data_3E6D
# 
_entry.id   3E6D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3E6D         pdb_00003e6d 10.2210/pdb3e6d/pdb 
RCSB  RCSB048931   ?            ?                   
WWPDB D_1000048931 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 3E5Q unspecified . 
PDB 3E5U unspecified . 
PDB 3E6X unspecified . 
PDB 3E6B unspecified . 
PDB 3E6C unspecified . 
# 
_pdbx_database_status.entry_id                        3E6D 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Levy, C.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator' 
_citation.journal_abbrev            Mol.Microbiol. 
_citation.journal_volume            70 
_citation.page_first                151 
_citation.page_last                 167 
_citation.year                      2008 
_citation.journal_id_ASTM           MOMIEE 
_citation.country                   UK 
_citation.journal_id_ISSN           0950-382X 
_citation.journal_id_CSD            2007 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18717788 
_citation.pdbx_database_id_DOI      10.1111/j.1365-2958.2008.06399.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Levy, C.'         1 ? 
primary 'Pike, K.'         2 ? 
primary 'Heyes, D.J.'      3 ? 
primary 'Joyce, M.G.'      4 ? 
primary 'Gabor, K.'        5 ? 
primary 'Smidt, H.'        6 ? 
primary 'van der Oost, J.' 7 ? 
primary 'Leys, D.'         8 ? 
# 
_cell.entry_id           3E6D 
_cell.length_a           42.950 
_cell.length_b           86.820 
_cell.length_c           124.410 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3E6D 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Cyclic nucleotide-binding protein' 28379.617 2   ? C200S ? ? 
2 water   nat water                               18.015    181 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CprK 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQTSYYSDPNSSSV
DKLAAALDHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQTSYYSDPNSSSV
DKLAAALDHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   VAL n 
1 4   GLU n 
1 5   GLY n 
1 6   LEU n 
1 7   GLY n 
1 8   LYS n 
1 9   ASP n 
1 10  PHE n 
1 11  CYS n 
1 12  GLY n 
1 13  ALA n 
1 14  ILE n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  ASN n 
1 19  PHE n 
1 20  PHE n 
1 21  PRO n 
1 22  ILE n 
1 23  GLU n 
1 24  LYS n 
1 25  LEU n 
1 26  ARG n 
1 27  ASN n 
1 28  TYR n 
1 29  THR n 
1 30  GLN n 
1 31  MET n 
1 32  GLY n 
1 33  LEU n 
1 34  ILE n 
1 35  ARG n 
1 36  ASP n 
1 37  PHE n 
1 38  ALA n 
1 39  LYS n 
1 40  GLY n 
1 41  SER n 
1 42  ALA n 
1 43  VAL n 
1 44  ILE n 
1 45  MET n 
1 46  PRO n 
1 47  GLY n 
1 48  GLU n 
1 49  GLU n 
1 50  ILE n 
1 51  THR n 
1 52  SER n 
1 53  MET n 
1 54  ILE n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  GLU n 
1 59  GLY n 
1 60  LYS n 
1 61  ILE n 
1 62  LYS n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  ILE n 
1 67  PHE n 
1 68  GLU n 
1 69  ASP n 
1 70  GLY n 
1 71  SER n 
1 72  GLU n 
1 73  LYS n 
1 74  LEU n 
1 75  LEU n 
1 76  TYR n 
1 77  TYR n 
1 78  ALA n 
1 79  GLY n 
1 80  GLY n 
1 81  ASN n 
1 82  SER n 
1 83  LEU n 
1 84  ILE n 
1 85  GLY n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  PRO n 
1 90  THR n 
1 91  GLY n 
1 92  ASN n 
1 93  ASN n 
1 94  ILE n 
1 95  TYR n 
1 96  ALA n 
1 97  THR n 
1 98  ALA n 
1 99  MET n 
1 100 GLU n 
1 101 PRO n 
1 102 THR n 
1 103 ARG n 
1 104 THR n 
1 105 CYS n 
1 106 TRP n 
1 107 PHE n 
1 108 SER n 
1 109 GLU n 
1 110 LYS n 
1 111 SER n 
1 112 LEU n 
1 113 ARG n 
1 114 THR n 
1 115 VAL n 
1 116 PHE n 
1 117 ARG n 
1 118 THR n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 MET n 
1 123 ILE n 
1 124 PHE n 
1 125 GLU n 
1 126 ILE n 
1 127 PHE n 
1 128 LYS n 
1 129 ASN n 
1 130 TYR n 
1 131 LEU n 
1 132 THR n 
1 133 LYS n 
1 134 VAL n 
1 135 ALA n 
1 136 TYR n 
1 137 TYR n 
1 138 ALA n 
1 139 ARG n 
1 140 GLN n 
1 141 VAL n 
1 142 ALA n 
1 143 GLU n 
1 144 MET n 
1 145 ASN n 
1 146 THR n 
1 147 TYR n 
1 148 ASN n 
1 149 PRO n 
1 150 THR n 
1 151 ILE n 
1 152 ARG n 
1 153 ILE n 
1 154 LEU n 
1 155 ARG n 
1 156 LEU n 
1 157 PHE n 
1 158 TYR n 
1 159 GLU n 
1 160 LEU n 
1 161 CYS n 
1 162 SER n 
1 163 SER n 
1 164 GLN n 
1 165 GLY n 
1 166 LYS n 
1 167 ARG n 
1 168 VAL n 
1 169 GLY n 
1 170 ASP n 
1 171 THR n 
1 172 TYR n 
1 173 GLU n 
1 174 ILE n 
1 175 THR n 
1 176 MET n 
1 177 PRO n 
1 178 LEU n 
1 179 SER n 
1 180 GLN n 
1 181 LYS n 
1 182 SER n 
1 183 ILE n 
1 184 GLY n 
1 185 GLU n 
1 186 ILE n 
1 187 THR n 
1 188 GLY n 
1 189 VAL n 
1 190 HIS n 
1 191 HIS n 
1 192 VAL n 
1 193 THR n 
1 194 VAL n 
1 195 SER n 
1 196 ARG n 
1 197 VAL n 
1 198 LEU n 
1 199 ALA n 
1 200 SER n 
1 201 LEU n 
1 202 LYS n 
1 203 ARG n 
1 204 GLU n 
1 205 ASN n 
1 206 ILE n 
1 207 LEU n 
1 208 ASP n 
1 209 LYS n 
1 210 LYS n 
1 211 LYS n 
1 212 ASN n 
1 213 LYS n 
1 214 ILE n 
1 215 ILE n 
1 216 VAL n 
1 217 TYR n 
1 218 ASN n 
1 219 LEU n 
1 220 GLY n 
1 221 GLU n 
1 222 LEU n 
1 223 LYS n 
1 224 HIS n 
1 225 LEU n 
1 226 SER n 
1 227 GLU n 
1 228 GLN n 
1 229 THR n 
1 230 SER n 
1 231 TYR n 
1 232 TYR n 
1 233 SER n 
1 234 ASP n 
1 235 PRO n 
1 236 ASN n 
1 237 SER n 
1 238 SER n 
1 239 SER n 
1 240 VAL n 
1 241 ASP n 
1 242 LYS n 
1 243 LEU n 
1 244 ALA n 
1 245 ALA n 
1 246 ALA n 
1 247 LEU n 
1 248 ASP n 
1 249 HIS n 
1 250 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Dhaf_0678 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    DCB-2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Desulfitobacterium hafniense' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272564 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTrc99 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q18R04_DESHD 
_struct_ref.pdbx_db_accession          Q18R04 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSVEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGG
NSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSYY
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3E6D A 1 ? 232 ? Q18R04 1 ? 232 ? 1 232 
2 1 3E6D B 1 ? 232 ? Q18R04 1 ? 232 ? 0 232 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3E6D SER A 200 ? UNP Q18R04 CYS 200 'engineered mutation' 200 1  
1 3E6D SER A 233 ? UNP Q18R04 ?   ?   'expression tag'      233 2  
1 3E6D ASP A 234 ? UNP Q18R04 ?   ?   'expression tag'      234 3  
1 3E6D PRO A 235 ? UNP Q18R04 ?   ?   'expression tag'      235 4  
1 3E6D ASN A 236 ? UNP Q18R04 ?   ?   'expression tag'      236 5  
1 3E6D SER A 237 ? UNP Q18R04 ?   ?   'expression tag'      237 6  
1 3E6D SER A 238 ? UNP Q18R04 ?   ?   'expression tag'      238 7  
1 3E6D SER A 239 ? UNP Q18R04 ?   ?   'expression tag'      239 8  
1 3E6D VAL A 240 ? UNP Q18R04 ?   ?   'expression tag'      240 9  
1 3E6D ASP A 241 ? UNP Q18R04 ?   ?   'expression tag'      241 10 
1 3E6D LYS A 242 ? UNP Q18R04 ?   ?   'expression tag'      242 11 
1 3E6D LEU A 243 ? UNP Q18R04 ?   ?   'expression tag'      243 12 
1 3E6D ALA A 244 ? UNP Q18R04 ?   ?   'expression tag'      244 13 
1 3E6D ALA A 245 ? UNP Q18R04 ?   ?   'expression tag'      245 14 
1 3E6D ALA A 246 ? UNP Q18R04 ?   ?   'expression tag'      246 15 
1 3E6D LEU A 247 ? UNP Q18R04 ?   ?   'expression tag'      247 16 
1 3E6D ASP A 248 ? UNP Q18R04 ?   ?   'expression tag'      248 17 
1 3E6D HIS A 249 ? UNP Q18R04 ?   ?   'expression tag'      249 18 
1 3E6D HIS A 250 ? UNP Q18R04 ?   ?   'expression tag'      250 19 
2 3E6D SER B 200 ? UNP Q18R04 CYS 200 'engineered mutation' 200 20 
2 3E6D SER B 233 ? UNP Q18R04 ?   ?   'expression tag'      233 21 
2 3E6D ASP B 234 ? UNP Q18R04 ?   ?   'expression tag'      234 22 
2 3E6D PRO B 235 ? UNP Q18R04 ?   ?   'expression tag'      235 23 
2 3E6D ASN B 236 ? UNP Q18R04 ?   ?   'expression tag'      236 24 
2 3E6D SER B 237 ? UNP Q18R04 ?   ?   'expression tag'      237 25 
2 3E6D SER B 238 ? UNP Q18R04 ?   ?   'expression tag'      238 26 
2 3E6D SER B 239 ? UNP Q18R04 ?   ?   'expression tag'      239 27 
2 3E6D VAL B 240 ? UNP Q18R04 ?   ?   'expression tag'      240 28 
2 3E6D ASP B 241 ? UNP Q18R04 ?   ?   'expression tag'      241 29 
2 3E6D LYS B 242 ? UNP Q18R04 ?   ?   'expression tag'      242 30 
2 3E6D LEU B 243 ? UNP Q18R04 ?   ?   'expression tag'      243 31 
2 3E6D ALA B 244 ? UNP Q18R04 ?   ?   'expression tag'      244 32 
2 3E6D ALA B 245 ? UNP Q18R04 ?   ?   'expression tag'      245 33 
2 3E6D ALA B 246 ? UNP Q18R04 ?   ?   'expression tag'      246 34 
2 3E6D LEU B 247 ? UNP Q18R04 ?   ?   'expression tag'      247 35 
2 3E6D ASP B 248 ? UNP Q18R04 ?   ?   'expression tag'      248 36 
2 3E6D HIS B 249 ? UNP Q18R04 ?   ?   'expression tag'      249 37 
2 3E6D HIS B 250 ? UNP Q18R04 ?   ?   'expression tag'      250 38 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3E6D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.04 
_exptl_crystal.density_percent_sol   39.80 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '100mM MES, 10% MPD, pH 6, VAPOR DIFFUSION, SITTING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
_exptl_crystal_grow.temp_details    ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3E6D 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.00 
_reflns.d_resolution_low             35.599 
_reflns.number_all                   28123 
_reflns.number_obs                   27656 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3E6D 
_refine.ls_d_res_high                            2.000 
_refine.ls_d_res_low                             35.599 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.ls_percent_reflns_obs                    85.690 
_refine.ls_number_reflns_obs                     27656 
_refine.ls_R_factor_obs                          0.233 
_refine.ls_R_factor_R_work                       0.231 
_refine.ls_R_factor_R_free                       0.280 
_refine.ls_percent_reflns_R_free                 5.170 
_refine.ls_number_reflns_R_free                  1429 
_refine.ls_number_reflns_R_work                  26227 
_refine.B_iso_mean                               36.990 
_refine.solvent_model_param_bsol                 49.224 
_refine.solvent_model_param_ksol                 0.374 
_refine.aniso_B[1][1]                            -4.607 
_refine.aniso_B[2][2]                            0.700 
_refine.aniso_B[3][3]                            3.907 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            -0.000 
_refine.overall_SU_ML                            0.360 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.B_iso_max                                91.90 
_refine.B_iso_min                                15.63 
_refine.pdbx_overall_phase_error                 28.810 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3239 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             181 
_refine_hist.number_atoms_total               3420 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        35.599 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           3302 0.004  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          4448 0.788  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     507  0.056  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      553  0.002  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 1214 17.379 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.000 2.072  10 94.000 2845 . 0.312 0.365 . 156 . 3001 . . 'X-RAY DIFFRACTION' 
2.072 2.154  10 96.000 2884 . 0.270 0.289 . 157 . 3041 . . 'X-RAY DIFFRACTION' 
2.154 2.252  10 92.000 2078 . 0.308 0.384 . 122 . 2200 . . 'X-RAY DIFFRACTION' 
2.252 2.371  10 87.000 2148 . 0.329 0.433 . 109 . 2257 . . 'X-RAY DIFFRACTION' 
2.371 2.520  10 94.000 2879 . 0.246 0.279 . 144 . 3023 . . 'X-RAY DIFFRACTION' 
2.520 2.714  10 94.000 2880 . 0.223 0.294 . 148 . 3028 . . 'X-RAY DIFFRACTION' 
2.714 2.987  10 94.000 2832 . 0.226 0.250 . 162 . 2994 . . 'X-RAY DIFFRACTION' 
2.987 3.419  10 92.000 2816 . 0.212 0.289 . 153 . 2969 . . 'X-RAY DIFFRACTION' 
3.419 4.307  10 69.000 2164 . 0.189 0.235 . 120 . 2284 . . 'X-RAY DIFFRACTION' 
4.307 35.604 10 83.000 2701 . 0.205 0.246 . 158 . 2859 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3E6D 
_struct.title                     'Crystal Structure of CprK C200S' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3E6D 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'CprK, Halorespiration, transcriptional regulator, TRANSCRIPTION REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 22  ? GLY A 32  ? ILE A 22  GLY A 32  5 ? 11 
HELX_P HELX_P2  2  GLU A 109 ? ASP A 119 ? GLU A 109 ASP A 119 1 ? 11 
HELX_P HELX_P3  3  GLU A 120 ? VAL A 141 ? GLU A 120 VAL A 141 1 ? 22 
HELX_P HELX_P4  4  PRO A 149 ? GLY A 165 ? PRO A 149 GLY A 165 1 ? 17 
HELX_P HELX_P5  5  SER A 179 ? GLY A 188 ? SER A 179 GLY A 188 1 ? 10 
HELX_P HELX_P6  6  HIS A 190 ? GLU A 204 ? HIS A 190 GLU A 204 1 ? 15 
HELX_P HELX_P7  7  ASN A 218 ? SER A 226 ? ASN A 218 SER A 226 1 ? 9  
HELX_P HELX_P8  8  ILE B 22  ? GLY B 32  ? ILE B 21  GLY B 31  5 ? 11 
HELX_P HELX_P9  9  SER B 108 ? ASP B 119 ? SER B 107 ASP B 118 1 ? 12 
HELX_P HELX_P10 10 GLU B 120 ? VAL B 141 ? GLU B 119 VAL B 140 1 ? 22 
HELX_P HELX_P11 11 PRO B 149 ? GLY B 165 ? PRO B 149 GLY B 165 1 ? 17 
HELX_P HELX_P12 12 SER B 179 ? GLY B 188 ? SER B 179 GLY B 188 1 ? 10 
HELX_P HELX_P13 13 HIS B 190 ? GLU B 204 ? HIS B 190 GLU B 204 1 ? 15 
HELX_P HELX_P14 14 ASN B 218 ? GLU B 227 ? ASN B 218 GLU B 227 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 33  ? PHE A 37  ? LEU A 33  PHE A 37  
A 2 THR A 102 ? SER A 108 ? THR A 102 SER A 108 
A 3 SER A 52  ? GLU A 58  ? SER A 52  GLU A 58  
A 4 SER A 82  ? GLY A 85  ? SER A 82  GLY A 85  
B 1 ALA A 42  ? ILE A 44  ? ALA A 42  ILE A 44  
B 2 ILE A 94  ? ALA A 98  ? ILE A 94  ALA A 98  
B 3 ILE A 61  ? ILE A 66  ? ILE A 61  ILE A 66  
B 4 GLU A 72  ? ALA A 78  ? GLU A 72  ALA A 78  
C 1 LYS A 166 ? VAL A 168 ? LYS A 166 VAL A 168 
C 2 THR A 171 ? THR A 175 ? THR A 171 THR A 175 
C 3 LYS A 213 ? VAL A 216 ? LYS A 213 VAL A 216 
C 4 LEU A 207 ? LYS A 210 ? LEU A 207 LYS A 210 
D 1 LEU B 33  ? PHE B 37  ? LEU B 32  PHE B 36  
D 2 THR B 102 ? PHE B 107 ? THR B 101 PHE B 106 
D 3 MET B 53  ? GLU B 58  ? MET B 52  GLU B 57  
D 4 LEU B 83  ? GLY B 85  ? LEU B 82  GLY B 84  
E 1 ALA B 42  ? ILE B 44  ? ALA B 41  ILE B 43  
E 2 ILE B 94  ? ALA B 98  ? ILE B 93  ALA B 97  
E 3 ILE B 61  ? ILE B 66  ? ILE B 60  ILE B 65  
E 4 GLU B 72  ? ALA B 78  ? GLU B 71  ALA B 77  
F 1 LYS B 166 ? ARG B 167 ? LYS B 166 ARG B 167 
F 2 TYR B 172 ? THR B 175 ? TYR B 172 THR B 175 
F 3 LYS B 213 ? VAL B 216 ? LYS B 213 VAL B 216 
F 4 LEU B 207 ? LYS B 209 ? LEU B 207 LYS B 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 33  ? N LEU A 33  O TRP A 106 ? O TRP A 106 
A 2 3 O ARG A 103 ? O ARG A 103 N GLU A 58  ? N GLU A 58  
A 3 4 N ILE A 54  ? N ILE A 54  O ILE A 84  ? O ILE A 84  
B 1 2 N VAL A 43  ? N VAL A 43  O ALA A 96  ? O ALA A 96  
B 2 3 O THR A 97  ? O THR A 97  N LYS A 62  ? N LYS A 62  
B 3 4 N LEU A 63  ? N LEU A 63  O TYR A 76  ? O TYR A 76  
C 1 2 N LYS A 166 ? N LYS A 166 O GLU A 173 ? O GLU A 173 
C 2 3 N TYR A 172 ? N TYR A 172 O VAL A 216 ? O VAL A 216 
C 3 4 O ILE A 215 ? O ILE A 215 N ASP A 208 ? N ASP A 208 
D 1 2 N LEU B 33  ? N LEU B 32  O TRP B 106 ? O TRP B 105 
D 2 3 O PHE B 107 ? O PHE B 106 N MET B 53  ? N MET B 52  
D 3 4 N ILE B 54  ? N ILE B 53  O ILE B 84  ? O ILE B 83  
E 1 2 N VAL B 43  ? N VAL B 42  O ALA B 96  ? O ALA B 95  
E 2 3 O THR B 97  ? O THR B 96  N LYS B 62  ? N LYS B 61  
E 3 4 N ILE B 65  ? N ILE B 64  O LYS B 73  ? O LYS B 72  
F 1 2 N LYS B 166 ? N LYS B 166 O GLU B 173 ? O GLU B 173 
F 2 3 N TYR B 172 ? N TYR B 172 O VAL B 216 ? O VAL B 216 
F 3 4 O ILE B 215 ? O ILE B 215 N ASP B 208 ? N ASP B 208 
# 
_atom_sites.entry_id                    3E6D 
_atom_sites.fract_transf_matrix[1][1]   0.023283 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011518 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008038 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 18  ? -12.327 3.557   -2.446  1.00 45.47 ? 18  ASN A N   1 
ATOM   2    C CA  . ASN A 1 18  ? -12.810 4.346   -3.576  1.00 45.68 ? 18  ASN A CA  1 
ATOM   3    C C   . ASN A 1 18  ? -12.929 3.511   -4.850  1.00 39.12 ? 18  ASN A C   1 
ATOM   4    O O   . ASN A 1 18  ? -11.932 3.033   -5.392  1.00 40.43 ? 18  ASN A O   1 
ATOM   5    C CB  . ASN A 1 18  ? -11.918 5.572   -3.802  1.00 45.06 ? 18  ASN A CB  1 
ATOM   6    N N   . PHE A 1 19  ? -14.162 3.344   -5.320  1.00 41.11 ? 19  PHE A N   1 
ATOM   7    C CA  . PHE A 1 19  ? -14.445 2.510   -6.484  1.00 41.00 ? 19  PHE A CA  1 
ATOM   8    C C   . PHE A 1 19  ? -14.303 3.259   -7.805  1.00 39.93 ? 19  PHE A C   1 
ATOM   9    O O   . PHE A 1 19  ? -14.336 2.648   -8.872  1.00 38.47 ? 19  PHE A O   1 
ATOM   10   C CB  . PHE A 1 19  ? -15.852 1.911   -6.389  1.00 41.83 ? 19  PHE A CB  1 
ATOM   11   C CG  . PHE A 1 19  ? -16.035 0.970   -5.232  1.00 44.16 ? 19  PHE A CG  1 
ATOM   12   C CD1 . PHE A 1 19  ? -15.001 0.148   -4.820  1.00 42.54 ? 19  PHE A CD1 1 
ATOM   13   C CD2 . PHE A 1 19  ? -17.251 0.891   -4.572  1.00 47.86 ? 19  PHE A CD2 1 
ATOM   14   C CE1 . PHE A 1 19  ? -15.168 -0.721  -3.758  1.00 52.20 ? 19  PHE A CE1 1 
ATOM   15   C CE2 . PHE A 1 19  ? -17.427 0.022   -3.513  1.00 55.00 ? 19  PHE A CE2 1 
ATOM   16   C CZ  . PHE A 1 19  ? -16.384 -0.786  -3.105  1.00 59.12 ? 19  PHE A CZ  1 
ATOM   17   N N   . PHE A 1 20  ? -14.165 4.581   -7.732  1.00 44.70 ? 20  PHE A N   1 
ATOM   18   C CA  . PHE A 1 20  ? -14.031 5.409   -8.929  1.00 39.57 ? 20  PHE A CA  1 
ATOM   19   C C   . PHE A 1 20  ? -15.059 5.027   -9.987  1.00 42.04 ? 20  PHE A C   1 
ATOM   20   O O   . PHE A 1 20  ? -14.694 4.614   -11.086 1.00 43.67 ? 20  PHE A O   1 
ATOM   21   C CB  . PHE A 1 20  ? -12.632 5.259   -9.523  1.00 37.26 ? 20  PHE A CB  1 
ATOM   22   C CG  . PHE A 1 20  ? -11.522 5.627   -8.577  1.00 41.49 ? 20  PHE A CG  1 
ATOM   23   C CD1 . PHE A 1 20  ? -10.681 4.652   -8.061  1.00 35.44 ? 20  PHE A CD1 1 
ATOM   24   C CD2 . PHE A 1 20  ? -11.307 6.949   -8.218  1.00 39.89 ? 20  PHE A CD2 1 
ATOM   25   C CE1 . PHE A 1 20  ? -9.654  4.987   -7.198  1.00 36.50 ? 20  PHE A CE1 1 
ATOM   26   C CE2 . PHE A 1 20  ? -10.280 7.289   -7.356  1.00 40.25 ? 20  PHE A CE2 1 
ATOM   27   C CZ  . PHE A 1 20  ? -9.453  6.306   -6.845  1.00 37.95 ? 20  PHE A CZ  1 
ATOM   28   N N   . PRO A 1 21  ? -16.351 5.167   -9.665  1.00 44.46 ? 21  PRO A N   1 
ATOM   29   C CA  . PRO A 1 21  ? -17.366 4.642   -10.585 1.00 38.09 ? 21  PRO A CA  1 
ATOM   30   C C   . PRO A 1 21  ? -17.523 5.482   -11.838 1.00 37.77 ? 21  PRO A C   1 
ATOM   31   O O   . PRO A 1 21  ? -17.339 6.697   -11.793 1.00 40.03 ? 21  PRO A O   1 
ATOM   32   C CB  . PRO A 1 21  ? -18.654 4.703   -9.763  1.00 38.34 ? 21  PRO A CB  1 
ATOM   33   C CG  . PRO A 1 21  ? -18.418 5.756   -8.743  1.00 39.44 ? 21  PRO A CG  1 
ATOM   34   C CD  . PRO A 1 21  ? -16.940 5.823   -8.484  1.00 44.22 ? 21  PRO A CD  1 
ATOM   35   N N   . ILE A 1 22  ? -17.846 4.824   -12.945 1.00 38.08 ? 22  ILE A N   1 
ATOM   36   C CA  . ILE A 1 22  ? -18.233 5.501   -14.177 1.00 37.93 ? 22  ILE A CA  1 
ATOM   37   C C   . ILE A 1 22  ? -19.576 4.936   -14.646 1.00 40.59 ? 22  ILE A C   1 
ATOM   38   O O   . ILE A 1 22  ? -19.633 3.943   -15.369 1.00 39.00 ? 22  ILE A O   1 
ATOM   39   C CB  . ILE A 1 22  ? -17.144 5.371   -15.283 1.00 34.42 ? 22  ILE A CB  1 
ATOM   40   C CG1 . ILE A 1 22  ? -17.717 5.750   -16.649 1.00 36.77 ? 22  ILE A CG1 1 
ATOM   41   C CG2 . ILE A 1 22  ? -16.555 3.962   -15.307 1.00 36.06 ? 22  ILE A CG2 1 
ATOM   42   C CD1 . ILE A 1 22  ? -16.666 6.100   -17.686 1.00 32.85 ? 22  ILE A CD1 1 
ATOM   43   N N   . GLU A 1 23  ? -20.657 5.576   -14.212 1.00 47.15 ? 23  GLU A N   1 
ATOM   44   C CA  . GLU A 1 23  ? -22.012 5.084   -14.452 1.00 43.32 ? 23  GLU A CA  1 
ATOM   45   C C   . GLU A 1 23  ? -22.380 5.017   -15.933 1.00 42.16 ? 23  GLU A C   1 
ATOM   46   O O   . GLU A 1 23  ? -23.181 4.172   -16.348 1.00 37.10 ? 23  GLU A O   1 
ATOM   47   C CB  . GLU A 1 23  ? -23.037 5.960   -13.717 1.00 48.77 ? 23  GLU A CB  1 
ATOM   48   C CG  . GLU A 1 23  ? -22.991 5.863   -12.193 1.00 51.42 ? 23  GLU A CG  1 
ATOM   49   C CD  . GLU A 1 23  ? -22.023 6.851   -11.545 1.00 58.78 ? 23  GLU A CD  1 
ATOM   50   O OE1 . GLU A 1 23  ? -21.064 7.299   -12.217 1.00 54.17 ? 23  GLU A OE1 1 
ATOM   51   O OE2 . GLU A 1 23  ? -22.229 7.177   -10.353 1.00 57.47 ? 23  GLU A OE2 1 
ATOM   52   N N   . LYS A 1 24  ? -21.791 5.904   -16.728 1.00 35.85 ? 24  LYS A N   1 
ATOM   53   C CA  . LYS A 1 24  ? -22.188 6.071   -18.124 1.00 35.67 ? 24  LYS A CA  1 
ATOM   54   C C   . LYS A 1 24  ? -21.899 4.864   -19.018 1.00 38.49 ? 24  LYS A C   1 
ATOM   55   O O   . LYS A 1 24  ? -22.480 4.732   -20.096 1.00 31.52 ? 24  LYS A O   1 
ATOM   56   C CB  . LYS A 1 24  ? -21.548 7.331   -18.708 1.00 42.46 ? 24  LYS A CB  1 
ATOM   57   N N   . LEU A 1 25  ? -21.006 3.985   -18.578 1.00 33.07 ? 25  LEU A N   1 
ATOM   58   C CA  . LEU A 1 25  ? -20.668 2.809   -19.376 1.00 39.18 ? 25  LEU A CA  1 
ATOM   59   C C   . LEU A 1 25  ? -21.801 1.783   -19.418 1.00 37.81 ? 25  LEU A C   1 
ATOM   60   O O   . LEU A 1 25  ? -21.811 0.897   -20.272 1.00 40.75 ? 25  LEU A O   1 
ATOM   61   C CB  . LEU A 1 25  ? -19.372 2.163   -18.882 1.00 35.42 ? 25  LEU A CB  1 
ATOM   62   C CG  . LEU A 1 25  ? -18.106 2.605   -19.611 1.00 38.40 ? 25  LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 25  ? -16.882 1.979   -18.965 1.00 38.57 ? 25  LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 25  ? -18.191 2.236   -21.086 1.00 28.72 ? 25  LEU A CD2 1 
ATOM   65   N N   . ARG A 1 26  ? -22.753 1.909   -18.496 1.00 40.16 ? 26  ARG A N   1 
ATOM   66   C CA  . ARG A 1 26  ? -23.899 1.003   -18.445 1.00 40.91 ? 26  ARG A CA  1 
ATOM   67   C C   . ARG A 1 26  ? -24.768 1.161   -19.685 1.00 41.06 ? 26  ARG A C   1 
ATOM   68   O O   . ARG A 1 26  ? -25.540 0.270   -20.032 1.00 38.15 ? 26  ARG A O   1 
ATOM   69   C CB  . ARG A 1 26  ? -24.737 1.254   -17.186 1.00 43.49 ? 26  ARG A CB  1 
ATOM   70   C CG  . ARG A 1 26  ? -23.994 1.006   -15.885 1.00 40.10 ? 26  ARG A CG  1 
ATOM   71   C CD  . ARG A 1 26  ? -24.730 1.595   -14.685 1.00 49.94 ? 26  ARG A CD  1 
ATOM   72   N NE  . ARG A 1 26  ? -25.797 0.723   -14.200 1.00 53.31 ? 26  ARG A NE  1 
ATOM   73   C CZ  . ARG A 1 26  ? -25.599 -0.328  -13.412 1.00 53.04 ? 26  ARG A CZ  1 
ATOM   74   N NH1 . ARG A 1 26  ? -24.372 -0.641  -13.019 1.00 53.05 ? 26  ARG A NH1 1 
ATOM   75   N NH2 . ARG A 1 26  ? -26.626 -1.068  -13.018 1.00 56.26 ? 26  ARG A NH2 1 
ATOM   76   N N   . ASN A 1 27  ? -24.636 2.303   -20.351 1.00 40.79 ? 27  ASN A N   1 
ATOM   77   C CA  . ASN A 1 27  ? -25.412 2.583   -21.551 1.00 38.14 ? 27  ASN A CA  1 
ATOM   78   C C   . ASN A 1 27  ? -24.836 1.920   -22.793 1.00 38.46 ? 27  ASN A C   1 
ATOM   79   O O   . ASN A 1 27  ? -25.376 2.071   -23.888 1.00 41.39 ? 27  ASN A O   1 
ATOM   80   C CB  . ASN A 1 27  ? -25.510 4.092   -21.779 1.00 44.07 ? 27  ASN A CB  1 
ATOM   81   C CG  . ASN A 1 27  ? -26.226 4.808   -20.647 1.00 49.29 ? 27  ASN A CG  1 
ATOM   82   O OD1 . ASN A 1 27  ? -25.941 5.968   -20.352 1.00 51.52 ? 27  ASN A OD1 1 
ATOM   83   N ND2 . ASN A 1 27  ? -27.159 4.115   -20.002 1.00 44.88 ? 27  ASN A ND2 1 
ATOM   84   N N   . TYR A 1 28  ? -23.743 1.180   -22.621 1.00 38.98 ? 28  TYR A N   1 
ATOM   85   C CA  . TYR A 1 28  ? -23.021 0.624   -23.762 1.00 41.45 ? 28  TYR A CA  1 
ATOM   86   C C   . TYR A 1 28  ? -22.566 -0.814  -23.553 1.00 40.76 ? 28  TYR A C   1 
ATOM   87   O O   . TYR A 1 28  ? -21.758 -1.338  -24.326 1.00 37.65 ? 28  TYR A O   1 
ATOM   88   C CB  . TYR A 1 28  ? -21.834 1.522   -24.122 1.00 35.63 ? 28  TYR A CB  1 
ATOM   89   C CG  . TYR A 1 28  ? -22.277 2.885   -24.575 1.00 33.04 ? 28  TYR A CG  1 
ATOM   90   C CD1 . TYR A 1 28  ? -22.304 3.957   -23.696 1.00 34.90 ? 28  TYR A CD1 1 
ATOM   91   C CD2 . TYR A 1 28  ? -22.704 3.094   -25.878 1.00 37.25 ? 28  TYR A CD2 1 
ATOM   92   C CE1 . TYR A 1 28  ? -22.726 5.207   -24.111 1.00 35.27 ? 28  TYR A CE1 1 
ATOM   93   C CE2 . TYR A 1 28  ? -23.128 4.338   -26.301 1.00 35.35 ? 28  TYR A CE2 1 
ATOM   94   C CZ  . TYR A 1 28  ? -23.142 5.389   -25.414 1.00 31.98 ? 28  TYR A CZ  1 
ATOM   95   O OH  . TYR A 1 28  ? -23.570 6.630   -25.834 1.00 32.89 ? 28  TYR A OH  1 
ATOM   96   N N   . THR A 1 29  ? -23.095 -1.456  -22.518 1.00 42.51 ? 29  THR A N   1 
ATOM   97   C CA  . THR A 1 29  ? -22.740 -2.843  -22.235 1.00 41.19 ? 29  THR A CA  1 
ATOM   98   C C   . THR A 1 29  ? -23.196 -3.807  -23.335 1.00 37.49 ? 29  THR A C   1 
ATOM   99   O O   . THR A 1 29  ? -22.776 -4.963  -23.358 1.00 42.46 ? 29  THR A O   1 
ATOM   100  C CB  . THR A 1 29  ? -23.287 -3.312  -20.864 1.00 41.87 ? 29  THR A CB  1 
ATOM   101  O OG1 . THR A 1 29  ? -24.697 -3.063  -20.794 1.00 41.26 ? 29  THR A OG1 1 
ATOM   102  C CG2 . THR A 1 29  ? -22.594 -2.572  -19.736 1.00 41.48 ? 29  THR A CG2 1 
ATOM   103  N N   . GLN A 1 30  ? -24.042 -3.335  -24.249 1.00 37.42 ? 30  GLN A N   1 
ATOM   104  C CA  . GLN A 1 30  ? -24.511 -4.179  -25.349 1.00 40.27 ? 30  GLN A CA  1 
ATOM   105  C C   . GLN A 1 30  ? -23.435 -4.341  -26.410 1.00 40.99 ? 30  GLN A C   1 
ATOM   106  O O   . GLN A 1 30  ? -23.619 -5.069  -27.386 1.00 40.24 ? 30  GLN A O   1 
ATOM   107  C CB  . GLN A 1 30  ? -25.764 -3.595  -26.009 1.00 39.10 ? 30  GLN A CB  1 
ATOM   108  C CG  . GLN A 1 30  ? -26.517 -2.595  -25.164 1.00 48.95 ? 30  GLN A CG  1 
ATOM   109  C CD  . GLN A 1 30  ? -25.996 -1.185  -25.342 1.00 43.92 ? 30  GLN A CD  1 
ATOM   110  O OE1 . GLN A 1 30  ? -25.932 -0.665  -26.456 1.00 48.74 ? 30  GLN A OE1 1 
ATOM   111  N NE2 . GLN A 1 30  ? -25.628 -0.554  -24.239 1.00 43.72 ? 30  GLN A NE2 1 
ATOM   112  N N   . MET A 1 31  ? -22.314 -3.654  -26.220 1.00 44.28 ? 31  MET A N   1 
ATOM   113  C CA  . MET A 1 31  ? -21.245 -3.656  -27.209 1.00 38.56 ? 31  MET A CA  1 
ATOM   114  C C   . MET A 1 31  ? -20.047 -4.478  -26.745 1.00 37.59 ? 31  MET A C   1 
ATOM   115  O O   . MET A 1 31  ? -19.137 -4.760  -27.524 1.00 34.36 ? 31  MET A O   1 
ATOM   116  C CB  . MET A 1 31  ? -20.835 -2.217  -27.531 1.00 41.92 ? 31  MET A CB  1 
ATOM   117  C CG  . MET A 1 31  ? -22.019 -1.259  -27.514 1.00 44.13 ? 31  MET A CG  1 
ATOM   118  S SD  . MET A 1 31  ? -21.847 0.149   -28.618 1.00 41.98 ? 31  MET A SD  1 
ATOM   119  C CE  . MET A 1 31  ? -23.438 0.941   -28.400 1.00 47.77 ? 31  MET A CE  1 
ATOM   120  N N   . GLY A 1 32  ? -20.052 -4.863  -25.475 1.00 31.50 ? 32  GLY A N   1 
ATOM   121  C CA  . GLY A 1 32  ? -19.015 -5.731  -24.950 1.00 33.22 ? 32  GLY A CA  1 
ATOM   122  C C   . GLY A 1 32  ? -19.540 -7.136  -24.716 1.00 39.46 ? 32  GLY A C   1 
ATOM   123  O O   . GLY A 1 32  ? -20.634 -7.486  -25.161 1.00 34.03 ? 32  GLY A O   1 
ATOM   124  N N   . LEU A 1 33  ? -18.750 -7.947  -24.022 1.00 41.23 ? 33  LEU A N   1 
ATOM   125  C CA  . LEU A 1 33  ? -19.147 -9.307  -23.684 1.00 41.57 ? 33  LEU A CA  1 
ATOM   126  C C   . LEU A 1 33  ? -19.525 -9.381  -22.210 1.00 44.00 ? 33  LEU A C   1 
ATOM   127  O O   . LEU A 1 33  ? -18.722 -9.043  -21.341 1.00 41.23 ? 33  LEU A O   1 
ATOM   128  C CB  . LEU A 1 33  ? -18.001 -10.281 -23.968 1.00 43.66 ? 33  LEU A CB  1 
ATOM   129  C CG  . LEU A 1 33  ? -18.235 -11.737 -23.548 1.00 50.88 ? 33  LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 33  ? -18.862 -12.538 -24.682 1.00 48.31 ? 33  LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 33  ? -16.929 -12.383 -23.104 1.00 48.29 ? 33  LEU A CD2 1 
ATOM   132  N N   . ILE A 1 34  ? -20.751 -9.810  -21.932 1.00 43.55 ? 34  ILE A N   1 
ATOM   133  C CA  . ILE A 1 34  ? -21.202 -9.987  -20.558 1.00 47.38 ? 34  ILE A CA  1 
ATOM   134  C C   . ILE A 1 34  ? -20.553 -11.222 -19.932 1.00 43.83 ? 34  ILE A C   1 
ATOM   135  O O   . ILE A 1 34  ? -20.426 -12.261 -20.578 1.00 42.74 ? 34  ILE A O   1 
ATOM   136  C CB  . ILE A 1 34  ? -22.741 -10.120 -20.482 1.00 45.79 ? 34  ILE A CB  1 
ATOM   137  C CG1 . ILE A 1 34  ? -23.417 -8.850  -21.003 1.00 45.80 ? 34  ILE A CG1 1 
ATOM   138  C CG2 . ILE A 1 34  ? -23.182 -10.401 -19.055 1.00 50.65 ? 34  ILE A CG2 1 
ATOM   139  C CD1 . ILE A 1 34  ? -23.213 -7.636  -20.110 1.00 46.63 ? 34  ILE A CD1 1 
ATOM   140  N N   . ARG A 1 35  ? -20.134 -11.101 -18.676 1.00 42.86 ? 35  ARG A N   1 
ATOM   141  C CA  . ARG A 1 35  ? -19.546 -12.225 -17.954 1.00 42.56 ? 35  ARG A CA  1 
ATOM   142  C C   . ARG A 1 35  ? -19.919 -12.196 -16.473 1.00 46.30 ? 35  ARG A C   1 
ATOM   143  O O   . ARG A 1 35  ? -19.601 -11.240 -15.763 1.00 43.70 ? 35  ARG A O   1 
ATOM   144  C CB  . ARG A 1 35  ? -18.022 -12.224 -18.098 1.00 39.67 ? 35  ARG A CB  1 
ATOM   145  C CG  . ARG A 1 35  ? -17.511 -12.371 -19.525 1.00 41.81 ? 35  ARG A CG  1 
ATOM   146  C CD  . ARG A 1 35  ? -16.040 -12.771 -19.529 1.00 40.78 ? 35  ARG A CD  1 
ATOM   147  N NE  . ARG A 1 35  ? -15.843 -14.049 -18.852 1.00 40.89 ? 35  ARG A NE  1 
ATOM   148  C CZ  . ARG A 1 35  ? -14.664 -14.525 -18.469 1.00 45.68 ? 35  ARG A CZ  1 
ATOM   149  N NH1 . ARG A 1 35  ? -13.557 -13.825 -18.690 1.00 44.62 ? 35  ARG A NH1 1 
ATOM   150  N NH2 . ARG A 1 35  ? -14.595 -15.701 -17.858 1.00 47.90 ? 35  ARG A NH2 1 
ATOM   151  N N   . ASP A 1 36  ? -20.588 -13.246 -16.007 1.00 45.06 ? 36  ASP A N   1 
ATOM   152  C CA  . ASP A 1 36  ? -20.934 -13.357 -14.592 1.00 46.17 ? 36  ASP A CA  1 
ATOM   153  C C   . ASP A 1 36  ? -19.969 -14.266 -13.835 1.00 46.88 ? 36  ASP A C   1 
ATOM   154  O O   . ASP A 1 36  ? -19.528 -15.287 -14.356 1.00 48.16 ? 36  ASP A O   1 
ATOM   155  C CB  . ASP A 1 36  ? -22.368 -13.857 -14.420 1.00 47.00 ? 36  ASP A CB  1 
ATOM   156  C CG  . ASP A 1 36  ? -23.381 -12.734 -14.440 1.00 54.91 ? 36  ASP A CG  1 
ATOM   157  O OD1 . ASP A 1 36  ? -23.301 -11.864 -15.336 1.00 57.25 ? 36  ASP A OD1 1 
ATOM   158  O OD2 . ASP A 1 36  ? -24.263 -12.723 -13.555 1.00 58.81 ? 36  ASP A OD2 1 
ATOM   159  N N   . PHE A 1 37  ? -19.649 -13.884 -12.602 1.00 50.03 ? 37  PHE A N   1 
ATOM   160  C CA  . PHE A 1 37  ? -18.738 -14.656 -11.763 1.00 50.89 ? 37  PHE A CA  1 
ATOM   161  C C   . PHE A 1 37  ? -19.367 -14.975 -10.410 1.00 50.75 ? 37  PHE A C   1 
ATOM   162  O O   . PHE A 1 37  ? -19.842 -14.079 -9.709  1.00 51.60 ? 37  PHE A O   1 
ATOM   163  C CB  . PHE A 1 37  ? -17.431 -13.892 -11.545 1.00 49.06 ? 37  PHE A CB  1 
ATOM   164  C CG  . PHE A 1 37  ? -16.593 -13.748 -12.784 1.00 49.59 ? 37  PHE A CG  1 
ATOM   165  C CD1 . PHE A 1 37  ? -16.662 -12.596 -13.551 1.00 48.66 ? 37  PHE A CD1 1 
ATOM   166  C CD2 . PHE A 1 37  ? -15.732 -14.759 -13.177 1.00 48.96 ? 37  PHE A CD2 1 
ATOM   167  C CE1 . PHE A 1 37  ? -15.891 -12.456 -14.688 1.00 44.51 ? 37  PHE A CE1 1 
ATOM   168  C CE2 . PHE A 1 37  ? -14.958 -14.628 -14.315 1.00 42.93 ? 37  PHE A CE2 1 
ATOM   169  C CZ  . PHE A 1 37  ? -15.037 -13.473 -15.071 1.00 47.52 ? 37  PHE A CZ  1 
ATOM   170  N N   . ALA A 1 38  ? -19.362 -16.252 -10.043 1.00 46.34 ? 38  ALA A N   1 
ATOM   171  C CA  . ALA A 1 38  ? -19.896 -16.663 -8.753  1.00 52.02 ? 38  ALA A CA  1 
ATOM   172  C C   . ALA A 1 38  ? -18.860 -16.416 -7.667  1.00 52.97 ? 38  ALA A C   1 
ATOM   173  O O   . ALA A 1 38  ? -17.659 -16.447 -7.931  1.00 54.59 ? 38  ALA A O   1 
ATOM   174  C CB  . ALA A 1 38  ? -20.298 -18.126 -8.785  1.00 57.16 ? 38  ALA A CB  1 
ATOM   175  N N   . LYS A 1 39  ? -19.329 -16.161 -6.449  1.00 54.41 ? 39  LYS A N   1 
ATOM   176  C CA  . LYS A 1 39  ? -18.442 -15.939 -5.313  1.00 54.84 ? 39  LYS A CA  1 
ATOM   177  C C   . LYS A 1 39  ? -17.344 -16.993 -5.277  1.00 54.23 ? 39  LYS A C   1 
ATOM   178  O O   . LYS A 1 39  ? -17.623 -18.190 -5.240  1.00 57.99 ? 39  LYS A O   1 
ATOM   179  C CB  . LYS A 1 39  ? -19.236 -15.957 -4.006  1.00 59.09 ? 39  LYS A CB  1 
ATOM   180  C CG  . LYS A 1 39  ? -18.424 -15.588 -2.774  1.00 57.92 ? 39  LYS A CG  1 
ATOM   181  C CD  . LYS A 1 39  ? -19.338 -15.212 -1.615  1.00 58.46 ? 39  LYS A CD  1 
ATOM   182  C CE  . LYS A 1 39  ? -18.547 -14.819 -0.377  1.00 65.42 ? 39  LYS A CE  1 
ATOM   183  N NZ  . LYS A 1 39  ? -17.811 -15.980 0.198   1.00 68.09 ? 39  LYS A NZ  1 
ATOM   184  N N   . GLY A 1 40  ? -16.095 -16.539 -5.304  1.00 57.41 ? 40  GLY A N   1 
ATOM   185  C CA  . GLY A 1 40  ? -14.953 -17.435 -5.306  1.00 45.60 ? 40  GLY A CA  1 
ATOM   186  C C   . GLY A 1 40  ? -14.287 -17.534 -6.664  1.00 52.25 ? 40  GLY A C   1 
ATOM   187  O O   . GLY A 1 40  ? -13.071 -17.713 -6.758  1.00 54.51 ? 40  GLY A O   1 
ATOM   188  N N   . SER A 1 41  ? -15.085 -17.425 -7.722  1.00 54.96 ? 41  SER A N   1 
ATOM   189  C CA  . SER A 1 41  ? -14.554 -17.475 -9.081  1.00 51.09 ? 41  SER A CA  1 
ATOM   190  C C   . SER A 1 41  ? -13.383 -16.518 -9.264  1.00 52.83 ? 41  SER A C   1 
ATOM   191  O O   . SER A 1 41  ? -13.303 -15.470 -8.618  1.00 50.44 ? 41  SER A O   1 
ATOM   192  C CB  . SER A 1 41  ? -15.642 -17.156 -10.111 1.00 54.15 ? 41  SER A CB  1 
ATOM   193  O OG  . SER A 1 41  ? -16.352 -18.325 -10.489 1.00 56.65 ? 41  SER A OG  1 
ATOM   194  N N   . ALA A 1 42  ? -12.467 -16.896 -10.146 1.00 52.78 ? 42  ALA A N   1 
ATOM   195  C CA  . ALA A 1 42  ? -11.384 -16.013 -10.528 1.00 51.81 ? 42  ALA A CA  1 
ATOM   196  C C   . ALA A 1 42  ? -11.835 -15.179 -11.723 1.00 51.78 ? 42  ALA A C   1 
ATOM   197  O O   . ALA A 1 42  ? -12.345 -15.710 -12.711 1.00 48.09 ? 42  ALA A O   1 
ATOM   198  C CB  . ALA A 1 42  ? -10.135 -16.814 -10.865 1.00 45.50 ? 42  ALA A CB  1 
ATOM   199  N N   . VAL A 1 43  ? -11.672 -13.867 -11.614 1.00 46.11 ? 43  VAL A N   1 
ATOM   200  C CA  . VAL A 1 43  ? -11.973 -12.970 -12.720 1.00 44.34 ? 43  VAL A CA  1 
ATOM   201  C C   . VAL A 1 43  ? -10.736 -12.855 -13.600 1.00 44.84 ? 43  VAL A C   1 
ATOM   202  O O   . VAL A 1 43  ? -10.829 -12.710 -14.820 1.00 43.32 ? 43  VAL A O   1 
ATOM   203  C CB  . VAL A 1 43  ? -12.373 -11.581 -12.210 1.00 46.25 ? 43  VAL A CB  1 
ATOM   204  C CG1 . VAL A 1 43  ? -12.740 -10.669 -13.371 1.00 48.37 ? 43  VAL A CG1 1 
ATOM   205  C CG2 . VAL A 1 43  ? -13.528 -11.698 -11.230 1.00 46.65 ? 43  VAL A CG2 1 
ATOM   206  N N   . ILE A 1 44  ? -9.573  -12.934 -12.963 1.00 50.05 ? 44  ILE A N   1 
ATOM   207  C CA  . ILE A 1 44  ? -8.300  -12.847 -13.660 1.00 50.33 ? 44  ILE A CA  1 
ATOM   208  C C   . ILE A 1 44  ? -7.303  -13.818 -13.042 1.00 50.90 ? 44  ILE A C   1 
ATOM   209  O O   . ILE A 1 44  ? -6.890  -13.649 -11.894 1.00 52.65 ? 44  ILE A O   1 
ATOM   210  C CB  . ILE A 1 44  ? -7.720  -11.421 -13.589 1.00 47.90 ? 44  ILE A CB  1 
ATOM   211  C CG1 . ILE A 1 44  ? -8.733  -10.403 -14.113 1.00 45.70 ? 44  ILE A CG1 1 
ATOM   212  C CG2 . ILE A 1 44  ? -6.417  -11.331 -14.370 1.00 48.94 ? 44  ILE A CG2 1 
ATOM   213  C CD1 . ILE A 1 44  ? -8.502  -8.998  -13.609 1.00 43.97 ? 44  ILE A CD1 1 
ATOM   214  N N   . MET A 1 45  ? -6.932  -14.842 -13.803 1.00 53.19 ? 45  MET A N   1 
ATOM   215  C CA  . MET A 1 45  ? -5.905  -15.785 -13.379 1.00 55.63 ? 45  MET A CA  1 
ATOM   216  C C   . MET A 1 45  ? -4.534  -15.130 -13.463 1.00 53.23 ? 45  MET A C   1 
ATOM   217  O O   . MET A 1 45  ? -4.263  -14.362 -14.383 1.00 52.81 ? 45  MET A O   1 
ATOM   218  C CB  . MET A 1 45  ? -5.929  -17.046 -14.248 1.00 58.34 ? 45  MET A CB  1 
ATOM   219  C CG  . MET A 1 45  ? -7.110  -17.977 -13.992 1.00 60.80 ? 45  MET A CG  1 
ATOM   220  S SD  . MET A 1 45  ? -6.988  -19.519 -14.930 1.00 91.90 ? 45  MET A SD  1 
ATOM   221  C CE  . MET A 1 45  ? -7.213  -18.928 -16.608 1.00 67.54 ? 45  MET A CE  1 
ATOM   222  N N   . PRO A 1 46  ? -3.662  -15.426 -12.492 1.00 51.39 ? 46  PRO A N   1 
ATOM   223  C CA  . PRO A 1 46  ? -2.309  -14.865 -12.517 1.00 53.69 ? 46  PRO A CA  1 
ATOM   224  C C   . PRO A 1 46  ? -1.553  -15.381 -13.732 1.00 50.61 ? 46  PRO A C   1 
ATOM   225  O O   . PRO A 1 46  ? -1.585  -16.579 -14.008 1.00 53.66 ? 46  PRO A O   1 
ATOM   226  C CB  . PRO A 1 46  ? -1.677  -15.407 -11.230 1.00 55.85 ? 46  PRO A CB  1 
ATOM   227  C CG  . PRO A 1 46  ? -2.827  -15.794 -10.363 1.00 53.36 ? 46  PRO A CG  1 
ATOM   228  C CD  . PRO A 1 46  ? -3.905  -16.247 -11.296 1.00 57.32 ? 46  PRO A CD  1 
ATOM   229  N N   . GLY A 1 47  ? -0.887  -14.487 -14.452 1.00 51.30 ? 47  GLY A N   1 
ATOM   230  C CA  . GLY A 1 47  ? -0.179  -14.874 -15.656 1.00 50.77 ? 47  GLY A CA  1 
ATOM   231  C C   . GLY A 1 47  ? -1.104  -14.904 -16.857 1.00 53.19 ? 47  GLY A C   1 
ATOM   232  O O   . GLY A 1 47  ? -0.651  -14.996 -17.997 1.00 55.26 ? 47  GLY A O   1 
ATOM   233  N N   . GLU A 1 48  ? -2.407  -14.834 -16.599 1.00 51.55 ? 48  GLU A N   1 
ATOM   234  C CA  . GLU A 1 48  ? -3.393  -14.762 -17.673 1.00 54.32 ? 48  GLU A CA  1 
ATOM   235  C C   . GLU A 1 48  ? -3.345  -13.408 -18.372 1.00 53.73 ? 48  GLU A C   1 
ATOM   236  O O   . GLU A 1 48  ? -3.475  -12.362 -17.736 1.00 48.42 ? 48  GLU A O   1 
ATOM   237  C CB  . GLU A 1 48  ? -4.806  -15.013 -17.148 1.00 51.59 ? 48  GLU A CB  1 
ATOM   238  C CG  . GLU A 1 48  ? -5.881  -14.384 -18.022 1.00 50.24 ? 48  GLU A CG  1 
ATOM   239  C CD  . GLU A 1 48  ? -7.284  -14.656 -17.529 1.00 50.42 ? 48  GLU A CD  1 
ATOM   240  O OE1 . GLU A 1 48  ? -7.481  -14.766 -16.302 1.00 54.65 ? 48  GLU A OE1 1 
ATOM   241  O OE2 . GLU A 1 48  ? -8.195  -14.756 -18.375 1.00 46.28 ? 48  GLU A OE2 1 
ATOM   242  N N   . GLU A 1 49  ? -3.170  -13.439 -19.687 1.00 51.75 ? 49  GLU A N   1 
ATOM   243  C CA  . GLU A 1 49  ? -3.067  -12.220 -20.474 1.00 51.25 ? 49  GLU A CA  1 
ATOM   244  C C   . GLU A 1 49  ? -4.428  -11.549 -20.681 1.00 48.00 ? 49  GLU A C   1 
ATOM   245  O O   . GLU A 1 49  ? -5.304  -12.091 -21.356 1.00 46.08 ? 49  GLU A O   1 
ATOM   246  C CB  . GLU A 1 49  ? -2.419  -12.520 -21.825 1.00 53.36 ? 49  GLU A CB  1 
ATOM   247  C CG  . GLU A 1 49  ? -2.350  -11.320 -22.747 1.00 53.73 ? 49  GLU A CG  1 
ATOM   248  C CD  . GLU A 1 49  ? -2.344  -11.716 -24.206 1.00 64.65 ? 49  GLU A CD  1 
ATOM   249  O OE1 . GLU A 1 49  ? -2.323  -12.932 -24.490 1.00 71.33 ? 49  GLU A OE1 1 
ATOM   250  O OE2 . GLU A 1 49  ? -2.362  -10.813 -25.069 1.00 68.74 ? 49  GLU A OE2 1 
ATOM   251  N N   . ILE A 1 50  ? -4.592  -10.366 -20.100 1.00 41.32 ? 50  ILE A N   1 
ATOM   252  C CA  . ILE A 1 50  ? -5.830  -9.610  -20.236 1.00 38.67 ? 50  ILE A CA  1 
ATOM   253  C C   . ILE A 1 50  ? -5.661  -8.479  -21.243 1.00 35.46 ? 50  ILE A C   1 
ATOM   254  O O   . ILE A 1 50  ? -4.739  -7.670  -21.134 1.00 35.19 ? 50  ILE A O   1 
ATOM   255  C CB  . ILE A 1 50  ? -6.282  -9.011  -18.889 1.00 37.05 ? 50  ILE A CB  1 
ATOM   256  C CG1 . ILE A 1 50  ? -6.580  -10.121 -17.884 1.00 41.27 ? 50  ILE A CG1 1 
ATOM   257  C CG2 . ILE A 1 50  ? -7.514  -8.127  -19.081 1.00 36.72 ? 50  ILE A CG2 1 
ATOM   258  C CD1 . ILE A 1 50  ? -7.725  -11.024 -18.301 1.00 37.91 ? 50  ILE A CD1 1 
ATOM   259  N N   . THR A 1 51  ? -6.551  -8.438  -22.230 1.00 33.11 ? 51  THR A N   1 
ATOM   260  C CA  . THR A 1 51  ? -6.551  -7.366  -23.218 1.00 32.09 ? 51  THR A CA  1 
ATOM   261  C C   . THR A 1 51  ? -7.919  -6.697  -23.268 1.00 30.04 ? 51  THR A C   1 
ATOM   262  O O   . THR A 1 51  ? -8.325  -6.171  -24.305 1.00 31.59 ? 51  THR A O   1 
ATOM   263  C CB  . THR A 1 51  ? -6.219  -7.886  -24.628 1.00 34.10 ? 51  THR A CB  1 
ATOM   264  O OG1 . THR A 1 51  ? -7.203  -8.847  -25.028 1.00 29.35 ? 51  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 51  ? -4.829  -8.523  -24.664 1.00 36.30 ? 51  THR A CG2 1 
ATOM   266  N N   . SER A 1 52  ? -8.632  -6.736  -22.148 1.00 28.68 ? 52  SER A N   1 
ATOM   267  C CA  . SER A 1 52  ? -9.973  -6.165  -22.071 1.00 29.63 ? 52  SER A CA  1 
ATOM   268  C C   . SER A 1 52  ? -10.174 -5.317  -20.821 1.00 31.09 ? 52  SER A C   1 
ATOM   269  O O   . SER A 1 52  ? -9.720  -5.672  -19.728 1.00 31.59 ? 52  SER A O   1 
ATOM   270  C CB  . SER A 1 52  ? -11.033 -7.273  -22.110 1.00 35.35 ? 52  SER A CB  1 
ATOM   271  O OG  . SER A 1 52  ? -11.192 -7.779  -23.431 1.00 39.82 ? 52  SER A OG  1 
ATOM   272  N N   . MET A 1 53  ? -10.853 -4.190  -20.995 1.00 31.47 ? 53  MET A N   1 
ATOM   273  C CA  . MET A 1 53  ? -11.311 -3.390  -19.872 1.00 31.73 ? 53  MET A CA  1 
ATOM   274  C C   . MET A 1 53  ? -12.503 -4.112  -19.273 1.00 34.95 ? 53  MET A C   1 
ATOM   275  O O   . MET A 1 53  ? -13.390 -4.553  -20.002 1.00 31.36 ? 53  MET A O   1 
ATOM   276  C CB  . MET A 1 53  ? -11.725 -1.996  -20.345 1.00 32.45 ? 53  MET A CB  1 
ATOM   277  C CG  . MET A 1 53  ? -10.586 -1.214  -20.965 1.00 38.06 ? 53  MET A CG  1 
ATOM   278  S SD  . MET A 1 53  ? -9.184  -1.179  -19.839 1.00 36.78 ? 53  MET A SD  1 
ATOM   279  C CE  . MET A 1 53  ? -9.914  -0.287  -18.471 1.00 38.12 ? 53  MET A CE  1 
ATOM   280  N N   . ILE A 1 54  ? -12.519 -4.244  -17.950 1.00 34.51 ? 54  ILE A N   1 
ATOM   281  C CA  . ILE A 1 54  ? -13.597 -4.958  -17.274 1.00 32.93 ? 54  ILE A CA  1 
ATOM   282  C C   . ILE A 1 54  ? -14.470 -4.025  -16.440 1.00 33.90 ? 54  ILE A C   1 
ATOM   283  O O   . ILE A 1 54  ? -14.005 -3.396  -15.489 1.00 35.73 ? 54  ILE A O   1 
ATOM   284  C CB  . ILE A 1 54  ? -13.054 -6.092  -16.389 1.00 32.95 ? 54  ILE A CB  1 
ATOM   285  C CG1 . ILE A 1 54  ? -12.058 -6.942  -17.183 1.00 33.70 ? 54  ILE A CG1 1 
ATOM   286  C CG2 . ILE A 1 54  ? -14.199 -6.953  -15.875 1.00 34.91 ? 54  ILE A CG2 1 
ATOM   287  C CD1 . ILE A 1 54  ? -11.304 -7.950  -16.347 1.00 31.48 ? 54  ILE A CD1 1 
ATOM   288  N N   . PHE A 1 55  ? -15.743 -3.952  -16.808 1.00 37.07 ? 55  PHE A N   1 
ATOM   289  C CA  . PHE A 1 55  ? -16.688 -3.039  -16.178 1.00 35.94 ? 55  PHE A CA  1 
ATOM   290  C C   . PHE A 1 55  ? -17.576 -3.771  -15.181 1.00 38.38 ? 55  PHE A C   1 
ATOM   291  O O   . PHE A 1 55  ? -18.425 -4.576  -15.564 1.00 38.59 ? 55  PHE A O   1 
ATOM   292  C CB  . PHE A 1 55  ? -17.548 -2.371  -17.252 1.00 32.47 ? 55  PHE A CB  1 
ATOM   293  C CG  . PHE A 1 55  ? -18.534 -1.370  -16.716 1.00 42.93 ? 55  PHE A CG  1 
ATOM   294  C CD1 . PHE A 1 55  ? -18.110 -0.304  -15.937 1.00 37.46 ? 55  PHE A CD1 1 
ATOM   295  C CD2 . PHE A 1 55  ? -19.886 -1.483  -17.012 1.00 37.95 ? 55  PHE A CD2 1 
ATOM   296  C CE1 . PHE A 1 55  ? -19.014 0.622   -15.454 1.00 38.64 ? 55  PHE A CE1 1 
ATOM   297  C CE2 . PHE A 1 55  ? -20.794 -0.562  -16.530 1.00 37.98 ? 55  PHE A CE2 1 
ATOM   298  C CZ  . PHE A 1 55  ? -20.358 0.494   -15.751 1.00 38.38 ? 55  PHE A CZ  1 
ATOM   299  N N   . LEU A 1 56  ? -17.383 -3.472  -13.900 1.00 37.09 ? 56  LEU A N   1 
ATOM   300  C CA  . LEU A 1 56  ? -18.148 -4.105  -12.832 1.00 40.65 ? 56  LEU A CA  1 
ATOM   301  C C   . LEU A 1 56  ? -19.518 -3.452  -12.671 1.00 45.40 ? 56  LEU A C   1 
ATOM   302  O O   . LEU A 1 56  ? -19.678 -2.507  -11.900 1.00 44.92 ? 56  LEU A O   1 
ATOM   303  C CB  . LEU A 1 56  ? -17.367 -4.028  -11.521 1.00 41.72 ? 56  LEU A CB  1 
ATOM   304  C CG  . LEU A 1 56  ? -17.457 -5.209  -10.558 1.00 42.54 ? 56  LEU A CG  1 
ATOM   305  C CD1 . LEU A 1 56  ? -16.236 -5.246  -9.654  1.00 46.46 ? 56  LEU A CD1 1 
ATOM   306  C CD2 . LEU A 1 56  ? -18.740 -5.151  -9.739  1.00 47.57 ? 56  LEU A CD2 1 
ATOM   307  N N   . VAL A 1 57  ? -20.504 -3.952  -13.408 1.00 43.99 ? 57  VAL A N   1 
ATOM   308  C CA  . VAL A 1 57  ? -21.856 -3.408  -13.330 1.00 45.95 ? 57  VAL A CA  1 
ATOM   309  C C   . VAL A 1 57  ? -22.574 -3.802  -12.033 1.00 51.41 ? 57  VAL A C   1 
ATOM   310  O O   . VAL A 1 57  ? -23.269 -2.984  -11.432 1.00 51.39 ? 57  VAL A O   1 
ATOM   311  C CB  . VAL A 1 57  ? -22.700 -3.774  -14.576 1.00 44.29 ? 57  VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 57  ? -21.999 -4.829  -15.409 1.00 44.30 ? 57  VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 57  ? -24.102 -4.215  -14.174 1.00 45.50 ? 57  VAL A CG2 1 
ATOM   314  N N   . GLU A 1 58  ? -22.390 -5.046  -11.600 1.00 49.49 ? 58  GLU A N   1 
ATOM   315  C CA  . GLU A 1 58  ? -22.983 -5.528  -10.353 1.00 51.21 ? 58  GLU A CA  1 
ATOM   316  C C   . GLU A 1 58  ? -22.003 -6.414  -9.593  1.00 51.02 ? 58  GLU A C   1 
ATOM   317  O O   . GLU A 1 58  ? -21.582 -7.441  -10.112 1.00 50.43 ? 58  GLU A O   1 
ATOM   318  C CB  . GLU A 1 58  ? -24.254 -6.336  -10.640 1.00 52.04 ? 58  GLU A CB  1 
ATOM   319  C CG  . GLU A 1 58  ? -25.472 -5.462  -10.864 1.00 56.11 ? 58  GLU A CG  1 
ATOM   320  N N   . GLY A 1 59  ? -21.640 -6.025  -8.371  1.00 51.16 ? 59  GLY A N   1 
ATOM   321  C CA  . GLY A 1 59  ? -20.831 -6.885  -7.521  1.00 48.22 ? 59  GLY A CA  1 
ATOM   322  C C   . GLY A 1 59  ? -19.705 -6.233  -6.737  1.00 50.87 ? 59  GLY A C   1 
ATOM   323  O O   . GLY A 1 59  ? -19.802 -5.080  -6.314  1.00 52.87 ? 59  GLY A O   1 
ATOM   324  N N   . LYS A 1 60  ? -18.629 -6.991  -6.541  1.00 46.78 ? 60  LYS A N   1 
ATOM   325  C CA  . LYS A 1 60  ? -17.470 -6.544  -5.776  1.00 48.83 ? 60  LYS A CA  1 
ATOM   326  C C   . LYS A 1 60  ? -16.309 -7.504  -6.039  1.00 52.11 ? 60  LYS A C   1 
ATOM   327  O O   . LYS A 1 60  ? -16.466 -8.720  -5.925  1.00 51.74 ? 60  LYS A O   1 
ATOM   328  C CB  . LYS A 1 60  ? -17.806 -6.519  -4.283  1.00 51.31 ? 60  LYS A CB  1 
ATOM   329  C CG  . LYS A 1 60  ? -16.880 -5.668  -3.422  1.00 50.89 ? 60  LYS A CG  1 
ATOM   330  C CD  . LYS A 1 60  ? -17.261 -5.790  -1.949  1.00 51.61 ? 60  LYS A CD  1 
ATOM   331  C CE  . LYS A 1 60  ? -16.733 -4.623  -1.116  1.00 56.06 ? 60  LYS A CE  1 
ATOM   332  N NZ  . LYS A 1 60  ? -15.270 -4.706  -0.826  1.00 55.85 ? 60  LYS A NZ  1 
ATOM   333  N N   . ILE A 1 61  ? -15.147 -6.962  -6.393  1.00 49.14 ? 61  ILE A N   1 
ATOM   334  C CA  . ILE A 1 61  ? -13.997 -7.797  -6.736  1.00 48.93 ? 61  ILE A CA  1 
ATOM   335  C C   . ILE A 1 61  ? -12.741 -7.428  -5.950  1.00 52.12 ? 61  ILE A C   1 
ATOM   336  O O   . ILE A 1 61  ? -12.450 -6.249  -5.740  1.00 49.18 ? 61  ILE A O   1 
ATOM   337  C CB  . ILE A 1 61  ? -13.685 -7.736  -8.250  1.00 47.75 ? 61  ILE A CB  1 
ATOM   338  C CG1 . ILE A 1 61  ? -14.810 -8.390  -9.054  1.00 45.27 ? 61  ILE A CG1 1 
ATOM   339  C CG2 . ILE A 1 61  ? -12.354 -8.411  -8.554  1.00 46.09 ? 61  ILE A CG2 1 
ATOM   340  C CD1 . ILE A 1 61  ? -14.661 -8.236  -10.557 1.00 40.00 ? 61  ILE A CD1 1 
ATOM   341  N N   . LYS A 1 62  ? -12.003 -8.444  -5.517  1.00 46.68 ? 62  LYS A N   1 
ATOM   342  C CA  . LYS A 1 62  ? -10.743 -8.232  -4.818  1.00 45.92 ? 62  LYS A CA  1 
ATOM   343  C C   . LYS A 1 62  ? -9.563  -8.446  -5.761  1.00 52.20 ? 62  LYS A C   1 
ATOM   344  O O   . LYS A 1 62  ? -9.388  -9.531  -6.318  1.00 50.03 ? 62  LYS A O   1 
ATOM   345  C CB  . LYS A 1 62  ? -10.637 -9.171  -3.622  1.00 51.98 ? 62  LYS A CB  1 
ATOM   346  N N   . LEU A 1 63  ? -8.761  -7.404  -5.944  1.00 48.95 ? 63  LEU A N   1 
ATOM   347  C CA  . LEU A 1 63  ? -7.574  -7.495  -6.781  1.00 48.89 ? 63  LEU A CA  1 
ATOM   348  C C   . LEU A 1 63  ? -6.331  -7.611  -5.924  1.00 47.84 ? 63  LEU A C   1 
ATOM   349  O O   . LEU A 1 63  ? -6.043  -6.727  -5.118  1.00 47.60 ? 63  LEU A O   1 
ATOM   350  C CB  . LEU A 1 63  ? -7.441  -6.269  -7.687  1.00 47.84 ? 63  LEU A CB  1 
ATOM   351  C CG  . LEU A 1 63  ? -8.183  -6.277  -9.017  1.00 48.27 ? 63  LEU A CG  1 
ATOM   352  C CD1 . LEU A 1 63  ? -9.665  -5.994  -8.812  1.00 45.07 ? 63  LEU A CD1 1 
ATOM   353  C CD2 . LEU A 1 63  ? -7.558  -5.265  -9.971  1.00 46.95 ? 63  LEU A CD2 1 
ATOM   354  N N   . ASP A 1 64  ? -5.602  -8.709  -6.096  1.00 50.47 ? 64  ASP A N   1 
ATOM   355  C CA  . ASP A 1 64  ? -4.295  -8.865  -5.477  1.00 50.33 ? 64  ASP A CA  1 
ATOM   356  C C   . ASP A 1 64  ? -3.226  -8.746  -6.551  1.00 49.18 ? 64  ASP A C   1 
ATOM   357  O O   . ASP A 1 64  ? -3.526  -8.805  -7.742  1.00 50.31 ? 64  ASP A O   1 
ATOM   358  C CB  . ASP A 1 64  ? -4.188  -10.214 -4.765  1.00 54.99 ? 64  ASP A CB  1 
ATOM   359  C CG  . ASP A 1 64  ? -4.901  -10.225 -3.425  1.00 56.85 ? 64  ASP A CG  1 
ATOM   360  O OD1 . ASP A 1 64  ? -5.001  -9.147  -2.803  1.00 51.14 ? 64  ASP A OD1 1 
ATOM   361  O OD2 . ASP A 1 64  ? -5.352  -11.310 -2.991  1.00 59.55 ? 64  ASP A OD2 1 
ATOM   362  N N   . ILE A 1 65  ? -1.981  -8.569  -6.129  1.00 50.76 ? 65  ILE A N   1 
ATOM   363  C CA  . ILE A 1 65  ? -0.880  -8.476  -7.074  1.00 53.05 ? 65  ILE A CA  1 
ATOM   364  C C   . ILE A 1 65  ? 0.324   -9.305  -6.632  1.00 53.30 ? 65  ILE A C   1 
ATOM   365  O O   . ILE A 1 65  ? 0.950   -9.020  -5.612  1.00 55.24 ? 65  ILE A O   1 
ATOM   366  C CB  . ILE A 1 65  ? -0.467  -7.012  -7.328  1.00 52.62 ? 65  ILE A CB  1 
ATOM   367  C CG1 . ILE A 1 65  ? 0.767   -6.957  -8.234  1.00 50.65 ? 65  ILE A CG1 1 
ATOM   368  C CG2 . ILE A 1 65  ? -0.218  -6.281  -6.014  1.00 51.42 ? 65  ILE A CG2 1 
ATOM   369  C CD1 . ILE A 1 65  ? 0.985   -5.611  -8.869  1.00 46.71 ? 65  ILE A CD1 1 
ATOM   370  N N   . ILE A 1 66  ? 0.632   -10.341 -7.403  1.00 55.30 ? 66  ILE A N   1 
ATOM   371  C CA  . ILE A 1 66  ? 1.772   -11.195 -7.107  1.00 56.86 ? 66  ILE A CA  1 
ATOM   372  C C   . ILE A 1 66  ? 3.050   -10.578 -7.651  1.00 56.44 ? 66  ILE A C   1 
ATOM   373  O O   . ILE A 1 66  ? 3.185   -10.373 -8.857  1.00 53.57 ? 66  ILE A O   1 
ATOM   374  C CB  . ILE A 1 66  ? 1.611   -12.600 -7.712  1.00 56.86 ? 66  ILE A CB  1 
ATOM   375  C CG1 . ILE A 1 66  ? 0.494   -13.366 -7.007  1.00 53.55 ? 66  ILE A CG1 1 
ATOM   376  C CG2 . ILE A 1 66  ? 2.921   -13.369 -7.618  1.00 60.37 ? 66  ILE A CG2 1 
ATOM   377  C CD1 . ILE A 1 66  ? -0.886  -13.037 -7.520  1.00 57.24 ? 66  ILE A CD1 1 
ATOM   378  N N   . PHE A 1 67  ? 3.986   -10.281 -6.756  1.00 55.39 ? 67  PHE A N   1 
ATOM   379  C CA  . PHE A 1 67  ? 5.270   -9.728  -7.157  1.00 56.94 ? 67  PHE A CA  1 
ATOM   380  C C   . PHE A 1 67  ? 6.179   -10.822 -7.703  1.00 58.91 ? 67  PHE A C   1 
ATOM   381  O O   . PHE A 1 67  ? 5.985   -12.004 -7.423  1.00 54.33 ? 67  PHE A O   1 
ATOM   382  C CB  . PHE A 1 67  ? 5.940   -9.000  -5.987  1.00 59.34 ? 67  PHE A CB  1 
ATOM   383  C CG  . PHE A 1 67  ? 5.197   -7.779  -5.531  1.00 52.13 ? 67  PHE A CG  1 
ATOM   384  C CD1 . PHE A 1 67  ? 4.157   -7.885  -4.624  1.00 57.61 ? 67  PHE A CD1 1 
ATOM   385  C CD2 . PHE A 1 67  ? 5.533   -6.524  -6.012  1.00 56.62 ? 67  PHE A CD2 1 
ATOM   386  C CE1 . PHE A 1 67  ? 3.463   -6.764  -4.205  1.00 57.83 ? 67  PHE A CE1 1 
ATOM   387  C CE2 . PHE A 1 67  ? 4.845   -5.397  -5.595  1.00 54.45 ? 67  PHE A CE2 1 
ATOM   388  C CZ  . PHE A 1 67  ? 3.809   -5.518  -4.689  1.00 53.85 ? 67  PHE A CZ  1 
ATOM   389  N N   . GLU A 1 68  ? 7.166   -10.411 -8.491  1.00 62.71 ? 68  GLU A N   1 
ATOM   390  C CA  . GLU A 1 68  ? 8.114   -11.322 -9.116  1.00 63.95 ? 68  GLU A CA  1 
ATOM   391  C C   . GLU A 1 68  ? 8.787   -12.236 -8.095  1.00 64.46 ? 68  GLU A C   1 
ATOM   392  O O   . GLU A 1 68  ? 9.353   -13.269 -8.455  1.00 64.90 ? 68  GLU A O   1 
ATOM   393  C CB  . GLU A 1 68  ? 9.180   -10.528 -9.873  1.00 66.40 ? 68  GLU A CB  1 
ATOM   394  C CG  . GLU A 1 68  ? 8.655   -9.292  -10.592 1.00 64.45 ? 68  GLU A CG  1 
ATOM   395  C CD  . GLU A 1 68  ? 8.521   -8.082  -9.679  1.00 67.63 ? 68  GLU A CD  1 
ATOM   396  O OE1 . GLU A 1 68  ? 8.076   -8.238  -8.523  1.00 64.03 ? 68  GLU A OE1 1 
ATOM   397  O OE2 . GLU A 1 68  ? 8.860   -6.965  -10.124 1.00 76.26 ? 68  GLU A OE2 1 
ATOM   398  N N   . ASP A 1 69  ? 8.726   -11.851 -6.823  1.00 67.28 ? 69  ASP A N   1 
ATOM   399  C CA  . ASP A 1 69  ? 9.344   -12.633 -5.756  1.00 66.30 ? 69  ASP A CA  1 
ATOM   400  C C   . ASP A 1 69  ? 8.383   -13.664 -5.171  1.00 61.42 ? 69  ASP A C   1 
ATOM   401  O O   . ASP A 1 69  ? 8.696   -14.321 -4.178  1.00 63.23 ? 69  ASP A O   1 
ATOM   402  C CB  . ASP A 1 69  ? 9.878   -11.717 -4.648  1.00 62.63 ? 69  ASP A CB  1 
ATOM   403  C CG  . ASP A 1 69  ? 8.771   -10.999 -3.894  1.00 65.24 ? 69  ASP A CG  1 
ATOM   404  O OD1 . ASP A 1 69  ? 7.584   -11.262 -4.172  1.00 63.73 ? 69  ASP A OD1 1 
ATOM   405  O OD2 . ASP A 1 69  ? 9.090   -10.169 -3.018  1.00 65.45 ? 69  ASP A OD2 1 
ATOM   406  N N   . GLY A 1 70  ? 7.212   -13.795 -5.786  1.00 58.50 ? 70  GLY A N   1 
ATOM   407  C CA  . GLY A 1 70  ? 6.232   -14.781 -5.370  1.00 57.66 ? 70  GLY A CA  1 
ATOM   408  C C   . GLY A 1 70  ? 5.294   -14.306 -4.277  1.00 63.33 ? 70  GLY A C   1 
ATOM   409  O O   . GLY A 1 70  ? 4.278   -14.948 -4.000  1.00 59.40 ? 70  GLY A O   1 
ATOM   410  N N   . SER A 1 71  ? 5.629   -13.180 -3.654  1.00 60.00 ? 71  SER A N   1 
ATOM   411  C CA  . SER A 1 71  ? 4.828   -12.656 -2.552  1.00 57.70 ? 71  SER A CA  1 
ATOM   412  C C   . SER A 1 71  ? 3.581   -11.946 -3.060  1.00 61.49 ? 71  SER A C   1 
ATOM   413  O O   . SER A 1 71  ? 3.559   -11.425 -4.177  1.00 61.18 ? 71  SER A O   1 
ATOM   414  C CB  . SER A 1 71  ? 5.652   -11.713 -1.669  1.00 62.68 ? 71  SER A CB  1 
ATOM   415  O OG  . SER A 1 71  ? 5.820   -10.446 -2.282  1.00 61.67 ? 71  SER A OG  1 
ATOM   416  N N   . GLU A 1 72  ? 2.547   -11.922 -2.226  1.00 62.20 ? 72  GLU A N   1 
ATOM   417  C CA  . GLU A 1 72  ? 1.267   -11.343 -2.608  1.00 58.57 ? 72  GLU A CA  1 
ATOM   418  C C   . GLU A 1 72  ? 0.782   -10.332 -1.576  1.00 57.13 ? 72  GLU A C   1 
ATOM   419  O O   . GLU A 1 72  ? 0.857   -10.572 -0.371  1.00 56.78 ? 72  GLU A O   1 
ATOM   420  C CB  . GLU A 1 72  ? 0.227   -12.450 -2.797  1.00 55.42 ? 72  GLU A CB  1 
ATOM   421  C CG  . GLU A 1 72  ? -1.147  -11.968 -3.225  1.00 55.19 ? 72  GLU A CG  1 
ATOM   422  C CD  . GLU A 1 72  ? -2.004  -13.094 -3.772  1.00 58.87 ? 72  GLU A CD  1 
ATOM   423  O OE1 . GLU A 1 72  ? -3.243  -12.943 -3.818  1.00 59.06 ? 72  GLU A OE1 1 
ATOM   424  O OE2 . GLU A 1 72  ? -1.435  -14.138 -4.156  1.00 64.98 ? 72  GLU A OE2 1 
ATOM   425  N N   . LYS A 1 73  ? 0.298   -9.195  -2.063  1.00 57.07 ? 73  LYS A N   1 
ATOM   426  C CA  . LYS A 1 73  ? -0.300  -8.178  -1.210  1.00 56.48 ? 73  LYS A CA  1 
ATOM   427  C C   . LYS A 1 73  ? -1.567  -7.655  -1.878  1.00 52.93 ? 73  LYS A C   1 
ATOM   428  O O   . LYS A 1 73  ? -1.731  -7.781  -3.090  1.00 52.59 ? 73  LYS A O   1 
ATOM   429  C CB  . LYS A 1 73  ? 0.683   -7.031  -0.972  1.00 58.45 ? 73  LYS A CB  1 
ATOM   430  C CG  . LYS A 1 73  ? 2.041   -7.468  -0.441  1.00 48.72 ? 73  LYS A CG  1 
ATOM   431  C CD  . LYS A 1 73  ? 2.950   -6.275  -0.194  1.00 59.05 ? 73  LYS A CD  1 
ATOM   432  C CE  . LYS A 1 73  ? 4.330   -6.716  0.280   1.00 57.21 ? 73  LYS A CE  1 
ATOM   433  N NZ  . LYS A 1 73  ? 5.285   -5.571  0.384   1.00 53.56 ? 73  LYS A NZ  1 
ATOM   434  N N   . LEU A 1 74  ? -2.466  -7.078  -1.089  1.00 56.26 ? 74  LEU A N   1 
ATOM   435  C CA  . LEU A 1 74  ? -3.679  -6.487  -1.640  1.00 56.76 ? 74  LEU A CA  1 
ATOM   436  C C   . LEU A 1 74  ? -3.320  -5.501  -2.749  1.00 52.77 ? 74  LEU A C   1 
ATOM   437  O O   . LEU A 1 74  ? -2.183  -5.043  -2.837  1.00 53.13 ? 74  LEU A O   1 
ATOM   438  C CB  . LEU A 1 74  ? -4.459  -5.761  -0.544  1.00 60.78 ? 74  LEU A CB  1 
ATOM   439  C CG  . LEU A 1 74  ? -5.863  -5.272  -0.903  1.00 56.39 ? 74  LEU A CG  1 
ATOM   440  C CD1 . LEU A 1 74  ? -6.900  -6.283  -0.451  1.00 52.71 ? 74  LEU A CD1 1 
ATOM   441  C CD2 . LEU A 1 74  ? -6.125  -3.917  -0.267  1.00 57.90 ? 74  LEU A CD2 1 
ATOM   442  N N   . LEU A 1 75  ? -4.288  -5.186  -3.602  1.00 53.89 ? 75  LEU A N   1 
ATOM   443  C CA  . LEU A 1 75  ? -4.099  -4.155  -4.616  1.00 53.50 ? 75  LEU A CA  1 
ATOM   444  C C   . LEU A 1 75  ? -5.194  -3.106  -4.462  1.00 51.91 ? 75  LEU A C   1 
ATOM   445  O O   . LEU A 1 75  ? -4.981  -2.065  -3.841  1.00 50.11 ? 75  LEU A O   1 
ATOM   446  C CB  . LEU A 1 75  ? -4.117  -4.755  -6.022  1.00 53.44 ? 75  LEU A CB  1 
ATOM   447  C CG  . LEU A 1 75  ? -3.733  -3.788  -7.142  1.00 51.74 ? 75  LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 75  ? -2.233  -3.589  -7.161  1.00 51.52 ? 75  LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 75  ? -4.227  -4.293  -8.487  1.00 50.09 ? 75  LEU A CD2 1 
ATOM   450  N N   . TYR A 1 76  ? -6.362  -3.373  -5.036  1.00 51.46 ? 76  TYR A N   1 
ATOM   451  C CA  . TYR A 1 76  ? -7.559  -2.601  -4.701  1.00 49.95 ? 76  TYR A CA  1 
ATOM   452  C C   . TYR A 1 76  ? -8.820  -3.443  -4.728  1.00 49.00 ? 76  TYR A C   1 
ATOM   453  O O   . TYR A 1 76  ? -8.807  -4.596  -5.159  1.00 50.36 ? 76  TYR A O   1 
ATOM   454  C CB  . TYR A 1 76  ? -7.734  -1.346  -5.574  1.00 54.56 ? 76  TYR A CB  1 
ATOM   455  C CG  . TYR A 1 76  ? -7.195  -1.437  -6.990  1.00 54.38 ? 76  TYR A CG  1 
ATOM   456  C CD1 . TYR A 1 76  ? -5.892  -1.054  -7.274  1.00 57.81 ? 76  TYR A CD1 1 
ATOM   457  C CD2 . TYR A 1 76  ? -7.987  -1.880  -8.042  1.00 53.31 ? 76  TYR A CD2 1 
ATOM   458  C CE1 . TYR A 1 76  ? -5.384  -1.109  -8.558  1.00 56.98 ? 76  TYR A CE1 1 
ATOM   459  C CE2 . TYR A 1 76  ? -7.483  -1.950  -9.339  1.00 54.37 ? 76  TYR A CE2 1 
ATOM   460  C CZ  . TYR A 1 76  ? -6.179  -1.552  -9.584  1.00 59.13 ? 76  TYR A CZ  1 
ATOM   461  O OH  . TYR A 1 76  ? -5.656  -1.615  -10.850 1.00 55.60 ? 76  TYR A OH  1 
ATOM   462  N N   . TYR A 1 77  ? -9.901  -2.858  -4.230  1.00 50.71 ? 77  TYR A N   1 
ATOM   463  C CA  . TYR A 1 77  ? -11.209 -3.490  -4.252  1.00 51.06 ? 77  TYR A CA  1 
ATOM   464  C C   . TYR A 1 77  ? -12.086 -2.770  -5.264  1.00 49.58 ? 77  TYR A C   1 
ATOM   465  O O   . TYR A 1 77  ? -12.373 -1.586  -5.108  1.00 49.22 ? 77  TYR A O   1 
ATOM   466  C CB  . TYR A 1 77  ? -11.864 -3.412  -2.873  1.00 49.21 ? 77  TYR A CB  1 
ATOM   467  C CG  . TYR A 1 77  ? -11.286 -4.354  -1.844  1.00 51.92 ? 77  TYR A CG  1 
ATOM   468  C CD1 . TYR A 1 77  ? -10.337 -3.921  -0.927  1.00 55.44 ? 77  TYR A CD1 1 
ATOM   469  C CD2 . TYR A 1 77  ? -11.702 -5.676  -1.778  1.00 54.39 ? 77  TYR A CD2 1 
ATOM   470  C CE1 . TYR A 1 77  ? -9.814  -4.783  0.020   1.00 49.11 ? 77  TYR A CE1 1 
ATOM   471  C CE2 . TYR A 1 77  ? -11.185 -6.543  -0.838  1.00 49.89 ? 77  TYR A CE2 1 
ATOM   472  C CZ  . TYR A 1 77  ? -10.243 -6.093  0.060   1.00 52.65 ? 77  TYR A CZ  1 
ATOM   473  O OH  . TYR A 1 77  ? -9.730  -6.960  0.998   1.00 57.86 ? 77  TYR A OH  1 
ATOM   474  N N   . ALA A 1 78  ? -12.505 -3.480  -6.305  1.00 48.07 ? 78  ALA A N   1 
ATOM   475  C CA  . ALA A 1 78  ? -13.414 -2.910  -7.287  1.00 47.13 ? 78  ALA A CA  1 
ATOM   476  C C   . ALA A 1 78  ? -14.847 -3.110  -6.812  1.00 47.32 ? 78  ALA A C   1 
ATOM   477  O O   . ALA A 1 78  ? -15.140 -4.064  -6.092  1.00 54.30 ? 78  ALA A O   1 
ATOM   478  C CB  . ALA A 1 78  ? -13.202 -3.551  -8.649  1.00 44.53 ? 78  ALA A CB  1 
ATOM   479  N N   . GLY A 1 79  ? -15.736 -2.207  -7.209  1.00 44.32 ? 79  GLY A N   1 
ATOM   480  C CA  . GLY A 1 79  ? -17.128 -2.290  -6.811  1.00 45.01 ? 79  GLY A CA  1 
ATOM   481  C C   . GLY A 1 79  ? -18.058 -1.861  -7.924  1.00 43.53 ? 79  GLY A C   1 
ATOM   482  O O   . GLY A 1 79  ? -17.666 -1.828  -9.092  1.00 41.83 ? 79  GLY A O   1 
ATOM   483  N N   . GLY A 1 80  ? -19.293 -1.528  -7.559  1.00 45.04 ? 80  GLY A N   1 
ATOM   484  C CA  . GLY A 1 80  ? -20.288 -1.088  -8.519  1.00 46.16 ? 80  GLY A CA  1 
ATOM   485  C C   . GLY A 1 80  ? -19.768 0.004   -9.436  1.00 44.27 ? 80  GLY A C   1 
ATOM   486  O O   . GLY A 1 80  ? -19.346 1.069   -8.979  1.00 42.86 ? 80  GLY A O   1 
ATOM   487  N N   . ASN A 1 81  ? -19.790 -0.274  -10.735 1.00 39.91 ? 81  ASN A N   1 
ATOM   488  C CA  . ASN A 1 81  ? -19.380 0.689   -11.754 1.00 41.92 ? 81  ASN A CA  1 
ATOM   489  C C   . ASN A 1 81  ? -17.877 0.983   -11.783 1.00 43.70 ? 81  ASN A C   1 
ATOM   490  O O   . ASN A 1 81  ? -17.441 1.946   -12.414 1.00 43.18 ? 81  ASN A O   1 
ATOM   491  C CB  . ASN A 1 81  ? -20.181 1.988   -11.629 1.00 40.14 ? 81  ASN A CB  1 
ATOM   492  C CG  . ASN A 1 81  ? -21.647 1.805   -11.972 1.00 42.13 ? 81  ASN A CG  1 
ATOM   493  O OD1 . ASN A 1 81  ? -21.991 1.161   -12.963 1.00 42.13 ? 81  ASN A OD1 1 
ATOM   494  N ND2 . ASN A 1 81  ? -22.521 2.373   -11.150 1.00 45.07 ? 81  ASN A ND2 1 
ATOM   495  N N   . SER A 1 82  ? -17.089 0.157   -11.103 1.00 40.88 ? 82  SER A N   1 
ATOM   496  C CA  . SER A 1 82  ? -15.637 0.253   -11.196 1.00 39.59 ? 82  SER A CA  1 
ATOM   497  C C   . SER A 1 82  ? -15.185 -0.220  -12.572 1.00 39.94 ? 82  SER A C   1 
ATOM   498  O O   . SER A 1 82  ? -15.849 -1.035  -13.211 1.00 38.80 ? 82  SER A O   1 
ATOM   499  C CB  . SER A 1 82  ? -14.955 -0.572  -10.101 1.00 37.49 ? 82  SER A CB  1 
ATOM   500  O OG  . SER A 1 82  ? -15.175 -0.010  -8.821  1.00 37.60 ? 82  SER A OG  1 
ATOM   501  N N   . LEU A 1 83  ? -14.059 0.307   -13.035 1.00 37.63 ? 83  LEU A N   1 
ATOM   502  C CA  . LEU A 1 83  ? -13.522 -0.094  -14.325 1.00 34.56 ? 83  LEU A CA  1 
ATOM   503  C C   . LEU A 1 83  ? -12.096 -0.578  -14.139 1.00 36.75 ? 83  LEU A C   1 
ATOM   504  O O   . LEU A 1 83  ? -11.201 0.199   -13.796 1.00 32.59 ? 83  LEU A O   1 
ATOM   505  C CB  . LEU A 1 83  ? -13.586 1.060   -15.326 1.00 37.21 ? 83  LEU A CB  1 
ATOM   506  C CG  . LEU A 1 83  ? -13.191 0.745   -16.772 1.00 38.74 ? 83  LEU A CG  1 
ATOM   507  C CD1 . LEU A 1 83  ? -14.155 -0.247  -17.403 1.00 40.20 ? 83  LEU A CD1 1 
ATOM   508  C CD2 . LEU A 1 83  ? -13.119 2.019   -17.600 1.00 36.70 ? 83  LEU A CD2 1 
ATOM   509  N N   . ILE A 1 84  ? -11.898 -1.875  -14.339 1.00 34.44 ? 84  ILE A N   1 
ATOM   510  C CA  . ILE A 1 84  ? -10.594 -2.491  -14.138 1.00 38.04 ? 84  ILE A CA  1 
ATOM   511  C C   . ILE A 1 84  ? -10.133 -3.191  -15.413 1.00 35.54 ? 84  ILE A C   1 
ATOM   512  O O   . ILE A 1 84  ? -10.720 -3.004  -16.478 1.00 31.93 ? 84  ILE A O   1 
ATOM   513  C CB  . ILE A 1 84  ? -10.634 -3.491  -12.972 1.00 40.48 ? 84  ILE A CB  1 
ATOM   514  C CG1 . ILE A 1 84  ? -11.691 -4.563  -13.235 1.00 38.92 ? 84  ILE A CG1 1 
ATOM   515  C CG2 . ILE A 1 84  ? -10.948 -2.771  -11.669 1.00 39.47 ? 84  ILE A CG2 1 
ATOM   516  C CD1 . ILE A 1 84  ? -11.769 -5.610  -12.150 1.00 43.26 ? 84  ILE A CD1 1 
ATOM   517  N N   . GLY A 1 85  ? -9.080  -3.992  -15.309 1.00 38.98 ? 85  GLY A N   1 
ATOM   518  C CA  . GLY A 1 85  ? -8.553  -4.678  -16.473 1.00 34.34 ? 85  GLY A CA  1 
ATOM   519  C C   . GLY A 1 85  ? -7.648  -3.760  -17.268 1.00 32.72 ? 85  GLY A C   1 
ATOM   520  O O   . GLY A 1 85  ? -7.226  -2.718  -16.772 1.00 35.99 ? 85  GLY A O   1 
ATOM   521  N N   . LYS A 1 86  ? -7.354  -4.142  -18.505 1.00 33.98 ? 86  LYS A N   1 
ATOM   522  C CA  . LYS A 1 86  ? -6.427  -3.380  -19.332 1.00 35.90 ? 86  LYS A CA  1 
ATOM   523  C C   . LYS A 1 86  ? -6.477  -3.818  -20.790 1.00 34.37 ? 86  LYS A C   1 
ATOM   524  O O   . LYS A 1 86  ? -6.968  -4.901  -21.107 1.00 32.22 ? 86  LYS A O   1 
ATOM   525  C CB  . LYS A 1 86  ? -5.001  -3.536  -18.801 1.00 36.81 ? 86  LYS A CB  1 
ATOM   526  C CG  . LYS A 1 86  ? -4.591  -4.985  -18.576 1.00 40.07 ? 86  LYS A CG  1 
ATOM   527  C CD  . LYS A 1 86  ? -3.211  -5.074  -17.952 1.00 47.70 ? 86  LYS A CD  1 
ATOM   528  C CE  . LYS A 1 86  ? -2.947  -6.458  -17.395 1.00 51.91 ? 86  LYS A CE  1 
ATOM   529  N NZ  . LYS A 1 86  ? -1.778  -6.460  -16.464 1.00 57.47 ? 86  LYS A NZ  1 
ATOM   530  N N   . LEU A 1 87  ? -5.959  -2.967  -21.671 1.00 33.15 ? 87  LEU A N   1 
ATOM   531  C CA  . LEU A 1 87  ? -5.881  -3.275  -23.093 1.00 30.19 ? 87  LEU A CA  1 
ATOM   532  C C   . LEU A 1 87  ? -4.475  -3.729  -23.478 1.00 32.69 ? 87  LEU A C   1 
ATOM   533  O O   . LEU A 1 87  ? -4.284  -4.370  -24.512 1.00 32.16 ? 87  LEU A O   1 
ATOM   534  C CB  . LEU A 1 87  ? -6.275  -2.052  -23.921 1.00 30.35 ? 87  LEU A CB  1 
ATOM   535  C CG  . LEU A 1 87  ? -7.717  -1.571  -23.778 1.00 33.32 ? 87  LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 87  ? -7.860  -0.125  -24.269 1.00 32.32 ? 87  LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 87  ? -8.653  -2.495  -24.526 1.00 28.38 ? 87  LEU A CD2 1 
ATOM   538  N N   . TYR A 1 88  ? -3.500  -3.387  -22.640 1.00 30.75 ? 88  TYR A N   1 
ATOM   539  C CA  . TYR A 1 88  ? -2.092  -3.648  -22.926 1.00 36.46 ? 88  TYR A CA  1 
ATOM   540  C C   . TYR A 1 88  ? -1.347  -4.011  -21.640 1.00 40.64 ? 88  TYR A C   1 
ATOM   541  O O   . TYR A 1 88  ? -1.830  -3.741  -20.540 1.00 45.05 ? 88  TYR A O   1 
ATOM   542  C CB  . TYR A 1 88  ? -1.440  -2.415  -23.574 1.00 33.97 ? 88  TYR A CB  1 
ATOM   543  C CG  . TYR A 1 88  ? -2.384  -1.599  -24.434 1.00 36.63 ? 88  TYR A CG  1 
ATOM   544  C CD1 . TYR A 1 88  ? -2.932  -0.412  -23.964 1.00 33.67 ? 88  TYR A CD1 1 
ATOM   545  C CD2 . TYR A 1 88  ? -2.739  -2.025  -25.709 1.00 38.07 ? 88  TYR A CD2 1 
ATOM   546  C CE1 . TYR A 1 88  ? -3.805  0.332   -24.743 1.00 36.81 ? 88  TYR A CE1 1 
ATOM   547  C CE2 . TYR A 1 88  ? -3.609  -1.289  -26.495 1.00 32.15 ? 88  TYR A CE2 1 
ATOM   548  C CZ  . TYR A 1 88  ? -4.139  -0.112  -26.008 1.00 34.32 ? 88  TYR A CZ  1 
ATOM   549  O OH  . TYR A 1 88  ? -5.008  0.620   -26.786 1.00 31.42 ? 88  TYR A OH  1 
ATOM   550  N N   . PRO A 1 89  ? -0.164  -4.625  -21.776 1.00 46.09 ? 89  PRO A N   1 
ATOM   551  C CA  . PRO A 1 89  ? 0.705   -4.926  -20.632 1.00 48.88 ? 89  PRO A CA  1 
ATOM   552  C C   . PRO A 1 89  ? 0.909   -3.726  -19.702 1.00 50.43 ? 89  PRO A C   1 
ATOM   553  O O   . PRO A 1 89  ? 0.939   -2.579  -20.157 1.00 49.60 ? 89  PRO A O   1 
ATOM   554  C CB  . PRO A 1 89  ? 2.029   -5.300  -21.298 1.00 48.57 ? 89  PRO A CB  1 
ATOM   555  C CG  . PRO A 1 89  ? 1.622   -5.894  -22.602 1.00 51.38 ? 89  PRO A CG  1 
ATOM   556  C CD  . PRO A 1 89  ? 0.384   -5.149  -23.040 1.00 46.49 ? 89  PRO A CD  1 
ATOM   557  N N   . THR A 1 90  ? 1.043   -4.002  -18.407 1.00 51.47 ? 90  THR A N   1 
ATOM   558  C CA  . THR A 1 90  ? 1.275   -2.960  -17.411 1.00 54.53 ? 90  THR A CA  1 
ATOM   559  C C   . THR A 1 90  ? 2.438   -3.318  -16.491 1.00 55.22 ? 90  THR A C   1 
ATOM   560  O O   . THR A 1 90  ? 3.002   -2.449  -15.827 1.00 56.26 ? 90  THR A O   1 
ATOM   561  C CB  . THR A 1 90  ? 0.031   -2.713  -16.531 1.00 51.85 ? 90  THR A CB  1 
ATOM   562  O OG1 . THR A 1 90  ? -0.279  -3.903  -15.792 1.00 47.34 ? 90  THR A OG1 1 
ATOM   563  C CG2 . THR A 1 90  ? -1.167  -2.305  -17.381 1.00 47.62 ? 90  THR A CG2 1 
ATOM   564  N N   . GLY A 1 91  ? 2.788   -4.599  -16.447 1.00 56.48 ? 91  GLY A N   1 
ATOM   565  C CA  . GLY A 1 91  ? 3.885   -5.055  -15.614 1.00 53.11 ? 91  GLY A CA  1 
ATOM   566  C C   . GLY A 1 91  ? 3.430   -5.509  -14.240 1.00 54.11 ? 91  GLY A C   1 
ATOM   567  O O   . GLY A 1 91  ? 4.250   -5.788  -13.366 1.00 60.28 ? 91  GLY A O   1 
ATOM   568  N N   . ASN A 1 92  ? 2.116   -5.576  -14.049 1.00 55.75 ? 92  ASN A N   1 
ATOM   569  C CA  . ASN A 1 92  ? 1.538   -6.035  -12.789 1.00 48.53 ? 92  ASN A CA  1 
ATOM   570  C C   . ASN A 1 92  ? 0.855   -7.390  -12.953 1.00 52.36 ? 92  ASN A C   1 
ATOM   571  O O   . ASN A 1 92  ? -0.209  -7.482  -13.568 1.00 56.78 ? 92  ASN A O   1 
ATOM   572  C CB  . ASN A 1 92  ? 0.514   -5.024  -12.260 1.00 51.76 ? 92  ASN A CB  1 
ATOM   573  C CG  . ASN A 1 92  ? 1.157   -3.769  -11.684 1.00 45.12 ? 92  ASN A CG  1 
ATOM   574  O OD1 . ASN A 1 92  ? 2.376   -3.599  -11.732 1.00 48.55 ? 92  ASN A OD1 1 
ATOM   575  N ND2 . ASN A 1 92  ? 0.331   -2.884  -11.134 1.00 34.34 ? 92  ASN A ND2 1 
ATOM   576  N N   . ASN A 1 93  ? 1.454   -8.442  -12.407 1.00 49.40 ? 93  ASN A N   1 
ATOM   577  C CA  . ASN A 1 93  ? 0.794   -9.741  -12.399 1.00 52.47 ? 93  ASN A CA  1 
ATOM   578  C C   . ASN A 1 93  ? -0.418  -9.718  -11.468 1.00 50.49 ? 93  ASN A C   1 
ATOM   579  O O   . ASN A 1 93  ? -0.281  -9.536  -10.258 1.00 49.08 ? 93  ASN A O   1 
ATOM   580  C CB  . ASN A 1 93  ? 1.762   -10.850 -11.994 1.00 53.31 ? 93  ASN A CB  1 
ATOM   581  C CG  . ASN A 1 93  ? 1.109   -12.218 -12.014 1.00 57.26 ? 93  ASN A CG  1 
ATOM   582  O OD1 . ASN A 1 93  ? 0.152   -12.452 -12.757 1.00 57.32 ? 93  ASN A OD1 1 
ATOM   583  N ND2 . ASN A 1 93  ? 1.621   -13.131 -11.197 1.00 62.02 ? 93  ASN A ND2 1 
ATOM   584  N N   . ILE A 1 94  ? -1.601  -9.908  -12.040 1.00 47.72 ? 94  ILE A N   1 
ATOM   585  C CA  . ILE A 1 94  ? -2.846  -9.689  -11.312 1.00 47.92 ? 94  ILE A CA  1 
ATOM   586  C C   . ILE A 1 94  ? -3.652  -10.961 -11.061 1.00 49.70 ? 94  ILE A C   1 
ATOM   587  O O   . ILE A 1 94  ? -3.884  -11.754 -11.972 1.00 46.03 ? 94  ILE A O   1 
ATOM   588  C CB  . ILE A 1 94  ? -3.754  -8.700  -12.063 1.00 49.55 ? 94  ILE A CB  1 
ATOM   589  C CG1 . ILE A 1 94  ? -3.064  -7.343  -12.217 1.00 49.89 ? 94  ILE A CG1 1 
ATOM   590  C CG2 . ILE A 1 94  ? -5.087  -8.559  -11.344 1.00 45.49 ? 94  ILE A CG2 1 
ATOM   591  C CD1 . ILE A 1 94  ? -3.070  -6.505  -10.957 1.00 46.82 ? 94  ILE A CD1 1 
ATOM   592  N N   . TYR A 1 95  ? -4.086  -11.140 -9.817  1.00 48.56 ? 95  TYR A N   1 
ATOM   593  C CA  . TYR A 1 95  ? -4.987  -12.228 -9.462  1.00 50.03 ? 95  TYR A CA  1 
ATOM   594  C C   . TYR A 1 95  ? -6.244  -11.675 -8.800  1.00 50.07 ? 95  TYR A C   1 
ATOM   595  O O   . TYR A 1 95  ? -6.203  -11.213 -7.656  1.00 52.57 ? 95  TYR A O   1 
ATOM   596  C CB  . TYR A 1 95  ? -4.295  -13.230 -8.535  1.00 52.09 ? 95  TYR A CB  1 
ATOM   597  C CG  . TYR A 1 95  ? -5.226  -14.288 -7.980  1.00 53.03 ? 95  TYR A CG  1 
ATOM   598  C CD1 . TYR A 1 95  ? -5.428  -14.416 -6.610  1.00 56.05 ? 95  TYR A CD1 1 
ATOM   599  C CD2 . TYR A 1 95  ? -5.911  -15.151 -8.825  1.00 51.92 ? 95  TYR A CD2 1 
ATOM   600  C CE1 . TYR A 1 95  ? -6.280  -15.379 -6.099  1.00 60.29 ? 95  TYR A CE1 1 
ATOM   601  C CE2 . TYR A 1 95  ? -6.766  -16.118 -8.323  1.00 54.89 ? 95  TYR A CE2 1 
ATOM   602  C CZ  . TYR A 1 95  ? -6.946  -16.227 -6.960  1.00 58.39 ? 95  TYR A CZ  1 
ATOM   603  O OH  . TYR A 1 95  ? -7.795  -17.184 -6.455  1.00 59.28 ? 95  TYR A OH  1 
ATOM   604  N N   . ALA A 1 96  ? -7.359  -11.721 -9.522  1.00 44.07 ? 96  ALA A N   1 
ATOM   605  C CA  . ALA A 1 96  ? -8.608  -11.151 -9.026  1.00 44.19 ? 96  ALA A CA  1 
ATOM   606  C C   . ALA A 1 96  ? -9.679  -12.217 -8.826  1.00 44.00 ? 96  ALA A C   1 
ATOM   607  O O   . ALA A 1 96  ? -9.697  -13.228 -9.523  1.00 44.90 ? 96  ALA A O   1 
ATOM   608  C CB  . ALA A 1 96  ? -9.108  -10.070 -9.975  1.00 43.73 ? 96  ALA A CB  1 
ATOM   609  N N   . THR A 1 97  ? -10.565 -11.977 -7.864  1.00 42.22 ? 97  THR A N   1 
ATOM   610  C CA  . THR A 1 97  ? -11.605 -12.932 -7.506  1.00 49.58 ? 97  THR A CA  1 
ATOM   611  C C   . THR A 1 97  ? -12.900 -12.241 -7.095  1.00 46.94 ? 97  THR A C   1 
ATOM   612  O O   . THR A 1 97  ? -12.878 -11.230 -6.390  1.00 52.08 ? 97  THR A O   1 
ATOM   613  C CB  . THR A 1 97  ? -11.155 -13.832 -6.339  1.00 50.73 ? 97  THR A CB  1 
ATOM   614  O OG1 . THR A 1 97  ? -10.558 -13.024 -5.317  1.00 51.33 ? 97  THR A OG1 1 
ATOM   615  C CG2 . THR A 1 97  ? -10.148 -14.867 -6.817  1.00 46.69 ? 97  THR A CG2 1 
ATOM   616  N N   . ALA A 1 98  ? -14.027 -12.795 -7.531  1.00 49.49 ? 98  ALA A N   1 
ATOM   617  C CA  . ALA A 1 98  ? -15.332 -12.292 -7.115  1.00 47.54 ? 98  ALA A CA  1 
ATOM   618  C C   . ALA A 1 98  ? -15.532 -12.527 -5.621  1.00 51.09 ? 98  ALA A C   1 
ATOM   619  O O   . ALA A 1 98  ? -15.331 -13.636 -5.127  1.00 50.91 ? 98  ALA A O   1 
ATOM   620  C CB  . ALA A 1 98  ? -16.441 -12.959 -7.912  1.00 47.63 ? 98  ALA A CB  1 
ATOM   621  N N   . MET A 1 99  ? -15.916 -11.476 -4.904  1.00 54.13 ? 99  MET A N   1 
ATOM   622  C CA  . MET A 1 99  ? -16.153 -11.576 -3.469  1.00 55.73 ? 99  MET A CA  1 
ATOM   623  C C   . MET A 1 99  ? -17.633 -11.796 -3.172  1.00 60.09 ? 99  MET A C   1 
ATOM   624  O O   . MET A 1 99  ? -18.022 -12.027 -2.027  1.00 65.18 ? 99  MET A O   1 
ATOM   625  C CB  . MET A 1 99  ? -15.644 -10.326 -2.751  1.00 53.59 ? 99  MET A CB  1 
ATOM   626  C CG  . MET A 1 99  ? -14.140 -10.135 -2.854  1.00 56.24 ? 99  MET A CG  1 
ATOM   627  S SD  . MET A 1 99  ? -13.499 -9.001  -1.610  1.00 71.35 ? 99  MET A SD  1 
ATOM   628  C CE  . MET A 1 99  ? -14.362 -7.499  -2.052  1.00 55.69 ? 99  MET A CE  1 
ATOM   629  N N   . GLU A 1 100 ? -18.447 -11.717 -4.218  1.00 52.91 ? 100 GLU A N   1 
ATOM   630  C CA  . GLU A 1 100 ? -19.878 -11.973 -4.134  1.00 54.74 ? 100 GLU A CA  1 
ATOM   631  C C   . GLU A 1 100 ? -20.371 -12.169 -5.561  1.00 56.15 ? 100 GLU A C   1 
ATOM   632  O O   . GLU A 1 100 ? -19.590 -12.028 -6.501  1.00 57.74 ? 100 GLU A O   1 
ATOM   633  C CB  . GLU A 1 100 ? -20.603 -10.805 -3.463  1.00 52.32 ? 100 GLU A CB  1 
ATOM   634  C CG  . GLU A 1 100 ? -20.261 -9.437  -4.030  1.00 55.89 ? 100 GLU A CG  1 
ATOM   635  C CD  . GLU A 1 100 ? -21.178 -8.341  -3.509  1.00 59.26 ? 100 GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 100 ? -20.752 -7.587  -2.606  1.00 57.43 ? 100 GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 100 ? -22.327 -8.241  -3.995  1.00 58.56 ? 100 GLU A OE2 1 
ATOM   638  N N   . PRO A 1 101 ? -21.659 -12.508 -5.739  1.00 53.89 ? 101 PRO A N   1 
ATOM   639  C CA  . PRO A 1 101 ? -22.138 -12.646 -7.117  1.00 53.82 ? 101 PRO A CA  1 
ATOM   640  C C   . PRO A 1 101 ? -21.907 -11.345 -7.872  1.00 54.64 ? 101 PRO A C   1 
ATOM   641  O O   . PRO A 1 101 ? -22.370 -10.293 -7.431  1.00 56.24 ? 101 PRO A O   1 
ATOM   642  C CB  . PRO A 1 101 ? -23.637 -12.896 -6.944  1.00 59.64 ? 101 PRO A CB  1 
ATOM   643  C CG  . PRO A 1 101 ? -23.774 -13.460 -5.573  1.00 56.96 ? 101 PRO A CG  1 
ATOM   644  C CD  . PRO A 1 101 ? -22.715 -12.791 -4.752  1.00 57.31 ? 101 PRO A CD  1 
ATOM   645  N N   . THR A 1 102 ? -21.200 -11.418 -8.993  1.00 55.45 ? 102 THR A N   1 
ATOM   646  C CA  . THR A 1 102 ? -20.788 -10.218 -9.709  1.00 45.90 ? 102 THR A CA  1 
ATOM   647  C C   . THR A 1 102 ? -21.039 -10.315 -11.211 1.00 46.55 ? 102 THR A C   1 
ATOM   648  O O   . THR A 1 102 ? -20.710 -11.317 -11.845 1.00 49.24 ? 102 THR A O   1 
ATOM   649  C CB  . THR A 1 102 ? -19.296 -9.917  -9.460  1.00 47.37 ? 102 THR A CB  1 
ATOM   650  O OG1 . THR A 1 102 ? -19.063 -9.784  -8.052  1.00 49.63 ? 102 THR A OG1 1 
ATOM   651  C CG2 . THR A 1 102 ? -18.869 -8.635  -10.171 1.00 45.20 ? 102 THR A CG2 1 
ATOM   652  N N   . ARG A 1 103 ? -21.629 -9.265  -11.769 1.00 48.24 ? 103 ARG A N   1 
ATOM   653  C CA  . ARG A 1 103 ? -21.824 -9.164  -13.207 1.00 47.17 ? 103 ARG A CA  1 
ATOM   654  C C   . ARG A 1 103 ? -20.842 -8.153  -13.795 1.00 46.38 ? 103 ARG A C   1 
ATOM   655  O O   . ARG A 1 103 ? -20.673 -7.054  -13.264 1.00 44.83 ? 103 ARG A O   1 
ATOM   656  C CB  . ARG A 1 103 ? -23.270 -8.774  -13.530 1.00 43.29 ? 103 ARG A CB  1 
ATOM   657  C CG  . ARG A 1 103 ? -23.502 -8.387  -14.984 1.00 52.74 ? 103 ARG A CG  1 
ATOM   658  C CD  . ARG A 1 103 ? -24.986 -8.370  -15.340 1.00 53.01 ? 103 ARG A CD  1 
ATOM   659  N NE  . ARG A 1 103 ? -25.390 -9.552  -16.101 1.00 62.52 ? 103 ARG A NE  1 
ATOM   660  C CZ  . ARG A 1 103 ? -26.647 -9.829  -16.438 1.00 63.63 ? 103 ARG A CZ  1 
ATOM   661  N NH1 . ARG A 1 103 ? -27.628 -9.015  -16.072 1.00 64.76 ? 103 ARG A NH1 1 
ATOM   662  N NH2 . ARG A 1 103 ? -26.925 -10.923 -17.136 1.00 60.96 ? 103 ARG A NH2 1 
ATOM   663  N N   . THR A 1 104 ? -20.182 -8.540  -14.881 1.00 45.36 ? 104 THR A N   1 
ATOM   664  C CA  . THR A 1 104 ? -19.228 -7.663  -15.547 1.00 42.38 ? 104 THR A CA  1 
ATOM   665  C C   . THR A 1 104 ? -19.537 -7.538  -17.032 1.00 43.73 ? 104 THR A C   1 
ATOM   666  O O   . THR A 1 104 ? -20.407 -8.229  -17.565 1.00 39.46 ? 104 THR A O   1 
ATOM   667  C CB  . THR A 1 104 ? -17.781 -8.171  -15.400 1.00 38.11 ? 104 THR A CB  1 
ATOM   668  O OG1 . THR A 1 104 ? -17.649 -9.444  -16.047 1.00 42.83 ? 104 THR A OG1 1 
ATOM   669  C CG2 . THR A 1 104 ? -17.402 -8.302  -13.937 1.00 34.08 ? 104 THR A CG2 1 
ATOM   670  N N   . CYS A 1 105 ? -18.817 -6.639  -17.692 1.00 39.79 ? 105 CYS A N   1 
ATOM   671  C CA  . CYS A 1 105 ? -18.901 -6.492  -19.135 1.00 39.02 ? 105 CYS A CA  1 
ATOM   672  C C   . CYS A 1 105 ? -17.490 -6.266  -19.659 1.00 38.76 ? 105 CYS A C   1 
ATOM   673  O O   . CYS A 1 105 ? -16.835 -5.297  -19.285 1.00 35.65 ? 105 CYS A O   1 
ATOM   674  C CB  . CYS A 1 105 ? -19.811 -5.321  -19.504 1.00 39.71 ? 105 CYS A CB  1 
ATOM   675  S SG  . CYS A 1 105 ? -19.934 -4.998  -21.272 1.00 39.39 ? 105 CYS A SG  1 
ATOM   676  N N   . TRP A 1 106 ? -17.016 -7.176  -20.501 1.00 33.24 ? 106 TRP A N   1 
ATOM   677  C CA  . TRP A 1 106 ? -15.652 -7.104  -21.011 1.00 34.56 ? 106 TRP A CA  1 
ATOM   678  C C   . TRP A 1 106 ? -15.566 -6.329  -22.329 1.00 34.90 ? 106 TRP A C   1 
ATOM   679  O O   . TRP A 1 106 ? -16.182 -6.704  -23.330 1.00 36.18 ? 106 TRP A O   1 
ATOM   680  C CB  . TRP A 1 106 ? -15.063 -8.514  -21.154 1.00 36.71 ? 106 TRP A CB  1 
ATOM   681  C CG  . TRP A 1 106 ? -14.731 -9.146  -19.830 1.00 31.31 ? 106 TRP A CG  1 
ATOM   682  C CD1 . TRP A 1 106 ? -15.525 -9.186  -18.719 1.00 32.41 ? 106 TRP A CD1 1 
ATOM   683  C CD2 . TRP A 1 106 ? -13.520 -9.829  -19.480 1.00 29.13 ? 106 TRP A CD2 1 
ATOM   684  N NE1 . TRP A 1 106 ? -14.879 -9.841  -17.697 1.00 32.86 ? 106 TRP A NE1 1 
ATOM   685  C CE2 . TRP A 1 106 ? -13.648 -10.247 -18.141 1.00 31.45 ? 106 TRP A CE2 1 
ATOM   686  C CE3 . TRP A 1 106 ? -12.340 -10.123 -20.170 1.00 32.42 ? 106 TRP A CE3 1 
ATOM   687  C CZ2 . TRP A 1 106 ? -12.641 -10.945 -17.478 1.00 33.81 ? 106 TRP A CZ2 1 
ATOM   688  C CZ3 . TRP A 1 106 ? -11.341 -10.816 -19.509 1.00 35.36 ? 106 TRP A CZ3 1 
ATOM   689  C CH2 . TRP A 1 106 ? -11.497 -11.217 -18.178 1.00 37.60 ? 106 TRP A CH2 1 
ATOM   690  N N   . PHE A 1 107 ? -14.799 -5.242  -22.313 1.00 29.89 ? 107 PHE A N   1 
ATOM   691  C CA  . PHE A 1 107 ? -14.641 -4.379  -23.482 1.00 27.81 ? 107 PHE A CA  1 
ATOM   692  C C   . PHE A 1 107 ? -13.265 -4.543  -24.113 1.00 30.34 ? 107 PHE A C   1 
ATOM   693  O O   . PHE A 1 107 ? -12.264 -4.109  -23.544 1.00 27.87 ? 107 PHE A O   1 
ATOM   694  C CB  . PHE A 1 107 ? -14.813 -2.911  -23.092 1.00 29.54 ? 107 PHE A CB  1 
ATOM   695  C CG  . PHE A 1 107 ? -16.223 -2.528  -22.749 1.00 29.35 ? 107 PHE A CG  1 
ATOM   696  C CD1 . PHE A 1 107 ? -16.621 -2.410  -21.429 1.00 33.44 ? 107 PHE A CD1 1 
ATOM   697  C CD2 . PHE A 1 107 ? -17.145 -2.263  -23.747 1.00 31.80 ? 107 PHE A CD2 1 
ATOM   698  C CE1 . PHE A 1 107 ? -17.917 -2.049  -21.110 1.00 35.35 ? 107 PHE A CE1 1 
ATOM   699  C CE2 . PHE A 1 107 ? -18.440 -1.901  -23.436 1.00 29.18 ? 107 PHE A CE2 1 
ATOM   700  C CZ  . PHE A 1 107 ? -18.826 -1.797  -22.114 1.00 31.87 ? 107 PHE A CZ  1 
ATOM   701  N N   . SER A 1 108 ? -13.212 -5.158  -25.289 1.00 29.57 ? 108 SER A N   1 
ATOM   702  C CA  . SER A 1 108 ? -11.966 -5.224  -26.041 1.00 31.78 ? 108 SER A CA  1 
ATOM   703  C C   . SER A 1 108 ? -11.724 -3.867  -26.686 1.00 30.30 ? 108 SER A C   1 
ATOM   704  O O   . SER A 1 108 ? -12.617 -3.020  -26.700 1.00 29.24 ? 108 SER A O   1 
ATOM   705  C CB  . SER A 1 108 ? -12.052 -6.295  -27.124 1.00 31.97 ? 108 SER A CB  1 
ATOM   706  O OG  . SER A 1 108 ? -13.047 -5.952  -28.076 1.00 31.90 ? 108 SER A OG  1 
ATOM   707  N N   . GLU A 1 109 ? -10.523 -3.668  -27.224 1.00 26.25 ? 109 GLU A N   1 
ATOM   708  C CA  . GLU A 1 109 ? -10.196 -2.426  -27.920 1.00 28.81 ? 109 GLU A CA  1 
ATOM   709  C C   . GLU A 1 109 ? -11.155 -2.183  -29.079 1.00 26.54 ? 109 GLU A C   1 
ATOM   710  O O   . GLU A 1 109 ? -11.617 -1.064  -29.294 1.00 23.83 ? 109 GLU A O   1 
ATOM   711  C CB  . GLU A 1 109 ? -8.758  -2.464  -28.445 1.00 30.47 ? 109 GLU A CB  1 
ATOM   712  C CG  . GLU A 1 109 ? -8.259  -1.134  -28.991 1.00 25.97 ? 109 GLU A CG  1 
ATOM   713  C CD  . GLU A 1 109 ? -6.837  -1.217  -29.518 1.00 32.66 ? 109 GLU A CD  1 
ATOM   714  O OE1 . GLU A 1 109 ? -5.905  -0.841  -28.777 1.00 35.95 ? 109 GLU A OE1 1 
ATOM   715  O OE2 . GLU A 1 109 ? -6.647  -1.670  -30.667 1.00 32.44 ? 109 GLU A OE2 1 
ATOM   716  N N   . LYS A 1 110 ? -11.444 -3.241  -29.826 1.00 27.03 ? 110 LYS A N   1 
ATOM   717  C CA  . LYS A 1 110 ? -12.359 -3.157  -30.959 1.00 28.49 ? 110 LYS A CA  1 
ATOM   718  C C   . LYS A 1 110 ? -13.767 -2.718  -30.541 1.00 30.86 ? 110 LYS A C   1 
ATOM   719  O O   . LYS A 1 110 ? -14.409 -1.934  -31.242 1.00 25.54 ? 110 LYS A O   1 
ATOM   720  C CB  . LYS A 1 110 ? -12.410 -4.489  -31.705 1.00 29.80 ? 110 LYS A CB  1 
ATOM   721  N N   . SER A 1 111 ? -14.249 -3.220  -29.407 1.00 27.03 ? 111 SER A N   1 
ATOM   722  C CA  . SER A 1 111 ? -15.578 -2.835  -28.932 1.00 28.28 ? 111 SER A CA  1 
ATOM   723  C C   . SER A 1 111 ? -15.596 -1.377  -28.473 1.00 27.18 ? 111 SER A C   1 
ATOM   724  O O   . SER A 1 111 ? -16.606 -0.682  -28.612 1.00 26.31 ? 111 SER A O   1 
ATOM   725  C CB  . SER A 1 111 ? -16.057 -3.759  -27.812 1.00 30.94 ? 111 SER A CB  1 
ATOM   726  O OG  . SER A 1 111 ? -15.478 -3.403  -26.569 1.00 37.66 ? 111 SER A OG  1 
ATOM   727  N N   . LEU A 1 112 ? -14.475 -0.916  -27.930 1.00 29.19 ? 112 LEU A N   1 
ATOM   728  C CA  . LEU A 1 112 ? -14.355 0.480   -27.534 1.00 28.89 ? 112 LEU A CA  1 
ATOM   729  C C   . LEU A 1 112 ? -14.406 1.404   -28.750 1.00 26.97 ? 112 LEU A C   1 
ATOM   730  O O   . LEU A 1 112 ? -15.034 2.464   -28.709 1.00 23.85 ? 112 LEU A O   1 
ATOM   731  C CB  . LEU A 1 112 ? -13.077 0.715   -26.721 1.00 27.37 ? 112 LEU A CB  1 
ATOM   732  C CG  . LEU A 1 112 ? -13.121 0.131   -25.301 1.00 29.87 ? 112 LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 112 ? -11.785 0.308   -24.583 1.00 26.97 ? 112 LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 112 ? -14.251 0.766   -24.503 1.00 28.31 ? 112 LEU A CD2 1 
ATOM   735  N N   . ARG A 1 113 ? -13.750 1.004   -29.835 1.00 24.25 ? 113 ARG A N   1 
ATOM   736  C CA  . ARG A 1 113 ? -13.795 1.812   -31.048 1.00 27.52 ? 113 ARG A CA  1 
ATOM   737  C C   . ARG A 1 113 ? -15.249 1.977   -31.487 1.00 24.62 ? 113 ARG A C   1 
ATOM   738  O O   . ARG A 1 113 ? -15.671 3.059   -31.885 1.00 20.06 ? 113 ARG A O   1 
ATOM   739  C CB  . ARG A 1 113 ? -12.946 1.197   -32.165 1.00 20.70 ? 113 ARG A CB  1 
ATOM   740  C CG  . ARG A 1 113 ? -11.444 1.202   -31.876 1.00 22.54 ? 113 ARG A CG  1 
ATOM   741  C CD  . ARG A 1 113 ? -10.656 0.578   -33.020 1.00 21.54 ? 113 ARG A CD  1 
ATOM   742  N NE  . ARG A 1 113 ? -9.263  0.343   -32.645 1.00 26.69 ? 113 ARG A NE  1 
ATOM   743  C CZ  . ARG A 1 113 ? -8.280  1.222   -32.819 1.00 26.28 ? 113 ARG A CZ  1 
ATOM   744  N NH1 . ARG A 1 113 ? -8.531  2.407   -33.370 1.00 23.07 ? 113 ARG A NH1 1 
ATOM   745  N NH2 . ARG A 1 113 ? -7.044  0.915   -32.440 1.00 26.70 ? 113 ARG A NH2 1 
ATOM   746  N N   . THR A 1 114 ? -16.009 0.893   -31.408 1.00 23.93 ? 114 THR A N   1 
ATOM   747  C CA  . THR A 1 114 ? -17.423 0.934   -31.755 1.00 23.27 ? 114 THR A CA  1 
ATOM   748  C C   . THR A 1 114 ? -18.174 1.914   -30.856 1.00 23.11 ? 114 THR A C   1 
ATOM   749  O O   . THR A 1 114 ? -18.958 2.735   -31.337 1.00 26.14 ? 114 THR A O   1 
ATOM   750  C CB  . THR A 1 114 ? -18.053 -0.463  -31.666 1.00 24.88 ? 114 THR A CB  1 
ATOM   751  O OG1 . THR A 1 114 ? -17.400 -1.338  -32.598 1.00 29.67 ? 114 THR A OG1 1 
ATOM   752  C CG2 . THR A 1 114 ? -19.540 -0.403  -31.991 1.00 27.99 ? 114 THR A CG2 1 
ATOM   753  N N   . VAL A 1 115 ? -17.933 1.824   -29.552 1.00 22.20 ? 115 VAL A N   1 
ATOM   754  C CA  . VAL A 1 115 ? -18.518 2.760   -28.599 1.00 22.48 ? 115 VAL A CA  1 
ATOM   755  C C   . VAL A 1 115 ? -18.179 4.203   -28.970 1.00 24.85 ? 115 VAL A C   1 
ATOM   756  O O   . VAL A 1 115 ? -19.073 5.031   -29.134 1.00 24.78 ? 115 VAL A O   1 
ATOM   757  C CB  . VAL A 1 115 ? -18.033 2.502   -27.155 1.00 26.29 ? 115 VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 115 ? -18.489 3.627   -26.234 1.00 27.96 ? 115 VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 115 ? -18.529 1.153   -26.644 1.00 30.11 ? 115 VAL A CG2 1 
ATOM   760  N N   . PHE A 1 116 ? -16.887 4.497   -29.112 1.00 23.32 ? 116 PHE A N   1 
ATOM   761  C CA  . PHE A 1 116 ? -16.435 5.862   -29.383 1.00 22.88 ? 116 PHE A CA  1 
ATOM   762  C C   . PHE A 1 116 ? -16.970 6.409   -30.703 1.00 21.07 ? 116 PHE A C   1 
ATOM   763  O O   . PHE A 1 116 ? -17.226 7.601   -30.824 1.00 21.06 ? 116 PHE A O   1 
ATOM   764  C CB  . PHE A 1 116 ? -14.897 5.961   -29.352 1.00 23.34 ? 116 PHE A CB  1 
ATOM   765  C CG  . PHE A 1 116 ? -14.285 5.542   -28.044 1.00 20.77 ? 116 PHE A CG  1 
ATOM   766  C CD1 . PHE A 1 116 ? -14.969 5.731   -26.854 1.00 22.32 ? 116 PHE A CD1 1 
ATOM   767  C CD2 . PHE A 1 116 ? -13.019 4.967   -28.004 1.00 23.23 ? 116 PHE A CD2 1 
ATOM   768  C CE1 . PHE A 1 116 ? -14.414 5.340   -25.647 1.00 22.71 ? 116 PHE A CE1 1 
ATOM   769  C CE2 . PHE A 1 116 ? -12.455 4.578   -26.800 1.00 19.95 ? 116 PHE A CE2 1 
ATOM   770  C CZ  . PHE A 1 116 ? -13.153 4.762   -25.622 1.00 25.22 ? 116 PHE A CZ  1 
ATOM   771  N N   . ARG A 1 117 ? -17.122 5.539   -31.694 1.00 18.34 ? 117 ARG A N   1 
ATOM   772  C CA  . ARG A 1 117 ? -17.663 5.956   -32.983 1.00 21.45 ? 117 ARG A CA  1 
ATOM   773  C C   . ARG A 1 117 ? -19.131 6.366   -32.871 1.00 27.74 ? 117 ARG A C   1 
ATOM   774  O O   . ARG A 1 117 ? -19.606 7.204   -33.638 1.00 25.38 ? 117 ARG A O   1 
ATOM   775  C CB  . ARG A 1 117 ? -17.500 4.857   -34.031 1.00 24.48 ? 117 ARG A CB  1 
ATOM   776  C CG  . ARG A 1 117 ? -16.054 4.665   -34.480 1.00 25.68 ? 117 ARG A CG  1 
ATOM   777  C CD  . ARG A 1 117 ? -15.848 3.331   -35.168 1.00 21.50 ? 117 ARG A CD  1 
ATOM   778  N NE  . ARG A 1 117 ? -14.424 3.059   -35.345 1.00 25.88 ? 117 ARG A NE  1 
ATOM   779  C CZ  . ARG A 1 117 ? -13.935 2.127   -36.153 1.00 26.08 ? 117 ARG A CZ  1 
ATOM   780  N NH1 . ARG A 1 117 ? -14.757 1.369   -36.867 1.00 24.82 ? 117 ARG A NH1 1 
ATOM   781  N NH2 . ARG A 1 117 ? -12.621 1.955   -36.253 1.00 25.53 ? 117 ARG A NH2 1 
ATOM   782  N N   . THR A 1 118 ? -19.842 5.780   -31.913 1.00 23.54 ? 118 THR A N   1 
ATOM   783  C CA  . THR A 1 118 ? -21.242 6.118   -31.693 1.00 26.14 ? 118 THR A CA  1 
ATOM   784  C C   . THR A 1 118 ? -21.388 7.370   -30.837 1.00 27.02 ? 118 THR A C   1 
ATOM   785  O O   . THR A 1 118 ? -22.207 8.245   -31.131 1.00 26.95 ? 118 THR A O   1 
ATOM   786  C CB  . THR A 1 118 ? -21.991 4.959   -31.001 1.00 24.23 ? 118 THR A CB  1 
ATOM   787  O OG1 . THR A 1 118 ? -21.818 3.754   -31.760 1.00 28.52 ? 118 THR A OG1 1 
ATOM   788  C CG2 . THR A 1 118 ? -23.484 5.279   -30.888 1.00 27.96 ? 118 THR A CG2 1 
ATOM   789  N N   . ASP A 1 119 ? -20.594 7.440   -29.772 1.00 25.21 ? 119 ASP A N   1 
ATOM   790  C CA  . ASP A 1 119 ? -20.678 8.535   -28.810 1.00 25.38 ? 119 ASP A CA  1 
ATOM   791  C C   . ASP A 1 119 ? -19.283 9.028   -28.422 1.00 25.31 ? 119 ASP A C   1 
ATOM   792  O O   . ASP A 1 119 ? -18.678 8.548   -27.458 1.00 23.95 ? 119 ASP A O   1 
ATOM   793  C CB  . ASP A 1 119 ? -21.443 8.084   -27.565 1.00 28.44 ? 119 ASP A CB  1 
ATOM   794  C CG  . ASP A 1 119 ? -21.683 9.212   -26.583 1.00 25.90 ? 119 ASP A CG  1 
ATOM   795  O OD1 . ASP A 1 119 ? -21.390 10.373  -26.920 1.00 25.52 ? 119 ASP A OD1 1 
ATOM   796  O OD2 . ASP A 1 119 ? -22.176 8.937   -25.470 1.00 34.88 ? 119 ASP A OD2 1 
ATOM   797  N N   . GLU A 1 120 ? -18.788 9.999   -29.176 1.00 26.26 ? 120 GLU A N   1 
ATOM   798  C CA  . GLU A 1 120 ? -17.459 10.560  -28.948 1.00 27.53 ? 120 GLU A CA  1 
ATOM   799  C C   . GLU A 1 120 ? -17.242 10.960  -27.492 1.00 26.05 ? 120 GLU A C   1 
ATOM   800  O O   . GLU A 1 120 ? -16.118 10.907  -26.985 1.00 22.50 ? 120 GLU A O   1 
ATOM   801  C CB  . GLU A 1 120 ? -17.235 11.764  -29.864 1.00 25.79 ? 120 GLU A CB  1 
ATOM   802  C CG  . GLU A 1 120 ? -15.785 12.196  -29.994 1.00 30.95 ? 120 GLU A CG  1 
ATOM   803  C CD  . GLU A 1 120 ? -15.624 13.436  -30.861 1.00 32.37 ? 120 GLU A CD  1 
ATOM   804  O OE1 . GLU A 1 120 ? -16.169 14.500  -30.493 1.00 36.91 ? 120 GLU A OE1 1 
ATOM   805  O OE2 . GLU A 1 120 ? -14.950 13.348  -31.909 1.00 35.37 ? 120 GLU A OE2 1 
ATOM   806  N N   . ASP A 1 121 ? -18.318 11.348  -26.813 1.00 22.24 ? 121 ASP A N   1 
ATOM   807  C CA  . ASP A 1 121 ? -18.207 11.843  -25.439 1.00 21.83 ? 121 ASP A CA  1 
ATOM   808  C C   . ASP A 1 121 ? -17.686 10.795  -24.452 1.00 24.71 ? 121 ASP A C   1 
ATOM   809  O O   . ASP A 1 121 ? -17.054 11.141  -23.452 1.00 23.72 ? 121 ASP A O   1 
ATOM   810  C CB  . ASP A 1 121 ? -19.548 12.402  -24.947 1.00 26.10 ? 121 ASP A CB  1 
ATOM   811  C CG  . ASP A 1 121 ? -19.935 13.690  -25.651 1.00 31.14 ? 121 ASP A CG  1 
ATOM   812  O OD1 . ASP A 1 121 ? -19.086 14.262  -26.368 1.00 29.07 ? 121 ASP A OD1 1 
ATOM   813  O OD2 . ASP A 1 121 ? -21.090 14.131  -25.487 1.00 26.33 ? 121 ASP A OD2 1 
ATOM   814  N N   . MET A 1 122 ? -17.954 9.522   -24.733 1.00 23.14 ? 122 MET A N   1 
ATOM   815  C CA  . MET A 1 122 ? -17.516 8.434   -23.858 1.00 24.02 ? 122 MET A CA  1 
ATOM   816  C C   . MET A 1 122 ? -15.995 8.388   -23.702 1.00 25.78 ? 122 MET A C   1 
ATOM   817  O O   . MET A 1 122 ? -15.488 7.968   -22.659 1.00 23.00 ? 122 MET A O   1 
ATOM   818  C CB  . MET A 1 122 ? -18.023 7.078   -24.363 1.00 24.32 ? 122 MET A CB  1 
ATOM   819  C CG  . MET A 1 122 ? -19.502 6.799   -24.087 1.00 29.69 ? 122 MET A CG  1 
ATOM   820  S SD  . MET A 1 122 ? -19.930 6.948   -22.345 1.00 33.53 ? 122 MET A SD  1 
ATOM   821  C CE  . MET A 1 122 ? -20.553 8.626   -22.329 1.00 39.74 ? 122 MET A CE  1 
ATOM   822  N N   . ILE A 1 123 ? -15.276 8.792   -24.745 1.00 22.21 ? 123 ILE A N   1 
ATOM   823  C CA  . ILE A 1 123 ? -13.824 8.915   -24.668 1.00 18.69 ? 123 ILE A CA  1 
ATOM   824  C C   . ILE A 1 123 ? -13.445 9.702   -23.424 1.00 21.72 ? 123 ILE A C   1 
ATOM   825  O O   . ILE A 1 123 ? -12.597 9.289   -22.631 1.00 21.81 ? 123 ILE A O   1 
ATOM   826  C CB  . ILE A 1 123 ? -13.254 9.688   -25.879 1.00 21.29 ? 123 ILE A CB  1 
ATOM   827  C CG1 . ILE A 1 123 ? -13.519 8.940   -27.187 1.00 19.09 ? 123 ILE A CG1 1 
ATOM   828  C CG2 . ILE A 1 123 ? -11.755 9.957   -25.692 1.00 19.96 ? 123 ILE A CG2 1 
ATOM   829  C CD1 . ILE A 1 123 ? -13.070 9.712   -28.402 1.00 25.64 ? 123 ILE A CD1 1 
ATOM   830  N N   . PHE A 1 124 ? -14.089 10.847  -23.260 1.00 20.29 ? 124 PHE A N   1 
ATOM   831  C CA  . PHE A 1 124 ? -13.738 11.751  -22.177 1.00 26.15 ? 124 PHE A CA  1 
ATOM   832  C C   . PHE A 1 124 ? -14.275 11.312  -20.815 1.00 26.09 ? 124 PHE A C   1 
ATOM   833  O O   . PHE A 1 124 ? -13.710 11.681  -19.783 1.00 25.06 ? 124 PHE A O   1 
ATOM   834  C CB  . PHE A 1 124 ? -14.141 13.184  -22.535 1.00 21.37 ? 124 PHE A CB  1 
ATOM   835  C CG  . PHE A 1 124 ? -13.452 13.699  -23.768 1.00 23.30 ? 124 PHE A CG  1 
ATOM   836  C CD1 . PHE A 1 124 ? -14.088 13.676  -24.998 1.00 26.54 ? 124 PHE A CD1 1 
ATOM   837  C CD2 . PHE A 1 124 ? -12.152 14.174  -23.699 1.00 21.00 ? 124 PHE A CD2 1 
ATOM   838  C CE1 . PHE A 1 124 ? -13.445 14.134  -26.135 1.00 31.10 ? 124 PHE A CE1 1 
ATOM   839  C CE2 . PHE A 1 124 ? -11.505 14.633  -24.828 1.00 23.74 ? 124 PHE A CE2 1 
ATOM   840  C CZ  . PHE A 1 124 ? -12.151 14.617  -26.048 1.00 23.21 ? 124 PHE A CZ  1 
ATOM   841  N N   . GLU A 1 125 ? -15.345 10.516  -20.815 1.00 27.85 ? 125 GLU A N   1 
ATOM   842  C CA  . GLU A 1 125 ? -15.846 9.896   -19.587 1.00 25.55 ? 125 GLU A CA  1 
ATOM   843  C C   . GLU A 1 125 ? -14.795 8.944   -19.041 1.00 29.43 ? 125 GLU A C   1 
ATOM   844  O O   . GLU A 1 125 ? -14.468 8.967   -17.854 1.00 28.83 ? 125 GLU A O   1 
ATOM   845  C CB  . GLU A 1 125 ? -17.138 9.111   -19.849 1.00 27.06 ? 125 GLU A CB  1 
ATOM   846  C CG  . GLU A 1 125 ? -18.361 9.961   -20.129 1.00 33.10 ? 125 GLU A CG  1 
ATOM   847  C CD  . GLU A 1 125 ? -18.861 10.686  -18.897 1.00 41.39 ? 125 GLU A CD  1 
ATOM   848  O OE1 . GLU A 1 125 ? -19.455 11.777  -19.049 1.00 45.40 ? 125 GLU A OE1 1 
ATOM   849  O OE2 . GLU A 1 125 ? -18.649 10.168  -17.777 1.00 42.57 ? 125 GLU A OE2 1 
ATOM   850  N N   . ILE A 1 126 ? -14.272 8.094   -19.919 1.00 27.42 ? 126 ILE A N   1 
ATOM   851  C CA  . ILE A 1 126 ? -13.210 7.168   -19.534 1.00 28.06 ? 126 ILE A CA  1 
ATOM   852  C C   . ILE A 1 126 ? -11.947 7.921   -19.120 1.00 28.77 ? 126 ILE A C   1 
ATOM   853  O O   . ILE A 1 126 ? -11.318 7.594   -18.118 1.00 28.56 ? 126 ILE A O   1 
ATOM   854  C CB  . ILE A 1 126 ? -12.890 6.172   -20.658 1.00 32.15 ? 126 ILE A CB  1 
ATOM   855  C CG1 . ILE A 1 126 ? -14.030 5.158   -20.803 1.00 30.26 ? 126 ILE A CG1 1 
ATOM   856  C CG2 . ILE A 1 126 ? -11.583 5.443   -20.375 1.00 32.00 ? 126 ILE A CG2 1 
ATOM   857  C CD1 . ILE A 1 126 ? -13.821 4.160   -21.915 1.00 31.46 ? 126 ILE A CD1 1 
ATOM   858  N N   . PHE A 1 127 ? -11.587 8.947   -19.882 1.00 31.18 ? 127 PHE A N   1 
ATOM   859  C CA  . PHE A 1 127 ? -10.384 9.710   -19.575 1.00 32.82 ? 127 PHE A CA  1 
ATOM   860  C C   . PHE A 1 127 ? -10.507 10.452  -18.238 1.00 30.49 ? 127 PHE A C   1 
ATOM   861  O O   . PHE A 1 127 ? -9.550  10.515  -17.468 1.00 28.77 ? 127 PHE A O   1 
ATOM   862  C CB  . PHE A 1 127 ? -10.035 10.677  -20.713 1.00 30.15 ? 127 PHE A CB  1 
ATOM   863  C CG  . PHE A 1 127 ? -8.629  11.182  -20.655 1.00 37.62 ? 127 PHE A CG  1 
ATOM   864  C CD1 . PHE A 1 127 ? -7.610  10.354  -20.218 1.00 39.48 ? 127 PHE A CD1 1 
ATOM   865  C CD2 . PHE A 1 127 ? -8.320  12.477  -21.036 1.00 41.81 ? 127 PHE A CD2 1 
ATOM   866  C CE1 . PHE A 1 127 ? -6.309  10.806  -20.153 1.00 35.92 ? 127 PHE A CE1 1 
ATOM   867  C CE2 . PHE A 1 127 ? -7.018  12.937  -20.974 1.00 36.65 ? 127 PHE A CE2 1 
ATOM   868  C CZ  . PHE A 1 127 ? -6.013  12.099  -20.535 1.00 36.11 ? 127 PHE A CZ  1 
ATOM   869  N N   . LYS A 1 128 ? -11.685 11.005  -17.962 1.00 26.80 ? 128 LYS A N   1 
ATOM   870  C CA  . LYS A 1 128 ? -11.916 11.682  -16.689 1.00 30.90 ? 128 LYS A CA  1 
ATOM   871  C C   . LYS A 1 128 ? -11.782 10.696  -15.530 1.00 34.63 ? 128 LYS A C   1 
ATOM   872  O O   . LYS A 1 128 ? -11.351 11.057  -14.434 1.00 34.07 ? 128 LYS A O   1 
ATOM   873  C CB  . LYS A 1 128 ? -13.289 12.364  -16.670 1.00 32.79 ? 128 LYS A CB  1 
ATOM   874  C CG  . LYS A 1 128 ? -13.619 13.063  -15.358 1.00 35.96 ? 128 LYS A CG  1 
ATOM   875  C CD  . LYS A 1 128 ? -14.517 12.217  -14.472 1.00 47.18 ? 128 LYS A CD  1 
ATOM   876  C CE  . LYS A 1 128 ? -15.944 12.755  -14.460 1.00 48.83 ? 128 LYS A CE  1 
ATOM   877  N NZ  . LYS A 1 128 ? -16.372 13.223  -15.805 1.00 44.25 ? 128 LYS A NZ  1 
ATOM   878  N N   . ASN A 1 129 ? -12.150 9.446   -15.785 1.00 34.20 ? 129 ASN A N   1 
ATOM   879  C CA  . ASN A 1 129 ? -12.059 8.393   -14.780 1.00 28.68 ? 129 ASN A CA  1 
ATOM   880  C C   . ASN A 1 129 ? -10.612 8.111   -14.377 1.00 31.49 ? 129 ASN A C   1 
ATOM   881  O O   . ASN A 1 129 ? -10.300 7.971   -13.192 1.00 29.18 ? 129 ASN A O   1 
ATOM   882  C CB  . ASN A 1 129 ? -12.725 7.120   -15.310 1.00 32.21 ? 129 ASN A CB  1 
ATOM   883  C CG  . ASN A 1 129 ? -12.515 5.928   -14.407 1.00 34.69 ? 129 ASN A CG  1 
ATOM   884  O OD1 . ASN A 1 129 ? -11.714 5.042   -14.708 1.00 35.54 ? 129 ASN A OD1 1 
ATOM   885  N ND2 . ASN A 1 129 ? -13.232 5.896   -13.292 1.00 33.70 ? 129 ASN A ND2 1 
ATOM   886  N N   . TYR A 1 130 ? -9.728  8.045   -15.367 1.00 31.13 ? 130 TYR A N   1 
ATOM   887  C CA  . TYR A 1 130 ? -8.321  7.750   -15.112 1.00 30.93 ? 130 TYR A CA  1 
ATOM   888  C C   . TYR A 1 130 ? -7.538  8.946   -14.583 1.00 32.12 ? 130 TYR A C   1 
ATOM   889  O O   . TYR A 1 130 ? -6.555  8.778   -13.861 1.00 33.76 ? 130 TYR A O   1 
ATOM   890  C CB  . TYR A 1 130 ? -7.660  7.130   -16.346 1.00 33.29 ? 130 TYR A CB  1 
ATOM   891  C CG  . TYR A 1 130 ? -7.964  5.654   -16.438 1.00 33.35 ? 130 TYR A CG  1 
ATOM   892  C CD1 . TYR A 1 130 ? -9.174  5.207   -16.951 1.00 37.98 ? 130 TYR A CD1 1 
ATOM   893  C CD2 . TYR A 1 130 ? -7.068  4.709   -15.954 1.00 33.21 ? 130 TYR A CD2 1 
ATOM   894  C CE1 . TYR A 1 130 ? -9.473  3.857   -17.008 1.00 35.71 ? 130 TYR A CE1 1 
ATOM   895  C CE2 . TYR A 1 130 ? -7.353  3.359   -16.010 1.00 37.30 ? 130 TYR A CE2 1 
ATOM   896  C CZ  . TYR A 1 130 ? -8.557  2.939   -16.539 1.00 37.74 ? 130 TYR A CZ  1 
ATOM   897  O OH  . TYR A 1 130 ? -8.840  1.596   -16.592 1.00 42.37 ? 130 TYR A OH  1 
ATOM   898  N N   . LEU A 1 131 ? -7.982  10.149  -14.930 1.00 25.96 ? 131 LEU A N   1 
ATOM   899  C CA  . LEU A 1 131 ? -7.372  11.355  -14.381 1.00 32.53 ? 131 LEU A CA  1 
ATOM   900  C C   . LEU A 1 131 ? -7.621  11.417  -12.877 1.00 31.93 ? 131 LEU A C   1 
ATOM   901  O O   . LEU A 1 131 ? -6.743  11.796  -12.106 1.00 33.78 ? 131 LEU A O   1 
ATOM   902  C CB  . LEU A 1 131 ? -7.911  12.610  -15.075 1.00 30.41 ? 131 LEU A CB  1 
ATOM   903  C CG  . LEU A 1 131 ? -7.438  12.787  -16.521 1.00 33.08 ? 131 LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 131 ? -8.121  13.978  -17.186 1.00 30.62 ? 131 LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 131 ? -5.922  12.933  -16.575 1.00 37.64 ? 131 LEU A CD2 1 
ATOM   906  N N   . THR A 1 132 ? -8.824  11.029  -12.470 1.00 27.56 ? 132 THR A N   1 
ATOM   907  C CA  . THR A 1 132 ? -9.187  10.973  -11.055 1.00 33.41 ? 132 THR A CA  1 
ATOM   908  C C   . THR A 1 132 ? -8.368  9.933   -10.275 1.00 33.25 ? 132 THR A C   1 
ATOM   909  O O   . THR A 1 132 ? -7.951  10.180  -9.143  1.00 34.61 ? 132 THR A O   1 
ATOM   910  C CB  . THR A 1 132 ? -10.686 10.674  -10.881 1.00 29.62 ? 132 THR A CB  1 
ATOM   911  O OG1 . THR A 1 132 ? -11.454 11.607  -11.651 1.00 31.73 ? 132 THR A OG1 1 
ATOM   912  C CG2 . THR A 1 132 ? -11.091 10.773  -9.416  1.00 31.33 ? 132 THR A CG2 1 
ATOM   913  N N   . LYS A 1 133 ? -8.139  8.773   -10.882 1.00 28.37 ? 133 LYS A N   1 
ATOM   914  C CA  . LYS A 1 133 ? -7.343  7.725   -10.250 1.00 34.61 ? 133 LYS A CA  1 
ATOM   915  C C   . LYS A 1 133 ? -5.881  8.130   -10.066 1.00 35.04 ? 133 LYS A C   1 
ATOM   916  O O   . LYS A 1 133 ? -5.277  7.876   -9.021  1.00 33.63 ? 133 LYS A O   1 
ATOM   917  C CB  . LYS A 1 133 ? -7.420  6.438   -11.067 1.00 34.97 ? 133 LYS A CB  1 
ATOM   918  C CG  . LYS A 1 133 ? -8.814  5.871   -11.191 1.00 30.23 ? 133 LYS A CG  1 
ATOM   919  C CD  . LYS A 1 133 ? -8.792  4.582   -11.998 1.00 36.87 ? 133 LYS A CD  1 
ATOM   920  C CE  . LYS A 1 133 ? -10.113 3.838   -11.896 1.00 33.39 ? 133 LYS A CE  1 
ATOM   921  N NZ  . LYS A 1 133 ? -10.092 2.568   -12.663 1.00 34.47 ? 133 LYS A NZ  1 
ATOM   922  N N   . VAL A 1 134 ? -5.313  8.760   -11.087 1.00 32.95 ? 134 VAL A N   1 
ATOM   923  C CA  . VAL A 1 134 ? -3.927  9.201   -11.022 1.00 38.57 ? 134 VAL A CA  1 
ATOM   924  C C   . VAL A 1 134 ? -3.776  10.334  -10.012 1.00 37.88 ? 134 VAL A C   1 
ATOM   925  O O   . VAL A 1 134 ? -2.732  10.481  -9.385  1.00 39.63 ? 134 VAL A O   1 
ATOM   926  C CB  . VAL A 1 134 ? -3.411  9.654   -12.401 1.00 38.20 ? 134 VAL A CB  1 
ATOM   927  C CG1 . VAL A 1 134 ? -2.053  10.323  -12.266 1.00 36.51 ? 134 VAL A CG1 1 
ATOM   928  C CG2 . VAL A 1 134 ? -3.338  8.467   -13.358 1.00 31.11 ? 134 VAL A CG2 1 
ATOM   929  N N   . ALA A 1 135 ? -4.828  11.130  -9.854  1.00 34.76 ? 135 ALA A N   1 
ATOM   930  C CA  . ALA A 1 135 ? -4.820  12.197  -8.862  1.00 39.59 ? 135 ALA A CA  1 
ATOM   931  C C   . ALA A 1 135 ? -4.791  11.563  -7.482  1.00 42.54 ? 135 ALA A C   1 
ATOM   932  O O   . ALA A 1 135 ? -3.995  11.941  -6.620  1.00 46.57 ? 135 ALA A O   1 
ATOM   933  C CB  . ALA A 1 135 ? -6.048  13.078  -9.014  1.00 40.84 ? 135 ALA A CB  1 
ATOM   934  N N   . TYR A 1 136 ? -5.670  10.587  -7.291  1.00 38.63 ? 136 TYR A N   1 
ATOM   935  C CA  . TYR A 1 136 ? -5.766  9.856   -6.037  1.00 42.54 ? 136 TYR A CA  1 
ATOM   936  C C   . TYR A 1 136 ? -4.427  9.253   -5.620  1.00 43.77 ? 136 TYR A C   1 
ATOM   937  O O   . TYR A 1 136 ? -3.911  9.561   -4.546  1.00 42.49 ? 136 TYR A O   1 
ATOM   938  C CB  . TYR A 1 136 ? -6.805  8.744   -6.168  1.00 43.38 ? 136 TYR A CB  1 
ATOM   939  C CG  . TYR A 1 136 ? -7.077  7.996   -4.885  1.00 47.87 ? 136 TYR A CG  1 
ATOM   940  C CD1 . TYR A 1 136 ? -7.774  8.601   -3.847  1.00 50.74 ? 136 TYR A CD1 1 
ATOM   941  C CD2 . TYR A 1 136 ? -6.656  6.684   -4.717  1.00 42.50 ? 136 TYR A CD2 1 
ATOM   942  C CE1 . TYR A 1 136 ? -8.037  7.927   -2.673  1.00 53.39 ? 136 TYR A CE1 1 
ATOM   943  C CE2 . TYR A 1 136 ? -6.917  5.997   -3.543  1.00 48.37 ? 136 TYR A CE2 1 
ATOM   944  C CZ  . TYR A 1 136 ? -7.609  6.626   -2.523  1.00 54.05 ? 136 TYR A CZ  1 
ATOM   945  O OH  . TYR A 1 136 ? -7.877  5.960   -1.347  1.00 61.63 ? 136 TYR A OH  1 
ATOM   946  N N   . TYR A 1 137 ? -3.871  8.399   -6.478  1.00 43.19 ? 137 TYR A N   1 
ATOM   947  C CA  . TYR A 1 137 ? -2.684  7.610   -6.139  1.00 41.14 ? 137 TYR A CA  1 
ATOM   948  C C   . TYR A 1 137 ? -1.417  8.435   -5.937  1.00 46.09 ? 137 TYR A C   1 
ATOM   949  O O   . TYR A 1 137 ? -0.648  8.179   -5.014  1.00 51.78 ? 137 TYR A O   1 
ATOM   950  C CB  . TYR A 1 137 ? -2.445  6.508   -7.177  1.00 44.27 ? 137 TYR A CB  1 
ATOM   951  C CG  . TYR A 1 137 ? -3.460  5.387   -7.101  1.00 40.19 ? 137 TYR A CG  1 
ATOM   952  C CD1 . TYR A 1 137 ? -4.411  5.215   -8.094  1.00 42.40 ? 137 TYR A CD1 1 
ATOM   953  C CD2 . TYR A 1 137 ? -3.475  4.517   -6.022  1.00 42.05 ? 137 TYR A CD2 1 
ATOM   954  C CE1 . TYR A 1 137 ? -5.354  4.202   -8.015  1.00 42.56 ? 137 TYR A CE1 1 
ATOM   955  C CE2 . TYR A 1 137 ? -4.407  3.497   -5.932  1.00 43.94 ? 137 TYR A CE2 1 
ATOM   956  C CZ  . TYR A 1 137 ? -5.344  3.343   -6.931  1.00 47.79 ? 137 TYR A CZ  1 
ATOM   957  O OH  . TYR A 1 137 ? -6.271  2.328   -6.856  1.00 43.95 ? 137 TYR A OH  1 
ATOM   958  N N   . ALA A 1 138 ? -1.196  9.419   -6.799  1.00 48.05 ? 138 ALA A N   1 
ATOM   959  C CA  . ALA A 1 138 ? -0.032  10.286  -6.666  1.00 49.13 ? 138 ALA A CA  1 
ATOM   960  C C   . ALA A 1 138 ? -0.092  11.038  -5.343  1.00 48.86 ? 138 ALA A C   1 
ATOM   961  O O   . ALA A 1 138 ? 0.922   11.214  -4.670  1.00 50.12 ? 138 ALA A O   1 
ATOM   962  C CB  . ALA A 1 138 ? 0.044   11.257  -7.833  1.00 48.11 ? 138 ALA A CB  1 
ATOM   963  N N   . ARG A 1 139 ? -1.292  11.471  -4.972  1.00 48.29 ? 139 ARG A N   1 
ATOM   964  C CA  . ARG A 1 139 ? -1.495  12.208  -3.730  1.00 48.33 ? 139 ARG A CA  1 
ATOM   965  C C   . ARG A 1 139 ? -1.195  11.365  -2.489  1.00 53.10 ? 139 ARG A C   1 
ATOM   966  O O   . ARG A 1 139 ? -0.718  11.880  -1.476  1.00 51.91 ? 139 ARG A O   1 
ATOM   967  C CB  . ARG A 1 139 ? -2.925  12.735  -3.652  1.00 46.95 ? 139 ARG A CB  1 
ATOM   968  C CG  . ARG A 1 139 ? -3.276  13.295  -2.291  1.00 52.67 ? 139 ARG A CG  1 
ATOM   969  C CD  . ARG A 1 139 ? -4.711  13.770  -2.235  1.00 48.49 ? 139 ARG A CD  1 
ATOM   970  N NE  . ARG A 1 139 ? -4.845  14.896  -1.319  1.00 59.38 ? 139 ARG A NE  1 
ATOM   971  C CZ  . ARG A 1 139 ? -5.977  15.554  -1.102  1.00 63.13 ? 139 ARG A CZ  1 
ATOM   972  N NH1 . ARG A 1 139 ? -7.088  15.195  -1.732  1.00 67.50 ? 139 ARG A NH1 1 
ATOM   973  N NH2 . ARG A 1 139 ? -5.997  16.571  -0.250  1.00 59.07 ? 139 ARG A NH2 1 
ATOM   974  N N   . GLN A 1 140 ? -1.496  10.073  -2.564  1.00 51.81 ? 140 GLN A N   1 
ATOM   975  C CA  . GLN A 1 140 ? -1.210  9.159   -1.465  1.00 52.57 ? 140 GLN A CA  1 
ATOM   976  C C   . GLN A 1 140 ? 0.291   8.926   -1.400  1.00 53.51 ? 140 GLN A C   1 
ATOM   977  O O   . GLN A 1 140 ? 0.910   9.052   -0.344  1.00 56.20 ? 140 GLN A O   1 
ATOM   978  C CB  . GLN A 1 140 ? -1.921  7.826   -1.683  1.00 49.32 ? 140 GLN A CB  1 
ATOM   979  C CG  . GLN A 1 140 ? -3.377  7.947   -2.101  1.00 50.78 ? 140 GLN A CG  1 
ATOM   980  C CD  . GLN A 1 140 ? -4.332  8.032   -0.923  1.00 58.19 ? 140 GLN A CD  1 
ATOM   981  O OE1 . GLN A 1 140 ? -4.219  8.916   -0.072  1.00 54.87 ? 140 GLN A OE1 1 
ATOM   982  N NE2 . GLN A 1 140 ? -5.291  7.111   -0.875  1.00 60.55 ? 140 GLN A NE2 1 
ATOM   983  N N   . VAL A 1 141 ? 0.867   8.586   -2.550  1.00 53.57 ? 141 VAL A N   1 
ATOM   984  C CA  . VAL A 1 141 ? 2.296   8.331   -2.664  1.00 51.43 ? 141 VAL A CA  1 
ATOM   985  C C   . VAL A 1 141 ? 3.090   9.617   -2.457  1.00 60.11 ? 141 VAL A C   1 
ATOM   986  O O   . VAL A 1 141 ? 4.200   9.596   -1.919  1.00 65.50 ? 141 VAL A O   1 
ATOM   987  C CB  . VAL A 1 141 ? 2.648   7.736   -4.044  1.00 54.61 ? 141 VAL A CB  1 
ATOM   988  C CG1 . VAL A 1 141 ? 4.139   7.460   -4.145  1.00 50.07 ? 141 VAL A CG1 1 
ATOM   989  C CG2 . VAL A 1 141 ? 1.846   6.463   -4.297  1.00 48.81 ? 141 VAL A CG2 1 
ATOM   990  N N   . PRO A 1 149 ? -2.375  -3.751  7.201   1.00 34.82 ? 149 PRO A N   1 
ATOM   991  C CA  . PRO A 1 149 ? -1.963  -2.950  8.360   1.00 34.54 ? 149 PRO A CA  1 
ATOM   992  C C   . PRO A 1 149 ? -1.829  -3.850  9.576   1.00 34.41 ? 149 PRO A C   1 
ATOM   993  O O   . PRO A 1 149 ? -0.796  -3.844  10.245  1.00 26.58 ? 149 PRO A O   1 
ATOM   994  C CB  . PRO A 1 149 ? -3.136  -1.977  8.562   1.00 43.07 ? 149 PRO A CB  1 
ATOM   995  C CG  . PRO A 1 149 ? -4.004  -2.117  7.339   1.00 35.18 ? 149 PRO A CG  1 
ATOM   996  C CD  . PRO A 1 149 ? -3.779  -3.508  6.839   1.00 35.05 ? 149 PRO A CD  1 
ATOM   997  N N   . THR A 1 150 ? -2.882  -4.614  9.851   1.00 27.79 ? 150 THR A N   1 
ATOM   998  C CA  . THR A 1 150 ? -2.826  -5.701  10.817  1.00 25.55 ? 150 THR A CA  1 
ATOM   999  C C   . THR A 1 150 ? -1.636  -6.610  10.514  1.00 28.24 ? 150 THR A C   1 
ATOM   1000 O O   . THR A 1 150 ? -0.978  -7.122  11.427  1.00 27.28 ? 150 THR A O   1 
ATOM   1001 C CB  . THR A 1 150 ? -4.128  -6.534  10.778  1.00 32.50 ? 150 THR A CB  1 
ATOM   1002 O OG1 . THR A 1 150 ? -5.209  -5.765  11.326  1.00 31.98 ? 150 THR A OG1 1 
ATOM   1003 C CG2 . THR A 1 150 ? -3.974  -7.824  11.564  1.00 24.83 ? 150 THR A CG2 1 
ATOM   1004 N N   . ILE A 1 151 ? -1.357  -6.797  9.229   1.00 25.80 ? 151 ILE A N   1 
ATOM   1005 C CA  . ILE A 1 151 ? -0.264  -7.660  8.794   1.00 29.12 ? 151 ILE A CA  1 
ATOM   1006 C C   . ILE A 1 151 ? 1.105   -7.176  9.296   1.00 29.47 ? 151 ILE A C   1 
ATOM   1007 O O   . ILE A 1 151 ? 1.981   -7.982  9.604   1.00 22.86 ? 151 ILE A O   1 
ATOM   1008 C CB  . ILE A 1 151 ? -0.252  -7.812  7.250   1.00 32.75 ? 151 ILE A CB  1 
ATOM   1009 C CG1 . ILE A 1 151 ? -1.255  -8.886  6.820   1.00 39.36 ? 151 ILE A CG1 1 
ATOM   1010 C CG2 . ILE A 1 151 ? 1.133   -8.185  6.757   1.00 34.54 ? 151 ILE A CG2 1 
ATOM   1011 N N   . ARG A 1 152 ? 1.284   -5.862  9.396   1.00 29.27 ? 152 ARG A N   1 
ATOM   1012 C CA  . ARG A 1 152 ? 2.551   -5.324  9.890   1.00 27.49 ? 152 ARG A CA  1 
ATOM   1013 C C   . ARG A 1 152 ? 2.853   -5.827  11.299  1.00 27.37 ? 152 ARG A C   1 
ATOM   1014 O O   . ARG A 1 152 ? 3.990   -6.178  11.610  1.00 26.04 ? 152 ARG A O   1 
ATOM   1015 C CB  . ARG A 1 152 ? 2.544   -3.797  9.901   1.00 28.25 ? 152 ARG A CB  1 
ATOM   1016 C CG  . ARG A 1 152 ? 2.417   -3.147  8.544   1.00 27.09 ? 152 ARG A CG  1 
ATOM   1017 C CD  . ARG A 1 152 ? 2.388   -1.641  8.705   1.00 31.22 ? 152 ARG A CD  1 
ATOM   1018 N NE  . ARG A 1 152 ? 1.969   -0.956  7.489   1.00 34.70 ? 152 ARG A NE  1 
ATOM   1019 C CZ  . ARG A 1 152 ? 1.551   0.304   7.459   1.00 41.48 ? 152 ARG A CZ  1 
ATOM   1020 N NH1 . ARG A 1 152 ? 1.490   1.006   8.582   1.00 33.75 ? 152 ARG A NH1 1 
ATOM   1021 N NH2 . ARG A 1 152 ? 1.187   0.863   6.311   1.00 45.08 ? 152 ARG A NH2 1 
ATOM   1022 N N   . ILE A 1 153 ? 1.826   -5.841  12.144  1.00 22.35 ? 153 ILE A N   1 
ATOM   1023 C CA  . ILE A 1 153 ? 1.952   -6.305  13.523  1.00 23.87 ? 153 ILE A CA  1 
ATOM   1024 C C   . ILE A 1 153 ? 2.249   -7.803  13.578  1.00 25.16 ? 153 ILE A C   1 
ATOM   1025 O O   . ILE A 1 153 ? 3.049   -8.260  14.397  1.00 24.38 ? 153 ILE A O   1 
ATOM   1026 C CB  . ILE A 1 153 ? 0.666   -6.007  14.320  1.00 22.52 ? 153 ILE A CB  1 
ATOM   1027 C CG1 . ILE A 1 153 ? 0.432   -4.496  14.412  1.00 23.05 ? 153 ILE A CG1 1 
ATOM   1028 C CG2 . ILE A 1 153 ? 0.708   -6.653  15.706  1.00 19.49 ? 153 ILE A CG2 1 
ATOM   1029 C CD1 . ILE A 1 153 ? -0.852  -4.131  15.101  1.00 24.13 ? 153 ILE A CD1 1 
ATOM   1030 N N   . LEU A 1 154 ? 1.603   -8.566  12.703  1.00 20.66 ? 154 LEU A N   1 
ATOM   1031 C CA  . LEU A 1 154 ? 1.834   -10.006 12.644  1.00 24.67 ? 154 LEU A CA  1 
ATOM   1032 C C   . LEU A 1 154 ? 3.254   -10.326 12.181  1.00 23.51 ? 154 LEU A C   1 
ATOM   1033 O O   . LEU A 1 154 ? 3.895   -11.241 12.700  1.00 22.57 ? 154 LEU A O   1 
ATOM   1034 C CB  . LEU A 1 154 ? 0.808   -10.680 11.728  1.00 28.74 ? 154 LEU A CB  1 
ATOM   1035 C CG  . LEU A 1 154 ? -0.636  -10.591 12.227  1.00 28.55 ? 154 LEU A CG  1 
ATOM   1036 C CD1 . LEU A 1 154 ? -1.598  -11.261 11.253  1.00 34.17 ? 154 LEU A CD1 1 
ATOM   1037 C CD2 . LEU A 1 154 ? -0.750  -11.194 13.620  1.00 28.19 ? 154 LEU A CD2 1 
ATOM   1038 N N   . ARG A 1 155 ? 3.732   -9.568  11.196  1.00 23.94 ? 155 ARG A N   1 
ATOM   1039 C CA  . ARG A 1 155 ? 5.079   -9.735  10.659  1.00 26.93 ? 155 ARG A CA  1 
ATOM   1040 C C   . ARG A 1 155 ? 6.139   -9.405  11.709  1.00 25.24 ? 155 ARG A C   1 
ATOM   1041 O O   . ARG A 1 155 ? 7.194   -10.035 11.757  1.00 23.86 ? 155 ARG A O   1 
ATOM   1042 C CB  . ARG A 1 155 ? 5.273   -8.855  9.419   1.00 31.49 ? 155 ARG A CB  1 
ATOM   1043 C CG  . ARG A 1 155 ? 4.493   -9.318  8.193   1.00 34.20 ? 155 ARG A CG  1 
ATOM   1044 C CD  . ARG A 1 155 ? 5.364   -10.097 7.211   1.00 37.66 ? 155 ARG A CD  1 
ATOM   1045 N NE  . ARG A 1 155 ? 6.237   -11.062 7.872   1.00 42.31 ? 155 ARG A NE  1 
ATOM   1046 C CZ  . ARG A 1 155 ? 7.566   -11.047 7.804   1.00 41.89 ? 155 ARG A CZ  1 
ATOM   1047 N NH1 . ARG A 1 155 ? 8.193   -10.117 7.094   1.00 36.46 ? 155 ARG A NH1 1 
ATOM   1048 N NH2 . ARG A 1 155 ? 8.268   -11.974 8.441   1.00 37.33 ? 155 ARG A NH2 1 
ATOM   1049 N N   . LEU A 1 156 ? 5.856   -8.413  12.547  1.00 24.31 ? 156 LEU A N   1 
ATOM   1050 C CA  . LEU A 1 156 ? 6.772   -8.061  13.628  1.00 23.24 ? 156 LEU A CA  1 
ATOM   1051 C C   . LEU A 1 156 ? 6.901   -9.228  14.601  1.00 22.28 ? 156 LEU A C   1 
ATOM   1052 O O   . LEU A 1 156 ? 8.003   -9.674  14.901  1.00 25.19 ? 156 LEU A O   1 
ATOM   1053 C CB  . LEU A 1 156 ? 6.307   -6.796  14.361  1.00 19.39 ? 156 LEU A CB  1 
ATOM   1054 C CG  . LEU A 1 156 ? 7.149   -6.347  15.562  1.00 21.66 ? 156 LEU A CG  1 
ATOM   1055 C CD1 . LEU A 1 156 ? 8.546   -5.921  15.118  1.00 22.29 ? 156 LEU A CD1 1 
ATOM   1056 C CD2 . LEU A 1 156 ? 6.466   -5.224  16.331  1.00 19.77 ? 156 LEU A CD2 1 
ATOM   1057 N N   . PHE A 1 157 ? 5.769   -9.730  15.083  1.00 24.68 ? 157 PHE A N   1 
ATOM   1058 C CA  . PHE A 1 157 ? 5.797   -10.834 16.034  1.00 25.81 ? 157 PHE A CA  1 
ATOM   1059 C C   . PHE A 1 157 ? 6.500   -12.053 15.438  1.00 25.98 ? 157 PHE A C   1 
ATOM   1060 O O   . PHE A 1 157 ? 7.280   -12.718 16.118  1.00 23.31 ? 157 PHE A O   1 
ATOM   1061 C CB  . PHE A 1 157 ? 4.386   -11.189 16.508  1.00 22.97 ? 157 PHE A CB  1 
ATOM   1062 C CG  . PHE A 1 157 ? 3.872   -10.291 17.605  1.00 23.12 ? 157 PHE A CG  1 
ATOM   1063 C CD1 . PHE A 1 157 ? 2.607   -9.733  17.533  1.00 23.48 ? 157 PHE A CD1 1 
ATOM   1064 C CD2 . PHE A 1 157 ? 4.661   -10.008 18.708  1.00 26.31 ? 157 PHE A CD2 1 
ATOM   1065 C CE1 . PHE A 1 157 ? 2.137   -8.911  18.545  1.00 25.28 ? 157 PHE A CE1 1 
ATOM   1066 C CE2 . PHE A 1 157 ? 4.197   -9.192  19.724  1.00 30.54 ? 157 PHE A CE2 1 
ATOM   1067 C CZ  . PHE A 1 157 ? 2.937   -8.639  19.641  1.00 25.05 ? 157 PHE A CZ  1 
ATOM   1068 N N   . TYR A 1 158 ? 6.244   -12.328 14.161  1.00 26.71 ? 158 TYR A N   1 
ATOM   1069 C CA  . TYR A 1 158 ? 6.825   -13.506 13.524  1.00 27.16 ? 158 TYR A CA  1 
ATOM   1070 C C   . TYR A 1 158 ? 8.341   -13.419 13.391  1.00 32.23 ? 158 TYR A C   1 
ATOM   1071 O O   . TYR A 1 158 ? 9.039   -14.392 13.667  1.00 27.63 ? 158 TYR A O   1 
ATOM   1072 C CB  . TYR A 1 158 ? 6.208   -13.795 12.154  1.00 27.81 ? 158 TYR A CB  1 
ATOM   1073 C CG  . TYR A 1 158 ? 6.905   -14.946 11.470  1.00 29.88 ? 158 TYR A CG  1 
ATOM   1074 C CD1 . TYR A 1 158 ? 6.573   -16.263 11.770  1.00 34.61 ? 158 TYR A CD1 1 
ATOM   1075 C CD2 . TYR A 1 158 ? 7.927   -14.719 10.556  1.00 34.22 ? 158 TYR A CD2 1 
ATOM   1076 C CE1 . TYR A 1 158 ? 7.227   -17.318 11.159  1.00 36.81 ? 158 TYR A CE1 1 
ATOM   1077 C CE2 . TYR A 1 158 ? 8.584   -15.766 9.945   1.00 36.74 ? 158 TYR A CE2 1 
ATOM   1078 C CZ  . TYR A 1 158 ? 8.234   -17.061 10.247  1.00 40.39 ? 158 TYR A CZ  1 
ATOM   1079 O OH  . TYR A 1 158 ? 8.897   -18.099 9.633   1.00 46.02 ? 158 TYR A OH  1 
ATOM   1080 N N   . GLU A 1 159 ? 8.841   -12.265 12.952  1.00 27.07 ? 159 GLU A N   1 
ATOM   1081 C CA  . GLU A 1 159 ? 10.282  -12.059 12.842  1.00 29.35 ? 159 GLU A CA  1 
ATOM   1082 C C   . GLU A 1 159 ? 10.956  -12.161 14.202  1.00 29.97 ? 159 GLU A C   1 
ATOM   1083 O O   . GLU A 1 159 ? 12.038  -12.740 14.325  1.00 31.02 ? 159 GLU A O   1 
ATOM   1084 C CB  . GLU A 1 159 ? 10.597  -10.707 12.203  1.00 28.51 ? 159 GLU A CB  1 
ATOM   1085 C CG  . GLU A 1 159 ? 10.215  -10.615 10.738  1.00 29.91 ? 159 GLU A CG  1 
ATOM   1086 C CD  . GLU A 1 159 ? 11.132  -11.427 9.846   1.00 35.44 ? 159 GLU A CD  1 
ATOM   1087 O OE1 . GLU A 1 159 ? 10.669  -11.867 8.775   1.00 34.13 ? 159 GLU A OE1 1 
ATOM   1088 O OE2 . GLU A 1 159 ? 12.310  -11.635 10.222  1.00 37.06 ? 159 GLU A OE2 1 
ATOM   1089 N N   . LEU A 1 160 ? 10.316  -11.587 15.218  1.00 23.04 ? 160 LEU A N   1 
ATOM   1090 C CA  . LEU A 1 160 ? 10.815  -11.669 16.589  1.00 25.31 ? 160 LEU A CA  1 
ATOM   1091 C C   . LEU A 1 160 ? 10.849  -13.108 17.091  1.00 30.32 ? 160 LEU A C   1 
ATOM   1092 O O   . LEU A 1 160 ? 11.801  -13.524 17.746  1.00 29.80 ? 160 LEU A O   1 
ATOM   1093 C CB  . LEU A 1 160 ? 9.949   -10.832 17.534  1.00 30.66 ? 160 LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 160 ? 10.472  -9.500  18.063  1.00 32.95 ? 160 LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 160 ? 11.276  -8.751  17.013  1.00 33.04 ? 160 LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 160 ? 9.314   -8.651  18.582  1.00 30.53 ? 160 LEU A CD2 1 
ATOM   1097 N N   . CYS A 1 161 ? 9.798   -13.863 16.795  1.00 28.74 ? 161 CYS A N   1 
ATOM   1098 C CA  . CYS A 1 161 ? 9.692   -15.220 17.310  1.00 31.38 ? 161 CYS A CA  1 
ATOM   1099 C C   . CYS A 1 161 ? 10.690  -16.181 16.661  1.00 33.33 ? 161 CYS A C   1 
ATOM   1100 O O   . CYS A 1 161 ? 11.277  -17.024 17.337  1.00 34.92 ? 161 CYS A O   1 
ATOM   1101 C CB  . CYS A 1 161 ? 8.268   -15.751 17.153  1.00 32.34 ? 161 CYS A CB  1 
ATOM   1102 S SG  . CYS A 1 161 ? 8.011   -17.352 17.959  1.00 34.29 ? 161 CYS A SG  1 
ATOM   1103 N N   . SER A 1 162 ? 10.886  -16.051 15.354  1.00 35.20 ? 162 SER A N   1 
ATOM   1104 C CA  . SER A 1 162 ? 11.739  -16.988 14.628  1.00 38.72 ? 162 SER A CA  1 
ATOM   1105 C C   . SER A 1 162 ? 13.224  -16.766 14.911  1.00 34.24 ? 162 SER A C   1 
ATOM   1106 O O   . SER A 1 162 ? 14.032  -17.686 14.771  1.00 37.92 ? 162 SER A O   1 
ATOM   1107 C CB  . SER A 1 162 ? 11.470  -16.906 13.125  1.00 40.88 ? 162 SER A CB  1 
ATOM   1108 O OG  . SER A 1 162 ? 12.137  -15.802 12.546  1.00 43.04 ? 162 SER A OG  1 
ATOM   1109 N N   . SER A 1 163 ? 13.585  -15.551 15.317  1.00 34.71 ? 163 SER A N   1 
ATOM   1110 C CA  . SER A 1 163 ? 14.992  -15.223 15.550  1.00 33.54 ? 163 SER A CA  1 
ATOM   1111 C C   . SER A 1 163 ? 15.348  -15.120 17.033  1.00 37.98 ? 163 SER A C   1 
ATOM   1112 O O   . SER A 1 163 ? 16.482  -15.399 17.430  1.00 36.13 ? 163 SER A O   1 
ATOM   1113 C CB  . SER A 1 163 ? 15.374  -13.927 14.823  1.00 31.65 ? 163 SER A CB  1 
ATOM   1114 O OG  . SER A 1 163 ? 14.713  -12.799 15.380  1.00 39.89 ? 163 SER A OG  1 
ATOM   1115 N N   . GLN A 1 164 ? 14.371  -14.731 17.844  1.00 32.50 ? 164 GLN A N   1 
ATOM   1116 C CA  . GLN A 1 164 ? 14.598  -14.455 19.258  1.00 34.56 ? 164 GLN A CA  1 
ATOM   1117 C C   . GLN A 1 164 ? 13.972  -15.511 20.165  1.00 33.12 ? 164 GLN A C   1 
ATOM   1118 O O   . GLN A 1 164 ? 14.308  -15.608 21.344  1.00 36.16 ? 164 GLN A O   1 
ATOM   1119 C CB  . GLN A 1 164 ? 14.029  -13.078 19.616  1.00 40.45 ? 164 GLN A CB  1 
ATOM   1120 C CG  . GLN A 1 164 ? 15.050  -11.955 19.751  1.00 42.20 ? 164 GLN A CG  1 
ATOM   1121 C CD  . GLN A 1 164 ? 16.258  -12.134 18.859  1.00 45.29 ? 164 GLN A CD  1 
ATOM   1122 O OE1 . GLN A 1 164 ? 17.347  -12.442 19.339  1.00 41.76 ? 164 GLN A OE1 1 
ATOM   1123 N NE2 . GLN A 1 164 ? 16.074  -11.949 17.557  1.00 42.28 ? 164 GLN A NE2 1 
ATOM   1124 N N   . GLY A 1 165 ? 13.066  -16.309 19.613  1.00 34.71 ? 165 GLY A N   1 
ATOM   1125 C CA  . GLY A 1 165 ? 12.246  -17.187 20.427  1.00 40.21 ? 165 GLY A CA  1 
ATOM   1126 C C   . GLY A 1 165 ? 12.864  -18.528 20.770  1.00 42.52 ? 165 GLY A C   1 
ATOM   1127 O O   . GLY A 1 165 ? 13.565  -19.128 19.957  1.00 43.67 ? 165 GLY A O   1 
ATOM   1128 N N   . LYS A 1 166 ? 12.588  -19.000 21.982  1.00 38.57 ? 166 LYS A N   1 
ATOM   1129 C CA  . LYS A 1 166 ? 13.066  -20.301 22.433  1.00 36.22 ? 166 LYS A CA  1 
ATOM   1130 C C   . LYS A 1 166 ? 11.925  -21.301 22.594  1.00 46.51 ? 166 LYS A C   1 
ATOM   1131 O O   . LYS A 1 166 ? 10.957  -21.055 23.321  1.00 38.72 ? 166 LYS A O   1 
ATOM   1132 C CB  . LYS A 1 166 ? 13.848  -20.153 23.735  1.00 38.07 ? 166 LYS A CB  1 
ATOM   1133 C CG  . LYS A 1 166 ? 15.125  -19.346 23.553  1.00 44.66 ? 166 LYS A CG  1 
ATOM   1134 C CD  . LYS A 1 166 ? 15.842  -19.088 24.858  1.00 43.94 ? 166 LYS A CD  1 
ATOM   1135 C CE  . LYS A 1 166 ? 17.152  -18.353 24.611  1.00 38.83 ? 166 LYS A CE  1 
ATOM   1136 N NZ  . LYS A 1 166 ? 17.945  -18.201 25.873  1.00 39.34 ? 166 LYS A NZ  1 
ATOM   1137 N N   . ARG A 1 167 ? 12.044  -22.430 21.902  1.00 39.34 ? 167 ARG A N   1 
ATOM   1138 C CA  . ARG A 1 167 ? 11.009  -23.449 21.935  1.00 40.97 ? 167 ARG A CA  1 
ATOM   1139 C C   . ARG A 1 167 ? 10.834  -24.014 23.334  1.00 45.07 ? 167 ARG A C   1 
ATOM   1140 O O   . ARG A 1 167 ? 11.802  -24.397 23.990  1.00 42.71 ? 167 ARG A O   1 
ATOM   1141 C CB  . ARG A 1 167 ? 11.305  -24.581 20.950  1.00 40.79 ? 167 ARG A CB  1 
ATOM   1142 C CG  . ARG A 1 167 ? 10.318  -25.732 21.059  1.00 47.21 ? 167 ARG A CG  1 
ATOM   1143 C CD  . ARG A 1 167 ? 10.668  -26.886 20.129  1.00 46.16 ? 167 ARG A CD  1 
ATOM   1144 N NE  . ARG A 1 167 ? 10.016  -28.117 20.566  1.00 53.26 ? 167 ARG A NE  1 
ATOM   1145 C CZ  . ARG A 1 167 ? 10.652  -29.160 21.091  1.00 54.25 ? 167 ARG A CZ  1 
ATOM   1146 N NH1 . ARG A 1 167 ? 11.974  -29.142 21.225  1.00 53.08 ? 167 ARG A NH1 1 
ATOM   1147 N NH2 . ARG A 1 167 ? 9.964   -30.228 21.468  1.00 49.76 ? 167 ARG A NH2 1 
ATOM   1148 N N   . VAL A 1 168 ? 9.582   -24.054 23.775  1.00 39.55 ? 168 VAL A N   1 
ATOM   1149 C CA  . VAL A 1 168 ? 9.209   -24.630 25.057  1.00 43.43 ? 168 VAL A CA  1 
ATOM   1150 C C   . VAL A 1 168 ? 7.996   -25.522 24.825  1.00 45.17 ? 168 VAL A C   1 
ATOM   1151 O O   . VAL A 1 168 ? 6.865   -25.038 24.748  1.00 39.09 ? 168 VAL A O   1 
ATOM   1152 C CB  . VAL A 1 168 ? 8.846   -23.537 26.078  1.00 42.07 ? 168 VAL A CB  1 
ATOM   1153 C CG1 . VAL A 1 168 ? 8.271   -24.156 27.342  1.00 43.71 ? 168 VAL A CG1 1 
ATOM   1154 C CG2 . VAL A 1 168 ? 10.063  -22.676 26.395  1.00 42.39 ? 168 VAL A CG2 1 
ATOM   1155 N N   . GLY A 1 169 ? 8.237   -26.824 24.698  1.00 41.72 ? 169 GLY A N   1 
ATOM   1156 C CA  . GLY A 1 169 ? 7.186   -27.759 24.344  1.00 36.65 ? 169 GLY A CA  1 
ATOM   1157 C C   . GLY A 1 169 ? 6.591   -27.419 22.990  1.00 41.58 ? 169 GLY A C   1 
ATOM   1158 O O   . GLY A 1 169 ? 7.305   -27.332 21.990  1.00 37.25 ? 169 GLY A O   1 
ATOM   1159 N N   . ASP A 1 170 ? 5.277   -27.222 22.959  1.00 38.04 ? 170 ASP A N   1 
ATOM   1160 C CA  . ASP A 1 170 ? 4.591   -26.839 21.733  1.00 40.03 ? 170 ASP A CA  1 
ATOM   1161 C C   . ASP A 1 170 ? 4.392   -25.321 21.680  1.00 41.88 ? 170 ASP A C   1 
ATOM   1162 O O   . ASP A 1 170 ? 3.414   -24.834 21.109  1.00 45.28 ? 170 ASP A O   1 
ATOM   1163 C CB  . ASP A 1 170 ? 3.239   -27.556 21.633  1.00 38.22 ? 170 ASP A CB  1 
ATOM   1164 C CG  . ASP A 1 170 ? 2.676   -27.552 20.221  1.00 44.30 ? 170 ASP A CG  1 
ATOM   1165 O OD1 . ASP A 1 170 ? 3.467   -27.686 19.262  1.00 42.37 ? 170 ASP A OD1 1 
ATOM   1166 O OD2 . ASP A 1 170 ? 1.442   -27.416 20.067  1.00 46.06 ? 170 ASP A OD2 1 
ATOM   1167 N N   . THR A 1 171 ? 5.314   -24.579 22.288  1.00 34.60 ? 171 THR A N   1 
ATOM   1168 C CA  . THR A 1 171 ? 5.240   -23.120 22.300  1.00 39.86 ? 171 THR A CA  1 
ATOM   1169 C C   . THR A 1 171 ? 6.601   -22.497 22.016  1.00 40.46 ? 171 THR A C   1 
ATOM   1170 O O   . THR A 1 171 ? 7.598   -23.202 21.864  1.00 43.64 ? 171 THR A O   1 
ATOM   1171 C CB  . THR A 1 171 ? 4.760   -22.572 23.666  1.00 37.84 ? 171 THR A CB  1 
ATOM   1172 O OG1 . THR A 1 171 ? 5.888   -22.387 24.531  1.00 38.36 ? 171 THR A OG1 1 
ATOM   1173 C CG2 . THR A 1 171 ? 3.755   -23.512 24.324  1.00 35.10 ? 171 THR A CG2 1 
ATOM   1174 N N   . TYR A 1 172 ? 6.625   -21.167 21.949  1.00 38.74 ? 172 TYR A N   1 
ATOM   1175 C CA  . TYR A 1 172 ? 7.861   -20.396 21.852  1.00 33.58 ? 172 TYR A CA  1 
ATOM   1176 C C   . TYR A 1 172 ? 7.808   -19.212 22.817  1.00 37.82 ? 172 TYR A C   1 
ATOM   1177 O O   . TYR A 1 172 ? 6.783   -18.529 22.924  1.00 33.40 ? 172 TYR A O   1 
ATOM   1178 C CB  . TYR A 1 172 ? 8.062   -19.881 20.426  1.00 40.06 ? 172 TYR A CB  1 
ATOM   1179 C CG  . TYR A 1 172 ? 8.686   -20.886 19.487  1.00 40.50 ? 172 TYR A CG  1 
ATOM   1180 C CD1 . TYR A 1 172 ? 7.963   -21.978 19.030  1.00 39.21 ? 172 TYR A CD1 1 
ATOM   1181 C CD2 . TYR A 1 172 ? 9.996   -20.734 19.050  1.00 41.08 ? 172 TYR A CD2 1 
ATOM   1182 C CE1 . TYR A 1 172 ? 8.529   -22.902 18.172  1.00 50.74 ? 172 TYR A CE1 1 
ATOM   1183 C CE2 . TYR A 1 172 ? 10.575  -21.651 18.192  1.00 47.98 ? 172 TYR A CE2 1 
ATOM   1184 C CZ  . TYR A 1 172 ? 9.837   -22.735 17.757  1.00 51.70 ? 172 TYR A CZ  1 
ATOM   1185 O OH  . TYR A 1 172 ? 10.406  -23.652 16.901  1.00 53.23 ? 172 TYR A OH  1 
ATOM   1186 N N   . GLU A 1 173 ? 8.905   -18.964 23.520  1.00 33.72 ? 173 GLU A N   1 
ATOM   1187 C CA  . GLU A 1 173 ? 8.961   -17.830 24.437  1.00 30.93 ? 173 GLU A CA  1 
ATOM   1188 C C   . GLU A 1 173 ? 10.018  -16.833 24.017  1.00 36.59 ? 173 GLU A C   1 
ATOM   1189 O O   . GLU A 1 173 ? 11.136  -17.206 23.665  1.00 42.04 ? 173 GLU A O   1 
ATOM   1190 C CB  . GLU A 1 173 ? 9.215   -18.287 25.875  1.00 36.92 ? 173 GLU A CB  1 
ATOM   1191 C CG  . GLU A 1 173 ? 8.030   -18.984 26.513  1.00 35.44 ? 173 GLU A CG  1 
ATOM   1192 C CD  . GLU A 1 173 ? 8.244   -19.281 27.984  1.00 46.21 ? 173 GLU A CD  1 
ATOM   1193 O OE1 . GLU A 1 173 ? 8.988   -18.527 28.651  1.00 47.10 ? 173 GLU A OE1 1 
ATOM   1194 O OE2 . GLU A 1 173 ? 7.660   -20.270 28.472  1.00 49.26 ? 173 GLU A OE2 1 
ATOM   1195 N N   . ILE A 1 174 ? 9.643   -15.561 24.046  1.00 34.78 ? 174 ILE A N   1 
ATOM   1196 C CA  . ILE A 1 174 ? 10.548  -14.469 23.750  1.00 33.65 ? 174 ILE A CA  1 
ATOM   1197 C C   . ILE A 1 174 ? 10.599  -13.561 24.967  1.00 36.29 ? 174 ILE A C   1 
ATOM   1198 O O   . ILE A 1 174 ? 9.572   -13.027 25.392  1.00 32.33 ? 174 ILE A O   1 
ATOM   1199 C CB  . ILE A 1 174 ? 10.051  -13.633 22.554  1.00 32.87 ? 174 ILE A CB  1 
ATOM   1200 C CG1 . ILE A 1 174 ? 9.661   -14.539 21.380  1.00 34.26 ? 174 ILE A CG1 1 
ATOM   1201 C CG2 . ILE A 1 174 ? 11.107  -12.620 22.146  1.00 35.27 ? 174 ILE A CG2 1 
ATOM   1202 C CD1 . ILE A 1 174 ? 8.734   -13.877 20.362  1.00 29.17 ? 174 ILE A CD1 1 
ATOM   1203 N N   . THR A 1 175 ? 11.787  -13.391 25.534  1.00 36.19 ? 175 THR A N   1 
ATOM   1204 C CA  . THR A 1 175 ? 11.940  -12.514 26.684  1.00 37.25 ? 175 THR A CA  1 
ATOM   1205 C C   . THR A 1 175 ? 12.347  -11.132 26.229  1.00 42.41 ? 175 THR A C   1 
ATOM   1206 O O   . THR A 1 175 ? 13.458  -10.923 25.739  1.00 51.05 ? 175 THR A O   1 
ATOM   1207 C CB  . THR A 1 175 ? 12.965  -13.038 27.693  1.00 39.40 ? 175 THR A CB  1 
ATOM   1208 O OG1 . THR A 1 175 ? 12.677  -14.407 27.998  1.00 49.36 ? 175 THR A OG1 1 
ATOM   1209 C CG2 . THR A 1 175 ? 12.902  -12.213 28.973  1.00 39.60 ? 175 THR A CG2 1 
ATOM   1210 N N   . MET A 1 176 ? 11.427  -10.193 26.393  1.00 36.97 ? 176 MET A N   1 
ATOM   1211 C CA  . MET A 1 176 ? 11.639  -8.816  25.993  1.00 39.14 ? 176 MET A CA  1 
ATOM   1212 C C   . MET A 1 176 ? 10.361  -8.051  26.272  1.00 42.49 ? 176 MET A C   1 
ATOM   1213 O O   . MET A 1 176 ? 9.262   -8.587  26.104  1.00 45.21 ? 176 MET A O   1 
ATOM   1214 C CB  . MET A 1 176 ? 11.953  -8.737  24.501  1.00 42.76 ? 176 MET A CB  1 
ATOM   1215 C CG  . MET A 1 176 ? 10.723  -8.858  23.609  1.00 37.33 ? 176 MET A CG  1 
ATOM   1216 S SD  . MET A 1 176 ? 11.117  -8.885  21.847  1.00 50.71 ? 176 MET A SD  1 
ATOM   1217 C CE  . MET A 1 176 ? 11.324  -7.139  21.471  1.00 34.60 ? 176 MET A CE  1 
ATOM   1218 N N   . PRO A 1 177 ? 10.492  -6.798  26.722  1.00 42.58 ? 177 PRO A N   1 
ATOM   1219 C CA  . PRO A 1 177 ? 9.292   -5.971  26.808  1.00 38.94 ? 177 PRO A CA  1 
ATOM   1220 C C   . PRO A 1 177 ? 8.965   -5.490  25.411  1.00 42.12 ? 177 PRO A C   1 
ATOM   1221 O O   . PRO A 1 177 ? 9.828   -5.562  24.536  1.00 45.79 ? 177 PRO A O   1 
ATOM   1222 C CB  . PRO A 1 177 ? 9.733   -4.797  27.681  1.00 41.82 ? 177 PRO A CB  1 
ATOM   1223 C CG  . PRO A 1 177 ? 11.209  -4.714  27.505  1.00 40.19 ? 177 PRO A CG  1 
ATOM   1224 C CD  . PRO A 1 177 ? 11.712  -6.082  27.138  1.00 43.61 ? 177 PRO A CD  1 
ATOM   1225 N N   . LEU A 1 178 ? 7.742   -5.016  25.209  1.00 36.77 ? 178 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 178 ? 7.294   -4.524  23.913  1.00 30.77 ? 178 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 178 ? 5.882   -3.996  24.094  1.00 34.08 ? 178 LEU A C   1 
ATOM   1228 O O   . LEU A 1 178 ? 4.906   -4.712  23.891  1.00 31.48 ? 178 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 178 ? 7.319   -5.637  22.863  1.00 31.73 ? 178 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 178 ? 6.990   -5.243  21.420  1.00 29.15 ? 178 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 178 ? 8.015   -4.271  20.876  1.00 30.97 ? 178 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 178 ? 6.908   -6.482  20.528  1.00 28.89 ? 178 LEU A CD2 1 
ATOM   1233 N N   . SER A 1 179 ? 5.788   -2.736  24.494  1.00 31.70 ? 179 SER A N   1 
ATOM   1234 C CA  . SER A 1 179 ? 4.511   -2.119  24.806  1.00 29.03 ? 179 SER A CA  1 
ATOM   1235 C C   . SER A 1 179 ? 3.637   -2.007  23.562  1.00 31.33 ? 179 SER A C   1 
ATOM   1236 O O   . SER A 1 179 ? 4.140   -2.007  22.436  1.00 29.11 ? 179 SER A O   1 
ATOM   1237 C CB  . SER A 1 179 ? 4.745   -0.729  25.387  1.00 33.04 ? 179 SER A CB  1 
ATOM   1238 O OG  . SER A 1 179 ? 5.245   0.143   24.391  1.00 31.27 ? 179 SER A OG  1 
ATOM   1239 N N   . GLN A 1 180 ? 2.327   -1.899  23.767  1.00 26.75 ? 180 GLN A N   1 
ATOM   1240 C CA  . GLN A 1 180 ? 1.412   -1.655  22.661  1.00 25.69 ? 180 GLN A CA  1 
ATOM   1241 C C   . GLN A 1 180 ? 1.764   -0.328  22.011  1.00 26.42 ? 180 GLN A C   1 
ATOM   1242 O O   . GLN A 1 180 ? 1.680   -0.176  20.795  1.00 26.72 ? 180 GLN A O   1 
ATOM   1243 C CB  . GLN A 1 180 ? -0.047  -1.653  23.135  1.00 28.57 ? 180 GLN A CB  1 
ATOM   1244 C CG  . GLN A 1 180 ? -0.565  -3.033  23.513  1.00 30.16 ? 180 GLN A CG  1 
ATOM   1245 C CD  . GLN A 1 180 ? -2.082  -3.145  23.475  1.00 26.08 ? 180 GLN A CD  1 
ATOM   1246 O OE1 . GLN A 1 180 ? -2.657  -4.061  24.058  1.00 23.34 ? 180 GLN A OE1 1 
ATOM   1247 N NE2 . GLN A 1 180 ? -2.733  -2.224  22.773  1.00 23.52 ? 180 GLN A NE2 1 
ATOM   1248 N N   . LYS A 1 181 ? 2.176   0.631   22.831  1.00 24.70 ? 181 LYS A N   1 
ATOM   1249 C CA  . LYS A 1 181 ? 2.578   1.937   22.325  1.00 29.77 ? 181 LYS A CA  1 
ATOM   1250 C C   . LYS A 1 181 ? 3.769   1.815   21.363  1.00 28.42 ? 181 LYS A C   1 
ATOM   1251 O O   . LYS A 1 181 ? 3.785   2.441   20.303  1.00 27.04 ? 181 LYS A O   1 
ATOM   1252 C CB  . LYS A 1 181 ? 2.891   2.880   23.493  1.00 29.68 ? 181 LYS A CB  1 
ATOM   1253 C CG  . LYS A 1 181 ? 2.962   4.346   23.119  1.00 37.78 ? 181 LYS A CG  1 
ATOM   1254 C CD  . LYS A 1 181 ? 4.369   4.893   23.256  1.00 40.91 ? 181 LYS A CD  1 
ATOM   1255 C CE  . LYS A 1 181 ? 4.646   5.352   24.682  1.00 41.67 ? 181 LYS A CE  1 
ATOM   1256 N NZ  . LYS A 1 181 ? 5.856   6.225   24.773  1.00 44.83 ? 181 LYS A NZ  1 
ATOM   1257 N N   . SER A 1 182 ? 4.751   0.994   21.729  1.00 24.20 ? 182 SER A N   1 
ATOM   1258 C CA  . SER A 1 182 ? 5.914   0.757   20.879  1.00 25.28 ? 182 SER A CA  1 
ATOM   1259 C C   . SER A 1 182 ? 5.532   0.060   19.578  1.00 25.40 ? 182 SER A C   1 
ATOM   1260 O O   . SER A 1 182 ? 5.998   0.427   18.496  1.00 25.23 ? 182 SER A O   1 
ATOM   1261 C CB  . SER A 1 182 ? 6.961   -0.078  21.614  1.00 32.89 ? 182 SER A CB  1 
ATOM   1262 O OG  . SER A 1 182 ? 7.767   0.725   22.451  1.00 36.27 ? 182 SER A OG  1 
ATOM   1263 N N   . ILE A 1 183 ? 4.693   -0.959  19.690  1.00 22.09 ? 183 ILE A N   1 
ATOM   1264 C CA  . ILE A 1 183 ? 4.241   -1.685  18.519  1.00 22.63 ? 183 ILE A CA  1 
ATOM   1265 C C   . ILE A 1 183 ? 3.587   -0.738  17.511  1.00 18.94 ? 183 ILE A C   1 
ATOM   1266 O O   . ILE A 1 183 ? 3.794   -0.862  16.301  1.00 19.96 ? 183 ILE A O   1 
ATOM   1267 C CB  . ILE A 1 183 ? 3.274   -2.809  18.919  1.00 20.84 ? 183 ILE A CB  1 
ATOM   1268 C CG1 . ILE A 1 183 ? 4.053   -3.965  19.560  1.00 24.41 ? 183 ILE A CG1 1 
ATOM   1269 C CG2 . ILE A 1 183 ? 2.456   -3.266  17.710  1.00 23.32 ? 183 ILE A CG2 1 
ATOM   1270 C CD1 . ILE A 1 183 ? 3.195   -4.892  20.405  1.00 25.04 ? 183 ILE A CD1 1 
ATOM   1271 N N   . GLY A 1 184 ? 2.813   0.218   18.018  1.00 22.95 ? 184 GLY A N   1 
ATOM   1272 C CA  . GLY A 1 184 ? 2.172   1.215   17.175  1.00 22.43 ? 184 GLY A CA  1 
ATOM   1273 C C   . GLY A 1 184 ? 3.163   2.165   16.522  1.00 23.70 ? 184 GLY A C   1 
ATOM   1274 O O   . GLY A 1 184 ? 3.049   2.473   15.335  1.00 28.11 ? 184 GLY A O   1 
ATOM   1275 N N   . GLU A 1 185 ? 4.142   2.628   17.294  1.00 23.96 ? 185 GLU A N   1 
ATOM   1276 C CA  . GLU A 1 185 ? 5.170   3.536   16.778  1.00 30.33 ? 185 GLU A CA  1 
ATOM   1277 C C   . GLU A 1 185 ? 6.046   2.874   15.712  1.00 24.54 ? 185 GLU A C   1 
ATOM   1278 O O   . GLU A 1 185 ? 6.505   3.534   14.781  1.00 25.26 ? 185 GLU A O   1 
ATOM   1279 C CB  . GLU A 1 185 ? 6.048   4.063   17.916  1.00 27.09 ? 185 GLU A CB  1 
ATOM   1280 C CG  . GLU A 1 185 ? 5.356   5.060   18.827  1.00 31.21 ? 185 GLU A CG  1 
ATOM   1281 C CD  . GLU A 1 185 ? 6.142   5.337   20.096  1.00 39.52 ? 185 GLU A CD  1 
ATOM   1282 O OE1 . GLU A 1 185 ? 7.237   4.760   20.259  1.00 37.81 ? 185 GLU A OE1 1 
ATOM   1283 O OE2 . GLU A 1 185 ? 5.669   6.135   20.932  1.00 42.31 ? 185 GLU A OE2 1 
ATOM   1284 N N   . ILE A 1 186 ? 6.277   1.574   15.860  1.00 21.38 ? 186 ILE A N   1 
ATOM   1285 C CA  . ILE A 1 186 ? 7.132   0.823   14.939  1.00 22.80 ? 186 ILE A CA  1 
ATOM   1286 C C   . ILE A 1 186 ? 6.408   0.486   13.636  1.00 23.69 ? 186 ILE A C   1 
ATOM   1287 O O   . ILE A 1 186 ? 6.988   0.575   12.557  1.00 24.24 ? 186 ILE A O   1 
ATOM   1288 C CB  . ILE A 1 186 ? 7.658   -0.480  15.591  1.00 20.71 ? 186 ILE A CB  1 
ATOM   1289 C CG1 . ILE A 1 186 ? 8.761   -0.163  16.605  1.00 21.20 ? 186 ILE A CG1 1 
ATOM   1290 C CG2 . ILE A 1 186 ? 8.190   -1.436  14.539  1.00 19.93 ? 186 ILE A CG2 1 
ATOM   1291 C CD1 . ILE A 1 186 ? 9.032   -1.295  17.587  1.00 23.24 ? 186 ILE A CD1 1 
ATOM   1292 N N   . THR A 1 187 ? 5.133   0.118   13.736  1.00 23.16 ? 187 THR A N   1 
ATOM   1293 C CA  . THR A 1 187 ? 4.380   -0.307  12.558  1.00 22.63 ? 187 THR A CA  1 
ATOM   1294 C C   . THR A 1 187 ? 3.571   0.824   11.941  1.00 23.51 ? 187 THR A C   1 
ATOM   1295 O O   . THR A 1 187 ? 3.105   0.711   10.813  1.00 27.33 ? 187 THR A O   1 
ATOM   1296 C CB  . THR A 1 187 ? 3.399   -1.446  12.893  1.00 24.28 ? 187 THR A CB  1 
ATOM   1297 O OG1 . THR A 1 187 ? 2.486   -0.997  13.900  1.00 22.83 ? 187 THR A OG1 1 
ATOM   1298 C CG2 . THR A 1 187 ? 4.142   -2.687  13.374  1.00 23.98 ? 187 THR A CG2 1 
ATOM   1299 N N   . GLY A 1 188 ? 3.393   1.906   12.690  1.00 25.40 ? 188 GLY A N   1 
ATOM   1300 C CA  . GLY A 1 188 ? 2.574   3.012   12.233  1.00 31.76 ? 188 GLY A CA  1 
ATOM   1301 C C   . GLY A 1 188 ? 1.088   2.687   12.245  1.00 31.14 ? 188 GLY A C   1 
ATOM   1302 O O   . GLY A 1 188 ? 0.287   3.393   11.636  1.00 28.30 ? 188 GLY A O   1 
ATOM   1303 N N   . VAL A 1 189 ? 0.721   1.613   12.938  1.00 26.79 ? 189 VAL A N   1 
ATOM   1304 C CA  . VAL A 1 189 ? -0.674  1.208   13.036  1.00 25.99 ? 189 VAL A CA  1 
ATOM   1305 C C   . VAL A 1 189 ? -1.382  1.930   14.179  1.00 27.00 ? 189 VAL A C   1 
ATOM   1306 O O   . VAL A 1 189 ? -0.861  2.021   15.293  1.00 23.34 ? 189 VAL A O   1 
ATOM   1307 C CB  . VAL A 1 189 ? -0.811  -0.319  13.211  1.00 29.29 ? 189 VAL A CB  1 
ATOM   1308 C CG1 . VAL A 1 189 ? -2.247  -0.687  13.564  1.00 31.38 ? 189 VAL A CG1 1 
ATOM   1309 C CG2 . VAL A 1 189 ? -0.370  -1.041  11.953  1.00 28.24 ? 189 VAL A CG2 1 
ATOM   1310 N N   . HIS A 1 190 ? -2.571  2.450   13.887  1.00 29.21 ? 190 HIS A N   1 
ATOM   1311 C CA  . HIS A 1 190 ? -3.387  3.148   14.879  1.00 30.54 ? 190 HIS A CA  1 
ATOM   1312 C C   . HIS A 1 190 ? -3.559  2.312   16.151  1.00 28.39 ? 190 HIS A C   1 
ATOM   1313 O O   . HIS A 1 190 ? -3.799  1.108   16.076  1.00 28.15 ? 190 HIS A O   1 
ATOM   1314 C CB  . HIS A 1 190 ? -4.750  3.489   14.272  1.00 33.65 ? 190 HIS A CB  1 
ATOM   1315 C CG  . HIS A 1 190 ? -5.651  4.252   15.189  1.00 41.10 ? 190 HIS A CG  1 
ATOM   1316 N ND1 . HIS A 1 190 ? -6.061  5.541   14.931  1.00 51.34 ? 190 HIS A ND1 1 
ATOM   1317 C CD2 . HIS A 1 190 ? -6.223  3.901   16.367  1.00 39.28 ? 190 HIS A CD2 1 
ATOM   1318 C CE1 . HIS A 1 190 ? -6.846  5.955   15.910  1.00 43.05 ? 190 HIS A CE1 1 
ATOM   1319 N NE2 . HIS A 1 190 ? -6.954  4.984   16.796  1.00 41.41 ? 190 HIS A NE2 1 
ATOM   1320 N N   . HIS A 1 191 ? -3.434  2.951   17.313  1.00 26.94 ? 191 HIS A N   1 
ATOM   1321 C CA  . HIS A 1 191 ? -3.469  2.240   18.593  1.00 27.97 ? 191 HIS A CA  1 
ATOM   1322 C C   . HIS A 1 191 ? -4.725  1.385   18.827  1.00 28.95 ? 191 HIS A C   1 
ATOM   1323 O O   . HIS A 1 191 ? -4.644  0.309   19.425  1.00 26.33 ? 191 HIS A O   1 
ATOM   1324 C CB  . HIS A 1 191 ? -3.228  3.192   19.775  1.00 31.85 ? 191 HIS A CB  1 
ATOM   1325 C CG  . HIS A 1 191 ? -4.420  4.012   20.162  1.00 36.31 ? 191 HIS A CG  1 
ATOM   1326 N ND1 . HIS A 1 191 ? -4.428  5.390   20.106  1.00 37.03 ? 191 HIS A ND1 1 
ATOM   1327 C CD2 . HIS A 1 191 ? -5.638  3.650   20.639  1.00 36.65 ? 191 HIS A CD2 1 
ATOM   1328 C CE1 . HIS A 1 191 ? -5.598  5.840   20.521  1.00 39.61 ? 191 HIS A CE1 1 
ATOM   1329 N NE2 . HIS A 1 191 ? -6.351  4.808   20.845  1.00 43.49 ? 191 HIS A NE2 1 
ATOM   1330 N N   . VAL A 1 192 ? -5.881  1.854   18.367  1.00 27.29 ? 192 VAL A N   1 
ATOM   1331 C CA  . VAL A 1 192 ? -7.100  1.060   18.496  1.00 26.36 ? 192 VAL A CA  1 
ATOM   1332 C C   . VAL A 1 192 ? -6.972  -0.256  17.733  1.00 22.83 ? 192 VAL A C   1 
ATOM   1333 O O   . VAL A 1 192 ? -7.389  -1.299  18.220  1.00 25.03 ? 192 VAL A O   1 
ATOM   1334 C CB  . VAL A 1 192 ? -8.361  1.833   18.029  1.00 30.09 ? 192 VAL A CB  1 
ATOM   1335 C CG1 . VAL A 1 192 ? -9.544  0.886   17.891  1.00 22.92 ? 192 VAL A CG1 1 
ATOM   1336 C CG2 . VAL A 1 192 ? -8.684  2.954   19.007  1.00 31.76 ? 192 VAL A CG2 1 
ATOM   1337 N N   . THR A 1 193 ? -6.366  -0.212  16.551  1.00 24.19 ? 193 THR A N   1 
ATOM   1338 C CA  . THR A 1 193 ? -6.108  -1.431  15.793  1.00 24.67 ? 193 THR A CA  1 
ATOM   1339 C C   . THR A 1 193 ? -5.147  -2.386  16.520  1.00 27.05 ? 193 THR A C   1 
ATOM   1340 O O   . THR A 1 193 ? -5.341  -3.602  16.501  1.00 22.86 ? 193 THR A O   1 
ATOM   1341 C CB  . THR A 1 193 ? -5.564  -1.120  14.396  1.00 30.52 ? 193 THR A CB  1 
ATOM   1342 O OG1 . THR A 1 193 ? -6.551  -0.397  13.651  1.00 30.23 ? 193 THR A OG1 1 
ATOM   1343 C CG2 . THR A 1 193 ? -5.211  -2.407  13.659  1.00 24.68 ? 193 THR A CG2 1 
ATOM   1344 N N   . VAL A 1 194 ? -4.113  -1.833  17.148  1.00 25.33 ? 194 VAL A N   1 
ATOM   1345 C CA  . VAL A 1 194 ? -3.169  -2.634  17.925  1.00 25.13 ? 194 VAL A CA  1 
ATOM   1346 C C   . VAL A 1 194 ? -3.895  -3.283  19.099  1.00 22.60 ? 194 VAL A C   1 
ATOM   1347 O O   . VAL A 1 194 ? -3.718  -4.469  19.392  1.00 19.60 ? 194 VAL A O   1 
ATOM   1348 C CB  . VAL A 1 194 ? -2.011  -1.773  18.470  1.00 24.35 ? 194 VAL A CB  1 
ATOM   1349 C CG1 . VAL A 1 194 ? -1.052  -2.624  19.291  1.00 23.90 ? 194 VAL A CG1 1 
ATOM   1350 C CG2 . VAL A 1 194 ? -1.285  -1.078  17.336  1.00 25.36 ? 194 VAL A CG2 1 
ATOM   1351 N N   . SER A 1 195 ? -4.708  -2.476  19.766  1.00 19.17 ? 195 SER A N   1 
ATOM   1352 C CA  . SER A 1 195 ? -5.531  -2.915  20.881  1.00 24.96 ? 195 SER A CA  1 
ATOM   1353 C C   . SER A 1 195 ? -6.282  -4.180  20.498  1.00 22.67 ? 195 SER A C   1 
ATOM   1354 O O   . SER A 1 195 ? -6.324  -5.154  21.251  1.00 18.89 ? 195 SER A O   1 
ATOM   1355 C CB  . SER A 1 195 ? -6.554  -1.820  21.207  1.00 23.60 ? 195 SER A CB  1 
ATOM   1356 O OG  . SER A 1 195 ? -6.935  -1.870  22.561  1.00 36.54 ? 195 SER A OG  1 
ATOM   1357 N N   . ARG A 1 196 ? -6.873  -4.144  19.309  1.00 20.82 ? 196 ARG A N   1 
ATOM   1358 C CA  . ARG A 1 196 ? -7.764  -5.198  18.841  1.00 23.18 ? 196 ARG A CA  1 
ATOM   1359 C C   . ARG A 1 196 ? -7.016  -6.431  18.342  1.00 21.35 ? 196 ARG A C   1 
ATOM   1360 O O   . ARG A 1 196 ? -7.458  -7.560  18.556  1.00 23.20 ? 196 ARG A O   1 
ATOM   1361 C CB  . ARG A 1 196 ? -8.685  -4.648  17.749  1.00 24.84 ? 196 ARG A CB  1 
ATOM   1362 C CG  . ARG A 1 196 ? -9.479  -5.705  17.006  1.00 24.72 ? 196 ARG A CG  1 
ATOM   1363 C CD  . ARG A 1 196 ? -10.753 -5.110  16.437  1.00 31.02 ? 196 ARG A CD  1 
ATOM   1364 N NE  . ARG A 1 196 ? -11.667 -6.148  15.981  1.00 27.96 ? 196 ARG A NE  1 
ATOM   1365 C CZ  . ARG A 1 196 ? -11.618 -6.681  14.766  1.00 34.50 ? 196 ARG A CZ  1 
ATOM   1366 N NH1 . ARG A 1 196 ? -10.703 -6.258  13.905  1.00 37.29 ? 196 ARG A NH1 1 
ATOM   1367 N NH2 . ARG A 1 196 ? -12.474 -7.629  14.408  1.00 35.60 ? 196 ARG A NH2 1 
ATOM   1368 N N   . VAL A 1 197 ? -5.888  -6.220  17.672  1.00 20.75 ? 197 VAL A N   1 
ATOM   1369 C CA  . VAL A 1 197 ? -5.080  -7.338  17.182  1.00 22.48 ? 197 VAL A CA  1 
ATOM   1370 C C   . VAL A 1 197 ? -4.538  -8.185  18.344  1.00 22.74 ? 197 VAL A C   1 
ATOM   1371 O O   . VAL A 1 197 ? -4.606  -9.420  18.318  1.00 20.30 ? 197 VAL A O   1 
ATOM   1372 C CB  . VAL A 1 197 ? -3.916  -6.858  16.286  1.00 22.41 ? 197 VAL A CB  1 
ATOM   1373 C CG1 . VAL A 1 197 ? -2.997  -8.010  15.942  1.00 19.57 ? 197 VAL A CG1 1 
ATOM   1374 C CG2 . VAL A 1 197 ? -4.450  -6.211  15.018  1.00 21.53 ? 197 VAL A CG2 1 
ATOM   1375 N N   . LEU A 1 198 ? -4.012  -7.514  19.364  1.00 18.52 ? 198 LEU A N   1 
ATOM   1376 C CA  . LEU A 1 198 ? -3.465  -8.192  20.537  1.00 20.89 ? 198 LEU A CA  1 
ATOM   1377 C C   . LEU A 1 198 ? -4.552  -8.946  21.301  1.00 22.57 ? 198 LEU A C   1 
ATOM   1378 O O   . LEU A 1 198 ? -4.350  -10.094 21.711  1.00 20.29 ? 198 LEU A O   1 
ATOM   1379 C CB  . LEU A 1 198 ? -2.754  -7.195  21.460  1.00 17.08 ? 198 LEU A CB  1 
ATOM   1380 C CG  . LEU A 1 198 ? -1.261  -6.959  21.189  1.00 25.31 ? 198 LEU A CG  1 
ATOM   1381 C CD1 . LEU A 1 198 ? -0.442  -8.177  21.582  1.00 28.08 ? 198 LEU A CD1 1 
ATOM   1382 C CD2 . LEU A 1 198 ? -1.015  -6.599  19.726  1.00 26.71 ? 198 LEU A CD2 1 
ATOM   1383 N N   . ALA A 1 199 ? -5.704  -8.299  21.486  1.00 20.75 ? 199 ALA A N   1 
ATOM   1384 C CA  . ALA A 1 199 ? -6.833  -8.937  22.150  1.00 20.17 ? 199 ALA A CA  1 
ATOM   1385 C C   . ALA A 1 199 ? -7.259  -10.213 21.433  1.00 18.71 ? 199 ALA A C   1 
ATOM   1386 O O   . ALA A 1 199 ? -7.561  -11.219 22.070  1.00 21.28 ? 199 ALA A O   1 
ATOM   1387 C CB  . ALA A 1 199 ? -8.016  -7.965  22.270  1.00 19.09 ? 199 ALA A CB  1 
ATOM   1388 N N   . SER A 1 200 ? -7.263  -10.191 20.108  1.00 20.02 ? 200 SER A N   1 
ATOM   1389 C CA  . SER A 1 200 ? -7.762  -11.344 19.369  1.00 24.61 ? 200 SER A CA  1 
ATOM   1390 C C   . SER A 1 200 ? -6.715  -12.460 19.253  1.00 23.14 ? 200 SER A C   1 
ATOM   1391 O O   . SER A 1 200 ? -7.060  -13.640 19.321  1.00 21.40 ? 200 SER A O   1 
ATOM   1392 C CB  . SER A 1 200 ? -8.337  -10.934 18.007  1.00 27.21 ? 200 SER A CB  1 
ATOM   1393 O OG  . SER A 1 200 ? -7.400  -11.093 16.966  1.00 35.73 ? 200 SER A OG  1 
ATOM   1394 N N   . LEU A 1 201 ? -5.442  -12.088 19.104  1.00 21.58 ? 201 LEU A N   1 
ATOM   1395 C CA  . LEU A 1 201 ? -4.354  -13.070 19.140  1.00 20.42 ? 201 LEU A CA  1 
ATOM   1396 C C   . LEU A 1 201 ? -4.417  -13.881 20.436  1.00 23.18 ? 201 LEU A C   1 
ATOM   1397 O O   . LEU A 1 201 ? -4.207  -15.090 20.437  1.00 24.53 ? 201 LEU A O   1 
ATOM   1398 C CB  . LEU A 1 201 ? -2.985  -12.388 19.026  1.00 20.78 ? 201 LEU A CB  1 
ATOM   1399 C CG  . LEU A 1 201 ? -2.566  -11.828 17.662  1.00 24.51 ? 201 LEU A CG  1 
ATOM   1400 C CD1 . LEU A 1 201 ? -1.212  -11.114 17.750  1.00 22.37 ? 201 LEU A CD1 1 
ATOM   1401 C CD2 . LEU A 1 201 ? -2.533  -12.932 16.616  1.00 27.99 ? 201 LEU A CD2 1 
ATOM   1402 N N   . LYS A 1 202 ? -4.709  -13.194 21.535  1.00 17.19 ? 202 LYS A N   1 
ATOM   1403 C CA  . LYS A 1 202 ? -4.831  -13.817 22.842  1.00 20.92 ? 202 LYS A CA  1 
ATOM   1404 C C   . LYS A 1 202 ? -6.046  -14.738 22.939  1.00 20.18 ? 202 LYS A C   1 
ATOM   1405 O O   . LYS A 1 202 ? -5.938  -15.890 23.365  1.00 19.70 ? 202 LYS A O   1 
ATOM   1406 C CB  . LYS A 1 202 ? -4.924  -12.732 23.911  1.00 24.76 ? 202 LYS A CB  1 
ATOM   1407 C CG  . LYS A 1 202 ? -4.849  -13.228 25.338  1.00 26.59 ? 202 LYS A CG  1 
ATOM   1408 C CD  . LYS A 1 202 ? -4.996  -12.052 26.287  1.00 30.68 ? 202 LYS A CD  1 
ATOM   1409 C CE  . LYS A 1 202 ? -5.032  -12.504 27.723  1.00 35.83 ? 202 LYS A CE  1 
ATOM   1410 N NZ  . LYS A 1 202 ? -5.782  -11.527 28.571  1.00 44.79 ? 202 LYS A NZ  1 
ATOM   1411 N N   . ARG A 1 203 ? -7.205  -14.215 22.557  1.00 18.88 ? 203 ARG A N   1 
ATOM   1412 C CA  . ARG A 1 203 ? -8.445  -14.984 22.574  1.00 21.98 ? 203 ARG A CA  1 
ATOM   1413 C C   . ARG A 1 203 ? -8.280  -16.270 21.754  1.00 27.35 ? 203 ARG A C   1 
ATOM   1414 O O   . ARG A 1 203 ? -8.653  -17.354 22.196  1.00 23.45 ? 203 ARG A O   1 
ATOM   1415 C CB  . ARG A 1 203 ? -9.596  -14.131 22.019  1.00 20.29 ? 203 ARG A CB  1 
ATOM   1416 C CG  . ARG A 1 203 ? -10.935 -14.847 21.940  1.00 28.47 ? 203 ARG A CG  1 
ATOM   1417 C CD  . ARG A 1 203 ? -11.593 -14.601 20.587  1.00 31.73 ? 203 ARG A CD  1 
ATOM   1418 N NE  . ARG A 1 203 ? -12.168 -13.267 20.470  1.00 33.37 ? 203 ARG A NE  1 
ATOM   1419 C CZ  . ARG A 1 203 ? -12.214 -12.559 19.343  1.00 32.26 ? 203 ARG A CZ  1 
ATOM   1420 N NH1 . ARG A 1 203 ? -11.697 -13.038 18.217  1.00 27.44 ? 203 ARG A NH1 1 
ATOM   1421 N NH2 . ARG A 1 203 ? -12.767 -11.354 19.350  1.00 31.85 ? 203 ARG A NH2 1 
ATOM   1422 N N   . GLU A 1 204 ? -7.688  -16.143 20.570  1.00 23.20 ? 204 GLU A N   1 
ATOM   1423 C CA  . GLU A 1 204 ? -7.513  -17.273 19.661  1.00 27.36 ? 204 GLU A CA  1 
ATOM   1424 C C   . GLU A 1 204 ? -6.369  -18.221 20.036  1.00 27.13 ? 204 GLU A C   1 
ATOM   1425 O O   . GLU A 1 204 ? -6.057  -19.145 19.285  1.00 28.07 ? 204 GLU A O   1 
ATOM   1426 C CB  . GLU A 1 204 ? -7.326  -16.773 18.225  1.00 26.08 ? 204 GLU A CB  1 
ATOM   1427 C CG  . GLU A 1 204 ? -8.491  -15.940 17.717  1.00 32.62 ? 204 GLU A CG  1 
ATOM   1428 C CD  . GLU A 1 204 ? -9.827  -16.611 17.963  1.00 33.79 ? 204 GLU A CD  1 
ATOM   1429 O OE1 . GLU A 1 204 ? -9.891  -17.858 17.891  1.00 38.36 ? 204 GLU A OE1 1 
ATOM   1430 O OE2 . GLU A 1 204 ? -10.813 -15.894 18.232  1.00 41.29 ? 204 GLU A OE2 1 
ATOM   1431 N N   . ASN A 1 205 ? -5.749  -17.995 21.189  1.00 28.24 ? 205 ASN A N   1 
ATOM   1432 C CA  . ASN A 1 205 ? -4.687  -18.880 21.662  1.00 28.27 ? 205 ASN A CA  1 
ATOM   1433 C C   . ASN A 1 205 ? -3.488  -18.954 20.718  1.00 31.46 ? 205 ASN A C   1 
ATOM   1434 O O   . ASN A 1 205 ? -2.818  -19.983 20.614  1.00 27.29 ? 205 ASN A O   1 
ATOM   1435 C CB  . ASN A 1 205 ? -5.253  -20.276 21.928  1.00 30.04 ? 205 ASN A CB  1 
ATOM   1436 C CG  . ASN A 1 205 ? -6.236  -20.285 23.079  1.00 33.80 ? 205 ASN A CG  1 
ATOM   1437 O OD1 . ASN A 1 205 ? -5.879  -19.960 24.212  1.00 34.25 ? 205 ASN A OD1 1 
ATOM   1438 N ND2 . ASN A 1 205 ? -7.488  -20.641 22.793  1.00 29.73 ? 205 ASN A ND2 1 
ATOM   1439 N N   . ILE A 1 206 ? -3.221  -17.851 20.032  1.00 26.52 ? 206 ILE A N   1 
ATOM   1440 C CA  . ILE A 1 206 ? -2.105  -17.787 19.106  1.00 27.33 ? 206 ILE A CA  1 
ATOM   1441 C C   . ILE A 1 206 ? -0.898  -17.169 19.798  1.00 25.59 ? 206 ILE A C   1 
ATOM   1442 O O   . ILE A 1 206 ? 0.220   -17.670 19.687  1.00 25.93 ? 206 ILE A O   1 
ATOM   1443 C CB  . ILE A 1 206 ? -2.468  -16.963 17.855  1.00 27.48 ? 206 ILE A CB  1 
ATOM   1444 C CG1 . ILE A 1 206 ? -3.607  -17.640 17.086  1.00 27.52 ? 206 ILE A CG1 1 
ATOM   1445 C CG2 . ILE A 1 206 ? -1.251  -16.762 16.960  1.00 27.23 ? 206 ILE A CG2 1 
ATOM   1446 C CD1 . ILE A 1 206 ? -4.306  -16.725 16.107  1.00 25.86 ? 206 ILE A CD1 1 
ATOM   1447 N N   . LEU A 1 207 ? -1.138  -16.090 20.533  1.00 24.23 ? 207 LEU A N   1 
ATOM   1448 C CA  . LEU A 1 207 ? -0.060  -15.328 21.144  1.00 21.11 ? 207 LEU A CA  1 
ATOM   1449 C C   . LEU A 1 207 ? -0.551  -14.505 22.329  1.00 23.67 ? 207 LEU A C   1 
ATOM   1450 O O   . LEU A 1 207 ? -1.594  -13.851 22.252  1.00 24.82 ? 207 LEU A O   1 
ATOM   1451 C CB  . LEU A 1 207 ? 0.579   -14.419 20.092  1.00 24.33 ? 207 LEU A CB  1 
ATOM   1452 C CG  . LEU A 1 207 ? 1.760   -13.536 20.491  1.00 29.63 ? 207 LEU A CG  1 
ATOM   1453 C CD1 . LEU A 1 207 ? 2.590   -13.188 19.260  1.00 29.03 ? 207 LEU A CD1 1 
ATOM   1454 C CD2 . LEU A 1 207 ? 1.289   -12.262 21.209  1.00 20.95 ? 207 LEU A CD2 1 
ATOM   1455 N N   . ASP A 1 208 ? 0.211   -14.540 23.418  1.00 23.98 ? 208 ASP A N   1 
ATOM   1456 C CA  . ASP A 1 208 ? -0.106  -13.784 24.627  1.00 24.11 ? 208 ASP A CA  1 
ATOM   1457 C C   . ASP A 1 208 ? 1.139   -13.047 25.124  1.00 25.03 ? 208 ASP A C   1 
ATOM   1458 O O   . ASP A 1 208 ? 2.232   -13.616 25.147  1.00 29.64 ? 208 ASP A O   1 
ATOM   1459 C CB  . ASP A 1 208 ? -0.609  -14.735 25.713  1.00 28.79 ? 208 ASP A CB  1 
ATOM   1460 C CG  . ASP A 1 208 ? -1.115  -14.010 26.945  1.00 34.13 ? 208 ASP A CG  1 
ATOM   1461 O OD1 . ASP A 1 208 ? -1.322  -14.682 27.978  1.00 36.73 ? 208 ASP A OD1 1 
ATOM   1462 O OD2 . ASP A 1 208 ? -1.314  -12.779 26.884  1.00 33.47 ? 208 ASP A OD2 1 
ATOM   1463 N N   . LYS A 1 209 ? 0.973   -11.784 25.509  1.00 26.47 ? 209 LYS A N   1 
ATOM   1464 C CA  . LYS A 1 209 ? 2.073   -10.989 26.053  1.00 28.37 ? 209 LYS A CA  1 
ATOM   1465 C C   . LYS A 1 209 ? 1.898   -10.824 27.563  1.00 33.33 ? 209 LYS A C   1 
ATOM   1466 O O   . LYS A 1 209 ? 1.067   -10.040 28.024  1.00 37.91 ? 209 LYS A O   1 
ATOM   1467 C CB  . LYS A 1 209 ? 2.173   -9.618  25.364  1.00 26.34 ? 209 LYS A CB  1 
ATOM   1468 C CG  . LYS A 1 209 ? 3.543   -8.949  25.549  1.00 28.03 ? 209 LYS A CG  1 
ATOM   1469 C CD  . LYS A 1 209 ? 3.637   -7.561  24.910  1.00 27.00 ? 209 LYS A CD  1 
ATOM   1470 C CE  . LYS A 1 209 ? 3.017   -6.499  25.812  1.00 30.01 ? 209 LYS A CE  1 
ATOM   1471 N NZ  . LYS A 1 209 ? 3.261   -6.847  27.251  1.00 38.41 ? 209 LYS A NZ  1 
ATOM   1472 N N   . LYS A 1 210 ? 2.671   -11.581 28.334  1.00 29.77 ? 210 LYS A N   1 
ATOM   1473 C CA  . LYS A 1 210 ? 2.561   -11.548 29.786  1.00 31.98 ? 210 LYS A CA  1 
ATOM   1474 C C   . LYS A 1 210 ? 3.703   -10.738 30.388  1.00 37.93 ? 210 LYS A C   1 
ATOM   1475 O O   . LYS A 1 210 ? 4.842   -11.207 30.438  1.00 36.29 ? 210 LYS A O   1 
ATOM   1476 C CB  . LYS A 1 210 ? 2.551   -12.963 30.348  1.00 30.14 ? 210 LYS A CB  1 
ATOM   1477 N N   . LYS A 1 211 ? 3.389   -9.528  30.849  1.00 29.65 ? 211 LYS A N   1 
ATOM   1478 C CA  . LYS A 1 211 ? 4.398   -8.586  31.323  1.00 33.30 ? 211 LYS A CA  1 
ATOM   1479 C C   . LYS A 1 211 ? 5.492   -8.461  30.271  1.00 32.62 ? 211 LYS A C   1 
ATOM   1480 O O   . LYS A 1 211 ? 5.211   -8.053  29.152  1.00 31.23 ? 211 LYS A O   1 
ATOM   1481 C CB  . LYS A 1 211 ? 4.975   -9.012  32.678  1.00 35.54 ? 211 LYS A CB  1 
ATOM   1482 C CG  . LYS A 1 211 ? 3.940   -9.559  33.657  1.00 37.71 ? 211 LYS A CG  1 
ATOM   1483 C CD  . LYS A 1 211 ? 4.183   -11.037 33.957  1.00 42.77 ? 211 LYS A CD  1 
ATOM   1484 C CE  . LYS A 1 211 ? 5.382   -11.580 33.179  1.00 38.73 ? 211 LYS A CE  1 
ATOM   1485 N NZ  . LYS A 1 211 ? 5.248   -13.033 32.820  1.00 40.52 ? 211 LYS A NZ  1 
ATOM   1486 N N   . ASN A 1 212 ? 6.724   -8.833  30.624  1.00 32.31 ? 212 ASN A N   1 
ATOM   1487 C CA  . ASN A 1 212 ? 7.852   -8.754  29.697  1.00 33.99 ? 212 ASN A CA  1 
ATOM   1488 C C   . ASN A 1 212 ? 8.182   -10.085 29.020  1.00 34.45 ? 212 ASN A C   1 
ATOM   1489 O O   . ASN A 1 212 ? 9.331   -10.355 28.676  1.00 37.80 ? 212 ASN A O   1 
ATOM   1490 C CB  . ASN A 1 212 ? 9.092   -8.203  30.404  1.00 31.97 ? 212 ASN A CB  1 
ATOM   1491 C CG  . ASN A 1 212 ? 8.937   -6.752  30.796  1.00 37.25 ? 212 ASN A CG  1 
ATOM   1492 O OD1 . ASN A 1 212 ? 8.249   -5.988  30.125  1.00 44.34 ? 212 ASN A OD1 1 
ATOM   1493 N ND2 . ASN A 1 212 ? 9.576   -6.363  31.891  1.00 34.90 ? 212 ASN A ND2 1 
ATOM   1494 N N   . LYS A 1 213 ? 7.169   -10.916 28.829  1.00 29.54 ? 213 LYS A N   1 
ATOM   1495 C CA  . LYS A 1 213 ? 7.366   -12.200 28.181  1.00 32.85 ? 213 LYS A CA  1 
ATOM   1496 C C   . LYS A 1 213 ? 6.307   -12.407 27.107  1.00 35.10 ? 213 LYS A C   1 
ATOM   1497 O O   . LYS A 1 213 ? 5.108   -12.254 27.358  1.00 32.91 ? 213 LYS A O   1 
ATOM   1498 C CB  . LYS A 1 213 ? 7.325   -13.332 29.215  1.00 27.89 ? 213 LYS A CB  1 
ATOM   1499 C CG  . LYS A 1 213 ? 7.733   -14.690 28.670  1.00 38.48 ? 213 LYS A CG  1 
ATOM   1500 C CD  . LYS A 1 213 ? 8.098   -15.658 29.788  1.00 45.01 ? 213 LYS A CD  1 
ATOM   1501 N N   . ILE A 1 214 ? 6.755   -12.741 25.904  1.00 31.09 ? 214 ILE A N   1 
ATOM   1502 C CA  . ILE A 1 214 ? 5.840   -13.053 24.819  1.00 26.66 ? 214 ILE A CA  1 
ATOM   1503 C C   . ILE A 1 214 ? 5.791   -14.556 24.586  1.00 32.26 ? 214 ILE A C   1 
ATOM   1504 O O   . ILE A 1 214 ? 6.820   -15.198 24.366  1.00 28.40 ? 214 ILE A O   1 
ATOM   1505 C CB  . ILE A 1 214 ? 6.243   -12.358 23.509  1.00 29.79 ? 214 ILE A CB  1 
ATOM   1506 C CG1 . ILE A 1 214 ? 6.318   -10.842 23.706  1.00 35.20 ? 214 ILE A CG1 1 
ATOM   1507 C CG2 . ILE A 1 214 ? 5.258   -12.713 22.405  1.00 30.16 ? 214 ILE A CG2 1 
ATOM   1508 C CD1 . ILE A 1 214 ? 6.769   -10.088 22.476  1.00 29.61 ? 214 ILE A CD1 1 
ATOM   1509 N N   . ILE A 1 215 ? 4.587   -15.114 24.631  1.00 26.45 ? 215 ILE A N   1 
ATOM   1510 C CA  . ILE A 1 215 ? 4.410   -16.541 24.435  1.00 24.80 ? 215 ILE A CA  1 
ATOM   1511 C C   . ILE A 1 215 ? 3.639   -16.793 23.153  1.00 30.60 ? 215 ILE A C   1 
ATOM   1512 O O   . ILE A 1 215 ? 2.512   -16.322 23.002  1.00 26.96 ? 215 ILE A O   1 
ATOM   1513 C CB  . ILE A 1 215 ? 3.640   -17.174 25.598  1.00 29.99 ? 215 ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 215 ? 4.219   -16.725 26.937  1.00 31.67 ? 215 ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 215 ? 3.653   -18.693 25.480  1.00 35.65 ? 215 ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 215 ? 3.315   -17.043 28.112  1.00 31.70 ? 215 ILE A CD1 1 
ATOM   1517 N N   . VAL A 1 216 ? 4.248   -17.533 22.232  1.00 26.74 ? 216 VAL A N   1 
ATOM   1518 C CA  . VAL A 1 216 ? 3.578   -17.929 20.996  1.00 26.08 ? 216 VAL A CA  1 
ATOM   1519 C C   . VAL A 1 216 ? 3.120   -19.381 21.104  1.00 32.64 ? 216 VAL A C   1 
ATOM   1520 O O   . VAL A 1 216 ? 3.937   -20.296 21.182  1.00 36.64 ? 216 VAL A O   1 
ATOM   1521 C CB  . VAL A 1 216 ? 4.490   -17.757 19.769  1.00 28.46 ? 216 VAL A CB  1 
ATOM   1522 C CG1 . VAL A 1 216 ? 3.772   -18.191 18.494  1.00 24.38 ? 216 VAL A CG1 1 
ATOM   1523 C CG2 . VAL A 1 216 ? 4.956   -16.323 19.659  1.00 29.72 ? 216 VAL A CG2 1 
ATOM   1524 N N   . TYR A 1 217 ? 1.809   -19.587 21.125  1.00 34.00 ? 217 TYR A N   1 
ATOM   1525 C CA  . TYR A 1 217 ? 1.250   -20.924 21.258  1.00 35.31 ? 217 TYR A CA  1 
ATOM   1526 C C   . TYR A 1 217 ? 1.087   -21.596 19.904  1.00 34.82 ? 217 TYR A C   1 
ATOM   1527 O O   . TYR A 1 217 ? 1.156   -22.817 19.796  1.00 43.29 ? 217 TYR A O   1 
ATOM   1528 C CB  . TYR A 1 217 ? -0.104  -20.862 21.961  1.00 31.78 ? 217 TYR A CB  1 
ATOM   1529 C CG  . TYR A 1 217 ? -0.055  -20.205 23.316  1.00 37.10 ? 217 TYR A CG  1 
ATOM   1530 C CD1 . TYR A 1 217 ? -0.445  -18.882 23.483  1.00 33.88 ? 217 TYR A CD1 1 
ATOM   1531 C CD2 . TYR A 1 217 ? 0.394   -20.903 24.429  1.00 35.77 ? 217 TYR A CD2 1 
ATOM   1532 C CE1 . TYR A 1 217 ? -0.397  -18.279 24.721  1.00 33.43 ? 217 TYR A CE1 1 
ATOM   1533 C CE2 . TYR A 1 217 ? 0.449   -20.305 25.669  1.00 33.74 ? 217 TYR A CE2 1 
ATOM   1534 C CZ  . TYR A 1 217 ? 0.048   -18.999 25.812  1.00 35.48 ? 217 TYR A CZ  1 
ATOM   1535 O OH  . TYR A 1 217 ? 0.109   -18.412 27.054  1.00 40.83 ? 217 TYR A OH  1 
ATOM   1536 N N   . ASN A 1 218 ? 0.855   -20.793 18.873  1.00 37.74 ? 218 ASN A N   1 
ATOM   1537 C CA  . ASN A 1 218 ? 0.600   -21.319 17.541  1.00 31.72 ? 218 ASN A CA  1 
ATOM   1538 C C   . ASN A 1 218 ? 1.391   -20.553 16.491  1.00 35.74 ? 218 ASN A C   1 
ATOM   1539 O O   . ASN A 1 218 ? 0.864   -19.668 15.816  1.00 34.23 ? 218 ASN A O   1 
ATOM   1540 C CB  . ASN A 1 218 ? -0.897  -21.270 17.231  1.00 34.00 ? 218 ASN A CB  1 
ATOM   1541 C CG  . ASN A 1 218 ? -1.269  -22.072 15.995  1.00 38.22 ? 218 ASN A CG  1 
ATOM   1542 O OD1 . ASN A 1 218 ? -0.407  -22.448 15.198  1.00 36.91 ? 218 ASN A OD1 1 
ATOM   1543 N ND2 . ASN A 1 218 ? -2.564  -22.336 15.829  1.00 36.55 ? 218 ASN A ND2 1 
ATOM   1544 N N   . LEU A 1 219 ? 2.665   -20.903 16.362  1.00 34.57 ? 219 LEU A N   1 
ATOM   1545 C CA  . LEU A 1 219 ? 3.556   -20.239 15.421  1.00 38.34 ? 219 LEU A CA  1 
ATOM   1546 C C   . LEU A 1 219 ? 3.081   -20.416 13.982  1.00 36.09 ? 219 LEU A C   1 
ATOM   1547 O O   . LEU A 1 219 ? 3.169   -19.493 13.176  1.00 36.14 ? 219 LEU A O   1 
ATOM   1548 C CB  . LEU A 1 219 ? 4.981   -20.773 15.580  1.00 35.81 ? 219 LEU A CB  1 
ATOM   1549 C CG  . LEU A 1 219 ? 6.056   -20.121 14.712  1.00 37.32 ? 219 LEU A CG  1 
ATOM   1550 C CD1 . LEU A 1 219 ? 6.016   -18.611 14.877  1.00 37.94 ? 219 LEU A CD1 1 
ATOM   1551 C CD2 . LEU A 1 219 ? 7.428   -20.665 15.078  1.00 38.87 ? 219 LEU A CD2 1 
ATOM   1552 N N   . GLY A 1 220 ? 2.578   -21.606 13.668  1.00 36.35 ? 220 GLY A N   1 
ATOM   1553 C CA  . GLY A 1 220 ? 2.077   -21.897 12.337  1.00 37.41 ? 220 GLY A CA  1 
ATOM   1554 C C   . GLY A 1 220 ? 0.938   -20.977 11.943  1.00 36.72 ? 220 GLY A C   1 
ATOM   1555 O O   . GLY A 1 220 ? 0.930   -20.412 10.851  1.00 40.74 ? 220 GLY A O   1 
ATOM   1556 N N   . GLU A 1 221 ? -0.031  -20.820 12.836  1.00 35.54 ? 221 GLU A N   1 
ATOM   1557 C CA  . GLU A 1 221 ? -1.137  -19.917 12.568  1.00 37.81 ? 221 GLU A CA  1 
ATOM   1558 C C   . GLU A 1 221 ? -0.625  -18.481 12.484  1.00 41.83 ? 221 GLU A C   1 
ATOM   1559 O O   . GLU A 1 221 ? -1.162  -17.664 11.733  1.00 46.00 ? 221 GLU A O   1 
ATOM   1560 C CB  . GLU A 1 221 ? -2.230  -20.050 13.631  1.00 38.06 ? 221 GLU A CB  1 
ATOM   1561 C CG  . GLU A 1 221 ? -3.448  -19.159 13.394  1.00 39.94 ? 221 GLU A CG  1 
ATOM   1562 C CD  . GLU A 1 221 ? -4.156  -19.470 12.089  1.00 45.27 ? 221 GLU A CD  1 
ATOM   1563 O OE1 . GLU A 1 221 ? -3.920  -20.561 11.529  1.00 44.32 ? 221 GLU A OE1 1 
ATOM   1564 O OE2 . GLU A 1 221 ? -4.947  -18.624 11.623  1.00 47.59 ? 221 GLU A OE2 1 
ATOM   1565 N N   . LEU A 1 222 ? 0.428   -18.183 13.239  1.00 38.18 ? 222 LEU A N   1 
ATOM   1566 C CA  . LEU A 1 222 ? 1.019   -16.852 13.202  1.00 38.24 ? 222 LEU A CA  1 
ATOM   1567 C C   . LEU A 1 222 ? 1.669   -16.592 11.847  1.00 35.41 ? 222 LEU A C   1 
ATOM   1568 O O   . LEU A 1 222 ? 1.531   -15.510 11.278  1.00 37.87 ? 222 LEU A O   1 
ATOM   1569 C CB  . LEU A 1 222 ? 2.051   -16.668 14.321  1.00 34.79 ? 222 LEU A CB  1 
ATOM   1570 C CG  . LEU A 1 222 ? 2.643   -15.254 14.344  1.00 31.46 ? 222 LEU A CG  1 
ATOM   1571 C CD1 . LEU A 1 222 ? 1.553   -14.241 14.665  1.00 31.63 ? 222 LEU A CD1 1 
ATOM   1572 C CD2 . LEU A 1 222 ? 3.799   -15.132 15.324  1.00 32.04 ? 222 LEU A CD2 1 
ATOM   1573 N N   . LYS A 1 223 ? 2.374   -17.590 11.331  1.00 37.82 ? 223 LYS A N   1 
ATOM   1574 C CA  . LYS A 1 223 ? 3.059   -17.447 10.052  1.00 42.02 ? 223 LYS A CA  1 
ATOM   1575 C C   . LYS A 1 223 ? 2.068   -17.338 8.896   1.00 43.76 ? 223 LYS A C   1 
ATOM   1576 O O   . LYS A 1 223 ? 2.272   -16.558 7.964   1.00 45.36 ? 223 LYS A O   1 
ATOM   1577 C CB  . LYS A 1 223 ? 4.023   -18.611 9.813   1.00 39.14 ? 223 LYS A CB  1 
ATOM   1578 C CG  . LYS A 1 223 ? 4.495   -18.725 8.372   1.00 45.23 ? 223 LYS A CG  1 
ATOM   1579 C CD  . LYS A 1 223 ? 5.365   -19.956 8.158   1.00 49.74 ? 223 LYS A CD  1 
ATOM   1580 C CE  . LYS A 1 223 ? 6.846   -19.621 8.248   1.00 53.03 ? 223 LYS A CE  1 
ATOM   1581 N NZ  . LYS A 1 223 ? 7.278   -18.693 7.159   1.00 45.29 ? 223 LYS A NZ  1 
ATOM   1582 N N   . HIS A 1 224 ? 0.993   -18.118 8.970   1.00 42.93 ? 224 HIS A N   1 
ATOM   1583 C CA  . HIS A 1 224 ? -0.032  -18.120 7.930   1.00 45.10 ? 224 HIS A CA  1 
ATOM   1584 C C   . HIS A 1 224 ? -0.804  -16.803 7.889   1.00 44.44 ? 224 HIS A C   1 
ATOM   1585 O O   . HIS A 1 224 ? -1.159  -16.307 6.818   1.00 41.63 ? 224 HIS A O   1 
ATOM   1586 C CB  . HIS A 1 224 ? -0.998  -19.290 8.130   1.00 44.87 ? 224 HIS A CB  1 
ATOM   1587 C CG  . HIS A 1 224 ? -2.191  -19.245 7.230   1.00 54.11 ? 224 HIS A CG  1 
ATOM   1588 N ND1 . HIS A 1 224 ? -3.420  -18.772 7.643   1.00 56.30 ? 224 HIS A ND1 1 
ATOM   1589 C CD2 . HIS A 1 224 ? -2.345  -19.604 5.932   1.00 55.03 ? 224 HIS A CD2 1 
ATOM   1590 C CE1 . HIS A 1 224 ? -4.277  -18.845 6.640   1.00 54.83 ? 224 HIS A CE1 1 
ATOM   1591 N NE2 . HIS A 1 224 ? -3.651  -19.346 5.593   1.00 53.68 ? 224 HIS A NE2 1 
ATOM   1592 N N   . LEU A 1 225 ? -1.055  -16.236 9.061   1.00 42.90 ? 225 LEU A N   1 
ATOM   1593 C CA  . LEU A 1 225 ? -1.779  -14.975 9.150   1.00 42.90 ? 225 LEU A CA  1 
ATOM   1594 C C   . LEU A 1 225 ? -0.967  -13.782 8.634   1.00 42.19 ? 225 LEU A C   1 
ATOM   1595 O O   . LEU A 1 225 ? -1.527  -12.854 8.048   1.00 41.92 ? 225 LEU A O   1 
ATOM   1596 C CB  . LEU A 1 225 ? -2.239  -14.730 10.589  1.00 38.18 ? 225 LEU A CB  1 
ATOM   1597 C CG  . LEU A 1 225 ? -3.395  -15.610 11.073  1.00 41.70 ? 225 LEU A CG  1 
ATOM   1598 C CD1 . LEU A 1 225 ? -3.713  -15.328 12.528  1.00 34.96 ? 225 LEU A CD1 1 
ATOM   1599 C CD2 . LEU A 1 225 ? -4.630  -15.405 10.206  1.00 40.82 ? 225 LEU A CD2 1 
ATOM   1600 N N   . SER A 1 226 ? 0.349   -13.819 8.840   1.00 38.86 ? 226 SER A N   1 
ATOM   1601 C CA  . SER A 1 226 ? 1.215   -12.679 8.528   1.00 40.03 ? 226 SER A CA  1 
ATOM   1602 C C   . SER A 1 226 ? 1.341   -12.412 7.029   1.00 41.57 ? 226 SER A C   1 
ATOM   1603 O O   . SER A 1 226 ? 1.826   -13.256 6.276   1.00 51.69 ? 226 SER A O   1 
ATOM   1604 C CB  . SER A 1 226 ? 2.605   -12.851 9.162   1.00 35.98 ? 226 SER A CB  1 
ATOM   1605 O OG  . SER A 1 226 ? 3.207   -14.078 8.797   1.00 42.09 ? 226 SER A OG  1 
ATOM   1606 N N   . PHE B 1 19  ? 9.029   9.341   -16.334 1.00 34.58 ? 18  PHE B N   1 
ATOM   1607 C CA  . PHE B 1 19  ? 8.411   10.373  -17.166 1.00 41.33 ? 18  PHE B CA  1 
ATOM   1608 C C   . PHE B 1 19  ? 7.108   9.912   -17.829 1.00 40.52 ? 18  PHE B C   1 
ATOM   1609 O O   . PHE B 1 19  ? 6.230   10.731  -18.113 1.00 42.71 ? 18  PHE B O   1 
ATOM   1610 C CB  . PHE B 1 19  ? 9.389   10.868  -18.238 1.00 43.52 ? 18  PHE B CB  1 
ATOM   1611 C CG  . PHE B 1 19  ? 10.577  11.613  -17.687 1.00 46.74 ? 18  PHE B CG  1 
ATOM   1612 C CD1 . PHE B 1 19  ? 10.450  12.417  -16.566 1.00 43.60 ? 18  PHE B CD1 1 
ATOM   1613 C CD2 . PHE B 1 19  ? 11.815  11.525  -18.306 1.00 40.76 ? 18  PHE B CD2 1 
ATOM   1614 C CE1 . PHE B 1 19  ? 11.538  13.108  -16.063 1.00 40.94 ? 18  PHE B CE1 1 
ATOM   1615 C CE2 . PHE B 1 19  ? 12.908  12.218  -17.810 1.00 41.88 ? 18  PHE B CE2 1 
ATOM   1616 C CZ  . PHE B 1 19  ? 12.767  13.013  -16.688 1.00 41.78 ? 18  PHE B CZ  1 
ATOM   1617 N N   . PHE B 1 20  ? 6.987   8.606   -18.067 1.00 35.03 ? 19  PHE B N   1 
ATOM   1618 C CA  . PHE B 1 20  ? 5.845   8.043   -18.794 1.00 33.83 ? 19  PHE B CA  1 
ATOM   1619 C C   . PHE B 1 20  ? 5.645   8.725   -20.147 1.00 34.87 ? 19  PHE B C   1 
ATOM   1620 O O   . PHE B 1 20  ? 4.599   9.325   -20.393 1.00 34.36 ? 19  PHE B O   1 
ATOM   1621 C CB  . PHE B 1 20  ? 4.555   8.147   -17.971 1.00 33.22 ? 19  PHE B CB  1 
ATOM   1622 C CG  . PHE B 1 20  ? 4.595   7.381   -16.678 1.00 39.89 ? 19  PHE B CG  1 
ATOM   1623 C CD1 . PHE B 1 20  ? 4.655   8.048   -15.464 1.00 36.55 ? 19  PHE B CD1 1 
ATOM   1624 C CD2 . PHE B 1 20  ? 4.577   5.998   -16.677 1.00 31.11 ? 19  PHE B CD2 1 
ATOM   1625 C CE1 . PHE B 1 20  ? 4.690   7.348   -14.273 1.00 37.64 ? 19  PHE B CE1 1 
ATOM   1626 C CE2 . PHE B 1 20  ? 4.616   5.290   -15.490 1.00 42.56 ? 19  PHE B CE2 1 
ATOM   1627 C CZ  . PHE B 1 20  ? 4.674   5.965   -14.285 1.00 41.82 ? 19  PHE B CZ  1 
ATOM   1628 N N   . PRO B 1 21  ? 6.644   8.614   -21.036 1.00 35.89 ? 20  PRO B N   1 
ATOM   1629 C CA  . PRO B 1 21  ? 6.650   9.357   -22.300 1.00 33.98 ? 20  PRO B CA  1 
ATOM   1630 C C   . PRO B 1 21  ? 5.498   8.959   -23.216 1.00 32.48 ? 20  PRO B C   1 
ATOM   1631 O O   . PRO B 1 21  ? 5.128   7.785   -23.274 1.00 24.99 ? 20  PRO B O   1 
ATOM   1632 C CB  . PRO B 1 21  ? 7.986   8.956   -22.944 1.00 33.46 ? 20  PRO B CB  1 
ATOM   1633 C CG  . PRO B 1 21  ? 8.783   8.300   -21.855 1.00 35.53 ? 20  PRO B CG  1 
ATOM   1634 C CD  . PRO B 1 21  ? 7.782   7.686   -20.937 1.00 35.01 ? 20  PRO B CD  1 
ATOM   1635 N N   . ILE B 1 22  ? 4.937   9.945   -23.909 1.00 26.82 ? 21  ILE B N   1 
ATOM   1636 C CA  . ILE B 1 22  ? 3.944   9.713   -24.951 1.00 30.62 ? 21  ILE B CA  1 
ATOM   1637 C C   . ILE B 1 22  ? 4.432   10.414  -26.218 1.00 32.31 ? 21  ILE B C   1 
ATOM   1638 O O   . ILE B 1 22  ? 3.945   11.481  -26.597 1.00 27.69 ? 21  ILE B O   1 
ATOM   1639 C CB  . ILE B 1 22  ? 2.525   10.185  -24.523 1.00 32.10 ? 21  ILE B CB  1 
ATOM   1640 C CG1 . ILE B 1 22  ? 1.561   10.201  -25.715 1.00 29.90 ? 21  ILE B CG1 1 
ATOM   1641 C CG2 . ILE B 1 22  ? 2.580   11.544  -23.840 1.00 28.14 ? 21  ILE B CG2 1 
ATOM   1642 C CD1 . ILE B 1 22  ? 0.840   8.905   -25.923 1.00 36.52 ? 21  ILE B CD1 1 
ATOM   1643 N N   . GLU B 1 23  ? 5.421   9.793   -26.854 1.00 28.44 ? 22  GLU B N   1 
ATOM   1644 C CA  . GLU B 1 23  ? 6.151   10.381  -27.974 1.00 30.07 ? 22  GLU B CA  1 
ATOM   1645 C C   . GLU B 1 23  ? 5.268   10.715  -29.171 1.00 26.66 ? 22  GLU B C   1 
ATOM   1646 O O   . GLU B 1 23  ? 5.479   11.723  -29.850 1.00 24.30 ? 22  GLU B O   1 
ATOM   1647 C CB  . GLU B 1 23  ? 7.276   9.431   -28.409 1.00 35.28 ? 22  GLU B CB  1 
ATOM   1648 C CG  . GLU B 1 23  ? 8.482   10.114  -29.028 1.00 31.43 ? 22  GLU B CG  1 
ATOM   1649 C CD  . GLU B 1 23  ? 9.624   9.149   -29.299 1.00 37.54 ? 22  GLU B CD  1 
ATOM   1650 O OE1 . GLU B 1 23  ? 9.366   7.934   -29.419 1.00 36.39 ? 22  GLU B OE1 1 
ATOM   1651 O OE2 . GLU B 1 23  ? 10.781  9.607   -29.403 1.00 43.15 ? 22  GLU B OE2 1 
ATOM   1652 N N   . LYS B 1 24  ? 4.281   9.868   -29.437 1.00 27.30 ? 23  LYS B N   1 
ATOM   1653 C CA  . LYS B 1 24  ? 3.448   10.038  -30.624 1.00 31.86 ? 23  LYS B CA  1 
ATOM   1654 C C   . LYS B 1 24  ? 2.753   11.399  -30.657 1.00 23.01 ? 23  LYS B C   1 
ATOM   1655 O O   . LYS B 1 24  ? 2.409   11.902  -31.720 1.00 22.13 ? 23  LYS B O   1 
ATOM   1656 C CB  . LYS B 1 24  ? 2.409   8.921   -30.724 1.00 27.56 ? 23  LYS B CB  1 
ATOM   1657 C CG  . LYS B 1 24  ? 2.228   8.401   -32.138 1.00 36.04 ? 23  LYS B CG  1 
ATOM   1658 C CD  . LYS B 1 24  ? 3.389   7.501   -32.514 1.00 36.65 ? 23  LYS B CD  1 
ATOM   1659 C CE  . LYS B 1 24  ? 3.833   7.706   -33.957 1.00 41.97 ? 23  LYS B CE  1 
ATOM   1660 N NZ  . LYS B 1 24  ? 5.165   7.044   -34.224 1.00 36.98 ? 23  LYS B NZ  1 
ATOM   1661 N N   . LEU B 1 25  ? 2.559   11.988  -29.482 1.00 25.00 ? 24  LEU B N   1 
ATOM   1662 C CA  . LEU B 1 25  ? 1.813   13.237  -29.355 1.00 26.96 ? 24  LEU B CA  1 
ATOM   1663 C C   . LEU B 1 25  ? 2.537   14.414  -30.012 1.00 23.97 ? 24  LEU B C   1 
ATOM   1664 O O   . LEU B 1 25  ? 1.915   15.417  -30.376 1.00 24.70 ? 24  LEU B O   1 
ATOM   1665 C CB  . LEU B 1 25  ? 1.518   13.518  -27.882 1.00 28.54 ? 24  LEU B CB  1 
ATOM   1666 C CG  . LEU B 1 25  ? 0.331   14.410  -27.525 1.00 31.57 ? 24  LEU B CG  1 
ATOM   1667 C CD1 . LEU B 1 25  ? -0.927  13.988  -28.270 1.00 28.16 ? 24  LEU B CD1 1 
ATOM   1668 C CD2 . LEU B 1 25  ? 0.097   14.392  -26.016 1.00 30.19 ? 24  LEU B CD2 1 
ATOM   1669 N N   . ARG B 1 26  ? 3.850   14.279  -30.180 1.00 22.94 ? 25  ARG B N   1 
ATOM   1670 C CA  . ARG B 1 26  ? 4.653   15.304  -30.844 1.00 21.98 ? 25  ARG B CA  1 
ATOM   1671 C C   . ARG B 1 26  ? 4.133   15.568  -32.247 1.00 22.60 ? 25  ARG B C   1 
ATOM   1672 O O   . ARG B 1 26  ? 4.292   16.663  -32.789 1.00 19.55 ? 25  ARG B O   1 
ATOM   1673 C CB  . ARG B 1 26  ? 6.119   14.866  -30.920 1.00 27.74 ? 25  ARG B CB  1 
ATOM   1674 C CG  . ARG B 1 26  ? 6.800   14.782  -29.569 1.00 32.24 ? 25  ARG B CG  1 
ATOM   1675 C CD  . ARG B 1 26  ? 8.304   14.618  -29.710 1.00 38.54 ? 25  ARG B CD  1 
ATOM   1676 N NE  . ARG B 1 26  ? 9.031   15.544  -28.838 1.00 43.07 ? 25  ARG B NE  1 
ATOM   1677 C CZ  . ARG B 1 26  ? 9.659   16.632  -29.269 1.00 40.07 ? 25  ARG B CZ  1 
ATOM   1678 N NH1 . ARG B 1 26  ? 9.665   16.931  -30.560 1.00 44.74 ? 25  ARG B NH1 1 
ATOM   1679 N NH2 . ARG B 1 26  ? 10.294  17.419  -28.416 1.00 53.87 ? 25  ARG B NH2 1 
ATOM   1680 N N   . ASN B 1 27  ? 3.509   14.550  -32.833 1.00 24.31 ? 26  ASN B N   1 
ATOM   1681 C CA  . ASN B 1 27  ? 2.991   14.647  -34.188 1.00 23.80 ? 26  ASN B CA  1 
ATOM   1682 C C   . ASN B 1 27  ? 1.735   15.522  -34.278 1.00 24.66 ? 26  ASN B C   1 
ATOM   1683 O O   . ASN B 1 27  ? 1.245   15.793  -35.373 1.00 26.04 ? 26  ASN B O   1 
ATOM   1684 C CB  . ASN B 1 27  ? 2.682   13.250  -34.743 1.00 28.35 ? 26  ASN B CB  1 
ATOM   1685 C CG  . ASN B 1 27  ? 3.926   12.385  -34.922 1.00 33.38 ? 26  ASN B CG  1 
ATOM   1686 O OD1 . ASN B 1 27  ? 3.822   11.194  -35.221 1.00 36.74 ? 26  ASN B OD1 1 
ATOM   1687 N ND2 . ASN B 1 27  ? 5.098   12.974  -34.743 1.00 26.93 ? 26  ASN B ND2 1 
ATOM   1688 N N   . TYR B 1 28  ? 1.212   15.960  -33.135 1.00 19.88 ? 27  TYR B N   1 
ATOM   1689 C CA  . TYR B 1 28  ? -0.070  16.670  -33.124 1.00 23.60 ? 27  TYR B CA  1 
ATOM   1690 C C   . TYR B 1 28  ? -0.057  18.017  -32.395 1.00 24.19 ? 27  TYR B C   1 
ATOM   1691 O O   . TYR B 1 28  ? -1.112  18.584  -32.120 1.00 24.82 ? 27  TYR B O   1 
ATOM   1692 C CB  . TYR B 1 28  ? -1.180  15.755  -32.576 1.00 23.88 ? 27  TYR B CB  1 
ATOM   1693 C CG  . TYR B 1 28  ? -1.343  14.498  -33.403 1.00 24.78 ? 27  TYR B CG  1 
ATOM   1694 C CD1 . TYR B 1 28  ? -0.639  13.341  -33.087 1.00 25.18 ? 27  TYR B CD1 1 
ATOM   1695 C CD2 . TYR B 1 28  ? -2.167  14.478  -34.524 1.00 23.70 ? 27  TYR B CD2 1 
ATOM   1696 C CE1 . TYR B 1 28  ? -0.768  12.192  -33.849 1.00 20.35 ? 27  TYR B CE1 1 
ATOM   1697 C CE2 . TYR B 1 28  ? -2.297  13.325  -35.294 1.00 23.90 ? 27  TYR B CE2 1 
ATOM   1698 C CZ  . TYR B 1 28  ? -1.586  12.193  -34.953 1.00 20.14 ? 27  TYR B CZ  1 
ATOM   1699 O OH  . TYR B 1 28  ? -1.698  11.048  -35.712 1.00 26.13 ? 27  TYR B OH  1 
ATOM   1700 N N   . THR B 1 29  ? 1.129   18.544  -32.105 1.00 23.27 ? 28  THR B N   1 
ATOM   1701 C CA  . THR B 1 29  ? 1.209   19.806  -31.368 1.00 25.11 ? 28  THR B CA  1 
ATOM   1702 C C   . THR B 1 29  ? 0.607   20.985  -32.137 1.00 23.00 ? 28  THR B C   1 
ATOM   1703 O O   . THR B 1 29  ? 0.221   21.987  -31.539 1.00 23.05 ? 28  THR B O   1 
ATOM   1704 C CB  . THR B 1 29  ? 2.656   20.148  -30.968 1.00 23.26 ? 28  THR B CB  1 
ATOM   1705 O OG1 . THR B 1 29  ? 3.525   19.892  -32.076 1.00 26.65 ? 28  THR B OG1 1 
ATOM   1706 C CG2 . THR B 1 29  ? 3.094   19.302  -29.776 1.00 27.10 ? 28  THR B CG2 1 
ATOM   1707 N N   . GLN B 1 30  ? 0.530   20.865  -33.458 1.00 21.62 ? 29  GLN B N   1 
ATOM   1708 C CA  . GLN B 1 30  ? -0.006  21.944  -34.283 1.00 25.09 ? 29  GLN B CA  1 
ATOM   1709 C C   . GLN B 1 30  ? -1.495  22.200  -34.011 1.00 25.83 ? 29  GLN B C   1 
ATOM   1710 O O   . GLN B 1 30  ? -2.050  23.216  -34.434 1.00 28.90 ? 29  GLN B O   1 
ATOM   1711 C CB  . GLN B 1 30  ? 0.234   21.673  -35.778 1.00 28.12 ? 29  GLN B CB  1 
ATOM   1712 C CG  . GLN B 1 30  ? -0.548  20.490  -36.364 1.00 28.38 ? 29  GLN B CG  1 
ATOM   1713 C CD  . GLN B 1 30  ? 0.168   19.150  -36.212 1.00 30.40 ? 29  GLN B CD  1 
ATOM   1714 O OE1 . GLN B 1 30  ? -0.230  18.152  -36.819 1.00 34.57 ? 29  GLN B OE1 1 
ATOM   1715 N NE2 . GLN B 1 30  ? 1.224   19.121  -35.404 1.00 27.31 ? 29  GLN B NE2 1 
ATOM   1716 N N   . MET B 1 31  ? -2.134  21.273  -33.306 1.00 27.25 ? 30  MET B N   1 
ATOM   1717 C CA  . MET B 1 31  ? -3.548  21.402  -32.960 1.00 23.80 ? 30  MET B CA  1 
ATOM   1718 C C   . MET B 1 31  ? -3.742  21.944  -31.548 1.00 23.38 ? 30  MET B C   1 
ATOM   1719 O O   . MET B 1 31  ? -4.855  22.286  -31.154 1.00 29.53 ? 30  MET B O   1 
ATOM   1720 C CB  . MET B 1 31  ? -4.249  20.058  -33.119 1.00 23.77 ? 30  MET B CB  1 
ATOM   1721 C CG  . MET B 1 31  ? -4.464  19.679  -34.569 1.00 29.38 ? 30  MET B CG  1 
ATOM   1722 S SD  . MET B 1 31  ? -4.416  17.903  -34.806 1.00 37.78 ? 30  MET B SD  1 
ATOM   1723 C CE  . MET B 1 31  ? -5.027  17.754  -36.482 1.00 27.77 ? 30  MET B CE  1 
ATOM   1724 N N   . GLY B 1 32  ? -2.656  22.030  -30.792 1.00 23.01 ? 31  GLY B N   1 
ATOM   1725 C CA  . GLY B 1 32  ? -2.711  22.606  -29.461 1.00 23.65 ? 31  GLY B CA  1 
ATOM   1726 C C   . GLY B 1 32  ? -2.152  24.012  -29.455 1.00 21.29 ? 31  GLY B C   1 
ATOM   1727 O O   . GLY B 1 32  ? -1.993  24.621  -30.511 1.00 22.80 ? 31  GLY B O   1 
ATOM   1728 N N   . LEU B 1 33  ? -1.867  24.532  -28.265 1.00 25.34 ? 32  LEU B N   1 
ATOM   1729 C CA  . LEU B 1 33  ? -1.287  25.863  -28.119 1.00 24.78 ? 32  LEU B CA  1 
ATOM   1730 C C   . LEU B 1 33  ? 0.088   25.777  -27.472 1.00 22.05 ? 32  LEU B C   1 
ATOM   1731 O O   . LEU B 1 33  ? 0.213   25.289  -26.350 1.00 23.91 ? 32  LEU B O   1 
ATOM   1732 C CB  . LEU B 1 33  ? -2.191  26.742  -27.255 1.00 24.63 ? 32  LEU B CB  1 
ATOM   1733 C CG  . LEU B 1 33  ? -3.596  27.026  -27.799 1.00 30.59 ? 32  LEU B CG  1 
ATOM   1734 C CD1 . LEU B 1 33  ? -4.502  27.616  -26.711 1.00 27.13 ? 32  LEU B CD1 1 
ATOM   1735 C CD2 . LEU B 1 33  ? -3.522  27.944  -29.011 1.00 28.49 ? 32  LEU B CD2 1 
ATOM   1736 N N   . ILE B 1 34  ? 1.113   26.263  -28.169 1.00 22.31 ? 33  ILE B N   1 
ATOM   1737 C CA  . ILE B 1 34  ? 2.484   26.225  -27.650 1.00 23.71 ? 33  ILE B CA  1 
ATOM   1738 C C   . ILE B 1 34  ? 2.710   27.329  -26.620 1.00 27.41 ? 33  ILE B C   1 
ATOM   1739 O O   . ILE B 1 34  ? 2.436   28.495  -26.889 1.00 26.32 ? 33  ILE B O   1 
ATOM   1740 C CB  . ILE B 1 34  ? 3.526   26.401  -28.778 1.00 26.37 ? 33  ILE B CB  1 
ATOM   1741 C CG1 . ILE B 1 34  ? 3.351   25.332  -29.864 1.00 28.98 ? 33  ILE B CG1 1 
ATOM   1742 C CG2 . ILE B 1 34  ? 4.938   26.353  -28.219 1.00 25.84 ? 33  ILE B CG2 1 
ATOM   1743 C CD1 . ILE B 1 34  ? 3.420   23.912  -29.357 1.00 23.32 ? 33  ILE B CD1 1 
ATOM   1744 N N   . ARG B 1 35  ? 3.204   26.964  -25.440 1.00 29.66 ? 34  ARG B N   1 
ATOM   1745 C CA  . ARG B 1 35  ? 3.569   27.959  -24.434 1.00 28.83 ? 34  ARG B CA  1 
ATOM   1746 C C   . ARG B 1 35  ? 4.969   27.676  -23.896 1.00 29.06 ? 34  ARG B C   1 
ATOM   1747 O O   . ARG B 1 35  ? 5.254   26.565  -23.445 1.00 27.28 ? 34  ARG B O   1 
ATOM   1748 C CB  . ARG B 1 35  ? 2.558   27.999  -23.280 1.00 22.88 ? 34  ARG B CB  1 
ATOM   1749 C CG  . ARG B 1 35  ? 1.097   28.097  -23.709 1.00 27.40 ? 34  ARG B CG  1 
ATOM   1750 C CD  . ARG B 1 35  ? 0.341   29.194  -22.948 1.00 35.21 ? 34  ARG B CD  1 
ATOM   1751 N NE  . ARG B 1 35  ? 0.160   28.886  -21.532 1.00 35.38 ? 34  ARG B NE  1 
ATOM   1752 C CZ  . ARG B 1 35  ? 0.603   29.639  -20.525 1.00 36.06 ? 34  ARG B CZ  1 
ATOM   1753 N NH1 . ARG B 1 35  ? 1.258   30.771  -20.762 1.00 35.67 ? 34  ARG B NH1 1 
ATOM   1754 N NH2 . ARG B 1 35  ? 0.378   29.260  -19.272 1.00 34.17 ? 34  ARG B NH2 1 
ATOM   1755 N N   . ASP B 1 36  ? 5.830   28.691  -23.945 1.00 28.87 ? 35  ASP B N   1 
ATOM   1756 C CA  . ASP B 1 36  ? 7.217   28.570  -23.499 1.00 35.45 ? 35  ASP B CA  1 
ATOM   1757 C C   . ASP B 1 36  ? 7.430   29.177  -22.110 1.00 34.79 ? 35  ASP B C   1 
ATOM   1758 O O   . ASP B 1 36  ? 6.896   30.242  -21.802 1.00 32.26 ? 35  ASP B O   1 
ATOM   1759 C CB  . ASP B 1 36  ? 8.159   29.228  -24.512 1.00 36.14 ? 35  ASP B CB  1 
ATOM   1760 C CG  . ASP B 1 36  ? 8.338   28.394  -25.770 1.00 40.65 ? 35  ASP B CG  1 
ATOM   1761 O OD1 . ASP B 1 36  ? 8.145   27.160  -25.699 1.00 39.45 ? 35  ASP B OD1 1 
ATOM   1762 O OD2 . ASP B 1 36  ? 8.674   28.968  -26.829 1.00 40.59 ? 35  ASP B OD2 1 
ATOM   1763 N N   . PHE B 1 37  ? 8.222   28.500  -21.284 1.00 27.78 ? 36  PHE B N   1 
ATOM   1764 C CA  . PHE B 1 37  ? 8.442   28.925  -19.904 1.00 30.97 ? 36  PHE B CA  1 
ATOM   1765 C C   . PHE B 1 37  ? 9.925   29.023  -19.574 1.00 33.44 ? 36  PHE B C   1 
ATOM   1766 O O   . PHE B 1 37  ? 10.667  28.056  -19.740 1.00 34.22 ? 36  PHE B O   1 
ATOM   1767 C CB  . PHE B 1 37  ? 7.779   27.953  -18.929 1.00 30.17 ? 36  PHE B CB  1 
ATOM   1768 C CG  . PHE B 1 37  ? 6.281   27.886  -19.056 1.00 31.90 ? 36  PHE B CG  1 
ATOM   1769 C CD1 . PHE B 1 37  ? 5.677   26.859  -19.767 1.00 28.16 ? 36  PHE B CD1 1 
ATOM   1770 C CD2 . PHE B 1 37  ? 5.476   28.846  -18.460 1.00 27.10 ? 36  PHE B CD2 1 
ATOM   1771 C CE1 . PHE B 1 37  ? 4.305   26.791  -19.880 1.00 28.86 ? 36  PHE B CE1 1 
ATOM   1772 C CE2 . PHE B 1 37  ? 4.100   28.783  -18.574 1.00 27.85 ? 36  PHE B CE2 1 
ATOM   1773 C CZ  . PHE B 1 37  ? 3.513   27.754  -19.283 1.00 29.51 ? 36  PHE B CZ  1 
ATOM   1774 N N   . ALA B 1 38  ? 10.348  30.192  -19.099 1.00 35.47 ? 37  ALA B N   1 
ATOM   1775 C CA  . ALA B 1 38  ? 11.729  30.398  -18.681 1.00 33.08 ? 37  ALA B CA  1 
ATOM   1776 C C   . ALA B 1 38  ? 11.995  29.623  -17.401 1.00 37.91 ? 37  ALA B C   1 
ATOM   1777 O O   . ALA B 1 38  ? 11.067  29.298  -16.661 1.00 34.34 ? 37  ALA B O   1 
ATOM   1778 C CB  . ALA B 1 38  ? 12.011  31.882  -18.475 1.00 36.68 ? 37  ALA B CB  1 
ATOM   1779 N N   . LYS B 1 39  ? 13.263  29.323  -17.147 1.00 36.84 ? 38  LYS B N   1 
ATOM   1780 C CA  . LYS B 1 39  ? 13.651  28.629  -15.926 1.00 37.43 ? 38  LYS B CA  1 
ATOM   1781 C C   . LYS B 1 39  ? 13.067  29.325  -14.705 1.00 34.85 ? 38  LYS B C   1 
ATOM   1782 O O   . LYS B 1 39  ? 13.144  30.545  -14.584 1.00 40.33 ? 38  LYS B O   1 
ATOM   1783 C CB  . LYS B 1 39  ? 15.174  28.581  -15.805 1.00 40.42 ? 38  LYS B CB  1 
ATOM   1784 C CG  . LYS B 1 39  ? 15.666  27.973  -14.504 1.00 44.86 ? 38  LYS B CG  1 
ATOM   1785 C CD  . LYS B 1 39  ? 17.085  28.413  -14.187 1.00 47.31 ? 38  LYS B CD  1 
ATOM   1786 C CE  . LYS B 1 39  ? 17.727  27.477  -13.177 1.00 58.72 ? 38  LYS B CE  1 
ATOM   1787 N NZ  . LYS B 1 39  ? 17.737  26.079  -13.686 1.00 50.44 ? 38  LYS B NZ  1 
ATOM   1788 N N   . GLY B 1 40  ? 12.470  28.548  -13.809 1.00 38.03 ? 39  GLY B N   1 
ATOM   1789 C CA  . GLY B 1 40  ? 11.924  29.085  -12.575 1.00 39.85 ? 39  GLY B CA  1 
ATOM   1790 C C   . GLY B 1 40  ? 10.509  29.629  -12.679 1.00 41.18 ? 39  GLY B C   1 
ATOM   1791 O O   . GLY B 1 40  ? 9.846   29.847  -11.661 1.00 38.75 ? 39  GLY B O   1 
ATOM   1792 N N   . SER B 1 41  ? 10.040  29.855  -13.903 1.00 35.44 ? 40  SER B N   1 
ATOM   1793 C CA  . SER B 1 41  ? 8.700   30.404  -14.104 1.00 42.41 ? 40  SER B CA  1 
ATOM   1794 C C   . SER B 1 41  ? 7.639   29.340  -13.862 1.00 40.73 ? 40  SER B C   1 
ATOM   1795 O O   . SER B 1 41  ? 7.868   28.156  -14.107 1.00 40.62 ? 40  SER B O   1 
ATOM   1796 C CB  . SER B 1 41  ? 8.547   31.019  -15.501 1.00 37.35 ? 40  SER B CB  1 
ATOM   1797 O OG  . SER B 1 41  ? 8.538   30.028  -16.514 1.00 40.44 ? 40  SER B OG  1 
ATOM   1798 N N   . ALA B 1 42  ? 6.484   29.776  -13.370 1.00 42.73 ? 41  ALA B N   1 
ATOM   1799 C CA  . ALA B 1 42  ? 5.387   28.880  -13.030 1.00 37.94 ? 41  ALA B CA  1 
ATOM   1800 C C   . ALA B 1 42  ? 4.618   28.404  -14.261 1.00 32.79 ? 41  ALA B C   1 
ATOM   1801 O O   . ALA B 1 42  ? 4.102   29.213  -15.034 1.00 33.59 ? 41  ALA B O   1 
ATOM   1802 C CB  . ALA B 1 42  ? 4.442   29.562  -12.049 1.00 36.05 ? 41  ALA B CB  1 
ATOM   1803 N N   . VAL B 1 43  ? 4.547   27.086  -14.430 1.00 40.14 ? 42  VAL B N   1 
ATOM   1804 C CA  . VAL B 1 43  ? 3.767   26.474  -15.501 1.00 33.15 ? 42  VAL B CA  1 
ATOM   1805 C C   . VAL B 1 43  ? 2.323   26.367  -15.045 1.00 32.02 ? 42  VAL B C   1 
ATOM   1806 O O   . VAL B 1 43  ? 1.392   26.585  -15.817 1.00 26.55 ? 42  VAL B O   1 
ATOM   1807 C CB  . VAL B 1 43  ? 4.291   25.064  -15.854 1.00 31.57 ? 42  VAL B CB  1 
ATOM   1808 C CG1 . VAL B 1 43  ? 3.566   24.509  -17.072 1.00 32.32 ? 42  VAL B CG1 1 
ATOM   1809 C CG2 . VAL B 1 43  ? 5.787   25.101  -16.109 1.00 35.36 ? 42  VAL B CG2 1 
ATOM   1810 N N   . ILE B 1 44  ? 2.153   26.020  -13.773 1.00 35.96 ? 43  ILE B N   1 
ATOM   1811 C CA  . ILE B 1 44  ? 0.842   25.972  -13.143 1.00 31.59 ? 43  ILE B CA  1 
ATOM   1812 C C   . ILE B 1 44  ? 0.915   26.762  -11.840 1.00 39.77 ? 43  ILE B C   1 
ATOM   1813 O O   . ILE B 1 44  ? 1.701   26.432  -10.951 1.00 37.39 ? 43  ILE B O   1 
ATOM   1814 C CB  . ILE B 1 44  ? 0.402   24.527  -12.849 1.00 33.63 ? 43  ILE B CB  1 
ATOM   1815 C CG1 . ILE B 1 44  ? 0.321   23.709  -14.143 1.00 32.89 ? 43  ILE B CG1 1 
ATOM   1816 C CG2 . ILE B 1 44  ? -0.938  24.509  -12.115 1.00 32.76 ? 43  ILE B CG2 1 
ATOM   1817 C CD1 . ILE B 1 44  ? -0.209  22.297  -13.942 1.00 32.21 ? 43  ILE B CD1 1 
ATOM   1818 N N   . MET B 1 45  ? 0.112   27.817  -11.738 1.00 35.01 ? 44  MET B N   1 
ATOM   1819 C CA  . MET B 1 45  ? 0.104   28.667  -10.552 1.00 43.56 ? 44  MET B CA  1 
ATOM   1820 C C   . MET B 1 45  ? -0.712  28.032  -9.426  1.00 43.60 ? 44  MET B C   1 
ATOM   1821 O O   . MET B 1 45  ? -1.657  27.289  -9.681  1.00 39.25 ? 44  MET B O   1 
ATOM   1822 C CB  . MET B 1 45  ? -0.442  30.056  -10.896 1.00 41.10 ? 44  MET B CB  1 
ATOM   1823 C CG  . MET B 1 45  ? 0.409   30.832  -11.902 1.00 41.23 ? 44  MET B CG  1 
ATOM   1824 S SD  . MET B 1 45  ? 1.752   31.787  -11.154 1.00 40.36 ? 44  MET B SD  1 
ATOM   1825 C CE  . MET B 1 45  ? 0.822   33.103  -10.367 1.00 39.10 ? 44  MET B CE  1 
ATOM   1826 N N   . PRO B 1 46  ? -0.341  28.319  -8.169  1.00 46.60 ? 45  PRO B N   1 
ATOM   1827 C CA  . PRO B 1 46  ? -1.085  27.747  -7.044  1.00 47.05 ? 45  PRO B CA  1 
ATOM   1828 C C   . PRO B 1 46  ? -2.544  28.180  -7.110  1.00 46.83 ? 45  PRO B C   1 
ATOM   1829 O O   . PRO B 1 46  ? -2.823  29.354  -7.344  1.00 44.83 ? 45  PRO B O   1 
ATOM   1830 C CB  . PRO B 1 46  ? -0.406  28.366  -5.816  1.00 47.12 ? 45  PRO B CB  1 
ATOM   1831 C CG  . PRO B 1 46  ? 0.931   28.823  -6.295  1.00 51.15 ? 45  PRO B CG  1 
ATOM   1832 C CD  . PRO B 1 46  ? 0.739   29.215  -7.726  1.00 44.79 ? 45  PRO B CD  1 
ATOM   1833 N N   . GLY B 1 47  ? -3.461  27.241  -6.924  1.00 46.02 ? 46  GLY B N   1 
ATOM   1834 C CA  . GLY B 1 47  ? -4.874  27.556  -6.981  1.00 45.92 ? 46  GLY B CA  1 
ATOM   1835 C C   . GLY B 1 47  ? -5.391  27.693  -8.398  1.00 43.16 ? 46  GLY B C   1 
ATOM   1836 O O   . GLY B 1 47  ? -6.601  27.778  -8.613  1.00 40.97 ? 46  GLY B O   1 
ATOM   1837 N N   . GLU B 1 48  ? -4.485  27.715  -9.371  1.00 42.67 ? 47  GLU B N   1 
ATOM   1838 C CA  . GLU B 1 48  ? -4.900  27.829  -10.763 1.00 39.60 ? 47  GLU B CA  1 
ATOM   1839 C C   . GLU B 1 48  ? -5.790  26.654  -11.143 1.00 40.61 ? 47  GLU B C   1 
ATOM   1840 O O   . GLU B 1 48  ? -5.629  25.541  -10.636 1.00 40.07 ? 47  GLU B O   1 
ATOM   1841 C CB  . GLU B 1 48  ? -3.701  27.920  -11.716 1.00 39.70 ? 47  GLU B CB  1 
ATOM   1842 C CG  . GLU B 1 48  ? -4.113  28.080  -13.176 1.00 34.36 ? 47  GLU B CG  1 
ATOM   1843 C CD  . GLU B 1 48  ? -2.938  28.149  -14.139 1.00 34.70 ? 47  GLU B CD  1 
ATOM   1844 O OE1 . GLU B 1 48  ? -1.775  28.215  -13.684 1.00 30.77 ? 47  GLU B OE1 1 
ATOM   1845 O OE2 . GLU B 1 48  ? -3.186  28.142  -15.364 1.00 30.98 ? 47  GLU B OE2 1 
ATOM   1846 N N   . GLU B 1 49  ? -6.729  26.918  -12.041 1.00 38.30 ? 48  GLU B N   1 
ATOM   1847 C CA  . GLU B 1 49  ? -7.714  25.931  -12.449 1.00 40.22 ? 48  GLU B CA  1 
ATOM   1848 C C   . GLU B 1 49  ? -7.402  25.402  -13.849 1.00 36.81 ? 48  GLU B C   1 
ATOM   1849 O O   . GLU B 1 49  ? -7.710  26.046  -14.853 1.00 37.50 ? 48  GLU B O   1 
ATOM   1850 C CB  . GLU B 1 49  ? -9.102  26.569  -12.410 1.00 44.35 ? 48  GLU B CB  1 
ATOM   1851 C CG  . GLU B 1 49  ? -10.217 25.698  -12.928 1.00 45.32 ? 48  GLU B CG  1 
ATOM   1852 C CD  . GLU B 1 49  ? -11.488 26.489  -13.174 1.00 59.96 ? 48  GLU B CD  1 
ATOM   1853 O OE1 . GLU B 1 49  ? -12.040 27.057  -12.204 1.00 66.65 ? 48  GLU B OE1 1 
ATOM   1854 O OE2 . GLU B 1 49  ? -11.933 26.545  -14.341 1.00 58.65 ? 48  GLU B OE2 1 
ATOM   1855 N N   . ILE B 1 50  ? -6.789  24.225  -13.909 1.00 35.39 ? 49  ILE B N   1 
ATOM   1856 C CA  . ILE B 1 50  ? -6.341  23.654  -15.176 1.00 28.10 ? 49  ILE B CA  1 
ATOM   1857 C C   . ILE B 1 50  ? -7.436  22.864  -15.891 1.00 27.40 ? 49  ILE B C   1 
ATOM   1858 O O   . ILE B 1 50  ? -8.020  21.940  -15.322 1.00 31.15 ? 49  ILE B O   1 
ATOM   1859 C CB  . ILE B 1 50  ? -5.109  22.751  -14.958 1.00 29.31 ? 49  ILE B CB  1 
ATOM   1860 C CG1 . ILE B 1 50  ? -3.970  23.572  -14.342 1.00 29.39 ? 49  ILE B CG1 1 
ATOM   1861 C CG2 . ILE B 1 50  ? -4.668  22.098  -16.265 1.00 25.33 ? 49  ILE B CG2 1 
ATOM   1862 C CD1 . ILE B 1 50  ? -3.519  24.735  -15.206 1.00 21.99 ? 49  ILE B CD1 1 
ATOM   1863 N N   . THR B 1 51  ? -7.713  23.230  -17.139 1.00 24.77 ? 50  THR B N   1 
ATOM   1864 C CA  . THR B 1 51  ? -8.650  22.465  -17.962 1.00 27.70 ? 50  THR B CA  1 
ATOM   1865 C C   . THR B 1 51  ? -8.035  21.965  -19.264 1.00 26.63 ? 50  THR B C   1 
ATOM   1866 O O   . THR B 1 51  ? -8.752  21.525  -20.159 1.00 30.40 ? 50  THR B O   1 
ATOM   1867 C CB  . THR B 1 51  ? -9.917  23.265  -18.308 1.00 26.84 ? 50  THR B CB  1 
ATOM   1868 O OG1 . THR B 1 51  ? -9.544  24.499  -18.932 1.00 31.17 ? 50  THR B OG1 1 
ATOM   1869 C CG2 . THR B 1 51  ? -10.728 23.551  -17.057 1.00 28.25 ? 50  THR B CG2 1 
ATOM   1870 N N   . SER B 1 52  ? -6.711  22.027  -19.366 1.00 26.00 ? 51  SER B N   1 
ATOM   1871 C CA  . SER B 1 52  ? -6.011  21.502  -20.534 1.00 23.34 ? 51  SER B CA  1 
ATOM   1872 C C   . SER B 1 52  ? -4.983  20.465  -20.112 1.00 24.88 ? 51  SER B C   1 
ATOM   1873 O O   . SER B 1 52  ? -4.443  20.540  -19.013 1.00 26.44 ? 51  SER B O   1 
ATOM   1874 C CB  . SER B 1 52  ? -5.297  22.619  -21.295 1.00 27.44 ? 51  SER B CB  1 
ATOM   1875 O OG  . SER B 1 52  ? -6.200  23.444  -21.998 1.00 26.83 ? 51  SER B OG  1 
ATOM   1876 N N   . MET B 1 53  ? -4.722  19.499  -20.991 1.00 20.81 ? 52  MET B N   1 
ATOM   1877 C CA  . MET B 1 53  ? -3.598  18.594  -20.818 1.00 22.97 ? 52  MET B CA  1 
ATOM   1878 C C   . MET B 1 53  ? -2.352  19.352  -21.251 1.00 23.19 ? 52  MET B C   1 
ATOM   1879 O O   . MET B 1 53  ? -2.399  20.120  -22.214 1.00 23.33 ? 52  MET B O   1 
ATOM   1880 C CB  . MET B 1 53  ? -3.769  17.341  -21.681 1.00 24.42 ? 52  MET B CB  1 
ATOM   1881 C CG  . MET B 1 53  ? -5.017  16.505  -21.366 1.00 26.83 ? 52  MET B CG  1 
ATOM   1882 S SD  . MET B 1 53  ? -5.172  16.059  -19.624 1.00 33.13 ? 52  MET B SD  1 
ATOM   1883 C CE  . MET B 1 53  ? -3.612  15.224  -19.321 1.00 28.12 ? 52  MET B CE  1 
ATOM   1884 N N   . ILE B 1 54  ? -1.246  19.142  -20.544 1.00 22.27 ? 53  ILE B N   1 
ATOM   1885 C CA  . ILE B 1 54  ? -0.009  19.862  -20.820 1.00 24.16 ? 53  ILE B CA  1 
ATOM   1886 C C   . ILE B 1 54  ? 1.059   18.888  -21.296 1.00 23.11 ? 53  ILE B C   1 
ATOM   1887 O O   . ILE B 1 54  ? 1.571   18.084  -20.520 1.00 29.35 ? 53  ILE B O   1 
ATOM   1888 C CB  . ILE B 1 54  ? 0.497   20.626  -19.565 1.00 26.83 ? 53  ILE B CB  1 
ATOM   1889 C CG1 . ILE B 1 54  ? -0.591  21.555  -19.029 1.00 26.64 ? 53  ILE B CG1 1 
ATOM   1890 C CG2 . ILE B 1 54  ? 1.741   21.440  -19.877 1.00 24.70 ? 53  ILE B CG2 1 
ATOM   1891 C CD1 . ILE B 1 54  ? -0.251  22.175  -17.692 1.00 23.19 ? 53  ILE B CD1 1 
ATOM   1892 N N   . PHE B 1 55  ? 1.380   18.968  -22.582 1.00 22.33 ? 54  PHE B N   1 
ATOM   1893 C CA  . PHE B 1 55  ? 2.393   18.122  -23.186 1.00 21.93 ? 54  PHE B CA  1 
ATOM   1894 C C   . PHE B 1 55  ? 3.758   18.800  -23.125 1.00 24.55 ? 54  PHE B C   1 
ATOM   1895 O O   . PHE B 1 55  ? 3.935   19.907  -23.630 1.00 24.30 ? 54  PHE B O   1 
ATOM   1896 C CB  . PHE B 1 55  ? 2.019   17.814  -24.636 1.00 23.64 ? 54  PHE B CB  1 
ATOM   1897 C CG  . PHE B 1 55  ? 2.997   16.920  -25.337 1.00 27.56 ? 54  PHE B CG  1 
ATOM   1898 C CD1 . PHE B 1 55  ? 3.253   15.646  -24.861 1.00 23.14 ? 54  PHE B CD1 1 
ATOM   1899 C CD2 . PHE B 1 55  ? 3.645   17.345  -26.485 1.00 27.82 ? 54  PHE B CD2 1 
ATOM   1900 C CE1 . PHE B 1 55  ? 4.149   14.813  -25.512 1.00 33.06 ? 54  PHE B CE1 1 
ATOM   1901 C CE2 . PHE B 1 55  ? 4.545   16.522  -27.138 1.00 32.72 ? 54  PHE B CE2 1 
ATOM   1902 C CZ  . PHE B 1 55  ? 4.799   15.252  -26.651 1.00 31.70 ? 54  PHE B CZ  1 
ATOM   1903 N N   . LEU B 1 56  ? 4.718   18.124  -22.502 1.00 28.89 ? 55  LEU B N   1 
ATOM   1904 C CA  . LEU B 1 56  ? 6.081   18.640  -22.365 1.00 26.82 ? 55  LEU B CA  1 
ATOM   1905 C C   . LEU B 1 56  ? 6.910   18.214  -23.569 1.00 29.61 ? 55  LEU B C   1 
ATOM   1906 O O   . LEU B 1 56  ? 7.365   17.071  -23.647 1.00 29.66 ? 55  LEU B O   1 
ATOM   1907 C CB  . LEU B 1 56  ? 6.706   18.098  -21.078 1.00 25.67 ? 55  LEU B CB  1 
ATOM   1908 C CG  . LEU B 1 56  ? 7.656   18.971  -20.262 1.00 33.38 ? 55  LEU B CG  1 
ATOM   1909 C CD1 . LEU B 1 56  ? 7.926   18.325  -18.908 1.00 29.49 ? 55  LEU B CD1 1 
ATOM   1910 C CD2 . LEU B 1 56  ? 8.950   19.204  -21.013 1.00 35.78 ? 55  LEU B CD2 1 
ATOM   1911 N N   . VAL B 1 57  ? 7.099   19.121  -24.520 1.00 26.12 ? 56  VAL B N   1 
ATOM   1912 C CA  . VAL B 1 57  ? 7.876   18.782  -25.710 1.00 33.54 ? 56  VAL B CA  1 
ATOM   1913 C C   . VAL B 1 57  ? 9.400   18.896  -25.508 1.00 35.48 ? 56  VAL B C   1 
ATOM   1914 O O   . VAL B 1 57  ? 10.161  18.139  -26.099 1.00 37.38 ? 56  VAL B O   1 
ATOM   1915 C CB  . VAL B 1 57  ? 7.385   19.539  -26.968 1.00 34.09 ? 56  VAL B CB  1 
ATOM   1916 C CG1 . VAL B 1 57  ? 6.192   20.420  -26.632 1.00 32.81 ? 56  VAL B CG1 1 
ATOM   1917 C CG2 . VAL B 1 57  ? 8.514   20.324  -27.614 1.00 36.64 ? 56  VAL B CG2 1 
ATOM   1918 N N   . GLU B 1 58  ? 9.837   19.824  -24.662 1.00 37.74 ? 57  GLU B N   1 
ATOM   1919 C CA  . GLU B 1 58  ? 11.246  19.897  -24.253 1.00 39.88 ? 57  GLU B CA  1 
ATOM   1920 C C   . GLU B 1 58  ? 11.387  20.622  -22.919 1.00 36.96 ? 57  GLU B C   1 
ATOM   1921 O O   . GLU B 1 58  ? 10.736  21.639  -22.691 1.00 37.21 ? 57  GLU B O   1 
ATOM   1922 C CB  . GLU B 1 58  ? 12.113  20.589  -25.315 1.00 45.28 ? 57  GLU B CB  1 
ATOM   1923 C CG  . GLU B 1 58  ? 12.758  19.645  -26.321 1.00 51.30 ? 57  GLU B CG  1 
ATOM   1924 C CD  . GLU B 1 58  ? 13.898  20.292  -27.101 1.00 62.67 ? 57  GLU B CD  1 
ATOM   1925 O OE1 . GLU B 1 58  ? 14.458  21.306  -26.624 1.00 60.69 ? 57  GLU B OE1 1 
ATOM   1926 O OE2 . GLU B 1 58  ? 14.236  19.782  -28.194 1.00 58.42 ? 57  GLU B OE2 1 
ATOM   1927 N N   . GLY B 1 59  ? 12.237  20.094  -22.042 1.00 35.75 ? 58  GLY B N   1 
ATOM   1928 C CA  . GLY B 1 59  ? 12.479  20.713  -20.752 1.00 35.79 ? 58  GLY B CA  1 
ATOM   1929 C C   . GLY B 1 59  ? 12.207  19.799  -19.569 1.00 37.11 ? 58  GLY B C   1 
ATOM   1930 O O   . GLY B 1 59  ? 12.183  18.576  -19.709 1.00 37.34 ? 58  GLY B O   1 
ATOM   1931 N N   . LYS B 1 60  ? 11.998  20.400  -18.400 1.00 33.29 ? 59  LYS B N   1 
ATOM   1932 C CA  . LYS B 1 60  ? 11.712  19.652  -17.179 1.00 38.94 ? 59  LYS B CA  1 
ATOM   1933 C C   . LYS B 1 60  ? 10.848  20.469  -16.219 1.00 39.08 ? 59  LYS B C   1 
ATOM   1934 O O   . LYS B 1 60  ? 11.054  21.674  -16.053 1.00 39.11 ? 59  LYS B O   1 
ATOM   1935 C CB  . LYS B 1 60  ? 13.007  19.221  -16.482 1.00 40.36 ? 59  LYS B CB  1 
ATOM   1936 C CG  . LYS B 1 60  ? 12.768  18.496  -15.161 1.00 46.34 ? 59  LYS B CG  1 
ATOM   1937 C CD  . LYS B 1 60  ? 14.034  17.847  -14.623 1.00 50.19 ? 59  LYS B CD  1 
ATOM   1938 C CE  . LYS B 1 60  ? 13.739  17.007  -13.391 1.00 52.60 ? 59  LYS B CE  1 
ATOM   1939 N NZ  . LYS B 1 60  ? 14.853  16.059  -13.088 1.00 60.36 ? 59  LYS B NZ  1 
ATOM   1940 N N   . ILE B 1 61  ? 9.890   19.803  -15.582 1.00 36.15 ? 60  ILE B N   1 
ATOM   1941 C CA  . ILE B 1 61  ? 8.942   20.484  -14.711 1.00 40.35 ? 60  ILE B CA  1 
ATOM   1942 C C   . ILE B 1 61  ? 8.737   19.767  -13.378 1.00 40.07 ? 60  ILE B C   1 
ATOM   1943 O O   . ILE B 1 61  ? 8.443   18.575  -13.335 1.00 41.92 ? 60  ILE B O   1 
ATOM   1944 C CB  . ILE B 1 61  ? 7.570   20.679  -15.402 1.00 35.02 ? 60  ILE B CB  1 
ATOM   1945 C CG1 . ILE B 1 61  ? 7.696   21.654  -16.578 1.00 32.78 ? 60  ILE B CG1 1 
ATOM   1946 C CG2 . ILE B 1 61  ? 6.537   21.173  -14.397 1.00 31.36 ? 60  ILE B CG2 1 
ATOM   1947 C CD1 . ILE B 1 61  ? 6.448   21.731  -17.464 1.00 24.92 ? 60  ILE B CD1 1 
ATOM   1948 N N   . LYS B 1 62  ? 8.902   20.516  -12.294 1.00 36.11 ? 61  LYS B N   1 
ATOM   1949 C CA  . LYS B 1 62  ? 8.655   20.018  -10.949 1.00 40.34 ? 61  LYS B CA  1 
ATOM   1950 C C   . LYS B 1 62  ? 7.205   20.287  -10.568 1.00 41.82 ? 61  LYS B C   1 
ATOM   1951 O O   . LYS B 1 62  ? 6.723   21.412  -10.708 1.00 40.91 ? 61  LYS B O   1 
ATOM   1952 C CB  . LYS B 1 62  ? 9.589   20.734  -9.974  1.00 45.43 ? 61  LYS B CB  1 
ATOM   1953 C CG  . LYS B 1 62  ? 9.367   20.435  -8.504  1.00 45.88 ? 61  LYS B CG  1 
ATOM   1954 C CD  . LYS B 1 62  ? 10.038  21.516  -7.672  1.00 54.00 ? 61  LYS B CD  1 
ATOM   1955 C CE  . LYS B 1 62  ? 10.585  20.978  -6.364  1.00 59.95 ? 61  LYS B CE  1 
ATOM   1956 N NZ  . LYS B 1 62  ? 11.569  21.929  -5.767  1.00 68.38 ? 61  LYS B NZ  1 
ATOM   1957 N N   . LEU B 1 63  ? 6.508   19.258  -10.092 1.00 42.87 ? 62  LEU B N   1 
ATOM   1958 C CA  . LEU B 1 63  ? 5.111   19.408  -9.695  1.00 41.94 ? 62  LEU B CA  1 
ATOM   1959 C C   . LEU B 1 63  ? 4.917   19.147  -8.209  1.00 50.92 ? 62  LEU B C   1 
ATOM   1960 O O   . LEU B 1 63  ? 4.873   17.997  -7.782  1.00 54.06 ? 62  LEU B O   1 
ATOM   1961 C CB  . LEU B 1 63  ? 4.201   18.462  -10.487 1.00 44.78 ? 62  LEU B CB  1 
ATOM   1962 C CG  . LEU B 1 63  ? 4.105   18.569  -12.009 1.00 42.32 ? 62  LEU B CG  1 
ATOM   1963 C CD1 . LEU B 1 63  ? 5.258   17.831  -12.663 1.00 45.39 ? 62  LEU B CD1 1 
ATOM   1964 C CD2 . LEU B 1 63  ? 2.781   17.999  -12.488 1.00 43.86 ? 62  LEU B CD2 1 
ATOM   1965 N N   . ASP B 1 64  ? 4.795   20.211  -7.423  1.00 50.34 ? 63  ASP B N   1 
ATOM   1966 C CA  . ASP B 1 64  ? 4.502   20.063  -6.002  1.00 48.86 ? 63  ASP B CA  1 
ATOM   1967 C C   . ASP B 1 64  ? 2.995   20.014  -5.804  1.00 54.00 ? 63  ASP B C   1 
ATOM   1968 O O   . ASP B 1 64  ? 2.235   20.528  -6.628  1.00 49.59 ? 63  ASP B O   1 
ATOM   1969 C CB  . ASP B 1 64  ? 5.082   21.225  -5.194  1.00 50.96 ? 63  ASP B CB  1 
ATOM   1970 C CG  . ASP B 1 64  ? 6.594   21.288  -5.255  1.00 54.22 ? 63  ASP B CG  1 
ATOM   1971 O OD1 . ASP B 1 64  ? 7.200   21.887  -4.344  1.00 53.85 ? 63  ASP B OD1 1 
ATOM   1972 O OD2 . ASP B 1 64  ? 7.176   20.746  -6.214  1.00 55.85 ? 63  ASP B OD2 1 
ATOM   1973 N N   . ILE B 1 65  ? 2.564   19.385  -4.717  1.00 53.31 ? 64  ILE B N   1 
ATOM   1974 C CA  . ILE B 1 65  ? 1.160   19.407  -4.335  1.00 55.28 ? 64  ILE B CA  1 
ATOM   1975 C C   . ILE B 1 65  ? 1.000   20.242  -3.071  1.00 59.20 ? 64  ILE B C   1 
ATOM   1976 O O   . ILE B 1 65  ? 1.899   20.290  -2.231  1.00 60.28 ? 64  ILE B O   1 
ATOM   1977 C CB  . ILE B 1 65  ? 0.582   17.991  -4.114  1.00 53.94 ? 64  ILE B CB  1 
ATOM   1978 C CG1 . ILE B 1 65  ? -0.824  18.083  -3.516  1.00 58.53 ? 64  ILE B CG1 1 
ATOM   1979 C CG2 . ILE B 1 65  ? 1.486   17.177  -3.206  1.00 55.96 ? 64  ILE B CG2 1 
ATOM   1980 C CD1 . ILE B 1 65  ? -1.673  16.855  -3.736  1.00 55.22 ? 64  ILE B CD1 1 
ATOM   1981 N N   . ILE B 1 66  ? -0.143  20.908  -2.949  1.00 59.72 ? 65  ILE B N   1 
ATOM   1982 C CA  . ILE B 1 66  ? -0.409  21.785  -1.817  1.00 59.77 ? 65  ILE B CA  1 
ATOM   1983 C C   . ILE B 1 66  ? -1.631  21.316  -1.034  1.00 64.77 ? 65  ILE B C   1 
ATOM   1984 O O   . ILE B 1 66  ? -2.765  21.486  -1.482  1.00 60.89 ? 65  ILE B O   1 
ATOM   1985 C CB  . ILE B 1 66  ? -0.641  23.227  -2.288  1.00 61.24 ? 65  ILE B CB  1 
ATOM   1986 C CG1 . ILE B 1 66  ? 0.625   23.771  -2.958  1.00 58.50 ? 65  ILE B CG1 1 
ATOM   1987 C CG2 . ILE B 1 66  ? -1.074  24.105  -1.118  1.00 65.63 ? 65  ILE B CG2 1 
ATOM   1988 C CD1 . ILE B 1 66  ? 0.400   25.007  -3.800  1.00 54.61 ? 65  ILE B CD1 1 
ATOM   1989 N N   . PHE B 1 67  ? -1.393  20.721  0.133   1.00 70.13 ? 66  PHE B N   1 
ATOM   1990 C CA  . PHE B 1 67  ? -2.475  20.236  0.986   1.00 68.14 ? 66  PHE B CA  1 
ATOM   1991 C C   . PHE B 1 67  ? -3.134  21.411  1.711   1.00 69.83 ? 66  PHE B C   1 
ATOM   1992 O O   . PHE B 1 67  ? -2.588  22.516  1.728   1.00 68.85 ? 66  PHE B O   1 
ATOM   1993 C CB  . PHE B 1 67  ? -1.954  19.183  1.969   1.00 64.13 ? 66  PHE B CB  1 
ATOM   1994 C CG  . PHE B 1 67  ? -1.087  18.134  1.323   1.00 64.06 ? 66  PHE B CG  1 
ATOM   1995 C CD1 . PHE B 1 67  ? 0.294   18.213  1.400   1.00 64.23 ? 66  PHE B CD1 1 
ATOM   1996 C CD2 . PHE B 1 67  ? -1.652  17.077  0.625   1.00 65.39 ? 66  PHE B CD2 1 
ATOM   1997 C CE1 . PHE B 1 67  ? 1.095   17.256  0.803   1.00 62.88 ? 66  PHE B CE1 1 
ATOM   1998 C CE2 . PHE B 1 67  ? -0.855  16.117  0.025   1.00 60.71 ? 66  PHE B CE2 1 
ATOM   1999 C CZ  . PHE B 1 67  ? 0.520   16.207  0.115   1.00 61.60 ? 66  PHE B CZ  1 
ATOM   2000 N N   . GLU B 1 68  ? -4.302  21.177  2.304   1.00 73.58 ? 67  GLU B N   1 
ATOM   2001 C CA  . GLU B 1 68  ? -5.146  22.278  2.785   1.00 76.65 ? 67  GLU B CA  1 
ATOM   2002 C C   . GLU B 1 68  ? -4.602  23.095  3.966   1.00 74.58 ? 67  GLU B C   1 
ATOM   2003 O O   . GLU B 1 68  ? -4.996  24.247  4.153   1.00 74.05 ? 67  GLU B O   1 
ATOM   2004 C CB  . GLU B 1 68  ? -6.577  21.802  3.077   1.00 74.06 ? 67  GLU B CB  1 
ATOM   2005 C CG  . GLU B 1 68  ? -7.419  22.842  3.808   1.00 70.26 ? 67  GLU B CG  1 
ATOM   2006 C CD  . GLU B 1 68  ? -8.843  22.929  3.294   1.00 75.68 ? 67  GLU B CD  1 
ATOM   2007 O OE1 . GLU B 1 68  ? -9.408  21.883  2.908   1.00 77.91 ? 67  GLU B OE1 1 
ATOM   2008 O OE2 . GLU B 1 68  ? -9.399  24.049  3.281   1.00 70.61 ? 67  GLU B OE2 1 
ATOM   2009 N N   . ASP B 1 69  ? -3.709  22.516  4.762   1.00 72.13 ? 68  ASP B N   1 
ATOM   2010 C CA  . ASP B 1 69  ? -3.135  23.266  5.877   1.00 74.34 ? 68  ASP B CA  1 
ATOM   2011 C C   . ASP B 1 69  ? -2.171  24.343  5.382   1.00 74.48 ? 68  ASP B C   1 
ATOM   2012 O O   . ASP B 1 69  ? -1.978  25.365  6.041   1.00 74.88 ? 68  ASP B O   1 
ATOM   2013 C CB  . ASP B 1 69  ? -2.450  22.342  6.890   1.00 70.73 ? 68  ASP B CB  1 
ATOM   2014 C CG  . ASP B 1 69  ? -1.447  21.407  6.246   1.00 73.37 ? 68  ASP B CG  1 
ATOM   2015 O OD1 . ASP B 1 69  ? -1.877  20.428  5.600   1.00 72.72 ? 68  ASP B OD1 1 
ATOM   2016 O OD2 . ASP B 1 69  ? -0.228  21.642  6.401   1.00 71.02 ? 68  ASP B OD2 1 
ATOM   2017 N N   . GLY B 1 70  ? -1.579  24.113  4.214   1.00 73.34 ? 69  GLY B N   1 
ATOM   2018 C CA  . GLY B 1 70  ? -0.658  25.066  3.620   1.00 70.63 ? 69  GLY B CA  1 
ATOM   2019 C C   . GLY B 1 70  ? 0.682   24.445  3.280   1.00 66.84 ? 69  GLY B C   1 
ATOM   2020 O O   . GLY B 1 70  ? 1.580   25.120  2.772   1.00 62.70 ? 69  GLY B O   1 
ATOM   2021 N N   . SER B 1 71  ? 0.816   23.152  3.558   1.00 68.94 ? 70  SER B N   1 
ATOM   2022 C CA  . SER B 1 71  ? 2.067   22.443  3.317   1.00 63.96 ? 70  SER B CA  1 
ATOM   2023 C C   . SER B 1 71  ? 2.256   22.111  1.837   1.00 65.17 ? 70  SER B C   1 
ATOM   2024 O O   . SER B 1 71  ? 1.296   22.092  1.066   1.00 66.42 ? 70  SER B O   1 
ATOM   2025 C CB  . SER B 1 71  ? 2.159   21.185  4.185   1.00 64.99 ? 70  SER B CB  1 
ATOM   2026 O OG  . SER B 1 71  ? 0.946   20.456  4.168   1.00 65.59 ? 70  SER B OG  1 
ATOM   2027 N N   . GLU B 1 72  ? 3.503   21.839  1.460   1.00 64.14 ? 71  GLU B N   1 
ATOM   2028 C CA  . GLU B 1 72  ? 3.912   21.766  0.062   1.00 59.71 ? 71  GLU B CA  1 
ATOM   2029 C C   . GLU B 1 72  ? 4.851   20.581  -0.177  1.00 63.29 ? 71  GLU B C   1 
ATOM   2030 O O   . GLU B 1 72  ? 5.989   20.585  0.289   1.00 65.70 ? 71  GLU B O   1 
ATOM   2031 C CB  . GLU B 1 72  ? 4.627   23.068  -0.300  1.00 60.49 ? 71  GLU B CB  1 
ATOM   2032 C CG  . GLU B 1 72  ? 5.406   23.044  -1.601  1.00 62.45 ? 71  GLU B CG  1 
ATOM   2033 C CD  . GLU B 1 72  ? 4.779   23.917  -2.667  1.00 63.39 ? 71  GLU B CD  1 
ATOM   2034 O OE1 . GLU B 1 72  ? 5.491   24.292  -3.625  1.00 59.10 ? 71  GLU B OE1 1 
ATOM   2035 O OE2 . GLU B 1 72  ? 3.578   24.239  -2.538  1.00 68.03 ? 71  GLU B OE2 1 
ATOM   2036 N N   . LYS B 1 73  ? 4.383   19.576  -0.912  1.00 61.28 ? 72  LYS B N   1 
ATOM   2037 C CA  . LYS B 1 73  ? 5.152   18.345  -1.088  1.00 63.74 ? 72  LYS B CA  1 
ATOM   2038 C C   . LYS B 1 73  ? 5.362   18.000  -2.565  1.00 62.56 ? 72  LYS B C   1 
ATOM   2039 O O   . LYS B 1 73  ? 4.441   18.122  -3.374  1.00 58.09 ? 72  LYS B O   1 
ATOM   2040 C CB  . LYS B 1 73  ? 4.449   17.191  -0.366  1.00 62.27 ? 72  LYS B CB  1 
ATOM   2041 C CG  . LYS B 1 73  ? 5.381   16.234  0.365   1.00 66.11 ? 72  LYS B CG  1 
ATOM   2042 C CD  . LYS B 1 73  ? 6.009   15.214  -0.571  1.00 69.04 ? 72  LYS B CD  1 
ATOM   2043 C CE  . LYS B 1 73  ? 6.977   14.309  0.182   1.00 74.47 ? 72  LYS B CE  1 
ATOM   2044 N NZ  . LYS B 1 73  ? 7.569   13.250  -0.684  1.00 72.03 ? 72  LYS B NZ  1 
ATOM   2045 N N   . LEU B 1 74  ? 6.572   17.564  -2.911  1.00 60.86 ? 73  LEU B N   1 
ATOM   2046 C CA  . LEU B 1 74  ? 6.897   17.203  -4.291  1.00 58.45 ? 73  LEU B CA  1 
ATOM   2047 C C   . LEU B 1 74  ? 6.071   16.003  -4.747  1.00 57.07 ? 73  LEU B C   1 
ATOM   2048 O O   . LEU B 1 74  ? 6.082   14.953  -4.106  1.00 58.59 ? 73  LEU B O   1 
ATOM   2049 C CB  . LEU B 1 74  ? 8.391   16.898  -4.436  1.00 57.23 ? 73  LEU B CB  1 
ATOM   2050 C CG  . LEU B 1 74  ? 9.015   17.041  -5.828  1.00 56.12 ? 73  LEU B CG  1 
ATOM   2051 C CD1 . LEU B 1 74  ? 10.523  16.843  -5.751  1.00 64.49 ? 73  LEU B CD1 1 
ATOM   2052 C CD2 . LEU B 1 74  ? 8.399   16.078  -6.832  1.00 54.98 ? 73  LEU B CD2 1 
ATOM   2053 N N   . LEU B 1 75  ? 5.365   16.167  -5.862  1.00 55.26 ? 74  LEU B N   1 
ATOM   2054 C CA  . LEU B 1 75  ? 4.439   15.153  -6.351  1.00 55.44 ? 74  LEU B CA  1 
ATOM   2055 C C   . LEU B 1 75  ? 5.143   14.212  -7.322  1.00 56.29 ? 74  LEU B C   1 
ATOM   2056 O O   . LEU B 1 75  ? 5.176   13.000  -7.116  1.00 63.10 ? 74  LEU B O   1 
ATOM   2057 C CB  . LEU B 1 75  ? 3.247   15.821  -7.035  1.00 53.23 ? 74  LEU B CB  1 
ATOM   2058 C CG  . LEU B 1 75  ? 1.859   15.324  -6.641  1.00 59.47 ? 74  LEU B CG  1 
ATOM   2059 C CD1 . LEU B 1 75  ? 0.835   15.782  -7.668  1.00 60.22 ? 74  LEU B CD1 1 
ATOM   2060 C CD2 . LEU B 1 75  ? 1.843   13.815  -6.507  1.00 55.70 ? 74  LEU B CD2 1 
ATOM   2061 N N   . TYR B 1 76  ? 5.688   14.785  -8.390  1.00 56.70 ? 75  TYR B N   1 
ATOM   2062 C CA  . TYR B 1 76  ? 6.594   14.076  -9.290  1.00 56.37 ? 75  TYR B CA  1 
ATOM   2063 C C   . TYR B 1 76  ? 7.240   15.053  -10.264 1.00 53.61 ? 75  TYR B C   1 
ATOM   2064 O O   . TYR B 1 76  ? 6.729   16.152  -10.478 1.00 54.02 ? 75  TYR B O   1 
ATOM   2065 C CB  . TYR B 1 76  ? 5.890   12.935  -10.045 1.00 55.90 ? 75  TYR B CB  1 
ATOM   2066 C CG  . TYR B 1 76  ? 4.566   13.289  -10.700 1.00 54.36 ? 75  TYR B CG  1 
ATOM   2067 C CD1 . TYR B 1 76  ? 3.362   12.886  -10.133 1.00 53.45 ? 75  TYR B CD1 1 
ATOM   2068 C CD2 . TYR B 1 76  ? 4.518   14.002  -11.894 1.00 52.86 ? 75  TYR B CD2 1 
ATOM   2069 C CE1 . TYR B 1 76  ? 2.145   13.193  -10.726 1.00 53.24 ? 75  TYR B CE1 1 
ATOM   2070 C CE2 . TYR B 1 76  ? 3.302   14.316  -12.496 1.00 49.31 ? 75  TYR B CE2 1 
ATOM   2071 C CZ  . TYR B 1 76  ? 2.119   13.908  -11.906 1.00 54.40 ? 75  TYR B CZ  1 
ATOM   2072 O OH  . TYR B 1 76  ? 0.908   14.215  -12.494 1.00 54.34 ? 75  TYR B OH  1 
ATOM   2073 N N   . TYR B 1 77  ? 8.376   14.663  -10.832 1.00 51.12 ? 76  TYR B N   1 
ATOM   2074 C CA  . TYR B 1 77  ? 8.996   15.454  -11.886 1.00 49.54 ? 76  TYR B CA  1 
ATOM   2075 C C   . TYR B 1 77  ? 8.390   15.057  -13.227 1.00 49.94 ? 76  TYR B C   1 
ATOM   2076 O O   . TYR B 1 77  ? 7.743   14.015  -13.342 1.00 52.79 ? 76  TYR B O   1 
ATOM   2077 C CB  . TYR B 1 77  ? 10.510  15.241  -11.917 1.00 49.23 ? 76  TYR B CB  1 
ATOM   2078 C CG  . TYR B 1 77  ? 11.263  15.887  -10.776 1.00 53.96 ? 76  TYR B CG  1 
ATOM   2079 C CD1 . TYR B 1 77  ? 11.541  15.179  -9.614  1.00 51.56 ? 76  TYR B CD1 1 
ATOM   2080 C CD2 . TYR B 1 77  ? 11.707  17.202  -10.865 1.00 54.22 ? 76  TYR B CD2 1 
ATOM   2081 C CE1 . TYR B 1 77  ? 12.234  15.762  -8.571  1.00 54.90 ? 76  TYR B CE1 1 
ATOM   2082 C CE2 . TYR B 1 77  ? 12.403  17.794  -9.825  1.00 55.67 ? 76  TYR B CE2 1 
ATOM   2083 C CZ  . TYR B 1 77  ? 12.663  17.067  -8.680  1.00 55.92 ? 76  TYR B CZ  1 
ATOM   2084 O OH  . TYR B 1 77  ? 13.353  17.642  -7.635  1.00 62.26 ? 76  TYR B OH  1 
ATOM   2085 N N   . ALA B 1 78  ? 8.593   15.897  -14.235 1.00 43.10 ? 77  ALA B N   1 
ATOM   2086 C CA  . ALA B 1 78  ? 8.131   15.612  -15.584 1.00 37.36 ? 77  ALA B CA  1 
ATOM   2087 C C   . ALA B 1 78  ? 9.209   16.023  -16.569 1.00 37.36 ? 77  ALA B C   1 
ATOM   2088 O O   . ALA B 1 78  ? 9.911   17.010  -16.352 1.00 40.56 ? 77  ALA B O   1 
ATOM   2089 C CB  . ALA B 1 78  ? 6.833   16.348  -15.874 1.00 44.33 ? 77  ALA B CB  1 
ATOM   2090 N N   . GLY B 1 79  ? 9.349   15.262  -17.648 1.00 37.53 ? 78  GLY B N   1 
ATOM   2091 C CA  . GLY B 1 79  ? 10.389  15.530  -18.621 1.00 34.24 ? 78  GLY B CA  1 
ATOM   2092 C C   . GLY B 1 79  ? 9.913   15.419  -20.054 1.00 36.62 ? 78  GLY B C   1 
ATOM   2093 O O   . GLY B 1 79  ? 8.711   15.359  -20.322 1.00 31.89 ? 78  GLY B O   1 
ATOM   2094 N N   . GLY B 1 80  ? 10.868  15.389  -20.978 1.00 33.19 ? 79  GLY B N   1 
ATOM   2095 C CA  . GLY B 1 80  ? 10.572  15.306  -22.397 1.00 35.04 ? 79  GLY B CA  1 
ATOM   2096 C C   . GLY B 1 80  ? 9.504   14.285  -22.739 1.00 31.97 ? 79  GLY B C   1 
ATOM   2097 O O   . GLY B 1 80  ? 9.606   13.117  -22.371 1.00 30.52 ? 79  GLY B O   1 
ATOM   2098 N N   . ASN B 1 81  ? 8.468   14.741  -23.436 1.00 31.57 ? 80  ASN B N   1 
ATOM   2099 C CA  . ASN B 1 81  ? 7.373   13.878  -23.878 1.00 30.07 ? 80  ASN B CA  1 
ATOM   2100 C C   . ASN B 1 81  ? 6.376   13.461  -22.793 1.00 30.64 ? 80  ASN B C   1 
ATOM   2101 O O   . ASN B 1 81  ? 5.490   12.648  -23.046 1.00 29.44 ? 80  ASN B O   1 
ATOM   2102 C CB  . ASN B 1 81  ? 7.917   12.648  -24.614 1.00 30.10 ? 80  ASN B CB  1 
ATOM   2103 C CG  . ASN B 1 81  ? 8.576   13.008  -25.918 1.00 31.03 ? 80  ASN B CG  1 
ATOM   2104 O OD1 . ASN B 1 81  ? 8.036   13.784  -26.703 1.00 29.30 ? 80  ASN B OD1 1 
ATOM   2105 N ND2 . ASN B 1 81  ? 9.759   12.459  -26.156 1.00 33.55 ? 80  ASN B ND2 1 
ATOM   2106 N N   . SER B 1 82  ? 6.519   14.016  -21.594 1.00 31.67 ? 81  SER B N   1 
ATOM   2107 C CA  . SER B 1 82  ? 5.565   13.758  -20.518 1.00 29.98 ? 81  SER B CA  1 
ATOM   2108 C C   . SER B 1 82  ? 4.236   14.452  -20.808 1.00 27.14 ? 81  SER B C   1 
ATOM   2109 O O   . SER B 1 82  ? 4.190   15.465  -21.505 1.00 25.41 ? 81  SER B O   1 
ATOM   2110 C CB  . SER B 1 82  ? 6.117   14.250  -19.175 1.00 32.10 ? 81  SER B CB  1 
ATOM   2111 O OG  . SER B 1 82  ? 7.234   13.486  -18.759 1.00 36.31 ? 81  SER B OG  1 
ATOM   2112 N N   . LEU B 1 83  ? 3.157   13.899  -20.275 1.00 26.94 ? 82  LEU B N   1 
ATOM   2113 C CA  . LEU B 1 83  ? 1.852   14.524  -20.392 1.00 27.54 ? 82  LEU B CA  1 
ATOM   2114 C C   . LEU B 1 83  ? 1.328   14.793  -18.995 1.00 31.52 ? 82  LEU B C   1 
ATOM   2115 O O   . LEU B 1 83  ? 1.085   13.865  -18.227 1.00 27.15 ? 82  LEU B O   1 
ATOM   2116 C CB  . LEU B 1 83  ? 0.878   13.625  -21.160 1.00 31.69 ? 82  LEU B CB  1 
ATOM   2117 C CG  . LEU B 1 83  ? -0.526  14.195  -21.398 1.00 28.37 ? 82  LEU B CG  1 
ATOM   2118 C CD1 . LEU B 1 83  ? -0.448  15.489  -22.177 1.00 28.62 ? 82  LEU B CD1 1 
ATOM   2119 C CD2 . LEU B 1 83  ? -1.409  13.192  -22.126 1.00 27.78 ? 82  LEU B CD2 1 
ATOM   2120 N N   . ILE B 1 84  ? 1.175   16.068  -18.657 1.00 28.51 ? 83  ILE B N   1 
ATOM   2121 C CA  . ILE B 1 84  ? 0.615   16.426  -17.360 1.00 28.33 ? 83  ILE B CA  1 
ATOM   2122 C C   . ILE B 1 84  ? -0.647  17.266  -17.535 1.00 30.52 ? 83  ILE B C   1 
ATOM   2123 O O   . ILE B 1 84  ? -1.216  17.321  -18.629 1.00 26.79 ? 83  ILE B O   1 
ATOM   2124 C CB  . ILE B 1 84  ? 1.655   17.121  -16.449 1.00 28.89 ? 83  ILE B CB  1 
ATOM   2125 C CG1 . ILE B 1 84  ? 2.198   18.397  -17.094 1.00 28.42 ? 83  ILE B CG1 1 
ATOM   2126 C CG2 . ILE B 1 84  ? 2.802   16.178  -16.155 1.00 29.15 ? 83  ILE B CG2 1 
ATOM   2127 C CD1 . ILE B 1 84  ? 3.200   19.141  -16.211 1.00 31.97 ? 83  ILE B CD1 1 
ATOM   2128 N N   . GLY B 1 85  ? -1.102  17.889  -16.454 1.00 28.48 ? 84  GLY B N   1 
ATOM   2129 C CA  . GLY B 1 85  ? -2.314  18.680  -16.499 1.00 30.24 ? 84  GLY B CA  1 
ATOM   2130 C C   . GLY B 1 85  ? -3.563  17.828  -16.387 1.00 32.50 ? 84  GLY B C   1 
ATOM   2131 O O   . GLY B 1 85  ? -3.506  16.692  -15.921 1.00 32.68 ? 84  GLY B O   1 
ATOM   2132 N N   . LYS B 1 86  ? -4.695  18.378  -16.819 1.00 30.47 ? 85  LYS B N   1 
ATOM   2133 C CA  . LYS B 1 86  ? -5.985  17.708  -16.657 1.00 33.81 ? 85  LYS B CA  1 
ATOM   2134 C C   . LYS B 1 86  ? -7.087  18.466  -17.388 1.00 29.55 ? 85  LYS B C   1 
ATOM   2135 O O   . LYS B 1 86  ? -6.875  19.588  -17.836 1.00 26.91 ? 85  LYS B O   1 
ATOM   2136 C CB  . LYS B 1 86  ? -6.322  17.583  -15.170 1.00 35.36 ? 85  LYS B CB  1 
ATOM   2137 C CG  . LYS B 1 86  ? -6.634  18.902  -14.479 1.00 36.66 ? 85  LYS B CG  1 
ATOM   2138 C CD  . LYS B 1 86  ? -6.295  18.833  -12.991 1.00 45.27 ? 85  LYS B CD  1 
ATOM   2139 C CE  . LYS B 1 86  ? -7.438  19.346  -12.117 1.00 44.90 ? 85  LYS B CE  1 
ATOM   2140 N NZ  . LYS B 1 86  ? -7.997  20.643  -12.584 1.00 40.60 ? 85  LYS B NZ  1 
ATOM   2141 N N   . LEU B 1 87  ? -8.263  17.853  -17.504 1.00 30.90 ? 86  LEU B N   1 
ATOM   2142 C CA  . LEU B 1 87  ? -9.385  18.479  -18.200 1.00 32.04 ? 86  LEU B CA  1 
ATOM   2143 C C   . LEU B 1 87  ? -10.485 18.929  -17.234 1.00 36.86 ? 86  LEU B C   1 
ATOM   2144 O O   . LEU B 1 87  ? -11.277 19.817  -17.550 1.00 34.00 ? 86  LEU B O   1 
ATOM   2145 C CB  . LEU B 1 87  ? -9.980  17.524  -19.244 1.00 28.05 ? 86  LEU B CB  1 
ATOM   2146 C CG  . LEU B 1 87  ? -9.064  17.056  -20.377 1.00 33.55 ? 86  LEU B CG  1 
ATOM   2147 C CD1 . LEU B 1 87  ? -9.765  16.015  -21.230 1.00 28.65 ? 86  LEU B CD1 1 
ATOM   2148 C CD2 . LEU B 1 87  ? -8.603  18.225  -21.234 1.00 22.85 ? 86  LEU B CD2 1 
ATOM   2149 N N   . TYR B 1 88  ? -10.524 18.308  -16.059 1.00 34.13 ? 87  TYR B N   1 
ATOM   2150 C CA  . TYR B 1 88  ? -11.583 18.546  -15.087 1.00 37.04 ? 87  TYR B CA  1 
ATOM   2151 C C   . TYR B 1 88  ? -10.993 18.646  -13.679 1.00 41.16 ? 87  TYR B C   1 
ATOM   2152 O O   . TYR B 1 88  ? -9.853  18.244  -13.453 1.00 44.79 ? 87  TYR B O   1 
ATOM   2153 C CB  . TYR B 1 88  ? -12.615 17.416  -15.173 1.00 35.63 ? 87  TYR B CB  1 
ATOM   2154 C CG  . TYR B 1 88  ? -12.862 16.947  -16.590 1.00 34.74 ? 87  TYR B CG  1 
ATOM   2155 C CD1 . TYR B 1 88  ? -12.276 15.775  -17.071 1.00 32.08 ? 87  TYR B CD1 1 
ATOM   2156 C CD2 . TYR B 1 88  ? -13.660 17.685  -17.459 1.00 35.70 ? 87  TYR B CD2 1 
ATOM   2157 C CE1 . TYR B 1 88  ? -12.496 15.344  -18.377 1.00 32.02 ? 87  TYR B CE1 1 
ATOM   2158 C CE2 . TYR B 1 88  ? -13.882 17.266  -18.766 1.00 33.53 ? 87  TYR B CE2 1 
ATOM   2159 C CZ  . TYR B 1 88  ? -13.298 16.099  -19.220 1.00 38.98 ? 87  TYR B CZ  1 
ATOM   2160 O OH  . TYR B 1 88  ? -13.517 15.687  -20.520 1.00 37.90 ? 87  TYR B OH  1 
ATOM   2161 N N   . PRO B 1 89  ? -11.765 19.196  -12.727 1.00 45.18 ? 88  PRO B N   1 
ATOM   2162 C CA  . PRO B 1 89  ? -11.285 19.350  -11.346 1.00 49.48 ? 88  PRO B CA  1 
ATOM   2163 C C   . PRO B 1 89  ? -10.985 18.012  -10.667 1.00 50.92 ? 88  PRO B C   1 
ATOM   2164 O O   . PRO B 1 89  ? -11.685 17.025  -10.909 1.00 49.49 ? 88  PRO B O   1 
ATOM   2165 C CB  . PRO B 1 89  ? -12.458 20.040  -10.640 1.00 47.94 ? 88  PRO B CB  1 
ATOM   2166 C CG  . PRO B 1 89  ? -13.236 20.694  -11.733 1.00 47.92 ? 88  PRO B CG  1 
ATOM   2167 C CD  . PRO B 1 89  ? -13.095 19.797  -12.922 1.00 43.41 ? 88  PRO B CD  1 
ATOM   2168 N N   . THR B 1 90  ? -9.955  17.984  -9.824  1.00 51.94 ? 89  THR B N   1 
ATOM   2169 C CA  . THR B 1 90  ? -9.588  16.760  -9.109  1.00 55.07 ? 89  THR B CA  1 
ATOM   2170 C C   . THR B 1 90  ? -9.537  16.944  -7.592  1.00 60.34 ? 89  THR B C   1 
ATOM   2171 O O   . THR B 1 90  ? -9.634  15.972  -6.842  1.00 65.35 ? 89  THR B O   1 
ATOM   2172 C CB  . THR B 1 90  ? -8.230  16.192  -9.584  1.00 53.46 ? 89  THR B CB  1 
ATOM   2173 O OG1 . THR B 1 90  ? -7.188  17.144  -9.332  1.00 55.62 ? 89  THR B OG1 1 
ATOM   2174 C CG2 . THR B 1 90  ? -8.270  15.865  -11.072 1.00 47.94 ? 89  THR B CG2 1 
ATOM   2175 N N   . GLY B 1 91  ? -9.383  18.185  -7.141  1.00 58.23 ? 90  GLY B N   1 
ATOM   2176 C CA  . GLY B 1 91  ? -9.284  18.462  -5.718  1.00 60.73 ? 90  GLY B CA  1 
ATOM   2177 C C   . GLY B 1 91  ? -7.850  18.445  -5.221  1.00 66.04 ? 90  GLY B C   1 
ATOM   2178 O O   . GLY B 1 91  ? -7.592  18.567  -4.021  1.00 63.29 ? 90  GLY B O   1 
ATOM   2179 N N   . ASN B 1 92  ? -6.915  18.273  -6.150  1.00 59.36 ? 91  ASN B N   1 
ATOM   2180 C CA  . ASN B 1 92  ? -5.496  18.424  -5.859  1.00 56.27 ? 91  ASN B CA  1 
ATOM   2181 C C   . ASN B 1 92  ? -5.056  19.817  -6.273  1.00 54.89 ? 91  ASN B C   1 
ATOM   2182 O O   . ASN B 1 92  ? -5.266  20.218  -7.415  1.00 58.79 ? 91  ASN B O   1 
ATOM   2183 C CB  . ASN B 1 92  ? -4.666  17.395  -6.633  1.00 51.01 ? 91  ASN B CB  1 
ATOM   2184 C CG  . ASN B 1 92  ? -4.546  16.059  -5.909  1.00 53.60 ? 91  ASN B CG  1 
ATOM   2185 O OD1 . ASN B 1 92  ? -5.091  15.868  -4.821  1.00 54.38 ? 91  ASN B OD1 1 
ATOM   2186 N ND2 . ASN B 1 92  ? -3.824  15.126  -6.519  1.00 48.79 ? 91  ASN B ND2 1 
ATOM   2187 N N   . ASN B 1 93  ? -4.456  20.567  -5.357  1.00 54.91 ? 92  ASN B N   1 
ATOM   2188 C CA  . ASN B 1 93  ? -3.867  21.838  -5.749  1.00 52.84 ? 92  ASN B CA  1 
ATOM   2189 C C   . ASN B 1 93  ? -2.427  21.662  -6.212  1.00 55.15 ? 92  ASN B C   1 
ATOM   2190 O O   . ASN B 1 93  ? -1.569  21.187  -5.465  1.00 52.92 ? 92  ASN B O   1 
ATOM   2191 C CB  . ASN B 1 93  ? -3.949  22.883  -4.643  1.00 50.43 ? 92  ASN B CB  1 
ATOM   2192 C CG  . ASN B 1 93  ? -3.652  24.279  -5.155  1.00 57.85 ? 92  ASN B CG  1 
ATOM   2193 O OD1 . ASN B 1 93  ? -4.265  24.738  -6.119  1.00 60.06 ? 92  ASN B OD1 1 
ATOM   2194 N ND2 . ASN B 1 93  ? -2.701  24.956  -4.521  1.00 56.65 ? 92  ASN B ND2 1 
ATOM   2195 N N   . ILE B 1 94  ? -2.174  22.057  -7.453  1.00 48.57 ? 93  ILE B N   1 
ATOM   2196 C CA  . ILE B 1 94  ? -0.877  21.845  -8.071  1.00 45.90 ? 93  ILE B CA  1 
ATOM   2197 C C   . ILE B 1 94  ? -0.123  23.147  -8.307  1.00 48.01 ? 93  ILE B C   1 
ATOM   2198 O O   . ILE B 1 94  ? -0.689  24.135  -8.779  1.00 46.41 ? 93  ILE B O   1 
ATOM   2199 C CB  . ILE B 1 94  ? -1.018  21.116  -9.412  1.00 39.79 ? 93  ILE B CB  1 
ATOM   2200 C CG1 . ILE B 1 94  ? -1.564  19.701  -9.195  1.00 46.14 ? 93  ILE B CG1 1 
ATOM   2201 C CG2 . ILE B 1 94  ? 0.315   21.098  -10.146 1.00 40.55 ? 93  ILE B CG2 1 
ATOM   2202 C CD1 . ILE B 1 94  ? -0.714  18.852  -8.272  1.00 48.25 ? 93  ILE B CD1 1 
ATOM   2203 N N   . TYR B 1 95  ? 1.162   23.130  -7.973  1.00 41.29 ? 94  TYR B N   1 
ATOM   2204 C CA  . TYR B 1 95  ? 2.064   24.229  -8.269  1.00 41.59 ? 94  TYR B CA  1 
ATOM   2205 C C   . TYR B 1 95  ? 3.233   23.646  -9.055  1.00 41.77 ? 94  TYR B C   1 
ATOM   2206 O O   . TYR B 1 95  ? 4.048   22.904  -8.506  1.00 44.65 ? 94  TYR B O   1 
ATOM   2207 C CB  . TYR B 1 95  ? 2.538   24.890  -6.970  1.00 45.17 ? 94  TYR B CB  1 
ATOM   2208 C CG  . TYR B 1 95  ? 3.529   26.024  -7.152  1.00 44.83 ? 94  TYR B CG  1 
ATOM   2209 C CD1 . TYR B 1 95  ? 4.751   26.020  -6.487  1.00 45.84 ? 94  TYR B CD1 1 
ATOM   2210 C CD2 . TYR B 1 95  ? 3.245   27.096  -7.988  1.00 45.90 ? 94  TYR B CD2 1 
ATOM   2211 C CE1 . TYR B 1 95  ? 5.660   27.058  -6.644  1.00 42.37 ? 94  TYR B CE1 1 
ATOM   2212 C CE2 . TYR B 1 95  ? 4.146   28.137  -8.155  1.00 47.08 ? 94  TYR B CE2 1 
ATOM   2213 C CZ  . TYR B 1 95  ? 5.351   28.114  -7.481  1.00 48.47 ? 94  TYR B CZ  1 
ATOM   2214 O OH  . TYR B 1 95  ? 6.247   29.147  -7.651  1.00 45.33 ? 94  TYR B OH  1 
ATOM   2215 N N   . ALA B 1 96  ? 3.297   23.956  -10.345 1.00 38.42 ? 95  ALA B N   1 
ATOM   2216 C CA  . ALA B 1 96  ? 4.316   23.376  -11.215 1.00 34.74 ? 95  ALA B CA  1 
ATOM   2217 C C   . ALA B 1 96  ? 5.344   24.405  -11.682 1.00 38.19 ? 95  ALA B C   1 
ATOM   2218 O O   . ALA B 1 96  ? 4.997   25.524  -12.069 1.00 38.40 ? 95  ALA B O   1 
ATOM   2219 C CB  . ALA B 1 96  ? 3.663   22.690  -12.413 1.00 35.13 ? 95  ALA B CB  1 
ATOM   2220 N N   . THR B 1 97  ? 6.611   24.005  -11.663 1.00 34.44 ? 96  THR B N   1 
ATOM   2221 C CA  . THR B 1 97  ? 7.712   24.917  -11.942 1.00 37.36 ? 96  THR B CA  1 
ATOM   2222 C C   . THR B 1 97  ? 8.685   24.380  -12.992 1.00 36.65 ? 96  THR B C   1 
ATOM   2223 O O   . THR B 1 97  ? 9.120   23.230  -12.925 1.00 40.14 ? 96  THR B O   1 
ATOM   2224 C CB  . THR B 1 97  ? 8.496   25.237  -10.646 1.00 40.04 ? 96  THR B CB  1 
ATOM   2225 O OG1 . THR B 1 97  ? 7.734   26.149  -9.845  1.00 48.76 ? 96  THR B OG1 1 
ATOM   2226 C CG2 . THR B 1 97  ? 9.847   25.857  -10.972 1.00 41.96 ? 96  THR B CG2 1 
ATOM   2227 N N   . ALA B 1 98  ? 9.027   25.222  -13.960 1.00 33.97 ? 97  ALA B N   1 
ATOM   2228 C CA  . ALA B 1 98  ? 9.992   24.850  -14.987 1.00 39.37 ? 97  ALA B CA  1 
ATOM   2229 C C   . ALA B 1 98  ? 11.418  24.889  -14.438 1.00 37.12 ? 97  ALA B C   1 
ATOM   2230 O O   . ALA B 1 98  ? 11.886  25.931  -13.984 1.00 36.85 ? 97  ALA B O   1 
ATOM   2231 C CB  . ALA B 1 98  ? 9.860   25.761  -16.193 1.00 29.06 ? 97  ALA B CB  1 
ATOM   2232 N N   . MET B 1 99  ? 12.102  23.750  -14.490 1.00 42.02 ? 98  MET B N   1 
ATOM   2233 C CA  . MET B 1 99  ? 13.468  23.634  -13.973 1.00 42.55 ? 98  MET B CA  1 
ATOM   2234 C C   . MET B 1 99  ? 14.509  24.149  -14.965 1.00 39.04 ? 98  MET B C   1 
ATOM   2235 O O   . MET B 1 99  ? 15.682  24.313  -14.625 1.00 46.45 ? 98  MET B O   1 
ATOM   2236 C CB  . MET B 1 99  ? 13.781  22.178  -13.623 1.00 42.32 ? 98  MET B CB  1 
ATOM   2237 C CG  . MET B 1 99  ? 12.765  21.506  -12.703 1.00 46.94 ? 98  MET B CG  1 
ATOM   2238 S SD  . MET B 1 99  ? 12.559  22.355  -11.125 1.00 61.39 ? 98  MET B SD  1 
ATOM   2239 C CE  . MET B 1 99  ? 14.257  22.790  -10.745 1.00 58.59 ? 98  MET B CE  1 
ATOM   2240 N N   . GLU B 1 100 ? 14.068  24.403  -16.192 1.00 39.20 ? 99  GLU B N   1 
ATOM   2241 C CA  . GLU B 1 100 ? 14.957  24.810  -17.272 1.00 39.52 ? 99  GLU B CA  1 
ATOM   2242 C C   . GLU B 1 100 ? 14.101  25.384  -18.385 1.00 37.36 ? 99  GLU B C   1 
ATOM   2243 O O   . GLU B 1 100 ? 12.886  25.223  -18.364 1.00 38.35 ? 99  GLU B O   1 
ATOM   2244 C CB  . GLU B 1 100 ? 15.723  23.597  -17.795 1.00 41.46 ? 99  GLU B CB  1 
ATOM   2245 C CG  . GLU B 1 100 ? 14.807  22.458  -18.237 1.00 39.86 ? 99  GLU B CG  1 
ATOM   2246 C CD  . GLU B 1 100 ? 15.571  21.255  -18.742 1.00 44.99 ? 99  GLU B CD  1 
ATOM   2247 O OE1 . GLU B 1 100 ? 16.356  21.407  -19.702 1.00 43.93 ? 99  GLU B OE1 1 
ATOM   2248 O OE2 . GLU B 1 100 ? 15.381  20.157  -18.181 1.00 51.04 ? 99  GLU B OE2 1 
ATOM   2249 N N   . PRO B 1 101 ? 14.721  26.060  -19.362 1.00 34.91 ? 100 PRO B N   1 
ATOM   2250 C CA  . PRO B 1 101 ? 13.893  26.503  -20.487 1.00 34.16 ? 100 PRO B CA  1 
ATOM   2251 C C   . PRO B 1 101 ? 13.021  25.337  -20.955 1.00 39.05 ? 100 PRO B C   1 
ATOM   2252 O O   . PRO B 1 101 ? 13.532  24.246  -21.200 1.00 36.76 ? 100 PRO B O   1 
ATOM   2253 C CB  . PRO B 1 101 ? 14.923  26.878  -21.556 1.00 37.05 ? 100 PRO B CB  1 
ATOM   2254 C CG  . PRO B 1 101 ? 16.154  27.237  -20.782 1.00 42.48 ? 100 PRO B CG  1 
ATOM   2255 C CD  . PRO B 1 101 ? 16.152  26.356  -19.562 1.00 39.35 ? 100 PRO B CD  1 
ATOM   2256 N N   . THR B 1 102 ? 11.717  25.558  -21.051 1.00 34.21 ? 101 THR B N   1 
ATOM   2257 C CA  . THR B 1 102 ? 10.796  24.466  -21.335 1.00 32.79 ? 101 THR B CA  1 
ATOM   2258 C C   . THR B 1 102 ? 9.740   24.878  -22.342 1.00 32.36 ? 101 THR B C   1 
ATOM   2259 O O   . THR B 1 102 ? 9.134   25.941  -22.215 1.00 33.00 ? 101 THR B O   1 
ATOM   2260 C CB  . THR B 1 102 ? 10.095  23.985  -20.054 1.00 34.93 ? 101 THR B CB  1 
ATOM   2261 O OG1 . THR B 1 102 ? 11.059  23.399  -19.171 1.00 34.76 ? 101 THR B OG1 1 
ATOM   2262 C CG2 . THR B 1 102 ? 9.016   22.951  -20.380 1.00 31.82 ? 101 THR B CG2 1 
ATOM   2263 N N   . ARG B 1 103 ? 9.526   24.030  -23.344 1.00 31.82 ? 102 ARG B N   1 
ATOM   2264 C CA  . ARG B 1 103 ? 8.450   24.236  -24.307 1.00 31.26 ? 102 ARG B CA  1 
ATOM   2265 C C   . ARG B 1 103 ? 7.298   23.261  -24.060 1.00 27.09 ? 102 ARG B C   1 
ATOM   2266 O O   . ARG B 1 103 ? 7.505   22.050  -23.952 1.00 27.51 ? 102 ARG B O   1 
ATOM   2267 C CB  . ARG B 1 103 ? 8.966   24.097  -25.741 1.00 33.74 ? 102 ARG B CB  1 
ATOM   2268 C CG  . ARG B 1 103 ? 7.866   24.146  -26.786 1.00 35.18 ? 102 ARG B CG  1 
ATOM   2269 C CD  . ARG B 1 103 ? 8.398   24.592  -28.133 1.00 35.64 ? 102 ARG B CD  1 
ATOM   2270 N NE  . ARG B 1 103 ? 8.955   25.938  -28.059 1.00 43.34 ? 102 ARG B NE  1 
ATOM   2271 C CZ  . ARG B 1 103 ? 9.588   26.547  -29.056 1.00 47.85 ? 102 ARG B CZ  1 
ATOM   2272 N NH1 . ARG B 1 103 ? 9.753   25.933  -30.221 1.00 45.03 ? 102 ARG B NH1 1 
ATOM   2273 N NH2 . ARG B 1 103 ? 10.063  27.773  -28.887 1.00 39.77 ? 102 ARG B NH2 1 
ATOM   2274 N N   . THR B 1 104 ? 6.086   23.793  -23.965 1.00 28.71 ? 103 THR B N   1 
ATOM   2275 C CA  . THR B 1 104 ? 4.919   22.951  -23.727 1.00 25.32 ? 103 THR B CA  1 
ATOM   2276 C C   . THR B 1 104 ? 3.886   23.149  -24.826 1.00 24.61 ? 103 THR B C   1 
ATOM   2277 O O   . THR B 1 104 ? 3.950   24.113  -25.586 1.00 25.32 ? 103 THR B O   1 
ATOM   2278 C CB  . THR B 1 104 ? 4.281   23.225  -22.332 1.00 25.39 ? 103 THR B CB  1 
ATOM   2279 O OG1 . THR B 1 104 ? 3.693   24.534  -22.307 1.00 22.46 ? 103 THR B OG1 1 
ATOM   2280 C CG2 . THR B 1 104 ? 5.328   23.124  -21.227 1.00 25.17 ? 103 THR B CG2 1 
ATOM   2281 N N   . CYS B 1 105 ? 2.949   22.213  -24.918 1.00 25.46 ? 104 CYS B N   1 
ATOM   2282 C CA  . CYS B 1 105 ? 1.812   22.341  -25.809 1.00 23.39 ? 104 CYS B CA  1 
ATOM   2283 C C   . CYS B 1 105 ? 0.583   22.013  -24.988 1.00 25.10 ? 104 CYS B C   1 
ATOM   2284 O O   . CYS B 1 105 ? 0.477   20.910  -24.452 1.00 25.03 ? 104 CYS B O   1 
ATOM   2285 C CB  . CYS B 1 105 ? 1.921   21.363  -26.981 1.00 22.69 ? 104 CYS B CB  1 
ATOM   2286 S SG  . CYS B 1 105 ? 0.552   21.454  -28.167 1.00 25.57 ? 104 CYS B SG  1 
ATOM   2287 N N   . TRP B 1 106 ? -0.331  22.975  -24.880 1.00 22.11 ? 105 TRP B N   1 
ATOM   2288 C CA  . TRP B 1 106 ? -1.562  22.805  -24.113 1.00 21.71 ? 105 TRP B CA  1 
ATOM   2289 C C   . TRP B 1 106 ? -2.705  22.303  -25.012 1.00 23.19 ? 105 TRP B C   1 
ATOM   2290 O O   . TRP B 1 106 ? -2.948  22.849  -26.091 1.00 24.96 ? 105 TRP B O   1 
ATOM   2291 C CB  . TRP B 1 106 ? -1.938  24.127  -23.420 1.00 26.66 ? 105 TRP B CB  1 
ATOM   2292 C CG  . TRP B 1 106 ? -0.941  24.555  -22.369 1.00 22.19 ? 105 TRP B CG  1 
ATOM   2293 C CD1 . TRP B 1 106 ? 0.414   24.657  -22.518 1.00 25.11 ? 105 TRP B CD1 1 
ATOM   2294 C CD2 . TRP B 1 106 ? -1.219  24.927  -21.008 1.00 23.85 ? 105 TRP B CD2 1 
ATOM   2295 N NE1 . TRP B 1 106 ? 0.996   25.060  -21.339 1.00 23.13 ? 105 TRP B NE1 1 
ATOM   2296 C CE2 . TRP B 1 106 ? 0.015   25.241  -20.400 1.00 24.09 ? 105 TRP B CE2 1 
ATOM   2297 C CE3 . TRP B 1 106 ? -2.391  25.026  -20.250 1.00 22.92 ? 105 TRP B CE3 1 
ATOM   2298 C CZ2 . TRP B 1 106 ? 0.114   25.645  -19.068 1.00 27.13 ? 105 TRP B CZ2 1 
ATOM   2299 C CZ3 . TRP B 1 106 ? -2.292  25.436  -18.924 1.00 26.72 ? 105 TRP B CZ3 1 
ATOM   2300 C CH2 . TRP B 1 106 ? -1.047  25.736  -18.347 1.00 26.13 ? 105 TRP B CH2 1 
ATOM   2301 N N   . PHE B 1 107 ? -3.391  21.258  -24.560 1.00 21.80 ? 106 PHE B N   1 
ATOM   2302 C CA  . PHE B 1 107 ? -4.482  20.647  -25.310 1.00 23.50 ? 106 PHE B CA  1 
ATOM   2303 C C   . PHE B 1 107 ? -5.796  20.738  -24.538 1.00 21.02 ? 106 PHE B C   1 
ATOM   2304 O O   . PHE B 1 107 ? -5.996  20.004  -23.575 1.00 24.11 ? 106 PHE B O   1 
ATOM   2305 C CB  . PHE B 1 107 ? -4.185  19.164  -25.578 1.00 21.67 ? 106 PHE B CB  1 
ATOM   2306 C CG  . PHE B 1 107 ? -3.112  18.921  -26.605 1.00 20.89 ? 106 PHE B CG  1 
ATOM   2307 C CD1 . PHE B 1 107 ? -1.835  18.540  -26.218 1.00 21.87 ? 106 PHE B CD1 1 
ATOM   2308 C CD2 . PHE B 1 107 ? -3.387  19.051  -27.959 1.00 21.47 ? 106 PHE B CD2 1 
ATOM   2309 C CE1 . PHE B 1 107 ? -0.848  18.315  -27.158 1.00 22.60 ? 106 PHE B CE1 1 
ATOM   2310 C CE2 . PHE B 1 107 ? -2.409  18.817  -28.905 1.00 24.42 ? 106 PHE B CE2 1 
ATOM   2311 C CZ  . PHE B 1 107 ? -1.134  18.450  -28.502 1.00 23.98 ? 106 PHE B CZ  1 
ATOM   2312 N N   . SER B 1 108 ? -6.686  21.633  -24.955 1.00 20.59 ? 107 SER B N   1 
ATOM   2313 C CA  . SER B 1 108 ? -8.036  21.673  -24.398 1.00 22.14 ? 107 SER B CA  1 
ATOM   2314 C C   . SER B 1 108 ? -8.807  20.424  -24.816 1.00 23.76 ? 107 SER B C   1 
ATOM   2315 O O   . SER B 1 108 ? -8.322  19.635  -25.628 1.00 23.43 ? 107 SER B O   1 
ATOM   2316 C CB  . SER B 1 108 ? -8.782  22.906  -24.895 1.00 22.78 ? 107 SER B CB  1 
ATOM   2317 O OG  . SER B 1 108 ? -9.005  22.819  -26.289 1.00 17.96 ? 107 SER B OG  1 
ATOM   2318 N N   . GLU B 1 109 ? -10.011 20.246  -24.277 1.00 22.37 ? 108 GLU B N   1 
ATOM   2319 C CA  . GLU B 1 109 ? -10.841 19.111  -24.673 1.00 23.04 ? 108 GLU B CA  1 
ATOM   2320 C C   . GLU B 1 109 ? -11.238 19.238  -26.138 1.00 23.30 ? 108 GLU B C   1 
ATOM   2321 O O   . GLU B 1 109 ? -11.278 18.247  -26.872 1.00 25.27 ? 108 GLU B O   1 
ATOM   2322 C CB  . GLU B 1 109 ? -12.088 18.984  -23.789 1.00 24.69 ? 108 GLU B CB  1 
ATOM   2323 C CG  . GLU B 1 109 ? -12.999 17.828  -24.182 1.00 22.55 ? 108 GLU B CG  1 
ATOM   2324 C CD  . GLU B 1 109 ? -14.373 17.913  -23.538 1.00 31.98 ? 108 GLU B CD  1 
ATOM   2325 O OE1 . GLU B 1 109 ? -14.488 17.646  -22.325 1.00 33.49 ? 108 GLU B OE1 1 
ATOM   2326 O OE2 . GLU B 1 109 ? -15.343 18.241  -24.252 1.00 34.17 ? 108 GLU B OE2 1 
ATOM   2327 N N   . LYS B 1 110 ? -11.523 20.461  -26.567 1.00 24.57 ? 109 LYS B N   1 
ATOM   2328 C CA  . LYS B 1 110 ? -11.865 20.702  -27.963 1.00 23.82 ? 109 LYS B CA  1 
ATOM   2329 C C   . LYS B 1 110 ? -10.729 20.302  -28.912 1.00 24.49 ? 109 LYS B C   1 
ATOM   2330 O O   . LYS B 1 110 ? -10.961 19.644  -29.924 1.00 20.74 ? 109 LYS B O   1 
ATOM   2331 C CB  . LYS B 1 110 ? -12.253 22.164  -28.191 1.00 27.95 ? 109 LYS B CB  1 
ATOM   2332 C CG  . LYS B 1 110 ? -12.618 22.463  -29.635 1.00 31.91 ? 109 LYS B CG  1 
ATOM   2333 C CD  . LYS B 1 110 ? -13.645 21.456  -30.141 1.00 42.78 ? 109 LYS B CD  1 
ATOM   2334 C CE  . LYS B 1 110 ? -13.555 21.265  -31.649 1.00 40.75 ? 109 LYS B CE  1 
ATOM   2335 N NZ  . LYS B 1 110 ? -14.467 20.187  -32.127 1.00 43.37 ? 109 LYS B NZ  1 
ATOM   2336 N N   . SER B 1 111 ? -9.501  20.695  -28.587 1.00 20.34 ? 110 SER B N   1 
ATOM   2337 C CA  . SER B 1 111 ? -8.374  20.361  -29.456 1.00 20.14 ? 110 SER B CA  1 
ATOM   2338 C C   . SER B 1 111 ? -8.080  18.859  -29.461 1.00 21.20 ? 110 SER B C   1 
ATOM   2339 O O   . SER B 1 111 ? -7.618  18.320  -30.466 1.00 19.72 ? 110 SER B O   1 
ATOM   2340 C CB  . SER B 1 111 ? -7.121  21.156  -29.092 1.00 24.24 ? 110 SER B CB  1 
ATOM   2341 O OG  . SER B 1 111 ? -6.586  20.724  -27.870 1.00 23.79 ? 110 SER B OG  1 
ATOM   2342 N N   . LEU B 1 112 ? -8.359  18.178  -28.351 1.00 20.84 ? 111 LEU B N   1 
ATOM   2343 C CA  . LEU B 1 112 ? -8.199  16.723  -28.319 1.00 20.77 ? 111 LEU B CA  1 
ATOM   2344 C C   . LEU B 1 112 ? -9.211  16.011  -29.213 1.00 21.29 ? 111 LEU B C   1 
ATOM   2345 O O   . LEU B 1 112 ? -8.889  14.997  -29.831 1.00 22.30 ? 111 LEU B O   1 
ATOM   2346 C CB  . LEU B 1 112 ? -8.264  16.181  -26.891 1.00 18.78 ? 111 LEU B CB  1 
ATOM   2347 C CG  . LEU B 1 112 ? -7.051  16.498  -26.019 1.00 22.73 ? 111 LEU B CG  1 
ATOM   2348 C CD1 . LEU B 1 112 ? -7.201  15.898  -24.627 1.00 27.53 ? 111 LEU B CD1 1 
ATOM   2349 C CD2 . LEU B 1 112 ? -5.780  15.993  -26.688 1.00 22.65 ? 111 LEU B CD2 1 
ATOM   2350 N N   . ARG B 1 113 ? -10.434 16.532  -29.278 1.00 21.53 ? 112 ARG B N   1 
ATOM   2351 C CA  . ARG B 1 113 ? -11.421 15.983  -30.203 1.00 24.49 ? 112 ARG B CA  1 
ATOM   2352 C C   . ARG B 1 113 ? -10.900 16.097  -31.630 1.00 24.40 ? 112 ARG B C   1 
ATOM   2353 O O   . ARG B 1 113 ? -11.044 15.180  -32.437 1.00 21.80 ? 112 ARG B O   1 
ATOM   2354 C CB  . ARG B 1 113 ? -12.767 16.706  -30.089 1.00 28.18 ? 112 ARG B CB  1 
ATOM   2355 C CG  . ARG B 1 113 ? -13.523 16.444  -28.803 1.00 26.56 ? 112 ARG B CG  1 
ATOM   2356 C CD  . ARG B 1 113 ? -14.879 17.140  -28.808 1.00 31.92 ? 112 ARG B CD  1 
ATOM   2357 N NE  . ARG B 1 113 ? -15.542 17.038  -27.512 1.00 34.44 ? 112 ARG B NE  1 
ATOM   2358 C CZ  . ARG B 1 113 ? -16.466 16.132  -27.209 1.00 33.15 ? 112 ARG B CZ  1 
ATOM   2359 N NH1 . ARG B 1 113 ? -16.856 15.237  -28.109 1.00 27.50 ? 112 ARG B NH1 1 
ATOM   2360 N NH2 . ARG B 1 113 ? -17.004 16.123  -25.999 1.00 34.97 ? 112 ARG B NH2 1 
ATOM   2361 N N   . THR B 1 114 ? -10.299 17.240  -31.938 1.00 23.12 ? 113 THR B N   1 
ATOM   2362 C CA  . THR B 1 114 ? -9.724  17.464  -33.253 1.00 23.04 ? 113 THR B CA  1 
ATOM   2363 C C   . THR B 1 114 ? -8.603  16.461  -33.507 1.00 21.71 ? 113 THR B C   1 
ATOM   2364 O O   . THR B 1 114 ? -8.532  15.861  -34.579 1.00 22.83 ? 113 THR B O   1 
ATOM   2365 C CB  . THR B 1 114 ? -9.186  18.896  -33.384 1.00 24.56 ? 113 THR B CB  1 
ATOM   2366 O OG1 . THR B 1 114 ? -10.225 19.819  -33.036 1.00 21.42 ? 113 THR B OG1 1 
ATOM   2367 C CG2 . THR B 1 114 ? -8.713  19.167  -34.807 1.00 25.28 ? 113 THR B CG2 1 
ATOM   2368 N N   . VAL B 1 115 ? -7.739  16.270  -32.516 1.00 20.91 ? 114 VAL B N   1 
ATOM   2369 C CA  . VAL B 1 115 ? -6.673  15.275  -32.640 1.00 24.18 ? 114 VAL B CA  1 
ATOM   2370 C C   . VAL B 1 115 ? -7.254  13.894  -32.932 1.00 21.07 ? 114 VAL B C   1 
ATOM   2371 O O   . VAL B 1 115 ? -6.840  13.224  -33.877 1.00 23.73 ? 114 VAL B O   1 
ATOM   2372 C CB  . VAL B 1 115 ? -5.808  15.180  -31.370 1.00 21.59 ? 114 VAL B CB  1 
ATOM   2373 C CG1 . VAL B 1 115 ? -4.944  13.906  -31.417 1.00 17.41 ? 114 VAL B CG1 1 
ATOM   2374 C CG2 . VAL B 1 115 ? -4.941  16.427  -31.210 1.00 21.35 ? 114 VAL B CG2 1 
ATOM   2375 N N   . PHE B 1 116 ? -8.223  13.480  -32.120 1.00 19.99 ? 115 PHE B N   1 
ATOM   2376 C CA  . PHE B 1 116 ? -8.803  12.145  -32.236 1.00 21.64 ? 115 PHE B CA  1 
ATOM   2377 C C   . PHE B 1 116 ? -9.509  11.908  -33.574 1.00 21.92 ? 115 PHE B C   1 
ATOM   2378 O O   . PHE B 1 116 ? -9.472  10.804  -34.116 1.00 19.44 ? 115 PHE B O   1 
ATOM   2379 C CB  . PHE B 1 116 ? -9.753  11.854  -31.069 1.00 20.04 ? 115 PHE B CB  1 
ATOM   2380 C CG  . PHE B 1 116 ? -9.091  11.895  -29.716 1.00 24.31 ? 115 PHE B CG  1 
ATOM   2381 C CD1 . PHE B 1 116 ? -7.748  11.571  -29.571 1.00 18.94 ? 115 PHE B CD1 1 
ATOM   2382 C CD2 . PHE B 1 116 ? -9.819  12.241  -28.583 1.00 20.40 ? 115 PHE B CD2 1 
ATOM   2383 C CE1 . PHE B 1 116 ? -7.143  11.596  -28.329 1.00 18.66 ? 115 PHE B CE1 1 
ATOM   2384 C CE2 . PHE B 1 116 ? -9.221  12.274  -27.342 1.00 22.10 ? 115 PHE B CE2 1 
ATOM   2385 C CZ  . PHE B 1 116 ? -7.875  11.951  -27.211 1.00 24.82 ? 115 PHE B CZ  1 
ATOM   2386 N N   . ARG B 1 117 ? -10.151 12.946  -34.101 1.00 23.64 ? 116 ARG B N   1 
ATOM   2387 C CA  . ARG B 1 117 ? -10.851 12.844  -35.380 1.00 22.50 ? 116 ARG B CA  1 
ATOM   2388 C C   . ARG B 1 117 ? -9.879  12.682  -36.545 1.00 22.52 ? 116 ARG B C   1 
ATOM   2389 O O   . ARG B 1 117 ? -10.241 12.153  -37.599 1.00 21.30 ? 116 ARG B O   1 
ATOM   2390 C CB  . ARG B 1 117 ? -11.758 14.061  -35.603 1.00 20.57 ? 116 ARG B CB  1 
ATOM   2391 C CG  . ARG B 1 117 ? -12.814 14.211  -34.525 1.00 24.81 ? 116 ARG B CG  1 
ATOM   2392 C CD  . ARG B 1 117 ? -13.772 15.362  -34.781 1.00 25.13 ? 116 ARG B CD  1 
ATOM   2393 N NE  . ARG B 1 117 ? -14.745 15.479  -33.696 1.00 29.89 ? 116 ARG B NE  1 
ATOM   2394 C CZ  . ARG B 1 117 ? -15.759 16.340  -33.686 1.00 38.19 ? 116 ARG B CZ  1 
ATOM   2395 N NH1 . ARG B 1 117 ? -15.945 17.166  -34.708 1.00 34.58 ? 116 ARG B NH1 1 
ATOM   2396 N NH2 . ARG B 1 117 ? -16.592 16.370  -32.654 1.00 30.87 ? 116 ARG B NH2 1 
ATOM   2397 N N   . THR B 1 118 ? -8.648  13.143  -36.354 1.00 20.45 ? 117 THR B N   1 
ATOM   2398 C CA  . THR B 1 118 ? -7.595  12.941  -37.344 1.00 21.23 ? 117 THR B CA  1 
ATOM   2399 C C   . THR B 1 118 ? -6.943  11.563  -37.224 1.00 17.92 ? 117 THR B C   1 
ATOM   2400 O O   . THR B 1 118 ? -6.531  10.974  -38.223 1.00 21.98 ? 117 THR B O   1 
ATOM   2401 C CB  . THR B 1 118 ? -6.510  14.040  -37.236 1.00 22.85 ? 117 THR B CB  1 
ATOM   2402 O OG1 . THR B 1 118 ? -7.091  15.310  -37.567 1.00 30.45 ? 117 THR B OG1 1 
ATOM   2403 C CG2 . THR B 1 118 ? -5.360  13.753  -38.183 1.00 25.51 ? 117 THR B CG2 1 
ATOM   2404 N N   . ASP B 1 119 ? -6.851  11.056  -35.999 1.00 17.58 ? 118 ASP B N   1 
ATOM   2405 C CA  . ASP B 1 119 ? -6.173  9.789   -35.743 1.00 16.23 ? 118 ASP B CA  1 
ATOM   2406 C C   . ASP B 1 119 ? -6.807  9.096   -34.547 1.00 18.31 ? 118 ASP B C   1 
ATOM   2407 O O   . ASP B 1 119 ? -6.542  9.459   -33.402 1.00 18.15 ? 118 ASP B O   1 
ATOM   2408 C CB  . ASP B 1 119 ? -4.672  10.027  -35.512 1.00 18.01 ? 118 ASP B CB  1 
ATOM   2409 C CG  . ASP B 1 119 ? -3.887  8.742   -35.339 1.00 22.64 ? 118 ASP B CG  1 
ATOM   2410 O OD1 . ASP B 1 119 ? -4.501  7.654   -35.414 1.00 20.73 ? 118 ASP B OD1 1 
ATOM   2411 O OD2 . ASP B 1 119 ? -2.649  8.820   -35.128 1.00 17.09 ? 118 ASP B OD2 1 
ATOM   2412 N N   . GLU B 1 120 ? -7.657  8.107   -34.822 1.00 19.95 ? 119 GLU B N   1 
ATOM   2413 C CA  . GLU B 1 120 ? -8.368  7.363   -33.778 1.00 21.45 ? 119 GLU B CA  1 
ATOM   2414 C C   . GLU B 1 120 ? -7.431  6.660   -32.791 1.00 22.19 ? 119 GLU B C   1 
ATOM   2415 O O   . GLU B 1 120 ? -7.766  6.509   -31.618 1.00 16.80 ? 119 GLU B O   1 
ATOM   2416 C CB  . GLU B 1 120 ? -9.307  6.325   -34.404 1.00 20.33 ? 119 GLU B CB  1 
ATOM   2417 C CG  . GLU B 1 120 ? -10.362 5.783   -33.449 1.00 20.26 ? 119 GLU B CG  1 
ATOM   2418 C CD  . GLU B 1 120 ? -11.241 4.722   -34.084 1.00 23.86 ? 119 GLU B CD  1 
ATOM   2419 O OE1 . GLU B 1 120 ? -10.789 3.566   -34.213 1.00 23.70 ? 119 GLU B OE1 1 
ATOM   2420 O OE2 . GLU B 1 120 ? -12.391 5.040   -34.449 1.00 22.06 ? 119 GLU B OE2 1 
ATOM   2421 N N   . ASP B 1 121 ? -6.271  6.211   -33.268 1.00 18.98 ? 120 ASP B N   1 
ATOM   2422 C CA  . ASP B 1 121 ? -5.342  5.495   -32.399 1.00 19.71 ? 120 ASP B CA  1 
ATOM   2423 C C   . ASP B 1 121 ? -4.802  6.377   -31.278 1.00 19.42 ? 120 ASP B C   1 
ATOM   2424 O O   . ASP B 1 121 ? -4.332  5.870   -30.262 1.00 24.89 ? 120 ASP B O   1 
ATOM   2425 C CB  . ASP B 1 121 ? -4.182  4.893   -33.191 1.00 21.32 ? 120 ASP B CB  1 
ATOM   2426 C CG  . ASP B 1 121 ? -4.553  3.596   -33.867 1.00 25.12 ? 120 ASP B CG  1 
ATOM   2427 O OD1 . ASP B 1 121 ? -5.732  3.193   -33.774 1.00 20.89 ? 120 ASP B OD1 1 
ATOM   2428 O OD2 . ASP B 1 121 ? -3.661  2.973   -34.483 1.00 25.40 ? 120 ASP B OD2 1 
ATOM   2429 N N   . MET B 1 122 ? -4.862  7.692   -31.459 1.00 15.63 ? 121 MET B N   1 
ATOM   2430 C CA  . MET B 1 122 ? -4.371  8.596   -30.428 1.00 20.82 ? 121 MET B CA  1 
ATOM   2431 C C   . MET B 1 122 ? -5.247  8.533   -29.181 1.00 22.72 ? 121 MET B C   1 
ATOM   2432 O O   . MET B 1 122 ? -4.798  8.868   -28.092 1.00 22.49 ? 121 MET B O   1 
ATOM   2433 C CB  . MET B 1 122 ? -4.256  10.039  -30.942 1.00 20.51 ? 121 MET B CB  1 
ATOM   2434 C CG  . MET B 1 122 ? -3.030  10.294  -31.812 1.00 20.92 ? 121 MET B CG  1 
ATOM   2435 S SD  . MET B 1 122 ? -1.490  9.783   -31.014 1.00 24.82 ? 121 MET B SD  1 
ATOM   2436 C CE  . MET B 1 122 ? -1.504  10.856  -29.585 1.00 18.79 ? 121 MET B CE  1 
ATOM   2437 N N   . ILE B 1 123 ? -6.498  8.108   -29.334 1.00 20.76 ? 122 ILE B N   1 
ATOM   2438 C CA  . ILE B 1 123 ? -7.331  7.881   -28.161 1.00 19.91 ? 122 ILE B CA  1 
ATOM   2439 C C   . ILE B 1 123 ? -6.668  6.819   -27.295 1.00 22.74 ? 122 ILE B C   1 
ATOM   2440 O O   . ILE B 1 123 ? -6.530  6.977   -26.083 1.00 18.15 ? 122 ILE B O   1 
ATOM   2441 C CB  . ILE B 1 123 ? -8.731  7.370   -28.533 1.00 23.38 ? 122 ILE B CB  1 
ATOM   2442 C CG1 . ILE B 1 123 ? -9.536  8.442   -29.281 1.00 22.42 ? 122 ILE B CG1 1 
ATOM   2443 C CG2 . ILE B 1 123 ? -9.463  6.900   -27.280 1.00 19.90 ? 122 ILE B CG2 1 
ATOM   2444 C CD1 . ILE B 1 123 ? -10.701 7.874   -30.070 1.00 20.95 ? 122 ILE B CD1 1 
ATOM   2445 N N   . PHE B 1 124 ? -6.257  5.728   -27.934 1.00 20.17 ? 123 PHE B N   1 
ATOM   2446 C CA  . PHE B 1 124 ? -5.699  4.587   -27.222 1.00 21.32 ? 123 PHE B CA  1 
ATOM   2447 C C   . PHE B 1 124 ? -4.256  4.805   -26.756 1.00 24.23 ? 123 PHE B C   1 
ATOM   2448 O O   . PHE B 1 124 ? -3.824  4.198   -25.782 1.00 23.47 ? 123 PHE B O   1 
ATOM   2449 C CB  . PHE B 1 124 ? -5.859  3.317   -28.061 1.00 22.75 ? 123 PHE B CB  1 
ATOM   2450 C CG  . PHE B 1 124 ? -7.293  2.967   -28.330 1.00 25.14 ? 123 PHE B CG  1 
ATOM   2451 C CD1 . PHE B 1 124 ? -7.895  3.311   -29.529 1.00 23.67 ? 123 PHE B CD1 1 
ATOM   2452 C CD2 . PHE B 1 124 ? -8.053  2.344   -27.357 1.00 22.05 ? 123 PHE B CD2 1 
ATOM   2453 C CE1 . PHE B 1 124 ? -9.223  3.004   -29.767 1.00 25.65 ? 123 PHE B CE1 1 
ATOM   2454 C CE2 . PHE B 1 124 ? -9.383  2.042   -27.584 1.00 27.39 ? 123 PHE B CE2 1 
ATOM   2455 C CZ  . PHE B 1 124 ? -9.967  2.370   -28.793 1.00 26.04 ? 123 PHE B CZ  1 
ATOM   2456 N N   . GLU B 1 125 ? -3.523  5.682   -27.438 1.00 19.24 ? 124 GLU B N   1 
ATOM   2457 C CA  . GLU B 1 125 ? -2.192  6.067   -26.977 1.00 23.71 ? 124 GLU B CA  1 
ATOM   2458 C C   . GLU B 1 125 ? -2.302  6.775   -25.628 1.00 24.62 ? 124 GLU B C   1 
ATOM   2459 O O   . GLU B 1 125 ? -1.505  6.536   -24.723 1.00 23.08 ? 124 GLU B O   1 
ATOM   2460 C CB  . GLU B 1 125 ? -1.495  6.987   -27.987 1.00 22.29 ? 124 GLU B CB  1 
ATOM   2461 C CG  . GLU B 1 125 ? -0.935  6.286   -29.212 1.00 25.85 ? 124 GLU B CG  1 
ATOM   2462 C CD  . GLU B 1 125 ? 0.391   5.583   -28.938 1.00 32.50 ? 124 GLU B CD  1 
ATOM   2463 O OE1 . GLU B 1 125 ? 0.745   4.672   -29.713 1.00 27.95 ? 124 GLU B OE1 1 
ATOM   2464 O OE2 . GLU B 1 125 ? 1.076   5.942   -27.954 1.00 33.82 ? 124 GLU B OE2 1 
ATOM   2465 N N   . ILE B 1 126 ? -3.294  7.652   -25.497 1.00 23.14 ? 125 ILE B N   1 
ATOM   2466 C CA  . ILE B 1 126 ? -3.499  8.372   -24.244 1.00 25.19 ? 125 ILE B CA  1 
ATOM   2467 C C   . ILE B 1 126 ? -4.019  7.440   -23.145 1.00 26.13 ? 125 ILE B C   1 
ATOM   2468 O O   . ILE B 1 126 ? -3.658  7.587   -21.979 1.00 27.10 ? 125 ILE B O   1 
ATOM   2469 C CB  . ILE B 1 126 ? -4.421  9.606   -24.433 1.00 26.71 ? 125 ILE B CB  1 
ATOM   2470 C CG1 . ILE B 1 126 ? -3.700  10.666  -25.266 1.00 24.38 ? 125 ILE B CG1 1 
ATOM   2471 C CG2 . ILE B 1 126 ? -4.794  10.214  -23.101 1.00 23.09 ? 125 ILE B CG2 1 
ATOM   2472 C CD1 . ILE B 1 126 ? -4.501  11.927  -25.494 1.00 32.54 ? 125 ILE B CD1 1 
ATOM   2473 N N   . PHE B 1 127 ? -4.845  6.468   -23.527 1.00 25.30 ? 126 PHE B N   1 
ATOM   2474 C CA  . PHE B 1 127 ? -5.395  5.509   -22.570 1.00 28.19 ? 126 PHE B CA  1 
ATOM   2475 C C   . PHE B 1 127 ? -4.281  4.679   -21.969 1.00 26.04 ? 126 PHE B C   1 
ATOM   2476 O O   . PHE B 1 127 ? -4.180  4.532   -20.752 1.00 28.81 ? 126 PHE B O   1 
ATOM   2477 C CB  . PHE B 1 127 ? -6.386  4.572   -23.259 1.00 26.02 ? 126 PHE B CB  1 
ATOM   2478 C CG  . PHE B 1 127 ? -7.780  5.108   -23.333 1.00 30.78 ? 126 PHE B CG  1 
ATOM   2479 C CD1 . PHE B 1 127 ? -8.036  6.448   -23.098 1.00 32.99 ? 126 PHE B CD1 1 
ATOM   2480 C CD2 . PHE B 1 127 ? -8.833  4.276   -23.672 1.00 35.27 ? 126 PHE B CD2 1 
ATOM   2481 C CE1 . PHE B 1 127 ? -9.322  6.944   -23.176 1.00 32.41 ? 126 PHE B CE1 1 
ATOM   2482 C CE2 . PHE B 1 127 ? -10.123 4.766   -23.755 1.00 34.32 ? 126 PHE B CE2 1 
ATOM   2483 C CZ  . PHE B 1 127 ? -10.366 6.103   -23.507 1.00 31.86 ? 126 PHE B CZ  1 
ATOM   2484 N N   . LYS B 1 128 ? -3.457  4.128   -22.849 1.00 23.76 ? 127 LYS B N   1 
ATOM   2485 C CA  . LYS B 1 128 ? -2.328  3.301   -22.459 1.00 30.82 ? 127 LYS B CA  1 
ATOM   2486 C C   . LYS B 1 128 ? -1.446  4.063   -21.476 1.00 28.53 ? 127 LYS B C   1 
ATOM   2487 O O   . LYS B 1 128 ? -1.041  3.534   -20.444 1.00 29.84 ? 127 LYS B O   1 
ATOM   2488 C CB  . LYS B 1 128 ? -1.536  2.920   -23.708 1.00 29.57 ? 127 LYS B CB  1 
ATOM   2489 C CG  . LYS B 1 128 ? -0.270  2.123   -23.464 1.00 37.41 ? 127 LYS B CG  1 
ATOM   2490 C CD  . LYS B 1 128 ? 0.531   2.030   -24.753 1.00 40.08 ? 127 LYS B CD  1 
ATOM   2491 C CE  . LYS B 1 128 ? 1.828   1.269   -24.558 1.00 50.97 ? 127 LYS B CE  1 
ATOM   2492 N NZ  . LYS B 1 128 ? 2.746   1.494   -25.707 1.00 61.51 ? 127 LYS B NZ  1 
ATOM   2493 N N   . ASN B 1 129 ? -1.165  5.318   -21.800 1.00 29.14 ? 128 ASN B N   1 
ATOM   2494 C CA  . ASN B 1 129 ? -0.350  6.153   -20.942 1.00 27.41 ? 128 ASN B CA  1 
ATOM   2495 C C   . ASN B 1 129 ? -0.936  6.221   -19.543 1.00 28.46 ? 128 ASN B C   1 
ATOM   2496 O O   . ASN B 1 129 ? -0.217  6.110   -18.555 1.00 30.85 ? 128 ASN B O   1 
ATOM   2497 C CB  . ASN B 1 129 ? -0.228  7.559   -21.525 1.00 31.49 ? 128 ASN B CB  1 
ATOM   2498 C CG  . ASN B 1 129 ? 0.642   8.464   -20.678 1.00 29.46 ? 128 ASN B CG  1 
ATOM   2499 O OD1 . ASN B 1 129 ? 0.141   9.271   -19.896 1.00 36.24 ? 128 ASN B OD1 1 
ATOM   2500 N ND2 . ASN B 1 129 ? 1.951   8.321   -20.814 1.00 34.10 ? 128 ASN B ND2 1 
ATOM   2501 N N   . TYR B 1 130 ? -2.249  6.393   -19.453 1.00 30.52 ? 129 TYR B N   1 
ATOM   2502 C CA  . TYR B 1 130 ? -2.861  6.558   -18.139 1.00 29.31 ? 129 TYR B CA  1 
ATOM   2503 C C   . TYR B 1 130 ? -3.091  5.246   -17.395 1.00 32.61 ? 129 TYR B C   1 
ATOM   2504 O O   . TYR B 1 130 ? -2.989  5.207   -16.168 1.00 31.62 ? 129 TYR B O   1 
ATOM   2505 C CB  . TYR B 1 130 ? -4.092  7.471   -18.189 1.00 34.15 ? 129 TYR B CB  1 
ATOM   2506 C CG  . TYR B 1 130 ? -3.657  8.916   -18.096 1.00 35.76 ? 129 TYR B CG  1 
ATOM   2507 C CD1 . TYR B 1 130 ? -3.260  9.617   -19.226 1.00 34.05 ? 129 TYR B CD1 1 
ATOM   2508 C CD2 . TYR B 1 130 ? -3.577  9.558   -16.865 1.00 40.33 ? 129 TYR B CD2 1 
ATOM   2509 C CE1 . TYR B 1 130 ? -2.832  10.935  -19.140 1.00 36.21 ? 129 TYR B CE1 1 
ATOM   2510 C CE2 . TYR B 1 130 ? -3.146  10.873  -16.765 1.00 38.89 ? 129 TYR B CE2 1 
ATOM   2511 C CZ  . TYR B 1 130 ? -2.773  11.554  -17.904 1.00 37.31 ? 129 TYR B CZ  1 
ATOM   2512 O OH  . TYR B 1 130 ? -2.341  12.855  -17.795 1.00 36.74 ? 129 TYR B OH  1 
ATOM   2513 N N   . LEU B 1 131 ? -3.359  4.175   -18.138 1.00 30.23 ? 130 LEU B N   1 
ATOM   2514 C CA  . LEU B 1 131 ? -3.382  2.837   -17.561 1.00 28.66 ? 130 LEU B CA  1 
ATOM   2515 C C   . LEU B 1 131 ? -2.024  2.526   -16.944 1.00 29.51 ? 130 LEU B C   1 
ATOM   2516 O O   . LEU B 1 131 ? -1.940  2.035   -15.823 1.00 33.49 ? 130 LEU B O   1 
ATOM   2517 C CB  . LEU B 1 131 ? -3.721  1.787   -18.624 1.00 32.08 ? 130 LEU B CB  1 
ATOM   2518 C CG  . LEU B 1 131 ? -5.195  1.520   -18.927 1.00 38.09 ? 130 LEU B CG  1 
ATOM   2519 C CD1 . LEU B 1 131 ? -5.372  0.987   -20.347 1.00 39.81 ? 130 LEU B CD1 1 
ATOM   2520 C CD2 . LEU B 1 131 ? -5.794  0.558   -17.900 1.00 39.14 ? 130 LEU B CD2 1 
ATOM   2521 N N   . THR B 1 132 ? -0.960  2.807   -17.689 1.00 33.20 ? 131 THR B N   1 
ATOM   2522 C CA  . THR B 1 132 ? 0.394   2.550   -17.212 1.00 29.77 ? 131 THR B CA  1 
ATOM   2523 C C   . THR B 1 132 ? 0.689   3.354   -15.945 1.00 35.98 ? 131 THR B C   1 
ATOM   2524 O O   . THR B 1 132 ? 1.277   2.837   -14.992 1.00 31.71 ? 131 THR B O   1 
ATOM   2525 C CB  . THR B 1 132 ? 1.450   2.886   -18.289 1.00 33.78 ? 131 THR B CB  1 
ATOM   2526 O OG1 . THR B 1 132 ? 1.255   2.045   -19.431 1.00 32.13 ? 131 THR B OG1 1 
ATOM   2527 C CG2 . THR B 1 132 ? 2.854   2.670   -17.744 1.00 32.96 ? 131 THR B CG2 1 
ATOM   2528 N N   . LYS B 1 133 ? 0.263   4.615   -15.936 1.00 29.32 ? 132 LYS B N   1 
ATOM   2529 C CA  . LYS B 1 133 ? 0.458   5.498   -14.788 1.00 28.74 ? 132 LYS B CA  1 
ATOM   2530 C C   . LYS B 1 133 ? -0.245  4.980   -13.544 1.00 31.46 ? 132 LYS B C   1 
ATOM   2531 O O   . LYS B 1 133 ? 0.369   4.850   -12.487 1.00 34.37 ? 132 LYS B O   1 
ATOM   2532 C CB  . LYS B 1 133 ? -0.018  6.917   -15.112 1.00 29.63 ? 132 LYS B CB  1 
ATOM   2533 C CG  . LYS B 1 133 ? 0.962   7.713   -15.955 1.00 31.56 ? 132 LYS B CG  1 
ATOM   2534 C CD  . LYS B 1 133 ? 0.340   8.992   -16.480 1.00 29.85 ? 132 LYS B CD  1 
ATOM   2535 C CE  . LYS B 1 133 ? 1.414   9.992   -16.863 1.00 37.45 ? 132 LYS B CE  1 
ATOM   2536 N NZ  . LYS B 1 133 ? 0.912   11.011  -17.826 1.00 28.63 ? 132 LYS B NZ  1 
ATOM   2537 N N   . VAL B 1 134 ? -1.535  4.690   -13.672 1.00 28.44 ? 133 VAL B N   1 
ATOM   2538 C CA  . VAL B 1 134 ? -2.300  4.118   -12.570 1.00 34.52 ? 133 VAL B CA  1 
ATOM   2539 C C   . VAL B 1 134 ? -1.676  2.820   -12.032 1.00 34.50 ? 133 VAL B C   1 
ATOM   2540 O O   . VAL B 1 134 ? -1.596  2.614   -10.820 1.00 34.22 ? 133 VAL B O   1 
ATOM   2541 C CB  . VAL B 1 134 ? -3.745  3.821   -12.987 1.00 33.69 ? 133 VAL B CB  1 
ATOM   2542 C CG1 . VAL B 1 134 ? -4.458  3.098   -11.875 1.00 34.49 ? 133 VAL B CG1 1 
ATOM   2543 C CG2 . VAL B 1 134 ? -4.473  5.109   -13.350 1.00 35.91 ? 133 VAL B CG2 1 
ATOM   2544 N N   . ALA B 1 135 ? -1.241  1.948   -12.937 1.00 34.91 ? 134 ALA B N   1 
ATOM   2545 C CA  . ALA B 1 135 ? -0.660  0.664   -12.549 1.00 39.19 ? 134 ALA B CA  1 
ATOM   2546 C C   . ALA B 1 135 ? 0.611   0.840   -11.726 1.00 40.17 ? 134 ALA B C   1 
ATOM   2547 O O   . ALA B 1 135 ? 0.863   0.081   -10.790 1.00 39.82 ? 134 ALA B O   1 
ATOM   2548 C CB  . ALA B 1 135 ? -0.388  -0.197  -13.776 1.00 40.09 ? 134 ALA B CB  1 
ATOM   2549 N N   . TYR B 1 136 ? 1.413   1.839   -12.081 1.00 36.79 ? 135 TYR B N   1 
ATOM   2550 C CA  . TYR B 1 136 ? 2.635   2.119   -11.337 1.00 42.78 ? 135 TYR B CA  1 
ATOM   2551 C C   . TYR B 1 136 ? 2.306   2.539   -9.906  1.00 42.48 ? 135 TYR B C   1 
ATOM   2552 O O   . TYR B 1 136 ? 2.760   1.916   -8.948  1.00 43.16 ? 135 TYR B O   1 
ATOM   2553 C CB  . TYR B 1 136 ? 3.468   3.199   -12.032 1.00 42.08 ? 135 TYR B CB  1 
ATOM   2554 C CG  . TYR B 1 136 ? 4.784   3.490   -11.342 1.00 48.45 ? 135 TYR B CG  1 
ATOM   2555 C CD1 . TYR B 1 136 ? 5.825   2.572   -11.381 1.00 51.79 ? 135 TYR B CD1 1 
ATOM   2556 C CD2 . TYR B 1 136 ? 4.987   4.682   -10.654 1.00 47.52 ? 135 TYR B CD2 1 
ATOM   2557 C CE1 . TYR B 1 136 ? 7.028   2.829   -10.757 1.00 53.05 ? 135 TYR B CE1 1 
ATOM   2558 C CE2 . TYR B 1 136 ? 6.191   4.946   -10.024 1.00 50.55 ? 135 TYR B CE2 1 
ATOM   2559 C CZ  . TYR B 1 136 ? 7.206   4.014   -10.081 1.00 53.53 ? 135 TYR B CZ  1 
ATOM   2560 O OH  . TYR B 1 136 ? 8.411   4.258   -9.464  1.00 62.14 ? 135 TYR B OH  1 
ATOM   2561 N N   . TYR B 1 137 ? 1.500   3.587   -9.769  1.00 41.87 ? 136 TYR B N   1 
ATOM   2562 C CA  . TYR B 1 137 ? 1.134   4.106   -8.454  1.00 42.37 ? 136 TYR B CA  1 
ATOM   2563 C C   . TYR B 1 137 ? 0.425   3.076   -7.582  1.00 45.31 ? 136 TYR B C   1 
ATOM   2564 O O   . TYR B 1 137 ? 0.728   2.948   -6.394  1.00 45.59 ? 136 TYR B O   1 
ATOM   2565 C CB  . TYR B 1 137 ? 0.283   5.367   -8.590  1.00 41.27 ? 136 TYR B CB  1 
ATOM   2566 C CG  . TYR B 1 137 ? 1.072   6.556   -9.067  1.00 41.97 ? 136 TYR B CG  1 
ATOM   2567 C CD1 . TYR B 1 137 ? 0.810   7.143   -10.298 1.00 42.89 ? 136 TYR B CD1 1 
ATOM   2568 C CD2 . TYR B 1 137 ? 2.099   7.081   -8.293  1.00 47.79 ? 136 TYR B CD2 1 
ATOM   2569 C CE1 . TYR B 1 137 ? 1.544   8.232   -10.739 1.00 48.98 ? 136 TYR B CE1 1 
ATOM   2570 C CE2 . TYR B 1 137 ? 2.837   8.165   -8.724  1.00 54.32 ? 136 TYR B CE2 1 
ATOM   2571 C CZ  . TYR B 1 137 ? 2.557   8.736   -9.947  1.00 53.63 ? 136 TYR B CZ  1 
ATOM   2572 O OH  . TYR B 1 137 ? 3.293   9.816   -10.372 1.00 51.64 ? 136 TYR B OH  1 
ATOM   2573 N N   . ALA B 1 138 ? -0.518  2.346   -8.170  1.00 41.52 ? 137 ALA B N   1 
ATOM   2574 C CA  . ALA B 1 138 ? -1.211  1.287   -7.449  1.00 44.53 ? 137 ALA B CA  1 
ATOM   2575 C C   . ALA B 1 138 ? -0.195  0.289   -6.903  1.00 45.72 ? 137 ALA B C   1 
ATOM   2576 O O   . ALA B 1 138 ? -0.278  -0.137  -5.752  1.00 52.71 ? 137 ALA B O   1 
ATOM   2577 C CB  . ALA B 1 138 ? -2.205  0.585   -8.363  1.00 41.42 ? 137 ALA B CB  1 
ATOM   2578 N N   . ARG B 1 139 ? 0.772   -0.067  -7.741  1.00 45.58 ? 138 ARG B N   1 
ATOM   2579 C CA  . ARG B 1 139 ? 1.802   -1.032  -7.378  1.00 45.70 ? 138 ARG B CA  1 
ATOM   2580 C C   . ARG B 1 139 ? 2.631   -0.559  -6.186  1.00 52.53 ? 138 ARG B C   1 
ATOM   2581 O O   . ARG B 1 139 ? 3.025   -1.360  -5.338  1.00 50.84 ? 138 ARG B O   1 
ATOM   2582 C CB  . ARG B 1 139 ? 2.708   -1.295  -8.580  1.00 43.04 ? 138 ARG B CB  1 
ATOM   2583 C CG  . ARG B 1 139 ? 3.792   -2.321  -8.349  1.00 49.52 ? 138 ARG B CG  1 
ATOM   2584 C CD  . ARG B 1 139 ? 4.576   -2.556  -9.628  1.00 47.25 ? 138 ARG B CD  1 
ATOM   2585 N NE  . ARG B 1 139 ? 5.701   -3.457  -9.417  1.00 53.36 ? 138 ARG B NE  1 
ATOM   2586 C CZ  . ARG B 1 139 ? 5.617   -4.782  -9.471  1.00 56.31 ? 138 ARG B CZ  1 
ATOM   2587 N NH1 . ARG B 1 139 ? 4.455   -5.366  -9.733  1.00 54.95 ? 138 ARG B NH1 1 
ATOM   2588 N NH2 . ARG B 1 139 ? 6.697   -5.522  -9.265  1.00 60.80 ? 138 ARG B NH2 1 
ATOM   2589 N N   . GLN B 1 140 ? 2.898   0.744   -6.126  1.00 49.37 ? 139 GLN B N   1 
ATOM   2590 C CA  . GLN B 1 140 ? 3.643   1.311   -5.008  1.00 53.10 ? 139 GLN B CA  1 
ATOM   2591 C C   . GLN B 1 140 ? 2.802   1.248   -3.737  1.00 52.43 ? 139 GLN B C   1 
ATOM   2592 O O   . GLN B 1 140 ? 3.330   1.091   -2.637  1.00 53.49 ? 139 GLN B O   1 
ATOM   2593 C CB  . GLN B 1 140 ? 4.050   2.757   -5.298  1.00 53.97 ? 139 GLN B CB  1 
ATOM   2594 C CG  . GLN B 1 140 ? 4.527   3.001   -6.714  1.00 54.14 ? 139 GLN B CG  1 
ATOM   2595 C CD  . GLN B 1 140 ? 5.579   2.004   -7.157  1.00 62.19 ? 139 GLN B CD  1 
ATOM   2596 O OE1 . GLN B 1 140 ? 6.646   1.896   -6.550  1.00 63.76 ? 139 GLN B OE1 1 
ATOM   2597 N NE2 . GLN B 1 140 ? 5.288   1.274   -8.229  1.00 58.79 ? 139 GLN B NE2 1 
ATOM   2598 N N   . VAL B 1 141 ? 1.488   1.368   -3.900  1.00 52.24 ? 140 VAL B N   1 
ATOM   2599 C CA  . VAL B 1 141 ? 0.556   1.280   -2.781  1.00 55.15 ? 140 VAL B CA  1 
ATOM   2600 C C   . VAL B 1 141 ? -0.015  -0.131  -2.636  1.00 59.74 ? 140 VAL B C   1 
ATOM   2601 O O   . VAL B 1 141 ? 0.700   -1.126  -2.780  1.00 60.49 ? 140 VAL B O   1 
ATOM   2602 C CB  . VAL B 1 141 ? -0.611  2.279   -2.941  1.00 50.25 ? 140 VAL B CB  1 
ATOM   2603 C CG1 . VAL B 1 141 ? -1.685  2.015   -1.895  1.00 52.65 ? 140 VAL B CG1 1 
ATOM   2604 C CG2 . VAL B 1 141 ? -0.105  3.712   -2.854  1.00 50.03 ? 140 VAL B CG2 1 
ATOM   2605 N N   . PRO B 1 149 ? 7.901   8.267   9.027   1.00 40.21 ? 149 PRO B N   1 
ATOM   2606 C CA  . PRO B 1 149 ? 7.930   6.908   8.470   1.00 39.26 ? 149 PRO B CA  1 
ATOM   2607 C C   . PRO B 1 149 ? 9.330   6.331   8.574   1.00 39.44 ? 149 PRO B C   1 
ATOM   2608 O O   . PRO B 1 149 ? 9.501   5.182   8.975   1.00 37.04 ? 149 PRO B O   1 
ATOM   2609 C CB  . PRO B 1 149 ? 7.563   7.116   6.992   1.00 41.22 ? 149 PRO B CB  1 
ATOM   2610 C CG  . PRO B 1 149 ? 7.088   8.534   6.886   1.00 44.48 ? 149 PRO B CG  1 
ATOM   2611 C CD  . PRO B 1 149 ? 7.779   9.284   7.976   1.00 40.48 ? 149 PRO B CD  1 
ATOM   2612 N N   . THR B 1 150 ? 10.320  7.138   8.206   1.00 35.50 ? 150 THR B N   1 
ATOM   2613 C CA  . THR B 1 150 ? 11.719  6.786   8.407   1.00 35.66 ? 150 THR B CA  1 
ATOM   2614 C C   . THR B 1 150 ? 11.994  6.655   9.902   1.00 30.01 ? 150 THR B C   1 
ATOM   2615 O O   . THR B 1 150 ? 12.844  5.870   10.330  1.00 27.49 ? 150 THR B O   1 
ATOM   2616 C CB  . THR B 1 150 ? 12.644  7.850   7.780   1.00 32.39 ? 150 THR B CB  1 
ATOM   2617 O OG1 . THR B 1 150 ? 12.642  7.696   6.354   1.00 37.34 ? 150 THR B OG1 1 
ATOM   2618 C CG2 . THR B 1 150 ? 14.070  7.714   8.299   1.00 34.89 ? 150 THR B CG2 1 
ATOM   2619 N N   . ILE B 1 151 ? 11.260  7.429   10.693  1.00 24.81 ? 151 ILE B N   1 
ATOM   2620 C CA  . ILE B 1 151 ? 11.364  7.359   12.141  1.00 29.32 ? 151 ILE B CA  1 
ATOM   2621 C C   . ILE B 1 151 ? 11.000  5.965   12.647  1.00 26.60 ? 151 ILE B C   1 
ATOM   2622 O O   . ILE B 1 151 ? 11.510  5.512   13.676  1.00 22.79 ? 151 ILE B O   1 
ATOM   2623 C CB  . ILE B 1 151 ? 10.443  8.391   12.820  1.00 29.52 ? 151 ILE B CB  1 
ATOM   2624 C CG1 . ILE B 1 151 ? 10.604  9.768   12.175  1.00 36.90 ? 151 ILE B CG1 1 
ATOM   2625 C CG2 . ILE B 1 151 ? 10.753  8.478   14.302  1.00 29.11 ? 151 ILE B CG2 1 
ATOM   2626 C CD1 . ILE B 1 151 ? 11.896  10.461  12.538  1.00 39.64 ? 151 ILE B CD1 1 
ATOM   2627 N N   . ARG B 1 152 ? 10.110  5.293   11.923  1.00 23.06 ? 152 ARG B N   1 
ATOM   2628 C CA  . ARG B 1 152 ? 9.672   3.953   12.304  1.00 25.80 ? 152 ARG B CA  1 
ATOM   2629 C C   . ARG B 1 152 ? 10.811  2.947   12.198  1.00 23.42 ? 152 ARG B C   1 
ATOM   2630 O O   . ARG B 1 152 ? 10.928  2.048   13.031  1.00 20.39 ? 152 ARG B O   1 
ATOM   2631 C CB  . ARG B 1 152 ? 8.484   3.489   11.453  1.00 25.94 ? 152 ARG B CB  1 
ATOM   2632 C CG  . ARG B 1 152 ? 7.199   4.279   11.660  1.00 30.11 ? 152 ARG B CG  1 
ATOM   2633 C CD  . ARG B 1 152 ? 6.127   3.769   10.717  1.00 29.49 ? 152 ARG B CD  1 
ATOM   2634 N NE  . ARG B 1 152 ? 5.162   4.802   10.376  1.00 40.57 ? 152 ARG B NE  1 
ATOM   2635 C CZ  . ARG B 1 152 ? 4.557   4.892   9.198   1.00 38.77 ? 152 ARG B CZ  1 
ATOM   2636 N NH1 . ARG B 1 152 ? 4.820   4.006   8.246   1.00 32.02 ? 152 ARG B NH1 1 
ATOM   2637 N NH2 . ARG B 1 152 ? 3.686   5.867   8.973   1.00 47.39 ? 152 ARG B NH2 1 
ATOM   2638 N N   . ILE B 1 153 ? 11.646  3.096   11.172  1.00 25.38 ? 153 ILE B N   1 
ATOM   2639 C CA  . ILE B 1 153 ? 12.804  2.219   11.018  1.00 23.68 ? 153 ILE B CA  1 
ATOM   2640 C C   . ILE B 1 153 ? 13.761  2.410   12.192  1.00 20.20 ? 153 ILE B C   1 
ATOM   2641 O O   . ILE B 1 153 ? 14.298  1.442   12.738  1.00 20.45 ? 153 ILE B O   1 
ATOM   2642 C CB  . ILE B 1 153 ? 13.545  2.463   9.695   1.00 23.56 ? 153 ILE B CB  1 
ATOM   2643 C CG1 . ILE B 1 153 ? 12.592  2.290   8.513   1.00 27.95 ? 153 ILE B CG1 1 
ATOM   2644 C CG2 . ILE B 1 153 ? 14.726  1.497   9.556   1.00 15.88 ? 153 ILE B CG2 1 
ATOM   2645 C CD1 . ILE B 1 153 ? 13.231  2.611   7.174   1.00 27.71 ? 153 ILE B CD1 1 
ATOM   2646 N N   . LEU B 1 154 ? 13.962  3.665   12.581  1.00 18.46 ? 154 LEU B N   1 
ATOM   2647 C CA  . LEU B 1 154 ? 14.829  3.983   13.708  1.00 20.36 ? 154 LEU B CA  1 
ATOM   2648 C C   . LEU B 1 154 ? 14.289  3.400   15.014  1.00 21.74 ? 154 LEU B C   1 
ATOM   2649 O O   . LEU B 1 154 ? 15.049  2.849   15.819  1.00 19.27 ? 154 LEU B O   1 
ATOM   2650 C CB  . LEU B 1 154 ? 15.015  5.497   13.832  1.00 21.98 ? 154 LEU B CB  1 
ATOM   2651 C CG  . LEU B 1 154 ? 15.592  6.181   12.588  1.00 23.83 ? 154 LEU B CG  1 
ATOM   2652 C CD1 . LEU B 1 154 ? 15.653  7.688   12.780  1.00 24.99 ? 154 LEU B CD1 1 
ATOM   2653 C CD2 . LEU B 1 154 ? 16.953  5.624   12.266  1.00 23.55 ? 154 LEU B CD2 1 
ATOM   2654 N N   . ARG B 1 155 ? 12.973  3.509   15.210  1.00 22.59 ? 155 ARG B N   1 
ATOM   2655 C CA  . ARG B 1 155 ? 12.318  2.948   16.394  1.00 20.85 ? 155 ARG B CA  1 
ATOM   2656 C C   . ARG B 1 155 ? 12.498  1.434   16.452  1.00 16.28 ? 155 ARG B C   1 
ATOM   2657 O O   . ARG B 1 155 ? 12.756  0.863   17.516  1.00 18.17 ? 155 ARG B O   1 
ATOM   2658 C CB  . ARG B 1 155 ? 10.824  3.337   16.442  1.00 21.84 ? 155 ARG B CB  1 
ATOM   2659 C CG  . ARG B 1 155 ? 10.544  4.502   17.387  1.00 24.93 ? 155 ARG B CG  1 
ATOM   2660 C CD  . ARG B 1 155 ? 9.420   5.428   16.924  1.00 32.96 ? 155 ARG B CD  1 
ATOM   2661 N NE  . ARG B 1 155 ? 9.668   6.786   17.404  1.00 40.47 ? 155 ARG B NE  1 
ATOM   2662 C CZ  . ARG B 1 155 ? 8.876   7.831   17.191  1.00 43.06 ? 155 ARG B CZ  1 
ATOM   2663 N NH1 . ARG B 1 155 ? 7.749   7.684   16.508  1.00 42.02 ? 155 ARG B NH1 1 
ATOM   2664 N NH2 . ARG B 1 155 ? 9.212   9.027   17.672  1.00 40.83 ? 155 ARG B NH2 1 
ATOM   2665 N N   . LEU B 1 156 ? 12.395  0.791   15.295  1.00 17.97 ? 156 LEU B N   1 
ATOM   2666 C CA  . LEU B 1 156 ? 12.554  -0.652  15.212  1.00 20.29 ? 156 LEU B CA  1 
ATOM   2667 C C   . LEU B 1 156 ? 13.950  -1.071  15.668  1.00 17.83 ? 156 LEU B C   1 
ATOM   2668 O O   . LEU B 1 156 ? 14.104  -1.948  16.524  1.00 21.34 ? 156 LEU B O   1 
ATOM   2669 C CB  . LEU B 1 156 ? 12.290  -1.137  13.786  1.00 18.32 ? 156 LEU B CB  1 
ATOM   2670 C CG  . LEU B 1 156 ? 12.650  -2.597  13.495  1.00 21.36 ? 156 LEU B CG  1 
ATOM   2671 C CD1 . LEU B 1 156 ? 11.863  -3.548  14.395  1.00 22.64 ? 156 LEU B CD1 1 
ATOM   2672 C CD2 . LEU B 1 156 ? 12.416  -2.919  12.041  1.00 21.93 ? 156 LEU B CD2 1 
ATOM   2673 N N   . PHE B 1 157 ? 14.967  -0.432  15.098  1.00 22.63 ? 157 PHE B N   1 
ATOM   2674 C CA  . PHE B 1 157 ? 16.352  -0.745  15.440  1.00 19.87 ? 157 PHE B CA  1 
ATOM   2675 C C   . PHE B 1 157 ? 16.632  -0.468  16.915  1.00 21.19 ? 157 PHE B C   1 
ATOM   2676 O O   . PHE B 1 157 ? 17.318  -1.244  17.578  1.00 19.52 ? 157 PHE B O   1 
ATOM   2677 C CB  . PHE B 1 157 ? 17.329  0.045   14.562  1.00 20.57 ? 157 PHE B CB  1 
ATOM   2678 C CG  . PHE B 1 157 ? 17.395  -0.436  13.139  1.00 25.62 ? 157 PHE B CG  1 
ATOM   2679 C CD1 . PHE B 1 157 ? 17.345  0.463   12.085  1.00 26.88 ? 157 PHE B CD1 1 
ATOM   2680 C CD2 . PHE B 1 157 ? 17.508  -1.786  12.856  1.00 31.32 ? 157 PHE B CD2 1 
ATOM   2681 C CE1 . PHE B 1 157 ? 17.413  0.022   10.771  1.00 28.38 ? 157 PHE B CE1 1 
ATOM   2682 C CE2 . PHE B 1 157 ? 17.571  -2.234  11.547  1.00 37.02 ? 157 PHE B CE2 1 
ATOM   2683 C CZ  . PHE B 1 157 ? 17.520  -1.330  10.503  1.00 33.31 ? 157 PHE B CZ  1 
ATOM   2684 N N   . TYR B 1 158 ? 16.101  0.635   17.436  1.00 17.26 ? 158 TYR B N   1 
ATOM   2685 C CA  . TYR B 1 158 ? 16.349  0.959   18.835  1.00 22.09 ? 158 TYR B CA  1 
ATOM   2686 C C   . TYR B 1 158 ? 15.725  -0.065  19.762  1.00 22.94 ? 158 TYR B C   1 
ATOM   2687 O O   . TYR B 1 158 ? 16.346  -0.497  20.730  1.00 23.86 ? 158 TYR B O   1 
ATOM   2688 C CB  . TYR B 1 158 ? 15.857  2.358   19.212  1.00 23.76 ? 158 TYR B CB  1 
ATOM   2689 C CG  . TYR B 1 158 ? 16.055  2.614   20.690  1.00 26.16 ? 158 TYR B CG  1 
ATOM   2690 C CD1 . TYR B 1 158 ? 17.331  2.721   21.228  1.00 23.42 ? 158 TYR B CD1 1 
ATOM   2691 C CD2 . TYR B 1 158 ? 14.970  2.691   21.555  1.00 25.09 ? 158 TYR B CD2 1 
ATOM   2692 C CE1 . TYR B 1 158 ? 17.522  2.923   22.585  1.00 25.96 ? 158 TYR B CE1 1 
ATOM   2693 C CE2 . TYR B 1 158 ? 15.150  2.895   22.913  1.00 29.00 ? 158 TYR B CE2 1 
ATOM   2694 C CZ  . TYR B 1 158 ? 16.426  3.009   23.421  1.00 33.44 ? 158 TYR B CZ  1 
ATOM   2695 O OH  . TYR B 1 158 ? 16.601  3.212   24.768  1.00 36.94 ? 158 TYR B OH  1 
ATOM   2696 N N   . GLU B 1 159 ? 14.490  -0.446  19.456  1.00 20.01 ? 159 GLU B N   1 
ATOM   2697 C CA  . GLU B 1 159 ? 13.771  -1.433  20.245  1.00 23.65 ? 159 GLU B CA  1 
ATOM   2698 C C   . GLU B 1 159 ? 14.549  -2.743  20.255  1.00 24.98 ? 159 GLU B C   1 
ATOM   2699 O O   . GLU B 1 159 ? 14.749  -3.355  21.305  1.00 23.14 ? 159 GLU B O   1 
ATOM   2700 C CB  . GLU B 1 159 ? 12.385  -1.660  19.647  1.00 22.79 ? 159 GLU B CB  1 
ATOM   2701 C CG  . GLU B 1 159 ? 11.401  -2.286  20.604  1.00 37.72 ? 159 GLU B CG  1 
ATOM   2702 C CD  . GLU B 1 159 ? 10.955  -1.322  21.694  1.00 38.62 ? 159 GLU B CD  1 
ATOM   2703 O OE1 . GLU B 1 159 ? 11.233  -0.103  21.585  1.00 39.19 ? 159 GLU B OE1 1 
ATOM   2704 O OE2 . GLU B 1 159 ? 10.330  -1.796  22.665  1.00 46.66 ? 159 GLU B OE2 1 
ATOM   2705 N N   . LEU B 1 160 ? 14.974  -3.167  19.068  1.00 22.50 ? 160 LEU B N   1 
ATOM   2706 C CA  . LEU B 1 160 ? 15.764  -4.379  18.900  1.00 16.79 ? 160 LEU B CA  1 
ATOM   2707 C C   . LEU B 1 160 ? 17.064  -4.315  19.690  1.00 25.57 ? 160 LEU B C   1 
ATOM   2708 O O   . LEU B 1 160 ? 17.440  -5.274  20.358  1.00 23.89 ? 160 LEU B O   1 
ATOM   2709 C CB  . LEU B 1 160 ? 16.075  -4.603  17.421  1.00 22.11 ? 160 LEU B CB  1 
ATOM   2710 C CG  . LEU B 1 160 ? 15.403  -5.731  16.629  1.00 29.90 ? 160 LEU B CG  1 
ATOM   2711 C CD1 . LEU B 1 160 ? 14.168  -6.301  17.308  1.00 24.72 ? 160 LEU B CD1 1 
ATOM   2712 C CD2 . LEU B 1 160 ? 15.094  -5.283  15.198  1.00 25.31 ? 160 LEU B CD2 1 
ATOM   2713 N N   . CYS B 1 161 ? 17.747  -3.178  19.622  1.00 20.69 ? 161 CYS B N   1 
ATOM   2714 C CA  . CYS B 1 161 ? 19.040  -3.058  20.277  1.00 21.36 ? 161 CYS B CA  1 
ATOM   2715 C C   . CYS B 1 161 ? 18.940  -3.088  21.806  1.00 25.08 ? 161 CYS B C   1 
ATOM   2716 O O   . CYS B 1 161 ? 19.647  -3.851  22.464  1.00 22.58 ? 161 CYS B O   1 
ATOM   2717 C CB  . CYS B 1 161 ? 19.770  -1.804  19.800  1.00 22.65 ? 161 CYS B CB  1 
ATOM   2718 S SG  . CYS B 1 161 ? 21.517  -1.761  20.249  1.00 23.97 ? 161 CYS B SG  1 
ATOM   2719 N N   . SER B 1 162 ? 18.063  -2.269  22.375  1.00 22.72 ? 162 SER B N   1 
ATOM   2720 C CA  . SER B 1 162 ? 17.977  -2.176  23.830  1.00 27.61 ? 162 SER B CA  1 
ATOM   2721 C C   . SER B 1 162 ? 17.460  -3.484  24.419  1.00 31.84 ? 162 SER B C   1 
ATOM   2722 O O   . SER B 1 162 ? 17.759  -3.827  25.562  1.00 29.38 ? 162 SER B O   1 
ATOM   2723 C CB  . SER B 1 162 ? 17.083  -1.014  24.263  1.00 29.00 ? 162 SER B CB  1 
ATOM   2724 O OG  . SER B 1 162 ? 15.732  -1.277  23.951  1.00 36.91 ? 162 SER B OG  1 
ATOM   2725 N N   . SER B 1 163 ? 16.688  -4.214  23.624  1.00 27.04 ? 163 SER B N   1 
ATOM   2726 C CA  . SER B 1 163 ? 16.108  -5.469  24.071  1.00 30.03 ? 163 SER B CA  1 
ATOM   2727 C C   . SER B 1 163 ? 16.998  -6.683  23.779  1.00 29.79 ? 163 SER B C   1 
ATOM   2728 O O   . SER B 1 163 ? 17.202  -7.525  24.654  1.00 33.85 ? 163 SER B O   1 
ATOM   2729 C CB  . SER B 1 163 ? 14.729  -5.661  23.433  1.00 31.55 ? 163 SER B CB  1 
ATOM   2730 O OG  . SER B 1 163 ? 14.090  -6.804  23.963  1.00 42.57 ? 163 SER B OG  1 
ATOM   2731 N N   . GLN B 1 164 ? 17.529  -6.765  22.560  1.00 22.20 ? 164 GLN B N   1 
ATOM   2732 C CA  . GLN B 1 164 ? 18.243  -7.962  22.108  1.00 24.25 ? 164 GLN B CA  1 
ATOM   2733 C C   . GLN B 1 164 ? 19.738  -7.739  21.828  1.00 27.92 ? 164 GLN B C   1 
ATOM   2734 O O   . GLN B 1 164 ? 20.471  -8.691  21.548  1.00 27.50 ? 164 GLN B O   1 
ATOM   2735 C CB  . GLN B 1 164 ? 17.570  -8.546  20.859  1.00 28.03 ? 164 GLN B CB  1 
ATOM   2736 C CG  . GLN B 1 164 ? 16.063  -8.743  20.998  1.00 30.70 ? 164 GLN B CG  1 
ATOM   2737 C CD  . GLN B 1 164 ? 15.707  -9.605  22.185  1.00 36.29 ? 164 GLN B CD  1 
ATOM   2738 O OE1 . GLN B 1 164 ? 16.096  -10.767 22.259  1.00 34.01 ? 164 GLN B OE1 1 
ATOM   2739 N NE2 . GLN B 1 164 ? 14.966  -9.038  23.127  1.00 39.39 ? 164 GLN B NE2 1 
ATOM   2740 N N   . GLY B 1 165 ? 20.186  -6.490  21.899  1.00 20.01 ? 165 GLY B N   1 
ATOM   2741 C CA  . GLY B 1 165 ? 21.572  -6.169  21.597  1.00 23.61 ? 165 GLY B CA  1 
ATOM   2742 C C   . GLY B 1 165 ? 22.564  -6.673  22.635  1.00 22.13 ? 165 GLY B C   1 
ATOM   2743 O O   . GLY B 1 165 ? 22.372  -6.490  23.837  1.00 19.66 ? 165 GLY B O   1 
ATOM   2744 N N   . LYS B 1 166 ? 23.633  -7.312  22.172  1.00 23.06 ? 166 LYS B N   1 
ATOM   2745 C CA  . LYS B 1 166 ? 24.710  -7.754  23.064  1.00 21.71 ? 166 LYS B CA  1 
ATOM   2746 C C   . LYS B 1 166 ? 25.926  -6.833  22.939  1.00 19.37 ? 166 LYS B C   1 
ATOM   2747 O O   . LYS B 1 166 ? 26.295  -6.422  21.837  1.00 19.09 ? 166 LYS B O   1 
ATOM   2748 C CB  . LYS B 1 166 ? 25.107  -9.203  22.754  1.00 25.57 ? 166 LYS B CB  1 
ATOM   2749 C CG  . LYS B 1 166 ? 23.983  -10.218 22.951  1.00 21.65 ? 166 LYS B CG  1 
ATOM   2750 C CD  . LYS B 1 166 ? 24.473  -11.639 22.685  1.00 25.28 ? 166 LYS B CD  1 
ATOM   2751 C CE  . LYS B 1 166 ? 23.414  -12.689 23.040  1.00 24.32 ? 166 LYS B CE  1 
ATOM   2752 N NZ  . LYS B 1 166 ? 22.278  -12.699 22.079  1.00 33.23 ? 166 LYS B NZ  1 
ATOM   2753 N N   . ARG B 1 167 ? 26.536  -6.500  24.069  1.00 18.73 ? 167 ARG B N   1 
ATOM   2754 C CA  . ARG B 1 167 ? 27.670  -5.585  24.084  1.00 19.22 ? 167 ARG B CA  1 
ATOM   2755 C C   . ARG B 1 167 ? 28.946  -6.329  23.711  1.00 18.71 ? 167 ARG B C   1 
ATOM   2756 O O   . ARG B 1 167 ? 29.345  -7.268  24.398  1.00 19.26 ? 167 ARG B O   1 
ATOM   2757 C CB  . ARG B 1 167 ? 27.817  -4.938  25.465  1.00 17.98 ? 167 ARG B CB  1 
ATOM   2758 C CG  . ARG B 1 167 ? 28.979  -3.949  25.590  1.00 18.02 ? 167 ARG B CG  1 
ATOM   2759 C CD  . ARG B 1 167 ? 28.698  -2.648  24.839  1.00 17.23 ? 167 ARG B CD  1 
ATOM   2760 N NE  . ARG B 1 167 ? 29.726  -1.637  25.079  1.00 23.79 ? 167 ARG B NE  1 
ATOM   2761 C CZ  . ARG B 1 167 ? 29.536  -0.530  25.788  1.00 25.84 ? 167 ARG B CZ  1 
ATOM   2762 N NH1 . ARG B 1 167 ? 28.345  -0.275  26.322  1.00 27.11 ? 167 ARG B NH1 1 
ATOM   2763 N NH2 . ARG B 1 167 ? 30.529  0.331   25.948  1.00 23.07 ? 167 ARG B NH2 1 
ATOM   2764 N N   . VAL B 1 168 ? 29.570  -5.909  22.612  1.00 20.07 ? 168 VAL B N   1 
ATOM   2765 C CA  . VAL B 1 168 ? 30.797  -6.528  22.112  1.00 18.89 ? 168 VAL B CA  1 
ATOM   2766 C C   . VAL B 1 168 ? 31.817  -5.425  21.858  1.00 18.54 ? 168 VAL B C   1 
ATOM   2767 O O   . VAL B 1 168 ? 31.814  -4.795  20.796  1.00 19.94 ? 168 VAL B O   1 
ATOM   2768 C CB  . VAL B 1 168 ? 30.549  -7.308  20.806  1.00 17.96 ? 168 VAL B CB  1 
ATOM   2769 C CG1 . VAL B 1 168 ? 31.837  -7.930  20.276  1.00 18.24 ? 168 VAL B CG1 1 
ATOM   2770 C CG2 . VAL B 1 168 ? 29.463  -8.381  20.998  1.00 18.28 ? 168 VAL B CG2 1 
ATOM   2771 N N   . GLY B 1 169 ? 32.685  -5.191  22.835  1.00 18.03 ? 169 GLY B N   1 
ATOM   2772 C CA  . GLY B 1 169 ? 33.534  -4.015  22.816  1.00 22.24 ? 169 GLY B CA  1 
ATOM   2773 C C   . GLY B 1 169 ? 32.627  -2.812  22.985  1.00 24.39 ? 169 GLY B C   1 
ATOM   2774 O O   . GLY B 1 169 ? 31.658  -2.856  23.748  1.00 23.12 ? 169 GLY B O   1 
ATOM   2775 N N   . ASP B 1 170 ? 32.919  -1.744  22.253  1.00 20.15 ? 170 ASP B N   1 
ATOM   2776 C CA  . ASP B 1 170 ? 32.077  -0.555  22.282  1.00 22.13 ? 170 ASP B CA  1 
ATOM   2777 C C   . ASP B 1 170 ? 31.066  -0.512  21.126  1.00 23.29 ? 170 ASP B C   1 
ATOM   2778 O O   . ASP B 1 170 ? 30.850  0.526   20.507  1.00 20.90 ? 170 ASP B O   1 
ATOM   2779 C CB  . ASP B 1 170 ? 32.944  0.703   22.341  1.00 23.90 ? 170 ASP B CB  1 
ATOM   2780 C CG  . ASP B 1 170 ? 33.651  0.841   23.676  1.00 25.90 ? 170 ASP B CG  1 
ATOM   2781 O OD1 . ASP B 1 170 ? 33.019  0.531   24.712  1.00 25.79 ? 170 ASP B OD1 1 
ATOM   2782 O OD2 . ASP B 1 170 ? 34.830  1.254   23.703  1.00 30.48 ? 170 ASP B OD2 1 
ATOM   2783 N N   . THR B 1 171 ? 30.459  -1.662  20.841  1.00 19.18 ? 171 THR B N   1 
ATOM   2784 C CA  . THR B 1 171 ? 29.356  -1.757  19.895  1.00 19.26 ? 171 THR B CA  1 
ATOM   2785 C C   . THR B 1 171 ? 28.290  -2.677  20.485  1.00 20.77 ? 171 THR B C   1 
ATOM   2786 O O   . THR B 1 171 ? 28.548  -3.411  21.439  1.00 19.29 ? 171 THR B O   1 
ATOM   2787 C CB  . THR B 1 171 ? 29.774  -2.383  18.558  1.00 19.21 ? 171 THR B CB  1 
ATOM   2788 O OG1 . THR B 1 171 ? 30.220  -3.729  18.779  1.00 23.70 ? 171 THR B OG1 1 
ATOM   2789 C CG2 . THR B 1 171 ? 30.877  -1.582  17.892  1.00 24.44 ? 171 THR B CG2 1 
ATOM   2790 N N   . TYR B 1 172 ? 27.096  -2.635  19.907  1.00 21.05 ? 172 TYR B N   1 
ATOM   2791 C CA  . TYR B 1 172 ? 26.065  -3.614  20.223  1.00 21.14 ? 172 TYR B CA  1 
ATOM   2792 C C   . TYR B 1 172 ? 25.776  -4.455  18.995  1.00 18.59 ? 172 TYR B C   1 
ATOM   2793 O O   . TYR B 1 172 ? 25.729  -3.942  17.880  1.00 21.58 ? 172 TYR B O   1 
ATOM   2794 C CB  . TYR B 1 172 ? 24.790  -2.930  20.734  1.00 17.88 ? 172 TYR B CB  1 
ATOM   2795 C CG  . TYR B 1 172 ? 24.920  -2.438  22.151  1.00 20.61 ? 172 TYR B CG  1 
ATOM   2796 C CD1 . TYR B 1 172 ? 25.381  -1.158  22.418  1.00 20.80 ? 172 TYR B CD1 1 
ATOM   2797 C CD2 . TYR B 1 172 ? 24.604  -3.264  23.229  1.00 21.63 ? 172 TYR B CD2 1 
ATOM   2798 C CE1 . TYR B 1 172 ? 25.523  -0.706  23.712  1.00 20.41 ? 172 TYR B CE1 1 
ATOM   2799 C CE2 . TYR B 1 172 ? 24.729  -2.815  24.531  1.00 20.20 ? 172 TYR B CE2 1 
ATOM   2800 C CZ  . TYR B 1 172 ? 25.191  -1.532  24.764  1.00 22.29 ? 172 TYR B CZ  1 
ATOM   2801 O OH  . TYR B 1 172 ? 25.338  -1.072  26.052  1.00 23.67 ? 172 TYR B OH  1 
ATOM   2802 N N   . GLU B 1 173 ? 25.599  -5.752  19.204  1.00 16.35 ? 173 GLU B N   1 
ATOM   2803 C CA  . GLU B 1 173 ? 25.304  -6.656  18.107  1.00 22.65 ? 173 GLU B CA  1 
ATOM   2804 C C   . GLU B 1 173 ? 23.959  -7.320  18.334  1.00 24.34 ? 173 GLU B C   1 
ATOM   2805 O O   . GLU B 1 173 ? 23.712  -7.890  19.398  1.00 21.03 ? 173 GLU B O   1 
ATOM   2806 C CB  . GLU B 1 173 ? 26.368  -7.743  17.999  1.00 21.32 ? 173 GLU B CB  1 
ATOM   2807 C CG  . GLU B 1 173 ? 27.718  -7.243  17.550  1.00 26.63 ? 173 GLU B CG  1 
ATOM   2808 C CD  . GLU B 1 173 ? 28.692  -8.378  17.298  1.00 29.63 ? 173 GLU B CD  1 
ATOM   2809 O OE1 . GLU B 1 173 ? 28.350  -9.544  17.596  1.00 27.67 ? 173 GLU B OE1 1 
ATOM   2810 O OE2 . GLU B 1 173 ? 29.800  -8.096  16.800  1.00 29.67 ? 173 GLU B OE2 1 
ATOM   2811 N N   . ILE B 1 174 ? 23.096  -7.240  17.329  1.00 20.71 ? 174 ILE B N   1 
ATOM   2812 C CA  . ILE B 1 174 ? 21.833  -7.957  17.342  1.00 23.57 ? 174 ILE B CA  1 
ATOM   2813 C C   . ILE B 1 174 ? 21.958  -9.132  16.378  1.00 23.96 ? 174 ILE B C   1 
ATOM   2814 O O   . ILE B 1 174 ? 22.214  -8.942  15.194  1.00 21.65 ? 174 ILE B O   1 
ATOM   2815 C CB  . ILE B 1 174 ? 20.669  -7.039  16.914  1.00 20.80 ? 174 ILE B CB  1 
ATOM   2816 C CG1 . ILE B 1 174 ? 20.703  -5.733  17.712  1.00 16.47 ? 174 ILE B CG1 1 
ATOM   2817 C CG2 . ILE B 1 174 ? 19.320  -7.746  17.090  1.00 22.41 ? 174 ILE B CG2 1 
ATOM   2818 C CD1 . ILE B 1 174 ? 19.925  -4.603  17.058  1.00 15.78 ? 174 ILE B CD1 1 
ATOM   2819 N N   . THR B 1 175 ? 21.809  -10.347 16.892  1.00 21.35 ? 175 THR B N   1 
ATOM   2820 C CA  . THR B 1 175 ? 21.884  -11.534 16.046  1.00 29.07 ? 175 THR B CA  1 
ATOM   2821 C C   . THR B 1 175 ? 20.505  -11.848 15.483  1.00 35.21 ? 175 THR B C   1 
ATOM   2822 O O   . THR B 1 175 ? 19.596  -12.244 16.213  1.00 30.03 ? 175 THR B O   1 
ATOM   2823 C CB  . THR B 1 175 ? 22.431  -12.748 16.809  1.00 30.27 ? 175 THR B CB  1 
ATOM   2824 O OG1 . THR B 1 175 ? 23.765  -12.466 17.245  1.00 36.23 ? 175 THR B OG1 1 
ATOM   2825 C CG2 . THR B 1 175 ? 22.447  -13.976 15.913  1.00 34.26 ? 175 THR B CG2 1 
ATOM   2826 N N   . MET B 1 176 ? 20.359  -11.664 14.178  1.00 29.79 ? 176 MET B N   1 
ATOM   2827 C CA  . MET B 1 176 ? 19.046  -11.667 13.559  1.00 36.54 ? 176 MET B CA  1 
ATOM   2828 C C   . MET B 1 176 ? 19.174  -11.422 12.065  1.00 37.55 ? 176 MET B C   1 
ATOM   2829 O O   . MET B 1 176 ? 19.799  -10.449 11.650  1.00 37.97 ? 176 MET B O   1 
ATOM   2830 C CB  . MET B 1 176 ? 18.197  -10.564 14.193  1.00 31.20 ? 176 MET B CB  1 
ATOM   2831 C CG  . MET B 1 176 ? 16.830  -10.375 13.587  1.00 44.02 ? 176 MET B CG  1 
ATOM   2832 S SD  . MET B 1 176 ? 15.822  -9.273  14.599  1.00 46.43 ? 176 MET B SD  1 
ATOM   2833 C CE  . MET B 1 176 ? 14.200  -9.637  13.930  1.00 39.68 ? 176 MET B CE  1 
ATOM   2834 N N   . PRO B 1 177 ? 18.594  -12.314 11.249  1.00 38.13 ? 177 PRO B N   1 
ATOM   2835 C CA  . PRO B 1 177 ? 18.544  -12.094 9.804   1.00 40.13 ? 177 PRO B CA  1 
ATOM   2836 C C   . PRO B 1 177 ? 17.326  -11.241 9.471   1.00 42.92 ? 177 PRO B C   1 
ATOM   2837 O O   . PRO B 1 177 ? 16.234  -11.771 9.266   1.00 46.86 ? 177 PRO B O   1 
ATOM   2838 C CB  . PRO B 1 177 ? 18.364  -13.510 9.234   1.00 37.19 ? 177 PRO B CB  1 
ATOM   2839 C CG  . PRO B 1 177 ? 18.332  -14.452 10.439  1.00 42.08 ? 177 PRO B CG  1 
ATOM   2840 C CD  . PRO B 1 177 ? 17.999  -13.606 11.619  1.00 41.29 ? 177 PRO B CD  1 
ATOM   2841 N N   . LEU B 1 178 ? 17.510  -9.929  9.436   1.00 42.12 ? 178 LEU B N   1 
ATOM   2842 C CA  . LEU B 1 178 ? 16.401  -9.017  9.206   1.00 37.92 ? 178 LEU B CA  1 
ATOM   2843 C C   . LEU B 1 178 ? 16.546  -8.367  7.836   1.00 38.13 ? 178 LEU B C   1 
ATOM   2844 O O   . LEU B 1 178 ? 17.197  -7.333  7.695   1.00 37.93 ? 178 LEU B O   1 
ATOM   2845 C CB  . LEU B 1 178 ? 16.357  -7.957  10.307  1.00 35.06 ? 178 LEU B CB  1 
ATOM   2846 C CG  . LEU B 1 178 ? 15.211  -6.945  10.272  1.00 37.14 ? 178 LEU B CG  1 
ATOM   2847 C CD1 . LEU B 1 178 ? 13.872  -7.646  10.394  1.00 38.19 ? 178 LEU B CD1 1 
ATOM   2848 C CD2 . LEU B 1 178 ? 15.377  -5.896  11.373  1.00 31.48 ? 178 LEU B CD2 1 
ATOM   2849 N N   . SER B 1 179 ? 15.940  -8.982  6.825   1.00 37.93 ? 179 SER B N   1 
ATOM   2850 C CA  . SER B 1 179 ? 16.072  -8.505  5.449   1.00 38.41 ? 179 SER B CA  1 
ATOM   2851 C C   . SER B 1 179 ? 15.470  -7.117  5.251   1.00 34.85 ? 179 SER B C   1 
ATOM   2852 O O   . SER B 1 179 ? 14.565  -6.715  5.980   1.00 33.22 ? 179 SER B O   1 
ATOM   2853 C CB  . SER B 1 179 ? 15.398  -9.477  4.487   1.00 40.14 ? 179 SER B CB  1 
ATOM   2854 O OG  . SER B 1 179 ? 13.992  -9.421  4.638   1.00 34.35 ? 179 SER B OG  1 
ATOM   2855 N N   . GLN B 1 180 ? 15.969  -6.394  4.253   1.00 31.28 ? 180 GLN B N   1 
ATOM   2856 C CA  . GLN B 1 180 ? 15.431  -5.082  3.916   1.00 33.38 ? 180 GLN B CA  1 
ATOM   2857 C C   . GLN B 1 180 ? 13.939  -5.154  3.602   1.00 30.15 ? 180 GLN B C   1 
ATOM   2858 O O   . GLN B 1 180 ? 13.185  -4.232  3.914   1.00 27.23 ? 180 GLN B O   1 
ATOM   2859 C CB  . GLN B 1 180 ? 16.190  -4.472  2.735   1.00 38.03 ? 180 GLN B CB  1 
ATOM   2860 C CG  . GLN B 1 180 ? 17.642  -4.131  3.037   1.00 38.20 ? 180 GLN B CG  1 
ATOM   2861 C CD  . GLN B 1 180 ? 18.218  -3.108  2.069   1.00 41.45 ? 180 GLN B CD  1 
ATOM   2862 O OE1 . GLN B 1 180 ? 19.429  -2.894  2.021   1.00 44.10 ? 180 GLN B OE1 1 
ATOM   2863 N NE2 . GLN B 1 180 ? 17.346  -2.464  1.299   1.00 38.64 ? 180 GLN B NE2 1 
ATOM   2864 N N   . LYS B 1 181 ? 13.510  -6.259  3.001   1.00 28.51 ? 181 LYS B N   1 
ATOM   2865 C CA  . LYS B 1 181 ? 12.106  -6.422  2.647   1.00 32.78 ? 181 LYS B CA  1 
ATOM   2866 C C   . LYS B 1 181 ? 11.223  -6.538  3.883   1.00 31.47 ? 181 LYS B C   1 
ATOM   2867 O O   . LYS B 1 181 ? 10.174  -5.901  3.961   1.00 29.10 ? 181 LYS B O   1 
ATOM   2868 C CB  . LYS B 1 181 ? 11.900  -7.637  1.742   1.00 41.10 ? 181 LYS B CB  1 
ATOM   2869 C CG  . LYS B 1 181 ? 10.486  -7.740  1.188   1.00 44.24 ? 181 LYS B CG  1 
ATOM   2870 C CD  . LYS B 1 181 ? 10.276  -9.018  0.385   1.00 56.23 ? 181 LYS B CD  1 
ATOM   2871 C CE  . LYS B 1 181 ? 9.853   -10.175 1.278   1.00 54.67 ? 181 LYS B CE  1 
ATOM   2872 N NZ  . LYS B 1 181 ? 10.785  -10.374 2.425   1.00 50.88 ? 181 LYS B NZ  1 
ATOM   2873 N N   . SER B 1 182 ? 11.657  -7.342  4.849   1.00 31.94 ? 182 SER B N   1 
ATOM   2874 C CA  . SER B 1 182 ? 10.920  -7.498  6.098   1.00 32.11 ? 182 SER B CA  1 
ATOM   2875 C C   . SER B 1 182 ? 10.780  -6.176  6.846   1.00 28.48 ? 182 SER B C   1 
ATOM   2876 O O   . SER B 1 182 ? 9.714   -5.866  7.383   1.00 26.86 ? 182 SER B O   1 
ATOM   2877 C CB  . SER B 1 182 ? 11.591  -8.540  6.990   1.00 30.48 ? 182 SER B CB  1 
ATOM   2878 O OG  . SER B 1 182 ? 11.399  -9.841  6.467   1.00 37.60 ? 182 SER B OG  1 
ATOM   2879 N N   . ILE B 1 183 ? 11.861  -5.404  6.879   1.00 24.81 ? 183 ILE B N   1 
ATOM   2880 C CA  . ILE B 1 183 ? 11.853  -4.101  7.532   1.00 28.22 ? 183 ILE B CA  1 
ATOM   2881 C C   . ILE B 1 183 ? 10.787  -3.221  6.897   1.00 28.38 ? 183 ILE B C   1 
ATOM   2882 O O   . ILE B 1 183 ? 10.058  -2.515  7.590   1.00 24.49 ? 183 ILE B O   1 
ATOM   2883 C CB  . ILE B 1 183 ? 13.232  -3.407  7.425   1.00 26.40 ? 183 ILE B CB  1 
ATOM   2884 C CG1 . ILE B 1 183 ? 14.299  -4.227  8.155   1.00 31.35 ? 183 ILE B CG1 1 
ATOM   2885 C CG2 . ILE B 1 183 ? 13.171  -1.997  7.989   1.00 26.36 ? 183 ILE B CG2 1 
ATOM   2886 C CD1 . ILE B 1 183 ? 15.693  -3.638  8.064   1.00 29.16 ? 183 ILE B CD1 1 
ATOM   2887 N N   . GLY B 1 184 ? 10.693  -3.281  5.573   1.00 29.82 ? 184 GLY B N   1 
ATOM   2888 C CA  . GLY B 1 184 ? 9.678   -2.545  4.846   1.00 26.87 ? 184 GLY B CA  1 
ATOM   2889 C C   . GLY B 1 184 ? 8.271   -2.999  5.195   1.00 25.16 ? 184 GLY B C   1 
ATOM   2890 O O   . GLY B 1 184 ? 7.381   -2.175  5.400   1.00 28.28 ? 184 GLY B O   1 
ATOM   2891 N N   . GLU B 1 185 ? 8.075   -4.311  5.269   1.00 27.19 ? 185 GLU B N   1 
ATOM   2892 C CA  . GLU B 1 185 ? 6.758   -4.888  5.543   1.00 33.03 ? 185 GLU B CA  1 
ATOM   2893 C C   . GLU B 1 185 ? 6.291   -4.640  6.972   1.00 28.91 ? 185 GLU B C   1 
ATOM   2894 O O   . GLU B 1 185 ? 5.089   -4.546  7.234   1.00 26.32 ? 185 GLU B O   1 
ATOM   2895 C CB  . GLU B 1 185 ? 6.764   -6.390  5.255   1.00 30.64 ? 185 GLU B CB  1 
ATOM   2896 C CG  . GLU B 1 185 ? 7.115   -6.731  3.820   1.00 40.21 ? 185 GLU B CG  1 
ATOM   2897 C CD  . GLU B 1 185 ? 7.313   -8.217  3.610   1.00 48.46 ? 185 GLU B CD  1 
ATOM   2898 O OE1 . GLU B 1 185 ? 7.879   -8.877  4.508   1.00 45.75 ? 185 GLU B OE1 1 
ATOM   2899 O OE2 . GLU B 1 185 ? 6.898   -8.723  2.545   1.00 56.11 ? 185 GLU B OE2 1 
ATOM   2900 N N   . ILE B 1 186 ? 7.243   -4.542  7.895   1.00 28.17 ? 186 ILE B N   1 
ATOM   2901 C CA  . ILE B 1 186 ? 6.927   -4.286  9.298   1.00 27.88 ? 186 ILE B CA  1 
ATOM   2902 C C   . ILE B 1 186 ? 6.597   -2.817  9.558   1.00 27.39 ? 186 ILE B C   1 
ATOM   2903 O O   . ILE B 1 186 ? 5.667   -2.505  10.299  1.00 25.95 ? 186 ILE B O   1 
ATOM   2904 C CB  . ILE B 1 186 ? 8.084   -4.711  10.231  1.00 25.74 ? 186 ILE B CB  1 
ATOM   2905 C CG1 . ILE B 1 186 ? 8.103   -6.227  10.402  1.00 29.29 ? 186 ILE B CG1 1 
ATOM   2906 C CG2 . ILE B 1 186 ? 7.951   -4.036  11.592  1.00 26.03 ? 186 ILE B CG2 1 
ATOM   2907 C CD1 . ILE B 1 186 ? 9.422   -6.761  10.922  1.00 26.24 ? 186 ILE B CD1 1 
ATOM   2908 N N   . THR B 1 187 ? 7.357   -1.916  8.942   1.00 25.38 ? 187 THR B N   1 
ATOM   2909 C CA  . THR B 1 187 ? 7.247   -0.496  9.261   1.00 25.37 ? 187 THR B CA  1 
ATOM   2910 C C   . THR B 1 187 ? 6.324   0.265   8.316   1.00 30.20 ? 187 THR B C   1 
ATOM   2911 O O   . THR B 1 187 ? 6.013   1.434   8.552   1.00 26.44 ? 187 THR B O   1 
ATOM   2912 C CB  . THR B 1 187 ? 8.629   0.189   9.251   1.00 27.87 ? 187 THR B CB  1 
ATOM   2913 O OG1 . THR B 1 187 ? 9.230   0.036   7.958   1.00 24.05 ? 187 THR B OG1 1 
ATOM   2914 C CG2 . THR B 1 187 ? 9.540   -0.424  10.314  1.00 26.29 ? 187 THR B CG2 1 
ATOM   2915 N N   . GLY B 1 188 ? 5.902   -0.397  7.244   1.00 26.65 ? 188 GLY B N   1 
ATOM   2916 C CA  . GLY B 1 188 ? 5.065   0.233   6.239   1.00 34.99 ? 188 GLY B CA  1 
ATOM   2917 C C   . GLY B 1 188 ? 5.849   1.232   5.409   1.00 33.89 ? 188 GLY B C   1 
ATOM   2918 O O   . GLY B 1 188 ? 5.375   2.336   5.127   1.00 31.29 ? 188 GLY B O   1 
ATOM   2919 N N   . VAL B 1 189 ? 7.056   0.843   5.018   1.00 31.64 ? 189 VAL B N   1 
ATOM   2920 C CA  . VAL B 1 189 ? 7.944   1.736   4.282   1.00 35.32 ? 189 VAL B CA  1 
ATOM   2921 C C   . VAL B 1 189 ? 8.414   1.135   2.961   1.00 33.58 ? 189 VAL B C   1 
ATOM   2922 O O   . VAL B 1 189 ? 8.793   -0.032  2.892   1.00 32.92 ? 189 VAL B O   1 
ATOM   2923 C CB  . VAL B 1 189 ? 9.161   2.139   5.136   1.00 36.08 ? 189 VAL B CB  1 
ATOM   2924 C CG1 . VAL B 1 189 ? 10.164  2.916   4.304   1.00 35.28 ? 189 VAL B CG1 1 
ATOM   2925 C CG2 . VAL B 1 189 ? 8.701   2.960   6.338   1.00 35.81 ? 189 VAL B CG2 1 
ATOM   2926 N N   . HIS B 1 190 ? 8.378   1.956   1.919   1.00 35.81 ? 190 HIS B N   1 
ATOM   2927 C CA  . HIS B 1 190 ? 8.759   1.555   0.571   1.00 41.93 ? 190 HIS B CA  1 
ATOM   2928 C C   . HIS B 1 190 ? 10.209  1.064   0.534   1.00 46.58 ? 190 HIS B C   1 
ATOM   2929 O O   . HIS B 1 190 ? 11.088  1.646   1.169   1.00 40.91 ? 190 HIS B O   1 
ATOM   2930 C CB  . HIS B 1 190 ? 8.568   2.744   -0.378  1.00 50.14 ? 190 HIS B CB  1 
ATOM   2931 C CG  . HIS B 1 190 ? 8.328   2.354   -1.806  1.00 56.19 ? 190 HIS B CG  1 
ATOM   2932 N ND1 . HIS B 1 190 ? 9.138   2.782   -2.834  1.00 61.73 ? 190 HIS B ND1 1 
ATOM   2933 C CD2 . HIS B 1 190 ? 7.369   1.590   -2.370  1.00 58.46 ? 190 HIS B CD2 1 
ATOM   2934 C CE1 . HIS B 1 190 ? 8.687   2.292   -3.979  1.00 63.30 ? 190 HIS B CE1 1 
ATOM   2935 N NE2 . HIS B 1 190 ? 7.613   1.561   -3.720  1.00 66.36 ? 190 HIS B NE2 1 
ATOM   2936 N N   . HIS B 1 191 ? 10.446  -0.010  -0.213  1.00 49.02 ? 191 HIS B N   1 
ATOM   2937 C CA  . HIS B 1 191 ? 11.769  -0.627  -0.310  1.00 49.79 ? 191 HIS B CA  1 
ATOM   2938 C C   . HIS B 1 191 ? 12.893  0.358   -0.640  1.00 47.90 ? 191 HIS B C   1 
ATOM   2939 O O   . HIS B 1 191 ? 14.034  0.167   -0.221  1.00 50.42 ? 191 HIS B O   1 
ATOM   2940 C CB  . HIS B 1 191 ? 11.748  -1.743  -1.356  1.00 56.31 ? 191 HIS B CB  1 
ATOM   2941 C CG  . HIS B 1 191 ? 11.314  -1.287  -2.715  1.00 62.02 ? 191 HIS B CG  1 
ATOM   2942 N ND1 . HIS B 1 191 ? 9.988   -1.156  -3.067  1.00 62.09 ? 191 HIS B ND1 1 
ATOM   2943 C CD2 . HIS B 1 191 ? 12.031  -0.934  -3.809  1.00 64.79 ? 191 HIS B CD2 1 
ATOM   2944 C CE1 . HIS B 1 191 ? 9.906   -0.739  -4.319  1.00 64.75 ? 191 HIS B CE1 1 
ATOM   2945 N NE2 . HIS B 1 191 ? 11.132  -0.597  -4.791  1.00 66.82 ? 191 HIS B NE2 1 
ATOM   2946 N N   . VAL B 1 192 ? 12.568  1.402   -1.397  1.00 51.98 ? 192 VAL B N   1 
ATOM   2947 C CA  . VAL B 1 192 ? 13.572  2.360   -1.846  1.00 45.45 ? 192 VAL B CA  1 
ATOM   2948 C C   . VAL B 1 192 ? 13.989  3.296   -0.723  1.00 43.11 ? 192 VAL B C   1 
ATOM   2949 O O   . VAL B 1 192 ? 15.137  3.734   -0.663  1.00 46.30 ? 192 VAL B O   1 
ATOM   2950 C CB  . VAL B 1 192 ? 13.065  3.203   -3.032  1.00 47.44 ? 192 VAL B CB  1 
ATOM   2951 C CG1 . VAL B 1 192 ? 14.237  3.831   -3.768  1.00 46.99 ? 192 VAL B CG1 1 
ATOM   2952 C CG2 . VAL B 1 192 ? 12.250  2.346   -3.983  1.00 56.41 ? 192 VAL B CG2 1 
ATOM   2953 N N   . THR B 1 193 ? 13.046  3.613   0.158   1.00 43.79 ? 193 THR B N   1 
ATOM   2954 C CA  . THR B 1 193 ? 13.321  4.477   1.300   1.00 42.72 ? 193 THR B CA  1 
ATOM   2955 C C   . THR B 1 193 ? 14.113  3.717   2.358   1.00 38.23 ? 193 THR B C   1 
ATOM   2956 O O   . THR B 1 193 ? 14.950  4.292   3.049   1.00 36.07 ? 193 THR B O   1 
ATOM   2957 C CB  . THR B 1 193 ? 12.021  5.020   1.924   1.00 40.34 ? 193 THR B CB  1 
ATOM   2958 O OG1 . THR B 1 193 ? 11.325  5.814   0.957   1.00 45.06 ? 193 THR B OG1 1 
ATOM   2959 C CG2 . THR B 1 193 ? 12.323  5.872   3.147   1.00 41.09 ? 193 THR B CG2 1 
ATOM   2960 N N   . VAL B 1 194 ? 13.844  2.419   2.470   1.00 35.00 ? 194 VAL B N   1 
ATOM   2961 C CA  . VAL B 1 194 ? 14.547  1.559   3.414   1.00 34.65 ? 194 VAL B CA  1 
ATOM   2962 C C   . VAL B 1 194 ? 16.031  1.458   3.063   1.00 36.17 ? 194 VAL B C   1 
ATOM   2963 O O   . VAL B 1 194 ? 16.890  1.532   3.939   1.00 37.01 ? 194 VAL B O   1 
ATOM   2964 C CB  . VAL B 1 194 ? 13.938  0.149   3.461   1.00 34.58 ? 194 VAL B CB  1 
ATOM   2965 C CG1 . VAL B 1 194 ? 14.742  -0.746  4.390   1.00 36.44 ? 194 VAL B CG1 1 
ATOM   2966 C CG2 . VAL B 1 194 ? 12.481  0.208   3.897   1.00 37.06 ? 194 VAL B CG2 1 
ATOM   2967 N N   . SER B 1 195 ? 16.328  1.284   1.780   1.00 38.72 ? 195 SER B N   1 
ATOM   2968 C CA  . SER B 1 195 ? 17.714  1.256   1.318   1.00 39.73 ? 195 SER B CA  1 
ATOM   2969 C C   . SER B 1 195 ? 18.414  2.577   1.610   1.00 32.19 ? 195 SER B C   1 
ATOM   2970 O O   . SER B 1 195 ? 19.575  2.597   2.015   1.00 36.43 ? 195 SER B O   1 
ATOM   2971 C CB  . SER B 1 195 ? 17.775  0.955   -0.178  1.00 37.50 ? 195 SER B CB  1 
ATOM   2972 O OG  . SER B 1 195 ? 17.466  -0.402  -0.433  1.00 44.06 ? 195 SER B OG  1 
ATOM   2973 N N   . ARG B 1 196 ? 17.695  3.675   1.413   1.00 33.11 ? 196 ARG B N   1 
ATOM   2974 C CA  . ARG B 1 196 ? 18.230  5.004   1.675   1.00 36.71 ? 196 ARG B CA  1 
ATOM   2975 C C   . ARG B 1 196 ? 18.577  5.185   3.151   1.00 36.50 ? 196 ARG B C   1 
ATOM   2976 O O   . ARG B 1 196 ? 19.673  5.640   3.489   1.00 31.07 ? 196 ARG B O   1 
ATOM   2977 C CB  . ARG B 1 196 ? 17.227  6.073   1.241   1.00 37.68 ? 196 ARG B CB  1 
ATOM   2978 C CG  . ARG B 1 196 ? 17.800  7.475   1.156   1.00 43.88 ? 196 ARG B CG  1 
ATOM   2979 C CD  . ARG B 1 196 ? 16.691  8.515   1.108   1.00 49.93 ? 196 ARG B CD  1 
ATOM   2980 N NE  . ARG B 1 196 ? 16.228  8.885   2.444   1.00 54.93 ? 196 ARG B NE  1 
ATOM   2981 C CZ  . ARG B 1 196 ? 15.015  9.362   2.712   1.00 58.58 ? 196 ARG B CZ  1 
ATOM   2982 N NH1 . ARG B 1 196 ? 14.126  9.509   1.739   1.00 59.33 ? 196 ARG B NH1 1 
ATOM   2983 N NH2 . ARG B 1 196 ? 14.684  9.681   3.956   1.00 54.64 ? 196 ARG B NH2 1 
ATOM   2984 N N   . VAL B 1 197 ? 17.636  4.835   4.023   1.00 35.59 ? 197 VAL B N   1 
ATOM   2985 C CA  . VAL B 1 197 ? 17.835  4.952   5.463   1.00 30.65 ? 197 VAL B CA  1 
ATOM   2986 C C   . VAL B 1 197 ? 19.061  4.174   5.924   1.00 30.68 ? 197 VAL B C   1 
ATOM   2987 O O   . VAL B 1 197 ? 19.894  4.690   6.670   1.00 27.64 ? 197 VAL B O   1 
ATOM   2988 C CB  . VAL B 1 197 ? 16.615  4.411   6.241   1.00 30.75 ? 197 VAL B CB  1 
ATOM   2989 C CG1 . VAL B 1 197 ? 16.819  4.601   7.739   1.00 26.47 ? 197 VAL B CG1 1 
ATOM   2990 C CG2 . VAL B 1 197 ? 15.348  5.096   5.778   1.00 29.37 ? 197 VAL B CG2 1 
ATOM   2991 N N   . LEU B 1 198 ? 19.160  2.922   5.490   1.00 30.19 ? 198 LEU B N   1 
ATOM   2992 C CA  . LEU B 1 198 ? 20.275  2.072   5.888   1.00 30.90 ? 198 LEU B CA  1 
ATOM   2993 C C   . LEU B 1 198 ? 21.623  2.589   5.367   1.00 30.75 ? 198 LEU B C   1 
ATOM   2994 O O   . LEU B 1 198 ? 22.634  2.516   6.062   1.00 28.37 ? 198 LEU B O   1 
ATOM   2995 C CB  . LEU B 1 198 ? 20.035  0.625   5.452   1.00 34.77 ? 198 LEU B CB  1 
ATOM   2996 C CG  . LEU B 1 198 ? 18.965  -0.130  6.241   1.00 36.33 ? 198 LEU B CG  1 
ATOM   2997 C CD1 . LEU B 1 198 ? 18.795  -1.550  5.721   1.00 35.29 ? 198 LEU B CD1 1 
ATOM   2998 C CD2 . LEU B 1 198 ? 19.341  -0.145  7.702   1.00 37.08 ? 198 LEU B CD2 1 
ATOM   2999 N N   . ALA B 1 199 ? 21.638  3.108   4.146   1.00 30.98 ? 199 ALA B N   1 
ATOM   3000 C CA  . ALA B 1 199 ? 22.861  3.684   3.596   1.00 34.49 ? 199 ALA B CA  1 
ATOM   3001 C C   . ALA B 1 199 ? 23.264  4.933   4.377   1.00 32.77 ? 199 ALA B C   1 
ATOM   3002 O O   . ALA B 1 199 ? 24.451  5.190   4.592   1.00 31.91 ? 199 ALA B O   1 
ATOM   3003 C CB  . ALA B 1 199 ? 22.680  4.013   2.125   1.00 36.06 ? 199 ALA B CB  1 
ATOM   3004 N N   . SER B 1 200 ? 22.265  5.700   4.804   1.00 30.72 ? 200 SER B N   1 
ATOM   3005 C CA  . SER B 1 200 ? 22.496  6.896   5.607   1.00 29.39 ? 200 SER B CA  1 
ATOM   3006 C C   . SER B 1 200 ? 23.021  6.547   6.998   1.00 29.66 ? 200 SER B C   1 
ATOM   3007 O O   . SER B 1 200 ? 23.970  7.163   7.482   1.00 26.05 ? 200 SER B O   1 
ATOM   3008 C CB  . SER B 1 200 ? 21.205  7.714   5.726   1.00 29.73 ? 200 SER B CB  1 
ATOM   3009 O OG  . SER B 1 200 ? 21.332  8.722   6.715   1.00 32.72 ? 200 SER B OG  1 
ATOM   3010 N N   . LEU B 1 201 ? 22.393  5.564   7.641   1.00 28.88 ? 201 LEU B N   1 
ATOM   3011 C CA  . LEU B 1 201 ? 22.830  5.113   8.961   1.00 27.85 ? 201 LEU B CA  1 
ATOM   3012 C C   . LEU B 1 201 ? 24.267  4.599   8.927   1.00 27.40 ? 201 LEU B C   1 
ATOM   3013 O O   . LEU B 1 201 ? 25.029  4.787   9.876   1.00 27.53 ? 201 LEU B O   1 
ATOM   3014 C CB  . LEU B 1 201 ? 21.902  4.020   9.493   1.00 27.94 ? 201 LEU B CB  1 
ATOM   3015 C CG  . LEU B 1 201 ? 20.537  4.508   9.987   1.00 32.23 ? 201 LEU B CG  1 
ATOM   3016 C CD1 . LEU B 1 201 ? 19.619  3.335   10.306  1.00 24.21 ? 201 LEU B CD1 1 
ATOM   3017 C CD2 . LEU B 1 201 ? 20.705  5.434   11.201  1.00 26.81 ? 201 LEU B CD2 1 
ATOM   3018 N N   . LYS B 1 202 ? 24.621  3.943   7.828   1.00 25.81 ? 202 LYS B N   1 
ATOM   3019 C CA  . LYS B 1 202 ? 25.971  3.428   7.621   1.00 34.14 ? 202 LYS B CA  1 
ATOM   3020 C C   . LYS B 1 202 ? 26.960  4.565   7.374   1.00 30.19 ? 202 LYS B C   1 
ATOM   3021 O O   . LYS B 1 202 ? 28.047  4.597   7.949   1.00 30.12 ? 202 LYS B O   1 
ATOM   3022 C CB  . LYS B 1 202 ? 25.976  2.470   6.429   1.00 35.81 ? 202 LYS B CB  1 
ATOM   3023 C CG  . LYS B 1 202 ? 27.298  1.778   6.167   1.00 36.95 ? 202 LYS B CG  1 
ATOM   3024 C CD  . LYS B 1 202 ? 27.160  0.826   4.985   1.00 42.01 ? 202 LYS B CD  1 
ATOM   3025 C CE  . LYS B 1 202 ? 28.203  -0.278  5.021   1.00 47.01 ? 202 LYS B CE  1 
ATOM   3026 N NZ  . LYS B 1 202 ? 27.871  -1.364  4.049   1.00 55.20 ? 202 LYS B NZ  1 
ATOM   3027 N N   . ARG B 1 203 ? 26.569  5.495   6.511   1.00 32.75 ? 203 ARG B N   1 
ATOM   3028 C CA  . ARG B 1 203 ? 27.411  6.629   6.150   1.00 34.83 ? 203 ARG B CA  1 
ATOM   3029 C C   . ARG B 1 203 ? 27.799  7.450   7.378   1.00 35.83 ? 203 ARG B C   1 
ATOM   3030 O O   . ARG B 1 203 ? 28.906  7.984   7.453   1.00 35.89 ? 203 ARG B O   1 
ATOM   3031 C CB  . ARG B 1 203 ? 26.673  7.516   5.141   1.00 37.60 ? 203 ARG B CB  1 
ATOM   3032 C CG  . ARG B 1 203 ? 27.568  8.173   4.107   1.00 46.62 ? 203 ARG B CG  1 
ATOM   3033 C CD  . ARG B 1 203 ? 28.304  9.374   4.672   1.00 48.10 ? 203 ARG B CD  1 
ATOM   3034 N NE  . ARG B 1 203 ? 27.526  10.604  4.551   1.00 54.88 ? 203 ARG B NE  1 
ATOM   3035 C CZ  . ARG B 1 203 ? 27.994  11.812  4.853   1.00 54.39 ? 203 ARG B CZ  1 
ATOM   3036 N NH1 . ARG B 1 203 ? 29.238  11.950  5.295   1.00 52.06 ? 203 ARG B NH1 1 
ATOM   3037 N NH2 . ARG B 1 203 ? 27.219  12.881  4.712   1.00 53.32 ? 203 ARG B NH2 1 
ATOM   3038 N N   . GLU B 1 204 ? 26.885  7.546   8.341   1.00 32.25 ? 204 GLU B N   1 
ATOM   3039 C CA  . GLU B 1 204 ? 27.106  8.375   9.526   1.00 32.92 ? 204 GLU B CA  1 
ATOM   3040 C C   . GLU B 1 204 ? 27.621  7.601   10.746  1.00 30.46 ? 204 GLU B C   1 
ATOM   3041 O O   . GLU B 1 204 ? 27.609  8.118   11.864  1.00 25.77 ? 204 GLU B O   1 
ATOM   3042 C CB  . GLU B 1 204 ? 25.834  9.149   9.880   1.00 34.09 ? 204 GLU B CB  1 
ATOM   3043 C CG  . GLU B 1 204 ? 25.305  10.005  8.742   1.00 37.89 ? 204 GLU B CG  1 
ATOM   3044 C CD  . GLU B 1 204 ? 26.223  11.168  8.419   1.00 47.78 ? 204 GLU B CD  1 
ATOM   3045 O OE1 . GLU B 1 204 ? 27.025  11.551  9.298   1.00 44.62 ? 204 GLU B OE1 1 
ATOM   3046 O OE2 . GLU B 1 204 ? 26.141  11.699  7.290   1.00 49.48 ? 204 GLU B OE2 1 
ATOM   3047 N N   . ASN B 1 205 ? 28.071  6.367   10.523  1.00 26.08 ? 205 ASN B N   1 
ATOM   3048 C CA  . ASN B 1 205 ? 28.689  5.559   11.575  1.00 27.25 ? 205 ASN B CA  1 
ATOM   3049 C C   . ASN B 1 205 ? 27.765  5.293   12.758  1.00 29.83 ? 205 ASN B C   1 
ATOM   3050 O O   . ASN B 1 205 ? 28.198  5.258   13.907  1.00 29.33 ? 205 ASN B O   1 
ATOM   3051 C CB  . ASN B 1 205 ? 29.990  6.207   12.051  1.00 31.94 ? 205 ASN B CB  1 
ATOM   3052 C CG  . ASN B 1 205 ? 31.044  6.267   10.953  1.00 41.19 ? 205 ASN B CG  1 
ATOM   3053 O OD1 . ASN B 1 205 ? 31.455  5.236   10.406  1.00 35.35 ? 205 ASN B OD1 1 
ATOM   3054 N ND2 . ASN B 1 205 ? 31.481  7.479   10.618  1.00 43.51 ? 205 ASN B ND2 1 
ATOM   3055 N N   . ILE B 1 206 ? 26.483  5.110   12.478  1.00 24.89 ? 206 ILE B N   1 
ATOM   3056 C CA  . ILE B 1 206 ? 25.533  4.867   13.550  1.00 28.16 ? 206 ILE B CA  1 
ATOM   3057 C C   . ILE B 1 206 ? 25.244  3.376   13.669  1.00 25.13 ? 206 ILE B C   1 
ATOM   3058 O O   . ILE B 1 206 ? 25.331  2.804   14.757  1.00 25.96 ? 206 ILE B O   1 
ATOM   3059 C CB  . ILE B 1 206 ? 24.241  5.663   13.335  1.00 27.40 ? 206 ILE B CB  1 
ATOM   3060 C CG1 . ILE B 1 206 ? 24.520  7.158   13.525  1.00 24.77 ? 206 ILE B CG1 1 
ATOM   3061 C CG2 . ILE B 1 206 ? 23.139  5.173   14.282  1.00 24.99 ? 206 ILE B CG2 1 
ATOM   3062 C CD1 . ILE B 1 206 ? 23.417  8.044   12.991  1.00 30.28 ? 206 ILE B CD1 1 
ATOM   3063 N N   . LEU B 1 207 ? 24.947  2.748   12.534  1.00 22.13 ? 207 LEU B N   1 
ATOM   3064 C CA  . LEU B 1 207 ? 24.521  1.356   12.504  1.00 26.22 ? 207 LEU B CA  1 
ATOM   3065 C C   . LEU B 1 207 ? 24.856  0.688   11.166  1.00 28.62 ? 207 LEU B C   1 
ATOM   3066 O O   . LEU B 1 207 ? 24.671  1.275   10.099  1.00 26.05 ? 207 LEU B O   1 
ATOM   3067 C CB  . LEU B 1 207 ? 23.015  1.280   12.799  1.00 26.83 ? 207 LEU B CB  1 
ATOM   3068 C CG  . LEU B 1 207 ? 22.231  -0.023  12.632  1.00 31.24 ? 207 LEU B CG  1 
ATOM   3069 C CD1 . LEU B 1 207 ? 21.015  -0.019  13.556  1.00 32.08 ? 207 LEU B CD1 1 
ATOM   3070 C CD2 . LEU B 1 207 ? 21.797  -0.206  11.188  1.00 23.53 ? 207 LEU B CD2 1 
ATOM   3071 N N   . ASP B 1 208 ? 25.353  -0.545  11.233  1.00 30.64 ? 208 ASP B N   1 
ATOM   3072 C CA  . ASP B 1 208 ? 25.684  -1.319  10.039  1.00 28.24 ? 208 ASP B CA  1 
ATOM   3073 C C   . ASP B 1 208 ? 24.835  -2.590  10.011  1.00 32.73 ? 208 ASP B C   1 
ATOM   3074 O O   . ASP B 1 208 ? 24.897  -3.411  10.926  1.00 30.74 ? 208 ASP B O   1 
ATOM   3075 C CB  . ASP B 1 208 ? 27.175  -1.665  10.020  1.00 29.53 ? 208 ASP B CB  1 
ATOM   3076 C CG  . ASP B 1 208 ? 27.625  -2.246  8.690   1.00 39.18 ? 208 ASP B CG  1 
ATOM   3077 O OD1 . ASP B 1 208 ? 28.747  -2.797  8.623   1.00 39.01 ? 208 ASP B OD1 1 
ATOM   3078 O OD2 . ASP B 1 208 ? 26.860  -2.150  7.711   1.00 32.37 ? 208 ASP B OD2 1 
ATOM   3079 N N   . LYS B 1 209 ? 24.034  -2.741  8.963   1.00 33.60 ? 209 LYS B N   1 
ATOM   3080 C CA  . LYS B 1 209 ? 23.077  -3.837  8.890   1.00 38.88 ? 209 LYS B CA  1 
ATOM   3081 C C   . LYS B 1 209 ? 23.563  -4.909  7.925   1.00 38.52 ? 209 LYS B C   1 
ATOM   3082 O O   . LYS B 1 209 ? 23.316  -4.817  6.725   1.00 39.62 ? 209 LYS B O   1 
ATOM   3083 C CB  . LYS B 1 209 ? 21.708  -3.306  8.447   1.00 38.45 ? 209 LYS B CB  1 
ATOM   3084 C CG  . LYS B 1 209 ? 20.506  -4.013  9.067   1.00 41.23 ? 209 LYS B CG  1 
ATOM   3085 C CD  . LYS B 1 209 ? 19.716  -4.819  8.054   1.00 32.82 ? 209 LYS B CD  1 
ATOM   3086 C CE  . LYS B 1 209 ? 20.507  -5.978  7.513   1.00 38.68 ? 209 LYS B CE  1 
ATOM   3087 N NZ  . LYS B 1 209 ? 19.628  -7.012  6.898   1.00 38.68 ? 209 LYS B NZ  1 
ATOM   3088 N N   . LYS B 1 210 ? 24.253  -5.920  8.451   1.00 38.30 ? 210 LYS B N   1 
ATOM   3089 C CA  . LYS B 1 210 ? 24.723  -7.032  7.625   1.00 36.58 ? 210 LYS B CA  1 
ATOM   3090 C C   . LYS B 1 210 ? 23.661  -8.119  7.467   1.00 45.46 ? 210 LYS B C   1 
ATOM   3091 O O   . LYS B 1 210 ? 22.507  -7.947  7.868   1.00 36.04 ? 210 LYS B O   1 
ATOM   3092 C CB  . LYS B 1 210 ? 25.990  -7.666  8.200   1.00 42.10 ? 210 LYS B CB  1 
ATOM   3093 C CG  . LYS B 1 210 ? 26.961  -6.717  8.876   1.00 43.47 ? 210 LYS B CG  1 
ATOM   3094 C CD  . LYS B 1 210 ? 28.397  -7.133  8.567   1.00 43.34 ? 210 LYS B CD  1 
ATOM   3095 C CE  . LYS B 1 210 ? 29.243  -7.285  9.826   1.00 54.38 ? 210 LYS B CE  1 
ATOM   3096 N NZ  . LYS B 1 210 ? 29.258  -8.695  10.348  1.00 48.54 ? 210 LYS B NZ  1 
ATOM   3097 N N   . LYS B 1 211 ? 24.074  -9.248  6.895   1.00 45.21 ? 211 LYS B N   1 
ATOM   3098 C CA  . LYS B 1 211 ? 23.163  -10.346 6.591   1.00 36.33 ? 211 LYS B CA  1 
ATOM   3099 C C   . LYS B 1 211 ? 22.615  -11.046 7.833   1.00 41.43 ? 211 LYS B C   1 
ATOM   3100 O O   . LYS B 1 211 ? 21.403  -11.226 7.971   1.00 40.92 ? 211 LYS B O   1 
ATOM   3101 C CB  . LYS B 1 211 ? 23.852  -11.360 5.678   1.00 44.12 ? 211 LYS B CB  1 
ATOM   3102 N N   . ASN B 1 212 ? 23.516  -11.447 8.726   1.00 36.98 ? 212 ASN B N   1 
ATOM   3103 C CA  . ASN B 1 212 ? 23.145  -12.204 9.916   1.00 36.38 ? 212 ASN B CA  1 
ATOM   3104 C C   . ASN B 1 212 ? 23.159  -11.342 11.166  1.00 36.05 ? 212 ASN B C   1 
ATOM   3105 O O   . ASN B 1 212 ? 22.706  -11.765 12.228  1.00 34.21 ? 212 ASN B O   1 
ATOM   3106 C CB  . ASN B 1 212 ? 24.112  -13.371 10.120  1.00 40.89 ? 212 ASN B CB  1 
ATOM   3107 C CG  . ASN B 1 212 ? 25.509  -12.905 10.495  1.00 46.95 ? 212 ASN B CG  1 
ATOM   3108 O OD1 . ASN B 1 212 ? 26.045  -11.969 9.896   1.00 48.47 ? 212 ASN B OD1 1 
ATOM   3109 N ND2 . ASN B 1 212 ? 26.105  -13.555 11.494  1.00 47.94 ? 212 ASN B ND2 1 
ATOM   3110 N N   . LYS B 1 213 ? 23.689  -10.131 11.036  1.00 34.60 ? 213 LYS B N   1 
ATOM   3111 C CA  . LYS B 1 213 ? 23.906  -9.279  12.194  1.00 30.73 ? 213 LYS B CA  1 
ATOM   3112 C C   . LYS B 1 213 ? 23.570  -7.823  11.937  1.00 31.32 ? 213 LYS B C   1 
ATOM   3113 O O   . LYS B 1 213 ? 23.630  -7.341  10.806  1.00 34.50 ? 213 LYS B O   1 
ATOM   3114 C CB  . LYS B 1 213 ? 25.365  -9.371  12.650  1.00 37.05 ? 213 LYS B CB  1 
ATOM   3115 C CG  . LYS B 1 213 ? 25.623  -10.326 13.799  1.00 35.87 ? 213 LYS B CG  1 
ATOM   3116 C CD  . LYS B 1 213 ? 27.087  -10.270 14.211  1.00 37.68 ? 213 LYS B CD  1 
ATOM   3117 N N   . ILE B 1 214 ? 23.218  -7.131  13.011  1.00 22.46 ? 214 ILE B N   1 
ATOM   3118 C CA  . ILE B 1 214 ? 23.108  -5.684  13.005  1.00 24.65 ? 214 ILE B CA  1 
ATOM   3119 C C   . ILE B 1 214 ? 24.078  -5.178  14.052  1.00 26.87 ? 214 ILE B C   1 
ATOM   3120 O O   . ILE B 1 214 ? 24.045  -5.620  15.202  1.00 26.93 ? 214 ILE B O   1 
ATOM   3121 C CB  . ILE B 1 214 ? 21.687  -5.230  13.365  1.00 24.63 ? 214 ILE B CB  1 
ATOM   3122 C CG1 . ILE B 1 214 ? 20.702  -5.716  12.297  1.00 29.09 ? 214 ILE B CG1 1 
ATOM   3123 C CG2 . ILE B 1 214 ? 21.639  -3.713  13.530  1.00 24.90 ? 214 ILE B CG2 1 
ATOM   3124 C CD1 . ILE B 1 214 ? 19.340  -6.086  12.837  1.00 29.53 ? 214 ILE B CD1 1 
ATOM   3125 N N   . ILE B 1 215 ? 24.957  -4.271  13.650  1.00 22.97 ? 215 ILE B N   1 
ATOM   3126 C CA  . ILE B 1 215 ? 25.972  -3.741  14.552  1.00 21.89 ? 215 ILE B CA  1 
ATOM   3127 C C   . ILE B 1 215 ? 25.703  -2.274  14.805  1.00 25.68 ? 215 ILE B C   1 
ATOM   3128 O O   . ILE B 1 215 ? 25.772  -1.449  13.893  1.00 23.20 ? 215 ILE B O   1 
ATOM   3129 C CB  . ILE B 1 215 ? 27.388  -3.911  13.973  1.00 22.70 ? 215 ILE B CB  1 
ATOM   3130 C CG1 . ILE B 1 215 ? 27.618  -5.376  13.588  1.00 26.75 ? 215 ILE B CG1 1 
ATOM   3131 C CG2 . ILE B 1 215 ? 28.438  -3.448  14.979  1.00 23.64 ? 215 ILE B CG2 1 
ATOM   3132 C CD1 . ILE B 1 215 ? 28.771  -5.589  12.640  1.00 30.60 ? 215 ILE B CD1 1 
ATOM   3133 N N   . VAL B 1 216 ? 25.379  -1.955  16.048  1.00 21.66 ? 216 VAL B N   1 
ATOM   3134 C CA  . VAL B 1 216 ? 25.111  -0.580  16.426  1.00 21.23 ? 216 VAL B CA  1 
ATOM   3135 C C   . VAL B 1 216 ? 26.381  0.074   16.966  1.00 23.32 ? 216 VAL B C   1 
ATOM   3136 O O   . VAL B 1 216 ? 26.969  -0.391  17.949  1.00 21.10 ? 216 VAL B O   1 
ATOM   3137 C CB  . VAL B 1 216 ? 23.985  -0.487  17.464  1.00 21.92 ? 216 VAL B CB  1 
ATOM   3138 C CG1 . VAL B 1 216 ? 23.654  0.974   17.748  1.00 23.30 ? 216 VAL B CG1 1 
ATOM   3139 C CG2 . VAL B 1 216 ? 22.747  -1.232  16.968  1.00 19.90 ? 216 VAL B CG2 1 
ATOM   3140 N N   . TYR B 1 217 ? 26.799  1.154   16.312  1.00 20.21 ? 217 TYR B N   1 
ATOM   3141 C CA  . TYR B 1 217 ? 28.029  1.849   16.677  1.00 21.63 ? 217 TYR B CA  1 
ATOM   3142 C C   . TYR B 1 217 ? 27.788  3.055   17.574  1.00 23.92 ? 217 TYR B C   1 
ATOM   3143 O O   . TYR B 1 217 ? 28.675  3.475   18.316  1.00 24.05 ? 217 TYR B O   1 
ATOM   3144 C CB  . TYR B 1 217 ? 28.782  2.283   15.418  1.00 25.63 ? 217 TYR B CB  1 
ATOM   3145 C CG  . TYR B 1 217 ? 29.478  1.147   14.717  1.00 25.14 ? 217 TYR B CG  1 
ATOM   3146 C CD1 . TYR B 1 217 ? 28.828  0.396   13.750  1.00 23.73 ? 217 TYR B CD1 1 
ATOM   3147 C CD2 . TYR B 1 217 ? 30.791  0.816   15.033  1.00 29.19 ? 217 TYR B CD2 1 
ATOM   3148 C CE1 . TYR B 1 217 ? 29.476  -0.656  13.109  1.00 26.62 ? 217 TYR B CE1 1 
ATOM   3149 C CE2 . TYR B 1 217 ? 31.443  -0.224  14.400  1.00 25.41 ? 217 TYR B CE2 1 
ATOM   3150 C CZ  . TYR B 1 217 ? 30.783  -0.957  13.439  1.00 30.33 ? 217 TYR B CZ  1 
ATOM   3151 O OH  . TYR B 1 217 ? 31.431  -2.000  12.813  1.00 32.00 ? 217 TYR B OH  1 
ATOM   3152 N N   . ASN B 1 218 ? 26.584  3.609   17.500  1.00 20.32 ? 218 ASN B N   1 
ATOM   3153 C CA  . ASN B 1 218 ? 26.247  4.816   18.240  1.00 24.34 ? 218 ASN B CA  1 
ATOM   3154 C C   . ASN B 1 218 ? 24.821  4.734   18.760  1.00 23.80 ? 218 ASN B C   1 
ATOM   3155 O O   . ASN B 1 218 ? 23.894  5.280   18.153  1.00 21.23 ? 218 ASN B O   1 
ATOM   3156 C CB  . ASN B 1 218 ? 26.404  6.047   17.344  1.00 25.23 ? 218 ASN B CB  1 
ATOM   3157 C CG  . ASN B 1 218 ? 26.413  7.347   18.129  1.00 26.08 ? 218 ASN B CG  1 
ATOM   3158 O OD1 . ASN B 1 218 ? 25.874  7.432   19.234  1.00 24.26 ? 218 ASN B OD1 1 
ATOM   3159 N ND2 . ASN B 1 218 ? 27.045  8.365   17.563  1.00 23.29 ? 218 ASN B ND2 1 
ATOM   3160 N N   . LEU B 1 219 ? 24.646  4.023   19.868  1.00 24.50 ? 219 LEU B N   1 
ATOM   3161 C CA  . LEU B 1 219 ? 23.325  3.820   20.454  1.00 22.07 ? 219 LEU B CA  1 
ATOM   3162 C C   . LEU B 1 219 ? 22.688  5.143   20.887  1.00 25.77 ? 219 LEU B C   1 
ATOM   3163 O O   . LEU B 1 219 ? 21.473  5.324   20.781  1.00 24.52 ? 219 LEU B O   1 
ATOM   3164 C CB  . LEU B 1 219 ? 23.411  2.852   21.643  1.00 22.79 ? 219 LEU B CB  1 
ATOM   3165 C CG  . LEU B 1 219 ? 22.071  2.548   22.333  1.00 27.89 ? 219 LEU B CG  1 
ATOM   3166 C CD1 . LEU B 1 219 ? 21.044  2.082   21.311  1.00 23.90 ? 219 LEU B CD1 1 
ATOM   3167 C CD2 . LEU B 1 219 ? 22.230  1.524   23.453  1.00 26.78 ? 219 LEU B CD2 1 
ATOM   3168 N N   . GLY B 1 220 ? 23.512  6.063   21.379  1.00 22.67 ? 220 GLY B N   1 
ATOM   3169 C CA  . GLY B 1 220 ? 23.034  7.363   21.816  1.00 24.66 ? 220 GLY B CA  1 
ATOM   3170 C C   . GLY B 1 220 ? 22.367  8.135   20.693  1.00 25.09 ? 220 GLY B C   1 
ATOM   3171 O O   . GLY B 1 220 ? 21.281  8.680   20.864  1.00 22.45 ? 220 GLY B O   1 
ATOM   3172 N N   . GLU B 1 221 ? 23.011  8.170   19.531  1.00 23.73 ? 221 GLU B N   1 
ATOM   3173 C CA  . GLU B 1 221 ? 22.476  8.916   18.399  1.00 25.59 ? 221 GLU B CA  1 
ATOM   3174 C C   . GLU B 1 221 ? 21.282  8.203   17.757  1.00 23.85 ? 221 GLU B C   1 
ATOM   3175 O O   . GLU B 1 221 ? 20.335  8.847   17.310  1.00 23.72 ? 221 GLU B O   1 
ATOM   3176 C CB  . GLU B 1 221 ? 23.576  9.195   17.371  1.00 25.78 ? 221 GLU B CB  1 
ATOM   3177 C CG  . GLU B 1 221 ? 23.118  9.957   16.136  1.00 26.92 ? 221 GLU B CG  1 
ATOM   3178 C CD  . GLU B 1 221 ? 22.626  11.366  16.431  1.00 25.30 ? 221 GLU B CD  1 
ATOM   3179 O OE1 . GLU B 1 221 ? 22.584  11.773  17.611  1.00 26.12 ? 221 GLU B OE1 1 
ATOM   3180 O OE2 . GLU B 1 221 ? 22.273  12.071  15.466  1.00 25.78 ? 221 GLU B OE2 1 
ATOM   3181 N N   . LEU B 1 222 ? 21.332  6.875   17.724  1.00 24.76 ? 222 LEU B N   1 
ATOM   3182 C CA  . LEU B 1 222 ? 20.212  6.082   17.229  1.00 25.36 ? 222 LEU B CA  1 
ATOM   3183 C C   . LEU B 1 222 ? 18.967  6.345   18.081  1.00 25.67 ? 222 LEU B C   1 
ATOM   3184 O O   . LEU B 1 222 ? 17.885  6.601   17.557  1.00 27.47 ? 222 LEU B O   1 
ATOM   3185 C CB  . LEU B 1 222 ? 20.562  4.588   17.231  1.00 19.77 ? 222 LEU B CB  1 
ATOM   3186 C CG  . LEU B 1 222 ? 19.397  3.624   16.971  1.00 20.63 ? 222 LEU B CG  1 
ATOM   3187 C CD1 . LEU B 1 222 ? 19.056  3.584   15.497  1.00 24.28 ? 222 LEU B CD1 1 
ATOM   3188 C CD2 . LEU B 1 222 ? 19.711  2.230   17.474  1.00 21.39 ? 222 LEU B CD2 1 
ATOM   3189 N N   . LYS B 1 223 ? 19.134  6.299   19.398  1.00 24.81 ? 223 LYS B N   1 
ATOM   3190 C CA  . LYS B 1 223 ? 18.029  6.526   20.322  1.00 25.48 ? 223 LYS B CA  1 
ATOM   3191 C C   . LYS B 1 223 ? 17.454  7.936   20.160  1.00 29.76 ? 223 LYS B C   1 
ATOM   3192 O O   . LYS B 1 223 ? 16.238  8.120   20.048  1.00 27.96 ? 223 LYS B O   1 
ATOM   3193 C CB  . LYS B 1 223 ? 18.496  6.292   21.762  1.00 24.77 ? 223 LYS B CB  1 
ATOM   3194 C CG  . LYS B 1 223 ? 17.453  6.591   22.828  1.00 31.60 ? 223 LYS B CG  1 
ATOM   3195 C CD  . LYS B 1 223 ? 17.908  6.110   24.194  1.00 32.61 ? 223 LYS B CD  1 
ATOM   3196 C CE  . LYS B 1 223 ? 17.183  6.844   25.306  1.00 35.41 ? 223 LYS B CE  1 
ATOM   3197 N NZ  . LYS B 1 223 ? 15.725  6.588   25.290  1.00 38.54 ? 223 LYS B NZ  1 
ATOM   3198 N N   . HIS B 1 224 ? 18.333  8.930   20.152  1.00 28.63 ? 224 HIS B N   1 
ATOM   3199 C CA  . HIS B 1 224 ? 17.908  10.308  19.957  1.00 27.77 ? 224 HIS B CA  1 
ATOM   3200 C C   . HIS B 1 224 ? 17.122  10.463  18.657  1.00 24.45 ? 224 HIS B C   1 
ATOM   3201 O O   . HIS B 1 224 ? 16.062  11.087  18.638  1.00 29.50 ? 224 HIS B O   1 
ATOM   3202 C CB  . HIS B 1 224 ? 19.112  11.253  19.968  1.00 27.07 ? 224 HIS B CB  1 
ATOM   3203 C CG  . HIS B 1 224 ? 18.839  12.573  19.318  1.00 30.25 ? 224 HIS B CG  1 
ATOM   3204 N ND1 . HIS B 1 224 ? 19.357  12.915  18.088  1.00 29.43 ? 224 HIS B ND1 1 
ATOM   3205 C CD2 . HIS B 1 224 ? 18.085  13.623  19.717  1.00 31.07 ? 224 HIS B CD2 1 
ATOM   3206 C CE1 . HIS B 1 224 ? 18.939  14.129  17.760  1.00 30.82 ? 224 HIS B CE1 1 
ATOM   3207 N NE2 . HIS B 1 224 ? 18.163  14.576  18.732  1.00 35.93 ? 224 HIS B NE2 1 
ATOM   3208 N N   . LEU B 1 225 ? 17.639  9.880   17.579  1.00 20.23 ? 225 LEU B N   1 
ATOM   3209 C CA  . LEU B 1 225 ? 17.006  9.979   16.267  1.00 22.62 ? 225 LEU B CA  1 
ATOM   3210 C C   . LEU B 1 225 ? 15.622  9.316   16.237  1.00 30.77 ? 225 LEU B C   1 
ATOM   3211 O O   . LEU B 1 225 ? 14.737  9.739   15.497  1.00 26.59 ? 225 LEU B O   1 
ATOM   3212 C CB  . LEU B 1 225 ? 17.909  9.374   15.182  1.00 24.93 ? 225 LEU B CB  1 
ATOM   3213 C CG  . LEU B 1 225 ? 19.173  10.148  14.800  1.00 22.85 ? 225 LEU B CG  1 
ATOM   3214 C CD1 . LEU B 1 225 ? 19.987  9.393   13.770  1.00 26.95 ? 225 LEU B CD1 1 
ATOM   3215 C CD2 . LEU B 1 225 ? 18.809  11.526  14.274  1.00 25.39 ? 225 LEU B CD2 1 
ATOM   3216 N N   . SER B 1 226 ? 15.437  8.285   17.054  1.00 23.37 ? 226 SER B N   1 
ATOM   3217 C CA  . SER B 1 226 ? 14.191  7.530   17.051  1.00 24.03 ? 226 SER B CA  1 
ATOM   3218 C C   . SER B 1 226 ? 13.095  8.215   17.868  1.00 29.22 ? 226 SER B C   1 
ATOM   3219 O O   . SER B 1 226 ? 11.927  7.860   17.762  1.00 29.70 ? 226 SER B O   1 
ATOM   3220 C CB  . SER B 1 226 ? 14.423  6.122   17.588  1.00 20.45 ? 226 SER B CB  1 
ATOM   3221 O OG  . SER B 1 226 ? 14.568  6.134   18.994  1.00 24.59 ? 226 SER B OG  1 
ATOM   3222 N N   . GLU B 1 227 ? 13.477  9.195   18.678  1.00 28.66 ? 227 GLU B N   1 
ATOM   3223 C CA  . GLU B 1 227 ? 12.524  9.896   19.525  1.00 32.79 ? 227 GLU B CA  1 
ATOM   3224 C C   . GLU B 1 227 ? 11.990  11.147  18.836  1.00 37.55 ? 227 GLU B C   1 
ATOM   3225 O O   . GLU B 1 227 ? 11.173  11.866  19.402  1.00 42.71 ? 227 GLU B O   1 
ATOM   3226 C CB  . GLU B 1 227 ? 13.166  10.246  20.869  1.00 32.65 ? 227 GLU B CB  1 
ATOM   3227 C CG  . GLU B 1 227 ? 13.332  9.047   21.791  1.00 36.59 ? 227 GLU B CG  1 
ATOM   3228 C CD  . GLU B 1 227 ? 14.473  9.210   22.781  1.00 37.41 ? 227 GLU B CD  1 
ATOM   3229 O OE1 . GLU B 1 227 ? 15.339  10.085  22.568  1.00 32.58 ? 227 GLU B OE1 1 
ATOM   3230 O OE2 . GLU B 1 227 ? 14.503  8.453   23.773  1.00 40.13 ? 227 GLU B OE2 1 
ATOM   3231 N N   . GLN B 1 228 ? 12.451  11.390  17.611  1.00 32.74 ? 228 GLN B N   1 
ATOM   3232 C CA  . GLN B 1 228 ? 11.995  12.539  16.827  1.00 40.43 ? 228 GLN B CA  1 
ATOM   3233 C C   . GLN B 1 228 ? 10.476  12.710  16.885  1.00 40.51 ? 228 GLN B C   1 
ATOM   3234 O O   . GLN B 1 228 ? 9.722   11.815  16.495  1.00 40.55 ? 228 GLN B O   1 
ATOM   3235 C CB  . GLN B 1 228 ? 12.455  12.420  15.371  1.00 38.14 ? 228 GLN B CB  1 
ATOM   3236 C CG  . GLN B 1 228 ? 13.706  13.219  15.032  1.00 37.18 ? 228 GLN B CG  1 
ATOM   3237 C CD  . GLN B 1 228 ? 14.196  12.953  13.614  1.00 44.39 ? 228 GLN B CD  1 
ATOM   3238 O OE1 . GLN B 1 228 ? 14.606  11.836  13.286  1.00 41.25 ? 228 GLN B OE1 1 
ATOM   3239 N NE2 . GLN B 1 228 ? 14.160  13.982  12.766  1.00 37.57 ? 228 GLN B NE2 1 
HETATM 3240 O O   . HOH C 2 .   ? 1.955   11.441  -0.357  1.00 46.50 ? 501 HOH A O   1 
HETATM 3241 O O   . HOH C 2 .   ? -8.448  -11.290 24.524  1.00 21.36 ? 503 HOH A O   1 
HETATM 3242 O O   . HOH C 2 .   ? -1.892  -11.148 22.403  1.00 19.79 ? 504 HOH A O   1 
HETATM 3243 O O   . HOH C 2 .   ? -20.489 11.628  -30.914 1.00 27.53 ? 506 HOH A O   1 
HETATM 3244 O O   . HOH C 2 .   ? -3.233  -16.841 24.455  1.00 24.25 ? 507 HOH A O   1 
HETATM 3245 O O   . HOH C 2 .   ? -5.558  -5.263  23.825  1.00 22.14 ? 511 HOH A O   1 
HETATM 3246 O O   . HOH C 2 .   ? -2.997  -11.222 -14.401 1.00 43.26 ? 512 HOH A O   1 
HETATM 3247 O O   . HOH C 2 .   ? -6.070  -8.755  27.396  1.00 32.41 ? 514 HOH A O   1 
HETATM 3248 O O   . HOH C 2 .   ? 5.073   -21.837 27.383  1.00 41.66 ? 516 HOH A O   1 
HETATM 3249 O O   . HOH C 2 .   ? -8.822  -2.478  -32.345 1.00 30.70 ? 518 HOH A O   1 
HETATM 3250 O O   . HOH C 2 .   ? -11.662 -10.314 16.676  1.00 27.45 ? 521 HOH A O   1 
HETATM 3251 O O   . HOH C 2 .   ? -12.982 2.842   -11.791 1.00 32.52 ? 526 HOH A O   1 
HETATM 3252 O O   . HOH C 2 .   ? -5.827  -4.425  -26.751 1.00 30.31 ? 528 HOH A O   1 
HETATM 3253 O O   . HOH C 2 .   ? -3.259  -19.847 24.750  1.00 33.85 ? 532 HOH A O   1 
HETATM 3254 O O   . HOH C 2 .   ? -4.801  -7.834  25.022  1.00 24.94 ? 534 HOH A O   1 
HETATM 3255 O O   . HOH C 2 .   ? -20.077 8.242   -15.683 1.00 36.87 ? 538 HOH A O   1 
HETATM 3256 O O   . HOH C 2 .   ? 0.438   -6.758  -17.952 1.00 53.81 ? 539 HOH A O   1 
HETATM 3257 O O   . HOH C 2 .   ? -19.125 14.591  -18.888 1.00 39.30 ? 542 HOH A O   1 
HETATM 3258 O O   . HOH C 2 .   ? -9.690  -5.803  -29.772 1.00 30.14 ? 544 HOH A O   1 
HETATM 3259 O O   . HOH C 2 .   ? 1.505   -3.001  26.567  1.00 29.63 ? 547 HOH A O   1 
HETATM 3260 O O   . HOH C 2 .   ? -8.094  -5.745  -26.955 1.00 29.92 ? 548 HOH A O   1 
HETATM 3261 O O   . HOH C 2 .   ? -14.425 -1.641  -33.916 1.00 32.16 ? 549 HOH A O   1 
HETATM 3262 O O   . HOH C 2 .   ? -13.426 10.915  -32.426 1.00 33.60 ? 551 HOH A O   1 
HETATM 3263 O O   . HOH C 2 .   ? -7.640  -1.672  -12.259 1.00 49.04 ? 552 HOH A O   1 
HETATM 3264 O O   . HOH C 2 .   ? 2.474   -0.998  -22.231 1.00 46.55 ? 553 HOH A O   1 
HETATM 3265 O O   . HOH C 2 .   ? -25.553 2.147   -10.967 1.00 48.27 ? 555 HOH A O   1 
HETATM 3266 O O   . HOH C 2 .   ? 1.445   0.721   25.931  1.00 32.37 ? 556 HOH A O   1 
HETATM 3267 O O   . HOH C 2 .   ? -6.334  -2.119  -33.846 1.00 34.21 ? 559 HOH A O   1 
HETATM 3268 O O   . HOH C 2 .   ? -0.698  1.305   20.429  1.00 32.45 ? 562 HOH A O   1 
HETATM 3269 O O   . HOH C 2 .   ? -9.642  -8.364  -25.677 1.00 42.57 ? 563 HOH A O   1 
HETATM 3270 O O   . HOH C 2 .   ? -15.412 -7.075  -25.902 1.00 36.73 ? 567 HOH A O   1 
HETATM 3271 O O   . HOH C 2 .   ? -1.699  -0.569  3.382   1.00 35.20 ? 568 HOH A O   1 
HETATM 3272 O O   . HOH C 2 .   ? 3.054   2.558   27.470  1.00 39.74 ? 569 HOH A O   1 
HETATM 3273 O O   . HOH C 2 .   ? -4.343  -1.599  3.095   1.00 56.15 ? 570 HOH A O   1 
HETATM 3274 O O   . HOH C 2 .   ? -20.349 10.510  -33.103 1.00 36.18 ? 578 HOH A O   1 
HETATM 3275 O O   . HOH C 2 .   ? -7.858  -18.334 25.353  1.00 31.81 ? 579 HOH A O   1 
HETATM 3276 O O   . HOH C 2 .   ? -1.637  -10.403 24.965  1.00 34.07 ? 581 HOH A O   1 
HETATM 3277 O O   . HOH C 2 .   ? 6.320   -13.657 7.264   1.00 45.68 ? 587 HOH A O   1 
HETATM 3278 O O   . HOH C 2 .   ? -3.055  -22.791 20.346  1.00 37.06 ? 590 HOH A O   1 
HETATM 3279 O O   . HOH C 2 .   ? -0.880  -5.824  25.343  1.00 29.60 ? 595 HOH A O   1 
HETATM 3280 O O   . HOH C 2 .   ? 19.598  -12.674 20.354  1.00 35.89 ? 596 HOH A O   1 
HETATM 3281 O O   . HOH C 2 .   ? -9.172  11.706  -7.176  1.00 39.87 ? 597 HOH A O   1 
HETATM 3282 O O   . HOH C 2 .   ? 2.443   -15.116 -17.751 1.00 48.43 ? 598 HOH A O   1 
HETATM 3283 O O   . HOH C 2 .   ? -2.755  -13.536 4.933   1.00 43.11 ? 600 HOH A O   1 
HETATM 3284 O O   . HOH C 2 .   ? -22.163 12.091  -28.778 1.00 39.86 ? 605 HOH A O   1 
HETATM 3285 O O   . HOH C 2 .   ? -10.936 14.267  -13.612 1.00 31.12 ? 606 HOH A O   1 
HETATM 3286 O O   . HOH C 2 .   ? -4.038  -9.494  29.268  1.00 35.70 ? 607 HOH A O   1 
HETATM 3287 O O   . HOH C 2 .   ? -2.860  -22.545 24.383  1.00 40.93 ? 608 HOH A O   1 
HETATM 3288 O O   . HOH C 2 .   ? -22.298 -5.064  -2.600  1.00 47.19 ? 611 HOH A O   1 
HETATM 3289 O O   . HOH C 2 .   ? 1.497   1.664   29.640  1.00 37.28 ? 612 HOH A O   1 
HETATM 3290 O O   . HOH C 2 .   ? -14.864 8.941   -31.555 1.00 38.33 ? 613 HOH A O   1 
HETATM 3291 O O   . HOH C 2 .   ? -2.266  -17.116 27.139  1.00 39.48 ? 615 HOH A O   1 
HETATM 3292 O O   . HOH C 2 .   ? -2.685  5.613   17.049  1.00 39.56 ? 616 HOH A O   1 
HETATM 3293 O O   . HOH C 2 .   ? -0.401  1.320   1.754   1.00 46.50 ? 620 HOH A O   1 
HETATM 3294 O O   . HOH C 2 .   ? -19.060 13.584  -32.001 1.00 38.32 ? 623 HOH A O   1 
HETATM 3295 O O   . HOH C 2 .   ? -0.872  -12.976 3.140   1.00 47.84 ? 624 HOH A O   1 
HETATM 3296 O O   . HOH C 2 .   ? 19.163  -14.937 17.160  1.00 39.79 ? 625 HOH A O   1 
HETATM 3297 O O   . HOH C 2 .   ? -11.628 0.785   -10.326 1.00 39.04 ? 627 HOH A O   1 
HETATM 3298 O O   . HOH C 2 .   ? 2.419   10.339  2.046   1.00 56.22 ? 628 HOH A O   1 
HETATM 3299 O O   . HOH C 2 .   ? 4.153   -12.975 -10.532 1.00 55.34 ? 629 HOH A O   1 
HETATM 3300 O O   . HOH C 2 .   ? -27.184 -0.673  -22.149 1.00 44.78 ? 632 HOH A O   1 
HETATM 3301 O O   . HOH C 2 .   ? -19.189 -3.890  -30.430 1.00 43.02 ? 636 HOH A O   1 
HETATM 3302 O O   . HOH C 2 .   ? -24.280 7.440   -21.698 1.00 47.17 ? 639 HOH A O   1 
HETATM 3303 O O   . HOH C 2 .   ? 3.339   7.014   20.198  1.00 46.23 ? 640 HOH A O   1 
HETATM 3304 O O   . HOH C 2 .   ? -27.385 -6.377  -16.349 1.00 50.47 ? 641 HOH A O   1 
HETATM 3305 O O   . HOH C 2 .   ? -15.085 -15.715 -2.878  1.00 50.46 ? 642 HOH A O   1 
HETATM 3306 O O   . HOH C 2 .   ? -25.281 -12.969 -16.586 1.00 59.12 ? 643 HOH A O   1 
HETATM 3307 O O   . HOH C 2 .   ? -17.665 0.691   -36.519 1.00 35.43 ? 646 HOH A O   1 
HETATM 3308 O O   . HOH C 2 .   ? -3.966  -22.455 18.014  1.00 44.76 ? 649 HOH A O   1 
HETATM 3309 O O   . HOH C 2 .   ? -3.990  1.929   11.287  1.00 38.50 ? 650 HOH A O   1 
HETATM 3310 O O   . HOH C 2 .   ? -6.024  -4.926  8.743   1.00 33.66 ? 651 HOH A O   1 
HETATM 3311 O O   . HOH C 2 .   ? 0.467   -24.685 21.931  1.00 40.92 ? 652 HOH A O   1 
HETATM 3312 O O   . HOH C 2 .   ? -13.928 -7.930  -29.676 1.00 36.86 ? 654 HOH A O   1 
HETATM 3313 O O   . HOH C 2 .   ? 8.767   2.584   20.778  1.00 38.31 ? 655 HOH A O   1 
HETATM 3314 O O   . HOH C 2 .   ? -2.955  -1.056  -20.286 1.00 44.80 ? 656 HOH A O   1 
HETATM 3315 O O   . HOH C 2 .   ? 6.809   -16.023 6.166   1.00 49.23 ? 658 HOH A O   1 
HETATM 3316 O O   . HOH C 2 .   ? -3.800  -0.133  -30.658 1.00 42.93 ? 660 HOH A O   1 
HETATM 3317 O O   . HOH C 2 .   ? 15.193  -12.527 24.678  1.00 42.30 ? 662 HOH A O   1 
HETATM 3318 O O   . HOH C 2 .   ? 8.079   4.343   22.829  1.00 45.59 ? 663 HOH A O   1 
HETATM 3319 O O   . HOH C 2 .   ? 12.807  -14.264 8.854   1.00 42.33 ? 665 HOH A O   1 
HETATM 3320 O O   . HOH C 2 .   ? -13.634 -9.313  -24.877 1.00 42.53 ? 666 HOH A O   1 
HETATM 3321 O O   . HOH C 2 .   ? -23.560 -4.071  -7.731  1.00 49.25 ? 667 HOH A O   1 
HETATM 3322 O O   . HOH C 2 .   ? 0.633   -20.034 29.463  1.00 48.96 ? 668 HOH A O   1 
HETATM 3323 O O   . HOH C 2 .   ? -2.589  -8.118  26.135  1.00 39.55 ? 672 HOH A O   1 
HETATM 3324 O O   . HOH C 2 .   ? -13.373 -16.295 16.982  1.00 41.45 ? 678 HOH A O   1 
HETATM 3325 O O   . HOH C 2 .   ? -24.369 -7.362  -24.411 1.00 45.17 ? 679 HOH A O   1 
HETATM 3326 O O   . HOH C 2 .   ? -16.762 -18.454 -13.105 1.00 42.98 ? 680 HOH A O   1 
HETATM 3327 O O   . HOH D 2 .   ? -7.195  22.412  -32.768 1.00 26.22 ? 502 HOH B O   1 
HETATM 3328 O O   . HOH D 2 .   ? -5.350  23.873  -26.761 1.00 22.00 ? 505 HOH B O   1 
HETATM 3329 O O   . HOH D 2 .   ? 6.498   7.244   -26.167 1.00 29.73 ? 508 HOH B O   1 
HETATM 3330 O O   . HOH D 2 .   ? 26.772  -11.014 19.097  1.00 29.37 ? 509 HOH B O   1 
HETATM 3331 O O   . HOH D 2 .   ? -4.167  16.454  -9.962  1.00 36.79 ? 510 HOH B O   1 
HETATM 3332 O O   . HOH D 2 .   ? 0.786   27.665  -30.683 1.00 30.32 ? 513 HOH B O   1 
HETATM 3333 O O   . HOH D 2 .   ? 24.206  1.062   27.035  1.00 38.49 ? 515 HOH B O   1 
HETATM 3334 O O   . HOH D 2 .   ? 4.704   31.907  -16.053 1.00 29.80 ? 517 HOH B O   1 
HETATM 3335 O O   . HOH D 2 .   ? -12.089 9.630   -34.141 1.00 25.98 ? 519 HOH B O   1 
HETATM 3336 O O   . HOH D 2 .   ? 2.254   -2.705  -1.519  1.00 46.38 ? 520 HOH B O   1 
HETATM 3337 O O   . HOH D 2 .   ? -6.782  11.921  -40.983 1.00 24.28 ? 522 HOH B O   1 
HETATM 3338 O O   . HOH D 2 .   ? 0.955   5.744   -24.861 1.00 27.07 ? 523 HOH B O   1 
HETATM 3339 O O   . HOH D 2 .   ? 23.067  0.587   7.897   1.00 32.26 ? 524 HOH B O   1 
HETATM 3340 O O   . HOH D 2 .   ? 21.445  -3.883  24.981  1.00 23.43 ? 525 HOH B O   1 
HETATM 3341 O O   . HOH D 2 .   ? 20.997  -10.568 19.708  1.00 24.65 ? 527 HOH B O   1 
HETATM 3342 O O   . HOH D 2 .   ? 3.934   7.413   -28.121 1.00 37.38 ? 529 HOH B O   1 
HETATM 3343 O O   . HOH D 2 .   ? -5.608  25.130  -24.120 1.00 24.79 ? 530 HOH B O   1 
HETATM 3344 O O   . HOH D 2 .   ? 8.594   32.393  -18.222 1.00 34.74 ? 531 HOH B O   1 
HETATM 3345 O O   . HOH D 2 .   ? 3.370   11.540  -19.054 1.00 29.96 ? 533 HOH B O   1 
HETATM 3346 O O   . HOH D 2 .   ? 21.470  -1.538  24.054  1.00 31.54 ? 535 HOH B O   1 
HETATM 3347 O O   . HOH D 2 .   ? -6.003  14.436  -41.576 1.00 28.46 ? 536 HOH B O   1 
HETATM 3348 O O   . HOH D 2 .   ? 18.888  -5.535  26.936  1.00 39.03 ? 537 HOH B O   1 
HETATM 3349 O O   . HOH D 2 .   ? -10.667 21.831  -21.863 1.00 25.16 ? 540 HOH B O   1 
HETATM 3350 O O   . HOH D 2 .   ? 5.255   31.350  -25.226 1.00 37.66 ? 541 HOH B O   1 
HETATM 3351 O O   . HOH D 2 .   ? -5.593  27.628  -16.609 1.00 28.34 ? 543 HOH B O   1 
HETATM 3352 O O   . HOH D 2 .   ? 15.234  7.802   5.431   1.00 48.38 ? 545 HOH B O   1 
HETATM 3353 O O   . HOH D 2 .   ? -12.483 22.700  -24.887 1.00 30.08 ? 546 HOH B O   1 
HETATM 3354 O O   . HOH D 2 .   ? 26.050  6.124   22.808  1.00 31.75 ? 550 HOH B O   1 
HETATM 3355 O O   . HOH D 2 .   ? 26.498  9.215   21.485  1.00 37.38 ? 554 HOH B O   1 
HETATM 3356 O O   . HOH D 2 .   ? 31.672  -8.904  24.077  1.00 27.75 ? 557 HOH B O   1 
HETATM 3357 O O   . HOH D 2 .   ? 13.623  -11.014 7.670   1.00 37.67 ? 558 HOH B O   1 
HETATM 3358 O O   . HOH D 2 .   ? 21.189  0.444   1.217   1.00 45.60 ? 560 HOH B O   1 
HETATM 3359 O O   . HOH D 2 .   ? -9.397  25.119  -27.192 1.00 36.55 ? 561 HOH B O   1 
HETATM 3360 O O   . HOH D 2 .   ? 20.036  -7.540  25.260  1.00 32.88 ? 564 HOH B O   1 
HETATM 3361 O O   . HOH D 2 .   ? 8.480   -1.526  24.350  1.00 35.14 ? 565 HOH B O   1 
HETATM 3362 O O   . HOH D 2 .   ? 20.171  9.633   23.310  1.00 30.32 ? 566 HOH B O   1 
HETATM 3363 O O   . HOH D 2 .   ? 13.342  10.559  -29.460 1.00 35.82 ? 571 HOH B O   1 
HETATM 3364 O O   . HOH D 2 .   ? 24.012  -10.750 19.148  1.00 32.24 ? 572 HOH B O   1 
HETATM 3365 O O   . HOH D 2 .   ? -4.297  27.058  -22.671 1.00 30.31 ? 573 HOH B O   1 
HETATM 3366 O O   . HOH D 2 .   ? -6.014  25.409  -18.526 1.00 26.95 ? 574 HOH B O   1 
HETATM 3367 O O   . HOH D 2 .   ? 5.945   9.242   -35.842 1.00 30.64 ? 575 HOH B O   1 
HETATM 3368 O O   . HOH D 2 .   ? 0.129   28.752  -16.514 1.00 31.23 ? 576 HOH B O   1 
HETATM 3369 O O   . HOH D 2 .   ? 6.592   4.515   -34.206 1.00 38.59 ? 577 HOH B O   1 
HETATM 3370 O O   . HOH D 2 .   ? 5.375   5.788   -29.451 1.00 35.77 ? 580 HOH B O   1 
HETATM 3371 O O   . HOH D 2 .   ? -8.955  15.870  -14.366 1.00 33.74 ? 582 HOH B O   1 
HETATM 3372 O O   . HOH D 2 .   ? 17.713  10.250  24.136  1.00 36.26 ? 583 HOH B O   1 
HETATM 3373 O O   . HOH D 2 .   ? -7.016  16.967  -41.252 1.00 37.94 ? 584 HOH B O   1 
HETATM 3374 O O   . HOH D 2 .   ? 4.116   31.245  -20.278 1.00 35.16 ? 585 HOH B O   1 
HETATM 3375 O O   . HOH D 2 .   ? 20.472  -10.302 25.406  1.00 34.83 ? 586 HOH B O   1 
HETATM 3376 O O   . HOH D 2 .   ? -13.435 7.508   -33.330 1.00 33.23 ? 588 HOH B O   1 
HETATM 3377 O O   . HOH D 2 .   ? 4.004   12.550  -16.510 1.00 35.79 ? 589 HOH B O   1 
HETATM 3378 O O   . HOH D 2 .   ? 16.008  23.000  -21.940 1.00 41.70 ? 591 HOH B O   1 
HETATM 3379 O O   . HOH D 2 .   ? 20.566  -8.614  10.060  1.00 35.92 ? 592 HOH B O   1 
HETATM 3380 O O   . HOH D 2 .   ? 5.670   32.316  -18.428 1.00 31.40 ? 593 HOH B O   1 
HETATM 3381 O O   . HOH D 2 .   ? -3.381  24.041  -9.487  1.00 43.57 ? 594 HOH B O   1 
HETATM 3382 O O   . HOH D 2 .   ? 31.919  4.876   16.985  1.00 41.23 ? 599 HOH B O   1 
HETATM 3383 O O   . HOH D 2 .   ? 14.845  6.485   28.183  1.00 40.46 ? 601 HOH B O   1 
HETATM 3384 O O   . HOH D 2 .   ? 14.112  9.736   26.130  1.00 42.04 ? 602 HOH B O   1 
HETATM 3385 O O   . HOH D 2 .   ? 27.625  10.942  12.993  1.00 42.88 ? 603 HOH B O   1 
HETATM 3386 O O   . HOH D 2 .   ? 7.090   29.723  -28.829 1.00 43.67 ? 604 HOH B O   1 
HETATM 3387 O O   . HOH D 2 .   ? 33.765  1.886   26.754  1.00 33.21 ? 609 HOH B O   1 
HETATM 3388 O O   . HOH D 2 .   ? 33.889  -6.139  25.311  1.00 28.94 ? 610 HOH B O   1 
HETATM 3389 O O   . HOH D 2 .   ? 30.138  5.764   15.351  1.00 36.32 ? 614 HOH B O   1 
HETATM 3390 O O   . HOH D 2 .   ? 6.922   8.057   13.080  1.00 37.03 ? 617 HOH B O   1 
HETATM 3391 O O   . HOH D 2 .   ? 7.134   12.539  14.925  1.00 44.20 ? 618 HOH B O   1 
HETATM 3392 O O   . HOH D 2 .   ? 30.552  -2.909  10.429  1.00 41.83 ? 619 HOH B O   1 
HETATM 3393 O O   . HOH D 2 .   ? -3.714  0.425   -15.028 1.00 35.05 ? 621 HOH B O   1 
HETATM 3394 O O   . HOH D 2 .   ? -7.494  14.814  -4.765  1.00 57.66 ? 622 HOH B O   1 
HETATM 3395 O O   . HOH D 2 .   ? 0.492   24.837  -32.365 1.00 35.61 ? 626 HOH B O   1 
HETATM 3396 O O   . HOH D 2 .   ? 2.874   32.702  -22.511 1.00 41.90 ? 630 HOH B O   1 
HETATM 3397 O O   . HOH D 2 .   ? 6.928   6.110   14.676  1.00 35.96 ? 631 HOH B O   1 
HETATM 3398 O O   . HOH D 2 .   ? -6.022  24.692  -29.217 1.00 34.17 ? 633 HOH B O   1 
HETATM 3399 O O   . HOH D 2 .   ? 34.085  -2.867  13.260  1.00 33.56 ? 634 HOH B O   1 
HETATM 3400 O O   . HOH D 2 .   ? -8.745  24.596  -21.608 1.00 38.89 ? 635 HOH B O   1 
HETATM 3401 O O   . HOH D 2 .   ? 19.218  9.845   8.434   1.00 53.31 ? 637 HOH B O   1 
HETATM 3402 O O   . HOH D 2 .   ? 31.099  2.943   19.606  1.00 38.86 ? 638 HOH B O   1 
HETATM 3403 O O   . HOH D 2 .   ? 19.566  -10.037 6.483   1.00 39.96 ? 644 HOH B O   1 
HETATM 3404 O O   . HOH D 2 .   ? -3.220  14.607  -42.421 1.00 38.59 ? 645 HOH B O   1 
HETATM 3405 O O   . HOH D 2 .   ? -9.692  22.633  -31.666 1.00 32.83 ? 647 HOH B O   1 
HETATM 3406 O O   . HOH D 2 .   ? 17.088  10.919  9.698   1.00 49.56 ? 648 HOH B O   1 
HETATM 3407 O O   . HOH D 2 .   ? 11.638  20.395  -29.095 1.00 46.72 ? 653 HOH B O   1 
HETATM 3408 O O   . HOH D 2 .   ? 15.466  -8.173  1.345   1.00 43.98 ? 657 HOH B O   1 
HETATM 3409 O O   . HOH D 2 .   ? -6.319  14.130  -44.192 1.00 32.13 ? 659 HOH B O   1 
HETATM 3410 O O   . HOH D 2 .   ? 17.636  -6.636  0.128   1.00 45.68 ? 661 HOH B O   1 
HETATM 3411 O O   . HOH D 2 .   ? 4.518   5.533   -25.177 1.00 39.66 ? 664 HOH B O   1 
HETATM 3412 O O   . HOH D 2 .   ? 7.126   10.726  1.192   1.00 55.02 ? 669 HOH B O   1 
HETATM 3413 O O   . HOH D 2 .   ? 8.527   8.325   -9.548  1.00 51.52 ? 670 HOH B O   1 
HETATM 3414 O O   . HOH D 2 .   ? 10.837  8.716   -10.892 1.00 49.73 ? 671 HOH B O   1 
HETATM 3415 O O   . HOH D 2 .   ? 5.996   12.019  -14.683 1.00 46.19 ? 673 HOH B O   1 
HETATM 3416 O O   . HOH D 2 .   ? 32.869  6.308   14.085  1.00 43.20 ? 674 HOH B O   1 
HETATM 3417 O O   . HOH D 2 .   ? 20.399  -0.707  26.192  1.00 45.90 ? 675 HOH B O   1 
HETATM 3418 O O   . HOH D 2 .   ? 11.646  13.437  11.679  1.00 49.40 ? 676 HOH B O   1 
HETATM 3419 O O   . HOH D 2 .   ? 30.403  10.871  3.015   1.00 55.50 ? 677 HOH B O   1 
HETATM 3420 O O   . HOH D 2 .   ? 6.584   28.319  -31.088 1.00 44.75 ? 681 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   VAL 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   LYS 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   ?   ?   ?   A . n 
A 1 10  PHE 10  10  ?   ?   ?   A . n 
A 1 11  CYS 11  11  ?   ?   ?   A . n 
A 1 12  GLY 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  ILE 14  14  ?   ?   ?   A . n 
A 1 15  ILE 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  ASP 17  17  ?   ?   ?   A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  MET 45  45  45  MET MET A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  MET 99  99  99  MET MET A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 MET 122 122 122 MET MET A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 PHE 127 127 127 PHE PHE A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ALA 142 142 ?   ?   ?   A . n 
A 1 143 GLU 143 143 ?   ?   ?   A . n 
A 1 144 MET 144 144 ?   ?   ?   A . n 
A 1 145 ASN 145 145 ?   ?   ?   A . n 
A 1 146 THR 146 146 ?   ?   ?   A . n 
A 1 147 TYR 147 147 ?   ?   ?   A . n 
A 1 148 ASN 148 148 ?   ?   ?   A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 TYR 158 158 158 TYR TYR A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 HIS 191 191 191 HIS HIS A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 ARG 203 203 203 ARG ARG A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 ILE 214 214 214 ILE ILE A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 VAL 216 216 216 VAL VAL A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLU 227 227 ?   ?   ?   A . n 
A 1 228 GLN 228 228 ?   ?   ?   A . n 
A 1 229 THR 229 229 ?   ?   ?   A . n 
A 1 230 SER 230 230 ?   ?   ?   A . n 
A 1 231 TYR 231 231 ?   ?   ?   A . n 
A 1 232 TYR 232 232 ?   ?   ?   A . n 
A 1 233 SER 233 233 ?   ?   ?   A . n 
A 1 234 ASP 234 234 ?   ?   ?   A . n 
A 1 235 PRO 235 235 ?   ?   ?   A . n 
A 1 236 ASN 236 236 ?   ?   ?   A . n 
A 1 237 SER 237 237 ?   ?   ?   A . n 
A 1 238 SER 238 238 ?   ?   ?   A . n 
A 1 239 SER 239 239 ?   ?   ?   A . n 
A 1 240 VAL 240 240 ?   ?   ?   A . n 
A 1 241 ASP 241 241 ?   ?   ?   A . n 
A 1 242 LYS 242 242 ?   ?   ?   A . n 
A 1 243 LEU 243 243 ?   ?   ?   A . n 
A 1 244 ALA 244 244 ?   ?   ?   A . n 
A 1 245 ALA 245 245 ?   ?   ?   A . n 
A 1 246 ALA 246 246 ?   ?   ?   A . n 
A 1 247 LEU 247 247 ?   ?   ?   A . n 
A 1 248 ASP 248 248 ?   ?   ?   A . n 
A 1 249 HIS 249 249 ?   ?   ?   A . n 
A 1 250 HIS 250 250 ?   ?   ?   A . n 
B 1 1   MET 1   0   ?   ?   ?   B . n 
B 1 2   SER 2   1   ?   ?   ?   B . n 
B 1 3   VAL 3   2   ?   ?   ?   B . n 
B 1 4   GLU 4   3   ?   ?   ?   B . n 
B 1 5   GLY 5   4   ?   ?   ?   B . n 
B 1 6   LEU 6   5   ?   ?   ?   B . n 
B 1 7   GLY 7   6   ?   ?   ?   B . n 
B 1 8   LYS 8   7   ?   ?   ?   B . n 
B 1 9   ASP 9   8   ?   ?   ?   B . n 
B 1 10  PHE 10  9   ?   ?   ?   B . n 
B 1 11  CYS 11  10  ?   ?   ?   B . n 
B 1 12  GLY 12  11  ?   ?   ?   B . n 
B 1 13  ALA 13  12  ?   ?   ?   B . n 
B 1 14  ILE 14  13  ?   ?   ?   B . n 
B 1 15  ILE 15  14  ?   ?   ?   B . n 
B 1 16  PRO 16  15  ?   ?   ?   B . n 
B 1 17  ASP 17  16  ?   ?   ?   B . n 
B 1 18  ASN 18  17  ?   ?   ?   B . n 
B 1 19  PHE 19  18  18  PHE PHE B . n 
B 1 20  PHE 20  19  19  PHE PHE B . n 
B 1 21  PRO 21  20  20  PRO PRO B . n 
B 1 22  ILE 22  21  21  ILE ILE B . n 
B 1 23  GLU 23  22  22  GLU GLU B . n 
B 1 24  LYS 24  23  23  LYS LYS B . n 
B 1 25  LEU 25  24  24  LEU LEU B . n 
B 1 26  ARG 26  25  25  ARG ARG B . n 
B 1 27  ASN 27  26  26  ASN ASN B . n 
B 1 28  TYR 28  27  27  TYR TYR B . n 
B 1 29  THR 29  28  28  THR THR B . n 
B 1 30  GLN 30  29  29  GLN GLN B . n 
B 1 31  MET 31  30  30  MET MET B . n 
B 1 32  GLY 32  31  31  GLY GLY B . n 
B 1 33  LEU 33  32  32  LEU LEU B . n 
B 1 34  ILE 34  33  33  ILE ILE B . n 
B 1 35  ARG 35  34  34  ARG ARG B . n 
B 1 36  ASP 36  35  35  ASP ASP B . n 
B 1 37  PHE 37  36  36  PHE PHE B . n 
B 1 38  ALA 38  37  37  ALA ALA B . n 
B 1 39  LYS 39  38  38  LYS LYS B . n 
B 1 40  GLY 40  39  39  GLY GLY B . n 
B 1 41  SER 41  40  40  SER SER B . n 
B 1 42  ALA 42  41  41  ALA ALA B . n 
B 1 43  VAL 43  42  42  VAL VAL B . n 
B 1 44  ILE 44  43  43  ILE ILE B . n 
B 1 45  MET 45  44  44  MET MET B . n 
B 1 46  PRO 46  45  45  PRO PRO B . n 
B 1 47  GLY 47  46  46  GLY GLY B . n 
B 1 48  GLU 48  47  47  GLU GLU B . n 
B 1 49  GLU 49  48  48  GLU GLU B . n 
B 1 50  ILE 50  49  49  ILE ILE B . n 
B 1 51  THR 51  50  50  THR THR B . n 
B 1 52  SER 52  51  51  SER SER B . n 
B 1 53  MET 53  52  52  MET MET B . n 
B 1 54  ILE 54  53  53  ILE ILE B . n 
B 1 55  PHE 55  54  54  PHE PHE B . n 
B 1 56  LEU 56  55  55  LEU LEU B . n 
B 1 57  VAL 57  56  56  VAL VAL B . n 
B 1 58  GLU 58  57  57  GLU GLU B . n 
B 1 59  GLY 59  58  58  GLY GLY B . n 
B 1 60  LYS 60  59  59  LYS LYS B . n 
B 1 61  ILE 61  60  60  ILE ILE B . n 
B 1 62  LYS 62  61  61  LYS LYS B . n 
B 1 63  LEU 63  62  62  LEU LEU B . n 
B 1 64  ASP 64  63  63  ASP ASP B . n 
B 1 65  ILE 65  64  64  ILE ILE B . n 
B 1 66  ILE 66  65  65  ILE ILE B . n 
B 1 67  PHE 67  66  66  PHE PHE B . n 
B 1 68  GLU 68  67  67  GLU GLU B . n 
B 1 69  ASP 69  68  68  ASP ASP B . n 
B 1 70  GLY 70  69  69  GLY GLY B . n 
B 1 71  SER 71  70  70  SER SER B . n 
B 1 72  GLU 72  71  71  GLU GLU B . n 
B 1 73  LYS 73  72  72  LYS LYS B . n 
B 1 74  LEU 74  73  73  LEU LEU B . n 
B 1 75  LEU 75  74  74  LEU LEU B . n 
B 1 76  TYR 76  75  75  TYR TYR B . n 
B 1 77  TYR 77  76  76  TYR TYR B . n 
B 1 78  ALA 78  77  77  ALA ALA B . n 
B 1 79  GLY 79  78  78  GLY GLY B . n 
B 1 80  GLY 80  79  79  GLY GLY B . n 
B 1 81  ASN 81  80  80  ASN ASN B . n 
B 1 82  SER 82  81  81  SER SER B . n 
B 1 83  LEU 83  82  82  LEU LEU B . n 
B 1 84  ILE 84  83  83  ILE ILE B . n 
B 1 85  GLY 85  84  84  GLY GLY B . n 
B 1 86  LYS 86  85  85  LYS LYS B . n 
B 1 87  LEU 87  86  86  LEU LEU B . n 
B 1 88  TYR 88  87  87  TYR TYR B . n 
B 1 89  PRO 89  88  88  PRO PRO B . n 
B 1 90  THR 90  89  89  THR THR B . n 
B 1 91  GLY 91  90  90  GLY GLY B . n 
B 1 92  ASN 92  91  91  ASN ASN B . n 
B 1 93  ASN 93  92  92  ASN ASN B . n 
B 1 94  ILE 94  93  93  ILE ILE B . n 
B 1 95  TYR 95  94  94  TYR TYR B . n 
B 1 96  ALA 96  95  95  ALA ALA B . n 
B 1 97  THR 97  96  96  THR THR B . n 
B 1 98  ALA 98  97  97  ALA ALA B . n 
B 1 99  MET 99  98  98  MET MET B . n 
B 1 100 GLU 100 99  99  GLU GLU B . n 
B 1 101 PRO 101 100 100 PRO PRO B . n 
B 1 102 THR 102 101 101 THR THR B . n 
B 1 103 ARG 103 102 102 ARG ARG B . n 
B 1 104 THR 104 103 103 THR THR B . n 
B 1 105 CYS 105 104 104 CYS CYS B . n 
B 1 106 TRP 106 105 105 TRP TRP B . n 
B 1 107 PHE 107 106 106 PHE PHE B . n 
B 1 108 SER 108 107 107 SER SER B . n 
B 1 109 GLU 109 108 108 GLU GLU B . n 
B 1 110 LYS 110 109 109 LYS LYS B . n 
B 1 111 SER 111 110 110 SER SER B . n 
B 1 112 LEU 112 111 111 LEU LEU B . n 
B 1 113 ARG 113 112 112 ARG ARG B . n 
B 1 114 THR 114 113 113 THR THR B . n 
B 1 115 VAL 115 114 114 VAL VAL B . n 
B 1 116 PHE 116 115 115 PHE PHE B . n 
B 1 117 ARG 117 116 116 ARG ARG B . n 
B 1 118 THR 118 117 117 THR THR B . n 
B 1 119 ASP 119 118 118 ASP ASP B . n 
B 1 120 GLU 120 119 119 GLU GLU B . n 
B 1 121 ASP 121 120 120 ASP ASP B . n 
B 1 122 MET 122 121 121 MET MET B . n 
B 1 123 ILE 123 122 122 ILE ILE B . n 
B 1 124 PHE 124 123 123 PHE PHE B . n 
B 1 125 GLU 125 124 124 GLU GLU B . n 
B 1 126 ILE 126 125 125 ILE ILE B . n 
B 1 127 PHE 127 126 126 PHE PHE B . n 
B 1 128 LYS 128 127 127 LYS LYS B . n 
B 1 129 ASN 129 128 128 ASN ASN B . n 
B 1 130 TYR 130 129 129 TYR TYR B . n 
B 1 131 LEU 131 130 130 LEU LEU B . n 
B 1 132 THR 132 131 131 THR THR B . n 
B 1 133 LYS 133 132 132 LYS LYS B . n 
B 1 134 VAL 134 133 133 VAL VAL B . n 
B 1 135 ALA 135 134 134 ALA ALA B . n 
B 1 136 TYR 136 135 135 TYR TYR B . n 
B 1 137 TYR 137 136 136 TYR TYR B . n 
B 1 138 ALA 138 137 137 ALA ALA B . n 
B 1 139 ARG 139 138 138 ARG ARG B . n 
B 1 140 GLN 140 139 139 GLN GLN B . n 
B 1 141 VAL 141 140 140 VAL VAL B . n 
B 1 142 ALA 142 142 ?   ?   ?   B . n 
B 1 143 GLU 143 143 ?   ?   ?   B . n 
B 1 144 MET 144 144 ?   ?   ?   B . n 
B 1 145 ASN 145 145 ?   ?   ?   B . n 
B 1 146 THR 146 146 ?   ?   ?   B . n 
B 1 147 TYR 147 147 ?   ?   ?   B . n 
B 1 148 ASN 148 148 ?   ?   ?   B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 ILE 151 151 151 ILE ILE B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 LEU 154 154 154 LEU LEU B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 PHE 157 157 157 PHE PHE B . n 
B 1 158 TYR 158 158 158 TYR TYR B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 CYS 161 161 161 CYS CYS B . n 
B 1 162 SER 162 162 162 SER SER B . n 
B 1 163 SER 163 163 163 SER SER B . n 
B 1 164 GLN 164 164 164 GLN GLN B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 ARG 167 167 167 ARG ARG B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASP 170 170 170 ASP ASP B . n 
B 1 171 THR 171 171 171 THR THR B . n 
B 1 172 TYR 172 172 172 TYR TYR B . n 
B 1 173 GLU 173 173 173 GLU GLU B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 MET 176 176 176 MET MET B . n 
B 1 177 PRO 177 177 177 PRO PRO B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 GLN 180 180 180 GLN GLN B . n 
B 1 181 LYS 181 181 181 LYS LYS B . n 
B 1 182 SER 182 182 182 SER SER B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 GLY 184 184 184 GLY GLY B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ILE 186 186 186 ILE ILE B . n 
B 1 187 THR 187 187 187 THR THR B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 VAL 189 189 189 VAL VAL B . n 
B 1 190 HIS 190 190 190 HIS HIS B . n 
B 1 191 HIS 191 191 191 HIS HIS B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 LEU 201 201 201 LEU LEU B . n 
B 1 202 LYS 202 202 202 LYS LYS B . n 
B 1 203 ARG 203 203 203 ARG ARG B . n 
B 1 204 GLU 204 204 204 GLU GLU B . n 
B 1 205 ASN 205 205 205 ASN ASN B . n 
B 1 206 ILE 206 206 206 ILE ILE B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 LYS 209 209 209 LYS LYS B . n 
B 1 210 LYS 210 210 210 LYS LYS B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 ASN 212 212 212 ASN ASN B . n 
B 1 213 LYS 213 213 213 LYS LYS B . n 
B 1 214 ILE 214 214 214 ILE ILE B . n 
B 1 215 ILE 215 215 215 ILE ILE B . n 
B 1 216 VAL 216 216 216 VAL VAL B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 ASN 218 218 218 ASN ASN B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 LEU 222 222 222 LEU LEU B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 HIS 224 224 224 HIS HIS B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 SER 226 226 226 SER SER B . n 
B 1 227 GLU 227 227 227 GLU GLU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 THR 229 229 ?   ?   ?   B . n 
B 1 230 SER 230 230 ?   ?   ?   B . n 
B 1 231 TYR 231 231 ?   ?   ?   B . n 
B 1 232 TYR 232 232 ?   ?   ?   B . n 
B 1 233 SER 233 233 ?   ?   ?   B . n 
B 1 234 ASP 234 234 ?   ?   ?   B . n 
B 1 235 PRO 235 235 ?   ?   ?   B . n 
B 1 236 ASN 236 236 ?   ?   ?   B . n 
B 1 237 SER 237 237 ?   ?   ?   B . n 
B 1 238 SER 238 238 ?   ?   ?   B . n 
B 1 239 SER 239 239 ?   ?   ?   B . n 
B 1 240 VAL 240 240 ?   ?   ?   B . n 
B 1 241 ASP 241 241 ?   ?   ?   B . n 
B 1 242 LYS 242 242 ?   ?   ?   B . n 
B 1 243 LEU 243 243 ?   ?   ?   B . n 
B 1 244 ALA 244 244 ?   ?   ?   B . n 
B 1 245 ALA 245 245 ?   ?   ?   B . n 
B 1 246 ALA 246 246 ?   ?   ?   B . n 
B 1 247 LEU 247 247 ?   ?   ?   B . n 
B 1 248 ASP 248 248 ?   ?   ?   B . n 
B 1 249 HIS 249 249 ?   ?   ?   B . n 
B 1 250 HIS 250 250 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  501 501 HOH HOH A . 
C 2 HOH 2  503 503 HOH HOH A . 
C 2 HOH 3  504 504 HOH HOH A . 
C 2 HOH 4  506 506 HOH HOH A . 
C 2 HOH 5  507 507 HOH HOH A . 
C 2 HOH 6  511 511 HOH HOH A . 
C 2 HOH 7  512 512 HOH HOH A . 
C 2 HOH 8  514 514 HOH HOH A . 
C 2 HOH 9  516 516 HOH HOH A . 
C 2 HOH 10 518 518 HOH HOH A . 
C 2 HOH 11 521 521 HOH HOH A . 
C 2 HOH 12 526 526 HOH HOH A . 
C 2 HOH 13 528 528 HOH HOH A . 
C 2 HOH 14 532 532 HOH HOH A . 
C 2 HOH 15 534 534 HOH HOH A . 
C 2 HOH 16 538 538 HOH HOH A . 
C 2 HOH 17 539 539 HOH HOH A . 
C 2 HOH 18 542 542 HOH HOH A . 
C 2 HOH 19 544 544 HOH HOH A . 
C 2 HOH 20 547 547 HOH HOH A . 
C 2 HOH 21 548 548 HOH HOH A . 
C 2 HOH 22 549 549 HOH HOH A . 
C 2 HOH 23 551 551 HOH HOH A . 
C 2 HOH 24 552 552 HOH HOH A . 
C 2 HOH 25 553 553 HOH HOH A . 
C 2 HOH 26 555 555 HOH HOH A . 
C 2 HOH 27 556 556 HOH HOH A . 
C 2 HOH 28 559 559 HOH HOH A . 
C 2 HOH 29 562 562 HOH HOH A . 
C 2 HOH 30 563 563 HOH HOH A . 
C 2 HOH 31 567 567 HOH HOH A . 
C 2 HOH 32 568 568 HOH HOH A . 
C 2 HOH 33 569 569 HOH HOH A . 
C 2 HOH 34 570 570 HOH HOH A . 
C 2 HOH 35 578 578 HOH HOH A . 
C 2 HOH 36 579 579 HOH HOH A . 
C 2 HOH 37 581 581 HOH HOH A . 
C 2 HOH 38 587 587 HOH HOH A . 
C 2 HOH 39 590 590 HOH HOH A . 
C 2 HOH 40 595 595 HOH HOH A . 
C 2 HOH 41 596 596 HOH HOH A . 
C 2 HOH 42 597 597 HOH HOH A . 
C 2 HOH 43 598 598 HOH HOH A . 
C 2 HOH 44 600 600 HOH HOH A . 
C 2 HOH 45 605 605 HOH HOH A . 
C 2 HOH 46 606 606 HOH HOH A . 
C 2 HOH 47 607 607 HOH HOH A . 
C 2 HOH 48 608 608 HOH HOH A . 
C 2 HOH 49 611 611 HOH HOH A . 
C 2 HOH 50 612 612 HOH HOH A . 
C 2 HOH 51 613 613 HOH HOH A . 
C 2 HOH 52 615 615 HOH HOH A . 
C 2 HOH 53 616 616 HOH HOH A . 
C 2 HOH 54 620 620 HOH HOH A . 
C 2 HOH 55 623 623 HOH HOH A . 
C 2 HOH 56 624 624 HOH HOH A . 
C 2 HOH 57 625 625 HOH HOH A . 
C 2 HOH 58 627 627 HOH HOH A . 
C 2 HOH 59 628 628 HOH HOH A . 
C 2 HOH 60 629 629 HOH HOH A . 
C 2 HOH 61 632 632 HOH HOH A . 
C 2 HOH 62 636 636 HOH HOH A . 
C 2 HOH 63 639 639 HOH HOH A . 
C 2 HOH 64 640 640 HOH HOH A . 
C 2 HOH 65 641 641 HOH HOH A . 
C 2 HOH 66 642 642 HOH HOH A . 
C 2 HOH 67 643 643 HOH HOH A . 
C 2 HOH 68 646 646 HOH HOH A . 
C 2 HOH 69 649 649 HOH HOH A . 
C 2 HOH 70 650 650 HOH HOH A . 
C 2 HOH 71 651 651 HOH HOH A . 
C 2 HOH 72 652 652 HOH HOH A . 
C 2 HOH 73 654 654 HOH HOH A . 
C 2 HOH 74 655 655 HOH HOH A . 
C 2 HOH 75 656 656 HOH HOH A . 
C 2 HOH 76 658 658 HOH HOH A . 
C 2 HOH 77 660 660 HOH HOH A . 
C 2 HOH 78 662 662 HOH HOH A . 
C 2 HOH 79 663 663 HOH HOH A . 
C 2 HOH 80 665 665 HOH HOH A . 
C 2 HOH 81 666 666 HOH HOH A . 
C 2 HOH 82 667 667 HOH HOH A . 
C 2 HOH 83 668 668 HOH HOH A . 
C 2 HOH 84 672 672 HOH HOH A . 
C 2 HOH 85 678 678 HOH HOH A . 
C 2 HOH 86 679 679 HOH HOH A . 
C 2 HOH 87 680 680 HOH HOH A . 
D 2 HOH 1  502 502 HOH HOH B . 
D 2 HOH 2  505 505 HOH HOH B . 
D 2 HOH 3  508 508 HOH HOH B . 
D 2 HOH 4  509 509 HOH HOH B . 
D 2 HOH 5  510 510 HOH HOH B . 
D 2 HOH 6  513 513 HOH HOH B . 
D 2 HOH 7  515 515 HOH HOH B . 
D 2 HOH 8  517 517 HOH HOH B . 
D 2 HOH 9  519 519 HOH HOH B . 
D 2 HOH 10 520 520 HOH HOH B . 
D 2 HOH 11 522 522 HOH HOH B . 
D 2 HOH 12 523 523 HOH HOH B . 
D 2 HOH 13 524 524 HOH HOH B . 
D 2 HOH 14 525 525 HOH HOH B . 
D 2 HOH 15 527 527 HOH HOH B . 
D 2 HOH 16 529 529 HOH HOH B . 
D 2 HOH 17 530 530 HOH HOH B . 
D 2 HOH 18 531 531 HOH HOH B . 
D 2 HOH 19 533 533 HOH HOH B . 
D 2 HOH 20 535 535 HOH HOH B . 
D 2 HOH 21 536 536 HOH HOH B . 
D 2 HOH 22 537 537 HOH HOH B . 
D 2 HOH 23 540 540 HOH HOH B . 
D 2 HOH 24 541 541 HOH HOH B . 
D 2 HOH 25 543 543 HOH HOH B . 
D 2 HOH 26 545 545 HOH HOH B . 
D 2 HOH 27 546 546 HOH HOH B . 
D 2 HOH 28 550 550 HOH HOH B . 
D 2 HOH 29 554 554 HOH HOH B . 
D 2 HOH 30 557 557 HOH HOH B . 
D 2 HOH 31 558 558 HOH HOH B . 
D 2 HOH 32 560 560 HOH HOH B . 
D 2 HOH 33 561 561 HOH HOH B . 
D 2 HOH 34 564 564 HOH HOH B . 
D 2 HOH 35 565 565 HOH HOH B . 
D 2 HOH 36 566 566 HOH HOH B . 
D 2 HOH 37 571 571 HOH HOH B . 
D 2 HOH 38 572 572 HOH HOH B . 
D 2 HOH 39 573 573 HOH HOH B . 
D 2 HOH 40 574 574 HOH HOH B . 
D 2 HOH 41 575 575 HOH HOH B . 
D 2 HOH 42 576 576 HOH HOH B . 
D 2 HOH 43 577 577 HOH HOH B . 
D 2 HOH 44 580 580 HOH HOH B . 
D 2 HOH 45 582 582 HOH HOH B . 
D 2 HOH 46 583 583 HOH HOH B . 
D 2 HOH 47 584 584 HOH HOH B . 
D 2 HOH 48 585 585 HOH HOH B . 
D 2 HOH 49 586 586 HOH HOH B . 
D 2 HOH 50 588 588 HOH HOH B . 
D 2 HOH 51 589 589 HOH HOH B . 
D 2 HOH 52 591 591 HOH HOH B . 
D 2 HOH 53 592 592 HOH HOH B . 
D 2 HOH 54 593 593 HOH HOH B . 
D 2 HOH 55 594 594 HOH HOH B . 
D 2 HOH 56 599 599 HOH HOH B . 
D 2 HOH 57 601 601 HOH HOH B . 
D 2 HOH 58 602 602 HOH HOH B . 
D 2 HOH 59 603 603 HOH HOH B . 
D 2 HOH 60 604 604 HOH HOH B . 
D 2 HOH 61 609 609 HOH HOH B . 
D 2 HOH 62 610 610 HOH HOH B . 
D 2 HOH 63 614 614 HOH HOH B . 
D 2 HOH 64 617 617 HOH HOH B . 
D 2 HOH 65 618 618 HOH HOH B . 
D 2 HOH 66 619 619 HOH HOH B . 
D 2 HOH 67 621 621 HOH HOH B . 
D 2 HOH 68 622 622 HOH HOH B . 
D 2 HOH 69 626 626 HOH HOH B . 
D 2 HOH 70 630 630 HOH HOH B . 
D 2 HOH 71 631 631 HOH HOH B . 
D 2 HOH 72 633 633 HOH HOH B . 
D 2 HOH 73 634 634 HOH HOH B . 
D 2 HOH 74 635 635 HOH HOH B . 
D 2 HOH 75 637 637 HOH HOH B . 
D 2 HOH 76 638 638 HOH HOH B . 
D 2 HOH 77 644 644 HOH HOH B . 
D 2 HOH 78 645 645 HOH HOH B . 
D 2 HOH 79 647 647 HOH HOH B . 
D 2 HOH 80 648 648 HOH HOH B . 
D 2 HOH 81 653 653 HOH HOH B . 
D 2 HOH 82 657 657 HOH HOH B . 
D 2 HOH 83 659 659 HOH HOH B . 
D 2 HOH 84 661 661 HOH HOH B . 
D 2 HOH 85 664 664 HOH HOH B . 
D 2 HOH 86 669 669 HOH HOH B . 
D 2 HOH 87 670 670 HOH HOH B . 
D 2 HOH 88 671 671 HOH HOH B . 
D 2 HOH 89 673 673 HOH HOH B . 
D 2 HOH 90 674 674 HOH HOH B . 
D 2 HOH 91 675 675 HOH HOH B . 
D 2 HOH 92 676 676 HOH HOH B . 
D 2 HOH 93 677 677 HOH HOH B . 
D 2 HOH 94 681 681 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4810  ? 
1 MORE         -34   ? 
1 'SSA (A^2)'  20040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-30 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2         
2 3 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX      .     ?               package 'Paul D. Adams' PDAdams@lbl.gov       refinement        http://www.phenix-online.org/ 
C++ ? 1 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB             help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 75  ? ? -124.16 -83.14  
2  1 ILE A 84  ? ? -123.13 -168.39 
3  1 ASP A 170 ? ? -96.63  30.57   
4  1 MET A 176 ? ? 177.43  142.43  
5  1 LEU A 178 ? ? -176.78 86.39   
6  1 LYS A 211 ? ? 50.50   -118.05 
7  1 ASN A 212 ? ? -98.35  30.01   
8  1 ILE B 83  ? ? -121.08 -166.51 
9  1 ASP B 170 ? ? -96.67  42.08   
10 1 MET B 176 ? ? 179.49  126.38  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 18  ? CG  ? A ASN 18  CG  
2  1 Y 1 A ASN 18  ? OD1 ? A ASN 18  OD1 
3  1 Y 1 A ASN 18  ? ND2 ? A ASN 18  ND2 
4  1 Y 1 A LYS 24  ? CG  ? A LYS 24  CG  
5  1 Y 1 A LYS 24  ? CD  ? A LYS 24  CD  
6  1 Y 1 A LYS 24  ? CE  ? A LYS 24  CE  
7  1 Y 1 A LYS 24  ? NZ  ? A LYS 24  NZ  
8  1 Y 1 A GLU 58  ? CD  ? A GLU 58  CD  
9  1 Y 1 A GLU 58  ? OE1 ? A GLU 58  OE1 
10 1 Y 1 A GLU 58  ? OE2 ? A GLU 58  OE2 
11 1 Y 1 A LYS 62  ? CG  ? A LYS 62  CG  
12 1 Y 1 A LYS 62  ? CD  ? A LYS 62  CD  
13 1 Y 1 A LYS 62  ? CE  ? A LYS 62  CE  
14 1 Y 1 A LYS 62  ? NZ  ? A LYS 62  NZ  
15 1 Y 1 A LYS 110 ? CG  ? A LYS 110 CG  
16 1 Y 1 A LYS 110 ? CD  ? A LYS 110 CD  
17 1 Y 1 A LYS 110 ? CE  ? A LYS 110 CE  
18 1 Y 1 A LYS 110 ? NZ  ? A LYS 110 NZ  
19 1 Y 1 A ILE 151 ? CD1 ? A ILE 151 CD1 
20 1 Y 1 A LYS 210 ? CG  ? A LYS 210 CG  
21 1 Y 1 A LYS 210 ? CD  ? A LYS 210 CD  
22 1 Y 1 A LYS 210 ? CE  ? A LYS 210 CE  
23 1 Y 1 A LYS 210 ? NZ  ? A LYS 210 NZ  
24 1 Y 1 A LYS 213 ? CE  ? A LYS 213 CE  
25 1 Y 1 A LYS 213 ? NZ  ? A LYS 213 NZ  
26 1 Y 1 B LYS 211 ? CG  ? B LYS 211 CG  
27 1 Y 1 B LYS 211 ? CD  ? B LYS 211 CD  
28 1 Y 1 B LYS 211 ? CE  ? B LYS 211 CE  
29 1 Y 1 B LYS 211 ? NZ  ? B LYS 211 NZ  
30 1 Y 1 B LYS 213 ? CE  ? B LYS 213 CE  
31 1 Y 1 B LYS 213 ? NZ  ? B LYS 213 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A VAL 3   ? A VAL 3   
4  1 Y 1 A GLU 4   ? A GLU 4   
5  1 Y 1 A GLY 5   ? A GLY 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A GLY 7   ? A GLY 7   
8  1 Y 1 A LYS 8   ? A LYS 8   
9  1 Y 1 A ASP 9   ? A ASP 9   
10 1 Y 1 A PHE 10  ? A PHE 10  
11 1 Y 1 A CYS 11  ? A CYS 11  
12 1 Y 1 A GLY 12  ? A GLY 12  
13 1 Y 1 A ALA 13  ? A ALA 13  
14 1 Y 1 A ILE 14  ? A ILE 14  
15 1 Y 1 A ILE 15  ? A ILE 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A ASP 17  ? A ASP 17  
18 1 Y 1 A ALA 142 ? A ALA 142 
19 1 Y 1 A GLU 143 ? A GLU 143 
20 1 Y 1 A MET 144 ? A MET 144 
21 1 Y 1 A ASN 145 ? A ASN 145 
22 1 Y 1 A THR 146 ? A THR 146 
23 1 Y 1 A TYR 147 ? A TYR 147 
24 1 Y 1 A ASN 148 ? A ASN 148 
25 1 Y 1 A GLU 227 ? A GLU 227 
26 1 Y 1 A GLN 228 ? A GLN 228 
27 1 Y 1 A THR 229 ? A THR 229 
28 1 Y 1 A SER 230 ? A SER 230 
29 1 Y 1 A TYR 231 ? A TYR 231 
30 1 Y 1 A TYR 232 ? A TYR 232 
31 1 Y 1 A SER 233 ? A SER 233 
32 1 Y 1 A ASP 234 ? A ASP 234 
33 1 Y 1 A PRO 235 ? A PRO 235 
34 1 Y 1 A ASN 236 ? A ASN 236 
35 1 Y 1 A SER 237 ? A SER 237 
36 1 Y 1 A SER 238 ? A SER 238 
37 1 Y 1 A SER 239 ? A SER 239 
38 1 Y 1 A VAL 240 ? A VAL 240 
39 1 Y 1 A ASP 241 ? A ASP 241 
40 1 Y 1 A LYS 242 ? A LYS 242 
41 1 Y 1 A LEU 243 ? A LEU 243 
42 1 Y 1 A ALA 244 ? A ALA 244 
43 1 Y 1 A ALA 245 ? A ALA 245 
44 1 Y 1 A ALA 246 ? A ALA 246 
45 1 Y 1 A LEU 247 ? A LEU 247 
46 1 Y 1 A ASP 248 ? A ASP 248 
47 1 Y 1 A HIS 249 ? A HIS 249 
48 1 Y 1 A HIS 250 ? A HIS 250 
49 1 Y 1 B MET 0   ? B MET 1   
50 1 Y 1 B SER 1   ? B SER 2   
51 1 Y 1 B VAL 2   ? B VAL 3   
52 1 Y 1 B GLU 3   ? B GLU 4   
53 1 Y 1 B GLY 4   ? B GLY 5   
54 1 Y 1 B LEU 5   ? B LEU 6   
55 1 Y 1 B GLY 6   ? B GLY 7   
56 1 Y 1 B LYS 7   ? B LYS 8   
57 1 Y 1 B ASP 8   ? B ASP 9   
58 1 Y 1 B PHE 9   ? B PHE 10  
59 1 Y 1 B CYS 10  ? B CYS 11  
60 1 Y 1 B GLY 11  ? B GLY 12  
61 1 Y 1 B ALA 12  ? B ALA 13  
62 1 Y 1 B ILE 13  ? B ILE 14  
63 1 Y 1 B ILE 14  ? B ILE 15  
64 1 Y 1 B PRO 15  ? B PRO 16  
65 1 Y 1 B ASP 16  ? B ASP 17  
66 1 Y 1 B ASN 17  ? B ASN 18  
67 1 Y 1 B ALA 142 ? B ALA 142 
68 1 Y 1 B GLU 143 ? B GLU 143 
69 1 Y 1 B MET 144 ? B MET 144 
70 1 Y 1 B ASN 145 ? B ASN 145 
71 1 Y 1 B THR 146 ? B THR 146 
72 1 Y 1 B TYR 147 ? B TYR 147 
73 1 Y 1 B ASN 148 ? B ASN 148 
74 1 Y 1 B THR 229 ? B THR 229 
75 1 Y 1 B SER 230 ? B SER 230 
76 1 Y 1 B TYR 231 ? B TYR 231 
77 1 Y 1 B TYR 232 ? B TYR 232 
78 1 Y 1 B SER 233 ? B SER 233 
79 1 Y 1 B ASP 234 ? B ASP 234 
80 1 Y 1 B PRO 235 ? B PRO 235 
81 1 Y 1 B ASN 236 ? B ASN 236 
82 1 Y 1 B SER 237 ? B SER 237 
83 1 Y 1 B SER 238 ? B SER 238 
84 1 Y 1 B SER 239 ? B SER 239 
85 1 Y 1 B VAL 240 ? B VAL 240 
86 1 Y 1 B ASP 241 ? B ASP 241 
87 1 Y 1 B LYS 242 ? B LYS 242 
88 1 Y 1 B LEU 243 ? B LEU 243 
89 1 Y 1 B ALA 244 ? B ALA 244 
90 1 Y 1 B ALA 245 ? B ALA 245 
91 1 Y 1 B ALA 246 ? B ALA 246 
92 1 Y 1 B LEU 247 ? B LEU 247 
93 1 Y 1 B ASP 248 ? B ASP 248 
94 1 Y 1 B HIS 249 ? B HIS 249 
95 1 Y 1 B HIS 250 ? B HIS 250 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#