data_3E6C
# 
_entry.id   3E6C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3E6C         pdb_00003e6c 10.2210/pdb3e6c/pdb 
NDB   PD1180       ?            ?                   
RCSB  RCSB048930   ?            ?                   
WWPDB D_1000048930 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 3E5Q unspecified . 
PDB 3E5U unspecified . 
PDB 3E6X unspecified . 
PDB 3E6B unspecified . 
PDB 3E6D unspecified . 
# 
_pdbx_database_status.entry_id                        3E6C 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Levy, C.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator' 
_citation.journal_abbrev            Mol.Microbiol. 
_citation.journal_volume            70 
_citation.page_first                151 
_citation.page_last                 167 
_citation.year                      2008 
_citation.journal_id_ASTM           MOMIEE 
_citation.country                   UK 
_citation.journal_id_ISSN           0950-382X 
_citation.journal_id_CSD            2007 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18717788 
_citation.pdbx_database_id_DOI      10.1111/j.1365-2958.2008.06399.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Levy, C.'         1 ? 
primary 'Pike, K.'         2 ? 
primary 'Heyes, D.J.'      3 ? 
primary 'Joyce, M.G.'      4 ? 
primary 'Gabor, K.'        5 ? 
primary 'Smidt, H.'        6 ? 
primary 'van der Oost, J.' 7 ? 
primary 'Leys, D.'         8 ? 
# 
_cell.entry_id           3E6C 
_cell.length_a           100.600 
_cell.length_b           100.600 
_cell.length_c           149.660 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3E6C 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                180 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cyclic nucleotide-binding protein'                                   28379.617 1   ? C200S ? ? 
2 polymer     syn 
;DNA (5'-D(P*DGP*DCP*DAP*DTP*DTP*DAP*DAP*DCP*DAP*DTP*DGP*DCP*DC)-3')
;
3935.587  1   ? ?     ? ? 
3 polymer     syn 
;DNA (5'-D(P*DGP*DGP*DCP*DAP*DTP*DGP*DTP*DTP*DAP*DAP*DTP*DGP*DC)-3')
;
4006.621  1   ? ?     ? ? 
4 non-polymer syn '(3-CHLORO-4-HYDROXYPHENYL)ACETIC ACID'                               186.592   1   ? ?     ? ? 
5 water       nat water                                                                 18.015    152 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CprK 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQTSYYSDPNSSSV
DKLAAALDHH
;
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQTSYYSDPNSSSV
DKLAAALDHH
;
C ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DA)(DT)(DT)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)' GCATTAACATGCC B ? 
3 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DA)(DT)(DG)(DT)(DT)(DA)(DA)(DT)(DG)(DC)' GGCATGTTAATGC A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   VAL n 
1 4   GLU n 
1 5   GLY n 
1 6   LEU n 
1 7   GLY n 
1 8   LYS n 
1 9   ASP n 
1 10  PHE n 
1 11  CYS n 
1 12  GLY n 
1 13  ALA n 
1 14  ILE n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  ASN n 
1 19  PHE n 
1 20  PHE n 
1 21  PRO n 
1 22  ILE n 
1 23  GLU n 
1 24  LYS n 
1 25  LEU n 
1 26  ARG n 
1 27  ASN n 
1 28  TYR n 
1 29  THR n 
1 30  GLN n 
1 31  MET n 
1 32  GLY n 
1 33  LEU n 
1 34  ILE n 
1 35  ARG n 
1 36  ASP n 
1 37  PHE n 
1 38  ALA n 
1 39  LYS n 
1 40  GLY n 
1 41  SER n 
1 42  ALA n 
1 43  VAL n 
1 44  ILE n 
1 45  MET n 
1 46  PRO n 
1 47  GLY n 
1 48  GLU n 
1 49  GLU n 
1 50  ILE n 
1 51  THR n 
1 52  SER n 
1 53  MET n 
1 54  ILE n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  GLU n 
1 59  GLY n 
1 60  LYS n 
1 61  ILE n 
1 62  LYS n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  ILE n 
1 67  PHE n 
1 68  GLU n 
1 69  ASP n 
1 70  GLY n 
1 71  SER n 
1 72  GLU n 
1 73  LYS n 
1 74  LEU n 
1 75  LEU n 
1 76  TYR n 
1 77  TYR n 
1 78  ALA n 
1 79  GLY n 
1 80  GLY n 
1 81  ASN n 
1 82  SER n 
1 83  LEU n 
1 84  ILE n 
1 85  GLY n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  PRO n 
1 90  THR n 
1 91  GLY n 
1 92  ASN n 
1 93  ASN n 
1 94  ILE n 
1 95  TYR n 
1 96  ALA n 
1 97  THR n 
1 98  ALA n 
1 99  MET n 
1 100 GLU n 
1 101 PRO n 
1 102 THR n 
1 103 ARG n 
1 104 THR n 
1 105 CYS n 
1 106 TRP n 
1 107 PHE n 
1 108 SER n 
1 109 GLU n 
1 110 LYS n 
1 111 SER n 
1 112 LEU n 
1 113 ARG n 
1 114 THR n 
1 115 VAL n 
1 116 PHE n 
1 117 ARG n 
1 118 THR n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 MET n 
1 123 ILE n 
1 124 PHE n 
1 125 GLU n 
1 126 ILE n 
1 127 PHE n 
1 128 LYS n 
1 129 ASN n 
1 130 TYR n 
1 131 LEU n 
1 132 THR n 
1 133 LYS n 
1 134 VAL n 
1 135 ALA n 
1 136 TYR n 
1 137 TYR n 
1 138 ALA n 
1 139 ARG n 
1 140 GLN n 
1 141 VAL n 
1 142 ALA n 
1 143 GLU n 
1 144 MET n 
1 145 ASN n 
1 146 THR n 
1 147 TYR n 
1 148 ASN n 
1 149 PRO n 
1 150 THR n 
1 151 ILE n 
1 152 ARG n 
1 153 ILE n 
1 154 LEU n 
1 155 ARG n 
1 156 LEU n 
1 157 PHE n 
1 158 TYR n 
1 159 GLU n 
1 160 LEU n 
1 161 CYS n 
1 162 SER n 
1 163 SER n 
1 164 GLN n 
1 165 GLY n 
1 166 LYS n 
1 167 ARG n 
1 168 VAL n 
1 169 GLY n 
1 170 ASP n 
1 171 THR n 
1 172 TYR n 
1 173 GLU n 
1 174 ILE n 
1 175 THR n 
1 176 MET n 
1 177 PRO n 
1 178 LEU n 
1 179 SER n 
1 180 GLN n 
1 181 LYS n 
1 182 SER n 
1 183 ILE n 
1 184 GLY n 
1 185 GLU n 
1 186 ILE n 
1 187 THR n 
1 188 GLY n 
1 189 VAL n 
1 190 HIS n 
1 191 HIS n 
1 192 VAL n 
1 193 THR n 
1 194 VAL n 
1 195 SER n 
1 196 ARG n 
1 197 VAL n 
1 198 LEU n 
1 199 ALA n 
1 200 SER n 
1 201 LEU n 
1 202 LYS n 
1 203 ARG n 
1 204 GLU n 
1 205 ASN n 
1 206 ILE n 
1 207 LEU n 
1 208 ASP n 
1 209 LYS n 
1 210 LYS n 
1 211 LYS n 
1 212 ASN n 
1 213 LYS n 
1 214 ILE n 
1 215 ILE n 
1 216 VAL n 
1 217 TYR n 
1 218 ASN n 
1 219 LEU n 
1 220 GLY n 
1 221 GLU n 
1 222 LEU n 
1 223 LYS n 
1 224 HIS n 
1 225 LEU n 
1 226 SER n 
1 227 GLU n 
1 228 GLN n 
1 229 THR n 
1 230 SER n 
1 231 TYR n 
1 232 TYR n 
1 233 SER n 
1 234 ASP n 
1 235 PRO n 
1 236 ASN n 
1 237 SER n 
1 238 SER n 
1 239 SER n 
1 240 VAL n 
1 241 ASP n 
1 242 LYS n 
1 243 LEU n 
1 244 ALA n 
1 245 ALA n 
1 246 ALA n 
1 247 LEU n 
1 248 ASP n 
1 249 HIS n 
1 250 HIS n 
2 1   DG  n 
2 2   DC  n 
2 3   DA  n 
2 4   DT  n 
2 5   DT  n 
2 6   DA  n 
2 7   DA  n 
2 8   DC  n 
2 9   DA  n 
2 10  DT  n 
2 11  DG  n 
2 12  DC  n 
2 13  DC  n 
3 1   DG  n 
3 2   DG  n 
3 3   DC  n 
3 4   DA  n 
3 5   DT  n 
3 6   DG  n 
3 7   DT  n 
3 8   DT  n 
3 9   DA  n 
3 10  DA  n 
3 11  DT  n 
3 12  DG  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Dhaf_0678 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    DCB-2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Desulfitobacterium hafniense' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272564 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTrc99 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 1 UNP Q18R04_DESHD Q18R04 1 
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSYY
;
? 
2 2 PDB 3E6C         3E6C   ? ? ? 
3 3 PDB 3E6C         3E6C   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3E6C C 1 ? 232 ? Q18R04 1   ? 232 ? 1   232 
2 2 3E6C B 1 ? 13  ? 3E6C   501 ? 513 ? 501 513 
3 3 3E6C A 1 ? 13  ? 3E6C   534 ? 546 ? 534 546 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3E6C SER C 200 ? UNP Q18R04 CYS 200 'engineered mutation' 200 1  
1 3E6C SER C 233 ? UNP Q18R04 ?   ?   'expression tag'      233 2  
1 3E6C ASP C 234 ? UNP Q18R04 ?   ?   'expression tag'      234 3  
1 3E6C PRO C 235 ? UNP Q18R04 ?   ?   'expression tag'      235 4  
1 3E6C ASN C 236 ? UNP Q18R04 ?   ?   'expression tag'      236 5  
1 3E6C SER C 237 ? UNP Q18R04 ?   ?   'expression tag'      237 6  
1 3E6C SER C 238 ? UNP Q18R04 ?   ?   'expression tag'      238 7  
1 3E6C SER C 239 ? UNP Q18R04 ?   ?   'expression tag'      239 8  
1 3E6C VAL C 240 ? UNP Q18R04 ?   ?   'expression tag'      240 9  
1 3E6C ASP C 241 ? UNP Q18R04 ?   ?   'expression tag'      241 10 
1 3E6C LYS C 242 ? UNP Q18R04 ?   ?   'expression tag'      242 11 
1 3E6C LEU C 243 ? UNP Q18R04 ?   ?   'expression tag'      243 12 
1 3E6C ALA C 244 ? UNP Q18R04 ?   ?   'expression tag'      244 13 
1 3E6C ALA C 245 ? UNP Q18R04 ?   ?   'expression tag'      245 14 
1 3E6C ALA C 246 ? UNP Q18R04 ?   ?   'expression tag'      246 15 
1 3E6C LEU C 247 ? UNP Q18R04 ?   ?   'expression tag'      247 16 
1 3E6C ASP C 248 ? UNP Q18R04 ?   ?   'expression tag'      248 17 
1 3E6C HIS C 249 ? UNP Q18R04 ?   ?   'expression tag'      249 18 
1 3E6C HIS C 250 ? UNP Q18R04 ?   ?   'expression tag'      250 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3C4 non-polymer         . '(3-CHLORO-4-HYDROXYPHENYL)ACETIC ACID' ? 'C8 H7 Cl O3'     186.592 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"    ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"     ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"    ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"            ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3E6C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.01 
_exptl_crystal.density_percent_sol   59.13 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3E6C 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             27.48 
_reflns.number_all                   39695 
_reflns.number_obs                   35026 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3E6C 
_refine.ls_number_reflns_obs                     35026 
_refine.ls_number_reflns_all                     39695 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.48 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    99.37 
_refine.ls_R_factor_obs                          0.21867 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21699 
_refine.ls_R_factor_R_free                       0.24956 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2108 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               46.792 
_refine.aniso_B[1][1]                            -0.33 
_refine.aniso_B[2][2]                            -0.33 
_refine.aniso_B[3][3]                            0.49 
_refine.aniso_B[1][2]                            -0.16 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.116 
_refine.pdbx_overall_ESU_R_Free                  0.115 
_refine.overall_SU_ML                            0.123 
_refine.overall_SU_B                             7.986 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1807 
_refine_hist.pdbx_number_atoms_nucleic_acid   533 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             152 
_refine_hist.number_atoms_total               2504 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        27.48 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.024  0.022  ? 2453 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.003  0.020  ? 1510 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.374  2.251  ? 3423 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.196  3.000  ? 3708 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.506  5.000  ? 224  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.826 23.780 ? 82   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.487 15.000 ? 339  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.131 15.000 ? 11   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.138  0.200  ? 385  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.020  ? 2305 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 440  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.216  0.200  ? 464  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.217  0.200  ? 1545 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.202  0.200  ? 1090 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.097  0.200  ? 1098 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.184  0.200  ? 132  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.553  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.287  0.200  ? 50   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.343  0.200  ? 13   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.532  1.500  ? 1253 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.408  1.500  ? 457  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.012  2.000  ? 1817 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.485  3.000  ? 1677 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.573  4.500  ? 1604 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_R_work             2838 
_refine_ls_shell.R_factor_R_work                  0.371 
_refine_ls_shell.percent_reflns_obs               99.14 
_refine_ls_shell.R_factor_R_free                  0.398 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             146 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3E6C 
_struct.title                     'CprK OCPA DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3E6C 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION/DNA' 
_struct_keywords.text            'CprK, Halorespiration, transcriptional regulator, TRANSCRIPTION REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 22  ? GLY A 32  ? ILE C 22  GLY C 32  5 ? 11 
HELX_P HELX_P2 2 SER A 108 ? ASP A 119 ? SER C 108 ASP C 119 1 ? 12 
HELX_P HELX_P3 3 GLU A 120 ? ASN A 145 ? GLU C 120 ASN C 145 1 ? 26 
HELX_P HELX_P4 4 ASN A 148 ? GLY A 165 ? ASN C 148 GLY C 165 1 ? 18 
HELX_P HELX_P5 5 SER A 179 ? GLY A 188 ? SER C 179 GLY C 188 1 ? 10 
HELX_P HELX_P6 6 HIS A 190 ? GLU A 204 ? HIS C 190 GLU C 204 1 ? 15 
HELX_P HELX_P7 7 ASN A 218 ? GLU A 227 ? ASN C 218 GLU C 227 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? B DG 1  N1 ? ? ? 1_555 C DC 13 N3 ? ? B DG 501 A DC 546 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog2  hydrog ? ? B DG 1  N2 ? ? ? 1_555 C DC 13 O2 ? ? B DG 501 A DC 546 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog3  hydrog ? ? B DG 1  O6 ? ? ? 1_555 C DC 13 N4 ? ? B DG 501 A DC 546 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog4  hydrog ? ? B DC 2  N3 ? ? ? 1_555 C DG 12 N1 ? ? B DC 502 A DG 545 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog5  hydrog ? ? B DC 2  N4 ? ? ? 1_555 C DG 12 O6 ? ? B DC 502 A DG 545 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog6  hydrog ? ? B DC 2  O2 ? ? ? 1_555 C DG 12 N2 ? ? B DC 502 A DG 545 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog7  hydrog ? ? B DA 3  N1 ? ? ? 1_555 C DT 11 N3 ? ? B DA 503 A DT 544 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog8  hydrog ? ? B DA 3  N6 ? ? ? 1_555 C DT 11 O4 ? ? B DA 503 A DT 544 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog9  hydrog ? ? B DT 4  N3 ? ? ? 1_555 C DA 10 N1 ? ? B DT 504 A DA 543 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog10 hydrog ? ? B DT 4  O4 ? ? ? 1_555 C DA 10 N6 ? ? B DT 504 A DA 543 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog11 hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA 9  N1 ? ? B DT 505 A DA 542 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog12 hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA 9  N6 ? ? B DT 505 A DA 542 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog13 hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 8  N3 ? ? B DA 506 A DT 541 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog14 hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 8  O4 ? ? B DA 506 A DT 541 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog15 hydrog ? ? B DA 7  N1 ? ? ? 1_555 C DT 7  N3 ? ? B DA 507 A DT 540 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog16 hydrog ? ? B DA 7  N6 ? ? ? 1_555 C DT 7  O4 ? ? B DA 507 A DT 540 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog17 hydrog ? ? B DC 8  N3 ? ? ? 1_555 C DG 6  N1 ? ? B DC 508 A DG 539 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog18 hydrog ? ? B DC 8  N4 ? ? ? 1_555 C DG 6  O6 ? ? B DC 508 A DG 539 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog19 hydrog ? ? B DC 8  O2 ? ? ? 1_555 C DG 6  N2 ? ? B DC 508 A DG 539 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog20 hydrog ? ? B DA 9  N1 ? ? ? 1_555 C DT 5  N3 ? ? B DA 509 A DT 538 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog21 hydrog ? ? B DA 9  N6 ? ? ? 1_555 C DT 5  O4 ? ? B DA 509 A DT 538 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog22 hydrog ? ? B DT 10 N3 ? ? ? 1_555 C DA 4  N1 ? ? B DT 510 A DA 537 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? ? 
hydrog23 hydrog ? ? B DG 11 N1 ? ? ? 1_555 C DC 3  N3 ? ? B DG 511 A DC 536 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog24 hydrog ? ? B DG 11 N2 ? ? ? 1_555 C DC 3  O2 ? ? B DG 511 A DC 536 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog25 hydrog ? ? B DG 11 O6 ? ? ? 1_555 C DC 3  N4 ? ? B DG 511 A DC 536 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog26 hydrog ? ? B DC 12 O2 ? ? ? 1_555 B DC 13 N4 ? ? B DC 512 B DC 513 1_555 ? ? ? ? ? ? 'DC-DC MISPAIR' ? ? ? 
hydrog27 hydrog ? ? B DC 12 N3 ? ? ? 1_555 C DG 1  N1 ? ? B DC 512 A DG 534 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog28 hydrog ? ? B DC 12 N4 ? ? ? 1_555 C DG 1  O6 ? ? B DC 512 A DG 534 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog29 hydrog ? ? B DC 12 O2 ? ? ? 1_555 C DG 1  N2 ? ? B DC 512 A DG 534 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 33  ? PHE A 37  ? LEU C 33  PHE C 37  
A 2 THR A 102 ? PHE A 107 ? THR C 102 PHE C 107 
A 3 MET A 53  ? GLU A 58  ? MET C 53  GLU C 58  
A 4 LEU A 83  ? ILE A 84  ? LEU C 83  ILE C 84  
B 1 ALA A 42  ? ILE A 44  ? ALA C 42  ILE C 44  
B 2 ILE A 94  ? ALA A 98  ? ILE C 94  ALA C 98  
B 3 ILE A 61  ? ILE A 66  ? ILE C 61  ILE C 66  
B 4 GLU A 72  ? ALA A 78  ? GLU C 72  ALA C 78  
C 1 LYS A 166 ? VAL A 168 ? LYS C 166 VAL C 168 
C 2 THR A 171 ? THR A 175 ? THR C 171 THR C 175 
C 3 LYS A 213 ? VAL A 216 ? LYS C 213 VAL C 216 
C 4 LEU A 207 ? LYS A 209 ? LEU C 207 LYS C 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 37  ? N PHE C 37  O THR A 102 ? O THR C 102 
A 2 3 O PHE A 107 ? O PHE C 107 N MET A 53  ? N MET C 53  
A 3 4 N ILE A 54  ? N ILE C 54  O ILE A 84  ? O ILE C 84  
B 1 2 N VAL A 43  ? N VAL C 43  O ALA A 96  ? O ALA C 96  
B 2 3 O TYR A 95  ? O TYR C 95  N ASP A 64  ? N ASP C 64  
B 3 4 N LEU A 63  ? N LEU C 63  O LEU A 75  ? O LEU C 75  
C 1 2 N LYS A 166 ? N LYS C 166 O GLU A 173 ? O GLU C 173 
C 2 3 N ILE A 174 ? N ILE C 174 O ILE A 214 ? O ILE C 214 
C 3 4 O ILE A 215 ? O ILE C 215 N ASP A 208 ? N ASP C 208 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    C 
_struct_site.pdbx_auth_comp_id    3C4 
_struct_site.pdbx_auth_seq_id     604 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE 3C4 C 604' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 TYR A 76  ? TYR C 76  . ? 1_555  ? 
2  AC1 10 ILE A 84  ? ILE C 84  . ? 1_555  ? 
3  AC1 10 GLY A 85  ? GLY C 85  . ? 1_555  ? 
4  AC1 10 LYS A 86  ? LYS C 86  . ? 1_555  ? 
5  AC1 10 THR A 90  ? THR C 90  . ? 1_555  ? 
6  AC1 10 ASN A 92  ? ASN C 92  . ? 1_555  ? 
7  AC1 10 ILE A 94  ? ILE C 94  . ? 1_555  ? 
8  AC1 10 TYR A 130 ? TYR C 130 . ? 1_555  ? 
9  AC1 10 LEU A 131 ? LEU C 131 . ? 11_555 ? 
10 AC1 10 LYS A 133 ? LYS C 133 . ? 1_555  ? 
# 
_atom_sites.entry_id                    3E6C 
_atom_sites.fract_transf_matrix[1][1]   0.009940 
_atom_sites.fract_transf_matrix[1][2]   0.005739 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011478 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006682 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 9   ? -13.680 55.547 4.604   1.00 67.14  ? 9    ASP C N     1 
ATOM   2    C  CA    . ASP A 1 9   ? -14.747 54.662 5.291   1.00 66.43  ? 9    ASP C CA    1 
ATOM   3    C  C     . ASP A 1 9   ? -14.538 53.098 5.058   1.00 64.80  ? 9    ASP C C     1 
ATOM   4    O  O     . ASP A 1 9   ? -14.821 52.372 5.976   1.00 65.08  ? 9    ASP C O     1 
ATOM   5    C  CB    . ASP A 1 9   ? -16.234 55.126 4.974   1.00 66.57  ? 9    ASP C CB    1 
ATOM   6    C  CG    . ASP A 1 9   ? -17.124 55.332 6.222   1.00 71.90  ? 9    ASP C CG    1 
ATOM   7    O  OD1   . ASP A 1 9   ? -18.036 56.195 6.162   1.00 75.42  ? 9    ASP C OD1   1 
ATOM   8    O  OD2   . ASP A 1 9   ? -16.985 54.665 7.293   1.00 80.86  ? 9    ASP C OD2   1 
ATOM   9    N  N     . PHE A 1 10  ? -14.074 52.557 3.920   1.00 63.38  ? 10   PHE C N     1 
ATOM   10   C  CA    . PHE A 1 10  ? -13.829 51.059 3.838   1.00 62.49  ? 10   PHE C CA    1 
ATOM   11   C  C     . PHE A 1 10  ? -12.908 50.517 2.718   1.00 60.98  ? 10   PHE C C     1 
ATOM   12   O  O     . PHE A 1 10  ? -13.209 50.636 1.487   1.00 61.42  ? 10   PHE C O     1 
ATOM   13   C  CB    . PHE A 1 10  ? -15.127 50.233 3.832   1.00 63.38  ? 10   PHE C CB    1 
ATOM   14   C  CG    . PHE A 1 10  ? -14.918 48.770 4.118   1.00 63.09  ? 10   PHE C CG    1 
ATOM   15   C  CD1   . PHE A 1 10  ? -14.722 48.327 5.418   1.00 63.49  ? 10   PHE C CD1   1 
ATOM   16   C  CD2   . PHE A 1 10  ? -14.912 47.839 3.085   1.00 67.06  ? 10   PHE C CD2   1 
ATOM   17   C  CE1   . PHE A 1 10  ? -14.531 47.006 5.685   1.00 64.14  ? 10   PHE C CE1   1 
ATOM   18   C  CE2   . PHE A 1 10  ? -14.716 46.473 3.346   1.00 65.90  ? 10   PHE C CE2   1 
ATOM   19   C  CZ    . PHE A 1 10  ? -14.525 46.063 4.654   1.00 65.32  ? 10   PHE C CZ    1 
ATOM   20   N  N     . CYS A 1 11  ? -11.770 49.955 3.135   1.00 57.27  ? 11   CYS C N     1 
ATOM   21   C  CA    . CYS A 1 11  ? -10.682 49.599 2.232   1.00 57.89  ? 11   CYS C CA    1 
ATOM   22   C  C     . CYS A 1 11  ? -10.581 48.064 2.148   1.00 59.61  ? 11   CYS C C     1 
ATOM   23   O  O     . CYS A 1 11  ? -9.621  47.433 2.624   1.00 60.49  ? 11   CYS C O     1 
ATOM   24   C  CB    . CYS A 1 11  ? -9.350  50.254 2.680   1.00 56.18  ? 11   CYS C CB    1 
ATOM   25   S  SG    . CYS A 1 11  ? -9.464  52.062 2.574   1.00 54.78  ? 11   CYS C SG    1 
ATOM   26   N  N     . GLY A 1 12  ? -11.593 47.484 1.496   1.00 59.85  ? 12   GLY C N     1 
ATOM   27   C  CA    . GLY A 1 12  ? -11.776 46.003 1.346   1.00 59.26  ? 12   GLY C CA    1 
ATOM   28   C  C     . GLY A 1 12  ? -11.887 45.579 -0.117  1.00 57.78  ? 12   GLY C C     1 
ATOM   29   O  O     . GLY A 1 12  ? -12.182 46.417 -1.011  1.00 58.34  ? 12   GLY C O     1 
ATOM   30   N  N     . ALA A 1 13  ? -11.517 44.317 -0.373  1.00 55.03  ? 13   ALA C N     1 
ATOM   31   C  CA    . ALA A 1 13  ? -11.633 43.668 -1.673  1.00 51.59  ? 13   ALA C CA    1 
ATOM   32   C  C     . ALA A 1 13  ? -11.686 42.169 -1.342  1.00 49.09  ? 13   ALA C C     1 
ATOM   33   O  O     . ALA A 1 13  ? -10.901 41.681 -0.582  1.00 48.08  ? 13   ALA C O     1 
ATOM   34   C  CB    . ALA A 1 13  ? -10.350 43.992 -2.616  1.00 51.14  ? 13   ALA C CB    1 
ATOM   35   N  N     . ILE A 1 14  ? -12.660 41.483 -1.850  1.00 48.58  ? 14   ILE C N     1 
ATOM   36   C  CA    . ILE A 1 14  ? -12.767 40.025 -1.790  1.00 47.83  ? 14   ILE C CA    1 
ATOM   37   C  C     . ILE A 1 14  ? -11.968 39.396 -2.954  1.00 49.20  ? 14   ILE C C     1 
ATOM   38   O  O     . ILE A 1 14  ? -11.381 38.316 -2.809  1.00 47.97  ? 14   ILE C O     1 
ATOM   39   C  CB    . ILE A 1 14  ? -14.249 39.658 -1.828  1.00 46.48  ? 14   ILE C CB    1 
ATOM   40   C  CG1   . ILE A 1 14  ? -14.907 40.166 -0.541  1.00 49.45  ? 14   ILE C CG1   1 
ATOM   41   C  CG2   . ILE A 1 14  ? -14.551 38.145 -1.928  1.00 48.10  ? 14   ILE C CG2   1 
ATOM   42   C  CD1   . ILE A 1 14  ? -16.285 39.751 -0.476  1.00 51.19  ? 14   ILE C CD1   1 
ATOM   43   N  N     . ILE A 1 15  ? -11.910 40.090 -4.096  1.00 49.24  ? 15   ILE C N     1 
ATOM   44   C  CA    . ILE A 1 15  ? -11.160 39.586 -5.262  1.00 49.21  ? 15   ILE C CA    1 
ATOM   45   C  C     . ILE A 1 15  ? -10.245 40.669 -5.810  1.00 49.23  ? 15   ILE C C     1 
ATOM   46   O  O     . ILE A 1 15  ? -10.469 41.845 -5.586  1.00 49.07  ? 15   ILE C O     1 
ATOM   47   C  CB    . ILE A 1 15  ? -12.044 39.005 -6.409  1.00 50.25  ? 15   ILE C CB    1 
ATOM   48   C  CG1   . ILE A 1 15  ? -13.054 39.985 -6.976  1.00 50.31  ? 15   ILE C CG1   1 
ATOM   49   C  CG2   . ILE A 1 15  ? -12.864 37.715 -5.970  1.00 43.33  ? 15   ILE C CG2   1 
ATOM   50   C  CD1   . ILE A 1 15  ? -13.642 39.491 -8.221  1.00 52.41  ? 15   ILE C CD1   1 
ATOM   51   N  N     . PRO A 1 16  ? -9.126  40.267 -6.411  1.00 48.40  ? 16   PRO C N     1 
ATOM   52   C  CA    . PRO A 1 16  ? -8.144  41.229 -6.846  1.00 48.36  ? 16   PRO C CA    1 
ATOM   53   C  C     . PRO A 1 16  ? -8.471  41.800 -8.242  1.00 52.26  ? 16   PRO C C     1 
ATOM   54   O  O     . PRO A 1 16  ? -7.745  41.606 -9.250  1.00 50.37  ? 16   PRO C O     1 
ATOM   55   C  CB    . PRO A 1 16  ? -6.882  40.424 -6.815  1.00 48.20  ? 16   PRO C CB    1 
ATOM   56   C  CG    . PRO A 1 16  ? -7.378  39.075 -7.300  1.00 48.36  ? 16   PRO C CG    1 
ATOM   57   C  CD    . PRO A 1 16  ? -8.658  38.885 -6.591  1.00 47.19  ? 16   PRO C CD    1 
ATOM   58   N  N     . ASP A 1 17  ? -9.555  42.547 -8.260  1.00 51.43  ? 17   ASP C N     1 
ATOM   59   C  CA    . ASP A 1 17  ? -10.086 43.111 -9.452  1.00 53.38  ? 17   ASP C CA    1 
ATOM   60   C  C     . ASP A 1 17  ? -10.650 44.464 -9.010  1.00 53.38  ? 17   ASP C C     1 
ATOM   61   O  O     . ASP A 1 17  ? -11.342 44.516 -7.973  1.00 53.27  ? 17   ASP C O     1 
ATOM   62   C  CB    . ASP A 1 17  ? -11.188 42.143 -9.967  1.00 54.24  ? 17   ASP C CB    1 
ATOM   63   C  CG    . ASP A 1 17  ? -11.761 42.542 -11.265 1.00 57.84  ? 17   ASP C CG    1 
ATOM   64   O  OD1   . ASP A 1 17  ? -11.134 43.235 -12.057 1.00 64.90  ? 17   ASP C OD1   1 
ATOM   65   O  OD2   . ASP A 1 17  ? -12.898 42.155 -11.501 1.00 68.19  ? 17   ASP C OD2   1 
ATOM   66   N  N     . ASN A 1 18  ? -10.321 45.553 -9.716  1.00 51.38  ? 18   ASN C N     1 
ATOM   67   C  CA    . ASN A 1 18  ? -10.886 46.868 -9.461  1.00 52.08  ? 18   ASN C CA    1 
ATOM   68   C  C     . ASN A 1 18  ? -10.717 47.335 -8.022  1.00 51.06  ? 18   ASN C C     1 
ATOM   69   O  O     . ASN A 1 18  ? -11.665 47.804 -7.378  1.00 49.57  ? 18   ASN C O     1 
ATOM   70   C  CB    . ASN A 1 18  ? -12.369 46.936 -9.806  1.00 52.83  ? 18   ASN C CB    1 
ATOM   71   C  CG    . ASN A 1 18  ? -12.655 46.743 -11.310 1.00 56.82  ? 18   ASN C CG    1 
ATOM   72   O  OD1   . ASN A 1 18  ? -11.965 47.275 -12.163 1.00 61.72  ? 18   ASN C OD1   1 
ATOM   73   N  ND2   . ASN A 1 18  ? -13.681 45.987 -11.611 1.00 54.13  ? 18   ASN C ND2   1 
ATOM   74   N  N     . PHE A 1 19  ? -9.509  47.256 -7.522  1.00 50.90  ? 19   PHE C N     1 
ATOM   75   C  CA    . PHE A 1 19  ? -9.250  47.715 -6.181  1.00 51.35  ? 19   PHE C CA    1 
ATOM   76   C  C     . PHE A 1 19  ? -9.516  49.207 -6.140  1.00 51.05  ? 19   PHE C C     1 
ATOM   77   O  O     . PHE A 1 19  ? -9.047  49.963 -7.033  1.00 53.14  ? 19   PHE C O     1 
ATOM   78   C  CB    . PHE A 1 19  ? -7.763  47.602 -5.870  1.00 50.92  ? 19   PHE C CB    1 
ATOM   79   C  CG    . PHE A 1 19  ? -7.246  46.199 -5.633  1.00 51.34  ? 19   PHE C CG    1 
ATOM   80   C  CD1   . PHE A 1 19  ? -6.180  45.680 -6.394  1.00 47.71  ? 19   PHE C CD1   1 
ATOM   81   C  CD2   . PHE A 1 19  ? -7.724  45.439 -4.577  1.00 49.41  ? 19   PHE C CD2   1 
ATOM   82   C  CE1   . PHE A 1 19  ? -5.678  44.455 -6.096  1.00 47.60  ? 19   PHE C CE1   1 
ATOM   83   C  CE2   . PHE A 1 19  ? -7.226  44.218 -4.311  1.00 50.64  ? 19   PHE C CE2   1 
ATOM   84   C  CZ    . PHE A 1 19  ? -6.189  43.734 -5.008  1.00 49.82  ? 19   PHE C CZ    1 
ATOM   85   N  N     . PHE A 1 20  ? -10.124 49.633 -5.025  1.00 49.18  ? 20   PHE C N     1 
ATOM   86   C  CA    . PHE A 1 20  ? -10.409 51.037 -4.741  1.00 47.37  ? 20   PHE C CA    1 
ATOM   87   C  C     . PHE A 1 20  ? -10.297 52.043 -5.875  1.00 47.80  ? 20   PHE C C     1 
ATOM   88   O  O     . PHE A 1 20  ? -9.367  52.838 -5.857  1.00 45.02  ? 20   PHE C O     1 
ATOM   89   C  CB    . PHE A 1 20  ? -9.560  51.572 -3.574  1.00 47.58  ? 20   PHE C CB    1 
ATOM   90   C  CG    . PHE A 1 20  ? -10.293 52.542 -2.746  1.00 46.17  ? 20   PHE C CG    1 
ATOM   91   C  CD1   . PHE A 1 20  ? -10.977 52.110 -1.651  1.00 48.93  ? 20   PHE C CD1   1 
ATOM   92   C  CD2   . PHE A 1 20  ? -10.292 53.863 -3.059  1.00 51.12  ? 20   PHE C CD2   1 
ATOM   93   C  CE1   . PHE A 1 20  ? -11.708 52.984 -0.881  1.00 46.76  ? 20   PHE C CE1   1 
ATOM   94   C  CE2   . PHE A 1 20  ? -11.022 54.757 -2.308  1.00 49.88  ? 20   PHE C CE2   1 
ATOM   95   C  CZ    . PHE A 1 20  ? -11.741 54.324 -1.250  1.00 49.12  ? 20   PHE C CZ    1 
ATOM   96   N  N     . PRO A 1 21  ? -11.257 52.021 -6.825  1.00 47.58  ? 21   PRO C N     1 
ATOM   97   C  CA    . PRO A 1 21  ? -11.201 53.047 -7.900  1.00 47.95  ? 21   PRO C CA    1 
ATOM   98   C  C     . PRO A 1 21  ? -11.324 54.468 -7.457  1.00 48.53  ? 21   PRO C C     1 
ATOM   99   O  O     . PRO A 1 21  ? -12.024 54.738 -6.463  1.00 48.26  ? 21   PRO C O     1 
ATOM   100  C  CB    . PRO A 1 21  ? -12.368 52.675 -8.778  1.00 47.58  ? 21   PRO C CB    1 
ATOM   101  C  CG    . PRO A 1 21  ? -12.503 51.224 -8.602  1.00 47.43  ? 21   PRO C CG    1 
ATOM   102  C  CD    . PRO A 1 21  ? -12.346 51.072 -7.075  1.00 47.48  ? 21   PRO C CD    1 
ATOM   103  N  N     . ILE A 1 22  ? -10.661 55.388 -8.155  1.00 47.35  ? 22   ILE C N     1 
ATOM   104  C  CA    . ILE A 1 22  ? -10.655 56.768 -7.706  1.00 48.20  ? 22   ILE C CA    1 
ATOM   105  C  C     . ILE A 1 22  ? -11.183 57.574 -8.901  1.00 48.78  ? 22   ILE C C     1 
ATOM   106  O  O     . ILE A 1 22  ? -10.418 58.048 -9.729  1.00 50.28  ? 22   ILE C O     1 
ATOM   107  C  CB    . ILE A 1 22  ? -9.243  57.314 -7.244  1.00 48.35  ? 22   ILE C CB    1 
ATOM   108  C  CG1   . ILE A 1 22  ? -8.614  56.537 -6.103  1.00 50.55  ? 22   ILE C CG1   1 
ATOM   109  C  CG2   . ILE A 1 22  ? -9.363  58.823 -6.808  1.00 46.21  ? 22   ILE C CG2   1 
ATOM   110  C  CD1   . ILE A 1 22  ? -7.054  56.745 -5.944  1.00 49.34  ? 22   ILE C CD1   1 
ATOM   111  N  N     . GLU A 1 23  ? -12.518 57.702 -8.970  1.00 48.81  ? 23   GLU C N     1 
ATOM   112  C  CA    . GLU A 1 23  ? -13.165 58.454 -9.998  1.00 49.60  ? 23   GLU C CA    1 
ATOM   113  C  C     . GLU A 1 23  ? -12.793 59.933 -10.010 1.00 50.75  ? 23   GLU C C     1 
ATOM   114  O  O     . GLU A 1 23  ? -12.792 60.566 -11.093 1.00 49.11  ? 23   GLU C O     1 
ATOM   115  C  CB    . GLU A 1 23  ? -14.667 58.306 -9.935  1.00 48.53  ? 23   GLU C CB    1 
ATOM   116  C  CG    . GLU A 1 23  ? -15.426 58.841 -11.168 1.00 54.43  ? 23   GLU C CG    1 
ATOM   117  C  CD    . GLU A 1 23  ? -15.918 60.288 -11.015 1.00 60.45  ? 23   GLU C CD    1 
ATOM   118  O  OE1   . GLU A 1 23  ? -16.331 60.886 -12.080 1.00 57.14  ? 23   GLU C OE1   1 
ATOM   119  O  OE2   . GLU A 1 23  ? -15.899 60.821 -9.834  1.00 62.18  ? 23   GLU C OE2   1 
ATOM   120  N  N     . LYS A 1 24  ? -12.490 60.523 -8.861  1.00 50.33  ? 24   LYS C N     1 
ATOM   121  C  CA    . LYS A 1 24  ? -12.140 61.923 -8.932  1.00 51.64  ? 24   LYS C CA    1 
ATOM   122  C  C     . LYS A 1 24  ? -10.830 62.241 -9.607  1.00 50.50  ? 24   LYS C C     1 
ATOM   123  O  O     . LYS A 1 24  ? -10.651 63.392 -9.962  1.00 52.10  ? 24   LYS C O     1 
ATOM   124  C  CB    . LYS A 1 24  ? -12.174 62.563 -7.557  1.00 52.10  ? 24   LYS C CB    1 
ATOM   125  C  CG    . LYS A 1 24  ? -13.586 62.637 -7.065  1.00 55.08  ? 24   LYS C CG    1 
ATOM   126  C  CD    . LYS A 1 24  ? -13.694 63.355 -5.631  1.00 55.89  ? 24   LYS C CD    1 
ATOM   127  C  CE    . LYS A 1 24  ? -14.190 64.823 -5.849  1.00 61.52  ? 24   LYS C CE    1 
ATOM   128  N  NZ    . LYS A 1 24  ? -13.588 65.357 -7.143  1.00 67.85  ? 24   LYS C NZ    1 
ATOM   129  N  N     . LEU A 1 25  ? -9.925  61.281 -9.807  1.00 50.53  ? 25   LEU C N     1 
ATOM   130  C  CA    . LEU A 1 25  ? -8.664  61.558 -10.472 1.00 50.96  ? 25   LEU C CA    1 
ATOM   131  C  C     . LEU A 1 25  ? -8.870  61.819 -11.944 1.00 51.00  ? 25   LEU C C     1 
ATOM   132  O  O     . LEU A 1 25  ? -7.961  62.288 -12.585 1.00 51.05  ? 25   LEU C O     1 
ATOM   133  C  CB    . LEU A 1 25  ? -7.649  60.413 -10.349 1.00 51.82  ? 25   LEU C CB    1 
ATOM   134  C  CG    . LEU A 1 25  ? -6.446  60.457 -9.461  1.00 55.83  ? 25   LEU C CG    1 
ATOM   135  C  CD1   . LEU A 1 25  ? -5.741  59.114 -9.565  1.00 56.84  ? 25   LEU C CD1   1 
ATOM   136  C  CD2   . LEU A 1 25  ? -5.552  61.582 -9.886  1.00 57.01  ? 25   LEU C CD2   1 
ATOM   137  N  N     . ARG A 1 26  ? -10.043 61.525 -12.469 1.00 50.97  ? 26   ARG C N     1 
ATOM   138  C  CA    . ARG A 1 26  ? -10.296 61.919 -13.835 1.00 51.26  ? 26   ARG C CA    1 
ATOM   139  C  C     . ARG A 1 26  ? -10.410 63.415 -14.046 1.00 50.49  ? 26   ARG C C     1 
ATOM   140  O  O     . ARG A 1 26  ? -10.271 63.825 -15.138 1.00 49.09  ? 26   ARG C O     1 
ATOM   141  C  CB    . ARG A 1 26  ? -11.434 61.153 -14.514 1.00 51.57  ? 26   ARG C CB    1 
ATOM   142  C  CG    . ARG A 1 26  ? -12.545 60.617 -13.736 1.00 54.62  ? 26   ARG C CG    1 
ATOM   143  C  CD    . ARG A 1 26  ? -13.590 60.055 -14.678 1.00 57.36  ? 26   ARG C CD    1 
ATOM   144  N  NE    . ARG A 1 26  ? -13.067 58.786 -15.051 1.00 64.55  ? 26   ARG C NE    1 
ATOM   145  C  CZ    . ARG A 1 26  ? -13.094 58.196 -16.246 1.00 52.99  ? 26   ARG C CZ    1 
ATOM   146  N  NH1   . ARG A 1 26  ? -13.627 58.664 -17.370 1.00 57.37  ? 26   ARG C NH1   1 
ATOM   147  N  NH2   . ARG A 1 26  ? -12.464 57.051 -16.291 1.00 57.05  ? 26   ARG C NH2   1 
ATOM   148  N  N     . ASN A 1 27  ? -10.649 64.208 -12.995 1.00 48.68  ? 27   ASN C N     1 
ATOM   149  C  CA    . ASN A 1 27  ? -10.596 65.668 -13.011 1.00 48.61  ? 27   ASN C CA    1 
ATOM   150  C  C     . ASN A 1 27  ? -9.195  66.265 -13.121 1.00 47.21  ? 27   ASN C C     1 
ATOM   151  O  O     . ASN A 1 27  ? -9.048  67.465 -13.300 1.00 48.97  ? 27   ASN C O     1 
ATOM   152  C  CB    . ASN A 1 27  ? -11.241 66.211 -11.705 1.00 51.19  ? 27   ASN C CB    1 
ATOM   153  C  CG    . ASN A 1 27  ? -12.691 65.775 -11.533 1.00 54.72  ? 27   ASN C CG    1 
ATOM   154  O  OD1   . ASN A 1 27  ? -13.430 65.761 -12.491 1.00 63.99  ? 27   ASN C OD1   1 
ATOM   155  N  ND2   . ASN A 1 27  ? -13.065 65.353 -10.363 1.00 56.10  ? 27   ASN C ND2   1 
ATOM   156  N  N     . TYR A 1 28  ? -8.161  65.432 -13.037 1.00 46.95  ? 28   TYR C N     1 
ATOM   157  C  CA    . TYR A 1 28  ? -6.780  65.864 -13.039 1.00 47.31  ? 28   TYR C CA    1 
ATOM   158  C  C     . TYR A 1 28  ? -5.881  65.172 -14.071 1.00 47.64  ? 28   TYR C C     1 
ATOM   159  O  O     . TYR A 1 28  ? -4.673  65.295 -14.040 1.00 46.16  ? 28   TYR C O     1 
ATOM   160  C  CB    . TYR A 1 28  ? -6.215  65.626 -11.630 1.00 48.91  ? 28   TYR C CB    1 
ATOM   161  C  CG    . TYR A 1 28  ? -7.065  66.287 -10.587 1.00 48.67  ? 28   TYR C CG    1 
ATOM   162  C  CD1   . TYR A 1 28  ? -7.870  65.543 -9.769  1.00 51.33  ? 28   TYR C CD1   1 
ATOM   163  C  CD2   . TYR A 1 28  ? -7.101  67.684 -10.460 1.00 51.80  ? 28   TYR C CD2   1 
ATOM   164  C  CE1   . TYR A 1 28  ? -8.685  66.143 -8.783  1.00 52.52  ? 28   TYR C CE1   1 
ATOM   165  C  CE2   . TYR A 1 28  ? -7.939  68.323 -9.492  1.00 51.80  ? 28   TYR C CE2   1 
ATOM   166  C  CZ    . TYR A 1 28  ? -8.701  67.514 -8.642  1.00 53.39  ? 28   TYR C CZ    1 
ATOM   167  O  OH    . TYR A 1 28  ? -9.490  68.072 -7.640  1.00 55.43  ? 28   TYR C OH    1 
ATOM   168  N  N     . THR A 1 29  ? -6.455  64.498 -15.052 1.00 48.98  ? 29   THR C N     1 
ATOM   169  C  CA    . THR A 1 29  ? -5.616  63.817 -16.029 1.00 48.55  ? 29   THR C CA    1 
ATOM   170  C  C     . THR A 1 29  ? -4.840  64.865 -16.910 1.00 47.83  ? 29   THR C C     1 
ATOM   171  O  O     . THR A 1 29  ? -3.793  64.574 -17.455 1.00 49.22  ? 29   THR C O     1 
ATOM   172  C  CB    . THR A 1 29  ? -6.465  62.828 -16.876 1.00 50.88  ? 29   THR C CB    1 
ATOM   173  O  OG1   . THR A 1 29  ? -7.636  63.511 -17.347 1.00 54.13  ? 29   THR C OG1   1 
ATOM   174  C  CG2   . THR A 1 29  ? -6.842  61.636 -16.059 1.00 51.39  ? 29   THR C CG2   1 
ATOM   175  N  N     . GLN A 1 30  ? -5.297  66.094 -17.028 1.00 47.70  ? 30   GLN C N     1 
ATOM   176  C  CA    . GLN A 1 30  ? -4.473  67.105 -17.712 1.00 48.27  ? 30   GLN C CA    1 
ATOM   177  C  C     . GLN A 1 30  ? -3.091  67.458 -17.090 1.00 47.05  ? 30   GLN C C     1 
ATOM   178  O  O     . GLN A 1 30  ? -2.262  68.120 -17.699 1.00 45.99  ? 30   GLN C O     1 
ATOM   179  C  CB    . GLN A 1 30  ? -5.311  68.377 -17.987 1.00 49.30  ? 30   GLN C CB    1 
ATOM   180  C  CG    . GLN A 1 30  ? -5.718  69.210 -16.781 1.00 53.22  ? 30   GLN C CG    1 
ATOM   181  C  CD    . GLN A 1 30  ? -6.684  68.562 -15.820 1.00 54.78  ? 30   GLN C CD    1 
ATOM   182  O  OE1   . GLN A 1 30  ? -7.312  67.546 -16.114 1.00 56.85  ? 30   GLN C OE1   1 
ATOM   183  N  NE2   . GLN A 1 30  ? -6.840  69.188 -14.660 1.00 54.73  ? 30   GLN C NE2   1 
ATOM   184  N  N     . MET A 1 31  ? -2.892  67.077 -15.845 1.00 48.23  ? 31   MET C N     1 
ATOM   185  C  CA    . MET A 1 31  ? -1.644  67.231 -15.147 1.00 48.15  ? 31   MET C CA    1 
ATOM   186  C  C     . MET A 1 31  ? -0.752  66.077 -15.389 1.00 47.13  ? 31   MET C C     1 
ATOM   187  O  O     . MET A 1 31  ? 0.427   66.129 -15.080 1.00 48.66  ? 31   MET C O     1 
ATOM   188  C  CB    . MET A 1 31  ? -1.911  67.462 -13.644 1.00 48.80  ? 31   MET C CB    1 
ATOM   189  C  CG    . MET A 1 31  ? -2.713  68.750 -13.466 1.00 47.35  ? 31   MET C CG    1 
ATOM   190  S  SD    . MET A 1 31  ? -3.449  68.886 -11.828 1.00 54.88  ? 31   MET C SD    1 
ATOM   191  C  CE    . MET A 1 31  ? -4.111  70.559 -11.868 1.00 50.23  ? 31   MET C CE    1 
ATOM   192  N  N     . GLY A 1 32  ? -1.296  65.025 -15.974 1.00 44.97  ? 32   GLY C N     1 
ATOM   193  C  CA    . GLY A 1 32  ? -0.499  63.837 -16.211 1.00 46.69  ? 32   GLY C CA    1 
ATOM   194  C  C     . GLY A 1 32  ? -0.376  63.625 -17.743 1.00 42.71  ? 32   GLY C C     1 
ATOM   195  O  O     . GLY A 1 32  ? -0.594  64.526 -18.610 1.00 44.95  ? 32   GLY C O     1 
ATOM   196  N  N     . LEU A 1 33  ? 0.035   62.432 -18.134 1.00 45.36  ? 33   LEU C N     1 
ATOM   197  C  CA    . LEU A 1 33  ? 0.251   62.137 -19.554 1.00 44.21  ? 33   LEU C CA    1 
ATOM   198  C  C     . LEU A 1 33  ? -0.662  61.063 -20.079 1.00 43.77  ? 33   LEU C C     1 
ATOM   199  O  O     . LEU A 1 33  ? -0.509  59.909 -19.773 1.00 43.48  ? 33   LEU C O     1 
ATOM   200  C  CB    . LEU A 1 33  ? 1.713   61.705 -19.757 1.00 46.58  ? 33   LEU C CB    1 
ATOM   201  C  CG    . LEU A 1 33  ? 2.798   62.781 -19.455 1.00 46.77  ? 33   LEU C CG    1 
ATOM   202  C  CD1   . LEU A 1 33  ? 4.141   62.101 -19.637 1.00 52.26  ? 33   LEU C CD1   1 
ATOM   203  C  CD2   . LEU A 1 33  ? 2.737   64.106 -20.556 1.00 44.74  ? 33   LEU C CD2   1 
ATOM   204  N  N     . ILE A 1 34  ? -1.497  61.313 -21.180 1.00 47.93  ? 34   ILE C N     1 
ATOM   205  C  CA    . ILE A 1 34  ? -2.387  60.306 -21.683 1.00 45.17  ? 34   ILE C CA    1 
ATOM   206  C  C     . ILE A 1 34  ? -1.576  59.333 -22.517 1.00 46.45  ? 34   ILE C C     1 
ATOM   207  O  O     . ILE A 1 34  ? -0.774  59.766 -23.446 1.00 45.82  ? 34   ILE C O     1 
ATOM   208  C  CB    . ILE A 1 34  ? -3.636  60.913 -22.412 1.00 47.66  ? 34   ILE C CB    1 
ATOM   209  C  CG1   . ILE A 1 34  ? -4.562  61.685 -21.458 1.00 44.12  ? 34   ILE C CG1   1 
ATOM   210  C  CG2   . ILE A 1 34  ? -4.375  59.829 -23.308 1.00 47.66  ? 34   ILE C CG2   1 
ATOM   211  C  CD1   . ILE A 1 34  ? -5.279  60.904 -20.462 1.00 45.00  ? 34   ILE C CD1   1 
ATOM   212  N  N     . ARG A 1 35  ? -1.920  58.068 -22.363 1.00 44.22  ? 35   ARG C N     1 
ATOM   213  C  CA    . ARG A 1 35  ? -1.279  57.029 -23.159 1.00 47.20  ? 35   ARG C CA    1 
ATOM   214  C  C     . ARG A 1 35  ? -2.276  55.876 -23.345 1.00 47.56  ? 35   ARG C C     1 
ATOM   215  O  O     . ARG A 1 35  ? -2.679  55.139 -22.376 1.00 40.25  ? 35   ARG C O     1 
ATOM   216  C  CB    . ARG A 1 35  ? -0.084  56.539 -22.499 1.00 46.97  ? 35   ARG C CB    1 
ATOM   217  C  CG    . ARG A 1 35  ? 1.105   56.386 -23.249 1.00 51.00  ? 35   ARG C CG    1 
ATOM   218  C  CD    . ARG A 1 35  ? 1.139   55.150 -23.896 1.00 58.27  ? 35   ARG C CD    1 
ATOM   219  N  NE    . ARG A 1 35  ? 2.498   54.672 -24.187 1.00 61.50  ? 35   ARG C NE    1 
ATOM   220  C  CZ    . ARG A 1 35  ? 2.804   53.919 -25.240 1.00 67.15  ? 35   ARG C CZ    1 
ATOM   221  N  NH1   . ARG A 1 35  ? 1.895   53.623 -26.222 1.00 73.37  ? 35   ARG C NH1   1 
ATOM   222  N  NH2   . ARG A 1 35  ? 4.055   53.483 -25.356 1.00 69.81  ? 35   ARG C NH2   1 
ATOM   223  N  N     . ASP A 1 36  ? -2.696  55.817 -24.563 1.00 46.09  ? 36   ASP C N     1 
ATOM   224  C  CA    . ASP A 1 36  ? -3.521  54.751 -25.183 1.00 49.25  ? 36   ASP C CA    1 
ATOM   225  C  C     . ASP A 1 36  ? -2.762  53.453 -25.643 1.00 52.23  ? 36   ASP C C     1 
ATOM   226  O  O     . ASP A 1 36  ? -1.580  53.484 -26.384 1.00 54.97  ? 36   ASP C O     1 
ATOM   227  C  CB    . ASP A 1 36  ? -4.254  55.249 -26.417 1.00 48.88  ? 36   ASP C CB    1 
ATOM   228  C  CG    . ASP A 1 36  ? -5.432  56.256 -26.144 1.00 42.23  ? 36   ASP C CG    1 
ATOM   229  O  OD1   . ASP A 1 36  ? -5.818  56.363 -24.994 1.00 47.44  ? 36   ASP C OD1   1 
ATOM   230  O  OD2   . ASP A 1 36  ? -6.049  56.882 -27.259 1.00 55.62  ? 36   ASP C OD2   1 
ATOM   231  N  N     . PHE A 1 37  ? -3.370  52.310 -25.160 1.00 50.97  ? 37   PHE C N     1 
ATOM   232  C  CA    . PHE A 1 37  ? -2.822  51.021 -25.697 1.00 50.30  ? 37   PHE C CA    1 
ATOM   233  C  C     . PHE A 1 37  ? -3.832  50.200 -26.452 1.00 48.18  ? 37   PHE C C     1 
ATOM   234  O  O     . PHE A 1 37  ? -5.013  50.150 -26.125 1.00 47.37  ? 37   PHE C O     1 
ATOM   235  C  CB    . PHE A 1 37  ? -2.265  50.150 -24.588 1.00 47.59  ? 37   PHE C CB    1 
ATOM   236  C  CG    . PHE A 1 37  ? -1.150  50.791 -23.832 1.00 50.43  ? 37   PHE C CG    1 
ATOM   237  C  CD1   . PHE A 1 37  ? -1.407  51.765 -22.854 1.00 47.17  ? 37   PHE C CD1   1 
ATOM   238  C  CD2   . PHE A 1 37  ? 0.173   50.489 -24.158 1.00 48.73  ? 37   PHE C CD2   1 
ATOM   239  C  CE1   . PHE A 1 37  ? -0.379  52.423 -22.211 1.00 49.79  ? 37   PHE C CE1   1 
ATOM   240  C  CE2   . PHE A 1 37  ? 1.241   51.147 -23.416 1.00 49.31  ? 37   PHE C CE2   1 
ATOM   241  C  CZ    . PHE A 1 37  ? 0.956   52.120 -22.516 1.00 48.86  ? 37   PHE C CZ    1 
ATOM   242  N  N     . ALA A 1 38  ? -3.308  49.467 -27.399 1.00 47.04  ? 38   ALA C N     1 
ATOM   243  C  CA    . ALA A 1 38  ? -4.077  48.538 -28.176 1.00 48.13  ? 38   ALA C CA    1 
ATOM   244  C  C     . ALA A 1 38  ? -4.277  47.221 -27.421 1.00 48.15  ? 38   ALA C C     1 
ATOM   245  O  O     . ALA A 1 38  ? -3.521  46.860 -26.544 1.00 47.34  ? 38   ALA C O     1 
ATOM   246  C  CB    . ALA A 1 38  ? -3.303  48.294 -29.472 1.00 45.63  ? 38   ALA C CB    1 
ATOM   247  N  N     . LYS A 1 39  ? -5.330  46.499 -27.774 1.00 48.98  ? 39   LYS C N     1 
ATOM   248  C  CA    . LYS A 1 39  ? -5.645  45.268 -27.106 1.00 50.66  ? 39   LYS C CA    1 
ATOM   249  C  C     . LYS A 1 39  ? -4.501  44.324 -27.391 1.00 49.85  ? 39   LYS C C     1 
ATOM   250  O  O     . LYS A 1 39  ? -4.106  44.135 -28.533 1.00 49.82  ? 39   LYS C O     1 
ATOM   251  C  CB    . LYS A 1 39  ? -6.950  44.695 -27.679 1.00 50.34  ? 39   LYS C CB    1 
ATOM   252  C  CG    . LYS A 1 39  ? -7.246  43.274 -27.267 1.00 52.39  ? 39   LYS C CG    1 
ATOM   253  C  CD    . LYS A 1 39  ? -8.718  42.914 -27.569 1.00 52.50  ? 39   LYS C CD    1 
ATOM   254  C  CE    . LYS A 1 39  ? -8.929  41.422 -27.432 1.00 54.71  ? 39   LYS C CE    1 
ATOM   255  N  NZ    . LYS A 1 39  ? -10.377 41.052 -27.551 1.00 52.97  ? 39   LYS C NZ    1 
ATOM   256  N  N     . GLY A 1 40  ? -3.963  43.736 -26.348 1.00 50.29  ? 40   GLY C N     1 
ATOM   257  C  CA    . GLY A 1 40  ? -2.928  42.758 -26.518 1.00 50.14  ? 40   GLY C CA    1 
ATOM   258  C  C     . GLY A 1 40  ? -1.574  43.364 -26.231 1.00 52.18  ? 40   GLY C C     1 
ATOM   259  O  O     . GLY A 1 40  ? -0.627  42.573 -26.117 1.00 55.16  ? 40   GLY C O     1 
ATOM   260  N  N     . SER A 1 41  ? -1.450  44.728 -26.144 1.00 50.37  ? 41   SER C N     1 
ATOM   261  C  CA    . SER A 1 41  ? -0.175  45.419 -25.950 1.00 49.00  ? 41   SER C CA    1 
ATOM   262  C  C     . SER A 1 41  ? 0.302   45.407 -24.535 1.00 48.77  ? 41   SER C C     1 
ATOM   263  O  O     . SER A 1 41  ? -0.534  45.432 -23.607 1.00 44.77  ? 41   SER C O     1 
ATOM   264  C  CB    . SER A 1 41  ? -0.340  46.911 -26.251 1.00 48.47  ? 41   SER C CB    1 
ATOM   265  O  OG    . SER A 1 41  ? -0.252  47.130 -27.629 1.00 53.44  ? 41   SER C OG    1 
ATOM   266  N  N     . ALA A 1 42  ? 1.633   45.497 -24.334 1.00 47.85  ? 42   ALA C N     1 
ATOM   267  C  CA    . ALA A 1 42  ? 2.202   45.665 -22.964 1.00 47.99  ? 42   ALA C CA    1 
ATOM   268  C  C     . ALA A 1 42  ? 2.126   47.143 -22.494 1.00 47.13  ? 42   ALA C C     1 
ATOM   269  O  O     . ALA A 1 42  ? 2.666   48.052 -23.158 1.00 44.99  ? 42   ALA C O     1 
ATOM   270  C  CB    . ALA A 1 42  ? 3.657   45.249 -23.005 1.00 48.58  ? 42   ALA C CB    1 
ATOM   271  N  N     . VAL A 1 43  ? 1.413   47.354 -21.391 1.00 47.45  ? 43   VAL C N     1 
ATOM   272  C  CA    . VAL A 1 43  ? 1.454   48.619 -20.620 1.00 47.20  ? 43   VAL C CA    1 
ATOM   273  C  C     . VAL A 1 43  ? 2.763   48.687 -19.814 1.00 46.59  ? 43   VAL C C     1 
ATOM   274  O  O     . VAL A 1 43  ? 3.365   49.731 -19.688 1.00 46.12  ? 43   VAL C O     1 
ATOM   275  C  CB    . VAL A 1 43  ? 0.190   48.789 -19.769 1.00 46.44  ? 43   VAL C CB    1 
ATOM   276  C  CG1   . VAL A 1 43  ? 0.229   50.111 -18.872 1.00 46.32  ? 43   VAL C CG1   1 
ATOM   277  C  CG2   . VAL A 1 43  ? -1.175  48.613 -20.624 1.00 44.35  ? 43   VAL C CG2   1 
ATOM   278  N  N     . ILE A 1 44  ? 3.172   47.556 -19.240 1.00 46.71  ? 44   ILE C N     1 
ATOM   279  C  CA    . ILE A 1 44  ? 4.463   47.405 -18.582 1.00 47.93  ? 44   ILE C CA    1 
ATOM   280  C  C     . ILE A 1 44  ? 5.071   46.164 -19.167 1.00 47.30  ? 44   ILE C C     1 
ATOM   281  O  O     . ILE A 1 44  ? 4.496   45.103 -19.084 1.00 45.54  ? 44   ILE C O     1 
ATOM   282  C  CB    . ILE A 1 44  ? 4.319   47.253 -17.030 1.00 46.98  ? 44   ILE C CB    1 
ATOM   283  C  CG1   . ILE A 1 44  ? 3.586   48.475 -16.462 1.00 47.02  ? 44   ILE C CG1   1 
ATOM   284  C  CG2   . ILE A 1 44  ? 5.680   46.890 -16.331 1.00 47.02  ? 44   ILE C CG2   1 
ATOM   285  C  CD1   . ILE A 1 44  ? 3.138   48.255 -14.962 1.00 47.32  ? 44   ILE C CD1   1 
ATOM   286  N  N     . MET A 1 45  ? 6.238   46.326 -19.768 1.00 51.43  ? 45   MET C N     1 
ATOM   287  C  CA    . MET A 1 45  ? 7.009   45.202 -20.289 1.00 55.29  ? 45   MET C CA    1 
ATOM   288  C  C     . MET A 1 45  ? 7.804   44.488 -19.198 1.00 53.85  ? 45   MET C C     1 
ATOM   289  O  O     . MET A 1 45  ? 8.291   45.114 -18.265 1.00 54.39  ? 45   MET C O     1 
ATOM   290  C  CB    . MET A 1 45  ? 7.978   45.651 -21.408 1.00 54.03  ? 45   MET C CB    1 
ATOM   291  C  CG    . MET A 1 45  ? 7.292   45.730 -22.727 1.00 60.90  ? 45   MET C CG    1 
ATOM   292  S  SD    . MET A 1 45  ? 7.717   47.317 -23.612 1.00 69.73  ? 45   MET C SD    1 
ATOM   293  C  CE    . MET A 1 45  ? 6.586   48.365 -22.566 1.00 68.26  ? 45   MET C CE    1 
ATOM   294  N  N     . PRO A 1 46  ? 8.009   43.176 -19.386 1.00 54.71  ? 46   PRO C N     1 
ATOM   295  C  CA    . PRO A 1 46  ? 8.856   42.397 -18.519 1.00 55.95  ? 46   PRO C CA    1 
ATOM   296  C  C     . PRO A 1 46  ? 10.212  43.081 -18.402 1.00 56.36  ? 46   PRO C C     1 
ATOM   297  O  O     . PRO A 1 46  ? 10.788  43.528 -19.404 1.00 56.97  ? 46   PRO C O     1 
ATOM   298  C  CB    . PRO A 1 46  ? 8.993   41.052 -19.256 1.00 55.71  ? 46   PRO C CB    1 
ATOM   299  C  CG    . PRO A 1 46  ? 7.895   40.987 -20.246 1.00 56.07  ? 46   PRO C CG    1 
ATOM   300  C  CD    . PRO A 1 46  ? 7.542   42.415 -20.566 1.00 56.25  ? 46   PRO C CD    1 
ATOM   301  N  N     . GLY A 1 47  ? 10.699  43.251 -17.195 1.00 56.80  ? 47   GLY C N     1 
ATOM   302  C  CA    . GLY A 1 47  ? 11.942  43.983 -17.034 1.00 55.83  ? 47   GLY C CA    1 
ATOM   303  C  C     . GLY A 1 47  ? 11.880  45.502 -17.177 1.00 56.05  ? 47   GLY C C     1 
ATOM   304  O  O     . GLY A 1 47  ? 12.877  46.130 -16.988 1.00 56.37  ? 47   GLY C O     1 
ATOM   305  N  N     . GLU A 1 48  ? 10.743  46.110 -17.503 1.00 56.09  ? 48   GLU C N     1 
ATOM   306  C  CA    . GLU A 1 48  ? 10.694  47.577 -17.653 1.00 56.28  ? 48   GLU C CA    1 
ATOM   307  C  C     . GLU A 1 48  ? 10.644  48.228 -16.235 1.00 55.64  ? 48   GLU C C     1 
ATOM   308  O  O     . GLU A 1 48  ? 9.910   47.761 -15.398 1.00 52.22  ? 48   GLU C O     1 
ATOM   309  C  CB    . GLU A 1 48  ? 9.449   47.972 -18.469 1.00 57.03  ? 48   GLU C CB    1 
ATOM   310  C  CG    . GLU A 1 48  ? 9.401   49.432 -18.798 1.00 58.49  ? 48   GLU C CG    1 
ATOM   311  C  CD    . GLU A 1 48  ? 8.172   49.890 -19.558 1.00 59.49  ? 48   GLU C CD    1 
ATOM   312  O  OE1   . GLU A 1 48  ? 8.139   51.088 -19.968 1.00 64.31  ? 48   GLU C OE1   1 
ATOM   313  O  OE2   . GLU A 1 48  ? 7.262   49.077 -19.786 1.00 59.64  ? 48   GLU C OE2   1 
ATOM   314  N  N     . GLU A 1 49  ? 11.444  49.261 -15.997 1.00 55.08  ? 49   GLU C N     1 
ATOM   315  C  CA    . GLU A 1 49  ? 11.414  49.949 -14.730 1.00 55.79  ? 49   GLU C CA    1 
ATOM   316  C  C     . GLU A 1 49  ? 10.396  51.075 -14.832 1.00 53.35  ? 49   GLU C C     1 
ATOM   317  O  O     . GLU A 1 49  ? 10.441  51.909 -15.705 1.00 52.03  ? 49   GLU C O     1 
ATOM   318  C  CB    . GLU A 1 49  ? 12.784  50.528 -14.352 1.00 56.81  ? 49   GLU C CB    1 
ATOM   319  C  CG    . GLU A 1 49  ? 12.793  50.974 -12.795 1.00 57.92  ? 49   GLU C CG    1 
ATOM   320  C  CD    . GLU A 1 49  ? 14.086  51.687 -12.435 1.00 60.61  ? 49   GLU C CD    1 
ATOM   321  O  OE1   . GLU A 1 49  ? 14.996  51.038 -11.835 1.00 67.35  ? 49   GLU C OE1   1 
ATOM   322  O  OE2   . GLU A 1 49  ? 14.187  52.889 -12.789 1.00 66.26  ? 49   GLU C OE2   1 
ATOM   323  N  N     . ILE A 1 50  ? 9.398   51.026 -13.986 1.00 50.14  ? 50   ILE C N     1 
ATOM   324  C  CA    . ILE A 1 50  ? 8.330   51.993 -13.991 1.00 48.40  ? 50   ILE C CA    1 
ATOM   325  C  C     . ILE A 1 50  ? 8.438   52.898 -12.760 1.00 50.38  ? 50   ILE C C     1 
ATOM   326  O  O     . ILE A 1 50  ? 8.629   52.388 -11.644 1.00 48.88  ? 50   ILE C O     1 
ATOM   327  C  CB    . ILE A 1 50  ? 6.975   51.208 -13.913 1.00 47.74  ? 50   ILE C CB    1 
ATOM   328  C  CG1   . ILE A 1 50  ? 6.787   50.288 -15.139 1.00 49.23  ? 50   ILE C CG1   1 
ATOM   329  C  CG2   . ILE A 1 50  ? 5.782   52.163 -13.813 1.00 45.63  ? 50   ILE C CG2   1 
ATOM   330  C  CD1   . ILE A 1 50  ? 6.699   51.030 -16.425 1.00 44.26  ? 50   ILE C CD1   1 
ATOM   331  N  N     . THR A 1 51  ? 8.334   54.204 -12.983 1.00 48.67  ? 51   THR C N     1 
ATOM   332  C  CA    . THR A 1 51  ? 8.344   55.166 -11.910 1.00 47.61  ? 51   THR C CA    1 
ATOM   333  C  C     . THR A 1 51  ? 7.259   56.244 -12.147 1.00 47.92  ? 51   THR C C     1 
ATOM   334  O  O     . THR A 1 51  ? 7.511   57.440 -12.153 1.00 48.82  ? 51   THR C O     1 
ATOM   335  C  CB    . THR A 1 51  ? 9.754   55.796 -11.735 1.00 48.54  ? 51   THR C CB    1 
ATOM   336  O  OG1   . THR A 1 51  ? 10.117  56.467 -12.941 1.00 51.64  ? 51   THR C OG1   1 
ATOM   337  C  CG2   . THR A 1 51  ? 10.841  54.812 -11.386 1.00 48.07  ? 51   THR C CG2   1 
ATOM   338  N  N     . SER A 1 52  ? 6.035   55.786 -12.275 1.00 49.33  ? 52   SER C N     1 
ATOM   339  C  CA    . SER A 1 52  ? 4.863   56.646 -12.482 1.00 50.69  ? 52   SER C CA    1 
ATOM   340  C  C     . SER A 1 52  ? 3.722   55.938 -11.894 1.00 49.19  ? 52   SER C C     1 
ATOM   341  O  O     . SER A 1 52  ? 3.655   54.717 -11.917 1.00 51.27  ? 52   SER C O     1 
ATOM   342  C  CB    . SER A 1 52  ? 4.490   56.840 -13.975 1.00 51.80  ? 52   SER C CB    1 
ATOM   343  O  OG    . SER A 1 52  ? 5.445   57.658 -14.620 1.00 50.70  ? 52   SER C OG    1 
ATOM   344  N  N     . MET A 1 53  ? 2.736   56.680 -11.418 1.00 48.34  ? 53   MET C N     1 
ATOM   345  C  CA    . MET A 1 53  ? 1.466   56.052 -11.179 1.00 48.91  ? 53   MET C CA    1 
ATOM   346  C  C     . MET A 1 53  ? 0.662   56.019 -12.495 1.00 48.54  ? 53   MET C C     1 
ATOM   347  O  O     . MET A 1 53  ? 0.753   56.953 -13.292 1.00 47.89  ? 53   MET C O     1 
ATOM   348  C  CB    . MET A 1 53  ? 0.749   56.805 -10.094 1.00 50.02  ? 53   MET C CB    1 
ATOM   349  C  CG    . MET A 1 53  ? 1.440   56.549 -8.628  1.00 50.07  ? 53   MET C CG    1 
ATOM   350  S  SD    . MET A 1 53  ? 0.304   56.779 -7.375  1.00 56.47  ? 53   MET C SD    1 
ATOM   351  C  CE    . MET A 1 53  ? 1.383   56.921 -6.006  1.00 45.42  ? 53   MET C CE    1 
ATOM   352  N  N     . ILE A 1 54  ? -0.075  54.950 -12.741 1.00 46.52  ? 54   ILE C N     1 
ATOM   353  C  CA    . ILE A 1 54  ? -0.761  54.757 -14.010 1.00 47.13  ? 54   ILE C CA    1 
ATOM   354  C  C     . ILE A 1 54  ? -2.246  54.617 -13.698 1.00 45.68  ? 54   ILE C C     1 
ATOM   355  O  O     . ILE A 1 54  ? -2.698  53.614 -13.177 1.00 44.47  ? 54   ILE C O     1 
ATOM   356  C  CB    . ILE A 1 54  ? -0.301  53.450 -14.803 1.00 46.41  ? 54   ILE C CB    1 
ATOM   357  C  CG1   . ILE A 1 54  ? 1.227   53.431 -14.983 1.00 47.42  ? 54   ILE C CG1   1 
ATOM   358  C  CG2   . ILE A 1 54  ? -0.912  53.410 -16.263 1.00 46.51  ? 54   ILE C CG2   1 
ATOM   359  C  CD1   . ILE A 1 54  ? 1.862   52.056 -15.293 1.00 48.20  ? 54   ILE C CD1   1 
ATOM   360  N  N     . PHE A 1 55  ? -2.990  55.631 -14.068 1.00 45.82  ? 55   PHE C N     1 
ATOM   361  C  CA    . PHE A 1 55  ? -4.408  55.700 -13.838 1.00 45.05  ? 55   PHE C CA    1 
ATOM   362  C  C     . PHE A 1 55  ? -5.112  55.125 -15.079 1.00 45.82  ? 55   PHE C C     1 
ATOM   363  O  O     . PHE A 1 55  ? -4.741  55.469 -16.149 1.00 47.20  ? 55   PHE C O     1 
ATOM   364  C  CB    . PHE A 1 55  ? -4.772  57.178 -13.620 1.00 43.79  ? 55   PHE C CB    1 
ATOM   365  C  CG    . PHE A 1 55  ? -6.260  57.410 -13.394 1.00 45.85  ? 55   PHE C CG    1 
ATOM   366  C  CD1   . PHE A 1 55  ? -6.914  56.814 -12.288 1.00 46.43  ? 55   PHE C CD1   1 
ATOM   367  C  CD2   . PHE A 1 55  ? -6.980  58.171 -14.297 1.00 48.55  ? 55   PHE C CD2   1 
ATOM   368  C  CE1   . PHE A 1 55  ? -8.234  57.032 -12.069 1.00 45.59  ? 55   PHE C CE1   1 
ATOM   369  C  CE2   . PHE A 1 55  ? -8.288  58.369 -14.133 1.00 49.06  ? 55   PHE C CE2   1 
ATOM   370  C  CZ    . PHE A 1 55  ? -8.958  57.792 -13.000 1.00 44.16  ? 55   PHE C CZ    1 
ATOM   371  N  N     . LEU A 1 56  ? -6.110  54.276 -14.914 1.00 48.55  ? 56   LEU C N     1 
ATOM   372  C  CA    . LEU A 1 56  ? -6.793  53.620 -16.017 1.00 48.03  ? 56   LEU C CA    1 
ATOM   373  C  C     . LEU A 1 56  ? -8.109  54.402 -16.216 1.00 48.77  ? 56   LEU C C     1 
ATOM   374  O  O     . LEU A 1 56  ? -9.041  54.453 -15.357 1.00 47.76  ? 56   LEU C O     1 
ATOM   375  C  CB    . LEU A 1 56  ? -6.966  52.127 -15.704 1.00 48.73  ? 56   LEU C CB    1 
ATOM   376  C  CG    . LEU A 1 56  ? -7.062  51.015 -16.736 1.00 51.96  ? 56   LEU C CG    1 
ATOM   377  C  CD1   . LEU A 1 56  ? -7.207  49.597 -16.184 1.00 55.94  ? 56   LEU C CD1   1 
ATOM   378  C  CD2   . LEU A 1 56  ? -8.238  51.365 -17.592 1.00 55.41  ? 56   LEU C CD2   1 
ATOM   379  N  N     . VAL A 1 57  ? -8.119  55.197 -17.270 1.00 47.48  ? 57   VAL C N     1 
ATOM   380  C  CA    . VAL A 1 57  ? -9.276  56.022 -17.612 1.00 47.54  ? 57   VAL C CA    1 
ATOM   381  C  C     . VAL A 1 57  ? -10.411 55.150 -18.216 1.00 49.04  ? 57   VAL C C     1 
ATOM   382  O  O     . VAL A 1 57  ? -11.577 55.320 -17.924 1.00 48.28  ? 57   VAL C O     1 
ATOM   383  C  CB    . VAL A 1 57  ? -8.894  57.129 -18.649 1.00 48.46  ? 57   VAL C CB    1 
ATOM   384  C  CG1   . VAL A 1 57  ? -10.155 57.973 -19.007 1.00 44.85  ? 57   VAL C CG1   1 
ATOM   385  C  CG2   . VAL A 1 57  ? -7.733  57.981 -18.137 1.00 44.70  ? 57   VAL C CG2   1 
ATOM   386  N  N     . GLU A 1 58  ? -10.058 54.189 -19.073 1.00 49.50  ? 58   GLU C N     1 
ATOM   387  C  CA    . GLU A 1 58  ? -11.042 53.345 -19.738 1.00 49.66  ? 58   GLU C CA    1 
ATOM   388  C  C     . GLU A 1 58  ? -10.346 52.057 -20.209 1.00 48.87  ? 58   GLU C C     1 
ATOM   389  O  O     . GLU A 1 58  ? -9.236  52.174 -20.718 1.00 47.95  ? 58   GLU C O     1 
ATOM   390  C  CB    . GLU A 1 58  ? -11.487 54.091 -20.969 1.00 52.58  ? 58   GLU C CB    1 
ATOM   391  C  CG    . GLU A 1 58  ? -12.608 53.483 -21.746 1.00 58.60  ? 58   GLU C CG    1 
ATOM   392  C  CD    . GLU A 1 58  ? -13.831 54.387 -21.707 1.00 67.03  ? 58   GLU C CD    1 
ATOM   393  O  OE1   . GLU A 1 58  ? -14.662 54.229 -22.664 1.00 67.74  ? 58   GLU C OE1   1 
ATOM   394  O  OE2   . GLU A 1 58  ? -13.909 55.242 -20.716 1.00 70.02  ? 58   GLU C OE2   1 
ATOM   395  N  N     . GLY A 1 59  ? -10.978 50.887 -20.087 1.00 47.14  ? 59   GLY C N     1 
ATOM   396  C  CA    . GLY A 1 59  ? -10.386 49.629 -20.548 1.00 46.76  ? 59   GLY C CA    1 
ATOM   397  C  C     . GLY A 1 59  ? -10.163 48.628 -19.430 1.00 48.04  ? 59   GLY C C     1 
ATOM   398  O  O     . GLY A 1 59  ? -10.888 48.595 -18.452 1.00 46.80  ? 59   GLY C O     1 
ATOM   399  N  N     . LYS A 1 60  ? -9.134  47.822 -19.578 1.00 49.24  ? 60   LYS C N     1 
ATOM   400  C  CA    . LYS A 1 60  ? -8.930  46.667 -18.737 1.00 49.90  ? 60   LYS C CA    1 
ATOM   401  C  C     . LYS A 1 60  ? -7.506  46.213 -18.883 1.00 49.22  ? 60   LYS C C     1 
ATOM   402  O  O     . LYS A 1 60  ? -7.069  45.924 -20.019 1.00 44.15  ? 60   LYS C O     1 
ATOM   403  C  CB    . LYS A 1 60  ? -9.799  45.496 -19.218 1.00 51.03  ? 60   LYS C CB    1 
ATOM   404  C  CG    . LYS A 1 60  ? -10.111 44.542 -18.067 1.00 51.96  ? 60   LYS C CG    1 
ATOM   405  C  CD    . LYS A 1 60  ? -10.766 43.302 -18.596 1.00 55.31  ? 60   LYS C CD    1 
ATOM   406  C  CE    . LYS A 1 60  ? -11.778 42.790 -17.646 1.00 60.48  ? 60   LYS C CE    1 
ATOM   407  N  NZ    . LYS A 1 60  ? -11.144 42.498 -16.384 1.00 65.52  ? 60   LYS C NZ    1 
ATOM   408  N  N     . ILE A 1 61  ? -6.798  46.128 -17.762 1.00 46.20  ? 61   ILE C N     1 
ATOM   409  C  CA    . ILE A 1 61  ? -5.400  45.609 -17.725 1.00 47.15  ? 61   ILE C CA    1 
ATOM   410  C  C     . ILE A 1 61  ? -5.287  44.330 -16.864 1.00 47.98  ? 61   ILE C C     1 
ATOM   411  O  O     . ILE A 1 61  ? -5.945  44.161 -15.813 1.00 48.55  ? 61   ILE C O     1 
ATOM   412  C  CB    . ILE A 1 61  ? -4.453  46.680 -17.261 1.00 47.43  ? 61   ILE C CB    1 
ATOM   413  C  CG1   . ILE A 1 61  ? -4.350  47.794 -18.289 1.00 48.12  ? 61   ILE C CG1   1 
ATOM   414  C  CG2   . ILE A 1 61  ? -3.084  46.113 -16.856 1.00 48.20  ? 61   ILE C CG2   1 
ATOM   415  C  CD1   . ILE A 1 61  ? -3.708  49.088 -17.779 1.00 47.29  ? 61   ILE C CD1   1 
ATOM   416  N  N     . LYS A 1 62  ? -4.506  43.370 -17.350 1.00 46.86  ? 62   LYS C N     1 
ATOM   417  C  CA    . LYS A 1 62  ? -4.170  42.218 -16.538 1.00 46.56  ? 62   LYS C CA    1 
ATOM   418  C  C     . LYS A 1 62  ? -2.752  42.387 -16.070 1.00 47.80  ? 62   LYS C C     1 
ATOM   419  O  O     . LYS A 1 62  ? -1.879  42.608 -16.844 1.00 45.25  ? 62   LYS C O     1 
ATOM   420  C  CB    . LYS A 1 62  ? -4.275  40.916 -17.296 1.00 48.46  ? 62   LYS C CB    1 
ATOM   421  C  CG    . LYS A 1 62  ? -3.978  39.685 -16.500 1.00 52.07  ? 62   LYS C CG    1 
ATOM   422  C  CD    . LYS A 1 62  ? -3.950  38.540 -17.467 1.00 54.81  ? 62   LYS C CD    1 
ATOM   423  C  CE    . LYS A 1 62  ? -3.994  37.174 -16.835 1.00 59.52  ? 62   LYS C CE    1 
ATOM   424  N  NZ    . LYS A 1 62  ? -2.656  36.750 -16.405 1.00 61.43  ? 62   LYS C NZ    1 
ATOM   425  N  N     . LEU A 1 63  ? -2.524  42.319 -14.784 1.00 45.96  ? 63   LEU C N     1 
ATOM   426  C  CA    . LEU A 1 63  ? -1.190  42.622 -14.229 1.00 46.37  ? 63   LEU C CA    1 
ATOM   427  C  C     . LEU A 1 63  ? -0.584  41.366 -13.489 1.00 47.59  ? 63   LEU C C     1 
ATOM   428  O  O     . LEU A 1 63  ? -1.182  40.811 -12.535 1.00 48.65  ? 63   LEU C O     1 
ATOM   429  C  CB    . LEU A 1 63  ? -1.287  43.856 -13.281 1.00 45.53  ? 63   LEU C CB    1 
ATOM   430  C  CG    . LEU A 1 63  ? 0.013   44.362 -12.734 1.00 48.15  ? 63   LEU C CG    1 
ATOM   431  C  CD1   . LEU A 1 63  ? 0.072   45.927 -12.834 1.00 46.29  ? 63   LEU C CD1   1 
ATOM   432  C  CD2   . LEU A 1 63  ? 0.415   43.837 -11.310 1.00 52.66  ? 63   LEU C CD2   1 
ATOM   433  N  N     . ASP A 1 64  ? 0.593   40.928 -13.935 1.00 46.72  ? 64   ASP C N     1 
ATOM   434  C  CA    . ASP A 1 64  ? 1.209   39.644 -13.548 1.00 46.96  ? 64   ASP C CA    1 
ATOM   435  C  C     . ASP A 1 64  ? 2.617   39.933 -13.001 1.00 46.52  ? 64   ASP C C     1 
ATOM   436  O  O     . ASP A 1 64  ? 3.160   40.984 -13.253 1.00 45.84  ? 64   ASP C O     1 
ATOM   437  C  CB    . ASP A 1 64  ? 1.392   38.649 -14.723 1.00 48.03  ? 64   ASP C CB    1 
ATOM   438  C  CG    . ASP A 1 64  ? 0.110   38.061 -15.269 1.00 48.76  ? 64   ASP C CG    1 
ATOM   439  O  OD1   . ASP A 1 64  ? -0.938  38.305 -14.737 1.00 53.19  ? 64   ASP C OD1   1 
ATOM   440  O  OD2   . ASP A 1 64  ? 0.170   37.350 -16.323 1.00 52.51  ? 64   ASP C OD2   1 
ATOM   441  N  N     . ILE A 1 65  ? 3.130   39.043 -12.165 1.00 47.15  ? 65   ILE C N     1 
ATOM   442  C  CA    . ILE A 1 65  ? 4.529   39.047 -11.779 1.00 48.35  ? 65   ILE C CA    1 
ATOM   443  C  C     . ILE A 1 65  ? 5.233   37.897 -12.522 1.00 49.19  ? 65   ILE C C     1 
ATOM   444  O  O     . ILE A 1 65  ? 4.646   36.866 -12.721 1.00 51.11  ? 65   ILE C O     1 
ATOM   445  C  CB    . ILE A 1 65  ? 4.682   38.861 -10.263 1.00 47.50  ? 65   ILE C CB    1 
ATOM   446  C  CG1   . ILE A 1 65  ? 6.145   39.013 -9.829  1.00 48.20  ? 65   ILE C CG1   1 
ATOM   447  C  CG2   . ILE A 1 65  ? 4.036   37.528 -9.799  1.00 48.18  ? 65   ILE C CG2   1 
ATOM   448  C  CD1   . ILE A 1 65  ? 6.160   39.218 -8.185  1.00 49.06  ? 65   ILE C CD1   1 
ATOM   449  N  N     . ILE A 1 66  ? 6.497   38.068 -12.872 1.00 49.69  ? 66   ILE C N     1 
ATOM   450  C  CA    . ILE A 1 66  ? 7.316   37.024 -13.442 1.00 49.56  ? 66   ILE C CA    1 
ATOM   451  C  C     . ILE A 1 66  ? 8.532   36.758 -12.560 1.00 48.88  ? 66   ILE C C     1 
ATOM   452  O  O     . ILE A 1 66  ? 9.311   37.636 -12.270 1.00 48.15  ? 66   ILE C O     1 
ATOM   453  C  CB    . ILE A 1 66  ? 7.796   37.423 -14.837 1.00 49.50  ? 66   ILE C CB    1 
ATOM   454  C  CG1   . ILE A 1 66  ? 6.613   37.855 -15.718 1.00 51.93  ? 66   ILE C CG1   1 
ATOM   455  C  CG2   . ILE A 1 66  ? 8.680   36.412 -15.478 1.00 47.51  ? 66   ILE C CG2   1 
ATOM   456  C  CD1   . ILE A 1 66  ? 7.118   38.361 -17.070 1.00 50.34  ? 66   ILE C CD1   1 
ATOM   457  N  N     . PHE A 1 67  ? 8.693   35.516 -12.174 1.00 49.55  ? 67   PHE C N     1 
ATOM   458  C  CA    . PHE A 1 67  ? 9.850   35.104 -11.434 1.00 50.46  ? 67   PHE C CA    1 
ATOM   459  C  C     . PHE A 1 67  ? 11.058  34.905 -12.345 1.00 52.12  ? 67   PHE C C     1 
ATOM   460  O  O     . PHE A 1 67  ? 10.976  34.815 -13.590 1.00 52.59  ? 67   PHE C O     1 
ATOM   461  C  CB    . PHE A 1 67  ? 9.536   33.857 -10.566 1.00 50.14  ? 67   PHE C CB    1 
ATOM   462  C  CG    . PHE A 1 67  ? 8.616   34.176 -9.412  1.00 51.30  ? 67   PHE C CG    1 
ATOM   463  C  CD1   . PHE A 1 67  ? 7.268   33.914 -9.497  1.00 52.77  ? 67   PHE C CD1   1 
ATOM   464  C  CD2   . PHE A 1 67  ? 9.094   34.810 -8.256  1.00 48.72  ? 67   PHE C CD2   1 
ATOM   465  C  CE1   . PHE A 1 67  ? 6.438   34.269 -8.477  1.00 52.46  ? 67   PHE C CE1   1 
ATOM   466  C  CE2   . PHE A 1 67  ? 8.264   35.132 -7.222  1.00 51.26  ? 67   PHE C CE2   1 
ATOM   467  C  CZ    . PHE A 1 67  ? 6.940   34.898 -7.341  1.00 49.11  ? 67   PHE C CZ    1 
ATOM   468  N  N     . GLU A 1 68  ? 12.187  34.798 -11.673 1.00 53.01  ? 68   GLU C N     1 
ATOM   469  C  CA    . GLU A 1 68  ? 13.520  34.613 -12.294 1.00 54.94  ? 68   GLU C CA    1 
ATOM   470  C  C     . GLU A 1 68  ? 13.569  33.381 -13.202 1.00 53.92  ? 68   GLU C C     1 
ATOM   471  O  O     . GLU A 1 68  ? 14.109  33.457 -14.300 1.00 56.12  ? 68   GLU C O     1 
ATOM   472  C  CB    . GLU A 1 68  ? 14.614  34.581 -11.181 1.00 55.56  ? 68   GLU C CB    1 
ATOM   473  C  CG    . GLU A 1 68  ? 14.354  35.618 -9.908  1.00 58.81  ? 68   GLU C CG    1 
ATOM   474  C  CD    . GLU A 1 68  ? 12.951  35.519 -9.071  1.00 59.49  ? 68   GLU C CD    1 
ATOM   475  O  OE1   . GLU A 1 68  ? 12.593  34.439 -8.479  1.00 54.78  ? 68   GLU C OE1   1 
ATOM   476  O  OE2   . GLU A 1 68  ? 12.238  36.563 -8.959  1.00 60.26  ? 68   GLU C OE2   1 
ATOM   477  N  N     . ASP A 1 69  ? 12.961  32.273 -12.798 1.00 52.54  ? 69   ASP C N     1 
ATOM   478  C  CA    . ASP A 1 69  ? 12.856  31.092 -13.647 1.00 52.83  ? 69   ASP C CA    1 
ATOM   479  C  C     . ASP A 1 69  ? 11.796  31.180 -14.736 1.00 53.19  ? 69   ASP C C     1 
ATOM   480  O  O     . ASP A 1 69  ? 11.493  30.188 -15.376 1.00 54.36  ? 69   ASP C O     1 
ATOM   481  C  CB    . ASP A 1 69  ? 12.591  29.865 -12.775 1.00 52.72  ? 69   ASP C CB    1 
ATOM   482  C  CG    . ASP A 1 69  ? 11.222  29.863 -12.130 1.00 53.35  ? 69   ASP C CG    1 
ATOM   483  O  OD1   . ASP A 1 69  ? 10.342  30.697 -12.443 1.00 52.84  ? 69   ASP C OD1   1 
ATOM   484  O  OD2   . ASP A 1 69  ? 11.029  28.977 -11.296 1.00 54.86  ? 69   ASP C OD2   1 
ATOM   485  N  N     . GLY A 1 70  ? 11.199  32.356 -14.921 1.00 54.20  ? 70   GLY C N     1 
ATOM   486  C  CA    . GLY A 1 70  ? 10.188  32.540 -15.920 1.00 53.83  ? 70   GLY C CA    1 
ATOM   487  C  C     . GLY A 1 70  ? 8.772   32.170 -15.530 1.00 53.77  ? 70   GLY C C     1 
ATOM   488  O  O     . GLY A 1 70  ? 7.870   32.324 -16.341 1.00 54.96  ? 70   GLY C O     1 
ATOM   489  N  N     . SER A 1 71  ? 8.542   31.671 -14.323 1.00 52.58  ? 71   SER C N     1 
ATOM   490  C  CA    . SER A 1 71  ? 7.171   31.425 -13.888 1.00 51.74  ? 71   SER C CA    1 
ATOM   491  C  C     . SER A 1 71  ? 6.401   32.714 -13.902 1.00 51.47  ? 71   SER C C     1 
ATOM   492  O  O     . SER A 1 71  ? 6.930   33.694 -13.456 1.00 52.78  ? 71   SER C O     1 
ATOM   493  C  CB    . SER A 1 71  ? 7.189   30.900 -12.474 1.00 51.91  ? 71   SER C CB    1 
ATOM   494  O  OG    . SER A 1 71  ? 7.641   29.587 -12.501 1.00 50.59  ? 71   SER C OG    1 
ATOM   495  N  N     . GLU A 1 72  ? 5.152   32.711 -14.346 1.00 50.80  ? 72   GLU C N     1 
ATOM   496  C  CA    . GLU A 1 72  ? 4.327   33.893 -14.373 1.00 50.95  ? 72   GLU C CA    1 
ATOM   497  C  C     . GLU A 1 72  ? 3.002   33.665 -13.639 1.00 51.11  ? 72   GLU C C     1 
ATOM   498  O  O     . GLU A 1 72  ? 2.341   32.629 -13.822 1.00 49.59  ? 72   GLU C O     1 
ATOM   499  C  CB    . GLU A 1 72  ? 4.060   34.336 -15.810 1.00 51.38  ? 72   GLU C CB    1 
ATOM   500  C  CG    . GLU A 1 72  ? 3.269   35.625 -15.904 1.00 51.68  ? 72   GLU C CG    1 
ATOM   501  C  CD    . GLU A 1 72  ? 3.036   36.102 -17.334 1.00 52.73  ? 72   GLU C CD    1 
ATOM   502  O  OE1   . GLU A 1 72  ? 3.779   35.658 -18.226 1.00 56.55  ? 72   GLU C OE1   1 
ATOM   503  O  OE2   . GLU A 1 72  ? 2.126   36.943 -17.579 1.00 56.44  ? 72   GLU C OE2   1 
ATOM   504  N  N     . LYS A 1 73  ? 2.636   34.637 -12.780 1.00 49.14  ? 73   LYS C N     1 
ATOM   505  C  CA    . LYS A 1 73  ? 1.410   34.564 -11.984 1.00 49.40  ? 73   LYS C CA    1 
ATOM   506  C  C     . LYS A 1 73  ? 0.602   35.827 -12.004 1.00 47.49  ? 73   LYS C C     1 
ATOM   507  O  O     . LYS A 1 73  ? 1.153   36.921 -12.031 1.00 49.14  ? 73   LYS C O     1 
ATOM   508  C  CB    . LYS A 1 73  ? 1.722   34.108 -10.542 1.00 49.03  ? 73   LYS C CB    1 
ATOM   509  C  CG    . LYS A 1 73  ? 2.507   32.746 -10.443 1.00 52.28  ? 73   LYS C CG    1 
ATOM   510  C  CD    . LYS A 1 73  ? 1.560   31.519 -10.560 1.00 52.18  ? 73   LYS C CD    1 
ATOM   511  C  CE    . LYS A 1 73  ? 2.307   30.296 -11.095 1.00 57.54  ? 73   LYS C CE    1 
ATOM   512  N  NZ    . LYS A 1 73  ? 1.389   29.177 -10.819 1.00 60.88  ? 73   LYS C NZ    1 
ATOM   513  N  N     . LEU A 1 74  ? -0.715  35.700 -11.905 1.00 48.84  ? 74   LEU C N     1 
ATOM   514  C  CA    . LEU A 1 74  ? -1.586  36.847 -11.775 1.00 49.68  ? 74   LEU C CA    1 
ATOM   515  C  C     . LEU A 1 74  ? -1.340  37.584 -10.468 1.00 51.38  ? 74   LEU C C     1 
ATOM   516  O  O     . LEU A 1 74  ? -1.317  36.927 -9.449  1.00 52.56  ? 74   LEU C O     1 
ATOM   517  C  CB    . LEU A 1 74  ? -3.037  36.408 -11.698 1.00 50.74  ? 74   LEU C CB    1 
ATOM   518  C  CG    . LEU A 1 74  ? -4.135  37.464 -11.589 1.00 50.89  ? 74   LEU C CG    1 
ATOM   519  C  CD1   . LEU A 1 74  ? -4.209  38.310 -12.864 1.00 51.90  ? 74   LEU C CD1   1 
ATOM   520  C  CD2   . LEU A 1 74  ? -5.458  36.718 -11.301 1.00 51.22  ? 74   LEU C CD2   1 
ATOM   521  N  N     . LEU A 1 75  ? -1.284  38.912 -10.521 1.00 51.41  ? 75   LEU C N     1 
ATOM   522  C  CA    . LEU A 1 75  ? -1.486  39.748 -9.350  1.00 50.04  ? 75   LEU C CA    1 
ATOM   523  C  C     . LEU A 1 75  ? -2.923  40.295 -9.246  1.00 50.29  ? 75   LEU C C     1 
ATOM   524  O  O     . LEU A 1 75  ? -3.606  40.066 -8.248  1.00 51.38  ? 75   LEU C O     1 
ATOM   525  C  CB    . LEU A 1 75  ? -0.407  40.810 -9.238  1.00 49.69  ? 75   LEU C CB    1 
ATOM   526  C  CG    . LEU A 1 75  ? 1.049   40.367 -8.973  1.00 50.95  ? 75   LEU C CG    1 
ATOM   527  C  CD1   . LEU A 1 75  ? 1.996   41.536 -8.683  1.00 48.39  ? 75   LEU C CD1   1 
ATOM   528  C  CD2   . LEU A 1 75  ? 1.163   39.297 -7.891  1.00 50.54  ? 75   LEU C CD2   1 
ATOM   529  N  N     . TYR A 1 76  ? -3.359  41.048 -10.246 1.00 48.48  ? 76   TYR C N     1 
ATOM   530  C  CA    . TYR A 1 76  ? -4.678  41.565 -10.275 1.00 47.57  ? 76   TYR C CA    1 
ATOM   531  C  C     . TYR A 1 76  ? -5.171  41.977 -11.641 1.00 48.51  ? 76   TYR C C     1 
ATOM   532  O  O     . TYR A 1 76  ? -4.403  42.069 -12.571 1.00 46.53  ? 76   TYR C O     1 
ATOM   533  C  CB    . TYR A 1 76  ? -4.801  42.748 -9.334  1.00 46.83  ? 76   TYR C CB    1 
ATOM   534  C  CG    . TYR A 1 76  ? -3.983  44.030 -9.602  1.00 43.96  ? 76   TYR C CG    1 
ATOM   535  C  CD1   . TYR A 1 76  ? -2.979  44.456 -8.720  1.00 49.63  ? 76   TYR C CD1   1 
ATOM   536  C  CD2   . TYR A 1 76  ? -4.326  44.889 -10.615 1.00 50.12  ? 76   TYR C CD2   1 
ATOM   537  C  CE1   . TYR A 1 76  ? -2.376  45.623 -8.880  1.00 47.65  ? 76   TYR C CE1   1 
ATOM   538  C  CE2   . TYR A 1 76  ? -3.709  46.077 -10.805 1.00 51.11  ? 76   TYR C CE2   1 
ATOM   539  C  CZ    . TYR A 1 76  ? -2.740  46.447 -9.923  1.00 47.27  ? 76   TYR C CZ    1 
ATOM   540  O  OH    . TYR A 1 76  ? -2.172  47.664 -10.026 1.00 48.11  ? 76   TYR C OH    1 
ATOM   541  N  N     . TYR A 1 77  ? -6.489  42.151 -11.742 1.00 49.37  ? 77   TYR C N     1 
ATOM   542  C  CA    . TYR A 1 77  ? -7.085  42.901 -12.835 1.00 49.83  ? 77   TYR C CA    1 
ATOM   543  C  C     . TYR A 1 77  ? -7.471  44.337 -12.432 1.00 49.81  ? 77   TYR C C     1 
ATOM   544  O  O     . TYR A 1 77  ? -7.910  44.620 -11.303 1.00 47.40  ? 77   TYR C O     1 
ATOM   545  C  CB    . TYR A 1 77  ? -8.309  42.205 -13.328 1.00 50.52  ? 77   TYR C CB    1 
ATOM   546  C  CG    . TYR A 1 77  ? -8.050  40.803 -13.835 1.00 51.30  ? 77   TYR C CG    1 
ATOM   547  C  CD1   . TYR A 1 77  ? -7.652  40.599 -15.155 1.00 53.81  ? 77   TYR C CD1   1 
ATOM   548  C  CD2   . TYR A 1 77  ? -8.238  39.698 -13.020 1.00 54.05  ? 77   TYR C CD2   1 
ATOM   549  C  CE1   . TYR A 1 77  ? -7.452  39.286 -15.673 1.00 55.22  ? 77   TYR C CE1   1 
ATOM   550  C  CE2   . TYR A 1 77  ? -8.039  38.374 -13.529 1.00 55.80  ? 77   TYR C CE2   1 
ATOM   551  C  CZ    . TYR A 1 77  ? -7.633  38.194 -14.827 1.00 54.27  ? 77   TYR C CZ    1 
ATOM   552  O  OH    . TYR A 1 77  ? -7.424  36.924 -15.382 1.00 58.01  ? 77   TYR C OH    1 
ATOM   553  N  N     . ALA A 1 78  ? -7.346  45.219 -13.428 1.00 48.88  ? 78   ALA C N     1 
ATOM   554  C  CA    . ALA A 1 78  ? -7.605  46.660 -13.334 1.00 48.26  ? 78   ALA C CA    1 
ATOM   555  C  C     . ALA A 1 78  ? -8.596  47.085 -14.407 1.00 48.79  ? 78   ALA C C     1 
ATOM   556  O  O     . ALA A 1 78  ? -8.471  46.738 -15.584 1.00 46.51  ? 78   ALA C O     1 
ATOM   557  C  CB    . ALA A 1 78  ? -6.318  47.469 -13.445 1.00 46.99  ? 78   ALA C CB    1 
ATOM   558  N  N     . GLY A 1 79  ? -9.588  47.844 -13.978 1.00 47.95  ? 79   GLY C N     1 
ATOM   559  C  CA    . GLY A 1 79  ? -10.635 48.419 -14.832 1.00 47.78  ? 79   GLY C CA    1 
ATOM   560  C  C     . GLY A 1 79  ? -10.668 49.947 -14.745 1.00 47.58  ? 79   GLY C C     1 
ATOM   561  O  O     . GLY A 1 79  ? -9.764  50.545 -14.312 1.00 49.33  ? 79   GLY C O     1 
ATOM   562  N  N     . GLY A 1 80  ? -11.748 50.559 -15.193 1.00 49.48  ? 80   GLY C N     1 
ATOM   563  C  CA    . GLY A 1 80  ? -11.849 52.013 -15.304 1.00 48.79  ? 80   GLY C CA    1 
ATOM   564  C  C     . GLY A 1 80  ? -11.725 52.587 -13.900 1.00 46.49  ? 80   GLY C C     1 
ATOM   565  O  O     . GLY A 1 80  ? -12.331 52.085 -12.968 1.00 46.75  ? 80   GLY C O     1 
ATOM   566  N  N     . ASN A 1 81  ? -10.911 53.645 -13.795 1.00 45.90  ? 81   ASN C N     1 
ATOM   567  C  CA    . ASN A 1 81  ? -10.652 54.363 -12.591 1.00 45.75  ? 81   ASN C CA    1 
ATOM   568  C  C     . ASN A 1 81  ? -9.750  53.645 -11.601 1.00 46.82  ? 81   ASN C C     1 
ATOM   569  O  O     . ASN A 1 81  ? -9.555  54.127 -10.499 1.00 45.68  ? 81   ASN C O     1 
ATOM   570  C  CB    . ASN A 1 81  ? -11.971 54.789 -11.923 1.00 47.22  ? 81   ASN C CB    1 
ATOM   571  C  CG    . ASN A 1 81  ? -12.795 55.730 -12.767 1.00 46.21  ? 81   ASN C CG    1 
ATOM   572  O  OD1   . ASN A 1 81  ? -14.022 55.723 -12.694 1.00 47.63  ? 81   ASN C OD1   1 
ATOM   573  N  ND2   . ASN A 1 81  ? -12.165 56.555 -13.519 1.00 42.96  ? 81   ASN C ND2   1 
ATOM   574  N  N     . SER A 1 82  ? -9.171  52.489 -11.972 1.00 46.80  ? 82   SER C N     1 
ATOM   575  C  CA    . SER A 1 82  ? -8.122  51.867 -11.202 1.00 47.41  ? 82   SER C CA    1 
ATOM   576  C  C     . SER A 1 82  ? -6.790  52.605 -11.330 1.00 46.87  ? 82   SER C C     1 
ATOM   577  O  O     . SER A 1 82  ? -6.535  53.404 -12.224 1.00 45.79  ? 82   SER C O     1 
ATOM   578  C  CB    . SER A 1 82  ? -7.910  50.372 -11.554 1.00 48.80  ? 82   SER C CB    1 
ATOM   579  O  OG    . SER A 1 82  ? -9.079  49.610 -11.188 1.00 50.03  ? 82   SER C OG    1 
ATOM   580  N  N     . LEU A 1 83  ? -5.971  52.360 -10.310 1.00 46.08  ? 83   LEU C N     1 
ATOM   581  C  CA    . LEU A 1 83  ? -4.654  52.969 -10.133 1.00 47.03  ? 83   LEU C CA    1 
ATOM   582  C  C     . LEU A 1 83  ? -3.593  51.867 -9.888  1.00 49.35  ? 83   LEU C C     1 
ATOM   583  O  O     . LEU A 1 83  ? -3.725  50.996 -9.020  1.00 49.98  ? 83   LEU C O     1 
ATOM   584  C  CB    . LEU A 1 83  ? -4.646  54.001 -9.015  1.00 50.12  ? 83   LEU C CB    1 
ATOM   585  C  CG    . LEU A 1 83  ? -3.395  54.863 -8.890  1.00 48.14  ? 83   LEU C CG    1 
ATOM   586  C  CD1   . LEU A 1 83  ? -3.370  55.908 -9.941  1.00 51.34  ? 83   LEU C CD1   1 
ATOM   587  C  CD2   . LEU A 1 83  ? -3.389  55.472 -7.398  1.00 44.88  ? 83   LEU C CD2   1 
ATOM   588  N  N     . ILE A 1 84  ? -2.611  51.821 -10.805 1.00 48.19  ? 84   ILE C N     1 
ATOM   589  C  CA    . ILE A 1 84  ? -1.295  51.150 -10.644 1.00 47.90  ? 84   ILE C CA    1 
ATOM   590  C  C     . ILE A 1 84  ? -0.292  52.020 -9.939  1.00 47.55  ? 84   ILE C C     1 
ATOM   591  O  O     . ILE A 1 84  ? 0.145   53.016 -10.439 1.00 47.64  ? 84   ILE C O     1 
ATOM   592  C  CB    . ILE A 1 84  ? -0.709  50.654 -12.028 1.00 47.77  ? 84   ILE C CB    1 
ATOM   593  C  CG1   . ILE A 1 84  ? -1.799  49.860 -12.794 1.00 48.94  ? 84   ILE C CG1   1 
ATOM   594  C  CG2   . ILE A 1 84  ? 0.494   49.728 -11.741 1.00 46.46  ? 84   ILE C CG2   1 
ATOM   595  C  CD1   . ILE A 1 84  ? -1.497  49.430 -14.342 1.00 47.05  ? 84   ILE C CD1   1 
ATOM   596  N  N     . GLY A 1 85  ? 0.042   51.647 -8.677  1.00 49.00  ? 85   GLY C N     1 
ATOM   597  C  CA    . GLY A 1 85  ? 0.792   52.503 -7.754  1.00 47.87  ? 85   GLY C CA    1 
ATOM   598  C  C     . GLY A 1 85  ? 2.287   52.301 -7.796  1.00 49.11  ? 85   GLY C C     1 
ATOM   599  O  O     . GLY A 1 85  ? 3.002   52.645 -6.858  1.00 47.95  ? 85   GLY C O     1 
ATOM   600  N  N     . LYS A 1 86  ? 2.816   52.002 -9.001  1.00 46.78  ? 86   LYS C N     1 
ATOM   601  C  CA    . LYS A 1 86  ? 4.300   51.775 -9.189  1.00 46.83  ? 86   LYS C CA    1 
ATOM   602  C  C     . LYS A 1 86  ? 5.192   53.003 -9.365  1.00 48.33  ? 86   LYS C C     1 
ATOM   603  O  O     . LYS A 1 86  ? 5.971   53.132 -10.323 1.00 47.12  ? 86   LYS C O     1 
ATOM   604  C  CB    . LYS A 1 86  ? 4.488   50.684 -10.256 1.00 48.29  ? 86   LYS C CB    1 
ATOM   605  C  CG    . LYS A 1 86  ? 3.930   49.361 -9.832  1.00 45.01  ? 86   LYS C CG    1 
ATOM   606  C  CD    . LYS A 1 86  ? 4.055   48.229 -10.904 1.00 46.88  ? 86   LYS C CD    1 
ATOM   607  C  CE    . LYS A 1 86  ? 5.395   48.062 -11.521 1.00 47.31  ? 86   LYS C CE    1 
ATOM   608  N  NZ    . LYS A 1 86  ? 6.608   47.909 -10.578 1.00 50.09  ? 86   LYS C NZ    1 
ATOM   609  N  N     . LEU A 1 87  ? 5.137   53.949 -8.409  1.00 45.49  ? 87   LEU C N     1 
ATOM   610  C  CA    . LEU A 1 87  ? 5.864   55.202 -8.541  1.00 46.00  ? 87   LEU C CA    1 
ATOM   611  C  C     . LEU A 1 87  ? 7.376   55.117 -8.376  1.00 45.49  ? 87   LEU C C     1 
ATOM   612  O  O     . LEU A 1 87  ? 8.138   55.998 -8.824  1.00 47.80  ? 87   LEU C O     1 
ATOM   613  C  CB    . LEU A 1 87  ? 5.351   56.200 -7.504  1.00 46.42  ? 87   LEU C CB    1 
ATOM   614  C  CG    . LEU A 1 87  ? 5.162   57.690 -7.707  1.00 48.29  ? 87   LEU C CG    1 
ATOM   615  C  CD1   . LEU A 1 87  ? 5.235   58.535 -6.497  1.00 46.79  ? 87   LEU C CD1   1 
ATOM   616  C  CD2   . LEU A 1 87  ? 5.558   58.364 -9.074  1.00 42.66  ? 87   LEU C CD2   1 
ATOM   617  N  N     . TYR A 1 88  ? 7.795   54.012 -7.780  1.00 46.53  ? 88   TYR C N     1 
ATOM   618  C  CA    . TYR A 1 88  ? 9.181   53.765 -7.395  1.00 46.84  ? 88   TYR C CA    1 
ATOM   619  C  C     . TYR A 1 88  ? 9.480   52.319 -7.728  1.00 45.89  ? 88   TYR C C     1 
ATOM   620  O  O     . TYR A 1 88  ? 8.552   51.475 -7.744  1.00 49.03  ? 88   TYR C O     1 
ATOM   621  C  CB    . TYR A 1 88  ? 9.408   54.002 -5.873  1.00 46.11  ? 88   TYR C CB    1 
ATOM   622  C  CG    . TYR A 1 88  ? 8.979   55.399 -5.465  1.00 47.43  ? 88   TYR C CG    1 
ATOM   623  C  CD1   . TYR A 1 88  ? 9.745   56.482 -5.811  1.00 45.95  ? 88   TYR C CD1   1 
ATOM   624  C  CD2   . TYR A 1 88  ? 7.800   55.645 -4.775  1.00 48.26  ? 88   TYR C CD2   1 
ATOM   625  C  CE1   . TYR A 1 88  ? 9.366   57.771 -5.535  1.00 48.11  ? 88   TYR C CE1   1 
ATOM   626  C  CE2   . TYR A 1 88  ? 7.396   56.954 -4.499  1.00 45.81  ? 88   TYR C CE2   1 
ATOM   627  C  CZ    . TYR A 1 88  ? 8.187   57.994 -4.880  1.00 43.92  ? 88   TYR C CZ    1 
ATOM   628  O  OH    . TYR A 1 88  ? 7.851   59.300 -4.653  1.00 48.78  ? 88   TYR C OH    1 
ATOM   629  N  N     . PRO A 1 89  ? 10.764  51.987 -7.946  1.00 46.60  ? 89   PRO C N     1 
ATOM   630  C  CA    . PRO A 1 89  ? 11.205  50.610 -8.171  1.00 47.68  ? 89   PRO C CA    1 
ATOM   631  C  C     . PRO A 1 89  ? 10.977  49.653 -6.976  1.00 49.30  ? 89   PRO C C     1 
ATOM   632  O  O     . PRO A 1 89  ? 11.156  50.054 -5.807  1.00 48.40  ? 89   PRO C O     1 
ATOM   633  C  CB    . PRO A 1 89  ? 12.685  50.771 -8.510  1.00 49.31  ? 89   PRO C CB    1 
ATOM   634  C  CG    . PRO A 1 89  ? 12.829  52.213 -8.905  1.00 47.31  ? 89   PRO C CG    1 
ATOM   635  C  CD    . PRO A 1 89  ? 11.870  52.902 -7.993  1.00 45.18  ? 89   PRO C CD    1 
ATOM   636  N  N     . THR A 1 90  ? 10.509  48.432 -7.262  1.00 49.56  ? 90   THR C N     1 
ATOM   637  C  CA    . THR A 1 90  ? 10.107  47.501 -6.215  1.00 52.72  ? 90   THR C CA    1 
ATOM   638  C  C     . THR A 1 90  ? 10.892  46.220 -6.112  1.00 55.49  ? 90   THR C C     1 
ATOM   639  O  O     . THR A 1 90  ? 10.735  45.456 -5.116  1.00 59.63  ? 90   THR C O     1 
ATOM   640  C  CB    . THR A 1 90  ? 8.690   47.113 -6.337  1.00 51.43  ? 90   THR C CB    1 
ATOM   641  O  OG1   . THR A 1 90  ? 8.527   46.258 -7.475  1.00 50.09  ? 90   THR C OG1   1 
ATOM   642  C  CG2   . THR A 1 90  ? 7.781   48.396 -6.406  1.00 49.00  ? 90   THR C CG2   1 
ATOM   643  N  N     . GLY A 1 91  ? 11.671  45.931 -7.106  1.00 55.19  ? 91   GLY C N     1 
ATOM   644  C  CA    . GLY A 1 91  ? 12.287  44.628 -7.105  1.00 56.23  ? 91   GLY C CA    1 
ATOM   645  C  C     . GLY A 1 91  ? 11.497  43.543 -7.789  1.00 55.10  ? 91   GLY C C     1 
ATOM   646  O  O     . GLY A 1 91  ? 12.045  42.490 -8.049  1.00 56.56  ? 91   GLY C O     1 
ATOM   647  N  N     . ASN A 1 92  ? 10.223  43.741 -8.082  1.00 53.23  ? 92   ASN C N     1 
ATOM   648  C  CA    . ASN A 1 92  ? 9.485   42.685 -8.743  1.00 49.95  ? 92   ASN C CA    1 
ATOM   649  C  C     . ASN A 1 92  ? 9.450   42.920 -10.251 1.00 51.25  ? 92   ASN C C     1 
ATOM   650  O  O     . ASN A 1 92  ? 9.272   44.050 -10.721 1.00 51.79  ? 92   ASN C O     1 
ATOM   651  C  CB    . ASN A 1 92  ? 8.056   42.595 -8.232  1.00 49.43  ? 92   ASN C CB    1 
ATOM   652  C  CG    . ASN A 1 92  ? 7.984   42.147 -6.759  1.00 46.21  ? 92   ASN C CG    1 
ATOM   653  O  OD1   . ASN A 1 92  ? 8.654   41.221 -6.400  1.00 48.57  ? 92   ASN C OD1   1 
ATOM   654  N  ND2   . ASN A 1 92  ? 7.046   42.723 -5.968  1.00 48.90  ? 92   ASN C ND2   1 
ATOM   655  N  N     . ASN A 1 93  ? 9.548   41.840 -11.005 1.00 50.44  ? 93   ASN C N     1 
ATOM   656  C  CA    . ASN A 1 93  ? 9.340   41.935 -12.464 1.00 49.93  ? 93   ASN C CA    1 
ATOM   657  C  C     . ASN A 1 93  ? 7.861   41.841 -12.854 1.00 49.28  ? 93   ASN C C     1 
ATOM   658  O  O     . ASN A 1 93  ? 7.242   40.800 -12.760 1.00 50.80  ? 93   ASN C O     1 
ATOM   659  C  CB    . ASN A 1 93  ? 10.124  40.841 -13.137 1.00 51.13  ? 93   ASN C CB    1 
ATOM   660  C  CG    . ASN A 1 93  ? 10.138  40.993 -14.688 1.00 55.02  ? 93   ASN C CG    1 
ATOM   661  O  OD1   . ASN A 1 93  ? 9.646   42.005 -15.200 1.00 59.68  ? 93   ASN C OD1   1 
ATOM   662  N  ND2   . ASN A 1 93  ? 10.650  39.975 -15.428 1.00 52.23  ? 93   ASN C ND2   1 
ATOM   663  N  N     . ILE A 1 94  ? 7.287   42.945 -13.285 1.00 48.39  ? 94   ILE C N     1 
ATOM   664  C  CA    . ILE A 1 94  ? 5.859   43.033 -13.515 1.00 48.60  ? 94   ILE C CA    1 
ATOM   665  C  C     . ILE A 1 94  ? 5.644   43.027 -15.060 1.00 48.75  ? 94   ILE C C     1 
ATOM   666  O  O     . ILE A 1 94  ? 6.414   43.638 -15.771 1.00 48.74  ? 94   ILE C O     1 
ATOM   667  C  CB    . ILE A 1 94  ? 5.327   44.318 -12.870 1.00 49.46  ? 94   ILE C CB    1 
ATOM   668  C  CG1   . ILE A 1 94  ? 5.511   44.244 -11.353 1.00 47.46  ? 94   ILE C CG1   1 
ATOM   669  C  CG2   . ILE A 1 94  ? 3.824   44.509 -13.162 1.00 48.58  ? 94   ILE C CG2   1 
ATOM   670  C  CD1   . ILE A 1 94  ? 4.818   43.089 -10.734 1.00 49.12  ? 94   ILE C CD1   1 
ATOM   671  N  N     . TYR A 1 95  ? 4.563   42.378 -15.508 1.00 48.04  ? 95   TYR C N     1 
ATOM   672  C  CA    . TYR A 1 95  ? 4.133   42.387 -16.902 1.00 49.26  ? 95   TYR C CA    1 
ATOM   673  C  C     . TYR A 1 95  ? 2.617   42.649 -16.902 1.00 47.32  ? 95   TYR C C     1 
ATOM   674  O  O     . TYR A 1 95  ? 1.856   41.878 -16.364 1.00 47.16  ? 95   TYR C O     1 
ATOM   675  C  CB    . TYR A 1 95  ? 4.430   41.023 -17.525 1.00 49.31  ? 95   TYR C CB    1 
ATOM   676  C  CG    . TYR A 1 95  ? 3.969   40.860 -18.957 1.00 49.74  ? 95   TYR C CG    1 
ATOM   677  C  CD1   . TYR A 1 95  ? 3.385   39.681 -19.383 1.00 52.94  ? 95   TYR C CD1   1 
ATOM   678  C  CD2   . TYR A 1 95  ? 4.122   41.889 -19.868 1.00 53.10  ? 95   TYR C CD2   1 
ATOM   679  C  CE1   . TYR A 1 95  ? 2.948   39.532 -20.714 1.00 56.27  ? 95   TYR C CE1   1 
ATOM   680  C  CE2   . TYR A 1 95  ? 3.709   41.751 -21.235 1.00 52.68  ? 95   TYR C CE2   1 
ATOM   681  C  CZ    . TYR A 1 95  ? 3.099   40.595 -21.622 1.00 53.36  ? 95   TYR C CZ    1 
ATOM   682  O  OH    . TYR A 1 95  ? 2.725   40.473 -22.973 1.00 58.21  ? 95   TYR C OH    1 
ATOM   683  N  N     . ALA A 1 96  ? 2.219   43.777 -17.492 1.00 47.23  ? 96   ALA C N     1 
ATOM   684  C  CA    . ALA A 1 96  ? 0.829   44.243 -17.499 1.00 47.95  ? 96   ALA C CA    1 
ATOM   685  C  C     . ALA A 1 96  ? 0.414   44.427 -18.952 1.00 46.70  ? 96   ALA C C     1 
ATOM   686  O  O     . ALA A 1 96  ? 1.117   45.092 -19.721 1.00 48.30  ? 96   ALA C O     1 
ATOM   687  C  CB    . ALA A 1 96  ? 0.653   45.574 -16.691 1.00 45.23  ? 96   ALA C CB    1 
ATOM   688  N  N     . THR A 1 97  ? -0.651  43.730 -19.345 1.00 48.46  ? 97   THR C N     1 
ATOM   689  C  CA    . THR A 1 97  ? -1.161  43.730 -20.724 1.00 48.66  ? 97   THR C CA    1 
ATOM   690  C  C     . THR A 1 97  ? -2.565  44.309 -20.799 1.00 47.90  ? 97   THR C C     1 
ATOM   691  O  O     . THR A 1 97  ? -3.356  44.166 -19.904 1.00 47.31  ? 97   THR C O     1 
ATOM   692  C  CB    . THR A 1 97  ? -1.125  42.310 -21.350 1.00 51.08  ? 97   THR C CB    1 
ATOM   693  O  OG1   . THR A 1 97  ? -2.019  41.455 -20.625 1.00 55.32  ? 97   THR C OG1   1 
ATOM   694  C  CG2   . THR A 1 97  ? 0.291   41.764 -21.274 1.00 54.01  ? 97   THR C CG2   1 
ATOM   695  N  N     . ALA A 1 98  ? -2.832  45.070 -21.838 1.00 47.66  ? 98   ALA C N     1 
ATOM   696  C  CA    . ALA A 1 98  ? -4.168  45.612 -22.138 1.00 48.89  ? 98   ALA C CA    1 
ATOM   697  C  C     . ALA A 1 98  ? -5.061  44.472 -22.656 1.00 49.97  ? 98   ALA C C     1 
ATOM   698  O  O     . ALA A 1 98  ? -4.800  43.929 -23.748 1.00 51.86  ? 98   ALA C O     1 
ATOM   699  C  CB    . ALA A 1 98  ? -4.078  46.775 -23.269 1.00 46.30  ? 98   ALA C CB    1 
ATOM   700  N  N     . MET A 1 99  ? -6.136  44.170 -21.932 1.00 50.68  ? 99   MET C N     1 
ATOM   701  C  CA    . MET A 1 99  ? -7.059  43.103 -22.328 1.00 53.14  ? 99   MET C CA    1 
ATOM   702  C  C     . MET A 1 99  ? -8.063  43.630 -23.342 1.00 53.70  ? 99   MET C C     1 
ATOM   703  O  O     . MET A 1 99  ? -8.765  42.882 -24.081 1.00 51.69  ? 99   MET C O     1 
ATOM   704  C  CB    . MET A 1 99  ? -7.769  42.545 -21.090 1.00 53.90  ? 99   MET C CB    1 
ATOM   705  C  CG    . MET A 1 99  ? -6.871  41.668 -20.250 1.00 56.23  ? 99   MET C CG    1 
ATOM   706  S  SD    . MET A 1 99  ? -7.692  41.166 -18.693 1.00 60.03  ? 99   MET C SD    1 
ATOM   707  C  CE    . MET A 1 99  ? -7.930  42.669 -17.769 1.00 69.76  ? 99   MET C CE    1 
ATOM   708  N  N     . GLU A 1 100 ? -8.127  44.946 -23.393 1.00 54.20  ? 100  GLU C N     1 
ATOM   709  C  CA    . GLU A 1 100 ? -8.962  45.622 -24.353 1.00 54.38  ? 100  GLU C CA    1 
ATOM   710  C  C     . GLU A 1 100 ? -8.319  46.959 -24.718 1.00 51.53  ? 100  GLU C C     1 
ATOM   711  O  O     . GLU A 1 100 ? -7.311  47.399 -24.067 1.00 52.93  ? 100  GLU C O     1 
ATOM   712  C  CB    . GLU A 1 100 ? -10.412 45.710 -23.791 1.00 54.79  ? 100  GLU C CB    1 
ATOM   713  C  CG    . GLU A 1 100 ? -10.695 46.668 -22.670 1.00 59.28  ? 100  GLU C CG    1 
ATOM   714  C  CD    . GLU A 1 100 ? -12.141 46.502 -22.065 1.00 60.18  ? 100  GLU C CD    1 
ATOM   715  O  OE1   . GLU A 1 100 ? -12.924 47.500 -21.994 1.00 66.31  ? 100  GLU C OE1   1 
ATOM   716  O  OE2   . GLU A 1 100 ? -12.467 45.364 -21.661 1.00 66.77  ? 100  GLU C OE2   1 
ATOM   717  N  N     . PRO A 1 101 ? -8.874  47.656 -25.695 1.00 50.30  ? 101  PRO C N     1 
ATOM   718  C  CA    . PRO A 1 101 ? -8.287  48.977 -25.933 1.00 49.21  ? 101  PRO C CA    1 
ATOM   719  C  C     . PRO A 1 101 ? -8.452  49.817 -24.698 1.00 47.93  ? 101  PRO C C     1 
ATOM   720  O  O     . PRO A 1 101 ? -9.589  49.912 -24.144 1.00 47.64  ? 101  PRO C O     1 
ATOM   721  C  CB    . PRO A 1 101 ? -9.101  49.549 -27.108 1.00 48.23  ? 101  PRO C CB    1 
ATOM   722  C  CG    . PRO A 1 101 ? -9.738  48.335 -27.785 1.00 50.48  ? 101  PRO C CG    1 
ATOM   723  C  CD    . PRO A 1 101 ? -9.973  47.353 -26.630 1.00 49.08  ? 101  PRO C CD    1 
ATOM   724  N  N     . THR A 1 102 ? -7.325  50.380 -24.237 1.00 47.25  ? 102  THR C N     1 
ATOM   725  C  CA    . THR A 1 102 ? -7.211  50.941 -22.913 1.00 47.22  ? 102  THR C CA    1 
ATOM   726  C  C     . THR A 1 102 ? -6.557  52.316 -23.005 1.00 47.08  ? 102  THR C C     1 
ATOM   727  O  O     . THR A 1 102 ? -5.493  52.467 -23.636 1.00 43.20  ? 102  THR C O     1 
ATOM   728  C  CB    . THR A 1 102 ? -6.412  49.976 -21.976 1.00 45.83  ? 102  THR C CB    1 
ATOM   729  O  OG1   . THR A 1 102 ? -7.177  48.758 -21.804 1.00 44.94  ? 102  THR C OG1   1 
ATOM   730  C  CG2   . THR A 1 102 ? -6.115  50.592 -20.718 1.00 50.17  ? 102  THR C CG2   1 
ATOM   731  N  N     . ARG A 1 103 ? -7.235  53.296 -22.330 1.00 46.29  ? 103  ARG C N     1 
ATOM   732  C  CA    . ARG A 1 103 ? -6.625  54.620 -21.996 1.00 46.42  ? 103  ARG C CA    1 
ATOM   733  C  C     . ARG A 1 103 ? -6.125  54.784 -20.606 1.00 47.18  ? 103  ARG C C     1 
ATOM   734  O  O     . ARG A 1 103 ? -6.852  54.564 -19.612 1.00 43.21  ? 103  ARG C O     1 
ATOM   735  C  CB    . ARG A 1 103 ? -7.646  55.730 -22.427 1.00 47.19  ? 103  ARG C CB    1 
ATOM   736  C  CG    . ARG A 1 103 ? -7.162  57.204 -22.177 1.00 48.24  ? 103  ARG C CG    1 
ATOM   737  C  CD    . ARG A 1 103 ? -8.002  58.252 -23.079 1.00 46.71  ? 103  ARG C CD    1 
ATOM   738  N  NE    . ARG A 1 103 ? -7.703  58.248 -24.479 1.00 52.38  ? 103  ARG C NE    1 
ATOM   739  C  CZ    . ARG A 1 103 ? -8.393  58.952 -25.353 1.00 47.60  ? 103  ARG C CZ    1 
ATOM   740  N  NH1   . ARG A 1 103 ? -9.419  59.657 -24.924 1.00 51.18  ? 103  ARG C NH1   1 
ATOM   741  N  NH2   . ARG A 1 103 ? -8.094  58.932 -26.679 1.00 57.88  ? 103  ARG C NH2   1 
ATOM   742  N  N     . THR A 1 104 ? -4.823  55.137 -20.501 1.00 46.13  ? 104  THR C N     1 
ATOM   743  C  CA    . THR A 1 104 ? -4.133  55.378 -19.289 1.00 46.71  ? 104  THR C CA    1 
ATOM   744  C  C     . THR A 1 104 ? -3.763  56.839 -19.229 1.00 46.09  ? 104  THR C C     1 
ATOM   745  O  O     . THR A 1 104 ? -3.729  57.556 -20.281 1.00 42.41  ? 104  THR C O     1 
ATOM   746  C  CB    . THR A 1 104 ? -2.884  54.421 -19.124 1.00 46.44  ? 104  THR C CB    1 
ATOM   747  O  OG1   . THR A 1 104 ? -1.912  54.696 -20.135 1.00 45.56  ? 104  THR C OG1   1 
ATOM   748  C  CG2   . THR A 1 104 ? -3.327  52.960 -19.263 1.00 40.95  ? 104  THR C CG2   1 
ATOM   749  N  N     . CYS A 1 105 ? -3.368  57.199 -18.036 1.00 44.90  ? 105  CYS C N     1 
ATOM   750  C  CA    . CYS A 1 105 ? -2.850  58.495 -17.642 1.00 46.15  ? 105  CYS C CA    1 
ATOM   751  C  C     . CYS A 1 105 ? -1.655  58.279 -16.623 1.00 45.22  ? 105  CYS C C     1 
ATOM   752  O  O     . CYS A 1 105 ? -1.800  57.630 -15.604 1.00 48.67  ? 105  CYS C O     1 
ATOM   753  C  CB    . CYS A 1 105 ? -3.897  59.405 -16.999 1.00 46.74  ? 105  CYS C CB    1 
ATOM   754  S  SG    . CYS A 1 105 ? -3.248  61.056 -16.756 1.00 47.91  ? 105  CYS C SG    1 
ATOM   755  N  N     . TRP A 1 106 ? -0.463  58.683 -17.060 1.00 47.08  ? 106  TRP C N     1 
ATOM   756  C  CA    . TRP A 1 106 ? 0.805   58.458 -16.364 1.00 45.91  ? 106  TRP C CA    1 
ATOM   757  C  C     . TRP A 1 106 ? 1.111   59.694 -15.533 1.00 46.63  ? 106  TRP C C     1 
ATOM   758  O  O     . TRP A 1 106 ? 1.208   60.821 -15.988 1.00 46.86  ? 106  TRP C O     1 
ATOM   759  C  CB    . TRP A 1 106 ? 1.927   58.060 -17.340 1.00 47.85  ? 106  TRP C CB    1 
ATOM   760  C  CG    . TRP A 1 106 ? 1.692   56.725 -17.994 1.00 46.94  ? 106  TRP C CG    1 
ATOM   761  C  CD1   . TRP A 1 106 ? 0.601   56.337 -18.748 1.00 48.78  ? 106  TRP C CD1   1 
ATOM   762  C  CD2   . TRP A 1 106 ? 2.548   55.603 -17.941 1.00 49.52  ? 106  TRP C CD2   1 
ATOM   763  N  NE1   . TRP A 1 106 ? 0.710   55.005 -19.114 1.00 46.66  ? 106  TRP C NE1   1 
ATOM   764  C  CE2   . TRP A 1 106 ? 1.924   54.553 -18.650 1.00 48.48  ? 106  TRP C CE2   1 
ATOM   765  C  CE3   . TRP A 1 106 ? 3.826   55.385 -17.404 1.00 49.57  ? 106  TRP C CE3   1 
ATOM   766  C  CZ2   . TRP A 1 106 ? 2.539   53.331 -18.820 1.00 49.68  ? 106  TRP C CZ2   1 
ATOM   767  C  CZ3   . TRP A 1 106 ? 4.417   54.157 -17.574 1.00 49.32  ? 106  TRP C CZ3   1 
ATOM   768  C  CH2   . TRP A 1 106 ? 3.787   53.163 -18.286 1.00 49.81  ? 106  TRP C CH2   1 
ATOM   769  N  N     . PHE A 1 107 ? 1.262   59.439 -14.232 1.00 44.69  ? 107  PHE C N     1 
ATOM   770  C  CA    . PHE A 1 107 ? 1.496   60.540 -13.257 1.00 45.19  ? 107  PHE C CA    1 
ATOM   771  C  C     . PHE A 1 107 ? 2.865   60.313 -12.680 1.00 44.00  ? 107  PHE C C     1 
ATOM   772  O  O     . PHE A 1 107 ? 3.089   59.370 -11.892 1.00 48.55  ? 107  PHE C O     1 
ATOM   773  C  CB    . PHE A 1 107 ? 0.452   60.516 -12.147 1.00 45.16  ? 107  PHE C CB    1 
ATOM   774  C  CG    . PHE A 1 107 ? -0.935  61.011 -12.537 1.00 45.84  ? 107  PHE C CG    1 
ATOM   775  C  CD1   . PHE A 1 107 ? -1.964  60.120 -12.703 1.00 48.26  ? 107  PHE C CD1   1 
ATOM   776  C  CD2   . PHE A 1 107 ? -1.189  62.400 -12.694 1.00 47.75  ? 107  PHE C CD2   1 
ATOM   777  C  CE1   . PHE A 1 107 ? -3.256  60.572 -13.000 1.00 49.15  ? 107  PHE C CE1   1 
ATOM   778  C  CE2   . PHE A 1 107 ? -2.444  62.876 -13.019 1.00 45.82  ? 107  PHE C CE2   1 
ATOM   779  C  CZ    . PHE A 1 107 ? -3.507  61.921 -13.193 1.00 47.88  ? 107  PHE C CZ    1 
ATOM   780  N  N     . SER A 1 108 ? 3.791   61.177 -13.022 1.00 44.89  ? 108  SER C N     1 
ATOM   781  C  CA    . SER A 1 108 ? 5.058   61.180 -12.334 1.00 45.32  ? 108  SER C CA    1 
ATOM   782  C  C     . SER A 1 108 ? 4.985   61.786 -10.947 1.00 46.58  ? 108  SER C C     1 
ATOM   783  O  O     . SER A 1 108 ? 3.934   62.245 -10.542 1.00 48.38  ? 108  SER C O     1 
ATOM   784  C  CB    . SER A 1 108 ? 6.041   61.980 -13.135 1.00 43.67  ? 108  SER C CB    1 
ATOM   785  O  OG    . SER A 1 108 ? 5.755   63.374 -13.091 1.00 41.99  ? 108  SER C OG    1 
ATOM   786  N  N     . GLU A 1 109 ? 6.080   61.698 -10.193 1.00 46.46  ? 109  GLU C N     1 
ATOM   787  C  CA    . GLU A 1 109 ? 6.156   62.338 -8.845  1.00 45.75  ? 109  GLU C CA    1 
ATOM   788  C  C     . GLU A 1 109 ? 5.925   63.808 -8.955  1.00 45.71  ? 109  GLU C C     1 
ATOM   789  O  O     . GLU A 1 109 ? 5.121   64.322 -8.253  1.00 45.45  ? 109  GLU C O     1 
ATOM   790  C  CB    . GLU A 1 109 ? 7.499   62.075 -8.178  1.00 45.82  ? 109  GLU C CB    1 
ATOM   791  C  CG    . GLU A 1 109 ? 7.488   62.487 -6.733  1.00 49.27  ? 109  GLU C CG    1 
ATOM   792  C  CD    . GLU A 1 109 ? 8.811   62.348 -6.066  1.00 52.51  ? 109  GLU C CD    1 
ATOM   793  O  OE1   . GLU A 1 109 ? 9.098   61.274 -5.513  1.00 59.81  ? 109  GLU C OE1   1 
ATOM   794  O  OE2   . GLU A 1 109 ? 9.498   63.346 -6.015  1.00 53.86  ? 109  GLU C OE2   1 
ATOM   795  N  N     . LYS A 1 110 ? 6.570   64.504 -9.882  1.00 46.28  ? 110  LYS C N     1 
ATOM   796  C  CA    . LYS A 1 110 ? 6.340   65.951 -10.064 1.00 47.87  ? 110  LYS C CA    1 
ATOM   797  C  C     . LYS A 1 110 ? 4.897   66.273 -10.366 1.00 46.93  ? 110  LYS C C     1 
ATOM   798  O  O     . LYS A 1 110 ? 4.387   67.275 -9.919  1.00 48.50  ? 110  LYS C O     1 
ATOM   799  C  CB    . LYS A 1 110 ? 7.133   66.487 -11.304 1.00 50.16  ? 110  LYS C CB    1 
ATOM   800  C  CG    . LYS A 1 110 ? 8.177   67.540 -11.066 1.00 56.10  ? 110  LYS C CG    1 
ATOM   801  C  CD    . LYS A 1 110 ? 9.446   66.929 -10.316 1.00 63.21  ? 110  LYS C CD    1 
ATOM   802  C  CE    . LYS A 1 110 ? 10.790  67.242 -11.078 1.00 63.92  ? 110  LYS C CE    1 
ATOM   803  N  NZ    . LYS A 1 110 ? 11.223  68.664 -10.860 1.00 63.92  ? 110  LYS C NZ    1 
ATOM   804  N  N     . SER A 1 111 ? 4.291   65.479 -11.240 1.00 47.51  ? 111  SER C N     1 
ATOM   805  C  CA    . SER A 1 111 ? 2.906   65.656 -11.692 1.00 47.60  ? 111  SER C CA    1 
ATOM   806  C  C     . SER A 1 111 ? 1.937   65.428 -10.506 1.00 46.63  ? 111  SER C C     1 
ATOM   807  O  O     . SER A 1 111 ? 1.028   66.166 -10.322 1.00 45.48  ? 111  SER C O     1 
ATOM   808  C  CB    . SER A 1 111 ? 2.636   64.661 -12.842 1.00 49.58  ? 111  SER C CB    1 
ATOM   809  O  OG    . SER A 1 111 ? 1.280   64.402 -12.919 1.00 55.52  ? 111  SER C OG    1 
ATOM   810  N  N     . LEU A 1 112 ? 2.209   64.435 -9.672  1.00 46.73  ? 112  LEU C N     1 
ATOM   811  C  CA    . LEU A 1 112 ? 1.431   64.250 -8.437  1.00 45.92  ? 112  LEU C CA    1 
ATOM   812  C  C     . LEU A 1 112 ? 1.489   65.417 -7.477  1.00 45.34  ? 112  LEU C C     1 
ATOM   813  O  O     . LEU A 1 112 ? 0.456   65.762 -6.919  1.00 46.62  ? 112  LEU C O     1 
ATOM   814  C  CB    . LEU A 1 112 ? 1.785   62.934 -7.785  1.00 45.29  ? 112  LEU C CB    1 
ATOM   815  C  CG    . LEU A 1 112 ? 1.295   61.707 -8.550  1.00 47.06  ? 112  LEU C CG    1 
ATOM   816  C  CD1   . LEU A 1 112 ? 2.050   60.492 -7.957  1.00 47.85  ? 112  LEU C CD1   1 
ATOM   817  C  CD2   . LEU A 1 112 ? -0.300  61.521 -8.584  1.00 43.14  ? 112  LEU C CD2   1 
ATOM   818  N  N     . ARG A 1 113 ? 2.651   66.074 -7.307  1.00 45.36  ? 113  ARG C N     1 
ATOM   819  C  CA    . ARG A 1 113 ? 2.734   67.263 -6.517  1.00 45.36  ? 113  ARG C CA    1 
ATOM   820  C  C     . ARG A 1 113 ? 1.774   68.316 -7.039  1.00 47.28  ? 113  ARG C C     1 
ATOM   821  O  O     . ARG A 1 113 ? 1.100   69.025 -6.242  1.00 45.92  ? 113  ARG C O     1 
ATOM   822  C  CB    . ARG A 1 113 ? 4.156   67.820 -6.526  1.00 46.63  ? 113  ARG C CB    1 
ATOM   823  C  CG    . ARG A 1 113 ? 5.112   66.874 -5.831  1.00 43.74  ? 113  ARG C CG    1 
ATOM   824  C  CD    . ARG A 1 113 ? 6.520   67.447 -5.753  1.00 46.81  ? 113  ARG C CD    1 
ATOM   825  N  NE    . ARG A 1 113 ? 7.455   66.445 -5.234  1.00 48.16  ? 113  ARG C NE    1 
ATOM   826  C  CZ    . ARG A 1 113 ? 7.920   66.366 -3.983  1.00 47.11  ? 113  ARG C CZ    1 
ATOM   827  N  NH1   . ARG A 1 113 ? 7.592   67.234 -3.024  1.00 47.56  ? 113  ARG C NH1   1 
ATOM   828  N  NH2   . ARG A 1 113 ? 8.747   65.411 -3.686  1.00 47.17  ? 113  ARG C NH2   1 
ATOM   829  N  N     . THR A 1 114 ? 1.712   68.456 -8.371  1.00 46.67  ? 114  THR C N     1 
ATOM   830  C  CA    . THR A 1 114 ? 0.835   69.437 -8.998  1.00 46.32  ? 114  THR C CA    1 
ATOM   831  C  C     . THR A 1 114 ? -0.639  69.168 -8.672  1.00 46.15  ? 114  THR C C     1 
ATOM   832  O  O     . THR A 1 114 ? -1.350  70.090 -8.348  1.00 46.55  ? 114  THR C O     1 
ATOM   833  C  CB    . THR A 1 114 ? 1.061   69.521 -10.545 1.00 48.07  ? 114  THR C CB    1 
ATOM   834  O  OG1   . THR A 1 114 ? 2.470   69.758 -10.751 1.00 46.78  ? 114  THR C OG1   1 
ATOM   835  C  CG2   . THR A 1 114 ? 0.156   70.595 -11.085 1.00 44.25  ? 114  THR C CG2   1 
ATOM   836  N  N     . VAL A 1 115 ? -1.045  67.897 -8.709  1.00 46.98  ? 115  VAL C N     1 
ATOM   837  C  CA    . VAL A 1 115 ? -2.392  67.417 -8.378  1.00 46.37  ? 115  VAL C CA    1 
ATOM   838  C  C     . VAL A 1 115 ? -2.688  67.736 -6.889  1.00 47.43  ? 115  VAL C C     1 
ATOM   839  O  O     . VAL A 1 115 ? -3.771  68.223 -6.564  1.00 48.62  ? 115  VAL C O     1 
ATOM   840  C  CB    . VAL A 1 115 ? -2.529  65.924 -8.654  1.00 46.34  ? 115  VAL C CB    1 
ATOM   841  C  CG1   . VAL A 1 115 ? -3.882  65.374 -8.162  1.00 44.79  ? 115  VAL C CG1   1 
ATOM   842  C  CG2   . VAL A 1 115 ? -2.337  65.590 -10.144 1.00 45.82  ? 115  VAL C CG2   1 
ATOM   843  N  N     . PHE A 1 116 ? -1.706  67.518 -6.017  1.00 46.66  ? 116  PHE C N     1 
ATOM   844  C  CA    . PHE A 1 116 ? -1.961  67.626 -4.543  1.00 46.11  ? 116  PHE C CA    1 
ATOM   845  C  C     . PHE A 1 116 ? -2.064  69.108 -4.153  1.00 47.33  ? 116  PHE C C     1 
ATOM   846  O  O     . PHE A 1 116 ? -2.769  69.472 -3.245  1.00 47.22  ? 116  PHE C O     1 
ATOM   847  C  CB    . PHE A 1 116 ? -0.828  66.926 -3.761  1.00 44.28  ? 116  PHE C CB    1 
ATOM   848  C  CG    . PHE A 1 116 ? -0.734  65.411 -4.010  1.00 43.19  ? 116  PHE C CG    1 
ATOM   849  C  CD1   . PHE A 1 116 ? -1.837  64.659 -4.443  1.00 45.42  ? 116  PHE C CD1   1 
ATOM   850  C  CD2   . PHE A 1 116 ? 0.466   64.741 -3.854  1.00 41.70  ? 116  PHE C CD2   1 
ATOM   851  C  CE1   . PHE A 1 116 ? -1.733  63.317 -4.708  1.00 43.57  ? 116  PHE C CE1   1 
ATOM   852  C  CE2   . PHE A 1 116 ? 0.524   63.384 -4.057  1.00 41.60  ? 116  PHE C CE2   1 
ATOM   853  C  CZ    . PHE A 1 116 ? -0.547  62.688 -4.464  1.00 41.91  ? 116  PHE C CZ    1 
ATOM   854  N  N     . ARG A 1 117 ? -1.377  69.969 -4.871  1.00 48.61  ? 117  ARG C N     1 
ATOM   855  C  CA    . ARG A 1 117 ? -1.438  71.374 -4.640  1.00 48.54  ? 117  ARG C CA    1 
ATOM   856  C  C     . ARG A 1 117 ? -2.769  71.936 -5.052  1.00 49.22  ? 117  ARG C C     1 
ATOM   857  O  O     . ARG A 1 117 ? -3.167  72.949 -4.522  1.00 48.86  ? 117  ARG C O     1 
ATOM   858  C  CB    . ARG A 1 117 ? -0.304  72.114 -5.375  1.00 49.47  ? 117  ARG C CB    1 
ATOM   859  C  CG    . ARG A 1 117 ? 1.039   71.730 -4.785  1.00 51.62  ? 117  ARG C CG    1 
ATOM   860  C  CD    . ARG A 1 117 ? 2.180   72.161 -5.599  1.00 53.45  ? 117  ARG C CD    1 
ATOM   861  N  NE    . ARG A 1 117 ? 3.399   71.522 -5.152  1.00 48.63  ? 117  ARG C NE    1 
ATOM   862  C  CZ    . ARG A 1 117 ? 4.596   71.827 -5.621  1.00 53.15  ? 117  ARG C CZ    1 
ATOM   863  N  NH1   . ARG A 1 117 ? 4.707   72.746 -6.553  1.00 53.83  ? 117  ARG C NH1   1 
ATOM   864  N  NH2   . ARG A 1 117 ? 5.691   71.229 -5.177  1.00 54.58  ? 117  ARG C NH2   1 
ATOM   865  N  N     . THR A 1 118 ? -3.459  71.267 -5.964  1.00 49.06  ? 118  THR C N     1 
ATOM   866  C  CA    . THR A 1 118 ? -4.804  71.637 -6.375  1.00 49.18  ? 118  THR C CA    1 
ATOM   867  C  C     . THR A 1 118 ? -5.885  70.974 -5.511  1.00 48.14  ? 118  THR C C     1 
ATOM   868  O  O     . THR A 1 118 ? -6.913  71.587 -5.199  1.00 48.64  ? 118  THR C O     1 
ATOM   869  C  CB    . THR A 1 118 ? -5.018  71.292 -7.850  1.00 48.91  ? 118  THR C CB    1 
ATOM   870  O  OG1   . THR A 1 118 ? -4.048  72.002 -8.615  1.00 53.57  ? 118  THR C OG1   1 
ATOM   871  C  CG2   . THR A 1 118 ? -6.384  71.702 -8.314  1.00 45.68  ? 118  THR C CG2   1 
ATOM   872  N  N     . ASP A 1 119 ? -5.646  69.753 -5.084  1.00 47.35  ? 119  ASP C N     1 
ATOM   873  C  CA    . ASP A 1 119 ? -6.627  69.008 -4.339  1.00 46.98  ? 119  ASP C CA    1 
ATOM   874  C  C     . ASP A 1 119 ? -5.929  68.079 -3.314  1.00 45.94  ? 119  ASP C C     1 
ATOM   875  O  O     . ASP A 1 119 ? -5.522  66.991 -3.681  1.00 45.20  ? 119  ASP C O     1 
ATOM   876  C  CB    . ASP A 1 119 ? -7.438  68.151 -5.348  1.00 48.25  ? 119  ASP C CB    1 
ATOM   877  C  CG    . ASP A 1 119 ? -8.617  67.442 -4.695  1.00 53.32  ? 119  ASP C CG    1 
ATOM   878  O  OD1   . ASP A 1 119 ? -8.638  67.446 -3.461  1.00 54.34  ? 119  ASP C OD1   1 
ATOM   879  O  OD2   . ASP A 1 119 ? -9.493  66.839 -5.362  1.00 58.22  ? 119  ASP C OD2   1 
ATOM   880  N  N     . GLU A 1 120 ? -5.823  68.533 -2.057  1.00 44.50  ? 120  GLU C N     1 
ATOM   881  C  CA    . GLU A 1 120 ? -5.109  67.821 -1.002  1.00 46.11  ? 120  GLU C CA    1 
ATOM   882  C  C     . GLU A 1 120 ? -5.811  66.499 -0.734  1.00 45.22  ? 120  GLU C C     1 
ATOM   883  O  O     . GLU A 1 120 ? -5.187  65.517 -0.353  1.00 46.63  ? 120  GLU C O     1 
ATOM   884  C  CB    . GLU A 1 120 ? -5.110  68.690 0.258   1.00 47.39  ? 120  GLU C CB    1 
ATOM   885  C  CG    . GLU A 1 120 ? -4.322  68.231 1.393   1.00 49.09  ? 120  GLU C CG    1 
ATOM   886  C  CD    . GLU A 1 120 ? -4.439  69.205 2.584   1.00 49.92  ? 120  GLU C CD    1 
ATOM   887  O  OE1   . GLU A 1 120 ? -5.568  69.354 3.043   1.00 46.98  ? 120  GLU C OE1   1 
ATOM   888  O  OE2   . GLU A 1 120 ? -3.464  69.885 2.998   1.00 50.68  ? 120  GLU C OE2   1 
ATOM   889  N  N     . ASP A 1 121 ? -7.127  66.417 -0.956  1.00 45.11  ? 121  ASP C N     1 
ATOM   890  C  CA    . ASP A 1 121 ? -7.834  65.076 -0.806  1.00 45.31  ? 121  ASP C CA    1 
ATOM   891  C  C     . ASP A 1 121 ? -7.401  63.964 -1.632  1.00 45.79  ? 121  ASP C C     1 
ATOM   892  O  O     . ASP A 1 121 ? -7.576  62.826 -1.294  1.00 43.90  ? 121  ASP C O     1 
ATOM   893  C  CB    . ASP A 1 121 ? -9.339  65.250 -1.015  1.00 46.55  ? 121  ASP C CB    1 
ATOM   894  C  CG    . ASP A 1 121 ? -9.963  66.170 -0.001  1.00 50.36  ? 121  ASP C CG    1 
ATOM   895  O  OD1   . ASP A 1 121 ? -9.314  66.546 1.000   1.00 51.72  ? 121  ASP C OD1   1 
ATOM   896  O  OD2   . ASP A 1 121 ? -11.112 66.576 -0.243  1.00 57.97  ? 121  ASP C OD2   1 
ATOM   897  N  N     . MET A 1 122 ? -6.880  64.228 -2.830  1.00 46.31  ? 122  MET C N     1 
ATOM   898  C  CA    . MET A 1 122 ? -6.363  63.138 -3.659  1.00 47.18  ? 122  MET C CA    1 
ATOM   899  C  C     . MET A 1 122 ? -5.225  62.371 -2.973  1.00 45.98  ? 122  MET C C     1 
ATOM   900  O  O     . MET A 1 122 ? -5.008  61.191 -3.214  1.00 48.99  ? 122  MET C O     1 
ATOM   901  C  CB    . MET A 1 122 ? -5.863  63.681 -5.050  1.00 47.69  ? 122  MET C CB    1 
ATOM   902  C  CG    . MET A 1 122 ? -7.003  64.145 -5.980  1.00 51.96  ? 122  MET C CG    1 
ATOM   903  S  SD    . MET A 1 122 ? -8.238  62.838 -6.198  1.00 57.18  ? 122  MET C SD    1 
ATOM   904  C  CE    . MET A 1 122 ? -9.584  63.436 -5.046  1.00 60.80  ? 122  MET C CE    1 
ATOM   905  N  N     . ILE A 1 123 ? -4.457  63.048 -2.114  1.00 48.06  ? 123  ILE C N     1 
ATOM   906  C  CA    . ILE A 1 123 ? -3.466  62.333 -1.285  1.00 45.29  ? 123  ILE C CA    1 
ATOM   907  C  C     . ILE A 1 123 ? -4.117  61.138 -0.598  1.00 45.51  ? 123  ILE C C     1 
ATOM   908  O  O     . ILE A 1 123 ? -3.584  60.032 -0.625  1.00 42.57  ? 123  ILE C O     1 
ATOM   909  C  CB    . ILE A 1 123 ? -2.791  63.258 -0.211  1.00 47.07  ? 123  ILE C CB    1 
ATOM   910  C  CG1   . ILE A 1 123 ? -2.042  64.467 -0.800  1.00 45.55  ? 123  ILE C CG1   1 
ATOM   911  C  CG2   . ILE A 1 123 ? -1.749  62.436 0.684   1.00 47.93  ? 123  ILE C CG2   1 
ATOM   912  C  CD1   . ILE A 1 123 ? -1.756  65.594 0.258   1.00 44.20  ? 123  ILE C CD1   1 
ATOM   913  N  N     . PHE A 1 124 ? -5.254  61.382 0.075   1.00 45.83  ? 124  PHE C N     1 
ATOM   914  C  CA    . PHE A 1 124 ? -5.863  60.378 0.932   1.00 46.16  ? 124  PHE C CA    1 
ATOM   915  C  C     . PHE A 1 124 ? -6.598  59.298 0.118   1.00 45.74  ? 124  PHE C C     1 
ATOM   916  O  O     . PHE A 1 124 ? -6.778  58.169 0.564   1.00 44.42  ? 124  PHE C O     1 
ATOM   917  C  CB    . PHE A 1 124 ? -6.729  61.095 1.938   1.00 45.87  ? 124  PHE C CB    1 
ATOM   918  C  CG    . PHE A 1 124 ? -5.918  62.006 2.855   1.00 39.75  ? 124  PHE C CG    1 
ATOM   919  C  CD1   . PHE A 1 124 ? -5.713  63.331 2.573   1.00 44.80  ? 124  PHE C CD1   1 
ATOM   920  C  CD2   . PHE A 1 124 ? -5.209  61.454 3.882   1.00 46.74  ? 124  PHE C CD2   1 
ATOM   921  C  CE1   . PHE A 1 124 ? -4.936  64.129 3.381   1.00 44.82  ? 124  PHE C CE1   1 
ATOM   922  C  CE2   . PHE A 1 124 ? -4.470  62.223 4.692   1.00 45.29  ? 124  PHE C CE2   1 
ATOM   923  C  CZ    . PHE A 1 124 ? -4.326  63.576 4.417   1.00 45.08  ? 124  PHE C CZ    1 
ATOM   924  N  N     . GLU A 1 125 ? -7.100  59.651 -1.041  1.00 47.02  ? 125  GLU C N     1 
ATOM   925  C  CA    . GLU A 1 125 ? -7.605  58.687 -1.961  1.00 45.89  ? 125  GLU C CA    1 
ATOM   926  C  C     . GLU A 1 125 ? -6.568  57.702 -2.385  1.00 46.37  ? 125  GLU C C     1 
ATOM   927  O  O     . GLU A 1 125 ? -6.868  56.518 -2.461  1.00 47.12  ? 125  GLU C O     1 
ATOM   928  C  CB    . GLU A 1 125 ? -8.257  59.355 -3.206  1.00 47.82  ? 125  GLU C CB    1 
ATOM   929  C  CG    . GLU A 1 125 ? -9.476  60.217 -2.871  1.00 49.45  ? 125  GLU C CG    1 
ATOM   930  C  CD    . GLU A 1 125 ? -10.581 59.447 -2.073  1.00 59.04  ? 125  GLU C CD    1 
ATOM   931  O  OE1   . GLU A 1 125 ? -10.950 59.777 -0.868  1.00 66.04  ? 125  GLU C OE1   1 
ATOM   932  O  OE2   . GLU A 1 125 ? -11.082 58.505 -2.654  1.00 64.50  ? 125  GLU C OE2   1 
ATOM   933  N  N     . ILE A 1 126 ? -5.362  58.174 -2.669  1.00 44.42  ? 126  ILE C N     1 
ATOM   934  C  CA    . ILE A 1 126 ? -4.276  57.249 -3.012  1.00 45.38  ? 126  ILE C CA    1 
ATOM   935  C  C     . ILE A 1 126 ? -3.893  56.334 -1.845  1.00 44.78  ? 126  ILE C C     1 
ATOM   936  O  O     . ILE A 1 126 ? -3.709  55.117 -1.989  1.00 47.10  ? 126  ILE C O     1 
ATOM   937  C  CB    . ILE A 1 126 ? -3.062  57.984 -3.618  1.00 44.48  ? 126  ILE C CB    1 
ATOM   938  C  CG1   . ILE A 1 126 ? -3.521  58.565 -5.001  1.00 48.35  ? 126  ILE C CG1   1 
ATOM   939  C  CG2   . ILE A 1 126 ? -1.961  57.031 -3.910  1.00 46.27  ? 126  ILE C CG2   1 
ATOM   940  C  CD1   . ILE A 1 126 ? -2.539  59.569 -5.691  1.00 45.87  ? 126  ILE C CD1   1 
ATOM   941  N  N     . PHE A 1 127 ? -3.768  56.920 -0.649  1.00 45.15  ? 127  PHE C N     1 
ATOM   942  C  CA    . PHE A 1 127 ? -3.576  56.090 0.562   1.00 43.59  ? 127  PHE C CA    1 
ATOM   943  C  C     . PHE A 1 127 ? -4.628  54.971 0.664   1.00 44.07  ? 127  PHE C C     1 
ATOM   944  O  O     . PHE A 1 127 ? -4.339  53.803 0.918   1.00 43.86  ? 127  PHE C O     1 
ATOM   945  C  CB    . PHE A 1 127 ? -3.678  56.915 1.880   1.00 43.99  ? 127  PHE C CB    1 
ATOM   946  C  CG    . PHE A 1 127 ? -2.555  57.845 2.148   1.00 45.23  ? 127  PHE C CG    1 
ATOM   947  C  CD1   . PHE A 1 127 ? -1.349  57.782 1.437   1.00 47.00  ? 127  PHE C CD1   1 
ATOM   948  C  CD2   . PHE A 1 127 ? -2.665  58.763 3.142   1.00 44.85  ? 127  PHE C CD2   1 
ATOM   949  C  CE1   . PHE A 1 127 ? -0.334  58.666 1.634   1.00 47.40  ? 127  PHE C CE1   1 
ATOM   950  C  CE2   . PHE A 1 127 ? -1.649  59.650 3.396   1.00 43.63  ? 127  PHE C CE2   1 
ATOM   951  C  CZ    . PHE A 1 127 ? -0.447  59.611 2.635   1.00 44.46  ? 127  PHE C CZ    1 
ATOM   952  N  N     . LYS A 1 128 ? -5.874  55.328 0.450   1.00 43.85  ? 128  LYS C N     1 
ATOM   953  C  CA    . LYS A 1 128 ? -6.998  54.316 0.475   1.00 44.81  ? 128  LYS C CA    1 
ATOM   954  C  C     . LYS A 1 128 ? -6.817  53.175 -0.529  1.00 45.66  ? 128  LYS C C     1 
ATOM   955  O  O     . LYS A 1 128 ? -7.107  51.991 -0.217  1.00 43.40  ? 128  LYS C O     1 
ATOM   956  C  CB    . LYS A 1 128 ? -8.335  54.993 0.246   1.00 46.26  ? 128  LYS C CB    1 
ATOM   957  C  CG    . LYS A 1 128 ? -8.814  55.837 1.434   1.00 44.65  ? 128  LYS C CG    1 
ATOM   958  C  CD    . LYS A 1 128 ? -10.051 56.516 1.098   1.00 44.40  ? 128  LYS C CD    1 
ATOM   959  C  CE    . LYS A 1 128 ? -10.255 57.668 1.984   1.00 47.92  ? 128  LYS C CE    1 
ATOM   960  N  NZ    . LYS A 1 128 ? -11.489 58.510 1.761   1.00 46.35  ? 128  LYS C NZ    1 
ATOM   961  N  N     . ASN A 1 129 ? -6.383  53.557 -1.706  1.00 46.60  ? 129  ASN C N     1 
ATOM   962  C  CA    . ASN A 1 129 ? -6.096  52.616 -2.775  1.00 46.13  ? 129  ASN C CA    1 
ATOM   963  C  C     . ASN A 1 129 ? -4.914  51.660 -2.358  1.00 46.65  ? 129  ASN C C     1 
ATOM   964  O  O     . ASN A 1 129 ? -4.983  50.435 -2.492  1.00 46.66  ? 129  ASN C O     1 
ATOM   965  C  CB    . ASN A 1 129 ? -5.809  53.383 -4.068  1.00 47.24  ? 129  ASN C CB    1 
ATOM   966  C  CG    . ASN A 1 129 ? -5.483  52.430 -5.219  1.00 48.07  ? 129  ASN C CG    1 
ATOM   967  O  OD1   . ASN A 1 129 ? -4.326  52.072 -5.387  1.00 47.59  ? 129  ASN C OD1   1 
ATOM   968  N  ND2   . ASN A 1 129 ? -6.496  52.004 -5.968  1.00 46.81  ? 129  ASN C ND2   1 
ATOM   969  N  N     . TYR A 1 130 ? -3.818  52.235 -1.852  1.00 46.05  ? 130  TYR C N     1 
ATOM   970  C  CA    . TYR A 1 130 ? -2.761  51.396 -1.347  1.00 46.30  ? 130  TYR C CA    1 
ATOM   971  C  C     . TYR A 1 130 ? -3.205  50.504 -0.203  1.00 44.32  ? 130  TYR C C     1 
ATOM   972  O  O     . TYR A 1 130 ? -2.762  49.331 -0.068  1.00 47.18  ? 130  TYR C O     1 
ATOM   973  C  CB    . TYR A 1 130 ? -1.604  52.231 -0.813  1.00 47.04  ? 130  TYR C CB    1 
ATOM   974  C  CG    . TYR A 1 130 ? -0.587  52.664 -1.845  1.00 50.25  ? 130  TYR C CG    1 
ATOM   975  C  CD1   . TYR A 1 130 ? -0.343  53.996 -2.065  1.00 49.56  ? 130  TYR C CD1   1 
ATOM   976  C  CD2   . TYR A 1 130 ? 0.165   51.725 -2.584  1.00 48.37  ? 130  TYR C CD2   1 
ATOM   977  C  CE1   . TYR A 1 130 ? 0.618   54.411 -2.995  1.00 50.81  ? 130  TYR C CE1   1 
ATOM   978  C  CE2   . TYR A 1 130 ? 1.188   52.136 -3.516  1.00 44.43  ? 130  TYR C CE2   1 
ATOM   979  C  CZ    . TYR A 1 130 ? 1.338   53.500 -3.749  1.00 46.23  ? 130  TYR C CZ    1 
ATOM   980  O  OH    . TYR A 1 130 ? 2.313   54.018 -4.584  1.00 46.30  ? 130  TYR C OH    1 
ATOM   981  N  N     . LEU A 1 131 ? -3.882  51.135 0.766   1.00 46.85  ? 131  LEU C N     1 
ATOM   982  C  CA    . LEU A 1 131 ? -4.337  50.332 1.953   1.00 46.86  ? 131  LEU C CA    1 
ATOM   983  C  C     . LEU A 1 131 ? -5.159  49.136 1.566   1.00 48.30  ? 131  LEU C C     1 
ATOM   984  O  O     . LEU A 1 131 ? -5.034  48.024 2.134   1.00 47.94  ? 131  LEU C O     1 
ATOM   985  C  CB    . LEU A 1 131 ? -5.078  51.246 2.961   1.00 47.18  ? 131  LEU C CB    1 
ATOM   986  C  CG    . LEU A 1 131 ? -5.571  50.606 4.249   1.00 47.07  ? 131  LEU C CG    1 
ATOM   987  C  CD1   . LEU A 1 131 ? -4.443  49.814 5.003   1.00 45.85  ? 131  LEU C CD1   1 
ATOM   988  C  CD2   . LEU A 1 131 ? -6.157  51.639 5.169   1.00 46.57  ? 131  LEU C CD2   1 
ATOM   989  N  N     . THR A 1 132 ? -6.101  49.354 0.639   1.00 49.01  ? 132  THR C N     1 
ATOM   990  C  CA    . THR A 1 132 ? -6.897  48.269 0.134   1.00 45.61  ? 132  THR C CA    1 
ATOM   991  C  C     . THR A 1 132 ? -6.057  47.113 -0.432  1.00 45.90  ? 132  THR C C     1 
ATOM   992  O  O     . THR A 1 132 ? -6.359  45.961 -0.234  1.00 46.36  ? 132  THR C O     1 
ATOM   993  C  CB    . THR A 1 132 ? -7.828  48.824 -0.952  1.00 46.93  ? 132  THR C CB    1 
ATOM   994  O  OG1   . THR A 1 132 ? -8.694  49.787 -0.377  1.00 46.12  ? 132  THR C OG1   1 
ATOM   995  C  CG2   . THR A 1 132 ? -8.672  47.737 -1.583  1.00 47.72  ? 132  THR C CG2   1 
ATOM   996  N  N     . LYS A 1 133 ? -4.981  47.437 -1.162  1.00 45.02  ? 133  LYS C N     1 
ATOM   997  C  CA    . LYS A 1 133 ? -4.143  46.399 -1.696  1.00 45.66  ? 133  LYS C CA    1 
ATOM   998  C  C     . LYS A 1 133 ? -3.368  45.674 -0.630  1.00 47.49  ? 133  LYS C C     1 
ATOM   999  O  O     . LYS A 1 133 ? -3.247  44.457 -0.629  1.00 49.36  ? 133  LYS C O     1 
ATOM   1000 C  CB    . LYS A 1 133 ? -3.163  47.073 -2.660  1.00 44.80  ? 133  LYS C CB    1 
ATOM   1001 C  CG    . LYS A 1 133 ? -3.879  47.508 -3.945  1.00 47.61  ? 133  LYS C CG    1 
ATOM   1002 C  CD    . LYS A 1 133 ? -2.862  48.231 -4.844  1.00 46.29  ? 133  LYS C CD    1 
ATOM   1003 C  CE    . LYS A 1 133 ? -3.579  48.889 -6.076  1.00 48.14  ? 133  LYS C CE    1 
ATOM   1004 N  NZ    . LYS A 1 133 ? -2.704  49.842 -6.835  1.00 44.61  ? 133  LYS C NZ    1 
ATOM   1005 N  N     . VAL A 1 134 ? -2.836  46.420 0.316   1.00 46.83  ? 134  VAL C N     1 
ATOM   1006 C  CA    . VAL A 1 134 ? -2.110  45.776 1.400   1.00 47.27  ? 134  VAL C CA    1 
ATOM   1007 C  C     . VAL A 1 134 ? -3.039  44.882 2.216   1.00 46.66  ? 134  VAL C C     1 
ATOM   1008 O  O     . VAL A 1 134 ? -2.683  43.752 2.490   1.00 49.60  ? 134  VAL C O     1 
ATOM   1009 C  CB    . VAL A 1 134 ? -1.431  46.793 2.370   1.00 46.70  ? 134  VAL C CB    1 
ATOM   1010 C  CG1   . VAL A 1 134 ? -0.717  46.005 3.518   1.00 44.90  ? 134  VAL C CG1   1 
ATOM   1011 C  CG2   . VAL A 1 134 ? -0.484  47.746 1.598   1.00 44.41  ? 134  VAL C CG2   1 
ATOM   1012 N  N     . ALA A 1 135 ? -4.244  45.341 2.594   1.00 45.26  ? 135  ALA C N     1 
ATOM   1013 C  CA    . ALA A 1 135 ? -5.212  44.529 3.331   1.00 45.58  ? 135  ALA C CA    1 
ATOM   1014 C  C     . ALA A 1 135 ? -5.580  43.209 2.577   1.00 46.20  ? 135  ALA C C     1 
ATOM   1015 O  O     . ALA A 1 135 ? -5.732  42.114 3.173   1.00 44.91  ? 135  ALA C O     1 
ATOM   1016 C  CB    . ALA A 1 135 ? -6.462  45.426 3.680   1.00 44.77  ? 135  ALA C CB    1 
ATOM   1017 N  N     . TYR A 1 136 ? -5.697  43.312 1.233   1.00 47.47  ? 136  TYR C N     1 
ATOM   1018 C  CA    . TYR A 1 136 ? -6.019  42.145 0.388   1.00 46.79  ? 136  TYR C CA    1 
ATOM   1019 C  C     . TYR A 1 136 ? -4.948  41.140 0.427   1.00 47.87  ? 136  TYR C C     1 
ATOM   1020 O  O     . TYR A 1 136 ? -5.223  39.965 0.735   1.00 49.81  ? 136  TYR C O     1 
ATOM   1021 C  CB    . TYR A 1 136 ? -6.408  42.521 -1.109  1.00 47.14  ? 136  TYR C CB    1 
ATOM   1022 C  CG    . TYR A 1 136 ? -6.663  41.278 -1.902  1.00 46.62  ? 136  TYR C CG    1 
ATOM   1023 C  CD1   . TYR A 1 136 ? -7.897  40.672 -1.858  1.00 45.80  ? 136  TYR C CD1   1 
ATOM   1024 C  CD2   . TYR A 1 136 ? -5.608  40.625 -2.562  1.00 48.74  ? 136  TYR C CD2   1 
ATOM   1025 C  CE1   . TYR A 1 136 ? -8.080  39.414 -2.470  1.00 47.58  ? 136  TYR C CE1   1 
ATOM   1026 C  CE2   . TYR A 1 136 ? -5.777  39.408 -3.204  1.00 45.71  ? 136  TYR C CE2   1 
ATOM   1027 C  CZ    . TYR A 1 136 ? -7.039  38.808 -3.174  1.00 49.08  ? 136  TYR C CZ    1 
ATOM   1028 O  OH    . TYR A 1 136 ? -7.299  37.533 -3.757  1.00 48.54  ? 136  TYR C OH    1 
ATOM   1029 N  N     . TYR A 1 137 ? -3.725  41.566 0.105   1.00 48.01  ? 137  TYR C N     1 
ATOM   1030 C  CA    . TYR A 1 137 ? -2.666  40.598 -0.096  1.00 47.10  ? 137  TYR C CA    1 
ATOM   1031 C  C     . TYR A 1 137 ? -2.164  40.076 1.253   1.00 46.87  ? 137  TYR C C     1 
ATOM   1032 O  O     . TYR A 1 137 ? -1.744  38.953 1.346   1.00 45.84  ? 137  TYR C O     1 
ATOM   1033 C  CB    . TYR A 1 137 ? -1.551  41.158 -0.962  1.00 48.42  ? 137  TYR C CB    1 
ATOM   1034 C  CG    . TYR A 1 137 ? -1.955  41.388 -2.409  1.00 46.53  ? 137  TYR C CG    1 
ATOM   1035 C  CD1   . TYR A 1 137 ? -2.139  42.669 -2.901  1.00 46.76  ? 137  TYR C CD1   1 
ATOM   1036 C  CD2   . TYR A 1 137 ? -2.103  40.294 -3.327  1.00 46.19  ? 137  TYR C CD2   1 
ATOM   1037 C  CE1   . TYR A 1 137 ? -2.528  42.911 -4.224  1.00 47.11  ? 137  TYR C CE1   1 
ATOM   1038 C  CE2   . TYR A 1 137 ? -2.441  40.521 -4.677  1.00 49.48  ? 137  TYR C CE2   1 
ATOM   1039 C  CZ    . TYR A 1 137 ? -2.684  41.825 -5.110  1.00 48.84  ? 137  TYR C CZ    1 
ATOM   1040 O  OH    . TYR A 1 137 ? -3.145  42.012 -6.392  1.00 49.24  ? 137  TYR C OH    1 
ATOM   1041 N  N     . ALA A 1 138 ? -2.082  40.946 2.250   1.00 46.66  ? 138  ALA C N     1 
ATOM   1042 C  CA    . ALA A 1 138 ? -1.707  40.466 3.571   1.00 45.74  ? 138  ALA C CA    1 
ATOM   1043 C  C     . ALA A 1 138 ? -2.672  39.410 4.104   1.00 45.24  ? 138  ALA C C     1 
ATOM   1044 O  O     . ALA A 1 138 ? -2.224  38.384 4.589   1.00 46.68  ? 138  ALA C O     1 
ATOM   1045 C  CB    . ALA A 1 138 ? -1.427  41.727 4.598   1.00 45.15  ? 138  ALA C CB    1 
ATOM   1046 N  N     . ARG A 1 139 ? -4.001  39.602 4.001   1.00 46.01  ? 139  ARG C N     1 
ATOM   1047 C  CA    . ARG A 1 139 ? -4.943  38.570 4.342   1.00 46.18  ? 139  ARG C CA    1 
ATOM   1048 C  C     . ARG A 1 139 ? -4.805  37.283 3.508   1.00 45.01  ? 139  ARG C C     1 
ATOM   1049 O  O     . ARG A 1 139 ? -4.980  36.224 4.031   1.00 45.24  ? 139  ARG C O     1 
ATOM   1050 C  CB    . ARG A 1 139 ? -6.358  39.138 4.165   1.00 45.48  ? 139  ARG C CB    1 
ATOM   1051 C  CG    . ARG A 1 139 ? -7.473  38.193 4.562   1.00 46.95  ? 139  ARG C CG    1 
ATOM   1052 C  CD    . ARG A 1 139 ? -8.745  38.770 4.190   1.00 51.75  ? 139  ARG C CD    1 
ATOM   1053 N  NE    . ARG A 1 139 ? -9.857  37.923 4.623   1.00 52.29  ? 139  ARG C NE    1 
ATOM   1054 C  CZ    . ARG A 1 139 ? -10.480 37.968 5.793   1.00 59.20  ? 139  ARG C CZ    1 
ATOM   1055 N  NH1   . ARG A 1 139 ? -10.164 38.845 6.762   1.00 60.82  ? 139  ARG C NH1   1 
ATOM   1056 N  NH2   . ARG A 1 139 ? -11.452 37.084 6.002   1.00 59.27  ? 139  ARG C NH2   1 
ATOM   1057 N  N     . GLN A 1 140 ? -4.505  37.415 2.210   1.00 45.11  ? 140  GLN C N     1 
ATOM   1058 C  CA    . GLN A 1 140 ? -4.429  36.278 1.311   1.00 44.10  ? 140  GLN C CA    1 
ATOM   1059 C  C     . GLN A 1 140 ? -3.246  35.409 1.743   1.00 41.21  ? 140  GLN C C     1 
ATOM   1060 O  O     . GLN A 1 140 ? -3.405  34.164 1.831   1.00 43.02  ? 140  GLN C O     1 
ATOM   1061 C  CB    . GLN A 1 140 ? -4.275  36.755 -0.152  1.00 44.43  ? 140  GLN C CB    1 
ATOM   1062 C  CG    . GLN A 1 140 ? -4.367  35.765 -1.281  1.00 49.22  ? 140  GLN C CG    1 
ATOM   1063 C  CD    . GLN A 1 140 ? -5.672  34.993 -1.255  1.00 55.08  ? 140  GLN C CD    1 
ATOM   1064 O  OE1   . GLN A 1 140 ? -6.646  35.421 -0.641  1.00 60.05  ? 140  GLN C OE1   1 
ATOM   1065 N  NE2   . GLN A 1 140 ? -5.680  33.834 -1.869  1.00 56.89  ? 140  GLN C NE2   1 
ATOM   1066 N  N     . VAL A 1 141 ? -2.115  36.036 2.098   1.00 35.00  ? 141  VAL C N     1 
ATOM   1067 C  CA    . VAL A 1 141 ? -0.981  35.290 2.620   1.00 31.80  ? 141  VAL C CA    1 
ATOM   1068 C  C     . VAL A 1 141 ? -1.455  34.458 3.875   1.00 32.60  ? 141  VAL C C     1 
ATOM   1069 O  O     . VAL A 1 141 ? -1.298  33.253 3.943   1.00 31.06  ? 141  VAL C O     1 
ATOM   1070 C  CB    . VAL A 1 141 ? 0.236   36.213 2.925   1.00 29.78  ? 141  VAL C CB    1 
ATOM   1071 C  CG1   . VAL A 1 141 ? 1.279   35.539 3.776   1.00 28.51  ? 141  VAL C CG1   1 
ATOM   1072 C  CG2   . VAL A 1 141 ? 0.817   36.776 1.570   1.00 26.11  ? 141  VAL C CG2   1 
ATOM   1073 N  N     . ALA A 1 142 ? -2.042  35.140 4.836   1.00 31.91  ? 142  ALA C N     1 
ATOM   1074 C  CA    . ALA A 1 142 ? -2.504  34.520 6.089   1.00 31.18  ? 142  ALA C CA    1 
ATOM   1075 C  C     . ALA A 1 142 ? -3.595  33.444 5.847   1.00 32.62  ? 142  ALA C C     1 
ATOM   1076 O  O     . ALA A 1 142 ? -3.608  32.403 6.508   1.00 31.54  ? 142  ALA C O     1 
ATOM   1077 C  CB    . ALA A 1 142 ? -2.934  35.658 7.071   1.00 29.23  ? 142  ALA C CB    1 
ATOM   1078 N  N     . GLU A 1 143 ? -4.478  33.654 4.891   1.00 33.88  ? 143  GLU C N     1 
ATOM   1079 C  CA    . GLU A 1 143 ? -5.479  32.686 4.533   1.00 35.46  ? 143  GLU C CA    1 
ATOM   1080 C  C     . GLU A 1 143 ? -4.876  31.442 3.882   1.00 36.59  ? 143  GLU C C     1 
ATOM   1081 O  O     . GLU A 1 143 ? -5.317  30.318 4.129   1.00 35.00  ? 143  GLU C O     1 
ATOM   1082 C  CB    . GLU A 1 143 ? -6.491  33.354 3.580   1.00 35.85  ? 143  GLU C CB    1 
ATOM   1083 C  CG    . GLU A 1 143 ? -8.007  33.051 3.789   1.00 43.42  ? 143  GLU C CG    1 
ATOM   1084 C  CD    . GLU A 1 143 ? -8.653  32.670 2.473   1.00 50.82  ? 143  GLU C CD    1 
ATOM   1085 O  OE1   . GLU A 1 143 ? -9.771  32.096 2.460   1.00 49.33  ? 143  GLU C OE1   1 
ATOM   1086 O  OE2   . GLU A 1 143 ? -7.978  32.945 1.430   1.00 55.32  ? 143  GLU C OE2   1 
ATOM   1087 N  N     . MET A 1 144 ? -3.890  31.620 3.035   1.00 36.79  ? 144  MET C N     1 
ATOM   1088 C  CA    . MET A 1 144 ? -3.247  30.447 2.440   1.00 39.53  ? 144  MET C CA    1 
ATOM   1089 C  C     . MET A 1 144 ? -2.458  29.635 3.453   1.00 40.20  ? 144  MET C C     1 
ATOM   1090 O  O     . MET A 1 144 ? -2.245  28.498 3.256   1.00 38.87  ? 144  MET C O     1 
ATOM   1091 C  CB    . MET A 1 144 ? -2.348  30.863 1.270   1.00 39.03  ? 144  MET C CB    1 
ATOM   1092 C  CG    . MET A 1 144 ? -3.123  31.416 0.071   1.00 40.93  ? 144  MET C CG    1 
ATOM   1093 S  SD    . MET A 1 144 ? -2.053  32.092 -1.258  1.00 44.23  ? 144  MET C SD    1 
ATOM   1094 C  CE    . MET A 1 144 ? -1.445  30.493 -1.766  1.00 47.29  ? 144  MET C CE    1 
ATOM   1095 N  N     . ASN A 1 145 ? -2.025  30.266 4.537   1.00 45.33  ? 145  ASN C N     1 
ATOM   1096 C  CA    . ASN A 1 145 ? -1.325  29.647 5.634   1.00 47.07  ? 145  ASN C CA    1 
ATOM   1097 C  C     . ASN A 1 145 ? -2.268  28.994 6.632   1.00 48.67  ? 145  ASN C C     1 
ATOM   1098 O  O     . ASN A 1 145 ? -1.816  28.274 7.520   1.00 51.06  ? 145  ASN C O     1 
ATOM   1099 C  CB    . ASN A 1 145 ? -0.425  30.673 6.364   1.00 47.79  ? 145  ASN C CB    1 
ATOM   1100 C  CG    . ASN A 1 145 ? 0.778   31.102 5.537   1.00 49.93  ? 145  ASN C CG    1 
ATOM   1101 O  OD1   . ASN A 1 145 ? 1.189   30.386 4.636   1.00 57.56  ? 145  ASN C OD1   1 
ATOM   1102 N  ND2   . ASN A 1 145 ? 1.338   32.296 5.832   1.00 52.01  ? 145  ASN C ND2   1 
ATOM   1103 N  N     . THR A 1 146 ? -3.573  29.195 6.481   1.00 49.49  ? 146  THR C N     1 
ATOM   1104 C  CA    . THR A 1 146 ? -4.597  28.753 7.432   1.00 49.07  ? 146  THR C CA    1 
ATOM   1105 C  C     . THR A 1 146 ? -5.567  27.712 6.835   1.00 49.86  ? 146  THR C C     1 
ATOM   1106 O  O     . THR A 1 146 ? -5.951  26.809 7.541   1.00 49.09  ? 146  THR C O     1 
ATOM   1107 C  CB    . THR A 1 146 ? -5.406  29.926 7.985   1.00 49.12  ? 146  THR C CB    1 
ATOM   1108 O  OG1   . THR A 1 146 ? -4.503  30.883 8.502   1.00 43.78  ? 146  THR C OG1   1 
ATOM   1109 C  CG2   . THR A 1 146 ? -6.328  29.504 9.111   1.00 51.89  ? 146  THR C CG2   1 
ATOM   1110 N  N     . TYR A 1 147 ? -5.959  27.840 5.570   1.00 50.41  ? 147  TYR C N     1 
ATOM   1111 C  CA    . TYR A 1 147 ? -7.017  27.003 4.983   1.00 51.62  ? 147  TYR C CA    1 
ATOM   1112 C  C     . TYR A 1 147 ? -6.493  26.279 3.764   1.00 51.72  ? 147  TYR C C     1 
ATOM   1113 O  O     . TYR A 1 147 ? -5.654  26.783 3.056   1.00 51.96  ? 147  TYR C O     1 
ATOM   1114 C  CB    . TYR A 1 147 ? -8.244  27.835 4.626   1.00 52.01  ? 147  TYR C CB    1 
ATOM   1115 C  CG    . TYR A 1 147 ? -8.795  28.595 5.796   1.00 51.46  ? 147  TYR C CG    1 
ATOM   1116 C  CD1   . TYR A 1 147 ? -9.655  27.981 6.693   1.00 53.71  ? 147  TYR C CD1   1 
ATOM   1117 C  CD2   . TYR A 1 147 ? -8.451  29.927 6.011   1.00 52.51  ? 147  TYR C CD2   1 
ATOM   1118 C  CE1   . TYR A 1 147 ? -10.130 28.666 7.796   1.00 53.78  ? 147  TYR C CE1   1 
ATOM   1119 C  CE2   . TYR A 1 147 ? -8.928  30.638 7.100   1.00 49.23  ? 147  TYR C CE2   1 
ATOM   1120 C  CZ    . TYR A 1 147 ? -9.767  30.021 7.992   1.00 53.85  ? 147  TYR C CZ    1 
ATOM   1121 O  OH    . TYR A 1 147 ? -10.273 30.696 9.096   1.00 54.47  ? 147  TYR C OH    1 
ATOM   1122 N  N     . ASN A 1 148 ? -7.027  25.107 3.521   1.00 51.85  ? 148  ASN C N     1 
ATOM   1123 C  CA    . ASN A 1 148 ? -6.560  24.243 2.455   1.00 52.76  ? 148  ASN C CA    1 
ATOM   1124 C  C     . ASN A 1 148 ? -7.152  24.790 1.160   1.00 53.34  ? 148  ASN C C     1 
ATOM   1125 O  O     . ASN A 1 148 ? -8.152  25.482 1.217   1.00 55.12  ? 148  ASN C O     1 
ATOM   1126 C  CB    . ASN A 1 148 ? -7.006  22.778 2.719   1.00 50.75  ? 148  ASN C CB    1 
ATOM   1127 C  CG    . ASN A 1 148 ? -6.129  22.020 3.734   1.00 48.73  ? 148  ASN C CG    1 
ATOM   1128 O  OD1   . ASN A 1 148 ? -4.976  22.280 3.879   1.00 46.17  ? 148  ASN C OD1   1 
ATOM   1129 N  ND2   . ASN A 1 148 ? -6.692  21.043 4.383   1.00 42.96  ? 148  ASN C ND2   1 
ATOM   1130 N  N     . PRO A 1 149 ? -6.520  24.542 -0.005  1.00 54.51  ? 149  PRO C N     1 
ATOM   1131 C  CA    . PRO A 1 149 ? -7.045  24.978 -1.320  1.00 54.49  ? 149  PRO C CA    1 
ATOM   1132 C  C     . PRO A 1 149 ? -8.560  24.865 -1.541  1.00 55.41  ? 149  PRO C C     1 
ATOM   1133 O  O     . PRO A 1 149 ? -9.176  25.862 -1.917  1.00 56.02  ? 149  PRO C O     1 
ATOM   1134 C  CB    . PRO A 1 149 ? -6.266  24.088 -2.294  1.00 55.07  ? 149  PRO C CB    1 
ATOM   1135 C  CG    . PRO A 1 149 ? -4.929  23.991 -1.643  1.00 54.62  ? 149  PRO C CG    1 
ATOM   1136 C  CD    . PRO A 1 149 ? -5.199  23.891 -0.160  1.00 55.09  ? 149  PRO C CD    1 
ATOM   1137 N  N     . THR A 1 150 ? -9.148  23.695 -1.277  1.00 54.79  ? 150  THR C N     1 
ATOM   1138 C  CA    . THR A 1 150 ? -10.559 23.437 -1.568  1.00 55.05  ? 150  THR C CA    1 
ATOM   1139 C  C     . THR A 1 150 ? -11.428 24.261 -0.628  1.00 54.61  ? 150  THR C C     1 
ATOM   1140 O  O     . THR A 1 150 ? -12.494 24.788 -1.021  1.00 55.50  ? 150  THR C O     1 
ATOM   1141 C  CB    . THR A 1 150 ? -10.948 21.936 -1.494  1.00 54.94  ? 150  THR C CB    1 
ATOM   1142 O  OG1   . THR A 1 150 ? -10.679 21.386 -0.200  1.00 57.03  ? 150  THR C OG1   1 
ATOM   1143 C  CG2   . THR A 1 150 ? -10.267 21.086 -2.579  1.00 56.11  ? 150  THR C CG2   1 
ATOM   1144 N  N     . ILE A 1 151 ? -10.974 24.396 0.613   1.00 53.88  ? 151  ILE C N     1 
ATOM   1145 C  CA    . ILE A 1 151 ? -11.625 25.295 1.566   1.00 53.87  ? 151  ILE C CA    1 
ATOM   1146 C  C     . ILE A 1 151 ? -11.565 26.766 1.140   1.00 54.21  ? 151  ILE C C     1 
ATOM   1147 O  O     . ILE A 1 151 ? -12.529 27.474 1.323   1.00 54.32  ? 151  ILE C O     1 
ATOM   1148 C  CB    . ILE A 1 151 ? -11.114 25.108 3.022   1.00 54.03  ? 151  ILE C CB    1 
ATOM   1149 C  CG1   . ILE A 1 151 ? -11.428 23.688 3.471   1.00 52.99  ? 151  ILE C CG1   1 
ATOM   1150 C  CG2   . ILE A 1 151 ? -11.776 26.124 3.983   1.00 51.49  ? 151  ILE C CG2   1 
ATOM   1151 C  CD1   . ILE A 1 151 ? -12.963 23.379 3.428   1.00 52.80  ? 151  ILE C CD1   1 
ATOM   1152 N  N     . ARG A 1 152 ? -10.433 27.220 0.584   1.00 54.63  ? 152  ARG C N     1 
ATOM   1153 C  CA    . ARG A 1 152 ? -10.327 28.560 0.112   1.00 53.55  ? 152  ARG C CA    1 
ATOM   1154 C  C     . ARG A 1 152 ? -11.307 28.860 -1.039  1.00 52.77  ? 152  ARG C C     1 
ATOM   1155 O  O     . ARG A 1 152 ? -11.765 29.976 -1.197  1.00 50.76  ? 152  ARG C O     1 
ATOM   1156 C  CB    . ARG A 1 152 ? -8.877  28.869 -0.284  1.00 54.26  ? 152  ARG C CB    1 
ATOM   1157 C  CG    . ARG A 1 152 ? -7.950  28.875 0.910   1.00 53.11  ? 152  ARG C CG    1 
ATOM   1158 C  CD    . ARG A 1 152 ? -6.652  29.593 0.697   1.00 53.49  ? 152  ARG C CD    1 
ATOM   1159 N  NE    . ARG A 1 152 ? -5.892  29.110 -0.442  1.00 53.34  ? 152  ARG C NE    1 
ATOM   1160 C  CZ    . ARG A 1 152 ? -4.941  28.193 -0.423  1.00 55.71  ? 152  ARG C CZ    1 
ATOM   1161 N  NH1   . ARG A 1 152 ? -4.563  27.590 0.680   1.00 57.03  ? 152  ARG C NH1   1 
ATOM   1162 N  NH2   . ARG A 1 152 ? -4.334  27.867 -1.552  1.00 54.09  ? 152  ARG C NH2   1 
ATOM   1163 N  N     . ILE A 1 153 ? -11.600 27.866 -1.848  1.00 51.15  ? 153  ILE C N     1 
ATOM   1164 C  CA    . ILE A 1 153 ? -12.573 28.067 -2.886  1.00 51.77  ? 153  ILE C CA    1 
ATOM   1165 C  C     . ILE A 1 153 ? -13.971 28.276 -2.269  1.00 50.72  ? 153  ILE C C     1 
ATOM   1166 O  O     . ILE A 1 153 ? -14.680 29.171 -2.637  1.00 52.24  ? 153  ILE C O     1 
ATOM   1167 C  CB    . ILE A 1 153 ? -12.613 26.819 -3.833  1.00 51.43  ? 153  ILE C CB    1 
ATOM   1168 C  CG1   . ILE A 1 153 ? -11.302 26.669 -4.618  1.00 49.32  ? 153  ILE C CG1   1 
ATOM   1169 C  CG2   . ILE A 1 153 ? -13.818 26.845 -4.737  1.00 50.35  ? 153  ILE C CG2   1 
ATOM   1170 C  CD1   . ILE A 1 153 ? -11.213 25.359 -5.385  1.00 49.69  ? 153  ILE C CD1   1 
ATOM   1171 N  N     . LEU A 1 154 ? -14.380 27.413 -1.344  1.00 52.67  ? 154  LEU C N     1 
ATOM   1172 C  CA    . LEU A 1 154 ? -15.688 27.550 -0.649  1.00 51.29  ? 154  LEU C CA    1 
ATOM   1173 C  C     . LEU A 1 154 ? -15.838 28.904 0.070   1.00 51.48  ? 154  LEU C C     1 
ATOM   1174 O  O     . LEU A 1 154 ? -16.904 29.536 0.076   1.00 50.69  ? 154  LEU C O     1 
ATOM   1175 C  CB    . LEU A 1 154 ? -15.863 26.408 0.394   1.00 52.49  ? 154  LEU C CB    1 
ATOM   1176 C  CG    . LEU A 1 154 ? -15.955 24.968 -0.142  1.00 53.48  ? 154  LEU C CG    1 
ATOM   1177 C  CD1   . LEU A 1 154 ? -16.539 23.991 0.870   1.00 52.79  ? 154  LEU C CD1   1 
ATOM   1178 C  CD2   . LEU A 1 154 ? -16.826 24.989 -1.367  1.00 52.32  ? 154  LEU C CD2   1 
ATOM   1179 N  N     . ARG A 1 155 ? -14.764 29.302 0.729   1.00 51.05  ? 155  ARG C N     1 
ATOM   1180 C  CA    . ARG A 1 155 ? -14.666 30.567 1.466   1.00 51.11  ? 155  ARG C CA    1 
ATOM   1181 C  C     . ARG A 1 155 ? -14.833 31.773 0.586   1.00 50.89  ? 155  ARG C C     1 
ATOM   1182 O  O     . ARG A 1 155 ? -15.374 32.754 1.028   1.00 51.05  ? 155  ARG C O     1 
ATOM   1183 C  CB    . ARG A 1 155 ? -13.294 30.675 2.157   1.00 51.21  ? 155  ARG C CB    1 
ATOM   1184 C  CG    . ARG A 1 155 ? -13.206 29.885 3.524   1.00 51.65  ? 155  ARG C CG    1 
ATOM   1185 C  CD    . ARG A 1 155 ? -11.849 29.952 4.181   1.00 51.94  ? 155  ARG C CD    1 
ATOM   1186 N  NE    . ARG A 1 155 ? -11.463 31.346 4.451   1.00 54.98  ? 155  ARG C NE    1 
ATOM   1187 C  CZ    . ARG A 1 155 ? -11.746 32.008 5.578   1.00 57.04  ? 155  ARG C CZ    1 
ATOM   1188 N  NH1   . ARG A 1 155 ? -12.444 31.418 6.551   1.00 59.13  ? 155  ARG C NH1   1 
ATOM   1189 N  NH2   . ARG A 1 155 ? -11.388 33.280 5.723   1.00 55.08  ? 155  ARG C NH2   1 
ATOM   1190 N  N     . LEU A 1 156 ? -14.321 31.708 -0.634  1.00 51.03  ? 156  LEU C N     1 
ATOM   1191 C  CA    . LEU A 1 156 ? -14.478 32.765 -1.623  1.00 51.50  ? 156  LEU C CA    1 
ATOM   1192 C  C     . LEU A 1 156 ? -15.933 32.942 -2.056  1.00 51.03  ? 156  LEU C C     1 
ATOM   1193 O  O     . LEU A 1 156 ? -16.395 34.073 -2.173  1.00 50.82  ? 156  LEU C O     1 
ATOM   1194 C  CB    . LEU A 1 156 ? -13.553 32.512 -2.864  1.00 51.64  ? 156  LEU C CB    1 
ATOM   1195 C  CG    . LEU A 1 156 ? -13.659 33.565 -3.981  1.00 52.05  ? 156  LEU C CG    1 
ATOM   1196 C  CD1   . LEU A 1 156 ? -13.107 34.960 -3.628  1.00 51.82  ? 156  LEU C CD1   1 
ATOM   1197 C  CD2   . LEU A 1 156 ? -13.023 33.028 -5.212  1.00 50.39  ? 156  LEU C CD2   1 
ATOM   1198 N  N     . PHE A 1 157 ? -16.599 31.840 -2.349  1.00 51.53  ? 157  PHE C N     1 
ATOM   1199 C  CA    . PHE A 1 157 ? -17.999 31.881 -2.775  1.00 53.35  ? 157  PHE C CA    1 
ATOM   1200 C  C     . PHE A 1 157 ? -18.902 32.349 -1.635  1.00 50.93  ? 157  PHE C C     1 
ATOM   1201 O  O     . PHE A 1 157 ? -19.877 33.040 -1.860  1.00 52.72  ? 157  PHE C O     1 
ATOM   1202 C  CB    . PHE A 1 157 ? -18.465 30.501 -3.256  1.00 53.96  ? 157  PHE C CB    1 
ATOM   1203 C  CG    . PHE A 1 157 ? -17.895 30.079 -4.546  1.00 56.67  ? 157  PHE C CG    1 
ATOM   1204 C  CD1   . PHE A 1 157 ? -17.667 30.987 -5.560  1.00 61.12  ? 157  PHE C CD1   1 
ATOM   1205 C  CD2   . PHE A 1 157 ? -17.652 28.741 -4.790  1.00 60.77  ? 157  PHE C CD2   1 
ATOM   1206 C  CE1   . PHE A 1 157 ? -17.150 30.565 -6.771  1.00 61.09  ? 157  PHE C CE1   1 
ATOM   1207 C  CE2   . PHE A 1 157 ? -17.147 28.297 -6.023  1.00 60.49  ? 157  PHE C CE2   1 
ATOM   1208 C  CZ    . PHE A 1 157 ? -16.887 29.216 -7.000  1.00 60.42  ? 157  PHE C CZ    1 
ATOM   1209 N  N     . TYR A 1 158 ? -18.593 31.928 -0.424  1.00 50.12  ? 158  TYR C N     1 
ATOM   1210 C  CA    . TYR A 1 158 ? -19.338 32.351 0.747   1.00 50.00  ? 158  TYR C CA    1 
ATOM   1211 C  C     . TYR A 1 158 ? -19.197 33.870 0.991   1.00 50.02  ? 158  TYR C C     1 
ATOM   1212 O  O     . TYR A 1 158 ? -20.171 34.557 1.234   1.00 49.68  ? 158  TYR C O     1 
ATOM   1213 C  CB    . TYR A 1 158 ? -18.925 31.534 2.016   1.00 51.22  ? 158  TYR C CB    1 
ATOM   1214 C  CG    . TYR A 1 158 ? -19.690 32.045 3.226   1.00 52.89  ? 158  TYR C CG    1 
ATOM   1215 C  CD1   . TYR A 1 158 ? -21.027 31.775 3.357   1.00 55.27  ? 158  TYR C CD1   1 
ATOM   1216 C  CD2   . TYR A 1 158 ? -19.095 32.873 4.169   1.00 54.69  ? 158  TYR C CD2   1 
ATOM   1217 C  CE1   . TYR A 1 158 ? -21.756 32.271 4.397   1.00 53.54  ? 158  TYR C CE1   1 
ATOM   1218 C  CE2   . TYR A 1 158 ? -19.823 33.365 5.239   1.00 55.35  ? 158  TYR C CE2   1 
ATOM   1219 C  CZ    . TYR A 1 158 ? -21.155 33.061 5.335   1.00 53.29  ? 158  TYR C CZ    1 
ATOM   1220 O  OH    . TYR A 1 158 ? -21.945 33.561 6.383   1.00 56.76  ? 158  TYR C OH    1 
ATOM   1221 N  N     . GLU A 1 159 ? -17.987 34.385 0.923   1.00 51.40  ? 159  GLU C N     1 
ATOM   1222 C  CA    . GLU A 1 159 ? -17.700 35.804 1.123   1.00 52.93  ? 159  GLU C CA    1 
ATOM   1223 C  C     . GLU A 1 159 ? -18.255 36.698 0.011   1.00 51.74  ? 159  GLU C C     1 
ATOM   1224 O  O     . GLU A 1 159 ? -18.689 37.797 0.273   1.00 51.90  ? 159  GLU C O     1 
ATOM   1225 C  CB    . GLU A 1 159 ? -16.155 36.036 1.221   1.00 52.44  ? 159  GLU C CB    1 
ATOM   1226 C  CG    . GLU A 1 159 ? -15.540 35.354 2.437   1.00 57.91  ? 159  GLU C CG    1 
ATOM   1227 C  CD    . GLU A 1 159 ? -13.986 35.284 2.442   1.00 59.20  ? 159  GLU C CD    1 
ATOM   1228 O  OE1   . GLU A 1 159 ? -13.349 36.100 1.743   1.00 71.79  ? 159  GLU C OE1   1 
ATOM   1229 O  OE2   . GLU A 1 159 ? -13.391 34.399 3.122   1.00 69.01  ? 159  GLU C OE2   1 
ATOM   1230 N  N     . LEU A 1 160 ? -18.176 36.263 -1.243  1.00 51.39  ? 160  LEU C N     1 
ATOM   1231 C  CA    . LEU A 1 160 ? -18.819 37.015 -2.325  1.00 51.28  ? 160  LEU C CA    1 
ATOM   1232 C  C     . LEU A 1 160 ? -20.303 37.016 -2.170  1.00 52.46  ? 160  LEU C C     1 
ATOM   1233 O  O     . LEU A 1 160 ? -20.925 38.019 -2.391  1.00 51.30  ? 160  LEU C O     1 
ATOM   1234 C  CB    . LEU A 1 160 ? -18.476 36.403 -3.666  1.00 51.55  ? 160  LEU C CB    1 
ATOM   1235 C  CG    . LEU A 1 160 ? -17.092 36.600 -4.185  1.00 50.13  ? 160  LEU C CG    1 
ATOM   1236 C  CD1   . LEU A 1 160 ? -16.913 35.711 -5.414  1.00 53.80  ? 160  LEU C CD1   1 
ATOM   1237 C  CD2   . LEU A 1 160 ? -16.827 38.101 -4.435  1.00 47.41  ? 160  LEU C CD2   1 
ATOM   1238 N  N     . CYS A 1 161 ? -20.861 35.882 -1.767  1.00 54.51  ? 161  CYS C N     1 
ATOM   1239 C  CA    . CYS A 1 161 ? -22.306 35.800 -1.492  1.00 56.16  ? 161  CYS C CA    1 
ATOM   1240 C  C     . CYS A 1 161 ? -22.769 36.734 -0.333  1.00 56.75  ? 161  CYS C C     1 
ATOM   1241 O  O     . CYS A 1 161 ? -23.703 37.495 -0.470  1.00 56.81  ? 161  CYS C O     1 
ATOM   1242 C  CB    . CYS A 1 161 ? -22.738 34.349 -1.278  1.00 55.05  ? 161  CYS C CB    1 
ATOM   1243 S  SG    . CYS A 1 161 ? -24.562 34.262 -1.296  1.00 56.95  ? 161  CYS C SG    1 
ATOM   1244 N  N     . SER A 1 162 ? -22.032 36.704 0.767   1.00 58.32  ? 162  SER C N     1 
ATOM   1245 C  CA    . SER A 1 162 ? -22.232 37.615 1.874   1.00 59.66  ? 162  SER C CA    1 
ATOM   1246 C  C     . SER A 1 162 ? -22.088 39.055 1.539   1.00 58.97  ? 162  SER C C     1 
ATOM   1247 O  O     . SER A 1 162 ? -22.879 39.859 1.966   1.00 60.09  ? 162  SER C O     1 
ATOM   1248 C  CB    . SER A 1 162 ? -21.249 37.256 2.976   1.00 61.02  ? 162  SER C CB    1 
ATOM   1249 O  OG    . SER A 1 162 ? -21.535 35.932 3.385   1.00 63.61  ? 162  SER C OG    1 
ATOM   1250 N  N     . SER A 1 163 ? -21.087 39.387 0.773   1.00 59.53  ? 163  SER C N     1 
ATOM   1251 C  CA    . SER A 1 163 ? -20.788 40.766 0.481   1.00 59.55  ? 163  SER C CA    1 
ATOM   1252 C  C     . SER A 1 163 ? -21.591 41.254 -0.675  1.00 58.62  ? 163  SER C C     1 
ATOM   1253 O  O     . SER A 1 163 ? -22.101 42.353 -0.620  1.00 58.44  ? 163  SER C O     1 
ATOM   1254 C  CB    . SER A 1 163 ? -19.316 40.905 0.146   1.00 60.14  ? 163  SER C CB    1 
ATOM   1255 O  OG    . SER A 1 163 ? -19.122 42.108 -0.562  1.00 63.48  ? 163  SER C OG    1 
ATOM   1256 N  N     . GLN A 1 164 ? -21.703 40.481 -1.759  1.00 58.04  ? 164  GLN C N     1 
ATOM   1257 C  CA    . GLN A 1 164 ? -22.497 40.975 -2.907  1.00 58.28  ? 164  GLN C CA    1 
ATOM   1258 C  C     . GLN A 1 164 ? -23.581 40.051 -3.539  1.00 55.73  ? 164  GLN C C     1 
ATOM   1259 O  O     . GLN A 1 164 ? -24.060 40.300 -4.636  1.00 55.47  ? 164  GLN C O     1 
ATOM   1260 C  CB    . GLN A 1 164 ? -21.556 41.538 -3.965  1.00 58.62  ? 164  GLN C CB    1 
ATOM   1261 C  CG    . GLN A 1 164 ? -20.630 40.518 -4.584  1.00 61.27  ? 164  GLN C CG    1 
ATOM   1262 C  CD    . GLN A 1 164 ? -19.912 41.089 -5.792  1.00 61.26  ? 164  GLN C CD    1 
ATOM   1263 O  OE1   . GLN A 1 164 ? -20.531 41.266 -6.860  1.00 66.17  ? 164  GLN C OE1   1 
ATOM   1264 N  NE2   . GLN A 1 164 ? -18.624 41.412 -5.634  1.00 59.04  ? 164  GLN C NE2   1 
ATOM   1265 N  N     . GLY A 1 165 ? -23.975 39.021 -2.828  1.00 52.89  ? 165  GLY C N     1 
ATOM   1266 C  CA    . GLY A 1 165 ? -24.984 38.100 -3.324  1.00 51.60  ? 165  GLY C CA    1 
ATOM   1267 C  C     . GLY A 1 165 ? -26.317 38.804 -3.101  1.00 49.50  ? 165  GLY C C     1 
ATOM   1268 O  O     . GLY A 1 165 ? -26.520 39.449 -2.072  1.00 50.75  ? 165  GLY C O     1 
ATOM   1269 N  N     . LYS A 1 166 ? -27.183 38.772 -4.090  1.00 47.50  ? 166  LYS C N     1 
ATOM   1270 C  CA    . LYS A 1 166 ? -28.511 39.361 -3.972  1.00 45.69  ? 166  LYS C CA    1 
ATOM   1271 C  C     . LYS A 1 166 ? -29.503 38.253 -3.706  1.00 43.53  ? 166  LYS C C     1 
ATOM   1272 O  O     . LYS A 1 166 ? -29.442 37.253 -4.380  1.00 41.66  ? 166  LYS C O     1 
ATOM   1273 C  CB    . LYS A 1 166 ? -28.855 40.064 -5.279  1.00 46.20  ? 166  LYS C CB    1 
ATOM   1274 C  CG    . LYS A 1 166 ? -30.066 40.949 -5.179  1.00 49.05  ? 166  LYS C CG    1 
ATOM   1275 C  CD    . LYS A 1 166 ? -30.462 41.656 -6.540  1.00 48.93  ? 166  LYS C CD    1 
ATOM   1276 C  CE    . LYS A 1 166 ? -31.969 41.689 -6.846  1.00 52.00  ? 166  LYS C CE    1 
ATOM   1277 N  NZ    . LYS A 1 166 ? -32.230 41.720 -8.344  1.00 54.13  ? 166  LYS C NZ    1 
ATOM   1278 N  N     . ARG A 1 167 ? -30.416 38.389 -2.741  1.00 42.54  ? 167  ARG C N     1 
ATOM   1279 C  CA    . ARG A 1 167 ? -31.432 37.346 -2.537  1.00 42.44  ? 167  ARG C CA    1 
ATOM   1280 C  C     . ARG A 1 167 ? -32.406 37.368 -3.694  1.00 39.71  ? 167  ARG C C     1 
ATOM   1281 O  O     . ARG A 1 167 ? -32.962 38.413 -3.963  1.00 36.77  ? 167  ARG C O     1 
ATOM   1282 C  CB    . ARG A 1 167 ? -32.286 37.593 -1.284  1.00 43.37  ? 167  ARG C CB    1 
ATOM   1283 C  CG    . ARG A 1 167 ? -31.775 36.763 -0.142  1.00 48.53  ? 167  ARG C CG    1 
ATOM   1284 C  CD    . ARG A 1 167 ? -32.743 36.784 1.036   1.00 49.54  ? 167  ARG C CD    1 
ATOM   1285 N  NE    . ARG A 1 167 ? -32.078 36.290 2.262   1.00 55.31  ? 167  ARG C NE    1 
ATOM   1286 C  CZ    . ARG A 1 167 ? -32.145 35.027 2.700   1.00 57.66  ? 167  ARG C CZ    1 
ATOM   1287 N  NH1   . ARG A 1 167 ? -32.784 34.073 2.027   1.00 58.48  ? 167  ARG C NH1   1 
ATOM   1288 N  NH2   . ARG A 1 167 ? -31.545 34.702 3.829   1.00 59.70  ? 167  ARG C NH2   1 
ATOM   1289 N  N     . VAL A 1 168 ? -32.638 36.215 -4.322  1.00 37.83  ? 168  VAL C N     1 
ATOM   1290 C  CA    . VAL A 1 168 ? -33.644 36.130 -5.382  1.00 35.30  ? 168  VAL C CA    1 
ATOM   1291 C  C     . VAL A 1 168 ? -34.563 34.943 -5.095  1.00 35.72  ? 168  VAL C C     1 
ATOM   1292 O  O     . VAL A 1 168 ? -34.228 33.842 -5.446  1.00 38.88  ? 168  VAL C O     1 
ATOM   1293 C  CB    . VAL A 1 168 ? -32.957 35.929 -6.736  1.00 35.76  ? 168  VAL C CB    1 
ATOM   1294 C  CG1   . VAL A 1 168 ? -34.064 35.826 -7.839  1.00 30.87  ? 168  VAL C CG1   1 
ATOM   1295 C  CG2   . VAL A 1 168 ? -32.036 37.088 -7.003  1.00 32.35  ? 168  VAL C CG2   1 
ATOM   1296 N  N     . GLY A 1 169 ? -35.653 35.144 -4.378  1.00 36.36  ? 169  GLY C N     1 
ATOM   1297 C  CA    . GLY A 1 169 ? -36.428 34.012 -3.913  1.00 38.29  ? 169  GLY C CA    1 
ATOM   1298 C  C     . GLY A 1 169 ? -35.659 33.009 -3.060  1.00 41.12  ? 169  GLY C C     1 
ATOM   1299 O  O     . GLY A 1 169 ? -35.063 33.350 -2.059  1.00 39.06  ? 169  GLY C O     1 
ATOM   1300 N  N     . ASP A 1 170 ? -35.722 31.760 -3.483  1.00 45.70  ? 170  ASP C N     1 
ATOM   1301 C  CA    . ASP A 1 170 ? -34.992 30.608 -2.912  1.00 49.20  ? 170  ASP C CA    1 
ATOM   1302 C  C     . ASP A 1 170 ? -33.409 30.674 -2.874  1.00 51.46  ? 170  ASP C C     1 
ATOM   1303 O  O     . ASP A 1 170 ? -32.723 29.905 -2.128  1.00 52.40  ? 170  ASP C O     1 
ATOM   1304 C  CB    . ASP A 1 170 ? -35.492 29.301 -3.659  1.00 49.90  ? 170  ASP C CB    1 
ATOM   1305 C  CG    . ASP A 1 170 ? -36.303 29.610 -5.009  1.00 51.72  ? 170  ASP C CG    1 
ATOM   1306 O  OD1   . ASP A 1 170 ? -35.774 29.466 -6.182  1.00 52.11  ? 170  ASP C OD1   1 
ATOM   1307 O  OD2   . ASP A 1 170 ? -37.509 30.013 -4.870  1.00 55.70  ? 170  ASP C OD2   1 
ATOM   1308 N  N     . THR A 1 171 ? -32.825 31.611 -3.629  1.00 51.82  ? 171  THR C N     1 
ATOM   1309 C  CA    . THR A 1 171 ? -31.432 31.570 -3.931  1.00 50.81  ? 171  THR C CA    1 
ATOM   1310 C  C     . THR A 1 171 ? -30.753 32.871 -3.574  1.00 51.13  ? 171  THR C C     1 
ATOM   1311 O  O     . THR A 1 171 ? -31.380 33.787 -3.058  1.00 50.73  ? 171  THR C O     1 
ATOM   1312 C  CB    . THR A 1 171 ? -31.259 31.299 -5.416  1.00 50.51  ? 171  THR C CB    1 
ATOM   1313 O  OG1   . THR A 1 171 ? -31.621 32.460 -6.161  1.00 49.92  ? 171  THR C OG1   1 
ATOM   1314 C  CG2   . THR A 1 171 ? -32.117 30.074 -5.858  1.00 49.91  ? 171  THR C CG2   1 
ATOM   1315 N  N     . TYR A 1 172 ? -29.440 32.905 -3.778  1.00 51.72  ? 172  TYR C N     1 
ATOM   1316 C  CA    . TYR A 1 172 ? -28.667 34.156 -3.906  1.00 52.56  ? 172  TYR C CA    1 
ATOM   1317 C  C     . TYR A 1 172 ? -28.038 34.151 -5.287  1.00 51.64  ? 172  TYR C C     1 
ATOM   1318 O  O     . TYR A 1 172 ? -27.568 33.115 -5.747  1.00 51.33  ? 172  TYR C O     1 
ATOM   1319 C  CB    . TYR A 1 172 ? -27.543 34.245 -2.873  1.00 53.33  ? 172  TYR C CB    1 
ATOM   1320 C  CG    . TYR A 1 172 ? -28.013 34.409 -1.442  1.00 55.50  ? 172  TYR C CG    1 
ATOM   1321 C  CD1   . TYR A 1 172 ? -28.381 33.291 -0.661  1.00 55.72  ? 172  TYR C CD1   1 
ATOM   1322 C  CD2   . TYR A 1 172 ? -28.034 35.658 -0.847  1.00 55.20  ? 172  TYR C CD2   1 
ATOM   1323 C  CE1   . TYR A 1 172 ? -28.773 33.451 0.643   1.00 56.71  ? 172  TYR C CE1   1 
ATOM   1324 C  CE2   . TYR A 1 172 ? -28.438 35.818 0.449   1.00 55.20  ? 172  TYR C CE2   1 
ATOM   1325 C  CZ    . TYR A 1 172 ? -28.794 34.712 1.178   1.00 55.46  ? 172  TYR C CZ    1 
ATOM   1326 O  OH    . TYR A 1 172 ? -29.182 34.888 2.448   1.00 57.79  ? 172  TYR C OH    1 
ATOM   1327 N  N     . GLU A 1 173 ? -28.043 35.307 -5.956  1.00 51.00  ? 173  GLU C N     1 
ATOM   1328 C  CA    . GLU A 1 173 ? -27.277 35.485 -7.182  1.00 50.87  ? 173  GLU C CA    1 
ATOM   1329 C  C     . GLU A 1 173 ? -26.087 36.420 -6.992  1.00 50.81  ? 173  GLU C C     1 
ATOM   1330 O  O     . GLU A 1 173 ? -26.247 37.511 -6.477  1.00 48.87  ? 173  GLU C O     1 
ATOM   1331 C  CB    . GLU A 1 173 ? -28.201 36.014 -8.258  1.00 50.19  ? 173  GLU C CB    1 
ATOM   1332 C  CG    . GLU A 1 173 ? -29.225 34.980 -8.650  1.00 50.92  ? 173  GLU C CG    1 
ATOM   1333 C  CD    . GLU A 1 173 ? -30.105 35.445 -9.782  1.00 51.54  ? 173  GLU C CD    1 
ATOM   1334 O  OE1   . GLU A 1 173 ? -29.835 36.540 -10.294 1.00 50.03  ? 173  GLU C OE1   1 
ATOM   1335 O  OE2   . GLU A 1 173 ? -31.071 34.710 -10.141 1.00 54.95  ? 173  GLU C OE2   1 
ATOM   1336 N  N     . ILE A 1 174 ? -24.894 35.992 -7.385  1.00 51.60  ? 174  ILE C N     1 
ATOM   1337 C  CA    . ILE A 1 174 ? -23.736 36.893 -7.449  1.00 53.58  ? 174  ILE C CA    1 
ATOM   1338 C  C     . ILE A 1 174 ? -23.530 37.265 -8.918  1.00 55.30  ? 174  ILE C C     1 
ATOM   1339 O  O     . ILE A 1 174 ? -23.119 36.429 -9.710  1.00 53.75  ? 174  ILE C O     1 
ATOM   1340 C  CB    . ILE A 1 174 ? -22.435 36.226 -6.950  1.00 53.50  ? 174  ILE C CB    1 
ATOM   1341 C  CG1   . ILE A 1 174 ? -22.577 35.707 -5.540  1.00 53.08  ? 174  ILE C CG1   1 
ATOM   1342 C  CG2   . ILE A 1 174 ? -21.271 37.207 -6.955  1.00 52.18  ? 174  ILE C CG2   1 
ATOM   1343 C  CD1   . ILE A 1 174 ? -21.793 34.404 -5.337  1.00 53.82  ? 174  ILE C CD1   1 
ATOM   1344 N  N     . THR A 1 175 ? -23.888 38.498 -9.284  1.00 58.03  ? 175  THR C N     1 
ATOM   1345 C  CA    . THR A 1 175 ? -23.839 38.906 -10.704 1.00 60.32  ? 175  THR C CA    1 
ATOM   1346 C  C     . THR A 1 175 ? -22.402 39.225 -10.997 1.00 61.99  ? 175  THR C C     1 
ATOM   1347 O  O     . THR A 1 175 ? -21.931 40.325 -10.742 1.00 61.01  ? 175  THR C O     1 
ATOM   1348 C  CB    . THR A 1 175 ? -24.811 40.072 -11.095 1.00 60.40  ? 175  THR C CB    1 
ATOM   1349 O  OG1   . THR A 1 175 ? -26.150 39.691 -10.758 1.00 60.72  ? 175  THR C OG1   1 
ATOM   1350 C  CG2   . THR A 1 175 ? -24.748 40.369 -12.631 1.00 58.92  ? 175  THR C CG2   1 
ATOM   1351 N  N     . MET A 1 176 ? -21.719 38.204 -11.496 1.00 64.00  ? 176  MET C N     1 
ATOM   1352 C  CA    . MET A 1 176 ? -20.324 38.293 -11.758 1.00 66.47  ? 176  MET C CA    1 
ATOM   1353 C  C     . MET A 1 176 ? -19.833 37.258 -12.794 1.00 65.45  ? 176  MET C C     1 
ATOM   1354 O  O     . MET A 1 176 ? -20.052 36.054 -12.623 1.00 65.28  ? 176  MET C O     1 
ATOM   1355 C  CB    . MET A 1 176 ? -19.589 38.092 -10.447 1.00 66.64  ? 176  MET C CB    1 
ATOM   1356 C  CG    . MET A 1 176 ? -18.087 38.396 -10.578 1.00 69.91  ? 176  MET C CG    1 
ATOM   1357 S  SD    . MET A 1 176 ? -17.270 38.052 -9.001  1.00 73.77  ? 176  MET C SD    1 
ATOM   1358 C  CE    . MET A 1 176 ? -18.442 38.899 -7.886  1.00 71.79  ? 176  MET C CE    1 
ATOM   1359 N  N     . PRO A 1 177 ? -19.137 37.730 -13.851 1.00 64.30  ? 177  PRO C N     1 
ATOM   1360 C  CA    . PRO A 1 177 ? -18.542 36.832 -14.829 1.00 63.30  ? 177  PRO C CA    1 
ATOM   1361 C  C     . PRO A 1 177 ? -17.147 36.442 -14.395 1.00 62.27  ? 177  PRO C C     1 
ATOM   1362 O  O     . PRO A 1 177 ? -16.246 37.261 -14.408 1.00 61.54  ? 177  PRO C O     1 
ATOM   1363 C  CB    . PRO A 1 177 ? -18.466 37.693 -16.108 1.00 63.45  ? 177  PRO C CB    1 
ATOM   1364 C  CG    . PRO A 1 177 ? -18.287 39.101 -15.606 1.00 64.09  ? 177  PRO C CG    1 
ATOM   1365 C  CD    . PRO A 1 177 ? -18.867 39.145 -14.185 1.00 64.98  ? 177  PRO C CD    1 
ATOM   1366 N  N     . LEU A 1 178 ? -16.970 35.177 -14.069 1.00 60.69  ? 178  LEU C N     1 
ATOM   1367 C  CA    . LEU A 1 178 ? -15.761 34.707 -13.410 1.00 59.40  ? 178  LEU C CA    1 
ATOM   1368 C  C     . LEU A 1 178 ? -15.394 33.303 -13.897 1.00 56.42  ? 178  LEU C C     1 
ATOM   1369 O  O     . LEU A 1 178 ? -16.115 32.391 -13.624 1.00 55.77  ? 178  LEU C O     1 
ATOM   1370 C  CB    . LEU A 1 178 ? -16.105 34.660 -11.916 1.00 60.13  ? 178  LEU C CB    1 
ATOM   1371 C  CG    . LEU A 1 178 ? -15.074 34.359 -10.851 1.00 63.01  ? 178  LEU C CG    1 
ATOM   1372 C  CD1   . LEU A 1 178 ? -13.766 35.279 -10.939 1.00 60.34  ? 178  LEU C CD1   1 
ATOM   1373 C  CD2   . LEU A 1 178 ? -15.976 34.493 -9.623  1.00 63.91  ? 178  LEU C CD2   1 
ATOM   1374 N  N     . SER A 1 179 ? -14.277 33.116 -14.584 1.00 54.24  ? 179  SER C N     1 
ATOM   1375 C  CA    . SER A 1 179 ? -13.958 31.789 -15.064 1.00 52.82  ? 179  SER C CA    1 
ATOM   1376 C  C     . SER A 1 179 ? -13.348 30.884 -13.985 1.00 52.17  ? 179  SER C C     1 
ATOM   1377 O  O     . SER A 1 179 ? -12.814 31.341 -13.013 1.00 52.02  ? 179  SER C O     1 
ATOM   1378 C  CB    . SER A 1 179 ? -13.028 31.883 -16.228 1.00 53.08  ? 179  SER C CB    1 
ATOM   1379 O  OG    . SER A 1 179 ? -11.836 32.529 -15.843 1.00 52.22  ? 179  SER C OG    1 
ATOM   1380 N  N     . GLN A 1 180 ? -13.418 29.577 -14.207 1.00 51.55  ? 180  GLN C N     1 
ATOM   1381 C  CA    . GLN A 1 180 ? -12.734 28.597 -13.347 1.00 50.49  ? 180  GLN C CA    1 
ATOM   1382 C  C     . GLN A 1 180 ? -11.227 28.812 -13.310 1.00 49.57  ? 180  GLN C C     1 
ATOM   1383 O  O     . GLN A 1 180 ? -10.596 28.663 -12.262 1.00 48.40  ? 180  GLN C O     1 
ATOM   1384 C  CB    . GLN A 1 180 ? -13.062 27.157 -13.779 1.00 50.51  ? 180  GLN C CB    1 
ATOM   1385 C  CG    . GLN A 1 180 ? -14.545 26.759 -13.554 1.00 50.71  ? 180  GLN C CG    1 
ATOM   1386 C  CD    . GLN A 1 180 ? -14.847 25.301 -13.829 1.00 49.90  ? 180  GLN C CD    1 
ATOM   1387 O  OE1   . GLN A 1 180 ? -16.035 24.868 -13.869 1.00 48.55  ? 180  GLN C OE1   1 
ATOM   1388 N  NE2   . GLN A 1 180 ? -13.794 24.519 -14.013 1.00 39.76  ? 180  GLN C NE2   1 
ATOM   1389 N  N     . LYS A 1 181 ? -10.656 29.149 -14.464 1.00 49.59  ? 181  LYS C N     1 
ATOM   1390 C  CA    . LYS A 1 181 ? -9.242  29.472 -14.597 1.00 50.10  ? 181  LYS C CA    1 
ATOM   1391 C  C     . LYS A 1 181 ? -8.882  30.633 -13.636 1.00 50.14  ? 181  LYS C C     1 
ATOM   1392 O  O     . LYS A 1 181 ? -7.897  30.525 -12.913 1.00 50.24  ? 181  LYS C O     1 
ATOM   1393 C  CB    . LYS A 1 181 ? -8.886  29.821 -16.044 1.00 50.59  ? 181  LYS C CB    1 
ATOM   1394 C  CG    . LYS A 1 181 ? -7.492  30.421 -16.249 1.00 50.23  ? 181  LYS C CG    1 
ATOM   1395 C  CD    . LYS A 1 181 ? -7.035  30.408 -17.735 1.00 51.14  ? 181  LYS C CD    1 
ATOM   1396 C  CE    . LYS A 1 181 ? -5.630  30.988 -17.936 1.00 52.62  ? 181  LYS C CE    1 
ATOM   1397 N  NZ    . LYS A 1 181 ? -5.573  32.480 -17.711 1.00 57.92  ? 181  LYS C NZ    1 
ATOM   1398 N  N     . SER A 1 182 ? -9.698  31.684 -13.601 1.00 50.16  ? 182  SER C N     1 
ATOM   1399 C  CA    . SER A 1 182 ? -9.415  32.855 -12.726 1.00 50.84  ? 182  SER C CA    1 
ATOM   1400 C  C     . SER A 1 182 ? -9.602  32.534 -11.286 1.00 50.41  ? 182  SER C C     1 
ATOM   1401 O  O     . SER A 1 182 ? -8.825  32.982 -10.480 1.00 50.96  ? 182  SER C O     1 
ATOM   1402 C  CB    A SER A 1 182 ? -10.311 34.041 -13.070 0.50 50.87  ? 182  SER C CB    1 
ATOM   1403 C  CB    B SER A 1 182 ? -10.332 34.035 -13.048 0.50 50.86  ? 182  SER C CB    1 
ATOM   1404 O  OG    A SER A 1 182 ? -9.996  34.518 -14.360 0.50 52.53  ? 182  SER C OG    1 
ATOM   1405 O  OG    B SER A 1 182 ? -10.118 34.486 -14.367 0.50 52.50  ? 182  SER C OG    1 
ATOM   1406 N  N     . ILE A 1 183 ? -10.675 31.834 -10.963 1.00 51.10  ? 183  ILE C N     1 
ATOM   1407 C  CA    . ILE A 1 183 ? -10.908 31.290 -9.600  1.00 50.68  ? 183  ILE C CA    1 
ATOM   1408 C  C     . ILE A 1 183 ? -9.644  30.560 -9.153  1.00 51.53  ? 183  ILE C C     1 
ATOM   1409 O  O     . ILE A 1 183 ? -9.110  30.854 -8.113  1.00 52.29  ? 183  ILE C O     1 
ATOM   1410 C  CB    . ILE A 1 183 ? -12.161 30.387 -9.499  1.00 50.34  ? 183  ILE C CB    1 
ATOM   1411 C  CG1   . ILE A 1 183 ? -13.439 31.165 -9.779  1.00 49.04  ? 183  ILE C CG1   1 
ATOM   1412 C  CG2   . ILE A 1 183 ? -12.286 29.720 -8.122  1.00 50.46  ? 183  ILE C CG2   1 
ATOM   1413 C  CD1   . ILE A 1 183 ? -14.768 30.258 -9.901  1.00 47.27  ? 183  ILE C CD1   1 
ATOM   1414 N  N     . GLY A 1 184 ? -9.119  29.665 -9.982  1.00 51.67  ? 184  GLY C N     1 
ATOM   1415 C  CA    . GLY A 1 184 ? -7.886  28.995 -9.644  1.00 51.39  ? 184  GLY C CA    1 
ATOM   1416 C  C     . GLY A 1 184 ? -6.728  29.933 -9.397  1.00 51.91  ? 184  GLY C C     1 
ATOM   1417 O  O     . GLY A 1 184 ? -5.900  29.719 -8.493  1.00 51.32  ? 184  GLY C O     1 
ATOM   1418 N  N     . GLU A 1 185 ? -6.615  30.972 -10.222 1.00 52.86  ? 185  GLU C N     1 
ATOM   1419 C  CA    . GLU A 1 185 ? -5.477  31.860 -10.174 1.00 53.32  ? 185  GLU C CA    1 
ATOM   1420 C  C     . GLU A 1 185 ? -5.544  32.729 -8.913  1.00 53.91  ? 185  GLU C C     1 
ATOM   1421 O  O     . GLU A 1 185 ? -4.535  32.976 -8.258  1.00 51.98  ? 185  GLU C O     1 
ATOM   1422 C  CB    . GLU A 1 185 ? -5.436  32.770 -11.415 1.00 53.44  ? 185  GLU C CB    1 
ATOM   1423 C  CG    . GLU A 1 185 ? -4.817  32.087 -12.649 1.00 56.49  ? 185  GLU C CG    1 
ATOM   1424 C  CD    . GLU A 1 185 ? -5.077  32.788 -13.970 1.00 55.86  ? 185  GLU C CD    1 
ATOM   1425 O  OE1   . GLU A 1 185 ? -5.807  33.781 -14.035 1.00 64.40  ? 185  GLU C OE1   1 
ATOM   1426 O  OE2   . GLU A 1 185 ? -4.552  32.323 -14.972 1.00 64.43  ? 185  GLU C OE2   1 
ATOM   1427 N  N     . ILE A 1 186 ? -6.763  33.187 -8.602  1.00 53.30  ? 186  ILE C N     1 
ATOM   1428 C  CA    . ILE A 1 186 ? -7.067  34.029 -7.441  1.00 53.51  ? 186  ILE C CA    1 
ATOM   1429 C  C     . ILE A 1 186 ? -6.854  33.237 -6.143  1.00 53.38  ? 186  ILE C C     1 
ATOM   1430 O  O     . ILE A 1 186 ? -6.238  33.781 -5.229  1.00 52.90  ? 186  ILE C O     1 
ATOM   1431 C  CB    . ILE A 1 186 ? -8.527  34.548 -7.536  1.00 52.57  ? 186  ILE C CB    1 
ATOM   1432 C  CG1   . ILE A 1 186 ? -8.647  35.630 -8.592  1.00 51.68  ? 186  ILE C CG1   1 
ATOM   1433 C  CG2   . ILE A 1 186 ? -9.114  35.037 -6.179  1.00 53.57  ? 186  ILE C CG2   1 
ATOM   1434 C  CD1   . ILE A 1 186 ? -10.110 35.890 -8.838  1.00 51.85  ? 186  ILE C CD1   1 
ATOM   1435 N  N     . THR A 1 187 ? -7.302  31.974 -6.104  1.00 53.45  ? 187  THR C N     1 
ATOM   1436 C  CA    . THR A 1 187 ? -7.287  31.141 -4.876  1.00 53.56  ? 187  THR C CA    1 
ATOM   1437 C  C     . THR A 1 187 ? -5.999  30.313 -4.723  1.00 54.57  ? 187  THR C C     1 
ATOM   1438 O  O     . THR A 1 187 ? -5.727  29.773 -3.620  1.00 55.18  ? 187  THR C O     1 
ATOM   1439 C  CB    . THR A 1 187 ? -8.497  30.208 -4.763  1.00 53.78  ? 187  THR C CB    1 
ATOM   1440 O  OG1   . THR A 1 187 ? -8.478  29.239 -5.833  1.00 49.76  ? 187  THR C OG1   1 
ATOM   1441 C  CG2   . THR A 1 187 ? -9.785  30.994 -4.830  1.00 50.86  ? 187  THR C CG2   1 
ATOM   1442 N  N     . GLY A 1 188 ? -5.213  30.228 -5.805  1.00 54.03  ? 188  GLY C N     1 
ATOM   1443 C  CA    . GLY A 1 188 ? -4.036  29.410 -5.824  1.00 54.70  ? 188  GLY C CA    1 
ATOM   1444 C  C     . GLY A 1 188 ? -4.349  27.936 -5.757  1.00 54.57  ? 188  GLY C C     1 
ATOM   1445 O  O     . GLY A 1 188 ? -3.842  27.241 -4.909  1.00 55.60  ? 188  GLY C O     1 
ATOM   1446 N  N     . VAL A 1 189 ? -5.220  27.481 -6.635  1.00 54.57  ? 189  VAL C N     1 
ATOM   1447 C  CA    . VAL A 1 189 ? -5.705  26.106 -6.671  1.00 54.00  ? 189  VAL C CA    1 
ATOM   1448 C  C     . VAL A 1 189 ? -5.626  25.748 -8.152  1.00 53.80  ? 189  VAL C C     1 
ATOM   1449 O  O     . VAL A 1 189 ? -5.886  26.616 -8.998  1.00 53.53  ? 189  VAL C O     1 
ATOM   1450 C  CB    . VAL A 1 189 ? -7.150  25.991 -6.154  1.00 54.60  ? 189  VAL C CB    1 
ATOM   1451 C  CG1   . VAL A 1 189 ? -7.673  24.523 -6.159  1.00 53.77  ? 189  VAL C CG1   1 
ATOM   1452 C  CG2   . VAL A 1 189 ? -7.258  26.595 -4.751  1.00 56.72  ? 189  VAL C CG2   1 
ATOM   1453 N  N     . HIS A 1 190 ? -5.229  24.501 -8.451  1.00 52.65  ? 190  HIS C N     1 
ATOM   1454 C  CA    . HIS A 1 190 ? -5.128  24.024 -9.812  1.00 51.53  ? 190  HIS C CA    1 
ATOM   1455 C  C     . HIS A 1 190 ? -6.527  24.094 -10.425 1.00 50.85  ? 190  HIS C C     1 
ATOM   1456 O  O     . HIS A 1 190 ? -7.520  23.758 -9.767  1.00 52.86  ? 190  HIS C O     1 
ATOM   1457 C  CB    . HIS A 1 190 ? -4.605  22.587 -9.816  1.00 50.05  ? 190  HIS C CB    1 
ATOM   1458 C  CG    . HIS A 1 190 ? -4.149  22.097 -11.160 1.00 50.09  ? 190  HIS C CG    1 
ATOM   1459 N  ND1   . HIS A 1 190 ? -2.826  21.875 -11.455 1.00 51.32  ? 190  HIS C ND1   1 
ATOM   1460 C  CD2   . HIS A 1 190 ? -4.843  21.708 -12.256 1.00 47.09  ? 190  HIS C CD2   1 
ATOM   1461 C  CE1   . HIS A 1 190 ? -2.722  21.404 -12.683 1.00 52.25  ? 190  HIS C CE1   1 
ATOM   1462 N  NE2   . HIS A 1 190 ? -3.937  21.284 -13.190 1.00 51.99  ? 190  HIS C NE2   1 
ATOM   1463 N  N     . HIS A 1 191 ? -6.617  24.476 -11.696 1.00 50.56  ? 191  HIS C N     1 
ATOM   1464 C  CA    . HIS A 1 191 ? -7.914  24.581 -12.365 1.00 49.50  ? 191  HIS C CA    1 
ATOM   1465 C  C     . HIS A 1 191 ? -8.691  23.267 -12.445 1.00 51.25  ? 191  HIS C C     1 
ATOM   1466 O  O     . HIS A 1 191 ? -9.886  23.268 -12.656 1.00 50.08  ? 191  HIS C O     1 
ATOM   1467 C  CB    . HIS A 1 191 ? -7.747  25.208 -13.756 1.00 49.51  ? 191  HIS C CB    1 
ATOM   1468 C  CG    . HIS A 1 191 ? -7.162  24.297 -14.788 1.00 50.00  ? 191  HIS C CG    1 
ATOM   1469 N  ND1   . HIS A 1 191 ? -5.802  24.126 -14.929 1.00 51.81  ? 191  HIS C ND1   1 
ATOM   1470 C  CD2   . HIS A 1 191 ? -7.743  23.538 -15.752 1.00 49.91  ? 191  HIS C CD2   1 
ATOM   1471 C  CE1   . HIS A 1 191 ? -5.572  23.274 -15.916 1.00 50.24  ? 191  HIS C CE1   1 
ATOM   1472 N  NE2   . HIS A 1 191 ? -6.736  22.889 -16.422 1.00 47.92  ? 191  HIS C NE2   1 
ATOM   1473 N  N     . VAL A 1 192 ? -8.008  22.131 -12.332 1.00 52.43  ? 192  VAL C N     1 
ATOM   1474 C  CA    . VAL A 1 192 ? -8.726  20.853 -12.414 1.00 52.24  ? 192  VAL C CA    1 
ATOM   1475 C  C     . VAL A 1 192 ? -9.383  20.618 -11.043 1.00 52.84  ? 192  VAL C C     1 
ATOM   1476 O  O     . VAL A 1 192 ? -10.511 20.121 -10.995 1.00 54.56  ? 192  VAL C O     1 
ATOM   1477 C  CB    . VAL A 1 192 ? -7.918  19.627 -13.016 1.00 52.54  ? 192  VAL C CB    1 
ATOM   1478 C  CG1   . VAL A 1 192 ? -6.582  20.060 -13.511 1.00 52.77  ? 192  VAL C CG1   1 
ATOM   1479 C  CG2   . VAL A 1 192 ? -7.899  18.363 -12.078 1.00 49.38  ? 192  VAL C CG2   1 
ATOM   1480 N  N     . THR A 1 193 ? -8.709  20.978 -9.945  1.00 52.75  ? 193  THR C N     1 
ATOM   1481 C  CA    . THR A 1 193 ? -9.340  20.909 -8.612  1.00 52.26  ? 193  THR C CA    1 
ATOM   1482 C  C     . THR A 1 193 ? -10.556 21.818 -8.575  1.00 51.53  ? 193  THR C C     1 
ATOM   1483 O  O     . THR A 1 193 ? -11.580 21.473 -7.989  1.00 50.61  ? 193  THR C O     1 
ATOM   1484 C  CB    . THR A 1 193 ? -8.366  21.296 -7.482  1.00 52.24  ? 193  THR C CB    1 
ATOM   1485 O  OG1   . THR A 1 193 ? -7.276  20.383 -7.465  1.00 52.75  ? 193  THR C OG1   1 
ATOM   1486 C  CG2   . THR A 1 193 ? -9.074  21.288 -6.111  1.00 51.92  ? 193  THR C CG2   1 
ATOM   1487 N  N     . VAL A 1 194 ? -10.451 22.976 -9.229  1.00 51.33  ? 194  VAL C N     1 
ATOM   1488 C  CA    . VAL A 1 194 ? -11.577 23.947 -9.259  1.00 50.75  ? 194  VAL C CA    1 
ATOM   1489 C  C     . VAL A 1 194 ? -12.761 23.285 -9.964  1.00 50.86  ? 194  VAL C C     1 
ATOM   1490 O  O     . VAL A 1 194 ? -13.927 23.353 -9.487  1.00 52.95  ? 194  VAL C O     1 
ATOM   1491 C  CB    . VAL A 1 194 ? -11.200 25.289 -9.971  1.00 50.77  ? 194  VAL C CB    1 
ATOM   1492 C  CG1   . VAL A 1 194 ? -12.426 26.201 -10.106 1.00 50.52  ? 194  VAL C CG1   1 
ATOM   1493 C  CG2   . VAL A 1 194 ? -10.085 26.026 -9.200  1.00 48.66  ? 194  VAL C CG2   1 
ATOM   1494 N  N     . SER A 1 195 ? -12.477 22.625 -11.091 1.00 50.20  ? 195  SER C N     1 
ATOM   1495 C  CA    . SER A 1 195 ? -13.544 21.919 -11.844 1.00 49.35  ? 195  SER C CA    1 
ATOM   1496 C  C     . SER A 1 195 ? -14.227 20.851 -11.016 1.00 49.98  ? 195  SER C C     1 
ATOM   1497 O  O     . SER A 1 195 ? -15.459 20.724 -11.027 1.00 48.45  ? 195  SER C O     1 
ATOM   1498 C  CB    . SER A 1 195 ? -13.023 21.312 -13.139 1.00 48.92  ? 195  SER C CB    1 
ATOM   1499 O  OG    . SER A 1 195 ? -14.077 20.665 -13.845 1.00 51.63  ? 195  SER C OG    1 
ATOM   1500 N  N     . ARG A 1 196 ? -13.422 20.105 -10.266 1.00 50.71  ? 196  ARG C N     1 
ATOM   1501 C  CA    . ARG A 1 196 ? -13.912 19.002 -9.421  1.00 51.03  ? 196  ARG C CA    1 
ATOM   1502 C  C     . ARG A 1 196 ? -14.827 19.462 -8.304  1.00 49.94  ? 196  ARG C C     1 
ATOM   1503 O  O     . ARG A 1 196 ? -15.873 18.924 -8.099  1.00 50.64  ? 196  ARG C O     1 
ATOM   1504 C  CB    . ARG A 1 196 ? -12.695 18.306 -8.803  1.00 51.46  ? 196  ARG C CB    1 
ATOM   1505 C  CG    . ARG A 1 196 ? -13.064 17.278 -7.754  1.00 53.39  ? 196  ARG C CG    1 
ATOM   1506 C  CD    . ARG A 1 196 ? -11.881 16.863 -6.931  1.00 53.39  ? 196  ARG C CD    1 
ATOM   1507 N  NE    . ARG A 1 196 ? -11.844 15.429 -6.983  1.00 54.43  ? 196  ARG C NE    1 
ATOM   1508 C  CZ    . ARG A 1 196 ? -12.387 14.601 -6.096  1.00 58.77  ? 196  ARG C CZ    1 
ATOM   1509 N  NH1   . ARG A 1 196 ? -13.005 15.080 -5.010  1.00 64.48  ? 196  ARG C NH1   1 
ATOM   1510 N  NH2   . ARG A 1 196 ? -12.309 13.294 -6.294  1.00 52.62  ? 196  ARG C NH2   1 
ATOM   1511 N  N     . VAL A 1 197 ? -14.370 20.481 -7.577  1.00 52.08  ? 197  VAL C N     1 
ATOM   1512 C  CA    . VAL A 1 197 ? -15.115 21.099 -6.469  1.00 51.71  ? 197  VAL C CA    1 
ATOM   1513 C  C     . VAL A 1 197 ? -16.434 21.667 -6.914  1.00 51.78  ? 197  VAL C C     1 
ATOM   1514 O  O     . VAL A 1 197 ? -17.458 21.467 -6.260  1.00 52.17  ? 197  VAL C O     1 
ATOM   1515 C  CB    . VAL A 1 197 ? -14.215 22.211 -5.795  1.00 52.57  ? 197  VAL C CB    1 
ATOM   1516 C  CG1   . VAL A 1 197 ? -15.062 23.214 -4.915  1.00 50.07  ? 197  VAL C CG1   1 
ATOM   1517 C  CG2   . VAL A 1 197 ? -13.069 21.526 -5.026  1.00 48.59  ? 197  VAL C CG2   1 
ATOM   1518 N  N     . LEU A 1 198 ? -16.433 22.365 -8.039  1.00 52.27  ? 198  LEU C N     1 
ATOM   1519 C  CA    . LEU A 1 198 ? -17.666 22.907 -8.601  1.00 51.85  ? 198  LEU C CA    1 
ATOM   1520 C  C     . LEU A 1 198 ? -18.625 21.832 -9.092  1.00 52.63  ? 198  LEU C C     1 
ATOM   1521 O  O     . LEU A 1 198 ? -19.831 22.017 -8.953  1.00 53.40  ? 198  LEU C O     1 
ATOM   1522 C  CB    . LEU A 1 198 ? -17.368 23.922 -9.722  1.00 52.73  ? 198  LEU C CB    1 
ATOM   1523 C  CG    . LEU A 1 198 ? -16.783 25.312 -9.379  1.00 52.42  ? 198  LEU C CG    1 
ATOM   1524 C  CD1   . LEU A 1 198 ? -16.352 26.131 -10.623 1.00 52.26  ? 198  LEU C CD1   1 
ATOM   1525 C  CD2   . LEU A 1 198 ? -17.767 26.112 -8.556  1.00 54.84  ? 198  LEU C CD2   1 
ATOM   1526 N  N     . ALA A 1 199 ? -18.111 20.734 -9.678  1.00 51.75  ? 199  ALA C N     1 
ATOM   1527 C  CA    . ALA A 1 199 ? -18.903 19.557 -9.991  1.00 50.87  ? 199  ALA C CA    1 
ATOM   1528 C  C     . ALA A 1 199 ? -19.662 19.079 -8.759  1.00 50.53  ? 199  ALA C C     1 
ATOM   1529 O  O     . ALA A 1 199 ? -20.870 18.805 -8.795  1.00 49.90  ? 199  ALA C O     1 
ATOM   1530 C  CB    . ALA A 1 199 ? -17.980 18.440 -10.515 1.00 51.21  ? 199  ALA C CB    1 
ATOM   1531 N  N     . SER A 1 200 ? -18.962 19.022 -7.642  1.00 50.28  ? 200  SER C N     1 
ATOM   1532 C  CA    . SER A 1 200 ? -19.549 18.507 -6.427  1.00 50.62  ? 200  SER C CA    1 
ATOM   1533 C  C     . SER A 1 200 ? -20.630 19.418 -5.969  1.00 50.34  ? 200  SER C C     1 
ATOM   1534 O  O     . SER A 1 200 ? -21.701 18.973 -5.688  1.00 48.13  ? 200  SER C O     1 
ATOM   1535 C  CB    . SER A 1 200 ? -18.514 18.407 -5.318  1.00 50.52  ? 200  SER C CB    1 
ATOM   1536 O  OG    . SER A 1 200 ? -17.743 17.254 -5.474  1.00 52.15  ? 200  SER C OG    1 
ATOM   1537 N  N     . LEU A 1 201 ? -20.294 20.704 -5.845  1.00 50.95  ? 201  LEU C N     1 
ATOM   1538 C  CA    . LEU A 1 201 ? -21.232 21.733 -5.359  1.00 51.53  ? 201  LEU C CA    1 
ATOM   1539 C  C     . LEU A 1 201 ? -22.488 21.776 -6.229  1.00 52.54  ? 201  LEU C C     1 
ATOM   1540 O  O     . LEU A 1 201 ? -23.581 22.041 -5.732  1.00 52.05  ? 201  LEU C O     1 
ATOM   1541 C  CB    . LEU A 1 201 ? -20.550 23.091 -5.337  1.00 51.53  ? 201  LEU C CB    1 
ATOM   1542 C  CG    . LEU A 1 201 ? -19.423 23.353 -4.337  1.00 49.86  ? 201  LEU C CG    1 
ATOM   1543 C  CD1   . LEU A 1 201 ? -18.755 24.726 -4.590  1.00 45.87  ? 201  LEU C CD1   1 
ATOM   1544 C  CD2   . LEU A 1 201 ? -19.958 23.297 -2.929  1.00 50.34  ? 201  LEU C CD2   1 
ATOM   1545 N  N     . LYS A 1 202 ? -22.324 21.533 -7.529  1.00 54.77  ? 202  LYS C N     1 
ATOM   1546 C  CA    . LYS A 1 202 ? -23.441 21.560 -8.475  1.00 55.88  ? 202  LYS C CA    1 
ATOM   1547 C  C     . LYS A 1 202 ? -24.357 20.368 -8.248  1.00 56.46  ? 202  LYS C C     1 
ATOM   1548 O  O     . LYS A 1 202 ? -25.567 20.542 -8.064  1.00 56.33  ? 202  LYS C O     1 
ATOM   1549 C  CB    . LYS A 1 202 ? -23.000 21.565 -9.961  1.00 56.17  ? 202  LYS C CB    1 
ATOM   1550 C  CG    . LYS A 1 202 ? -24.165 22.035 -10.902 1.00 57.39  ? 202  LYS C CG    1 
ATOM   1551 C  CD    . LYS A 1 202 ? -24.338 21.221 -12.187 1.00 61.13  ? 202  LYS C CD    1 
ATOM   1552 C  CE    . LYS A 1 202 ? -23.914 22.006 -13.454 1.00 63.50  ? 202  LYS C CE    1 
ATOM   1553 N  NZ    . LYS A 1 202 ? -25.060 22.768 -14.084 1.00 65.00  ? 202  LYS C NZ    1 
ATOM   1554 N  N     . ARG A 1 203 ? -23.770 19.170 -8.248  1.00 57.10  ? 203  ARG C N     1 
ATOM   1555 C  CA    . ARG A 1 203 ? -24.559 17.951 -8.138  1.00 57.42  ? 203  ARG C CA    1 
ATOM   1556 C  C     . ARG A 1 203 ? -25.192 17.814 -6.758  1.00 56.71  ? 203  ARG C C     1 
ATOM   1557 O  O     . ARG A 1 203 ? -26.275 17.234 -6.653  1.00 57.44  ? 203  ARG C O     1 
ATOM   1558 C  CB    . ARG A 1 203 ? -23.761 16.691 -8.522  1.00 58.19  ? 203  ARG C CB    1 
ATOM   1559 C  CG    . ARG A 1 203 ? -23.252 15.839 -7.354  1.00 59.50  ? 203  ARG C CG    1 
ATOM   1560 C  CD    . ARG A 1 203 ? -22.592 14.569 -7.828  1.00 58.18  ? 203  ARG C CD    1 
ATOM   1561 N  NE    . ARG A 1 203 ? -21.301 14.855 -8.423  1.00 58.34  ? 203  ARG C NE    1 
ATOM   1562 C  CZ    . ARG A 1 203 ? -20.177 15.023 -7.731  1.00 59.82  ? 203  ARG C CZ    1 
ATOM   1563 N  NH1   . ARG A 1 203 ? -20.163 14.941 -6.397  1.00 61.06  ? 203  ARG C NH1   1 
ATOM   1564 N  NH2   . ARG A 1 203 ? -19.056 15.295 -8.375  1.00 58.71  ? 203  ARG C NH2   1 
ATOM   1565 N  N     . GLU A 1 204 ? -24.573 18.369 -5.718  1.00 55.90  ? 204  GLU C N     1 
ATOM   1566 C  CA    . GLU A 1 204 ? -25.242 18.415 -4.420  1.00 55.81  ? 204  GLU C CA    1 
ATOM   1567 C  C     . GLU A 1 204 ? -26.230 19.570 -4.278  1.00 54.97  ? 204  GLU C C     1 
ATOM   1568 O  O     . GLU A 1 204 ? -26.692 19.790 -3.173  1.00 54.91  ? 204  GLU C O     1 
ATOM   1569 C  CB    . GLU A 1 204 ? -24.270 18.595 -3.275  1.00 55.74  ? 204  GLU C CB    1 
ATOM   1570 C  CG    . GLU A 1 204 ? -22.995 17.878 -3.399  1.00 59.75  ? 204  GLU C CG    1 
ATOM   1571 C  CD    . GLU A 1 204 ? -22.546 17.331 -2.077  1.00 64.78  ? 204  GLU C CD    1 
ATOM   1572 O  OE1   . GLU A 1 204 ? -21.598 17.939 -1.458  1.00 64.68  ? 204  GLU C OE1   1 
ATOM   1573 O  OE2   . GLU A 1 204 ? -23.181 16.296 -1.692  1.00 67.57  ? 204  GLU C OE2   1 
ATOM   1574 N  N     . ASN A 1 205 ? -26.463 20.356 -5.339  1.00 54.87  ? 205  ASN C N     1 
ATOM   1575 C  CA    . ASN A 1 205 ? -27.380 21.486 -5.285  1.00 54.94  ? 205  ASN C CA    1 
ATOM   1576 C  C     . ASN A 1 205 ? -27.097 22.565 -4.227  1.00 54.46  ? 205  ASN C C     1 
ATOM   1577 O  O     . ASN A 1 205 ? -27.983 23.051 -3.512  1.00 51.62  ? 205  ASN C O     1 
ATOM   1578 C  CB    . ASN A 1 205 ? -28.808 20.954 -5.182  1.00 56.60  ? 205  ASN C CB    1 
ATOM   1579 C  CG    . ASN A 1 205 ? -29.361 20.614 -6.541  1.00 59.17  ? 205  ASN C CG    1 
ATOM   1580 O  OD1   . ASN A 1 205 ? -29.552 19.428 -6.899  1.00 59.37  ? 205  ASN C OD1   1 
ATOM   1581 N  ND2   . ASN A 1 205 ? -29.565 21.687 -7.357  1.00 64.75  ? 205  ASN C ND2   1 
ATOM   1582 N  N     . ILE A 1 206 ? -25.833 22.975 -4.165  1.00 54.61  ? 206  ILE C N     1 
ATOM   1583 C  CA    . ILE A 1 206 ? -25.393 23.995 -3.197  1.00 54.65  ? 206  ILE C CA    1 
ATOM   1584 C  C     . ILE A 1 206 ? -25.182 25.286 -3.942  1.00 54.98  ? 206  ILE C C     1 
ATOM   1585 O  O     . ILE A 1 206 ? -25.585 26.328 -3.468  1.00 55.14  ? 206  ILE C O     1 
ATOM   1586 C  CB    . ILE A 1 206 ? -24.137 23.520 -2.407  1.00 54.28  ? 206  ILE C CB    1 
ATOM   1587 C  CG1   . ILE A 1 206 ? -24.534 22.310 -1.522  1.00 55.43  ? 206  ILE C CG1   1 
ATOM   1588 C  CG2   . ILE A 1 206 ? -23.561 24.658 -1.549  1.00 54.54  ? 206  ILE C CG2   1 
ATOM   1589 C  CD1   . ILE A 1 206 ? -23.428 21.431 -1.085  1.00 54.16  ? 206  ILE C CD1   1 
ATOM   1590 N  N     . LEU A 1 207 ? -24.626 25.168 -5.145  1.00 55.73  ? 207  LEU C N     1 
ATOM   1591 C  CA    . LEU A 1 207 ? -24.127 26.292 -5.893  1.00 56.70  ? 207  LEU C CA    1 
ATOM   1592 C  C     . LEU A 1 207 ? -23.911 25.900 -7.352  1.00 56.91  ? 207  LEU C C     1 
ATOM   1593 O  O     . LEU A 1 207 ? -23.383 24.835 -7.643  1.00 55.59  ? 207  LEU C O     1 
ATOM   1594 C  CB    . LEU A 1 207 ? -22.798 26.745 -5.261  1.00 56.76  ? 207  LEU C CB    1 
ATOM   1595 C  CG    . LEU A 1 207 ? -21.891 27.842 -5.803  1.00 58.08  ? 207  LEU C CG    1 
ATOM   1596 C  CD1   . LEU A 1 207 ? -21.121 28.431 -4.608  1.00 62.20  ? 207  LEU C CD1   1 
ATOM   1597 C  CD2   . LEU A 1 207 ? -20.965 27.386 -6.920  1.00 57.72  ? 207  LEU C CD2   1 
ATOM   1598 N  N     . ASP A 1 208 ? -24.262 26.822 -8.245  1.00 58.11  ? 208  ASP C N     1 
ATOM   1599 C  CA    . ASP A 1 208 ? -24.024 26.712 -9.682  1.00 58.72  ? 208  ASP C CA    1 
ATOM   1600 C  C     . ASP A 1 208 ? -23.342 27.979 -10.231 1.00 58.33  ? 208  ASP C C     1 
ATOM   1601 O  O     . ASP A 1 208 ? -23.901 29.049 -10.261 1.00 57.16  ? 208  ASP C O     1 
ATOM   1602 C  CB    . ASP A 1 208 ? -25.375 26.458 -10.385 1.00 59.12  ? 208  ASP C CB    1 
ATOM   1603 C  CG    . ASP A 1 208 ? -25.230 25.765 -11.727 1.00 60.02  ? 208  ASP C CG    1 
ATOM   1604 O  OD1   . ASP A 1 208 ? -24.086 25.678 -12.226 1.00 62.70  ? 208  ASP C OD1   1 
ATOM   1605 O  OD2   . ASP A 1 208 ? -26.263 25.296 -12.281 1.00 65.17  ? 208  ASP C OD2   1 
ATOM   1606 N  N     . LYS A 1 209 ? -22.089 27.831 -10.630 1.00 59.49  ? 209  LYS C N     1 
ATOM   1607 C  CA    . LYS A 1 209 ? -21.310 28.893 -11.254 1.00 59.53  ? 209  LYS C CA    1 
ATOM   1608 C  C     . LYS A 1 209 ? -21.581 28.872 -12.770 1.00 60.12  ? 209  LYS C C     1 
ATOM   1609 O  O     . LYS A 1 209 ? -21.094 27.993 -13.457 1.00 61.16  ? 209  LYS C O     1 
ATOM   1610 C  CB    . LYS A 1 209 ? -19.821 28.667 -10.928 1.00 59.21  ? 209  LYS C CB    1 
ATOM   1611 C  CG    . LYS A 1 209 ? -18.861 29.781 -11.358 1.00 59.67  ? 209  LYS C CG    1 
ATOM   1612 C  CD    . LYS A 1 209 ? -18.063 29.346 -12.603 1.00 59.29  ? 209  LYS C CD    1 
ATOM   1613 C  CE    . LYS A 1 209 ? -17.481 30.533 -13.264 1.00 60.55  ? 209  LYS C CE    1 
ATOM   1614 N  NZ    . LYS A 1 209 ? -17.733 30.568 -14.717 1.00 56.49  ? 209  LYS C NZ    1 
ATOM   1615 N  N     . LYS A 1 210 ? -22.366 29.827 -13.278 1.00 60.33  ? 210  LYS C N     1 
ATOM   1616 C  CA    . LYS A 1 210 ? -22.707 29.920 -14.711 1.00 60.06  ? 210  LYS C CA    1 
ATOM   1617 C  C     . LYS A 1 210 ? -21.831 30.962 -15.406 1.00 59.73  ? 210  LYS C C     1 
ATOM   1618 O  O     . LYS A 1 210 ? -20.843 31.439 -14.815 1.00 59.64  ? 210  LYS C O     1 
ATOM   1619 C  CB    . LYS A 1 210 ? -24.172 30.283 -14.847 1.00 60.42  ? 210  LYS C CB    1 
ATOM   1620 C  CG    . LYS A 1 210 ? -25.020 29.374 -14.012 1.00 62.27  ? 210  LYS C CG    1 
ATOM   1621 C  CD    . LYS A 1 210 ? -26.418 29.840 -13.916 1.00 63.37  ? 210  LYS C CD    1 
ATOM   1622 C  CE    . LYS A 1 210 ? -27.235 29.361 -15.073 1.00 65.07  ? 210  LYS C CE    1 
ATOM   1623 N  NZ    . LYS A 1 210 ? -27.820 28.045 -14.738 1.00 67.97  ? 210  LYS C NZ    1 
ATOM   1624 N  N     . LYS A 1 211 ? -22.173 31.317 -16.646 1.00 59.60  ? 211  LYS C N     1 
ATOM   1625 C  CA    . LYS A 1 211 ? -21.342 32.260 -17.416 1.00 59.48  ? 211  LYS C CA    1 
ATOM   1626 C  C     . LYS A 1 211 ? -21.222 33.617 -16.732 1.00 59.35  ? 211  LYS C C     1 
ATOM   1627 O  O     . LYS A 1 211 ? -20.123 34.180 -16.591 1.00 59.75  ? 211  LYS C O     1 
ATOM   1628 C  CB    . LYS A 1 211 ? -21.888 32.467 -18.829 1.00 59.58  ? 211  LYS C CB    1 
ATOM   1629 N  N     . ASN A 1 212 ? -22.352 34.160 -16.318 1.00 58.85  ? 212  ASN C N     1 
ATOM   1630 C  CA    . ASN A 1 212 ? -22.365 35.534 -15.845 1.00 58.22  ? 212  ASN C CA    1 
ATOM   1631 C  C     . ASN A 1 212 ? -22.909 35.701 -14.438 1.00 56.66  ? 212  ASN C C     1 
ATOM   1632 O  O     . ASN A 1 212 ? -23.062 36.822 -14.001 1.00 56.71  ? 212  ASN C O     1 
ATOM   1633 C  CB    . ASN A 1 212 ? -23.195 36.377 -16.833 1.00 58.63  ? 212  ASN C CB    1 
ATOM   1634 C  CG    . ASN A 1 212 ? -22.651 36.291 -18.266 1.00 60.10  ? 212  ASN C CG    1 
ATOM   1635 O  OD1   . ASN A 1 212 ? -21.461 36.570 -18.501 1.00 60.83  ? 212  ASN C OD1   1 
ATOM   1636 N  ND2   . ASN A 1 212 ? -23.502 35.863 -19.212 1.00 58.19  ? 212  ASN C ND2   1 
ATOM   1637 N  N     . LYS A 1 213 ? -23.189 34.593 -13.752 1.00 55.09  ? 213  LYS C N     1 
ATOM   1638 C  CA    . LYS A 1 213 ? -23.809 34.588 -12.427 1.00 53.53  ? 213  LYS C CA    1 
ATOM   1639 C  C     . LYS A 1 213 ? -23.369 33.305 -11.694 1.00 52.45  ? 213  LYS C C     1 
ATOM   1640 O  O     . LYS A 1 213 ? -23.208 32.236 -12.300 1.00 50.99  ? 213  LYS C O     1 
ATOM   1641 C  CB    . LYS A 1 213 ? -25.350 34.571 -12.503 1.00 53.79  ? 213  LYS C CB    1 
ATOM   1642 C  CG    . LYS A 1 213 ? -26.077 35.866 -12.731 1.00 54.40  ? 213  LYS C CG    1 
ATOM   1643 C  CD    . LYS A 1 213 ? -27.573 35.613 -12.838 1.00 52.80  ? 213  LYS C CD    1 
ATOM   1644 N  N     . ILE A 1 214 ? -23.104 33.441 -10.403 1.00 51.10  ? 214  ILE C N     1 
ATOM   1645 C  CA    . ILE A 1 214 ? -23.054 32.319 -9.503  1.00 51.45  ? 214  ILE C CA    1 
ATOM   1646 C  C     . ILE A 1 214 ? -24.383 32.340 -8.747  1.00 51.62  ? 214  ILE C C     1 
ATOM   1647 O  O     . ILE A 1 214 ? -24.778 33.371 -8.222  1.00 51.17  ? 214  ILE C O     1 
ATOM   1648 C  CB    . ILE A 1 214 ? -21.911 32.366 -8.477  1.00 51.59  ? 214  ILE C CB    1 
ATOM   1649 C  CG1   . ILE A 1 214 ? -20.554 32.371 -9.162  1.00 52.58  ? 214  ILE C CG1   1 
ATOM   1650 C  CG2   . ILE A 1 214 ? -21.929 31.136 -7.563  1.00 50.63  ? 214  ILE C CG2   1 
ATOM   1651 C  CD1   . ILE A 1 214 ? -19.722 33.640 -8.926  1.00 53.01  ? 214  ILE C CD1   1 
ATOM   1652 N  N     . ILE A 1 215 ? -25.033 31.181 -8.686  1.00 52.45  ? 215  ILE C N     1 
ATOM   1653 C  CA    . ILE A 1 215 ? -26.296 30.978 -7.974  1.00 52.36  ? 215  ILE C CA    1 
ATOM   1654 C  C     . ILE A 1 215 ? -26.108 30.062 -6.745  1.00 52.65  ? 215  ILE C C     1 
ATOM   1655 O  O     . ILE A 1 215 ? -25.649 28.953 -6.879  1.00 51.81  ? 215  ILE C O     1 
ATOM   1656 C  CB    . ILE A 1 215 ? -27.382 30.444 -8.980  1.00 53.24  ? 215  ILE C CB    1 
ATOM   1657 C  CG1   . ILE A 1 215 ? -27.430 31.400 -10.192 1.00 53.20  ? 215  ILE C CG1   1 
ATOM   1658 C  CG2   . ILE A 1 215 ? -28.802 30.284 -8.300  1.00 51.20  ? 215  ILE C CG2   1 
ATOM   1659 C  CD1   . ILE A 1 215 ? -28.400 31.064 -11.227 1.00 52.80  ? 215  ILE C CD1   1 
ATOM   1660 N  N     . VAL A 1 216 ? -26.403 30.548 -5.535  1.00 52.97  ? 216  VAL C N     1 
ATOM   1661 C  CA    . VAL A 1 216 ? -26.259 29.732 -4.327  1.00 53.40  ? 216  VAL C CA    1 
ATOM   1662 C  C     . VAL A 1 216 ? -27.642 29.309 -3.898  1.00 54.72  ? 216  VAL C C     1 
ATOM   1663 O  O     . VAL A 1 216 ? -28.496 30.124 -3.554  1.00 53.77  ? 216  VAL C O     1 
ATOM   1664 C  CB    . VAL A 1 216 ? -25.464 30.476 -3.192  1.00 53.98  ? 216  VAL C CB    1 
ATOM   1665 C  CG1   . VAL A 1 216 ? -25.177 29.557 -2.042  1.00 53.39  ? 216  VAL C CG1   1 
ATOM   1666 C  CG2   . VAL A 1 216 ? -24.142 31.016 -3.755  1.00 52.97  ? 216  VAL C CG2   1 
ATOM   1667 N  N     . TYR A 1 217 ? -27.873 28.009 -4.061  1.00 55.49  ? 217  TYR C N     1 
ATOM   1668 C  CA    . TYR A 1 217 ? -29.095 27.356 -3.682  1.00 55.07  ? 217  TYR C CA    1 
ATOM   1669 C  C     . TYR A 1 217 ? -29.102 27.040 -2.199  1.00 55.38  ? 217  TYR C C     1 
ATOM   1670 O  O     . TYR A 1 217 ? -30.146 26.810 -1.646  1.00 56.02  ? 217  TYR C O     1 
ATOM   1671 C  CB    . TYR A 1 217 ? -29.225 26.055 -4.467  1.00 55.00  ? 217  TYR C CB    1 
ATOM   1672 C  CG    . TYR A 1 217 ? -29.281 26.272 -5.950  1.00 55.44  ? 217  TYR C CG    1 
ATOM   1673 C  CD1   . TYR A 1 217 ? -30.412 26.826 -6.545  1.00 59.14  ? 217  TYR C CD1   1 
ATOM   1674 C  CD2   . TYR A 1 217 ? -28.203 25.925 -6.779  1.00 57.61  ? 217  TYR C CD2   1 
ATOM   1675 C  CE1   . TYR A 1 217 ? -30.479 27.015 -7.940  1.00 59.52  ? 217  TYR C CE1   1 
ATOM   1676 C  CE2   . TYR A 1 217 ? -28.255 26.104 -8.152  1.00 56.33  ? 217  TYR C CE2   1 
ATOM   1677 C  CZ    . TYR A 1 217 ? -29.387 26.653 -8.722  1.00 58.23  ? 217  TYR C CZ    1 
ATOM   1678 O  OH    . TYR A 1 217 ? -29.463 26.829 -10.073 1.00 58.37  ? 217  TYR C OH    1 
ATOM   1679 N  N     . ASN A 1 218 ? -27.951 27.019 -1.541  1.00 56.19  ? 218  ASN C N     1 
ATOM   1680 C  CA    . ASN A 1 218 ? -27.888 26.576 -0.147  1.00 56.92  ? 218  ASN C CA    1 
ATOM   1681 C  C     . ASN A 1 218 ? -26.709 27.216 0.595   1.00 56.57  ? 218  ASN C C     1 
ATOM   1682 O  O     . ASN A 1 218 ? -25.646 26.625 0.716   1.00 58.33  ? 218  ASN C O     1 
ATOM   1683 C  CB    . ASN A 1 218 ? -27.865 25.000 -0.082  1.00 57.31  ? 218  ASN C CB    1 
ATOM   1684 C  CG    . ASN A 1 218 ? -28.130 24.428 1.334   1.00 55.54  ? 218  ASN C CG    1 
ATOM   1685 O  OD1   . ASN A 1 218 ? -27.967 25.121 2.330   1.00 51.21  ? 218  ASN C OD1   1 
ATOM   1686 N  ND2   . ASN A 1 218 ? -28.536 23.148 1.404   1.00 53.91  ? 218  ASN C ND2   1 
ATOM   1687 N  N     . LEU A 1 219 ? -26.912 28.441 1.082   1.00 56.31  ? 219  LEU C N     1 
ATOM   1688 C  CA    . LEU A 1 219 ? -25.868 29.226 1.755   1.00 55.61  ? 219  LEU C CA    1 
ATOM   1689 C  C     . LEU A 1 219 ? -25.406 28.615 3.068   1.00 54.86  ? 219  LEU C C     1 
ATOM   1690 O  O     . LEU A 1 219 ? -24.224 28.614 3.370   1.00 55.77  ? 219  LEU C O     1 
ATOM   1691 C  CB    . LEU A 1 219 ? -26.340 30.678 2.004   1.00 55.77  ? 219  LEU C CB    1 
ATOM   1692 C  CG    . LEU A 1 219 ? -25.185 31.643 2.328   1.00 56.96  ? 219  LEU C CG    1 
ATOM   1693 C  CD1   . LEU A 1 219 ? -24.084 31.589 1.275   1.00 51.50  ? 219  LEU C CD1   1 
ATOM   1694 C  CD2   . LEU A 1 219 ? -25.759 33.031 2.477   1.00 54.64  ? 219  LEU C CD2   1 
ATOM   1695 N  N     . GLY A 1 220 ? -26.317 28.081 3.856   1.00 53.74  ? 220  GLY C N     1 
ATOM   1696 C  CA    . GLY A 1 220 ? -25.938 27.506 5.147   1.00 52.78  ? 220  GLY C CA    1 
ATOM   1697 C  C     . GLY A 1 220 ? -25.097 26.262 5.058   1.00 51.94  ? 220  GLY C C     1 
ATOM   1698 O  O     . GLY A 1 220 ? -24.251 26.058 5.918   1.00 53.53  ? 220  GLY C O     1 
ATOM   1699 N  N     . GLU A 1 221 ? -25.330 25.438 4.028   1.00 51.69  ? 221  GLU C N     1 
ATOM   1700 C  CA    . GLU A 1 221 ? -24.465 24.286 3.695   1.00 51.48  ? 221  GLU C CA    1 
ATOM   1701 C  C     . GLU A 1 221 ? -23.138 24.712 3.105   1.00 51.25  ? 221  GLU C C     1 
ATOM   1702 O  O     . GLU A 1 221 ? -22.106 24.135 3.403   1.00 49.90  ? 221  GLU C O     1 
ATOM   1703 C  CB    . GLU A 1 221 ? -25.129 23.350 2.689   1.00 52.30  ? 221  GLU C CB    1 
ATOM   1704 C  CG    . GLU A 1 221 ? -24.316 22.054 2.399   1.00 52.57  ? 221  GLU C CG    1 
ATOM   1705 C  CD    . GLU A 1 221 ? -24.258 21.048 3.606   1.00 55.45  ? 221  GLU C CD    1 
ATOM   1706 O  OE1   . GLU A 1 221 ? -24.724 21.439 4.709   1.00 53.30  ? 221  GLU C OE1   1 
ATOM   1707 O  OE2   . GLU A 1 221 ? -23.772 19.860 3.453   1.00 56.20  ? 221  GLU C OE2   1 
ATOM   1708 N  N     . LEU A 1 222 ? -23.182 25.681 2.196   1.00 50.53  ? 222  LEU C N     1 
ATOM   1709 C  CA    . LEU A 1 222 ? -21.953 26.241 1.687   1.00 50.94  ? 222  LEU C CA    1 
ATOM   1710 C  C     . LEU A 1 222 ? -21.059 26.638 2.862   1.00 50.90  ? 222  LEU C C     1 
ATOM   1711 O  O     . LEU A 1 222 ? -19.840 26.371 2.872   1.00 50.31  ? 222  LEU C O     1 
ATOM   1712 C  CB    . LEU A 1 222 ? -22.249 27.455 0.804   1.00 50.44  ? 222  LEU C CB    1 
ATOM   1713 C  CG    . LEU A 1 222 ? -20.977 28.134 0.252   1.00 50.49  ? 222  LEU C CG    1 
ATOM   1714 C  CD1   . LEU A 1 222 ? -20.040 27.129 -0.443  1.00 51.37  ? 222  LEU C CD1   1 
ATOM   1715 C  CD2   . LEU A 1 222 ? -21.392 29.280 -0.659  1.00 50.06  ? 222  LEU C CD2   1 
ATOM   1716 N  N     . LYS A 1 223 ? -21.665 27.354 3.814   1.00 50.95  ? 223  LYS C N     1 
ATOM   1717 C  CA    . LYS A 1 223 ? -20.916 27.925 4.923   1.00 51.41  ? 223  LYS C CA    1 
ATOM   1718 C  C     . LYS A 1 223 ? -20.383 26.807 5.841   1.00 51.81  ? 223  LYS C C     1 
ATOM   1719 O  O     . LYS A 1 223 ? -19.240 26.810 6.262   1.00 51.28  ? 223  LYS C O     1 
ATOM   1720 C  CB    . LYS A 1 223 ? -21.817 28.890 5.669   1.00 51.57  ? 223  LYS C CB    1 
ATOM   1721 C  CG    . LYS A 1 223 ? -21.248 29.428 6.943   1.00 54.38  ? 223  LYS C CG    1 
ATOM   1722 C  CD    . LYS A 1 223 ? -22.371 30.128 7.692   1.00 58.18  ? 223  LYS C CD    1 
ATOM   1723 C  CE    . LYS A 1 223 ? -22.139 30.168 9.196   1.00 61.77  ? 223  LYS C CE    1 
ATOM   1724 N  NZ    . LYS A 1 223 ? -21.002 31.088 9.457   1.00 63.79  ? 223  LYS C NZ    1 
ATOM   1725 N  N     . HIS A 1 224 ? -21.223 25.836 6.118   1.00 52.12  ? 224  HIS C N     1 
ATOM   1726 C  CA    . HIS A 1 224 ? -20.845 24.715 6.946   1.00 52.97  ? 224  HIS C CA    1 
ATOM   1727 C  C     . HIS A 1 224 ? -19.639 23.950 6.383   1.00 53.03  ? 224  HIS C C     1 
ATOM   1728 O  O     . HIS A 1 224 ? -18.635 23.770 7.071   1.00 54.03  ? 224  HIS C O     1 
ATOM   1729 C  CB    . HIS A 1 224 ? -22.059 23.800 7.085   1.00 53.44  ? 224  HIS C CB    1 
ATOM   1730 C  CG    . HIS A 1 224 ? -21.732 22.488 7.697   1.00 55.37  ? 224  HIS C CG    1 
ATOM   1731 N  ND1   . HIS A 1 224 ? -21.952 21.295 7.043   1.00 58.96  ? 224  HIS C ND1   1 
ATOM   1732 C  CD2   . HIS A 1 224 ? -21.153 22.179 8.879   1.00 55.23  ? 224  HIS C CD2   1 
ATOM   1733 C  CE1   . HIS A 1 224 ? -21.559 20.300 7.816   1.00 57.77  ? 224  HIS C CE1   1 
ATOM   1734 N  NE2   . HIS A 1 224 ? -21.063 20.812 8.930   1.00 57.84  ? 224  HIS C NE2   1 
ATOM   1735 N  N     . LEU A 1 225 ? -19.751 23.499 5.137   1.00 52.78  ? 225  LEU C N     1 
ATOM   1736 C  CA    . LEU A 1 225 ? -18.615 22.910 4.416   1.00 51.91  ? 225  LEU C CA    1 
ATOM   1737 C  C     . LEU A 1 225 ? -17.338 23.775 4.399   1.00 51.55  ? 225  LEU C C     1 
ATOM   1738 O  O     . LEU A 1 225 ? -16.251 23.216 4.423   1.00 50.83  ? 225  LEU C O     1 
ATOM   1739 C  CB    . LEU A 1 225 ? -18.994 22.617 2.960   1.00 52.43  ? 225  LEU C CB    1 
ATOM   1740 C  CG    . LEU A 1 225 ? -20.195 21.706 2.684   1.00 48.91  ? 225  LEU C CG    1 
ATOM   1741 C  CD1   . LEU A 1 225 ? -20.566 21.732 1.192   1.00 47.15  ? 225  LEU C CD1   1 
ATOM   1742 C  CD2   . LEU A 1 225 ? -19.916 20.315 3.136   1.00 48.89  ? 225  LEU C CD2   1 
ATOM   1743 N  N     . SER A 1 226 ? -17.472 25.106 4.317   1.00 51.36  ? 226  SER C N     1 
ATOM   1744 C  CA    . SER A 1 226 ? -16.304 26.007 4.322   1.00 51.98  ? 226  SER C CA    1 
ATOM   1745 C  C     . SER A 1 226 ? -15.598 26.023 5.648   1.00 52.76  ? 226  SER C C     1 
ATOM   1746 O  O     . SER A 1 226 ? -14.479 26.567 5.747   1.00 52.16  ? 226  SER C O     1 
ATOM   1747 C  CB    . SER A 1 226 ? -16.669 27.456 3.948   1.00 51.78  ? 226  SER C CB    1 
ATOM   1748 O  OG    . SER A 1 226 ? -17.416 28.120 4.954   1.00 52.26  ? 226  SER C OG    1 
ATOM   1749 N  N     . GLU A 1 227 ? -16.248 25.439 6.659   1.00 54.59  ? 227  GLU C N     1 
ATOM   1750 C  CA    . GLU A 1 227 ? -15.706 25.399 8.010   1.00 55.37  ? 227  GLU C CA    1 
ATOM   1751 C  C     . GLU A 1 227 ? -14.991 24.126 8.327   1.00 56.03  ? 227  GLU C C     1 
ATOM   1752 O  O     . GLU A 1 227 ? -14.509 23.993 9.447   1.00 56.25  ? 227  GLU C O     1 
ATOM   1753 C  CB    . GLU A 1 227 ? -16.794 25.687 9.042   1.00 55.15  ? 227  GLU C CB    1 
ATOM   1754 C  CG    . GLU A 1 227 ? -17.064 27.177 9.089   1.00 57.21  ? 227  GLU C CG    1 
ATOM   1755 C  CD    . GLU A 1 227 ? -18.501 27.524 9.403   1.00 60.59  ? 227  GLU C CD    1 
ATOM   1756 O  OE1   . GLU A 1 227 ? -18.920 28.658 9.026   1.00 65.23  ? 227  GLU C OE1   1 
ATOM   1757 O  OE2   . GLU A 1 227 ? -19.205 26.670 9.978   1.00 60.75  ? 227  GLU C OE2   1 
ATOM   1758 N  N     . GLN A 1 228 ? -14.875 23.221 7.343   1.00 56.42  ? 228  GLN C N     1 
ATOM   1759 C  CA    . GLN A 1 228 ? -14.193 21.926 7.512   1.00 56.44  ? 228  GLN C CA    1 
ATOM   1760 C  C     . GLN A 1 228 ? -12.807 22.054 6.954   1.00 56.35  ? 228  GLN C C     1 
ATOM   1761 O  O     . GLN A 1 228 ? -12.417 23.121 6.511   1.00 55.82  ? 228  GLN C O     1 
ATOM   1762 C  CB    . GLN A 1 228 ? -14.944 20.780 6.809   1.00 56.23  ? 228  GLN C CB    1 
ATOM   1763 C  CG    . GLN A 1 228 ? -16.410 20.693 7.090   1.00 56.46  ? 228  GLN C CG    1 
ATOM   1764 C  CD    . GLN A 1 228 ? -16.726 20.764 8.546   1.00 57.93  ? 228  GLN C CD    1 
ATOM   1765 O  OE1   . GLN A 1 228 ? -17.716 21.365 8.947   1.00 59.71  ? 228  GLN C OE1   1 
ATOM   1766 N  NE2   . GLN A 1 228 ? -15.883 20.169 9.356   1.00 59.31  ? 228  GLN C NE2   1 
ATOM   1767 N  N     . THR A 1 229 ? -12.026 20.992 7.008   1.00 56.45  ? 229  THR C N     1 
ATOM   1768 C  CA    . THR A 1 229 ? -10.614 21.129 6.653   1.00 57.47  ? 229  THR C CA    1 
ATOM   1769 C  C     . THR A 1 229 ? -10.333 20.751 5.192   1.00 58.34  ? 229  THR C C     1 
ATOM   1770 O  O     . THR A 1 229 ? -9.244  21.100 4.642   1.00 58.54  ? 229  THR C O     1 
ATOM   1771 C  CB    . THR A 1 229 ? -9.689  20.358 7.604   1.00 57.05  ? 229  THR C CB    1 
ATOM   1772 O  OG1   . THR A 1 229 ? -9.730  18.980 7.268   1.00 59.04  ? 229  THR C OG1   1 
ATOM   1773 C  CG2   . THR A 1 229 ? -10.115 20.547 9.044   1.00 56.44  ? 229  THR C CG2   1 
ATOM   1774 N  N     . SER A 1 230 ? -11.319 20.085 4.568   1.00 58.42  ? 230  SER C N     1 
ATOM   1775 C  CA    . SER A 1 230 ? -11.216 19.678 3.165   1.00 58.83  ? 230  SER C CA    1 
ATOM   1776 C  C     . SER A 1 230 ? -12.562 19.565 2.512   1.00 58.63  ? 230  SER C C     1 
ATOM   1777 O  O     . SER A 1 230 ? -13.551 19.306 3.166   1.00 57.97  ? 230  SER C O     1 
ATOM   1778 C  CB    . SER A 1 230 ? -10.517 18.319 3.040   1.00 59.28  ? 230  SER C CB    1 
ATOM   1779 O  OG    . SER A 1 230 ? -10.079 18.122 1.700   1.00 61.02  ? 230  SER C OG    1 
ATOM   1780 N  N     . TYR A 1 231 ? -12.610 19.784 1.208   1.00 59.24  ? 231  TYR C N     1 
ATOM   1781 C  CA    . TYR A 1 231 ? -13.813 19.443 0.428   1.00 59.62  ? 231  TYR C CA    1 
ATOM   1782 C  C     . TYR A 1 231 ? -13.330 18.864 -0.874  1.00 61.55  ? 231  TYR C C     1 
ATOM   1783 O  O     . TYR A 1 231 ? -13.742 19.253 -1.931  1.00 62.18  ? 231  TYR C O     1 
ATOM   1784 C  CB    . TYR A 1 231 ? -14.683 20.667 0.163   1.00 58.38  ? 231  TYR C CB    1 
ATOM   1785 C  CG    . TYR A 1 231 ? -16.018 20.349 -0.495  1.00 56.97  ? 231  TYR C CG    1 
ATOM   1786 C  CD1   . TYR A 1 231 ? -16.262 20.669 -1.813  1.00 53.33  ? 231  TYR C CD1   1 
ATOM   1787 C  CD2   . TYR A 1 231 ? -17.012 19.715 0.199   1.00 54.80  ? 231  TYR C CD2   1 
ATOM   1788 C  CE1   . TYR A 1 231 ? -17.444 20.385 -2.417  1.00 56.25  ? 231  TYR C CE1   1 
ATOM   1789 C  CE2   . TYR A 1 231 ? -18.233 19.438 -0.401  1.00 55.40  ? 231  TYR C CE2   1 
ATOM   1790 C  CZ    . TYR A 1 231 ? -18.446 19.790 -1.717  1.00 53.29  ? 231  TYR C CZ    1 
ATOM   1791 O  OH    . TYR A 1 231 ? -19.663 19.512 -2.323  1.00 57.80  ? 231  TYR C OH    1 
ATOM   1792 N  N     . TYR A 1 232 ? -12.408 17.938 -0.788  1.00 64.32  ? 232  TYR C N     1 
ATOM   1793 C  CA    . TYR A 1 232 ? -12.037 17.113 -1.926  1.00 66.10  ? 232  TYR C CA    1 
ATOM   1794 C  C     . TYR A 1 232 ? -13.015 15.906 -1.811  1.00 67.14  ? 232  TYR C C     1 
ATOM   1795 O  O     . TYR A 1 232 ? -12.684 14.811 -1.325  1.00 66.98  ? 232  TYR C O     1 
ATOM   1796 C  CB    . TYR A 1 232 ? -10.526 16.801 -1.829  1.00 66.79  ? 232  TYR C CB    1 
ATOM   1797 C  CG    . TYR A 1 232 ? -9.871  16.341 -3.113  1.00 67.27  ? 232  TYR C CG    1 
ATOM   1798 C  CD1   . TYR A 1 232 ? -9.339  17.261 -4.030  1.00 67.39  ? 232  TYR C CD1   1 
ATOM   1799 C  CD2   . TYR A 1 232 ? -9.782  14.975 -3.413  1.00 67.76  ? 232  TYR C CD2   1 
ATOM   1800 C  CE1   . TYR A 1 232 ? -8.718  16.817 -5.226  1.00 67.98  ? 232  TYR C CE1   1 
ATOM   1801 C  CE2   . TYR A 1 232 ? -9.173  14.512 -4.600  1.00 67.45  ? 232  TYR C CE2   1 
ATOM   1802 C  CZ    . TYR A 1 232 ? -8.641  15.435 -5.494  1.00 68.50  ? 232  TYR C CZ    1 
ATOM   1803 O  OH    . TYR A 1 232 ? -8.066  14.952 -6.644  1.00 67.36  ? 232  TYR C OH    1 
ATOM   1804 N  N     . SER A 1 233 ? -14.270 16.189 -2.194  1.00 68.55  ? 233  SER C N     1 
ATOM   1805 C  CA    . SER A 1 233 ? -15.404 15.281 -2.007  1.00 68.88  ? 233  SER C CA    1 
ATOM   1806 C  C     . SER A 1 233 ? -16.287 15.242 -3.260  1.00 68.95  ? 233  SER C C     1 
ATOM   1807 O  O     . SER A 1 233 ? -17.121 14.346 -3.427  1.00 68.17  ? 233  SER C O     1 
ATOM   1808 C  CB    . SER A 1 233 ? -16.223 15.724 -0.786  1.00 69.14  ? 233  SER C CB    1 
ATOM   1809 O  OG    . SER A 1 233 ? -15.374 15.984 0.325   1.00 69.79  ? 233  SER C OG    1 
ATOM   1810 P  P     . DG  B 2 1   ? -7.683  15.898 4.820   1.00 56.32  ? 501  DG  B P     1 
ATOM   1811 O  OP1   . DG  B 2 1   ? -7.711  16.762 6.040   1.00 58.04  ? 501  DG  B OP1   1 
ATOM   1812 O  OP2   . DG  B 2 1   ? -8.807  15.166 4.160   1.00 57.50  ? 501  DG  B OP2   1 
ATOM   1813 O  "O5'" . DG  B 2 1   ? -7.025  16.707 3.615   1.00 55.89  ? 501  DG  B "O5'" 1 
ATOM   1814 C  "C5'" . DG  B 2 1   ? -5.991  17.657 3.849   1.00 51.89  ? 501  DG  B "C5'" 1 
ATOM   1815 C  "C4'" . DG  B 2 1   ? -5.573  18.061 2.477   1.00 49.80  ? 501  DG  B "C4'" 1 
ATOM   1816 O  "O4'" . DG  B 2 1   ? -4.801  17.008 1.906   1.00 51.22  ? 501  DG  B "O4'" 1 
ATOM   1817 C  "C3'" . DG  B 2 1   ? -6.708  18.269 1.493   1.00 50.69  ? 501  DG  B "C3'" 1 
ATOM   1818 O  "O3'" . DG  B 2 1   ? -6.473  19.462 0.770   1.00 48.75  ? 501  DG  B "O3'" 1 
ATOM   1819 C  "C2'" . DG  B 2 1   ? -6.686  17.054 0.588   1.00 49.62  ? 501  DG  B "C2'" 1 
ATOM   1820 C  "C1'" . DG  B 2 1   ? -5.204  16.776 0.581   1.00 53.07  ? 501  DG  B "C1'" 1 
ATOM   1821 N  N9    . DG  B 2 1   ? -4.823  15.394 0.321   1.00 55.40  ? 501  DG  B N9    1 
ATOM   1822 C  C8    . DG  B 2 1   ? -5.501  14.228 0.641   1.00 54.81  ? 501  DG  B C8    1 
ATOM   1823 N  N7    . DG  B 2 1   ? -4.855  13.168 0.287   1.00 55.08  ? 501  DG  B N7    1 
ATOM   1824 C  C5    . DG  B 2 1   ? -3.654  13.619 -0.301  1.00 55.74  ? 501  DG  B C5    1 
ATOM   1825 C  C6    . DG  B 2 1   ? -2.502  12.936 -0.874  1.00 55.51  ? 501  DG  B C6    1 
ATOM   1826 O  O6    . DG  B 2 1   ? -2.261  11.706 -1.043  1.00 55.56  ? 501  DG  B O6    1 
ATOM   1827 N  N1    . DG  B 2 1   ? -1.534  13.841 -1.326  1.00 55.34  ? 501  DG  B N1    1 
ATOM   1828 C  C2    . DG  B 2 1   ? -1.622  15.223 -1.241  1.00 55.74  ? 501  DG  B C2    1 
ATOM   1829 N  N2    . DG  B 2 1   ? -0.602  15.935 -1.733  1.00 54.36  ? 501  DG  B N2    1 
ATOM   1830 N  N3    . DG  B 2 1   ? -2.662  15.850 -0.690  1.00 55.66  ? 501  DG  B N3    1 
ATOM   1831 C  C4    . DG  B 2 1   ? -3.631  15.002 -0.252  1.00 56.18  ? 501  DG  B C4    1 
ATOM   1832 P  P     . DC  B 2 2   ? -7.499  20.043 -0.280  1.00 51.02  ? 502  DC  B P     1 
ATOM   1833 O  OP1   . DC  B 2 2   ? -7.400  21.500 -0.051  1.00 49.23  ? 502  DC  B OP1   1 
ATOM   1834 O  OP2   . DC  B 2 2   ? -8.811  19.360 -0.159  1.00 52.12  ? 502  DC  B OP2   1 
ATOM   1835 O  "O5'" . DC  B 2 2   ? -6.838  19.823 -1.706  1.00 50.50  ? 502  DC  B "O5'" 1 
ATOM   1836 C  "C5'" . DC  B 2 2   ? -5.513  20.320 -1.561  1.00 51.39  ? 502  DC  B "C5'" 1 
ATOM   1837 C  "C4'" . DC  B 2 2   ? -4.585  19.894 -2.637  1.00 51.69  ? 502  DC  B "C4'" 1 
ATOM   1838 O  "O4'" . DC  B 2 2   ? -4.309  18.515 -2.412  1.00 55.05  ? 502  DC  B "O4'" 1 
ATOM   1839 C  "C3'" . DC  B 2 2   ? -5.156  20.093 -4.012  1.00 53.52  ? 502  DC  B "C3'" 1 
ATOM   1840 O  "O3'" . DC  B 2 2   ? -4.197  20.473 -4.870  1.00 51.29  ? 502  DC  B "O3'" 1 
ATOM   1841 C  "C2'" . DC  B 2 2   ? -5.492  18.688 -4.404  1.00 57.66  ? 502  DC  B "C2'" 1 
ATOM   1842 C  "C1'" . DC  B 2 2   ? -4.366  17.943 -3.686  1.00 59.34  ? 502  DC  B "C1'" 1 
ATOM   1843 N  N1    . DC  B 2 2   ? -4.681  16.498 -3.561  1.00 61.78  ? 502  DC  B N1    1 
ATOM   1844 C  C2    . DC  B 2 2   ? -3.741  15.508 -3.928  1.00 62.18  ? 502  DC  B C2    1 
ATOM   1845 O  O2    . DC  B 2 2   ? -2.604  15.805 -4.358  1.00 62.05  ? 502  DC  B O2    1 
ATOM   1846 N  N3    . DC  B 2 2   ? -4.150  14.226 -3.798  1.00 62.66  ? 502  DC  B N3    1 
ATOM   1847 C  C4    . DC  B 2 2   ? -5.371  13.911 -3.336  1.00 62.64  ? 502  DC  B C4    1 
ATOM   1848 N  N4    . DC  B 2 2   ? -5.744  12.629 -3.203  1.00 62.73  ? 502  DC  B N4    1 
ATOM   1849 C  C5    . DC  B 2 2   ? -6.306  14.907 -2.972  1.00 61.98  ? 502  DC  B C5    1 
ATOM   1850 C  C6    . DC  B 2 2   ? -5.927  16.167 -3.106  1.00 62.39  ? 502  DC  B C6    1 
ATOM   1851 P  P     . DA  B 2 3   ? -4.187  21.785 -5.724  1.00 46.83  ? 503  DA  B P     1 
ATOM   1852 O  OP1   . DA  B 2 3   ? -3.968  22.869 -4.750  1.00 54.12  ? 503  DA  B OP1   1 
ATOM   1853 O  OP2   . DA  B 2 3   ? -5.136  21.825 -6.827  1.00 53.62  ? 503  DA  B OP2   1 
ATOM   1854 O  "O5'" . DA  B 2 3   ? -2.808  21.489 -6.492  1.00 54.06  ? 503  DA  B "O5'" 1 
ATOM   1855 C  "C5'" . DA  B 2 3   ? -1.578  21.245 -5.722  1.00 54.97  ? 503  DA  B "C5'" 1 
ATOM   1856 C  "C4'" . DA  B 2 3   ? -0.527  20.473 -6.515  1.00 54.94  ? 503  DA  B "C4'" 1 
ATOM   1857 O  "O4'" . DA  B 2 3   ? -0.821  19.051 -6.458  1.00 55.74  ? 503  DA  B "O4'" 1 
ATOM   1858 C  "C3'" . DA  B 2 3   ? -0.452  20.845 -8.004  1.00 56.33  ? 503  DA  B "C3'" 1 
ATOM   1859 O  "O3'" . DA  B 2 3   ? 0.907   20.815 -8.421  1.00 58.48  ? 503  DA  B "O3'" 1 
ATOM   1860 C  "C2'" . DA  B 2 3   ? -1.312  19.806 -8.704  1.00 56.79  ? 503  DA  B "C2'" 1 
ATOM   1861 C  "C1'" . DA  B 2 3   ? -1.152  18.592 -7.780  1.00 59.33  ? 503  DA  B "C1'" 1 
ATOM   1862 N  N9    . DA  B 2 3   ? -2.313  17.707 -7.596  1.00 61.08  ? 503  DA  B N9    1 
ATOM   1863 C  C8    . DA  B 2 3   ? -3.566  18.097 -7.232  1.00 61.57  ? 503  DA  B C8    1 
ATOM   1864 N  N7    . DA  B 2 3   ? -4.397  17.104 -7.095  1.00 61.79  ? 503  DA  B N7    1 
ATOM   1865 C  C5    . DA  B 2 3   ? -3.663  15.973 -7.389  1.00 62.30  ? 503  DA  B C5    1 
ATOM   1866 C  C6    . DA  B 2 3   ? -3.995  14.598 -7.422  1.00 61.34  ? 503  DA  B C6    1 
ATOM   1867 N  N6    . DA  B 2 3   ? -5.199  14.100 -7.140  1.00 59.82  ? 503  DA  B N6    1 
ATOM   1868 N  N1    . DA  B 2 3   ? -3.015  13.750 -7.760  1.00 61.08  ? 503  DA  B N1    1 
ATOM   1869 C  C2    . DA  B 2 3   ? -1.798  14.204 -8.049  1.00 61.12  ? 503  DA  B C2    1 
ATOM   1870 N  N3    . DA  B 2 3   ? -1.365  15.455 -8.053  1.00 62.35  ? 503  DA  B N3    1 
ATOM   1871 C  C4    . DA  B 2 3   ? -2.360  16.319 -7.699  1.00 63.02  ? 503  DA  B C4    1 
ATOM   1872 P  P     . DT  B 2 4   ? 1.370   21.224 -9.891  1.00 60.35  ? 504  DT  B P     1 
ATOM   1873 O  OP1   . DT  B 2 4   ? 2.778   21.620 -9.636  1.00 63.38  ? 504  DT  B OP1   1 
ATOM   1874 O  OP2   . DT  B 2 4   ? 0.402   22.091 -10.570 1.00 61.39  ? 504  DT  B OP2   1 
ATOM   1875 O  "O5'" . DT  B 2 4   ? 1.336   19.878 -10.749 1.00 64.28  ? 504  DT  B "O5'" 1 
ATOM   1876 C  "C5'" . DT  B 2 4   ? 1.974   18.745 -10.210 1.00 69.31  ? 504  DT  B "C5'" 1 
ATOM   1877 C  "C4'" . DT  B 2 4   ? 1.767   17.510 -11.068 1.00 71.77  ? 504  DT  B "C4'" 1 
ATOM   1878 O  "O4'" . DT  B 2 4   ? 0.587   16.847 -10.573 1.00 71.18  ? 504  DT  B "O4'" 1 
ATOM   1879 C  "C3'" . DT  B 2 4   ? 1.633   17.714 -12.587 1.00 73.36  ? 504  DT  B "C3'" 1 
ATOM   1880 O  "O3'" . DT  B 2 4   ? 2.651   16.899 -13.250 1.00 78.82  ? 504  DT  B "O3'" 1 
ATOM   1881 C  "C2'" . DT  B 2 4   ? 0.208   17.282 -12.888 1.00 72.80  ? 504  DT  B "C2'" 1 
ATOM   1882 C  "C1'" . DT  B 2 4   ? -0.146  16.403 -11.689 1.00 73.54  ? 504  DT  B "C1'" 1 
ATOM   1883 N  N1    . DT  B 2 4   ? -1.621  16.343 -11.306 1.00 74.06  ? 504  DT  B N1    1 
ATOM   1884 C  C2    . DT  B 2 4   ? -2.145  15.079 -11.115 1.00 74.78  ? 504  DT  B C2    1 
ATOM   1885 O  O2    . DT  B 2 4   ? -1.478  14.070 -11.227 1.00 74.42  ? 504  DT  B O2    1 
ATOM   1886 N  N3    . DT  B 2 4   ? -3.470  15.031 -10.775 1.00 74.49  ? 504  DT  B N3    1 
ATOM   1887 C  C4    . DT  B 2 4   ? -4.311  16.103 -10.597 1.00 74.42  ? 504  DT  B C4    1 
ATOM   1888 O  O4    . DT  B 2 4   ? -5.472  15.892 -10.286 1.00 73.48  ? 504  DT  B O4    1 
ATOM   1889 C  C5    . DT  B 2 4   ? -3.709  17.425 -10.800 1.00 73.85  ? 504  DT  B C5    1 
ATOM   1890 C  C7    . DT  B 2 4   ? -4.504  18.685 -10.645 1.00 73.86  ? 504  DT  B C7    1 
ATOM   1891 C  C6    . DT  B 2 4   ? -2.412  17.477 -11.144 1.00 73.46  ? 504  DT  B C6    1 
ATOM   1892 P  P     . DT  B 2 5   ? 3.245   17.100 -14.752 1.00 81.31  ? 505  DT  B P     1 
ATOM   1893 O  OP1   . DT  B 2 5   ? 4.701   16.809 -14.672 1.00 81.96  ? 505  DT  B OP1   1 
ATOM   1894 O  OP2   . DT  B 2 5   ? 2.798   18.402 -15.317 1.00 79.98  ? 505  DT  B OP2   1 
ATOM   1895 O  "O5'" . DT  B 2 5   ? 2.519   15.910 -15.555 1.00 80.65  ? 505  DT  B "O5'" 1 
ATOM   1896 C  "C5'" . DT  B 2 5   ? 2.497   14.577 -15.045 1.00 81.87  ? 505  DT  B "C5'" 1 
ATOM   1897 C  "C4'" . DT  B 2 5   ? 1.381   13.813 -15.712 1.00 82.68  ? 505  DT  B "C4'" 1 
ATOM   1898 O  "O4'" . DT  B 2 5   ? 0.175   14.042 -14.959 1.00 82.02  ? 505  DT  B "O4'" 1 
ATOM   1899 C  "C3'" . DT  B 2 5   ? 1.116   14.233 -17.160 1.00 84.47  ? 505  DT  B "C3'" 1 
ATOM   1900 O  "O3'" . DT  B 2 5   ? 1.612   13.146 -18.021 1.00 88.59  ? 505  DT  B "O3'" 1 
ATOM   1901 C  "C2'" . DT  B 2 5   ? -0.392  14.511 -17.202 1.00 83.74  ? 505  DT  B "C2'" 1 
ATOM   1902 C  "C1'" . DT  B 2 5   ? -0.916  14.017 -15.850 1.00 83.59  ? 505  DT  B "C1'" 1 
ATOM   1903 N  N1    . DT  B 2 5   ? -2.090  14.789 -15.253 1.00 84.39  ? 505  DT  B N1    1 
ATOM   1904 C  C2    . DT  B 2 5   ? -3.108  14.076 -14.626 1.00 83.89  ? 505  DT  B C2    1 
ATOM   1905 O  O2    . DT  B 2 5   ? -3.135  12.878 -14.520 1.00 83.48  ? 505  DT  B O2    1 
ATOM   1906 N  N3    . DT  B 2 5   ? -4.130  14.828 -14.110 1.00 84.69  ? 505  DT  B N3    1 
ATOM   1907 C  C4    . DT  B 2 5   ? -4.251  16.204 -14.154 1.00 83.74  ? 505  DT  B C4    1 
ATOM   1908 O  O4    . DT  B 2 5   ? -5.228  16.727 -13.669 1.00 83.78  ? 505  DT  B O4    1 
ATOM   1909 C  C5    . DT  B 2 5   ? -3.176  16.930 -14.805 1.00 83.57  ? 505  DT  B C5    1 
ATOM   1910 C  C7    . DT  B 2 5   ? -3.196  18.431 -14.910 1.00 83.35  ? 505  DT  B C7    1 
ATOM   1911 C  C6    . DT  B 2 5   ? -2.162  16.192 -15.318 1.00 84.47  ? 505  DT  B C6    1 
ATOM   1912 P  P     . DA  B 2 6   ? 1.656   13.013 -19.640 1.00 90.31  ? 506  DA  B P     1 
ATOM   1913 O  OP1   . DA  B 2 6   ? 2.963   12.378 -19.897 1.00 92.10  ? 506  DA  B OP1   1 
ATOM   1914 O  OP2   . DA  B 2 6   ? 1.327   14.258 -20.380 1.00 90.46  ? 506  DA  B OP2   1 
ATOM   1915 O  "O5'" . DA  B 2 6   ? 0.503   11.935 -19.932 1.00 90.94  ? 506  DA  B "O5'" 1 
ATOM   1916 C  "C5'" . DA  B 2 6   ? -0.267  11.233 -18.929 1.00 92.55  ? 506  DA  B "C5'" 1 
ATOM   1917 C  "C4'" . DA  B 2 6   ? -1.677  11.051 -19.469 1.00 94.45  ? 506  DA  B "C4'" 1 
ATOM   1918 O  "O4'" . DA  B 2 6   ? -2.660  11.793 -18.679 1.00 94.46  ? 506  DA  B "O4'" 1 
ATOM   1919 C  "C3'" . DA  B 2 6   ? -1.852  11.548 -20.916 1.00 95.79  ? 506  DA  B "C3'" 1 
ATOM   1920 O  "O3'" . DA  B 2 6   ? -2.695  10.660 -21.638 1.00 98.74  ? 506  DA  B "O3'" 1 
ATOM   1921 C  "C2'" . DA  B 2 6   ? -2.505  12.908 -20.749 1.00 95.05  ? 506  DA  B "C2'" 1 
ATOM   1922 C  "C1'" . DA  B 2 6   ? -3.421  12.609 -19.563 1.00 94.71  ? 506  DA  B "C1'" 1 
ATOM   1923 N  N9    . DA  B 2 6   ? -3.898  13.795 -18.859 1.00 94.66  ? 506  DA  B N9    1 
ATOM   1924 C  C8    . DA  B 2 6   ? -3.293  15.020 -18.737 1.00 94.44  ? 506  DA  B C8    1 
ATOM   1925 N  N7    . DA  B 2 6   ? -3.988  15.887 -18.041 1.00 94.72  ? 506  DA  B N7    1 
ATOM   1926 C  C5    . DA  B 2 6   ? -5.126  15.183 -17.677 1.00 94.97  ? 506  DA  B C5    1 
ATOM   1927 C  C6    . DA  B 2 6   ? -6.270  15.528 -16.926 1.00 94.43  ? 506  DA  B C6    1 
ATOM   1928 N  N6    . DA  B 2 6   ? -6.474  16.718 -16.368 1.00 93.78  ? 506  DA  B N6    1 
ATOM   1929 N  N1    . DA  B 2 6   ? -7.206  14.568 -16.768 1.00 94.76  ? 506  DA  B N1    1 
ATOM   1930 C  C2    . DA  B 2 6   ? -7.024  13.359 -17.319 1.00 94.51  ? 506  DA  B C2    1 
ATOM   1931 N  N3    . DA  B 2 6   ? -5.996  12.922 -18.043 1.00 93.94  ? 506  DA  B N3    1 
ATOM   1932 C  C4    . DA  B 2 6   ? -5.079  13.888 -18.180 1.00 94.72  ? 506  DA  B C4    1 
ATOM   1933 P  P     . DA  B 2 7   ? -2.634  10.428 -23.231 1.00 99.08  ? 507  DA  B P     1 
ATOM   1934 O  OP1   . DA  B 2 7   ? -1.334  9.745  -23.483 1.00 98.92  ? 507  DA  B OP1   1 
ATOM   1935 O  OP2   . DA  B 2 7   ? -2.904  11.696 -23.988 1.00 97.24  ? 507  DA  B OP2   1 
ATOM   1936 O  "O5'" . DA  B 2 7   ? -3.862  9.368  -23.362 1.00 96.92  ? 507  DA  B "O5'" 1 
ATOM   1937 C  "C5'" . DA  B 2 7   ? -4.969  9.226  -22.420 1.00 95.96  ? 507  DA  B "C5'" 1 
ATOM   1938 C  "C4'" . DA  B 2 7   ? -6.297  9.809  -22.929 1.00 95.34  ? 507  DA  B "C4'" 1 
ATOM   1939 O  "O4'" . DA  B 2 7   ? -6.641  10.984 -22.130 1.00 93.79  ? 507  DA  B "O4'" 1 
ATOM   1940 C  "C3'" . DA  B 2 7   ? -6.351  10.255 -24.405 1.00 95.53  ? 507  DA  B "C3'" 1 
ATOM   1941 O  "O3'" . DA  B 2 7   ? -7.605  9.830  -25.020 1.00 97.19  ? 507  DA  B "O3'" 1 
ATOM   1942 C  "C2'" . DA  B 2 7   ? -6.126  11.763 -24.276 1.00 94.33  ? 507  DA  B "C2'" 1 
ATOM   1943 C  "C1'" . DA  B 2 7   ? -6.931  12.059 -23.013 1.00 93.56  ? 507  DA  B "C1'" 1 
ATOM   1944 N  N9    . DA  B 2 7   ? -6.660  13.359 -22.385 1.00 93.44  ? 507  DA  B N9    1 
ATOM   1945 C  C8    . DA  B 2 7   ? -5.658  14.251 -22.668 1.00 93.03  ? 507  DA  B C8    1 
ATOM   1946 N  N7    . DA  B 2 7   ? -5.686  15.340 -21.940 1.00 92.77  ? 507  DA  B N7    1 
ATOM   1947 C  C5    . DA  B 2 7   ? -6.791  15.161 -21.128 1.00 93.26  ? 507  DA  B C5    1 
ATOM   1948 C  C6    . DA  B 2 7   ? -7.380  15.961 -20.124 1.00 93.08  ? 507  DA  B C6    1 
ATOM   1949 N  N6    . DA  B 2 7   ? -6.885  17.137 -19.772 1.00 92.99  ? 507  DA  B N6    1 
ATOM   1950 N  N1    . DA  B 2 7   ? -8.475  15.505 -19.484 1.00 92.71  ? 507  DA  B N1    1 
ATOM   1951 C  C2    . DA  B 2 7   ? -8.960  14.312 -19.847 1.00 93.08  ? 507  DA  B C2    1 
ATOM   1952 N  N3    . DA  B 2 7   ? -8.504  13.466 -20.779 1.00 93.11  ? 507  DA  B N3    1 
ATOM   1953 C  C4    . DA  B 2 7   ? -7.404  13.949 -21.387 1.00 93.32  ? 507  DA  B C4    1 
ATOM   1954 P  P     . DC  B 2 8   ? -8.380  10.534 -26.261 1.00 98.30  ? 508  DC  B P     1 
ATOM   1955 O  OP1   . DC  B 2 8   ? -7.928  9.944  -27.530 1.00 99.00  ? 508  DC  B OP1   1 
ATOM   1956 O  OP2   . DC  B 2 8   ? -8.315  12.010 -26.230 1.00 99.23  ? 508  DC  B OP2   1 
ATOM   1957 O  "O5'" . DC  B 2 8   ? -9.875  10.074 -25.880 1.00 98.95  ? 508  DC  B "O5'" 1 
ATOM   1958 C  "C5'" . DC  B 2 8   ? -10.450 10.267 -24.534 1.00 99.08  ? 508  DC  B "C5'" 1 
ATOM   1959 C  "C4'" . DC  B 2 8   ? -11.221 11.590 -24.351 1.00 99.05  ? 508  DC  B "C4'" 1 
ATOM   1960 O  "O4'" . DC  B 2 8   ? -10.382 12.613 -23.703 1.00 98.98  ? 508  DC  B "O4'" 1 
ATOM   1961 C  "C3'" . DC  B 2 8   ? -11.769 12.249 -25.640 1.00 98.67  ? 508  DC  B "C3'" 1 
ATOM   1962 O  "O3'" . DC  B 2 8   ? -13.225 12.218 -25.661 1.00 97.65  ? 508  DC  B "O3'" 1 
ATOM   1963 C  "C2'" . DC  B 2 8   ? -11.132 13.644 -25.634 1.00 98.35  ? 508  DC  B "C2'" 1 
ATOM   1964 C  "C1'" . DC  B 2 8   ? -10.844 13.880 -24.157 1.00 98.54  ? 508  DC  B "C1'" 1 
ATOM   1965 N  N1    . DC  B 2 8   ? -9.905  15.081 -23.912 1.00 98.65  ? 508  DC  B N1    1 
ATOM   1966 C  C2    . DC  B 2 8   ? -10.269 16.106 -22.999 1.00 97.63  ? 508  DC  B C2    1 
ATOM   1967 O  O2    . DC  B 2 8   ? -11.324 16.035 -22.365 1.00 97.23  ? 508  DC  B O2    1 
ATOM   1968 N  N3    . DC  B 2 8   ? -9.441  17.159 -22.816 1.00 96.77  ? 508  DC  B N3    1 
ATOM   1969 C  C4    . DC  B 2 8   ? -8.302  17.241 -23.486 1.00 97.48  ? 508  DC  B C4    1 
ATOM   1970 N  N4    . DC  B 2 8   ? -7.530  18.294 -23.263 1.00 97.31  ? 508  DC  B N4    1 
ATOM   1971 C  C5    . DC  B 2 8   ? -7.908  16.239 -24.425 1.00 98.11  ? 508  DC  B C5    1 
ATOM   1972 C  C6    . DC  B 2 8   ? -8.727  15.194 -24.610 1.00 98.01  ? 508  DC  B C6    1 
ATOM   1973 P  P     . DA  B 2 9   ? -14.172 13.309 -26.397 1.00 98.17  ? 509  DA  B P     1 
ATOM   1974 O  OP1   . DA  B 2 9   ? -15.503 12.691 -26.654 1.00 97.64  ? 509  DA  B OP1   1 
ATOM   1975 O  OP2   . DA  B 2 9   ? -13.499 14.030 -27.519 1.00 95.89  ? 509  DA  B OP2   1 
ATOM   1976 O  "O5'" . DA  B 2 9   ? -14.228 14.346 -25.156 1.00 96.60  ? 509  DA  B "O5'" 1 
ATOM   1977 C  "C5'" . DA  B 2 9   ? -15.187 14.350 -24.070 1.00 91.21  ? 509  DA  B "C5'" 1 
ATOM   1978 C  "C4'" . DA  B 2 9   ? -15.893 15.689 -24.099 1.00 87.78  ? 509  DA  B "C4'" 1 
ATOM   1979 O  "O4'" . DA  B 2 9   ? -14.918 16.760 -24.022 1.00 85.68  ? 509  DA  B "O4'" 1 
ATOM   1980 C  "C3'" . DA  B 2 9   ? -16.691 15.955 -25.380 1.00 85.90  ? 509  DA  B "C3'" 1 
ATOM   1981 O  "O3'" . DA  B 2 9   ? -17.985 16.444 -24.962 1.00 83.02  ? 509  DA  B "O3'" 1 
ATOM   1982 C  "C2'" . DA  B 2 9   ? -15.767 16.874 -26.211 1.00 85.65  ? 509  DA  B "C2'" 1 
ATOM   1983 C  "C1'" . DA  B 2 9   ? -15.051 17.662 -25.119 1.00 84.88  ? 509  DA  B "C1'" 1 
ATOM   1984 N  N9    . DA  B 2 9   ? -13.686 18.132 -25.345 1.00 84.25  ? 509  DA  B N9    1 
ATOM   1985 C  C8    . DA  B 2 9   ? -12.693 17.553 -26.074 1.00 84.16  ? 509  DA  B C8    1 
ATOM   1986 N  N7    . DA  B 2 9   ? -11.557 18.204 -26.032 1.00 84.10  ? 509  DA  B N7    1 
ATOM   1987 C  C5    . DA  B 2 9   ? -11.815 19.282 -25.197 1.00 84.99  ? 509  DA  B C5    1 
ATOM   1988 C  C6    . DA  B 2 9   ? -11.028 20.362 -24.729 1.00 84.49  ? 509  DA  B C6    1 
ATOM   1989 N  N6    . DA  B 2 9   ? -9.754  20.535 -25.066 1.00 83.95  ? 509  DA  B N6    1 
ATOM   1990 N  N1    . DA  B 2 9   ? -11.596 21.264 -23.899 1.00 84.26  ? 509  DA  B N1    1 
ATOM   1991 C  C2    . DA  B 2 9   ? -12.872 21.098 -23.555 1.00 84.36  ? 509  DA  B C2    1 
ATOM   1992 N  N3    . DA  B 2 9   ? -13.711 20.131 -23.923 1.00 84.79  ? 509  DA  B N3    1 
ATOM   1993 C  C4    . DA  B 2 9   ? -13.122 19.244 -24.755 1.00 84.87  ? 509  DA  B C4    1 
ATOM   1994 P  P     . DT  B 2 10  ? -18.872 17.528 -25.722 1.00 82.67  ? 510  DT  B P     1 
ATOM   1995 O  OP1   . DT  B 2 10  ? -20.253 17.283 -25.238 1.00 82.27  ? 510  DT  B OP1   1 
ATOM   1996 O  OP2   . DT  B 2 10  ? -18.483 17.670 -27.155 1.00 82.46  ? 510  DT  B OP2   1 
ATOM   1997 O  "O5'" . DT  B 2 10  ? -18.375 18.901 -25.073 1.00 85.44  ? 510  DT  B "O5'" 1 
ATOM   1998 C  "C5'" . DT  B 2 10  ? -18.749 19.371 -23.758 1.00 83.95  ? 510  DT  B "C5'" 1 
ATOM   1999 C  "C4'" . DT  B 2 10  ? -18.510 20.849 -23.824 1.00 82.38  ? 510  DT  B "C4'" 1 
ATOM   2000 O  "O4'" . DT  B 2 10  ? -17.136 20.965 -24.234 1.00 81.61  ? 510  DT  B "O4'" 1 
ATOM   2001 C  "C3'" . DT  B 2 10  ? -19.340 21.568 -24.884 1.00 82.16  ? 510  DT  B "C3'" 1 
ATOM   2002 O  "O3'" . DT  B 2 10  ? -20.071 22.575 -24.238 1.00 83.70  ? 510  DT  B "O3'" 1 
ATOM   2003 C  "C2'" . DT  B 2 10  ? -18.327 22.014 -25.937 1.00 81.48  ? 510  DT  B "C2'" 1 
ATOM   2004 C  "C1'" . DT  B 2 10  ? -17.026 22.008 -25.166 1.00 82.31  ? 510  DT  B "C1'" 1 
ATOM   2005 N  N1    . DT  B 2 10  ? -15.803 21.734 -25.944 1.00 83.11  ? 510  DT  B N1    1 
ATOM   2006 C  C2    . DT  B 2 10  ? -14.683 22.554 -25.821 1.00 82.63  ? 510  DT  B C2    1 
ATOM   2007 O  O2    . DT  B 2 10  ? -14.589 23.545 -25.126 1.00 83.18  ? 510  DT  B O2    1 
ATOM   2008 N  N3    . DT  B 2 10  ? -13.629 22.181 -26.582 1.00 82.70  ? 510  DT  B N3    1 
ATOM   2009 C  C4    . DT  B 2 10  ? -13.586 21.100 -27.428 1.00 83.24  ? 510  DT  B C4    1 
ATOM   2010 O  O4    . DT  B 2 10  ? -12.572 20.882 -28.053 1.00 83.61  ? 510  DT  B O4    1 
ATOM   2011 C  C5    . DT  B 2 10  ? -14.772 20.266 -27.510 1.00 83.43  ? 510  DT  B C5    1 
ATOM   2012 C  C7    . DT  B 2 10  ? -14.845 19.056 -28.391 1.00 82.88  ? 510  DT  B C7    1 
ATOM   2013 C  C6    . DT  B 2 10  ? -15.811 20.615 -26.760 1.00 83.42  ? 510  DT  B C6    1 
ATOM   2014 P  P     . DG  B 2 11  ? -20.434 23.968 -24.914 1.00 86.13  ? 511  DG  B P     1 
ATOM   2015 O  OP1   . DG  B 2 11  ? -21.619 24.527 -24.206 1.00 84.68  ? 511  DG  B OP1   1 
ATOM   2016 O  OP2   . DG  B 2 11  ? -20.392 23.888 -26.384 1.00 85.89  ? 511  DG  B OP2   1 
ATOM   2017 O  "O5'" . DG  B 2 11  ? -19.098 24.736 -24.551 1.00 87.22  ? 511  DG  B "O5'" 1 
ATOM   2018 C  "C5'" . DG  B 2 11  ? -18.914 25.401 -23.339 1.00 88.01  ? 511  DG  B "C5'" 1 
ATOM   2019 C  "C4'" . DG  B 2 11  ? -18.028 26.573 -23.679 1.00 89.82  ? 511  DG  B "C4'" 1 
ATOM   2020 O  "O4'" . DG  B 2 11  ? -16.895 26.124 -24.471 1.00 89.41  ? 511  DG  B "O4'" 1 
ATOM   2021 C  "C3'" . DG  B 2 11  ? -18.703 27.670 -24.491 1.00 91.27  ? 511  DG  B "C3'" 1 
ATOM   2022 O  "O3'" . DG  B 2 11  ? -18.380 28.910 -23.838 1.00 93.60  ? 511  DG  B "O3'" 1 
ATOM   2023 C  "C2'" . DG  B 2 11  ? -18.126 27.460 -25.897 1.00 91.32  ? 511  DG  B "C2'" 1 
ATOM   2024 C  "C1'" . DG  B 2 11  ? -16.723 26.951 -25.596 1.00 92.08  ? 511  DG  B "C1'" 1 
ATOM   2025 N  N9    . DG  B 2 11  ? -16.076 26.069 -26.556 1.00 92.85  ? 511  DG  B N9    1 
ATOM   2026 C  C8    . DG  B 2 11  ? -16.611 24.901 -27.049 1.00 93.18  ? 511  DG  B C8    1 
ATOM   2027 N  N7    . DG  B 2 11  ? -15.833 24.269 -27.883 1.00 93.23  ? 511  DG  B N7    1 
ATOM   2028 C  C5    . DG  B 2 11  ? -14.689 25.063 -27.944 1.00 93.83  ? 511  DG  B C5    1 
ATOM   2029 C  C6    . DG  B 2 11  ? -13.475 24.888 -28.678 1.00 93.85  ? 511  DG  B C6    1 
ATOM   2030 O  O6    . DG  B 2 11  ? -13.163 23.970 -29.450 1.00 93.68  ? 511  DG  B O6    1 
ATOM   2031 N  N1    . DG  B 2 11  ? -12.552 25.917 -28.451 1.00 93.37  ? 511  DG  B N1    1 
ATOM   2032 C  C2    . DG  B 2 11  ? -12.782 26.985 -27.628 1.00 92.70  ? 511  DG  B C2    1 
ATOM   2033 N  N2    . DG  B 2 11  ? -11.784 27.849 -27.549 1.00 92.85  ? 511  DG  B N2    1 
ATOM   2034 N  N3    . DG  B 2 11  ? -13.900 27.172 -26.930 1.00 93.12  ? 511  DG  B N3    1 
ATOM   2035 C  C4    . DG  B 2 11  ? -14.815 26.175 -27.119 1.00 93.68  ? 511  DG  B C4    1 
ATOM   2036 P  P     . DC  B 2 12  ? -18.691 30.365 -24.422 1.00 95.84  ? 512  DC  B P     1 
ATOM   2037 O  OP1   . DC  B 2 12  ? -18.530 31.331 -23.327 1.00 95.94  ? 512  DC  B OP1   1 
ATOM   2038 O  OP2   . DC  B 2 12  ? -19.975 30.303 -25.161 1.00 96.28  ? 512  DC  B OP2   1 
ATOM   2039 O  "O5'" . DC  B 2 12  ? -17.489 30.591 -25.453 1.00 99.20  ? 512  DC  B "O5'" 1 
ATOM   2040 C  "C5'" . DC  B 2 12  ? -16.230 31.099 -25.056 1.00 101.85 ? 512  DC  B "C5'" 1 
ATOM   2041 C  "C4'" . DC  B 2 12  ? -15.534 31.678 -26.266 1.00 104.68 ? 512  DC  B "C4'" 1 
ATOM   2042 O  "O4'" . DC  B 2 12  ? -15.232 30.602 -27.186 1.00 106.29 ? 512  DC  B "O4'" 1 
ATOM   2043 C  "C3'" . DC  B 2 12  ? -16.357 32.690 -27.069 1.00 106.86 ? 512  DC  B "C3'" 1 
ATOM   2044 O  "O3'" . DC  B 2 12  ? -15.501 33.784 -27.506 1.00 108.17 ? 512  DC  B "O3'" 1 
ATOM   2045 C  "C2'" . DC  B 2 12  ? -16.901 31.822 -28.215 1.00 107.64 ? 512  DC  B "C2'" 1 
ATOM   2046 C  "C1'" . DC  B 2 12  ? -15.677 30.952 -28.490 1.00 108.65 ? 512  DC  B "C1'" 1 
ATOM   2047 N  N1    . DC  B 2 12  ? -15.853 29.692 -29.338 1.00 109.43 ? 512  DC  B N1    1 
ATOM   2048 C  C2    . DC  B 2 12  ? -15.471 29.633 -30.699 1.00 109.79 ? 512  DC  B C2    1 
ATOM   2049 O  O2    . DC  B 2 12  ? -14.992 30.611 -31.293 1.00 109.94 ? 512  DC  B O2    1 
ATOM   2050 N  N3    . DC  B 2 12  ? -15.650 28.466 -31.371 1.00 110.54 ? 512  DC  B N3    1 
ATOM   2051 C  C4    . DC  B 2 12  ? -16.167 27.384 -30.771 1.00 110.14 ? 512  DC  B C4    1 
ATOM   2052 N  N4    . DC  B 2 12  ? -16.323 26.253 -31.473 1.00 109.59 ? 512  DC  B N4    1 
ATOM   2053 C  C5    . DC  B 2 12  ? -16.552 27.428 -29.401 1.00 110.42 ? 512  DC  B C5    1 
ATOM   2054 C  C6    . DC  B 2 12  ? -16.377 28.581 -28.738 1.00 110.13 ? 512  DC  B C6    1 
ATOM   2055 P  P     . DC  B 2 13  ? -15.850 35.344 -27.377 1.00 108.34 ? 513  DC  B P     1 
ATOM   2056 O  OP1   . DC  B 2 13  ? -15.693 35.692 -25.954 1.00 107.43 ? 513  DC  B OP1   1 
ATOM   2057 O  OP2   . DC  B 2 13  ? -17.132 35.553 -28.095 1.00 108.84 ? 513  DC  B OP2   1 
ATOM   2058 O  "O5'" . DC  B 2 13  ? -14.660 36.063 -28.205 1.00 112.56 ? 513  DC  B "O5'" 1 
ATOM   2059 C  "C5'" . DC  B 2 13  ? -14.609 37.490 -28.562 1.00 116.14 ? 513  DC  B "C5'" 1 
ATOM   2060 C  "C4'" . DC  B 2 13  ? -13.413 37.897 -29.457 1.00 117.99 ? 513  DC  B "C4'" 1 
ATOM   2061 O  "O4'" . DC  B 2 13  ? -13.096 36.898 -30.461 1.00 119.38 ? 513  DC  B "O4'" 1 
ATOM   2062 C  "C3'" . DC  B 2 13  ? -13.578 39.094 -30.390 1.00 118.71 ? 513  DC  B "C3'" 1 
ATOM   2063 O  "O3'" . DC  B 2 13  ? -12.289 39.474 -30.880 1.00 118.37 ? 513  DC  B "O3'" 1 
ATOM   2064 C  "C2'" . DC  B 2 13  ? -14.479 38.523 -31.493 1.00 119.15 ? 513  DC  B "C2'" 1 
ATOM   2065 C  "C1'" . DC  B 2 13  ? -13.971 37.072 -31.576 1.00 120.07 ? 513  DC  B "C1'" 1 
ATOM   2066 N  N1    . DC  B 2 13  ? -14.964 35.875 -31.547 1.00 120.79 ? 513  DC  B N1    1 
ATOM   2067 C  C2    . DC  B 2 13  ? -14.463 34.619 -31.970 1.00 120.86 ? 513  DC  B C2    1 
ATOM   2068 O  O2    . DC  B 2 13  ? -13.289 34.523 -32.351 1.00 120.83 ? 513  DC  B O2    1 
ATOM   2069 N  N3    . DC  B 2 13  ? -15.264 33.524 -31.968 1.00 120.20 ? 513  DC  B N3    1 
ATOM   2070 C  C4    . DC  B 2 13  ? -16.522 33.630 -31.560 1.00 120.27 ? 513  DC  B C4    1 
ATOM   2071 N  N4    . DC  B 2 13  ? -17.235 32.500 -31.592 1.00 120.59 ? 513  DC  B N4    1 
ATOM   2072 C  C5    . DC  B 2 13  ? -17.077 34.879 -31.112 1.00 120.36 ? 513  DC  B C5    1 
ATOM   2073 C  C6    . DC  B 2 13  ? -16.277 35.961 -31.118 1.00 120.52 ? 513  DC  B C6    1 
ATOM   2074 P  P     . DG  C 3 1   ? -13.766 24.673 -40.160 1.00 136.39 ? 534  DG  A P     1 
ATOM   2075 O  OP1   . DG  C 3 1   ? -14.911 24.817 -41.105 1.00 135.42 ? 534  DG  A OP1   1 
ATOM   2076 O  OP2   . DG  C 3 1   ? -13.262 23.337 -39.740 1.00 135.52 ? 534  DG  A OP2   1 
ATOM   2077 O  "O5'" . DG  C 3 1   ? -12.516 25.550 -40.669 1.00 135.20 ? 534  DG  A "O5'" 1 
ATOM   2078 C  "C5'" . DG  C 3 1   ? -12.229 26.852 -40.122 1.00 134.70 ? 534  DG  A "C5'" 1 
ATOM   2079 C  "C4'" . DG  C 3 1   ? -11.039 26.907 -39.155 1.00 134.29 ? 534  DG  A "C4'" 1 
ATOM   2080 O  "O4'" . DG  C 3 1   ? -11.544 27.250 -37.834 1.00 134.03 ? 534  DG  A "O4'" 1 
ATOM   2081 C  "C3'" . DG  C 3 1   ? -10.169 25.648 -38.990 1.00 134.14 ? 534  DG  A "C3'" 1 
ATOM   2082 O  "O3'" . DG  C 3 1   ? -8.815  25.914 -39.440 1.00 133.90 ? 534  DG  A "O3'" 1 
ATOM   2083 C  "C2'" . DG  C 3 1   ? -10.238 25.288 -37.499 1.00 133.95 ? 534  DG  A "C2'" 1 
ATOM   2084 C  "C1'" . DG  C 3 1   ? -11.145 26.320 -36.838 1.00 133.29 ? 534  DG  A "C1'" 1 
ATOM   2085 N  N9    . DG  C 3 1   ? -12.347 25.776 -36.211 1.00 133.06 ? 534  DG  A N9    1 
ATOM   2086 C  C8    . DG  C 3 1   ? -12.805 24.470 -36.180 1.00 132.82 ? 534  DG  A C8    1 
ATOM   2087 N  N7    . DG  C 3 1   ? -13.928 24.333 -35.535 1.00 132.88 ? 534  DG  A N7    1 
ATOM   2088 C  C5    . DG  C 3 1   ? -14.234 25.626 -35.122 1.00 133.01 ? 534  DG  A C5    1 
ATOM   2089 C  C6    . DG  C 3 1   ? -15.339 26.100 -34.382 1.00 132.88 ? 534  DG  A C6    1 
ATOM   2090 O  O6    . DG  C 3 1   ? -16.286 25.433 -33.939 1.00 132.66 ? 534  DG  A O6    1 
ATOM   2091 N  N1    . DG  C 3 1   ? -15.267 27.485 -34.174 1.00 132.90 ? 534  DG  A N1    1 
ATOM   2092 C  C2    . DG  C 3 1   ? -14.255 28.313 -34.624 1.00 132.71 ? 534  DG  A C2    1 
ATOM   2093 N  N2    . DG  C 3 1   ? -14.356 29.616 -34.330 1.00 132.68 ? 534  DG  A N2    1 
ATOM   2094 N  N3    . DG  C 3 1   ? -13.211 27.878 -35.318 1.00 132.69 ? 534  DG  A N3    1 
ATOM   2095 C  C4    . DG  C 3 1   ? -13.271 26.531 -35.528 1.00 133.10 ? 534  DG  A C4    1 
ATOM   2096 P  P     . DG  C 3 2   ? -7.515  25.066 -38.974 1.00 134.02 ? 535  DG  A P     1 
ATOM   2097 O  OP1   . DG  C 3 2   ? -6.473  25.196 -40.026 1.00 134.14 ? 535  DG  A OP1   1 
ATOM   2098 O  OP2   . DG  C 3 2   ? -7.959  23.710 -38.544 1.00 132.83 ? 535  DG  A OP2   1 
ATOM   2099 O  "O5'" . DG  C 3 2   ? -6.976  25.877 -37.681 1.00 132.54 ? 535  DG  A "O5'" 1 
ATOM   2100 C  "C5'" . DG  C 3 2   ? -7.052  27.328 -37.475 1.00 129.29 ? 535  DG  A "C5'" 1 
ATOM   2101 C  "C4'" . DG  C 3 2   ? -7.045  27.684 -35.986 1.00 126.97 ? 535  DG  A "C4'" 1 
ATOM   2102 O  "O4'" . DG  C 3 2   ? -8.381  27.518 -35.430 1.00 126.17 ? 535  DG  A "O4'" 1 
ATOM   2103 C  "C3'" . DG  C 3 2   ? -6.117  26.831 -35.111 1.00 125.19 ? 535  DG  A "C3'" 1 
ATOM   2104 O  "O3'" . DG  C 3 2   ? -5.033  27.626 -34.615 1.00 122.49 ? 535  DG  A "O3'" 1 
ATOM   2105 C  "C2'" . DG  C 3 2   ? -7.018  26.237 -34.017 1.00 124.96 ? 535  DG  A "C2'" 1 
ATOM   2106 C  "C1'" . DG  C 3 2   ? -8.311  27.036 -34.103 1.00 125.23 ? 535  DG  A "C1'" 1 
ATOM   2107 N  N9    . DG  C 3 2   ? -9.493  26.238 -33.775 1.00 125.20 ? 535  DG  A N9    1 
ATOM   2108 C  C8    . DG  C 3 2   ? -9.726  24.935 -34.147 1.00 125.04 ? 535  DG  A C8    1 
ATOM   2109 N  N7    . DG  C 3 2   ? -10.852 24.460 -33.711 1.00 125.02 ? 535  DG  A N7    1 
ATOM   2110 C  C5    . DG  C 3 2   ? -11.413 25.509 -32.995 1.00 125.44 ? 535  DG  A C5    1 
ATOM   2111 C  C6    . DG  C 3 2   ? -12.646 25.578 -32.287 1.00 125.40 ? 535  DG  A C6    1 
ATOM   2112 O  O6    . DG  C 3 2   ? -13.514 24.703 -32.154 1.00 125.29 ? 535  DG  A O6    1 
ATOM   2113 N  N1    . DG  C 3 2   ? -12.845 26.823 -31.698 1.00 125.14 ? 535  DG  A N1    1 
ATOM   2114 C  C2    . DG  C 3 2   ? -11.970 27.874 -31.769 1.00 125.01 ? 535  DG  A C2    1 
ATOM   2115 N  N2    . DG  C 3 2   ? -12.354 28.982 -31.123 1.00 125.07 ? 535  DG  A N2    1 
ATOM   2116 N  N3    . DG  C 3 2   ? -10.812 27.826 -32.425 1.00 125.25 ? 535  DG  A N3    1 
ATOM   2117 C  C4    . DG  C 3 2   ? -10.590 26.618 -33.020 1.00 125.42 ? 535  DG  A C4    1 
ATOM   2118 P  P     . DC  C 3 3   ? -4.107  27.110 -33.403 1.00 120.05 ? 536  DC  A P     1 
ATOM   2119 O  OP1   . DC  C 3 3   ? -2.770  27.724 -33.581 1.00 121.07 ? 536  DC  A OP1   1 
ATOM   2120 O  OP2   . DC  C 3 3   ? -4.225  25.629 -33.257 1.00 118.78 ? 536  DC  A OP2   1 
ATOM   2121 O  "O5'" . DC  C 3 3   ? -4.817  27.817 -32.139 1.00 115.64 ? 536  DC  A "O5'" 1 
ATOM   2122 C  "C5'" . DC  C 3 3   ? -5.142  29.222 -32.051 1.00 109.15 ? 536  DC  A "C5'" 1 
ATOM   2123 C  "C4'" . DC  C 3 3   ? -5.662  29.511 -30.657 1.00 104.76 ? 536  DC  A "C4'" 1 
ATOM   2124 O  "O4'" . DC  C 3 3   ? -6.866  28.734 -30.469 1.00 102.77 ? 536  DC  A "O4'" 1 
ATOM   2125 C  "C3'" . DC  C 3 3   ? -4.742  29.090 -29.504 1.00 101.52 ? 536  DC  A "C3'" 1 
ATOM   2126 O  "O3'" . DC  C 3 3   ? -4.936  30.001 -28.398 1.00 96.72  ? 536  DC  A "O3'" 1 
ATOM   2127 C  "C2'" . DC  C 3 3   ? -5.189  27.650 -29.240 1.00 101.30 ? 536  DC  A "C2'" 1 
ATOM   2128 C  "C1'" . DC  C 3 3   ? -6.686  27.870 -29.353 1.00 102.07 ? 536  DC  A "C1'" 1 
ATOM   2129 N  N1    . DC  C 3 3   ? -7.532  26.669 -29.558 1.00 102.12 ? 536  DC  A N1    1 
ATOM   2130 C  C2    . DC  C 3 3   ? -8.899  26.908 -29.754 1.00 102.38 ? 536  DC  A C2    1 
ATOM   2131 O  O2    . DC  C 3 3   ? -9.323  28.070 -29.747 1.00 102.22 ? 536  DC  A O2    1 
ATOM   2132 N  N3    . DC  C 3 3   ? -9.728  25.862 -29.952 1.00 102.19 ? 536  DC  A N3    1 
ATOM   2133 C  C4    . DC  C 3 3   ? -9.244  24.624 -29.953 1.00 102.00 ? 536  DC  A C4    1 
ATOM   2134 N  N4    . DC  C 3 3   ? -10.136 23.658 -30.144 1.00 101.96 ? 536  DC  A N4    1 
ATOM   2135 C  C5    . DC  C 3 3   ? -7.857  24.338 -29.752 1.00 101.85 ? 536  DC  A C5    1 
ATOM   2136 C  C6    . DC  C 3 3   ? -7.038  25.386 -29.555 1.00 102.27 ? 536  DC  A C6    1 
ATOM   2137 P  P     . DA  C 3 4   ? -4.433  29.743 -26.886 1.00 91.66  ? 537  DA  A P     1 
ATOM   2138 O  OP1   . DA  C 3 4   ? -3.628  30.931 -26.477 1.00 91.46  ? 537  DA  A OP1   1 
ATOM   2139 O  OP2   . DA  C 3 4   ? -3.891  28.374 -26.718 1.00 91.33  ? 537  DA  A OP2   1 
ATOM   2140 O  "O5'" . DA  C 3 4   ? -5.807  29.749 -26.078 1.00 86.08  ? 537  DA  A "O5'" 1 
ATOM   2141 C  "C5'" . DA  C 3 4   ? -6.830  30.731 -26.352 1.00 80.77  ? 537  DA  A "C5'" 1 
ATOM   2142 C  "C4'" . DA  C 3 4   ? -7.938  30.602 -25.331 1.00 75.74  ? 537  DA  A "C4'" 1 
ATOM   2143 O  "O4'" . DA  C 3 4   ? -8.757  29.438 -25.582 1.00 74.44  ? 537  DA  A "O4'" 1 
ATOM   2144 C  "C3'" . DA  C 3 4   ? -7.435  30.359 -23.919 1.00 72.30  ? 537  DA  A "C3'" 1 
ATOM   2145 O  "O3'" . DA  C 3 4   ? -8.375  30.948 -23.092 1.00 64.87  ? 537  DA  A "O3'" 1 
ATOM   2146 C  "C2'" . DA  C 3 4   ? -7.372  28.841 -23.741 1.00 72.96  ? 537  DA  A "C2'" 1 
ATOM   2147 C  "C1'" . DA  C 3 4   ? -8.572  28.455 -24.573 1.00 75.43  ? 537  DA  A "C1'" 1 
ATOM   2148 N  N9    . DA  C 3 4   ? -8.467  27.167 -25.238 1.00 76.84  ? 537  DA  A N9    1 
ATOM   2149 C  C8    . DA  C 3 4   ? -7.398  26.581 -25.872 1.00 76.92  ? 537  DA  A C8    1 
ATOM   2150 N  N7    . DA  C 3 4   ? -7.674  25.398 -26.370 1.00 76.84  ? 537  DA  A N7    1 
ATOM   2151 C  C5    . DA  C 3 4   ? -9.017  25.220 -26.050 1.00 77.04  ? 537  DA  A C5    1 
ATOM   2152 C  C6    . DA  C 3 4   ? -9.949  24.202 -26.300 1.00 76.87  ? 537  DA  A C6    1 
ATOM   2153 N  N6    . DA  C 3 4   ? -9.653  23.079 -26.947 1.00 77.15  ? 537  DA  A N6    1 
ATOM   2154 N  N1    . DA  C 3 4   ? -11.209 24.355 -25.845 1.00 77.24  ? 537  DA  A N1    1 
ATOM   2155 C  C2    . DA  C 3 4   ? -11.542 25.455 -25.172 1.00 76.89  ? 537  DA  A C2    1 
ATOM   2156 N  N3    . DA  C 3 4   ? -10.773 26.490 -24.883 1.00 77.43  ? 537  DA  A N3    1 
ATOM   2157 C  C4    . DA  C 3 4   ? -9.520  26.302 -25.359 1.00 77.45  ? 537  DA  A C4    1 
ATOM   2158 P  P     . DT  C 3 5   ? -8.222  30.994 -21.509 1.00 57.79  ? 538  DT  A P     1 
ATOM   2159 O  OP1   . DT  C 3 5   ? -8.689  32.387 -21.352 1.00 55.64  ? 538  DT  A OP1   1 
ATOM   2160 O  OP2   . DT  C 3 5   ? -6.927  30.453 -20.990 1.00 52.72  ? 538  DT  A OP2   1 
ATOM   2161 O  "O5'" . DT  C 3 5   ? -9.383  29.976 -21.052 1.00 53.70  ? 538  DT  A "O5'" 1 
ATOM   2162 C  "C5'" . DT  C 3 5   ? -10.776 30.257 -21.379 1.00 52.65  ? 538  DT  A "C5'" 1 
ATOM   2163 C  "C4'" . DT  C 3 5   ? -11.660 29.048 -21.100 1.00 53.93  ? 538  DT  A "C4'" 1 
ATOM   2164 O  "O4'" . DT  C 3 5   ? -11.229 27.942 -21.928 1.00 55.15  ? 538  DT  A "O4'" 1 
ATOM   2165 C  "C3'" . DT  C 3 5   ? -11.596 28.498 -19.671 1.00 52.92  ? 538  DT  A "C3'" 1 
ATOM   2166 O  "O3'" . DT  C 3 5   ? -12.898 28.533 -19.060 1.00 49.07  ? 538  DT  A "O3'" 1 
ATOM   2167 C  "C2'" . DT  C 3 5   ? -10.992 27.090 -19.769 1.00 54.84  ? 538  DT  A "C2'" 1 
ATOM   2168 C  "C1'" . DT  C 3 5   ? -11.345 26.723 -21.204 1.00 60.28  ? 538  DT  A "C1'" 1 
ATOM   2169 N  N1    . DT  C 3 5   ? -10.480 25.657 -21.841 1.00 62.35  ? 538  DT  A N1    1 
ATOM   2170 C  C2    . DT  C 3 5   ? -10.989 24.407 -22.264 1.00 64.06  ? 538  DT  A C2    1 
ATOM   2171 O  O2    . DT  C 3 5   ? -12.139 24.005 -22.158 1.00 62.71  ? 538  DT  A O2    1 
ATOM   2172 N  N3    . DT  C 3 5   ? -10.041 23.581 -22.823 1.00 63.90  ? 538  DT  A N3    1 
ATOM   2173 C  C4    . DT  C 3 5   ? -8.680  23.853 -23.016 1.00 64.93  ? 538  DT  A C4    1 
ATOM   2174 O  O4    . DT  C 3 5   ? -7.925  23.020 -23.541 1.00 64.26  ? 538  DT  A O4    1 
ATOM   2175 C  C5    . DT  C 3 5   ? -8.214  25.170 -22.561 1.00 63.95  ? 538  DT  A C5    1 
ATOM   2176 C  C7    . DT  C 3 5   ? -6.781  25.597 -22.712 1.00 63.28  ? 538  DT  A C7    1 
ATOM   2177 C  C6    . DT  C 3 5   ? -9.128  25.985 -22.006 1.00 63.60  ? 538  DT  A C6    1 
ATOM   2178 P  P     . DG  C 3 6   ? -13.087 28.059 -17.572 1.00 49.50  ? 539  DG  A P     1 
ATOM   2179 O  OP1   . DG  C 3 6   ? -14.250 28.779 -17.013 1.00 47.68  ? 539  DG  A OP1   1 
ATOM   2180 O  OP2   . DG  C 3 6   ? -11.769 27.839 -16.888 1.00 48.00  ? 539  DG  A OP2   1 
ATOM   2181 O  "O5'" . DG  C 3 6   ? -13.571 26.561 -17.748 1.00 52.46  ? 539  DG  A "O5'" 1 
ATOM   2182 C  "C5'" . DG  C 3 6   ? -14.716 26.259 -18.594 1.00 56.08  ? 539  DG  A "C5'" 1 
ATOM   2183 C  "C4'" . DG  C 3 6   ? -14.929 24.756 -18.739 1.00 55.38  ? 539  DG  A "C4'" 1 
ATOM   2184 O  "O4'" . DG  C 3 6   ? -13.825 24.233 -19.518 1.00 55.91  ? 539  DG  A "O4'" 1 
ATOM   2185 C  "C3'" . DG  C 3 6   ? -14.981 23.961 -17.436 1.00 55.39  ? 539  DG  A "C3'" 1 
ATOM   2186 O  "O3'" . DG  C 3 6   ? -16.092 23.104 -17.504 1.00 53.67  ? 539  DG  A "O3'" 1 
ATOM   2187 C  "C2'" . DG  C 3 6   ? -13.655 23.239 -17.400 1.00 55.52  ? 539  DG  A "C2'" 1 
ATOM   2188 C  "C1'" . DG  C 3 6   ? -13.430 23.060 -18.878 1.00 60.93  ? 539  DG  A "C1'" 1 
ATOM   2189 N  N9    . DG  C 3 6   ? -12.079 22.804 -19.292 1.00 63.13  ? 539  DG  A N9    1 
ATOM   2190 C  C8    . DG  C 3 6   ? -10.970 23.597 -19.242 1.00 64.15  ? 539  DG  A C8    1 
ATOM   2191 N  N7    . DG  C 3 6   ? -9.909  23.030 -19.731 1.00 64.87  ? 539  DG  A N7    1 
ATOM   2192 C  C5    . DG  C 3 6   ? -10.351 21.773 -20.147 1.00 66.53  ? 539  DG  A C5    1 
ATOM   2193 C  C6    . DG  C 3 6   ? -9.690  20.668 -20.779 1.00 64.97  ? 539  DG  A C6    1 
ATOM   2194 O  O6    . DG  C 3 6   ? -8.512  20.559 -21.100 1.00 64.70  ? 539  DG  A O6    1 
ATOM   2195 N  N1    . DG  C 3 6   ? -10.539 19.596 -21.033 1.00 64.36  ? 539  DG  A N1    1 
ATOM   2196 C  C2    . DG  C 3 6   ? -11.887 19.560 -20.723 1.00 65.64  ? 539  DG  A C2    1 
ATOM   2197 N  N2    . DG  C 3 6   ? -12.577 18.456 -21.023 1.00 64.84  ? 539  DG  A N2    1 
ATOM   2198 N  N3    . DG  C 3 6   ? -12.529 20.576 -20.143 1.00 67.23  ? 539  DG  A N3    1 
ATOM   2199 C  C4    . DG  C 3 6   ? -11.700 21.639 -19.884 1.00 66.36  ? 539  DG  A C4    1 
ATOM   2200 P  P     . DT  C 3 7   ? -16.509 22.021 -16.410 1.00 53.84  ? 540  DT  A P     1 
ATOM   2201 O  OP1   . DT  C 3 7   ? -17.984 21.926 -16.512 1.00 56.68  ? 540  DT  A OP1   1 
ATOM   2202 O  OP2   . DT  C 3 7   ? -15.890 22.035 -15.071 1.00 53.29  ? 540  DT  A OP2   1 
ATOM   2203 O  "O5'" . DT  C 3 7   ? -15.838 20.726 -17.045 1.00 58.96  ? 540  DT  A "O5'" 1 
ATOM   2204 C  "C5'" . DT  C 3 7   ? -16.352 19.965 -18.173 1.00 59.70  ? 540  DT  A "C5'" 1 
ATOM   2205 C  "C4'" . DT  C 3 7   ? -15.980 18.501 -17.975 1.00 59.60  ? 540  DT  A "C4'" 1 
ATOM   2206 O  "O4'" . DT  C 3 7   ? -14.604 18.366 -18.313 1.00 60.95  ? 540  DT  A "O4'" 1 
ATOM   2207 C  "C3'" . DT  C 3 7   ? -16.073 17.927 -16.569 1.00 61.67  ? 540  DT  A "C3'" 1 
ATOM   2208 O  "O3'" . DT  C 3 7   ? -16.906 16.827 -16.716 1.00 63.95  ? 540  DT  A "O3'" 1 
ATOM   2209 C  "C2'" . DT  C 3 7   ? -14.654 17.543 -16.112 1.00 61.99  ? 540  DT  A "C2'" 1 
ATOM   2210 C  "C1'" . DT  C 3 7   ? -13.930 17.471 -17.439 1.00 64.22  ? 540  DT  A "C1'" 1 
ATOM   2211 N  N1    . DT  C 3 7   ? -12.524 17.970 -17.594 1.00 66.84  ? 540  DT  A N1    1 
ATOM   2212 C  C2    . DT  C 3 7   ? -11.634 17.201 -18.317 1.00 67.57  ? 540  DT  A C2    1 
ATOM   2213 O  O2    . DT  C 3 7   ? -11.933 16.108 -18.761 1.00 65.95  ? 540  DT  A O2    1 
ATOM   2214 N  N3    . DT  C 3 7   ? -10.372 17.767 -18.458 1.00 68.91  ? 540  DT  A N3    1 
ATOM   2215 C  C4    . DT  C 3 7   ? -9.924  18.999 -17.984 1.00 67.08  ? 540  DT  A C4    1 
ATOM   2216 O  O4    . DT  C 3 7   ? -8.782  19.393 -18.192 1.00 66.48  ? 540  DT  A O4    1 
ATOM   2217 C  C5    . DT  C 3 7   ? -10.914 19.778 -17.265 1.00 67.19  ? 540  DT  A C5    1 
ATOM   2218 C  C7    . DT  C 3 7   ? -10.582 21.134 -16.713 1.00 66.08  ? 540  DT  A C7    1 
ATOM   2219 C  C6    . DT  C 3 7   ? -12.148 19.239 -17.119 1.00 67.78  ? 540  DT  A C6    1 
ATOM   2220 P  P     . DT  C 3 8   ? -17.547 15.957 -15.530 1.00 67.55  ? 541  DT  A P     1 
ATOM   2221 O  OP1   . DT  C 3 8   ? -18.734 15.520 -16.291 1.00 69.77  ? 541  DT  A OP1   1 
ATOM   2222 O  OP2   . DT  C 3 8   ? -17.617 16.566 -14.174 1.00 64.84  ? 541  DT  A OP2   1 
ATOM   2223 O  "O5'" . DT  C 3 8   ? -16.550 14.729 -15.325 1.00 69.91  ? 541  DT  A "O5'" 1 
ATOM   2224 C  "C5'" . DT  C 3 8   ? -16.176 13.883 -16.408 1.00 71.16  ? 541  DT  A "C5'" 1 
ATOM   2225 C  "C4'" . DT  C 3 8   ? -15.112 12.931 -15.913 1.00 72.88  ? 541  DT  A "C4'" 1 
ATOM   2226 O  "O4'" . DT  C 3 8   ? -13.813 13.512 -16.142 1.00 72.83  ? 541  DT  A "O4'" 1 
ATOM   2227 C  "C3'" . DT  C 3 8   ? -15.144 12.568 -14.421 1.00 75.08  ? 541  DT  A "C3'" 1 
ATOM   2228 O  "O3'" . DT  C 3 8   ? -15.167 11.165 -14.359 1.00 79.71  ? 541  DT  A "O3'" 1 
ATOM   2229 C  "C2'" . DT  C 3 8   ? -13.860 13.125 -13.812 1.00 74.33  ? 541  DT  A "C2'" 1 
ATOM   2230 C  "C1'" . DT  C 3 8   ? -12.974 13.240 -15.034 1.00 74.69  ? 541  DT  A "C1'" 1 
ATOM   2231 N  N1    . DT  C 3 8   ? -12.000 14.352 -15.084 1.00 76.29  ? 541  DT  A N1    1 
ATOM   2232 C  C2    . DT  C 3 8   ? -10.885 14.153 -15.900 1.00 76.59  ? 541  DT  A C2    1 
ATOM   2233 O  O2    . DT  C 3 8   ? -10.658 13.127 -16.530 1.00 75.25  ? 541  DT  A O2    1 
ATOM   2234 N  N3    . DT  C 3 8   ? -10.013 15.224 -15.946 1.00 76.96  ? 541  DT  A N3    1 
ATOM   2235 C  C4    . DT  C 3 8   ? -10.127 16.452 -15.298 1.00 76.13  ? 541  DT  A C4    1 
ATOM   2236 O  O4    . DT  C 3 8   ? -9.261  17.322 -15.429 1.00 75.45  ? 541  DT  A O4    1 
ATOM   2237 C  C5    . DT  C 3 8   ? -11.315 16.593 -14.475 1.00 75.36  ? 541  DT  A C5    1 
ATOM   2238 C  C7    . DT  C 3 8   ? -11.534 17.860 -13.735 1.00 74.62  ? 541  DT  A C7    1 
ATOM   2239 C  C6    . DT  C 3 8   ? -12.194 15.568 -14.404 1.00 75.85  ? 541  DT  A C6    1 
ATOM   2240 P  P     . DA  C 3 9   ? -15.177 10.309 -13.014 1.00 84.14  ? 542  DA  A P     1 
ATOM   2241 O  OP1   . DA  C 3 9   ? -16.210 9.286  -13.298 1.00 87.33  ? 542  DA  A OP1   1 
ATOM   2242 O  OP2   . DA  C 3 9   ? -15.220 11.172 -11.801 1.00 83.78  ? 542  DA  A OP2   1 
ATOM   2243 O  "O5'" . DA  C 3 9   ? -13.805 9.494  -13.070 1.00 83.54  ? 542  DA  A "O5'" 1 
ATOM   2244 C  "C5'" . DA  C 3 9   ? -13.264 9.062  -14.337 1.00 83.73  ? 542  DA  A "C5'" 1 
ATOM   2245 C  "C4'" . DA  C 3 9   ? -11.948 8.355  -14.078 1.00 83.91  ? 542  DA  A "C4'" 1 
ATOM   2246 O  "O4'" . DA  C 3 9   ? -10.831 9.268  -14.261 1.00 82.17  ? 542  DA  A "O4'" 1 
ATOM   2247 C  "C3'" . DA  C 3 9   ? -11.834 7.790  -12.651 1.00 84.65  ? 542  DA  A "C3'" 1 
ATOM   2248 O  "O3'" . DA  C 3 9   ? -11.272 6.446  -12.788 1.00 86.55  ? 542  DA  A "O3'" 1 
ATOM   2249 C  "C2'" . DA  C 3 9   ? -11.042 8.873  -11.903 1.00 83.75  ? 542  DA  A "C2'" 1 
ATOM   2250 C  "C1'" . DA  C 3 9   ? -10.171 9.495  -13.013 1.00 83.40  ? 542  DA  A "C1'" 1 
ATOM   2251 N  N9    . DA  C 3 9   ? -9.851  10.930 -12.881 1.00 83.77  ? 542  DA  A N9    1 
ATOM   2252 C  C8    . DA  C 3 9   ? -10.575 11.909 -12.255 1.00 83.75  ? 542  DA  A C8    1 
ATOM   2253 N  N7    . DA  C 3 9   ? -10.033 13.103 -12.332 1.00 84.01  ? 542  DA  A N7    1 
ATOM   2254 C  C5    . DA  C 3 9   ? -8.866  12.926 -13.043 1.00 83.64  ? 542  DA  A C5    1 
ATOM   2255 C  C6    . DA  C 3 9   ? -7.827  13.801 -13.448 1.00 83.62  ? 542  DA  A C6    1 
ATOM   2256 N  N6    . DA  C 3 9   ? -7.786  15.104 -13.193 1.00 83.17  ? 542  DA  A N6    1 
ATOM   2257 N  N1    . DA  C 3 9   ? -6.796  13.287 -14.152 1.00 83.93  ? 542  DA  A N1    1 
ATOM   2258 C  C2    . DA  C 3 9   ? -6.805  11.980 -14.422 1.00 83.80  ? 542  DA  A C2    1 
ATOM   2259 N  N3    . DA  C 3 9   ? -7.717  11.063 -14.088 1.00 83.79  ? 542  DA  A N3    1 
ATOM   2260 C  C4    . DA  C 3 9   ? -8.742  11.590 -13.391 1.00 84.27  ? 542  DA  A C4    1 
ATOM   2261 P  P     . DA  C 3 10  ? -10.101 5.719  -11.958 1.00 87.68  ? 543  DA  A P     1 
ATOM   2262 O  OP1   . DA  C 3 10  ? -10.191 4.327  -12.419 1.00 89.32  ? 543  DA  A OP1   1 
ATOM   2263 O  OP2   . DA  C 3 10  ? -10.289 6.013  -10.504 1.00 86.50  ? 543  DA  A OP2   1 
ATOM   2264 O  "O5'" . DA  C 3 10  ? -8.714  6.318  -12.543 1.00 86.68  ? 543  DA  A "O5'" 1 
ATOM   2265 C  "C5'" . DA  C 3 10  ? -7.898  5.722  -13.578 1.00 86.97  ? 543  DA  A "C5'" 1 
ATOM   2266 C  "C4'" . DA  C 3 10  ? -6.470  5.691  -13.075 1.00 87.98  ? 543  DA  A "C4'" 1 
ATOM   2267 O  "O4'" . DA  C 3 10  ? -6.034  7.071  -12.990 1.00 87.91  ? 543  DA  A "O4'" 1 
ATOM   2268 C  "C3'" . DA  C 3 10  ? -6.352  5.097  -11.665 1.00 89.52  ? 543  DA  A "C3'" 1 
ATOM   2269 O  "O3'" . DA  C 3 10  ? -5.350  4.051  -11.470 1.00 91.64  ? 543  DA  A "O3'" 1 
ATOM   2270 C  "C2'" . DA  C 3 10  ? -6.122  6.277  -10.719 1.00 89.08  ? 543  DA  A "C2'" 1 
ATOM   2271 C  "C1'" . DA  C 3 10  ? -5.683  7.416  -11.643 1.00 88.04  ? 543  DA  A "C1'" 1 
ATOM   2272 N  N9    . DA  C 3 10  ? -6.201  8.739  -11.227 1.00 87.50  ? 543  DA  A N9    1 
ATOM   2273 C  C8    . DA  C 3 10  ? -7.385  9.064  -10.618 1.00 86.93  ? 543  DA  A C8    1 
ATOM   2274 N  N7    . DA  C 3 10  ? -7.520  10.346 -10.377 1.00 87.47  ? 543  DA  A N7    1 
ATOM   2275 C  C5    . DA  C 3 10  ? -6.342  10.908 -10.845 1.00 87.48  ? 543  DA  A C5    1 
ATOM   2276 C  C6    . DA  C 3 10  ? -5.843  12.233 -10.895 1.00 87.11  ? 543  DA  A C6    1 
ATOM   2277 N  N6    . DA  C 3 10  ? -6.476  13.314 -10.455 1.00 86.50  ? 543  DA  A N6    1 
ATOM   2278 N  N1    . DA  C 3 10  ? -4.638  12.423 -11.442 1.00 87.10  ? 543  DA  A N1    1 
ATOM   2279 C  C2    . DA  C 3 10  ? -3.967  11.364 -11.896 1.00 87.38  ? 543  DA  A C2    1 
ATOM   2280 N  N3    . DA  C 3 10  ? -4.315  10.084 -11.909 1.00 86.94  ? 543  DA  A N3    1 
ATOM   2281 C  C4    . DA  C 3 10  ? -5.526  9.926  -11.366 1.00 87.11  ? 543  DA  A C4    1 
ATOM   2282 P  P     . DT  C 3 11  ? -3.775  3.988  -11.838 1.00 93.58  ? 544  DT  A P     1 
ATOM   2283 O  OP1   . DT  C 3 11  ? -3.654  3.865  -13.328 1.00 92.13  ? 544  DT  A OP1   1 
ATOM   2284 O  OP2   . DT  C 3 11  ? -3.253  2.985  -10.869 1.00 91.40  ? 544  DT  A OP2   1 
ATOM   2285 O  "O5'" . DT  C 3 11  ? -3.076  5.365  -11.373 1.00 93.33  ? 544  DT  A "O5'" 1 
ATOM   2286 C  "C5'" . DT  C 3 11  ? -1.958  5.928  -12.096 1.00 90.48  ? 544  DT  A "C5'" 1 
ATOM   2287 C  "C4'" . DT  C 3 11  ? -1.022  6.687  -11.175 1.00 88.23  ? 544  DT  A "C4'" 1 
ATOM   2288 O  "O4'" . DT  C 3 11  ? -1.671  7.870  -10.636 1.00 86.95  ? 544  DT  A "O4'" 1 
ATOM   2289 C  "C3'" . DT  C 3 11  ? -0.546  5.909  -9.960  1.00 87.25  ? 544  DT  A "C3'" 1 
ATOM   2290 O  "O3'" . DT  C 3 11  ? 0.862   6.080  -9.940  1.00 88.27  ? 544  DT  A "O3'" 1 
ATOM   2291 C  "C2'" . DT  C 3 11  ? -1.287  6.525  -8.760  1.00 86.22  ? 544  DT  A "C2'" 1 
ATOM   2292 C  "C1'" . DT  C 3 11  ? -1.417  7.970  -9.230  1.00 85.58  ? 544  DT  A "C1'" 1 
ATOM   2293 N  N1    . DT  C 3 11  ? -2.524  8.872  -8.693  1.00 85.35  ? 544  DT  A N1    1 
ATOM   2294 C  C2    . DT  C 3 11  ? -2.281  10.230 -8.573  1.00 84.17  ? 544  DT  A C2    1 
ATOM   2295 O  O2    . DT  C 3 11  ? -1.205  10.749 -8.820  1.00 83.78  ? 544  DT  A O2    1 
ATOM   2296 N  N3    . DT  C 3 11  ? -3.350  10.954 -8.131  1.00 82.54  ? 544  DT  A N3    1 
ATOM   2297 C  C4    . DT  C 3 11  ? -4.607  10.499 -7.819  1.00 83.78  ? 544  DT  A C4    1 
ATOM   2298 O  O4    . DT  C 3 11  ? -5.507  11.227 -7.431  1.00 83.38  ? 544  DT  A O4    1 
ATOM   2299 C  C5    . DT  C 3 11  ? -4.804  9.087  -7.978  1.00 84.51  ? 544  DT  A C5    1 
ATOM   2300 C  C7    . DT  C 3 11  ? -6.136  8.481  -7.659  1.00 84.65  ? 544  DT  A C7    1 
ATOM   2301 C  C6    . DT  C 3 11  ? -3.776  8.350  -8.410  1.00 85.04  ? 544  DT  A C6    1 
ATOM   2302 P  P     . DG  C 3 12  ? 1.821   5.399  -8.829  1.00 90.22  ? 545  DG  A P     1 
ATOM   2303 O  OP1   . DG  C 3 12  ? 2.904   4.847  -9.684  1.00 90.02  ? 545  DG  A OP1   1 
ATOM   2304 O  OP2   . DG  C 3 12  ? 1.044   4.623  -7.816  1.00 88.15  ? 545  DG  A OP2   1 
ATOM   2305 O  "O5'" . DG  C 3 12  ? 2.478   6.592  -7.954  1.00 88.33  ? 545  DG  A "O5'" 1 
ATOM   2306 C  "C5'" . DG  C 3 12  ? 3.088   7.774  -8.529  1.00 84.44  ? 545  DG  A "C5'" 1 
ATOM   2307 C  "C4'" . DG  C 3 12  ? 3.100   8.846  -7.462  1.00 81.62  ? 545  DG  A "C4'" 1 
ATOM   2308 O  "O4'" . DG  C 3 12  ? 1.732   9.308  -7.262  1.00 80.10  ? 545  DG  A "O4'" 1 
ATOM   2309 C  "C3'" . DG  C 3 12  ? 3.607   8.345  -6.089  1.00 79.67  ? 545  DG  A "C3'" 1 
ATOM   2310 O  "O3'" . DG  C 3 12  ? 4.419   9.299  -5.384  1.00 74.68  ? 545  DG  A "O3'" 1 
ATOM   2311 C  "C2'" . DG  C 3 12  ? 2.328   8.125  -5.310  1.00 79.89  ? 545  DG  A "C2'" 1 
ATOM   2312 C  "C1'" . DG  C 3 12  ? 1.580   9.327  -5.863  1.00 80.20  ? 545  DG  A "C1'" 1 
ATOM   2313 N  N9    . DG  C 3 12  ? 0.189   9.328  -5.515  1.00 80.77  ? 545  DG  A N9    1 
ATOM   2314 C  C8    . DG  C 3 12  ? -0.656  8.255  -5.322  1.00 80.77  ? 545  DG  A C8    1 
ATOM   2315 N  N7    . DG  C 3 12  ? -1.860  8.627  -4.997  1.00 81.35  ? 545  DG  A N7    1 
ATOM   2316 C  C5    . DG  C 3 12  ? -1.768  10.023 -4.972  1.00 81.32  ? 545  DG  A C5    1 
ATOM   2317 C  C6    . DG  C 3 12  ? -2.738  10.988 -4.682  1.00 80.14  ? 545  DG  A C6    1 
ATOM   2318 O  O6    . DG  C 3 12  ? -3.896  10.773 -4.378  1.00 79.78  ? 545  DG  A O6    1 
ATOM   2319 N  N1    . DG  C 3 12  ? -2.249  12.285 -4.775  1.00 80.14  ? 545  DG  A N1    1 
ATOM   2320 C  C2    . DG  C 3 12  ? -0.973  12.631 -5.103  1.00 80.13  ? 545  DG  A C2    1 
ATOM   2321 N  N2    . DG  C 3 12  ? -0.728  13.930 -5.129  1.00 79.77  ? 545  DG  A N2    1 
ATOM   2322 N  N3    . DG  C 3 12  ? -0.027  11.753 -5.380  1.00 80.40  ? 545  DG  A N3    1 
ATOM   2323 C  C4    . DG  C 3 12  ? -0.510  10.478 -5.292  1.00 81.38  ? 545  DG  A C4    1 
ATOM   2324 P  P     . DC  C 3 13  ? 5.979   9.488  -5.734  1.00 70.26  ? 546  DC  A P     1 
ATOM   2325 O  OP1   . DC  C 3 13  ? 6.249   9.016  -7.138  1.00 65.51  ? 546  DC  A OP1   1 
ATOM   2326 O  OP2   . DC  C 3 13  ? 6.531   9.072  -4.417  1.00 65.70  ? 546  DC  A OP2   1 
ATOM   2327 O  "O5'" . DC  C 3 13  ? 6.304   11.056 -5.902  1.00 67.68  ? 546  DC  A "O5'" 1 
ATOM   2328 C  "C5'" . DC  C 3 13  ? 5.665   11.908 -6.884  1.00 65.16  ? 546  DC  A "C5'" 1 
ATOM   2329 C  "C4'" . DC  C 3 13  ? 5.252   13.201 -6.176  1.00 64.01  ? 546  DC  A "C4'" 1 
ATOM   2330 O  "O4'" . DC  C 3 13  ? 4.067   13.037 -5.366  1.00 64.65  ? 546  DC  A "O4'" 1 
ATOM   2331 C  "C3'" . DC  C 3 13  ? 6.256   13.739 -5.162  1.00 63.99  ? 546  DC  A "C3'" 1 
ATOM   2332 O  "O3'" . DC  C 3 13  ? 6.378   15.086 -5.517  1.00 62.22  ? 546  DC  A "O3'" 1 
ATOM   2333 C  "C2'" . DC  C 3 13  ? 5.703   13.502 -3.741  1.00 63.65  ? 546  DC  A "C2'" 1 
ATOM   2334 C  "C1'" . DC  C 3 13  ? 4.222   13.553 -4.035  1.00 65.95  ? 546  DC  A "C1'" 1 
ATOM   2335 N  N1    . DC  C 3 13  ? 3.219   12.727 -3.273  1.00 67.88  ? 546  DC  A N1    1 
ATOM   2336 C  C2    . DC  C 3 13  ? 1.960   13.321 -2.951  1.00 68.36  ? 546  DC  A C2    1 
ATOM   2337 O  O2    . DC  C 3 13  ? 1.721   14.510 -3.203  1.00 66.64  ? 546  DC  A O2    1 
ATOM   2338 N  N3    . DC  C 3 13  ? 1.021   12.586 -2.320  1.00 67.83  ? 546  DC  A N3    1 
ATOM   2339 C  C4    . DC  C 3 13  ? 1.254   11.308 -2.029  1.00 68.14  ? 546  DC  A C4    1 
ATOM   2340 N  N4    . DC  C 3 13  ? 0.259   10.680 -1.402  1.00 67.31  ? 546  DC  A N4    1 
ATOM   2341 C  C5    . DC  C 3 13  ? 2.500   10.653 -2.361  1.00 68.11  ? 546  DC  A C5    1 
ATOM   2342 C  C6    . DC  C 3 13  ? 3.440   11.391 -2.993  1.00 67.66  ? 546  DC  A C6    1 
HETATM 2343 O  O2    . 3C4 D 4 .   ? 6.058   45.152 -7.362  1.00 27.22  ? 604  3C4 C O2    1 
HETATM 2344 C  C     . 3C4 D 4 .   ? 5.066   45.780 -7.756  1.00 23.29  ? 604  3C4 C C     1 
HETATM 2345 O  O1    . 3C4 D 4 .   ? 5.182   46.688 -8.631  1.00 27.76  ? 604  3C4 C O1    1 
HETATM 2346 C  CG    . 3C4 D 4 .   ? 3.741   45.526 -7.015  1.00 21.09  ? 604  3C4 C CG    1 
HETATM 2347 C  CA    . 3C4 D 4 .   ? 2.609   46.403 -7.322  1.00 22.78  ? 604  3C4 C CA    1 
HETATM 2348 C  CD2   . 3C4 D 4 .   ? 1.884   46.184 -8.498  1.00 23.68  ? 604  3C4 C CD2   1 
HETATM 2349 C  CE2   . 3C4 D 4 .   ? 0.908   46.890 -8.815  1.00 20.18  ? 604  3C4 C CE2   1 
HETATM 2350 C  CZ    . 3C4 D 4 .   ? 0.408   48.021 -7.988  1.00 18.05  ? 604  3C4 C CZ    1 
HETATM 2351 O  OH    . 3C4 D 4 .   ? -0.693  48.807 -8.272  1.00 23.12  ? 604  3C4 C OH    1 
HETATM 2352 CL CL    . 3C4 D 4 .   ? 0.677   49.382 -5.687  1.00 24.80  ? 604  3C4 C CL    1 
HETATM 2353 C  CE1   . 3C4 D 4 .   ? 1.175   48.133 -6.731  1.00 20.48  ? 604  3C4 C CE1   1 
HETATM 2354 C  CD1   . 3C4 D 4 .   ? 2.190   47.376 -6.474  1.00 23.74  ? 604  3C4 C CD1   1 
HETATM 2355 O  O     . HOH E 5 .   ? -6.857  50.424 -8.315  1.00 22.67  ? 1001 HOH C O     1 
HETATM 2356 O  O     . HOH E 5 .   ? 7.661   55.153 -15.717 1.00 29.70  ? 1002 HOH C O     1 
HETATM 2357 O  O     . HOH E 5 .   ? -7.303  47.013 -9.707  1.00 29.37  ? 1003 HOH C O     1 
HETATM 2358 O  O     . HOH E 5 .   ? -7.514  38.523 0.829   1.00 30.61  ? 1004 HOH C O     1 
HETATM 2359 O  O     . HOH E 5 .   ? 9.730   39.107 -9.902  1.00 29.22  ? 1005 HOH C O     1 
HETATM 2360 O  O     . HOH E 5 .   ? 7.981   50.303 -10.074 1.00 25.69  ? 1006 HOH C O     1 
HETATM 2361 O  O     . HOH E 5 .   ? 8.259   59.842 -11.077 1.00 25.58  ? 1007 HOH C O     1 
HETATM 2362 O  O     . HOH E 5 .   ? -1.832  52.159 -5.323  1.00 21.36  ? 1008 HOH C O     1 
HETATM 2363 O  O     . HOH E 5 .   ? -3.613  37.679 -6.578  1.00 34.56  ? 1009 HOH C O     1 
HETATM 2364 O  O     . HOH E 5 .   ? -11.799 47.400 -3.564  1.00 30.11  ? 1010 HOH C O     1 
HETATM 2365 O  O     . HOH E 5 .   ? 9.316   65.819 -7.845  1.00 38.95  ? 1011 HOH C O     1 
HETATM 2366 O  O     . HOH E 5 .   ? -1.652  32.873 -11.883 1.00 33.88  ? 1012 HOH C O     1 
HETATM 2367 O  O     . HOH E 5 .   ? 8.595   45.470 -14.814 1.00 30.61  ? 1013 HOH C O     1 
HETATM 2368 O  O     . HOH E 5 .   ? -36.755 37.681 -3.419  1.00 34.81  ? 1014 HOH C O     1 
HETATM 2369 O  O     . HOH E 5 .   ? -36.677 29.438 -0.683  1.00 40.18  ? 1015 HOH C O     1 
HETATM 2370 O  O     . HOH E 5 .   ? -5.238  48.381 -8.970  1.00 33.84  ? 1016 HOH C O     1 
HETATM 2371 O  O     . HOH E 5 .   ? -5.177  36.506 -4.978  1.00 31.23  ? 1017 HOH C O     1 
HETATM 2372 O  O     . HOH E 5 .   ? -10.632 60.386 -22.032 1.00 34.96  ? 1018 HOH C O     1 
HETATM 2373 O  O     . HOH E 5 .   ? -2.391  34.228 -15.349 1.00 42.02  ? 1019 HOH C O     1 
HETATM 2374 O  O     . HOH E 5 .   ? 0.691   34.212 7.911   1.00 37.82  ? 1020 HOH C O     1 
HETATM 2375 O  O     . HOH E 5 .   ? 1.445   68.512 -14.178 1.00 40.23  ? 1021 HOH C O     1 
HETATM 2376 O  O     . HOH E 5 .   ? 9.240   58.234 -9.012  1.00 31.79  ? 1022 HOH C O     1 
HETATM 2377 O  O     . HOH E 5 .   ? -11.468 49.576 -11.487 1.00 34.14  ? 1023 HOH C O     1 
HETATM 2378 O  O     . HOH E 5 .   ? 8.355   46.368 -12.282 1.00 39.90  ? 1024 HOH C O     1 
HETATM 2379 O  O     . HOH E 5 .   ? -0.515  49.748 -28.146 1.00 38.77  ? 1025 HOH C O     1 
HETATM 2380 O  O     . HOH E 5 .   ? -10.643 32.222 -0.237  1.00 37.67  ? 1026 HOH C O     1 
HETATM 2381 O  O     . HOH E 5 .   ? -5.357  65.259 -20.446 1.00 43.70  ? 1027 HOH C O     1 
HETATM 2382 O  O     . HOH E 5 .   ? 8.825   63.344 -11.448 1.00 31.71  ? 1028 HOH C O     1 
HETATM 2383 O  O     . HOH E 5 .   ? -0.402  40.318 -18.204 1.00 41.41  ? 1029 HOH C O     1 
HETATM 2384 O  O     . HOH E 5 .   ? -11.586 38.978 -15.344 1.00 51.91  ? 1030 HOH C O     1 
HETATM 2385 O  O     . HOH E 5 .   ? -11.926 49.462 -24.090 1.00 49.61  ? 1031 HOH C O     1 
HETATM 2386 O  O     . HOH E 5 .   ? -11.270 44.902 -14.283 1.00 46.81  ? 1035 HOH C O     1 
HETATM 2387 O  O     . HOH E 5 .   ? -12.645 35.395 -15.005 1.00 53.08  ? 1036 HOH C O     1 
HETATM 2388 O  O     . HOH E 5 .   ? -15.191 54.153 -10.411 1.00 39.57  ? 1037 HOH C O     1 
HETATM 2389 O  O     . HOH E 5 .   ? 11.768  37.996 -13.378 1.00 46.84  ? 1038 HOH C O     1 
HETATM 2390 O  O     . HOH E 5 .   ? -6.250  28.355 -12.815 1.00 45.38  ? 1039 HOH C O     1 
HETATM 2391 O  O     . HOH E 5 .   ? -14.076 42.630 -4.287  1.00 38.25  ? 1040 HOH C O     1 
HETATM 2392 O  O     . HOH E 5 .   ? -2.545  25.633 2.224   1.00 61.15  ? 1041 HOH C O     1 
HETATM 2393 O  O     . HOH E 5 .   ? -8.572  23.914 5.798   1.00 40.65  ? 1042 HOH C O     1 
HETATM 2394 O  O     . HOH E 5 .   ? -12.880 19.645 10.237  1.00 57.76  ? 1043 HOH C O     1 
HETATM 2395 O  O     . HOH E 5 .   ? -14.348 48.150 -7.177  1.00 40.24  ? 1044 HOH C O     1 
HETATM 2396 O  O     . HOH E 5 .   ? -0.949  70.176 1.247   1.00 41.16  ? 1045 HOH C O     1 
HETATM 2397 O  O     . HOH E 5 .   ? 3.037   65.223 -16.717 1.00 42.37  ? 1048 HOH C O     1 
HETATM 2398 O  O     . HOH E 5 .   ? -8.561  44.989 0.875   1.00 37.40  ? 1049 HOH C O     1 
HETATM 2399 O  O     . HOH E 5 .   ? -9.207  33.413 -2.303  1.00 39.46  ? 1051 HOH C O     1 
HETATM 2400 O  O     . HOH E 5 .   ? -7.541  57.024 -29.476 1.00 31.27  ? 1052 HOH C O     1 
HETATM 2401 O  O     . HOH E 5 .   ? -30.529 40.567 -0.917  1.00 43.89  ? 1054 HOH C O     1 
HETATM 2402 O  O     . HOH E 5 .   ? 5.387   50.857 -20.893 1.00 50.05  ? 1055 HOH C O     1 
HETATM 2403 O  O     . HOH E 5 .   ? -17.741 41.834 -3.367  1.00 57.18  ? 1056 HOH C O     1 
HETATM 2404 O  O     . HOH E 5 .   ? -23.361 40.379 -7.202  1.00 42.36  ? 1057 HOH C O     1 
HETATM 2405 O  O     . HOH E 5 .   ? -15.931 20.716 3.460   1.00 54.24  ? 1058 HOH C O     1 
HETATM 2406 O  O     . HOH E 5 .   ? -17.726 39.246 2.828   1.00 57.49  ? 1059 HOH C O     1 
HETATM 2407 O  O     . HOH E 5 .   ? -3.885  32.912 -3.531  1.00 45.14  ? 1060 HOH C O     1 
HETATM 2408 O  O     . HOH E 5 .   ? -34.255 27.170 -6.878  1.00 49.64  ? 1061 HOH C O     1 
HETATM 2409 O  O     . HOH E 5 .   ? -10.400 35.493 3.494   1.00 57.30  ? 1062 HOH C O     1 
HETATM 2410 O  O     . HOH E 5 .   ? -15.155 17.652 -4.605  1.00 55.95  ? 1063 HOH C O     1 
HETATM 2411 O  O     . HOH E 5 .   ? -10.278 61.819 -17.754 1.00 45.39  ? 1064 HOH C O     1 
HETATM 2412 O  O     . HOH E 5 .   ? 10.464  62.901 -2.343  1.00 42.68  ? 1065 HOH C O     1 
HETATM 2413 O  O     . HOH E 5 .   ? -11.880 34.493 0.281   1.00 54.45  ? 1066 HOH C O     1 
HETATM 2414 O  O     . HOH E 5 .   ? -10.081 61.898 0.407   1.00 40.02  ? 1067 HOH C O     1 
HETATM 2415 O  O     . HOH E 5 .   ? -9.313  36.066 -3.156  1.00 40.91  ? 1068 HOH C O     1 
HETATM 2416 O  O     . HOH E 5 .   ? -23.622 14.668 -4.386  1.00 85.56  ? 1069 HOH C O     1 
HETATM 2417 O  O     . HOH E 5 .   ? -13.042 18.075 6.926   1.00 54.26  ? 1070 HOH C O     1 
HETATM 2418 O  O     . HOH E 5 .   ? -12.150 41.014 -14.509 1.00 53.07  ? 1071 HOH C O     1 
HETATM 2419 O  O     . HOH E 5 .   ? 5.177   50.278 -23.631 1.00 63.17  ? 1073 HOH C O     1 
HETATM 2420 O  O     . HOH E 5 .   ? 11.395  44.911 -13.996 1.00 55.42  ? 1074 HOH C O     1 
HETATM 2421 O  O     . HOH E 5 .   ? -12.360 32.008 9.858   1.00 44.22  ? 1075 HOH C O     1 
HETATM 2422 O  O     . HOH E 5 .   ? -3.780  25.211 -12.758 1.00 44.88  ? 1076 HOH C O     1 
HETATM 2423 O  O     . HOH E 5 .   ? 12.512  46.002 -20.677 1.00 51.42  ? 1077 HOH C O     1 
HETATM 2424 O  O     . HOH E 5 .   ? -0.320  37.424 -19.348 1.00 51.65  ? 1078 HOH C O     1 
HETATM 2425 O  O     . HOH E 5 .   ? -9.581  40.154 1.219   1.00 61.90  ? 1079 HOH C O     1 
HETATM 2426 O  O     . HOH E 5 .   ? -10.881 36.980 -0.654  1.00 47.90  ? 1080 HOH C O     1 
HETATM 2427 O  O     . HOH E 5 .   ? -4.240  27.966 -10.597 1.00 47.68  ? 1081 HOH C O     1 
HETATM 2428 O  O     . HOH E 5 .   ? -23.239 24.834 -14.980 1.00 72.12  ? 1082 HOH C O     1 
HETATM 2429 O  O     . HOH E 5 .   ? 10.597  52.678 -18.473 1.00 63.64  ? 1083 HOH C O     1 
HETATM 2430 O  O     . HOH E 5 .   ? -7.225  47.249 -29.934 1.00 47.70  ? 1084 HOH C O     1 
HETATM 2431 O  O     . HOH E 5 .   ? 6.685   53.729 -20.468 1.00 49.82  ? 1085 HOH C O     1 
HETATM 2432 O  O     . HOH E 5 .   ? 9.491   47.158 -10.104 1.00 52.47  ? 1086 HOH C O     1 
HETATM 2433 O  O     . HOH E 5 .   ? -8.983  61.291 -20.273 1.00 51.29  ? 1087 HOH C O     1 
HETATM 2434 O  O     . HOH E 5 .   ? -1.478  72.204 -8.976  1.00 57.47  ? 1088 HOH C O     1 
HETATM 2435 O  O     . HOH E 5 .   ? -30.153 39.585 -8.514  1.00 69.59  ? 1089 HOH C O     1 
HETATM 2436 O  O     . HOH E 5 .   ? -20.984 24.801 -9.776  1.00 49.91  ? 1091 HOH C O     1 
HETATM 2437 O  O     . HOH E 5 .   ? -29.488 18.261 -3.459  1.00 72.20  ? 1092 HOH C O     1 
HETATM 2438 O  O     . HOH E 5 .   ? -35.096 32.229 -7.886  1.00 45.87  ? 1093 HOH C O     1 
HETATM 2439 O  O     . HOH E 5 .   ? -13.498 51.141 -19.006 1.00 40.70  ? 1094 HOH C O     1 
HETATM 2440 O  O     . HOH E 5 .   ? 13.306  50.122 -18.152 1.00 45.87  ? 1095 HOH C O     1 
HETATM 2441 O  O     . HOH E 5 .   ? -27.018 22.670 -9.225  1.00 69.82  ? 1096 HOH C O     1 
HETATM 2442 O  O     . HOH E 5 .   ? -24.605 29.570 -18.280 1.00 60.10  ? 1097 HOH C O     1 
HETATM 2443 O  O     . HOH E 5 .   ? -20.518 15.246 -3.357  1.00 57.95  ? 1098 HOH C O     1 
HETATM 2444 O  O     . HOH E 5 .   ? -11.804 25.404 7.574   1.00 56.10  ? 1099 HOH C O     1 
HETATM 2445 O  O     . HOH E 5 .   ? -29.392 29.990 0.113   1.00 58.18  ? 1100 HOH C O     1 
HETATM 2446 O  O     . HOH E 5 .   ? 3.593   29.656 -14.178 1.00 68.53  ? 1101 HOH C O     1 
HETATM 2447 O  O     . HOH E 5 .   ? -7.201  17.897 -8.176  1.00 57.76  ? 1103 HOH C O     1 
HETATM 2448 O  O     . HOH E 5 .   ? -16.919 59.705 -14.236 1.00 47.33  ? 1104 HOH C O     1 
HETATM 2449 O  O     . HOH E 5 .   ? 9.323   49.046 -12.068 1.00 41.72  ? 1105 HOH C O     1 
HETATM 2450 O  O     . HOH E 5 .   ? 3.215   48.654 -25.666 1.00 46.30  ? 1106 HOH C O     1 
HETATM 2451 O  O     . HOH E 5 .   ? 1.550   51.178 -27.330 1.00 54.01  ? 1108 HOH C O     1 
HETATM 2452 O  O     . HOH E 5 .   ? -12.872 42.132 -20.861 1.00 86.57  ? 1109 HOH C O     1 
HETATM 2453 O  O     . HOH E 5 .   ? -12.496 45.008 -5.336  1.00 60.32  ? 1111 HOH C O     1 
HETATM 2454 O  O     . HOH E 5 .   ? -37.580 27.683 -6.208  1.00 37.38  ? 1112 HOH C O     1 
HETATM 2455 O  O     . HOH E 5 .   ? 3.307   62.348 -15.731 1.00 30.94  ? 1113 HOH C O     1 
HETATM 2456 O  O     . HOH E 5 .   ? -2.238  32.399 -9.153  1.00 33.41  ? 1114 HOH C O     1 
HETATM 2457 O  O     . HOH E 5 .   ? -11.301 24.140 -14.826 1.00 43.31  ? 1115 HOH C O     1 
HETATM 2458 O  O     . HOH E 5 .   ? 4.698   55.614 -21.116 1.00 46.75  ? 1116 HOH C O     1 
HETATM 2459 O  O     . HOH E 5 .   ? 0.221   70.708 -15.127 1.00 44.39  ? 1117 HOH C O     1 
HETATM 2460 O  O     . HOH E 5 .   ? -6.609  71.492 -1.516  1.00 39.46  ? 1118 HOH C O     1 
HETATM 2461 O  O     . HOH E 5 .   ? -9.970  45.892 -29.957 1.00 65.13  ? 1119 HOH C O     1 
HETATM 2462 O  O     . HOH E 5 .   ? 5.037   60.411 -16.380 1.00 43.73  ? 1120 HOH C O     1 
HETATM 2463 O  O     . HOH E 5 .   ? -12.012 66.144 -3.218  1.00 60.57  ? 1121 HOH C O     1 
HETATM 2464 O  O     . HOH E 5 .   ? 1.349   27.934 7.644   1.00 63.91  ? 1123 HOH C O     1 
HETATM 2465 O  O     . HOH E 5 .   ? -0.428  33.632 -15.927 1.00 44.80  ? 1124 HOH C O     1 
HETATM 2466 O  O     . HOH E 5 .   ? -4.437  19.928 6.595   1.00 58.58  ? 1125 HOH C O     1 
HETATM 2467 O  O     . HOH E 5 .   ? -35.193 43.076 -8.979  1.00 49.84  ? 1126 HOH C O     1 
HETATM 2468 O  O     . HOH E 5 .   ? -9.111  42.629 2.446   1.00 47.06  ? 1127 HOH C O     1 
HETATM 2469 O  O     . HOH E 5 .   ? -15.145 62.347 -15.943 1.00 48.60  ? 1128 HOH C O     1 
HETATM 2470 O  O     . HOH E 5 .   ? -12.960 47.186 -17.461 1.00 40.60  ? 1129 HOH C O     1 
HETATM 2471 O  O     . HOH E 5 .   ? -3.005  25.227 5.044   1.00 55.59  ? 1130 HOH C O     1 
HETATM 2472 O  O     . HOH E 5 .   ? -16.222 56.930 -14.158 1.00 37.12  ? 1131 HOH C O     1 
HETATM 2473 O  O     . HOH E 5 .   ? -13.022 60.825 -4.128  1.00 66.19  ? 1132 HOH C O     1 
HETATM 2474 O  O     . HOH E 5 .   ? -19.626 33.627 -13.329 1.00 47.09  ? 1133 HOH C O     1 
HETATM 2475 O  O     . HOH E 5 .   ? 3.412   45.090 -26.501 1.00 36.73  ? 1134 HOH C O     1 
HETATM 2476 O  O     . HOH E 5 .   ? -1.237  30.439 -13.059 1.00 51.81  ? 1136 HOH C O     1 
HETATM 2477 O  O     . HOH E 5 .   ? -19.132 15.510 -1.587  1.00 63.86  ? 1137 HOH C O     1 
HETATM 2478 O  O     . HOH E 5 .   ? 2.404   73.669 -8.848  1.00 47.75  ? 1138 HOH C O     1 
HETATM 2479 O  O     . HOH E 5 .   ? -10.444 50.288 -31.502 1.00 55.69  ? 1139 HOH C O     1 
HETATM 2480 O  O     . HOH E 5 .   ? 8.395   53.757 -18.403 1.00 53.67  ? 1140 HOH C O     1 
HETATM 2481 O  O     . HOH E 5 .   ? -16.454 16.052 -7.790  1.00 54.82  ? 1141 HOH C O     1 
HETATM 2482 O  O     . HOH E 5 .   ? -31.765 38.718 3.031   1.00 61.63  ? 1142 HOH C O     1 
HETATM 2483 O  O     . HOH E 5 .   ? 1.225   28.333 3.826   1.00 54.80  ? 1143 HOH C O     1 
HETATM 2484 O  O     . HOH E 5 .   ? -32.535 33.316 -0.415  1.00 53.32  ? 1144 HOH C O     1 
HETATM 2485 O  O     . HOH E 5 .   ? -8.637  62.521 -26.615 1.00 61.18  ? 1145 HOH C O     1 
HETATM 2486 O  O     . HOH E 5 .   ? 2.770   57.622 -21.189 1.00 61.97  ? 1146 HOH C O     1 
HETATM 2487 O  O     . HOH E 5 .   ? 0.914   68.162 -18.201 1.00 57.00  ? 1148 HOH C O     1 
HETATM 2488 O  O     . HOH E 5 .   ? -0.527  26.268 -7.929  1.00 73.58  ? 1150 HOH C O     1 
HETATM 2489 O  O     . HOH E 5 .   ? -2.107  29.517 -9.382  1.00 50.61  ? 1151 HOH C O     1 
HETATM 2490 O  O     . HOH E 5 .   ? -18.752 34.841 -10.581 1.00 81.81  ? 1152 HOH C O     1 
HETATM 2491 O  O     . HOH F 5 .   ? -12.078 38.708 -33.497 1.00 74.75  ? 1032 HOH B O     1 
HETATM 2492 O  O     . HOH F 5 .   ? 0.213   18.319 -15.541 1.00 70.94  ? 1072 HOH B O     1 
HETATM 2493 O  O     . HOH F 5 .   ? -11.173 14.425 -28.412 1.00 79.95  ? 1090 HOH B O     1 
HETATM 2494 O  O     . HOH F 5 .   ? 1.162   12.604 -11.540 1.00 62.07  ? 1107 HOH B O     1 
HETATM 2495 O  O     . HOH F 5 .   ? -9.063  14.179 1.826   1.00 61.69  ? 1147 HOH B O     1 
HETATM 2496 O  O     . HOH F 5 .   ? -1.279  24.535 -8.846  1.00 52.62  ? 1149 HOH B O     1 
HETATM 2497 O  O     . HOH G 5 .   ? -10.055 25.815 -16.695 1.00 48.38  ? 1033 HOH A O     1 
HETATM 2498 O  O     . HOH G 5 .   ? 1.470   10.482 -9.425  1.00 60.10  ? 1034 HOH A O     1 
HETATM 2499 O  O     . HOH G 5 .   ? -17.077 21.534 -12.880 1.00 54.35  ? 1046 HOH A O     1 
HETATM 2500 O  O     . HOH G 5 .   ? -16.382 28.521 -15.783 1.00 37.99  ? 1047 HOH A O     1 
HETATM 2501 O  O     . HOH G 5 .   ? 2.290   17.217 -3.644  1.00 64.09  ? 1050 HOH A O     1 
HETATM 2502 O  O     . HOH G 5 .   ? -8.447  6.467  -8.457  1.00 60.72  ? 1053 HOH A O     1 
HETATM 2503 O  O     . HOH G 5 .   ? -9.841  22.227 -38.588 1.00 89.58  ? 1102 HOH A O     1 
HETATM 2504 O  O     . HOH G 5 .   ? -4.387  26.491 -24.558 1.00 68.48  ? 1110 HOH A O     1 
HETATM 2505 O  O     . HOH G 5 .   ? -7.385  24.068 -19.658 1.00 55.34  ? 1122 HOH A O     1 
HETATM 2506 O  O     . HOH G 5 .   ? -6.903  28.209 -20.478 1.00 50.24  ? 1135 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   C . n 
A 1 2   SER 2   2   ?   ?   ?   C . n 
A 1 3   VAL 3   3   ?   ?   ?   C . n 
A 1 4   GLU 4   4   ?   ?   ?   C . n 
A 1 5   GLY 5   5   ?   ?   ?   C . n 
A 1 6   LEU 6   6   ?   ?   ?   C . n 
A 1 7   GLY 7   7   ?   ?   ?   C . n 
A 1 8   LYS 8   8   ?   ?   ?   C . n 
A 1 9   ASP 9   9   9   ASP ASP C . n 
A 1 10  PHE 10  10  10  PHE PHE C . n 
A 1 11  CYS 11  11  11  CYS CYS C . n 
A 1 12  GLY 12  12  12  GLY GLY C . n 
A 1 13  ALA 13  13  13  ALA ALA C . n 
A 1 14  ILE 14  14  14  ILE ILE C . n 
A 1 15  ILE 15  15  15  ILE ILE C . n 
A 1 16  PRO 16  16  16  PRO PRO C . n 
A 1 17  ASP 17  17  17  ASP ASP C . n 
A 1 18  ASN 18  18  18  ASN ASN C . n 
A 1 19  PHE 19  19  19  PHE PHE C . n 
A 1 20  PHE 20  20  20  PHE PHE C . n 
A 1 21  PRO 21  21  21  PRO PRO C . n 
A 1 22  ILE 22  22  22  ILE ILE C . n 
A 1 23  GLU 23  23  23  GLU GLU C . n 
A 1 24  LYS 24  24  24  LYS LYS C . n 
A 1 25  LEU 25  25  25  LEU LEU C . n 
A 1 26  ARG 26  26  26  ARG ARG C . n 
A 1 27  ASN 27  27  27  ASN ASN C . n 
A 1 28  TYR 28  28  28  TYR TYR C . n 
A 1 29  THR 29  29  29  THR THR C . n 
A 1 30  GLN 30  30  30  GLN GLN C . n 
A 1 31  MET 31  31  31  MET MET C . n 
A 1 32  GLY 32  32  32  GLY GLY C . n 
A 1 33  LEU 33  33  33  LEU LEU C . n 
A 1 34  ILE 34  34  34  ILE ILE C . n 
A 1 35  ARG 35  35  35  ARG ARG C . n 
A 1 36  ASP 36  36  36  ASP ASP C . n 
A 1 37  PHE 37  37  37  PHE PHE C . n 
A 1 38  ALA 38  38  38  ALA ALA C . n 
A 1 39  LYS 39  39  39  LYS LYS C . n 
A 1 40  GLY 40  40  40  GLY GLY C . n 
A 1 41  SER 41  41  41  SER SER C . n 
A 1 42  ALA 42  42  42  ALA ALA C . n 
A 1 43  VAL 43  43  43  VAL VAL C . n 
A 1 44  ILE 44  44  44  ILE ILE C . n 
A 1 45  MET 45  45  45  MET MET C . n 
A 1 46  PRO 46  46  46  PRO PRO C . n 
A 1 47  GLY 47  47  47  GLY GLY C . n 
A 1 48  GLU 48  48  48  GLU GLU C . n 
A 1 49  GLU 49  49  49  GLU GLU C . n 
A 1 50  ILE 50  50  50  ILE ILE C . n 
A 1 51  THR 51  51  51  THR THR C . n 
A 1 52  SER 52  52  52  SER SER C . n 
A 1 53  MET 53  53  53  MET MET C . n 
A 1 54  ILE 54  54  54  ILE ILE C . n 
A 1 55  PHE 55  55  55  PHE PHE C . n 
A 1 56  LEU 56  56  56  LEU LEU C . n 
A 1 57  VAL 57  57  57  VAL VAL C . n 
A 1 58  GLU 58  58  58  GLU GLU C . n 
A 1 59  GLY 59  59  59  GLY GLY C . n 
A 1 60  LYS 60  60  60  LYS LYS C . n 
A 1 61  ILE 61  61  61  ILE ILE C . n 
A 1 62  LYS 62  62  62  LYS LYS C . n 
A 1 63  LEU 63  63  63  LEU LEU C . n 
A 1 64  ASP 64  64  64  ASP ASP C . n 
A 1 65  ILE 65  65  65  ILE ILE C . n 
A 1 66  ILE 66  66  66  ILE ILE C . n 
A 1 67  PHE 67  67  67  PHE PHE C . n 
A 1 68  GLU 68  68  68  GLU GLU C . n 
A 1 69  ASP 69  69  69  ASP ASP C . n 
A 1 70  GLY 70  70  70  GLY GLY C . n 
A 1 71  SER 71  71  71  SER SER C . n 
A 1 72  GLU 72  72  72  GLU GLU C . n 
A 1 73  LYS 73  73  73  LYS LYS C . n 
A 1 74  LEU 74  74  74  LEU LEU C . n 
A 1 75  LEU 75  75  75  LEU LEU C . n 
A 1 76  TYR 76  76  76  TYR TYR C . n 
A 1 77  TYR 77  77  77  TYR TYR C . n 
A 1 78  ALA 78  78  78  ALA ALA C . n 
A 1 79  GLY 79  79  79  GLY GLY C . n 
A 1 80  GLY 80  80  80  GLY GLY C . n 
A 1 81  ASN 81  81  81  ASN ASN C . n 
A 1 82  SER 82  82  82  SER SER C . n 
A 1 83  LEU 83  83  83  LEU LEU C . n 
A 1 84  ILE 84  84  84  ILE ILE C . n 
A 1 85  GLY 85  85  85  GLY GLY C . n 
A 1 86  LYS 86  86  86  LYS LYS C . n 
A 1 87  LEU 87  87  87  LEU LEU C . n 
A 1 88  TYR 88  88  88  TYR TYR C . n 
A 1 89  PRO 89  89  89  PRO PRO C . n 
A 1 90  THR 90  90  90  THR THR C . n 
A 1 91  GLY 91  91  91  GLY GLY C . n 
A 1 92  ASN 92  92  92  ASN ASN C . n 
A 1 93  ASN 93  93  93  ASN ASN C . n 
A 1 94  ILE 94  94  94  ILE ILE C . n 
A 1 95  TYR 95  95  95  TYR TYR C . n 
A 1 96  ALA 96  96  96  ALA ALA C . n 
A 1 97  THR 97  97  97  THR THR C . n 
A 1 98  ALA 98  98  98  ALA ALA C . n 
A 1 99  MET 99  99  99  MET MET C . n 
A 1 100 GLU 100 100 100 GLU GLU C . n 
A 1 101 PRO 101 101 101 PRO PRO C . n 
A 1 102 THR 102 102 102 THR THR C . n 
A 1 103 ARG 103 103 103 ARG ARG C . n 
A 1 104 THR 104 104 104 THR THR C . n 
A 1 105 CYS 105 105 105 CYS CYS C . n 
A 1 106 TRP 106 106 106 TRP TRP C . n 
A 1 107 PHE 107 107 107 PHE PHE C . n 
A 1 108 SER 108 108 108 SER SER C . n 
A 1 109 GLU 109 109 109 GLU GLU C . n 
A 1 110 LYS 110 110 110 LYS LYS C . n 
A 1 111 SER 111 111 111 SER SER C . n 
A 1 112 LEU 112 112 112 LEU LEU C . n 
A 1 113 ARG 113 113 113 ARG ARG C . n 
A 1 114 THR 114 114 114 THR THR C . n 
A 1 115 VAL 115 115 115 VAL VAL C . n 
A 1 116 PHE 116 116 116 PHE PHE C . n 
A 1 117 ARG 117 117 117 ARG ARG C . n 
A 1 118 THR 118 118 118 THR THR C . n 
A 1 119 ASP 119 119 119 ASP ASP C . n 
A 1 120 GLU 120 120 120 GLU GLU C . n 
A 1 121 ASP 121 121 121 ASP ASP C . n 
A 1 122 MET 122 122 122 MET MET C . n 
A 1 123 ILE 123 123 123 ILE ILE C . n 
A 1 124 PHE 124 124 124 PHE PHE C . n 
A 1 125 GLU 125 125 125 GLU GLU C . n 
A 1 126 ILE 126 126 126 ILE ILE C . n 
A 1 127 PHE 127 127 127 PHE PHE C . n 
A 1 128 LYS 128 128 128 LYS LYS C . n 
A 1 129 ASN 129 129 129 ASN ASN C . n 
A 1 130 TYR 130 130 130 TYR TYR C . n 
A 1 131 LEU 131 131 131 LEU LEU C . n 
A 1 132 THR 132 132 132 THR THR C . n 
A 1 133 LYS 133 133 133 LYS LYS C . n 
A 1 134 VAL 134 134 134 VAL VAL C . n 
A 1 135 ALA 135 135 135 ALA ALA C . n 
A 1 136 TYR 136 136 136 TYR TYR C . n 
A 1 137 TYR 137 137 137 TYR TYR C . n 
A 1 138 ALA 138 138 138 ALA ALA C . n 
A 1 139 ARG 139 139 139 ARG ARG C . n 
A 1 140 GLN 140 140 140 GLN GLN C . n 
A 1 141 VAL 141 141 141 VAL VAL C . n 
A 1 142 ALA 142 142 142 ALA ALA C . n 
A 1 143 GLU 143 143 143 GLU GLU C . n 
A 1 144 MET 144 144 144 MET MET C . n 
A 1 145 ASN 145 145 145 ASN ASN C . n 
A 1 146 THR 146 146 146 THR THR C . n 
A 1 147 TYR 147 147 147 TYR TYR C . n 
A 1 148 ASN 148 148 148 ASN ASN C . n 
A 1 149 PRO 149 149 149 PRO PRO C . n 
A 1 150 THR 150 150 150 THR THR C . n 
A 1 151 ILE 151 151 151 ILE ILE C . n 
A 1 152 ARG 152 152 152 ARG ARG C . n 
A 1 153 ILE 153 153 153 ILE ILE C . n 
A 1 154 LEU 154 154 154 LEU LEU C . n 
A 1 155 ARG 155 155 155 ARG ARG C . n 
A 1 156 LEU 156 156 156 LEU LEU C . n 
A 1 157 PHE 157 157 157 PHE PHE C . n 
A 1 158 TYR 158 158 158 TYR TYR C . n 
A 1 159 GLU 159 159 159 GLU GLU C . n 
A 1 160 LEU 160 160 160 LEU LEU C . n 
A 1 161 CYS 161 161 161 CYS CYS C . n 
A 1 162 SER 162 162 162 SER SER C . n 
A 1 163 SER 163 163 163 SER SER C . n 
A 1 164 GLN 164 164 164 GLN GLN C . n 
A 1 165 GLY 165 165 165 GLY GLY C . n 
A 1 166 LYS 166 166 166 LYS LYS C . n 
A 1 167 ARG 167 167 167 ARG ARG C . n 
A 1 168 VAL 168 168 168 VAL VAL C . n 
A 1 169 GLY 169 169 169 GLY GLY C . n 
A 1 170 ASP 170 170 170 ASP ASP C . n 
A 1 171 THR 171 171 171 THR THR C . n 
A 1 172 TYR 172 172 172 TYR TYR C . n 
A 1 173 GLU 173 173 173 GLU GLU C . n 
A 1 174 ILE 174 174 174 ILE ILE C . n 
A 1 175 THR 175 175 175 THR THR C . n 
A 1 176 MET 176 176 176 MET MET C . n 
A 1 177 PRO 177 177 177 PRO PRO C . n 
A 1 178 LEU 178 178 178 LEU LEU C . n 
A 1 179 SER 179 179 179 SER SER C . n 
A 1 180 GLN 180 180 180 GLN GLN C . n 
A 1 181 LYS 181 181 181 LYS LYS C . n 
A 1 182 SER 182 182 182 SER SER C . n 
A 1 183 ILE 183 183 183 ILE ILE C . n 
A 1 184 GLY 184 184 184 GLY GLY C . n 
A 1 185 GLU 185 185 185 GLU GLU C . n 
A 1 186 ILE 186 186 186 ILE ILE C . n 
A 1 187 THR 187 187 187 THR THR C . n 
A 1 188 GLY 188 188 188 GLY GLY C . n 
A 1 189 VAL 189 189 189 VAL VAL C . n 
A 1 190 HIS 190 190 190 HIS HIS C . n 
A 1 191 HIS 191 191 191 HIS HIS C . n 
A 1 192 VAL 192 192 192 VAL VAL C . n 
A 1 193 THR 193 193 193 THR THR C . n 
A 1 194 VAL 194 194 194 VAL VAL C . n 
A 1 195 SER 195 195 195 SER SER C . n 
A 1 196 ARG 196 196 196 ARG ARG C . n 
A 1 197 VAL 197 197 197 VAL VAL C . n 
A 1 198 LEU 198 198 198 LEU LEU C . n 
A 1 199 ALA 199 199 199 ALA ALA C . n 
A 1 200 SER 200 200 200 SER SER C . n 
A 1 201 LEU 201 201 201 LEU LEU C . n 
A 1 202 LYS 202 202 202 LYS LYS C . n 
A 1 203 ARG 203 203 203 ARG ARG C . n 
A 1 204 GLU 204 204 204 GLU GLU C . n 
A 1 205 ASN 205 205 205 ASN ASN C . n 
A 1 206 ILE 206 206 206 ILE ILE C . n 
A 1 207 LEU 207 207 207 LEU LEU C . n 
A 1 208 ASP 208 208 208 ASP ASP C . n 
A 1 209 LYS 209 209 209 LYS LYS C . n 
A 1 210 LYS 210 210 210 LYS LYS C . n 
A 1 211 LYS 211 211 211 LYS LYS C . n 
A 1 212 ASN 212 212 212 ASN ASN C . n 
A 1 213 LYS 213 213 213 LYS LYS C . n 
A 1 214 ILE 214 214 214 ILE ILE C . n 
A 1 215 ILE 215 215 215 ILE ILE C . n 
A 1 216 VAL 216 216 216 VAL VAL C . n 
A 1 217 TYR 217 217 217 TYR TYR C . n 
A 1 218 ASN 218 218 218 ASN ASN C . n 
A 1 219 LEU 219 219 219 LEU LEU C . n 
A 1 220 GLY 220 220 220 GLY GLY C . n 
A 1 221 GLU 221 221 221 GLU GLU C . n 
A 1 222 LEU 222 222 222 LEU LEU C . n 
A 1 223 LYS 223 223 223 LYS LYS C . n 
A 1 224 HIS 224 224 224 HIS HIS C . n 
A 1 225 LEU 225 225 225 LEU LEU C . n 
A 1 226 SER 226 226 226 SER SER C . n 
A 1 227 GLU 227 227 227 GLU GLU C . n 
A 1 228 GLN 228 228 228 GLN GLN C . n 
A 1 229 THR 229 229 229 THR THR C . n 
A 1 230 SER 230 230 230 SER SER C . n 
A 1 231 TYR 231 231 231 TYR TYR C . n 
A 1 232 TYR 232 232 232 TYR TYR C . n 
A 1 233 SER 233 233 233 SER SER C . n 
A 1 234 ASP 234 234 ?   ?   ?   C . n 
A 1 235 PRO 235 235 ?   ?   ?   C . n 
A 1 236 ASN 236 236 ?   ?   ?   C . n 
A 1 237 SER 237 237 ?   ?   ?   C . n 
A 1 238 SER 238 238 ?   ?   ?   C . n 
A 1 239 SER 239 239 ?   ?   ?   C . n 
A 1 240 VAL 240 240 ?   ?   ?   C . n 
A 1 241 ASP 241 241 ?   ?   ?   C . n 
A 1 242 LYS 242 242 ?   ?   ?   C . n 
A 1 243 LEU 243 243 ?   ?   ?   C . n 
A 1 244 ALA 244 244 ?   ?   ?   C . n 
A 1 245 ALA 245 245 ?   ?   ?   C . n 
A 1 246 ALA 246 246 ?   ?   ?   C . n 
A 1 247 LEU 247 247 ?   ?   ?   C . n 
A 1 248 ASP 248 248 ?   ?   ?   C . n 
A 1 249 HIS 249 249 ?   ?   ?   C . n 
A 1 250 HIS 250 250 ?   ?   ?   C . n 
B 2 1   DG  1   501 501 DG  G   B . n 
B 2 2   DC  2   502 502 DC  C   B . n 
B 2 3   DA  3   503 503 DA  A   B . n 
B 2 4   DT  4   504 504 DT  T   B . n 
B 2 5   DT  5   505 505 DT  T   B . n 
B 2 6   DA  6   506 506 DA  A   B . n 
B 2 7   DA  7   507 507 DA  A   B . n 
B 2 8   DC  8   508 508 DC  C   B . n 
B 2 9   DA  9   509 509 DA  A   B . n 
B 2 10  DT  10  510 510 DT  T   B . n 
B 2 11  DG  11  511 511 DG  G   B . n 
B 2 12  DC  12  512 512 DC  C   B . n 
B 2 13  DC  13  513 513 DC  C   B . n 
C 3 1   DG  1   534 534 DG  G   A . n 
C 3 2   DG  2   535 535 DG  G   A . n 
C 3 3   DC  3   536 536 DC  C   A . n 
C 3 4   DA  4   537 537 DA  A   A . n 
C 3 5   DT  5   538 538 DT  T   A . n 
C 3 6   DG  6   539 539 DG  G   A . n 
C 3 7   DT  7   540 540 DT  T   A . n 
C 3 8   DT  8   541 541 DT  T   A . n 
C 3 9   DA  9   542 542 DA  A   A . n 
C 3 10  DA  10  543 543 DA  A   A . n 
C 3 11  DT  11  544 544 DT  T   A . n 
C 3 12  DG  12  545 545 DG  G   A . n 
C 3 13  DC  13  546 546 DC  C   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 3C4 1   604  604  3C4 3C4 C . 
E 5 HOH 1   1001 1001 HOH HOH C . 
E 5 HOH 2   1002 1002 HOH HOH C . 
E 5 HOH 3   1003 1003 HOH HOH C . 
E 5 HOH 4   1004 1004 HOH HOH C . 
E 5 HOH 5   1005 1005 HOH HOH C . 
E 5 HOH 6   1006 1006 HOH HOH C . 
E 5 HOH 7   1007 1007 HOH HOH C . 
E 5 HOH 8   1008 1008 HOH HOH C . 
E 5 HOH 9   1009 1009 HOH HOH C . 
E 5 HOH 10  1010 1010 HOH HOH C . 
E 5 HOH 11  1011 1011 HOH HOH C . 
E 5 HOH 12  1012 1012 HOH HOH C . 
E 5 HOH 13  1013 1013 HOH HOH C . 
E 5 HOH 14  1014 1014 HOH HOH C . 
E 5 HOH 15  1015 1015 HOH HOH C . 
E 5 HOH 16  1016 1016 HOH HOH C . 
E 5 HOH 17  1017 1017 HOH HOH C . 
E 5 HOH 18  1018 1018 HOH HOH C . 
E 5 HOH 19  1019 1019 HOH HOH C . 
E 5 HOH 20  1020 1020 HOH HOH C . 
E 5 HOH 21  1021 1021 HOH HOH C . 
E 5 HOH 22  1022 1022 HOH HOH C . 
E 5 HOH 23  1023 1023 HOH HOH C . 
E 5 HOH 24  1024 1024 HOH HOH C . 
E 5 HOH 25  1025 1025 HOH HOH C . 
E 5 HOH 26  1026 1026 HOH HOH C . 
E 5 HOH 27  1027 1027 HOH HOH C . 
E 5 HOH 28  1028 1028 HOH HOH C . 
E 5 HOH 29  1029 1029 HOH HOH C . 
E 5 HOH 30  1030 1030 HOH HOH C . 
E 5 HOH 31  1031 1031 HOH HOH C . 
E 5 HOH 32  1035 1035 HOH HOH C . 
E 5 HOH 33  1036 1036 HOH HOH C . 
E 5 HOH 34  1037 1037 HOH HOH C . 
E 5 HOH 35  1038 1038 HOH HOH C . 
E 5 HOH 36  1039 1039 HOH HOH C . 
E 5 HOH 37  1040 1040 HOH HOH C . 
E 5 HOH 38  1041 1041 HOH HOH C . 
E 5 HOH 39  1042 1042 HOH HOH C . 
E 5 HOH 40  1043 1043 HOH HOH C . 
E 5 HOH 41  1044 1044 HOH HOH C . 
E 5 HOH 42  1045 1045 HOH HOH C . 
E 5 HOH 43  1048 1048 HOH HOH C . 
E 5 HOH 44  1049 1049 HOH HOH C . 
E 5 HOH 45  1051 1051 HOH HOH C . 
E 5 HOH 46  1052 1052 HOH HOH C . 
E 5 HOH 47  1054 1054 HOH HOH C . 
E 5 HOH 48  1055 1055 HOH HOH C . 
E 5 HOH 49  1056 1056 HOH HOH C . 
E 5 HOH 50  1057 1057 HOH HOH C . 
E 5 HOH 51  1058 1058 HOH HOH C . 
E 5 HOH 52  1059 1059 HOH HOH C . 
E 5 HOH 53  1060 1060 HOH HOH C . 
E 5 HOH 54  1061 1061 HOH HOH C . 
E 5 HOH 55  1062 1062 HOH HOH C . 
E 5 HOH 56  1063 1063 HOH HOH C . 
E 5 HOH 57  1064 1064 HOH HOH C . 
E 5 HOH 58  1065 1065 HOH HOH C . 
E 5 HOH 59  1066 1066 HOH HOH C . 
E 5 HOH 60  1067 1067 HOH HOH C . 
E 5 HOH 61  1068 1068 HOH HOH C . 
E 5 HOH 62  1069 1069 HOH HOH C . 
E 5 HOH 63  1070 1070 HOH HOH C . 
E 5 HOH 64  1071 1071 HOH HOH C . 
E 5 HOH 65  1073 1073 HOH HOH C . 
E 5 HOH 66  1074 1074 HOH HOH C . 
E 5 HOH 67  1075 1075 HOH HOH C . 
E 5 HOH 68  1076 1076 HOH HOH C . 
E 5 HOH 69  1077 1077 HOH HOH C . 
E 5 HOH 70  1078 1078 HOH HOH C . 
E 5 HOH 71  1079 1079 HOH HOH C . 
E 5 HOH 72  1080 1080 HOH HOH C . 
E 5 HOH 73  1081 1081 HOH HOH C . 
E 5 HOH 74  1082 1082 HOH HOH C . 
E 5 HOH 75  1083 1083 HOH HOH C . 
E 5 HOH 76  1084 1084 HOH HOH C . 
E 5 HOH 77  1085 1085 HOH HOH C . 
E 5 HOH 78  1086 1086 HOH HOH C . 
E 5 HOH 79  1087 1087 HOH HOH C . 
E 5 HOH 80  1088 1088 HOH HOH C . 
E 5 HOH 81  1089 1089 HOH HOH C . 
E 5 HOH 82  1091 1091 HOH HOH C . 
E 5 HOH 83  1092 1092 HOH HOH C . 
E 5 HOH 84  1093 1093 HOH HOH C . 
E 5 HOH 85  1094 1094 HOH HOH C . 
E 5 HOH 86  1095 1095 HOH HOH C . 
E 5 HOH 87  1096 1096 HOH HOH C . 
E 5 HOH 88  1097 1097 HOH HOH C . 
E 5 HOH 89  1098 1098 HOH HOH C . 
E 5 HOH 90  1099 1099 HOH HOH C . 
E 5 HOH 91  1100 1100 HOH HOH C . 
E 5 HOH 92  1101 1101 HOH HOH C . 
E 5 HOH 93  1103 1103 HOH HOH C . 
E 5 HOH 94  1104 1104 HOH HOH C . 
E 5 HOH 95  1105 1105 HOH HOH C . 
E 5 HOH 96  1106 1106 HOH HOH C . 
E 5 HOH 97  1108 1108 HOH HOH C . 
E 5 HOH 98  1109 1109 HOH HOH C . 
E 5 HOH 99  1111 1111 HOH HOH C . 
E 5 HOH 100 1112 1112 HOH HOH C . 
E 5 HOH 101 1113 1113 HOH HOH C . 
E 5 HOH 102 1114 1114 HOH HOH C . 
E 5 HOH 103 1115 1115 HOH HOH C . 
E 5 HOH 104 1116 1116 HOH HOH C . 
E 5 HOH 105 1117 1117 HOH HOH C . 
E 5 HOH 106 1118 1118 HOH HOH C . 
E 5 HOH 107 1119 1119 HOH HOH C . 
E 5 HOH 108 1120 1120 HOH HOH C . 
E 5 HOH 109 1121 1121 HOH HOH C . 
E 5 HOH 110 1123 1123 HOH HOH C . 
E 5 HOH 111 1124 1124 HOH HOH C . 
E 5 HOH 112 1125 1125 HOH HOH C . 
E 5 HOH 113 1126 1126 HOH HOH C . 
E 5 HOH 114 1127 1127 HOH HOH C . 
E 5 HOH 115 1128 1128 HOH HOH C . 
E 5 HOH 116 1129 1129 HOH HOH C . 
E 5 HOH 117 1130 1130 HOH HOH C . 
E 5 HOH 118 1131 1131 HOH HOH C . 
E 5 HOH 119 1132 1132 HOH HOH C . 
E 5 HOH 120 1133 1133 HOH HOH C . 
E 5 HOH 121 1134 1134 HOH HOH C . 
E 5 HOH 122 1136 1136 HOH HOH C . 
E 5 HOH 123 1137 1137 HOH HOH C . 
E 5 HOH 124 1138 1138 HOH HOH C . 
E 5 HOH 125 1139 1139 HOH HOH C . 
E 5 HOH 126 1140 1140 HOH HOH C . 
E 5 HOH 127 1141 1141 HOH HOH C . 
E 5 HOH 128 1142 1142 HOH HOH C . 
E 5 HOH 129 1143 1143 HOH HOH C . 
E 5 HOH 130 1144 1144 HOH HOH C . 
E 5 HOH 131 1145 1145 HOH HOH C . 
E 5 HOH 132 1146 1146 HOH HOH C . 
E 5 HOH 133 1148 1148 HOH HOH C . 
E 5 HOH 134 1150 1150 HOH HOH C . 
E 5 HOH 135 1151 1151 HOH HOH C . 
E 5 HOH 136 1152 1152 HOH HOH C . 
F 5 HOH 1   1032 1032 HOH HOH B . 
F 5 HOH 2   1072 1072 HOH HOH B . 
F 5 HOH 3   1090 1090 HOH HOH B . 
F 5 HOH 4   1107 1107 HOH HOH B . 
F 5 HOH 5   1147 1147 HOH HOH B . 
F 5 HOH 6   1149 1149 HOH HOH B . 
G 5 HOH 1   1033 1033 HOH HOH A . 
G 5 HOH 2   1034 1034 HOH HOH A . 
G 5 HOH 3   1046 1046 HOH HOH A . 
G 5 HOH 4   1047 1047 HOH HOH A . 
G 5 HOH 5   1050 1050 HOH HOH A . 
G 5 HOH 6   1053 1053 HOH HOH A . 
G 5 HOH 7   1102 1102 HOH HOH A . 
G 5 HOH 8   1110 1110 HOH HOH A . 
G 5 HOH 9   1122 1122 HOH HOH A . 
G 5 HOH 10  1135 1135 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11370 ? 
1 MORE         -85   ? 
1 'SSA (A^2)'  25810 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 11_555 -x+y,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-30 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2         
2 3 'Structure model' struct_ref_seq_dif 
3 3 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_struct_ref_seq_dif.details'         
4 3 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 3 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 3 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -17.9640 28.2290 -4.2760  -0.3055 -0.2685 0.1196  -0.0472 0.0735 -0.0041 7.0397 1.6818 2.3460 -0.1072 1.3607 0.0893 
-0.0804 0.0743 -1.2080 -0.0674 0.1945 0.2771 -0.0095 -0.3512 -0.1141 'X-RAY DIFFRACTION' 
2 ? refined -2.3760  51.5300 -10.8920 -0.2711 -0.2418 -0.4265 -0.0313 0.0234 -0.0132 1.6371 2.3830 2.3569 0.0769  0.2473 0.1121 
-0.1255 0.2388 -0.0832 -0.3319 0.1020 0.0470 -0.2562 -0.0454 0.0235  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 C 145 A 145 C 233 A 233 ? 'X-RAY DIFFRACTION' ? 
2 2 C 9   A 9   C 140 A 140 ? 'X-RAY DIFFRACTION' ? 
# 
_software.name             REFMAC 
_software.classification   refinement 
_software.version          5.2 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O C HOH 1150 ? ? O B HOH 1149 ? ? 2.10 
2 1 O C HOH 1019 ? ? O C HOH 1124 ? ? 2.13 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 P B DG  501  ? ? 1_555 "O3'" A DC  546  ? ? 11_555 1.69 
2 1 O C HOH 1123 ? ? 1_555 O     C HOH 1150 ? ? 11_555 1.88 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG    C ASP 36  ? ? OD2   C ASP 36  ? ? 1.420 1.249 0.171  0.023 N 
2 1 C     C ASP 36  ? ? O     C ASP 36  ? ? 1.395 1.229 0.166  0.019 N 
3 1 CB    C GLU 68  ? ? CG    C GLU 68  ? ? 1.662 1.517 0.145  0.019 N 
4 1 CG    C GLU 68  ? ? CD    C GLU 68  ? ? 1.637 1.515 0.122  0.015 N 
5 1 CA    C ALA 138 ? ? CB    C ALA 138 ? ? 1.650 1.520 0.130  0.021 N 
6 1 "O3'" B DC  502 ? ? "C3'" B DC  502 ? ? 1.342 1.419 -0.077 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE    C ARG 26  ? ? CZ    C ARG 26  ? ? NH1   C ARG 26  ? ? 127.62 120.30 7.32   0.50 N 
2  1 NE    C ARG 26  ? ? CZ    C ARG 26  ? ? NH2   C ARG 26  ? ? 114.12 120.30 -6.18  0.50 N 
3  1 CB    C LEU 178 ? ? CG    C LEU 178 ? ? CD2   C LEU 178 ? ? 98.39  111.00 -12.61 1.70 N 
4  1 OP1   B DG  501 ? ? P     B DG  501 ? ? OP2   B DG  501 ? ? 128.98 119.60 9.38   1.50 N 
5  1 "O5'" B DG  501 ? ? "C5'" B DG  501 ? ? "C4'" B DG  501 ? ? 103.49 109.40 -5.91  0.80 N 
6  1 P     B DC  502 ? ? "O5'" B DC  502 ? ? "C5'" B DC  502 ? ? 104.35 120.90 -16.55 1.60 N 
7  1 "O4'" B DC  502 ? ? "C4'" B DC  502 ? ? "C3'" B DC  502 ? ? 110.28 106.00 4.28   0.60 N 
8  1 "C3'" B DT  504 ? ? "O3'" B DT  504 ? ? P     B DT  505 ? ? 127.11 119.70 7.41   1.20 Y 
9  1 "C3'" B DT  505 ? ? "O3'" B DT  505 ? ? P     B DA  506 ? ? 130.69 119.70 10.99  1.20 Y 
10 1 "O4'" B DA  507 ? ? "C1'" B DA  507 ? ? N9    B DA  507 ? ? 111.48 108.30 3.18   0.30 N 
11 1 "C3'" B DA  507 ? ? "O3'" B DA  507 ? ? P     B DC  508 ? ? 127.28 119.70 7.58   1.20 Y 
12 1 "O4'" B DC  508 ? ? "C1'" B DC  508 ? ? N1    B DC  508 ? ? 116.39 108.30 8.09   0.30 N 
13 1 "O4'" B DA  509 ? ? "C1'" B DA  509 ? ? N9    B DA  509 ? ? 103.61 108.00 -4.39  0.70 N 
14 1 "O5'" B DT  510 ? ? "C5'" B DT  510 ? ? "C4'" B DT  510 ? ? 103.85 109.40 -5.55  0.80 N 
15 1 "O4'" B DG  511 ? ? "C1'" B DG  511 ? ? N9    B DG  511 ? ? 103.04 108.00 -4.96  0.70 N 
16 1 "O4'" B DC  513 ? ? "C4'" B DC  513 ? ? "C3'" B DC  513 ? ? 98.08  104.50 -6.42  0.40 N 
17 1 "O4'" A DG  535 ? ? "C1'" A DG  535 ? ? N9    A DG  535 ? ? 110.88 108.30 2.58   0.30 N 
18 1 "O3'" A DG  539 ? ? P     A DT  540 ? ? OP2   A DT  540 ? ? 120.43 110.50 9.93   1.10 Y 
19 1 "O4'" A DT  540 ? ? "C1'" A DT  540 ? ? N1    A DT  540 ? ? 99.88  108.00 -8.12  0.70 N 
20 1 "O3'" A DT  540 ? ? P     A DT  541 ? ? OP2   A DT  541 ? ? 118.06 110.50 7.56   1.10 Y 
21 1 "O4'" A DT  541 ? ? "C1'" A DT  541 ? ? N1    A DT  541 ? ? 102.67 108.00 -5.33  0.70 N 
22 1 "C3'" A DA  542 ? ? "O3'" A DA  542 ? ? P     A DA  543 ? ? 130.26 119.70 10.56  1.20 Y 
23 1 "O4'" A DA  543 ? ? "C1'" A DA  543 ? ? N9    A DA  543 ? ? 113.16 108.30 4.86   0.30 N 
24 1 "C3'" A DA  543 ? ? "O3'" A DA  543 ? ? P     A DT  544 ? ? 131.65 119.70 11.95  1.20 Y 
25 1 "C1'" A DG  545 ? ? "O4'" A DG  545 ? ? "C4'" A DG  545 ? ? 104.01 110.10 -6.09  1.00 N 
26 1 "C3'" A DG  545 ? ? "C2'" A DG  545 ? ? "C1'" A DG  545 ? ? 96.53  102.40 -5.87  0.80 N 
27 1 "O4'" A DG  545 ? ? "C1'" A DG  545 ? ? N9    A DG  545 ? ? 110.25 108.30 1.95   0.30 N 
28 1 OP1   A DC  546 ? ? P     A DC  546 ? ? OP2   A DC  546 ? ? 132.18 119.60 12.58  1.50 N 
29 1 "O5'" A DC  546 ? ? P     A DC  546 ? ? OP1   A DC  546 ? ? 99.89  105.70 -5.81  0.90 N 
30 1 "O4'" A DC  546 ? ? "C4'" A DC  546 ? ? "C3'" A DC  546 ? ? 101.96 104.50 -2.54  0.40 N 
31 1 "C4'" A DC  546 ? ? "C3'" A DC  546 ? ? "C2'" A DC  546 ? ? 108.79 103.10 5.69   0.90 N 
32 1 "O4'" A DC  546 ? ? "C1'" A DC  546 ? ? N1    A DC  546 ? ? 101.54 108.00 -6.46  0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE C 10  ? ? -161.35 114.56 
2 1 CYS C 11  ? ? -110.71 70.32  
3 1 PHE C 20  ? ? 13.92   72.55  
4 1 ASN C 218 ? ? -153.24 83.13  
5 1 TYR C 231 ? ? -140.11 48.35  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 C LYS 211 ? CG ? A LYS 211 CG 
2 1 Y 1 C LYS 211 ? CD ? A LYS 211 CD 
3 1 Y 1 C LYS 211 ? CE ? A LYS 211 CE 
4 1 Y 1 C LYS 211 ? NZ ? A LYS 211 NZ 
5 1 Y 1 C LYS 213 ? CE ? A LYS 213 CE 
6 1 Y 1 C LYS 213 ? NZ ? A LYS 213 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C MET 1   ? A MET 1   
2  1 Y 1 C SER 2   ? A SER 2   
3  1 Y 1 C VAL 3   ? A VAL 3   
4  1 Y 1 C GLU 4   ? A GLU 4   
5  1 Y 1 C GLY 5   ? A GLY 5   
6  1 Y 1 C LEU 6   ? A LEU 6   
7  1 Y 1 C GLY 7   ? A GLY 7   
8  1 Y 1 C LYS 8   ? A LYS 8   
9  1 Y 1 C ASP 234 ? A ASP 234 
10 1 Y 1 C PRO 235 ? A PRO 235 
11 1 Y 1 C ASN 236 ? A ASN 236 
12 1 Y 1 C SER 237 ? A SER 237 
13 1 Y 1 C SER 238 ? A SER 238 
14 1 Y 1 C SER 239 ? A SER 239 
15 1 Y 1 C VAL 240 ? A VAL 240 
16 1 Y 1 C ASP 241 ? A ASP 241 
17 1 Y 1 C LYS 242 ? A LYS 242 
18 1 Y 1 C LEU 243 ? A LEU 243 
19 1 Y 1 C ALA 244 ? A ALA 244 
20 1 Y 1 C ALA 245 ? A ALA 245 
21 1 Y 1 C ALA 246 ? A ALA 246 
22 1 Y 1 C LEU 247 ? A LEU 247 
23 1 Y 1 C ASP 248 ? A ASP 248 
24 1 Y 1 C HIS 249 ? A HIS 249 
25 1 Y 1 C HIS 250 ? A HIS 250 
# 
_ndb_struct_conf_na.entry_id   3E6C 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 13 1_555 -0.048 0.010  0.014  -8.001  -15.561 -4.543  1  B_DG501:DC546_A B 501 ? A 546 ? 19 1 
1 B DC 2  1_555 C DG 12 1_555 0.272  -0.258 -0.325 -2.358  5.300   -3.819  2  B_DC502:DG545_A B 502 ? A 545 ? 19 1 
1 B DA 3  1_555 C DT 11 1_555 0.205  -0.136 -0.051 3.461   -1.914  -0.905  3  B_DA503:DT544_A B 503 ? A 544 ? 20 1 
1 B DT 4  1_555 C DA 10 1_555 0.233  -0.216 -0.831 2.657   -13.824 -1.082  4  B_DT504:DA543_A B 504 ? A 543 ? 20 1 
1 B DT 5  1_555 C DA 9  1_555 0.128  -0.113 -1.239 5.483   -12.965 2.647   5  B_DT505:DA542_A B 505 ? A 542 ? 20 1 
1 B DA 6  1_555 C DT 8  1_555 0.122  -0.097 -0.928 -3.777  -3.438  -0.390  6  B_DA506:DT541_A B 506 ? A 541 ? 20 1 
1 B DA 7  1_555 C DT 7  1_555 -0.387 0.017  -0.665 16.886  -8.655  5.073   7  B_DA507:DT540_A B 507 ? A 540 ? 20 1 
1 B DC 8  1_555 C DG 6  1_555 0.206  0.248  -0.066 13.558  -12.935 1.700   8  B_DC508:DG539_A B 508 ? A 539 ? 19 1 
1 B DA 9  1_555 C DT 5  1_555 -0.390 0.077  0.436  9.263   -8.025  7.267   9  B_DA509:DT538_A B 509 ? A 538 ? 20 1 
1 B DT 10 1_555 C DA 4  1_555 0.476  0.394  0.352  0.513   -10.765 8.755   10 B_DT510:DA537_A B 510 ? A 537 ? ?  ? 
1 B DG 11 1_555 C DC 3  1_555 -0.210 0.214  -1.257 -33.892 -27.455 3.179   11 B_DG511:DC536_A B 511 ? A 536 ? 19 1 
1 B DC 12 1_555 C DG 1  1_555 -0.707 -0.143 -0.618 -41.817 8.839   -14.274 12 B_DC512:DG534_A B 512 ? A 534 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 13 1_555 B DC 2  1_555 C DG 12 1_555 0.911  0.357  3.399 0.665   -10.577 39.181 1.731  -1.239 3.215 -15.432 
-0.970  40.535 1  BB_DG501DC502:DG545DC546_AA B 501 ? A 546 ? B 502 ? A 545 ? 
1 B DC 2  1_555 C DG 12 1_555 B DA 3  1_555 C DT 11 1_555 -0.753 0.583  3.357 -4.655  -3.312  35.043 1.457  0.530  3.359 -5.456  
7.667   35.491 2  BB_DC502DA503:DT544DG545_AA B 502 ? A 545 ? B 503 ? A 544 ? 
1 B DA 3  1_555 C DT 11 1_555 B DT 4  1_555 C DA 10 1_555 0.162  -0.441 3.325 4.990   2.627   30.531 -1.336 0.670  3.261 4.935   
-9.375  31.035 3  BB_DA503DT504:DA543DT544_AA B 503 ? A 544 ? B 504 ? A 543 ? 
1 B DT 4  1_555 C DA 10 1_555 B DT 5  1_555 C DA 9  1_555 0.711  0.375  3.160 6.781   7.078   33.592 -0.445 -0.159 3.248 11.935  
-11.434 34.954 4  BB_DT504DT505:DA542DA543_AA B 504 ? A 543 ? B 505 ? A 542 ? 
1 B DT 5  1_555 C DA 9  1_555 B DA 6  1_555 C DT 8  1_555 0.408  0.511  3.667 -2.507  16.440  28.462 -2.372 -1.220 3.405 30.381  
4.634   32.878 5  BB_DT505DA506:DT541DA542_AA B 505 ? A 542 ? B 506 ? A 541 ? 
1 B DA 6  1_555 C DT 8  1_555 B DA 7  1_555 C DT 7  1_555 0.323  0.672  2.842 0.829   6.322   26.772 0.026  -0.497 2.928 13.413  
-1.758  27.507 6  BB_DA506DA507:DT540DT541_AA B 506 ? A 541 ? B 507 ? A 540 ? 
1 B DA 7  1_555 C DT 7  1_555 B DC 8  1_555 C DG 6  1_555 0.769  -1.081 3.312 -3.820  4.590   34.140 -2.506 -1.866 3.045 7.745   
6.445   34.643 7  BB_DA507DC508:DG539DT540_AA B 507 ? A 540 ? B 508 ? A 539 ? 
1 B DC 8  1_555 C DG 6  1_555 B DA 9  1_555 C DT 5  1_555 -0.024 -0.824 3.351 0.927   6.264   31.420 -2.624 0.210  3.130 11.422  
-1.691  32.036 8  BB_DC508DA509:DT538DG539_AA B 508 ? A 539 ? B 509 ? A 538 ? 
1 B DA 9  1_555 C DT 5  1_555 B DT 10 1_555 C DA 4  1_555 -0.102 -0.324 3.374 -0.025  -4.616  40.436 0.064  0.143  3.389 -6.652  
0.036   40.688 9  BB_DA509DT510:DA537DT538_AA B 509 ? A 538 ? B 510 ? A 537 ? 
1 B DT 10 1_555 C DA 4  1_555 B DG 11 1_555 C DC 3  1_555 -0.502 -0.243 3.829 6.860   15.467  35.948 -2.441 1.664  3.311 23.524  
-10.433 39.611 10 BB_DT510DG511:DC536DA537_AA B 510 ? A 537 ? B 511 ? A 536 ? 
1 B DG 11 1_555 C DC 3  1_555 B DC 12 1_555 C DG 1  1_555 -0.165 1.183  5.592 -40.651 12.584  35.256 -0.122 -4.371 4.066 15.416  
49.798  54.734 11 BB_DG511DC512:DG534DC536_AA B 511 ? A 536 ? B 512 ? A 534 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 '(3-CHLORO-4-HYDROXYPHENYL)ACETIC ACID' 3C4 
5 water                                   HOH 
#