1 
ATOM   5185 O  O   . SER C 1 226 ? 8.279   27.144 1.882   1.00 33.11  ? 226  SER B O   1 
ATOM   5186 C  CB  . SER C 1 226 ? 7.723   24.130 1.033   1.00 34.45  ? 226  SER B CB  1 
ATOM   5187 O  OG  . SER C 1 226 ? 9.065   23.744 0.836   1.00 30.43  ? 226  SER B OG  1 
ATOM   5188 N  N   . GLU C 1 227 ? 9.417   26.848 -0.028  1.00 35.91  ? 227  GLU B N   1 
ATOM   5189 C  CA  . GLU C 1 227 ? 10.389  27.904 0.273   1.00 37.65  ? 227  GLU B CA  1 
ATOM   5190 C  C   . GLU C 1 227 ? 9.950   29.274 -0.243  1.00 36.32  ? 227  GLU B C   1 
ATOM   5191 O  O   . GLU C 1 227 ? 10.774  30.167 -0.198  1.00 36.87  ? 227  GLU B O   1 
ATOM   5192 C  CB  . GLU C 1 227 ? 11.795  27.498 -0.272  1.00 37.92  ? 227  GLU B CB  1 
ATOM   5193 C  CG  . GLU C 1 227 ? 12.318  26.204 0.382   1.00 38.45  ? 227  GLU B CG  1 
ATOM   5194 C  CD  . GLU C 1 227 ? 13.483  25.511 -0.342  1.00 39.56  ? 227  GLU B CD  1 
ATOM   5195 O  OE1 . GLU C 1 227 ? 13.782  25.839 -1.528  1.00 41.63  ? 227  GLU B OE1 1 
ATOM   5196 O  OE2 . GLU C 1 227 ? 14.077  24.614 0.303   1.00 39.90  ? 227  GLU B OE2 1 
ATOM   5197 N  N   . ASP D 1 9   ? 34.649  49.399 68.992  1.00 33.15  ? 9    ASP D N   1 
ATOM   5198 C  CA  . ASP D 1 9   ? 34.993  48.110 68.259  1.00 34.48  ? 9    ASP D CA  1 
ATOM   5199 C  C   . ASP D 1 9   ? 34.503  46.912 69.085  1.00 33.19  ? 9    ASP D C   1 
ATOM   5200 O  O   . ASP D 1 9   ? 34.529  45.774 68.619  1.00 32.31  ? 9    ASP D O   1 
ATOM   5201 C  CB  . ASP D 1 9   ? 36.496  47.956 67.920  1.00 35.22  ? 9    ASP D CB  1 
ATOM   5202 C  CG  . ASP D 1 9   ? 36.959  48.881 66.731  1.00 36.63  ? 9    ASP D CG  1 
ATOM   5203 O  OD1 . ASP D 1 9   ? 38.167  48.879 66.375  1.00 44.02  ? 9    ASP D OD1 1 
ATOM   5204 O  OD2 . ASP D 1 9   ? 36.149  49.631 66.182  1.00 38.39  ? 9    ASP D OD2 1 
ATOM   5205 N  N   . PHE D 1 10  ? 34.007  47.183 70.290  1.00 31.13  ? 10   PHE D N   1 
ATOM   5206 C  CA  . PHE D 1 10  ? 33.543  46.109 71.115  1.00 29.95  ? 10   PHE D CA  1 
ATOM   5207 C  C   . PHE D 1 10  ? 32.229  45.473 70.670  1.00 27.32  ? 10   PHE D C   1 
ATOM   5208 O  O   . PHE D 1 10  ? 31.153  46.086 70.674  1.00 26.99  ? 10   PHE D O   1 
ATOM   5209 C  CB  . PHE D 1 10  ? 33.513  46.458 72.570  1.00 29.94  ? 10   PHE D CB  1 
ATOM   5210 C  CG  . PHE D 1 10  ? 33.265  45.257 73.449  1.00 31.05  ? 10   PHE D CG  1 
ATOM   5211 C  CD1 . PHE D 1 10  ? 34.264  44.306 73.640  1.00 29.73  ? 10   PHE D CD1 1 
ATOM   5212 C  CD2 . PHE D 1 10  ? 32.020  45.082 74.084  1.00 30.49  ? 10   PHE D CD2 1 
ATOM   5213 C  CE1 . PHE D 1 10  ? 34.014  43.207 74.433  1.00 34.31  ? 10   PHE D CE1 1 
ATOM   5214 C  CE2 . PHE D 1 10  ? 31.807  43.990 74.907  1.00 34.95  ? 10   PHE D CE2 1 
ATOM   5215 C  CZ  . PHE D 1 10  ? 32.813  43.059 75.083  1.00 29.11  ? 10   PHE D CZ  1 
ATOM   5216 N  N   . CYS D 1 11  ? 32.341  44.193 70.376  1.00 26.54  ? 11   CYS D N   1 
ATOM   5217 C  CA  . CYS D 1 11  ? 31.226  43.426 69.775  1.00 28.52  ? 11   CYS D CA  1 
ATOM   5218 C  C   . CYS D 1 11  ? 30.596  42.396 70.730  1.00 28.83  ? 11   CYS D C   1 
ATOM   5219 O  O   . CYS D 1 11  ? 30.105  41.386 70.305  1.00 27.19  ? 11   CYS D O   1 
ATOM   5220 C  CB  . CYS D 1 11  ? 31.705  42.783 68.487  1.00 27.00  ? 11   CYS D CB  1 
ATOM   5221 S  SG  . CYS D 1 11  ? 31.962  43.976 67.217  1.00 25.86  ? 11   CYS D SG  1 
ATOM   5222 N  N   . GLY D 1 12  ? 30.684  42.667 72.032  1.00 29.43  ? 12   GLY D N   1 
ATOM   5223 C  CA  . GLY D 1 12  ? 30.024  41.850 73.071  1.00 30.05  ? 12   GLY D CA  1 
ATOM   5224 C  C   . GLY D 1 12  ? 28.633  42.395 73.482  1.00 30.83  ? 12   GLY D C   1 
ATOM   5225 O  O   . GLY D 1 12  ? 28.371  43.576 73.452  1.00 32.35  ? 12   GLY D O   1 
ATOM   5226 N  N   . ALA D 1 13  ? 27.711  41.523 73.810  1.00 30.99  ? 13   ALA D N   1 
ATOM   5227 C  CA  . ALA D 1 13  ? 26.374  41.945 74.257  1.00 30.43  ? 13   ALA D CA  1 
ATOM   5228 C  C   . ALA D 1 13  ? 25.916  40.986 75.345  1.00 28.13  ? 13   ALA D C   1 
ATOM   5229 O  O   . ALA D 1 13  ? 26.214  39.830 75.306  1.00 27.49  ? 13   ALA D O   1 
ATOM   5230 C  CB  . ALA D 1 13  ? 25.388  41.968 73.093  1.00 29.59  ? 13   ALA D CB  1 
ATOM   5231 N  N   . ILE D 1 14  ? 25.241  41.509 76.353  1.00 28.64  ? 14   ILE D N   1 
ATOM   5232 C  CA  . ILE D 1 14  ? 24.733  40.719 77.498  1.00 28.09  ? 14   ILE D CA  1 
ATOM   5233 C  C   . ILE D 1 14  ? 23.255  40.372 77.270  1.00 27.00  ? 14   ILE D C   1 
ATOM   5234 O  O   . ILE D 1 14  ? 22.756  39.348 77.683  1.00 25.62  ? 14   ILE D O   1 
ATOM   5235 C  CB  . ILE D 1 14  ? 24.946  41.511 78.837  1.00 28.38  ? 14   ILE D CB  1 
ATOM   5236 C  CG1 . ILE D 1 14  ? 26.435  41.855 79.038  1.00 29.79  ? 14   ILE D CG1 1 
ATOM   5237 C  CG2 . ILE D 1 14  ? 24.383  40.762 80.102  1.00 29.31  ? 14   ILE D CG2 1 
ATOM   5238 C  CD1 . ILE D 1 14  ? 26.728  42.609 80.360  1.00 30.74  ? 14   ILE D CD1 1 
ATOM   5239 N  N   . ILE D 1 15  ? 22.528  41.289 76.672  1.00 27.40  ? 15   ILE D N   1 
ATOM   5240 C  CA  . ILE D 1 15  ? 21.099  41.090 76.436  1.00 29.39  ? 15   ILE D CA  1 
ATOM   5241 C  C   . ILE D 1 15  ? 20.826  41.394 74.938  1.00 28.29  ? 15   ILE D C   1 
ATOM   5242 O  O   . ILE D 1 15  ? 21.507  42.205 74.359  1.00 26.62  ? 15   ILE D O   1 
ATOM   5243 C  CB  . ILE D 1 15  ? 20.157  41.964 77.349  1.00 29.37  ? 15   ILE D CB  1 
ATOM   5244 C  CG1 . ILE D 1 15  ? 20.201  43.413 76.951  1.00 32.15  ? 15   ILE D CG1 1 
ATOM   5245 C  CG2 . ILE D 1 15  ? 20.421  41.692 78.888  1.00 32.98  ? 15   ILE D CG2 1 
ATOM   5246 C  CD1 . ILE D 1 15  ? 19.051  44.208 77.472  1.00 32.54  ? 15   ILE D CD1 1 
ATOM   5247 N  N   . PRO D 1 16  ? 19.819  40.745 74.357  1.00 28.26  ? 16   PRO D N   1 
ATOM   5248 C  CA  . PRO D 1 16  ? 19.448  40.756 72.959  1.00 28.24  ? 16   PRO D CA  1 
ATOM   5249 C  C   . PRO D 1 16  ? 18.516  41.957 72.742  1.00 29.18  ? 16   PRO D C   1 
ATOM   5250 O  O   . PRO D 1 16  ? 17.302  41.832 72.438  1.00 27.78  ? 16   PRO D O   1 
ATOM   5251 C  CB  . PRO D 1 16  ? 18.696  39.455 72.806  1.00 27.92  ? 16   PRO D CB  1 
ATOM   5252 C  CG  . PRO D 1 16  ? 18.079  39.192 74.088  1.00 28.05  ? 16   PRO D CG  1 
ATOM   5253 C  CD  . PRO D 1 16  ? 18.856  39.949 75.143  1.00 28.17  ? 16   PRO D CD  1 
ATOM   5254 N  N   . ASP D 1 17  ? 19.109  43.129 72.917  1.00 29.20  ? 17   ASP D N   1 
ATOM   5255 C  CA  . ASP D 1 17  ? 18.409  44.363 72.778  1.00 29.36  ? 17   ASP D CA  1 
ATOM   5256 C  C   . ASP D 1 17  ? 19.430  45.374 72.260  1.00 28.31  ? 17   ASP D C   1 
ATOM   5257 O  O   . ASP D 1 17  ? 20.532  45.495 72.819  1.00 28.80  ? 17   ASP D O   1 
ATOM   5258 C  CB  . ASP D 1 17  ? 17.893  44.782 74.148  1.00 29.68  ? 17   ASP D CB  1 
ATOM   5259 C  CG  . ASP D 1 17  ? 16.944  45.980 74.094  1.00 33.22  ? 17   ASP D CG  1 
ATOM   5260 O  OD1 . ASP D 1 17  ? 16.484  46.377 73.010  1.00 38.55  ? 17   ASP D OD1 1 
ATOM   5261 O  OD2 . ASP D 1 17  ? 16.720  46.575 75.153  1.00 43.20  ? 17   ASP D OD2 1 
ATOM   5262 N  N   . ASN D 1 18  ? 19.064  46.114 71.238  1.00 27.03  ? 18   ASN D N   1 
ATOM   5263 C  CA  . ASN D 1 18  ? 19.951  47.168 70.672  1.00 27.15  ? 18   ASN D CA  1 
ATOM   5264 C  C   . ASN D 1 18  ? 21.356  46.691 70.373  1.00 25.82  ? 18   ASN D C   1 
ATOM   5265 O  O   . ASN D 1 18  ? 22.376  47.288 70.785  1.00 26.78  ? 18   ASN D O   1 
ATOM   5266 C  CB  . ASN D 1 18  ? 19.947  48.402 71.576  1.00 27.79  ? 18   ASN D CB  1 
ATOM   5267 C  CG  . ASN D 1 18  ? 18.569  49.046 71.652  1.00 28.79  ? 18   ASN D CG  1 
ATOM   5268 O  OD1 . ASN D 1 18  ? 17.827  48.983 70.698  1.00 32.25  ? 18   ASN D OD1 1 
ATOM   5269 N  ND2 . ASN D 1 18  ? 18.227  49.666 72.795  1.00 28.50  ? 18   ASN D ND2 1 
ATOM   5270 N  N   . PHE D 1 19  ? 21.419  45.637 69.600  1.00 25.13  ? 19   PHE D N   1 
ATOM   5271 C  CA  . PHE D 1 19  ? 22.729  45.133 69.156  1.00 26.76  ? 19   PHE D CA  1 
ATOM   5272 C  C   . PHE D 1 19  ? 23.389  46.279 68.333  1.00 26.58  ? 19   PHE D C   1 
ATOM   5273 O  O   . PHE D 1 19  ? 22.749  46.999 67.529  1.00 26.55  ? 19   PHE D O   1 
ATOM   5274 C  CB  . PHE D 1 19  ? 22.660  43.880 68.271  1.00 24.77  ? 19   PHE D CB  1 
ATOM   5275 C  CG  . PHE D 1 19  ? 22.231  42.624 68.937  1.00 26.60  ? 19   PHE D CG  1 
ATOM   5276 C  CD1 . PHE D 1 19  ? 22.935  42.094 70.059  1.00 27.11  ? 19   PHE D CD1 1 
ATOM   5277 C  CD2 . PHE D 1 19  ? 21.150  41.862 68.390  1.00 22.15  ? 19   PHE D CD2 1 
ATOM   5278 C  CE1 . PHE D 1 19  ? 22.543  40.874 70.595  1.00 26.05  ? 19   PHE D CE1 1 
ATOM   5279 C  CE2 . PHE D 1 19  ? 20.802  40.646 68.931  1.00 25.21  ? 19   PHE D CE2 1 
ATOM   5280 C  CZ  . PHE D 1 19  ? 21.469  40.139 70.018  1.00 24.87  ? 19   PHE D CZ  1 
ATOM   5281 N  N   . PHE D 1 20  ? 24.647  46.487 68.644  1.00 27.09  ? 20   PHE D N   1 
ATOM   5282 C  CA  . PHE D 1 20  ? 25.518  47.354 67.852  1.00 25.08  ? 20   PHE D CA  1 
ATOM   5283 C  C   . PHE D 1 20  ? 24.875  48.433 66.904  1.00 24.96  ? 20   PHE D C   1 
ATOM   5284 O  O   . PHE D 1 20  ? 24.798  48.255 65.717  1.00 25.30  ? 20   PHE D O   1 
ATOM   5285 C  CB  . PHE D 1 20  ? 26.594  46.488 67.164  1.00 24.19  ? 20   PHE D CB  1 
ATOM   5286 C  CG  . PHE D 1 20  ? 27.829  47.255 66.939  1.00 24.52  ? 20   PHE D CG  1 
ATOM   5287 C  CD1 . PHE D 1 20  ? 28.864  47.190 67.853  1.00 25.08  ? 20   PHE D CD1 1 
ATOM   5288 C  CD2 . PHE D 1 20  ? 27.932  48.107 65.852  1.00 20.90  ? 20   PHE D CD2 1 
ATOM   5289 C  CE1 . PHE D 1 20  ? 29.996  48.010 67.713  1.00 28.85  ? 20   PHE D CE1 1 
ATOM   5290 C  CE2 . PHE D 1 20  ? 29.029  48.919 65.731  1.00 23.47  ? 20   PHE D CE2 1 
ATOM   5291 C  CZ  . PHE D 1 20  ? 30.062  48.869 66.655  1.00 21.62  ? 20   PHE D CZ  1 
ATOM   5292 N  N   . PRO D 1 21  ? 24.345  49.545 67.490  1.00 25.33  ? 21   PRO D N   1 
ATOM   5293 C  CA  . PRO D 1 21  ? 23.724  50.571 66.653  1.00 24.60  ? 21   PRO D CA  1 
ATOM   5294 C  C   . PRO D 1 21  ? 24.772  51.248 65.750  1.00 22.89  ? 21   PRO D C   1 
ATOM   5295 O  O   . PRO D 1 21  ? 25.989  51.327 66.043  1.00 22.44  ? 21   PRO D O   1 
ATOM   5296 C  CB  . PRO D 1 21  ? 22.971  51.526 67.642  1.00 23.72  ? 21   PRO D CB  1 
ATOM   5297 C  CG  . PRO D 1 21  ? 23.302  50.995 69.083  1.00 28.47  ? 21   PRO D CG  1 
ATOM   5298 C  CD  . PRO D 1 21  ? 24.223  49.773 68.951  1.00 24.90  ? 21   PRO D CD  1 
ATOM   5299 N  N   . ILE D 1 22  ? 24.259  51.589 64.594  1.00 23.22  ? 22   ILE D N   1 
ATOM   5300 C  CA  . ILE D 1 22  ? 24.979  52.270 63.546  1.00 23.46  ? 22   ILE D CA  1 
ATOM   5301 C  C   . ILE D 1 22  ? 24.231  53.593 63.250  1.00 23.00  ? 22   ILE D C   1 
ATOM   5302 O  O   . ILE D 1 22  ? 23.544  53.700 62.243  1.00 21.22  ? 22   ILE D O   1 
ATOM   5303 C  CB  . ILE D 1 22  ? 25.146  51.389 62.288  1.00 24.01  ? 22   ILE D CB  1 
ATOM   5304 C  CG1 . ILE D 1 22  ? 25.736  49.983 62.637  1.00 25.29  ? 22   ILE D CG1 1 
ATOM   5305 C  CG2 . ILE D 1 22  ? 26.072  52.145 61.248  1.00 23.71  ? 22   ILE D CG2 1 
ATOM   5306 C  CD1 . ILE D 1 22  ? 25.598  48.958 61.494  1.00 23.66  ? 22   ILE D CD1 1 
ATOM   5307 N  N   . GLU D 1 23  ? 24.415  54.582 64.113  1.00 23.47  ? 23   GLU D N   1 
ATOM   5308 C  CA  . GLU D 1 23  ? 23.825  55.908 63.932  1.00 24.56  ? 23   GLU D CA  1 
ATOM   5309 C  C   . GLU D 1 23  ? 24.179  56.531 62.577  1.00 24.60  ? 23   GLU D C   1 
ATOM   5310 O  O   . GLU D 1 23  ? 23.359  57.226 61.963  1.00 22.58  ? 23   GLU D O   1 
ATOM   5311 C  CB  . GLU D 1 23  ? 24.269  56.851 65.057  1.00 24.83  ? 23   GLU D CB  1 
ATOM   5312 C  CG  . GLU D 1 23  ? 23.754  58.328 64.973  1.00 30.36  ? 23   GLU D CG  1 
ATOM   5313 C  CD  . GLU D 1 23  ? 24.548  59.347 63.971  1.00 37.92  ? 23   GLU D CD  1 
ATOM   5314 O  OE1 . GLU D 1 23  ? 25.798  59.406 63.962  1.00 43.13  ? 23   GLU D OE1 1 
ATOM   5315 O  OE2 . GLU D 1 23  ? 23.883  60.108 63.201  1.00 41.86  ? 23   GLU D OE2 1 
ATOM   5316 N  N   . LYS D 1 24  ? 25.364  56.212 62.060  1.00 23.51  ? 24   LYS D N   1 
ATOM   5317 C  CA  . LYS D 1 24  ? 25.789  56.837 60.836  1.00 25.33  ? 24   LYS D CA  1 
ATOM   5318 C  C   . LYS D 1 24  ? 25.016  56.439 59.616  1.00 25.63  ? 24   LYS D C   1 
ATOM   5319 O  O   . LYS D 1 24  ? 25.069  57.176 58.636  1.00 26.18  ? 24   LYS D O   1 
ATOM   5320 C  CB  . LYS D 1 24  ? 27.307  56.663 60.602  1.00 26.72  ? 24   LYS D CB  1 
ATOM   5321 C  CG  . LYS D 1 24  ? 28.091  57.629 61.422  1.00 27.55  ? 24   LYS D CG  1 
ATOM   5322 C  CD  . LYS D 1 24  ? 29.602  57.643 61.089  1.00 31.92  ? 24   LYS D CD  1 
ATOM   5323 C  CE  . LYS D 1 24  ? 30.317  58.832 61.758  1.00 34.32  ? 24   LYS D CE  1 
ATOM   5324 N  NZ  . LYS D 1 24  ? 29.881  60.170 61.242  1.00 38.44  ? 24   LYS D NZ  1 
ATOM   5325 N  N   . LEU D 1 25  ? 24.357  55.260 59.617  1.00 24.30  ? 25   LEU D N   1 
ATOM   5326 C  CA  . LEU D 1 25  ? 23.441  54.917 58.513  1.00 25.64  ? 25   LEU D CA  1 
ATOM   5327 C  C   . LEU D 1 25  ? 22.359  55.928 58.171  1.00 24.34  ? 25   LEU D C   1 
ATOM   5328 O  O   . LEU D 1 25  ? 21.840  55.964 57.057  1.00 23.48  ? 25   LEU D O   1 
ATOM   5329 C  CB  . LEU D 1 25  ? 22.817  53.551 58.729  1.00 26.20  ? 25   LEU D CB  1 
ATOM   5330 C  CG  . LEU D 1 25  ? 23.100  52.369 57.818  1.00 30.33  ? 25   LEU D CG  1 
ATOM   5331 C  CD1 . LEU D 1 25  ? 24.277  52.566 56.992  1.00 25.49  ? 25   LEU D CD1 1 
ATOM   5332 C  CD2 . LEU D 1 25  ? 23.041  50.982 58.579  1.00 25.79  ? 25   LEU D CD2 1 
ATOM   5333 N  N   . ARG D 1 26  ? 21.982  56.736 59.150  1.00 25.70  ? 26   ARG D N   1 
ATOM   5334 C  CA  . ARG D 1 26  ? 21.088  57.827 58.933  1.00 26.42  ? 26   ARG D CA  1 
ATOM   5335 C  C   . ARG D 1 26  ? 21.597  58.868 57.909  1.00 24.36  ? 26   ARG D C   1 
ATOM   5336 O  O   . ARG D 1 26  ? 20.812  59.574 57.309  1.00 23.13  ? 26   ARG D O   1 
ATOM   5337 C  CB  . ARG D 1 26  ? 20.615  58.406 60.283  1.00 27.93  ? 26   ARG D CB  1 
ATOM   5338 C  CG  . ARG D 1 26  ? 21.524  59.063 61.128  1.00 32.18  ? 26   ARG D CG  1 
ATOM   5339 C  CD  . ARG D 1 26  ? 20.795  59.486 62.480  1.00 33.33  ? 26   ARG D CD  1 
ATOM   5340 N  NE  . ARG D 1 26  ? 19.977  58.414 63.015  1.00 38.38  ? 26   ARG D NE  1 
ATOM   5341 C  CZ  . ARG D 1 26  ? 18.651  58.466 63.319  1.00 38.36  ? 26   ARG D CZ  1 
ATOM   5342 N  NH1 . ARG D 1 26  ? 17.912  59.574 63.142  1.00 38.30  ? 26   ARG D NH1 1 
ATOM   5343 N  NH2 . ARG D 1 26  ? 18.066  57.373 63.836  1.00 34.63  ? 26   ARG D NH2 1 
ATOM   5344 N  N   . ASN D 1 27  ? 22.890  58.904 57.683  1.00 22.96  ? 27   ASN D N   1 
ATOM   5345 C  CA  . ASN D 1 27  ? 23.472  59.665 56.592  1.00 24.28  ? 27   ASN D CA  1 
ATOM   5346 C  C   . ASN D 1 27  ? 23.216  59.146 55.145  1.00 23.27  ? 27   ASN D C   1 
ATOM   5347 O  O   . ASN D 1 27  ? 23.542  59.868 54.172  1.00 22.20  ? 27   ASN D O   1 
ATOM   5348 C  CB  . ASN D 1 27  ? 24.976  59.855 56.841  1.00 22.79  ? 27   ASN D CB  1 
ATOM   5349 C  CG  . ASN D 1 27  ? 25.271  60.653 58.067  1.00 28.35  ? 27   ASN D CG  1 
ATOM   5350 O  OD1 . ASN D 1 27  ? 24.501  61.520 58.426  1.00 25.60  ? 27   ASN D OD1 1 
ATOM   5351 N  ND2 . ASN D 1 27  ? 26.401  60.362 58.731  1.00 31.77  ? 27   ASN D ND2 1 
ATOM   5352 N  N   . TYR D 1 28  ? 22.664  57.936 55.005  1.00 22.94  ? 28   TYR D N   1 
ATOM   5353 C  CA  . TYR D 1 28  ? 22.570  57.246 53.723  1.00 24.79  ? 28   TYR D CA  1 
ATOM   5354 C  C   . TYR D 1 28  ? 21.139  56.799 53.387  1.00 25.69  ? 28   TYR D C   1 
ATOM   5355 O  O   . TYR D 1 28  ? 20.932  56.058 52.416  1.00 26.30  ? 28   TYR D O   1 
ATOM   5356 C  CB  . TYR D 1 28  ? 23.594  56.073 53.657  1.00 23.16  ? 28   TYR D CB  1 
ATOM   5357 C  CG  . TYR D 1 28  ? 24.926  56.535 53.966  1.00 21.73  ? 28   TYR D CG  1 
ATOM   5358 C  CD1 . TYR D 1 28  ? 25.475  56.380 55.225  1.00 24.37  ? 28   TYR D CD1 1 
ATOM   5359 C  CD2 . TYR D 1 28  ? 25.660  57.228 53.036  1.00 21.28  ? 28   TYR D CD2 1 
ATOM   5360 C  CE1 . TYR D 1 28  ? 26.705  56.945 55.542  1.00 23.63  ? 28   TYR D CE1 1 
ATOM   5361 C  CE2 . TYR D 1 28  ? 26.854  57.743 53.339  1.00 23.86  ? 28   TYR D CE2 1 
ATOM   5362 C  CZ  . TYR D 1 28  ? 27.373  57.639 54.570  1.00 23.39  ? 28   TYR D CZ  1 
ATOM   5363 O  OH  . TYR D 1 28  ? 28.583  58.270 54.760  1.00 24.19  ? 28   TYR D OH  1 
ATOM   5364 N  N   . THR D 1 29  ? 20.162  57.252 54.182  1.00 27.07  ? 29   THR D N   1 
ATOM   5365 C  CA  . THR D 1 29  ? 18.758  56.806 54.104  1.00 27.50  ? 29   THR D CA  1 
ATOM   5366 C  C   . THR D 1 29  ? 18.064  57.177 52.772  1.00 28.18  ? 29   THR D C   1 
ATOM   5367 O  O   . THR D 1 29  ? 17.178  56.474 52.318  1.00 25.83  ? 29   THR D O   1 
ATOM   5368 C  CB  . THR D 1 29  ? 17.872  57.338 55.340  1.00 27.59  ? 29   THR D CB  1 
ATOM   5369 O  OG1 . THR D 1 29  ? 17.996  58.764 55.426  1.00 32.83  ? 29   THR D OG1 1 
ATOM   5370 C  CG2 . THR D 1 29  ? 18.325  56.743 56.664  1.00 25.90  ? 29   THR D CG2 1 
ATOM   5371 N  N   . GLN D 1 30  ? 18.498  58.269 52.138  1.00 28.86  ? 30   GLN D N   1 
ATOM   5372 C  CA  . GLN D 1 30  ? 17.986  58.676 50.823  1.00 30.05  ? 30   GLN D CA  1 
ATOM   5373 C  C   . GLN D 1 30  ? 18.347  57.669 49.735  1.00 27.74  ? 30   GLN D C   1 
ATOM   5374 O  O   . GLN D 1 30  ? 17.731  57.611 48.692  1.00 29.12  ? 30   GLN D O   1 
ATOM   5375 C  CB  . GLN D 1 30  ? 18.571  60.050 50.455  1.00 30.84  ? 30   GLN D CB  1 
ATOM   5376 C  CG  . GLN D 1 30  ? 18.247  61.087 51.553  1.00 35.84  ? 30   GLN D CG  1 
ATOM   5377 C  CD  . GLN D 1 30  ? 19.040  62.419 51.423  1.00 35.84  ? 30   GLN D CD  1 
ATOM   5378 O  OE1 . GLN D 1 30  ? 20.310  62.450 51.432  1.00 37.98  ? 30   GLN D OE1 1 
ATOM   5379 N  NE2 . GLN D 1 30  ? 18.278  63.540 51.359  1.00 40.71  ? 30   GLN D NE2 1 
ATOM   5380 N  N   . MET D 1 31  ? 19.372  56.872 49.993  1.00 27.63  ? 31   MET D N   1 
ATOM   5381 C  CA  . MET D 1 31  ? 19.747  55.701 49.154  1.00 25.79  ? 31   MET D CA  1 
ATOM   5382 C  C   . MET D 1 31  ? 18.898  54.452 49.328  1.00 24.56  ? 31   MET D C   1 
ATOM   5383 O  O   . MET D 1 31  ? 18.930  53.537 48.489  1.00 23.58  ? 31   MET D O   1 
ATOM   5384 C  CB  . MET D 1 31  ? 21.205  55.354 49.405  1.00 26.08  ? 31   MET D CB  1 
ATOM   5385 C  CG  . MET D 1 31  ? 22.156  56.464 48.995  1.00 27.40  ? 31   MET D CG  1 
ATOM   5386 S  SD  . MET D 1 31  ? 23.825  56.097 49.429  1.00 27.61  ? 31   MET D SD  1 
ATOM   5387 C  CE  . MET D 1 31  ? 24.649  57.658 49.075  1.00 22.49  ? 31   MET D CE  1 
ATOM   5388 N  N   . GLY D 1 32  ? 18.115  54.394 50.375  1.00 23.99  ? 32   GLY D N   1 
ATOM   5389 C  CA  . GLY D 1 32  ? 17.295  53.195 50.657  1.00 24.31  ? 32   GLY D CA  1 
ATOM   5390 C  C   . GLY D 1 32  ? 15.825  53.563 50.533  1.00 23.97  ? 32   GLY D C   1 
ATOM   5391 O  O   . GLY D 1 32  ? 15.521  54.595 50.013  1.00 22.90  ? 32   GLY D O   1 
ATOM   5392 N  N   . LEU D 1 33  ? 14.916  52.732 51.039  1.00 23.41  ? 33   LEU D N   1 
ATOM   5393 C  CA  . LEU D 1 33  ? 13.489  53.006 50.921  1.00 23.97  ? 33   LEU D CA  1 
ATOM   5394 C  C   . LEU D 1 33  ? 12.865  53.163 52.309  1.00 22.69  ? 33   LEU D C   1 
ATOM   5395 O  O   . LEU D 1 33  ? 12.934  52.258 53.130  1.00 20.75  ? 33   LEU D O   1 
ATOM   5396 C  CB  . LEU D 1 33  ? 12.757  51.943 50.129  1.00 26.24  ? 33   LEU D CB  1 
ATOM   5397 C  CG  . LEU D 1 33  ? 13.264  51.732 48.698  1.00 31.23  ? 33   LEU D CG  1 
ATOM   5398 C  CD1 . LEU D 1 33  ? 12.542  50.501 48.060  1.00 33.82  ? 33   LEU D CD1 1 
ATOM   5399 C  CD2 . LEU D 1 33  ? 13.065  53.044 47.831  1.00 31.01  ? 33   LEU D CD2 1 
ATOM   5400 N  N   . ILE D 1 34  ? 12.272  54.317 52.557  1.00 21.97  ? 34   ILE D N   1 
ATOM   5401 C  CA  . ILE D 1 34  ? 11.625  54.628 53.863  1.00 22.04  ? 34   ILE D CA  1 
ATOM   5402 C  C   . ILE D 1 34  ? 10.302  53.911 53.954  1.00 22.16  ? 34   ILE D C   1 
ATOM   5403 O  O   . ILE D 1 34  ? 9.477   53.936 53.005  1.00 18.94  ? 34   ILE D O   1 
ATOM   5404 C  CB  . ILE D 1 34  ? 11.386  56.155 54.090  1.00 22.31  ? 34   ILE D CB  1 
ATOM   5405 C  CG1 . ILE D 1 34  ? 12.718  56.906 54.034  1.00 23.60  ? 34   ILE D CG1 1 
ATOM   5406 C  CG2 . ILE D 1 34  ? 10.577  56.459 55.426  1.00 21.44  ? 34   ILE D CG2 1 
ATOM   5407 C  CD1 . ILE D 1 34  ? 13.661  56.441 55.072  1.00 22.92  ? 34   ILE D CD1 1 
ATOM   5408 N  N   . ARG D 1 35  ? 10.106  53.197 55.051  1.00 20.46  ? 35   ARG D N   1 
ATOM   5409 C  CA  . ARG D 1 35  ? 8.853   52.462 55.249  1.00 22.42  ? 35   ARG D CA  1 
ATOM   5410 C  C   . ARG D 1 35  ? 8.414   52.629 56.686  1.00 20.42  ? 35   ARG D C   1 
ATOM   5411 O  O   . ARG D 1 35  ? 9.174   52.337 57.560  1.00 17.65  ? 35   ARG D O   1 
ATOM   5412 C  CB  . ARG D 1 35  ? 9.056   50.992 54.954  1.00 21.62  ? 35   ARG D CB  1 
ATOM   5413 C  CG  . ARG D 1 35  ? 9.099   50.683 53.510  1.00 26.99  ? 35   ARG D CG  1 
ATOM   5414 C  CD  . ARG D 1 35  ? 9.148   49.217 53.181  1.00 27.98  ? 35   ARG D CD  1 
ATOM   5415 N  NE  . ARG D 1 35  ? 7.895   48.563 53.509  1.00 34.17  ? 35   ARG D NE  1 
ATOM   5416 C  CZ  . ARG D 1 35  ? 7.676   47.266 53.387  1.00 35.14  ? 35   ARG D CZ  1 
ATOM   5417 N  NH1 . ARG D 1 35  ? 8.659   46.477 52.953  1.00 38.01  ? 35   ARG D NH1 1 
ATOM   5418 N  NH2 . ARG D 1 35  ? 6.491   46.761 53.723  1.00 35.46  ? 35   ARG D NH2 1 
ATOM   5419 N  N   . ASP D 1 36  ? 7.189   53.085 56.920  1.00 20.77  ? 36   ASP D N   1 
ATOM   5420 C  CA  . ASP D 1 36  ? 6.687   53.345 58.280  1.00 19.95  ? 36   ASP D CA  1 
ATOM   5421 C  C   . ASP D 1 36  ? 5.690   52.280 58.732  1.00 21.45  ? 36   ASP D C   1 
ATOM   5422 O  O   . ASP D 1 36  ? 4.872   51.806 57.966  1.00 21.95  ? 36   ASP D O   1 
ATOM   5423 C  CB  . ASP D 1 36  ? 5.980   54.694 58.348  1.00 20.72  ? 36   ASP D CB  1 
ATOM   5424 C  CG  . ASP D 1 36  ? 6.887   55.871 58.066  1.00 18.54  ? 36   ASP D CG  1 
ATOM   5425 O  OD1 . ASP D 1 36  ? 8.058   55.731 58.260  1.00 17.72  ? 36   ASP D OD1 1 
ATOM   5426 O  OD2 . ASP D 1 36  ? 6.366   56.936 57.685  1.00 20.65  ? 36   ASP D OD2 1 
ATOM   5427 N  N   . PHE D 1 37  ? 5.719   51.972 60.021  1.00 21.53  ? 37   PHE D N   1 
ATOM   5428 C  CA  . PHE D 1 37  ? 4.873   50.980 60.593  1.00 21.64  ? 37   PHE D CA  1 
ATOM   5429 C  C   . PHE D 1 37  ? 4.173   51.533 61.841  1.00 21.22  ? 37   PHE D C   1 
ATOM   5430 O  O   . PHE D 1 37  ? 4.809   52.027 62.802  1.00 20.14  ? 37   PHE D O   1 
ATOM   5431 C  CB  . PHE D 1 37  ? 5.675   49.702 60.884  1.00 21.89  ? 37   PHE D CB  1 
ATOM   5432 C  CG  . PHE D 1 37  ? 6.286   49.102 59.655  1.00 21.77  ? 37   PHE D CG  1 
ATOM   5433 C  CD1 . PHE D 1 37  ? 5.598   48.175 58.912  1.00 22.14  ? 37   PHE D CD1 1 
ATOM   5434 C  CD2 . PHE D 1 37  ? 7.505   49.518 59.197  1.00 22.78  ? 37   PHE D CD2 1 
ATOM   5435 C  CE1 . PHE D 1 37  ? 6.145   47.628 57.753  1.00 21.13  ? 37   PHE D CE1 1 
ATOM   5436 C  CE2 . PHE D 1 37  ? 8.058   48.999 58.042  1.00 22.97  ? 37   PHE D CE2 1 
ATOM   5437 C  CZ  . PHE D 1 37  ? 7.373   48.050 57.309  1.00 24.66  ? 37   PHE D CZ  1 
ATOM   5438 N  N   . ALA D 1 38  ? 2.854   51.411 61.800  1.00 21.18  ? 38   ALA D N   1 
ATOM   5439 C  CA  . ALA D 1 38  ? 1.973   51.733 62.933  1.00 21.52  ? 38   ALA D CA  1 
ATOM   5440 C  C   . ALA D 1 38  ? 2.255   50.704 64.041  1.00 20.03  ? 38   ALA D C   1 
ATOM   5441 O  O   . ALA D 1 38  ? 2.681   49.597 63.741  1.00 20.47  ? 38   ALA D O   1 
ATOM   5442 C  CB  . ALA D 1 38  ? 0.491   51.703 62.509  1.00 20.45  ? 38   ALA D CB  1 
ATOM   5443 N  N   . LYS D 1 39  ? 2.093   51.117 65.300  1.00 21.97  ? 39   LYS D N   1 
ATOM   5444 C  CA  . LYS D 1 39  ? 2.173   50.242 66.477  1.00 23.45  ? 39   LYS D CA  1 
ATOM   5445 C  C   . LYS D 1 39  ? 1.326   48.980 66.285  1.00 24.20  ? 39   LYS D C   1 
ATOM   5446 O  O   . LYS D 1 39  ? 0.200   49.083 65.905  1.00 23.29  ? 39   LYS D O   1 
ATOM   5447 C  CB  . LYS D 1 39  ? 1.675   50.952 67.730  1.00 23.42  ? 39   LYS D CB  1 
ATOM   5448 C  CG  . LYS D 1 39  ? 1.675   50.021 69.025  1.00 25.81  ? 39   LYS D CG  1 
ATOM   5449 C  CD  . LYS D 1 39  ? 1.754   50.876 70.317  1.00 27.89  ? 39   LYS D CD  1 
ATOM   5450 C  CE  . LYS D 1 39  ? 1.887   50.031 71.568  1.00 29.32  ? 39   LYS D CE  1 
ATOM   5451 N  NZ  . LYS D 1 39  ? 0.572   49.496 71.947  1.00 32.33  ? 39   LYS D NZ  1 
ATOM   5452 N  N   . GLY D 1 40  ? 1.884   47.794 66.530  1.00 24.69  ? 40   GLY D N   1 
ATOM   5453 C  CA  . GLY D 1 40  ? 1.141   46.546 66.310  1.00 24.60  ? 40   GLY D CA  1 
ATOM   5454 C  C   . GLY D 1 40  ? 1.266   45.938 64.925  1.00 25.35  ? 40   GLY D C   1 
ATOM   5455 O  O   . GLY D 1 40  ? 0.957   44.777 64.731  1.00 26.28  ? 40   GLY D O   1 
ATOM   5456 N  N   . SER D 1 41  ? 1.733   46.709 63.945  1.00 25.11  ? 41   SER D N   1 
ATOM   5457 C  CA  . SER D 1 41  ? 1.840   46.213 62.561  1.00 24.56  ? 41   SER D CA  1 
ATOM   5458 C  C   . SER D 1 41  ? 3.104   45.370 62.308  1.00 23.75  ? 41   SER D C   1 
ATOM   5459 O  O   . SER D 1 41  ? 4.063   45.454 63.073  1.00 21.26  ? 41   SER D O   1 
ATOM   5460 C  CB  . SER D 1 41  ? 1.680   47.363 61.566  1.00 25.12  ? 41   SER D CB  1 
ATOM   5461 O  OG  . SER D 1 41  ? 2.857   48.105 61.464  1.00 26.68  ? 41   SER D OG  1 
ATOM   5462 N  N   . ALA D 1 42  ? 3.105   44.601 61.214  1.00 22.70  ? 42   ALA D N   1 
ATOM   5463 C  CA  . ALA D 1 42  ? 4.199   43.691 60.890  1.00 22.77  ? 42   ALA D CA  1 
ATOM   5464 C  C   . ALA D 1 42  ? 5.266   44.360 60.029  1.00 22.67  ? 42   ALA D C   1 
ATOM   5465 O  O   . ALA D 1 42  ? 4.987   44.760 58.967  1.00 22.37  ? 42   ALA D O   1 
ATOM   5466 C  CB  . ALA D 1 42  ? 3.675   42.423 60.192  1.00 23.17  ? 42   ALA D CB  1 
ATOM   5467 N  N   . VAL D 1 43  ? 6.485   44.525 60.536  1.00 22.71  ? 43   VAL D N   1 
ATOM   5468 C  CA  . VAL D 1 43  ? 7.619   45.029 59.751  1.00 22.91  ? 43   VAL D CA  1 
ATOM   5469 C  C   . VAL D 1 43  ? 8.048   43.852 58.843  1.00 23.20  ? 43   VAL D C   1 
ATOM   5470 O  O   . VAL D 1 43  ? 8.342   44.024 57.677  1.00 23.51  ? 43   VAL D O   1 
ATOM   5471 C  CB  . VAL D 1 43  ? 8.790   45.495 60.702  1.00 24.40  ? 43   VAL D CB  1 
ATOM   5472 C  CG1 . VAL D 1 43  ? 10.043  45.850 59.896  1.00 21.85  ? 43   VAL D CG1 1 
ATOM   5473 C  CG2 . VAL D 1 43  ? 8.307   46.686 61.579  1.00 21.88  ? 43   VAL D CG2 1 
ATOM   5474 N  N   . ILE D 1 44  ? 8.069   42.656 59.413  1.00 24.38  ? 44   ILE D N   1 
ATOM   5475 C  CA  . ILE D 1 44  ? 8.277   41.397 58.687  1.00 24.19  ? 44   ILE D CA  1 
ATOM   5476 C  C   . ILE D 1 44  ? 7.136   40.457 59.005  1.00 26.34  ? 44   ILE D C   1 
ATOM   5477 O  O   . ILE D 1 44  ? 6.951   40.082 60.156  1.00 26.09  ? 44   ILE D O   1 
ATOM   5478 C  CB  . ILE D 1 44  ? 9.614   40.666 59.049  1.00 24.27  ? 44   ILE D CB  1 
ATOM   5479 C  CG1 . ILE D 1 44  ? 10.780  41.621 58.865  1.00 19.65  ? 44   ILE D CG1 1 
ATOM   5480 C  CG2 . ILE D 1 44  ? 9.777   39.392 58.118  1.00 21.19  ? 44   ILE D CG2 1 
ATOM   5481 C  CD1 . ILE D 1 44  ? 12.209  41.100 59.238  1.00 22.05  ? 44   ILE D CD1 1 
ATOM   5482 N  N   . MET D 1 45  ? 6.369   40.062 57.978  1.00 27.99  ? 45   MET D N   1 
ATOM   5483 C  CA  . MET D 1 45  ? 5.249   39.171 58.208  1.00 30.88  ? 45   MET D CA  1 
ATOM   5484 C  C   . MET D 1 45  ? 5.806   37.757 58.259  1.00 29.08  ? 45   MET D C   1 
ATOM   5485 O  O   . MET D 1 45  ? 6.815   37.454 57.584  1.00 28.64  ? 45   MET D O   1 
ATOM   5486 C  CB  . MET D 1 45  ? 4.220   39.281 57.073  1.00 30.90  ? 45   MET D CB  1 
ATOM   5487 C  CG  . MET D 1 45  ? 3.697   40.701 56.816  1.00 33.97  ? 45   MET D CG  1 
ATOM   5488 S  SD  . MET D 1 45  ? 2.700   40.931 55.294  1.00 39.51  ? 45   MET D SD  1 
ATOM   5489 C  CE  . MET D 1 45  ? 3.921   41.277 54.003  1.00 36.47  ? 45   MET D CE  1 
ATOM   5490 N  N   . PRO D 1 46  ? 5.131   36.857 59.008  1.00 28.75  ? 46   PRO D N   1 
ATOM   5491 C  CA  . PRO D 1 46  ? 5.515   35.458 58.941  1.00 28.15  ? 46   PRO D CA  1 
ATOM   5492 C  C   . PRO D 1 46  ? 5.403   34.891 57.518  1.00 27.73  ? 46   PRO D C   1 
ATOM   5493 O  O   . PRO D 1 46  ? 4.448   35.190 56.813  1.00 27.20  ? 46   PRO D O   1 
ATOM   5494 C  CB  . PRO D 1 46  ? 4.508   34.760 59.877  1.00 28.12  ? 46   PRO D CB  1 
ATOM   5495 C  CG  . PRO D 1 46  ? 3.537   35.714 60.271  1.00 28.17  ? 46   PRO D CG  1 
ATOM   5496 C  CD  . PRO D 1 46  ? 3.958   37.087 59.871  1.00 28.49  ? 46   PRO D CD  1 
ATOM   5497 N  N   . GLY D 1 47  ? 6.370   34.102 57.089  1.00 28.18  ? 47   GLY D N   1 
ATOM   5498 C  CA  . GLY D 1 47  ? 6.414   33.652 55.692  1.00 28.81  ? 47   GLY D CA  1 
ATOM   5499 C  C   . GLY D 1 47  ? 6.928   34.666 54.665  1.00 29.68  ? 47   GLY D C   1 
ATOM   5500 O  O   . GLY D 1 47  ? 7.117   34.309 53.508  1.00 30.35  ? 47   GLY D O   1 
ATOM   5501 N  N   . GLU D 1 48  ? 7.144   35.928 55.054  1.00 29.67  ? 48   GLU D N   1 
ATOM   5502 C  CA  . GLU D 1 48  ? 7.642   36.929 54.113  1.00 30.41  ? 48   GLU D CA  1 
ATOM   5503 C  C   . GLU D 1 48  ? 9.141   36.696 53.849  1.00 29.58  ? 48   GLU D C   1 
ATOM   5504 O  O   . GLU D 1 48  ? 9.902   36.549 54.777  1.00 29.92  ? 48   GLU D O   1 
ATOM   5505 C  CB  . GLU D 1 48  ? 7.436   38.358 54.641  1.00 29.78  ? 48   GLU D CB  1 
ATOM   5506 C  CG  . GLU D 1 48  ? 7.650   39.476 53.557  1.00 31.27  ? 48   GLU D CG  1 
ATOM   5507 C  CD  . GLU D 1 48  ? 7.432   40.874 54.106  1.00 32.66  ? 48   GLU D CD  1 
ATOM   5508 O  OE1 . GLU D 1 48  ? 7.090   40.987 55.294  1.00 31.92  ? 48   GLU D OE1 1 
ATOM   5509 O  OE2 . GLU D 1 48  ? 7.577   41.863 53.355  1.00 38.54  ? 48   GLU D OE2 1 
ATOM   5510 N  N   . GLU D 1 49  ? 9.517   36.633 52.582  1.00 30.08  ? 49   GLU D N   1 
ATOM   5511 C  CA  . GLU D 1 49  ? 10.895  36.628 52.113  1.00 30.20  ? 49   GLU D CA  1 
ATOM   5512 C  C   . GLU D 1 49  ? 11.445  38.063 52.158  1.00 26.64  ? 49   GLU D C   1 
ATOM   5513 O  O   . GLU D 1 49  ? 10.947  38.963 51.518  1.00 27.89  ? 49   GLU D O   1 
ATOM   5514 C  CB  . GLU D 1 49  ? 10.979  36.097 50.665  1.00 31.55  ? 49   GLU D CB  1 
ATOM   5515 C  CG  . GLU D 1 49  ? 12.326  35.354 50.275  1.00 33.79  ? 49   GLU D CG  1 
ATOM   5516 C  CD  . GLU D 1 49  ? 13.160  35.898 48.986  1.00 35.97  ? 49   GLU D CD  1 
ATOM   5517 O  OE1 . GLU D 1 49  ? 12.620  36.676 48.067  1.00 40.78  ? 49   GLU D OE1 1 
ATOM   5518 O  OE2 . GLU D 1 49  ? 14.401  35.534 48.943  1.00 34.43  ? 49   GLU D OE2 1 
ATOM   5519 N  N   . ILE D 1 50  ? 12.450  38.264 52.967  1.00 24.51  ? 50   ILE D N   1 
ATOM   5520 C  CA  . ILE D 1 50  ? 13.129  39.526 53.142  1.00 22.71  ? 50   ILE D CA  1 
ATOM   5521 C  C   . ILE D 1 50  ? 14.517  39.416 52.477  1.00 22.74  ? 50   ILE D C   1 
ATOM   5522 O  O   . ILE D 1 50  ? 15.304  38.456 52.712  1.00 20.87  ? 50   ILE D O   1 
ATOM   5523 C  CB  . ILE D 1 50  ? 13.221  39.885 54.662  1.00 22.63  ? 50   ILE D CB  1 
ATOM   5524 C  CG1 . ILE D 1 50  ? 11.826  39.889 55.288  1.00 21.63  ? 50   ILE D CG1 1 
ATOM   5525 C  CG2 . ILE D 1 50  ? 13.982  41.224 54.885  1.00 21.68  ? 50   ILE D CG2 1 
ATOM   5526 C  CD1 . ILE D 1 50  ? 10.923  41.131 54.847  1.00 24.86  ? 50   ILE D CD1 1 
ATOM   5527 N  N   . THR D 1 51  ? 14.800  40.386 51.615  1.00 22.14  ? 51   THR D N   1 
ATOM   5528 C  CA  . THR D 1 51  ? 16.088  40.497 50.944  1.00 23.23  ? 51   THR D CA  1 
ATOM   5529 C  C   . THR D 1 51  ? 16.589  41.920 51.058  1.00 23.81  ? 51   THR D C   1 
ATOM   5530 O  O   . THR D 1 51  ? 17.055  42.502 50.105  1.00 24.02  ? 51   THR D O   1 
ATOM   5531 C  CB  . THR D 1 51  ? 15.998  40.050 49.497  1.00 25.86  ? 51   THR D CB  1 
ATOM   5532 O  OG1 . THR D 1 51  ? 14.967  40.809 48.816  1.00 25.48  ? 51   THR D OG1 1 
ATOM   5533 C  CG2 . THR D 1 51  ? 15.785  38.571 49.426  1.00 23.26  ? 51   THR D CG2 1 
ATOM   5534 N  N   . SER D 1 52  ? 16.504  42.478 52.278  1.00 24.00  ? 52   SER D N   1 
ATOM   5535 C  CA  . SER D 1 52  ? 17.042  43.811 52.546  1.00 25.11  ? 52   SER D CA  1 
ATOM   5536 C  C   . SER D 1 52  ? 17.639  43.919 53.932  1.00 24.52  ? 52   SER D C   1 
ATOM   5537 O  O   . SER D 1 52  ? 17.120  43.323 54.838  1.00 27.36  ? 52   SER D O   1 
ATOM   5538 C  CB  . SER D 1 52  ? 15.947  44.888 52.515  1.00 26.26  ? 52   SER D CB  1 
ATOM   5539 O  OG  . SER D 1 52  ? 14.972  44.692 51.512  1.00 28.33  ? 52   SER D OG  1 
ATOM   5540 N  N   . MET D 1 53  ? 18.566  44.833 54.124  1.00 23.12  ? 53   MET D N   1 
ATOM   5541 C  CA  . MET D 1 53  ? 18.856  45.294 55.467  1.00 24.81  ? 53   MET D CA  1 
ATOM   5542 C  C   . MET D 1 53  ? 17.814  46.336 55.888  1.00 23.09  ? 53   MET D C   1 
ATOM   5543 O  O   . MET D 1 53  ? 17.368  47.123 55.057  1.00 23.80  ? 53   MET D O   1 
ATOM   5544 C  CB  . MET D 1 53  ? 20.299  45.760 55.593  1.00 24.01  ? 53   MET D CB  1 
ATOM   5545 C  CG  . MET D 1 53  ? 21.244  44.476 55.367  1.00 26.61  ? 53   MET D CG  1 
ATOM   5546 S  SD  . MET D 1 53  ? 22.806  44.913 55.994  1.00 29.75  ? 53   MET D SD  1 
ATOM   5547 C  CE  . MET D 1 53  ? 23.784  43.578 55.270  1.00 22.83  ? 53   MET D CE  1 
ATOM   5548 N  N   . ILE D 1 54  ? 17.399  46.285 57.158  1.00 21.63  ? 54   ILE D N   1 
ATOM   5549 C  CA  . ILE D 1 54  ? 16.340  47.164 57.622  1.00 21.86  ? 54   ILE D CA  1 
ATOM   5550 C  C   . ILE D 1 54  ? 16.944  47.965 58.730  1.00 20.50  ? 54   ILE D C   1 
ATOM   5551 O  O   . ILE D 1 54  ? 17.285  47.443 59.805  1.00 21.28  ? 54   ILE D O   1 
ATOM   5552 C  CB  . ILE D 1 54  ? 15.076  46.383 58.104  1.00 21.32  ? 54   ILE D CB  1 
ATOM   5553 C  CG1 . ILE D 1 54  ? 14.518  45.478 56.985  1.00 23.71  ? 54   ILE D CG1 1 
ATOM   5554 C  CG2 . ILE D 1 54  ? 13.947  47.452 58.582  1.00 20.85  ? 54   ILE D CG2 1 
ATOM   5555 C  CD1 . ILE D 1 54  ? 13.544  44.326 57.507  1.00 22.80  ? 54   ILE D CD1 1 
ATOM   5556 N  N   . PHE D 1 55  ? 17.124  49.243 58.452  1.00 21.80  ? 55   PHE D N   1 
ATOM   5557 C  CA  . PHE D 1 55  ? 17.688  50.162 59.407  1.00 20.93  ? 55   PHE D CA  1 
ATOM   5558 C  C   . PHE D 1 55  ? 16.530  50.815 60.143  1.00 21.15  ? 55   PHE D C   1 
ATOM   5559 O  O   . PHE D 1 55  ? 15.602  51.321 59.544  1.00 21.05  ? 55   PHE D O   1 
ATOM   5560 C  CB  . PHE D 1 55  ? 18.559  51.176 58.672  1.00 20.39  ? 55   PHE D CB  1 
ATOM   5561 C  CG  . PHE D 1 55  ? 19.129  52.246 59.572  1.00 20.78  ? 55   PHE D CG  1 
ATOM   5562 C  CD1 . PHE D 1 55  ? 19.988  51.926 60.619  1.00 19.83  ? 55   PHE D CD1 1 
ATOM   5563 C  CD2 . PHE D 1 55  ? 18.733  53.582 59.435  1.00 22.24  ? 55   PHE D CD2 1 
ATOM   5564 C  CE1 . PHE D 1 55  ? 20.514  52.910 61.446  1.00 23.80  ? 55   PHE D CE1 1 
ATOM   5565 C  CE2 . PHE D 1 55  ? 19.266  54.524 60.230  1.00 22.45  ? 55   PHE D CE2 1 
ATOM   5566 C  CZ  . PHE D 1 55  ? 20.186  54.184 61.261  1.00 22.26  ? 55   PHE D CZ  1 
ATOM   5567 N  N   . LEU D 1 56  ? 16.595  50.834 61.454  1.00 22.66  ? 56   LEU D N   1 
ATOM   5568 C  CA  . LEU D 1 56  ? 15.594  51.440 62.258  1.00 23.77  ? 56   LEU D CA  1 
ATOM   5569 C  C   . LEU D 1 56  ? 15.948  52.907 62.558  1.00 24.67  ? 56   LEU D C   1 
ATOM   5570 O  O   . LEU D 1 56  ? 16.887  53.237 63.328  1.00 25.36  ? 56   LEU D O   1 
ATOM   5571 C  CB  . LEU D 1 56  ? 15.404  50.562 63.492  1.00 24.48  ? 56   LEU D CB  1 
ATOM   5572 C  CG  . LEU D 1 56  ? 14.057  50.326 64.054  1.00 26.46  ? 56   LEU D CG  1 
ATOM   5573 C  CD1 . LEU D 1 56  ? 13.959  49.342 65.181  1.00 25.46  ? 56   LEU D CD1 1 
ATOM   5574 C  CD2 . LEU D 1 56  ? 13.698  51.787 64.581  1.00 30.13  ? 56   LEU D CD2 1 
ATOM   5575 N  N   . VAL D 1 57  ? 15.203  53.809 61.928  1.00 24.84  ? 57   VAL D N   1 
ATOM   5576 C  CA  . VAL D 1 57  ? 15.465  55.215 62.045  1.00 25.45  ? 57   VAL D CA  1 
ATOM   5577 C  C   . VAL D 1 57  ? 14.889  55.674 63.435  1.00 25.76  ? 57   VAL D C   1 
ATOM   5578 O  O   . VAL D 1 57  ? 15.537  56.350 64.210  1.00 25.70  ? 57   VAL D O   1 
ATOM   5579 C  CB  . VAL D 1 57  ? 14.799  55.971 60.856  1.00 25.52  ? 57   VAL D CB  1 
ATOM   5580 C  CG1 . VAL D 1 57  ? 15.050  57.447 60.945  1.00 29.02  ? 57   VAL D CG1 1 
ATOM   5581 C  CG2 . VAL D 1 57  ? 15.271  55.427 59.552  1.00 22.33  ? 57   VAL D CG2 1 
ATOM   5582 N  N   . GLU D 1 58  ? 13.674  55.273 63.765  1.00 26.06  ? 58   GLU D N   1 
ATOM   5583 C  CA  . GLU D 1 58  ? 13.069  55.671 65.033  1.00 25.67  ? 58   GLU D CA  1 
ATOM   5584 C  C   . GLU D 1 58  ? 11.988  54.632 65.401  1.00 24.11  ? 58   GLU D C   1 
ATOM   5585 O  O   . GLU D 1 58  ? 11.255  54.186 64.543  1.00 22.95  ? 58   GLU D O   1 
ATOM   5586 C  CB  . GLU D 1 58  ? 12.438  57.081 64.904  1.00 26.37  ? 58   GLU D CB  1 
ATOM   5587 C  CG  . GLU D 1 58  ? 11.748  57.641 66.211  1.00 30.80  ? 58   GLU D CG  1 
ATOM   5588 C  CD  . GLU D 1 58  ? 10.189  57.334 66.422  1.00 36.85  ? 58   GLU D CD  1 
ATOM   5589 O  OE1 . GLU D 1 58  ? 9.425   57.129 65.406  1.00 34.02  ? 58   GLU D OE1 1 
ATOM   5590 O  OE2 . GLU D 1 58  ? 9.730   57.370 67.644  1.00 36.25  ? 58   GLU D OE2 1 
ATOM   5591 N  N   . GLY D 1 59  ? 11.820  54.360 66.678  1.00 23.55  ? 59   GLY D N   1 
ATOM   5592 C  CA  . GLY D 1 59  ? 10.830  53.361 67.111  1.00 22.83  ? 59   GLY D CA  1 
ATOM   5593 C  C   . GLY D 1 59  ? 11.414  52.149 67.778  1.00 22.38  ? 59   GLY D C   1 
ATOM   5594 O  O   . GLY D 1 59  ? 12.488  52.190 68.417  1.00 22.90  ? 59   GLY D O   1 
ATOM   5595 N  N   . LYS D 1 60  ? 10.683  51.067 67.664  1.00 21.43  ? 60   LYS D N   1 
ATOM   5596 C  CA  . LYS D 1 60  ? 10.969  49.887 68.458  1.00 22.37  ? 60   LYS D CA  1 
ATOM   5597 C  C   . LYS D 1 60  ? 10.302  48.685 67.827  1.00 21.86  ? 60   LYS D C   1 
ATOM   5598 O  O   . LYS D 1 60  ? 9.126   48.711 67.498  1.00 21.69  ? 60   LYS D O   1 
ATOM   5599 C  CB  . LYS D 1 60  ? 10.473  50.030 69.903  1.00 22.86  ? 60   LYS D CB  1 
ATOM   5600 C  CG  . LYS D 1 60  ? 10.931  48.899 70.793  1.00 25.72  ? 60   LYS D CG  1 
ATOM   5601 C  CD  . LYS D 1 60  ? 10.909  49.357 72.244  1.00 29.22  ? 60   LYS D CD  1 
ATOM   5602 C  CE  . LYS D 1 60  ? 11.199  48.237 73.202  1.00 34.13  ? 60   LYS D CE  1 
ATOM   5603 N  NZ  . LYS D 1 60  ? 12.629  47.969 73.420  1.00 38.34  ? 60   LYS D NZ  1 
ATOM   5604 N  N   . ILE D 1 61  ? 11.080  47.652 67.645  1.00 22.61  ? 61   ILE D N   1 
ATOM   5605 C  CA  . ILE D 1 61  ? 10.647  46.412 67.011  1.00 23.71  ? 61   ILE D CA  1 
ATOM   5606 C  C   . ILE D 1 61  ? 11.006  45.214 67.896  1.00 23.70  ? 61   ILE D C   1 
ATOM   5607 O  O   . ILE D 1 61  ? 12.082  45.171 68.459  1.00 23.38  ? 61   ILE D O   1 
ATOM   5608 C  CB  . ILE D 1 61  ? 11.357  46.269 65.641  1.00 23.81  ? 61   ILE D CB  1 
ATOM   5609 C  CG1 . ILE D 1 61  ? 10.759  47.283 64.618  1.00 24.20  ? 61   ILE D CG1 1 
ATOM   5610 C  CG2 . ILE D 1 61  ? 11.329  44.858 65.131  1.00 25.44  ? 61   ILE D CG2 1 
ATOM   5611 C  CD1 . ILE D 1 61  ? 11.469  47.276 63.139  1.00 22.87  ? 61   ILE D CD1 1 
ATOM   5612 N  N   . LYS D 1 62  ? 10.058  44.315 68.067  1.00 23.89  ? 62   LYS D N   1 
ATOM   5613 C  CA  . LYS D 1 62  ? 10.265  42.970 68.579  1.00 23.53  ? 62   LYS D CA  1 
ATOM   5614 C  C   . LYS D 1 62  ? 10.382  41.968 67.404  1.00 22.76  ? 62   LYS D C   1 
ATOM   5615 O  O   . LYS D 1 62  ? 9.460   41.785 66.582  1.00 20.31  ? 62   LYS D O   1 
ATOM   5616 C  CB  . LYS D 1 62  ? 9.128   42.556 69.486  1.00 23.58  ? 62   LYS D CB  1 
ATOM   5617 C  CG  . LYS D 1 62  ? 9.339   41.244 70.239  1.00 24.56  ? 62   LYS D CG  1 
ATOM   5618 C  CD  . LYS D 1 62  ? 8.097   40.911 71.040  1.00 26.84  ? 62   LYS D CD  1 
ATOM   5619 C  CE  . LYS D 1 62  ? 8.380   39.817 72.058  1.00 29.20  ? 62   LYS D CE  1 
ATOM   5620 N  NZ  . LYS D 1 62  ? 8.330   38.448 71.450  1.00 29.34  ? 62   LYS D NZ  1 
ATOM   5621 N  N   . LEU D 1 63  ? 11.517  41.305 67.334  1.00 21.28  ? 63   LEU D N   1 
ATOM   5622 C  CA  . LEU D 1 63  ? 11.754  40.346 66.260  1.00 21.32  ? 63   LEU D CA  1 
ATOM   5623 C  C   . LEU D 1 63  ? 11.810  38.881 66.791  1.00 22.41  ? 63   LEU D C   1 
ATOM   5624 O  O   . LEU D 1 63  ? 12.660  38.518 67.587  1.00 22.79  ? 63   LEU D O   1 
ATOM   5625 C  CB  . LEU D 1 63  ? 13.019  40.716 65.451  1.00 21.17  ? 63   LEU D CB  1 
ATOM   5626 C  CG  . LEU D 1 63  ? 13.427  39.957 64.164  1.00 19.72  ? 63   LEU D CG  1 
ATOM   5627 C  CD1 . LEU D 1 63  ? 14.154  40.890 63.136  1.00 23.20  ? 63   LEU D CD1 1 
ATOM   5628 C  CD2 . LEU D 1 63  ? 14.321  38.694 64.449  1.00 16.80  ? 63   LEU D CD2 1 
ATOM   5629 N  N   . ASP D 1 64  ? 10.893  38.050 66.271  1.00 23.63  ? 64   ASP D N   1 
ATOM   5630 C  CA  . ASP D 1 64  ? 10.733  36.673 66.691  1.00 24.71  ? 64   ASP D CA  1 
ATOM   5631 C  C   . ASP D 1 64  ? 11.021  35.676 65.578  1.00 23.50  ? 64   ASP D C   1 
ATOM   5632 O  O   . ASP D 1 64  ? 10.988  35.988 64.393  1.00 23.66  ? 64   ASP D O   1 
ATOM   5633 C  CB  . ASP D 1 64  ? 9.275   36.385 67.137  1.00 24.39  ? 64   ASP D CB  1 
ATOM   5634 C  CG  . ASP D 1 64  ? 8.880   37.097 68.446  1.00 25.76  ? 64   ASP D CG  1 
ATOM   5635 O  OD1 . ASP D 1 64  ? 9.751   37.703 69.066  1.00 25.01  ? 64   ASP D OD1 1 
ATOM   5636 O  OD2 . ASP D 1 64  ? 7.646   37.108 68.800  1.00 29.68  ? 64   ASP D OD2 1 
ATOM   5637 N  N   . ILE D 1 65  ? 11.256  34.444 66.011  1.00 23.94  ? 65   ILE D N   1 
ATOM   5638 C  CA  . ILE D 1 65  ? 11.329  33.288 65.088  1.00 23.56  ? 65   ILE D CA  1 
ATOM   5639 C  C   . ILE D 1 65  ? 10.079  32.425 65.252  1.00 23.09  ? 65   ILE D C   1 
ATOM   5640 O  O   . ILE D 1 65  ? 9.553   32.262 66.342  1.00 23.15  ? 65   ILE D O   1 
ATOM   5641 C  CB  . ILE D 1 65  ? 12.689  32.542 65.154  1.00 22.79  ? 65   ILE D CB  1 
ATOM   5642 C  CG1 . ILE D 1 65  ? 12.803  31.503 64.025  1.00 23.29  ? 65   ILE D CG1 1 
ATOM   5643 C  CG2 . ILE D 1 65  ? 12.965  31.845 66.513  1.00 24.28  ? 65   ILE D CG2 1 
ATOM   5644 C  CD1 . ILE D 1 65  ? 14.139  30.789 64.145  1.00 25.61  ? 65   ILE D CD1 1 
ATOM   5645 N  N   . ILE D 1 66  ? 9.532   31.966 64.148  1.00 22.76  ? 66   ILE D N   1 
ATOM   5646 C  CA  . ILE D 1 66  ? 8.394   31.075 64.237  1.00 23.79  ? 66   ILE D CA  1 
ATOM   5647 C  C   . ILE D 1 66  ? 8.810   29.739 63.653  1.00 24.72  ? 66   ILE D C   1 
ATOM   5648 O  O   . ILE D 1 66  ? 9.280   29.672 62.511  1.00 25.65  ? 66   ILE D O   1 
ATOM   5649 C  CB  . ILE D 1 66  ? 7.234   31.608 63.441  1.00 23.17  ? 66   ILE D CB  1 
ATOM   5650 C  CG1 . ILE D 1 66  ? 6.866   33.039 63.916  1.00 24.19  ? 66   ILE D CG1 1 
ATOM   5651 C  CG2 . ILE D 1 66  ? 6.038   30.648 63.543  1.00 22.12  ? 66   ILE D CG2 1 
ATOM   5652 C  CD1 . ILE D 1 66  ? 5.669   33.680 63.168  1.00 23.31  ? 66   ILE D CD1 1 
ATOM   5653 N  N   . PHE D 1 67  ? 8.525   28.696 64.388  1.00 25.13  ? 67   PHE D N   1 
ATOM   5654 C  CA  . PHE D 1 67  ? 8.741   27.370 63.925  1.00 26.94  ? 67   PHE D CA  1 
ATOM   5655 C  C   . PHE D 1 67  ? 7.492   26.824 63.165  1.00 28.20  ? 67   PHE D C   1 
ATOM   5656 O  O   . PHE D 1 67  ? 6.458   27.496 63.019  1.00 26.28  ? 67   PHE D O   1 
ATOM   5657 C  CB  . PHE D 1 67  ? 9.170   26.506 65.104  1.00 26.78  ? 67   PHE D CB  1 
ATOM   5658 C  CG  . PHE D 1 67  ? 10.535  26.807 65.598  1.00 25.61  ? 67   PHE D CG  1 
ATOM   5659 C  CD1 . PHE D 1 67  ? 11.659  26.476 64.846  1.00 27.60  ? 67   PHE D CD1 1 
ATOM   5660 C  CD2 . PHE D 1 67  ? 10.720  27.429 66.803  1.00 25.94  ? 67   PHE D CD2 1 
ATOM   5661 C  CE1 . PHE D 1 67  ? 12.937  26.744 65.306  1.00 28.37  ? 67   PHE D CE1 1 
ATOM   5662 C  CE2 . PHE D 1 67  ? 11.992  27.707 67.258  1.00 27.19  ? 67   PHE D CE2 1 
ATOM   5663 C  CZ  . PHE D 1 67  ? 13.098  27.396 66.521  1.00 27.37  ? 67   PHE D CZ  1 
ATOM   5664 N  N   . GLU D 1 68  ? 7.674   25.632 62.623  1.00 30.25  ? 68   GLU D N   1 
ATOM   5665 C  CA  . GLU D 1 68  ? 6.680   24.923 61.797  1.00 31.19  ? 68   GLU D CA  1 
ATOM   5666 C  C   . GLU D 1 68  ? 5.340   24.663 62.500  1.00 31.89  ? 68   GLU D C   1 
ATOM   5667 O  O   . GLU D 1 68  ? 4.277   24.717 61.870  1.00 32.97  ? 68   GLU D O   1 
ATOM   5668 C  CB  . GLU D 1 68  ? 7.280   23.585 61.321  1.00 32.36  ? 68   GLU D CB  1 
ATOM   5669 C  CG  . GLU D 1 68  ? 8.653   23.689 60.598  1.00 34.78  ? 68   GLU D CG  1 
ATOM   5670 C  CD  . GLU D 1 68  ? 9.878   23.431 61.550  1.00 36.64  ? 68   GLU D CD  1 
ATOM   5671 O  OE1 . GLU D 1 68  ? 10.390  24.354 62.246  1.00 26.64  ? 68   GLU D OE1 1 
ATOM   5672 O  OE2 . GLU D 1 68  ? 10.311  22.264 61.538  1.00 44.10  ? 68   GLU D OE2 1 
ATOM   5673 N  N   . ASP D 1 69  ? 5.378   24.376 63.790  1.00 32.52  ? 69   ASP D N   1 
ATOM   5674 C  CA  . ASP D 1 69  ? 4.160   24.185 64.568  1.00 33.10  ? 69   ASP D CA  1 
ATOM   5675 C  C   . ASP D 1 69  ? 3.445   25.471 65.080  1.00 34.08  ? 69   ASP D C   1 
ATOM   5676 O  O   . ASP D 1 69  ? 2.436   25.372 65.823  1.00 33.33  ? 69   ASP D O   1 
ATOM   5677 C  CB  . ASP D 1 69  ? 4.448   23.236 65.731  1.00 34.44  ? 69   ASP D CB  1 
ATOM   5678 C  CG  . ASP D 1 69  ? 5.442   23.820 66.767  1.00 35.09  ? 69   ASP D CG  1 
ATOM   5679 O  OD1 . ASP D 1 69  ? 6.093   24.827 66.486  1.00 34.26  ? 69   ASP D OD1 1 
ATOM   5680 O  OD2 . ASP D 1 69  ? 5.555   23.226 67.870  1.00 38.71  ? 69   ASP D OD2 1 
ATOM   5681 N  N   . GLY D 1 70  ? 3.955   26.661 64.692  1.00 32.46  ? 70   GLY D N   1 
ATOM   5682 C  CA  . GLY D 1 70  ? 3.416   27.921 65.161  1.00 32.81  ? 70   GLY D CA  1 
ATOM   5683 C  C   . GLY D 1 70  ? 4.104   28.481 66.399  1.00 32.87  ? 70   GLY D C   1 
ATOM   5684 O  O   . GLY D 1 70  ? 3.909   29.623 66.724  1.00 33.83  ? 70   GLY D O   1 
ATOM   5685 N  N   . SER D 1 71  ? 4.911   27.688 67.094  1.00 33.04  ? 71   SER D N   1 
ATOM   5686 C  CA  . SER D 1 71  ? 5.525   28.180 68.296  1.00 33.87  ? 71   SER D CA  1 
ATOM   5687 C  C   . SER D 1 71  ? 6.534   29.297 67.934  1.00 32.44  ? 71   SER D C   1 
ATOM   5688 O  O   . SER D 1 71  ? 7.127   29.323 66.856  1.00 31.27  ? 71   SER D O   1 
ATOM   5689 C  CB  . SER D 1 71  ? 6.109   27.054 69.147  1.00 35.15  ? 71   SER D CB  1 
ATOM   5690 O  OG  . SER D 1 71  ? 7.051   26.270 68.451  1.00 39.77  ? 71   SER D OG  1 
ATOM   5691 N  N   . GLU D 1 72  ? 6.615   30.271 68.823  1.00 30.68  ? 72   GLU D N   1 
ATOM   5692 C  CA  . GLU D 1 72  ? 7.264   31.501 68.503  1.00 30.17  ? 72   GLU D CA  1 
ATOM   5693 C  C   . GLU D 1 72  ? 8.188   31.873 69.645  1.00 28.64  ? 72   GLU D C   1 
ATOM   5694 O  O   . GLU D 1 72  ? 7.804   31.762 70.812  1.00 28.19  ? 72   GLU D O   1 
ATOM   5695 C  CB  . GLU D 1 72  ? 6.195   32.534 68.280  1.00 30.24  ? 72   GLU D CB  1 
ATOM   5696 C  CG  . GLU D 1 72  ? 6.724   33.829 67.896  1.00 31.03  ? 72   GLU D CG  1 
ATOM   5697 C  CD  . GLU D 1 72  ? 5.695   34.769 67.390  1.00 31.42  ? 72   GLU D CD  1 
ATOM   5698 O  OE1 . GLU D 1 72  ? 4.639   34.299 66.900  1.00 30.76  ? 72   GLU D OE1 1 
ATOM   5699 O  OE2 . GLU D 1 72  ? 5.995   35.997 67.488  1.00 28.26  ? 72   GLU D OE2 1 
ATOM   5700 N  N   . LYS D 1 73  ? 9.401   32.288 69.310  1.00 26.09  ? 73   LYS D N   1 
ATOM   5701 C  CA  . LYS D 1 73  ? 10.369  32.732 70.293  1.00 26.00  ? 73   LYS D CA  1 
ATOM   5702 C  C   . LYS D 1 73  ? 10.965  34.104 69.956  1.00 25.09  ? 73   LYS D C   1 
ATOM   5703 O  O   . LYS D 1 73  ? 11.187  34.390 68.801  1.00 25.75  ? 73   LYS D O   1 
ATOM   5704 C  CB  . LYS D 1 73  ? 11.492  31.683 70.451  1.00 25.45  ? 73   LYS D CB  1 
ATOM   5705 C  CG  . LYS D 1 73  ? 11.036  30.450 71.165  1.00 29.81  ? 73   LYS D CG  1 
ATOM   5706 C  CD  . LYS D 1 73  ? 10.919  30.715 72.695  1.00 33.63  ? 73   LYS D CD  1 
ATOM   5707 C  CE  . LYS D 1 73  ? 9.702   30.132 73.309  1.00 37.09  ? 73   LYS D CE  1 
ATOM   5708 N  NZ  . LYS D 1 73  ? 9.593   28.690 73.186  1.00 36.01  ? 73   LYS D NZ  1 
ATOM   5709 N  N   . LEU D 1 74  ? 11.229  34.930 70.980  1.00 25.10  ? 74   LEU D N   1 
ATOM   5710 C  CA  . LEU D 1 74  ? 11.989  36.148 70.841  1.00 25.45  ? 74   LEU D CA  1 
ATOM   5711 C  C   . LEU D 1 74  ? 13.401  35.853 70.330  1.00 25.38  ? 74   LEU D C   1 
ATOM   5712 O  O   . LEU D 1 74  ? 14.074  34.900 70.798  1.00 25.17  ? 74   LEU D O   1 
ATOM   5713 C  CB  . LEU D 1 74  ? 12.093  36.846 72.205  1.00 26.58  ? 74   LEU D CB  1 
ATOM   5714 C  CG  . LEU D 1 74  ? 12.990  38.093 72.257  1.00 24.41  ? 74   LEU D CG  1 
ATOM   5715 C  CD1 . LEU D 1 74  ? 12.168  39.235 71.607  1.00 25.25  ? 74   LEU D CD1 1 
ATOM   5716 C  CD2 . LEU D 1 74  ? 13.511  38.474 73.686  1.00 27.01  ? 74   LEU D CD2 1 
ATOM   5717 N  N   . LEU D 1 75  ? 13.831  36.599 69.312  1.00 24.89  ? 75   LEU D N   1 
ATOM   5718 C  CA  . LEU D 1 75  ? 15.228  36.683 68.983  1.00 24.11  ? 75   LEU D CA  1 
ATOM   5719 C  C   . LEU D 1 75  ? 15.838  37.910 69.631  1.00 22.67  ? 75   LEU D C   1 
ATOM   5720 O  O   . LEU D 1 75  ? 16.843  37.825 70.327  1.00 22.19  ? 75   LEU D O   1 
ATOM   5721 C  CB  . LEU D 1 75  ? 15.486  36.645 67.468  1.00 23.51  ? 75   LEU D CB  1 
ATOM   5722 C  CG  . LEU D 1 75  ? 15.193  35.327 66.711  1.00 24.03  ? 75   LEU D CG  1 
ATOM   5723 C  CD1 . LEU D 1 75  ? 15.797  35.247 65.258  1.00 22.39  ? 75   LEU D CD1 1 
ATOM   5724 C  CD2 . LEU D 1 75  ? 15.720  34.134 67.569  1.00 24.69  ? 75   LEU D CD2 1 
ATOM   5725 N  N   . TYR D 1 76  ? 15.241  39.067 69.381  1.00 21.43  ? 76   TYR D N   1 
ATOM   5726 C  CA  . TYR D 1 76  ? 15.775  40.325 69.864  1.00 20.76  ? 76   TYR D CA  1 
ATOM   5727 C  C   . TYR D 1 76  ? 14.822  41.503 69.746  1.00 21.55  ? 76   TYR D C   1 
ATOM   5728 O  O   . TYR D 1 76  ? 13.825  41.426 69.029  1.00 20.47  ? 76   TYR D O   1 
ATOM   5729 C  CB  . TYR D 1 76  ? 17.133  40.694 69.208  1.00 20.18  ? 76   TYR D CB  1 
ATOM   5730 C  CG  . TYR D 1 76  ? 17.176  41.067 67.744  1.00 20.47  ? 76   TYR D CG  1 
ATOM   5731 C  CD1 . TYR D 1 76  ? 17.836  40.261 66.844  1.00 23.00  ? 76   TYR D CD1 1 
ATOM   5732 C  CD2 . TYR D 1 76  ? 16.582  42.245 67.258  1.00 20.29  ? 76   TYR D CD2 1 
ATOM   5733 C  CE1 . TYR D 1 76  ? 17.909  40.607 65.528  1.00 20.79  ? 76   TYR D CE1 1 
ATOM   5734 C  CE2 . TYR D 1 76  ? 16.652  42.620 65.928  1.00 22.50  ? 76   TYR D CE2 1 
ATOM   5735 C  CZ  . TYR D 1 76  ? 17.386  41.807 65.063  1.00 22.13  ? 76   TYR D CZ  1 
ATOM   5736 O  OH  . TYR D 1 76  ? 17.552  42.161 63.736  1.00 23.10  ? 76   TYR D OH  1 
ATOM   5737 N  N   . TYR D 1 77  ? 15.116  42.509 70.565  1.00 22.17  ? 77   TYR D N   1 
ATOM   5738 C  CA  . TYR D 1 77  ? 14.516  43.806 70.487  1.00 24.00  ? 77   TYR D CA  1 
ATOM   5739 C  C   . TYR D 1 77  ? 15.465  44.809 69.785  1.00 24.45  ? 77   TYR D C   1 
ATOM   5740 O  O   . TYR D 1 77  ? 16.716  44.741 69.923  1.00 24.35  ? 77   TYR D O   1 
ATOM   5741 C  CB  . TYR D 1 77  ? 14.169  44.280 71.891  1.00 25.71  ? 77   TYR D CB  1 
ATOM   5742 C  CG  . TYR D 1 77  ? 13.014  43.576 72.519  1.00 24.94  ? 77   TYR D CG  1 
ATOM   5743 C  CD1 . TYR D 1 77  ? 11.707  43.917 72.214  1.00 24.13  ? 77   TYR D CD1 1 
ATOM   5744 C  CD2 . TYR D 1 77  ? 13.236  42.576 73.443  1.00 27.03  ? 77   TYR D CD2 1 
ATOM   5745 C  CE1 . TYR D 1 77  ? 10.664  43.267 72.827  1.00 28.51  ? 77   TYR D CE1 1 
ATOM   5746 C  CE2 . TYR D 1 77  ? 12.225  41.943 74.037  1.00 27.90  ? 77   TYR D CE2 1 
ATOM   5747 C  CZ  . TYR D 1 77  ? 10.934  42.264 73.743  1.00 25.89  ? 77   TYR D CZ  1 
ATOM   5748 O  OH  . TYR D 1 77  ? 9.929   41.565 74.437  1.00 29.72  ? 77   TYR D OH  1 
ATOM   5749 N  N   . ALA D 1 78  ? 14.872  45.723 69.040  1.00 23.00  ? 78   ALA D N   1 
ATOM   5750 C  CA  . ALA D 1 78  ? 15.625  46.732 68.227  1.00 23.80  ? 78   ALA D CA  1 
ATOM   5751 C  C   . ALA D 1 78  ? 15.029  48.101 68.430  1.00 22.76  ? 78   ALA D C   1 
ATOM   5752 O  O   . ALA D 1 78  ? 13.863  48.231 68.385  1.00 21.75  ? 78   ALA D O   1 
ATOM   5753 C  CB  . ALA D 1 78  ? 15.594  46.393 66.749  1.00 22.00  ? 78   ALA D CB  1 
ATOM   5754 N  N   . GLY D 1 79  ? 15.869  49.108 68.661  1.00 21.79  ? 79   GLY D N   1 
ATOM   5755 C  CA  . GLY D 1 79  ? 15.435  50.460 68.763  1.00 22.15  ? 79   GLY D CA  1 
ATOM   5756 C  C   . GLY D 1 79  ? 16.095  51.326 67.727  1.00 20.44  ? 79   GLY D C   1 
ATOM   5757 O  O   . GLY D 1 79  ? 16.673  50.843 66.747  1.00 20.10  ? 79   GLY D O   1 
ATOM   5758 N  N   . GLY D 1 80  ? 16.027  52.593 67.966  1.00 20.44  ? 80   GLY D N   1 
ATOM   5759 C  CA  . GLY D 1 80  ? 16.665  53.629 67.100  1.00 22.41  ? 80   GLY D CA  1 
ATOM   5760 C  C   . GLY D 1 80  ? 18.134  53.283 66.758  1.00 22.94  ? 80   GLY D C   1 
ATOM   5761 O  O   . GLY D 1 80  ? 18.930  52.974 67.642  1.00 23.95  ? 80   GLY D O   1 
ATOM   5762 N  N   . ASN D 1 81  ? 18.471  53.281 65.468  1.00 23.28  ? 81   ASN D N   1 
ATOM   5763 C  CA  . ASN D 1 81  ? 19.856  52.962 64.969  1.00 24.55  ? 81   ASN D CA  1 
ATOM   5764 C  C   . ASN D 1 81  ? 20.206  51.494 64.906  1.00 24.38  ? 81   ASN D C   1 
ATOM   5765 O  O   . ASN D 1 81  ? 21.299  51.201 64.490  1.00 24.55  ? 81   ASN D O   1 
ATOM   5766 C  CB  . ASN D 1 81  ? 20.981  53.814 65.692  1.00 25.00  ? 81   ASN D CB  1 
ATOM   5767 C  CG  . ASN D 1 81  ? 20.730  55.337 65.555  1.00 25.12  ? 81   ASN D CG  1 
ATOM   5768 O  OD1 . ASN D 1 81  ? 20.352  55.793 64.522  1.00 23.99  ? 81   ASN D OD1 1 
ATOM   5769 N  ND2 . ASN D 1 81  ? 20.947  56.087 66.614  1.00 27.28  ? 81   ASN D ND2 1 
ATOM   5770 N  N   . SER D 1 82  ? 19.269  50.590 65.289  1.00 23.86  ? 82   SER D N   1 
ATOM   5771 C  CA  . SER D 1 82  ? 19.420  49.155 65.068  1.00 23.44  ? 82   SER D CA  1 
ATOM   5772 C  C   . SER D 1 82  ? 19.349  48.792 63.576  1.00 22.70  ? 82   SER D C   1 
ATOM   5773 O  O   . SER D 1 82  ? 18.778  49.469 62.760  1.00 19.63  ? 82   SER D O   1 
ATOM   5774 C  CB  . SER D 1 82  ? 18.413  48.305 65.872  1.00 23.32  ? 82   SER D CB  1 
ATOM   5775 O  OG  . SER D 1 82  ? 18.699  48.359 67.281  1.00 24.48  ? 82   SER D OG  1 
ATOM   5776 N  N   . LEU D 1 83  ? 19.934  47.659 63.267  1.00 22.26  ? 83   LEU D N   1 
ATOM   5777 C  CA  . LEU D 1 83  ? 19.940  47.100 61.942  1.00 22.17  ? 83   LEU D CA  1 
ATOM   5778 C  C   . LEU D 1 83  ? 19.469  45.667 61.990  1.00 22.51  ? 83   LEU D C   1 
ATOM   5779 O  O   . LEU D 1 83  ? 19.955  44.838 62.729  1.00 22.97  ? 83   LEU D O   1 
ATOM   5780 C  CB  . LEU D 1 83  ? 21.348  47.218 61.303  1.00 23.75  ? 83   LEU D CB  1 
ATOM   5781 C  CG  . LEU D 1 83  ? 21.540  46.769 59.848  1.00 22.26  ? 83   LEU D CG  1 
ATOM   5782 C  CD1 . LEU D 1 83  ? 20.846  47.696 58.870  1.00 23.10  ? 83   LEU D CD1 1 
ATOM   5783 C  CD2 . LEU D 1 83  ? 23.074  46.615 59.642  1.00 21.58  ? 83   LEU D CD2 1 
ATOM   5784 N  N   . ILE D 1 84  ? 18.500  45.365 61.146  1.00 21.76  ? 84   ILE D N   1 
ATOM   5785 C  CA  . ILE D 1 84  ? 18.139  43.989 60.862  1.00 21.66  ? 84   ILE D CA  1 
ATOM   5786 C  C   . ILE D 1 84  ? 18.907  43.511 59.619  1.00 22.57  ? 84   ILE D C   1 
ATOM   5787 O  O   . ILE D 1 84  ? 18.690  44.026 58.531  1.00 21.57  ? 84   ILE D O   1 
ATOM   5788 C  CB  . ILE D 1 84  ? 16.577  43.866 60.646  1.00 21.66  ? 84   ILE D CB  1 
ATOM   5789 C  CG1 . ILE D 1 84  ? 15.771  44.497 61.820  1.00 23.24  ? 84   ILE D CG1 1 
ATOM   5790 C  CG2 . ILE D 1 84  ? 16.149  42.339 60.380  1.00 20.85  ? 84   ILE D CG2 1 
ATOM   5791 C  CD1 . ILE D 1 84  ? 14.192  44.539 61.604  1.00 20.91  ? 84   ILE D CD1 1 
ATOM   5792 N  N   . GLY D 1 85  ? 19.729  42.462 59.755  1.00 21.45  ? 85   GLY D N   1 
ATOM   5793 C  CA  . GLY D 1 85  ? 20.701  42.120 58.702  1.00 21.72  ? 85   GLY D CA  1 
ATOM   5794 C  C   . GLY D 1 85  ? 20.205  41.040 57.719  1.00 21.08  ? 85   GLY D C   1 
ATOM   5795 O  O   . GLY D 1 85  ? 21.005  40.226 57.242  1.00 22.74  ? 85   GLY D O   1 
ATOM   5796 N  N   . LYS D 1 86  ? 18.912  40.997 57.441  1.00 20.16  ? 86   LYS D N   1 
ATOM   5797 C  CA  . LYS D 1 86  ? 18.296  39.907 56.635  1.00 22.39  ? 86   LYS D CA  1 
ATOM   5798 C  C   . LYS D 1 86  ? 18.349  40.108 55.094  1.00 22.22  ? 86   LYS D C   1 
ATOM   5799 O  O   . LYS D 1 86  ? 17.339  40.128 54.406  1.00 23.49  ? 86   LYS D O   1 
ATOM   5800 C  CB  . LYS D 1 86  ? 16.885  39.573 57.126  1.00 21.68  ? 86   LYS D CB  1 
ATOM   5801 C  CG  . LYS D 1 86  ? 16.825  38.983 58.512  1.00 24.73  ? 86   LYS D CG  1 
ATOM   5802 C  CD  . LYS D 1 86  ? 15.350  38.855 59.029  1.00 23.84  ? 86   LYS D CD  1 
ATOM   5803 C  CE  . LYS D 1 86  ? 14.429  38.090 58.090  1.00 25.05  ? 86   LYS D CE  1 
ATOM   5804 N  NZ  . LYS D 1 86  ? 14.830  36.689 57.862  1.00 21.32  ? 86   LYS D NZ  1 
ATOM   5805 N  N   . LEU D 1 87  ? 19.560  40.202 54.558  1.00 22.43  ? 87   LEU D N   1 
ATOM   5806 C  CA  . LEU D 1 87  ? 19.736  40.669 53.170  1.00 22.46  ? 87   LEU D CA  1 
ATOM   5807 C  C   . LEU D 1 87  ? 19.525  39.525 52.220  1.00 23.31  ? 87   LEU D C   1 
ATOM   5808 O  O   . LEU D 1 87  ? 19.254  39.751 51.048  1.00 22.88  ? 87   LEU D O   1 
ATOM   5809 C  CB  . LEU D 1 87  ? 21.114  41.303 52.989  1.00 22.93  ? 87   LEU D CB  1 
ATOM   5810 C  CG  . LEU D 1 87  ? 21.490  41.880 51.611  1.00 22.80  ? 87   LEU D CG  1 
ATOM   5811 C  CD1 . LEU D 1 87  ? 20.552  43.061 51.270  1.00 22.63  ? 87   LEU D CD1 1 
ATOM   5812 C  CD2 . LEU D 1 87  ? 22.998  42.327 51.645  1.00 21.53  ? 87   LEU D CD2 1 
ATOM   5813 N  N   . TYR D 1 88  ? 19.663  38.267 52.724  1.00 22.73  ? 88   TYR D N   1 
ATOM   5814 C  CA  . TYR D 1 88  ? 19.476  37.050 51.936  1.00 23.10  ? 88   TYR D CA  1 
ATOM   5815 C  C   . TYR D 1 88  ? 18.589  36.051 52.708  1.00 23.57  ? 88   TYR D C   1 
ATOM   5816 O  O   . TYR D 1 88  ? 18.429  36.207 53.936  1.00 25.25  ? 88   TYR D O   1 
ATOM   5817 C  CB  . TYR D 1 88  ? 20.850  36.417 51.663  1.00 23.91  ? 88   TYR D CB  1 
ATOM   5818 C  CG  . TYR D 1 88  ? 21.802  37.388 51.005  1.00 23.43  ? 88   TYR D CG  1 
ATOM   5819 C  CD1 . TYR D 1 88  ? 22.821  37.940 51.723  1.00 22.78  ? 88   TYR D CD1 1 
ATOM   5820 C  CD2 . TYR D 1 88  ? 21.630  37.782 49.650  1.00 21.51  ? 88   TYR D CD2 1 
ATOM   5821 C  CE1 . TYR D 1 88  ? 23.680  38.848 51.185  1.00 21.90  ? 88   TYR D CE1 1 
ATOM   5822 C  CE2 . TYR D 1 88  ? 22.536  38.750 49.090  1.00 26.55  ? 88   TYR D CE2 1 
ATOM   5823 C  CZ  . TYR D 1 88  ? 23.561  39.251 49.882  1.00 24.34  ? 88   TYR D CZ  1 
ATOM   5824 O  OH  . TYR D 1 88  ? 24.481  40.188 49.455  1.00 23.36  ? 88   TYR D OH  1 
ATOM   5825 N  N   . PRO D 1 89  ? 17.968  35.091 52.009  1.00 24.29  ? 89   PRO D N   1 
ATOM   5826 C  CA  . PRO D 1 89  ? 17.233  33.974 52.647  1.00 23.79  ? 89   PRO D CA  1 
ATOM   5827 C  C   . PRO D 1 89  ? 18.060  33.121 53.599  1.00 23.61  ? 89   PRO D C   1 
ATOM   5828 O  O   . PRO D 1 89  ? 19.175  32.772 53.279  1.00 22.56  ? 89   PRO D O   1 
ATOM   5829 C  CB  . PRO D 1 89  ? 16.809  33.110 51.468  1.00 25.15  ? 89   PRO D CB  1 
ATOM   5830 C  CG  . PRO D 1 89  ? 17.500  33.629 50.314  1.00 25.25  ? 89   PRO D CG  1 
ATOM   5831 C  CD  . PRO D 1 89  ? 17.941  34.979 50.527  1.00 23.71  ? 89   PRO D CD  1 
ATOM   5832 N  N   . THR D 1 90  ? 17.483  32.781 54.751  1.00 24.33  ? 90   THR D N   1 
ATOM   5833 C  CA  . THR D 1 90  ? 18.190  32.053 55.822  1.00 24.86  ? 90   THR D CA  1 
ATOM   5834 C  C   . THR D 1 90  ? 17.548  30.723 56.150  1.00 25.69  ? 90   THR D C   1 
ATOM   5835 O  O   . THR D 1 90  ? 18.100  29.914 56.853  1.00 25.45  ? 90   THR D O   1 
ATOM   5836 C  CB  . THR D 1 90  ? 18.263  32.922 57.110  1.00 24.70  ? 90   THR D CB  1 
ATOM   5837 O  OG1 . THR D 1 90  ? 16.947  33.078 57.656  1.00 22.88  ? 90   THR D OG1 1 
ATOM   5838 C  CG2 . THR D 1 90  ? 18.812  34.277 56.762  1.00 21.49  ? 90   THR D CG2 1 
ATOM   5839 N  N   . GLY D 1 91  ? 16.363  30.485 55.645  1.00 26.74  ? 91   GLY D N   1 
ATOM   5840 C  CA  . GLY D 1 91  ? 15.674  29.326 56.070  1.00 26.81  ? 91   GLY D CA  1 
ATOM   5841 C  C   . GLY D 1 91  ? 14.763  29.537 57.255  1.00 27.32  ? 91   GLY D C   1 
ATOM   5842 O  O   . GLY D 1 91  ? 13.891  28.693 57.481  1.00 28.87  ? 91   GLY D O   1 
ATOM   5843 N  N   . ASN D 1 92  ? 14.904  30.645 57.986  1.00 25.98  ? 92   ASN D N   1 
ATOM   5844 C  CA  . ASN D 1 92  ? 14.095  30.883 59.202  1.00 25.66  ? 92   ASN D CA  1 
ATOM   5845 C  C   . ASN D 1 92  ? 12.854  31.676 58.894  1.00 25.31  ? 92   ASN D C   1 
ATOM   5846 O  O   . ASN D 1 92  ? 12.897  32.603 58.097  1.00 25.99  ? 92   ASN D O   1 
ATOM   5847 C  CB  . ASN D 1 92  ? 14.868  31.582 60.360  1.00 25.16  ? 92   ASN D CB  1 
ATOM   5848 C  CG  . ASN D 1 92  ? 16.075  30.744 60.889  1.00 27.68  ? 92   ASN D CG  1 
ATOM   5849 O  OD1 . ASN D 1 92  ? 15.970  29.541 61.020  1.00 25.80  ? 92   ASN D OD1 1 
ATOM   5850 N  ND2 . ASN D 1 92  ? 17.195  31.402 61.213  1.00 21.58  ? 92   ASN D ND2 1 
ATOM   5851 N  N   . ASN D 1 93  ? 11.770  31.373 59.613  1.00 25.53  ? 93   ASN D N   1 
ATOM   5852 C  CA  . ASN D 1 93  ? 10.547  32.129 59.497  1.00 24.84  ? 93   ASN D CA  1 
ATOM   5853 C  C   . ASN D 1 93  ? 10.617  33.183 60.579  1.00 24.16  ? 93   ASN D C   1 
ATOM   5854 O  O   . ASN D 1 93  ? 10.738  32.870 61.712  1.00 24.34  ? 93   ASN D O   1 
ATOM   5855 C  CB  . ASN D 1 93  ? 9.304   31.214 59.631  1.00 25.85  ? 93   ASN D CB  1 
ATOM   5856 C  CG  . ASN D 1 93  ? 7.988   31.949 59.374  1.00 24.29  ? 93   ASN D CG  1 
ATOM   5857 O  OD1 . ASN D 1 93  ? 7.968   33.190 59.179  1.00 30.64  ? 93   ASN D OD1 1 
ATOM   5858 N  ND2 . ASN D 1 93  ? 6.900   31.222 59.369  1.00 17.15  ? 93   ASN D ND2 1 
ATOM   5859 N  N   . ILE D 1 94  ? 10.628  34.457 60.176  1.00 23.18  ? 94   ILE D N   1 
ATOM   5860 C  CA  . ILE D 1 94  ? 10.801  35.566 61.059  1.00 22.17  ? 94   ILE D CA  1 
ATOM   5861 C  C   . ILE D 1 94  ? 9.537   36.415 61.094  1.00 21.54  ? 94   ILE D C   1 
ATOM   5862 O  O   . ILE D 1 94  ? 8.892   36.669 60.082  1.00 20.28  ? 94   ILE D O   1 
ATOM   5863 C  CB  . ILE D 1 94  ? 12.071  36.460 60.681  1.00 22.07  ? 94   ILE D CB  1 
ATOM   5864 C  CG1 . ILE D 1 94  ? 13.362  35.630 60.717  1.00 23.76  ? 94   ILE D CG1 1 
ATOM   5865 C  CG2 . ILE D 1 94  ? 12.141  37.749 61.542  1.00 20.70  ? 94   ILE D CG2 1 
ATOM   5866 C  CD1 . ILE D 1 94  ? 13.706  34.873 61.998  1.00 18.81  ? 94   ILE D CD1 1 
ATOM   5867 N  N   . TYR D 1 95  ? 9.199   36.860 62.295  1.00 22.51  ? 95   TYR D N   1 
ATOM   5868 C  CA  . TYR D 1 95  ? 8.074   37.745 62.475  1.00 23.32  ? 95   TYR D CA  1 
ATOM   5869 C  C   . TYR D 1 95  ? 8.525   38.924 63.327  1.00 22.53  ? 95   TYR D C   1 
ATOM   5870 O  O   . TYR D 1 95  ? 9.058   38.744 64.408  1.00 22.90  ? 95   TYR D O   1 
ATOM   5871 C  CB  . TYR D 1 95  ? 6.894   36.990 63.134  1.00 25.04  ? 95   TYR D CB  1 
ATOM   5872 C  CG  . TYR D 1 95  ? 5.704   37.873 63.465  1.00 28.13  ? 95   TYR D CG  1 
ATOM   5873 C  CD1 . TYR D 1 95  ? 5.273   38.903 62.593  1.00 29.43  ? 95   TYR D CD1 1 
ATOM   5874 C  CD2 . TYR D 1 95  ? 5.013   37.685 64.641  1.00 31.56  ? 95   TYR D CD2 1 
ATOM   5875 C  CE1 . TYR D 1 95  ? 4.127   39.702 62.913  1.00 31.95  ? 95   TYR D CE1 1 
ATOM   5876 C  CE2 . TYR D 1 95  ? 3.916   38.463 64.975  1.00 33.44  ? 95   TYR D CE2 1 
ATOM   5877 C  CZ  . TYR D 1 95  ? 3.477   39.463 64.124  1.00 32.29  ? 95   TYR D CZ  1 
ATOM   5878 O  OH  . TYR D 1 95  ? 2.422   40.194 64.546  1.00 31.59  ? 95   TYR D OH  1 
ATOM   5879 N  N   . ALA D 1 96  ? 8.403   40.136 62.813  1.00 21.95  ? 96   ALA D N   1 
ATOM   5880 C  CA  . ALA D 1 96  ? 8.880   41.303 63.565  1.00 22.00  ? 96   ALA D CA  1 
ATOM   5881 C  C   . ALA D 1 96  ? 7.774   42.329 63.574  1.00 22.83  ? 96   ALA D C   1 
ATOM   5882 O  O   . ALA D 1 96  ? 7.188   42.636 62.514  1.00 23.26  ? 96   ALA D O   1 
ATOM   5883 C  CB  . ALA D 1 96  ? 10.165  41.869 62.960  1.00 18.78  ? 96   ALA D CB  1 
ATOM   5884 N  N   . THR D 1 97  ? 7.493   42.857 64.761  1.00 23.39  ? 97   THR D N   1 
ATOM   5885 C  CA  . THR D 1 97  ? 6.389   43.791 64.932  1.00 24.34  ? 97   THR D CA  1 
ATOM   5886 C  C   . THR D 1 97  ? 6.827   45.089 65.496  1.00 22.63  ? 97   THR D C   1 
ATOM   5887 O  O   . THR D 1 97  ? 7.677   45.142 66.366  1.00 23.33  ? 97   THR D O   1 
ATOM   5888 C  CB  . THR D 1 97  ? 5.290   43.269 65.931  1.00 25.19  ? 97   THR D CB  1 
ATOM   5889 O  OG1 . THR D 1 97  ? 5.951   42.599 67.005  1.00 28.94  ? 97   THR D OG1 1 
ATOM   5890 C  CG2 . THR D 1 97  ? 4.377   42.348 65.267  1.00 27.08  ? 97   THR D CG2 1 
ATOM   5891 N  N   . ALA D 1 98  ? 6.171   46.133 65.060  1.00 23.57  ? 98   ALA D N   1 
ATOM   5892 C  CA  . ALA D 1 98  ? 6.430   47.503 65.572  1.00 23.83  ? 98   ALA D CA  1 
ATOM   5893 C  C   . ALA D 1 98  ? 5.756   47.567 66.942  1.00 24.45  ? 98   ALA D C   1 
ATOM   5894 O  O   . ALA D 1 98  ? 4.589   47.204 67.068  1.00 24.33  ? 98   ALA D O   1 
ATOM   5895 C  CB  . ALA D 1 98  ? 5.911   48.541 64.601  1.00 21.76  ? 98   ALA D CB  1 
ATOM   5896 N  N   . MET D 1 99  ? 6.529   47.895 67.990  1.00 26.08  ? 99   MET D N   1 
ATOM   5897 C  CA  . MET D 1 99  ? 6.001   48.055 69.348  1.00 26.78  ? 99   MET D CA  1 
ATOM   5898 C  C   . MET D 1 99  ? 5.516   49.463 69.612  1.00 26.80  ? 99   MET D C   1 
ATOM   5899 O  O   . MET D 1 99  ? 4.995   49.737 70.682  1.00 25.11  ? 99   MET D O   1 
ATOM   5900 C  CB  . MET D 1 99  ? 7.038   47.672 70.383  1.00 27.27  ? 99   MET D CB  1 
ATOM   5901 C  CG  . MET D 1 99  ? 7.328   46.177 70.372  1.00 28.63  ? 99   MET D CG  1 
ATOM   5902 S  SD  . MET D 1 99  ? 8.679   45.861 71.493  1.00 31.28  ? 99   MET D SD  1 
ATOM   5903 C  CE  . MET D 1 99  ? 7.785   45.780 73.067  1.00 31.91  ? 99   MET D CE  1 
ATOM   5904 N  N   . GLU D 1 100 ? 5.658   50.326 68.603  1.00 26.21  ? 100  GLU D N   1 
ATOM   5905 C  CA  . GLU D 1 100 ? 5.314   51.758 68.665  1.00 26.99  ? 100  GLU D CA  1 
ATOM   5906 C  C   . GLU D 1 100 ? 5.439   52.260 67.242  1.00 24.46  ? 100  GLU D C   1 
ATOM   5907 O  O   . GLU D 1 100 ? 5.984   51.553 66.407  1.00 26.67  ? 100  GLU D O   1 
ATOM   5908 C  CB  . GLU D 1 100 ? 6.246   52.518 69.640  1.00 26.57  ? 100  GLU D CB  1 
ATOM   5909 C  CG  . GLU D 1 100 ? 7.731   52.609 69.316  1.00 28.94  ? 100  GLU D CG  1 
ATOM   5910 C  CD  . GLU D 1 100 ? 8.552   53.244 70.487  1.00 30.60  ? 100  GLU D CD  1 
ATOM   5911 O  OE1 . GLU D 1 100 ? 8.572   52.665 71.591  1.00 35.95  ? 100  GLU D OE1 1 
ATOM   5912 O  OE2 . GLU D 1 100 ? 9.183   54.308 70.307  1.00 35.95  ? 100  GLU D OE2 1 
ATOM   5913 N  N   . PRO D 1 101 ? 4.947   53.445 66.940  1.00 25.41  ? 101  PRO D N   1 
ATOM   5914 C  CA  . PRO D 1 101 ? 5.198   53.985 65.583  1.00 24.51  ? 101  PRO D CA  1 
ATOM   5915 C  C   . PRO D 1 101 ? 6.680   53.957 65.203  1.00 22.79  ? 101  PRO D C   1 
ATOM   5916 O  O   . PRO D 1 101 ? 7.513   54.512 65.901  1.00 23.06  ? 101  PRO D O   1 
ATOM   5917 C  CB  . PRO D 1 101 ? 4.727   55.430 65.680  1.00 24.94  ? 101  PRO D CB  1 
ATOM   5918 C  CG  . PRO D 1 101 ? 3.730   55.430 66.761  1.00 26.36  ? 101  PRO D CG  1 
ATOM   5919 C  CD  . PRO D 1 101 ? 4.139   54.368 67.750  1.00 24.30  ? 101  PRO D CD  1 
ATOM   5920 N  N   . THR D 1 102 ? 6.998   53.291 64.104  1.00 22.46  ? 102  THR D N   1 
ATOM   5921 C  CA  . THR D 1 102 ? 8.390   53.008 63.739  1.00 21.51  ? 102  THR D CA  1 
ATOM   5922 C  C   . THR D 1 102 ? 8.681   53.419 62.293  1.00 23.15  ? 102  THR D C   1 
ATOM   5923 O  O   . THR D 1 102 ? 7.947   53.035 61.366  1.00 25.49  ? 102  THR D O   1 
ATOM   5924 C  CB  . THR D 1 102 ? 8.716   51.492 63.999  1.00 21.83  ? 102  THR D CB  1 
ATOM   5925 O  OG1 . THR D 1 102 ? 8.618   51.242 65.403  1.00 21.34  ? 102  THR D OG1 1 
ATOM   5926 C  CG2 . THR D 1 102 ? 10.104  51.075 63.476  1.00 20.76  ? 102  THR D CG2 1 
ATOM   5927 N  N   . ARG D 1 103 ? 9.727   54.232 62.100  1.00 23.06  ? 103  ARG D N   1 
ATOM   5928 C  CA  . ARG D 1 103 ? 10.296  54.511 60.774  1.00 22.67  ? 103  ARG D CA  1 
ATOM   5929 C  C   . ARG D 1 103 ? 11.517  53.614 60.430  1.00 23.42  ? 103  ARG D C   1 
ATOM   5930 O  O   . ARG D 1 103 ? 12.490  53.567 61.177  1.00 21.95  ? 103  ARG D O   1 
ATOM   5931 C  CB  . ARG D 1 103 ? 10.723  55.960 60.685  1.00 21.93  ? 103  ARG D CB  1 
ATOM   5932 C  CG  . ARG D 1 103 ? 11.179  56.350 59.291  1.00 24.64  ? 103  ARG D CG  1 
ATOM   5933 C  CD  . ARG D 1 103 ? 11.016  57.792 58.975  1.00 25.01  ? 103  ARG D CD  1 
ATOM   5934 N  NE  . ARG D 1 103 ? 9.650   58.129 58.644  1.00 24.38  ? 103  ARG D NE  1 
ATOM   5935 C  CZ  . ARG D 1 103 ? 9.227   59.324 58.327  1.00 23.17  ? 103  ARG D CZ  1 
ATOM   5936 N  NH1 . ARG D 1 103 ? 10.066  60.338 58.257  1.00 24.63  ? 103  ARG D NH1 1 
ATOM   5937 N  NH2 . ARG D 1 103 ? 7.940   59.512 58.073  1.00 23.46  ? 103  ARG D NH2 1 
ATOM   5938 N  N   . THR D 1 104 ? 11.459  52.948 59.288  1.00 22.75  ? 104  THR D N   1 
ATOM   5939 C  CA  . THR D 1 104 ? 12.548  52.099 58.833  1.00 22.87  ? 104  THR D CA  1 
ATOM   5940 C  C   . THR D 1 104 ? 13.075  52.614 57.534  1.00 22.85  ? 104  THR D C   1 
ATOM   5941 O  O   . THR D 1 104 ? 12.392  53.351 56.802  1.00 21.57  ? 104  THR D O   1 
ATOM   5942 C  CB  . THR D 1 104 ? 12.116  50.599 58.699  1.00 22.10  ? 104  THR D CB  1 
ATOM   5943 O  OG1 . THR D 1 104 ? 11.131  50.435 57.673  1.00 23.59  ? 104  THR D OG1 1 
ATOM   5944 C  CG2 . THR D 1 104 ? 11.576  50.056 59.986  1.00 23.77  ? 104  THR D CG2 1 
ATOM   5945 N  N   . CYS D 1 105 ? 14.320  52.250 57.249  1.00 23.16  ? 105  CYS D N   1 
ATOM   5946 C  CA  . CYS D 1 105 ? 14.846  52.389 55.912  1.00 23.20  ? 105  CYS D CA  1 
ATOM   5947 C  C   . CYS D 1 105 ? 15.290  51.019 55.443  1.00 23.85  ? 105  CYS D C   1 
ATOM   5948 O  O   . CYS D 1 105 ? 16.200  50.457 56.032  1.00 22.06  ? 105  CYS D O   1 
ATOM   5949 C  CB  . CYS D 1 105 ? 16.032  53.366 55.920  1.00 23.62  ? 105  CYS D CB  1 
ATOM   5950 S  SG  . CYS D 1 105 ? 16.735  53.786 54.293  1.00 23.29  ? 105  CYS D SG  1 
ATOM   5951 N  N   . TRP D 1 106 ? 14.749  50.584 54.297  1.00 23.21  ? 106  TRP D N   1 
ATOM   5952 C  CA  . TRP D 1 106 ? 15.089  49.269 53.735  1.00 23.22  ? 106  TRP D CA  1 
ATOM   5953 C  C   . TRP D 1 106 ? 16.175  49.460 52.707  1.00 22.28  ? 106  TRP D C   1 
ATOM   5954 O  O   . TRP D 1 106 ? 15.988  50.231 51.751  1.00 22.12  ? 106  TRP D O   1 
ATOM   5955 C  CB  . TRP D 1 106 ? 13.862  48.601 53.113  1.00 22.99  ? 106  TRP D CB  1 
ATOM   5956 C  CG  . TRP D 1 106 ? 12.880  48.189 54.160  1.00 24.33  ? 106  TRP D CG  1 
ATOM   5957 C  CD1 . TRP D 1 106 ? 12.370  48.973 55.183  1.00 22.23  ? 106  TRP D CD1 1 
ATOM   5958 C  CD2 . TRP D 1 106 ? 12.244  46.909 54.281  1.00 22.13  ? 106  TRP D CD2 1 
ATOM   5959 N  NE1 . TRP D 1 106 ? 11.504  48.240 55.950  1.00 24.24  ? 106  TRP D NE1 1 
ATOM   5960 C  CE2 . TRP D 1 106 ? 11.383  46.980 55.426  1.00 21.36  ? 106  TRP D CE2 1 
ATOM   5961 C  CE3 . TRP D 1 106 ? 12.323  45.717 53.560  1.00 21.38  ? 106  TRP D CE3 1 
ATOM   5962 C  CZ2 . TRP D 1 106 ? 10.631  45.929 55.854  1.00 22.23  ? 106  TRP D CZ2 1 
ATOM   5963 C  CZ3 . TRP D 1 106 ? 11.514  44.632 53.976  1.00 23.87  ? 106  TRP D CZ3 1 
ATOM   5964 C  CH2 . TRP D 1 106 ? 10.664  44.756 55.101  1.00 23.42  ? 106  TRP D CH2 1 
ATOM   5965 N  N   . PHE D 1 107 ? 17.281  48.744 52.896  1.00 22.84  ? 107  PHE D N   1 
ATOM   5966 C  CA  . PHE D 1 107 ? 18.403  48.752 51.947  1.00 23.84  ? 107  PHE D CA  1 
ATOM   5967 C  C   . PHE D 1 107 ? 18.538  47.435 51.195  1.00 23.31  ? 107  PHE D C   1 
ATOM   5968 O  O   . PHE D 1 107 ? 18.908  46.417 51.767  1.00 22.13  ? 107  PHE D O   1 
ATOM   5969 C  CB  . PHE D 1 107 ? 19.735  49.051 52.646  1.00 23.19  ? 107  PHE D CB  1 
ATOM   5970 C  CG  . PHE D 1 107 ? 19.843  50.447 53.276  1.00 22.60  ? 107  PHE D CG  1 
ATOM   5971 C  CD1 . PHE D 1 107 ? 20.335  51.539 52.525  1.00 24.39  ? 107  PHE D CD1 1 
ATOM   5972 C  CD2 . PHE D 1 107 ? 19.570  50.645 54.626  1.00 24.47  ? 107  PHE D CD2 1 
ATOM   5973 C  CE1 . PHE D 1 107 ? 20.423  52.820 53.092  1.00 21.72  ? 107  PHE D CE1 1 
ATOM   5974 C  CE2 . PHE D 1 107 ? 19.716  51.937 55.229  1.00 25.64  ? 107  PHE D CE2 1 
ATOM   5975 C  CZ  . PHE D 1 107 ? 20.154  53.013 54.438  1.00 24.23  ? 107  PHE D CZ  1 
ATOM   5976 N  N   . SER D 1 108 ? 18.288  47.474 49.891  1.00 21.60  ? 108  SER D N   1 
ATOM   5977 C  CA  . SER D 1 108 ? 18.578  46.331 49.026  1.00 21.24  ? 108  SER D CA  1 
ATOM   5978 C  C   . SER D 1 108 ? 20.092  46.158 48.830  1.00 21.88  ? 108  SER D C   1 
ATOM   5979 O  O   . SER D 1 108 ? 20.839  47.029 49.212  1.00 21.50  ? 108  SER D O   1 
ATOM   5980 C  CB  . SER D 1 108 ? 18.023  46.567 47.658  1.00 21.51  ? 108  SER D CB  1 
ATOM   5981 O  OG  . SER D 1 108 ? 18.636  47.749 47.129  1.00 20.90  ? 108  SER D OG  1 
ATOM   5982 N  N   . GLU D 1 109 ? 20.539  45.056 48.234  1.00 22.13  ? 109  GLU D N   1 
ATOM   5983 C  CA  . GLU D 1 109 ? 21.982  44.924 47.910  1.00 23.00  ? 109  GLU D CA  1 
ATOM   5984 C  C   . GLU D 1 109 ? 22.526  46.058 46.990  1.00 22.99  ? 109  GLU D C   1 
ATOM   5985 O  O   . GLU D 1 109 ? 23.606  46.582 47.221  1.00 21.95  ? 109  GLU D O   1 
ATOM   5986 C  CB  . GLU D 1 109 ? 22.268  43.585 47.300  1.00 23.39  ? 109  GLU D CB  1 
ATOM   5987 C  CG  . GLU D 1 109 ? 23.734  43.207 47.245  1.00 24.10  ? 109  GLU D CG  1 
ATOM   5988 C  CD  . GLU D 1 109 ? 23.974  41.967 46.383  1.00 26.47  ? 109  GLU D CD  1 
ATOM   5989 O  OE1 . GLU D 1 109 ? 23.945  40.833 46.880  1.00 33.56  ? 109  GLU D OE1 1 
ATOM   5990 O  OE2 . GLU D 1 109 ? 24.211  42.138 45.181  1.00 30.91  ? 109  GLU D OE2 1 
ATOM   5991 N  N   . LYS D 1 110 ? 21.744  46.428 45.993  1.00 23.35  ? 110  LYS D N   1 
ATOM   5992 C  CA  . LYS D 1 110 ? 22.077  47.524 45.098  1.00 25.07  ? 110  LYS D CA  1 
ATOM   5993 C  C   . LYS D 1 110 ? 22.238  48.816 45.823  1.00 23.84  ? 110  LYS D C   1 
ATOM   5994 O  O   . LYS D 1 110 ? 23.215  49.506 45.606  1.00 23.42  ? 110  LYS D O   1 
ATOM   5995 C  CB  . LYS D 1 110 ? 21.036  47.628 43.965  1.00 25.10  ? 110  LYS D CB  1 
ATOM   5996 C  CG  . LYS D 1 110 ? 21.417  48.480 42.788  1.00 28.15  ? 110  LYS D CG  1 
ATOM   5997 C  CD  . LYS D 1 110 ? 20.248  48.599 41.790  1.00 29.40  ? 110  LYS D CD  1 
ATOM   5998 C  CE  . LYS D 1 110 ? 20.670  49.285 40.462  1.00 34.17  ? 110  LYS D CE  1 
ATOM   5999 N  NZ  . LYS D 1 110 ? 19.520  49.911 39.737  1.00 35.03  ? 110  LYS D NZ  1 
ATOM   6000 N  N   . SER D 1 111 ? 21.317  49.152 46.714  1.00 23.52  ? 111  SER D N   1 
ATOM   6001 C  CA  . SER D 1 111 ? 21.495  50.381 47.454  1.00 24.73  ? 111  SER D CA  1 
ATOM   6002 C  C   . SER D 1 111 ? 22.686  50.368 48.448  1.00 24.52  ? 111  SER D C   1 
ATOM   6003 O  O   . SER D 1 111 ? 23.258  51.433 48.672  1.00 25.23  ? 111  SER D O   1 
ATOM   6004 C  CB  . SER D 1 111 ? 20.240  50.784 48.172  1.00 24.53  ? 111  SER D CB  1 
ATOM   6005 O  OG  . SER D 1 111 ? 20.059  49.960 49.222  1.00 27.57  ? 111  SER D OG  1 
ATOM   6006 N  N   . LEU D 1 112 ? 23.014  49.201 49.035  1.00 23.16  ? 112  LEU D N   1 
ATOM   6007 C  CA  . LEU D 1 112 ? 24.211  49.068 49.877  1.00 24.21  ? 112  LEU D CA  1 
ATOM   6008 C  C   . LEU D 1 112 ? 25.482  49.204 49.109  1.00 23.84  ? 112  LEU D C   1 
ATOM   6009 O  O   . LEU D 1 112 ? 26.395  49.805 49.601  1.00 24.72  ? 112  LEU D O   1 
ATOM   6010 C  CB  . LEU D 1 112 ? 24.199  47.744 50.671  1.00 23.08  ? 112  LEU D CB  1 
ATOM   6011 C  CG  . LEU D 1 112 ? 23.102  47.617 51.687  1.00 26.98  ? 112  LEU D CG  1 
ATOM   6012 C  CD1 . LEU D 1 112 ? 22.897  46.163 52.149  1.00 29.27  ? 112  LEU D CD1 1 
ATOM   6013 C  CD2 . LEU D 1 112 ? 23.298  48.621 52.877  1.00 20.97  ? 112  LEU D CD2 1 
ATOM   6014 N  N   . ARG D 1 113 ? 25.535  48.733 47.862  1.00 24.95  ? 113  ARG D N   1 
ATOM   6015 C  CA  . ARG D 1 113 ? 26.674  49.079 47.001  1.00 24.41  ? 113  ARG D CA  1 
ATOM   6016 C  C   . ARG D 1 113 ? 26.930  50.613 46.896  1.00 23.86  ? 113  ARG D C   1 
ATOM   6017 O  O   . ARG D 1 113 ? 28.063  51.057 47.020  1.00 22.90  ? 113  ARG D O   1 
ATOM   6018 C  CB  . ARG D 1 113 ? 26.551  48.460 45.580  1.00 24.46  ? 113  ARG D CB  1 
ATOM   6019 C  CG  . ARG D 1 113 ? 26.517  46.971 45.606  1.00 24.08  ? 113  ARG D CG  1 
ATOM   6020 C  CD  . ARG D 1 113 ? 26.410  46.369 44.188  1.00 25.49  ? 113  ARG D CD  1 
ATOM   6021 N  NE  . ARG D 1 113 ? 26.328  44.899 44.276  1.00 26.41  ? 113  ARG D NE  1 
ATOM   6022 C  CZ  . ARG D 1 113 ? 27.350  44.048 44.302  1.00 27.93  ? 113  ARG D CZ  1 
ATOM   6023 N  NH1 . ARG D 1 113 ? 28.637  44.415 44.231  1.00 23.87  ? 113  ARG D NH1 1 
ATOM   6024 N  NH2 . ARG D 1 113 ? 27.085  42.762 44.427  1.00 30.67  ? 113  ARG D NH2 1 
ATOM   6025 N  N   . THR D 1 114 ? 25.876  51.372 46.646  1.00 22.97  ? 114  THR D N   1 
ATOM   6026 C  CA  . THR D 1 114 ? 25.954  52.808 46.621  1.00 23.93  ? 114  THR D CA  1 
ATOM   6027 C  C   . THR D 1 114 ? 26.397  53.384 47.986  1.00 22.91  ? 114  THR D C   1 
ATOM   6028 O  O   . THR D 1 114 ? 27.199  54.336 48.035  1.00 20.62  ? 114  THR D O   1 
ATOM   6029 C  CB  . THR D 1 114 ? 24.594  53.411 46.194  1.00 25.07  ? 114  THR D CB  1 
ATOM   6030 O  OG1 . THR D 1 114 ? 24.198  52.801 44.969  1.00 24.87  ? 114  THR D OG1 1 
ATOM   6031 C  CG2 . THR D 1 114 ? 24.639  54.964 46.047  1.00 22.12  ? 114  THR D CG2 1 
ATOM   6032 N  N   . VAL D 1 115 ? 25.858  52.836 49.066  1.00 21.69  ? 115  VAL D N   1 
ATOM   6033 C  CA  . VAL D 1 115 ? 26.287  53.254 50.391  1.00 21.24  ? 115  VAL D CA  1 
ATOM   6034 C  C   . VAL D 1 115 ? 27.805  53.081 50.524  1.00 20.70  ? 115  VAL D C   1 
ATOM   6035 O  O   . VAL D 1 115 ? 28.513  54.040 50.827  1.00 20.78  ? 115  VAL D O   1 
ATOM   6036 C  CB  . VAL D 1 115 ? 25.534  52.543 51.544  1.00 21.52  ? 115  VAL D CB  1 
ATOM   6037 C  CG1 . VAL D 1 115 ? 26.216  52.916 52.933  1.00 19.97  ? 115  VAL D CG1 1 
ATOM   6038 C  CG2 . VAL D 1 115 ? 24.038  52.818 51.492  1.00 22.09  ? 115  VAL D CG2 1 
ATOM   6039 N  N   . PHE D 1 116 ? 28.299  51.911 50.187  1.00 20.62  ? 116  PHE D N   1 
ATOM   6040 C  CA  . PHE D 1 116 ? 29.688  51.579 50.392  1.00 20.63  ? 116  PHE D CA  1 
ATOM   6041 C  C   . PHE D 1 116 ? 30.651  52.280 49.433  1.00 20.30  ? 116  PHE D C   1 
ATOM   6042 O  O   . PHE D 1 116 ? 31.742  52.541 49.807  1.00 20.70  ? 116  PHE D O   1 
ATOM   6043 C  CB  . PHE D 1 116 ? 29.911  50.079 50.275  1.00 20.53  ? 116  PHE D CB  1 
ATOM   6044 C  CG  . PHE D 1 116 ? 29.049  49.234 51.192  1.00 20.80  ? 116  PHE D CG  1 
ATOM   6045 C  CD1 . PHE D 1 116 ? 28.691  49.678 52.451  1.00 19.49  ? 116  PHE D CD1 1 
ATOM   6046 C  CD2 . PHE D 1 116 ? 28.622  47.978 50.788  1.00 19.55  ? 116  PHE D CD2 1 
ATOM   6047 C  CE1 . PHE D 1 116 ? 27.914  48.906 53.290  1.00 22.09  ? 116  PHE D CE1 1 
ATOM   6048 C  CE2 . PHE D 1 116 ? 27.785  47.221 51.658  1.00 20.92  ? 116  PHE D CE2 1 
ATOM   6049 C  CZ  . PHE D 1 116 ? 27.421  47.731 52.882  1.00 23.18  ? 116  PHE D CZ  1 
ATOM   6050 N  N   . ARG D 1 117 ? 30.222  52.523 48.196  1.00 20.08  ? 117  ARG D N   1 
ATOM   6051 C  CA  . ARG D 1 117 ? 30.863  53.400 47.250  1.00 20.32  ? 117  ARG D CA  1 
ATOM   6052 C  C   . ARG D 1 117 ? 31.034  54.840 47.706  1.00 19.39  ? 117  ARG D C   1 
ATOM   6053 O  O   . ARG D 1 117 ? 31.997  55.471 47.345  1.00 19.20  ? 117  ARG D O   1 
ATOM   6054 C  CB  . ARG D 1 117 ? 30.087  53.374 45.955  1.00 21.39  ? 117  ARG D CB  1 
ATOM   6055 C  CG  . ARG D 1 117 ? 30.321  52.151 45.188  1.00 23.65  ? 117  ARG D CG  1 
ATOM   6056 C  CD  . ARG D 1 117 ? 29.304  51.983 44.078  1.00 25.67  ? 117  ARG D CD  1 
ATOM   6057 N  NE  . ARG D 1 117 ? 29.315  50.613 43.580  1.00 28.82  ? 117  ARG D NE  1 
ATOM   6058 C  CZ  . ARG D 1 117 ? 28.493  50.158 42.616  1.00 30.23  ? 117  ARG D CZ  1 
ATOM   6059 N  NH1 . ARG D 1 117 ? 27.649  50.968 41.995  1.00 31.16  ? 117  ARG D NH1 1 
ATOM   6060 N  NH2 . ARG D 1 117 ? 28.549  48.891 42.237  1.00 26.66  ? 117  ARG D NH2 1 
ATOM   6061 N  N   . THR D 1 118 ? 30.155  55.300 48.589  1.00 19.99  ? 118  THR D N   1 
ATOM   6062 C  CA  . THR D 1 118 ? 30.192  56.598 49.206  1.00 20.64  ? 118  THR D CA  1 
ATOM   6063 C  C   . THR D 1 118 ? 31.040  56.620 50.523  1.00 20.50  ? 118  THR D C   1 
ATOM   6064 O  O   . THR D 1 118 ? 31.768  57.557 50.789  1.00 20.97  ? 118  THR D O   1 
ATOM   6065 C  CB  . THR D 1 118 ? 28.709  57.033 49.478  1.00 21.77  ? 118  THR D CB  1 
ATOM   6066 O  OG1 . THR D 1 118 ? 27.968  56.894 48.236  1.00 21.53  ? 118  THR D OG1 1 
ATOM   6067 C  CG2 . THR D 1 118 ? 28.587  58.505 50.073  1.00 20.17  ? 118  THR D CG2 1 
ATOM   6068 N  N   . ASP D 1 119 ? 30.886  55.596 51.331  1.00 20.81  ? 119  ASP D N   1 
ATOM   6069 C  CA  . ASP D 1 119 ? 31.465  55.545 52.676  1.00 20.42  ? 119  ASP D CA  1 
ATOM   6070 C  C   . ASP D 1 119 ? 31.872  54.121 53.030  1.00 19.50  ? 119  ASP D C   1 
ATOM   6071 O  O   . ASP D 1 119 ? 31.095  53.354 53.514  1.00 19.22  ? 119  ASP D O   1 
ATOM   6072 C  CB  . ASP D 1 119 ? 30.503  56.120 53.709  1.00 21.12  ? 119  ASP D CB  1 
ATOM   6073 C  CG  . ASP D 1 119 ? 31.182  56.601 54.921  1.00 23.41  ? 119  ASP D CG  1 
ATOM   6074 O  OD1 . ASP D 1 119 ? 31.980  57.543 54.789  1.00 23.53  ? 119  ASP D OD1 1 
ATOM   6075 O  OD2 . ASP D 1 119 ? 30.906  56.094 56.005  1.00 29.21  ? 119  ASP D OD2 1 
ATOM   6076 N  N   . GLU D 1 120 ? 33.142  53.833 52.784  1.00 20.10  ? 120  GLU D N   1 
ATOM   6077 C  CA  . GLU D 1 120 ? 33.740  52.522 52.999  1.00 20.50  ? 120  GLU D CA  1 
ATOM   6078 C  C   . GLU D 1 120 ? 33.612  52.060 54.459  1.00 20.75  ? 120  GLU D C   1 
ATOM   6079 O  O   . GLU D 1 120 ? 33.433  50.851 54.736  1.00 19.42  ? 120  GLU D O   1 
ATOM   6080 C  CB  . GLU D 1 120 ? 35.187  52.566 52.489  1.00 20.53  ? 120  GLU D CB  1 
ATOM   6081 C  CG  . GLU D 1 120 ? 36.102  51.398 52.806  1.00 24.55  ? 120  GLU D CG  1 
ATOM   6082 C  CD  . GLU D 1 120 ? 37.521  51.669 52.454  1.00 20.87  ? 120  GLU D CD  1 
ATOM   6083 O  OE1 . GLU D 1 120 ? 38.268  52.281 53.255  1.00 24.23  ? 120  GLU D OE1 1 
ATOM   6084 O  OE2 . GLU D 1 120 ? 37.856  51.390 51.301  1.00 26.86  ? 120  GLU D OE2 1 
ATOM   6085 N  N   . ASP D 1 121 ? 33.624  53.034 55.395  1.00 21.12  ? 121  ASP D N   1 
ATOM   6086 C  CA  . ASP D 1 121 ? 33.542  52.751 56.820  1.00 21.33  ? 121  ASP D CA  1 
ATOM   6087 C  C   . ASP D 1 121 ? 32.246  52.058 57.235  1.00 22.07  ? 121  ASP D C   1 
ATOM   6088 O  O   . ASP D 1 121 ? 32.247  51.292 58.243  1.00 21.65  ? 121  ASP D O   1 
ATOM   6089 C  CB  . ASP D 1 121 ? 33.699  54.047 57.676  1.00 22.82  ? 121  ASP D CB  1 
ATOM   6090 C  CG  . ASP D 1 121 ? 35.121  54.433 57.909  1.00 25.69  ? 121  ASP D CG  1 
ATOM   6091 O  OD1 . ASP D 1 121 ? 35.973  53.605 57.614  1.00 26.78  ? 121  ASP D OD1 1 
ATOM   6092 O  OD2 . ASP D 1 121 ? 35.368  55.646 58.265  1.00 36.91  ? 121  ASP D OD2 1 
ATOM   6093 N  N   . MET D 1 122 ? 31.156  52.263 56.478  1.00 20.40  ? 122  MET D N   1 
ATOM   6094 C  CA  . MET D 1 122 ? 29.885  51.574 56.727  1.00 20.84  ? 122  MET D CA  1 
ATOM   6095 C  C   . MET D 1 122 ? 29.950  50.023 56.557  1.00 21.15  ? 122  MET D C   1 
ATOM   6096 O  O   . MET D 1 122 ? 29.232  49.302 57.247  1.00 21.98  ? 122  MET D O   1 
ATOM   6097 C  CB  . MET D 1 122 ? 28.707  52.175 55.889  1.00 20.08  ? 122  MET D CB  1 
ATOM   6098 C  CG  . MET D 1 122 ? 28.414  53.614 56.177  1.00 20.41  ? 122  MET D CG  1 
ATOM   6099 S  SD  . MET D 1 122 ? 27.797  53.862 57.884  1.00 27.34  ? 122  MET D SD  1 
ATOM   6100 C  CE  . MET D 1 122 ? 29.325  54.423 58.611  1.00 24.49  ? 122  MET D CE  1 
ATOM   6101 N  N   . ILE D 1 123 ? 30.810  49.527 55.692  1.00 21.51  ? 123  ILE D N   1 
ATOM   6102 C  CA  . ILE D 1 123 ? 31.081  48.076 55.615  1.00 21.38  ? 123  ILE D CA  1 
ATOM   6103 C  C   . ILE D 1 123 ? 31.405  47.500 56.989  1.00 20.98  ? 123  ILE D C   1 
ATOM   6104 O  O   . ILE D 1 123 ? 30.850  46.452 57.441  1.00 20.15  ? 123  ILE D O   1 
ATOM   6105 C  CB  . ILE D 1 123 ? 32.229  47.732 54.678  1.00 22.20  ? 123  ILE D CB  1 
ATOM   6106 C  CG1 . ILE D 1 123 ? 32.015  48.272 53.223  1.00 21.42  ? 123  ILE D CG1 1 
ATOM   6107 C  CG2 . ILE D 1 123 ? 32.475  46.183 54.803  1.00 22.43  ? 123  ILE D CG2 1 
ATOM   6108 C  CD1 . ILE D 1 123 ? 33.272  48.303 52.371  1.00 19.36  ? 123  ILE D CD1 1 
ATOM   6109 N  N   . PHE D 1 124 ? 32.365  48.126 57.641  1.00 21.19  ? 124  PHE D N   1 
ATOM   6110 C  CA  . PHE D 1 124 ? 32.929  47.566 58.872  1.00 20.20  ? 124  PHE D CA  1 
ATOM   6111 C  C   . PHE D 1 124 ? 31.990  47.762 60.049  1.00 19.56  ? 124  PHE D C   1 
ATOM   6112 O  O   . PHE D 1 124 ? 31.973  46.938 60.928  1.00 19.15  ? 124  PHE D O   1 
ATOM   6113 C  CB  . PHE D 1 124 ? 34.312  48.133 59.134  1.00 20.68  ? 124  PHE D CB  1 
ATOM   6114 C  CG  . PHE D 1 124 ? 35.261  47.831 58.036  1.00 20.31  ? 124  PHE D CG  1 
ATOM   6115 C  CD1 . PHE D 1 124 ? 35.869  46.617 57.988  1.00 18.84  ? 124  PHE D CD1 1 
ATOM   6116 C  CD2 . PHE D 1 124 ? 35.510  48.762 57.007  1.00 19.23  ? 124  PHE D CD2 1 
ATOM   6117 C  CE1 . PHE D 1 124 ? 36.681  46.298 56.961  1.00 17.84  ? 124  PHE D CE1 1 
ATOM   6118 C  CE2 . PHE D 1 124 ? 36.313  48.425 55.954  1.00 20.28  ? 124  PHE D CE2 1 
ATOM   6119 C  CZ  . PHE D 1 124 ? 36.914  47.189 55.931  1.00 19.47  ? 124  PHE D CZ  1 
ATOM   6120 N  N   . GLU D 1 125 ? 31.171  48.815 60.045  1.00 19.88  ? 125  GLU D N   1 
ATOM   6121 C  CA  . GLU D 1 125 ? 30.106  48.992 61.050  1.00 19.27  ? 125  GLU D CA  1 
ATOM   6122 C  C   . GLU D 1 125 ? 29.081  47.856 60.978  1.00 20.56  ? 125  GLU D C   1 
ATOM   6123 O  O   . GLU D 1 125 ? 28.717  47.286 62.001  1.00 20.78  ? 125  GLU D O   1 
ATOM   6124 C  CB  . GLU D 1 125 ? 29.410  50.322 60.920  1.00 21.57  ? 125  GLU D CB  1 
ATOM   6125 C  CG  . GLU D 1 125 ? 30.280  51.587 61.267  1.00 21.80  ? 125  GLU D CG  1 
ATOM   6126 C  CD  . GLU D 1 125 ? 31.055  51.399 62.576  1.00 25.98  ? 125  GLU D CD  1 
ATOM   6127 O  OE1 . GLU D 1 125 ? 30.411  51.333 63.644  1.00 28.57  ? 125  GLU D OE1 1 
ATOM   6128 O  OE2 . GLU D 1 125 ? 32.311  51.253 62.518  1.00 28.31  ? 125  GLU D OE2 1 
ATOM   6129 N  N   . ILE D 1 126 ? 28.695  47.487 59.761  1.00 19.59  ? 126  ILE D N   1 
ATOM   6130 C  CA  . ILE D 1 126 ? 27.862  46.400 59.536  1.00 19.58  ? 126  ILE D CA  1 
ATOM   6131 C  C   . ILE D 1 126 ? 28.506  45.066 59.940  1.00 20.60  ? 126  ILE D C   1 
ATOM   6132 O  O   . ILE D 1 126 ? 27.839  44.225 60.561  1.00 21.56  ? 126  ILE D O   1 
ATOM   6133 C  CB  . ILE D 1 126 ? 27.239  46.375 58.063  1.00 19.57  ? 126  ILE D CB  1 
ATOM   6134 C  CG1 . ILE D 1 126 ? 26.378  47.606 57.831  1.00 18.01  ? 126  ILE D CG1 1 
ATOM   6135 C  CG2 . ILE D 1 126 ? 26.429  45.043 57.833  1.00 17.91  ? 126  ILE D CG2 1 
ATOM   6136 C  CD1 . ILE D 1 126 ? 25.914  47.902 56.344  1.00 17.28  ? 126  ILE D CD1 1 
ATOM   6137 N  N   . PHE D 1 127 ? 29.778  44.882 59.650  1.00 20.89  ? 127  PHE D N   1 
ATOM   6138 C  CA  . PHE D 1 127 ? 30.497  43.738 60.199  1.00 21.26  ? 127  PHE D CA  1 
ATOM   6139 C  C   . PHE D 1 127 ? 30.433  43.647 61.719  1.00 19.97  ? 127  PHE D C   1 
ATOM   6140 O  O   . PHE D 1 127 ? 30.182  42.574 62.219  1.00 21.58  ? 127  PHE D O   1 
ATOM   6141 C  CB  . PHE D 1 127 ? 31.979  43.712 59.814  1.00 20.62  ? 127  PHE D CB  1 
ATOM   6142 C  CG  . PHE D 1 127 ? 32.266  43.432 58.381  1.00 18.58  ? 127  PHE D CG  1 
ATOM   6143 C  CD1 . PHE D 1 127 ? 31.320  42.961 57.511  1.00 21.77  ? 127  PHE D CD1 1 
ATOM   6144 C  CD2 . PHE D 1 127 ? 33.558  43.647 57.901  1.00 19.50  ? 127  PHE D CD2 1 
ATOM   6145 C  CE1 . PHE D 1 127 ? 31.655  42.680 56.181  1.00 20.50  ? 127  PHE D CE1 1 
ATOM   6146 C  CE2 . PHE D 1 127 ? 33.895  43.350 56.602  1.00 21.31  ? 127  PHE D CE2 1 
ATOM   6147 C  CZ  . PHE D 1 127 ? 32.929  42.884 55.731  1.00 21.06  ? 127  PHE D CZ  1 
ATOM   6148 N  N   . LYS D 1 128 ? 30.634  44.755 62.431  1.00 22.27  ? 128  LYS D N   1 
ATOM   6149 C  CA  . LYS D 1 128 ? 30.548  44.794 63.867  1.00 22.09  ? 128  LYS D CA  1 
ATOM   6150 C  C   . LYS D 1 128 ? 29.138  44.342 64.318  1.00 22.04  ? 128  LYS D C   1 
ATOM   6151 O  O   . LYS D 1 128 ? 29.002  43.639 65.316  1.00 21.64  ? 128  LYS D O   1 
ATOM   6152 C  CB  . LYS D 1 128 ? 30.916  46.161 64.462  1.00 21.88  ? 128  LYS D CB  1 
ATOM   6153 C  CG  . LYS D 1 128 ? 32.361  46.540 64.224  1.00 24.16  ? 128  LYS D CG  1 
ATOM   6154 C  CD  . LYS D 1 128 ? 32.620  47.985 64.490  1.00 23.96  ? 128  LYS D CD  1 
ATOM   6155 C  CE  . LYS D 1 128 ? 33.952  48.442 63.962  1.00 25.73  ? 128  LYS D CE  1 
ATOM   6156 N  NZ  . LYS D 1 128 ? 34.278  49.931 64.070  1.00 21.61  ? 128  LYS D NZ  1 
ATOM   6157 N  N   . ASN D 1 129 ? 28.118  44.756 63.598  1.00 22.66  ? 129  ASN D N   1 
ATOM   6158 C  CA  . ASN D 1 129 ? 26.758  44.470 63.942  1.00 21.15  ? 129  ASN D CA  1 
ATOM   6159 C  C   . ASN D 1 129 ? 26.470  42.989 63.777  1.00 22.34  ? 129  ASN D C   1 
ATOM   6160 O  O   . ASN D 1 129 ? 25.944  42.345 64.704  1.00 19.77  ? 129  ASN D O   1 
ATOM   6161 C  CB  . ASN D 1 129 ? 25.807  45.411 63.131  1.00 23.09  ? 129  ASN D CB  1 
ATOM   6162 C  CG  . ASN D 1 129 ? 24.309  45.168 63.453  1.00 21.99  ? 129  ASN D CG  1 
ATOM   6163 O  OD1 . ASN D 1 129 ? 23.706  44.307 62.891  1.00 20.83  ? 129  ASN D OD1 1 
ATOM   6164 N  ND2 . ASN D 1 129 ? 23.744  45.990 64.320  1.00 20.42  ? 129  ASN D ND2 1 
ATOM   6165 N  N   . TYR D 1 130 ? 26.892  42.404 62.633  1.00 20.44  ? 130  TYR D N   1 
ATOM   6166 C  CA  . TYR D 1 130 ? 26.797  41.009 62.483  1.00 21.26  ? 130  TYR D CA  1 
ATOM   6167 C  C   . TYR D 1 130 ? 27.583  40.185 63.514  1.00 20.03  ? 130  TYR D C   1 
ATOM   6168 O  O   . TYR D 1 130 ? 27.076  39.231 64.022  1.00 20.79  ? 130  TYR D O   1 
ATOM   6169 C  CB  . TYR D 1 130 ? 27.297  40.538 61.101  1.00 18.48  ? 130  TYR D CB  1 
ATOM   6170 C  CG  . TYR D 1 130 ? 26.331  40.639 60.012  1.00 20.00  ? 130  TYR D CG  1 
ATOM   6171 C  CD1 . TYR D 1 130 ? 25.174  39.834 59.989  1.00 21.52  ? 130  TYR D CD1 1 
ATOM   6172 C  CD2 . TYR D 1 130 ? 26.627  41.376 58.870  1.00 21.04  ? 130  TYR D CD2 1 
ATOM   6173 C  CE1 . TYR D 1 130 ? 24.265  39.899 58.914  1.00 20.90  ? 130  TYR D CE1 1 
ATOM   6174 C  CE2 . TYR D 1 130 ? 25.765  41.394 57.793  1.00 20.84  ? 130  TYR D CE2 1 
ATOM   6175 C  CZ  . TYR D 1 130 ? 24.567  40.693 57.803  1.00 19.19  ? 130  TYR D CZ  1 
ATOM   6176 O  OH  . TYR D 1 130 ? 23.723  40.689 56.655  1.00 22.72  ? 130  TYR D OH  1 
ATOM   6177 N  N   . LEU D 1 131 ? 28.816  40.533 63.744  1.00 20.69  ? 131  LEU D N   1 
ATOM   6178 C  CA  . LEU D 1 131 ? 29.683  39.893 64.753  1.00 19.92  ? 131  LEU D CA  1 
ATOM   6179 C  C   . LEU D 1 131 ? 29.101  39.881 66.143  1.00 20.83  ? 131  LEU D C   1 
ATOM   6180 O  O   . LEU D 1 131 ? 29.180  38.863 66.837  1.00 20.35  ? 131  LEU D O   1 
ATOM   6181 C  CB  . LEU D 1 131 ? 31.069  40.501 64.775  1.00 18.97  ? 131  LEU D CB  1 
ATOM   6182 C  CG  . LEU D 1 131 ? 32.143  39.909 65.687  1.00 18.60  ? 131  LEU D CG  1 
ATOM   6183 C  CD1 . LEU D 1 131 ? 32.254  38.350 65.482  1.00 19.32  ? 131  LEU D CD1 1 
ATOM   6184 C  CD2 . LEU D 1 131 ? 33.508  40.534 65.566  1.00 20.53  ? 131  LEU D CD2 1 
ATOM   6185 N  N   . THR D 1 132 ? 28.561  41.019 66.558  1.00 19.85  ? 132  THR D N   1 
ATOM   6186 C  CA  . THR D 1 132 ? 27.917  41.153 67.834  1.00 19.66  ? 132  THR D CA  1 
ATOM   6187 C  C   . THR D 1 132 ? 26.819  40.102 67.925  1.00 20.83  ? 132  THR D C   1 
ATOM   6188 O  O   . THR D 1 132 ? 26.727  39.432 68.919  1.00 22.02  ? 132  THR D O   1 
ATOM   6189 C  CB  . THR D 1 132 ? 27.327  42.567 68.074  1.00 18.05  ? 132  THR D CB  1 
ATOM   6190 O  OG1 . THR D 1 132 ? 28.412  43.499 68.025  1.00 19.31  ? 132  THR D OG1 1 
ATOM   6191 C  CG2 . THR D 1 132 ? 26.663  42.676 69.451  1.00 17.92  ? 132  THR D CG2 1 
ATOM   6192 N  N   . LYS D 1 133 ? 26.002  39.994 66.899  1.00 20.31  ? 133  LYS D N   1 
ATOM   6193 C  CA  . LYS D 1 133 ? 24.936  38.936 66.881  1.00 22.64  ? 133  LYS D CA  1 
ATOM   6194 C  C   . LYS D 1 133 ? 25.455  37.533 66.971  1.00 22.38  ? 133  LYS D C   1 
ATOM   6195 O  O   . LYS D 1 133 ? 24.938  36.721 67.751  1.00 22.64  ? 133  LYS D O   1 
ATOM   6196 C  CB  . LYS D 1 133 ? 24.046  39.084 65.641  1.00 21.23  ? 133  LYS D CB  1 
ATOM   6197 C  CG  . LYS D 1 133 ? 23.306  40.457 65.686  1.00 24.17  ? 133  LYS D CG  1 
ATOM   6198 C  CD  . LYS D 1 133 ? 22.524  40.771 64.396  1.00 22.53  ? 133  LYS D CD  1 
ATOM   6199 C  CE  . LYS D 1 133 ? 21.772  42.093 64.487  1.00 21.31  ? 133  LYS D CE  1 
ATOM   6200 N  NZ  . LYS D 1 133 ? 21.200  42.379 63.137  1.00 21.99  ? 133  LYS D NZ  1 
ATOM   6201 N  N   . VAL D 1 134 ? 26.491  37.241 66.186  1.00 22.72  ? 134  VAL D N   1 
ATOM   6202 C  CA  . VAL D 1 134 ? 26.985  35.896 66.141  1.00 22.32  ? 134  VAL D CA  1 
ATOM   6203 C  C   . VAL D 1 134 ? 27.530  35.542 67.539  1.00 21.61  ? 134  VAL D C   1 
ATOM   6204 O  O   . VAL D 1 134 ? 27.254  34.465 68.072  1.00 20.91  ? 134  VAL D O   1 
ATOM   6205 C  CB  . VAL D 1 134 ? 28.139  35.669 65.080  1.00 23.33  ? 134  VAL D CB  1 
ATOM   6206 C  CG1 . VAL D 1 134 ? 28.801  34.233 65.274  1.00 21.61  ? 134  VAL D CG1 1 
ATOM   6207 C  CG2 . VAL D 1 134 ? 27.717  35.925 63.588  1.00 16.96  ? 134  VAL D CG2 1 
ATOM   6208 N  N   . ALA D 1 135 ? 28.349  36.431 68.100  1.00 20.99  ? 135  ALA D N   1 
ATOM   6209 C  CA  . ALA D 1 135 ? 28.948  36.225 69.416  1.00 20.70  ? 135  ALA D CA  1 
ATOM   6210 C  C   . ALA D 1 135 ? 27.914  36.005 70.529  1.00 21.06  ? 135  ALA D C   1 
ATOM   6211 O  O   . ALA D 1 135 ? 28.178  35.263 71.444  1.00 21.81  ? 135  ALA D O   1 
ATOM   6212 C  CB  . ALA D 1 135 ? 29.945  37.455 69.793  1.00 19.73  ? 135  ALA D CB  1 
ATOM   6213 N  N   . TYR D 1 136 ? 26.787  36.726 70.462  1.00 21.98  ? 136  TYR D N   1 
ATOM   6214 C  CA  . TYR D 1 136 ? 25.768  36.644 71.484  1.00 21.38  ? 136  TYR D CA  1 
ATOM   6215 C  C   . TYR D 1 136 ? 25.061  35.271 71.424  1.00 19.80  ? 136  TYR D C   1 
ATOM   6216 O  O   . TYR D 1 136 ? 25.050  34.514 72.391  1.00 20.47  ? 136  TYR D O   1 
ATOM   6217 C  CB  . TYR D 1 136 ? 24.734  37.828 71.339  1.00 22.19  ? 136  TYR D CB  1 
ATOM   6218 C  CG  . TYR D 1 136 ? 23.579  37.586 72.286  1.00 22.16  ? 136  TYR D CG  1 
ATOM   6219 C  CD1 . TYR D 1 136 ? 22.432  36.919 71.863  1.00 23.95  ? 136  TYR D CD1 1 
ATOM   6220 C  CD2 . TYR D 1 136 ? 23.700  37.911 73.657  1.00 26.32  ? 136  TYR D CD2 1 
ATOM   6221 C  CE1 . TYR D 1 136 ? 21.410  36.616 72.785  1.00 19.11  ? 136  TYR D CE1 1 
ATOM   6222 C  CE2 . TYR D 1 136 ? 22.692  37.629 74.554  1.00 26.02  ? 136  TYR D CE2 1 
ATOM   6223 C  CZ  . TYR D 1 136 ? 21.569  36.983 74.127  1.00 23.76  ? 136  TYR D CZ  1 
ATOM   6224 O  OH  . TYR D 1 136 ? 20.580  36.734 75.046  1.00 24.10  ? 136  TYR D OH  1 
ATOM   6225 N  N   . TYR D 1 137 ? 24.609  34.890 70.249  1.00 20.36  ? 137  TYR D N   1 
ATOM   6226 C  CA  . TYR D 1 137 ? 23.888  33.614 70.073  1.00 20.98  ? 137  TYR D CA  1 
ATOM   6227 C  C   . TYR D 1 137 ? 24.734  32.395 70.178  1.00 20.42  ? 137  TYR D C   1 
ATOM   6228 O  O   . TYR D 1 137 ? 24.299  31.439 70.781  1.00 20.72  ? 137  TYR D O   1 
ATOM   6229 C  CB  . TYR D 1 137 ? 23.013  33.581 68.795  1.00 21.32  ? 137  TYR D CB  1 
ATOM   6230 C  CG  . TYR D 1 137 ? 21.939  34.631 68.799  1.00 21.29  ? 137  TYR D CG  1 
ATOM   6231 C  CD1 . TYR D 1 137 ? 20.789  34.477 69.539  1.00 22.17  ? 137  TYR D CD1 1 
ATOM   6232 C  CD2 . TYR D 1 137 ? 22.077  35.801 68.004  1.00 24.28  ? 137  TYR D CD2 1 
ATOM   6233 C  CE1 . TYR D 1 137 ? 19.832  35.501 69.564  1.00 25.22  ? 137  TYR D CE1 1 
ATOM   6234 C  CE2 . TYR D 1 137 ? 21.087  36.820 67.979  1.00 20.96  ? 137  TYR D CE2 1 
ATOM   6235 C  CZ  . TYR D 1 137 ? 19.971  36.655 68.742  1.00 19.87  ? 137  TYR D CZ  1 
ATOM   6236 O  OH  . TYR D 1 137 ? 19.011  37.691 68.787  1.00 19.87  ? 137  TYR D OH  1 
ATOM   6237 N  N   . ALA D 1 138 ? 25.949  32.433 69.660  1.00 21.25  ? 138  ALA D N   1 
ATOM   6238 C  CA  . ALA D 1 138 ? 26.884  31.321 69.830  1.00 22.06  ? 138  ALA D CA  1 
ATOM   6239 C  C   . ALA D 1 138 ? 27.222  31.114 71.306  1.00 22.96  ? 138  ALA D C   1 
ATOM   6240 O  O   . ALA D 1 138 ? 27.168  30.001 71.841  1.00 23.35  ? 138  ALA D O   1 
ATOM   6241 C  CB  . ALA D 1 138 ? 28.151  31.563 68.979  1.00 21.35  ? 138  ALA D CB  1 
ATOM   6242 N  N   . ARG D 1 139 ? 27.533  32.203 72.006  1.00 24.19  ? 139  ARG D N   1 
ATOM   6243 C  CA  . ARG D 1 139 ? 27.741  32.116 73.460  1.00 24.71  ? 139  ARG D CA  1 
ATOM   6244 C  C   . ARG D 1 139 ? 26.555  31.533 74.209  1.00 22.49  ? 139  ARG D C   1 
ATOM   6245 O  O   . ARG D 1 139 ? 26.724  30.684 75.083  1.00 23.87  ? 139  ARG D O   1 
ATOM   6246 C  CB  . ARG D 1 139 ? 28.071  33.476 74.096  1.00 23.61  ? 139  ARG D CB  1 
ATOM   6247 C  CG  . ARG D 1 139 ? 28.364  33.329 75.619  1.00 26.96  ? 139  ARG D CG  1 
ATOM   6248 C  CD  . ARG D 1 139 ? 28.700  34.582 76.339  1.00 30.67  ? 139  ARG D CD  1 
ATOM   6249 N  NE  . ARG D 1 139 ? 27.787  35.685 76.039  1.00 36.48  ? 139  ARG D NE  1 
ATOM   6250 C  CZ  . ARG D 1 139 ? 26.747  36.085 76.791  1.00 40.09  ? 139  ARG D CZ  1 
ATOM   6251 N  NH1 . ARG D 1 139 ? 26.360  35.439 77.926  1.00 43.16  ? 139  ARG D NH1 1 
ATOM   6252 N  NH2 . ARG D 1 139 ? 26.054  37.134 76.377  1.00 39.64  ? 139  ARG D NH2 1 
ATOM   6253 N  N   . GLN D 1 140 ? 25.377  31.996 73.882  1.00 22.36  ? 140  GLN D N   1 
ATOM   6254 C  CA  . GLN D 1 140 ? 24.159  31.555 74.515  1.00 23.47  ? 140  GLN D CA  1 
ATOM   6255 C  C   . GLN D 1 140 ? 23.819  30.046 74.349  1.00 22.16  ? 140  GLN D C   1 
ATOM   6256 O  O   . GLN D 1 140 ? 23.413  29.414 75.329  1.00 19.02  ? 140  GLN D O   1 
ATOM   6257 C  CB  . GLN D 1 140 ? 23.058  32.503 74.066  1.00 25.51  ? 140  GLN D CB  1 
ATOM   6258 C  CG  . GLN D 1 140 ? 21.736  32.239 74.561  1.00 28.97  ? 140  GLN D CG  1 
ATOM   6259 C  CD  . GLN D 1 140 ? 21.540  32.714 76.006  1.00 40.69  ? 140  GLN D CD  1 
ATOM   6260 O  OE1 . GLN D 1 140 ? 22.231  33.657 76.508  1.00 40.85  ? 140  GLN D OE1 1 
ATOM   6261 N  NE2 . GLN D 1 140 ? 20.608  32.027 76.705  1.00 38.73  ? 140  GLN D NE2 1 
ATOM   6262 N  N   . VAL D 1 141 ? 23.993  29.503 73.124  1.00 20.54  ? 141  VAL D N   1 
ATOM   6263 C  CA  . VAL D 1 141 ? 23.899  28.132 72.841  1.00 20.24  ? 141  VAL D CA  1 
ATOM   6264 C  C   . VAL D 1 141 ? 24.880  27.416 73.771  1.00 18.87  ? 141  VAL D C   1 
ATOM   6265 O  O   . VAL D 1 141 ? 24.484  26.486 74.471  1.00 19.58  ? 141  VAL D O   1 
ATOM   6266 C  CB  . VAL D 1 141 ? 24.222  27.764 71.321  1.00 19.18  ? 141  VAL D CB  1 
ATOM   6267 C  CG1 . VAL D 1 141 ? 24.485  26.179 71.150  1.00 19.78  ? 141  VAL D CG1 1 
ATOM   6268 C  CG2 . VAL D 1 141 ? 23.081  28.285 70.373  1.00 21.50  ? 141  VAL D CG2 1 
ATOM   6269 N  N   . ALA D 1 142 ? 26.144  27.793 73.733  1.00 18.79  ? 142  ALA D N   1 
ATOM   6270 C  CA  . ALA D 1 142 ? 27.169  27.088 74.541  1.00 18.97  ? 142  ALA D CA  1 
ATOM   6271 C  C   . ALA D 1 142 ? 26.824  27.208 76.025  1.00 18.96  ? 142  ALA D C   1 
ATOM   6272 O  O   . ALA D 1 142 ? 27.005  26.280 76.785  1.00 20.36  ? 142  ALA D O   1 
ATOM   6273 C  CB  . ALA D 1 142 ? 28.585  27.631 74.261  1.00 17.74  ? 142  ALA D CB  1 
ATOM   6274 N  N   . GLU D 1 143 ? 26.316  28.343 76.445  1.00 18.55  ? 143  GLU D N   1 
ATOM   6275 C  CA  . GLU D 1 143 ? 25.986  28.504 77.845  1.00 21.88  ? 143  GLU D CA  1 
ATOM   6276 C  C   . GLU D 1 143 ? 24.796  27.635 78.291  1.00 20.48  ? 143  GLU D C   1 
ATOM   6277 O  O   . GLU D 1 143 ? 24.812  27.030 79.376  1.00 18.10  ? 143  GLU D O   1 
ATOM   6278 C  CB  . GLU D 1 143 ? 25.781  29.983 78.182  1.00 21.55  ? 143  GLU D CB  1 
ATOM   6279 C  CG  . GLU D 1 143 ? 25.273  30.148 79.555  1.00 28.85  ? 143  GLU D CG  1 
ATOM   6280 C  CD  . GLU D 1 143 ? 24.900  31.568 79.908  1.00 30.99  ? 143  GLU D CD  1 
ATOM   6281 O  OE1 . GLU D 1 143 ? 23.680  31.920 79.773  1.00 39.09  ? 143  GLU D OE1 1 
ATOM   6282 O  OE2 . GLU D 1 143 ? 25.848  32.292 80.257  1.00 42.64  ? 143  GLU D OE2 1 
ATOM   6283 N  N   . MET D 1 144 ? 23.784  27.540 77.438  1.00 20.48  ? 144  MET D N   1 
ATOM   6284 C  CA  . MET D 1 144 ? 22.713  26.621 77.679  1.00 22.66  ? 144  MET D CA  1 
ATOM   6285 C  C   . MET D 1 144 ? 23.160  25.173 77.786  1.00 22.06  ? 144  MET D C   1 
ATOM   6286 O  O   . MET D 1 144 ? 22.536  24.417 78.487  1.00 21.99  ? 144  MET D O   1 
ATOM   6287 C  CB  . MET D 1 144 ? 21.594  26.798 76.622  1.00 23.45  ? 144  MET D CB  1 
ATOM   6288 C  CG  . MET D 1 144 ? 20.923  28.145 76.707  1.00 25.35  ? 144  MET D CG  1 
ATOM   6289 S  SD  . MET D 1 144 ? 19.927  28.576 75.227  1.00 31.72  ? 144  MET D SD  1 
ATOM   6290 C  CE  . MET D 1 144 ? 18.599  27.512 75.662  1.00 29.00  ? 144  MET D CE  1 
ATOM   6291 N  N   . ASN D 1 145 ? 24.219  24.778 77.082  1.00 20.94  ? 145  ASN D N   1 
ATOM   6292 C  CA  . ASN D 1 145 ? 24.738  23.433 77.162  1.00 20.39  ? 145  ASN D CA  1 
ATOM   6293 C  C   . ASN D 1 145 ? 25.693  23.166 78.329  1.00 20.28  ? 145  ASN D C   1 
ATOM   6294 O  O   . ASN D 1 145 ? 26.093  22.039 78.552  1.00 19.88  ? 145  ASN D O   1 
ATOM   6295 C  CB  . ASN D 1 145 ? 25.385  23.057 75.833  1.00 20.79  ? 145  ASN D CB  1 
ATOM   6296 C  CG  . ASN D 1 145 ? 24.334  22.891 74.738  1.00 25.36  ? 145  ASN D CG  1 
ATOM   6297 O  OD1 . ASN D 1 145 ? 23.206  22.436 75.033  1.00 31.40  ? 145  ASN D OD1 1 
ATOM   6298 N  ND2 . ASN D 1 145 ? 24.676  23.239 73.504  1.00 26.34  ? 145  ASN D ND2 1 
ATOM   6299 N  N   . THR D 1 146 ? 26.028  24.222 79.047  1.00 19.73  ? 146  THR D N   1 
ATOM   6300 C  CA  . THR D 1 146 ? 27.025  24.201 80.100  1.00 19.87  ? 146  THR D CA  1 
ATOM   6301 C  C   . THR D 1 146 ? 26.380  24.389 81.455  1.00 20.49  ? 146  THR D C   1 
ATOM   6302 O  O   . THR D 1 146 ? 26.681  23.644 82.378  1.00 19.18  ? 146  THR D O   1 
ATOM   6303 C  CB  . THR D 1 146 ? 28.148  25.200 79.837  1.00 17.86  ? 146  THR D CB  1 
ATOM   6304 O  OG1 . THR D 1 146 ? 28.651  24.975 78.517  1.00 18.73  ? 146  THR D OG1 1 
ATOM   6305 C  CG2 . THR D 1 146 ? 29.301  24.992 80.876  1.00 17.54  ? 146  THR D CG2 1 
ATOM   6306 N  N   . TYR D 1 147 ? 25.457  25.323 81.557  1.00 19.86  ? 147  TYR D N   1 
ATOM   6307 C  CA  . TYR D 1 147 ? 24.968  25.796 82.852  1.00 20.37  ? 147  TYR D CA  1 
ATOM   6308 C  C   . TYR D 1 147 ? 23.474  25.607 83.000  1.00 21.29  ? 147  TYR D C   1 
ATOM   6309 O  O   . TYR D 1 147 ? 22.716  25.892 82.064  1.00 21.55  ? 147  TYR D O   1 
ATOM   6310 C  CB  . TYR D 1 147 ? 25.301  27.274 83.052  1.00 19.94  ? 147  TYR D CB  1 
ATOM   6311 C  CG  . TYR D 1 147 ? 26.818  27.527 83.072  1.00 21.03  ? 147  TYR D CG  1 
ATOM   6312 C  CD1 . TYR D 1 147 ? 27.432  28.243 82.045  1.00 23.34  ? 147  TYR D CD1 1 
ATOM   6313 C  CD2 . TYR D 1 147 ? 27.640  27.033 84.115  1.00 17.12  ? 147  TYR D CD2 1 
ATOM   6314 C  CE1 . TYR D 1 147 ? 28.816  28.483 82.025  1.00 20.15  ? 147  TYR D CE1 1 
ATOM   6315 C  CE2 . TYR D 1 147 ? 29.013  27.251 84.096  1.00 19.45  ? 147  TYR D CE2 1 
ATOM   6316 C  CZ  . TYR D 1 147 ? 29.593  27.994 83.021  1.00 24.04  ? 147  TYR D CZ  1 
ATOM   6317 O  OH  . TYR D 1 147 ? 30.942  28.253 82.974  1.00 27.22  ? 147  TYR D OH  1 
ATOM   6318 N  N   . ASN D 1 148 ? 23.067  25.205 84.202  1.00 21.86  ? 148  ASN D N   1 
ATOM   6319 C  CA  . ASN D 1 148 ? 21.665  24.993 84.511  1.00 23.47  ? 148  ASN D CA  1 
ATOM   6320 C  C   . ASN D 1 148 ? 20.882  26.305 84.553  1.00 23.41  ? 148  ASN D C   1 
ATOM   6321 O  O   . ASN D 1 148 ? 21.479  27.361 84.652  1.00 20.66  ? 148  ASN D O   1 
ATOM   6322 C  CB  . ASN D 1 148 ? 21.509  24.083 85.750  1.00 24.63  ? 148  ASN D CB  1 
ATOM   6323 C  CG  . ASN D 1 148 ? 21.674  24.782 87.089  1.00 27.16  ? 148  ASN D CG  1 
ATOM   6324 O  OD1 . ASN D 1 148 ? 21.380  25.967 87.268  1.00 33.58  ? 148  ASN D OD1 1 
ATOM   6325 N  ND2 . ASN D 1 148 ? 22.070  23.988 88.090  1.00 28.43  ? 148  ASN D ND2 1 
ATOM   6326 N  N   . PRO D 1 149 ? 19.551  26.228 84.419  1.00 24.80  ? 149  PRO D N   1 
ATOM   6327 C  CA  . PRO D 1 149 ? 18.730  27.447 84.389  1.00 25.73  ? 149  PRO D CA  1 
ATOM   6328 C  C   . PRO D 1 149 ? 18.990  28.452 85.531  1.00 25.58  ? 149  PRO D C   1 
ATOM   6329 O  O   . PRO D 1 149 ? 19.068  29.655 85.282  1.00 21.46  ? 149  PRO D O   1 
ATOM   6330 C  CB  . PRO D 1 149 ? 17.298  26.911 84.476  1.00 25.37  ? 149  PRO D CB  1 
ATOM   6331 C  CG  . PRO D 1 149 ? 17.397  25.523 83.873  1.00 24.45  ? 149  PRO D CG  1 
ATOM   6332 C  CD  . PRO D 1 149 ? 18.735  25.003 84.254  1.00 24.36  ? 149  PRO D CD  1 
ATOM   6333 N  N   . THR D 1 150 ? 19.113  27.978 86.765  1.00 27.40  ? 150  THR D N   1 
ATOM   6334 C  CA  . THR D 1 150 ? 19.268  28.919 87.845  1.00 28.02  ? 150  THR D CA  1 
ATOM   6335 C  C   . THR D 1 150 ? 20.638  29.547 87.741  1.00 27.26  ? 150  THR D C   1 
ATOM   6336 O  O   . THR D 1 150 ? 20.805  30.719 88.011  1.00 29.59  ? 150  THR D O   1 
ATOM   6337 C  CB  . THR D 1 150 ? 19.058  28.256 89.276  1.00 28.98  ? 150  THR D CB  1 
ATOM   6338 O  OG1 . THR D 1 150 ? 20.155  27.390 89.567  1.00 37.45  ? 150  THR D OG1 1 
ATOM   6339 C  CG2 . THR D 1 150 ? 17.803  27.492 89.335  1.00 30.93  ? 150  THR D CG2 1 
ATOM   6340 N  N   . ILE D 1 151 ? 21.660  28.766 87.375  1.00 27.93  ? 151  ILE D N   1 
ATOM   6341 C  CA  . ILE D 1 151 ? 23.029  29.334 87.184  1.00 26.99  ? 151  ILE D CA  1 
ATOM   6342 C  C   . ILE D 1 151 ? 23.042  30.353 86.035  1.00 26.74  ? 151  ILE D C   1 
ATOM   6343 O  O   . ILE D 1 151 ? 23.715  31.355 86.106  1.00 25.03  ? 151  ILE D O   1 
ATOM   6344 C  CB  . ILE D 1 151 ? 24.080  28.233 86.950  1.00 26.95  ? 151  ILE D CB  1 
ATOM   6345 C  CG1 . ILE D 1 151 ? 24.254  27.416 88.209  1.00 28.16  ? 151  ILE D CG1 1 
ATOM   6346 C  CG2 . ILE D 1 151 ? 25.461  28.811 86.524  1.00 26.80  ? 151  ILE D CG2 1 
ATOM   6347 C  CD1 . ILE D 1 151 ? 24.660  28.291 89.355  1.00 30.22  ? 151  ILE D CD1 1 
ATOM   6348 N  N   . ARG D 1 152 ? 22.248  30.151 84.985  1.00 25.51  ? 152  ARG D N   1 
ATOM   6349 C  CA  . ARG D 1 152 ? 22.246  31.169 83.912  1.00 27.02  ? 152  ARG D CA  1 
ATOM   6350 C  C   . ARG D 1 152 ? 21.642  32.528 84.344  1.00 27.43  ? 152  ARG D C   1 
ATOM   6351 O  O   . ARG D 1 152 ? 22.123  33.588 83.958  1.00 27.54  ? 152  ARG D O   1 
ATOM   6352 C  CB  . ARG D 1 152 ? 21.572  30.642 82.655  1.00 27.64  ? 152  ARG D CB  1 
ATOM   6353 C  CG  . ARG D 1 152 ? 22.324  29.452 82.025  1.00 28.84  ? 152  ARG D CG  1 
ATOM   6354 C  CD  . ARG D 1 152 ? 21.828  29.155 80.676  1.00 33.46  ? 152  ARG D CD  1 
ATOM   6355 N  NE  . ARG D 1 152 ? 20.816  28.131 80.658  1.00 37.75  ? 152  ARG D NE  1 
ATOM   6356 C  CZ  . ARG D 1 152 ? 19.547  28.350 80.392  1.00 38.91  ? 152  ARG D CZ  1 
ATOM   6357 N  NH1 . ARG D 1 152 ? 19.140  29.580 80.123  1.00 43.51  ? 152  ARG D NH1 1 
ATOM   6358 N  NH2 . ARG D 1 152 ? 18.691  27.337 80.349  1.00 36.33  ? 152  ARG D NH2 1 
ATOM   6359 N  N   . ILE D 1 153 ? 20.603  32.482 85.124  1.00 27.84  ? 153  ILE D N   1 
ATOM   6360 C  CA  . ILE D 1 153 ? 20.049  33.685 85.692  1.00 29.44  ? 153  ILE D CA  1 
ATOM   6361 C  C   . ILE D 1 153 ? 21.058  34.377 86.592  1.00 29.27  ? 153  ILE D C   1 
ATOM   6362 O  O   . ILE D 1 153 ? 21.191  35.565 86.507  1.00 30.05  ? 153  ILE D O   1 
ATOM   6363 C  CB  . ILE D 1 153 ? 18.793  33.400 86.513  1.00 31.02  ? 153  ILE D CB  1 
ATOM   6364 C  CG1 . ILE D 1 153 ? 17.706  32.706 85.642  1.00 30.60  ? 153  ILE D CG1 1 
ATOM   6365 C  CG2 . ILE D 1 153 ? 18.340  34.664 87.201  1.00 28.20  ? 153  ILE D CG2 1 
ATOM   6366 C  CD1 . ILE D 1 153 ? 16.609  31.989 86.497  1.00 28.93  ? 153  ILE D CD1 1 
ATOM   6367 N  N   . LEU D 1 154 ? 21.821  33.622 87.382  1.00 29.99  ? 154  LEU D N   1 
ATOM   6368 C  CA  . LEU D 1 154 ? 22.799  34.259 88.240  1.00 31.26  ? 154  LEU D CA  1 
ATOM   6369 C  C   . LEU D 1 154 ? 23.941  34.860 87.454  1.00 30.20  ? 154  LEU D C   1 
ATOM   6370 O  O   . LEU D 1 154 ? 24.442  35.901 87.890  1.00 31.07  ? 154  LEU D O   1 
ATOM   6371 C  CB  . LEU D 1 154 ? 23.326  33.351 89.354  1.00 30.27  ? 154  LEU D CB  1 
ATOM   6372 C  CG  . LEU D 1 154 ? 22.297  32.752 90.308  1.00 33.88  ? 154  LEU D CG  1 
ATOM   6373 C  CD1 . LEU D 1 154 ? 22.906  31.582 91.013  1.00 35.74  ? 154  LEU D CD1 1 
ATOM   6374 C  CD2 . LEU D 1 154 ? 21.772  33.749 91.307  1.00 37.03  ? 154  LEU D CD2 1 
ATOM   6375 N  N   . ARG D 1 155 ? 24.406  34.178 86.394  1.00 29.55  ? 155  ARG D N   1 
ATOM   6376 C  CA  . ARG D 1 155 ? 25.410  34.706 85.490  1.00 29.17  ? 155  ARG D CA  1 
ATOM   6377 C  C   . ARG D 1 155 ? 24.923  35.998 84.872  1.00 28.67  ? 155  ARG D C   1 
ATOM   6378 O  O   . ARG D 1 155 ? 25.694  36.938 84.728  1.00 28.24  ? 155  ARG D O   1 
ATOM   6379 C  CB  . ARG D 1 155 ? 25.803  33.692 84.383  1.00 29.10  ? 155  ARG D CB  1 
ATOM   6380 C  CG  . ARG D 1 155 ? 26.500  32.437 84.983  1.00 29.22  ? 155  ARG D CG  1 
ATOM   6381 C  CD  . ARG D 1 155 ? 26.813  31.376 83.962  1.00 28.46  ? 155  ARG D CD  1 
ATOM   6382 N  NE  . ARG D 1 155 ? 27.525  31.901 82.791  1.00 26.21  ? 155  ARG D NE  1 
ATOM   6383 C  CZ  . ARG D 1 155 ? 28.840  31.980 82.638  1.00 29.43  ? 155  ARG D CZ  1 
ATOM   6384 N  NH1 . ARG D 1 155 ? 29.664  31.651 83.622  1.00 29.74  ? 155  ARG D NH1 1 
ATOM   6385 N  NH2 . ARG D 1 155 ? 29.344  32.445 81.510  1.00 26.73  ? 155  ARG D NH2 1 
ATOM   6386 N  N   . LEU D 1 156 ? 23.646  36.041 84.499  1.00 29.06  ? 156  LEU D N   1 
ATOM   6387 C  CA  . LEU D 1 156 ? 23.063  37.257 83.898  1.00 29.26  ? 156  LEU D CA  1 
ATOM   6388 C  C   . LEU D 1 156 ? 23.156  38.436 84.833  1.00 30.56  ? 156  LEU D C   1 
ATOM   6389 O  O   . LEU D 1 156 ? 23.646  39.490 84.424  1.00 29.01  ? 156  LEU D O   1 
ATOM   6390 C  CB  . LEU D 1 156 ? 21.622  37.058 83.443  1.00 29.50  ? 156  LEU D CB  1 
ATOM   6391 C  CG  . LEU D 1 156 ? 20.891  38.276 82.893  1.00 28.59  ? 156  LEU D CG  1 
ATOM   6392 C  CD1 . LEU D 1 156 ? 21.668  38.875 81.712  1.00 28.79  ? 156  LEU D CD1 1 
ATOM   6393 C  CD2 . LEU D 1 156 ? 19.449  37.984 82.484  1.00 30.85  ? 156  LEU D CD2 1 
ATOM   6394 N  N   . PHE D 1 157 ? 22.723  38.253 86.075  1.00 31.77  ? 157  PHE D N   1 
ATOM   6395 C  CA  . PHE D 1 157 ? 22.850  39.323 87.072  1.00 33.71  ? 157  PHE D CA  1 
ATOM   6396 C  C   . PHE D 1 157 ? 24.272  39.704 87.343  1.00 33.41  ? 157  PHE D C   1 
ATOM   6397 O  O   . PHE D 1 157 ? 24.556  40.878 87.433  1.00 34.09  ? 157  PHE D O   1 
ATOM   6398 C  CB  . PHE D 1 157 ? 22.182  38.957 88.394  1.00 35.04  ? 157  PHE D CB  1 
ATOM   6399 C  CG  . PHE D 1 157 ? 20.685  38.871 88.323  1.00 33.26  ? 157  PHE D CG  1 
ATOM   6400 C  CD1 . PHE D 1 157 ? 20.030  37.817 88.909  1.00 34.41  ? 157  PHE D CD1 1 
ATOM   6401 C  CD2 . PHE D 1 157 ? 19.943  39.847 87.690  1.00 39.82  ? 157  PHE D CD2 1 
ATOM   6402 C  CE1 . PHE D 1 157 ? 18.656  37.705 88.875  1.00 36.87  ? 157  PHE D CE1 1 
ATOM   6403 C  CE2 . PHE D 1 157 ? 18.542  39.751 87.641  1.00 41.43  ? 157  PHE D CE2 1 
ATOM   6404 C  CZ  . PHE D 1 157 ? 17.907  38.649 88.271  1.00 37.27  ? 157  PHE D CZ  1 
ATOM   6405 N  N   . TYR D 1 158 ? 25.154  38.719 87.540  1.00 33.89  ? 158  TYR D N   1 
ATOM   6406 C  CA  . TYR D 1 158 ? 26.582  38.994 87.715  1.00 34.15  ? 158  TYR D CA  1 
ATOM   6407 C  C   . TYR D 1 158 ? 27.192  39.874 86.589  1.00 34.79  ? 158  TYR D C   1 
ATOM   6408 O  O   . TYR D 1 158 ? 27.907  40.875 86.883  1.00 33.56  ? 158  TYR D O   1 
ATOM   6409 C  CB  . TYR D 1 158 ? 27.394  37.704 87.814  1.00 35.09  ? 158  TYR D CB  1 
ATOM   6410 C  CG  . TYR D 1 158 ? 28.820  38.018 88.042  1.00 36.63  ? 158  TYR D CG  1 
ATOM   6411 C  CD1 . TYR D 1 158 ? 29.204  38.541 89.244  1.00 38.33  ? 158  TYR D CD1 1 
ATOM   6412 C  CD2 . TYR D 1 158 ? 29.770  37.920 87.027  1.00 36.33  ? 158  TYR D CD2 1 
ATOM   6413 C  CE1 . TYR D 1 158 ? 30.507  38.929 89.472  1.00 41.09  ? 158  TYR D CE1 1 
ATOM   6414 C  CE2 . TYR D 1 158 ? 31.111  38.311 87.264  1.00 37.80  ? 158  TYR D CE2 1 
ATOM   6415 C  CZ  . TYR D 1 158 ? 31.445  38.790 88.511  1.00 36.73  ? 158  TYR D CZ  1 
ATOM   6416 O  OH  . TYR D 1 158 ? 32.698  39.179 88.871  1.00 39.64  ? 158  TYR D OH  1 
ATOM   6417 N  N   . GLU D 1 159 ? 26.932  39.482 85.334  1.00 34.60  ? 159  GLU D N   1 
ATOM   6418 C  CA  . GLU D 1 159 ? 27.386  40.195 84.141  1.00 35.33  ? 159  GLU D CA  1 
ATOM   6419 C  C   . GLU D 1 159 ? 26.822  41.602 84.063  1.00 35.81  ? 159  GLU D C   1 
ATOM   6420 O  O   . GLU D 1 159 ? 27.563  42.557 83.798  1.00 36.27  ? 159  GLU D O   1 
ATOM   6421 C  CB  . GLU D 1 159 ? 27.008  39.432 82.883  1.00 36.04  ? 159  GLU D CB  1 
ATOM   6422 C  CG  . GLU D 1 159 ? 27.789  38.143 82.710  1.00 36.57  ? 159  GLU D CG  1 
ATOM   6423 C  CD  . GLU D 1 159 ? 27.064  37.053 81.875  1.00 36.69  ? 159  GLU D CD  1 
ATOM   6424 O  OE1 . GLU D 1 159 ? 26.060  37.323 81.170  1.00 38.45  ? 159  GLU D OE1 1 
ATOM   6425 O  OE2 . GLU D 1 159 ? 27.525  35.902 81.951  1.00 40.49  ? 159  GLU D OE2 1 
ATOM   6426 N  N   . LEU D 1 160 ? 25.528  41.755 84.309  1.00 34.89  ? 160  LEU D N   1 
ATOM   6427 C  CA  . LEU D 1 160 ? 24.926  43.082 84.336  1.00 34.81  ? 160  LEU D CA  1 
ATOM   6428 C  C   . LEU D 1 160 ? 25.516  44.000 85.456  1.00 35.79  ? 160  LEU D C   1 
ATOM   6429 O  O   . LEU D 1 160 ? 25.708  45.187 85.246  1.00 35.75  ? 160  LEU D O   1 
ATOM   6430 C  CB  . LEU D 1 160 ? 23.400  42.951 84.500  1.00 34.99  ? 160  LEU D CB  1 
ATOM   6431 C  CG  . LEU D 1 160 ? 22.547  42.564 83.275  1.00 33.19  ? 160  LEU D CG  1 
ATOM   6432 C  CD1 . LEU D 1 160 ? 21.155  42.006 83.627  1.00 29.58  ? 160  LEU D CD1 1 
ATOM   6433 C  CD2 . LEU D 1 160 ? 22.378  43.757 82.445  1.00 31.71  ? 160  LEU D CD2 1 
ATOM   6434 N  N   . CYS D 1 161 ? 25.749  43.459 86.662  1.00 36.30  ? 161  CYS D N   1 
ATOM   6435 C  CA  . CYS D 1 161 ? 26.430  44.196 87.731  1.00 36.11  ? 161  CYS D CA  1 
ATOM   6436 C  C   . CYS D 1 161 ? 27.877  44.551 87.433  1.00 36.78  ? 161  CYS D C   1 
ATOM   6437 O  O   . CYS D 1 161 ? 28.291  45.682 87.719  1.00 36.93  ? 161  CYS D O   1 
ATOM   6438 C  CB  . CYS D 1 161 ? 26.326  43.448 89.079  1.00 36.81  ? 161  CYS D CB  1 
ATOM   6439 S  SG  . CYS D 1 161 ? 26.788  44.440 90.485  1.00 36.83  ? 161  CYS D SG  1 
ATOM   6440 N  N   . SER D 1 162 ? 28.647  43.626 86.862  1.00 36.87  ? 162  SER D N   1 
ATOM   6441 C  CA  . SER D 1 162 ? 30.031  43.946 86.453  1.00 38.71  ? 162  SER D CA  1 
ATOM   6442 C  C   . SER D 1 162 ? 30.099  45.031 85.391  1.00 38.47  ? 162  SER D C   1 
ATOM   6443 O  O   . SER D 1 162 ? 31.019  45.823 85.327  1.00 38.39  ? 162  SER D O   1 
ATOM   6444 C  CB  . SER D 1 162 ? 30.771  42.682 85.992  1.00 38.11  ? 162  SER D CB  1 
ATOM   6445 O  OG  . SER D 1 162 ? 30.844  41.779 87.107  1.00 37.63  ? 162  SER D OG  1 
ATOM   6446 N  N   . SER D 1 163 ? 29.099  45.024 84.544  1.00 39.77  ? 163  SER D N   1 
ATOM   6447 C  CA  . SER D 1 163 ? 29.030  45.818 83.340  1.00 39.69  ? 163  SER D CA  1 
ATOM   6448 C  C   . SER D 1 163 ? 28.581  47.230 83.715  1.00 39.60  ? 163  SER D C   1 
ATOM   6449 O  O   . SER D 1 163 ? 29.261  48.182 83.420  1.00 38.62  ? 163  SER D O   1 
ATOM   6450 C  CB  . SER D 1 163 ? 27.996  45.175 82.418  1.00 39.72  ? 163  SER D CB  1 
ATOM   6451 O  OG  . SER D 1 163 ? 27.953  45.880 81.207  1.00 43.31  ? 163  SER D OG  1 
ATOM   6452 N  N   . GLN D 1 164 ? 27.435  47.337 84.375  1.00 39.95  ? 164  GLN D N   1 
ATOM   6453 C  CA  . GLN D 1 164 ? 26.787  48.619 84.594  1.00 41.32  ? 164  GLN D CA  1 
ATOM   6454 C  C   . GLN D 1 164 ? 26.261  48.860 86.015  1.00 41.15  ? 164  GLN D C   1 
ATOM   6455 O  O   . GLN D 1 164 ? 25.485  49.807 86.240  1.00 41.83  ? 164  GLN D O   1 
ATOM   6456 C  CB  . GLN D 1 164 ? 25.658  48.801 83.577  1.00 41.97  ? 164  GLN D CB  1 
ATOM   6457 C  CG  . GLN D 1 164 ? 24.466  47.882 83.820  1.00 42.22  ? 164  GLN D CG  1 
ATOM   6458 C  CD  . GLN D 1 164 ? 23.409  48.068 82.767  1.00 42.68  ? 164  GLN D CD  1 
ATOM   6459 O  OE1 . GLN D 1 164 ? 23.455  47.410 81.736  1.00 43.61  ? 164  GLN D OE1 1 
ATOM   6460 N  NE2 . GLN D 1 164 ? 22.456  49.000 83.009  1.00 43.64  ? 164  GLN D NE2 1 
ATOM   6461 N  N   . GLY D 1 165 ? 26.726  48.045 86.952  1.00 40.59  ? 165  GLY D N   1 
ATOM   6462 C  CA  . GLY D 1 165 ? 26.458  48.226 88.370  1.00 39.89  ? 165  GLY D CA  1 
ATOM   6463 C  C   . GLY D 1 165 ? 27.270  49.399 88.884  1.00 40.28  ? 165  GLY D C   1 
ATOM   6464 O  O   . GLY D 1 165 ? 28.513  49.390 88.817  1.00 39.68  ? 165  GLY D O   1 
ATOM   6465 N  N   . LYS D 1 166 ? 26.541  50.408 89.372  1.00 40.03  ? 166  LYS D N   1 
ATOM   6466 C  CA  . LYS D 1 166 ? 27.098  51.603 89.994  1.00 41.21  ? 166  LYS D CA  1 
ATOM   6467 C  C   . LYS D 1 166 ? 27.141  51.462 91.518  1.00 40.82  ? 166  LYS D C   1 
ATOM   6468 O  O   . LYS D 1 166 ? 26.128  51.207 92.159  1.00 39.12  ? 166  LYS D O   1 
ATOM   6469 C  CB  . LYS D 1 166 ? 26.282  52.847 89.568  1.00 41.16  ? 166  LYS D CB  1 
ATOM   6470 C  CG  . LYS D 1 166 ? 25.971  52.847 88.055  1.00 41.68  ? 166  LYS D CG  1 
ATOM   6471 C  CD  . LYS D 1 166 ? 25.494  54.197 87.533  1.00 42.96  ? 166  LYS D CD  1 
ATOM   6472 C  CE  . LYS D 1 166 ? 25.295  54.170 85.997  1.00 43.04  ? 166  LYS D CE  1 
ATOM   6473 N  NZ  . LYS D 1 166 ? 24.002  53.523 85.611  1.00 42.71  ? 166  LYS D NZ  1 
ATOM   6474 N  N   . ARG D 1 167 ? 28.328  51.651 92.090  1.00 41.72  ? 167  ARG D N   1 
ATOM   6475 C  CA  . ARG D 1 167 ? 28.517  51.433 93.506  1.00 42.27  ? 167  ARG D CA  1 
ATOM   6476 C  C   . ARG D 1 167 ? 27.829  52.567 94.303  1.00 41.89  ? 167  ARG D C   1 
ATOM   6477 O  O   . ARG D 1 167 ? 28.021  53.739 94.012  1.00 41.57  ? 167  ARG D O   1 
ATOM   6478 C  CB  . ARG D 1 167 ? 30.010  51.298 93.833  1.00 42.65  ? 167  ARG D CB  1 
ATOM   6479 C  CG  . ARG D 1 167 ? 30.256  50.991 95.318  1.00 43.65  ? 167  ARG D CG  1 
ATOM   6480 C  CD  . ARG D 1 167 ? 31.744  50.737 95.668  1.00 44.66  ? 167  ARG D CD  1 
ATOM   6481 N  NE  . ARG D 1 167 ? 31.853  50.190 97.033  1.00 46.12  ? 167  ARG D NE  1 
ATOM   6482 C  CZ  . ARG D 1 167 ? 31.568  48.924 97.358  1.00 47.19  ? 167  ARG D CZ  1 
ATOM   6483 N  NH1 . ARG D 1 167 ? 31.164  48.067 96.434  1.00 45.40  ? 167  ARG D NH1 1 
ATOM   6484 N  NH2 . ARG D 1 167 ? 31.663  48.515 98.622  1.00 48.15  ? 167  ARG D NH2 1 
ATOM   6485 N  N   . VAL D 1 168 ? 26.995  52.195 95.273  1.00 41.56  ? 168  VAL D N   1 
ATOM   6486 C  CA  . VAL D 1 168 ? 26.159  53.148 96.012  1.00 41.82  ? 168  VAL D CA  1 
ATOM   6487 C  C   . VAL D 1 168 ? 26.168  52.681 97.455  1.00 41.85  ? 168  VAL D C   1 
ATOM   6488 O  O   . VAL D 1 168 ? 25.353  51.842 97.840  1.00 41.68  ? 168  VAL D O   1 
ATOM   6489 C  CB  . VAL D 1 168 ? 24.695  53.189 95.467  1.00 41.69  ? 168  VAL D CB  1 
ATOM   6490 C  CG1 . VAL D 1 168 ? 23.859  54.166 96.254  1.00 42.32  ? 168  VAL D CG1 1 
ATOM   6491 C  CG2 . VAL D 1 168 ? 24.665  53.562 93.979  1.00 42.11  ? 168  VAL D CG2 1 
ATOM   6492 N  N   . GLY D 1 169 ? 27.100  53.213 98.244  1.00 42.12  ? 169  GLY D N   1 
ATOM   6493 C  CA  . GLY D 1 169 ? 27.428  52.647 99.555  1.00 42.36  ? 169  GLY D CA  1 
ATOM   6494 C  C   . GLY D 1 169 ? 28.091  51.286 99.377  1.00 42.78  ? 169  GLY D C   1 
ATOM   6495 O  O   . GLY D 1 169 ? 28.938  51.104 98.501  1.00 42.66  ? 169  GLY D O   1 
ATOM   6496 N  N   . ASP D 1 170 ? 27.656  50.311 100.170 1.00 43.30  ? 170  ASP D N   1 
ATOM   6497 C  CA  . ASP D 1 170 ? 28.228  48.960 100.169 1.00 43.72  ? 170  ASP D CA  1 
ATOM   6498 C  C   . ASP D 1 170 ? 27.498  48.092 99.111  1.00 43.87  ? 170  ASP D C   1 
ATOM   6499 O  O   . ASP D 1 170 ? 27.711  46.873 99.027  1.00 44.31  ? 170  ASP D O   1 
ATOM   6500 C  CB  . ASP D 1 170 ? 28.139  48.326 101.579 1.00 44.16  ? 170  ASP D CB  1 
ATOM   6501 C  CG  . ASP D 1 170 ? 28.337  49.368 102.746 1.00 45.40  ? 170  ASP D CG  1 
ATOM   6502 O  OD1 . ASP D 1 170 ? 27.452  49.452 103.626 1.00 47.87  ? 170  ASP D OD1 1 
ATOM   6503 O  OD2 . ASP D 1 170 ? 29.360  50.106 102.784 1.00 44.61  ? 170  ASP D OD2 1 
ATOM   6504 N  N   . THR D 1 171 ? 26.644  48.736 98.307  1.00 43.35  ? 171  THR D N   1 
ATOM   6505 C  CA  . THR D 1 171 ? 25.801  48.064 97.331  1.00 42.93  ? 171  THR D CA  1 
ATOM   6506 C  C   . THR D 1 171 ? 26.139  48.487 95.892  1.00 42.32  ? 171  THR D C   1 
ATOM   6507 O  O   . THR D 1 171 ? 26.909  49.422 95.653  1.00 42.50  ? 171  THR D O   1 
ATOM   6508 C  CB  . THR D 1 171 ? 24.279  48.358 97.559  1.00 42.96  ? 171  THR D CB  1 
ATOM   6509 O  OG1 . THR D 1 171 ? 23.928  49.633 96.991  1.00 42.17  ? 171  THR D OG1 1 
ATOM   6510 C  CG2 . THR D 1 171 ? 23.875  48.282 99.065  1.00 43.44  ? 171  THR D CG2 1 
ATOM   6511 N  N   . TYR D 1 172 ? 25.522  47.793 94.946  1.00 41.95  ? 172  TYR D N   1 
ATOM   6512 C  CA  . TYR D 1 172 ? 25.559  48.166 93.537  1.00 41.63  ? 172  TYR D CA  1 
ATOM   6513 C  C   . TYR D 1 172 ? 24.127  48.307 93.024  1.00 40.96  ? 172  TYR D C   1 
ATOM   6514 O  O   . TYR D 1 172 ? 23.270  47.493 93.347  1.00 40.44  ? 172  TYR D O   1 
ATOM   6515 C  CB  . TYR D 1 172 ? 26.281  47.094 92.706  1.00 42.65  ? 172  TYR D CB  1 
ATOM   6516 C  CG  . TYR D 1 172 ? 27.760  46.956 92.963  1.00 42.97  ? 172  TYR D CG  1 
ATOM   6517 C  CD1 . TYR D 1 172 ? 28.234  46.151 93.990  1.00 41.80  ? 172  TYR D CD1 1 
ATOM   6518 C  CD2 . TYR D 1 172 ? 28.691  47.631 92.155  1.00 43.19  ? 172  TYR D CD2 1 
ATOM   6519 C  CE1 . TYR D 1 172 ? 29.579  46.030 94.221  1.00 44.93  ? 172  TYR D CE1 1 
ATOM   6520 C  CE2 . TYR D 1 172 ? 30.044  47.516 92.369  1.00 43.13  ? 172  TYR D CE2 1 
ATOM   6521 C  CZ  . TYR D 1 172 ? 30.484  46.723 93.402  1.00 45.92  ? 172  TYR D CZ  1 
ATOM   6522 O  OH  . TYR D 1 172 ? 31.830  46.609 93.631  1.00 47.27  ? 172  TYR D OH  1 
ATOM   6523 N  N   . GLU D 1 173 ? 23.879  49.326 92.215  1.00 40.60  ? 173  GLU D N   1 
ATOM   6524 C  CA  . GLU D 1 173 ? 22.575  49.569 91.631  1.00 40.73  ? 173  GLU D CA  1 
ATOM   6525 C  C   . GLU D 1 173 ? 22.693  49.499 90.131  1.00 40.36  ? 173  GLU D C   1 
ATOM   6526 O  O   . GLU D 1 173 ? 23.521  50.183 89.531  1.00 40.61  ? 173  GLU D O   1 
ATOM   6527 C  CB  . GLU D 1 173 ? 22.037  50.937 92.062  1.00 41.07  ? 173  GLU D CB  1 
ATOM   6528 C  CG  . GLU D 1 173 ? 21.784  51.015 93.562  1.00 42.11  ? 173  GLU D CG  1 
ATOM   6529 C  CD  . GLU D 1 173 ? 21.170  52.336 94.049  1.00 42.61  ? 173  GLU D CD  1 
ATOM   6530 O  OE1 . GLU D 1 173 ? 21.485  53.422 93.505  1.00 43.45  ? 173  GLU D OE1 1 
ATOM   6531 O  OE2 . GLU D 1 173 ? 20.379  52.274 95.029  1.00 47.08  ? 173  GLU D OE2 1 
ATOM   6532 N  N   . ILE D 1 174 ? 21.883  48.639 89.536  1.00 39.84  ? 174  ILE D N   1 
ATOM   6533 C  CA  . ILE D 1 174 ? 21.772  48.507 88.097  1.00 40.08  ? 174  ILE D CA  1 
ATOM   6534 C  C   . ILE D 1 174 ? 20.430  49.150 87.777  1.00 40.44  ? 174  ILE D C   1 
ATOM   6535 O  O   . ILE D 1 174 ? 19.369  48.658 88.179  1.00 40.54  ? 174  ILE D O   1 
ATOM   6536 C  CB  . ILE D 1 174 ? 21.781  47.016 87.609  1.00 39.24  ? 174  ILE D CB  1 
ATOM   6537 C  CG1 . ILE D 1 174 ? 23.077  46.282 87.978  1.00 39.48  ? 174  ILE D CG1 1 
ATOM   6538 C  CG2 . ILE D 1 174 ? 21.622  46.926 86.105  1.00 39.90  ? 174  ILE D CG2 1 
ATOM   6539 C  CD1 . ILE D 1 174 ? 22.889  44.771 88.096  1.00 39.65  ? 174  ILE D CD1 1 
ATOM   6540 N  N   . THR D 1 175 ? 20.489  50.274 87.087  1.00 41.05  ? 175  THR D N   1 
ATOM   6541 C  CA  . THR D 1 175 ? 19.289  50.980 86.685  1.00 41.25  ? 175  THR D CA  1 
ATOM   6542 C  C   . THR D 1 175 ? 18.850  50.506 85.329  1.00 42.38  ? 175  THR D C   1 
ATOM   6543 O  O   . THR D 1 175 ? 19.433  50.895 84.314  1.00 41.69  ? 175  THR D O   1 
ATOM   6544 C  CB  . THR D 1 175 ? 19.522  52.483 86.591  1.00 40.49  ? 175  THR D CB  1 
ATOM   6545 O  OG1 . THR D 1 175 ? 20.321  52.874 87.704  1.00 38.66  ? 175  THR D OG1 1 
ATOM   6546 C  CG2 . THR D 1 175 ? 18.182  53.210 86.561  1.00 38.15  ? 175  THR D CG2 1 
ATOM   6547 N  N   . MET D 1 176 ? 17.823  49.664 85.317  1.00 43.69  ? 176  MET D N   1 
ATOM   6548 C  CA  . MET D 1 176 ? 17.230  49.228 84.052  1.00 45.64  ? 176  MET D CA  1 
ATOM   6549 C  C   . MET D 1 176 ? 15.917  48.476 84.267  1.00 45.13  ? 176  MET D C   1 
ATOM   6550 O  O   . MET D 1 176 ? 15.776  47.744 85.271  1.00 44.97  ? 176  MET D O   1 
ATOM   6551 C  CB  . MET D 1 176 ? 18.210  48.331 83.278  1.00 45.09  ? 176  MET D CB  1 
ATOM   6552 C  CG  . MET D 1 176 ? 18.660  47.182 84.084  1.00 47.92  ? 176  MET D CG  1 
ATOM   6553 S  SD  . MET D 1 176 ? 19.594  45.954 83.189  1.00 49.66  ? 176  MET D SD  1 
ATOM   6554 C  CE  . MET D 1 176 ? 18.645  45.769 81.641  1.00 46.21  ? 176  MET D CE  1 
ATOM   6555 N  N   . PRO D 1 177 ? 14.977  48.603 83.299  1.00 45.23  ? 177  PRO D N   1 
ATOM   6556 C  CA  . PRO D 1 177 ? 13.786  47.774 83.420  1.00 45.37  ? 177  PRO D CA  1 
ATOM   6557 C  C   . PRO D 1 177 ? 14.153  46.395 82.899  1.00 45.06  ? 177  PRO D C   1 
ATOM   6558 O  O   . PRO D 1 177 ? 14.409  46.243 81.693  1.00 46.30  ? 177  PRO D O   1 
ATOM   6559 C  CB  . PRO D 1 177 ? 12.780  48.465 82.499  1.00 45.42  ? 177  PRO D CB  1 
ATOM   6560 C  CG  . PRO D 1 177 ? 13.609  49.136 81.462  1.00 45.05  ? 177  PRO D CG  1 
ATOM   6561 C  CD  . PRO D 1 177 ? 14.985  49.365 82.039  1.00 44.75  ? 177  PRO D CD  1 
ATOM   6562 N  N   . LEU D 1 178 ? 14.250  45.430 83.809  1.00 44.20  ? 178  LEU D N   1 
ATOM   6563 C  CA  . LEU D 1 178 ? 14.402  44.030 83.454  1.00 42.96  ? 178  LEU D CA  1 
ATOM   6564 C  C   . LEU D 1 178 ? 13.310  43.235 84.184  1.00 41.18  ? 178  LEU D C   1 
ATOM   6565 O  O   . LEU D 1 178 ? 13.432  42.919 85.371  1.00 40.47  ? 178  LEU D O   1 
ATOM   6566 C  CB  . LEU D 1 178 ? 15.807  43.552 83.822  1.00 43.29  ? 178  LEU D CB  1 
ATOM   6567 C  CG  . LEU D 1 178 ? 16.287  42.195 83.289  1.00 43.02  ? 178  LEU D CG  1 
ATOM   6568 C  CD1 . LEU D 1 178 ? 16.757  42.217 81.842  1.00 40.08  ? 178  LEU D CD1 1 
ATOM   6569 C  CD2 . LEU D 1 178 ? 17.421  41.736 84.232  1.00 43.72  ? 178  LEU D CD2 1 
ATOM   6570 N  N   . SER D 1 179 ? 12.215  42.963 83.473  1.00 39.35  ? 179  SER D N   1 
ATOM   6571 C  CA  . SER D 1 179 ? 11.067  42.257 84.070  1.00 39.23  ? 179  SER D CA  1 
ATOM   6572 C  C   . SER D 1 179 ? 11.442  40.797 84.323  1.00 38.07  ? 179  SER D C   1 
ATOM   6573 O  O   . SER D 1 179 ? 12.405  40.291 83.739  1.00 37.72  ? 179  SER D O   1 
ATOM   6574 C  CB  . SER D 1 179 ? 9.861   42.309 83.154  1.00 38.78  ? 179  SER D CB  1 
ATOM   6575 O  OG  . SER D 1 179 ? 10.150  41.758 81.880  1.00 39.55  ? 179  SER D OG  1 
ATOM   6576 N  N   . GLN D 1 180 ? 10.691  40.126 85.166  1.00 37.07  ? 180  GLN D N   1 
ATOM   6577 C  CA  . GLN D 1 180 ? 10.857  38.694 85.295  1.00 37.49  ? 180  GLN D CA  1 
ATOM   6578 C  C   . GLN D 1 180 ? 10.571  38.023 83.957  1.00 36.90  ? 180  GLN D C   1 
ATOM   6579 O  O   . GLN D 1 180 ? 11.235  37.058 83.604  1.00 37.14  ? 180  GLN D O   1 
ATOM   6580 C  CB  . GLN D 1 180 ? 9.933   38.106 86.373  1.00 36.72  ? 180  GLN D CB  1 
ATOM   6581 C  CG  . GLN D 1 180 ? 10.507  38.198 87.738  1.00 37.76  ? 180  GLN D CG  1 
ATOM   6582 C  CD  . GLN D 1 180 ? 9.694   37.448 88.810  1.00 39.61  ? 180  GLN D CD  1 
ATOM   6583 O  OE1 . GLN D 1 180 ? 9.225   36.321 88.600  1.00 40.24  ? 180  GLN D OE1 1 
ATOM   6584 N  NE2 . GLN D 1 180 ? 9.525   38.091 89.970  1.00 41.07  ? 180  GLN D NE2 1 
ATOM   6585 N  N   . LYS D 1 181 ? 9.581   38.501 83.216  1.00 36.61  ? 181  LYS D N   1 
ATOM   6586 C  CA  . LYS D 1 181 ? 9.261   37.846 81.969  1.00 37.44  ? 181  LYS D CA  1 
ATOM   6587 C  C   . LYS D 1 181 ? 10.422  37.978 80.950  1.00 37.88  ? 181  LYS D C   1 
ATOM   6588 O  O   . LYS D 1 181 ? 10.702  37.013 80.243  1.00 39.00  ? 181  LYS D O   1 
ATOM   6589 C  CB  . LYS D 1 181 ? 7.900   38.287 81.413  1.00 38.15  ? 181  LYS D CB  1 
ATOM   6590 C  CG  . LYS D 1 181 ? 7.910   39.510 80.517  1.00 41.45  ? 181  LYS D CG  1 
ATOM   6591 C  CD  . LYS D 1 181 ? 7.733   39.144 79.068  1.00 44.08  ? 181  LYS D CD  1 
ATOM   6592 C  CE  . LYS D 1 181 ? 6.291   38.792 78.724  1.00 44.51  ? 181  LYS D CE  1 
ATOM   6593 N  NZ  . LYS D 1 181 ? 6.102   39.235 77.329  1.00 46.21  ? 181  LYS D NZ  1 
ATOM   6594 N  N   . SER D 1 182 ? 11.134  39.121 80.938  1.00 36.75  ? 182  SER D N   1 
ATOM   6595 C  CA  . SER D 1 182 ? 12.281  39.309 80.035  1.00 36.28  ? 182  SER D CA  1 
ATOM   6596 C  C   . SER D 1 182 ? 13.466  38.450 80.400  1.00 35.41  ? 182  SER D C   1 
ATOM   6597 O  O   . SER D 1 182 ? 14.087  37.869 79.511  1.00 35.49  ? 182  SER D O   1 
ATOM   6598 C  CB  . SER D 1 182 ? 12.702  40.786 79.968  1.00 35.92  ? 182  SER D CB  1 
ATOM   6599 O  OG  . SER D 1 182 ? 11.615  41.557 79.457  1.00 39.53  ? 182  SER D OG  1 
ATOM   6600 N  N   . ILE D 1 183 ? 13.803  38.393 81.695  1.00 34.26  ? 183  ILE D N   1 
ATOM   6601 C  CA  . ILE D 1 183 ? 14.721  37.356 82.230  1.00 34.21  ? 183  ILE D CA  1 
ATOM   6602 C  C   . ILE D 1 183 ? 14.332  35.945 81.732  1.00 35.66  ? 183  ILE D C   1 
ATOM   6603 O  O   . ILE D 1 183 ? 15.195  35.142 81.328  1.00 36.82  ? 183  ILE D O   1 
ATOM   6604 C  CB  . ILE D 1 183 ? 14.794  37.424 83.811  1.00 33.96  ? 183  ILE D CB  1 
ATOM   6605 C  CG1 . ILE D 1 183 ? 15.334  38.783 84.275  1.00 31.70  ? 183  ILE D CG1 1 
ATOM   6606 C  CG2 . ILE D 1 183 ? 15.671  36.276 84.375  1.00 32.92  ? 183  ILE D CG2 1 
ATOM   6607 C  CD1 . ILE D 1 183 ? 14.985  39.267 85.774  1.00 34.72  ? 183  ILE D CD1 1 
ATOM   6608 N  N   . GLY D 1 184 ? 13.034  35.652 81.765  1.00 35.48  ? 184  GLY D N   1 
ATOM   6609 C  CA  . GLY D 1 184 ? 12.478  34.459 81.161  1.00 37.40  ? 184  GLY D CA  1 
ATOM   6610 C  C   . GLY D 1 184 ? 12.879  34.307 79.691  1.00 37.63  ? 184  GLY D C   1 
ATOM   6611 O  O   . GLY D 1 184 ? 13.529  33.354 79.339  1.00 37.18  ? 184  GLY D O   1 
ATOM   6612 N  N   . GLU D 1 185 ? 12.565  35.321 78.900  1.00 38.43  ? 185  GLU D N   1 
ATOM   6613 C  CA  . GLU D 1 185 ? 12.811  35.353 77.439  1.00 39.84  ? 185  GLU D CA  1 
ATOM   6614 C  C   . GLU D 1 185 ? 14.298  35.200 77.079  1.00 39.46  ? 185  GLU D C   1 
ATOM   6615 O  O   . GLU D 1 185 ? 14.673  34.377 76.241  1.00 39.03  ? 185  GLU D O   1 
ATOM   6616 C  CB  . GLU D 1 185 ? 12.273  36.667 76.841  1.00 39.85  ? 185  GLU D CB  1 
ATOM   6617 C  CG  . GLU D 1 185 ? 10.718  36.818 76.843  1.00 42.04  ? 185  GLU D CG  1 
ATOM   6618 C  CD  . GLU D 1 185 ? 10.237  38.095 76.154  1.00 42.36  ? 185  GLU D CD  1 
ATOM   6619 O  OE1 . GLU D 1 185 ? 10.890  39.173 76.295  1.00 45.15  ? 185  GLU D OE1 1 
ATOM   6620 O  OE2 . GLU D 1 185 ? 9.177   38.026 75.480  1.00 47.25  ? 185  GLU D OE2 1 
ATOM   6621 N  N   . ILE D 1 186 ? 15.120  35.983 77.756  1.00 39.67  ? 186  ILE D N   1 
ATOM   6622 C  CA  . ILE D 1 186 ? 16.551  36.049 77.532  1.00 39.94  ? 186  ILE D CA  1 
ATOM   6623 C  C   . ILE D 1 186 ? 17.279  34.784 77.971  1.00 40.17  ? 186  ILE D C   1 
ATOM   6624 O  O   . ILE D 1 186 ? 18.089  34.276 77.231  1.00 40.07  ? 186  ILE D O   1 
ATOM   6625 C  CB  . ILE D 1 186 ? 17.164  37.208 78.338  1.00 38.90  ? 186  ILE D CB  1 
ATOM   6626 C  CG1 . ILE D 1 186 ? 16.713  38.561 77.765  1.00 39.64  ? 186  ILE D CG1 1 
ATOM   6627 C  CG2 . ILE D 1 186 ? 18.652  37.087 78.365  1.00 39.28  ? 186  ILE D CG2 1 
ATOM   6628 C  CD1 . ILE D 1 186 ? 16.928  39.692 78.757  1.00 40.54  ? 186  ILE D CD1 1 
ATOM   6629 N  N   . THR D 1 187 ? 17.062  34.338 79.219  1.00 39.83  ? 187  THR D N   1 
ATOM   6630 C  CA  . THR D 1 187 ? 17.680  33.124 79.698  1.00 37.77  ? 187  THR D CA  1 
ATOM   6631 C  C   . THR D 1 187 ? 16.955  31.909 79.124  1.00 36.96  ? 187  THR D C   1 
ATOM   6632 O  O   . THR D 1 187 ? 17.535  30.853 79.021  1.00 37.93  ? 187  THR D O   1 
ATOM   6633 C  CB  . THR D 1 187 ? 17.748  33.078 81.229  1.00 39.87  ? 187  THR D CB  1 
ATOM   6634 O  OG1 . THR D 1 187 ? 16.410  33.155 81.778  1.00 37.58  ? 187  THR D OG1 1 
ATOM   6635 C  CG2 . THR D 1 187 ? 18.695  34.241 81.749  1.00 37.14  ? 187  THR D CG2 1 
ATOM   6636 N  N   . GLY D 1 188 ? 15.706  32.041 78.706  1.00 34.42  ? 188  GLY D N   1 
ATOM   6637 C  CA  . GLY D 1 188 ? 14.928  30.869 78.311  1.00 33.99  ? 188  GLY D CA  1 
ATOM   6638 C  C   . GLY D 1 188 ? 14.256  30.079 79.451  1.00 32.12  ? 188  GLY D C   1 
ATOM   6639 O  O   . GLY D 1 188 ? 13.450  29.180 79.248  1.00 34.04  ? 188  GLY D O   1 
ATOM   6640 N  N   . VAL D 1 189 ? 14.547  30.454 80.652  1.00 31.06  ? 189  VAL D N   1 
ATOM   6641 C  CA  . VAL D 1 189 ? 14.089  29.746 81.831  1.00 30.28  ? 189  VAL D CA  1 
ATOM   6642 C  C   . VAL D 1 189 ? 12.584  30.014 82.106  1.00 30.78  ? 189  VAL D C   1 
ATOM   6643 O  O   . VAL D 1 189 ? 12.061  31.111 81.934  1.00 29.03  ? 189  VAL D O   1 
ATOM   6644 C  CB  . VAL D 1 189 ? 14.976  30.216 82.975  1.00 30.44  ? 189  VAL D CB  1 
ATOM   6645 C  CG1 . VAL D 1 189 ? 14.518  29.675 84.249  1.00 26.58  ? 189  VAL D CG1 1 
ATOM   6646 C  CG2 . VAL D 1 189 ? 16.510  29.875 82.628  1.00 29.13  ? 189  VAL D CG2 1 
ATOM   6647 N  N   . HIS D 1 190 ? 11.897  28.977 82.565  1.00 32.00  ? 190  HIS D N   1 
ATOM   6648 C  CA  . HIS D 1 190 ? 10.493  29.069 82.879  1.00 33.03  ? 190  HIS D CA  1 
ATOM   6649 C  C   . HIS D 1 190 ? 10.238  30.050 84.036  1.00 32.37  ? 190  HIS D C   1 
ATOM   6650 O  O   . HIS D 1 190 ? 11.081  30.214 84.907  1.00 30.89  ? 190  HIS D O   1 
ATOM   6651 C  CB  . HIS D 1 190 ? 9.930   27.635 83.121  1.00 33.69  ? 190  HIS D CB  1 
ATOM   6652 C  CG  . HIS D 1 190 ? 10.000  26.787 81.892  1.00 36.33  ? 190  HIS D CG  1 
ATOM   6653 N  ND1 . HIS D 1 190 ? 9.599   25.466 81.847  1.00 34.89  ? 190  HIS D ND1 1 
ATOM   6654 C  CD2 . HIS D 1 190 ? 10.446  27.091 80.643  1.00 38.81  ? 190  HIS D CD2 1 
ATOM   6655 C  CE1 . HIS D 1 190 ? 9.790   24.997 80.625  1.00 38.80  ? 190  HIS D CE1 1 
ATOM   6656 N  NE2 . HIS D 1 190 ? 10.313  25.959 79.877  1.00 40.24  ? 190  HIS D NE2 1 
ATOM   6657 N  N   . HIS D 1 191 ? 9.063   30.683 84.017  1.00 31.66  ? 191  HIS D N   1 
ATOM   6658 C  CA  A HIS D 1 191 ? 8.772   31.752 84.968  0.50 31.76  ? 191  HIS D CA  1 
ATOM   6659 C  CA  B HIS D 1 191 ? 8.712   31.739 84.980  0.50 31.71  ? 191  HIS D CA  1 
ATOM   6660 C  C   . HIS D 1 191 ? 8.828   31.328 86.449  1.00 30.70  ? 191  HIS D C   1 
ATOM   6661 O  O   . HIS D 1 191 ? 9.293   32.101 87.287  1.00 29.70  ? 191  HIS D O   1 
ATOM   6662 C  CB  A HIS D 1 191 ? 7.441   32.467 84.619  0.50 31.73  ? 191  HIS D CB  1 
ATOM   6663 C  CB  B HIS D 1 191 ? 7.279   32.240 84.723  0.50 31.58  ? 191  HIS D CB  1 
ATOM   6664 C  CG  A HIS D 1 191 ? 6.206   31.692 84.960  0.50 31.41  ? 191  HIS D CG  1 
ATOM   6665 C  CG  B HIS D 1 191 ? 6.789   33.224 85.745  0.50 31.11  ? 191  HIS D CG  1 
ATOM   6666 N  ND1 A HIS D 1 191 ? 5.611   30.812 84.079  0.50 32.48  ? 191  HIS D ND1 1 
ATOM   6667 N  ND1 B HIS D 1 191 ? 7.349   34.473 85.908  0.50 30.47  ? 191  HIS D ND1 1 
ATOM   6668 C  CD2 A HIS D 1 191 ? 5.433   31.694 86.069  0.50 30.34  ? 191  HIS D CD2 1 
ATOM   6669 C  CD2 B HIS D 1 191 ? 5.771   33.152 86.635  0.50 32.30  ? 191  HIS D CD2 1 
ATOM   6670 C  CE1 A HIS D 1 191 ? 4.538   30.294 84.639  0.50 30.08  ? 191  HIS D CE1 1 
ATOM   6671 C  CE1 B HIS D 1 191 ? 6.711   35.122 86.864  0.50 30.46  ? 191  HIS D CE1 1 
ATOM   6672 N  NE2 A HIS D 1 191 ? 4.414   30.807 85.851  0.50 30.92  ? 191  HIS D NE2 1 
ATOM   6673 N  NE2 B HIS D 1 191 ? 5.752   34.342 87.324  0.50 31.63  ? 191  HIS D NE2 1 
ATOM   6674 N  N   . VAL D 1 192 ? 8.353   30.114 86.772  1.00 30.53  ? 192  VAL D N   1 
ATOM   6675 C  CA  . VAL D 1 192 ? 8.429   29.618 88.137  1.00 30.07  ? 192  VAL D CA  1 
ATOM   6676 C  C   . VAL D 1 192 ? 9.871   29.616 88.667  1.00 30.14  ? 192  VAL D C   1 
ATOM   6677 O  O   . VAL D 1 192 ? 10.104  29.999 89.794  1.00 30.98  ? 192  VAL D O   1 
ATOM   6678 C  CB  . VAL D 1 192 ? 7.785   28.184 88.308  1.00 29.77  ? 192  VAL D CB  1 
ATOM   6679 C  CG1 . VAL D 1 192 ? 8.586   27.123 87.507  1.00 32.28  ? 192  VAL D CG1 1 
ATOM   6680 C  CG2 . VAL D 1 192 ? 7.676   27.773 89.795  1.00 30.07  ? 192  VAL D CG2 1 
ATOM   6681 N  N   . THR D 1 193 ? 10.827  29.170 87.865  1.00 30.25  ? 193  THR D N   1 
ATOM   6682 C  CA  . THR D 1 193 ? 12.242  29.123 88.284  1.00 30.30  ? 193  THR D CA  1 
ATOM   6683 C  C   . THR D 1 193 ? 12.815  30.518 88.416  1.00 29.72  ? 193  THR D C   1 
ATOM   6684 O  O   . THR D 1 193 ? 13.519  30.794 89.378  1.00 30.46  ? 193  THR D O   1 
ATOM   6685 C  CB  . THR D 1 193 ? 13.093  28.361 87.259  1.00 30.84  ? 193  THR D CB  1 
ATOM   6686 O  OG1 . THR D 1 193 ? 12.590  27.055 87.199  1.00 26.34  ? 193  THR D OG1 1 
ATOM   6687 C  CG2 . THR D 1 193 ? 14.614  28.340 87.618  1.00 30.56  ? 193  THR D CG2 1 
ATOM   6688 N  N   . VAL D 1 194 ? 12.456  31.394 87.483  1.00 28.82  ? 194  VAL D N   1 
ATOM   6689 C  CA  . VAL D 1 194 ? 12.804  32.817 87.574  1.00 29.10  ? 194  VAL D CA  1 
ATOM   6690 C  C   . VAL D 1 194 ? 12.263  33.394 88.891  1.00 28.13  ? 194  VAL D C   1 
ATOM   6691 O  O   . VAL D 1 194 ? 13.009  34.036 89.619  1.00 28.61  ? 194  VAL D O   1 
ATOM   6692 C  CB  . VAL D 1 194 ? 12.304  33.709 86.377  1.00 28.58  ? 194  VAL D CB  1 
ATOM   6693 C  CG1 . VAL D 1 194 ? 12.624  35.217 86.678  1.00 28.63  ? 194  VAL D CG1 1 
ATOM   6694 C  CG2 . VAL D 1 194 ? 12.847  33.234 85.029  1.00 26.85  ? 194  VAL D CG2 1 
ATOM   6695 N  N   . SER D 1 195 ? 10.994  33.164 89.194  1.00 29.30  ? 195  SER D N   1 
ATOM   6696 C  CA  . SER D 1 195 ? 10.404  33.654 90.451  1.00 29.73  ? 195  SER D CA  1 
ATOM   6697 C  C   . SER D 1 195 ? 11.141  33.137 91.726  1.00 28.10  ? 195  SER D C   1 
ATOM   6698 O  O   . SER D 1 195 ? 11.415  33.897 92.599  1.00 27.17  ? 195  SER D O   1 
ATOM   6699 C  CB  . SER D 1 195 ? 8.915   33.323 90.534  1.00 29.22  ? 195  SER D CB  1 
ATOM   6700 O  OG  . SER D 1 195 ? 8.286   33.827 89.358  1.00 35.80  ? 195  SER D OG  1 
ATOM   6701 N  N   . ARG D 1 196 ? 11.402  31.833 91.785  1.00 28.70  ? 196  ARG D N   1 
ATOM   6702 C  CA  . ARG D 1 196 ? 12.063  31.181 92.883  1.00 29.82  ? 196  ARG D CA  1 
ATOM   6703 C  C   . ARG D 1 196 ? 13.470  31.711 93.100  1.00 29.84  ? 196  ARG D C   1 
ATOM   6704 O  O   . ARG D 1 196 ? 13.861  31.984 94.204  1.00 30.34  ? 196  ARG D O   1 
ATOM   6705 C  CB  . ARG D 1 196 ? 12.095  29.653 92.652  1.00 30.39  ? 196  ARG D CB  1 
ATOM   6706 C  CG  . ARG D 1 196 ? 12.689  28.860 93.817  1.00 30.50  ? 196  ARG D CG  1 
ATOM   6707 C  CD  . ARG D 1 196 ? 12.736  27.350 93.636  1.00 34.80  ? 196  ARG D CD  1 
ATOM   6708 N  NE  . ARG D 1 196 ? 13.436  26.932 92.439  1.00 41.55  ? 196  ARG D NE  1 
ATOM   6709 C  CZ  . ARG D 1 196 ? 12.840  26.459 91.330  1.00 44.01  ? 196  ARG D CZ  1 
ATOM   6710 N  NH1 . ARG D 1 196 ? 11.502  26.358 91.228  1.00 45.86  ? 196  ARG D NH1 1 
ATOM   6711 N  NH2 . ARG D 1 196 ? 13.589  26.064 90.315  1.00 38.96  ? 196  ARG D NH2 1 
ATOM   6712 N  N   . VAL D 1 197 ? 14.221  31.891 92.026  1.00 30.06  ? 197  VAL D N   1 
ATOM   6713 C  CA  . VAL D 1 197 ? 15.613  32.310 92.143  1.00 29.88  ? 197  VAL D CA  1 
ATOM   6714 C  C   . VAL D 1 197 ? 15.614  33.746 92.666  1.00 30.31  ? 197  VAL D C   1 
ATOM   6715 O  O   . VAL D 1 197 ? 16.361  34.049 93.560  1.00 28.64  ? 197  VAL D O   1 
ATOM   6716 C  CB  . VAL D 1 197 ? 16.374  32.136 90.742  1.00 29.24  ? 197  VAL D CB  1 
ATOM   6717 C  CG1 . VAL D 1 197 ? 17.645  32.861 90.752  1.00 30.37  ? 197  VAL D CG1 1 
ATOM   6718 C  CG2 . VAL D 1 197 ? 16.564  30.633 90.416  1.00 27.93  ? 197  VAL D CG2 1 
ATOM   6719 N  N   . LEU D 1 198 ? 14.746  34.621 92.114  1.00 30.92  ? 198  LEU D N   1 
ATOM   6720 C  CA  . LEU D 1 198 ? 14.606  36.028 92.604  1.00 30.98  ? 198  LEU D CA  1 
ATOM   6721 C  C   . LEU D 1 198 ? 14.165  36.073 94.071  1.00 30.65  ? 198  LEU D C   1 
ATOM   6722 O  O   . LEU D 1 198 ? 14.774  36.817 94.915  1.00 29.79  ? 198  LEU D O   1 
ATOM   6723 C  CB  . LEU D 1 198 ? 13.689  36.868 91.631  1.00 31.68  ? 198  LEU D CB  1 
ATOM   6724 C  CG  . LEU D 1 198 ? 14.365  37.187 90.285  1.00 34.69  ? 198  LEU D CG  1 
ATOM   6725 C  CD1 . LEU D 1 198 ? 13.467  37.937 89.319  1.00 38.72  ? 198  LEU D CD1 1 
ATOM   6726 C  CD2 . LEU D 1 198 ? 15.631  37.965 90.534  1.00 38.92  ? 198  LEU D CD2 1 
ATOM   6727 N  N   . ALA D 1 199 ? 13.201  35.197 94.420  1.00 29.65  ? 199  ALA D N   1 
ATOM   6728 C  CA  . ALA D 1 199 ? 12.838  35.035 95.809  1.00 29.53  ? 199  ALA D CA  1 
ATOM   6729 C  C   . ALA D 1 199 ? 14.046  34.596 96.692  1.00 29.35  ? 199  ALA D C   1 
ATOM   6730 O  O   . ALA D 1 199 ? 14.208  35.135 97.793  1.00 26.13  ? 199  ALA D O   1 
ATOM   6731 C  CB  . ALA D 1 199 ? 11.637  34.127 95.987  1.00 27.41  ? 199  ALA D CB  1 
ATOM   6732 N  N   . CYS D 1 200 ? 14.895  33.667 96.243  1.00 29.27  ? 200  CYS D N   1 
ATOM   6733 C  CA  . CYS D 1 200 ? 16.021  33.288 97.139  1.00 31.60  ? 200  CYS D CA  1 
ATOM   6734 C  C   . CYS D 1 200 ? 17.066  34.360 97.254  1.00 31.09  ? 200  CYS D C   1 
ATOM   6735 O  O   . CYS D 1 200 ? 17.546  34.609 98.325  1.00 32.02  ? 200  CYS D O   1 
ATOM   6736 C  CB  . CYS D 1 200 ? 16.765  32.035 96.732  1.00 30.93  ? 200  CYS D CB  1 
ATOM   6737 S  SG  . CYS D 1 200 ? 15.760  30.722 96.439  1.00 46.91  ? 200  CYS D SG  1 
ATOM   6738 N  N   . LEU D 1 201 ? 17.458  34.946 96.131  1.00 32.77  ? 201  LEU D N   1 
ATOM   6739 C  CA  . LEU D 1 201 ? 18.418  36.045 96.162  1.00 33.19  ? 201  LEU D CA  1 
ATOM   6740 C  C   . LEU D 1 201 ? 17.980  37.143 97.132  1.00 33.09  ? 201  LEU D C   1 
ATOM   6741 O  O   . LEU D 1 201 ? 18.806  37.705 97.843  1.00 31.51  ? 201  LEU D O   1 
ATOM   6742 C  CB  . LEU D 1 201 ? 18.617  36.613 94.752  1.00 33.22  ? 201  LEU D CB  1 
ATOM   6743 C  CG  . LEU D 1 201 ? 19.263  35.723 93.696  1.00 34.42  ? 201  LEU D CG  1 
ATOM   6744 C  CD1 . LEU D 1 201 ? 19.073  36.320 92.272  1.00 32.50  ? 201  LEU D CD1 1 
ATOM   6745 C  CD2 . LEU D 1 201 ? 20.756  35.513 93.980  1.00 37.17  ? 201  LEU D CD2 1 
ATOM   6746 N  N   . LYS D 1 202 ? 16.681  37.447 97.164  1.00 32.59  ? 202  LYS D N   1 
ATOM   6747 C  CA  . LYS D 1 202 ? 16.190  38.444 98.088  1.00 32.66  ? 202  LYS D CA  1 
ATOM   6748 C  C   . LYS D 1 202 ? 16.269  37.922 99.525  1.00 32.46  ? 202  LYS D C   1 
ATOM   6749 O  O   . LYS D 1 202 ? 16.691  38.645 100.425 1.00 31.16  ? 202  LYS D O   1 
ATOM   6750 C  CB  . LYS D 1 202 ? 14.743  38.833 97.749  1.00 33.04  ? 202  LYS D CB  1 
ATOM   6751 C  CG  . LYS D 1 202 ? 14.114  39.890 98.693  1.00 32.80  ? 202  LYS D CG  1 
ATOM   6752 C  CD  . LYS D 1 202 ? 12.749  40.309 98.169  1.00 33.90  ? 202  LYS D CD  1 
ATOM   6753 C  CE  . LYS D 1 202 ? 12.285  41.628 98.746  1.00 36.71  ? 202  LYS D CE  1 
ATOM   6754 N  NZ  . LYS D 1 202 ? 10.864  41.913 98.391  1.00 38.15  ? 202  LYS D NZ  1 
ATOM   6755 N  N   . ARG D 1 203 ? 15.822  36.671 99.723  1.00 32.07  ? 203  ARG D N   1 
ATOM   6756 C  CA  . ARG D 1 203 ? 15.748  36.076 101.043 1.00 32.35  ? 203  ARG D CA  1 
ATOM   6757 C  C   . ARG D 1 203 ? 17.135  36.040 101.701 1.00 32.75  ? 203  ARG D C   1 
ATOM   6758 O  O   . ARG D 1 203 ? 17.264  36.320 102.860 1.00 33.55  ? 203  ARG D O   1 
ATOM   6759 C  CB  . ARG D 1 203 ? 15.120  34.666 100.961 1.00 31.55  ? 203  ARG D CB  1 
ATOM   6760 C  CG  . ARG D 1 203 ? 15.325  33.790 102.201 1.00 30.02  ? 203  ARG D CG  1 
ATOM   6761 C  CD  . ARG D 1 203 ? 14.599  32.497 102.135 1.00 30.98  ? 203  ARG D CD  1 
ATOM   6762 N  NE  . ARG D 1 203 ? 13.301  32.704 101.530 1.00 31.40  ? 203  ARG D NE  1 
ATOM   6763 C  CZ  . ARG D 1 203 ? 12.941  32.336 100.302 1.00 28.49  ? 203  ARG D CZ  1 
ATOM   6764 N  NH1 . ARG D 1 203 ? 13.757  31.629 99.542  1.00 29.23  ? 203  ARG D NH1 1 
ATOM   6765 N  NH2 . ARG D 1 203 ? 11.716  32.647 99.844  1.00 28.40  ? 203  ARG D NH2 1 
ATOM   6766 N  N   . GLU D 1 204 ? 18.151  35.705 100.921 1.00 34.60  ? 204  GLU D N   1 
ATOM   6767 C  CA  . GLU D 1 204 ? 19.549  35.643 101.370 1.00 36.16  ? 204  GLU D CA  1 
ATOM   6768 C  C   . GLU D 1 204 ? 20.310  36.967 101.269 1.00 36.29  ? 204  GLU D C   1 
ATOM   6769 O  O   . GLU D 1 204 ? 21.506  36.961 101.346 1.00 36.84  ? 204  GLU D O   1 
ATOM   6770 C  CB  . GLU D 1 204 ? 20.272  34.569 100.586 1.00 35.22  ? 204  GLU D CB  1 
ATOM   6771 C  CG  . GLU D 1 204 ? 19.385  33.361 100.454 1.00 40.80  ? 204  GLU D CG  1 
ATOM   6772 C  CD  . GLU D 1 204 ? 20.066  32.131 99.933  1.00 46.33  ? 204  GLU D CD  1 
ATOM   6773 O  OE1 . GLU D 1 204 ? 20.595  32.191 98.781  1.00 47.49  ? 204  GLU D OE1 1 
ATOM   6774 O  OE2 . GLU D 1 204 ? 20.057  31.120 100.701 1.00 47.15  ? 204  GLU D OE2 1 
ATOM   6775 N  N   . ASN D 1 205 ? 19.596  38.083 101.114 1.00 37.10  ? 205  ASN D N   1 
ATOM   6776 C  CA  . ASN D 1 205 ? 20.173  39.450 101.008 1.00 37.93  ? 205  ASN D CA  1 
ATOM   6777 C  C   . ASN D 1 205 ? 21.320  39.608 100.031 1.00 37.10  ? 205  ASN D C   1 
ATOM   6778 O  O   . ASN D 1 205 ? 22.327  40.243 100.328 1.00 38.19  ? 205  ASN D O   1 
ATOM   6779 C  CB  . ASN D 1 205 ? 20.562  39.970 102.373 1.00 37.48  ? 205  ASN D CB  1 
ATOM   6780 C  CG  . ASN D 1 205 ? 19.378  40.016 103.329 1.00 40.18  ? 205  ASN D CG  1 
ATOM   6781 O  OD1 . ASN D 1 205 ? 19.357  39.314 104.351 1.00 40.90  ? 205  ASN D OD1 1 
ATOM   6782 N  ND2 . ASN D 1 205 ? 18.374  40.834 102.996 1.00 42.81  ? 205  ASN D ND2 1 
ATOM   6783 N  N   . ILE D 1 206 ? 21.136  39.044 98.853  1.00 37.31  ? 206  ILE D N   1 
ATOM   6784 C  CA  . ILE D 1 206 ? 22.153  39.081 97.767  1.00 37.37  ? 206  ILE D CA  1 
ATOM   6785 C  C   . ILE D 1 206 ? 21.716  40.136 96.798  1.00 38.18  ? 206  ILE D C   1 
ATOM   6786 O  O   . ILE D 1 206 ? 22.482  41.035 96.460  1.00 37.75  ? 206  ILE D O   1 
ATOM   6787 C  CB  . ILE D 1 206 ? 22.311  37.746 97.078  1.00 37.07  ? 206  ILE D CB  1 
ATOM   6788 C  CG1 . ILE D 1 206 ? 22.921  36.709 98.048  1.00 37.65  ? 206  ILE D CG1 1 
ATOM   6789 C  CG2 . ILE D 1 206 ? 23.172  37.885 95.777  1.00 36.19  ? 206  ILE D CG2 1 
ATOM   6790 C  CD1 . ILE D 1 206 ? 22.333  35.311 97.910  1.00 37.26  ? 206  ILE D CD1 1 
ATOM   6791 N  N   . LEU D 1 207 ? 20.458  40.085 96.395  1.00 39.11  ? 207  LEU D N   1 
ATOM   6792 C  CA  . LEU D 1 207 ? 20.000  41.016 95.384  1.00 41.00  ? 207  LEU D CA  1 
ATOM   6793 C  C   . LEU D 1 207 ? 18.489  41.128 95.449  1.00 42.41  ? 207  LEU D C   1 
ATOM   6794 O  O   . LEU D 1 207 ? 17.802  40.145 95.719  1.00 41.21  ? 207  LEU D O   1 
ATOM   6795 C  CB  . LEU D 1 207 ? 20.575  40.577 94.004  1.00 40.58  ? 207  LEU D CB  1 
ATOM   6796 C  CG  . LEU D 1 207 ? 19.981  40.691 92.596  1.00 40.14  ? 207  LEU D CG  1 
ATOM   6797 C  CD1 . LEU D 1 207 ? 20.989  40.109 91.545  1.00 35.71  ? 207  LEU D CD1 1 
ATOM   6798 C  CD2 . LEU D 1 207 ? 18.638  40.018 92.533  1.00 35.81  ? 207  LEU D CD2 1 
ATOM   6799 N  N   . ASP D 1 208 ? 18.002  42.346 95.240  1.00 44.73  ? 208  ASP D N   1 
ATOM   6800 C  CA  . ASP D 1 208 ? 16.576  42.659 95.188  1.00 47.75  ? 208  ASP D CA  1 
ATOM   6801 C  C   . ASP D 1 208 ? 16.278  43.256 93.788  1.00 48.84  ? 208  ASP D C   1 
ATOM   6802 O  O   . ASP D 1 208 ? 16.780  44.323 93.445  1.00 49.21  ? 208  ASP D O   1 
ATOM   6803 C  CB  . ASP D 1 208 ? 16.248  43.641 96.319  1.00 48.32  ? 208  ASP D CB  1 
ATOM   6804 C  CG  . ASP D 1 208 ? 14.768  43.868 96.509  1.00 50.76  ? 208  ASP D CG  1 
ATOM   6805 O  OD1 . ASP D 1 208 ? 13.965  43.072 95.973  1.00 55.85  ? 208  ASP D OD1 1 
ATOM   6806 O  OD2 . ASP D 1 208 ? 14.406  44.839 97.213  1.00 53.51  ? 208  ASP D OD2 1 
ATOM   6807 N  N   . LYS D 1 209 ? 15.479  42.545 92.981  1.00 50.73  ? 209  LYS D N   1 
ATOM   6808 C  CA  . LYS D 1 209 ? 15.378  42.814 91.518  1.00 51.43  ? 209  LYS D CA  1 
ATOM   6809 C  C   . LYS D 1 209 ? 14.599  44.078 91.174  1.00 52.61  ? 209  LYS D C   1 
ATOM   6810 O  O   . LYS D 1 209 ? 15.035  44.812 90.261  1.00 54.30  ? 209  LYS D O   1 
ATOM   6811 C  CB  . LYS D 1 209 ? 14.789  41.636 90.716  1.00 52.18  ? 209  LYS D CB  1 
ATOM   6812 C  CG  . LYS D 1 209 ? 14.984  41.749 89.159  1.00 51.08  ? 209  LYS D CG  1 
ATOM   6813 C  CD  . LYS D 1 209 ? 13.651  41.712 88.405  1.00 54.35  ? 209  LYS D CD  1 
ATOM   6814 N  N   . LYS D 1 210 ? 13.467  44.312 91.848  1.00 52.17  ? 210  LYS D N   1 
ATOM   6815 C  CA  . LYS D 1 210 ? 12.631  45.516 91.639  1.00 52.31  ? 210  LYS D CA  1 
ATOM   6816 C  C   . LYS D 1 210 ? 12.285  45.955 90.163  1.00 52.31  ? 210  LYS D C   1 
ATOM   6817 O  O   . LYS D 1 210 ? 12.956  45.590 89.186  1.00 51.78  ? 210  LYS D O   1 
ATOM   6818 C  CB  . LYS D 1 210 ? 13.253  46.705 92.400  1.00 52.47  ? 210  LYS D CB  1 
ATOM   6819 C  CG  . LYS D 1 210 ? 13.386  46.501 93.901  1.00 51.90  ? 210  LYS D CG  1 
ATOM   6820 C  CD  . LYS D 1 210 ? 13.719  47.842 94.552  1.00 52.81  ? 210  LYS D CD  1 
ATOM   6821 C  CE  . LYS D 1 210 ? 13.515  47.871 96.067  1.00 51.91  ? 210  LYS D CE  1 
ATOM   6822 N  NZ  . LYS D 1 210 ? 14.039  49.170 96.615  1.00 50.48  ? 210  LYS D NZ  1 
ATOM   6823 N  N   . LYS D 1 211 ? 11.241  46.782 90.025  1.00 52.44  ? 211  LYS D N   1 
ATOM   6824 C  CA  . LYS D 1 211 ? 10.708  47.177 88.698  1.00 52.35  ? 211  LYS D CA  1 
ATOM   6825 C  C   . LYS D 1 211 ? 11.692  48.023 87.857  1.00 51.95  ? 211  LYS D C   1 
ATOM   6826 O  O   . LYS D 1 211 ? 11.946  47.723 86.683  1.00 52.36  ? 211  LYS D O   1 
ATOM   6827 C  CB  . LYS D 1 211 ? 9.377   47.942 88.861  1.00 52.39  ? 211  LYS D CB  1 
ATOM   6828 C  CG  . LYS D 1 211 ? 8.585   48.119 87.562  1.00 52.40  ? 211  LYS D CG  1 
ATOM   6829 C  CD  . LYS D 1 211 ? 7.144   48.562 87.807  1.00 52.78  ? 211  LYS D CD  1 
ATOM   6830 C  CE  . LYS D 1 211 ? 6.233   47.385 88.190  1.00 52.54  ? 211  LYS D CE  1 
ATOM   6831 N  NZ  . LYS D 1 211 ? 4.846   47.870 88.462  1.00 51.87  ? 211  LYS D NZ  1 
ATOM   6832 N  N   . ASN D 1 212 ? 12.251  49.054 88.494  1.00 51.27  ? 212  ASN D N   1 
ATOM   6833 C  CA  . ASN D 1 212 ? 13.001  50.131 87.834  1.00 50.23  ? 212  ASN D CA  1 
ATOM   6834 C  C   . ASN D 1 212 ? 14.534  49.959 87.932  1.00 49.58  ? 212  ASN D C   1 
ATOM   6835 O  O   . ASN D 1 212 ? 15.276  50.514 87.100  1.00 49.54  ? 212  ASN D O   1 
ATOM   6836 C  CB  . ASN D 1 212 ? 12.577  51.463 88.483  1.00 50.57  ? 212  ASN D CB  1 
ATOM   6837 C  CG  . ASN D 1 212 ? 13.038  52.680 87.705  1.00 52.04  ? 212  ASN D CG  1 
ATOM   6838 O  OD1 . ASN D 1 212 ? 13.346  52.591 86.516  1.00 56.25  ? 212  ASN D OD1 1 
ATOM   6839 N  ND2 . ASN D 1 212 ? 13.094  53.830 88.376  1.00 52.00  ? 212  ASN D ND2 1 
ATOM   6840 N  N   . LYS D 1 213 ? 14.968  49.194 88.950  1.00 48.28  ? 213  LYS D N   1 
ATOM   6841 C  CA  . LYS D 1 213 ? 16.370  49.071 89.417  1.00 47.31  ? 213  LYS D CA  1 
ATOM   6842 C  C   . LYS D 1 213 ? 16.598  47.659 89.995  1.00 45.81  ? 213  LYS D C   1 
ATOM   6843 O  O   . LYS D 1 213 ? 15.649  46.983 90.332  1.00 45.22  ? 213  LYS D O   1 
ATOM   6844 C  CB  . LYS D 1 213 ? 16.656  50.096 90.540  1.00 47.28  ? 213  LYS D CB  1 
ATOM   6845 C  CG  . LYS D 1 213 ? 17.062  51.487 90.051  1.00 48.75  ? 213  LYS D CG  1 
ATOM   6846 C  CD  . LYS D 1 213 ? 17.244  52.476 91.207  1.00 48.32  ? 213  LYS D CD  1 
ATOM   6847 C  CE  . LYS D 1 213 ? 15.910  53.084 91.657  1.00 49.38  ? 213  LYS D CE  1 
ATOM   6848 N  NZ  . LYS D 1 213 ? 16.080  54.434 92.247  1.00 48.80  ? 213  LYS D NZ  1 
ATOM   6849 N  N   . ILE D 1 214 ? 17.857  47.241 90.111  1.00 44.64  ? 214  ILE D N   1 
ATOM   6850 C  CA  . ILE D 1 214 ? 18.260  45.970 90.720  1.00 43.87  ? 214  ILE D CA  1 
ATOM   6851 C  C   . ILE D 1 214 ? 19.316  46.344 91.752  1.00 42.92  ? 214  ILE D C   1 
ATOM   6852 O  O   . ILE D 1 214 ? 20.341  46.926 91.372  1.00 43.47  ? 214  ILE D O   1 
ATOM   6853 C  CB  . ILE D 1 214 ? 18.902  45.042 89.678  1.00 44.20  ? 214  ILE D CB  1 
ATOM   6854 C  CG1 . ILE D 1 214 ? 17.942  44.773 88.493  1.00 46.07  ? 214  ILE D CG1 1 
ATOM   6855 C  CG2 . ILE D 1 214 ? 19.425  43.756 90.332  1.00 42.70  ? 214  ILE D CG2 1 
ATOM   6856 C  CD1 . ILE D 1 214 ? 18.558  43.848 87.363  1.00 45.51  ? 214  ILE D CD1 1 
ATOM   6857 N  N   . ILE D 1 215 ? 19.062  46.119 93.050  1.00 41.36  ? 215  ILE D N   1 
ATOM   6858 C  CA  . ILE D 1 215 ? 20.076  46.385 94.094  1.00 40.55  ? 215  ILE D CA  1 
ATOM   6859 C  C   . ILE D 1 215 ? 20.888  45.129 94.453  1.00 38.97  ? 215  ILE D C   1 
ATOM   6860 O  O   . ILE D 1 215 ? 20.339  44.163 94.935  1.00 39.53  ? 215  ILE D O   1 
ATOM   6861 C  CB  . ILE D 1 215 ? 19.476  46.934 95.414  1.00 40.39  ? 215  ILE D CB  1 
ATOM   6862 C  CG1 . ILE D 1 215 ? 18.659  48.224 95.192  1.00 40.59  ? 215  ILE D CG1 1 
ATOM   6863 C  CG2 . ILE D 1 215 ? 20.599  47.184 96.433  1.00 40.23  ? 215  ILE D CG2 1 
ATOM   6864 C  CD1 . ILE D 1 215 ? 17.146  48.014 95.045  1.00 38.33  ? 215  ILE D CD1 1 
ATOM   6865 N  N   . VAL D 1 216 ? 22.195  45.142 94.234  1.00 37.35  ? 216  VAL D N   1 
ATOM   6866 C  CA  . VAL D 1 216 ? 23.056  44.067 94.716  1.00 36.66  ? 216  VAL D CA  1 
ATOM   6867 C  C   . VAL D 1 216 ? 23.738  44.442 96.048  1.00 36.91  ? 216  VAL D C   1 
ATOM   6868 O  O   . VAL D 1 216 ? 24.596  45.313 96.101  1.00 37.48  ? 216  VAL D O   1 
ATOM   6869 C  CB  . VAL D 1 216 ? 24.120  43.673 93.693  1.00 36.05  ? 216  VAL D CB  1 
ATOM   6870 C  CG1 . VAL D 1 216 ? 24.817  42.435 94.138  1.00 35.43  ? 216  VAL D CG1 1 
ATOM   6871 C  CG2 . VAL D 1 216 ? 23.493  43.501 92.321  1.00 37.57  ? 216  VAL D CG2 1 
ATOM   6872 N  N   . TYR D 1 217 ? 23.365  43.737 97.110  1.00 37.75  ? 217  TYR D N   1 
ATOM   6873 C  CA  . TYR D 1 217 ? 23.921  43.934 98.456  1.00 39.05  ? 217  TYR D CA  1 
ATOM   6874 C  C   . TYR D 1 217 ? 25.178  43.111 98.633  1.00 39.03  ? 217  TYR D C   1 
ATOM   6875 O  O   . TYR D 1 217 ? 26.017  43.451 99.434  1.00 37.60  ? 217  TYR D O   1 
ATOM   6876 C  CB  . TYR D 1 217 ? 22.911  43.514 99.542  1.00 39.11  ? 217  TYR D CB  1 
ATOM   6877 C  CG  . TYR D 1 217 ? 21.581  44.162 99.358  1.00 40.14  ? 217  TYR D CG  1 
ATOM   6878 C  CD1 . TYR D 1 217 ? 21.313  45.461 99.853  1.00 39.39  ? 217  TYR D CD1 1 
ATOM   6879 C  CD2 . TYR D 1 217 ? 20.570  43.475 98.710  1.00 39.87  ? 217  TYR D CD2 1 
ATOM   6880 C  CE1 . TYR D 1 217 ? 20.047  46.055 99.653  1.00 41.41  ? 217  TYR D CE1 1 
ATOM   6881 C  CE2 . TYR D 1 217 ? 19.337  44.035 98.510  1.00 41.08  ? 217  TYR D CE2 1 
ATOM   6882 C  CZ  . TYR D 1 217 ? 19.061  45.309 98.949  1.00 41.07  ? 217  TYR D CZ  1 
ATOM   6883 O  OH  . TYR D 1 217 ? 17.786  45.779 98.696  1.00 41.26  ? 217  TYR D OH  1 
ATOM   6884 N  N   . ASN D 1 218 ? 25.292  42.009 97.902  1.00 39.31  ? 218  ASN D N   1 
ATOM   6885 C  CA  . ASN D 1 218 ? 26.455  41.174 98.038  1.00 39.59  ? 218  ASN D CA  1 
ATOM   6886 C  C   . ASN D 1 218 ? 26.940  40.653 96.699  1.00 39.29  ? 218  ASN D C   1 
ATOM   6887 O  O   . ASN D 1 218 ? 26.653  39.536 96.330  1.00 39.98  ? 218  ASN D O   1 
ATOM   6888 C  CB  . ASN D 1 218 ? 26.162  40.061 99.013  1.00 40.35  ? 218  ASN D CB  1 
ATOM   6889 C  CG  . ASN D 1 218 ? 27.395  39.520 99.642  1.00 40.83  ? 218  ASN D CG  1 
ATOM   6890 O  OD1 . ASN D 1 218 ? 28.495  39.712 99.135  1.00 40.23  ? 218  ASN D OD1 1 
ATOM   6891 N  ND2 . ASN D 1 218 ? 27.223  38.815 100.761 1.00 42.17  ? 218  ASN D ND2 1 
ATOM   6892 N  N   . LEU D 1 219 ? 27.713  41.480 95.995  1.00 38.46  ? 219  LEU D N   1 
ATOM   6893 C  CA  . LEU D 1 219 ? 28.315  41.112 94.707  1.00 38.00  ? 219  LEU D CA  1 
ATOM   6894 C  C   . LEU D 1 219 ? 29.232  39.873 94.770  1.00 38.01  ? 219  LEU D C   1 
ATOM   6895 O  O   . LEU D 1 219 ? 29.245  39.071 93.865  1.00 37.71  ? 219  LEU D O   1 
ATOM   6896 C  CB  . LEU D 1 219 ? 29.111  42.309 94.136  1.00 38.30  ? 219  LEU D CB  1 
ATOM   6897 C  CG  . LEU D 1 219 ? 29.807  42.119 92.778  1.00 38.16  ? 219  LEU D CG  1 
ATOM   6898 C  CD1 . LEU D 1 219 ? 28.819  41.564 91.744  1.00 35.69  ? 219  LEU D CD1 1 
ATOM   6899 C  CD2 . LEU D 1 219 ? 30.473  43.441 92.345  1.00 39.06  ? 219  LEU D CD2 1 
ATOM   6900 N  N   . GLY D 1 220 ? 30.029  39.736 95.819  1.00 38.14  ? 220  GLY D N   1 
ATOM   6901 C  CA  . GLY D 1 220 ? 30.949  38.607 95.925  1.00 38.03  ? 220  GLY D CA  1 
ATOM   6902 C  C   . GLY D 1 220 ? 30.205  37.304 96.058  1.00 37.52  ? 220  GLY D C   1 
ATOM   6903 O  O   . GLY D 1 220 ? 30.576  36.297 95.462  1.00 37.75  ? 220  GLY D O   1 
ATOM   6904 N  N   . GLU D 1 221 ? 29.143  37.340 96.854  1.00 37.89  ? 221  GLU D N   1 
ATOM   6905 C  CA  . GLU D 1 221 ? 28.243  36.232 97.047  1.00 37.03  ? 221  GLU D CA  1 
ATOM   6906 C  C   . GLU D 1 221 ? 27.483  35.887 95.755  1.00 37.03  ? 221  GLU D C   1 
ATOM   6907 O  O   . GLU D 1 221 ? 27.376  34.717 95.412  1.00 36.73  ? 221  GLU D O   1 
ATOM   6908 C  CB  . GLU D 1 221 ? 27.260  36.577 98.166  1.00 38.50  ? 221  GLU D CB  1 
ATOM   6909 C  CG  . GLU D 1 221 ? 26.254  35.474 98.569  1.00 38.66  ? 221  GLU D CG  1 
ATOM   6910 C  CD  . GLU D 1 221 ? 26.906  34.250 99.186  1.00 43.48  ? 221  GLU D CD  1 
ATOM   6911 O  OE1 . GLU D 1 221 ? 28.160  34.182 99.149  1.00 45.16  ? 221  GLU D OE1 1 
ATOM   6912 O  OE2 . GLU D 1 221 ? 26.169  33.368 99.724  1.00 45.56  ? 221  GLU D OE2 1 
ATOM   6913 N  N   . LEU D 1 222 ? 26.987  36.897 95.029  1.00 36.23  ? 222  LEU D N   1 
ATOM   6914 C  CA  . LEU D 1 222 ? 26.363  36.646 93.709  1.00 35.46  ? 222  LEU D CA  1 
ATOM   6915 C  C   . LEU D 1 222 ? 27.332  35.919 92.762  1.00 35.86  ? 222  LEU D C   1 
ATOM   6916 O  O   . LEU D 1 222 ? 26.982  34.893 92.222  1.00 35.67  ? 222  LEU D O   1 
ATOM   6917 C  CB  . LEU D 1 222 ? 25.841  37.949 93.083  1.00 35.18  ? 222  LEU D CB  1 
ATOM   6918 C  CG  . LEU D 1 222 ? 25.318  37.902 91.659  1.00 35.24  ? 222  LEU D CG  1 
ATOM   6919 C  CD1 . LEU D 1 222 ? 24.074  36.944 91.604  1.00 30.50  ? 222  LEU D CD1 1 
ATOM   6920 C  CD2 . LEU D 1 222 ? 24.978  39.305 91.197  1.00 32.36  ? 222  LEU D CD2 1 
ATOM   6921 N  N   . LYS D 1 223 ? 28.550  36.447 92.588  1.00 35.88  ? 223  LYS D N   1 
ATOM   6922 C  CA  . LYS D 1 223 ? 29.589  35.814 91.824  1.00 37.07  ? 223  LYS D CA  1 
ATOM   6923 C  C   . LYS D 1 223 ? 29.872  34.372 92.238  1.00 38.17  ? 223  LYS D C   1 
ATOM   6924 O  O   . LYS D 1 223 ? 29.981  33.482 91.383  1.00 37.35  ? 223  LYS D O   1 
ATOM   6925 C  CB  . LYS D 1 223 ? 30.888  36.625 91.952  1.00 37.01  ? 223  LYS D CB  1 
ATOM   6926 C  CG  . LYS D 1 223 ? 32.011  36.092 91.116  1.00 38.66  ? 223  LYS D CG  1 
ATOM   6927 C  CD  . LYS D 1 223 ? 33.363  36.842 91.271  1.00 40.30  ? 223  LYS D CD  1 
ATOM   6928 C  CE  . LYS D 1 223 ? 34.499  36.175 90.435  1.00 42.83  ? 223  LYS D CE  1 
ATOM   6929 N  NZ  . LYS D 1 223 ? 34.627  36.836 89.112  1.00 44.64  ? 223  LYS D NZ  1 
ATOM   6930 N  N   . HIS D 1 224 ? 30.069  34.173 93.549  1.00 40.29  ? 224  HIS D N   1 
ATOM   6931 C  CA  . HIS D 1 224 ? 30.280  32.851 94.149  1.00 41.31  ? 224  HIS D CA  1 
ATOM   6932 C  C   . HIS D 1 224 ? 29.091  31.915 93.831  1.00 41.29  ? 224  HIS D C   1 
ATOM   6933 O  O   . HIS D 1 224 ? 29.309  30.833 93.300  1.00 42.01  ? 224  HIS D O   1 
ATOM   6934 C  CB  . HIS D 1 224 ? 30.496  33.016 95.643  1.00 42.87  ? 224  HIS D CB  1 
ATOM   6935 C  CG  . HIS D 1 224 ? 30.263  31.773 96.454  1.00 46.39  ? 224  HIS D CG  1 
ATOM   6936 N  ND1 . HIS D 1 224 ? 31.171  30.734 96.512  1.00 49.27  ? 224  HIS D ND1 1 
ATOM   6937 C  CD2 . HIS D 1 224 ? 29.236  31.422 97.267  1.00 50.02  ? 224  HIS D CD2 1 
ATOM   6938 C  CE1 . HIS D 1 224 ? 30.705  29.789 97.311  1.00 51.61  ? 224  HIS D CE1 1 
ATOM   6939 N  NE2 . HIS D 1 224 ? 29.530  30.178 97.780  1.00 53.39  ? 224  HIS D NE2 1 
ATOM   6940 N  N   . LEU D 1 225 ? 27.844  32.339 94.110  1.00 41.49  ? 225  LEU D N   1 
ATOM   6941 C  CA  . LEU D 1 225 ? 26.642  31.535 93.709  1.00 40.91  ? 225  LEU D CA  1 
ATOM   6942 C  C   . LEU D 1 225 ? 26.574  31.279 92.194  1.00 40.62  ? 225  LEU D C   1 
ATOM   6943 O  O   . LEU D 1 225 ? 26.202  30.190 91.792  1.00 40.11  ? 225  LEU D O   1 
ATOM   6944 C  CB  . LEU D 1 225 ? 25.336  32.154 94.217  1.00 40.91  ? 225  LEU D CB  1 
ATOM   6945 C  CG  . LEU D 1 225 ? 25.139  32.303 95.736  1.00 40.54  ? 225  LEU D CG  1 
ATOM   6946 C  CD1 . LEU D 1 225 ? 24.095  33.354 96.128  1.00 41.04  ? 225  LEU D CD1 1 
ATOM   6947 C  CD2 . LEU D 1 225 ? 24.843  30.988 96.444  1.00 42.81  ? 225  LEU D CD2 1 
ATOM   6948 N  N   . SER D 1 226 ? 26.971  32.237 91.339  1.00 40.92  ? 226  SER D N   1 
ATOM   6949 C  CA  . SER D 1 226 ? 26.950  31.968 89.887  1.00 41.43  ? 226  SER D CA  1 
ATOM   6950 C  C   . SER D 1 226 ? 28.016  30.988 89.476  1.00 42.75  ? 226  SER D C   1 
ATOM   6951 O  O   . SER D 1 226 ? 28.003  30.526 88.355  1.00 41.69  ? 226  SER D O   1 
ATOM   6952 C  CB  . SER D 1 226 ? 27.053  33.229 89.033  1.00 41.66  ? 226  SER D CB  1 
ATOM   6953 O  OG  . SER D 1 226 ? 28.303  33.848 89.168  1.00 40.77  ? 226  SER D OG  1 
ATOM   6954 N  N   . GLU D 1 227 ? 28.932  30.659 90.397  1.00 45.33  ? 227  GLU D N   1 
ATOM   6955 C  CA  . GLU D 1 227 ? 30.017  29.689 90.139  1.00 47.52  ? 227  GLU D CA  1 
ATOM   6956 C  C   . GLU D 1 227 ? 29.756  28.284 90.707  1.00 48.63  ? 227  GLU D C   1 
ATOM   6957 O  O   . GLU D 1 227 ? 30.678  27.451 90.749  1.00 48.46  ? 227  GLU D O   1 
ATOM   6958 C  CB  . GLU D 1 227 ? 31.323  30.201 90.753  1.00 47.71  ? 227  GLU D CB  1 
ATOM   6959 C  CG  . GLU D 1 227 ? 32.004  31.341 90.025  1.00 47.85  ? 227  GLU D CG  1 
ATOM   6960 C  CD  . GLU D 1 227 ? 33.120  31.955 90.867  1.00 49.30  ? 227  GLU D CD  1 
ATOM   6961 O  OE1 . GLU D 1 227 ? 33.832  32.850 90.340  1.00 46.27  ? 227  GLU D OE1 1 
ATOM   6962 O  OE2 . GLU D 1 227 ? 33.273  31.537 92.068  1.00 52.24  ? 227  GLU D OE2 1 
ATOM   6963 N  N   . GLN D 1 228 ? 28.521  28.000 91.127  1.00 51.39  ? 228  GLN D N   1 
ATOM   6964 C  CA  . GLN D 1 228 ? 28.297  26.885 92.039  1.00 52.42  ? 228  GLN D CA  1 
ATOM   6965 C  C   . GLN D 1 228 ? 26.824  26.562 92.156  1.00 52.86  ? 228  GLN D C   1 
ATOM   6966 O  O   . GLN D 1 228 ? 26.219  26.825 93.201  1.00 53.45  ? 228  GLN D O   1 
ATOM   6967 C  CB  . GLN D 1 228 ? 28.891  27.284 93.429  1.00 53.82  ? 228  GLN D CB  1 
ATOM   6968 C  CG  . GLN D 1 228 ? 28.845  26.250 94.575  1.00 55.27  ? 228  GLN D CG  1 
ATOM   6969 C  CD  . GLN D 1 228 ? 29.721  25.012 94.346  1.00 61.83  ? 228  GLN D CD  1 
ATOM   6970 O  OE1 . GLN D 1 228 ? 29.662  24.340 93.286  1.00 65.26  ? 228  GLN D OE1 1 
ATOM   6971 N  NE2 . GLN D 1 228 ? 30.521  24.683 95.363  1.00 64.37  ? 228  GLN D NE2 1 
HETATM 6972 O  O2  . 3C4 E 2 .   ? 14.006  20.470 19.766  1.00 21.03  ? 501  3C4 A O2  1 
HETATM 6973 C  C   . 3C4 E 2 .   ? 14.365  20.886 20.872  1.00 19.73  ? 501  3C4 A C   1 
HETATM 6974 O  O1  . 3C4 E 2 .   ? 15.496  20.630 21.270  1.00 20.99  ? 501  3C4 A O1  1 
HETATM 6975 C  CG  . 3C4 E 2 .   ? 13.363  21.653 21.693  1.00 19.64  ? 501  3C4 A CG  1 
HETATM 6976 C  CA  . 3C4 E 2 .   ? 13.725  21.753 23.167  1.00 19.78  ? 501  3C4 A CA  1 
HETATM 6977 C  CD2 . 3C4 E 2 .   ? 14.532  22.774 23.542  1.00 19.73  ? 501  3C4 A CD2 1 
HETATM 6978 C  CE2 . 3C4 E 2 .   ? 14.917  22.944 24.738  1.00 18.64  ? 501  3C4 A CE2 1 
HETATM 6979 C  CZ  . 3C4 E 2 .   ? 14.474  22.108 25.846  1.00 21.92  ? 501  3C4 A CZ  1 
HETATM 6980 O  OH  . 3C4 E 2 .   ? 14.819  22.249 27.243  1.00 21.93  ? 501  3C4 A OH  1 
HETATM 6981 CL CL  . 3C4 E 2 .   ? 12.967  19.889 26.628  1.00 19.95  ? 501  3C4 A CL  1 
HETATM 6982 C  CE1 . 3C4 E 2 .   ? 13.578  20.984 25.380  1.00 18.33  ? 501  3C4 A CE1 1 
HETATM 6983 C  CD1 . 3C4 E 2 .   ? 13.221  20.861 24.071  1.00 17.70  ? 501  3C4 A CD1 1 
HETATM 6984 O  O2  . 3C4 F 2 .   ? 33.000  35.586 69.925  1.00 19.12  ? 502  3C4 C O2  1 
HETATM 6985 C  C   . 3C4 F 2 .   ? 33.313  35.014 68.900  1.00 19.60  ? 502  3C4 C C   1 
HETATM 6986 O  O1  . 3C4 F 2 .   ? 34.458  35.189 68.425  1.00 22.50  ? 502  3C4 C O1  1 
HETATM 6987 C  CG  . 3C4 F 2 .   ? 32.250  34.193 68.168  1.00 20.58  ? 502  3C4 C CG  1 
HETATM 6988 C  CA  . 3C4 F 2 .   ? 32.665  33.872 66.705  1.00 19.08  ? 502  3C4 C CA  1 
HETATM 6989 C  CD2 . 3C4 F 2 .   ? 33.464  32.814 66.472  1.00 19.14  ? 502  3C4 C CD2 1 
HETATM 6990 C  CE2 . 3C4 F 2 .   ? 33.872  32.477 65.285  1.00 19.67  ? 502  3C4 C CE2 1 
HETATM 6991 C  CZ  . 3C4 F 2 .   ? 33.430  33.210 64.050  1.00 20.01  ? 502  3C4 C CZ  1 
HETATM 6992 O  OH  . 3C4 F 2 .   ? 33.808  32.938 62.736  1.00 20.35  ? 502  3C4 C OH  1 
HETATM 6993 CL CL  . 3C4 F 2 .   ? 31.879  35.370 63.088  1.00 18.11  ? 502  3C4 C CL  1 
HETATM 6994 C  CE1 . 3C4 F 2 .   ? 32.492  34.335 64.374  1.00 21.11  ? 502  3C4 C CE1 1 
HETATM 6995 C  CD1 . 3C4 F 2 .   ? 32.160  34.613 65.687  1.00 16.62  ? 502  3C4 C CD1 1 
HETATM 6996 O  O2  . 3C4 G 2 .   ? -10.854 -2.702 23.628  1.00 48.76  ? 505  3C4 B O2  1 
HETATM 6997 C  C   . 3C4 G 2 .   ? -10.670 -3.528 24.553  1.00 48.04  ? 505  3C4 B C   1 
HETATM 6998 O  O1  . 3C4 G 2 .   ? -9.531  -3.965 24.809  1.00 47.64  ? 505  3C4 B O1  1 
HETATM 6999 C  CG  . 3C4 G 2 .   ? -11.834 -3.967 25.409  1.00 48.37  ? 505  3C4 B CG  1 
HETATM 7000 C  CA  . 3C4 G 2 .   ? -12.880 -2.891 25.433  1.00 48.84  ? 505  3C4 B CA  1 
HETATM 7001 C  CD2 . 3C4 G 2 .   ? -12.598 -1.673 25.926  1.00 48.26  ? 505  3C4 B CD2 1 
HETATM 7002 C  CE2 . 3C4 G 2 .   ? -13.401 -0.717 25.978  1.00 47.34  ? 505  3C4 B CE2 1 
HETATM 7003 C  CZ  . 3C4 G 2 .   ? -14.772 -0.830 25.511  1.00 49.30  ? 505  3C4 B CZ  1 
HETATM 7004 O  OH  . 3C4 G 2 .   ? -15.800 0.149  25.487  1.00 49.60  ? 505  3C4 B OH  1 
HETATM 7005 CL CL  . 3C4 G 2 .   ? -16.531 -2.437 24.240  1.00 54.09  ? 505  3C4 B CL  1 
HETATM 7006 C  CE1 . 3C4 G 2 .   ? -14.990 -2.180 24.954  1.00 48.07  ? 505  3C4 B CE1 1 
HETATM 7007 C  CD1 . 3C4 G 2 .   ? -14.068 -3.138 24.930  1.00 48.19  ? 505  3C4 B CD1 1 
HETATM 7008 O  O2  . 3C4 H 2 .   ? -1.663  20.777 30.130  1.00 20.43  ? 504  3C4 B O2  1 
HETATM 7009 C  C   . 3C4 H 2 .   ? -1.580  19.590 29.740  1.00 21.44  ? 504  3C4 B C   1 
HETATM 7010 O  O1  . 3C4 H 2 .   ? -2.164  18.647 30.332  1.00 22.98  ? 504  3C4 B O1  1 
HETATM 7011 C  CG  . 3C4 H 2 .   ? -0.783  19.371 28.474  1.00 21.49  ? 504  3C4 B CG  1 
HETATM 7012 C  CA  . 3C4 H 2 .   ? -0.506  17.945 28.099  1.00 19.70  ? 504  3C4 B CA  1 
HETATM 7013 C  CD2 . 3C4 H 2 .   ? -1.481  17.180 27.532  1.00 20.40  ? 504  3C4 B CD2 1 
HETATM 7014 C  CE2 . 3C4 H 2 .   ? -1.309  15.944 27.203  1.00 19.70  ? 504  3C4 B CE2 1 
HETATM 7015 C  CZ  . 3C4 H 2 .   ? -0.005  15.270 27.378  1.00 19.21  ? 504  3C4 B CZ  1 
HETATM 7016 O  OH  . 3C4 H 2 .   ? 0.289   13.961 26.978  1.00 20.83  ? 504  3C4 B OH  1 
HETATM 7017 CL CL  . 3C4 H 2 .   ? 2.568   15.567 28.341  1.00 17.98  ? 504  3C4 B CL  1 
HETATM 7018 C  CE1 . 3C4 H 2 .   ? 1.013   16.183 27.994  1.00 20.42  ? 504  3C4 B CE1 1 
HETATM 7019 C  CD1 . 3C4 H 2 .   ? 0.712   17.461 28.359  1.00 18.76  ? 504  3C4 B CD1 1 
HETATM 7020 O  O2  . 3C4 I 2 .   ? 17.216  33.869 60.020  1.00 22.00  ? 503  3C4 D O2  1 
HETATM 7021 C  C   . 3C4 I 2 .   ? 17.257  35.064 60.348  1.00 20.07  ? 503  3C4 D C   1 
HETATM 7022 O  O1  . 3C4 I 2 .   ? 16.724  35.909 59.667  1.00 22.31  ? 503  3C4 D O1  1 
HETATM 7023 C  CG  . 3C4 I 2 .   ? 18.089  35.465 61.534  1.00 19.78  ? 503  3C4 D CG  1 
HETATM 7024 C  CA  . 3C4 I 2 .   ? 18.386  36.962 61.666  1.00 17.87  ? 503  3C4 D CA  1 
HETATM 7025 C  CD2 . 3C4 I 2 .   ? 17.436  37.750 62.194  1.00 19.39  ? 503  3C4 D CD2 1 
HETATM 7026 C  CE2 . 3C4 I 2 .   ? 17.571  38.996 62.354  1.00 20.49  ? 503  3C4 D CE2 1 
HETATM 7027 C  CZ  . 3C4 I 2 .   ? 18.822  39.688 62.070  1.00 17.86  ? 503  3C4 D CZ  1 
HETATM 7028 O  OH  . 3C4 I 2 .   ? 19.078  41.037 62.295  1.00 17.40  ? 503  3C4 D OH  1 
HETATM 7029 CL CL  . 3C4 I 2 .   ? 21.423  39.344 61.100  1.00 18.02  ? 503  3C4 D CL  1 
HETATM 7030 C  CE1 . 3C4 I 2 .   ? 19.860  38.744 61.510  1.00 17.48  ? 503  3C4 D CE1 1 
HETATM 7031 C  CD1 . 3C4 I 2 .   ? 19.575  37.429 61.352  1.00 18.19  ? 503  3C4 D CD1 1 
HETATM 7032 O  O   . HOH J 3 .   ? 13.153  19.074 30.333  1.00 19.75  ? 1009 HOH A O   1 
HETATM 7033 O  O   . HOH J 3 .   ? 11.553  35.510 18.999  1.00 24.52  ? 1013 HOH A O   1 
HETATM 7034 O  O   . HOH J 3 .   ? 18.817  17.207 21.235  1.00 20.85  ? 1022 HOH A O   1 
HETATM 7035 O  O   . HOH J 3 .   ? 14.265  25.541 30.704  1.00 26.47  ? 1037 HOH A O   1 
HETATM 7036 O  O   . HOH J 3 .   ? 14.015  24.707 33.347  1.00 26.22  ? 1039 HOH A O   1 
HETATM 7037 O  O   . HOH J 3 .   ? 14.803  23.936 13.339  1.00 24.22  ? 1044 HOH A O   1 
HETATM 7038 O  O   . HOH J 3 .   ? 21.425  22.587 17.824  1.00 26.59  ? 1048 HOH A O   1 
HETATM 7039 O  O   . HOH J 3 .   ? 25.316  8.293  27.560  1.00 25.44  ? 1049 HOH A O   1 
HETATM 7040 O  O   . HOH J 3 .   ? 21.362  10.361 24.936  1.00 31.50  ? 1053 HOH A O   1 
HETATM 7041 O  O   . HOH J 3 .   ? 14.053  3.359  40.487  1.00 32.04  ? 1057 HOH A O   1 
HETATM 7042 O  O   . HOH J 3 .   ? 17.209  5.050  43.549  1.00 26.67  ? 1075 HOH A O   1 
HETATM 7043 O  O   . HOH J 3 .   ? 10.646  14.285 43.151  1.00 29.76  ? 1080 HOH A O   1 
HETATM 7044 O  O   . HOH J 3 .   ? 23.600  10.811 26.367  1.00 23.33  ? 1081 HOH A O   1 
HETATM 7045 O  O   . HOH J 3 .   ? 12.573  20.645 41.670  1.00 25.91  ? 1084 HOH A O   1 
HETATM 7046 O  O   . HOH J 3 .   ? 3.105   25.327 31.696  1.00 29.34  ? 1090 HOH A O   1 
HETATM 7047 O  O   . HOH J 3 .   ? 14.873  3.587  43.877  1.00 27.10  ? 1097 HOH A O   1 
HETATM 7048 O  O   . HOH J 3 .   ? 19.317  20.839 18.493  1.00 25.43  ? 1101 HOH A O   1 
HETATM 7049 O  O   . HOH J 3 .   ? 17.993  5.000  25.249  1.00 26.32  ? 1106 HOH A O   1 
HETATM 7050 O  O   . HOH J 3 .   ? 20.530  18.363 19.082  1.00 26.46  ? 1109 HOH A O   1 
HETATM 7051 O  O   . HOH J 3 .   ? 22.138  26.444 40.909  1.00 41.25  ? 1114 HOH A O   1 
HETATM 7052 O  O   . HOH J 3 .   ? 27.583  14.008 31.382  1.00 27.96  ? 1119 HOH A O   1 
HETATM 7053 O  O   . HOH J 3 .   ? 13.496  28.069 31.471  1.00 29.72  ? 1121 HOH A O   1 
HETATM 7054 O  O   . HOH J 3 .   ? 0.864   29.068 26.965  1.00 29.31  ? 1138 HOH A O   1 
HETATM 7055 O  O   . HOH J 3 .   ? 14.169  27.340 36.039  1.00 40.48  ? 1145 HOH A O   1 
HETATM 7056 O  O   . HOH J 3 .   ? 17.663  18.069 18.099  1.00 32.43  ? 1146 HOH A O   1 
HETATM 7057 O  O   . HOH J 3 .   ? 25.572  16.712 24.121  1.00 23.54  ? 1151 HOH A O   1 
HETATM 7058 O  O   . HOH J 3 .   ? 10.199  29.732 38.010  1.00 38.08  ? 1162 HOH A O   1 
HETATM 7059 O  O   . HOH J 3 .   ? 6.294   32.049 23.979  1.00 41.86  ? 1163 HOH A O   1 
HETATM 7060 O  O   . HOH J 3 .   ? 21.747  6.597  47.160  1.00 32.31  ? 1169 HOH A O   1 
HETATM 7061 O  O   . HOH J 3 .   ? 20.940  14.363 47.791  1.00 37.19  ? 1178 HOH A O   1 
HETATM 7062 O  O   . HOH J 3 .   ? 10.488  24.114 40.883  1.00 25.42  ? 1187 HOH A O   1 
HETATM 7063 O  O   . HOH J 3 .   ? 7.509   27.007 35.665  1.00 38.50  ? 1201 HOH A O   1 
HETATM 7064 O  O   . HOH J 3 .   ? 16.102  4.224  39.466  1.00 29.01  ? 1202 HOH A O   1 
HETATM 7065 O  O   . HOH J 3 .   ? 32.912  18.247 35.760  1.00 30.91  ? 1203 HOH A O   1 
HETATM 7066 O  O   . HOH J 3 .   ? 25.502  29.251 42.129  1.00 52.18  ? 1213 HOH A O   1 
HETATM 7067 O  O   . HOH J 3 .   ? 13.733  24.042 42.499  1.00 26.94  ? 1216 HOH A O   1 
HETATM 7068 O  O   . HOH J 3 .   ? 34.356  24.844 31.070  1.00 43.72  ? 1220 HOH A O   1 
HETATM 7069 O  O   . HOH J 3 .   ? 5.152   25.636 37.165  1.00 51.71  ? 1241 HOH A O   1 
HETATM 7070 O  O   . HOH J 3 .   ? 5.357   32.203 34.516  1.00 37.00  ? 1242 HOH A O   1 
HETATM 7071 O  O   . HOH J 3 .   ? 31.250  17.454 37.868  1.00 40.11  ? 1244 HOH A O   1 
HETATM 7072 O  O   . HOH J 3 .   ? 28.284  11.324 44.752  1.00 42.98  ? 1249 HOH A O   1 
HETATM 7073 O  O   . HOH J 3 .   ? 26.695  35.073 36.221  1.00 31.44  ? 1255 HOH A O   1 
HETATM 7074 O  O   . HOH J 3 .   ? 25.927  3.547  38.369  1.00 38.64  ? 1256 HOH A O   1 
HETATM 7075 O  O   . HOH J 3 .   ? 14.925  13.943 46.733  1.00 40.27  ? 1257 HOH A O   1 
HETATM 7076 O  O   . HOH J 3 .   ? -9.466  37.006 18.989  1.00 38.06  ? 1258 HOH A O   1 
HETATM 7077 O  O   . HOH J 3 .   ? 16.560  34.526 7.294   1.00 29.80  ? 1260 HOH A O   1 
HETATM 7078 O  O   . HOH J 3 .   ? 12.436  45.604 37.655  1.00 51.86  ? 1261 HOH A O   1 
HETATM 7079 O  O   . HOH J 3 .   ? 4.264   23.197 44.317  1.00 45.57  ? 1262 HOH A O   1 
HETATM 7080 O  O   . HOH J 3 .   ? 1.270   31.145 25.033  1.00 52.67  ? 1263 HOH A O   1 
HETATM 7081 O  O   . HOH J 3 .   ? 25.248  40.749 31.481  1.00 55.79  ? 1268 HOH A O   1 
HETATM 7082 O  O   . HOH J 3 .   ? -1.156  34.422 28.061  1.00 38.39  ? 1277 HOH A O   1 
HETATM 7083 O  O   . HOH J 3 .   ? 25.301  4.643  34.457  1.00 32.23  ? 1279 HOH A O   1 
HETATM 7084 O  O   . HOH J 3 .   ? 12.530  36.659 14.279  1.00 43.51  ? 1280 HOH A O   1 
HETATM 7085 O  O   . HOH J 3 .   ? -1.579  53.501 21.252  1.00 67.99  ? 1281 HOH A O   1 
HETATM 7086 O  O   . HOH J 3 .   ? 21.298  15.064 19.080  1.00 33.65  ? 1282 HOH A O   1 
HETATM 7087 O  O   . HOH J 3 .   ? 9.495   50.758 37.606  1.00 53.76  ? 1283 HOH A O   1 
HETATM 7088 O  O   . HOH J 3 .   ? 28.094  23.703 23.290  1.00 32.27  ? 1286 HOH A O   1 
HETATM 7089 O  O   . HOH J 3 .   ? 25.724  14.630 20.843  1.00 29.07  ? 1288 HOH A O   1 
HETATM 7090 O  O   . HOH J 3 .   ? 20.784  16.554 16.448  1.00 43.20  ? 1296 HOH A O   1 
HETATM 7091 O  O   . HOH J 3 .   ? 14.534  20.418 43.330  1.00 23.68  ? 1298 HOH A O   1 
HETATM 7092 O  O   . HOH J 3 .   ? 35.058  28.828 29.741  1.00 46.16  ? 1302 HOH A O   1 
HETATM 7093 O  O   . HOH J 3 .   ? 27.847  10.154 36.548  1.00 39.97  ? 1303 HOH A O   1 
HETATM 7094 O  O   . HOH J 3 .   ? 14.574  37.763 30.165  1.00 45.79  ? 1312 HOH A O   1 
HETATM 7095 O  O   . HOH J 3 .   ? -6.961  34.104 30.536  1.00 49.70  ? 1325 HOH A O   1 
HETATM 7096 O  O   . HOH J 3 .   ? 6.069   52.287 40.803  1.00 60.31  ? 1331 HOH A O   1 
HETATM 7097 O  O   . HOH J 3 .   ? 20.911  3.356  26.062  1.00 39.19  ? 1333 HOH A O   1 
HETATM 7098 O  O   . HOH J 3 .   ? -5.970  39.010 41.105  1.00 59.76  ? 1335 HOH A O   1 
HETATM 7099 O  O   . HOH J 3 .   ? 6.422   46.315 13.977  1.00 52.30  ? 1336 HOH A O   1 
HETATM 7100 O  O   . HOH J 3 .   ? 7.339   49.825 17.521  1.00 68.02  ? 1345 HOH A O   1 
HETATM 7101 O  O   . HOH J 3 .   ? 23.078  26.227 11.528  1.00 39.41  ? 1350 HOH A O   1 
HETATM 7102 O  O   . HOH J 3 .   ? 8.646   35.191 18.843  1.00 41.35  ? 1355 HOH A O   1 
HETATM 7103 O  O   . HOH J 3 .   ? 8.305   42.888 19.362  1.00 54.39  ? 1357 HOH A O   1 
HETATM 7104 O  O   . HOH J 3 .   ? -5.688  42.288 16.635  1.00 49.69  ? 1362 HOH A O   1 
HETATM 7105 O  O   . HOH J 3 .   ? 18.185  16.295 15.323  1.00 38.57  ? 1364 HOH A O   1 
HETATM 7106 O  O   . HOH J 3 .   ? 9.014   19.746 43.211  1.00 32.13  ? 1370 HOH A O   1 
HETATM 7107 O  O   . HOH J 3 .   ? 3.512   33.218 20.255  1.00 34.16  ? 1373 HOH A O   1 
HETATM 7108 O  O   . HOH J 3 .   ? 11.390  46.949 24.194  1.00 64.19  ? 1374 HOH A O   1 
HETATM 7109 O  O   . HOH J 3 .   ? 7.757   36.630 16.746  1.00 40.40  ? 1377 HOH A O   1 
HETATM 7110 O  O   . HOH J 3 .   ? -1.940  55.207 33.139  1.00 59.08  ? 1379 HOH A O   1 
HETATM 7111 O  O   . HOH J 3 .   ? 19.865  20.877 47.532  1.00 46.37  ? 1381 HOH A O   1 
HETATM 7112 O  O   . HOH J 3 .   ? -10.935 32.115 27.333  1.00 38.40  ? 1382 HOH A O   1 
HETATM 7113 O  O   . HOH J 3 .   ? 13.023  15.910 45.559  1.00 30.38  ? 1399 HOH A O   1 
HETATM 7114 O  O   . HOH J 3 .   ? 20.005  32.301 21.477  1.00 35.88  ? 1403 HOH A O   1 
HETATM 7115 O  O   . HOH J 3 .   ? 7.512   45.580 33.020  1.00 82.53  ? 1411 HOH A O   1 
HETATM 7116 O  O   . HOH J 3 .   ? 27.652  15.245 28.685  1.00 36.03  ? 1412 HOH A O   1 
HETATM 7117 O  O   . HOH J 3 .   ? 22.923  4.976  29.146  1.00 30.10  ? 1416 HOH A O   1 
HETATM 7118 O  O   . HOH J 3 .   ? 31.989  36.749 30.476  1.00 41.49  ? 1417 HOH A O   1 
HETATM 7119 O  O   . HOH J 3 .   ? 19.360  26.469 9.623   1.00 31.22  ? 1421 HOH A O   1 
HETATM 7120 O  O   . HOH J 3 .   ? 13.065  18.483 44.855  1.00 32.84  ? 1423 HOH A O   1 
HETATM 7121 O  O   . HOH J 3 .   ? 22.473  13.304 18.109  1.00 40.42  ? 1437 HOH A O   1 
HETATM 7122 O  O   . HOH J 3 .   ? 11.950  33.380 7.197   1.00 39.34  ? 1443 HOH A O   1 
HETATM 7123 O  O   . HOH J 3 .   ? 1.804   24.247 44.211  1.00 52.82  ? 1445 HOH A O   1 
HETATM 7124 O  O   . HOH J 3 .   ? 25.536  4.309  29.756  1.00 46.14  ? 1453 HOH A O   1 
HETATM 7125 O  O   . HOH J 3 .   ? 27.344  18.405 16.586  1.00 40.16  ? 1455 HOH A O   1 
HETATM 7126 O  O   . HOH J 3 .   ? 22.111  18.284 14.758  1.00 65.12  ? 1457 HOH A O   1 
HETATM 7127 O  O   . HOH J 3 .   ? 1.045   40.665 14.795  1.00 56.84  ? 1458 HOH A O   1 
HETATM 7128 O  O   . HOH J 3 .   ? -6.353  33.458 15.788  1.00 40.45  ? 1468 HOH A O   1 
HETATM 7129 O  O   . HOH J 3 .   ? 1.288   20.834 43.733  1.00 51.37  ? 1477 HOH A O   1 
HETATM 7130 O  O   . HOH J 3 .   ? 12.294  37.483 30.385  1.00 52.75  ? 1493 HOH A O   1 
HETATM 7131 O  O   . HOH J 3 .   ? -11.147 40.675 33.668  1.00 57.92  ? 1506 HOH A O   1 
HETATM 7132 O  O   . HOH J 3 .   ? 33.082  30.585 26.541  1.00 45.06  ? 1508 HOH A O   1 
HETATM 7133 O  O   . HOH J 3 .   ? -10.029 49.843 45.454  1.00 44.29  ? 1512 HOH A O   1 
HETATM 7134 O  O   . HOH J 3 .   ? 14.031  26.668 42.930  1.00 37.38  ? 1523 HOH A O   1 
HETATM 7135 O  O   . HOH J 3 .   ? 7.158   44.271 21.104  1.00 58.36  ? 1524 HOH A O   1 
HETATM 7136 O  O   . HOH J 3 .   ? -1.289  35.351 25.916  1.00 40.13  ? 1525 HOH A O   1 
HETATM 7137 O  O   . HOH J 3 .   ? 18.659  2.537  43.412  1.00 43.22  ? 1528 HOH A O   1 
HETATM 7138 O  O   . HOH J 3 .   ? 2.287   33.007 26.613  1.00 44.88  ? 1538 HOH A O   1 
HETATM 7139 O  O   . HOH J 3 .   ? 16.533  35.915 9.300   1.00 37.14  ? 1549 HOH A O   1 
HETATM 7140 O  O   . HOH J 3 .   ? 15.101  35.703 12.131  1.00 34.69  ? 1550 HOH A O   1 
HETATM 7141 O  O   . HOH J 3 .   ? 8.991   22.727 42.761  1.00 43.36  ? 1551 HOH A O   1 
HETATM 7142 O  O   . HOH J 3 .   ? 1.044   34.651 24.702  1.00 52.58  ? 1558 HOH A O   1 
HETATM 7143 O  O   . HOH J 3 .   ? 26.496  33.438 39.975  1.00 38.61  ? 1561 HOH A O   1 
HETATM 7144 O  O   . HOH J 3 .   ? 21.109  20.617 15.402  1.00 43.32  ? 1563 HOH A O   1 
HETATM 7145 O  O   . HOH J 3 .   ? 18.592  1.104  41.072  1.00 36.48  ? 1564 HOH A O   1 
HETATM 7146 O  O   . HOH J 3 .   ? 26.854  39.655 33.184  1.00 47.82  ? 1568 HOH A O   1 
HETATM 7147 O  O   . HOH J 3 .   ? 8.057   26.057 39.353  1.00 33.06  ? 1573 HOH A O   1 
HETATM 7148 O  O   . HOH J 3 .   ? 15.554  0.548  41.614  1.00 28.40  ? 1578 HOH A O   1 
HETATM 7149 O  O   . HOH J 3 .   ? 0.576   33.993 22.276  1.00 59.37  ? 1580 HOH A O   1 
HETATM 7150 O  O   . HOH J 3 .   ? 20.240  21.352 13.182  1.00 38.46  ? 1581 HOH A O   1 
HETATM 7151 O  O   . HOH J 3 .   ? 6.258   33.228 20.611  1.00 37.96  ? 1591 HOH A O   1 
HETATM 7152 O  O   . HOH J 3 .   ? 28.420  29.140 17.945  1.00 44.28  ? 1597 HOH A O   1 
HETATM 7153 O  O   . HOH K 3 .   ? 31.998  35.711 59.281  1.00 18.67  ? 1011 HOH C O   1 
HETATM 7154 O  O   . HOH K 3 .   ? 37.771  38.623 68.014  1.00 19.34  ? 1016 HOH C O   1 
HETATM 7155 O  O   . HOH K 3 .   ? 32.843  29.754 57.076  1.00 22.22  ? 1019 HOH C O   1 
HETATM 7156 O  O   . HOH K 3 .   ? 46.434  40.847 57.479  1.00 29.43  ? 1023 HOH C O   1 
HETATM 7157 O  O   . HOH K 3 .   ? 34.209  32.810 76.834  1.00 20.06  ? 1029 HOH C O   1 
HETATM 7158 O  O   . HOH K 3 .   ? 26.547  27.166 54.950  1.00 34.17  ? 1035 HOH C O   1 
HETATM 7159 O  O   . HOH K 3 .   ? 30.673  20.677 72.501  1.00 24.83  ? 1042 HOH C O   1 
HETATM 7160 O  O   . HOH K 3 .   ? 32.979  29.283 59.611  1.00 25.04  ? 1045 HOH C O   1 
HETATM 7161 O  O   . HOH K 3 .   ? 22.982  12.447 51.374  1.00 26.63  ? 1059 HOH C O   1 
HETATM 7162 O  O   . HOH K 3 .   ? 19.696  4.186  64.634  1.00 40.30  ? 1062 HOH C O   1 
HETATM 7163 O  O   . HOH K 3 .   ? 18.179  -0.676 68.675  1.00 38.75  ? 1063 HOH C O   1 
HETATM 7164 O  O   . HOH K 3 .   ? 43.943  46.820 60.489  1.00 28.88  ? 1064 HOH C O   1 
HETATM 7165 O  O   . HOH K 3 .   ? 38.390  35.508 71.211  1.00 24.83  ? 1068 HOH C O   1 
HETATM 7166 O  O   . HOH K 3 .   ? 31.189  32.719 48.228  1.00 25.25  ? 1071 HOH C O   1 
HETATM 7167 O  O   . HOH K 3 .   ? 32.636  26.760 59.139  1.00 30.40  ? 1077 HOH C O   1 
HETATM 7168 O  O   . HOH K 3 .   ? 19.724  24.937 61.927  1.00 41.88  ? 1078 HOH C O   1 
HETATM 7169 O  O   . HOH K 3 .   ? 7.339   14.268 61.622  1.00 43.24  ? 1079 HOH C O   1 
HETATM 7170 O  O   . HOH K 3 .   ? 42.331  44.626 62.122  1.00 24.00  ? 1082 HOH C O   1 
HETATM 7171 O  O   . HOH K 3 .   ? 32.461  29.674 47.565  1.00 27.07  ? 1092 HOH C O   1 
HETATM 7172 O  O   . HOH K 3 .   ? 9.669   18.966 72.775  1.00 36.14  ? 1099 HOH C O   1 
HETATM 7173 O  O   . HOH K 3 .   ? 34.825  46.057 42.844  1.00 31.85  ? 1104 HOH C O   1 
HETATM 7174 O  O   . HOH K 3 .   ? 17.544  2.249  51.899  1.00 39.57  ? 1108 HOH C O   1 
HETATM 7175 O  O   . HOH K 3 .   ? 44.611  39.083 64.924  1.00 27.82  ? 1113 HOH C O   1 
HETATM 7176 O  O   . HOH K 3 .   ? 40.377  33.863 72.132  1.00 31.56  ? 1123 HOH C O   1 
HETATM 7177 O  O   . HOH K 3 .   ? 22.009  29.509 58.886  1.00 31.56  ? 1127 HOH C O   1 
HETATM 7178 O  O   . HOH K 3 .   ? 26.932  11.640 72.090  1.00 40.65  ? 1133 HOH C O   1 
HETATM 7179 O  O   . HOH K 3 .   ? 32.799  50.047 46.573  1.00 34.20  ? 1137 HOH C O   1 
HETATM 7180 O  O   . HOH K 3 .   ? 6.609   11.983 64.735  1.00 40.00  ? 1143 HOH C O   1 
HETATM 7181 O  O   . HOH K 3 .   ? 29.516  6.803  66.181  1.00 39.90  ? 1147 HOH C O   1 
HETATM 7182 O  O   . HOH K 3 .   ? 29.155  29.466 49.651  1.00 26.14  ? 1148 HOH C O   1 
HETATM 7183 O  O   . HOH K 3 .   ? 37.632  25.298 46.325  1.00 38.87  ? 1152 HOH C O   1 
HETATM 7184 O  O   . HOH K 3 .   ? 39.570  37.816 70.400  1.00 25.78  ? 1154 HOH C O   1 
HETATM 7185 O  O   . HOH K 3 .   ? 33.183  32.934 46.326  1.00 38.96  ? 1155 HOH C O   1 
HETATM 7186 O  O   . HOH K 3 .   ? 12.098  0.081  49.753  1.00 31.48  ? 1158 HOH C O   1 
HETATM 7187 O  O   . HOH K 3 .   ? 24.127  22.524 56.498  1.00 35.77  ? 1159 HOH C O   1 
HETATM 7188 O  O   . HOH K 3 .   ? 44.386  50.699 48.992  1.00 44.26  ? 1161 HOH C O   1 
HETATM 7189 O  O   . HOH K 3 .   ? 8.765   7.336  53.943  1.00 35.30  ? 1171 HOH C O   1 
HETATM 7190 O  O   . HOH K 3 .   ? 14.209  14.304 76.029  1.00 46.29  ? 1172 HOH C O   1 
HETATM 7191 O  O   . HOH K 3 .   ? 34.244  38.869 42.511  1.00 39.24  ? 1174 HOH C O   1 
HETATM 7192 O  O   . HOH K 3 .   ? 20.747  16.088 77.448  1.00 42.91  ? 1179 HOH C O   1 
HETATM 7193 O  O   . HOH K 3 .   ? 31.792  34.386 77.052  1.00 42.28  ? 1181 HOH C O   1 
HETATM 7194 O  O   . HOH K 3 .   ? 37.127  31.927 41.896  1.00 39.94  ? 1189 HOH C O   1 
HETATM 7195 O  O   . HOH K 3 .   ? 34.437  20.957 78.801  1.00 31.78  ? 1195 HOH C O   1 
HETATM 7196 O  O   . HOH K 3 .   ? 40.010  45.083 63.631  1.00 29.19  ? 1199 HOH C O   1 
HETATM 7197 O  O   . HOH K 3 .   ? 42.273  32.383 78.852  1.00 36.78  ? 1204 HOH C O   1 
HETATM 7198 O  O   . HOH K 3 .   ? 29.208  39.087 46.235  1.00 26.87  ? 1209 HOH C O   1 
HETATM 7199 O  O   . HOH K 3 .   ? 25.436  23.770 67.381  1.00 36.45  ? 1211 HOH C O   1 
HETATM 7200 O  O   . HOH K 3 .   ? 41.497  14.860 63.533  1.00 41.28  ? 1214 HOH C O   1 
HETATM 7201 O  O   . HOH K 3 .   ? 22.499  3.735  70.090  1.00 36.93  ? 1225 HOH C O   1 
HETATM 7202 O  O   . HOH K 3 .   ? 34.236  25.132 54.012  1.00 45.27  ? 1226 HOH C O   1 
HETATM 7203 O  O   . HOH K 3 .   ? 41.610  43.089 70.932  1.00 45.10  ? 1227 HOH C O   1 
HETATM 7204 O  O   . HOH K 3 .   ? 22.398  18.802 50.494  1.00 58.72  ? 1230 HOH C O   1 
HETATM 7205 O  O   . HOH K 3 .   ? 6.979   11.632 53.981  1.00 41.41  ? 1235 HOH C O   1 
HETATM 7206 O  O   . HOH K 3 .   ? 45.478  19.364 55.098  1.00 48.18  ? 1236 HOH C O   1 
HETATM 7207 O  O   . HOH K 3 .   ? 28.756  24.479 53.108  1.00 36.68  ? 1238 HOH C O   1 
HETATM 7208 O  O   . HOH K 3 .   ? 36.733  50.171 62.758  1.00 28.19  ? 1239 HOH C O   1 
HETATM 7209 O  O   . HOH K 3 .   ? 16.512  -3.153 66.673  1.00 45.80  ? 1243 HOH C O   1 
HETATM 7210 O  O   . HOH K 3 .   ? 19.953  26.085 64.183  1.00 28.90  ? 1247 HOH C O   1 
HETATM 7211 O  O   . HOH K 3 .   ? 46.015  38.338 73.085  1.00 41.03  ? 1250 HOH C O   1 
HETATM 7212 O  O   . HOH K 3 .   ? 51.844  36.160 53.792  1.00 38.00  ? 1253 HOH C O   1 
HETATM 7213 O  O   . HOH K 3 .   ? 19.731  28.134 59.748  1.00 39.52  ? 1259 HOH C O   1 
HETATM 7214 O  O   . HOH K 3 .   ? 41.611  49.931 58.545  1.00 37.39  ? 1266 HOH C O   1 
HETATM 7215 O  O   . HOH K 3 .   ? 16.576  2.515  73.237  1.00 42.64  ? 1267 HOH C O   1 
HETATM 7216 O  O   . HOH K 3 .   ? 10.505  -0.089 58.139  1.00 50.48  ? 1269 HOH C O   1 
HETATM 7217 O  O   . HOH K 3 .   ? 53.128  29.822 58.579  1.00 35.66  ? 1272 HOH C O   1 
HETATM 7218 O  O   . HOH K 3 .   ? 22.238  4.655  76.038  1.00 53.06  ? 1275 HOH C O   1 
HETATM 7219 O  O   . HOH K 3 .   ? 9.805   18.803 65.026  1.00 43.76  ? 1278 HOH C O   1 
HETATM 7220 O  O   . HOH K 3 .   ? 26.296  8.607  59.770  1.00 48.60  ? 1285 HOH C O   1 
HETATM 7221 O  O   . HOH K 3 .   ? 37.648  41.728 40.356  1.00 51.78  ? 1292 HOH C O   1 
HETATM 7222 O  O   . HOH K 3 .   ? 37.214  31.662 79.511  1.00 34.44  ? 1307 HOH C O   1 
HETATM 7223 O  O   . HOH K 3 .   ? 8.408   13.394 66.236  1.00 41.79  ? 1316 HOH C O   1 
HETATM 7224 O  O   . HOH K 3 .   ? 27.134  13.556 73.230  1.00 46.69  ? 1330 HOH C O   1 
HETATM 7225 O  O   . HOH K 3 .   ? 16.685  10.812 79.024  1.00 55.68  ? 1332 HOH C O   1 
HETATM 7226 O  O   . HOH K 3 .   ? 50.833  18.182 60.794  1.00 50.09  ? 1338 HOH C O   1 
HETATM 7227 O  O   . HOH K 3 .   ? 25.526  10.629 79.364  1.00 42.84  ? 1343 HOH C O   1 
HETATM 7228 O  O   . HOH K 3 .   ? 35.314  48.714 45.274  1.00 31.81  ? 1352 HOH C O   1 
HETATM 7229 O  O   . HOH K 3 .   ? 36.330  51.595 60.510  1.00 39.82  ? 1360 HOH C O   1 
HETATM 7230 O  O   . HOH K 3 .   ? 30.585  8.974  68.555  1.00 48.73  ? 1365 HOH C O   1 
HETATM 7231 O  O   . HOH K 3 .   ? 17.140  22.541 76.047  1.00 46.08  ? 1380 HOH C O   1 
HETATM 7232 O  O   . HOH K 3 .   ? 24.567  4.730  65.844  1.00 59.33  ? 1388 HOH C O   1 
HETATM 7233 O  O   . HOH K 3 .   ? 22.364  22.788 71.304  1.00 43.78  ? 1390 HOH C O   1 
HETATM 7234 O  O   . HOH K 3 .   ? 15.485  0.439  61.333  1.00 54.88  ? 1393 HOH C O   1 
HETATM 7235 O  O   . HOH K 3 .   ? 8.879   15.913 65.859  1.00 41.21  ? 1396 HOH C O   1 
HETATM 7236 O  O   . HOH K 3 .   ? 39.794  40.225 72.679  1.00 35.22  ? 1398 HOH C O   1 
HETATM 7237 O  O   . HOH K 3 .   ? 7.598   14.969 59.215  1.00 44.04  ? 1405 HOH C O   1 
HETATM 7238 O  O   . HOH K 3 .   ? 17.922  19.900 65.933  1.00 34.53  ? 1409 HOH C O   1 
HETATM 7239 O  O   . HOH K 3 .   ? 47.271  32.363 66.674  1.00 33.87  ? 1418 HOH C O   1 
HETATM 7240 O  O   . HOH K 3 .   ? 9.375   7.670  51.754  1.00 38.38  ? 1426 HOH C O   1 
HETATM 7241 O  O   . HOH K 3 .   ? 38.597  16.609 56.060  1.00 54.92  ? 1427 HOH C O   1 
HETATM 7242 O  O   . HOH K 3 .   ? 49.100  34.232 49.047  1.00 39.62  ? 1430 HOH C O   1 
HETATM 7243 O  O   . HOH K 3 .   ? 44.226  43.249 69.909  1.00 36.44  ? 1431 HOH C O   1 
HETATM 7244 O  O   . HOH K 3 .   ? 6.143   4.080  46.850  1.00 41.62  ? 1434 HOH C O   1 
HETATM 7245 O  O   . HOH K 3 .   ? 36.504  22.160 83.320  1.00 38.94  ? 1435 HOH C O   1 
HETATM 7246 O  O   . HOH K 3 .   ? 6.798   10.069 47.473  1.00 34.17  ? 1436 HOH C O   1 
HETATM 7247 O  O   . HOH K 3 .   ? 40.198  40.982 69.954  1.00 33.18  ? 1438 HOH C O   1 
HETATM 7248 O  O   . HOH K 3 .   ? 27.872  33.316 46.657  1.00 31.77  ? 1439 HOH C O   1 
HETATM 7249 O  O   . HOH K 3 .   ? 22.992  29.508 45.667  1.00 46.15  ? 1440 HOH C O   1 
HETATM 7250 O  O   . HOH K 3 .   ? 28.218  3.336  56.918  1.00 61.19  ? 1444 HOH C O   1 
HETATM 7251 O  O   . HOH K 3 .   ? 16.079  20.767 55.615  1.00 35.75  ? 1446 HOH C O   1 
HETATM 7252 O  O   . HOH K 3 .   ? 39.240  21.305 70.531  1.00 46.55  ? 1451 HOH C O   1 
HETATM 7253 O  O   . HOH K 3 .   ? 7.103   14.548 64.557  1.00 49.66  ? 1466 HOH C O   1 
HETATM 7254 O  O   . HOH K 3 .   ? 4.885   12.619 55.605  1.00 42.92  ? 1469 HOH C O   1 
HETATM 7255 O  O   . HOH K 3 .   ? 46.581  40.002 60.320  1.00 49.97  ? 1470 HOH C O   1 
HETATM 7256 O  O   . HOH K 3 .   ? 32.672  29.857 83.944  1.00 31.77  ? 1471 HOH C O   1 
HETATM 7257 O  O   . HOH K 3 .   ? 21.215  12.712 80.020  1.00 64.15  ? 1473 HOH C O   1 
HETATM 7258 O  O   . HOH K 3 .   ? 27.024  24.634 56.998  1.00 42.67  ? 1476 HOH C O   1 
HETATM 7259 O  O   . HOH K 3 .   ? 10.454  -0.071 68.594  1.00 92.95  ? 1480 HOH C O   1 
HETATM 7260 O  O   . HOH K 3 .   ? 9.124   28.049 69.674  1.00 43.78  ? 1484 HOH C O   1 
HETATM 7261 O  O   . HOH K 3 .   ? 19.881  21.012 67.652  1.00 53.19  ? 1485 HOH C O   1 
HETATM 7262 O  O   . HOH K 3 .   ? 45.977  19.563 70.257  1.00 43.58  ? 1491 HOH C O   1 
HETATM 7263 O  O   . HOH K 3 .   ? 20.520  21.866 62.934  1.00 41.54  ? 1498 HOH C O   1 
HETATM 7264 O  O   . HOH K 3 .   ? 7.202   14.612 73.261  1.00 49.78  ? 1504 HOH C O   1 
HETATM 7265 O  O   . HOH K 3 .   ? 36.153  16.239 66.371  1.00 41.71  ? 1509 HOH C O   1 
HETATM 7266 O  O   . HOH K 3 .   ? 38.995  23.765 69.402  1.00 40.45  ? 1515 HOH C O   1 
HETATM 7267 O  O   . HOH K 3 .   ? 13.002  -0.818 52.694  1.00 50.59  ? 1529 HOH C O   1 
HETATM 7268 O  O   . HOH K 3 .   ? 30.805  13.168 63.342  1.00 42.68  ? 1534 HOH C O   1 
HETATM 7269 O  O   . HOH K 3 .   ? 32.197  30.629 86.816  1.00 38.74  ? 1535 HOH C O   1 
HETATM 7270 O  O   . HOH K 3 .   ? 21.247  27.777 46.720  1.00 55.38  ? 1543 HOH C O   1 
HETATM 7271 O  O   . HOH K 3 .   ? 45.412  34.305 44.720  1.00 40.45  ? 1546 HOH C O   1 
HETATM 7272 O  O   . HOH K 3 .   ? 21.610  2.633  67.360  1.00 57.53  ? 1553 HOH C O   1 
HETATM 7273 O  O   . HOH K 3 .   ? 44.078  17.374 66.100  1.00 48.05  ? 1555 HOH C O   1 
HETATM 7274 O  O   . HOH K 3 .   ? 44.396  44.831 66.527  1.00 48.24  ? 1565 HOH C O   1 
HETATM 7275 O  O   . HOH K 3 .   ? 18.759  27.470 47.114  1.00 43.12  ? 1576 HOH C O   1 
HETATM 7276 O  O   . HOH K 3 .   ? 33.785  19.740 71.271  1.00 33.98  ? 1577 HOH C O   1 
HETATM 7277 O  O   . HOH K 3 .   ? 21.266  25.777 49.239  1.00 35.84  ? 1582 HOH C O   1 
HETATM 7278 O  O   . HOH K 3 .   ? 34.988  49.050 48.770  1.00 39.29  ? 1589 HOH C O   1 
HETATM 7279 O  O   . HOH K 3 .   ? 11.076  6.527  53.597  1.00 50.15  ? 1590 HOH C O   1 
HETATM 7280 O  O   . HOH K 3 .   ? 31.514  36.981 43.873  1.00 42.12  ? 1593 HOH C O   1 
HETATM 7281 O  O   . HOH K 3 .   ? 17.160  25.446 58.099  1.00 43.34  ? 1595 HOH C O   1 
HETATM 7282 O  O   . HOH K 3 .   ? 49.751  23.450 54.782  1.00 46.64  ? 1596 HOH C O   1 
HETATM 7283 O  O   . HOH L 3 .   ? 9.495   3.249  23.074  1.00 20.50  ? 1008 HOH B O   1 
HETATM 7284 O  O   . HOH L 3 .   ? -0.022  10.699 20.815  1.00 19.03  ? 1014 HOH B O   1 
HETATM 7285 O  O   . HOH L 3 .   ? 4.650   12.490 28.040  1.00 23.95  ? 1017 HOH B O   1 
HETATM 7286 O  O   . HOH L 3 .   ? 8.933   0.514  24.012  1.00 22.23  ? 1018 HOH B O   1 
HETATM 7287 O  O   . HOH L 3 .   ? 8.973   16.507 17.934  1.00 21.77  ? 1020 HOH B O   1 
HETATM 7288 O  O   . HOH L 3 .   ? -0.029  10.398 40.845  1.00 21.08  ? 1024 HOH B O   1 
HETATM 7289 O  O   . HOH L 3 .   ? -0.988  32.416 2.998   1.00 25.39  ? 1026 HOH B O   1 
HETATM 7290 O  O   . HOH L 3 .   ? 2.358   9.256  22.955  1.00 17.92  ? 1027 HOH B O   1 
HETATM 7291 O  O   . HOH L 3 .   ? 8.634   4.883  19.635  1.00 21.19  ? 1028 HOH B O   1 
HETATM 7292 O  O   . HOH L 3 .   ? 0.598   11.308 23.133  1.00 18.99  ? 1032 HOH B O   1 
HETATM 7293 O  O   . HOH L 3 .   ? 1.025   12.776 40.726  1.00 28.34  ? 1034 HOH B O   1 
HETATM 7294 O  O   . HOH L 3 .   ? -5.606  10.994 37.821  1.00 24.18  ? 1041 HOH B O   1 
HETATM 7295 O  O   . HOH L 3 .   ? 15.768  -1.351 40.599  1.00 19.31  ? 1043 HOH B O   1 
HETATM 7296 O  O   . HOH L 3 .   ? -17.254 4.020  28.589  1.00 27.54  ? 1047 HOH B O   1 
HETATM 7297 O  O   . HOH L 3 .   ? 13.796  -5.689 37.939  1.00 22.50  ? 1051 HOH B O   1 
HETATM 7298 O  O   . HOH L 3 .   ? -4.080  17.961 -3.619  1.00 32.48  ? 1055 HOH B O   1 
HETATM 7299 O  O   . HOH L 3 .   ? -2.180  3.808  38.988  1.00 22.96  ? 1056 HOH B O   1 
HETATM 7300 O  O   . HOH L 3 .   ? -13.217 0.207  32.726  1.00 26.31  ? 1058 HOH B O   1 
HETATM 7301 O  O   . HOH L 3 .   ? -2.732  17.153 34.621  1.00 24.10  ? 1061 HOH B O   1 
HETATM 7302 O  O   . HOH L 3 .   ? 6.027   2.700  44.552  1.00 26.55  ? 1067 HOH B O   1 
HETATM 7303 O  O   . HOH L 3 .   ? 5.881   21.419 14.804  1.00 42.24  ? 1072 HOH B O   1 
HETATM 7304 O  O   . HOH L 3 .   ? -5.369  17.954 35.288  1.00 23.50  ? 1085 HOH B O   1 
HETATM 7305 O  O   . HOH L 3 .   ? 6.774   14.129 43.440  1.00 21.52  ? 1086 HOH B O   1 
HETATM 7306 O  O   . HOH L 3 .   ? -6.098  30.693 7.818   1.00 33.13  ? 1089 HOH B O   1 
HETATM 7307 O  O   . HOH L 3 .   ? -4.040  17.634 38.287  1.00 28.12  ? 1093 HOH B O   1 
HETATM 7308 O  O   . HOH L 3 .   ? -8.657  22.103 16.517  1.00 28.89  ? 1095 HOH B O   1 
HETATM 7309 O  O   . HOH L 3 .   ? -10.329 14.958 2.929   1.00 34.60  ? 1096 HOH B O   1 
HETATM 7310 O  O   . HOH L 3 .   ? -9.257  -5.703 21.058  1.00 29.21  ? 1098 HOH B O   1 
HETATM 7311 O  O   . HOH L 3 .   ? 7.186   1.568  20.998  1.00 25.79  ? 1100 HOH B O   1 
HETATM 7312 O  O   . HOH L 3 .   ? -9.012  -1.620 19.930  1.00 48.96  ? 1102 HOH B O   1 
HETATM 7313 O  O   . HOH L 3 .   ? -7.080  26.453 -6.304  1.00 25.14  ? 1105 HOH B O   1 
HETATM 7314 O  O   . HOH L 3 .   ? -8.849  18.391 32.423  1.00 26.48  ? 1107 HOH B O   1 
HETATM 7315 O  O   . HOH L 3 .   ? -9.338  20.914 -2.452  1.00 29.25  ? 1110 HOH B O   1 
HETATM 7316 O  O   . HOH L 3 .   ? -9.626  22.423 6.653   1.00 32.26  ? 1120 HOH B O   1 
HETATM 7317 O  O   . HOH L 3 .   ? 15.078  3.264  27.443  1.00 22.83  ? 1122 HOH B O   1 
HETATM 7318 O  O   . HOH L 3 .   ? 16.376  5.940  15.769  1.00 65.16  ? 1129 HOH B O   1 
HETATM 7319 O  O   . HOH L 3 .   ? 2.650   31.410 -1.074  1.00 39.93  ? 1131 HOH B O   1 
HETATM 7320 O  O   . HOH L 3 .   ? 0.818   8.175  43.718  1.00 19.14  ? 1136 HOH B O   1 
HETATM 7321 O  O   . HOH L 3 .   ? -7.430  20.601 -8.563  1.00 22.63  ? 1140 HOH B O   1 
HETATM 7322 O  O   . HOH L 3 .   ? -7.347  13.204 9.332   1.00 37.82  ? 1141 HOH B O   1 
HETATM 7323 O  O   . HOH L 3 .   ? 13.025  27.478 6.461   1.00 34.08  ? 1142 HOH B O   1 
HETATM 7324 O  O   . HOH L 3 .   ? 8.119   24.036 10.790  1.00 42.95  ? 1144 HOH B O   1 
HETATM 7325 O  O   . HOH L 3 .   ? -4.975  0.372  19.123  1.00 30.64  ? 1157 HOH B O   1 
HETATM 7326 O  O   . HOH L 3 .   ? -18.155 2.151  21.994  1.00 38.02  ? 1160 HOH B O   1 
HETATM 7327 O  O   . HOH L 3 .   ? 9.016   13.132 44.735  1.00 27.78  ? 1164 HOH B O   1 
HETATM 7328 O  O   . HOH L 3 .   ? -0.464  21.184 15.759  1.00 35.09  ? 1165 HOH B O   1 
HETATM 7329 O  O   . HOH L 3 .   ? -6.479  -2.795 36.787  1.00 30.26  ? 1166 HOH B O   1 
HETATM 7330 O  O   . HOH L 3 .   ? 12.059  32.398 12.542  1.00 36.79  ? 1168 HOH B O   1 
HETATM 7331 O  O   . HOH L 3 .   ? 3.807   23.144 8.810   1.00 32.01  ? 1170 HOH B O   1 
HETATM 7332 O  O   . HOH L 3 .   ? 10.700  15.415 -7.966  1.00 44.20  ? 1173 HOH B O   1 
HETATM 7333 O  O   . HOH L 3 .   ? -9.508  24.315 8.482   1.00 38.09  ? 1176 HOH B O   1 
HETATM 7334 O  O   . HOH L 3 .   ? 5.110   8.306  45.032  1.00 25.48  ? 1177 HOH B O   1 
HETATM 7335 O  O   . HOH L 3 .   ? -10.977 -0.171 19.242  1.00 32.71  ? 1182 HOH B O   1 
HETATM 7336 O  O   . HOH L 3 .   ? -13.705 16.582 21.713  1.00 40.88  ? 1183 HOH B O   1 
HETATM 7337 O  O   . HOH L 3 .   ? -12.063 17.070 6.114   1.00 31.15  ? 1184 HOH B O   1 
HETATM 7338 O  O   . HOH L 3 .   ? 5.705   32.634 4.782   1.00 27.11  ? 1185 HOH B O   1 
HETATM 7339 O  O   . HOH L 3 .   ? -6.231  18.982 32.848  1.00 26.61  ? 1186 HOH B O   1 
HETATM 7340 O  O   . HOH L 3 .   ? -7.270  25.705 29.461  1.00 28.13  ? 1192 HOH B O   1 
HETATM 7341 O  O   . HOH L 3 .   ? -0.989  29.737 -1.786  1.00 37.54  ? 1193 HOH B O   1 
HETATM 7342 O  O   . HOH L 3 .   ? -4.691  -4.582 29.338  1.00 36.82  ? 1194 HOH B O   1 
HETATM 7343 O  O   . HOH L 3 .   ? -3.225  26.639 -9.422  1.00 42.90  ? 1197 HOH B O   1 
HETATM 7344 O  O   . HOH L 3 .   ? -3.708  30.658 -1.497  1.00 44.98  ? 1198 HOH B O   1 
HETATM 7345 O  O   . HOH L 3 .   ? 6.634   10.678 17.470  1.00 31.06  ? 1200 HOH B O   1 
HETATM 7346 O  O   . HOH L 3 .   ? -5.959  -5.776 27.080  1.00 31.53  ? 1207 HOH B O   1 
HETATM 7347 O  O   . HOH L 3 .   ? -4.532  21.957 36.616  1.00 39.83  ? 1217 HOH B O   1 
HETATM 7348 O  O   . HOH L 3 .   ? 4.081   -8.432 31.727  1.00 43.98  ? 1218 HOH B O   1 
HETATM 7349 O  O   . HOH L 3 .   ? -3.959  2.321  17.453  1.00 36.54  ? 1223 HOH B O   1 
HETATM 7350 O  O   . HOH L 3 .   ? -0.050  1.212  46.052  1.00 60.23  ? 1232 HOH B O   1 
HETATM 7351 O  O   . HOH L 3 .   ? -4.105  31.005 9.396   1.00 46.89  ? 1233 HOH B O   1 
HETATM 7352 O  O   . HOH L 3 .   ? 2.986   1.311  18.486  1.00 31.75  ? 1234 HOH B O   1 
HETATM 7353 O  O   . HOH L 3 .   ? -11.566 10.151 33.704  1.00 28.22  ? 1237 HOH B O   1 
HETATM 7354 O  O   . HOH L 3 .   ? 8.136   -5.562 40.353  1.00 37.14  ? 1240 HOH B O   1 
HETATM 7355 O  O   . HOH L 3 .   ? -5.784  31.497 5.567   1.00 46.67  ? 1248 HOH B O   1 
HETATM 7356 O  O   . HOH L 3 .   ? 0.262   5.629  19.235  1.00 43.67  ? 1252 HOH B O   1 
HETATM 7357 O  O   . HOH L 3 .   ? -2.727  -5.651 32.764  1.00 35.03  ? 1254 HOH B O   1 
HETATM 7358 O  O   . HOH L 3 .   ? -11.059 15.940 39.428  1.00 44.02  ? 1264 HOH B O   1 
HETATM 7359 O  O   . HOH L 3 .   ? -12.246 27.056 9.198   1.00 40.58  ? 1271 HOH B O   1 
HETATM 7360 O  O   . HOH L 3 .   ? -11.775 15.594 22.633  1.00 38.61  ? 1273 HOH B O   1 
HETATM 7361 O  O   . HOH L 3 .   ? -1.239  25.257 14.634  1.00 34.72  ? 1276 HOH B O   1 
HETATM 7362 O  O   . HOH L 3 .   ? -2.370  -1.340 20.351  1.00 44.75  ? 1284 HOH B O   1 
HETATM 7363 O  O   . HOH L 3 .   ? 0.466   25.464 -5.741  1.00 35.80  ? 1289 HOH B O   1 
HETATM 7364 O  O   . HOH L 3 .   ? -1.895  1.441  40.459  1.00 37.35  ? 1293 HOH B O   1 
HETATM 7365 O  O   . HOH L 3 .   ? 2.023   -2.811 20.008  1.00 32.13  ? 1294 HOH B O   1 
HETATM 7366 O  O   . HOH L 3 .   ? 7.901   32.411 18.599  1.00 41.34  ? 1295 HOH B O   1 
HETATM 7367 O  O   . HOH L 3 .   ? -16.839 20.386 33.809  1.00 54.68  ? 1299 HOH B O   1 
HETATM 7368 O  O   . HOH L 3 .   ? 1.987   22.929 10.872  1.00 45.02  ? 1300 HOH B O   1 
HETATM 7369 O  O   . HOH L 3 .   ? -11.659 26.028 30.275  1.00 40.99  ? 1301 HOH B O   1 
HETATM 7370 O  O   . HOH L 3 .   ? 5.107   19.579 11.486  1.00 34.78  ? 1308 HOH B O   1 
HETATM 7371 O  O   . HOH L 3 .   ? -10.584 29.627 33.540  1.00 53.02  ? 1314 HOH B O   1 
HETATM 7372 O  O   . HOH L 3 .   ? 9.866   17.945 16.178  1.00 50.07  ? 1318 HOH B O   1 
HETATM 7373 O  O   . HOH L 3 .   ? -6.252  13.670 40.474  1.00 36.83  ? 1320 HOH B O   1 
HETATM 7374 O  O   . HOH L 3 .   ? -7.785  11.927 3.863   1.00 41.85  ? 1323 HOH B O   1 
HETATM 7375 O  O   . HOH L 3 .   ? -2.249  15.786 -9.522  1.00 53.52  ? 1326 HOH B O   1 
HETATM 7376 O  O   . HOH L 3 .   ? 14.806  -2.815 42.097  1.00 34.29  ? 1328 HOH B O   1 
HETATM 7377 O  O   . HOH L 3 .   ? -13.753 3.994  32.981  1.00 46.13  ? 1337 HOH B O   1 
HETATM 7378 O  O   . HOH L 3 .   ? 3.873   6.410  4.176   1.00 43.22  ? 1340 HOH B O   1 
HETATM 7379 O  O   . HOH L 3 .   ? -6.869  7.090  -1.614  1.00 52.30  ? 1342 HOH B O   1 
HETATM 7380 O  O   . HOH L 3 .   ? 3.492   4.652  1.008   1.00 62.84  ? 1349 HOH B O   1 
HETATM 7381 O  O   . HOH L 3 .   ? 3.603   34.223 10.528  1.00 43.13  ? 1353 HOH B O   1 
HETATM 7382 O  O   . HOH L 3 .   ? 12.986  3.714  21.868  1.00 27.58  ? 1358 HOH B O   1 
HETATM 7383 O  O   . HOH L 3 .   ? -4.016  7.976  16.650  1.00 38.77  ? 1366 HOH B O   1 
HETATM 7384 O  O   . HOH L 3 .   ? 8.650   -1.131 44.637  1.00 44.67  ? 1367 HOH B O   1 
HETATM 7385 O  O   . HOH L 3 .   ? -2.001  28.771 -8.765  1.00 42.68  ? 1371 HOH B O   1 
HETATM 7386 O  O   . HOH L 3 .   ? -4.033  -3.528 36.458  1.00 32.09  ? 1376 HOH B O   1 
HETATM 7387 O  O   . HOH L 3 .   ? -18.149 10.220 29.399  1.00 36.37  ? 1384 HOH B O   1 
HETATM 7388 O  O   . HOH L 3 .   ? 17.137  3.525  19.757  1.00 40.23  ? 1386 HOH B O   1 
HETATM 7389 O  O   . HOH L 3 .   ? -20.602 9.313  26.622  1.00 49.26  ? 1389 HOH B O   1 
HETATM 7390 O  O   . HOH L 3 .   ? 4.337   15.588 -11.982 1.00 62.87  ? 1391 HOH B O   1 
HETATM 7391 O  O   . HOH L 3 .   ? 5.498   0.936  18.992  1.00 29.79  ? 1397 HOH B O   1 
HETATM 7392 O  O   . HOH L 3 .   ? -4.319  17.749 40.892  1.00 34.21  ? 1404 HOH B O   1 
HETATM 7393 O  O   . HOH L 3 .   ? -7.765  11.295 13.096  1.00 38.45  ? 1406 HOH B O   1 
HETATM 7394 O  O   . HOH L 3 .   ? 13.568  -0.029 26.306  1.00 31.10  ? 1414 HOH B O   1 
HETATM 7395 O  O   . HOH L 3 .   ? -7.025  29.088 -6.762  1.00 34.79  ? 1415 HOH B O   1 
HETATM 7396 O  O   . HOH L 3 .   ? -4.988  11.331 2.997   1.00 52.42  ? 1419 HOH B O   1 
HETATM 7397 O  O   . HOH L 3 .   ? 4.332   32.672 0.087   1.00 32.79  ? 1420 HOH B O   1 
HETATM 7398 O  O   . HOH L 3 .   ? 17.478  2.347  38.684  1.00 30.31  ? 1422 HOH B O   1 
HETATM 7399 O  O   . HOH L 3 .   ? 10.711  3.503  19.963  1.00 30.91  ? 1425 HOH B O   1 
HETATM 7400 O  O   . HOH L 3 .   ? 11.671  0.588  24.889  1.00 44.99  ? 1428 HOH B O   1 
HETATM 7401 O  O   . HOH L 3 .   ? -1.986  20.521 17.794  1.00 32.29  ? 1441 HOH B O   1 
HETATM 7402 O  O   . HOH L 3 .   ? -0.065  26.005 -3.615  1.00 36.80  ? 1447 HOH B O   1 
HETATM 7403 O  O   . HOH L 3 .   ? -9.468  7.943  5.068   1.00 54.88  ? 1452 HOH B O   1 
HETATM 7404 O  O   . HOH L 3 .   ? -4.143  5.971  38.727  1.00 35.46  ? 1456 HOH B O   1 
HETATM 7405 O  O   . HOH L 3 .   ? 1.804   -7.264 31.045  1.00 38.75  ? 1460 HOH B O   1 
HETATM 7406 O  O   . HOH L 3 .   ? 2.090   33.729 -0.613  1.00 39.32  ? 1461 HOH B O   1 
HETATM 7407 O  O   . HOH L 3 .   ? 9.543   -2.650 42.764  1.00 56.41  ? 1463 HOH B O   1 
HETATM 7408 O  O   . HOH L 3 .   ? -15.086 25.047 19.936  1.00 42.46  ? 1467 HOH B O   1 
HETATM 7409 O  O   . HOH L 3 .   ? -1.447  3.921  42.804  1.00 48.04  ? 1478 HOH B O   1 
HETATM 7410 O  O   . HOH L 3 .   ? 3.564   2.909  -1.530  1.00 78.29  ? 1479 HOH B O   1 
HETATM 7411 O  O   . HOH L 3 .   ? 2.905   -5.380 21.581  1.00 48.54  ? 1482 HOH B O   1 
HETATM 7412 O  O   . HOH L 3 .   ? -2.228  25.555 -11.758 1.00 54.46  ? 1486 HOH B O   1 
HETATM 7413 O  O   . HOH L 3 .   ? -8.122  19.021 -3.970  1.00 32.68  ? 1490 HOH B O   1 
HETATM 7414 O  O   . HOH L 3 .   ? -9.490  -4.606 18.272  1.00 52.32  ? 1495 HOH B O   1 
HETATM 7415 O  O   . HOH L 3 .   ? 2.342   20.200 12.336  1.00 42.77  ? 1496 HOH B O   1 
HETATM 7416 O  O   . HOH L 3 .   ? 4.755   12.639 12.977  1.00 32.71  ? 1505 HOH B O   1 
HETATM 7417 O  O   . HOH L 3 .   ? -6.451  23.866 15.699  1.00 35.96  ? 1507 HOH B O   1 
HETATM 7418 O  O   . HOH L 3 .   ? 0.350   2.015  43.571  1.00 39.53  ? 1513 HOH B O   1 
HETATM 7419 O  O   . HOH L 3 .   ? -7.507  25.881 14.116  1.00 38.13  ? 1514 HOH B O   1 
HETATM 7420 O  O   . HOH L 3 .   ? -15.744 4.947  31.024  1.00 44.89  ? 1526 HOH B O   1 
HETATM 7421 O  O   . HOH L 3 .   ? 5.641   11.974 46.052  1.00 32.82  ? 1527 HOH B O   1 
HETATM 7422 O  O   . HOH L 3 .   ? -8.812  19.488 -6.411  1.00 39.71  ? 1539 HOH B O   1 
HETATM 7423 O  O   . HOH L 3 .   ? -18.109 1.594  18.743  1.00 38.54  ? 1541 HOH B O   1 
HETATM 7424 O  O   . HOH L 3 .   ? -4.558  23.828 18.022  1.00 37.84  ? 1552 HOH B O   1 
HETATM 7425 O  O   . HOH L 3 .   ? 8.924   6.854  17.535  1.00 34.87  ? 1556 HOH B O   1 
HETATM 7426 O  O   . HOH L 3 .   ? 0.911   2.356  -6.093  1.00 49.83  ? 1557 HOH B O   1 
HETATM 7427 O  O   . HOH L 3 .   ? -2.623  23.446 15.893  1.00 39.84  ? 1562 HOH B O   1 
HETATM 7428 O  O   . HOH L 3 .   ? -1.609  -0.664 17.801  1.00 46.98  ? 1570 HOH B O   1 
HETATM 7429 O  O   . HOH L 3 .   ? 15.785  -4.137 26.351  1.00 31.51  ? 1571 HOH B O   1 
HETATM 7430 O  O   . HOH L 3 .   ? -3.845  8.173  24.789  1.00 180.85 ? 1575 HOH B O   1 
HETATM 7431 O  O   . HOH L 3 .   ? 10.535  15.983 13.062  1.00 46.36  ? 1584 HOH B O   1 
HETATM 7432 O  O   . HOH L 3 .   ? 12.639  27.900 3.840   1.00 39.34  ? 1592 HOH B O   1 
HETATM 7433 O  O   . HOH L 3 .   ? 15.997  -2.179 28.667  1.00 27.80  ? 1594 HOH B O   1 
HETATM 7434 O  O   . HOH M 3 .   ? 21.369  46.418 65.761  1.00 20.80  ? 1010 HOH D O   1 
HETATM 7435 O  O   . HOH M 3 .   ? 28.300  52.357 64.560  1.00 17.86  ? 1012 HOH D O   1 
HETATM 7436 O  O   . HOH M 3 .   ? 1.392   50.528 59.427  1.00 21.05  ? 1015 HOH D O   1 
HETATM 7437 O  O   . HOH M 3 .   ? 32.393  59.357 48.739  1.00 19.37  ? 1021 HOH D O   1 
HETATM 7438 O  O   . HOH M 3 .   ? 19.449  44.717 44.824  1.00 23.62  ? 1025 HOH D O   1 
HETATM 7439 O  O   . HOH M 3 .   ? 16.148  36.918 55.039  1.00 17.62  ? 1030 HOH D O   1 
HETATM 7440 O  O   . HOH M 3 .   ? 19.512  44.234 65.736  1.00 21.13  ? 1031 HOH D O   1 
HETATM 7441 O  O   . HOH M 3 .   ? 23.346  42.466 60.825  1.00 20.22  ? 1033 HOH D O   1 
HETATM 7442 O  O   . HOH M 3 .   ? 16.559  30.580 99.598  1.00 38.66  ? 1036 HOH D O   1 
HETATM 7443 O  O   . HOH M 3 .   ? 25.678  54.198 66.754  1.00 24.92  ? 1038 HOH D O   1 
HETATM 7444 O  O   . HOH M 3 .   ? 17.216  35.680 72.337  1.00 25.25  ? 1046 HOH D O   1 
HETATM 7445 O  O   . HOH M 3 .   ? 18.942  44.992 68.282  1.00 21.57  ? 1050 HOH D O   1 
HETATM 7446 O  O   . HOH M 3 .   ? 16.371  49.632 49.005  1.00 18.43  ? 1052 HOH D O   1 
HETATM 7447 O  O   . HOH M 3 .   ? 13.146  42.679 51.211  1.00 25.36  ? 1054 HOH D O   1 
HETATM 7448 O  O   . HOH M 3 .   ? 34.110  54.663 46.472  1.00 21.08  ? 1060 HOH D O   1 
HETATM 7449 O  O   . HOH M 3 .   ? 25.123  24.500 86.008  1.00 27.95  ? 1066 HOH D O   1 
HETATM 7450 O  O   . HOH M 3 .   ? 25.618  45.677 70.896  1.00 32.14  ? 1069 HOH D O   1 
HETATM 7451 O  O   . HOH M 3 .   ? 7.307   39.891 67.214  1.00 30.91  ? 1070 HOH D O   1 
HETATM 7452 O  O   . HOH M 3 .   ? 15.592  45.352 49.490  1.00 46.70  ? 1074 HOH D O   1 
HETATM 7453 O  O   . HOH M 3 .   ? 27.566  54.896 63.302  1.00 21.49  ? 1076 HOH D O   1 
HETATM 7454 O  O   . HOH M 3 .   ? 9.927   34.815 83.967  1.00 33.38  ? 1083 HOH D O   1 
HETATM 7455 O  O   . HOH M 3 .   ? 25.281  38.804 45.846  1.00 28.33  ? 1087 HOH D O   1 
HETATM 7456 O  O   . HOH M 3 .   ? 27.898  39.720 71.414  1.00 23.49  ? 1088 HOH D O   1 
HETATM 7457 O  O   . HOH M 3 .   ? 11.978  36.476 99.106  1.00 30.77  ? 1091 HOH D O   1 
HETATM 7458 O  O   . HOH M 3 .   ? 27.713  32.802 79.079  1.00 34.98  ? 1094 HOH D O   1 
HETATM 7459 O  O   . HOH M 3 .   ? 18.556  42.989 47.880  1.00 25.40  ? 1103 HOH D O   1 
HETATM 7460 O  O   . HOH M 3 .   ? 38.143  55.508 57.859  1.00 30.78  ? 1111 HOH D O   1 
HETATM 7461 O  O   . HOH M 3 .   ? 27.546  51.177 68.177  1.00 26.08  ? 1112 HOH D O   1 
HETATM 7462 O  O   . HOH M 3 .   ? 31.884  52.037 65.931  1.00 25.21  ? 1115 HOH D O   1 
HETATM 7463 O  O   . HOH M 3 .   ? 16.259  26.529 91.547  1.00 44.58  ? 1116 HOH D O   1 
HETATM 7464 O  O   . HOH M 3 .   ? 14.537  57.436 50.987  1.00 32.30  ? 1117 HOH D O   1 
HETATM 7465 O  O   . HOH M 3 .   ? 13.429  26.381 83.051  1.00 36.33  ? 1118 HOH D O   1 
HETATM 7466 O  O   . HOH M 3 .   ? 9.849   32.704 81.826  1.00 34.39  ? 1125 HOH D O   1 
HETATM 7467 O  O   . HOH M 3 .   ? 9.860   35.895 57.504  1.00 26.16  ? 1126 HOH D O   1 
HETATM 7468 O  O   . HOH M 3 .   ? 27.175  24.931 90.253  1.00 55.76  ? 1130 HOH D O   1 
HETATM 7469 O  O   . HOH M 3 .   ? 24.213  44.297 76.315  1.00 30.38  ? 1132 HOH D O   1 
HETATM 7470 O  O   . HOH M 3 .   ? 12.767  30.772 96.562  1.00 27.61  ? 1134 HOH D O   1 
HETATM 7471 O  O   . HOH M 3 .   ? 28.513  58.743 57.653  1.00 28.51  ? 1135 HOH D O   1 
HETATM 7472 O  O   . HOH M 3 .   ? 10.376  33.973 73.903  1.00 24.26  ? 1139 HOH D O   1 
HETATM 7473 O  O   . HOH M 3 .   ? 11.694  29.067 61.417  1.00 33.48  ? 1149 HOH D O   1 
HETATM 7474 O  O   . HOH M 3 .   ? 8.931   41.873 87.052  1.00 33.06  ? 1150 HOH D O   1 
HETATM 7475 O  O   . HOH M 3 .   ? 16.070  59.652 54.289  1.00 38.12  ? 1156 HOH D O   1 
HETATM 7476 O  O   . HOH M 3 .   ? 15.494  39.352 94.027  1.00 32.15  ? 1167 HOH D O   1 
HETATM 7477 O  O   . HOH M 3 .   ? 12.538  60.837 59.335  1.00 34.15  ? 1175 HOH D O   1 
HETATM 7478 O  O   . HOH M 3 .   ? 22.966  51.013 85.386  1.00 47.05  ? 1180 HOH D O   1 
HETATM 7479 O  O   . HOH M 3 .   ? 13.274  35.929 54.811  1.00 33.08  ? 1188 HOH D O   1 
HETATM 7480 O  O   . HOH M 3 .   ? 2.211   31.525 69.110  1.00 49.47  ? 1190 HOH D O   1 
HETATM 7481 O  O   . HOH M 3 .   ? 0.457   44.517 60.157  1.00 41.32  ? 1191 HOH D O   1 
HETATM 7482 O  O   . HOH M 3 .   ? 23.346  49.238 72.684  1.00 32.49  ? 1205 HOH D O   1 
HETATM 7483 O  O   . HOH M 3 .   ? 23.219  33.980 81.567  1.00 30.97  ? 1206 HOH D O   1 
HETATM 7484 O  O   . HOH M 3 .   ? 18.485  24.906 87.775  1.00 33.98  ? 1208 HOH D O   1 
HETATM 7485 O  O   . HOH M 3 .   ? 11.342  50.089 91.162  1.00 61.69  ? 1210 HOH D O   1 
HETATM 7486 O  O   . HOH M 3 .   ? 23.373  44.474 43.706  1.00 29.36  ? 1212 HOH D O   1 
HETATM 7487 O  O   . HOH M 3 .   ? 13.663  55.629 68.350  1.00 31.04  ? 1215 HOH D O   1 
HETATM 7488 O  O   . HOH M 3 .   ? 25.312  23.095 70.392  1.00 42.40  ? 1219 HOH D O   1 
HETATM 7489 O  O   . HOH M 3 .   ? 11.832  30.426 76.118  1.00 40.39  ? 1221 HOH D O   1 
HETATM 7490 O  O   . HOH M 3 .   ? 36.003  51.278 49.080  1.00 34.82  ? 1222 HOH D O   1 
HETATM 7491 O  O   . HOH M 3 .   ? 33.744  51.836 60.379  1.00 24.87  ? 1224 HOH D O   1 
HETATM 7492 O  O   . HOH M 3 .   ? 18.085  31.236 102.002 1.00 55.68  ? 1229 HOH D O   1 
HETATM 7493 O  O   . HOH M 3 .   ? 6.778   56.827 54.528  1.00 44.61  ? 1231 HOH D O   1 
HETATM 7494 O  O   . HOH M 3 .   ? 7.362   50.586 73.152  1.00 46.61  ? 1245 HOH D O   1 
HETATM 7495 O  O   . HOH M 3 .   ? 24.053  55.114 68.610  1.00 40.11  ? 1246 HOH D O   1 
HETATM 7496 O  O   . HOH M 3 .   ? 20.526  53.913 46.097  1.00 38.74  ? 1251 HOH D O   1 
HETATM 7497 O  O   . HOH M 3 .   ? 17.511  59.227 58.823  1.00 42.92  ? 1265 HOH D O   1 
HETATM 7498 O  O   . HOH M 3 .   ? 18.645  35.336 74.198  1.00 32.11  ? 1270 HOH D O   1 
HETATM 7499 O  O   . HOH M 3 .   ? 5.741   53.970 54.784  1.00 32.21  ? 1274 HOH D O   1 
HETATM 7500 O  O   . HOH M 3 .   ? 7.399   42.729 74.543  1.00 52.46  ? 1287 HOH D O   1 
HETATM 7501 O  O   . HOH M 3 .   ? 29.845  41.914 82.166  1.00 41.21  ? 1290 HOH D O   1 
HETATM 7502 O  O   . HOH M 3 .   ? 22.903  52.729 89.222  1.00 54.26  ? 1297 HOH D O   1 
HETATM 7503 O  O   . HOH M 3 .   ? 14.822  35.884 51.647  1.00 28.71  ? 1305 HOH D O   1 
HETATM 7504 O  O   . HOH M 3 .   ? 7.120   44.120 55.347  1.00 37.56  ? 1306 HOH D O   1 
HETATM 7505 O  O   . HOH M 3 .   ? 7.174   29.845 81.393  1.00 38.60  ? 1309 HOH D O   1 
HETATM 7506 O  O   . HOH M 3 .   ? 19.887  40.533 48.461  1.00 35.51  ? 1310 HOH D O   1 
HETATM 7507 O  O   . HOH M 3 .   ? 12.075  56.382 50.562  1.00 32.35  ? 1313 HOH D O   1 
HETATM 7508 O  O   . HOH M 3 .   ? 22.653  62.575 54.623  1.00 34.21  ? 1315 HOH D O   1 
HETATM 7509 O  O   . HOH M 3 .   ? 14.437  47.573 49.608  1.00 38.64  ? 1317 HOH D O   1 
HETATM 7510 O  O   . HOH M 3 .   ? 11.834  20.367 61.331  1.00 42.63  ? 1319 HOH D O   1 
HETATM 7511 O  O   . HOH M 3 .   ? 27.522  39.774 44.655  1.00 36.52  ? 1321 HOH D O   1 
HETATM 7512 O  O   . HOH M 3 .   ? 20.931  58.886 66.687  1.00 43.34  ? 1322 HOH D O   1 
HETATM 7513 O  O   . HOH M 3 .   ? 21.228  49.086 68.263  1.00 38.97  ? 1324 HOH D O   1 
HETATM 7514 O  O   . HOH M 3 .   ? 20.314  31.750 95.713  1.00 50.80  ? 1327 HOH D O   1 
HETATM 7515 O  O   . HOH M 3 .   ? 21.377  39.933 45.862  1.00 36.77  ? 1329 HOH D O   1 
HETATM 7516 O  O   . HOH M 3 .   ? 6.888   27.825 85.149  1.00 39.27  ? 1334 HOH D O   1 
HETATM 7517 O  O   . HOH M 3 .   ? 10.080  35.993 93.002  1.00 27.16  ? 1339 HOH D O   1 
HETATM 7518 O  O   . HOH M 3 .   ? 16.899  33.067 75.057  1.00 44.26  ? 1341 HOH D O   1 
HETATM 7519 O  O   . HOH M 3 .   ? 4.733   28.301 60.972  1.00 37.91  ? 1344 HOH D O   1 
HETATM 7520 O  O   . HOH M 3 .   ? 12.561  32.717 74.777  1.00 39.16  ? 1346 HOH D O   1 
HETATM 7521 O  O   . HOH M 3 .   ? 33.313  40.775 85.199  1.00 39.61  ? 1347 HOH D O   1 
HETATM 7522 O  O   . HOH M 3 .   ? 28.114  44.697 96.996  1.00 51.94  ? 1348 HOH D O   1 
HETATM 7523 O  O   . HOH M 3 .   ? 12.007  43.950 80.493  1.00 43.48  ? 1351 HOH D O   1 
HETATM 7524 O  O   . HOH M 3 .   ? 17.240  46.229 43.957  1.00 47.46  ? 1354 HOH D O   1 
HETATM 7525 O  O   . HOH M 3 .   ? 6.516   24.708 82.953  1.00 46.07  ? 1356 HOH D O   1 
HETATM 7526 O  O   . HOH M 3 .   ? 12.478  35.375 57.298  1.00 30.48  ? 1359 HOH D O   1 
HETATM 7527 O  O   . HOH M 3 .   ? 2.638   34.331 85.347  1.00 61.47  ? 1361 HOH D O   1 
HETATM 7528 O  O   . HOH M 3 .   ? 20.579  52.090 70.765  1.00 47.03  ? 1363 HOH D O   1 
HETATM 7529 O  O   . HOH M 3 .   ? 7.248   39.494 84.426  1.00 46.87  ? 1368 HOH D O   1 
HETATM 7530 O  O   . HOH M 3 .   ? 23.175  44.619 73.483  1.00 44.80  ? 1369 HOH D O   1 
HETATM 7531 O  O   . HOH M 3 .   ? 21.724  29.210 98.663  1.00 46.77  ? 1372 HOH D O   1 
HETATM 7532 O  O   . HOH M 3 .   ? 30.524  34.100 78.980  1.00 44.45  ? 1375 HOH D O   1 
HETATM 7533 O  O   . HOH M 3 .   ? 7.423   36.633 50.562  1.00 44.51  ? 1378 HOH D O   1 
HETATM 7534 O  O   . HOH M 3 .   ? 22.178  60.961 65.080  1.00 47.71  ? 1385 HOH D O   1 
HETATM 7535 O  O   . HOH M 3 .   ? 14.643  48.193 71.776  1.00 30.71  ? 1392 HOH D O   1 
HETATM 7536 O  O   . HOH M 3 .   ? 14.130  59.404 57.729  1.00 31.88  ? 1402 HOH D O   1 
HETATM 7537 O  O   . HOH M 3 .   ? 10.963  32.139 77.698  1.00 51.00  ? 1410 HOH D O   1 
HETATM 7538 O  O   . HOH M 3 .   ? 16.949  35.814 47.148  1.00 40.70  ? 1424 HOH D O   1 
HETATM 7539 O  O   . HOH M 3 .   ? 14.566  31.169 53.362  1.00 41.37  ? 1432 HOH D O   1 
HETATM 7540 O  O   . HOH M 3 .   ? 14.661  45.796 86.529  1.00 41.41  ? 1442 HOH D O   1 
HETATM 7541 O  O   . HOH M 3 .   ? 20.826  59.588 47.598  1.00 41.55  ? 1448 HOH D O   1 
HETATM 7542 O  O   . HOH M 3 .   ? 10.810  38.226 94.508  1.00 33.44  ? 1449 HOH D O   1 
HETATM 7543 O  O   . HOH M 3 .   ? 33.876  52.664 45.025  1.00 33.58  ? 1450 HOH D O   1 
HETATM 7544 O  O   . HOH M 3 .   ? 27.131  56.910 86.128  1.00 57.26  ? 1454 HOH D O   1 
HETATM 7545 O  O   . HOH M 3 .   ? 22.607  25.204 91.267  1.00 52.37  ? 1459 HOH D O   1 
HETATM 7546 O  O   . HOH M 3 .   ? 29.798  33.994 86.427  1.00 36.32  ? 1462 HOH D O   1 
HETATM 7547 O  O   . HOH M 3 .   ? 37.049  51.829 46.590  1.00 29.81  ? 1464 HOH D O   1 
HETATM 7548 O  O   . HOH M 3 .   ? 14.766  32.439 72.154  1.00 38.58  ? 1472 HOH D O   1 
HETATM 7549 O  O   . HOH M 3 .   ? 27.705  49.533 70.502  1.00 32.97  ? 1474 HOH D O   1 
HETATM 7550 O  O   . HOH M 3 .   ? 27.944  45.952 75.485  1.00 42.45  ? 1475 HOH D O   1 
HETATM 7551 O  O   . HOH M 3 .   ? 12.249  39.428 49.216  1.00 39.79  ? 1481 HOH D O   1 
HETATM 7552 O  O   . HOH M 3 .   ? 20.253  61.017 54.964  1.00 48.50  ? 1483 HOH D O   1 
HETATM 7553 O  O   . HOH M 3 .   ? 7.635   55.919 68.283  1.00 46.27  ? 1487 HOH D O   1 
HETATM 7554 O  O   . HOH M 3 .   ? 25.987  55.433 92.000  1.00 49.38  ? 1489 HOH D O   1 
HETATM 7555 O  O   . HOH M 3 .   ? 33.313  49.713 48.506  1.00 32.92  ? 1492 HOH D O   1 
HETATM 7556 O  O   . HOH M 3 .   ? 18.262  31.265 76.009  1.00 46.59  ? 1494 HOH D O   1 
HETATM 7557 O  O   . HOH M 3 .   ? 21.322  29.908 94.445  1.00 43.81  ? 1497 HOH D O   1 
HETATM 7558 O  O   . HOH M 3 .   ? 8.548   36.684 73.510  1.00 43.23  ? 1499 HOH D O   1 
HETATM 7559 O  O   . HOH M 3 .   ? 21.744  54.228 69.436  1.00 42.59  ? 1500 HOH D O   1 
HETATM 7560 O  O   . HOH M 3 .   ? 30.289  56.094 43.343  1.00 45.87  ? 1501 HOH D O   1 
HETATM 7561 O  O   . HOH M 3 .   ? 25.018  35.322 74.911  1.00 44.88  ? 1502 HOH D O   1 
HETATM 7562 O  O   . HOH M 3 .   ? 28.206  26.007 87.466  1.00 47.87  ? 1503 HOH D O   1 
HETATM 7563 O  O   . HOH M 3 .   ? 15.263  51.757 84.326  1.00 58.81  ? 1510 HOH D O   1 
HETATM 7564 O  O   . HOH M 3 .   ? 11.385  45.998 75.658  1.00 51.03  ? 1511 HOH D O   1 
HETATM 7565 O  O   . HOH M 3 .   ? 24.559  24.097 89.712  1.00 38.75  ? 1516 HOH D O   1 
HETATM 7566 O  O   . HOH M 3 .   ? 16.137  55.290 47.359  1.00 39.00  ? 1517 HOH D O   1 
HETATM 7567 O  O   . HOH M 3 .   ? 15.458  57.322 67.358  1.00 50.02  ? 1518 HOH D O   1 
HETATM 7568 O  O   . HOH M 3 .   ? 13.209  52.152 70.934  1.00 30.27  ? 1519 HOH D O   1 
HETATM 7569 O  O   . HOH M 3 .   ? -1.498  45.848 61.122  1.00 60.19  ? 1520 HOH D O   1 
HETATM 7570 O  O   . HOH M 3 .   ? 20.722  62.310 61.596  1.00 40.05  ? 1521 HOH D O   1 
HETATM 7571 O  O   . HOH M 3 .   ? 28.212  37.990 73.532  1.00 36.54  ? 1530 HOH D O   1 
HETATM 7572 O  O   . HOH M 3 .   ? 29.960  57.727 46.043  1.00 34.60  ? 1542 HOH D O   1 
HETATM 7573 O  O   . HOH M 3 .   ? 13.093  44.667 76.555  1.00 48.76  ? 1544 HOH D O   1 
HETATM 7574 O  O   . HOH M 3 .   ? 28.043  55.470 43.486  1.00 37.88  ? 1545 HOH D O   1 
HETATM 7575 O  O   . HOH M 3 .   ? 30.555  41.010 98.411  1.00 40.84  ? 1547 HOH D O   1 
HETATM 7576 O  O   . HOH M 3 .   ? 27.132  59.060 46.562  1.00 27.78  ? 1548 HOH D O   1 
HETATM 7577 O  O   . HOH M 3 .   ? 14.984  33.902 56.081  1.00 34.91  ? 1560 HOH D O   1 
HETATM 7578 O  O   . HOH M 3 .   ? 4.150   30.612 70.606  1.00 42.96  ? 1566 HOH D O   1 
HETATM 7579 O  O   . HOH M 3 .   ? 31.978  54.496 65.093  1.00 38.80  ? 1567 HOH D O   1 
HETATM 7580 O  O   . HOH M 3 .   ? 19.765  52.584 81.674  1.00 46.22  ? 1569 HOH D O   1 
HETATM 7581 O  O   . HOH M 3 .   ? 5.177   22.496 82.293  1.00 58.80  ? 1574 HOH D O   1 
HETATM 7582 O  O   . HOH M 3 .   ? 4.996   49.973 54.995  1.00 43.80  ? 1579 HOH D O   1 
HETATM 7583 O  O   . HOH M 3 .   ? 31.162  28.575 94.575  1.00 68.99  ? 1583 HOH D O   1 
HETATM 7584 O  O   . HOH M 3 .   ? 28.991  27.982 87.832  1.00 51.08  ? 1586 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   VAL 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   LYS 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  CYS 11  11  11  CYS CYS A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  MET 45  45  45  MET MET A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  MET 99  99  99  MET MET A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 MET 122 122 122 MET MET A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 PHE 127 127 127 PHE PHE A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 TYR 158 158 158 TYR TYR A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 HIS 191 191 191 HIS HIS A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 CYS 200 200 200 CYS CYS A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 ARG 203 203 203 ARG ARG A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 ILE 214 214 214 ILE ILE A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 VAL 216 216 216 VAL VAL A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 LYS 223 223 ?   ?   ?   A . n 
A 1 224 HIS 224 224 ?   ?   ?   A . n 
A 1 225 LEU 225 225 ?   ?   ?   A . n 
A 1 226 SER 226 226 ?   ?   ?   A . n 
A 1 227 GLU 227 227 ?   ?   ?   A . n 
A 1 228 GLN 228 228 ?   ?   ?   A . n 
A 1 229 THR 229 229 ?   ?   ?   A . n 
A 1 230 SER 230 230 ?   ?   ?   A . n 
A 1 231 TYR 231 231 ?   ?   ?   A . n 
A 1 232 TYR 232 232 ?   ?   ?   A . n 
A 1 233 SER 233 233 ?   ?   ?   A . n 
A 1 234 ASP 234 234 ?   ?   ?   A . n 
A 1 235 PRO 235 235 ?   ?   ?   A . n 
A 1 236 ASN 236 236 ?   ?   ?   A . n 
A 1 237 SER 237 237 ?   ?   ?   A . n 
A 1 238 SER 238 238 ?   ?   ?   A . n 
A 1 239 SER 239 239 ?   ?   ?   A . n 
A 1 240 VAL 240 240 ?   ?   ?   A . n 
A 1 241 ASP 241 241 ?   ?   ?   A . n 
A 1 242 LYS 242 242 ?   ?   ?   A . n 
A 1 243 LEU 243 243 ?   ?   ?   A . n 
A 1 244 ALA 244 244 ?   ?   ?   A . n 
A 1 245 ALA 245 245 ?   ?   ?   A . n 
A 1 246 ALA 246 246 ?   ?   ?   A . n 
A 1 247 LEU 247 247 ?   ?   ?   A . n 
A 1 248 ASP 248 248 ?   ?   ?   A . n 
A 1 249 HIS 249 249 ?   ?   ?   A . n 
A 1 250 HIS 250 250 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   C . n 
B 1 2   SER 2   2   ?   ?   ?   C . n 
B 1 3   VAL 3   3   ?   ?   ?   C . n 
B 1 4   GLU 4   4   ?   ?   ?   C . n 
B 1 5   GLY 5   5   ?   ?   ?   C . n 
B 1 6   LEU 6   6   ?   ?   ?   C . n 
B 1 7   GLY 7   7   ?   ?   ?   C . n 
B 1 8   LYS 8   8   ?   ?   ?   C . n 
B 1 9   ASP 9   9   9   ASP ASP C . n 
B 1 10  PHE 10  10  10  PHE PHE C . n 
B 1 11  CYS 11  11  11  CYS CYS C . n 
B 1 12  GLY 12  12  12  GLY GLY C . n 
B 1 13  ALA 13  13  13  ALA ALA C . n 
B 1 14  ILE 14  14  14  ILE ILE C . n 
B 1 15  ILE 15  15  15  ILE ILE C . n 
B 1 16  PRO 16  16  16  PRO PRO C . n 
B 1 17  ASP 17  17  17  ASP ASP C . n 
B 1 18  ASN 18  18  18  ASN ASN C . n 
B 1 19  PHE 19  19  19  PHE PHE C . n 
B 1 20  PHE 20  20  20  PHE PHE C . n 
B 1 21  PRO 21  21  21  PRO PRO C . n 
B 1 22  ILE 22  22  22  ILE ILE C . n 
B 1 23  GLU 23  23  23  GLU GLU C . n 
B 1 24  LYS 24  24  24  LYS LYS C . n 
B 1 25  LEU 25  25  25  LEU LEU C . n 
B 1 26  ARG 26  26  26  ARG ARG C . n 
B 1 27  ASN 27  27  27  ASN ASN C . n 
B 1 28  TYR 28  28  28  TYR TYR C . n 
B 1 29  THR 29  29  29  THR THR C . n 
B 1 30  GLN 30  30  30  GLN GLN C . n 
B 1 31  MET 31  31  31  MET MET C . n 
B 1 32  GLY 32  32  32  GLY GLY C . n 
B 1 33  LEU 33  33  33  LEU LEU C . n 
B 1 34  ILE 34  34  34  ILE ILE C . n 
B 1 35  ARG 35  35  35  ARG ARG C . n 
B 1 36  ASP 36  36  36  ASP ASP C . n 
B 1 37  PHE 37  37  37  PHE PHE C . n 
B 1 38  ALA 38  38  38  ALA ALA C . n 
B 1 39  LYS 39  39  39  LYS LYS C . n 
B 1 40  GLY 40  40  40  GLY GLY C . n 
B 1 41  SER 41  41  41  SER SER C . n 
B 1 42  ALA 42  42  42  ALA ALA C . n 
B 1 43  VAL 43  43  43  VAL VAL C . n 
B 1 44  ILE 44  44  44  ILE ILE C . n 
B 1 45  MET 45  45  45  MET MET C . n 
B 1 46  PRO 46  46  46  PRO PRO C . n 
B 1 47  GLY 47  47  47  GLY GLY C . n 
B 1 48  GLU 48  48  48  GLU GLU C . n 
B 1 49  GLU 49  49  49  GLU GLU C . n 
B 1 50  ILE 50  50  50  ILE ILE C . n 
B 1 51  THR 51  51  51  THR THR C . n 
B 1 52  SER 52  52  52  SER SER C . n 
B 1 53  MET 53  53  53  MET MET C . n 
B 1 54  ILE 54  54  54  ILE ILE C . n 
B 1 55  PHE 55  55  55  PHE PHE C . n 
B 1 56  LEU 56  56  56  LEU LEU C . n 
B 1 57  VAL 57  57  57  VAL VAL C . n 
B 1 58  GLU 58  58  58  GLU GLU C . n 
B 1 59  GLY 59  59  59  GLY GLY C . n 
B 1 60  LYS 60  60  60  LYS LYS C . n 
B 1 61  ILE 61  61  61  ILE ILE C . n 
B 1 62  LYS 62  62  62  LYS LYS C . n 
B 1 63  LEU 63  63  63  LEU LEU C . n 
B 1 64  ASP 64  64  64  ASP ASP C . n 
B 1 65  ILE 65  65  65  ILE ILE C . n 
B 1 66  ILE 66  66  66  ILE ILE C . n 
B 1 67  PHE 67  67  67  PHE PHE C . n 
B 1 68  GLU 68  68  68  GLU GLU C . n 
B 1 69  ASP 69  69  69  ASP ASP C . n 
B 1 70  GLY 70  70  70  GLY GLY C . n 
B 1 71  SER 71  71  71  SER SER C . n 
B 1 72  GLU 72  72  72  GLU GLU C . n 
B 1 73  LYS 73  73  73  LYS LYS C . n 
B 1 74  LEU 74  74  74  LEU LEU C . n 
B 1 75  LEU 75  75  75  LEU LEU C . n 
B 1 76  TYR 76  76  76  TYR TYR C . n 
B 1 77  TYR 77  77  77  TYR TYR C . n 
B 1 78  ALA 78  78  78  ALA ALA C . n 
B 1 79  GLY 79  79  79  GLY GLY C . n 
B 1 80  GLY 80  80  80  GLY GLY C . n 
B 1 81  ASN 81  81  81  ASN ASN C . n 
B 1 82  SER 82  82  82  SER SER C . n 
B 1 83  LEU 83  83  83  LEU LEU C . n 
B 1 84  ILE 84  84  84  ILE ILE C . n 
B 1 85  GLY 85  85  85  GLY GLY C . n 
B 1 86  LYS 86  86  86  LYS LYS C . n 
B 1 87  LEU 87  87  87  LEU LEU C . n 
B 1 88  TYR 88  88  88  TYR TYR C . n 
B 1 89  PRO 89  89  89  PRO PRO C . n 
B 1 90  THR 90  90  90  THR THR C . n 
B 1 91  GLY 91  91  91  GLY GLY C . n 
B 1 92  ASN 92  92  92  ASN ASN C . n 
B 1 93  ASN 93  93  93  ASN ASN C . n 
B 1 94  ILE 94  94  94  ILE ILE C . n 
B 1 95  TYR 95  95  95  TYR TYR C . n 
B 1 96  ALA 96  96  96  ALA ALA C . n 
B 1 97  THR 97  97  97  THR THR C . n 
B 1 98  ALA 98  98  98  ALA ALA C . n 
B 1 99  MET 99  99  99  MET MET C . n 
B 1 100 GLU 100 100 100 GLU GLU C . n 
B 1 101 PRO 101 101 101 PRO PRO C . n 
B 1 102 THR 102 102 102 THR THR C . n 
B 1 103 ARG 103 103 103 ARG ARG C . n 
B 1 104 THR 104 104 104 THR THR C . n 
B 1 105 CYS 105 105 105 CYS CYS C . n 
B 1 106 TRP 106 106 106 TRP TRP C . n 
B 1 107 PHE 107 107 107 PHE PHE C . n 
B 1 108 SER 108 108 108 SER SER C . n 
B 1 109 GLU 109 109 109 GLU GLU C . n 
B 1 110 LYS 110 110 110 LYS LYS C . n 
B 1 111 SER 111 111 111 SER SER C . n 
B 1 112 LEU 112 112 112 LEU LEU C . n 
B 1 113 ARG 113 113 113 ARG ARG C . n 
B 1 114 THR 114 114 114 THR THR C . n 
B 1 115 VAL 115 115 115 VAL VAL C . n 
B 1 116 PHE 116 116 116 PHE PHE C . n 
B 1 117 ARG 117 117 117 ARG ARG C . n 
B 1 118 THR 118 118 118 THR THR C . n 
B 1 119 ASP 119 119 119 ASP ASP C . n 
B 1 120 GLU 120 120 120 GLU GLU C . n 
B 1 121 ASP 121 121 121 ASP ASP C . n 
B 1 122 MET 122 122 122 MET MET C . n 
B 1 123 ILE 123 123 123 ILE ILE C . n 
B 1 124 PHE 124 124 124 PHE PHE C . n 
B 1 125 GLU 125 125 125 GLU GLU C . n 
B 1 126 ILE 126 126 126 ILE ILE C . n 
B 1 127 PHE 127 127 127 PHE PHE C . n 
B 1 128 LYS 128 128 128 LYS LYS C . n 
B 1 129 ASN 129 129 129 ASN ASN C . n 
B 1 130 TYR 130 130 130 TYR TYR C . n 
B 1 131 LEU 131 131 131 LEU LEU C . n 
B 1 132 THR 132 132 132 THR THR C . n 
B 1 133 LYS 133 133 133 LYS LYS C . n 
B 1 134 VAL 134 134 134 VAL VAL C . n 
B 1 135 ALA 135 135 135 ALA ALA C . n 
B 1 136 TYR 136 136 136 TYR TYR C . n 
B 1 137 TYR 137 137 137 TYR TYR C . n 
B 1 138 ALA 138 138 138 ALA ALA C . n 
B 1 139 ARG 139 139 139 ARG ARG C . n 
B 1 140 GLN 140 140 140 GLN GLN C . n 
B 1 141 VAL 141 141 141 VAL VAL C . n 
B 1 142 ALA 142 142 142 ALA ALA C . n 
B 1 143 GLU 143 143 143 GLU GLU C . n 
B 1 144 MET 144 144 144 MET MET C . n 
B 1 145 ASN 145 145 145 ASN ASN C . n 
B 1 146 THR 146 146 146 THR THR C . n 
B 1 147 TYR 147 147 147 TYR TYR C . n 
B 1 148 ASN 148 148 148 ASN ASN C . n 
B 1 149 PRO 149 149 149 PRO PRO C . n 
B 1 150 THR 150 150 150 THR THR C . n 
B 1 151 ILE 151 151 151 ILE ILE C . n 
B 1 152 ARG 152 152 152 ARG ARG C . n 
B 1 153 ILE 153 153 153 ILE ILE C . n 
B 1 154 LEU 154 154 154 LEU LEU C . n 
B 1 155 ARG 155 155 155 ARG ARG C . n 
B 1 156 LEU 156 156 156 LEU LEU C . n 
B 1 157 PHE 157 157 157 PHE PHE C . n 
B 1 158 TYR 158 158 158 TYR TYR C . n 
B 1 159 GLU 159 159 159 GLU GLU C . n 
B 1 160 LEU 160 160 160 LEU LEU C . n 
B 1 161 CYS 161 161 161 CYS CYS C . n 
B 1 162 SER 162 162 162 SER SER C . n 
B 1 163 SER 163 163 163 SER SER C . n 
B 1 164 GLN 164 164 164 GLN GLN C . n 
B 1 165 GLY 165 165 165 GLY GLY C . n 
B 1 166 LYS 166 166 166 LYS LYS C . n 
B 1 167 ARG 167 167 167 ARG ARG C . n 
B 1 168 VAL 168 168 168 VAL VAL C . n 
B 1 169 GLY 169 169 169 GLY GLY C . n 
B 1 170 ASP 170 170 170 ASP ASP C . n 
B 1 171 THR 171 171 171 THR THR C . n 
B 1 172 TYR 172 172 172 TYR TYR C . n 
B 1 173 GLU 173 173 173 GLU GLU C . n 
B 1 174 ILE 174 174 174 ILE ILE C . n 
B 1 175 THR 175 175 175 THR THR C . n 
B 1 176 MET 176 176 176 MET MET C . n 
B 1 177 PRO 177 177 177 PRO PRO C . n 
B 1 178 LEU 178 178 178 LEU LEU C . n 
B 1 179 SER 179 179 179 SER SER C . n 
B 1 180 GLN 180 180 180 GLN GLN C . n 
B 1 181 LYS 181 181 181 LYS LYS C . n 
B 1 182 SER 182 182 182 SER SER C . n 
B 1 183 ILE 183 183 183 ILE ILE C . n 
B 1 184 GLY 184 184 184 GLY GLY C . n 
B 1 185 GLU 185 185 185 GLU GLU C . n 
B 1 186 ILE 186 186 186 ILE ILE C . n 
B 1 187 THR 187 187 187 THR THR C . n 
B 1 188 GLY 188 188 188 GLY GLY C . n 
B 1 189 VAL 189 189 189 VAL VAL C . n 
B 1 190 HIS 190 190 190 HIS HIS C . n 
B 1 191 HIS 191 191 191 HIS HIS C . n 
B 1 192 VAL 192 192 192 VAL VAL C . n 
B 1 193 THR 193 193 193 THR THR C . n 
B 1 194 VAL 194 194 194 VAL VAL C . n 
B 1 195 SER 195 195 195 SER SER C . n 
B 1 196 ARG 196 196 196 ARG ARG C . n 
B 1 197 VAL 197 197 197 VAL VAL C . n 
B 1 198 LEU 198 198 198 LEU LEU C . n 
B 1 199 ALA 199 199 199 ALA ALA C . n 
B 1 200 CYS 200 200 200 CYS CYS C . n 
B 1 201 LEU 201 201 201 LEU LEU C . n 
B 1 202 LYS 202 202 202 LYS LYS C . n 
B 1 203 ARG 203 203 203 ARG ARG C . n 
B 1 204 GLU 204 204 204 GLU GLU C . n 
B 1 205 ASN 205 205 205 ASN ASN C . n 
B 1 206 ILE 206 206 206 ILE ILE C . n 
B 1 207 LEU 207 207 207 LEU LEU C . n 
B 1 208 ASP 208 208 208 ASP ASP C . n 
B 1 209 LYS 209 209 209 LYS LYS C . n 
B 1 210 LYS 210 210 210 LYS LYS C . n 
B 1 211 LYS 211 211 211 LYS LYS C . n 
B 1 212 ASN 212 212 212 ASN ASN C . n 
B 1 213 LYS 213 213 213 LYS LYS C . n 
B 1 214 ILE 214 214 214 ILE ILE C . n 
B 1 215 ILE 215 215 215 ILE ILE C . n 
B 1 216 VAL 216 216 216 VAL VAL C . n 
B 1 217 TYR 217 217 217 TYR TYR C . n 
B 1 218 ASN 218 218 218 ASN ASN C . n 
B 1 219 LEU 219 219 219 LEU LEU C . n 
B 1 220 GLY 220 220 220 GLY GLY C . n 
B 1 221 GLU 221 221 221 GLU GLU C . n 
B 1 222 LEU 222 222 222 LEU LEU C . n 
B 1 223 LYS 223 223 ?   ?   ?   C . n 
B 1 224 HIS 224 224 ?   ?   ?   C . n 
B 1 225 LEU 225 225 ?   ?   ?   C . n 
B 1 226 SER 226 226 ?   ?   ?   C . n 
B 1 227 GLU 227 227 ?   ?   ?   C . n 
B 1 228 GLN 228 228 ?   ?   ?   C . n 
B 1 229 THR 229 229 ?   ?   ?   C . n 
B 1 230 SER 230 230 ?   ?   ?   C . n 
B 1 231 TYR 231 231 ?   ?   ?   C . n 
B 1 232 TYR 232 232 ?   ?   ?   C . n 
B 1 233 SER 233 233 ?   ?   ?   C . n 
B 1 234 ASP 234 234 ?   ?   ?   C . n 
B 1 235 PRO 235 235 ?   ?   ?   C . n 
B 1 236 ASN 236 236 ?   ?   ?   C . n 
B 1 237 SER 237 237 ?   ?   ?   C . n 
B 1 238 SER 238 238 ?   ?   ?   C . n 
B 1 239 SER 239 239 ?   ?   ?   C . n 
B 1 240 VAL 240 240 ?   ?   ?   C . n 
B 1 241 ASP 241 241 ?   ?   ?   C . n 
B 1 242 LYS 242 242 ?   ?   ?   C . n 
B 1 243 LEU 243 243 ?   ?   ?   C . n 
B 1 244 ALA 244 244 ?   ?   ?   C . n 
B 1 245 ALA 245 245 ?   ?   ?   C . n 
B 1 246 ALA 246 246 ?   ?   ?   C . n 
B 1 247 LEU 247 247 ?   ?   ?   C . n 
B 1 248 ASP 248 248 ?   ?   ?   C . n 
B 1 249 HIS 249 249 ?   ?   ?   C . n 
B 1 250 HIS 250 250 ?   ?   ?   C . n 
C 1 1   MET 1   1   ?   ?   ?   B . n 
C 1 2   SER 2   2   ?   ?   ?   B . n 
C 1 3   VAL 3   3   ?   ?   ?   B . n 
C 1 4   GLU 4   4   ?   ?   ?   B . n 
C 1 5   GLY 5   5   ?   ?   ?   B . n 
C 1 6   LEU 6   6   ?   ?   ?   B . n 
C 1 7   GLY 7   7   ?   ?   ?   B . n 
C 1 8   LYS 8   8   ?   ?   ?   B . n 
C 1 9   ASP 9   9   9   ASP ASP B . n 
C 1 10  PHE 10  10  10  PHE PHE B . n 
C 1 11  CYS 11  11  11  CYS CYS B . n 
C 1 12  GLY 12  12  12  GLY GLY B . n 
C 1 13  ALA 13  13  13  ALA ALA B . n 
C 1 14  ILE 14  14  14  ILE ILE B . n 
C 1 15  ILE 15  15  15  ILE ILE B . n 
C 1 16  PRO 16  16  16  PRO PRO B . n 
C 1 17  ASP 17  17  17  ASP ASP B . n 
C 1 18  ASN 18  18  18  ASN ASN B . n 
C 1 19  PHE 19  19  19  PHE PHE B . n 
C 1 20  PHE 20  20  20  PHE PHE B . n 
C 1 21  PRO 21  21  21  PRO PRO B . n 
C 1 22  ILE 22  22  22  ILE ILE B . n 
C 1 23  GLU 23  23  23  GLU GLU B . n 
C 1 24  LYS 24  24  24  LYS LYS B . n 
C 1 25  LEU 25  25  25  LEU LEU B . n 
C 1 26  ARG 26  26  26  ARG ARG B . n 
C 1 27  ASN 27  27  27  ASN ASN B . n 
C 1 28  TYR 28  28  28  TYR TYR B . n 
C 1 29  THR 29  29  29  THR THR B . n 
C 1 30  GLN 30  30  30  GLN GLN B . n 
C 1 31  MET 31  31  31  MET MET B . n 
C 1 32  GLY 32  32  32  GLY GLY B . n 
C 1 33  LEU 33  33  33  LEU LEU B . n 
C 1 34  ILE 34  34  34  ILE ILE B . n 
C 1 35  ARG 35  35  35  ARG ARG B . n 
C 1 36  ASP 36  36  36  ASP ASP B . n 
C 1 37  PHE 37  37  37  PHE PHE B . n 
C 1 38  ALA 38  38  38  ALA ALA B . n 
C 1 39  LYS 39  39  39  LYS LYS B . n 
C 1 40  GLY 40  40  40  GLY GLY B . n 
C 1 41  SER 41  41  41  SER SER B . n 
C 1 42  ALA 42  42  42  ALA ALA B . n 
C 1 43  VAL 43  43  43  VAL VAL B . n 
C 1 44  ILE 44  44  44  ILE ILE B . n 
C 1 45  MET 45  45  45  MET MET B . n 
C 1 46  PRO 46  46  46  PRO PRO B . n 
C 1 47  GLY 47  47  47  GLY GLY B . n 
C 1 48  GLU 48  48  48  GLU GLU B . n 
C 1 49  GLU 49  49  49  GLU GLU B . n 
C 1 50  ILE 50  50  50  ILE ILE B . n 
C 1 51  THR 51  51  51  THR THR B . n 
C 1 52  SER 52  52  52  SER SER B . n 
C 1 53  MET 53  53  53  MET MET B . n 
C 1 54  ILE 54  54  54  ILE ILE B . n 
C 1 55  PHE 55  55  55  PHE PHE B . n 
C 1 56  LEU 56  56  56  LEU LEU B . n 
C 1 57  VAL 57  57  57  VAL VAL B . n 
C 1 58  GLU 58  58  58  GLU GLU B . n 
C 1 59  GLY 59  59  59  GLY GLY B . n 
C 1 60  LYS 60  60  60  LYS LYS B . n 
C 1 61  ILE 61  61  61  ILE ILE B . n 
C 1 62  LYS 62  62  62  LYS LYS B . n 
C 1 63  LEU 63  63  63  LEU LEU B . n 
C 1 64  ASP 64  64  64  ASP ASP B . n 
C 1 65  ILE 65  65  65  ILE ILE B . n 
C 1 66  ILE 66  66  66  ILE ILE B . n 
C 1 67  PHE 67  67  67  PHE PHE B . n 
C 1 68  GLU 68  68  68  GLU GLU B . n 
C 1 69  ASP 69  69  69  ASP ASP B . n 
C 1 70  GLY 70  70  70  GLY GLY B . n 
C 1 71  SER 71  71  71  SER SER B . n 
C 1 72  GLU 72  72  72  GLU GLU B . n 
C 1 73  LYS 73  73  73  LYS LYS B . n 
C 1 74  LEU 74  74  74  LEU LEU B . n 
C 1 75  LEU 75  75  75  LEU LEU B . n 
C 1 76  TYR 76  76  76  TYR TYR B . n 
C 1 77  TYR 77  77  77  TYR TYR B . n 
C 1 78  ALA 78  78  78  ALA ALA B . n 
C 1 79  GLY 79  79  79  GLY GLY B . n 
C 1 80  GLY 80  80  80  GLY GLY B . n 
C 1 81  ASN 81  81  81  ASN ASN B . n 
C 1 82  SER 82  82  82  SER SER B . n 
C 1 83  LEU 83  83  83  LEU LEU B . n 
C 1 84  ILE 84  84  84  ILE ILE B . n 
C 1 85  GLY 85  85  85  GLY GLY B . n 
C 1 86  LYS 86  86  86  LYS LYS B . n 
C 1 87  LEU 87  87  87  LEU LEU B . n 
C 1 88  TYR 88  88  88  TYR TYR B . n 
C 1 89  PRO 89  89  89  PRO PRO B . n 
C 1 90  THR 90  90  90  THR THR B . n 
C 1 91  GLY 91  91  91  GLY GLY B . n 
C 1 92  ASN 92  92  92  ASN ASN B . n 
C 1 93  ASN 93  93  93  ASN ASN B . n 
C 1 94  ILE 94  94  94  ILE ILE B . n 
C 1 95  TYR 95  95  95  TYR TYR B . n 
C 1 96  ALA 96  96  96  ALA ALA B . n 
C 1 97  THR 97  97  97  THR THR B . n 
C 1 98  ALA 98  98  98  ALA ALA B . n 
C 1 99  MET 99  99  99  MET MET B . n 
C 1 100 GLU 100 100 100 GLU GLU B . n 
C 1 101 PRO 101 101 101 PRO PRO B . n 
C 1 102 THR 102 102 102 THR THR B . n 
C 1 103 ARG 103 103 103 ARG ARG B . n 
C 1 104 THR 104 104 104 THR THR B . n 
C 1 105 CYS 105 105 105 CYS CYS B . n 
C 1 106 TRP 106 106 106 TRP TRP B . n 
C 1 107 PHE 107 107 107 PHE PHE B . n 
C 1 108 SER 108 108 108 SER SER B . n 
C 1 109 GLU 109 109 109 GLU GLU B . n 
C 1 110 LYS 110 110 110 LYS LYS B . n 
C 1 111 SER 111 111 111 SER SER B . n 
C 1 112 LEU 112 112 112 LEU LEU B . n 
C 1 113 ARG 113 113 113 ARG ARG B . n 
C 1 114 THR 114 114 114 THR THR B . n 
C 1 115 VAL 115 115 115 VAL VAL B . n 
C 1 116 PHE 116 116 116 PHE PHE B . n 
C 1 117 ARG 117 117 117 ARG ARG B . n 
C 1 118 THR 118 118 118 THR THR B . n 
C 1 119 ASP 119 119 119 ASP ASP B . n 
C 1 120 GLU 120 120 120 GLU GLU B . n 
C 1 121 ASP 121 121 121 ASP ASP B . n 
C 1 122 MET 122 122 122 MET MET B . n 
C 1 123 ILE 123 123 123 ILE ILE B . n 
C 1 124 PHE 124 124 124 PHE PHE B . n 
C 1 125 GLU 125 125 125 GLU GLU B . n 
C 1 126 ILE 126 126 126 ILE ILE B . n 
C 1 127 PHE 127 127 127 PHE PHE B . n 
C 1 128 LYS 128 128 128 LYS LYS B . n 
C 1 129 ASN 129 129 129 ASN ASN B . n 
C 1 130 TYR 130 130 130 TYR TYR B . n 
C 1 131 LEU 131 131 131 LEU LEU B . n 
C 1 132 THR 132 132 132 THR THR B . n 
C 1 133 LYS 133 133 133 LYS LYS B . n 
C 1 134 VAL 134 134 134 VAL VAL B . n 
C 1 135 ALA 135 135 135 ALA ALA B . n 
C 1 136 TYR 136 136 136 TYR TYR B . n 
C 1 137 TYR 137 137 137 TYR TYR B . n 
C 1 138 ALA 138 138 138 ALA ALA B . n 
C 1 139 ARG 139 139 139 ARG ARG B . n 
C 1 140 GLN 140 140 140 GLN GLN B . n 
C 1 141 VAL 141 141 141 VAL VAL B . n 
C 1 142 ALA 142 142 142 ALA ALA B . n 
C 1 143 GLU 143 143 143 GLU GLU B . n 
C 1 144 MET 144 144 144 MET MET B . n 
C 1 145 ASN 145 145 145 ASN ASN B . n 
C 1 146 THR 146 146 146 THR THR B . n 
C 1 147 TYR 147 147 147 TYR TYR B . n 
C 1 148 ASN 148 148 148 ASN ASN B . n 
C 1 149 PRO 149 149 149 PRO PRO B . n 
C 1 150 THR 150 150 150 THR THR B . n 
C 1 151 ILE 151 151 151 ILE ILE B . n 
C 1 152 ARG 152 152 152 ARG ARG B . n 
C 1 153 ILE 153 153 153 ILE ILE B . n 
C 1 154 LEU 154 154 154 LEU LEU B . n 
C 1 155 ARG 155 155 155 ARG ARG B . n 
C 1 156 LEU 156 156 156 LEU LEU B . n 
C 1 157 PHE 157 157 157 PHE PHE B . n 
C 1 158 TYR 158 158 158 TYR TYR B . n 
C 1 159 GLU 159 159 159 GLU GLU B . n 
C 1 160 LEU 160 160 160 LEU LEU B . n 
C 1 161 CYS 161 161 161 CYS CYS B . n 
C 1 162 SER 162 162 162 SER SER B . n 
C 1 163 SER 163 163 163 SER SER B . n 
C 1 164 GLN 164 164 164 GLN GLN B . n 
C 1 165 GLY 165 165 165 GLY GLY B . n 
C 1 166 LYS 166 166 166 LYS LYS B . n 
C 1 167 ARG 167 167 167 ARG ARG B . n 
C 1 168 VAL 168 168 168 VAL VAL B . n 
C 1 169 GLY 169 169 169 GLY GLY B . n 
C 1 170 ASP 170 170 170 ASP ASP B . n 
C 1 171 THR 171 171 171 THR THR B . n 
C 1 172 TYR 172 172 172 TYR TYR B . n 
C 1 173 GLU 173 173 173 GLU GLU B . n 
C 1 174 ILE 174 174 174 ILE ILE B . n 
C 1 175 THR 175 175 175 THR THR B . n 
C 1 176 MET 176 176 176 MET MET B . n 
C 1 177 PRO 177 177 177 PRO PRO B . n 
C 1 178 LEU 178 178 178 LEU LEU B . n 
C 1 179 SER 179 179 179 SER SER B . n 
C 1 180 GLN 180 180 180 GLN GLN B . n 
C 1 181 LYS 181 181 181 LYS LYS B . n 
C 1 182 SER 182 182 182 SER SER B . n 
C 1 183 ILE 183 183 183 ILE ILE B . n 
C 1 184 GLY 184 184 184 GLY GLY B . n 
C 1 185 GLU 185 185 185 GLU GLU B . n 
C 1 186 ILE 186 186 186 ILE ILE B . n 
C 1 187 THR 187 187 187 THR THR B . n 
C 1 188 GLY 188 188 188 GLY GLY B . n 
C 1 189 VAL 189 189 189 VAL VAL B . n 
C 1 190 HIS 190 190 190 HIS HIS B . n 
C 1 191 HIS 191 191 191 HIS HIS B . n 
C 1 192 VAL 192 192 192 VAL VAL B . n 
C 1 193 THR 193 193 193 THR THR B . n 
C 1 194 VAL 194 194 194 VAL VAL B . n 
C 1 195 SER 195 195 195 SER SER B . n 
C 1 196 ARG 196 196 196 ARG ARG B . n 
C 1 197 VAL 197 197 197 VAL VAL B . n 
C 1 198 LEU 198 198 198 LEU LEU B . n 
C 1 199 ALA 199 199 199 ALA ALA B . n 
C 1 200 CYS 200 200 200 CYS CYS B . n 
C 1 201 LEU 201 201 201 LEU LEU B . n 
C 1 202 LYS 202 202 202 LYS LYS B . n 
C 1 203 ARG 203 203 203 ARG ARG B . n 
C 1 204 GLU 204 204 204 GLU GLU B . n 
C 1 205 ASN 205 205 205 ASN ASN B . n 
C 1 206 ILE 206 206 206 ILE ILE B . n 
C 1 207 LEU 207 207 207 LEU LEU B . n 
C 1 208 ASP 208 208 208 ASP ASP B . n 
C 1 209 LYS 209 209 209 LYS LYS B . n 
C 1 210 LYS 210 210 210 LYS LYS B . n 
C 1 211 LYS 211 211 211 LYS LYS B . n 
C 1 212 ASN 212 212 212 ASN ASN B . n 
C 1 213 LYS 213 213 213 LYS LYS B . n 
C 1 214 ILE 214 214 214 ILE ILE B . n 
C 1 215 ILE 215 215 215 ILE ILE B . n 
C 1 216 VAL 216 216 216 VAL VAL B . n 
C 1 217 TYR 217 217 217 TYR TYR B . n 
C 1 218 ASN 218 218 218 ASN ASN B . n 
C 1 219 LEU 219 219 219 LEU LEU B . n 
C 1 220 GLY 220 220 220 GLY GLY B . n 
C 1 221 GLU 221 221 221 GLU GLU B . n 
C 1 222 LEU 222 222 222 LEU LEU B . n 
C 1 223 LYS 223 223 223 LYS LYS B . n 
C 1 224 HIS 224 224 224 HIS HIS B . n 
C 1 225 LEU 225 225 225 LEU LEU B . n 
C 1 226 SER 226 226 226 SER SER B . n 
C 1 227 GLU 227 227 227 GLU GLU B . n 
C 1 228 GLN 228 228 ?   ?   ?   B . n 
C 1 229 THR 229 229 ?   ?   ?   B . n 
C 1 230 SER 230 230 ?   ?   ?   B . n 
C 1 231 TYR 231 231 ?   ?   ?   B . n 
C 1 232 TYR 232 232 ?   ?   ?   B . n 
C 1 233 SER 233 233 ?   ?   ?   B . n 
C 1 234 ASP 234 234 ?   ?   ?   B . n 
C 1 235 PRO 235 235 ?   ?   ?   B . n 
C 1 236 ASN 236 236 ?   ?   ?   B . n 
C 1 237 SER 237 237 ?   ?   ?   B . n 
C 1 238 SER 238 238 ?   ?   ?   B . n 
C 1 239 SER 239 239 ?   ?   ?   B . n 
C 1 240 VAL 240 240 ?   ?   ?   B . n 
C 1 241 ASP 241 241 ?   ?   ?   B . n 
C 1 242 LYS 242 242 ?   ?   ?   B . n 
C 1 243 LEU 243 243 ?   ?   ?   B . n 
C 1 244 ALA 244 244 ?   ?   ?   B . n 
C 1 245 ALA 245 245 ?   ?   ?   B . n 
C 1 246 ALA 246 246 ?   ?   ?   B . n 
C 1 247 LEU 247 247 ?   ?   ?   B . n 
C 1 248 ASP 248 248 ?   ?   ?   B . n 
C 1 249 HIS 249 249 ?   ?   ?   B . n 
C 1 250 HIS 250 250 ?   ?   ?   B . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   SER 2   2   ?   ?   ?   D . n 
D 1 3   VAL 3   3   ?   ?   ?   D . n 
D 1 4   GLU 4   4   ?   ?   ?   D . n 
D 1 5   GLY 5   5   ?   ?   ?   D . n 
D 1 6   LEU 6   6   ?   ?   ?   D . n 
D 1 7   GLY 7   7   ?   ?   ?   D . n 
D 1 8   LYS 8   8   ?   ?   ?   D . n 
D 1 9   ASP 9   9   9   ASP ASP D . n 
D 1 10  PHE 10  10  10  PHE PHE D . n 
D 1 11  CYS 11  11  11  CYS CYS D . n 
D 1 12  GLY 12  12  12  GLY GLY D . n 
D 1 13  ALA 13  13  13  ALA ALA D . n 
D 1 14  ILE 14  14  14  ILE ILE D . n 
D 1 15  ILE 15  15  15  ILE ILE D . n 
D 1 16  PRO 16  16  16  PRO PRO D . n 
D 1 17  ASP 17  17  17  ASP ASP D . n 
D 1 18  ASN 18  18  18  ASN ASN D . n 
D 1 19  PHE 19  19  19  PHE PHE D . n 
D 1 20  PHE 20  20  20  PHE PHE D . n 
D 1 21  PRO 21  21  21  PRO PRO D . n 
D 1 22  ILE 22  22  22  ILE ILE D . n 
D 1 23  GLU 23  23  23  GLU GLU D . n 
D 1 24  LYS 24  24  24  LYS LYS D . n 
D 1 25  LEU 25  25  25  LEU LEU D . n 
D 1 26  ARG 26  26  26  ARG ARG D . n 
D 1 27  ASN 27  27  27  ASN ASN D . n 
D 1 28  TYR 28  28  28  TYR TYR D . n 
D 1 29  THR 29  29  29  THR THR D . n 
D 1 30  GLN 30  30  30  GLN GLN D . n 
D 1 31  MET 31  31  31  MET MET D . n 
D 1 32  GLY 32  32  32  GLY GLY D . n 
D 1 33  LEU 33  33  33  LEU LEU D . n 
D 1 34  ILE 34  34  34  ILE ILE D . n 
D 1 35  ARG 35  35  35  ARG ARG D . n 
D 1 36  ASP 36  36  36  ASP ASP D . n 
D 1 37  PHE 37  37  37  PHE PHE D . n 
D 1 38  ALA 38  38  38  ALA ALA D . n 
D 1 39  LYS 39  39  39  LYS LYS D . n 
D 1 40  GLY 40  40  40  GLY GLY D . n 
D 1 41  SER 41  41  41  SER SER D . n 
D 1 42  ALA 42  42  42  ALA ALA D . n 
D 1 43  VAL 43  43  43  VAL VAL D . n 
D 1 44  ILE 44  44  44  ILE ILE D . n 
D 1 45  MET 45  45  45  MET MET D . n 
D 1 46  PRO 46  46  46  PRO PRO D . n 
D 1 47  GLY 47  47  47  GLY GLY D . n 
D 1 48  GLU 48  48  48  GLU GLU D . n 
D 1 49  GLU 49  49  49  GLU GLU D . n 
D 1 50  ILE 50  50  50  ILE ILE D . n 
D 1 51  THR 51  51  51  THR THR D . n 
D 1 52  SER 52  52  52  SER SER D . n 
D 1 53  MET 53  53  53  MET MET D . n 
D 1 54  ILE 54  54  54  ILE ILE D . n 
D 1 55  PHE 55  55  55  PHE PHE D . n 
D 1 56  LEU 56  56  56  LEU LEU D . n 
D 1 57  VAL 57  57  57  VAL VAL D . n 
D 1 58  GLU 58  58  58  GLU GLU D . n 
D 1 59  GLY 59  59  59  GLY GLY D . n 
D 1 60  LYS 60  60  60  LYS LYS D . n 
D 1 61  ILE 61  61  61  ILE ILE D . n 
D 1 62  LYS 62  62  62  LYS LYS D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  ASP 64  64  64  ASP ASP D . n 
D 1 65  ILE 65  65  65  ILE ILE D . n 
D 1 66  ILE 66  66  66  ILE ILE D . n 
D 1 67  PHE 67  67  67  PHE PHE D . n 
D 1 68  GLU 68  68  68  GLU GLU D . n 
D 1 69  ASP 69  69  69  ASP ASP D . n 
D 1 70  GLY 70  70  70  GLY GLY D . n 
D 1 71  SER 71  71  71  SER SER D . n 
D 1 72  GLU 72  72  72  GLU GLU D . n 
D 1 73  LYS 73  73  73  LYS LYS D . n 
D 1 74  LEU 74  74  74  LEU LEU D . n 
D 1 75  LEU 75  75  75  LEU LEU D . n 
D 1 76  TYR 76  76  76  TYR TYR D . n 
D 1 77  TYR 77  77  77  TYR TYR D . n 
D 1 78  ALA 78  78  78  ALA ALA D . n 
D 1 79  GLY 79  79  79  GLY GLY D . n 
D 1 80  GLY 80  80  80  GLY GLY D . n 
D 1 81  ASN 81  81  81  ASN ASN D . n 
D 1 82  SER 82  82  82  SER SER D . n 
D 1 83  LEU 83  83  83  LEU LEU D . n 
D 1 84  ILE 84  84  84  ILE ILE D . n 
D 1 85  GLY 85  85  85  GLY GLY D . n 
D 1 86  LYS 86  86  86  LYS LYS D . n 
D 1 87  LEU 87  87  87  LEU LEU D . n 
D 1 88  TYR 88  88  88  TYR TYR D . n 
D 1 89  PRO 89  89  89  PRO PRO D . n 
D 1 90  THR 90  90  90  THR THR D . n 
D 1 91  GLY 91  91  91  GLY GLY D . n 
D 1 92  ASN 92  92  92  ASN ASN D . n 
D 1 93  ASN 93  93  93  ASN ASN D . n 
D 1 94  ILE 94  94  94  ILE ILE D . n 
D 1 95  TYR 95  95  95  TYR TYR D . n 
D 1 96  ALA 96  96  96  ALA ALA D . n 
D 1 97  THR 97  97  97  THR THR D . n 
D 1 98  ALA 98  98  98  ALA ALA D . n 
D 1 99  MET 99  99  99  MET MET D . n 
D 1 100 GLU 100 100 100 GLU GLU D . n 
D 1 101 PRO 101 101 101 PRO PRO D . n 
D 1 102 THR 102 102 102 THR THR D . n 
D 1 103 ARG 103 103 103 ARG ARG D . n 
D 1 104 THR 104 104 104 THR THR D . n 
D 1 105 CYS 105 105 105 CYS CYS D . n 
D 1 106 TRP 106 106 106 TRP TRP D . n 
D 1 107 PHE 107 107 107 PHE PHE D . n 
D 1 108 SER 108 108 108 SER SER D . n 
D 1 109 GLU 109 109 109 GLU GLU D . n 
D 1 110 LYS 110 110 110 LYS LYS D . n 
D 1 111 SER 111 111 111 SER SER D . n 
D 1 112 LEU 112 112 112 LEU LEU D . n 
D 1 113 ARG 113 113 113 ARG ARG D . n 
D 1 114 THR 114 114 114 THR THR D . n 
D 1 115 VAL 115 115 115 VAL VAL D . n 
D 1 116 PHE 116 116 116 PHE PHE D . n 
D 1 117 ARG 117 117 117 ARG ARG D . n 
D 1 118 THR 118 118 118 THR THR D . n 
D 1 119 ASP 119 119 119 ASP ASP D . n 
D 1 120 GLU 120 120 120 GLU GLU D . n 
D 1 121 ASP 121 121 121 ASP ASP D . n 
D 1 122 MET 122 122 122 MET MET D . n 
D 1 123 ILE 123 123 123 ILE ILE D . n 
D 1 124 PHE 124 124 124 PHE PHE D . n 
D 1 125 GLU 125 125 125 GLU GLU D . n 
D 1 126 ILE 126 126 126 ILE ILE D . n 
D 1 127 PHE 127 127 127 PHE PHE D . n 
D 1 128 LYS 128 128 128 LYS LYS D . n 
D 1 129 ASN 129 129 129 ASN ASN D . n 
D 1 130 TYR 130 130 130 TYR TYR D . n 
D 1 131 LEU 131 131 131 LEU LEU D . n 
D 1 132 THR 132 132 132 THR THR D . n 
D 1 133 LYS 133 133 133 LYS LYS D . n 
D 1 134 VAL 134 134 134 VAL VAL D . n 
D 1 135 ALA 135 135 135 ALA ALA D . n 
D 1 136 TYR 136 136 136 TYR TYR D . n 
D 1 137 TYR 137 137 137 TYR TYR D . n 
D 1 138 ALA 138 138 138 ALA ALA D . n 
D 1 139 ARG 139 139 139 ARG ARG D . n 
D 1 140 GLN 140 140 140 GLN GLN D . n 
D 1 141 VAL 141 141 141 VAL VAL D . n 
D 1 142 ALA 142 142 142 ALA ALA D . n 
D 1 143 GLU 143 143 143 GLU GLU D . n 
D 1 144 MET 144 144 144 MET MET D . n 
D 1 145 ASN 145 145 145 ASN ASN D . n 
D 1 146 THR 146 146 146 THR THR D . n 
D 1 147 TYR 147 147 147 TYR TYR D . n 
D 1 148 ASN 148 148 148 ASN ASN D . n 
D 1 149 PRO 149 149 149 PRO PRO D . n 
D 1 150 THR 150 150 150 THR THR D . n 
D 1 151 ILE 151 151 151 ILE ILE D . n 
D 1 152 ARG 152 152 152 ARG ARG D . n 
D 1 153 ILE 153 153 153 ILE ILE D . n 
D 1 154 LEU 154 154 154 LEU LEU D . n 
D 1 155 ARG 155 155 155 ARG ARG D . n 
D 1 156 LEU 156 156 156 LEU LEU D . n 
D 1 157 PHE 157 157 157 PHE PHE D . n 
D 1 158 TYR 158 158 158 TYR TYR D . n 
D 1 159 GLU 159 159 159 GLU GLU D . n 
D 1 160 LEU 160 160 160 LEU LEU D . n 
D 1 161 CYS 161 161 161 CYS CYS D . n 
D 1 162 SER 162 162 162 SER SER D . n 
D 1 163 SER 163 163 163 SER SER D . n 
D 1 164 GLN 164 164 164 GLN GLN D . n 
D 1 165 GLY 165 165 165 GLY GLY D . n 
D 1 166 LYS 166 166 166 LYS LYS D . n 
D 1 167 ARG 167 167 167 ARG ARG D . n 
D 1 168 VAL 168 168 168 VAL VAL D . n 
D 1 169 GLY 169 169 169 GLY GLY D . n 
D 1 170 ASP 170 170 170 ASP ASP D . n 
D 1 171 THR 171 171 171 THR THR D . n 
D 1 172 TYR 172 172 172 TYR TYR D . n 
D 1 173 GLU 173 173 173 GLU GLU D . n 
D 1 174 ILE 174 174 174 ILE ILE D . n 
D 1 175 THR 175 175 175 THR THR D . n 
D 1 176 MET 176 176 176 MET MET D . n 
D 1 177 PRO 177 177 177 PRO PRO D . n 
D 1 178 LEU 178 178 178 LEU LEU D . n 
D 1 179 SER 179 179 179 SER SER D . n 
D 1 180 GLN 180 180 180 GLN GLN D . n 
D 1 181 LYS 181 181 181 LYS LYS D . n 
D 1 182 SER 182 182 182 SER SER D . n 
D 1 183 ILE 183 183 183 ILE ILE D . n 
D 1 184 GLY 184 184 184 GLY GLY D . n 
D 1 185 GLU 185 185 185 GLU GLU D . n 
D 1 186 ILE 186 186 186 ILE ILE D . n 
D 1 187 THR 187 187 187 THR THR D . n 
D 1 188 GLY 188 188 188 GLY GLY D . n 
D 1 189 VAL 189 189 189 VAL VAL D . n 
D 1 190 HIS 190 190 190 HIS HIS D . n 
D 1 191 HIS 191 191 191 HIS HIS D . n 
D 1 192 VAL 192 192 192 VAL VAL D . n 
D 1 193 THR 193 193 193 THR THR D . n 
D 1 194 VAL 194 194 194 VAL VAL D . n 
D 1 195 SER 195 195 195 SER SER D . n 
D 1 196 ARG 196 196 196 ARG ARG D . n 
D 1 197 VAL 197 197 197 VAL VAL D . n 
D 1 198 LEU 198 198 198 LEU LEU D . n 
D 1 199 ALA 199 199 199 ALA ALA D . n 
D 1 200 CYS 200 200 200 CYS CYS D . n 
D 1 201 LEU 201 201 201 LEU LEU D . n 
D 1 202 LYS 202 202 202 LYS LYS D . n 
D 1 203 ARG 203 203 203 ARG ARG D . n 
D 1 204 GLU 204 204 204 GLU GLU D . n 
D 1 205 ASN 205 205 205 ASN ASN D . n 
D 1 206 ILE 206 206 206 ILE ILE D . n 
D 1 207 LEU 207 207 207 LEU LEU D . n 
D 1 208 ASP 208 208 208 ASP ASP D . n 
D 1 209 LYS 209 209 209 LYS LYS D . n 
D 1 210 LYS 210 210 210 LYS LYS D . n 
D 1 211 LYS 211 211 211 LYS LYS D . n 
D 1 212 ASN 212 212 212 ASN ASN D . n 
D 1 213 LYS 213 213 213 LYS LYS D . n 
D 1 214 ILE 214 214 214 ILE ILE D . n 
D 1 215 ILE 215 215 215 ILE ILE D . n 
D 1 216 VAL 216 216 216 VAL VAL D . n 
D 1 217 TYR 217 217 217 TYR TYR D . n 
D 1 218 ASN 218 218 218 ASN ASN D . n 
D 1 219 LEU 219 219 219 LEU LEU D . n 
D 1 220 GLY 220 220 220 GLY GLY D . n 
D 1 221 GLU 221 221 221 GLU GLU D . n 
D 1 222 LEU 222 222 222 LEU LEU D . n 
D 1 223 LYS 223 223 223 LYS LYS D . n 
D 1 224 HIS 224 224 224 HIS HIS D . n 
D 1 225 LEU 225 225 225 LEU LEU D . n 
D 1 226 SER 226 226 226 SER SER D . n 
D 1 227 GLU 227 227 227 GLU GLU D . n 
D 1 228 GLN 228 228 228 GLN GLN D . n 
D 1 229 THR 229 229 ?   ?   ?   D . n 
D 1 230 SER 230 230 ?   ?   ?   D . n 
D 1 231 TYR 231 231 ?   ?   ?   D . n 
D 1 232 TYR 232 232 ?   ?   ?   D . n 
D 1 233 SER 233 233 ?   ?   ?   D . n 
D 1 234 ASP 234 234 ?   ?   ?   D . n 
D 1 235 PRO 235 235 ?   ?   ?   D . n 
D 1 236 ASN 236 236 ?   ?   ?   D . n 
D 1 237 SER 237 237 ?   ?   ?   D . n 
D 1 238 SER 238 238 ?   ?   ?   D . n 
D 1 239 SER 239 239 ?   ?   ?   D . n 
D 1 240 VAL 240 240 ?   ?   ?   D . n 
D 1 241 ASP 241 241 ?   ?   ?   D . n 
D 1 242 LYS 242 242 ?   ?   ?   D . n 
D 1 243 LEU 243 243 ?   ?   ?   D . n 
D 1 244 ALA 244 244 ?   ?   ?   D . n 
D 1 245 ALA 245 245 ?   ?   ?   D . n 
D 1 246 ALA 246 246 ?   ?   ?   D . n 
D 1 247 LEU 247 247 ?   ?   ?   D . n 
D 1 248 ASP 248 248 ?   ?   ?   D . n 
D 1 249 HIS 249 249 ?   ?   ?   D . n 
D 1 250 HIS 250 250 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 3C4 1   501  501  3C4 3C4 A . 
F 2 3C4 1   502  502  3C4 3C4 C . 
G 2 3C4 1   505  505  3C4 3C4 B . 
H 2 3C4 1   504  504  3C4 3C4 B . 
I 2 3C4 1   503  503  3C4 3C4 D . 
J 3 HOH 1   1009 1009 HOH HOH A . 
J 3 HOH 2   1013 1013 HOH HOH A . 
J 3 HOH 3   1022 1022 HOH HOH A . 
J 3 HOH 4   1037 1037 HOH HOH A . 
J 3 HOH 5   1039 1039 HOH HOH A . 
J 3 HOH 6   1044 1044 HOH HOH A . 
J 3 HOH 7   1048 1048 HOH HOH A . 
J 3 HOH 8   1049 1049 HOH HOH A . 
J 3 HOH 9   1053 1053 HOH HOH A . 
J 3 HOH 10  1057 1057 HOH HOH A . 
J 3 HOH 11  1075 1075 HOH HOH A . 
J 3 HOH 12  1080 1080 HOH HOH A . 
J 3 HOH 13  1081 1081 HOH HOH A . 
J 3 HOH 14  1084 1084 HOH HOH A . 
J 3 HOH 15  1090 1090 HOH HOH A . 
J 3 HOH 16  1097 1097 HOH HOH A . 
J 3 HOH 17  1101 1101 HOH HOH A . 
J 3 HOH 18  1106 1106 HOH HOH A . 
J 3 HOH 19  1109 1109 HOH HOH A . 
J 3 HOH 20  1114 1114 HOH HOH A . 
J 3 HOH 21  1119 1119 HOH HOH A . 
J 3 HOH 22  1121 1121 HOH HOH A . 
J 3 HOH 23  1138 1138 HOH HOH A . 
J 3 HOH 24  1145 1145 HOH HOH A . 
J 3 HOH 25  1146 1146 HOH HOH A . 
J 3 HOH 26  1151 1151 HOH HOH A . 
J 3 HOH 27  1162 1162 HOH HOH A . 
J 3 HOH 28  1163 1163 HOH HOH A . 
J 3 HOH 29  1169 1169 HOH HOH A . 
J 3 HOH 30  1178 1178 HOH HOH A . 
J 3 HOH 31  1187 1187 HOH HOH A . 
J 3 HOH 32  1201 1201 HOH HOH A . 
J 3 HOH 33  1202 1202 HOH HOH A . 
J 3 HOH 34  1203 1203 HOH HOH A . 
J 3 HOH 35  1213 1213 HOH HOH A . 
J 3 HOH 36  1216 1216 HOH HOH A . 
J 3 HOH 37  1220 1220 HOH HOH A . 
J 3 HOH 38  1241 1241 HOH HOH A . 
J 3 HOH 39  1242 1242 HOH HOH A . 
J 3 HOH 40  1244 1244 HOH HOH A . 
J 3 HOH 41  1249 1249 HOH HOH A . 
J 3 HOH 42  1255 1255 HOH HOH A . 
J 3 HOH 43  1256 1256 HOH HOH A . 
J 3 HOH 44  1257 1257 HOH HOH A . 
J 3 HOH 45  1258 1258 HOH HOH A . 
J 3 HOH 46  1260 1260 HOH HOH A . 
J 3 HOH 47  1261 1261 HOH HOH A . 
J 3 HOH 48  1262 1262 HOH HOH A . 
J 3 HOH 49  1263 1263 HOH HOH A . 
J 3 HOH 50  1268 1268 HOH HOH A . 
J 3 HOH 51  1277 1277 HOH HOH A . 
J 3 HOH 52  1279 1279 HOH HOH A . 
J 3 HOH 53  1280 1280 HOH HOH A . 
J 3 HOH 54  1281 1281 HOH HOH A . 
J 3 HOH 55  1282 1282 HOH HOH A . 
J 3 HOH 56  1283 1283 HOH HOH A . 
J 3 HOH 57  1286 1286 HOH HOH A . 
J 3 HOH 58  1288 1288 HOH HOH A . 
J 3 HOH 59  1296 1296 HOH HOH A . 
J 3 HOH 60  1298 1298 HOH HOH A . 
J 3 HOH 61  1302 1302 HOH HOH A . 
J 3 HOH 62  1303 1303 HOH HOH A . 
J 3 HOH 63  1312 1312 HOH HOH A . 
J 3 HOH 64  1325 1325 HOH HOH A . 
J 3 HOH 65  1331 1331 HOH HOH A . 
J 3 HOH 66  1333 1333 HOH HOH A . 
J 3 HOH 67  1335 1335 HOH HOH A . 
J 3 HOH 68  1336 1336 HOH HOH A . 
J 3 HOH 69  1345 1345 HOH HOH A . 
J 3 HOH 70  1350 1350 HOH HOH A . 
J 3 HOH 71  1355 1355 HOH HOH A . 
J 3 HOH 72  1357 1357 HOH HOH A . 
J 3 HOH 73  1362 1362 HOH HOH A . 
J 3 HOH 74  1364 1364 HOH HOH A . 
J 3 HOH 75  1370 1370 HOH HOH A . 
J 3 HOH 76  1373 1373 HOH HOH A . 
J 3 HOH 77  1374 1374 HOH HOH A . 
J 3 HOH 78  1377 1377 HOH HOH A . 
J 3 HOH 79  1379 1379 HOH HOH A . 
J 3 HOH 80  1381 1381 HOH HOH A . 
J 3 HOH 81  1382 1382 HOH HOH A . 
J 3 HOH 82  1399 1399 HOH HOH A . 
J 3 HOH 83  1403 1403 HOH HOH A . 
J 3 HOH 84  1411 1411 HOH HOH A . 
J 3 HOH 85  1412 1412 HOH HOH A . 
J 3 HOH 86  1416 1416 HOH HOH A . 
J 3 HOH 87  1417 1417 HOH HOH A . 
J 3 HOH 88  1421 1421 HOH HOH A . 
J 3 HOH 89  1423 1423 HOH HOH A . 
J 3 HOH 90  1437 1437 HOH HOH A . 
J 3 HOH 91  1443 1443 HOH HOH A . 
J 3 HOH 92  1445 1445 HOH HOH A . 
J 3 HOH 93  1453 1453 HOH HOH A . 
J 3 HOH 94  1455 1455 HOH HOH A . 
J 3 HOH 95  1457 1457 HOH HOH A . 
J 3 HOH 96  1458 1458 HOH HOH A . 
J 3 HOH 97  1468 1468 HOH HOH A . 
J 3 HOH 98  1477 1477 HOH HOH A . 
J 3 HOH 99  1493 1493 HOH HOH A . 
J 3 HOH 100 1506 1506 HOH HOH A . 
J 3 HOH 101 1508 1508 HOH HOH A . 
J 3 HOH 102 1512 1512 HOH HOH A . 
J 3 HOH 103 1523 1523 HOH HOH A . 
J 3 HOH 104 1524 1524 HOH HOH A . 
J 3 HOH 105 1525 1525 HOH HOH A . 
J 3 HOH 106 1528 1528 HOH HOH A . 
J 3 HOH 107 1538 1538 HOH HOH A . 
J 3 HOH 108 1549 1549 HOH HOH A . 
J 3 HOH 109 1550 1550 HOH HOH A . 
J 3 HOH 110 1551 1551 HOH HOH A . 
J 3 HOH 111 1558 1558 HOH HOH A . 
J 3 HOH 112 1561 1561 HOH HOH A . 
J 3 HOH 113 1563 1563 HOH HOH A . 
J 3 HOH 114 1564 1564 HOH HOH A . 
J 3 HOH 115 1568 1568 HOH HOH A . 
J 3 HOH 116 1573 1573 HOH HOH A . 
J 3 HOH 117 1578 1578 HOH HOH A . 
J 3 HOH 118 1580 1580 HOH HOH A . 
J 3 HOH 119 1581 1581 HOH HOH A . 
J 3 HOH 120 1591 1591 HOH HOH A . 
J 3 HOH 121 1597 1597 HOH HOH A . 
K 3 HOH 1   1011 1011 HOH HOH C . 
K 3 HOH 2   1016 1016 HOH HOH C . 
K 3 HOH 3   1019 1019 HOH HOH C . 
K 3 HOH 4   1023 1023 HOH HOH C . 
K 3 HOH 5   1029 1029 HOH HOH C . 
K 3 HOH 6   1035 1035 HOH HOH C . 
K 3 HOH 7   1042 1042 HOH HOH C . 
K 3 HOH 8   1045 1045 HOH HOH C . 
K 3 HOH 9   1059 1059 HOH HOH C . 
K 3 HOH 10  1062 1062 HOH HOH C . 
K 3 HOH 11  1063 1063 HOH HOH C . 
K 3 HOH 12  1064 1064 HOH HOH C . 
K 3 HOH 13  1068 1068 HOH HOH C . 
K 3 HOH 14  1071 1071 HOH HOH C . 
K 3 HOH 15  1077 1077 HOH HOH C . 
K 3 HOH 16  1078 1078 HOH HOH C . 
K 3 HOH 17  1079 1079 HOH HOH C . 
K 3 HOH 18  1082 1082 HOH HOH C . 
K 3 HOH 19  1092 1092 HOH HOH C . 
K 3 HOH 20  1099 1099 HOH HOH C . 
K 3 HOH 21  1104 1104 HOH HOH C . 
K 3 HOH 22  1108 1108 HOH HOH C . 
K 3 HOH 23  1113 1113 HOH HOH C . 
K 3 HOH 24  1123 1123 HOH HOH C . 
K 3 HOH 25  1127 1127 HOH HOH C . 
K 3 HOH 26  1133 1133 HOH HOH C . 
K 3 HOH 27  1137 1137 HOH HOH C . 
K 3 HOH 28  1143 1143 HOH HOH C . 
K 3 HOH 29  1147 1147 HOH HOH C . 
K 3 HOH 30  1148 1148 HOH HOH C . 
K 3 HOH 31  1152 1152 HOH HOH C . 
K 3 HOH 32  1154 1154 HOH HOH C . 
K 3 HOH 33  1155 1155 HOH HOH C . 
K 3 HOH 34  1158 1158 HOH HOH C . 
K 3 HOH 35  1159 1159 HOH HOH C . 
K 3 HOH 36  1161 1161 HOH HOH C . 
K 3 HOH 37  1171 1171 HOH HOH C . 
K 3 HOH 38  1172 1172 HOH HOH C . 
K 3 HOH 39  1174 1174 HOH HOH C . 
K 3 HOH 40  1179 1179 HOH HOH C . 
K 3 HOH 41  1181 1181 HOH HOH C . 
K 3 HOH 42  1189 1189 HOH HOH C . 
K 3 HOH 43  1195 1195 HOH HOH C . 
K 3 HOH 44  1199 1199 HOH HOH C . 
K 3 HOH 45  1204 1204 HOH HOH C . 
K 3 HOH 46  1209 1209 HOH HOH C . 
K 3 HOH 47  1211 1211 HOH HOH C . 
K 3 HOH 48  1214 1214 HOH HOH C . 
K 3 HOH 49  1225 1225 HOH HOH C . 
K 3 HOH 50  1226 1226 HOH HOH C . 
K 3 HOH 51  1227 1227 HOH HOH C . 
K 3 HOH 52  1230 1230 HOH HOH C . 
K 3 HOH 53  1235 1235 HOH HOH C . 
K 3 HOH 54  1236 1236 HOH HOH C . 
K 3 HOH 55  1238 1238 HOH HOH C . 
K 3 HOH 56  1239 1239 HOH HOH C . 
K 3 HOH 57  1243 1243 HOH HOH C . 
K 3 HOH 58  1247 1247 HOH HOH C . 
K 3 HOH 59  1250 1250 HOH HOH C . 
K 3 HOH 60  1253 1253 HOH HOH C . 
K 3 HOH 61  1259 1259 HOH HOH C . 
K 3 HOH 62  1266 1266 HOH HOH C . 
K 3 HOH 63  1267 1267 HOH HOH C . 
K 3 HOH 64  1269 1269 HOH HOH C . 
K 3 HOH 65  1272 1272 HOH HOH C . 
K 3 HOH 66  1275 1275 HOH HOH C . 
K 3 HOH 67  1278 1278 HOH HOH C . 
K 3 HOH 68  1285 1285 HOH HOH C . 
K 3 HOH 69  1292 1292 HOH HOH C . 
K 3 HOH 70  1307 1307 HOH HOH C . 
K 3 HOH 71  1316 1316 HOH HOH C . 
K 3 HOH 72  1330 1330 HOH HOH C . 
K 3 HOH 73  1332 1332 HOH HOH C . 
K 3 HOH 74  1338 1338 HOH HOH C . 
K 3 HOH 75  1343 1343 HOH HOH C . 
K 3 HOH 76  1352 1352 HOH HOH C . 
K 3 HOH 77  1360 1360 HOH HOH C . 
K 3 HOH 78  1365 1365 HOH HOH C . 
K 3 HOH 79  1380 1380 HOH HOH C . 
K 3 HOH 80  1388 1388 HOH HOH C . 
K 3 HOH 81  1390 1390 HOH HOH C . 
K 3 HOH 82  1393 1393 HOH HOH C . 
K 3 HOH 83  1396 1396 HOH HOH C . 
K 3 HOH 84  1398 1398 HOH HOH C . 
K 3 HOH 85  1405 1405 HOH HOH C . 
K 3 HOH 86  1409 1409 HOH HOH C . 
K 3 HOH 87  1418 1418 HOH HOH C . 
K 3 HOH 88  1426 1426 HOH HOH C . 
K 3 HOH 89  1427 1427 HOH HOH C . 
K 3 HOH 90  1430 1430 HOH HOH C . 
K 3 HOH 91  1431 1431 HOH HOH C . 
K 3 HOH 92  1434 1434 HOH HOH C . 
K 3 HOH 93  1435 1435 HOH HOH C . 
K 3 HOH 94  1436 1436 HOH HOH C . 
K 3 HOH 95  1438 1438 HOH HOH C . 
K 3 HOH 96  1439 1439 HOH HOH C . 
K 3 HOH 97  1440 1440 HOH HOH C . 
K 3 HOH 98  1444 1444 HOH HOH C . 
K 3 HOH 99  1446 1446 HOH HOH C . 
K 3 HOH 100 1451 1451 HOH HOH C . 
K 3 HOH 101 1466 1466 HOH HOH C . 
K 3 HOH 102 1469 1469 HOH HOH C . 
K 3 HOH 103 1470 1470 HOH HOH C . 
K 3 HOH 104 1471 1471 HOH HOH C . 
K 3 HOH 105 1473 1473 HOH HOH C . 
K 3 HOH 106 1476 1476 HOH HOH C . 
K 3 HOH 107 1480 1480 HOH HOH C . 
K 3 HOH 108 1484 1484 HOH HOH C . 
K 3 HOH 109 1485 1485 HOH HOH C . 
K 3 HOH 110 1491 1491 HOH HOH C . 
K 3 HOH 111 1498 1498 HOH HOH C . 
K 3 HOH 112 1504 1504 HOH HOH C . 
K 3 HOH 113 1509 1509 HOH HOH C . 
K 3 HOH 114 1515 1515 HOH HOH C . 
K 3 HOH 115 1529 1529 HOH HOH C . 
K 3 HOH 116 1534 1534 HOH HOH C . 
K 3 HOH 117 1535 1535 HOH HOH C . 
K 3 HOH 118 1543 1543 HOH HOH C . 
K 3 HOH 119 1546 1546 HOH HOH C . 
K 3 HOH 120 1553 1553 HOH HOH C . 
K 3 HOH 121 1555 1555 HOH HOH C . 
K 3 HOH 122 1565 1565 HOH HOH C . 
K 3 HOH 123 1576 1576 HOH HOH C . 
K 3 HOH 124 1577 1577 HOH HOH C . 
K 3 HOH 125 1582 1582 HOH HOH C . 
K 3 HOH 126 1589 1589 HOH HOH C . 
K 3 HOH 127 1590 1590 HOH HOH C . 
K 3 HOH 128 1593 1593 HOH HOH C . 
K 3 HOH 129 1595 1595 HOH HOH C . 
K 3 HOH 130 1596 1596 HOH HOH C . 
L 3 HOH 1   1008 1008 HOH HOH B . 
L 3 HOH 2   1014 1014 HOH HOH B . 
L 3 HOH 3   1017 1017 HOH HOH B . 
L 3 HOH 4   1018 1018 HOH HOH B . 
L 3 HOH 5   1020 1020 HOH HOH B . 
L 3 HOH 6   1024 1024 HOH HOH B . 
L 3 HOH 7   1026 1026 HOH HOH B . 
L 3 HOH 8   1027 1027 HOH HOH B . 
L 3 HOH 9   1028 1028 HOH HOH B . 
L 3 HOH 10  1032 1032 HOH HOH B . 
L 3 HOH 11  1034 1034 HOH HOH B . 
L 3 HOH 12  1041 1041 HOH HOH B . 
L 3 HOH 13  1043 1043 HOH HOH B . 
L 3 HOH 14  1047 1047 HOH HOH B . 
L 3 HOH 15  1051 1051 HOH HOH B . 
L 3 HOH 16  1055 1055 HOH HOH B . 
L 3 HOH 17  1056 1056 HOH HOH B . 
L 3 HOH 18  1058 1058 HOH HOH B . 
L 3 HOH 19  1061 1061 HOH HOH B . 
L 3 HOH 20  1067 1067 HOH HOH B . 
L 3 HOH 21  1072 1072 HOH HOH B . 
L 3 HOH 22  1085 1085 HOH HOH B . 
L 3 HOH 23  1086 1086 HOH HOH B . 
L 3 HOH 24  1089 1089 HOH HOH B . 
L 3 HOH 25  1093 1093 HOH HOH B . 
L 3 HOH 26  1095 1095 HOH HOH B . 
L 3 HOH 27  1096 1096 HOH HOH B . 
L 3 HOH 28  1098 1098 HOH HOH B . 
L 3 HOH 29  1100 1100 HOH HOH B . 
L 3 HOH 30  1102 1102 HOH HOH B . 
L 3 HOH 31  1105 1105 HOH HOH B . 
L 3 HOH 32  1107 1107 HOH HOH B . 
L 3 HOH 33  1110 1110 HOH HOH B . 
L 3 HOH 34  1120 1120 HOH HOH B . 
L 3 HOH 35  1122 1122 HOH HOH B . 
L 3 HOH 36  1129 1129 HOH HOH B . 
L 3 HOH 37  1131 1131 HOH HOH B . 
L 3 HOH 38  1136 1136 HOH HOH B . 
L 3 HOH 39  1140 1140 HOH HOH B . 
L 3 HOH 40  1141 1141 HOH HOH B . 
L 3 HOH 41  1142 1142 HOH HOH B . 
L 3 HOH 42  1144 1144 HOH HOH B . 
L 3 HOH 43  1157 1157 HOH HOH B . 
L 3 HOH 44  1160 1160 HOH HOH B . 
L 3 HOH 45  1164 1164 HOH HOH B . 
L 3 HOH 46  1165 1165 HOH HOH B . 
L 3 HOH 47  1166 1166 HOH HOH B . 
L 3 HOH 48  1168 1168 HOH HOH B . 
L 3 HOH 49  1170 1170 HOH HOH B . 
L 3 HOH 50  1173 1173 HOH HOH B . 
L 3 HOH 51  1176 1176 HOH HOH B . 
L 3 HOH 52  1177 1177 HOH HOH B . 
L 3 HOH 53  1182 1182 HOH HOH B . 
L 3 HOH 54  1183 1183 HOH HOH B . 
L 3 HOH 55  1184 1184 HOH HOH B . 
L 3 HOH 56  1185 1185 HOH HOH B . 
L 3 HOH 57  1186 1186 HOH HOH B . 
L 3 HOH 58  1192 1192 HOH HOH B . 
L 3 HOH 59  1193 1193 HOH HOH B . 
L 3 HOH 60  1194 1194 HOH HOH B . 
L 3 HOH 61  1197 1197 HOH HOH B . 
L 3 HOH 62  1198 1198 HOH HOH B . 
L 3 HOH 63  1200 1200 HOH HOH B . 
L 3 HOH 64  1207 1207 HOH HOH B . 
L 3 HOH 65  1217 1217 HOH HOH B . 
L 3 HOH 66  1218 1218 HOH HOH B . 
L 3 HOH 67  1223 1223 HOH HOH B . 
L 3 HOH 68  1232 1232 HOH HOH B . 
L 3 HOH 69  1233 1233 HOH HOH B . 
L 3 HOH 70  1234 1234 HOH HOH B . 
L 3 HOH 71  1237 1237 HOH HOH B . 
L 3 HOH 72  1240 1240 HOH HOH B . 
L 3 HOH 73  1248 1248 HOH HOH B . 
L 3 HOH 74  1252 1252 HOH HOH B . 
L 3 HOH 75  1254 1254 HOH HOH B . 
L 3 HOH 76  1264 1264 HOH HOH B . 
L 3 HOH 77  1271 1271 HOH HOH B . 
L 3 HOH 78  1273 1273 HOH HOH B . 
L 3 HOH 79  1276 1276 HOH HOH B . 
L 3 HOH 80  1284 1284 HOH HOH B . 
L 3 HOH 81  1289 1289 HOH HOH B . 
L 3 HOH 82  1293 1293 HOH HOH B . 
L 3 HOH 83  1294 1294 HOH HOH B . 
L 3 HOH 84  1295 1295 HOH HOH B . 
L 3 HOH 85  1299 1299 HOH HOH B . 
L 3 HOH 86  1300 1300 HOH HOH B . 
L 3 HOH 87  1301 1301 HOH HOH B . 
L 3 HOH 88  1308 1308 HOH HOH B . 
L 3 HOH 89  1314 1314 HOH HOH B . 
L 3 HOH 90  1318 1318 HOH HOH B . 
L 3 HOH 91  1320 1320 HOH HOH B . 
L 3 HOH 92  1323 1323 HOH HOH B . 
L 3 HOH 93  1326 1326 HOH HOH B . 
L 3 HOH 94  1328 1328 HOH HOH B . 
L 3 HOH 95  1337 1337 HOH HOH B . 
L 3 HOH 96  1340 1340 HOH HOH B . 
L 3 HOH 97  1342 1342 HOH HOH B . 
L 3 HOH 98  1349 1349 HOH HOH B . 
L 3 HOH 99  1353 1353 HOH HOH B . 
L 3 HOH 100 1358 1358 HOH HOH B . 
L 3 HOH 101 1366 1366 HOH HOH B . 
L 3 HOH 102 1367 1367 HOH HOH B . 
L 3 HOH 103 1371 1371 HOH HOH B . 
L 3 HOH 104 1376 1376 HOH HOH B . 
L 3 HOH 105 1384 1384 HOH HOH B . 
L 3 HOH 106 1386 1386 HOH HOH B . 
L 3 HOH 107 1389 1389 HOH HOH B . 
L 3 HOH 108 1391 1391 HOH HOH B . 
L 3 HOH 109 1397 1397 HOH HOH B . 
L 3 HOH 110 1404 1404 HOH HOH B . 
L 3 HOH 111 1406 1406 HOH HOH B . 
L 3 HOH 112 1414 1414 HOH HOH B . 
L 3 HOH 113 1415 1415 HOH HOH B . 
L 3 HOH 114 1419 1419 HOH HOH B . 
L 3 HOH 115 1420 1420 HOH HOH B . 
L 3 HOH 116 1422 1422 HOH HOH B . 
L 3 HOH 117 1425 1425 HOH HOH B . 
L 3 HOH 118 1428 1428 HOH HOH B . 
L 3 HOH 119 1441 1441 HOH HOH B . 
L 3 HOH 120 1447 1447 HOH HOH B . 
L 3 HOH 121 1452 1452 HOH HOH B . 
L 3 HOH 122 1456 1456 HOH HOH B . 
L 3 HOH 123 1460 1460 HOH HOH B . 
L 3 HOH 124 1461 1461 HOH HOH B . 
L 3 HOH 125 1463 1463 HOH HOH B . 
L 3 HOH 126 1467 1467 HOH HOH B . 
L 3 HOH 127 1478 1478 HOH HOH B . 
L 3 HOH 128 1479 1479 HOH HOH B . 
L 3 HOH 129 1482 1482 HOH HOH B . 
L 3 HOH 130 1486 1486 HOH HOH B . 
L 3 HOH 131 1490 1490 HOH HOH B . 
L 3 HOH 132 1495 1495 HOH HOH B . 
L 3 HOH 133 1496 1496 HOH HOH B . 
L 3 HOH 134 1505 1505 HOH HOH B . 
L 3 HOH 135 1507 1507 HOH HOH B . 
L 3 HOH 136 1513 1513 HOH HOH B . 
L 3 HOH 137 1514 1514 HOH HOH B . 
L 3 HOH 138 1526 1526 HOH HOH B . 
L 3 HOH 139 1527 1527 HOH HOH B . 
L 3 HOH 140 1539 1539 HOH HOH B . 
L 3 HOH 141 1541 1541 HOH HOH B . 
L 3 HOH 142 1552 1552 HOH HOH B . 
L 3 HOH 143 1556 1556 HOH HOH B . 
L 3 HOH 144 1557 1557 HOH HOH B . 
L 3 HOH 145 1562 1562 HOH HOH B . 
L 3 HOH 146 1570 1570 HOH HOH B . 
L 3 HOH 147 1571 1571 HOH HOH B . 
L 3 HOH 148 1575 1575 HOH HOH B . 
L 3 HOH 149 1584 1584 HOH HOH B . 
L 3 HOH 150 1592 1592 HOH HOH B . 
L 3 HOH 151 1594 1594 HOH HOH B . 
M 3 HOH 1   1010 1010 HOH HOH D . 
M 3 HOH 2   1012 1012 HOH HOH D . 
M 3 HOH 3   1015 1015 HOH HOH D . 
M 3 HOH 4   1021 1021 HOH HOH D . 
M 3 HOH 5   1025 1025 HOH HOH D . 
M 3 HOH 6   1030 1030 HOH HOH D . 
M 3 HOH 7   1031 1031 HOH HOH D . 
M 3 HOH 8   1033 1033 HOH HOH D . 
M 3 HOH 9   1036 1036 HOH HOH D . 
M 3 HOH 10  1038 1038 HOH HOH D . 
M 3 HOH 11  1046 1046 HOH HOH D . 
M 3 HOH 12  1050 1050 HOH HOH D . 
M 3 HOH 13  1052 1052 HOH HOH D . 
M 3 HOH 14  1054 1054 HOH HOH D . 
M 3 HOH 15  1060 1060 HOH HOH D . 
M 3 HOH 16  1066 1066 HOH HOH D . 
M 3 HOH 17  1069 1069 HOH HOH D . 
M 3 HOH 18  1070 1070 HOH HOH D . 
M 3 HOH 19  1074 1074 HOH HOH D . 
M 3 HOH 20  1076 1076 HOH HOH D . 
M 3 HOH 21  1083 1083 HOH HOH D . 
M 3 HOH 22  1087 1087 HOH HOH D . 
M 3 HOH 23  1088 1088 HOH HOH D . 
M 3 HOH 24  1091 1091 HOH HOH D . 
M 3 HOH 25  1094 1094 HOH HOH D . 
M 3 HOH 26  1103 1103 HOH HOH D . 
M 3 HOH 27  1111 1111 HOH HOH D . 
M 3 HOH 28  1112 1112 HOH HOH D . 
M 3 HOH 29  1115 1115 HOH HOH D . 
M 3 HOH 30  1116 1116 HOH HOH D . 
M 3 HOH 31  1117 1117 HOH HOH D . 
M 3 HOH 32  1118 1118 HOH HOH D . 
M 3 HOH 33  1125 1125 HOH HOH D . 
M 3 HOH 34  1126 1126 HOH HOH D . 
M 3 HOH 35  1130 1130 HOH HOH D . 
M 3 HOH 36  1132 1132 HOH HOH D . 
M 3 HOH 37  1134 1134 HOH HOH D . 
M 3 HOH 38  1135 1135 HOH HOH D . 
M 3 HOH 39  1139 1139 HOH HOH D . 
M 3 HOH 40  1149 1149 HOH HOH D . 
M 3 HOH 41  1150 1150 HOH HOH D . 
M 3 HOH 42  1156 1156 HOH HOH D . 
M 3 HOH 43  1167 1167 HOH HOH D . 
M 3 HOH 44  1175 1175 HOH HOH D . 
M 3 HOH 45  1180 1180 HOH HOH D . 
M 3 HOH 46  1188 1188 HOH HOH D . 
M 3 HOH 47  1190 1190 HOH HOH D . 
M 3 HOH 48  1191 1191 HOH HOH D . 
M 3 HOH 49  1205 1205 HOH HOH D . 
M 3 HOH 50  1206 1206 HOH HOH D . 
M 3 HOH 51  1208 1208 HOH HOH D . 
M 3 HOH 52  1210 1210 HOH HOH D . 
M 3 HOH 53  1212 1212 HOH HOH D . 
M 3 HOH 54  1215 1215 HOH HOH D . 
M 3 HOH 55  1219 1219 HOH HOH D . 
M 3 HOH 56  1221 1221 HOH HOH D . 
M 3 HOH 57  1222 1222 HOH HOH D . 
M 3 HOH 58  1224 1224 HOH HOH D . 
M 3 HOH 59  1229 1229 HOH HOH D . 
M 3 HOH 60  1231 1231 HOH HOH D . 
M 3 HOH 61  1245 1245 HOH HOH D . 
M 3 HOH 62  1246 1246 HOH HOH D . 
M 3 HOH 63  1251 1251 HOH HOH D . 
M 3 HOH 64  1265 1265 HOH HOH D . 
M 3 HOH 65  1270 1270 HOH HOH D . 
M 3 HOH 66  1274 1274 HOH HOH D . 
M 3 HOH 67  1287 1287 HOH HOH D . 
M 3 HOH 68  1290 1290 HOH HOH D . 
M 3 HOH 69  1297 1297 HOH HOH D . 
M 3 HOH 70  1305 1305 HOH HOH D . 
M 3 HOH 71  1306 1306 HOH HOH D . 
M 3 HOH 72  1309 1309 HOH HOH D . 
M 3 HOH 73  1310 1310 HOH HOH D . 
M 3 HOH 74  1313 1313 HOH HOH D . 
M 3 HOH 75  1315 1315 HOH HOH D . 
M 3 HOH 76  1317 1317 HOH HOH D . 
M 3 HOH 77  1319 1319 HOH HOH D . 
M 3 HOH 78  1321 1321 HOH HOH D . 
M 3 HOH 79  1322 1322 HOH HOH D . 
M 3 HOH 80  1324 1324 HOH HOH D . 
M 3 HOH 81  1327 1327 HOH HOH D . 
M 3 HOH 82  1329 1329 HOH HOH D . 
M 3 HOH 83  1334 1334 HOH HOH D . 
M 3 HOH 84  1339 1339 HOH HOH D . 
M 3 HOH 85  1341 1341 HOH HOH D . 
M 3 HOH 86  1344 1344 HOH HOH D . 
M 3 HOH 87  1346 1346 HOH HOH D . 
M 3 HOH 88  1347 1347 HOH HOH D . 
M 3 HOH 89  1348 1348 HOH HOH D . 
M 3 HOH 90  1351 1351 HOH HOH D . 
M 3 HOH 91  1354 1354 HOH HOH D . 
M 3 HOH 92  1356 1356 HOH HOH D . 
M 3 HOH 93  1359 1359 HOH HOH D . 
M 3 HOH 94  1361 1361 HOH HOH D . 
M 3 HOH 95  1363 1363 HOH HOH D . 
M 3 HOH 96  1368 1368 HOH HOH D . 
M 3 HOH 97  1369 1369 HOH HOH D . 
M 3 HOH 98  1372 1372 HOH HOH D . 
M 3 HOH 99  1375 1375 HOH HOH D . 
M 3 HOH 100 1378 1378 HOH HOH D . 
M 3 HOH 101 1385 1385 HOH HOH D . 
M 3 HOH 102 1392 1392 HOH HOH D . 
M 3 HOH 103 1402 1402 HOH HOH D . 
M 3 HOH 104 1410 1410 HOH HOH D . 
M 3 HOH 105 1424 1424 HOH HOH D . 
M 3 HOH 106 1432 1432 HOH HOH D . 
M 3 HOH 107 1442 1442 HOH HOH D . 
M 3 HOH 108 1448 1448 HOH HOH D . 
M 3 HOH 109 1449 1449 HOH HOH D . 
M 3 HOH 110 1450 1450 HOH HOH D . 
M 3 HOH 111 1454 1454 HOH HOH D . 
M 3 HOH 112 1459 1459 HOH HOH D . 
M 3 HOH 113 1462 1462 HOH HOH D . 
M 3 HOH 114 1464 1464 HOH HOH D . 
M 3 HOH 115 1472 1472 HOH HOH D . 
M 3 HOH 116 1474 1474 HOH HOH D . 
M 3 HOH 117 1475 1475 HOH HOH D . 
M 3 HOH 118 1481 1481 HOH HOH D . 
M 3 HOH 119 1483 1483 HOH HOH D . 
M 3 HOH 120 1487 1487 HOH HOH D . 
M 3 HOH 121 1489 1489 HOH HOH D . 
M 3 HOH 122 1492 1492 HOH HOH D . 
M 3 HOH 123 1494 1494 HOH HOH D . 
M 3 HOH 124 1497 1497 HOH HOH D . 
M 3 HOH 125 1499 1499 HOH HOH D . 
M 3 HOH 126 1500 1500 HOH HOH D . 
M 3 HOH 127 1501 1501 HOH HOH D . 
M 3 HOH 128 1502 1502 HOH HOH D . 
M 3 HOH 129 1503 1503 HOH HOH D . 
M 3 HOH 130 1510 1510 HOH HOH D . 
M 3 HOH 131 1511 1511 HOH HOH D . 
M 3 HOH 132 1516 1516 HOH HOH D . 
M 3 HOH 133 1517 1517 HOH HOH D . 
M 3 HOH 134 1518 1518 HOH HOH D . 
M 3 HOH 135 1519 1519 HOH HOH D . 
M 3 HOH 136 1520 1520 HOH HOH D . 
M 3 HOH 137 1521 1521 HOH HOH D . 
M 3 HOH 138 1530 1530 HOH HOH D . 
M 3 HOH 139 1542 1542 HOH HOH D . 
M 3 HOH 140 1544 1544 HOH HOH D . 
M 3 HOH 141 1545 1545 HOH HOH D . 
M 3 HOH 142 1547 1547 HOH HOH D . 
M 3 HOH 143 1548 1548 HOH HOH D . 
M 3 HOH 144 1560 1560 HOH HOH D . 
M 3 HOH 145 1566 1566 HOH HOH D . 
M 3 HOH 146 1567 1567 HOH HOH D . 
M 3 HOH 147 1569 1569 HOH HOH D . 
M 3 HOH 148 1574 1574 HOH HOH D . 
M 3 HOH 149 1579 1579 HOH HOH D . 
M 3 HOH 150 1583 1583 HOH HOH D . 
M 3 HOH 151 1586 1586 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,H,J,L 
2 1 B,D,F,I,K,M   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5470  ? 
1 MORE         -55   ? 
1 'SSA (A^2)'  19210 ? 
2 'ABSA (A^2)' 5780  ? 
2 MORE         -62   ? 
2 'SSA (A^2)'  19060 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-12-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 0.2060  44.8390 30.8290 0.2544  -0.3466 0.2480  0.0374  0.0734  -0.1824 11.0486 13.4027 9.2019  0.2642  -2.5618 
-0.2628 0.2086 -0.8572 1.7877  1.0260  -0.0963 0.1373  -1.4620 -0.0645 -0.1122 'X-RAY DIFFRACTION' 
2 ? refined -0.0670 17.2690 0.4940  0.0131  -0.0727 -0.0839 0.0682  -0.1229 0.0296  5.9750  2.7425  6.1285  -1.1118 1.6134  
-1.1949 0.4249 0.1811  -0.4611 -0.3429 -0.1573 0.1292  0.6659  0.2198  -0.2676 'X-RAY DIFFRACTION' 
3 ? refined 18.8980 9.9990  62.2940 0.0932  -0.2154 -0.1790 -0.0734 -0.0879 0.0677  4.0998  5.5817  13.7687 2.1321  3.5500  2.1605 
0.1587 -0.1095 -0.2079 0.6420  -0.1887 -0.2850 0.7634  -0.1529 0.0300  'X-RAY DIFFRACTION' 
4 ? refined 19.3650 40.0670 89.6510 0.0190  -0.0898 -0.1280 -0.0436 0.0610  0.0118  8.1871  4.2775  7.7091  4.1333  -2.7405 
-1.0726 0.3991 -0.2163 0.5410  0.1706  -0.0926 0.2634  -0.8872 -0.0032 -0.3065 'X-RAY DIFFRACTION' 
5 ? refined 16.3720 23.0770 29.3810 -0.0222 -0.0286 -0.0706 -0.0863 -0.0044 -0.0171 1.1546  1.5956  1.7555  -0.0971 0.3389  
-0.9202 0.0477 0.0267  0.1503  0.2045  -0.1310 -0.0819 -0.3039 0.2992  0.0833  'X-RAY DIFFRACTION' 
6 ? refined -0.2670 11.3410 26.4710 -0.0677 -0.0481 -0.0340 -0.0205 -0.0020 -0.0226 1.1412  1.3621  1.5589  0.2255  0.1718  
-0.5525 0.0778 0.0564  0.0400  0.0004  0.0260  0.2317  0.0384  -0.0771 -0.1038 'X-RAY DIFFRACTION' 
7 ? refined 35.2870 31.9000 60.6780 -0.0010 -0.0441 -0.0729 0.0958  0.0077  -0.0091 1.1326  1.7779  2.5297  0.2336  -0.1742 
-0.9318 0.0365 -0.0063 -0.0956 -0.2858 -0.1510 -0.2423 0.4094  0.4055  0.1145  'X-RAY DIFFRACTION' 
8 ? refined 18.5640 43.7710 62.4110 -0.0546 -0.0649 -0.0419 0.0084  -0.0215 -0.0086 1.0314  1.8628  1.6597  0.0785  -0.1124 
-0.9315 0.0648 0.0165  0.0289  -0.0281 0.0701  0.2442  -0.0107 -0.1165 -0.1349 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 150 A 150 A 222 A 222 ? 'X-RAY DIFFRACTION' ? 
2 2 B 150 C 150 B 227 C 227 ? 'X-RAY DIFFRACTION' ? 
3 3 C 150 B 150 C 222 B 222 ? 'X-RAY DIFFRACTION' ? 
4 4 D 150 D 150 D 228 D 228 ? 'X-RAY DIFFRACTION' ? 
5 5 A 9   A 9   A 149 A 149 ? 'X-RAY DIFFRACTION' ? 
6 6 B 9   C 9   B 149 C 149 ? 'X-RAY DIFFRACTION' ? 
7 7 C 9   B 9   C 149 B 149 ? 'X-RAY DIFFRACTION' ? 
8 8 D 9   D 9   D 149 D 149 ? 'X-RAY DIFFRACTION' ? 
# 
_software.name             REFMAC 
_software.classification   refinement 
_software.version          5.2.0019 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   C HOH 1589 ? ? O D HOH 1492 ? ? 1.82 
2 1 OD2 B ASP 121  ? ? O B HOH 1594 ? ? 1.90 
3 1 NZ  C LYS 62   ? ? O C HOH 1577 ? ? 2.02 
4 1 O   C HOH 1137 ? ? O D HOH 1492 ? ? 2.03 
5 1 O   D HOH 1503 ? ? O D HOH 1586 ? ? 2.16 
6 1 O   A HOH 1578 ? ? O B HOH 1043 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CG A GLU 49  ? ? CD  A GLU 49  ? ? 1.609 1.515 0.094  0.015 N 
2  1 CG A GLU 68  ? ? CD  A GLU 68  ? ? 1.625 1.515 0.110  0.015 N 
3  1 CB A THR 171 ? ? OG1 A THR 171 ? ? 1.782 1.428 0.354  0.020 N 
4  1 CB A THR 171 ? ? CG2 A THR 171 ? ? 1.861 1.519 0.342  0.033 N 
5  1 CG C GLU 68  ? ? CD  C GLU 68  ? ? 1.640 1.515 0.125  0.015 N 
6  1 CB C CYS 200 ? ? SG  C CYS 200 ? ? 1.623 1.812 -0.189 0.016 N 
7  1 CA B ALA 135 ? ? CB  B ALA 135 ? ? 1.665 1.520 0.145  0.021 N 
8  1 CB B CYS 200 ? ? SG  B CYS 200 ? ? 1.641 1.812 -0.171 0.016 N 
9  1 C  B GLU 221 ? ? N   B LEU 222 ? ? 1.575 1.336 0.239  0.023 Y 
10 1 CG D GLU 23  ? ? CD  D GLU 23  ? ? 1.635 1.515 0.120  0.015 N 
11 1 CG D GLU 49  ? ? CD  D GLU 49  ? ? 1.629 1.515 0.114  0.015 N 
12 1 CD D GLU 49  ? ? OE1 D GLU 49  ? ? 1.320 1.252 0.068  0.011 N 
13 1 CB D CYS 200 ? ? SG  D CYS 200 ? ? 1.679 1.812 -0.133 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A LEU 56  ? ? CG A LEU 56  ? ? CD1 A LEU 56  ? ? 98.80  111.00 -12.20 1.70 N 
2  1 CB A PHE 127 ? ? CG A PHE 127 ? ? CD1 A PHE 127 ? ? 125.06 120.80 4.26   0.70 N 
3  1 NE A ARG 139 ? ? CZ A ARG 139 ? ? NH1 A ARG 139 ? ? 124.36 120.30 4.06   0.50 N 
4  1 NE A ARG 139 ? ? CZ A ARG 139 ? ? NH2 A ARG 139 ? ? 117.02 120.30 -3.28  0.50 N 
5  1 NE C ARG 139 ? ? CZ C ARG 139 ? ? NH1 C ARG 139 ? ? 124.70 120.30 4.40   0.50 N 
6  1 NE C ARG 139 ? ? CZ C ARG 139 ? ? NH2 C ARG 139 ? ? 115.84 120.30 -4.46  0.50 N 
7  1 NE C ARG 196 ? ? CZ C ARG 196 ? ? NH1 C ARG 196 ? ? 123.56 120.30 3.26   0.50 N 
8  1 NE B ARG 26  ? ? CZ B ARG 26  ? ? NH2 B ARG 26  ? ? 116.74 120.30 -3.56  0.50 N 
9  1 CB D LEU 56  ? ? CG D LEU 56  ? ? CD2 D LEU 56  ? ? 100.63 111.00 -10.37 1.70 N 
10 1 NE D ARG 113 ? ? CZ D ARG 113 ? ? NH1 D ARG 113 ? ? 124.17 120.30 3.87   0.50 N 
11 1 CA D LEU 207 ? ? CB D LEU 207 ? ? CG  D LEU 207 ? ? 130.52 115.30 15.22  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 20  ? ? 13.53   78.64  
2  1 ARG A 167 ? ? -69.61  97.24  
3  1 ASN A 205 ? ? 62.12   65.07  
4  1 ILE A 206 ? ? -130.97 -49.59 
5  1 PHE C 10  ? ? -35.70  104.81 
6  1 PHE C 20  ? ? 10.62   79.64  
7  1 ASN C 81  ? ? 81.01   2.71   
8  1 ASP C 170 ? ? -99.31  42.12  
9  1 LYS C 213 ? ? -174.79 141.52 
10 1 PHE B 20  ? ? 18.36   80.32  
11 1 THR B 51  ? ? -141.36 46.23  
12 1 ILE B 206 ? ? -103.93 -62.57 
13 1 PHE D 20  ? ? 20.67   74.63  
14 1 LYS D 210 ? ? 46.79   161.24 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASP C 9 ? ? PHE C 10 ? ? 126.51  
2 1 ASP B 9 ? ? PHE B 10 ? ? -144.80 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B GLU 58  ? CD  ? C GLU 58  CD  
2 1 Y 1 B GLU 58  ? OE1 ? C GLU 58  OE1 
3 1 Y 1 B GLU 58  ? OE2 ? C GLU 58  OE2 
4 1 Y 1 D LYS 209 ? CE  ? D LYS 209 CE  
5 1 Y 1 D LYS 209 ? NZ  ? D LYS 209 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A VAL 3   ? A VAL 3   
4   1 Y 1 A GLU 4   ? A GLU 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A LEU 6   ? A LEU 6   
7   1 Y 1 A GLY 7   ? A GLY 7   
8   1 Y 1 A LYS 8   ? A LYS 8   
9   1 Y 1 A LYS 223 ? A LYS 223 
10  1 Y 1 A HIS 224 ? A HIS 224 
11  1 Y 1 A LEU 225 ? A LEU 225 
12  1 Y 1 A SER 226 ? A SER 226 
13  1 Y 1 A GLU 227 ? A GLU 227 
14  1 Y 1 A GLN 228 ? A GLN 228 
15  1 Y 1 A THR 229 ? A THR 229 
16  1 Y 1 A SER 230 ? A SER 230 
17  1 Y 1 A TYR 231 ? A TYR 231 
18  1 Y 1 A TYR 232 ? A TYR 232 
19  1 Y 1 A SER 233 ? A SER 233 
20  1 Y 1 A ASP 234 ? A ASP 234 
21  1 Y 1 A PRO 235 ? A PRO 235 
22  1 Y 1 A ASN 236 ? A ASN 236 
23  1 Y 1 A SER 237 ? A SER 237 
24  1 Y 1 A SER 238 ? A SER 238 
25  1 Y 1 A SER 239 ? A SER 239 
26  1 Y 1 A VAL 240 ? A VAL 240 
27  1 Y 1 A ASP 241 ? A ASP 241 
28  1 Y 1 A LYS 242 ? A LYS 242 
29  1 Y 1 A LEU 243 ? A LEU 243 
30  1 Y 1 A ALA 244 ? A ALA 244 
31  1 Y 1 A ALA 245 ? A ALA 245 
32  1 Y 1 A ALA 246 ? A ALA 246 
33  1 Y 1 A LEU 247 ? A LEU 247 
34  1 Y 1 A ASP 248 ? A ASP 248 
35  1 Y 1 A HIS 249 ? A HIS 249 
36  1 Y 1 A HIS 250 ? A HIS 250 
37  1 Y 1 C MET 1   ? B MET 1   
38  1 Y 1 C SER 2   ? B SER 2   
39  1 Y 1 C VAL 3   ? B VAL 3   
40  1 Y 1 C GLU 4   ? B GLU 4   
41  1 Y 1 C GLY 5   ? B GLY 5   
42  1 Y 1 C LEU 6   ? B LEU 6   
43  1 Y 1 C GLY 7   ? B GLY 7   
44  1 Y 1 C LYS 8   ? B LYS 8   
45  1 Y 1 C LYS 223 ? B LYS 223 
46  1 Y 1 C HIS 224 ? B HIS 224 
47  1 Y 1 C LEU 225 ? B LEU 225 
48  1 Y 1 C SER 226 ? B SER 226 
49  1 Y 1 C GLU 227 ? B GLU 227 
50  1 Y 1 C GLN 228 ? B GLN 228 
51  1 Y 1 C THR 229 ? B THR 229 
52  1 Y 1 C SER 230 ? B SER 230 
53  1 Y 1 C TYR 231 ? B TYR 231 
54  1 Y 1 C TYR 232 ? B TYR 232 
55  1 Y 1 C SER 233 ? B SER 233 
56  1 Y 1 C ASP 234 ? B ASP 234 
57  1 Y 1 C PRO 235 ? B PRO 235 
58  1 Y 1 C ASN 236 ? B ASN 236 
59  1 Y 1 C SER 237 ? B SER 237 
60  1 Y 1 C SER 238 ? B SER 238 
61  1 Y 1 C SER 239 ? B SER 239 
62  1 Y 1 C VAL 240 ? B VAL 240 
63  1 Y 1 C ASP 241 ? B ASP 241 
64  1 Y 1 C LYS 242 ? B LYS 242 
65  1 Y 1 C LEU 243 ? B LEU 243 
66  1 Y 1 C ALA 244 ? B ALA 244 
67  1 Y 1 C ALA 245 ? B ALA 245 
68  1 Y 1 C ALA 246 ? B ALA 246 
69  1 Y 1 C LEU 247 ? B LEU 247 
70  1 Y 1 C ASP 248 ? B ASP 248 
71  1 Y 1 C HIS 249 ? B HIS 249 
72  1 Y 1 C HIS 250 ? B HIS 250 
73  1 Y 1 B MET 1   ? C MET 1   
74  1 Y 1 B SER 2   ? C SER 2   
75  1 Y 1 B VAL 3   ? C VAL 3   
76  1 Y 1 B GLU 4   ? C GLU 4   
77  1 Y 1 B GLY 5   ? C GLY 5   
78  1 Y 1 B LEU 6   ? C LEU 6   
79  1 Y 1 B GLY 7   ? C GLY 7   
80  1 Y 1 B LYS 8   ? C LYS 8   
81  1 Y 1 B GLN 228 ? C GLN 228 
82  1 Y 1 B THR 229 ? C THR 229 
83  1 Y 1 B SER 230 ? C SER 230 
84  1 Y 1 B TYR 231 ? C TYR 231 
85  1 Y 1 B TYR 232 ? C TYR 232 
86  1 Y 1 B SER 233 ? C SER 233 
87  1 Y 1 B ASP 234 ? C ASP 234 
88  1 Y 1 B PRO 235 ? C PRO 235 
89  1 Y 1 B ASN 236 ? C ASN 236 
90  1 Y 1 B SER 237 ? C SER 237 
91  1 Y 1 B SER 238 ? C SER 238 
92  1 Y 1 B SER 239 ? C SER 239 
93  1 Y 1 B VAL 240 ? C VAL 240 
94  1 Y 1 B ASP 241 ? C ASP 241 
95  1 Y 1 B LYS 242 ? C LYS 242 
96  1 Y 1 B LEU 243 ? C LEU 243 
97  1 Y 1 B ALA 244 ? C ALA 244 
98  1 Y 1 B ALA 245 ? C ALA 245 
99  1 Y 1 B ALA 246 ? C ALA 246 
100 1 Y 1 B LEU 247 ? C LEU 247 
101 1 Y 1 B ASP 248 ? C ASP 248 
102 1 Y 1 B HIS 249 ? C HIS 249 
103 1 Y 1 B HIS 250 ? C HIS 250 
104 1 Y 1 D MET 1   ? D MET 1   
105 1 Y 1 D SER 2   ? D SER 2   
106 1 Y 1 D VAL 3   ? D VAL 3   
107 1 Y 1 D GLU 4   ? D GLU 4   
108 1 Y 1 D GLY 5   ? D GLY 5   
109 1 Y 1 D LEU 6   ? D LEU 6   
110 1 Y 1 D GLY 7   ? D GLY 7   
111 1 Y 1 D LYS 8   ? D LYS 8   
112 1 Y 1 D THR 229 ? D THR 229 
113 1 Y 1 D SER 230 ? D SER 230 
114 1 Y 1 D TYR 231 ? D TYR 231 
115 1 Y 1 D TYR 232 ? D TYR 232 
116 1 Y 1 D SER 233 ? D SER 233 
117 1 Y 1 D ASP 234 ? D ASP 234 
118 1 Y 1 D PRO 235 ? D PRO 235 
119 1 Y 1 D ASN 236 ? D ASN 236 
120 1 Y 1 D SER 237 ? D SER 237 
121 1 Y 1 D SER 238 ? D SER 238 
122 1 Y 1 D SER 239 ? D SER 239 
123 1 Y 1 D VAL 240 ? D VAL 240 
124 1 Y 1 D ASP 241 ? D ASP 241 
125 1 Y 1 D LYS 242 ? D LYS 242 
126 1 Y 1 D LEU 243 ? D LEU 243 
127 1 Y 1 D ALA 244 ? D ALA 244 
128 1 Y 1 D ALA 245 ? D ALA 245 
129 1 Y 1 D ALA 246 ? D ALA 246 
130 1 Y 1 D LEU 247 ? D LEU 247 
131 1 Y 1 D ASP 248 ? D ASP 248 
132 1 Y 1 D HIS 249 ? D HIS 249 
133 1 Y 1 D HIS 250 ? D HIS 250 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(3-CHLORO-4-HYDROXYPHENYL)ACETIC ACID' 3C4 
3 water                                   HOH 
#