data_3E8N
# 
_entry.id   3E8N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3E8N         
RCSB  RCSB049013   
WWPDB D_1000049013 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3E8N 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yan, S.'    1 
'Wang, Z.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'RDEA119/BAY 869766: a potent, selective, allosteric inhibitor of MEK1/2 for the treatment of cancer.' 
_citation.journal_abbrev            'Cancer Res.' 
_citation.journal_volume            69 
_citation.page_first                6839 
_citation.page_last                 6847 
_citation.year                      2009 
_citation.journal_id_ASTM           CNREA8 
_citation.country                   US 
_citation.journal_id_ISSN           0008-5472 
_citation.journal_id_CSD            0400 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19706763 
_citation.pdbx_database_id_DOI      10.1158/0008-5472.CAN-09-0679 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Iverson, C.'    1  
primary 'Larson, G.'     2  
primary 'Lai, C.'        3  
primary 'Yeh, L.T.'      4  
primary 'Dadson, C.'     5  
primary 'Weingarten, P.' 6  
primary 'Appleby, T.'    7  
primary 'Vo, T.'         8  
primary 'Maderna, A.'    9  
primary 'Vernier, J.M.'  10 
primary 'Hamatake, R.'   11 
primary 'Miner, J.N.'    12 
primary 'Quart, B.'      13 
# 
_cell.entry_id           3E8N 
_cell.length_a           82.261 
_cell.length_b           82.261 
_cell.length_c           129.778 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3E8N 
_symmetry.space_group_name_H-M             'P 62' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                171 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Dual specificity mitogen-activated protein kinase kinase 1' 37930.609 1  2.7.12.2 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION' 24.305    1  ?        ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181   1  ?        ? ? ? 
4 non-polymer syn 
'N-{3,4-difluoro-2-[(2-fluoro-4-iodophenyl)amino]-6-methoxyphenyl}-1-[(2S)-2,3-dihydroxypropyl]cyclopropanesulfonamide' 572.337   
1  ?        ? ? ? 
5 water       nat water 18.015    65 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MAP kinase kinase 1, MAPKK 1, ERK activator kinase 1, MAPK/ERK kinase 1, MEK1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEIS
ICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMA
NSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIG
LNQPSTPTHAAGVLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEIS
ICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMA
NSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIG
LNQPSTPTHAAGVLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   LEU n 
1 4   LYS n 
1 5   ASP n 
1 6   ASP n 
1 7   ASP n 
1 8   PHE n 
1 9   GLU n 
1 10  LYS n 
1 11  ILE n 
1 12  SER n 
1 13  GLU n 
1 14  LEU n 
1 15  GLY n 
1 16  ALA n 
1 17  GLY n 
1 18  ASN n 
1 19  GLY n 
1 20  GLY n 
1 21  VAL n 
1 22  VAL n 
1 23  PHE n 
1 24  LYS n 
1 25  VAL n 
1 26  SER n 
1 27  HIS n 
1 28  LYS n 
1 29  PRO n 
1 30  SER n 
1 31  GLY n 
1 32  LEU n 
1 33  VAL n 
1 34  MET n 
1 35  ALA n 
1 36  ARG n 
1 37  LYS n 
1 38  LEU n 
1 39  ILE n 
1 40  HIS n 
1 41  LEU n 
1 42  GLU n 
1 43  ILE n 
1 44  LYS n 
1 45  PRO n 
1 46  ALA n 
1 47  ILE n 
1 48  ARG n 
1 49  ASN n 
1 50  GLN n 
1 51  ILE n 
1 52  ILE n 
1 53  ARG n 
1 54  GLU n 
1 55  LEU n 
1 56  GLN n 
1 57  VAL n 
1 58  LEU n 
1 59  HIS n 
1 60  GLU n 
1 61  CYS n 
1 62  ASN n 
1 63  SER n 
1 64  PRO n 
1 65  TYR n 
1 66  ILE n 
1 67  VAL n 
1 68  GLY n 
1 69  PHE n 
1 70  TYR n 
1 71  GLY n 
1 72  ALA n 
1 73  PHE n 
1 74  TYR n 
1 75  SER n 
1 76  ASP n 
1 77  GLY n 
1 78  GLU n 
1 79  ILE n 
1 80  SER n 
1 81  ILE n 
1 82  CYS n 
1 83  MET n 
1 84  GLU n 
1 85  HIS n 
1 86  MET n 
1 87  ASP n 
1 88  GLY n 
1 89  GLY n 
1 90  SER n 
1 91  LEU n 
1 92  ASP n 
1 93  GLN n 
1 94  VAL n 
1 95  LEU n 
1 96  LYS n 
1 97  LYS n 
1 98  ALA n 
1 99  GLY n 
1 100 ARG n 
1 101 ILE n 
1 102 PRO n 
1 103 GLU n 
1 104 GLN n 
1 105 ILE n 
1 106 LEU n 
1 107 GLY n 
1 108 LYS n 
1 109 VAL n 
1 110 SER n 
1 111 ILE n 
1 112 ALA n 
1 113 VAL n 
1 114 ILE n 
1 115 LYS n 
1 116 GLY n 
1 117 LEU n 
1 118 THR n 
1 119 TYR n 
1 120 LEU n 
1 121 ARG n 
1 122 GLU n 
1 123 LYS n 
1 124 HIS n 
1 125 LYS n 
1 126 ILE n 
1 127 MET n 
1 128 HIS n 
1 129 ARG n 
1 130 ASP n 
1 131 VAL n 
1 132 LYS n 
1 133 PRO n 
1 134 SER n 
1 135 ASN n 
1 136 ILE n 
1 137 LEU n 
1 138 VAL n 
1 139 ASN n 
1 140 SER n 
1 141 ARG n 
1 142 GLY n 
1 143 GLU n 
1 144 ILE n 
1 145 LYS n 
1 146 LEU n 
1 147 CYS n 
1 148 ASP n 
1 149 PHE n 
1 150 GLY n 
1 151 VAL n 
1 152 SER n 
1 153 GLY n 
1 154 GLN n 
1 155 LEU n 
1 156 ILE n 
1 157 ASP n 
1 158 SER n 
1 159 MET n 
1 160 ALA n 
1 161 ASN n 
1 162 SER n 
1 163 PHE n 
1 164 VAL n 
1 165 GLY n 
1 166 THR n 
1 167 ARG n 
1 168 SER n 
1 169 TYR n 
1 170 MET n 
1 171 SER n 
1 172 PRO n 
1 173 GLU n 
1 174 ARG n 
1 175 LEU n 
1 176 GLN n 
1 177 GLY n 
1 178 THR n 
1 179 HIS n 
1 180 TYR n 
1 181 SER n 
1 182 VAL n 
1 183 GLN n 
1 184 SER n 
1 185 ASP n 
1 186 ILE n 
1 187 TRP n 
1 188 SER n 
1 189 MET n 
1 190 GLY n 
1 191 LEU n 
1 192 SER n 
1 193 LEU n 
1 194 VAL n 
1 195 GLU n 
1 196 MET n 
1 197 ALA n 
1 198 VAL n 
1 199 GLY n 
1 200 ARG n 
1 201 TYR n 
1 202 PRO n 
1 203 ILE n 
1 204 PRO n 
1 205 PRO n 
1 206 PRO n 
1 207 ASP n 
1 208 ALA n 
1 209 LYS n 
1 210 GLU n 
1 211 LEU n 
1 212 GLU n 
1 213 LEU n 
1 214 MET n 
1 215 PHE n 
1 216 GLY n 
1 217 CYS n 
1 218 GLN n 
1 219 VAL n 
1 220 GLU n 
1 221 GLY n 
1 222 ASP n 
1 223 ALA n 
1 224 ALA n 
1 225 GLU n 
1 226 THR n 
1 227 PRO n 
1 228 PRO n 
1 229 ARG n 
1 230 PRO n 
1 231 ARG n 
1 232 THR n 
1 233 PRO n 
1 234 GLY n 
1 235 ARG n 
1 236 PRO n 
1 237 LEU n 
1 238 SER n 
1 239 SER n 
1 240 TYR n 
1 241 GLY n 
1 242 MET n 
1 243 ASP n 
1 244 SER n 
1 245 ARG n 
1 246 PRO n 
1 247 PRO n 
1 248 MET n 
1 249 ALA n 
1 250 ILE n 
1 251 PHE n 
1 252 GLU n 
1 253 LEU n 
1 254 LEU n 
1 255 ASP n 
1 256 TYR n 
1 257 ILE n 
1 258 VAL n 
1 259 ASN n 
1 260 GLU n 
1 261 PRO n 
1 262 PRO n 
1 263 PRO n 
1 264 LYS n 
1 265 LEU n 
1 266 PRO n 
1 267 SER n 
1 268 GLY n 
1 269 VAL n 
1 270 PHE n 
1 271 SER n 
1 272 LEU n 
1 273 GLU n 
1 274 PHE n 
1 275 GLN n 
1 276 ASP n 
1 277 PHE n 
1 278 VAL n 
1 279 ASN n 
1 280 LYS n 
1 281 CYS n 
1 282 LEU n 
1 283 ILE n 
1 284 LYS n 
1 285 ASN n 
1 286 PRO n 
1 287 ALA n 
1 288 GLU n 
1 289 ARG n 
1 290 ALA n 
1 291 ASP n 
1 292 LEU n 
1 293 LYS n 
1 294 GLN n 
1 295 LEU n 
1 296 MET n 
1 297 VAL n 
1 298 HIS n 
1 299 ALA n 
1 300 PHE n 
1 301 ILE n 
1 302 LYS n 
1 303 ARG n 
1 304 SER n 
1 305 ASP n 
1 306 ALA n 
1 307 GLU n 
1 308 GLU n 
1 309 VAL n 
1 310 ASP n 
1 311 PHE n 
1 312 ALA n 
1 313 GLY n 
1 314 TRP n 
1 315 LEU n 
1 316 CYS n 
1 317 SER n 
1 318 THR n 
1 319 ILE n 
1 320 GLY n 
1 321 LEU n 
1 322 ASN n 
1 323 GLN n 
1 324 PRO n 
1 325 SER n 
1 326 THR n 
1 327 PRO n 
1 328 THR n 
1 329 HIS n 
1 330 ALA n 
1 331 ALA n 
1 332 GLY n 
1 333 VAL n 
1 334 LEU n 
1 335 GLU n 
1 336 HIS n 
1 337 HIS n 
1 338 HIS n 
1 339 HIS n 
1 340 HIS n 
1 341 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 MEK1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET24b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MP2K1_HUMAN 
_struct_ref.pdbx_db_accession          Q02750 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISI
CMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYG
MDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
NQPSTPTHAAGV
;
_struct_ref.pdbx_align_begin           62 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3E8N 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 333 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q02750 
_struct_ref_seq.db_align_beg                  62 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  393 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       62 
_struct_ref_seq.pdbx_auth_seq_align_end       393 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3E8N MET A 1   ? UNP Q02750 ? ? 'EXPRESSION TAG' 61  1 
1 3E8N LEU A 334 ? UNP Q02750 ? ? 'EXPRESSION TAG' 394 2 
1 3E8N GLU A 335 ? UNP Q02750 ? ? 'EXPRESSION TAG' 395 3 
1 3E8N HIS A 336 ? UNP Q02750 ? ? 'EXPRESSION TAG' 396 4 
1 3E8N HIS A 337 ? UNP Q02750 ? ? 'EXPRESSION TAG' 397 5 
1 3E8N HIS A 338 ? UNP Q02750 ? ? 'EXPRESSION TAG' 398 6 
1 3E8N HIS A 339 ? UNP Q02750 ? ? 'EXPRESSION TAG' 399 7 
1 3E8N HIS A 340 ? UNP Q02750 ? ? 'EXPRESSION TAG' 400 8 
1 3E8N HIS A 341 ? UNP Q02750 ? ? 'EXPRESSION TAG' 401 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'           133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3'    507.181 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'         121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER ? 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'                 24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'           105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'          117.146 
VRA non-polymer         . 
'N-{3,4-difluoro-2-[(2-fluoro-4-iodophenyl)amino]-6-methoxyphenyl}-1-[(2S)-2,3-dihydroxypropyl]cyclopropanesulfonamide' ? 
'C19 H20 F3 I N2 O5 S' 572.337 
# 
_exptl.entry_id          3E8N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.34 
_exptl_crystal.density_percent_sol   63.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    
'20 mM HEPES, 150 mM NH4H2PO4, 0.5 mM EDTA, 2 mM TCEP, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           150 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-03-13 
_diffrn_detector.details                'Osmic blue mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3E8N 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             99 
_reflns.number_all                   17269 
_reflns.number_obs                   17113 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.125 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.36 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.9 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1703 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3E8N 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             6 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     17243 
_refine.ls_number_reflns_obs                     16933 
_refine.ls_number_reflns_R_free                  1688 
_refine.ls_percent_reflns_obs                    98.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1S9J' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.173 
_refine.aniso_B[1][2]                            -0.121 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][2]                            0.173 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            -0.346 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2276 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         63 
_refine_hist.number_atoms_solvent             65 
_refine_hist.number_atoms_total               2404 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        6 
# 
_struct.entry_id                  3E8N 
_struct.title                     
'X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) complexed with a potent inhibitor RDEA119 and MgATP' 
_struct.pdbx_descriptor           'Dual specificity mitogen-activated protein kinase kinase 1 (E.C.2.7.12.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3E8N 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;PROTEIN KINASE-LIGAND-MGATP COMPLEX, RDEA119, RDEA-119, MEK1, MEK1-RDEA119 complex, Acetylation, ATP-binding, Disease mutation, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Tyrosine-protein kinase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'MEK1 IS A MONOMER IN SOLUTION AND IN THE ASYMMETRIC UNIT' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 4   ? ASP A 6   ? LYS A 64  ASP A 66  5 ? 3  
HELX_P HELX_P2  2  LYS A 44  ? GLN A 56  ? LYS A 104 GLN A 116 1 ? 13 
HELX_P HELX_P3  3  VAL A 57  ? CYS A 61  ? VAL A 117 CYS A 121 5 ? 5  
HELX_P HELX_P4  4  SER A 90  ? GLY A 99  ? SER A 150 GLY A 159 1 ? 10 
HELX_P HELX_P5  5  PRO A 102 ? LYS A 125 ? PRO A 162 LYS A 185 1 ? 24 
HELX_P HELX_P6  6  LYS A 132 ? SER A 134 ? LYS A 192 SER A 194 5 ? 3  
HELX_P HELX_P7  7  SER A 152 ? MET A 159 ? SER A 212 MET A 219 1 ? 8  
HELX_P HELX_P8  8  SER A 171 ? GLY A 177 ? SER A 231 GLY A 237 1 ? 7  
HELX_P HELX_P9  9  VAL A 182 ? GLY A 199 ? VAL A 242 GLY A 259 1 ? 18 
HELX_P HELX_P10 10 ASP A 207 ? PHE A 215 ? ASP A 267 PHE A 275 1 ? 9  
HELX_P HELX_P11 11 ALA A 249 ? GLU A 260 ? ALA A 309 GLU A 320 1 ? 12 
HELX_P HELX_P12 12 SER A 271 ? LEU A 282 ? SER A 331 LEU A 342 1 ? 12 
HELX_P HELX_P13 13 ASP A 291 ? VAL A 297 ? ASP A 351 VAL A 357 1 ? 7  
HELX_P HELX_P14 14 HIS A 298 ? GLU A 307 ? HIS A 358 GLU A 367 1 ? 10 
HELX_P HELX_P15 15 ASP A 310 ? ILE A 319 ? ASP A 370 ILE A 379 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ASN 135 OD1 ? ? ? 1_555 B MG  . MG  ? ? A ASN 195 A MG  500  1_555 ? ? ? ? ? ? ? 1.889 ? 
metalc2 metalc ? ? A ASP 148 OD1 ? ? ? 1_555 B MG  . MG  ? ? A ASP 208 A MG  500  1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc3 metalc ? ? B MG  .   MG  ? ? ? 1_555 E HOH . O   ? ? A MG  500 A HOH 1002 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc4 metalc ? ? B MG  .   MG  ? ? ? 1_555 C ATP . O2A ? ? A MG  500 A ATP 600  1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc5 metalc ? ? B MG  .   MG  ? ? ? 1_555 C ATP . O1B ? ? A MG  500 A ATP 600  1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc6 metalc ? ? B MG  .   MG  ? ? ? 1_555 E HOH . O   ? ? A MG  500 A HOH 1003 1_555 ? ? ? ? ? ? ? 1.980 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ILE 
_struct_mon_prot_cis.label_seq_id           203 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ILE 
_struct_mon_prot_cis.auth_seq_id            263 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    204 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     264 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.38 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 8   ? ALA A 16  ? PHE A 68  ALA A 76  
A 2 VAL A 21  ? HIS A 27  ? VAL A 81  HIS A 87  
A 3 VAL A 33  ? HIS A 40  ? VAL A 93  HIS A 100 
A 4 GLU A 78  ? GLU A 84  ? GLU A 138 GLU A 144 
A 5 PHE A 69  ? TYR A 74  ? PHE A 129 TYR A 134 
B 1 ILE A 136 ? VAL A 138 ? ILE A 196 VAL A 198 
B 2 ILE A 144 ? LEU A 146 ? ILE A 204 LEU A 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 9   ? N GLU A 69  O SER A 26  ? O SER A 86  
A 2 3 N VAL A 21  ? N VAL A 81  O LEU A 38  ? O LEU A 98  
A 3 4 N ALA A 35  ? N ALA A 95  O MET A 83  ? O MET A 143 
A 4 5 O SER A 80  ? O SER A 140 N PHE A 73  ? N PHE A 133 
B 1 2 N LEU A 137 ? N LEU A 197 O LYS A 145 ? O LYS A 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 500'  
AC2 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE ATP A 600' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE VRA A1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASN A 135 ? ASN A 195  . ? 1_555 ? 
2  AC1 5  ASP A 148 ? ASP A 208  . ? 1_555 ? 
3  AC1 5  ATP C .   ? ATP A 600  . ? 1_555 ? 
4  AC1 5  HOH E .   ? HOH A 1002 . ? 1_555 ? 
5  AC1 5  HOH E .   ? HOH A 1003 . ? 1_555 ? 
6  AC2 24 GLY A 17  ? GLY A 77   . ? 1_555 ? 
7  AC2 24 ASN A 18  ? ASN A 78   . ? 1_555 ? 
8  AC2 24 GLY A 20  ? GLY A 80   . ? 1_555 ? 
9  AC2 24 VAL A 22  ? VAL A 82   . ? 1_555 ? 
10 AC2 24 ALA A 35  ? ALA A 95   . ? 1_555 ? 
11 AC2 24 LYS A 37  ? LYS A 97   . ? 1_555 ? 
12 AC2 24 MET A 83  ? MET A 143  . ? 1_555 ? 
13 AC2 24 GLU A 84  ? GLU A 144  . ? 1_555 ? 
14 AC2 24 MET A 86  ? MET A 146  . ? 1_555 ? 
15 AC2 24 SER A 90  ? SER A 150  . ? 1_555 ? 
16 AC2 24 GLN A 93  ? GLN A 153  . ? 1_555 ? 
17 AC2 24 LYS A 132 ? LYS A 192  . ? 1_555 ? 
18 AC2 24 SER A 134 ? SER A 194  . ? 1_555 ? 
19 AC2 24 ASN A 135 ? ASN A 195  . ? 1_555 ? 
20 AC2 24 LEU A 137 ? LEU A 197  . ? 1_555 ? 
21 AC2 24 ASP A 148 ? ASP A 208  . ? 1_555 ? 
22 AC2 24 MG  B .   ? MG  A 500  . ? 1_555 ? 
23 AC2 24 VRA D .   ? VRA A 1001 . ? 1_555 ? 
24 AC2 24 HOH E .   ? HOH A 1002 . ? 1_555 ? 
25 AC2 24 HOH E .   ? HOH A 1003 . ? 1_555 ? 
26 AC2 24 HOH E .   ? HOH A 1014 . ? 1_555 ? 
27 AC2 24 HOH E .   ? HOH A 1030 . ? 1_555 ? 
28 AC2 24 HOH E .   ? HOH A 1044 . ? 1_555 ? 
29 AC2 24 HOH E .   ? HOH A 1066 . ? 1_555 ? 
30 AC3 13 GLY A 19  ? GLY A 79   . ? 1_555 ? 
31 AC3 13 LYS A 37  ? LYS A 97   . ? 1_555 ? 
32 AC3 13 LEU A 55  ? LEU A 115  . ? 1_555 ? 
33 AC3 13 VAL A 67  ? VAL A 127  . ? 1_555 ? 
34 AC3 13 ASP A 130 ? ASP A 190  . ? 1_555 ? 
35 AC3 13 ASP A 148 ? ASP A 208  . ? 1_555 ? 
36 AC3 13 PHE A 149 ? PHE A 209  . ? 1_555 ? 
37 AC3 13 VAL A 151 ? VAL A 211  . ? 1_555 ? 
38 AC3 13 SER A 152 ? SER A 212  . ? 1_555 ? 
39 AC3 13 LEU A 155 ? LEU A 215  . ? 1_555 ? 
40 AC3 13 ATP C .   ? ATP A 600  . ? 1_555 ? 
41 AC3 13 HOH E .   ? HOH A 1002 . ? 1_555 ? 
42 AC3 13 HOH E .   ? HOH A 1022 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3E8N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3E8N 
_atom_sites.fract_transf_matrix[1][1]   0.012156 
_atom_sites.fract_transf_matrix[1][2]   0.007019 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014037 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007705 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
I  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 41.237 19.591 58.517 1.00 51.25 ? 61   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 40.024 19.951 59.317 1.00 50.14 ? 61   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 38.813 20.167 58.407 1.00 49.76 ? 61   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 38.939 20.633 57.275 1.00 47.54 ? 61   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 40.320 21.197 60.160 1.00 50.18 ? 61   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 39.107 21.915 60.684 1.00 51.87 ? 61   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 39.536 23.242 61.837 1.00 48.89 ? 61   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 38.332 22.908 63.136 1.00 48.32 ? 61   MET A CE    1 
ATOM   9    N  N     . GLU A 1 2   ? 37.641 19.801 58.910 1.00 51.51 ? 62   GLU A N     1 
ATOM   10   C  CA    . GLU A 1 2   ? 36.408 19.928 58.154 1.00 52.23 ? 62   GLU A CA    1 
ATOM   11   C  C     . GLU A 1 2   ? 35.721 21.262 58.390 1.00 50.24 ? 62   GLU A C     1 
ATOM   12   O  O     . GLU A 1 2   ? 35.604 21.724 59.528 1.00 50.25 ? 62   GLU A O     1 
ATOM   13   C  CB    . GLU A 1 2   ? 35.459 18.792 58.521 1.00 56.97 ? 62   GLU A CB    1 
ATOM   14   C  CG    . GLU A 1 2   ? 34.135 18.849 57.783 1.00 65.17 ? 62   GLU A CG    1 
ATOM   15   C  CD    . GLU A 1 2   ? 33.253 17.645 58.067 1.00 70.73 ? 62   GLU A CD    1 
ATOM   16   O  OE1   . GLU A 1 2   ? 33.679 16.506 57.751 1.00 73.77 ? 62   GLU A OE1   1 
ATOM   17   O  OE2   . GLU A 1 2   ? 32.134 17.838 58.605 1.00 72.16 ? 62   GLU A OE2   1 
ATOM   18   N  N     . LEU A 1 3   ? 35.273 21.879 57.303 1.00 48.14 ? 63   LEU A N     1 
ATOM   19   C  CA    . LEU A 1 3   ? 34.581 23.157 57.376 1.00 48.98 ? 63   LEU A CA    1 
ATOM   20   C  C     . LEU A 1 3   ? 33.122 22.973 57.756 1.00 50.12 ? 63   LEU A C     1 
ATOM   21   O  O     . LEU A 1 3   ? 32.448 22.077 57.258 1.00 50.38 ? 63   LEU A O     1 
ATOM   22   C  CB    . LEU A 1 3   ? 34.679 23.883 56.045 1.00 48.21 ? 63   LEU A CB    1 
ATOM   23   C  CG    . LEU A 1 3   ? 35.854 24.851 55.938 1.00 48.24 ? 63   LEU A CG    1 
ATOM   24   C  CD1   . LEU A 1 3   ? 37.050 24.349 56.719 1.00 45.64 ? 63   LEU A CD1   1 
ATOM   25   C  CD2   . LEU A 1 3   ? 36.172 25.049 54.470 1.00 48.09 ? 63   LEU A CD2   1 
ATOM   26   N  N     . LYS A 1 4   ? 32.645 23.846 58.636 1.00 51.93 ? 64   LYS A N     1 
ATOM   27   C  CA    . LYS A 1 4   ? 31.280 23.800 59.151 1.00 52.25 ? 64   LYS A CA    1 
ATOM   28   C  C     . LYS A 1 4   ? 30.710 25.227 59.253 1.00 52.45 ? 64   LYS A C     1 
ATOM   29   O  O     . LYS A 1 4   ? 31.410 26.154 59.675 1.00 52.64 ? 64   LYS A O     1 
ATOM   30   C  CB    . LYS A 1 4   ? 31.326 23.119 60.520 1.00 53.23 ? 64   LYS A CB    1 
ATOM   31   C  CG    . LYS A 1 4   ? 30.002 22.931 61.198 1.00 56.77 ? 64   LYS A CG    1 
ATOM   32   C  CD    . LYS A 1 4   ? 30.068 21.737 62.160 1.00 59.46 ? 64   LYS A CD    1 
ATOM   33   C  CE    . LYS A 1 4   ? 31.187 21.874 63.184 1.00 56.61 ? 64   LYS A CE    1 
ATOM   34   N  NZ    . LYS A 1 4   ? 31.027 23.098 64.016 1.00 56.57 ? 64   LYS A NZ    1 
ATOM   35   N  N     . ASP A 1 5   ? 29.444 25.396 58.873 1.00 52.02 ? 65   ASP A N     1 
ATOM   36   C  CA    . ASP A 1 5   ? 28.777 26.706 58.883 1.00 52.02 ? 65   ASP A CA    1 
ATOM   37   C  C     . ASP A 1 5   ? 28.894 27.541 60.157 1.00 52.56 ? 65   ASP A C     1 
ATOM   38   O  O     . ASP A 1 5   ? 29.164 28.741 60.097 1.00 51.30 ? 65   ASP A O     1 
ATOM   39   C  CB    . ASP A 1 5   ? 27.288 26.552 58.551 1.00 52.38 ? 65   ASP A CB    1 
ATOM   40   C  CG    . ASP A 1 5   ? 26.538 27.886 58.582 1.00 52.55 ? 65   ASP A CG    1 
ATOM   41   O  OD1   . ASP A 1 5   ? 26.863 28.783 57.775 1.00 51.31 ? 65   ASP A OD1   1 
ATOM   42   O  OD2   . ASP A 1 5   ? 25.623 28.040 59.420 1.00 53.58 ? 65   ASP A OD2   1 
ATOM   43   N  N     . ASP A 1 6   ? 28.682 26.919 61.309 1.00 53.23 ? 66   ASP A N     1 
ATOM   44   C  CA    . ASP A 1 6   ? 28.752 27.661 62.554 1.00 55.76 ? 66   ASP A CA    1 
ATOM   45   C  C     . ASP A 1 6   ? 30.176 28.082 62.939 1.00 54.82 ? 66   ASP A C     1 
ATOM   46   O  O     . ASP A 1 6   ? 30.356 28.907 63.832 1.00 54.88 ? 66   ASP A O     1 
ATOM   47   C  CB    . ASP A 1 6   ? 28.110 26.850 63.682 1.00 59.25 ? 66   ASP A CB    1 
ATOM   48   C  CG    . ASP A 1 6   ? 28.826 25.547 63.935 1.00 63.12 ? 66   ASP A CG    1 
ATOM   49   O  OD1   . ASP A 1 6   ? 28.429 24.823 64.880 1.00 64.16 ? 66   ASP A OD1   1 
ATOM   50   O  OD2   . ASP A 1 6   ? 29.788 25.251 63.185 1.00 66.54 ? 66   ASP A OD2   1 
ATOM   51   N  N     . ASP A 1 7   ? 31.180 27.520 62.268 1.00 53.48 ? 67   ASP A N     1 
ATOM   52   C  CA    . ASP A 1 7   ? 32.579 27.861 62.538 1.00 52.09 ? 67   ASP A CA    1 
ATOM   53   C  C     . ASP A 1 7   ? 33.055 29.119 61.814 1.00 52.06 ? 67   ASP A C     1 
ATOM   54   O  O     . ASP A 1 7   ? 34.223 29.491 61.942 1.00 51.33 ? 67   ASP A O     1 
ATOM   55   C  CB    . ASP A 1 7   ? 33.503 26.709 62.155 1.00 51.20 ? 67   ASP A CB    1 
ATOM   56   C  CG    . ASP A 1 7   ? 33.522 25.619 63.190 1.00 53.44 ? 67   ASP A CG    1 
ATOM   57   O  OD1   . ASP A 1 7   ? 34.151 24.569 62.944 1.00 56.20 ? 67   ASP A OD1   1 
ATOM   58   O  OD2   . ASP A 1 7   ? 32.911 25.809 64.260 1.00 55.85 ? 67   ASP A OD2   1 
ATOM   59   N  N     . PHE A 1 8   ? 32.167 29.761 61.049 1.00 51.19 ? 68   PHE A N     1 
ATOM   60   C  CA    . PHE A 1 8   ? 32.525 30.975 60.313 1.00 50.95 ? 68   PHE A CA    1 
ATOM   61   C  C     . PHE A 1 8   ? 31.958 32.232 60.949 1.00 51.64 ? 68   PHE A C     1 
ATOM   62   O  O     . PHE A 1 8   ? 31.100 32.164 61.821 1.00 52.48 ? 68   PHE A O     1 
ATOM   63   C  CB    . PHE A 1 8   ? 32.069 30.900 58.839 1.00 46.68 ? 68   PHE A CB    1 
ATOM   64   C  CG    . PHE A 1 8   ? 32.873 29.936 58.006 1.00 46.44 ? 68   PHE A CG    1 
ATOM   65   C  CD1   . PHE A 1 8   ? 32.485 28.608 57.876 1.00 46.52 ? 68   PHE A CD1   1 
ATOM   66   C  CD2   . PHE A 1 8   ? 34.065 30.333 57.426 1.00 46.47 ? 68   PHE A CD2   1 
ATOM   67   C  CE1   . PHE A 1 8   ? 33.282 27.694 57.201 1.00 42.92 ? 68   PHE A CE1   1 
ATOM   68   C  CE2   . PHE A 1 8   ? 34.864 29.419 56.753 1.00 45.59 ? 68   PHE A CE2   1 
ATOM   69   C  CZ    . PHE A 1 8   ? 34.470 28.100 56.639 1.00 43.12 ? 68   PHE A CZ    1 
ATOM   70   N  N     . GLU A 1 9   ? 32.456 33.380 60.504 1.00 53.97 ? 69   GLU A N     1 
ATOM   71   C  CA    . GLU A 1 9   ? 32.008 34.670 61.011 1.00 55.60 ? 69   GLU A CA    1 
ATOM   72   C  C     . GLU A 1 9   ? 32.164 35.681 59.884 1.00 54.27 ? 69   GLU A C     1 
ATOM   73   O  O     . GLU A 1 9   ? 33.254 35.858 59.339 1.00 53.63 ? 69   GLU A O     1 
ATOM   74   C  CB    . GLU A 1 9   ? 32.860 35.082 62.208 1.00 60.69 ? 69   GLU A CB    1 
ATOM   75   C  CG    . GLU A 1 9   ? 32.284 36.205 63.036 1.00 66.83 ? 69   GLU A CG    1 
ATOM   76   C  CD    . GLU A 1 9   ? 32.902 36.249 64.419 1.00 72.34 ? 69   GLU A CD    1 
ATOM   77   O  OE1   . GLU A 1 9   ? 34.120 36.542 64.518 1.00 74.73 ? 69   GLU A OE1   1 
ATOM   78   O  OE2   . GLU A 1 9   ? 32.175 35.973 65.404 1.00 73.73 ? 69   GLU A OE2   1 
ATOM   79   N  N     . LYS A 1 10  ? 31.068 36.339 59.534 1.00 52.86 ? 70   LYS A N     1 
ATOM   80   C  CA    . LYS A 1 10  ? 31.086 37.307 58.454 1.00 53.14 ? 70   LYS A CA    1 
ATOM   81   C  C     . LYS A 1 10  ? 31.842 38.575 58.845 1.00 52.12 ? 70   LYS A C     1 
ATOM   82   O  O     . LYS A 1 10  ? 31.673 39.102 59.941 1.00 53.88 ? 70   LYS A O     1 
ATOM   83   C  CB    . LYS A 1 10  ? 29.648 37.645 58.037 1.00 54.64 ? 70   LYS A CB    1 
ATOM   84   C  CG    . LYS A 1 10  ? 29.535 38.612 56.867 1.00 58.35 ? 70   LYS A CG    1 
ATOM   85   C  CD    . LYS A 1 10  ? 28.097 39.064 56.644 1.00 60.56 ? 70   LYS A CD    1 
ATOM   86   C  CE    . LYS A 1 10  ? 27.183 37.901 56.267 1.00 63.19 ? 70   LYS A CE    1 
ATOM   87   N  NZ    . LYS A 1 10  ? 25.797 38.353 55.898 1.00 65.02 ? 70   LYS A NZ    1 
ATOM   88   N  N     . ILE A 1 11  ? 32.687 39.045 57.938 1.00 49.76 ? 71   ILE A N     1 
ATOM   89   C  CA    . ILE A 1 11  ? 33.468 40.243 58.155 1.00 48.91 ? 71   ILE A CA    1 
ATOM   90   C  C     . ILE A 1 11  ? 32.918 41.332 57.247 1.00 51.00 ? 71   ILE A C     1 
ATOM   91   O  O     . ILE A 1 11  ? 32.670 42.461 57.681 1.00 51.30 ? 71   ILE A O     1 
ATOM   92   C  CB    . ILE A 1 11  ? 34.940 40.000 57.801 1.00 48.52 ? 71   ILE A CB    1 
ATOM   93   C  CG1   . ILE A 1 11  ? 35.541 38.992 58.778 1.00 46.14 ? 71   ILE A CG1   1 
ATOM   94   C  CG2   . ILE A 1 11  ? 35.722 41.309 57.827 1.00 44.73 ? 71   ILE A CG2   1 
ATOM   95   C  CD1   . ILE A 1 11  ? 36.957 38.634 58.443 1.00 45.72 ? 71   ILE A CD1   1 
ATOM   96   N  N     . SER A 1 12  ? 32.719 40.982 55.982 1.00 52.50 ? 72   SER A N     1 
ATOM   97   C  CA    . SER A 1 12  ? 32.191 41.919 54.999 1.00 54.11 ? 72   SER A CA    1 
ATOM   98   C  C     . SER A 1 12  ? 31.752 41.200 53.723 1.00 55.05 ? 72   SER A C     1 
ATOM   99   O  O     . SER A 1 12  ? 31.777 39.970 53.652 1.00 55.23 ? 72   SER A O     1 
ATOM   100  C  CB    . SER A 1 12  ? 33.249 42.974 54.678 1.00 54.45 ? 72   SER A CB    1 
ATOM   101  O  OG    . SER A 1 12  ? 34.467 42.372 54.275 1.00 56.87 ? 72   SER A OG    1 
ATOM   102  N  N     . GLU A 1 13  ? 31.340 41.964 52.718 1.00 56.18 ? 73   GLU A N     1 
ATOM   103  C  CA    . GLU A 1 13  ? 30.906 41.365 51.461 1.00 56.97 ? 73   GLU A CA    1 
ATOM   104  C  C     . GLU A 1 13  ? 31.906 41.701 50.357 1.00 56.17 ? 73   GLU A C     1 
ATOM   105  O  O     . GLU A 1 13  ? 32.188 42.871 50.106 1.00 56.89 ? 73   GLU A O     1 
ATOM   106  C  CB    . GLU A 1 13  ? 29.514 41.874 51.073 1.00 58.75 ? 73   GLU A CB    1 
ATOM   107  C  CG    . GLU A 1 13  ? 28.886 41.112 49.910 1.00 62.67 ? 73   GLU A CG    1 
ATOM   108  C  CD    . GLU A 1 13  ? 27.573 41.716 49.442 1.00 65.43 ? 73   GLU A CD    1 
ATOM   109  O  OE1   . GLU A 1 13  ? 26.660 41.892 50.284 1.00 67.13 ? 73   GLU A OE1   1 
ATOM   110  O  OE2   . GLU A 1 13  ? 27.451 42.010 48.229 1.00 66.53 ? 73   GLU A OE2   1 
ATOM   111  N  N     . LEU A 1 14  ? 32.443 40.678 49.701 1.00 54.29 ? 74   LEU A N     1 
ATOM   112  C  CA    . LEU A 1 14  ? 33.413 40.902 48.639 1.00 53.79 ? 74   LEU A CA    1 
ATOM   113  C  C     . LEU A 1 14  ? 32.701 41.219 47.334 1.00 53.56 ? 74   LEU A C     1 
ATOM   114  O  O     . LEU A 1 14  ? 33.276 41.801 46.424 1.00 53.56 ? 74   LEU A O     1 
ATOM   115  C  CB    . LEU A 1 14  ? 34.305 39.672 48.462 1.00 54.76 ? 74   LEU A CB    1 
ATOM   116  C  CG    . LEU A 1 14  ? 35.159 39.317 49.680 1.00 56.01 ? 74   LEU A CG    1 
ATOM   117  C  CD1   . LEU A 1 14  ? 35.780 37.941 49.515 1.00 55.02 ? 74   LEU A CD1   1 
ATOM   118  C  CD2   . LEU A 1 14  ? 36.232 40.385 49.861 1.00 57.07 ? 74   LEU A CD2   1 
ATOM   119  N  N     . GLY A 1 15  ? 31.438 40.833 47.240 1.00 54.50 ? 75   GLY A N     1 
ATOM   120  C  CA    . GLY A 1 15  ? 30.698 41.106 46.027 1.00 53.76 ? 75   GLY A CA    1 
ATOM   121  C  C     . GLY A 1 15  ? 29.594 40.103 45.792 1.00 54.30 ? 75   GLY A C     1 
ATOM   122  O  O     . GLY A 1 15  ? 29.409 39.152 46.566 1.00 51.64 ? 75   GLY A O     1 
ATOM   123  N  N     . ALA A 1 16  ? 28.855 40.316 44.710 1.00 54.85 ? 76   ALA A N     1 
ATOM   124  C  CA    . ALA A 1 16  ? 27.761 39.429 44.364 1.00 55.89 ? 76   ALA A CA    1 
ATOM   125  C  C     . ALA A 1 16  ? 27.617 39.356 42.864 1.00 56.60 ? 76   ALA A C     1 
ATOM   126  O  O     . ALA A 1 16  ? 27.985 40.282 42.151 1.00 56.17 ? 76   ALA A O     1 
ATOM   127  C  CB    . ALA A 1 16  ? 26.474 39.918 44.994 1.00 55.64 ? 76   ALA A CB    1 
ATOM   128  N  N     . GLY A 1 17  ? 27.096 38.232 42.393 1.00 59.87 ? 77   GLY A N     1 
ATOM   129  C  CA    . GLY A 1 17  ? 26.897 38.040 40.973 1.00 62.34 ? 77   GLY A CA    1 
ATOM   130  C  C     . GLY A 1 17  ? 25.541 37.411 40.726 1.00 63.80 ? 77   GLY A C     1 
ATOM   131  O  O     . GLY A 1 17  ? 24.725 37.298 41.644 1.00 63.52 ? 77   GLY A O     1 
ATOM   132  N  N     . ASN A 1 18  ? 25.296 36.994 39.489 1.00 65.04 ? 78   ASN A N     1 
ATOM   133  C  CA    . ASN A 1 18  ? 24.023 36.376 39.151 1.00 67.60 ? 78   ASN A CA    1 
ATOM   134  C  C     . ASN A 1 18  ? 23.882 34.983 39.750 1.00 67.57 ? 78   ASN A C     1 
ATOM   135  O  O     . ASN A 1 18  ? 22.770 34.507 39.964 1.00 68.12 ? 78   ASN A O     1 
ATOM   136  C  CB    . ASN A 1 18  ? 23.851 36.283 37.634 1.00 68.94 ? 78   ASN A CB    1 
ATOM   137  C  CG    . ASN A 1 18  ? 23.842 37.637 36.965 1.00 71.93 ? 78   ASN A CG    1 
ATOM   138  O  OD1   . ASN A 1 18  ? 23.164 38.567 37.417 1.00 71.77 ? 78   ASN A OD1   1 
ATOM   139  N  ND2   . ASN A 1 18  ? 24.589 37.758 35.870 1.00 73.80 ? 78   ASN A ND2   1 
ATOM   140  N  N     . GLY A 1 19  ? 25.007 34.331 40.021 1.00 67.72 ? 79   GLY A N     1 
ATOM   141  C  CA    . GLY A 1 19  ? 24.962 32.989 40.574 1.00 66.41 ? 79   GLY A CA    1 
ATOM   142  C  C     . GLY A 1 19  ? 25.009 32.904 42.087 1.00 64.56 ? 79   GLY A C     1 
ATOM   143  O  O     . GLY A 1 19  ? 24.449 31.979 42.679 1.00 64.18 ? 79   GLY A O     1 
ATOM   144  N  N     . GLY A 1 20  ? 25.678 33.857 42.722 1.00 62.22 ? 80   GLY A N     1 
ATOM   145  C  CA    . GLY A 1 20  ? 25.761 33.820 44.169 1.00 61.10 ? 80   GLY A CA    1 
ATOM   146  C  C     . GLY A 1 20  ? 26.410 35.038 44.786 1.00 59.60 ? 80   GLY A C     1 
ATOM   147  O  O     . GLY A 1 20  ? 26.749 36.000 44.101 1.00 59.34 ? 80   GLY A O     1 
ATOM   148  N  N     . VAL A 1 21  ? 26.565 35.006 46.100 1.00 58.71 ? 81   VAL A N     1 
ATOM   149  C  CA    . VAL A 1 21  ? 27.194 36.108 46.802 1.00 58.17 ? 81   VAL A CA    1 
ATOM   150  C  C     . VAL A 1 21  ? 28.368 35.556 47.601 1.00 57.08 ? 81   VAL A C     1 
ATOM   151  O  O     . VAL A 1 21  ? 28.297 34.464 48.176 1.00 54.68 ? 81   VAL A O     1 
ATOM   152  C  CB    . VAL A 1 21  ? 26.210 36.824 47.754 1.00 58.12 ? 81   VAL A CB    1 
ATOM   153  C  CG1   . VAL A 1 21  ? 25.646 35.839 48.762 1.00 57.20 ? 81   VAL A CG1   1 
ATOM   154  C  CG2   . VAL A 1 21  ? 26.923 37.964 48.464 1.00 56.39 ? 81   VAL A CG2   1 
ATOM   155  N  N     . VAL A 1 22  ? 29.462 36.303 47.615 1.00 55.69 ? 82   VAL A N     1 
ATOM   156  C  CA    . VAL A 1 22  ? 30.640 35.860 48.336 1.00 54.42 ? 82   VAL A CA    1 
ATOM   157  C  C     . VAL A 1 22  ? 31.038 36.849 49.418 1.00 51.70 ? 82   VAL A C     1 
ATOM   158  O  O     . VAL A 1 22  ? 31.085 38.055 49.189 1.00 50.84 ? 82   VAL A O     1 
ATOM   159  C  CB    . VAL A 1 22  ? 31.818 35.604 47.351 1.00 54.72 ? 82   VAL A CB    1 
ATOM   160  C  CG1   . VAL A 1 22  ? 31.676 36.484 46.132 1.00 57.10 ? 82   VAL A CG1   1 
ATOM   161  C  CG2   . VAL A 1 22  ? 33.143 35.858 48.039 1.00 53.11 ? 82   VAL A CG2   1 
ATOM   162  N  N     . PHE A 1 23  ? 31.289 36.331 50.612 1.00 49.58 ? 83   PHE A N     1 
ATOM   163  C  CA    . PHE A 1 23  ? 31.686 37.174 51.727 1.00 50.01 ? 83   PHE A CA    1 
ATOM   164  C  C     . PHE A 1 23  ? 33.140 36.914 52.133 1.00 49.92 ? 83   PHE A C     1 
ATOM   165  O  O     . PHE A 1 23  ? 33.724 35.857 51.838 1.00 45.72 ? 83   PHE A O     1 
ATOM   166  C  CB    . PHE A 1 23  ? 30.788 36.927 52.954 1.00 51.37 ? 83   PHE A CB    1 
ATOM   167  C  CG    . PHE A 1 23  ? 29.328 37.215 52.719 1.00 55.02 ? 83   PHE A CG    1 
ATOM   168  C  CD1   . PHE A 1 23  ? 28.515 36.280 52.105 1.00 54.22 ? 83   PHE A CD1   1 
ATOM   169  C  CD2   . PHE A 1 23  ? 28.765 38.422 53.125 1.00 56.92 ? 83   PHE A CD2   1 
ATOM   170  C  CE1   . PHE A 1 23  ? 27.176 36.543 51.880 1.00 55.60 ? 83   PHE A CE1   1 
ATOM   171  C  CE2   . PHE A 1 23  ? 27.421 38.693 52.901 1.00 55.97 ? 83   PHE A CE2   1 
ATOM   172  C  CZ    . PHE A 1 23  ? 26.627 37.748 52.284 1.00 56.25 ? 83   PHE A CZ    1 
ATOM   173  N  N     . LYS A 1 24  ? 33.718 37.906 52.802 1.00 49.49 ? 84   LYS A N     1 
ATOM   174  C  CA    . LYS A 1 24  ? 35.072 37.806 53.325 1.00 47.76 ? 84   LYS A CA    1 
ATOM   175  C  C     . LYS A 1 24  ? 34.766 37.364 54.742 1.00 45.65 ? 84   LYS A C     1 
ATOM   176  O  O     . LYS A 1 24  ? 34.184 38.109 55.524 1.00 46.45 ? 84   LYS A O     1 
ATOM   177  C  CB    . LYS A 1 24  ? 35.757 39.175 53.341 1.00 49.72 ? 84   LYS A CB    1 
ATOM   178  C  CG    . LYS A 1 24  ? 37.207 39.135 53.808 1.00 51.07 ? 84   LYS A CG    1 
ATOM   179  C  CD    . LYS A 1 24  ? 37.732 40.536 54.076 1.00 52.96 ? 84   LYS A CD    1 
ATOM   180  C  CE    . LYS A 1 24  ? 39.178 40.505 54.528 1.00 55.47 ? 84   LYS A CE    1 
ATOM   181  N  NZ    . LYS A 1 24  ? 39.614 41.811 55.096 1.00 56.42 ? 84   LYS A NZ    1 
ATOM   182  N  N     . VAL A 1 25  ? 35.123 36.139 55.070 1.00 42.32 ? 85   VAL A N     1 
ATOM   183  C  CA    . VAL A 1 25  ? 34.821 35.655 56.393 1.00 40.36 ? 85   VAL A CA    1 
ATOM   184  C  C     . VAL A 1 25  ? 36.043 35.199 57.149 1.00 40.67 ? 85   VAL A C     1 
ATOM   185  O  O     . VAL A 1 25  ? 37.149 35.099 56.614 1.00 40.37 ? 85   VAL A O     1 
ATOM   186  C  CB    . VAL A 1 25  ? 33.858 34.454 56.348 1.00 40.84 ? 85   VAL A CB    1 
ATOM   187  C  CG1   . VAL A 1 25  ? 32.565 34.828 55.618 1.00 36.62 ? 85   VAL A CG1   1 
ATOM   188  C  CG2   . VAL A 1 25  ? 34.559 33.285 55.677 1.00 38.02 ? 85   VAL A CG2   1 
ATOM   189  N  N     . SER A 1 26  ? 35.820 34.901 58.414 1.00 39.46 ? 86   SER A N     1 
ATOM   190  C  CA    . SER A 1 26  ? 36.883 34.426 59.263 1.00 38.55 ? 86   SER A CA    1 
ATOM   191  C  C     . SER A 1 26  ? 36.509 33.020 59.721 1.00 36.10 ? 86   SER A C     1 
ATOM   192  O  O     . SER A 1 26  ? 35.380 32.786 60.149 1.00 35.24 ? 86   SER A O     1 
ATOM   193  C  CB    . SER A 1 26  ? 37.029 35.372 60.454 1.00 39.89 ? 86   SER A CB    1 
ATOM   194  O  OG    . SER A 1 26  ? 37.829 34.780 61.454 1.00 44.53 ? 86   SER A OG    1 
ATOM   195  N  N     . HIS A 1 27  ? 37.432 32.076 59.590 1.00 35.59 ? 87   HIS A N     1 
ATOM   196  C  CA    . HIS A 1 27  ? 37.172 30.706 60.024 1.00 36.77 ? 87   HIS A CA    1 
ATOM   197  C  C     . HIS A 1 27  ? 37.714 30.664 61.452 1.00 37.93 ? 87   HIS A C     1 
ATOM   198  O  O     . HIS A 1 27  ? 38.893 30.403 61.671 1.00 37.84 ? 87   HIS A O     1 
ATOM   199  C  CB    . HIS A 1 27  ? 37.905 29.699 59.109 1.00 37.91 ? 87   HIS A CB    1 
ATOM   200  C  CG    . HIS A 1 27  ? 37.671 28.263 59.474 1.00 39.92 ? 87   HIS A CG    1 
ATOM   201  N  ND1   . HIS A 1 27  ? 38.693 27.402 59.828 1.00 41.03 ? 87   HIS A ND1   1 
ATOM   202  C  CD2   . HIS A 1 27  ? 36.528 27.543 59.579 1.00 40.51 ? 87   HIS A CD2   1 
ATOM   203  C  CE1   . HIS A 1 27  ? 38.189 26.223 60.137 1.00 40.53 ? 87   HIS A CE1   1 
ATOM   204  N  NE2   . HIS A 1 27  ? 36.875 26.281 59.995 1.00 41.68 ? 87   HIS A NE2   1 
ATOM   205  N  N     . LYS A 1 28  ? 36.848 30.948 62.422 1.00 39.80 ? 88   LYS A N     1 
ATOM   206  C  CA    . LYS A 1 28  ? 37.248 31.000 63.828 1.00 41.26 ? 88   LYS A CA    1 
ATOM   207  C  C     . LYS A 1 28  ? 38.187 29.909 64.323 1.00 41.16 ? 88   LYS A C     1 
ATOM   208  O  O     . LYS A 1 28  ? 39.211 30.202 64.919 1.00 42.83 ? 88   LYS A O     1 
ATOM   209  C  CB    . LYS A 1 28  ? 36.008 31.064 64.718 1.00 41.87 ? 88   LYS A CB    1 
ATOM   210  C  CG    . LYS A 1 28  ? 35.179 32.314 64.466 1.00 46.62 ? 88   LYS A CG    1 
ATOM   211  C  CD    . LYS A 1 28  ? 33.914 32.366 65.318 1.00 50.65 ? 88   LYS A CD    1 
ATOM   212  C  CE    . LYS A 1 28  ? 32.966 31.221 64.994 1.00 51.91 ? 88   LYS A CE    1 
ATOM   213  N  NZ    . LYS A 1 28  ? 31.695 31.383 65.748 1.00 54.91 ? 88   LYS A NZ    1 
ATOM   214  N  N     . PRO A 1 29  ? 37.862 28.639 64.065 1.00 41.70 ? 89   PRO A N     1 
ATOM   215  C  CA    . PRO A 1 29  ? 38.723 27.546 64.522 1.00 41.18 ? 89   PRO A CA    1 
ATOM   216  C  C     . PRO A 1 29  ? 40.196 27.687 64.134 1.00 42.73 ? 89   PRO A C     1 
ATOM   217  O  O     . PRO A 1 29  ? 41.100 27.394 64.931 1.00 43.28 ? 89   PRO A O     1 
ATOM   218  C  CB    . PRO A 1 29  ? 38.079 26.310 63.891 1.00 40.52 ? 89   PRO A CB    1 
ATOM   219  C  CG    . PRO A 1 29  ? 36.633 26.690 63.775 1.00 38.18 ? 89   PRO A CG    1 
ATOM   220  C  CD    . PRO A 1 29  ? 36.714 28.124 63.297 1.00 40.54 ? 89   PRO A CD    1 
ATOM   221  N  N     . SER A 1 30  ? 40.446 28.133 62.911 1.00 42.44 ? 90   SER A N     1 
ATOM   222  C  CA    . SER A 1 30  ? 41.821 28.268 62.442 1.00 42.23 ? 90   SER A CA    1 
ATOM   223  C  C     . SER A 1 30  ? 42.314 29.711 62.475 1.00 42.76 ? 90   SER A C     1 
ATOM   224  O  O     . SER A 1 30  ? 43.521 29.959 62.500 1.00 44.20 ? 90   SER A O     1 
ATOM   225  C  CB    . SER A 1 30  ? 41.937 27.715 61.019 1.00 42.04 ? 90   SER A CB    1 
ATOM   226  O  OG    . SER A 1 30  ? 41.116 28.453 60.132 1.00 41.61 ? 90   SER A OG    1 
ATOM   227  N  N     . GLY A 1 31  ? 41.377 30.652 62.477 1.00 43.11 ? 91   GLY A N     1 
ATOM   228  C  CA    . GLY A 1 31  ? 41.732 32.056 62.504 1.00 43.18 ? 91   GLY A CA    1 
ATOM   229  C  C     . GLY A 1 31  ? 42.101 32.532 61.119 1.00 44.28 ? 91   GLY A C     1 
ATOM   230  O  O     . GLY A 1 31  ? 42.486 33.684 60.905 1.00 44.24 ? 91   GLY A O     1 
ATOM   231  N  N     . LEU A 1 32  ? 41.953 31.639 60.157 1.00 45.02 ? 92   LEU A N     1 
ATOM   232  C  CA    . LEU A 1 32  ? 42.297 31.949 58.780 1.00 45.59 ? 92   LEU A CA    1 
ATOM   233  C  C     . LEU A 1 32  ? 41.185 32.722 58.060 1.00 44.98 ? 92   LEU A C     1 
ATOM   234  O  O     . LEU A 1 32  ? 40.017 32.348 58.129 1.00 46.50 ? 92   LEU A O     1 
ATOM   235  C  CB    . LEU A 1 32  ? 42.581 30.640 58.061 1.00 47.70 ? 92   LEU A CB    1 
ATOM   236  C  CG    . LEU A 1 32  ? 43.613 30.638 56.956 1.00 50.95 ? 92   LEU A CG    1 
ATOM   237  C  CD1   . LEU A 1 32  ? 45.005 31.010 57.503 1.00 53.69 ? 92   LEU A CD1   1 
ATOM   238  C  CD2   . LEU A 1 32  ? 43.629 29.235 56.374 1.00 53.89 ? 92   LEU A CD2   1 
ATOM   239  N  N     . VAL A 1 33  ? 41.539 33.807 57.384 1.00 42.36 ? 93   VAL A N     1 
ATOM   240  C  CA    . VAL A 1 33  ? 40.540 34.574 56.657 1.00 39.41 ? 93   VAL A CA    1 
ATOM   241  C  C     . VAL A 1 33  ? 40.305 33.910 55.298 1.00 40.44 ? 93   VAL A C     1 
ATOM   242  O  O     . VAL A 1 33  ? 41.253 33.557 54.597 1.00 40.55 ? 93   VAL A O     1 
ATOM   243  C  CB    . VAL A 1 33  ? 40.981 36.033 56.474 1.00 38.05 ? 93   VAL A CB    1 
ATOM   244  C  CG1   . VAL A 1 33  ? 40.407 36.606 55.188 1.00 36.18 ? 93   VAL A CG1   1 
ATOM   245  C  CG2   . VAL A 1 33  ? 40.496 36.842 57.653 1.00 35.09 ? 93   VAL A CG2   1 
ATOM   246  N  N     . MET A 1 34  ? 39.034 33.737 54.935 1.00 39.53 ? 94   MET A N     1 
ATOM   247  C  CA    . MET A 1 34  ? 38.663 33.061 53.693 1.00 37.66 ? 94   MET A CA    1 
ATOM   248  C  C     . MET A 1 34  ? 37.608 33.805 52.888 1.00 37.37 ? 94   MET A C     1 
ATOM   249  O  O     . MET A 1 34  ? 37.035 34.800 53.348 1.00 35.63 ? 94   MET A O     1 
ATOM   250  C  CB    . MET A 1 34  ? 38.123 31.652 54.022 1.00 37.37 ? 94   MET A CB    1 
ATOM   251  C  CG    . MET A 1 34  ? 39.091 30.773 54.821 1.00 40.64 ? 94   MET A CG    1 
ATOM   252  S  SD    . MET A 1 34  ? 38.561 29.051 55.133 1.00 40.40 ? 94   MET A SD    1 
ATOM   253  C  CE    . MET A 1 34  ? 36.962 29.167 54.600 1.00 44.73 ? 94   MET A CE    1 
ATOM   254  N  N     . ALA A 1 35  ? 37.380 33.337 51.664 1.00 36.28 ? 95   ALA A N     1 
ATOM   255  C  CA    . ALA A 1 35  ? 36.331 33.909 50.823 1.00 34.41 ? 95   ALA A CA    1 
ATOM   256  C  C     . ALA A 1 35  ? 35.317 32.783 50.771 1.00 34.77 ? 95   ALA A C     1 
ATOM   257  O  O     . ALA A 1 35  ? 35.644 31.643 50.425 1.00 33.37 ? 95   ALA A O     1 
ATOM   258  C  CB    . ALA A 1 35  ? 36.844 34.233 49.426 1.00 32.80 ? 95   ALA A CB    1 
ATOM   259  N  N     . ARG A 1 36  ? 34.095 33.104 51.159 1.00 35.43 ? 96   ARG A N     1 
ATOM   260  C  CA    . ARG A 1 36  ? 33.030 32.126 51.176 1.00 36.70 ? 96   ARG A CA    1 
ATOM   261  C  C     . ARG A 1 36  ? 31.974 32.544 50.163 1.00 37.41 ? 96   ARG A C     1 
ATOM   262  O  O     . ARG A 1 36  ? 31.408 33.637 50.250 1.00 35.89 ? 96   ARG A O     1 
ATOM   263  C  CB    . ARG A 1 36  ? 32.417 32.052 52.570 1.00 37.97 ? 96   ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 36  ? 31.329 31.013 52.690 1.00 42.04 ? 96   ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 36  ? 30.634 31.092 54.035 1.00 41.61 ? 96   ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 36  ? 29.781 29.931 54.233 1.00 43.00 ? 96   ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 36  ? 29.029 29.722 55.306 1.00 41.83 ? 96   ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 36  ? 29.020 30.609 56.291 1.00 39.68 ? 96   ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 36  ? 28.298 28.614 55.392 1.00 40.67 ? 96   ARG A NH2   1 
ATOM   270  N  N     . LYS A 1 37  ? 31.740 31.678 49.188 1.00 37.14 ? 97   LYS A N     1 
ATOM   271  C  CA    . LYS A 1 37  ? 30.752 31.936 48.158 1.00 37.29 ? 97   LYS A CA    1 
ATOM   272  C  C     . LYS A 1 37  ? 29.490 31.151 48.496 1.00 39.53 ? 97   LYS A C     1 
ATOM   273  O  O     . LYS A 1 37  ? 29.549 29.943 48.753 1.00 37.88 ? 97   LYS A O     1 
ATOM   274  C  CB    . LYS A 1 37  ? 31.275 31.496 46.789 1.00 35.02 ? 97   LYS A CB    1 
ATOM   275  C  CG    . LYS A 1 37  ? 30.176 31.394 45.748 1.00 36.54 ? 97   LYS A CG    1 
ATOM   276  C  CD    . LYS A 1 37  ? 30.690 31.110 44.346 1.00 35.22 ? 97   LYS A CD    1 
ATOM   277  C  CE    . LYS A 1 37  ? 31.482 32.273 43.772 1.00 34.31 ? 97   LYS A CE    1 
ATOM   278  N  NZ    . LYS A 1 37  ? 31.655 32.056 42.314 1.00 32.10 ? 97   LYS A NZ    1 
ATOM   279  N  N     . LEU A 1 38  ? 28.351 31.832 48.505 1.00 39.84 ? 98   LEU A N     1 
ATOM   280  C  CA    . LEU A 1 38  ? 27.096 31.160 48.802 1.00 41.30 ? 98   LEU A CA    1 
ATOM   281  C  C     . LEU A 1 38  ? 26.277 31.050 47.524 1.00 42.23 ? 98   LEU A C     1 
ATOM   282  O  O     . LEU A 1 38  ? 26.073 32.034 46.806 1.00 40.23 ? 98   LEU A O     1 
ATOM   283  C  CB    . LEU A 1 38  ? 26.319 31.929 49.874 1.00 41.71 ? 98   LEU A CB    1 
ATOM   284  C  CG    . LEU A 1 38  ? 27.081 32.187 51.186 1.00 43.66 ? 98   LEU A CG    1 
ATOM   285  C  CD1   . LEU A 1 38  ? 26.283 33.158 52.045 1.00 43.60 ? 98   LEU A CD1   1 
ATOM   286  C  CD2   . LEU A 1 38  ? 27.321 30.877 51.939 1.00 42.63 ? 98   LEU A CD2   1 
ATOM   287  N  N     . ILE A 1 39  ? 25.830 29.838 47.224 1.00 42.83 ? 99   ILE A N     1 
ATOM   288  C  CA    . ILE A 1 39  ? 25.028 29.618 46.031 1.00 44.94 ? 99   ILE A CA    1 
ATOM   289  C  C     . ILE A 1 39  ? 23.678 29.061 46.464 1.00 46.06 ? 99   ILE A C     1 
ATOM   290  O  O     . ILE A 1 39  ? 23.580 27.902 46.857 1.00 45.56 ? 99   ILE A O     1 
ATOM   291  C  CB    . ILE A 1 39  ? 25.716 28.615 45.069 1.00 44.28 ? 99   ILE A CB    1 
ATOM   292  C  CG1   . ILE A 1 39  ? 27.159 29.044 44.798 1.00 44.82 ? 99   ILE A CG1   1 
ATOM   293  C  CG2   . ILE A 1 39  ? 24.977 28.562 43.756 1.00 41.71 ? 99   ILE A CG2   1 
ATOM   294  C  CD1   . ILE A 1 39  ? 27.956 28.006 44.037 1.00 42.43 ? 99   ILE A CD1   1 
ATOM   295  N  N     . HIS A 1 40  ? 22.643 29.890 46.394 1.00 48.38 ? 100  HIS A N     1 
ATOM   296  C  CA    . HIS A 1 40  ? 21.306 29.458 46.787 1.00 53.09 ? 100  HIS A CA    1 
ATOM   297  C  C     . HIS A 1 40  ? 20.711 28.528 45.736 1.00 54.95 ? 100  HIS A C     1 
ATOM   298  O  O     . HIS A 1 40  ? 20.496 28.931 44.597 1.00 55.50 ? 100  HIS A O     1 
ATOM   299  C  CB    . HIS A 1 40  ? 20.379 30.666 46.968 1.00 54.29 ? 100  HIS A CB    1 
ATOM   300  C  CG    . HIS A 1 40  ? 19.017 30.305 47.488 1.00 58.79 ? 100  HIS A CG    1 
ATOM   301  N  ND1   . HIS A 1 40  ? 18.781 30.008 48.809 1.00 60.81 ? 100  HIS A ND1   1 
ATOM   302  C  CD2   . HIS A 1 40  ? 17.834 30.158 46.843 1.00 58.68 ? 100  HIS A CD2   1 
ATOM   303  C  CE1   . HIS A 1 40  ? 17.502 29.690 48.963 1.00 60.83 ? 100  HIS A CE1   1 
ATOM   304  N  NE2   . HIS A 1 40  ? 16.911 29.773 47.789 1.00 60.93 ? 100  HIS A NE2   1 
ATOM   305  N  N     . LEU A 1 41  ? 20.450 27.283 46.110 1.00 57.55 ? 101  LEU A N     1 
ATOM   306  C  CA    . LEU A 1 41  ? 19.869 26.336 45.169 1.00 62.04 ? 101  LEU A CA    1 
ATOM   307  C  C     . LEU A 1 41  ? 18.600 25.685 45.698 1.00 65.94 ? 101  LEU A C     1 
ATOM   308  O  O     . LEU A 1 41  ? 18.612 24.961 46.699 1.00 66.22 ? 101  LEU A O     1 
ATOM   309  C  CB    . LEU A 1 41  ? 20.874 25.246 44.782 1.00 60.60 ? 101  LEU A CB    1 
ATOM   310  C  CG    . LEU A 1 41  ? 21.790 25.620 43.612 1.00 59.59 ? 101  LEU A CG    1 
ATOM   311  C  CD1   . LEU A 1 41  ? 22.635 24.428 43.193 1.00 56.25 ? 101  LEU A CD1   1 
ATOM   312  C  CD2   . LEU A 1 41  ? 20.927 26.102 42.456 1.00 57.25 ? 101  LEU A CD2   1 
ATOM   313  N  N     . GLU A 1 42  ? 17.503 25.954 45.006 1.00 69.40 ? 102  GLU A N     1 
ATOM   314  C  CA    . GLU A 1 42  ? 16.212 25.406 45.364 1.00 73.10 ? 102  GLU A CA    1 
ATOM   315  C  C     . GLU A 1 42  ? 16.070 24.072 44.625 1.00 73.79 ? 102  GLU A C     1 
ATOM   316  O  O     . GLU A 1 42  ? 15.300 23.960 43.668 1.00 74.25 ? 102  GLU A O     1 
ATOM   317  C  CB    . GLU A 1 42  ? 15.123 26.394 44.938 1.00 75.42 ? 102  GLU A CB    1 
ATOM   318  C  CG    . GLU A 1 42  ? 13.727 26.073 45.426 1.00 78.60 ? 102  GLU A CG    1 
ATOM   319  C  CD    . GLU A 1 42  ? 12.740 27.174 45.077 1.00 80.27 ? 102  GLU A CD    1 
ATOM   320  O  OE1   . GLU A 1 42  ? 12.937 28.318 45.549 1.00 80.09 ? 102  GLU A OE1   1 
ATOM   321  O  OE2   . GLU A 1 42  ? 11.772 26.895 44.328 1.00 81.86 ? 102  GLU A OE2   1 
ATOM   322  N  N     . ILE A 1 43  ? 16.832 23.072 45.070 1.00 74.11 ? 103  ILE A N     1 
ATOM   323  C  CA    . ILE A 1 43  ? 16.819 21.739 44.456 1.00 74.60 ? 103  ILE A CA    1 
ATOM   324  C  C     . ILE A 1 43  ? 16.794 20.632 45.521 1.00 74.71 ? 103  ILE A C     1 
ATOM   325  O  O     . ILE A 1 43  ? 17.146 20.874 46.678 1.00 74.52 ? 103  ILE A O     1 
ATOM   326  C  CB    . ILE A 1 43  ? 18.067 21.545 43.556 1.00 74.99 ? 103  ILE A CB    1 
ATOM   327  C  CG1   . ILE A 1 43  ? 17.654 20.952 42.199 1.00 75.72 ? 103  ILE A CG1   1 
ATOM   328  C  CG2   . ILE A 1 43  ? 19.109 20.703 44.285 1.00 73.93 ? 103  ILE A CG2   1 
ATOM   329  C  CD1   . ILE A 1 43  ? 16.931 19.608 42.261 1.00 76.07 ? 103  ILE A CD1   1 
ATOM   330  N  N     . LYS A 1 44  ? 16.382 19.425 45.130 1.00 75.50 ? 104  LYS A N     1 
ATOM   331  C  CA    . LYS A 1 44  ? 16.305 18.290 46.061 1.00 76.09 ? 104  LYS A CA    1 
ATOM   332  C  C     . LYS A 1 44  ? 17.610 18.061 46.804 1.00 76.55 ? 104  LYS A C     1 
ATOM   333  O  O     . LYS A 1 44  ? 18.684 18.408 46.318 1.00 77.79 ? 104  LYS A O     1 
ATOM   334  C  CB    . LYS A 1 44  ? 15.946 16.986 45.337 1.00 75.38 ? 104  LYS A CB    1 
ATOM   335  C  CG    . LYS A 1 44  ? 14.611 16.972 44.616 1.00 75.34 ? 104  LYS A CG    1 
ATOM   336  C  CD    . LYS A 1 44  ? 14.236 15.546 44.212 1.00 75.04 ? 104  LYS A CD    1 
ATOM   337  C  CE    . LYS A 1 44  ? 13.163 15.525 43.125 1.00 75.06 ? 104  LYS A CE    1 
ATOM   338  N  NZ    . LYS A 1 44  ? 13.672 16.035 41.811 1.00 73.62 ? 104  LYS A NZ    1 
ATOM   339  N  N     . PRO A 1 45  ? 17.529 17.447 47.992 1.00 77.31 ? 105  PRO A N     1 
ATOM   340  C  CA    . PRO A 1 45  ? 18.701 17.158 48.823 1.00 77.63 ? 105  PRO A CA    1 
ATOM   341  C  C     . PRO A 1 45  ? 19.613 16.079 48.241 1.00 77.32 ? 105  PRO A C     1 
ATOM   342  O  O     . PRO A 1 45  ? 20.810 16.056 48.518 1.00 78.42 ? 105  PRO A O     1 
ATOM   343  C  CB    . PRO A 1 45  ? 18.079 16.727 50.146 1.00 78.12 ? 105  PRO A CB    1 
ATOM   344  C  CG    . PRO A 1 45  ? 16.832 16.030 49.696 1.00 76.76 ? 105  PRO A CG    1 
ATOM   345  C  CD    . PRO A 1 45  ? 16.296 16.985 48.654 1.00 76.64 ? 105  PRO A CD    1 
ATOM   346  N  N     . ALA A 1 46  ? 19.045 15.186 47.439 1.00 76.04 ? 106  ALA A N     1 
ATOM   347  C  CA    . ALA A 1 46  ? 19.824 14.107 46.844 1.00 75.28 ? 106  ALA A CA    1 
ATOM   348  C  C     . ALA A 1 46  ? 20.838 14.666 45.864 1.00 74.96 ? 106  ALA A C     1 
ATOM   349  O  O     . ALA A 1 46  ? 22.021 14.312 45.895 1.00 74.04 ? 106  ALA A O     1 
ATOM   350  C  CB    . ALA A 1 46  ? 18.901 13.129 46.133 1.00 74.94 ? 106  ALA A CB    1 
ATOM   351  N  N     . ILE A 1 47  ? 20.362 15.541 44.988 1.00 74.53 ? 107  ILE A N     1 
ATOM   352  C  CA    . ILE A 1 47  ? 21.221 16.151 43.992 1.00 74.46 ? 107  ILE A CA    1 
ATOM   353  C  C     . ILE A 1 47  ? 22.289 17.046 44.626 1.00 74.90 ? 107  ILE A C     1 
ATOM   354  O  O     . ILE A 1 47  ? 23.457 17.005 44.224 1.00 75.23 ? 107  ILE A O     1 
ATOM   355  C  CB    . ILE A 1 47  ? 20.396 16.966 42.968 1.00 73.70 ? 107  ILE A CB    1 
ATOM   356  C  CG1   . ILE A 1 47  ? 21.146 18.241 42.599 1.00 72.57 ? 107  ILE A CG1   1 
ATOM   357  C  CG2   . ILE A 1 47  ? 19.026 17.289 43.526 1.00 73.14 ? 107  ILE A CG2   1 
ATOM   358  C  CD1   . ILE A 1 47  ? 20.427 19.068 41.576 1.00 74.98 ? 107  ILE A CD1   1 
ATOM   359  N  N     . ARG A 1 48  ? 21.906 17.843 45.621 1.00 73.00 ? 108  ARG A N     1 
ATOM   360  C  CA    . ARG A 1 48  ? 22.883 18.707 46.262 1.00 71.91 ? 108  ARG A CA    1 
ATOM   361  C  C     . ARG A 1 48  ? 24.007 17.859 46.847 1.00 70.63 ? 108  ARG A C     1 
ATOM   362  O  O     . ARG A 1 48  ? 25.155 18.293 46.916 1.00 71.37 ? 108  ARG A O     1 
ATOM   363  C  CB    . ARG A 1 48  ? 22.245 19.561 47.360 1.00 72.28 ? 108  ARG A CB    1 
ATOM   364  C  CG    . ARG A 1 48  ? 21.909 18.824 48.619 1.00 74.67 ? 108  ARG A CG    1 
ATOM   365  C  CD    . ARG A 1 48  ? 21.566 19.811 49.720 1.00 75.36 ? 108  ARG A CD    1 
ATOM   366  N  NE    . ARG A 1 48  ? 21.019 19.155 50.908 1.00 78.54 ? 108  ARG A NE    1 
ATOM   367  C  CZ    . ARG A 1 48  ? 21.600 18.151 51.561 1.00 80.40 ? 108  ARG A CZ    1 
ATOM   368  N  NH1   . ARG A 1 48  ? 21.011 17.633 52.632 1.00 80.20 ? 108  ARG A NH1   1 
ATOM   369  N  NH2   . ARG A 1 48  ? 22.761 17.658 51.142 1.00 81.09 ? 108  ARG A NH2   1 
ATOM   370  N  N     . ASN A 1 49  ? 23.685 16.639 47.255 1.00 69.47 ? 109  ASN A N     1 
ATOM   371  C  CA    . ASN A 1 49  ? 24.709 15.763 47.800 1.00 68.38 ? 109  ASN A CA    1 
ATOM   372  C  C     . ASN A 1 49  ? 25.724 15.431 46.724 1.00 65.92 ? 109  ASN A C     1 
ATOM   373  O  O     . ASN A 1 49  ? 26.921 15.322 46.997 1.00 65.09 ? 109  ASN A O     1 
ATOM   374  C  CB    . ASN A 1 49  ? 24.092 14.471 48.331 1.00 71.04 ? 109  ASN A CB    1 
ATOM   375  C  CG    . ASN A 1 49  ? 23.296 14.694 49.596 1.00 73.06 ? 109  ASN A CG    1 
ATOM   376  O  OD1   . ASN A 1 49  ? 23.781 15.327 50.540 1.00 74.04 ? 109  ASN A OD1   1 
ATOM   377  N  ND2   . ASN A 1 49  ? 22.072 14.174 49.629 1.00 73.06 ? 109  ASN A ND2   1 
ATOM   378  N  N     . GLN A 1 50  ? 25.238 15.271 45.497 1.00 62.87 ? 110  GLN A N     1 
ATOM   379  C  CA    . GLN A 1 50  ? 26.109 14.954 44.378 1.00 59.65 ? 110  GLN A CA    1 
ATOM   380  C  C     . GLN A 1 50  ? 27.013 16.151 44.095 1.00 57.30 ? 110  GLN A C     1 
ATOM   381  O  O     . GLN A 1 50  ? 28.211 15.995 43.841 1.00 56.66 ? 110  GLN A O     1 
ATOM   382  C  CB    . GLN A 1 50  ? 25.276 14.639 43.142 1.00 59.53 ? 110  GLN A CB    1 
ATOM   383  C  CG    . GLN A 1 50  ? 26.017 13.862 42.080 1.00 60.02 ? 110  GLN A CG    1 
ATOM   384  C  CD    . GLN A 1 50  ? 25.291 13.904 40.757 1.00 60.58 ? 110  GLN A CD    1 
ATOM   385  O  OE1   . GLN A 1 50  ? 24.062 13.808 40.709 1.00 60.47 ? 110  GLN A OE1   1 
ATOM   386  N  NE2   . GLN A 1 50  ? 26.045 14.045 39.669 1.00 61.19 ? 110  GLN A NE2   1 
ATOM   387  N  N     . ILE A 1 51  ? 26.425 17.345 44.141 1.00 54.74 ? 111  ILE A N     1 
ATOM   388  C  CA    . ILE A 1 51  ? 27.164 18.578 43.902 1.00 52.82 ? 111  ILE A CA    1 
ATOM   389  C  C     . ILE A 1 51  ? 28.288 18.700 44.928 1.00 53.11 ? 111  ILE A C     1 
ATOM   390  O  O     . ILE A 1 51  ? 29.464 18.799 44.569 1.00 52.31 ? 111  ILE A O     1 
ATOM   391  C  CB    . ILE A 1 51  ? 26.230 19.808 43.978 1.00 50.14 ? 111  ILE A CB    1 
ATOM   392  C  CG1   . ILE A 1 51  ? 25.163 19.704 42.883 1.00 50.34 ? 111  ILE A CG1   1 
ATOM   393  C  CG2   . ILE A 1 51  ? 27.030 21.087 43.815 1.00 49.38 ? 111  ILE A CG2   1 
ATOM   394  C  CD1   . ILE A 1 51  ? 24.306 20.955 42.688 1.00 49.57 ? 111  ILE A CD1   1 
ATOM   395  N  N     . ILE A 1 52  ? 27.927 18.673 46.206 1.00 53.81 ? 112  ILE A N     1 
ATOM   396  C  CA    . ILE A 1 52  ? 28.924 18.752 47.269 1.00 55.27 ? 112  ILE A CA    1 
ATOM   397  C  C     . ILE A 1 52  ? 30.012 17.694 47.074 1.00 55.83 ? 112  ILE A C     1 
ATOM   398  O  O     . ILE A 1 52  ? 31.190 17.944 47.329 1.00 55.70 ? 112  ILE A O     1 
ATOM   399  C  CB    . ILE A 1 52  ? 28.288 18.542 48.663 1.00 53.41 ? 112  ILE A CB    1 
ATOM   400  C  CG1   . ILE A 1 52  ? 27.855 19.881 49.258 1.00 54.60 ? 112  ILE A CG1   1 
ATOM   401  C  CG2   . ILE A 1 52  ? 29.289 17.905 49.596 1.00 52.52 ? 112  ILE A CG2   1 
ATOM   402  C  CD1   . ILE A 1 52  ? 26.778 20.576 48.491 1.00 55.85 ? 112  ILE A CD1   1 
ATOM   403  N  N     . ARG A 1 53  ? 29.617 16.515 46.611 1.00 56.89 ? 113  ARG A N     1 
ATOM   404  C  CA    . ARG A 1 53  ? 30.576 15.441 46.408 1.00 58.28 ? 113  ARG A CA    1 
ATOM   405  C  C     . ARG A 1 53  ? 31.475 15.702 45.213 1.00 57.89 ? 113  ARG A C     1 
ATOM   406  O  O     . ARG A 1 53  ? 32.651 15.337 45.225 1.00 58.15 ? 113  ARG A O     1 
ATOM   407  C  CB    . ARG A 1 53  ? 29.849 14.112 46.237 1.00 60.08 ? 113  ARG A CB    1 
ATOM   408  C  CG    . ARG A 1 53  ? 30.773 12.920 46.081 1.00 64.50 ? 113  ARG A CG    1 
ATOM   409  C  CD    . ARG A 1 53  ? 29.977 11.627 46.091 1.00 68.86 ? 113  ARG A CD    1 
ATOM   410  N  NE    . ARG A 1 53  ? 28.773 11.732 45.262 1.00 72.23 ? 113  ARG A NE    1 
ATOM   411  C  CZ    . ARG A 1 53  ? 27.534 11.805 45.741 1.00 73.04 ? 113  ARG A CZ    1 
ATOM   412  N  NH1   . ARG A 1 53  ? 27.323 11.781 47.051 1.00 72.30 ? 113  ARG A NH1   1 
ATOM   413  N  NH2   . ARG A 1 53  ? 26.504 11.906 44.908 1.00 73.70 ? 113  ARG A NH2   1 
ATOM   414  N  N     . GLU A 1 54  ? 30.930 16.335 44.179 1.00 57.36 ? 114  GLU A N     1 
ATOM   415  C  CA    . GLU A 1 54  ? 31.728 16.632 42.999 1.00 57.24 ? 114  GLU A CA    1 
ATOM   416  C  C     . GLU A 1 54  ? 32.650 17.820 43.262 1.00 55.89 ? 114  GLU A C     1 
ATOM   417  O  O     . GLU A 1 54  ? 33.711 17.929 42.649 1.00 57.67 ? 114  GLU A O     1 
ATOM   418  C  CB    . GLU A 1 54  ? 30.834 16.926 41.780 1.00 59.13 ? 114  GLU A CB    1 
ATOM   419  C  CG    . GLU A 1 54  ? 29.971 15.750 41.317 1.00 61.27 ? 114  GLU A CG    1 
ATOM   420  C  CD    . GLU A 1 54  ? 29.092 16.081 40.107 1.00 61.19 ? 114  GLU A CD    1 
ATOM   421  O  OE1   . GLU A 1 54  ? 28.545 17.199 40.046 1.00 62.89 ? 114  GLU A OE1   1 
ATOM   422  O  OE2   . GLU A 1 54  ? 28.933 15.214 39.224 1.00 61.57 ? 114  GLU A OE2   1 
ATOM   423  N  N     . LEU A 1 55  ? 32.266 18.710 44.176 1.00 53.06 ? 115  LEU A N     1 
ATOM   424  C  CA    . LEU A 1 55  ? 33.108 19.879 44.463 1.00 50.18 ? 115  LEU A CA    1 
ATOM   425  C  C     . LEU A 1 55  ? 34.374 19.493 45.200 1.00 48.95 ? 115  LEU A C     1 
ATOM   426  O  O     . LEU A 1 55  ? 35.349 20.238 45.201 1.00 48.69 ? 115  LEU A O     1 
ATOM   427  C  CB    . LEU A 1 55  ? 32.353 20.911 45.299 1.00 46.25 ? 115  LEU A CB    1 
ATOM   428  C  CG    . LEU A 1 55  ? 31.157 21.582 44.632 1.00 44.51 ? 115  LEU A CG    1 
ATOM   429  C  CD1   . LEU A 1 55  ? 30.462 22.465 45.633 1.00 42.27 ? 115  LEU A CD1   1 
ATOM   430  C  CD2   . LEU A 1 55  ? 31.613 22.388 43.427 1.00 44.01 ? 115  LEU A CD2   1 
ATOM   431  N  N     . GLN A 1 56  ? 34.354 18.320 45.820 1.00 49.04 ? 116  GLN A N     1 
ATOM   432  C  CA    . GLN A 1 56  ? 35.502 17.840 46.577 1.00 49.51 ? 116  GLN A CA    1 
ATOM   433  C  C     . GLN A 1 56  ? 36.788 17.723 45.770 1.00 49.07 ? 116  GLN A C     1 
ATOM   434  O  O     . GLN A 1 56  ? 37.872 17.883 46.322 1.00 49.46 ? 116  GLN A O     1 
ATOM   435  C  CB    . GLN A 1 56  ? 35.181 16.496 47.225 1.00 49.19 ? 116  GLN A CB    1 
ATOM   436  C  CG    . GLN A 1 56  ? 34.011 16.549 48.197 1.00 51.14 ? 116  GLN A CG    1 
ATOM   437  C  CD    . GLN A 1 56  ? 34.174 17.639 49.239 1.00 51.97 ? 116  GLN A CD    1 
ATOM   438  O  OE1   . GLN A 1 56  ? 35.196 17.709 49.926 1.00 56.30 ? 116  GLN A OE1   1 
ATOM   439  N  NE2   . GLN A 1 56  ? 33.169 18.496 49.361 1.00 49.94 ? 116  GLN A NE2   1 
ATOM   440  N  N     . VAL A 1 57  ? 36.688 17.457 44.473 1.00 49.04 ? 117  VAL A N     1 
ATOM   441  C  CA    . VAL A 1 57  ? 37.904 17.329 43.686 1.00 50.19 ? 117  VAL A CA    1 
ATOM   442  C  C     . VAL A 1 57  ? 38.670 18.643 43.695 1.00 49.47 ? 117  VAL A C     1 
ATOM   443  O  O     . VAL A 1 57  ? 39.812 18.720 43.237 1.00 49.49 ? 117  VAL A O     1 
ATOM   444  C  CB    . VAL A 1 57  ? 37.615 16.911 42.229 1.00 51.22 ? 117  VAL A CB    1 
ATOM   445  C  CG1   . VAL A 1 57  ? 36.284 16.191 42.158 1.00 51.99 ? 117  VAL A CG1   1 
ATOM   446  C  CG2   . VAL A 1 57  ? 37.656 18.122 41.324 1.00 51.29 ? 117  VAL A CG2   1 
ATOM   447  N  N     . LEU A 1 58  ? 38.040 19.682 44.221 1.00 49.80 ? 118  LEU A N     1 
ATOM   448  C  CA    . LEU A 1 58  ? 38.695 20.980 44.303 1.00 50.97 ? 118  LEU A CA    1 
ATOM   449  C  C     . LEU A 1 58  ? 39.923 20.885 45.213 1.00 52.27 ? 118  LEU A C     1 
ATOM   450  O  O     . LEU A 1 58  ? 40.853 21.675 45.083 1.00 52.10 ? 118  LEU A O     1 
ATOM   451  C  CB    . LEU A 1 58  ? 37.717 22.027 44.836 1.00 48.83 ? 118  LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 58  ? 37.218 23.049 43.820 1.00 49.19 ? 118  LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 58  ? 37.344 22.522 42.403 1.00 47.03 ? 118  LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 58  ? 35.781 23.407 44.156 1.00 48.27 ? 118  LEU A CD2   1 
ATOM   455  N  N     . HIS A 1 59  ? 39.917 19.918 46.134 1.00 54.52 ? 119  HIS A N     1 
ATOM   456  C  CA    . HIS A 1 59  ? 41.044 19.710 47.049 1.00 56.71 ? 119  HIS A CA    1 
ATOM   457  C  C     . HIS A 1 59  ? 42.269 19.235 46.270 1.00 57.54 ? 119  HIS A C     1 
ATOM   458  O  O     . HIS A 1 59  ? 43.407 19.416 46.704 1.00 57.37 ? 119  HIS A O     1 
ATOM   459  C  CB    . HIS A 1 59  ? 40.688 18.675 48.122 1.00 57.44 ? 119  HIS A CB    1 
ATOM   460  C  CG    . HIS A 1 59  ? 39.919 19.240 49.281 1.00 60.54 ? 119  HIS A CG    1 
ATOM   461  N  ND1   . HIS A 1 59  ? 38.753 18.677 49.745 1.00 61.85 ? 119  HIS A ND1   1 
ATOM   462  C  CD2   . HIS A 1 59  ? 40.164 20.315 50.069 1.00 61.22 ? 119  HIS A CD2   1 
ATOM   463  C  CE1   . HIS A 1 59  ? 38.303 19.381 50.774 1.00 60.90 ? 119  HIS A CE1   1 
ATOM   464  N  NE2   . HIS A 1 59  ? 39.140 20.377 50.988 1.00 62.12 ? 119  HIS A NE2   1 
ATOM   465  N  N     . GLU A 1 60  ? 42.021 18.628 45.113 1.00 58.85 ? 120  GLU A N     1 
ATOM   466  C  CA    . GLU A 1 60  ? 43.085 18.128 44.254 1.00 60.18 ? 120  GLU A CA    1 
ATOM   467  C  C     . GLU A 1 60  ? 43.558 19.148 43.222 1.00 59.04 ? 120  GLU A C     1 
ATOM   468  O  O     . GLU A 1 60  ? 44.514 18.887 42.492 1.00 57.78 ? 120  GLU A O     1 
ATOM   469  C  CB    . GLU A 1 60  ? 42.637 16.845 43.546 1.00 63.35 ? 120  GLU A CB    1 
ATOM   470  C  CG    . GLU A 1 60  ? 43.042 15.590 44.291 1.00 68.63 ? 120  GLU A CG    1 
ATOM   471  C  CD    . GLU A 1 60  ? 42.747 15.700 45.771 1.00 73.25 ? 120  GLU A CD    1 
ATOM   472  O  OE1   . GLU A 1 60  ? 41.550 15.665 46.143 1.00 76.59 ? 120  GLU A OE1   1 
ATOM   473  O  OE2   . GLU A 1 60  ? 43.711 15.841 46.563 1.00 74.68 ? 120  GLU A OE2   1 
ATOM   474  N  N     . CYS A 1 61  ? 42.892 20.302 43.162 1.00 57.67 ? 121  CYS A N     1 
ATOM   475  C  CA    . CYS A 1 61  ? 43.271 21.353 42.219 1.00 56.70 ? 121  CYS A CA    1 
ATOM   476  C  C     . CYS A 1 61  ? 44.240 22.305 42.886 1.00 56.60 ? 121  CYS A C     1 
ATOM   477  O  O     . CYS A 1 61  ? 43.857 23.363 43.392 1.00 57.25 ? 121  CYS A O     1 
ATOM   478  C  CB    . CYS A 1 61  ? 42.047 22.127 41.737 1.00 55.13 ? 121  CYS A CB    1 
ATOM   479  S  SG    . CYS A 1 61  ? 40.963 21.163 40.681 1.00 56.63 ? 121  CYS A SG    1 
ATOM   480  N  N     . ASN A 1 62  ? 45.507 21.917 42.875 1.00 55.32 ? 122  ASN A N     1 
ATOM   481  C  CA    . ASN A 1 62  ? 46.552 22.713 43.488 1.00 53.96 ? 122  ASN A CA    1 
ATOM   482  C  C     . ASN A 1 62  ? 47.456 23.258 42.398 1.00 50.99 ? 122  ASN A C     1 
ATOM   483  O  O     . ASN A 1 62  ? 48.085 22.505 41.650 1.00 48.93 ? 122  ASN A O     1 
ATOM   484  C  CB    . ASN A 1 62  ? 47.351 21.843 44.458 1.00 58.37 ? 122  ASN A CB    1 
ATOM   485  C  CG    . ASN A 1 62  ? 46.465 20.884 45.238 1.00 61.46 ? 122  ASN A CG    1 
ATOM   486  O  OD1   . ASN A 1 62  ? 45.671 21.296 46.082 1.00 62.02 ? 122  ASN A OD1   1 
ATOM   487  N  ND2   . ASN A 1 62  ? 46.592 19.589 44.943 1.00 64.82 ? 122  ASN A ND2   1 
ATOM   488  N  N     . SER A 1 63  ? 47.514 24.576 42.306 1.00 47.70 ? 123  SER A N     1 
ATOM   489  C  CA    . SER A 1 63  ? 48.331 25.206 41.296 1.00 45.31 ? 123  SER A CA    1 
ATOM   490  C  C     . SER A 1 63  ? 48.500 26.666 41.626 1.00 45.70 ? 123  SER A C     1 
ATOM   491  O  O     . SER A 1 63  ? 47.645 27.271 42.267 1.00 46.15 ? 123  SER A O     1 
ATOM   492  C  CB    . SER A 1 63  ? 47.685 25.057 39.922 1.00 43.56 ? 123  SER A CB    1 
ATOM   493  O  OG    . SER A 1 63  ? 48.320 25.902 38.985 1.00 45.82 ? 123  SER A OG    1 
ATOM   494  N  N     . PRO A 1 64  ? 49.630 27.251 41.218 1.00 46.45 ? 124  PRO A N     1 
ATOM   495  C  CA    . PRO A 1 64  ? 49.873 28.666 41.496 1.00 45.89 ? 124  PRO A CA    1 
ATOM   496  C  C     . PRO A 1 64  ? 49.013 29.573 40.622 1.00 45.36 ? 124  PRO A C     1 
ATOM   497  O  O     . PRO A 1 64  ? 48.924 30.775 40.865 1.00 45.48 ? 124  PRO A O     1 
ATOM   498  C  CB    . PRO A 1 64  ? 51.372 28.816 41.225 1.00 45.40 ? 124  PRO A CB    1 
ATOM   499  C  CG    . PRO A 1 64  ? 51.631 27.792 40.165 1.00 46.14 ? 124  PRO A CG    1 
ATOM   500  C  CD    . PRO A 1 64  ? 50.829 26.605 40.648 1.00 45.86 ? 124  PRO A CD    1 
ATOM   501  N  N     . TYR A 1 65  ? 48.378 28.991 39.610 1.00 45.03 ? 125  TYR A N     1 
ATOM   502  C  CA    . TYR A 1 65  ? 47.527 29.766 38.719 1.00 44.37 ? 125  TYR A CA    1 
ATOM   503  C  C     . TYR A 1 65  ? 46.048 29.489 38.967 1.00 43.42 ? 125  TYR A C     1 
ATOM   504  O  O     . TYR A 1 65  ? 45.197 29.916 38.191 1.00 43.28 ? 125  TYR A O     1 
ATOM   505  C  CB    . TYR A 1 65  ? 47.880 29.458 37.270 1.00 45.26 ? 125  TYR A CB    1 
ATOM   506  C  CG    . TYR A 1 65  ? 49.353 29.579 37.003 1.00 49.97 ? 125  TYR A CG    1 
ATOM   507  C  CD1   . TYR A 1 65  ? 50.134 28.453 36.779 1.00 52.44 ? 125  TYR A CD1   1 
ATOM   508  C  CD2   . TYR A 1 65  ? 49.976 30.822 37.015 1.00 52.01 ? 125  TYR A CD2   1 
ATOM   509  C  CE1   . TYR A 1 65  ? 51.499 28.562 36.576 1.00 54.57 ? 125  TYR A CE1   1 
ATOM   510  C  CE2   . TYR A 1 65  ? 51.336 30.942 36.814 1.00 53.84 ? 125  TYR A CE2   1 
ATOM   511  C  CZ    . TYR A 1 65  ? 52.093 29.807 36.593 1.00 55.45 ? 125  TYR A CZ    1 
ATOM   512  O  OH    . TYR A 1 65  ? 53.445 29.920 36.364 1.00 58.03 ? 125  TYR A OH    1 
ATOM   513  N  N     . ILE A 1 66  ? 45.750 28.787 40.058 1.00 40.02 ? 126  ILE A N     1 
ATOM   514  C  CA    . ILE A 1 66  ? 44.382 28.444 40.414 1.00 36.35 ? 126  ILE A CA    1 
ATOM   515  C  C     . ILE A 1 66  ? 44.057 28.857 41.841 1.00 38.25 ? 126  ILE A C     1 
ATOM   516  O  O     . ILE A 1 66  ? 44.812 28.550 42.765 1.00 35.80 ? 126  ILE A O     1 
ATOM   517  C  CB    . ILE A 1 66  ? 44.146 26.925 40.376 1.00 37.26 ? 126  ILE A CB    1 
ATOM   518  C  CG1   . ILE A 1 66  ? 44.385 26.374 38.967 1.00 35.52 ? 126  ILE A CG1   1 
ATOM   519  C  CG2   . ILE A 1 66  ? 42.736 26.621 40.899 1.00 30.70 ? 126  ILE A CG2   1 
ATOM   520  C  CD1   . ILE A 1 66  ? 43.396 26.836 37.935 1.00 35.72 ? 126  ILE A CD1   1 
ATOM   521  N  N     . VAL A 1 67  ? 42.922 29.519 42.041 1.00 38.46 ? 127  VAL A N     1 
ATOM   522  C  CA    . VAL A 1 67  ? 42.541 29.921 43.388 1.00 36.27 ? 127  VAL A CA    1 
ATOM   523  C  C     . VAL A 1 67  ? 42.507 28.735 44.349 1.00 36.54 ? 127  VAL A C     1 
ATOM   524  O  O     . VAL A 1 67  ? 41.948 27.679 44.039 1.00 34.81 ? 127  VAL A O     1 
ATOM   525  C  CB    . VAL A 1 67  ? 41.180 30.624 43.391 1.00 36.97 ? 127  VAL A CB    1 
ATOM   526  C  CG1   . VAL A 1 67  ? 40.612 30.669 44.812 1.00 33.66 ? 127  VAL A CG1   1 
ATOM   527  C  CG2   . VAL A 1 67  ? 41.351 32.046 42.849 1.00 34.25 ? 127  VAL A CG2   1 
ATOM   528  N  N     . GLY A 1 68  ? 43.137 28.918 45.511 1.00 37.33 ? 128  GLY A N     1 
ATOM   529  C  CA    . GLY A 1 68  ? 43.185 27.878 46.525 1.00 35.09 ? 128  GLY A CA    1 
ATOM   530  C  C     . GLY A 1 68  ? 41.799 27.542 47.027 1.00 37.26 ? 128  GLY A C     1 
ATOM   531  O  O     . GLY A 1 68  ? 40.928 28.411 47.080 1.00 38.17 ? 128  GLY A O     1 
ATOM   532  N  N     . PHE A 1 69  ? 41.593 26.284 47.403 1.00 37.70 ? 129  PHE A N     1 
ATOM   533  C  CA    . PHE A 1 69  ? 40.293 25.833 47.884 1.00 39.00 ? 129  PHE A CA    1 
ATOM   534  C  C     . PHE A 1 69  ? 40.388 25.274 49.296 1.00 39.10 ? 129  PHE A C     1 
ATOM   535  O  O     . PHE A 1 69  ? 41.351 24.592 49.619 1.00 37.45 ? 129  PHE A O     1 
ATOM   536  C  CB    . PHE A 1 69  ? 39.744 24.776 46.925 1.00 41.08 ? 129  PHE A CB    1 
ATOM   537  C  CG    . PHE A 1 69  ? 38.543 24.042 47.445 1.00 42.54 ? 129  PHE A CG    1 
ATOM   538  C  CD1   . PHE A 1 69  ? 38.678 22.806 48.055 1.00 41.99 ? 129  PHE A CD1   1 
ATOM   539  C  CD2   . PHE A 1 69  ? 37.274 24.569 47.279 1.00 44.30 ? 129  PHE A CD2   1 
ATOM   540  C  CE1   . PHE A 1 69  ? 37.567 22.109 48.484 1.00 45.61 ? 129  PHE A CE1   1 
ATOM   541  C  CE2   . PHE A 1 69  ? 36.156 23.879 47.706 1.00 44.83 ? 129  PHE A CE2   1 
ATOM   542  C  CZ    . PHE A 1 69  ? 36.300 22.646 48.304 1.00 46.35 ? 129  PHE A CZ    1 
ATOM   543  N  N     . TYR A 1 70  ? 39.401 25.567 50.141 1.00 40.43 ? 130  TYR A N     1 
ATOM   544  C  CA    . TYR A 1 70  ? 39.428 25.067 51.518 1.00 43.81 ? 130  TYR A CA    1 
ATOM   545  C  C     . TYR A 1 70  ? 38.387 23.980 51.790 1.00 43.91 ? 130  TYR A C     1 
ATOM   546  O  O     . TYR A 1 70  ? 38.632 23.059 52.568 1.00 43.02 ? 130  TYR A O     1 
ATOM   547  C  CB    . TYR A 1 70  ? 39.231 26.213 52.522 1.00 46.77 ? 130  TYR A CB    1 
ATOM   548  C  CG    . TYR A 1 70  ? 40.423 27.129 52.661 1.00 50.70 ? 130  TYR A CG    1 
ATOM   549  C  CD1   . TYR A 1 70  ? 41.620 26.674 53.213 1.00 52.81 ? 130  TYR A CD1   1 
ATOM   550  C  CD2   . TYR A 1 70  ? 40.368 28.438 52.210 1.00 52.82 ? 130  TYR A CD2   1 
ATOM   551  C  CE1   . TYR A 1 70  ? 42.732 27.503 53.304 1.00 54.88 ? 130  TYR A CE1   1 
ATOM   552  C  CE2   . TYR A 1 70  ? 41.471 29.276 52.295 1.00 55.37 ? 130  TYR A CE2   1 
ATOM   553  C  CZ    . TYR A 1 70  ? 42.652 28.804 52.839 1.00 55.73 ? 130  TYR A CZ    1 
ATOM   554  O  OH    . TYR A 1 70  ? 43.759 29.631 52.887 1.00 57.37 ? 130  TYR A OH    1 
ATOM   555  N  N     . GLY A 1 71  ? 37.226 24.088 51.158 1.00 42.01 ? 131  GLY A N     1 
ATOM   556  C  CA    . GLY A 1 71  ? 36.201 23.093 51.383 1.00 42.56 ? 131  GLY A CA    1 
ATOM   557  C  C     . GLY A 1 71  ? 34.834 23.506 50.882 1.00 43.32 ? 131  GLY A C     1 
ATOM   558  O  O     . GLY A 1 71  ? 34.552 24.693 50.656 1.00 42.54 ? 131  GLY A O     1 
ATOM   559  N  N     . ALA A 1 72  ? 33.976 22.515 50.697 1.00 43.16 ? 132  ALA A N     1 
ATOM   560  C  CA    . ALA A 1 72  ? 32.633 22.782 50.218 1.00 45.40 ? 132  ALA A CA    1 
ATOM   561  C  C     . ALA A 1 72  ? 31.646 22.002 51.047 1.00 46.35 ? 132  ALA A C     1 
ATOM   562  O  O     . ALA A 1 72  ? 31.874 20.829 51.340 1.00 46.91 ? 132  ALA A O     1 
ATOM   563  C  CB    . ALA A 1 72  ? 32.515 22.390 48.757 1.00 45.89 ? 132  ALA A CB    1 
ATOM   564  N  N     . PHE A 1 73  ? 30.562 22.663 51.441 1.00 47.28 ? 133  PHE A N     1 
ATOM   565  C  CA    . PHE A 1 73  ? 29.515 22.026 52.231 1.00 49.87 ? 133  PHE A CA    1 
ATOM   566  C  C     . PHE A 1 73  ? 28.171 22.724 52.014 1.00 52.92 ? 133  PHE A C     1 
ATOM   567  O  O     . PHE A 1 73  ? 28.110 23.829 51.471 1.00 52.51 ? 133  PHE A O     1 
ATOM   568  C  CB    . PHE A 1 73  ? 29.868 22.030 53.729 1.00 47.91 ? 133  PHE A CB    1 
ATOM   569  C  CG    . PHE A 1 73  ? 29.980 23.402 54.316 1.00 47.29 ? 133  PHE A CG    1 
ATOM   570  C  CD1   . PHE A 1 73  ? 31.170 24.108 54.241 1.00 48.03 ? 133  PHE A CD1   1 
ATOM   571  C  CD2   . PHE A 1 73  ? 28.884 24.005 54.903 1.00 47.13 ? 133  PHE A CD2   1 
ATOM   572  C  CE1   . PHE A 1 73  ? 31.257 25.411 54.709 1.00 47.67 ? 133  PHE A CE1   1 
ATOM   573  C  CE2   . PHE A 1 73  ? 28.958 25.306 55.372 1.00 47.87 ? 133  PHE A CE2   1 
ATOM   574  C  CZ    . PHE A 1 73  ? 30.151 26.007 55.285 1.00 49.07 ? 133  PHE A CZ    1 
ATOM   575  N  N     . TYR A 1 74  ? 27.095 22.061 52.429 1.00 56.37 ? 134  TYR A N     1 
ATOM   576  C  CA    . TYR A 1 74  ? 25.747 22.605 52.298 1.00 58.48 ? 134  TYR A CA    1 
ATOM   577  C  C     . TYR A 1 74  ? 25.267 23.042 53.681 1.00 59.51 ? 134  TYR A C     1 
ATOM   578  O  O     . TYR A 1 74  ? 25.388 22.296 54.653 1.00 60.10 ? 134  TYR A O     1 
ATOM   579  C  CB    . TYR A 1 74  ? 24.802 21.551 51.697 1.00 58.76 ? 134  TYR A CB    1 
ATOM   580  C  CG    . TYR A 1 74  ? 23.349 21.976 51.676 1.00 61.52 ? 134  TYR A CG    1 
ATOM   581  C  CD1   . TYR A 1 74  ? 22.460 21.534 52.656 1.00 62.17 ? 134  TYR A CD1   1 
ATOM   582  C  CD2   . TYR A 1 74  ? 22.876 22.864 50.711 1.00 61.68 ? 134  TYR A CD2   1 
ATOM   583  C  CE1   . TYR A 1 74  ? 21.146 21.968 52.678 1.00 62.56 ? 134  TYR A CE1   1 
ATOM   584  C  CE2   . TYR A 1 74  ? 21.565 23.305 50.725 1.00 61.37 ? 134  TYR A CE2   1 
ATOM   585  C  CZ    . TYR A 1 74  ? 20.706 22.855 51.712 1.00 63.19 ? 134  TYR A CZ    1 
ATOM   586  O  OH    . TYR A 1 74  ? 19.411 23.310 51.750 1.00 64.32 ? 134  TYR A OH    1 
ATOM   587  N  N     . SER A 1 75  ? 24.743 24.257 53.771 1.00 60.92 ? 135  SER A N     1 
ATOM   588  C  CA    . SER A 1 75  ? 24.272 24.773 55.044 1.00 63.56 ? 135  SER A CA    1 
ATOM   589  C  C     . SER A 1 75  ? 22.759 24.853 55.069 1.00 65.40 ? 135  SER A C     1 
ATOM   590  O  O     . SER A 1 75  ? 22.083 23.832 55.171 1.00 68.84 ? 135  SER A O     1 
ATOM   591  C  CB    . SER A 1 75  ? 24.878 26.153 55.313 1.00 64.39 ? 135  SER A CB    1 
ATOM   592  O  OG    . SER A 1 75  ? 24.465 26.655 56.568 1.00 63.99 ? 135  SER A OG    1 
ATOM   593  N  N     . ASP A 1 76  ? 22.211 26.054 54.972 1.00 65.99 ? 136  ASP A N     1 
ATOM   594  C  CA    . ASP A 1 76  ? 20.761 26.179 55.009 1.00 66.71 ? 136  ASP A CA    1 
ATOM   595  C  C     . ASP A 1 76  ? 20.216 26.825 53.757 1.00 64.93 ? 136  ASP A C     1 
ATOM   596  O  O     . ASP A 1 76  ? 20.083 28.042 53.687 1.00 63.75 ? 136  ASP A O     1 
ATOM   597  C  CB    . ASP A 1 76  ? 20.324 26.981 56.239 1.00 70.56 ? 136  ASP A CB    1 
ATOM   598  C  CG    . ASP A 1 76  ? 18.810 27.149 56.324 1.00 76.30 ? 136  ASP A CG    1 
ATOM   599  O  OD1   . ASP A 1 76  ? 18.075 26.151 56.100 1.00 78.48 ? 136  ASP A OD1   1 
ATOM   600  O  OD2   . ASP A 1 76  ? 18.350 28.276 56.629 1.00 78.44 ? 136  ASP A OD2   1 
ATOM   601  N  N     . GLY A 1 77  ? 19.904 26.001 52.765 1.00 63.67 ? 137  GLY A N     1 
ATOM   602  C  CA    . GLY A 1 77  ? 19.360 26.532 51.534 1.00 62.89 ? 137  GLY A CA    1 
ATOM   603  C  C     . GLY A 1 77  ? 20.418 26.995 50.554 1.00 61.94 ? 137  GLY A C     1 
ATOM   604  O  O     . GLY A 1 77  ? 20.130 27.760 49.632 1.00 62.25 ? 137  GLY A O     1 
ATOM   605  N  N     . GLU A 1 78  ? 21.649 26.541 50.750 1.00 60.85 ? 138  GLU A N     1 
ATOM   606  C  CA    . GLU A 1 78  ? 22.729 26.913 49.846 1.00 60.41 ? 138  GLU A CA    1 
ATOM   607  C  C     . GLU A 1 78  ? 24.050 26.235 50.124 1.00 56.44 ? 138  GLU A C     1 
ATOM   608  O  O     . GLU A 1 78  ? 24.406 25.979 51.264 1.00 54.32 ? 138  GLU A O     1 
ATOM   609  C  CB    . GLU A 1 78  ? 22.927 28.426 49.848 1.00 63.47 ? 138  GLU A CB    1 
ATOM   610  C  CG    . GLU A 1 78  ? 22.776 29.072 51.191 1.00 64.63 ? 138  GLU A CG    1 
ATOM   611  C  CD    . GLU A 1 78  ? 22.466 30.544 51.046 1.00 67.37 ? 138  GLU A CD    1 
ATOM   612  O  OE1   . GLU A 1 78  ? 21.519 30.876 50.301 1.00 67.40 ? 138  GLU A OE1   1 
ATOM   613  O  OE2   . GLU A 1 78  ? 23.163 31.369 51.673 1.00 70.67 ? 138  GLU A OE2   1 
ATOM   614  N  N     . ILE A 1 79  ? 24.774 25.931 49.060 1.00 54.61 ? 139  ILE A N     1 
ATOM   615  C  CA    . ILE A 1 79  ? 26.052 25.293 49.233 1.00 53.38 ? 139  ILE A CA    1 
ATOM   616  C  C     . ILE A 1 79  ? 27.093 26.390 49.409 1.00 52.16 ? 139  ILE A C     1 
ATOM   617  O  O     . ILE A 1 79  ? 26.950 27.511 48.896 1.00 51.64 ? 139  ILE A O     1 
ATOM   618  C  CB    . ILE A 1 79  ? 26.435 24.434 48.020 1.00 54.55 ? 139  ILE A CB    1 
ATOM   619  C  CG1   . ILE A 1 79  ? 26.936 25.330 46.908 1.00 54.75 ? 139  ILE A CG1   1 
ATOM   620  C  CG2   . ILE A 1 79  ? 25.227 23.620 47.535 1.00 53.18 ? 139  ILE A CG2   1 
ATOM   621  C  CD1   . ILE A 1 79  ? 27.808 24.595 45.943 1.00 58.27 ? 139  ILE A CD1   1 
ATOM   622  N  N     . SER A 1 80  ? 28.140 26.067 50.153 1.00 49.61 ? 140  SER A N     1 
ATOM   623  C  CA    . SER A 1 80  ? 29.216 27.014 50.407 1.00 47.08 ? 140  SER A CA    1 
ATOM   624  C  C     . SER A 1 80  ? 30.488 26.544 49.744 1.00 46.15 ? 140  SER A C     1 
ATOM   625  O  O     . SER A 1 80  ? 30.847 25.372 49.834 1.00 47.53 ? 140  SER A O     1 
ATOM   626  C  CB    . SER A 1 80  ? 29.481 27.147 51.915 1.00 45.44 ? 140  SER A CB    1 
ATOM   627  O  OG    . SER A 1 80  ? 28.593 28.052 52.534 1.00 41.55 ? 140  SER A OG    1 
ATOM   628  N  N     . ILE A 1 81  ? 31.162 27.449 49.055 1.00 44.13 ? 141  ILE A N     1 
ATOM   629  C  CA    . ILE A 1 81  ? 32.434 27.095 48.454 1.00 42.24 ? 141  ILE A CA    1 
ATOM   630  C  C     . ILE A 1 81  ? 33.403 28.049 49.130 1.00 41.92 ? 141  ILE A C     1 
ATOM   631  O  O     . ILE A 1 81  ? 33.325 29.268 48.964 1.00 39.66 ? 141  ILE A O     1 
ATOM   632  C  CB    . ILE A 1 81  ? 32.425 27.281 46.921 1.00 42.88 ? 141  ILE A CB    1 
ATOM   633  C  CG1   . ILE A 1 81  ? 31.336 26.387 46.316 1.00 41.63 ? 141  ILE A CG1   1 
ATOM   634  C  CG2   . ILE A 1 81  ? 33.790 26.916 46.349 1.00 39.76 ? 141  ILE A CG2   1 
ATOM   635  C  CD1   . ILE A 1 81  ? 31.412 26.212 44.821 1.00 41.88 ? 141  ILE A CD1   1 
ATOM   636  N  N     . CYS A 1 82  ? 34.280 27.491 49.948 1.00 42.42 ? 142  CYS A N     1 
ATOM   637  C  CA    . CYS A 1 82  ? 35.232 28.309 50.674 1.00 42.87 ? 142  CYS A CA    1 
ATOM   638  C  C     . CYS A 1 82  ? 36.583 28.292 49.996 1.00 42.72 ? 142  CYS A C     1 
ATOM   639  O  O     . CYS A 1 82  ? 37.166 27.228 49.743 1.00 42.45 ? 142  CYS A O     1 
ATOM   640  C  CB    . CYS A 1 82  ? 35.353 27.817 52.114 1.00 44.11 ? 142  CYS A CB    1 
ATOM   641  S  SG    . CYS A 1 82  ? 33.798 27.864 53.018 1.00 47.99 ? 142  CYS A SG    1 
ATOM   642  N  N     . MET A 1 83  ? 37.090 29.483 49.706 1.00 42.02 ? 143  MET A N     1 
ATOM   643  C  CA    . MET A 1 83  ? 38.368 29.580 49.031 1.00 40.78 ? 143  MET A CA    1 
ATOM   644  C  C     . MET A 1 83  ? 39.321 30.625 49.617 1.00 40.76 ? 143  MET A C     1 
ATOM   645  O  O     . MET A 1 83  ? 39.001 31.344 50.576 1.00 38.50 ? 143  MET A O     1 
ATOM   646  C  CB    . MET A 1 83  ? 38.120 29.840 47.536 1.00 40.30 ? 143  MET A CB    1 
ATOM   647  C  CG    . MET A 1 83  ? 37.414 31.151 47.231 1.00 42.84 ? 143  MET A CG    1 
ATOM   648  S  SD    . MET A 1 83  ? 36.787 31.357 45.498 1.00 43.68 ? 143  MET A SD    1 
ATOM   649  C  CE    . MET A 1 83  ? 34.999 31.671 45.877 1.00 46.14 ? 143  MET A CE    1 
ATOM   650  N  N     . GLU A 1 84  ? 40.515 30.668 49.036 1.00 39.83 ? 144  GLU A N     1 
ATOM   651  C  CA    . GLU A 1 84  ? 41.556 31.604 49.433 1.00 39.27 ? 144  GLU A CA    1 
ATOM   652  C  C     . GLU A 1 84  ? 41.033 33.010 49.165 1.00 39.17 ? 144  GLU A C     1 
ATOM   653  O  O     . GLU A 1 84  ? 40.353 33.247 48.171 1.00 39.08 ? 144  GLU A O     1 
ATOM   654  C  CB    . GLU A 1 84  ? 42.816 31.329 48.603 1.00 39.53 ? 144  GLU A CB    1 
ATOM   655  C  CG    . GLU A 1 84  ? 43.847 32.442 48.533 1.00 41.90 ? 144  GLU A CG    1 
ATOM   656  C  CD    . GLU A 1 84  ? 44.953 32.136 47.504 1.00 46.07 ? 144  GLU A CD    1 
ATOM   657  O  OE1   . GLU A 1 84  ? 45.899 32.954 47.362 1.00 45.32 ? 144  GLU A OE1   1 
ATOM   658  O  OE2   . GLU A 1 84  ? 44.871 31.073 46.836 1.00 44.48 ? 144  GLU A OE2   1 
ATOM   659  N  N     . HIS A 1 85  ? 41.312 33.939 50.066 1.00 39.41 ? 145  HIS A N     1 
ATOM   660  C  CA    . HIS A 1 85  ? 40.860 35.298 49.855 1.00 40.54 ? 145  HIS A CA    1 
ATOM   661  C  C     . HIS A 1 85  ? 41.932 36.019 49.037 1.00 40.53 ? 145  HIS A C     1 
ATOM   662  O  O     . HIS A 1 85  ? 43.103 35.999 49.391 1.00 41.64 ? 145  HIS A O     1 
ATOM   663  C  CB    . HIS A 1 85  ? 40.653 36.016 51.186 1.00 41.32 ? 145  HIS A CB    1 
ATOM   664  C  CG    . HIS A 1 85  ? 40.463 37.493 51.034 1.00 45.03 ? 145  HIS A CG    1 
ATOM   665  N  ND1   . HIS A 1 85  ? 41.115 38.412 51.825 1.00 46.28 ? 145  HIS A ND1   1 
ATOM   666  C  CD2   . HIS A 1 85  ? 39.730 38.208 50.148 1.00 46.30 ? 145  HIS A CD2   1 
ATOM   667  C  CE1   . HIS A 1 85  ? 40.795 39.633 51.431 1.00 46.90 ? 145  HIS A CE1   1 
ATOM   668  N  NE2   . HIS A 1 85  ? 39.958 39.537 50.416 1.00 47.12 ? 145  HIS A NE2   1 
ATOM   669  N  N     . MET A 1 86  ? 41.543 36.632 47.926 1.00 40.21 ? 146  MET A N     1 
ATOM   670  C  CA    . MET A 1 86  ? 42.508 37.345 47.104 1.00 40.62 ? 146  MET A CA    1 
ATOM   671  C  C     . MET A 1 86  ? 42.270 38.830 47.342 1.00 41.71 ? 146  MET A C     1 
ATOM   672  O  O     . MET A 1 86  ? 41.345 39.436 46.783 1.00 41.80 ? 146  MET A O     1 
ATOM   673  C  CB    . MET A 1 86  ? 42.324 36.988 45.632 1.00 39.51 ? 146  MET A CB    1 
ATOM   674  C  CG    . MET A 1 86  ? 42.438 35.500 45.332 1.00 38.47 ? 146  MET A CG    1 
ATOM   675  S  SD    . MET A 1 86  ? 44.158 34.868 45.389 1.00 36.84 ? 146  MET A SD    1 
ATOM   676  C  CE    . MET A 1 86  ? 44.829 35.636 43.923 1.00 32.44 ? 146  MET A CE    1 
ATOM   677  N  N     . ASP A 1 87  ? 43.112 39.405 48.194 1.00 40.62 ? 147  ASP A N     1 
ATOM   678  C  CA    . ASP A 1 87  ? 42.989 40.802 48.566 1.00 40.67 ? 147  ASP A CA    1 
ATOM   679  C  C     . ASP A 1 87  ? 43.002 41.779 47.406 1.00 38.29 ? 147  ASP A C     1 
ATOM   680  O  O     . ASP A 1 87  ? 42.663 42.939 47.582 1.00 40.51 ? 147  ASP A O     1 
ATOM   681  C  CB    . ASP A 1 87  ? 44.067 41.170 49.595 1.00 44.09 ? 147  ASP A CB    1 
ATOM   682  C  CG    . ASP A 1 87  ? 45.486 41.003 49.066 1.00 47.75 ? 147  ASP A CG    1 
ATOM   683  O  OD1   . ASP A 1 87  ? 46.419 41.199 49.878 1.00 51.14 ? 147  ASP A OD1   1 
ATOM   684  O  OD2   . ASP A 1 87  ? 45.677 40.688 47.864 1.00 46.57 ? 147  ASP A OD2   1 
ATOM   685  N  N     . GLY A 1 88  ? 43.377 41.309 46.224 1.00 37.77 ? 148  GLY A N     1 
ATOM   686  C  CA    . GLY A 1 88  ? 43.403 42.175 45.059 1.00 37.82 ? 148  GLY A CA    1 
ATOM   687  C  C     . GLY A 1 88  ? 42.082 42.149 44.297 1.00 40.27 ? 148  GLY A C     1 
ATOM   688  O  O     . GLY A 1 88  ? 41.834 43.014 43.460 1.00 40.52 ? 148  GLY A O     1 
ATOM   689  N  N     . GLY A 1 89  ? 41.234 41.157 44.571 1.00 39.18 ? 149  GLY A N     1 
ATOM   690  C  CA    . GLY A 1 89  ? 39.959 41.082 43.886 1.00 38.59 ? 149  GLY A CA    1 
ATOM   691  C  C     . GLY A 1 89  ? 40.014 40.543 42.462 1.00 38.72 ? 149  GLY A C     1 
ATOM   692  O  O     . GLY A 1 89  ? 41.002 39.921 42.049 1.00 38.15 ? 149  GLY A O     1 
ATOM   693  N  N     . SER A 1 90  ? 38.948 40.789 41.706 1.00 35.52 ? 150  SER A N     1 
ATOM   694  C  CA    . SER A 1 90  ? 38.861 40.311 40.335 1.00 36.89 ? 150  SER A CA    1 
ATOM   695  C  C     . SER A 1 90  ? 39.381 41.363 39.370 1.00 38.24 ? 150  SER A C     1 
ATOM   696  O  O     . SER A 1 90  ? 39.360 42.561 39.672 1.00 37.09 ? 150  SER A O     1 
ATOM   697  C  CB    . SER A 1 90  ? 37.410 39.955 39.996 1.00 38.14 ? 150  SER A CB    1 
ATOM   698  O  OG    . SER A 1 90  ? 36.555 41.068 40.195 1.00 39.09 ? 150  SER A OG    1 
ATOM   699  N  N     . LEU A 1 91  ? 39.847 40.919 38.205 1.00 39.76 ? 151  LEU A N     1 
ATOM   700  C  CA    . LEU A 1 91  ? 40.373 41.849 37.217 1.00 42.18 ? 151  LEU A CA    1 
ATOM   701  C  C     . LEU A 1 91  ? 39.327 42.850 36.754 1.00 43.33 ? 151  LEU A C     1 
ATOM   702  O  O     . LEU A 1 91  ? 39.648 44.011 36.510 1.00 44.21 ? 151  LEU A O     1 
ATOM   703  C  CB    . LEU A 1 91  ? 40.971 41.105 36.012 1.00 41.12 ? 151  LEU A CB    1 
ATOM   704  C  CG    . LEU A 1 91  ? 42.401 40.609 36.282 1.00 42.45 ? 151  LEU A CG    1 
ATOM   705  C  CD1   . LEU A 1 91  ? 43.115 40.213 34.983 1.00 40.04 ? 151  LEU A CD1   1 
ATOM   706  C  CD2   . LEU A 1 91  ? 43.161 41.742 36.989 1.00 40.03 ? 151  LEU A CD2   1 
ATOM   707  N  N     . ASP A 1 92  ? 38.073 42.424 36.650 1.00 45.85 ? 152  ASP A N     1 
ATOM   708  C  CA    . ASP A 1 92  ? 37.039 43.355 36.214 1.00 47.01 ? 152  ASP A CA    1 
ATOM   709  C  C     . ASP A 1 92  ? 36.950 44.504 37.236 1.00 45.29 ? 152  ASP A C     1 
ATOM   710  O  O     . ASP A 1 92  ? 36.711 45.652 36.863 1.00 42.66 ? 152  ASP A O     1 
ATOM   711  C  CB    . ASP A 1 92  ? 35.702 42.604 36.000 1.00 49.92 ? 152  ASP A CB    1 
ATOM   712  C  CG    . ASP A 1 92  ? 34.772 42.677 37.188 1.00 52.91 ? 152  ASP A CG    1 
ATOM   713  O  OD1   . ASP A 1 92  ? 33.801 43.473 37.127 1.00 54.60 ? 152  ASP A OD1   1 
ATOM   714  O  OD2   . ASP A 1 92  ? 35.002 41.938 38.173 1.00 56.42 ? 152  ASP A OD2   1 
ATOM   715  N  N     . GLN A 1 93  ? 37.185 44.195 38.515 1.00 46.84 ? 153  GLN A N     1 
ATOM   716  C  CA    . GLN A 1 93  ? 37.190 45.211 39.577 1.00 48.12 ? 153  GLN A CA    1 
ATOM   717  C  C     . GLN A 1 93  ? 38.375 46.173 39.389 1.00 49.31 ? 153  GLN A C     1 
ATOM   718  O  O     . GLN A 1 93  ? 38.195 47.393 39.386 1.00 49.44 ? 153  GLN A O     1 
ATOM   719  C  CB    . GLN A 1 93  ? 37.313 44.572 40.961 1.00 46.52 ? 153  GLN A CB    1 
ATOM   720  C  CG    . GLN A 1 93  ? 36.052 43.951 41.497 1.00 47.42 ? 153  GLN A CG    1 
ATOM   721  C  CD    . GLN A 1 93  ? 36.233 43.399 42.909 1.00 48.39 ? 153  GLN A CD    1 
ATOM   722  O  OE1   . GLN A 1 93  ? 36.926 42.398 43.119 1.00 47.66 ? 153  GLN A OE1   1 
ATOM   723  N  NE2   . GLN A 1 93  ? 35.615 44.059 43.886 1.00 49.78 ? 153  GLN A NE2   1 
ATOM   724  N  N     . VAL A 1 94  ? 39.582 45.626 39.233 1.00 48.32 ? 154  VAL A N     1 
ATOM   725  C  CA    . VAL A 1 94  ? 40.748 46.477 39.048 1.00 49.64 ? 154  VAL A CA    1 
ATOM   726  C  C     . VAL A 1 94  ? 40.630 47.233 37.723 1.00 51.71 ? 154  VAL A C     1 
ATOM   727  O  O     . VAL A 1 94  ? 41.174 48.327 37.573 1.00 52.80 ? 154  VAL A O     1 
ATOM   728  C  CB    . VAL A 1 94  ? 42.095 45.679 39.043 1.00 47.29 ? 154  VAL A CB    1 
ATOM   729  C  CG1   . VAL A 1 94  ? 41.989 44.452 39.913 1.00 43.79 ? 154  VAL A CG1   1 
ATOM   730  C  CG2   . VAL A 1 94  ? 42.493 45.336 37.637 1.00 48.17 ? 154  VAL A CG2   1 
ATOM   731  N  N     . LEU A 1 95  ? 39.911 46.658 36.763 1.00 52.33 ? 155  LEU A N     1 
ATOM   732  C  CA    . LEU A 1 95  ? 39.741 47.303 35.468 1.00 54.01 ? 155  LEU A CA    1 
ATOM   733  C  C     . LEU A 1 95  ? 38.989 48.617 35.607 1.00 55.96 ? 155  LEU A C     1 
ATOM   734  O  O     . LEU A 1 95  ? 39.256 49.568 34.876 1.00 55.64 ? 155  LEU A O     1 
ATOM   735  C  CB    . LEU A 1 95  ? 38.993 46.383 34.500 1.00 52.32 ? 155  LEU A CB    1 
ATOM   736  C  CG    . LEU A 1 95  ? 38.739 46.957 33.101 1.00 52.61 ? 155  LEU A CG    1 
ATOM   737  C  CD1   . LEU A 1 95  ? 40.033 47.512 32.513 1.00 53.20 ? 155  LEU A CD1   1 
ATOM   738  C  CD2   . LEU A 1 95  ? 38.163 45.870 32.199 1.00 52.57 ? 155  LEU A CD2   1 
ATOM   739  N  N     . LYS A 1 96  ? 38.050 48.670 36.545 1.00 59.59 ? 156  LYS A N     1 
ATOM   740  C  CA    . LYS A 1 96  ? 37.271 49.883 36.762 1.00 63.08 ? 156  LYS A CA    1 
ATOM   741  C  C     . LYS A 1 96  ? 38.157 51.000 37.315 1.00 64.69 ? 156  LYS A C     1 
ATOM   742  O  O     . LYS A 1 96  ? 38.281 52.070 36.710 1.00 64.92 ? 156  LYS A O     1 
ATOM   743  C  CB    . LYS A 1 96  ? 36.115 49.619 37.736 1.00 64.34 ? 156  LYS A CB    1 
ATOM   744  C  CG    . LYS A 1 96  ? 35.151 48.518 37.311 1.00 63.49 ? 156  LYS A CG    1 
ATOM   745  C  CD    . LYS A 1 96  ? 33.987 48.422 38.295 1.00 65.38 ? 156  LYS A CD    1 
ATOM   746  C  CE    . LYS A 1 96  ? 33.121 47.170 38.077 1.00 67.28 ? 156  LYS A CE    1 
ATOM   747  N  NZ    . LYS A 1 96  ? 32.430 47.128 36.754 1.00 68.90 ? 156  LYS A NZ    1 
ATOM   748  N  N     . LYS A 1 97  ? 38.779 50.746 38.461 1.00 64.82 ? 157  LYS A N     1 
ATOM   749  C  CA    . LYS A 1 97  ? 39.641 51.747 39.071 1.00 65.63 ? 157  LYS A CA    1 
ATOM   750  C  C     . LYS A 1 97  ? 40.809 52.140 38.164 1.00 65.95 ? 157  LYS A C     1 
ATOM   751  O  O     . LYS A 1 97  ? 41.311 53.259 38.244 1.00 67.25 ? 157  LYS A O     1 
ATOM   752  C  CB    . LYS A 1 97  ? 40.169 51.239 40.410 1.00 65.96 ? 157  LYS A CB    1 
ATOM   753  C  CG    . LYS A 1 97  ? 39.072 50.739 41.323 1.00 68.10 ? 157  LYS A CG    1 
ATOM   754  C  CD    . LYS A 1 97  ? 39.521 50.691 42.770 1.00 69.95 ? 157  LYS A CD    1 
ATOM   755  C  CE    . LYS A 1 97  ? 39.741 52.092 43.328 1.00 70.56 ? 157  LYS A CE    1 
ATOM   756  N  NZ    . LYS A 1 97  ? 40.096 52.029 44.777 1.00 71.41 ? 157  LYS A NZ    1 
ATOM   757  N  N     . ALA A 1 98  ? 41.231 51.222 37.298 1.00 65.56 ? 158  ALA A N     1 
ATOM   758  C  CA    . ALA A 1 98  ? 42.343 51.478 36.388 1.00 65.02 ? 158  ALA A CA    1 
ATOM   759  C  C     . ALA A 1 98  ? 41.857 52.065 35.074 1.00 65.20 ? 158  ALA A C     1 
ATOM   760  O  O     . ALA A 1 98  ? 42.610 52.727 34.355 1.00 64.55 ? 158  ALA A O     1 
ATOM   761  C  CB    . ALA A 1 98  ? 43.110 50.188 36.121 1.00 64.72 ? 158  ALA A CB    1 
ATOM   762  N  N     . GLY A 1 99  ? 40.591 51.809 34.763 1.00 65.01 ? 159  GLY A N     1 
ATOM   763  C  CA    . GLY A 1 99  ? 40.015 52.304 33.530 1.00 64.49 ? 159  GLY A CA    1 
ATOM   764  C  C     . GLY A 1 99  ? 40.515 51.505 32.344 1.00 63.82 ? 159  GLY A C     1 
ATOM   765  O  O     . GLY A 1 99  ? 39.781 51.241 31.393 1.00 63.96 ? 159  GLY A O     1 
ATOM   766  N  N     . ARG A 1 100 ? 41.779 51.111 32.406 1.00 63.26 ? 160  ARG A N     1 
ATOM   767  C  CA    . ARG A 1 100 ? 42.387 50.344 31.336 1.00 62.31 ? 160  ARG A CA    1 
ATOM   768  C  C     . ARG A 1 100 ? 43.621 49.677 31.918 1.00 61.00 ? 160  ARG A C     1 
ATOM   769  O  O     . ARG A 1 100 ? 44.237 50.209 32.845 1.00 61.65 ? 160  ARG A O     1 
ATOM   770  C  CB    . ARG A 1 100 ? 42.779 51.271 30.186 1.00 62.73 ? 160  ARG A CB    1 
ATOM   771  C  CG    . ARG A 1 100 ? 43.056 50.564 28.872 1.00 66.21 ? 160  ARG A CG    1 
ATOM   772  C  CD    . ARG A 1 100 ? 43.805 51.476 27.916 1.00 69.57 ? 160  ARG A CD    1 
ATOM   773  N  NE    . ARG A 1 100 ? 43.054 52.679 27.576 1.00 71.57 ? 160  ARG A NE    1 
ATOM   774  C  CZ    . ARG A 1 100 ? 43.616 53.841 27.252 1.00 73.26 ? 160  ARG A CZ    1 
ATOM   775  N  NH1   . ARG A 1 100 ? 44.940 53.956 27.228 1.00 73.17 ? 160  ARG A NH1   1 
ATOM   776  N  NH2   . ARG A 1 100 ? 42.855 54.886 26.947 1.00 72.47 ? 160  ARG A NH2   1 
ATOM   777  N  N     . ILE A 1 101 ? 43.975 48.512 31.384 1.00 58.24 ? 161  ILE A N     1 
ATOM   778  C  CA    . ILE A 1 101 ? 45.133 47.785 31.877 1.00 55.84 ? 161  ILE A CA    1 
ATOM   779  C  C     . ILE A 1 101 ? 46.211 47.687 30.822 1.00 55.50 ? 161  ILE A C     1 
ATOM   780  O  O     . ILE A 1 101 ? 45.968 47.226 29.714 1.00 54.78 ? 161  ILE A O     1 
ATOM   781  C  CB    . ILE A 1 101 ? 44.751 46.390 32.342 1.00 55.17 ? 161  ILE A CB    1 
ATOM   782  C  CG1   . ILE A 1 101 ? 43.759 46.504 33.507 1.00 55.44 ? 161  ILE A CG1   1 
ATOM   783  C  CG2   . ILE A 1 101 ? 45.996 45.630 32.763 1.00 54.64 ? 161  ILE A CG2   1 
ATOM   784  C  CD1   . ILE A 1 101 ? 43.138 45.193 33.932 1.00 56.13 ? 161  ILE A CD1   1 
ATOM   785  N  N     . PRO A 1 102 ? 47.430 48.136 31.163 1.00 55.32 ? 162  PRO A N     1 
ATOM   786  C  CA    . PRO A 1 102 ? 48.608 48.135 30.284 1.00 54.59 ? 162  PRO A CA    1 
ATOM   787  C  C     . PRO A 1 102 ? 48.913 46.789 29.621 1.00 54.22 ? 162  PRO A C     1 
ATOM   788  O  O     . PRO A 1 102 ? 48.663 45.726 30.192 1.00 53.69 ? 162  PRO A O     1 
ATOM   789  C  CB    . PRO A 1 102 ? 49.731 48.579 31.217 1.00 53.93 ? 162  PRO A CB    1 
ATOM   790  C  CG    . PRO A 1 102 ? 49.021 49.435 32.229 1.00 53.81 ? 162  PRO A CG    1 
ATOM   791  C  CD    . PRO A 1 102 ? 47.774 48.654 32.503 1.00 53.63 ? 162  PRO A CD    1 
ATOM   792  N  N     . GLU A 1 103 ? 49.465 46.848 28.414 1.00 54.22 ? 163  GLU A N     1 
ATOM   793  C  CA    . GLU A 1 103 ? 49.812 45.642 27.682 1.00 55.54 ? 163  GLU A CA    1 
ATOM   794  C  C     . GLU A 1 103 ? 50.821 44.803 28.465 1.00 55.71 ? 163  GLU A C     1 
ATOM   795  O  O     . GLU A 1 103 ? 50.781 43.575 28.423 1.00 54.88 ? 163  GLU A O     1 
ATOM   796  C  CB    . GLU A 1 103 ? 50.411 45.989 26.318 1.00 55.07 ? 163  GLU A CB    1 
ATOM   797  C  CG    . GLU A 1 103 ? 50.644 44.769 25.453 1.00 55.36 ? 163  GLU A CG    1 
ATOM   798  C  CD    . GLU A 1 103 ? 51.308 45.095 24.134 1.00 55.65 ? 163  GLU A CD    1 
ATOM   799  O  OE1   . GLU A 1 103 ? 50.971 46.143 23.537 1.00 56.12 ? 163  GLU A OE1   1 
ATOM   800  O  OE2   . GLU A 1 103 ? 52.159 44.292 23.687 1.00 55.88 ? 163  GLU A OE2   1 
ATOM   801  N  N     . GLN A 1 104 ? 51.726 45.471 29.174 1.00 56.18 ? 164  GLN A N     1 
ATOM   802  C  CA    . GLN A 1 104 ? 52.744 44.780 29.965 1.00 56.52 ? 164  GLN A CA    1 
ATOM   803  C  C     . GLN A 1 104 ? 52.087 43.857 30.981 1.00 52.80 ? 164  GLN A C     1 
ATOM   804  O  O     . GLN A 1 104 ? 52.431 42.679 31.086 1.00 52.04 ? 164  GLN A O     1 
ATOM   805  C  CB    . GLN A 1 104 ? 53.633 45.798 30.693 1.00 61.30 ? 164  GLN A CB    1 
ATOM   806  C  CG    . GLN A 1 104 ? 54.504 46.634 29.763 1.00 67.33 ? 164  GLN A CG    1 
ATOM   807  C  CD    . GLN A 1 104 ? 55.640 45.833 29.153 1.00 70.49 ? 164  GLN A CD    1 
ATOM   808  O  OE1   . GLN A 1 104 ? 56.286 46.273 28.200 1.00 72.50 ? 164  GLN A OE1   1 
ATOM   809  N  NE2   . GLN A 1 104 ? 55.896 44.653 29.708 1.00 72.59 ? 164  GLN A NE2   1 
ATOM   810  N  N     . ILE A 1 105 ? 51.136 44.406 31.726 1.00 48.95 ? 165  ILE A N     1 
ATOM   811  C  CA    . ILE A 1 105 ? 50.424 43.634 32.723 1.00 46.32 ? 165  ILE A CA    1 
ATOM   812  C  C     . ILE A 1 105 ? 49.604 42.537 32.050 1.00 43.59 ? 165  ILE A C     1 
ATOM   813  O  O     . ILE A 1 105 ? 49.649 41.385 32.469 1.00 42.83 ? 165  ILE A O     1 
ATOM   814  C  CB    . ILE A 1 105 ? 49.510 44.542 33.566 1.00 48.07 ? 165  ILE A CB    1 
ATOM   815  C  CG1   . ILE A 1 105 ? 50.354 45.642 34.218 1.00 49.17 ? 165  ILE A CG1   1 
ATOM   816  C  CG2   . ILE A 1 105 ? 48.824 43.741 34.655 1.00 46.11 ? 165  ILE A CG2   1 
ATOM   817  C  CD1   . ILE A 1 105 ? 51.502 45.105 35.040 1.00 48.00 ? 165  ILE A CD1   1 
ATOM   818  N  N     . LEU A 1 106 ? 48.879 42.877 30.991 1.00 42.21 ? 166  LEU A N     1 
ATOM   819  C  CA    . LEU A 1 106 ? 48.074 41.874 30.305 1.00 41.66 ? 166  LEU A CA    1 
ATOM   820  C  C     . LEU A 1 106 ? 48.900 40.684 29.832 1.00 42.93 ? 166  LEU A C     1 
ATOM   821  O  O     . LEU A 1 106 ? 48.381 39.572 29.700 1.00 42.76 ? 166  LEU A O     1 
ATOM   822  C  CB    . LEU A 1 106 ? 47.331 42.498 29.125 1.00 40.56 ? 166  LEU A CB    1 
ATOM   823  C  CG    . LEU A 1 106 ? 46.241 43.502 29.557 1.00 41.67 ? 166  LEU A CG    1 
ATOM   824  C  CD1   . LEU A 1 106 ? 45.494 44.006 28.343 1.00 39.12 ? 166  LEU A CD1   1 
ATOM   825  C  CD2   . LEU A 1 106 ? 45.281 42.822 30.526 1.00 38.88 ? 166  LEU A CD2   1 
ATOM   826  N  N     . GLY A 1 107 ? 50.190 40.909 29.585 1.00 43.17 ? 167  GLY A N     1 
ATOM   827  C  CA    . GLY A 1 107 ? 51.047 39.823 29.138 1.00 40.98 ? 167  GLY A CA    1 
ATOM   828  C  C     . GLY A 1 107 ? 51.253 38.839 30.271 1.00 40.64 ? 167  GLY A C     1 
ATOM   829  O  O     . GLY A 1 107 ? 51.224 37.618 30.079 1.00 38.18 ? 167  GLY A O     1 
ATOM   830  N  N     . LYS A 1 108 ? 51.462 39.371 31.470 1.00 41.82 ? 168  LYS A N     1 
ATOM   831  C  CA    . LYS A 1 108 ? 51.659 38.507 32.624 1.00 45.85 ? 168  LYS A CA    1 
ATOM   832  C  C     . LYS A 1 108 ? 50.345 37.764 32.884 1.00 45.77 ? 168  LYS A C     1 
ATOM   833  O  O     . LYS A 1 108 ? 50.345 36.553 33.120 1.00 46.73 ? 168  LYS A O     1 
ATOM   834  C  CB    . LYS A 1 108 ? 52.076 39.328 33.850 1.00 48.07 ? 168  LYS A CB    1 
ATOM   835  C  CG    . LYS A 1 108 ? 52.996 38.563 34.797 1.00 56.19 ? 168  LYS A CG    1 
ATOM   836  C  CD    . LYS A 1 108 ? 53.416 39.408 36.009 1.00 60.41 ? 168  LYS A CD    1 
ATOM   837  C  CE    . LYS A 1 108 ? 54.403 38.673 36.928 1.00 60.00 ? 168  LYS A CE    1 
ATOM   838  N  NZ    . LYS A 1 108 ? 54.842 39.561 38.050 1.00 60.66 ? 168  LYS A NZ    1 
ATOM   839  N  N     . VAL A 1 109 ? 49.233 38.499 32.805 1.00 43.85 ? 169  VAL A N     1 
ATOM   840  C  CA    . VAL A 1 109 ? 47.896 37.945 32.999 1.00 40.62 ? 169  VAL A CA    1 
ATOM   841  C  C     . VAL A 1 109 ? 47.659 36.807 32.009 1.00 39.14 ? 169  VAL A C     1 
ATOM   842  O  O     . VAL A 1 109 ? 47.171 35.731 32.375 1.00 35.84 ? 169  VAL A O     1 
ATOM   843  C  CB    . VAL A 1 109 ? 46.802 39.026 32.784 1.00 42.35 ? 169  VAL A CB    1 
ATOM   844  C  CG1   . VAL A 1 109 ? 45.404 38.383 32.785 1.00 41.78 ? 169  VAL A CG1   1 
ATOM   845  C  CG2   . VAL A 1 109 ? 46.896 40.070 33.888 1.00 39.49 ? 169  VAL A CG2   1 
ATOM   846  N  N     . SER A 1 110 ? 48.021 37.046 30.754 1.00 35.09 ? 170  SER A N     1 
ATOM   847  C  CA    . SER A 1 110 ? 47.843 36.033 29.736 1.00 34.44 ? 170  SER A CA    1 
ATOM   848  C  C     . SER A 1 110 ? 48.613 34.770 30.105 1.00 37.26 ? 170  SER A C     1 
ATOM   849  O  O     . SER A 1 110 ? 48.113 33.652 29.922 1.00 38.72 ? 170  SER A O     1 
ATOM   850  C  CB    . SER A 1 110 ? 48.314 36.537 28.370 1.00 36.00 ? 170  SER A CB    1 
ATOM   851  O  OG    . SER A 1 110 ? 47.653 37.743 28.001 1.00 33.06 ? 170  SER A OG    1 
ATOM   852  N  N     . ILE A 1 111 ? 49.824 34.932 30.634 1.00 36.32 ? 171  ILE A N     1 
ATOM   853  C  CA    . ILE A 1 111 ? 50.618 33.768 30.996 1.00 35.44 ? 171  ILE A CA    1 
ATOM   854  C  C     . ILE A 1 111 ? 49.896 32.983 32.076 1.00 34.48 ? 171  ILE A C     1 
ATOM   855  O  O     . ILE A 1 111 ? 49.681 31.772 31.928 1.00 34.48 ? 171  ILE A O     1 
ATOM   856  C  CB    . ILE A 1 111 ? 52.061 34.174 31.461 1.00 36.69 ? 171  ILE A CB    1 
ATOM   857  C  CG1   . ILE A 1 111 ? 52.843 34.691 30.249 1.00 37.84 ? 171  ILE A CG1   1 
ATOM   858  C  CG2   . ILE A 1 111 ? 52.791 32.977 32.060 1.00 32.31 ? 171  ILE A CG2   1 
ATOM   859  C  CD1   . ILE A 1 111 ? 54.095 35.475 30.569 1.00 37.41 ? 171  ILE A CD1   1 
ATOM   860  N  N     . ALA A 1 112 ? 49.503 33.657 33.151 1.00 33.04 ? 172  ALA A N     1 
ATOM   861  C  CA    . ALA A 1 112 ? 48.786 32.964 34.220 1.00 33.26 ? 172  ALA A CA    1 
ATOM   862  C  C     . ALA A 1 112 ? 47.511 32.264 33.698 1.00 34.08 ? 172  ALA A C     1 
ATOM   863  O  O     . ALA A 1 112 ? 47.238 31.118 34.060 1.00 32.90 ? 172  ALA A O     1 
ATOM   864  C  CB    . ALA A 1 112 ? 48.434 33.940 35.327 1.00 32.70 ? 172  ALA A CB    1 
ATOM   865  N  N     . VAL A 1 113 ? 46.743 32.933 32.842 1.00 33.33 ? 173  VAL A N     1 
ATOM   866  C  CA    . VAL A 1 113 ? 45.526 32.318 32.319 1.00 33.31 ? 173  VAL A CA    1 
ATOM   867  C  C     . VAL A 1 113 ? 45.830 31.052 31.524 1.00 36.12 ? 173  VAL A C     1 
ATOM   868  O  O     . VAL A 1 113 ? 45.232 30.000 31.756 1.00 36.45 ? 173  VAL A O     1 
ATOM   869  C  CB    . VAL A 1 113 ? 44.719 33.302 31.424 1.00 32.54 ? 173  VAL A CB    1 
ATOM   870  C  CG1   . VAL A 1 113 ? 43.637 32.556 30.669 1.00 27.39 ? 173  VAL A CG1   1 
ATOM   871  C  CG2   . VAL A 1 113 ? 44.099 34.413 32.293 1.00 25.60 ? 173  VAL A CG2   1 
ATOM   872  N  N     . ILE A 1 114 ? 46.763 31.149 30.588 1.00 38.91 ? 174  ILE A N     1 
ATOM   873  C  CA    . ILE A 1 114 ? 47.142 29.999 29.772 1.00 40.21 ? 174  ILE A CA    1 
ATOM   874  C  C     . ILE A 1 114 ? 47.626 28.833 30.626 1.00 41.43 ? 174  ILE A C     1 
ATOM   875  O  O     . ILE A 1 114 ? 47.259 27.683 30.388 1.00 41.42 ? 174  ILE A O     1 
ATOM   876  C  CB    . ILE A 1 114 ? 48.265 30.358 28.796 1.00 41.80 ? 174  ILE A CB    1 
ATOM   877  C  CG1   . ILE A 1 114 ? 47.763 31.414 27.806 1.00 43.78 ? 174  ILE A CG1   1 
ATOM   878  C  CG2   . ILE A 1 114 ? 48.755 29.103 28.096 1.00 39.25 ? 174  ILE A CG2   1 
ATOM   879  C  CD1   . ILE A 1 114 ? 48.768 31.777 26.729 1.00 45.08 ? 174  ILE A CD1   1 
ATOM   880  N  N     . LYS A 1 115 ? 48.456 29.128 31.618 1.00 42.11 ? 175  LYS A N     1 
ATOM   881  C  CA    . LYS A 1 115 ? 48.969 28.073 32.476 1.00 43.91 ? 175  LYS A CA    1 
ATOM   882  C  C     . LYS A 1 115 ? 47.871 27.486 33.349 1.00 42.34 ? 175  LYS A C     1 
ATOM   883  O  O     . LYS A 1 115 ? 47.853 26.280 33.602 1.00 42.84 ? 175  LYS A O     1 
ATOM   884  C  CB    . LYS A 1 115 ? 50.136 28.594 33.324 1.00 47.08 ? 175  LYS A CB    1 
ATOM   885  C  CG    . LYS A 1 115 ? 51.444 28.754 32.529 1.00 49.70 ? 175  LYS A CG    1 
ATOM   886  C  CD    . LYS A 1 115 ? 52.580 29.278 33.397 1.00 52.53 ? 175  LYS A CD    1 
ATOM   887  C  CE    . LYS A 1 115 ? 53.916 29.255 32.665 1.00 54.70 ? 175  LYS A CE    1 
ATOM   888  N  NZ    . LYS A 1 115 ? 55.009 29.830 33.508 1.00 56.88 ? 175  LYS A NZ    1 
ATOM   889  N  N     . GLY A 1 116 ? 46.954 28.333 33.811 1.00 41.41 ? 176  GLY A N     1 
ATOM   890  C  CA    . GLY A 1 116 ? 45.846 27.840 34.620 1.00 38.20 ? 176  GLY A CA    1 
ATOM   891  C  C     . GLY A 1 116 ? 44.956 26.912 33.794 1.00 36.77 ? 176  GLY A C     1 
ATOM   892  O  O     . GLY A 1 116 ? 44.571 25.823 34.239 1.00 35.03 ? 176  GLY A O     1 
ATOM   893  N  N     . LEU A 1 117 ? 44.628 27.341 32.579 1.00 34.48 ? 177  LEU A N     1 
ATOM   894  C  CA    . LEU A 1 117 ? 43.791 26.535 31.709 1.00 35.69 ? 177  LEU A CA    1 
ATOM   895  C  C     . LEU A 1 117 ? 44.481 25.211 31.401 1.00 37.41 ? 177  LEU A C     1 
ATOM   896  O  O     . LEU A 1 117 ? 43.863 24.142 31.474 1.00 36.83 ? 177  LEU A O     1 
ATOM   897  C  CB    . LEU A 1 117 ? 43.471 27.298 30.417 1.00 33.89 ? 177  LEU A CB    1 
ATOM   898  C  CG    . LEU A 1 117 ? 42.096 27.971 30.296 1.00 33.83 ? 177  LEU A CG    1 
ATOM   899  C  CD1   . LEU A 1 117 ? 41.652 28.562 31.603 1.00 33.91 ? 177  LEU A CD1   1 
ATOM   900  C  CD2   . LEU A 1 117 ? 42.153 29.043 29.219 1.00 34.29 ? 177  LEU A CD2   1 
ATOM   901  N  N     . THR A 1 118 ? 45.774 25.289 31.080 1.00 39.54 ? 178  THR A N     1 
ATOM   902  C  CA    . THR A 1 118 ? 46.589 24.115 30.758 1.00 38.21 ? 178  THR A CA    1 
ATOM   903  C  C     . THR A 1 118 ? 46.630 23.136 31.929 1.00 40.61 ? 178  THR A C     1 
ATOM   904  O  O     . THR A 1 118 ? 46.522 21.917 31.752 1.00 41.68 ? 178  THR A O     1 
ATOM   905  C  CB    . THR A 1 118 ? 48.031 24.531 30.398 1.00 37.71 ? 178  THR A CB    1 
ATOM   906  O  OG1   . THR A 1 118 ? 47.999 25.374 29.241 1.00 38.34 ? 178  THR A OG1   1 
ATOM   907  C  CG2   . THR A 1 118 ? 48.890 23.297 30.095 1.00 34.74 ? 178  THR A CG2   1 
ATOM   908  N  N     . TYR A 1 119 ? 46.792 23.670 33.131 1.00 40.03 ? 179  TYR A N     1 
ATOM   909  C  CA    . TYR A 1 119 ? 46.821 22.820 34.304 1.00 41.19 ? 179  TYR A CA    1 
ATOM   910  C  C     . TYR A 1 119 ? 45.472 22.104 34.448 1.00 41.41 ? 179  TYR A C     1 
ATOM   911  O  O     . TYR A 1 119 ? 45.431 20.880 34.576 1.00 41.71 ? 179  TYR A O     1 
ATOM   912  C  CB    . TYR A 1 119 ? 47.117 23.646 35.553 1.00 41.25 ? 179  TYR A CB    1 
ATOM   913  C  CG    . TYR A 1 119 ? 46.856 22.894 36.832 1.00 44.43 ? 179  TYR A CG    1 
ATOM   914  C  CD1   . TYR A 1 119 ? 47.806 22.037 37.373 1.00 44.55 ? 179  TYR A CD1   1 
ATOM   915  C  CD2   . TYR A 1 119 ? 45.628 23.003 37.473 1.00 45.77 ? 179  TYR A CD2   1 
ATOM   916  C  CE1   . TYR A 1 119 ? 47.532 21.307 38.514 1.00 44.34 ? 179  TYR A CE1   1 
ATOM   917  C  CE2   . TYR A 1 119 ? 45.344 22.280 38.606 1.00 45.81 ? 179  TYR A CE2   1 
ATOM   918  C  CZ    . TYR A 1 119 ? 46.297 21.430 39.123 1.00 46.51 ? 179  TYR A CZ    1 
ATOM   919  O  OH    . TYR A 1 119 ? 45.994 20.687 40.244 1.00 48.65 ? 179  TYR A OH    1 
ATOM   920  N  N     . LEU A 1 120 ? 44.374 22.859 34.404 1.00 41.02 ? 180  LEU A N     1 
ATOM   921  C  CA    . LEU A 1 120 ? 43.052 22.263 34.541 1.00 41.60 ? 180  LEU A CA    1 
ATOM   922  C  C     . LEU A 1 120 ? 42.803 21.155 33.526 1.00 42.81 ? 180  LEU A C     1 
ATOM   923  O  O     . LEU A 1 120 ? 42.218 20.120 33.853 1.00 42.42 ? 180  LEU A O     1 
ATOM   924  C  CB    . LEU A 1 120 ? 41.950 23.322 34.420 1.00 41.50 ? 180  LEU A CB    1 
ATOM   925  C  CG    . LEU A 1 120 ? 41.759 24.293 35.592 1.00 42.95 ? 180  LEU A CG    1 
ATOM   926  C  CD1   . LEU A 1 120 ? 40.732 25.337 35.208 1.00 41.20 ? 180  LEU A CD1   1 
ATOM   927  C  CD2   . LEU A 1 120 ? 41.311 23.550 36.848 1.00 41.74 ? 180  LEU A CD2   1 
ATOM   928  N  N     . ARG A 1 121 ? 43.252 21.358 32.296 1.00 44.92 ? 181  ARG A N     1 
ATOM   929  C  CA    . ARG A 1 121 ? 43.048 20.346 31.279 1.00 49.17 ? 181  ARG A CA    1 
ATOM   930  C  C     . ARG A 1 121 ? 43.970 19.130 31.398 1.00 51.02 ? 181  ARG A C     1 
ATOM   931  O  O     . ARG A 1 121 ? 43.511 17.994 31.309 1.00 51.09 ? 181  ARG A O     1 
ATOM   932  C  CB    . ARG A 1 121 ? 43.191 20.953 29.883 1.00 52.03 ? 181  ARG A CB    1 
ATOM   933  C  CG    . ARG A 1 121 ? 43.223 19.895 28.806 1.00 56.51 ? 181  ARG A CG    1 
ATOM   934  C  CD    . ARG A 1 121 ? 42.932 20.466 27.449 1.00 63.16 ? 181  ARG A CD    1 
ATOM   935  N  NE    . ARG A 1 121 ? 42.953 19.431 26.415 1.00 68.27 ? 181  ARG A NE    1 
ATOM   936  C  CZ    . ARG A 1 121 ? 42.215 18.322 26.438 1.00 69.98 ? 181  ARG A CZ    1 
ATOM   937  N  NH1   . ARG A 1 121 ? 41.383 18.084 27.447 1.00 70.07 ? 181  ARG A NH1   1 
ATOM   938  N  NH2   . ARG A 1 121 ? 42.307 17.452 25.441 1.00 71.71 ? 181  ARG A NH2   1 
ATOM   939  N  N     . GLU A 1 122 ? 45.261 19.367 31.606 1.00 52.33 ? 182  GLU A N     1 
ATOM   940  C  CA    . GLU A 1 122 ? 46.223 18.279 31.708 1.00 55.43 ? 182  GLU A CA    1 
ATOM   941  C  C     . GLU A 1 122 ? 46.063 17.401 32.947 1.00 56.04 ? 182  GLU A C     1 
ATOM   942  O  O     . GLU A 1 122 ? 46.045 16.172 32.850 1.00 54.16 ? 182  GLU A O     1 
ATOM   943  C  CB    . GLU A 1 122 ? 47.652 18.835 31.668 1.00 59.24 ? 182  GLU A CB    1 
ATOM   944  C  CG    . GLU A 1 122 ? 48.055 19.440 30.329 1.00 66.89 ? 182  GLU A CG    1 
ATOM   945  C  CD    . GLU A 1 122 ? 48.142 18.398 29.212 1.00 72.78 ? 182  GLU A CD    1 
ATOM   946  O  OE1   . GLU A 1 122 ? 49.054 17.530 29.267 1.00 75.28 ? 182  GLU A OE1   1 
ATOM   947  O  OE2   . GLU A 1 122 ? 47.295 18.442 28.281 1.00 74.66 ? 182  GLU A OE2   1 
ATOM   948  N  N     . LYS A 1 123 ? 45.927 18.024 34.112 1.00 56.26 ? 183  LYS A N     1 
ATOM   949  C  CA    . LYS A 1 123 ? 45.819 17.263 35.345 1.00 56.41 ? 183  LYS A CA    1 
ATOM   950  C  C     . LYS A 1 123 ? 44.420 16.921 35.834 1.00 55.92 ? 183  LYS A C     1 
ATOM   951  O  O     . LYS A 1 123 ? 44.274 16.153 36.780 1.00 57.07 ? 183  LYS A O     1 
ATOM   952  C  CB    . LYS A 1 123 ? 46.583 17.986 36.452 1.00 57.53 ? 183  LYS A CB    1 
ATOM   953  C  CG    . LYS A 1 123 ? 48.047 18.251 36.118 1.00 60.75 ? 183  LYS A CG    1 
ATOM   954  C  CD    . LYS A 1 123 ? 48.825 18.528 37.389 1.00 63.52 ? 183  LYS A CD    1 
ATOM   955  C  CE    . LYS A 1 123 ? 50.197 19.134 37.133 1.00 64.63 ? 183  LYS A CE    1 
ATOM   956  N  NZ    . LYS A 1 123 ? 50.770 19.632 38.424 1.00 62.47 ? 183  LYS A NZ    1 
ATOM   957  N  N     . HIS A 1 124 ? 43.388 17.475 35.207 1.00 55.31 ? 184  HIS A N     1 
ATOM   958  C  CA    . HIS A 1 124 ? 42.024 17.189 35.644 1.00 52.72 ? 184  HIS A CA    1 
ATOM   959  C  C     . HIS A 1 124 ? 41.064 16.991 34.487 1.00 52.88 ? 184  HIS A C     1 
ATOM   960  O  O     . HIS A 1 124 ? 39.877 16.735 34.692 1.00 50.66 ? 184  HIS A O     1 
ATOM   961  C  CB    . HIS A 1 124 ? 41.531 18.312 36.545 1.00 50.85 ? 184  HIS A CB    1 
ATOM   962  C  CG    . HIS A 1 124 ? 42.311 18.434 37.812 1.00 52.00 ? 184  HIS A CG    1 
ATOM   963  N  ND1   . HIS A 1 124 ? 42.171 17.545 38.857 1.00 51.18 ? 184  HIS A ND1   1 
ATOM   964  C  CD2   . HIS A 1 124 ? 43.300 19.286 38.171 1.00 52.90 ? 184  HIS A CD2   1 
ATOM   965  C  CE1   . HIS A 1 124 ? 43.043 17.843 39.803 1.00 52.30 ? 184  HIS A CE1   1 
ATOM   966  N  NE2   . HIS A 1 124 ? 43.742 18.895 39.412 1.00 52.78 ? 184  HIS A NE2   1 
ATOM   967  N  N     . LYS A 1 125 ? 41.586 17.109 33.271 1.00 52.97 ? 185  LYS A N     1 
ATOM   968  C  CA    . LYS A 1 125 ? 40.777 16.935 32.075 1.00 54.26 ? 185  LYS A CA    1 
ATOM   969  C  C     . LYS A 1 125 ? 39.475 17.735 32.118 1.00 53.61 ? 185  LYS A C     1 
ATOM   970  O  O     . LYS A 1 125 ? 38.400 17.181 31.898 1.00 54.47 ? 185  LYS A O     1 
ATOM   971  C  CB    . LYS A 1 125 ? 40.467 15.445 31.876 1.00 56.33 ? 185  LYS A CB    1 
ATOM   972  C  CG    . LYS A 1 125 ? 41.718 14.575 31.750 1.00 61.24 ? 185  LYS A CG    1 
ATOM   973  C  CD    . LYS A 1 125 ? 41.388 13.099 31.525 1.00 63.42 ? 185  LYS A CD    1 
ATOM   974  C  CE    . LYS A 1 125 ? 42.659 12.239 31.476 1.00 64.20 ? 185  LYS A CE    1 
ATOM   975  N  NZ    . LYS A 1 125 ? 43.626 12.646 30.402 1.00 65.18 ? 185  LYS A NZ    1 
ATOM   976  N  N     . ILE A 1 126 ? 39.561 19.030 32.413 1.00 52.18 ? 186  ILE A N     1 
ATOM   977  C  CA    . ILE A 1 126 ? 38.356 19.857 32.444 1.00 51.86 ? 186  ILE A CA    1 
ATOM   978  C  C     . ILE A 1 126 ? 38.566 21.268 31.889 1.00 50.82 ? 186  ILE A C     1 
ATOM   979  O  O     . ILE A 1 126 ? 39.641 21.855 32.031 1.00 50.06 ? 186  ILE A O     1 
ATOM   980  C  CB    . ILE A 1 126 ? 37.787 19.987 33.862 1.00 52.89 ? 186  ILE A CB    1 
ATOM   981  C  CG1   . ILE A 1 126 ? 38.713 20.815 34.738 1.00 53.16 ? 186  ILE A CG1   1 
ATOM   982  C  CG2   . ILE A 1 126 ? 37.597 18.615 34.472 1.00 55.02 ? 186  ILE A CG2   1 
ATOM   983  C  CD1   . ILE A 1 126 ? 38.155 21.007 36.127 1.00 51.30 ? 186  ILE A CD1   1 
ATOM   984  N  N     . MET A 1 127 ? 37.536 21.804 31.239 1.00 48.05 ? 187  MET A N     1 
ATOM   985  C  CA    . MET A 1 127 ? 37.623 23.143 30.687 1.00 46.12 ? 187  MET A CA    1 
ATOM   986  C  C     . MET A 1 127 ? 37.026 24.104 31.696 1.00 44.48 ? 187  MET A C     1 
ATOM   987  O  O     . MET A 1 127 ? 36.236 23.713 32.558 1.00 44.17 ? 187  MET A O     1 
ATOM   988  C  CB    . MET A 1 127 ? 36.879 23.249 29.346 1.00 47.49 ? 187  MET A CB    1 
ATOM   989  C  CG    . MET A 1 127 ? 35.360 23.246 29.442 1.00 49.23 ? 187  MET A CG    1 
ATOM   990  S  SD    . MET A 1 127 ? 34.532 23.448 27.821 1.00 52.09 ? 187  MET A SD    1 
ATOM   991  C  CE    . MET A 1 127 ? 34.351 25.287 27.699 1.00 49.74 ? 187  MET A CE    1 
ATOM   992  N  N     . HIS A 1 128 ? 37.403 25.368 31.594 1.00 43.35 ? 188  HIS A N     1 
ATOM   993  C  CA    . HIS A 1 128 ? 36.895 26.360 32.525 1.00 42.53 ? 188  HIS A CA    1 
ATOM   994  C  C     . HIS A 1 128 ? 35.384 26.593 32.354 1.00 41.19 ? 188  HIS A C     1 
ATOM   995  O  O     . HIS A 1 128 ? 34.614 26.440 33.306 1.00 39.92 ? 188  HIS A O     1 
ATOM   996  C  CB    . HIS A 1 128 ? 37.649 27.669 32.334 1.00 40.84 ? 188  HIS A CB    1 
ATOM   997  C  CG    . HIS A 1 128 ? 37.415 28.654 33.428 1.00 41.48 ? 188  HIS A CG    1 
ATOM   998  N  ND1   . HIS A 1 128 ? 38.398 29.005 34.329 1.00 42.91 ? 188  HIS A ND1   1 
ATOM   999  C  CD2   . HIS A 1 128 ? 36.314 29.354 33.786 1.00 42.83 ? 188  HIS A CD2   1 
ATOM   1000 C  CE1   . HIS A 1 128 ? 37.913 29.877 35.189 1.00 44.13 ? 188  HIS A CE1   1 
ATOM   1001 N  NE2   . HIS A 1 128 ? 36.647 30.109 34.884 1.00 44.02 ? 188  HIS A NE2   1 
ATOM   1002 N  N     . ARG A 1 129 ? 34.993 26.964 31.133 1.00 40.08 ? 189  ARG A N     1 
ATOM   1003 C  CA    . ARG A 1 129 ? 33.607 27.249 30.736 1.00 39.49 ? 189  ARG A CA    1 
ATOM   1004 C  C     . ARG A 1 129 ? 33.134 28.654 31.050 1.00 38.17 ? 189  ARG A C     1 
ATOM   1005 O  O     . ARG A 1 129 ? 32.098 29.074 30.550 1.00 39.44 ? 189  ARG A O     1 
ATOM   1006 C  CB    . ARG A 1 129 ? 32.598 26.275 31.374 1.00 40.49 ? 189  ARG A CB    1 
ATOM   1007 C  CG    . ARG A 1 129 ? 32.589 24.873 30.813 1.00 44.12 ? 189  ARG A CG    1 
ATOM   1008 C  CD    . ARG A 1 129 ? 31.248 24.179 31.070 1.00 49.60 ? 189  ARG A CD    1 
ATOM   1009 N  NE    . ARG A 1 129 ? 31.112 22.923 30.326 1.00 55.03 ? 189  ARG A NE    1 
ATOM   1010 C  CZ    . ARG A 1 129 ? 31.849 21.832 30.537 1.00 58.94 ? 189  ARG A CZ    1 
ATOM   1011 N  NH1   . ARG A 1 129 ? 32.789 21.827 31.476 1.00 60.03 ? 189  ARG A NH1   1 
ATOM   1012 N  NH2   . ARG A 1 129 ? 31.643 20.739 29.812 1.00 59.50 ? 189  ARG A NH2   1 
ATOM   1013 N  N     . ASP A 1 130 ? 33.876 29.394 31.866 1.00 37.83 ? 190  ASP A N     1 
ATOM   1014 C  CA    . ASP A 1 130 ? 33.431 30.741 32.240 1.00 34.44 ? 190  ASP A CA    1 
ATOM   1015 C  C     . ASP A 1 130 ? 34.594 31.711 32.488 1.00 34.39 ? 190  ASP A C     1 
ATOM   1016 O  O     . ASP A 1 130 ? 34.696 32.352 33.536 1.00 30.31 ? 190  ASP A O     1 
ATOM   1017 C  CB    . ASP A 1 130 ? 32.546 30.644 33.485 1.00 34.41 ? 190  ASP A CB    1 
ATOM   1018 C  CG    . ASP A 1 130 ? 31.750 31.917 33.753 1.00 37.74 ? 190  ASP A CG    1 
ATOM   1019 O  OD1   . ASP A 1 130 ? 31.219 32.044 34.886 1.00 36.56 ? 190  ASP A OD1   1 
ATOM   1020 O  OD2   . ASP A 1 130 ? 31.646 32.781 32.846 1.00 36.56 ? 190  ASP A OD2   1 
ATOM   1021 N  N     . VAL A 1 131 ? 35.480 31.798 31.506 1.00 33.38 ? 191  VAL A N     1 
ATOM   1022 C  CA    . VAL A 1 131 ? 36.616 32.692 31.589 1.00 31.21 ? 191  VAL A CA    1 
ATOM   1023 C  C     . VAL A 1 131 ? 36.137 34.086 31.235 1.00 32.91 ? 191  VAL A C     1 
ATOM   1024 O  O     . VAL A 1 131 ? 35.501 34.275 30.206 1.00 32.92 ? 191  VAL A O     1 
ATOM   1025 C  CB    . VAL A 1 131 ? 37.691 32.298 30.591 1.00 32.00 ? 191  VAL A CB    1 
ATOM   1026 C  CG1   . VAL A 1 131 ? 38.790 33.342 30.577 1.00 28.05 ? 191  VAL A CG1   1 
ATOM   1027 C  CG2   . VAL A 1 131 ? 38.218 30.921 30.930 1.00 29.07 ? 191  VAL A CG2   1 
ATOM   1028 N  N     . LYS A 1 132 ? 36.444 35.050 32.097 1.00 33.81 ? 192  LYS A N     1 
ATOM   1029 C  CA    . LYS A 1 132 ? 36.063 36.449 31.910 1.00 34.35 ? 192  LYS A CA    1 
ATOM   1030 C  C     . LYS A 1 132 ? 36.759 37.197 33.050 1.00 34.20 ? 192  LYS A C     1 
ATOM   1031 O  O     . LYS A 1 132 ? 37.085 36.605 34.077 1.00 34.77 ? 192  LYS A O     1 
ATOM   1032 C  CB    . LYS A 1 132 ? 34.532 36.607 31.999 1.00 35.68 ? 192  LYS A CB    1 
ATOM   1033 C  CG    . LYS A 1 132 ? 33.953 36.291 33.369 1.00 39.25 ? 192  LYS A CG    1 
ATOM   1034 C  CD    . LYS A 1 132 ? 32.583 35.635 33.274 1.00 44.57 ? 192  LYS A CD    1 
ATOM   1035 C  CE    . LYS A 1 132 ? 31.500 36.488 33.904 1.00 45.89 ? 192  LYS A CE    1 
ATOM   1036 N  NZ    . LYS A 1 132 ? 31.443 37.808 33.214 1.00 50.69 ? 192  LYS A NZ    1 
ATOM   1037 N  N     . PRO A 1 133 ? 36.976 38.506 32.895 1.00 34.22 ? 193  PRO A N     1 
ATOM   1038 C  CA    . PRO A 1 133 ? 37.645 39.328 33.912 1.00 33.94 ? 193  PRO A CA    1 
ATOM   1039 C  C     . PRO A 1 133 ? 37.264 39.069 35.376 1.00 35.78 ? 193  PRO A C     1 
ATOM   1040 O  O     . PRO A 1 133 ? 38.137 38.988 36.248 1.00 35.82 ? 193  PRO A O     1 
ATOM   1041 C  CB    . PRO A 1 133 ? 37.335 40.759 33.465 1.00 33.45 ? 193  PRO A CB    1 
ATOM   1042 C  CG    . PRO A 1 133 ? 37.253 40.615 31.962 1.00 35.05 ? 193  PRO A CG    1 
ATOM   1043 C  CD    . PRO A 1 133 ? 36.425 39.347 31.821 1.00 34.04 ? 193  PRO A CD    1 
ATOM   1044 N  N     . SER A 1 134 ? 35.976 38.925 35.658 1.00 34.33 ? 194  SER A N     1 
ATOM   1045 C  CA    . SER A 1 134 ? 35.553 38.686 37.038 1.00 32.29 ? 194  SER A CA    1 
ATOM   1046 C  C     . SER A 1 134 ? 36.031 37.337 37.584 1.00 32.55 ? 194  SER A C     1 
ATOM   1047 O  O     . SER A 1 134 ? 36.088 37.158 38.795 1.00 32.24 ? 194  SER A O     1 
ATOM   1048 C  CB    . SER A 1 134 ? 34.031 38.722 37.142 1.00 33.74 ? 194  SER A CB    1 
ATOM   1049 O  OG    . SER A 1 134 ? 33.487 37.526 36.602 1.00 31.30 ? 194  SER A OG    1 
ATOM   1050 N  N     . ASN A 1 135 ? 36.339 36.371 36.720 1.00 30.68 ? 195  ASN A N     1 
ATOM   1051 C  CA    . ASN A 1 135 ? 36.786 35.080 37.249 1.00 34.34 ? 195  ASN A CA    1 
ATOM   1052 C  C     . ASN A 1 135 ? 38.320 34.930 37.275 1.00 36.39 ? 195  ASN A C     1 
ATOM   1053 O  O     . ASN A 1 135 ? 38.861 33.818 37.364 1.00 35.35 ? 195  ASN A O     1 
ATOM   1054 C  CB    . ASN A 1 135 ? 36.136 33.909 36.495 1.00 35.52 ? 195  ASN A CB    1 
ATOM   1055 C  CG    . ASN A 1 135 ? 34.623 33.844 36.718 1.00 39.60 ? 195  ASN A CG    1 
ATOM   1056 O  OD1   . ASN A 1 135 ? 34.096 34.542 37.579 1.00 38.29 ? 195  ASN A OD1   1 
ATOM   1057 N  ND2   . ASN A 1 135 ? 33.927 33.007 35.948 1.00 36.81 ? 195  ASN A ND2   1 
ATOM   1058 N  N     . ILE A 1 136 ? 39.015 36.057 37.179 1.00 34.85 ? 196  ILE A N     1 
ATOM   1059 C  CA    . ILE A 1 136 ? 40.468 36.059 37.244 1.00 35.43 ? 196  ILE A CA    1 
ATOM   1060 C  C     . ILE A 1 136 ? 40.826 36.892 38.469 1.00 35.69 ? 196  ILE A C     1 
ATOM   1061 O  O     . ILE A 1 136 ? 40.604 38.098 38.488 1.00 34.45 ? 196  ILE A O     1 
ATOM   1062 C  CB    . ILE A 1 136 ? 41.099 36.682 35.983 1.00 34.49 ? 196  ILE A CB    1 
ATOM   1063 C  CG1   . ILE A 1 136 ? 40.654 35.920 34.743 1.00 32.52 ? 196  ILE A CG1   1 
ATOM   1064 C  CG2   . ILE A 1 136 ? 42.605 36.600 36.071 1.00 37.48 ? 196  ILE A CG2   1 
ATOM   1065 C  CD1   . ILE A 1 136 ? 41.165 36.529 33.455 1.00 27.46 ? 196  ILE A CD1   1 
ATOM   1066 N  N     . LEU A 1 137 ? 41.351 36.238 39.500 1.00 35.52 ? 197  LEU A N     1 
ATOM   1067 C  CA    . LEU A 1 137 ? 41.706 36.930 40.738 1.00 37.31 ? 197  LEU A CA    1 
ATOM   1068 C  C     . LEU A 1 137 ? 43.192 37.271 40.827 1.00 37.76 ? 197  LEU A C     1 
ATOM   1069 O  O     . LEU A 1 137 ? 44.024 36.672 40.148 1.00 37.65 ? 197  LEU A O     1 
ATOM   1070 C  CB    . LEU A 1 137 ? 41.282 36.076 41.943 1.00 37.95 ? 197  LEU A CB    1 
ATOM   1071 C  CG    . LEU A 1 137 ? 39.815 36.171 42.391 1.00 40.20 ? 197  LEU A CG    1 
ATOM   1072 C  CD1   . LEU A 1 137 ? 38.914 36.617 41.239 1.00 38.11 ? 197  LEU A CD1   1 
ATOM   1073 C  CD2   . LEU A 1 137 ? 39.380 34.838 42.945 1.00 39.65 ? 197  LEU A CD2   1 
ATOM   1074 N  N     . VAL A 1 138 ? 43.513 38.254 41.657 1.00 38.57 ? 198  VAL A N     1 
ATOM   1075 C  CA    . VAL A 1 138 ? 44.892 38.690 41.840 1.00 38.60 ? 198  VAL A CA    1 
ATOM   1076 C  C     . VAL A 1 138 ? 45.058 39.178 43.275 1.00 42.02 ? 198  VAL A C     1 
ATOM   1077 O  O     . VAL A 1 138 ? 44.101 39.658 43.885 1.00 41.14 ? 198  VAL A O     1 
ATOM   1078 C  CB    . VAL A 1 138 ? 45.273 39.846 40.875 1.00 36.94 ? 198  VAL A CB    1 
ATOM   1079 C  CG1   . VAL A 1 138 ? 45.195 39.380 39.439 1.00 36.22 ? 198  VAL A CG1   1 
ATOM   1080 C  CG2   . VAL A 1 138 ? 44.368 41.046 41.105 1.00 33.15 ? 198  VAL A CG2   1 
ATOM   1081 N  N     . ASN A 1 139 ? 46.266 39.032 43.816 1.00 43.87 ? 199  ASN A N     1 
ATOM   1082 C  CA    . ASN A 1 139 ? 46.548 39.474 45.171 1.00 46.27 ? 199  ASN A CA    1 
ATOM   1083 C  C     . ASN A 1 139 ? 47.794 40.344 45.240 1.00 48.78 ? 199  ASN A C     1 
ATOM   1084 O  O     . ASN A 1 139 ? 48.565 40.446 44.278 1.00 48.03 ? 199  ASN A O     1 
ATOM   1085 C  CB    . ASN A 1 139 ? 46.705 38.284 46.122 1.00 46.95 ? 199  ASN A CB    1 
ATOM   1086 C  CG    . ASN A 1 139 ? 47.817 37.337 45.707 1.00 48.15 ? 199  ASN A CG    1 
ATOM   1087 O  OD1   . ASN A 1 139 ? 48.842 37.753 45.156 1.00 47.64 ? 199  ASN A OD1   1 
ATOM   1088 N  ND2   . ASN A 1 139 ? 47.627 36.055 45.990 1.00 47.92 ? 199  ASN A ND2   1 
ATOM   1089 N  N     . SER A 1 140 ? 47.974 40.963 46.404 1.00 50.55 ? 200  SER A N     1 
ATOM   1090 C  CA    . SER A 1 140 ? 49.094 41.854 46.676 1.00 50.00 ? 200  SER A CA    1 
ATOM   1091 C  C     . SER A 1 140 ? 50.456 41.173 46.513 1.00 51.84 ? 200  SER A C     1 
ATOM   1092 O  O     . SER A 1 140 ? 51.478 41.846 46.361 1.00 51.31 ? 200  SER A O     1 
ATOM   1093 C  CB    . SER A 1 140 ? 48.943 42.438 48.084 1.00 46.64 ? 200  SER A CB    1 
ATOM   1094 O  OG    . SER A 1 140 ? 48.692 41.421 49.035 1.00 40.43 ? 200  SER A OG    1 
ATOM   1095 N  N     . ARG A 1 141 ? 50.471 39.843 46.545 1.00 52.11 ? 201  ARG A N     1 
ATOM   1096 C  CA    . ARG A 1 141 ? 51.714 39.099 46.361 1.00 51.75 ? 201  ARG A CA    1 
ATOM   1097 C  C     . ARG A 1 141 ? 52.036 38.969 44.881 1.00 50.53 ? 201  ARG A C     1 
ATOM   1098 O  O     . ARG A 1 141 ? 53.019 38.332 44.518 1.00 51.65 ? 201  ARG A O     1 
ATOM   1099 C  CB    . ARG A 1 141 ? 51.613 37.700 46.964 1.00 53.97 ? 201  ARG A CB    1 
ATOM   1100 C  CG    . ARG A 1 141 ? 51.601 37.669 48.479 1.00 58.97 ? 201  ARG A CG    1 
ATOM   1101 C  CD    . ARG A 1 141 ? 51.598 36.244 48.989 1.00 64.26 ? 201  ARG A CD    1 
ATOM   1102 N  NE    . ARG A 1 141 ? 50.268 35.650 48.912 1.00 71.13 ? 201  ARG A NE    1 
ATOM   1103 C  CZ    . ARG A 1 141 ? 49.996 34.373 49.167 1.00 74.62 ? 201  ARG A CZ    1 
ATOM   1104 N  NH1   . ARG A 1 141 ? 48.745 33.936 49.072 1.00 75.42 ? 201  ARG A NH1   1 
ATOM   1105 N  NH2   . ARG A 1 141 ? 50.973 33.534 49.505 1.00 75.67 ? 201  ARG A NH2   1 
ATOM   1106 N  N     . GLY A 1 142 ? 51.195 39.551 44.029 1.00 50.04 ? 202  GLY A N     1 
ATOM   1107 C  CA    . GLY A 1 142 ? 51.426 39.489 42.592 1.00 47.76 ? 202  GLY A CA    1 
ATOM   1108 C  C     . GLY A 1 142 ? 50.886 38.257 41.880 1.00 47.33 ? 202  GLY A C     1 
ATOM   1109 O  O     . GLY A 1 142 ? 51.078 38.091 40.670 1.00 45.41 ? 202  GLY A O     1 
ATOM   1110 N  N     . GLU A 1 143 ? 50.197 37.391 42.611 1.00 47.65 ? 203  GLU A N     1 
ATOM   1111 C  CA    . GLU A 1 143 ? 49.666 36.186 41.994 1.00 48.54 ? 203  GLU A CA    1 
ATOM   1112 C  C     . GLU A 1 143 ? 48.384 36.461 41.195 1.00 48.19 ? 203  GLU A C     1 
ATOM   1113 O  O     . GLU A 1 143 ? 47.561 37.309 41.558 1.00 46.62 ? 203  GLU A O     1 
ATOM   1114 C  CB    . GLU A 1 143 ? 49.409 35.116 43.056 1.00 50.55 ? 203  GLU A CB    1 
ATOM   1115 C  CG    . GLU A 1 143 ? 50.536 34.945 44.063 1.00 53.34 ? 203  GLU A CG    1 
ATOM   1116 C  CD    . GLU A 1 143 ? 50.243 33.847 45.071 1.00 57.60 ? 203  GLU A CD    1 
ATOM   1117 O  OE1   . GLU A 1 143 ? 50.303 32.656 44.690 1.00 60.91 ? 203  GLU A OE1   1 
ATOM   1118 O  OE2   . GLU A 1 143 ? 49.938 34.166 46.240 1.00 59.01 ? 203  GLU A OE2   1 
ATOM   1119 N  N     . ILE A 1 144 ? 48.245 35.730 40.093 1.00 46.46 ? 204  ILE A N     1 
ATOM   1120 C  CA    . ILE A 1 144 ? 47.107 35.832 39.196 1.00 43.40 ? 204  ILE A CA    1 
ATOM   1121 C  C     . ILE A 1 144 ? 46.545 34.418 39.102 1.00 42.73 ? 204  ILE A C     1 
ATOM   1122 O  O     . ILE A 1 144 ? 47.212 33.509 38.594 1.00 42.21 ? 204  ILE A O     1 
ATOM   1123 C  CB    . ILE A 1 144 ? 47.569 36.314 37.820 1.00 44.56 ? 204  ILE A CB    1 
ATOM   1124 C  CG1   . ILE A 1 144 ? 48.461 37.547 37.990 1.00 44.72 ? 204  ILE A CG1   1 
ATOM   1125 C  CG2   . ILE A 1 144 ? 46.366 36.636 36.946 1.00 44.81 ? 204  ILE A CG2   1 
ATOM   1126 C  CD1   . ILE A 1 144 ? 49.040 38.072 36.700 1.00 43.09 ? 204  ILE A CD1   1 
ATOM   1127 N  N     . LYS A 1 145 ? 45.319 34.239 39.593 1.00 40.21 ? 205  LYS A N     1 
ATOM   1128 C  CA    . LYS A 1 145 ? 44.677 32.922 39.631 1.00 38.50 ? 205  LYS A CA    1 
ATOM   1129 C  C     . LYS A 1 145 ? 43.266 32.864 39.016 1.00 36.93 ? 205  LYS A C     1 
ATOM   1130 O  O     . LYS A 1 145 ? 42.504 33.830 39.081 1.00 37.22 ? 205  LYS A O     1 
ATOM   1131 C  CB    . LYS A 1 145 ? 44.593 32.449 41.090 1.00 39.44 ? 205  LYS A CB    1 
ATOM   1132 C  CG    . LYS A 1 145 ? 45.899 32.431 41.872 1.00 40.94 ? 205  LYS A CG    1 
ATOM   1133 C  CD    . LYS A 1 145 ? 45.601 32.371 43.376 1.00 43.33 ? 205  LYS A CD    1 
ATOM   1134 C  CE    . LYS A 1 145 ? 46.854 32.206 44.236 1.00 44.12 ? 205  LYS A CE    1 
ATOM   1135 N  NZ    . LYS A 1 145 ? 47.300 30.785 44.257 1.00 45.54 ? 205  LYS A NZ    1 
ATOM   1136 N  N     . LEU A 1 146 ? 42.921 31.718 38.433 1.00 34.08 ? 206  LEU A N     1 
ATOM   1137 C  CA    . LEU A 1 146 ? 41.603 31.528 37.834 1.00 33.02 ? 206  LEU A CA    1 
ATOM   1138 C  C     . LEU A 1 146 ? 40.663 30.911 38.860 1.00 33.44 ? 206  LEU A C     1 
ATOM   1139 O  O     . LEU A 1 146 ? 41.092 30.138 39.719 1.00 31.78 ? 206  LEU A O     1 
ATOM   1140 C  CB    . LEU A 1 146 ? 41.675 30.590 36.627 1.00 31.46 ? 206  LEU A CB    1 
ATOM   1141 C  CG    . LEU A 1 146 ? 42.508 31.060 35.436 1.00 34.79 ? 206  LEU A CG    1 
ATOM   1142 C  CD1   . LEU A 1 146 ? 42.590 29.951 34.409 1.00 32.62 ? 206  LEU A CD1   1 
ATOM   1143 C  CD2   . LEU A 1 146 ? 41.896 32.306 34.842 1.00 32.72 ? 206  LEU A CD2   1 
ATOM   1144 N  N     . CYS A 1 147 ? 39.387 31.265 38.788 1.00 31.25 ? 207  CYS A N     1 
ATOM   1145 C  CA    . CYS A 1 147 ? 38.420 30.679 39.692 1.00 31.27 ? 207  CYS A CA    1 
ATOM   1146 C  C     . CYS A 1 147 ? 37.129 30.427 38.916 1.00 32.07 ? 207  CYS A C     1 
ATOM   1147 O  O     . CYS A 1 147 ? 37.035 30.734 37.728 1.00 30.89 ? 207  CYS A O     1 
ATOM   1148 C  CB    . CYS A 1 147 ? 38.152 31.605 40.880 1.00 32.57 ? 207  CYS A CB    1 
ATOM   1149 S  SG    . CYS A 1 147 ? 37.136 33.058 40.483 1.00 37.92 ? 207  CYS A SG    1 
ATOM   1150 N  N     . ASP A 1 148 ? 36.146 29.838 39.586 1.00 31.17 ? 208  ASP A N     1 
ATOM   1151 C  CA    . ASP A 1 148 ? 34.853 29.592 38.965 1.00 31.12 ? 208  ASP A CA    1 
ATOM   1152 C  C     . ASP A 1 148 ? 34.865 28.748 37.681 1.00 31.19 ? 208  ASP A C     1 
ATOM   1153 O  O     . ASP A 1 148 ? 34.207 29.079 36.697 1.00 29.13 ? 208  ASP A O     1 
ATOM   1154 C  CB    . ASP A 1 148 ? 34.161 30.952 38.737 1.00 29.20 ? 208  ASP A CB    1 
ATOM   1155 C  CG    . ASP A 1 148 ? 33.790 31.620 40.045 1.00 31.54 ? 208  ASP A CG    1 
ATOM   1156 O  OD1   . ASP A 1 148 ? 33.422 32.818 40.051 1.00 32.66 ? 208  ASP A OD1   1 
ATOM   1157 O  OD2   . ASP A 1 148 ? 33.860 30.931 41.093 1.00 31.18 ? 208  ASP A OD2   1 
ATOM   1158 N  N     . PHE A 1 149 ? 35.612 27.653 37.697 1.00 30.93 ? 209  PHE A N     1 
ATOM   1159 C  CA    . PHE A 1 149 ? 35.655 26.778 36.541 1.00 33.74 ? 209  PHE A CA    1 
ATOM   1160 C  C     . PHE A 1 149 ? 34.732 25.569 36.813 1.00 35.98 ? 209  PHE A C     1 
ATOM   1161 O  O     . PHE A 1 149 ? 34.493 25.208 37.969 1.00 34.96 ? 209  PHE A O     1 
ATOM   1162 C  CB    . PHE A 1 149 ? 37.109 26.361 36.251 1.00 32.58 ? 209  PHE A CB    1 
ATOM   1163 C  CG    . PHE A 1 149 ? 37.879 25.927 37.465 1.00 32.59 ? 209  PHE A CG    1 
ATOM   1164 C  CD1   . PHE A 1 149 ? 37.748 24.639 37.945 1.00 33.56 ? 209  PHE A CD1   1 
ATOM   1165 C  CD2   . PHE A 1 149 ? 38.727 26.810 38.130 1.00 35.61 ? 209  PHE A CD2   1 
ATOM   1166 C  CE1   . PHE A 1 149 ? 38.451 24.221 39.060 1.00 34.95 ? 209  PHE A CE1   1 
ATOM   1167 C  CE2   . PHE A 1 149 ? 39.436 26.401 39.249 1.00 35.95 ? 209  PHE A CE2   1 
ATOM   1168 C  CZ    . PHE A 1 149 ? 39.295 25.101 39.717 1.00 34.59 ? 209  PHE A CZ    1 
ATOM   1169 N  N     . GLY A 1 150 ? 34.204 24.970 35.749 1.00 37.21 ? 210  GLY A N     1 
ATOM   1170 C  CA    . GLY A 1 150 ? 33.285 23.855 35.902 1.00 42.23 ? 210  GLY A CA    1 
ATOM   1171 C  C     . GLY A 1 150 ? 33.899 22.551 36.369 1.00 45.36 ? 210  GLY A C     1 
ATOM   1172 O  O     . GLY A 1 150 ? 34.372 21.745 35.560 1.00 46.83 ? 210  GLY A O     1 
ATOM   1173 N  N     . VAL A 1 151 ? 33.884 22.329 37.676 1.00 45.47 ? 211  VAL A N     1 
ATOM   1174 C  CA    . VAL A 1 151 ? 34.449 21.112 38.227 1.00 47.11 ? 211  VAL A CA    1 
ATOM   1175 C  C     . VAL A 1 151 ? 33.350 20.083 38.488 1.00 48.50 ? 211  VAL A C     1 
ATOM   1176 O  O     . VAL A 1 151 ? 33.572 18.876 38.398 1.00 48.99 ? 211  VAL A O     1 
ATOM   1177 C  CB    . VAL A 1 151 ? 35.230 21.416 39.533 1.00 45.95 ? 211  VAL A CB    1 
ATOM   1178 C  CG1   . VAL A 1 151 ? 34.423 22.334 40.430 1.00 44.89 ? 211  VAL A CG1   1 
ATOM   1179 C  CG2   . VAL A 1 151 ? 35.558 20.134 40.247 1.00 44.21 ? 211  VAL A CG2   1 
ATOM   1180 N  N     . SER A 1 152 ? 32.159 20.574 38.798 1.00 49.51 ? 212  SER A N     1 
ATOM   1181 C  CA    . SER A 1 152 ? 31.018 19.714 39.067 1.00 51.91 ? 212  SER A CA    1 
ATOM   1182 C  C     . SER A 1 152 ? 30.013 19.774 37.928 1.00 52.10 ? 212  SER A C     1 
ATOM   1183 O  O     . SER A 1 152 ? 29.409 20.824 37.662 1.00 51.09 ? 212  SER A O     1 
ATOM   1184 C  CB    . SER A 1 152 ? 30.327 20.132 40.363 1.00 53.46 ? 212  SER A CB    1 
ATOM   1185 O  OG    . SER A 1 152 ? 28.984 19.675 40.381 1.00 55.64 ? 212  SER A OG    1 
ATOM   1186 N  N     . GLY A 1 153 ? 29.831 18.637 37.267 1.00 51.22 ? 213  GLY A N     1 
ATOM   1187 C  CA    . GLY A 1 153 ? 28.897 18.580 36.167 1.00 51.32 ? 213  GLY A CA    1 
ATOM   1188 C  C     . GLY A 1 153 ? 27.508 18.915 36.657 1.00 52.69 ? 213  GLY A C     1 
ATOM   1189 O  O     . GLY A 1 153 ? 26.775 19.692 36.036 1.00 52.52 ? 213  GLY A O     1 
ATOM   1190 N  N     . GLN A 1 154 ? 27.145 18.345 37.796 1.00 52.16 ? 214  GLN A N     1 
ATOM   1191 C  CA    . GLN A 1 154 ? 25.822 18.587 38.327 1.00 53.27 ? 214  GLN A CA    1 
ATOM   1192 C  C     . GLN A 1 154 ? 25.540 20.067 38.581 1.00 53.92 ? 214  GLN A C     1 
ATOM   1193 O  O     . GLN A 1 154 ? 24.426 20.541 38.334 1.00 54.35 ? 214  GLN A O     1 
ATOM   1194 C  CB    . GLN A 1 154 ? 25.610 17.779 39.604 1.00 54.36 ? 214  GLN A CB    1 
ATOM   1195 C  CG    . GLN A 1 154 ? 24.201 17.872 40.108 1.00 56.24 ? 214  GLN A CG    1 
ATOM   1196 C  CD    . GLN A 1 154 ? 23.197 17.402 39.075 1.00 58.99 ? 214  GLN A CD    1 
ATOM   1197 O  OE1   . GLN A 1 154 ? 22.122 17.979 38.940 1.00 58.93 ? 214  GLN A OE1   1 
ATOM   1198 N  NE2   . GLN A 1 154 ? 23.538 16.341 38.348 1.00 59.42 ? 214  GLN A NE2   1 
ATOM   1199 N  N     . LEU A 1 155 ? 26.535 20.807 39.066 1.00 53.61 ? 215  LEU A N     1 
ATOM   1200 C  CA    . LEU A 1 155 ? 26.331 22.233 39.328 1.00 52.53 ? 215  LEU A CA    1 
ATOM   1201 C  C     . LEU A 1 155 ? 26.088 22.965 38.009 1.00 51.54 ? 215  LEU A C     1 
ATOM   1202 O  O     . LEU A 1 155 ? 25.239 23.851 37.919 1.00 50.14 ? 215  LEU A O     1 
ATOM   1203 C  CB    . LEU A 1 155 ? 27.550 22.839 40.024 1.00 52.57 ? 215  LEU A CB    1 
ATOM   1204 C  CG    . LEU A 1 155 ? 27.245 23.675 41.262 1.00 51.27 ? 215  LEU A CG    1 
ATOM   1205 C  CD1   . LEU A 1 155 ? 28.471 24.493 41.570 1.00 49.53 ? 215  LEU A CD1   1 
ATOM   1206 C  CD2   . LEU A 1 155 ? 26.041 24.582 41.044 1.00 51.34 ? 215  LEU A CD2   1 
ATOM   1207 N  N     . ILE A 1 156 ? 26.849 22.591 36.985 1.00 51.54 ? 216  ILE A N     1 
ATOM   1208 C  CA    . ILE A 1 156 ? 26.690 23.207 35.676 1.00 51.04 ? 216  ILE A CA    1 
ATOM   1209 C  C     . ILE A 1 156 ? 25.229 23.049 35.243 1.00 52.23 ? 216  ILE A C     1 
ATOM   1210 O  O     . ILE A 1 156 ? 24.618 24.003 34.780 1.00 52.22 ? 216  ILE A O     1 
ATOM   1211 C  CB    . ILE A 1 156 ? 27.611 22.544 34.616 1.00 49.95 ? 216  ILE A CB    1 
ATOM   1212 C  CG1   . ILE A 1 156 ? 29.074 22.654 35.046 1.00 49.55 ? 216  ILE A CG1   1 
ATOM   1213 C  CG2   . ILE A 1 156 ? 27.427 23.218 33.268 1.00 47.25 ? 216  ILE A CG2   1 
ATOM   1214 C  CD1   . ILE A 1 156 ? 30.048 22.009 34.086 1.00 43.72 ? 216  ILE A CD1   1 
ATOM   1215 N  N     . ASP A 1 157 ? 24.671 21.850 35.405 1.00 53.16 ? 217  ASP A N     1 
ATOM   1216 C  CA    . ASP A 1 157 ? 23.284 21.611 35.021 1.00 56.96 ? 217  ASP A CA    1 
ATOM   1217 C  C     . ASP A 1 157 ? 22.301 22.468 35.815 1.00 58.11 ? 217  ASP A C     1 
ATOM   1218 O  O     . ASP A 1 157 ? 21.412 23.106 35.244 1.00 58.88 ? 217  ASP A O     1 
ATOM   1219 C  CB    . ASP A 1 157 ? 22.897 20.134 35.201 1.00 59.01 ? 217  ASP A CB    1 
ATOM   1220 C  CG    . ASP A 1 157 ? 23.786 19.183 34.403 1.00 61.39 ? 217  ASP A CG    1 
ATOM   1221 O  OD1   . ASP A 1 157 ? 24.237 19.560 33.294 1.00 62.60 ? 217  ASP A OD1   1 
ATOM   1222 O  OD2   . ASP A 1 157 ? 24.020 18.049 34.883 1.00 61.80 ? 217  ASP A OD2   1 
ATOM   1223 N  N     . SER A 1 158 ? 22.458 22.488 37.131 1.00 58.86 ? 218  SER A N     1 
ATOM   1224 C  CA    . SER A 1 158 ? 21.553 23.254 37.972 1.00 60.35 ? 218  SER A CA    1 
ATOM   1225 C  C     . SER A 1 158 ? 21.696 24.760 37.809 1.00 61.70 ? 218  SER A C     1 
ATOM   1226 O  O     . SER A 1 158 ? 20.961 25.534 38.421 1.00 62.97 ? 218  SER A O     1 
ATOM   1227 C  CB    . SER A 1 158 ? 21.742 22.839 39.424 1.00 60.26 ? 218  SER A CB    1 
ATOM   1228 O  OG    . SER A 1 158 ? 21.440 21.458 39.554 1.00 60.41 ? 218  SER A OG    1 
ATOM   1229 N  N     . MET A 1 159 ? 22.638 25.178 36.973 1.00 63.29 ? 219  MET A N     1 
ATOM   1230 C  CA    . MET A 1 159 ? 22.846 26.601 36.718 1.00 65.15 ? 219  MET A CA    1 
ATOM   1231 C  C     . MET A 1 159 ? 22.506 26.895 35.249 1.00 66.68 ? 219  MET A C     1 
ATOM   1232 O  O     . MET A 1 159 ? 22.639 28.031 34.789 1.00 67.63 ? 219  MET A O     1 
ATOM   1233 C  CB    . MET A 1 159 ? 24.307 26.992 37.003 1.00 64.52 ? 219  MET A CB    1 
ATOM   1234 C  CG    . MET A 1 159 ? 24.807 26.701 38.420 1.00 64.84 ? 219  MET A CG    1 
ATOM   1235 S  SD    . MET A 1 159 ? 24.158 27.835 39.656 1.00 63.16 ? 219  MET A SD    1 
ATOM   1236 C  CE    . MET A 1 159 ? 24.249 29.384 38.742 1.00 62.40 ? 219  MET A CE    1 
ATOM   1237 N  N     . ALA A 1 160 ? 22.067 25.869 34.520 1.00 67.45 ? 220  ALA A N     1 
ATOM   1238 C  CA    . ALA A 1 160 ? 21.724 26.018 33.104 1.00 68.46 ? 220  ALA A CA    1 
ATOM   1239 C  C     . ALA A 1 160 ? 20.606 27.037 32.859 1.00 68.99 ? 220  ALA A C     1 
ATOM   1240 O  O     . ALA A 1 160 ? 20.421 27.503 31.737 1.00 67.91 ? 220  ALA A O     1 
ATOM   1241 C  CB    . ALA A 1 160 ? 21.329 24.659 32.514 1.00 66.96 ? 220  ALA A CB    1 
ATOM   1242 N  N     . ASN A 1 161 ? 19.868 27.383 33.910 1.00 70.96 ? 221  ASN A N     1 
ATOM   1243 C  CA    . ASN A 1 161 ? 18.772 28.343 33.785 1.00 72.48 ? 221  ASN A CA    1 
ATOM   1244 C  C     . ASN A 1 161 ? 19.076 29.657 34.496 1.00 73.60 ? 221  ASN A C     1 
ATOM   1245 O  O     . ASN A 1 161 ? 18.232 30.196 35.221 1.00 74.36 ? 221  ASN A O     1 
ATOM   1246 C  CB    . ASN A 1 161 ? 17.486 27.736 34.339 1.00 71.25 ? 221  ASN A CB    1 
ATOM   1247 C  CG    . ASN A 1 161 ? 17.184 26.386 33.721 1.00 73.48 ? 221  ASN A CG    1 
ATOM   1248 O  OD1   . ASN A 1 161 ? 17.254 26.221 32.493 1.00 72.76 ? 221  ASN A OD1   1 
ATOM   1249 N  ND2   . ASN A 1 161 ? 16.846 25.410 34.560 1.00 73.14 ? 221  ASN A ND2   1 
ATOM   1250 N  N     . SER A 1 162 ? 20.285 30.170 34.265 1.00 73.50 ? 222  SER A N     1 
ATOM   1251 C  CA    . SER A 1 162 ? 20.745 31.413 34.871 1.00 71.85 ? 222  SER A CA    1 
ATOM   1252 C  C     . SER A 1 162 ? 20.535 31.368 36.379 1.00 71.81 ? 222  SER A C     1 
ATOM   1253 O  O     . SER A 1 162 ? 21.029 30.462 37.055 1.00 71.01 ? 222  SER A O     1 
ATOM   1254 C  CB    . SER A 1 162 ? 19.998 32.606 34.276 1.00 70.91 ? 222  SER A CB    1 
ATOM   1255 O  OG    . SER A 1 162 ? 20.513 33.831 34.782 1.00 71.68 ? 222  SER A OG    1 
ATOM   1256 N  N     . VAL A 1 164 ? 22.994 34.442 33.131 1.00 75.79 ? 224  VAL A N     1 
ATOM   1257 C  CA    . VAL A 1 164 ? 23.199 34.822 31.735 1.00 76.75 ? 224  VAL A CA    1 
ATOM   1258 C  C     . VAL A 1 164 ? 23.840 36.208 31.620 1.00 76.40 ? 224  VAL A C     1 
ATOM   1259 O  O     . VAL A 1 164 ? 25.066 36.342 31.592 1.00 77.27 ? 224  VAL A O     1 
ATOM   1260 C  CB    . VAL A 1 164 ? 21.871 34.840 30.963 1.00 77.83 ? 224  VAL A CB    1 
ATOM   1261 C  CG1   . VAL A 1 164 ? 22.143 35.085 29.483 1.00 79.78 ? 224  VAL A CG1   1 
ATOM   1262 C  CG2   . VAL A 1 164 ? 21.137 33.523 31.156 1.00 79.68 ? 224  VAL A CG2   1 
ATOM   1263 N  N     . GLY A 1 165 ? 23.007 37.239 31.552 1.00 75.00 ? 225  GLY A N     1 
ATOM   1264 C  CA    . GLY A 1 165 ? 23.533 38.586 31.444 1.00 74.09 ? 225  GLY A CA    1 
ATOM   1265 C  C     . GLY A 1 165 ? 23.774 39.036 30.016 1.00 73.17 ? 225  GLY A C     1 
ATOM   1266 O  O     . GLY A 1 165 ? 24.223 38.256 29.167 1.00 72.29 ? 225  GLY A O     1 
ATOM   1267 N  N     . THR A 1 166 ? 23.467 40.310 29.765 1.00 71.78 ? 226  THR A N     1 
ATOM   1268 C  CA    . THR A 1 166 ? 23.632 40.935 28.456 1.00 69.02 ? 226  THR A CA    1 
ATOM   1269 C  C     . THR A 1 166 ? 25.022 40.686 27.839 1.00 68.45 ? 226  THR A C     1 
ATOM   1270 O  O     . THR A 1 166 ? 25.149 39.955 26.858 1.00 69.53 ? 226  THR A O     1 
ATOM   1271 C  CB    . THR A 1 166 ? 23.368 42.459 28.542 1.00 67.67 ? 226  THR A CB    1 
ATOM   1272 O  OG1   . THR A 1 166 ? 24.205 43.144 27.603 1.00 69.98 ? 226  THR A OG1   1 
ATOM   1273 C  CG2   . THR A 1 166 ? 23.638 42.982 29.947 1.00 66.12 ? 226  THR A CG2   1 
ATOM   1274 N  N     . ARG A 1 167 ? 26.060 41.288 28.408 1.00 65.77 ? 227  ARG A N     1 
ATOM   1275 C  CA    . ARG A 1 167 ? 27.414 41.105 27.898 1.00 63.34 ? 227  ARG A CA    1 
ATOM   1276 C  C     . ARG A 1 167 ? 27.797 39.631 27.945 1.00 60.01 ? 227  ARG A C     1 
ATOM   1277 O  O     . ARG A 1 167 ? 27.767 39.014 29.010 1.00 61.92 ? 227  ARG A O     1 
ATOM   1278 C  CB    . ARG A 1 167 ? 28.387 41.936 28.735 1.00 66.12 ? 227  ARG A CB    1 
ATOM   1279 C  CG    . ARG A 1 167 ? 28.178 43.436 28.558 1.00 71.40 ? 227  ARG A CG    1 
ATOM   1280 C  CD    . ARG A 1 167 ? 28.611 44.237 29.776 1.00 76.10 ? 227  ARG A CD    1 
ATOM   1281 N  NE    . ARG A 1 167 ? 29.973 43.928 30.210 1.00 78.82 ? 227  ARG A NE    1 
ATOM   1282 C  CZ    . ARG A 1 167 ? 30.673 44.689 31.047 1.00 79.69 ? 227  ARG A CZ    1 
ATOM   1283 N  NH1   . ARG A 1 167 ? 30.139 45.804 31.534 1.00 79.37 ? 227  ARG A NH1   1 
ATOM   1284 N  NH2   . ARG A 1 167 ? 31.900 44.332 31.404 1.00 79.41 ? 227  ARG A NH2   1 
ATOM   1285 N  N     . SER A 1 168 ? 28.158 39.064 26.797 1.00 54.08 ? 228  SER A N     1 
ATOM   1286 C  CA    . SER A 1 168 ? 28.531 37.653 26.736 1.00 49.04 ? 228  SER A CA    1 
ATOM   1287 C  C     . SER A 1 168 ? 29.983 37.409 26.321 1.00 46.67 ? 228  SER A C     1 
ATOM   1288 O  O     . SER A 1 168 ? 30.508 38.089 25.449 1.00 43.71 ? 228  SER A O     1 
ATOM   1289 C  CB    . SER A 1 168 ? 27.602 36.914 25.769 1.00 49.23 ? 228  SER A CB    1 
ATOM   1290 O  OG    . SER A 1 168 ? 27.883 35.517 25.728 1.00 49.21 ? 228  SER A OG    1 
ATOM   1291 N  N     . TYR A 1 169 ? 30.623 36.425 26.952 1.00 44.49 ? 229  TYR A N     1 
ATOM   1292 C  CA    . TYR A 1 169 ? 32.006 36.064 26.636 1.00 41.75 ? 229  TYR A CA    1 
ATOM   1293 C  C     . TYR A 1 169 ? 31.991 34.672 26.005 1.00 40.17 ? 229  TYR A C     1 
ATOM   1294 O  O     . TYR A 1 169 ? 33.033 34.033 25.858 1.00 39.37 ? 229  TYR A O     1 
ATOM   1295 C  CB    . TYR A 1 169 ? 32.871 36.034 27.902 1.00 40.39 ? 229  TYR A CB    1 
ATOM   1296 C  CG    . TYR A 1 169 ? 32.992 37.359 28.604 1.00 42.02 ? 229  TYR A CG    1 
ATOM   1297 C  CD1   . TYR A 1 169 ? 34.027 38.243 28.312 1.00 42.73 ? 229  TYR A CD1   1 
ATOM   1298 C  CD2   . TYR A 1 169 ? 32.042 37.747 29.534 1.00 44.55 ? 229  TYR A CD2   1 
ATOM   1299 C  CE1   . TYR A 1 169 ? 34.103 39.485 28.933 1.00 43.66 ? 229  TYR A CE1   1 
ATOM   1300 C  CE2   . TYR A 1 169 ? 32.104 38.975 30.156 1.00 44.16 ? 229  TYR A CE2   1 
ATOM   1301 C  CZ    . TYR A 1 169 ? 33.132 39.844 29.856 1.00 46.01 ? 229  TYR A CZ    1 
ATOM   1302 O  OH    . TYR A 1 169 ? 33.166 41.069 30.490 1.00 46.49 ? 229  TYR A OH    1 
ATOM   1303 N  N     . MET A 1 170 ? 30.803 34.209 25.630 1.00 38.76 ? 230  MET A N     1 
ATOM   1304 C  CA    . MET A 1 170 ? 30.658 32.889 25.028 1.00 39.24 ? 230  MET A CA    1 
ATOM   1305 C  C     . MET A 1 170 ? 31.117 32.857 23.575 1.00 38.73 ? 230  MET A C     1 
ATOM   1306 O  O     . MET A 1 170 ? 30.833 33.774 22.802 1.00 36.84 ? 230  MET A O     1 
ATOM   1307 C  CB    . MET A 1 170 ? 29.203 32.423 25.090 1.00 43.06 ? 230  MET A CB    1 
ATOM   1308 C  CG    . MET A 1 170 ? 28.641 32.285 26.488 1.00 45.70 ? 230  MET A CG    1 
ATOM   1309 S  SD    . MET A 1 170 ? 27.342 31.024 26.509 1.00 53.07 ? 230  MET A SD    1 
ATOM   1310 C  CE    . MET A 1 170 ? 27.351 30.480 28.259 1.00 49.27 ? 230  MET A CE    1 
ATOM   1311 N  N     . SER A 1 171 ? 31.807 31.785 23.201 1.00 36.73 ? 231  SER A N     1 
ATOM   1312 C  CA    . SER A 1 171 ? 32.292 31.662 21.843 1.00 35.31 ? 231  SER A CA    1 
ATOM   1313 C  C     . SER A 1 171 ? 31.123 31.543 20.879 1.00 36.00 ? 231  SER A C     1 
ATOM   1314 O  O     . SER A 1 171 ? 29.991 31.240 21.264 1.00 32.78 ? 231  SER A O     1 
ATOM   1315 C  CB    . SER A 1 171 ? 33.202 30.432 21.693 1.00 34.60 ? 231  SER A CB    1 
ATOM   1316 O  OG    . SER A 1 171 ? 32.454 29.229 21.595 1.00 30.97 ? 231  SER A OG    1 
ATOM   1317 N  N     . PRO A 1 172 ? 31.394 31.790 19.595 1.00 37.39 ? 232  PRO A N     1 
ATOM   1318 C  CA    . PRO A 1 172 ? 30.360 31.703 18.568 1.00 36.58 ? 232  PRO A CA    1 
ATOM   1319 C  C     . PRO A 1 172 ? 29.799 30.286 18.534 1.00 38.90 ? 232  PRO A C     1 
ATOM   1320 O  O     . PRO A 1 172 ? 28.572 30.107 18.466 1.00 40.82 ? 232  PRO A O     1 
ATOM   1321 C  CB    . PRO A 1 172 ? 31.106 32.067 17.292 1.00 37.36 ? 232  PRO A CB    1 
ATOM   1322 C  CG    . PRO A 1 172 ? 32.176 32.997 17.779 1.00 38.57 ? 232  PRO A CG    1 
ATOM   1323 C  CD    . PRO A 1 172 ? 32.646 32.348 19.057 1.00 36.29 ? 232  PRO A CD    1 
ATOM   1324 N  N     . GLU A 1 173 ? 30.674 29.275 18.608 1.00 36.03 ? 233  GLU A N     1 
ATOM   1325 C  CA    . GLU A 1 173 ? 30.183 27.891 18.564 1.00 36.31 ? 233  GLU A CA    1 
ATOM   1326 C  C     . GLU A 1 173 ? 29.316 27.530 19.768 1.00 38.01 ? 233  GLU A C     1 
ATOM   1327 O  O     . GLU A 1 173 ? 28.326 26.806 19.633 1.00 38.42 ? 233  GLU A O     1 
ATOM   1328 C  CB    . GLU A 1 173 ? 31.328 26.862 18.439 1.00 33.42 ? 233  GLU A CB    1 
ATOM   1329 C  CG    . GLU A 1 173 ? 32.197 26.698 19.673 1.00 35.93 ? 233  GLU A CG    1 
ATOM   1330 C  CD    . GLU A 1 173 ? 33.407 27.633 19.668 1.00 39.52 ? 233  GLU A CD    1 
ATOM   1331 O  OE1   . GLU A 1 173 ? 33.319 28.735 19.047 1.00 37.58 ? 233  GLU A OE1   1 
ATOM   1332 O  OE2   . GLU A 1 173 ? 34.432 27.268 20.294 1.00 34.57 ? 233  GLU A OE2   1 
ATOM   1333 N  N     . ARG A 1 174 ? 29.675 28.029 20.945 1.00 39.24 ? 234  ARG A N     1 
ATOM   1334 C  CA    . ARG A 1 174 ? 28.886 27.719 22.128 1.00 41.02 ? 234  ARG A CA    1 
ATOM   1335 C  C     . ARG A 1 174 ? 27.524 28.417 22.115 1.00 41.57 ? 234  ARG A C     1 
ATOM   1336 O  O     . ARG A 1 174 ? 26.549 27.891 22.646 1.00 38.83 ? 234  ARG A O     1 
ATOM   1337 C  CB    . ARG A 1 174 ? 29.646 28.104 23.383 1.00 43.43 ? 234  ARG A CB    1 
ATOM   1338 C  CG    . ARG A 1 174 ? 28.856 27.830 24.630 1.00 47.23 ? 234  ARG A CG    1 
ATOM   1339 C  CD    . ARG A 1 174 ? 29.702 28.038 25.854 1.00 49.18 ? 234  ARG A CD    1 
ATOM   1340 N  NE    . ARG A 1 174 ? 28.903 27.826 27.052 1.00 51.99 ? 234  ARG A NE    1 
ATOM   1341 C  CZ    . ARG A 1 174 ? 29.394 27.830 28.284 1.00 52.19 ? 234  ARG A CZ    1 
ATOM   1342 N  NH1   . ARG A 1 174 ? 30.690 28.035 28.482 1.00 52.08 ? 234  ARG A NH1   1 
ATOM   1343 N  NH2   . ARG A 1 174 ? 28.586 27.632 29.312 1.00 47.99 ? 234  ARG A NH2   1 
ATOM   1344 N  N     . LEU A 1 175 ? 27.463 29.599 21.507 1.00 41.56 ? 235  LEU A N     1 
ATOM   1345 C  CA    . LEU A 1 175 ? 26.213 30.333 21.421 1.00 43.42 ? 235  LEU A CA    1 
ATOM   1346 C  C     . LEU A 1 175 ? 25.261 29.663 20.431 1.00 45.50 ? 235  LEU A C     1 
ATOM   1347 O  O     . LEU A 1 175 ? 24.043 29.738 20.587 1.00 45.65 ? 235  LEU A O     1 
ATOM   1348 C  CB    . LEU A 1 175 ? 26.466 31.773 20.972 1.00 43.20 ? 235  LEU A CB    1 
ATOM   1349 C  CG    . LEU A 1 175 ? 27.113 32.735 21.964 1.00 45.50 ? 235  LEU A CG    1 
ATOM   1350 C  CD1   . LEU A 1 175 ? 27.610 33.954 21.237 1.00 46.52 ? 235  LEU A CD1   1 
ATOM   1351 C  CD2   . LEU A 1 175 ? 26.107 33.124 23.044 1.00 48.16 ? 235  LEU A CD2   1 
ATOM   1352 N  N     . GLN A 1 176 ? 25.820 29.001 19.419 1.00 47.49 ? 236  GLN A N     1 
ATOM   1353 C  CA    . GLN A 1 176 ? 25.007 28.354 18.400 1.00 49.20 ? 236  GLN A CA    1 
ATOM   1354 C  C     . GLN A 1 176 ? 24.550 26.936 18.721 1.00 50.36 ? 236  GLN A C     1 
ATOM   1355 O  O     . GLN A 1 176 ? 23.468 26.517 18.298 1.00 51.05 ? 236  GLN A O     1 
ATOM   1356 C  CB    . GLN A 1 176 ? 25.737 28.358 17.053 1.00 47.70 ? 236  GLN A CB    1 
ATOM   1357 C  CG    . GLN A 1 176 ? 25.924 29.745 16.442 1.00 50.43 ? 236  GLN A CG    1 
ATOM   1358 C  CD    . GLN A 1 176 ? 26.665 29.712 15.101 1.00 53.35 ? 236  GLN A CD    1 
ATOM   1359 O  OE1   . GLN A 1 176 ? 26.128 29.243 14.083 1.00 53.11 ? 236  GLN A OE1   1 
ATOM   1360 N  NE2   . GLN A 1 176 ? 27.908 30.202 15.098 1.00 50.30 ? 236  GLN A NE2   1 
ATOM   1361 N  N     . GLY A 1 177 ? 25.347 26.192 19.471 1.00 49.40 ? 237  GLY A N     1 
ATOM   1362 C  CA    . GLY A 1 177 ? 24.933 24.842 19.770 1.00 51.55 ? 237  GLY A CA    1 
ATOM   1363 C  C     . GLY A 1 177 ? 25.701 24.186 20.886 1.00 53.47 ? 237  GLY A C     1 
ATOM   1364 O  O     . GLY A 1 177 ? 26.228 24.846 21.783 1.00 53.79 ? 237  GLY A O     1 
ATOM   1365 N  N     . THR A 1 178 ? 25.762 22.865 20.814 1.00 55.39 ? 238  THR A N     1 
ATOM   1366 C  CA    . THR A 1 178 ? 26.451 22.067 21.809 1.00 59.09 ? 238  THR A CA    1 
ATOM   1367 C  C     . THR A 1 178 ? 27.791 21.553 21.267 1.00 59.41 ? 238  THR A C     1 
ATOM   1368 O  O     . THR A 1 178 ? 28.510 20.837 21.953 1.00 60.32 ? 238  THR A O     1 
ATOM   1369 C  CB    . THR A 1 178 ? 25.567 20.871 22.233 1.00 60.70 ? 238  THR A CB    1 
ATOM   1370 O  OG1   . THR A 1 178 ? 25.402 19.980 21.120 1.00 63.48 ? 238  THR A OG1   1 
ATOM   1371 C  CG2   . THR A 1 178 ? 24.184 21.360 22.674 1.00 59.95 ? 238  THR A CG2   1 
ATOM   1372 N  N     . HIS A 1 179 ? 28.121 21.923 20.033 1.00 59.96 ? 239  HIS A N     1 
ATOM   1373 C  CA    . HIS A 1 179 ? 29.377 21.497 19.424 1.00 59.60 ? 239  HIS A CA    1 
ATOM   1374 C  C     . HIS A 1 179 ? 30.523 22.431 19.815 1.00 58.46 ? 239  HIS A C     1 
ATOM   1375 O  O     . HIS A 1 179 ? 31.055 23.157 18.970 1.00 57.41 ? 239  HIS A O     1 
ATOM   1376 C  CB    . HIS A 1 179 ? 29.249 21.468 17.895 1.00 61.87 ? 239  HIS A CB    1 
ATOM   1377 C  CG    . HIS A 1 179 ? 28.305 20.419 17.382 1.00 64.78 ? 239  HIS A CG    1 
ATOM   1378 N  ND1   . HIS A 1 179 ? 27.694 19.502 18.205 1.00 65.17 ? 239  HIS A ND1   1 
ATOM   1379 C  CD2   . HIS A 1 179 ? 27.911 20.120 16.119 1.00 65.20 ? 239  HIS A CD2   1 
ATOM   1380 C  CE1   . HIS A 1 179 ? 26.964 18.675 17.473 1.00 66.50 ? 239  HIS A CE1   1 
ATOM   1381 N  NE2   . HIS A 1 179 ? 27.079 19.028 16.207 1.00 65.35 ? 239  HIS A NE2   1 
ATOM   1382 N  N     . TYR A 1 180 ? 30.893 22.413 21.094 1.00 56.06 ? 240  TYR A N     1 
ATOM   1383 C  CA    . TYR A 1 180 ? 31.978 23.250 21.596 1.00 53.84 ? 240  TYR A CA    1 
ATOM   1384 C  C     . TYR A 1 180 ? 32.732 22.484 22.675 1.00 51.85 ? 240  TYR A C     1 
ATOM   1385 O  O     . TYR A 1 180 ? 32.207 21.519 23.238 1.00 53.15 ? 240  TYR A O     1 
ATOM   1386 C  CB    . TYR A 1 180 ? 31.422 24.555 22.179 1.00 56.14 ? 240  TYR A CB    1 
ATOM   1387 C  CG    . TYR A 1 180 ? 30.681 24.371 23.482 1.00 59.14 ? 240  TYR A CG    1 
ATOM   1388 C  CD1   . TYR A 1 180 ? 31.338 24.484 24.703 1.00 58.94 ? 240  TYR A CD1   1 
ATOM   1389 C  CD2   . TYR A 1 180 ? 29.326 24.056 23.488 1.00 61.00 ? 240  TYR A CD2   1 
ATOM   1390 C  CE1   . TYR A 1 180 ? 30.667 24.289 25.895 1.00 60.97 ? 240  TYR A CE1   1 
ATOM   1391 C  CE2   . TYR A 1 180 ? 28.645 23.860 24.670 1.00 62.10 ? 240  TYR A CE2   1 
ATOM   1392 C  CZ    . TYR A 1 180 ? 29.316 23.979 25.873 1.00 62.59 ? 240  TYR A CZ    1 
ATOM   1393 O  OH    . TYR A 1 180 ? 28.618 23.813 27.050 1.00 62.50 ? 240  TYR A OH    1 
ATOM   1394 N  N     . SER A 1 181 ? 33.956 22.917 22.962 1.00 48.24 ? 241  SER A N     1 
ATOM   1395 C  CA    . SER A 1 181 ? 34.795 22.272 23.971 1.00 43.77 ? 241  SER A CA    1 
ATOM   1396 C  C     . SER A 1 181 ? 35.875 23.249 24.471 1.00 40.69 ? 241  SER A C     1 
ATOM   1397 O  O     . SER A 1 181 ? 35.670 24.454 24.449 1.00 39.86 ? 241  SER A O     1 
ATOM   1398 C  CB    . SER A 1 181 ? 35.428 21.010 23.370 1.00 43.71 ? 241  SER A CB    1 
ATOM   1399 O  OG    . SER A 1 181 ? 36.132 20.247 24.344 1.00 40.33 ? 241  SER A OG    1 
ATOM   1400 N  N     . VAL A 1 182 ? 37.020 22.733 24.901 1.00 39.21 ? 242  VAL A N     1 
ATOM   1401 C  CA    . VAL A 1 182 ? 38.093 23.576 25.431 1.00 38.78 ? 242  VAL A CA    1 
ATOM   1402 C  C     . VAL A 1 182 ? 38.449 24.811 24.607 1.00 39.60 ? 242  VAL A C     1 
ATOM   1403 O  O     . VAL A 1 182 ? 38.817 25.843 25.166 1.00 41.84 ? 242  VAL A O     1 
ATOM   1404 C  CB    . VAL A 1 182 ? 39.390 22.771 25.661 1.00 39.56 ? 242  VAL A CB    1 
ATOM   1405 C  CG1   . VAL A 1 182 ? 39.146 21.688 26.697 1.00 37.99 ? 242  VAL A CG1   1 
ATOM   1406 C  CG2   . VAL A 1 182 ? 39.879 22.175 24.345 1.00 38.82 ? 242  VAL A CG2   1 
ATOM   1407 N  N     . GLN A 1 183 ? 38.355 24.710 23.286 1.00 37.07 ? 243  GLN A N     1 
ATOM   1408 C  CA    . GLN A 1 183 ? 38.670 25.838 22.428 1.00 34.33 ? 243  GLN A CA    1 
ATOM   1409 C  C     . GLN A 1 183 ? 37.801 27.040 22.746 1.00 35.08 ? 243  GLN A C     1 
ATOM   1410 O  O     . GLN A 1 183 ? 38.181 28.187 22.486 1.00 33.75 ? 243  GLN A O     1 
ATOM   1411 C  CB    . GLN A 1 183 ? 38.503 25.450 20.955 1.00 35.84 ? 243  GLN A CB    1 
ATOM   1412 C  CG    . GLN A 1 183 ? 39.709 24.705 20.380 1.00 37.09 ? 243  GLN A CG    1 
ATOM   1413 C  CD    . GLN A 1 183 ? 41.015 25.455 20.623 1.00 36.24 ? 243  GLN A CD    1 
ATOM   1414 O  OE1   . GLN A 1 183 ? 41.584 25.403 21.709 1.00 33.91 ? 243  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN A 1 183 ? 41.476 26.179 19.609 1.00 38.23 ? 243  GLN A NE2   1 
ATOM   1416 N  N     . SER A 1 184 ? 36.627 26.773 23.308 1.00 35.29 ? 244  SER A N     1 
ATOM   1417 C  CA    . SER A 1 184 ? 35.690 27.830 23.669 1.00 34.40 ? 244  SER A CA    1 
ATOM   1418 C  C     . SER A 1 184 ? 36.307 28.780 24.704 1.00 35.16 ? 244  SER A C     1 
ATOM   1419 O  O     . SER A 1 184 ? 36.025 29.986 24.707 1.00 32.50 ? 244  SER A O     1 
ATOM   1420 C  CB    . SER A 1 184 ? 34.404 27.211 24.214 1.00 34.80 ? 244  SER A CB    1 
ATOM   1421 O  OG    . SER A 1 184 ? 33.321 28.106 24.079 1.00 35.52 ? 244  SER A OG    1 
ATOM   1422 N  N     . ASP A 1 185 ? 37.150 28.234 25.581 1.00 35.20 ? 245  ASP A N     1 
ATOM   1423 C  CA    . ASP A 1 185 ? 37.808 29.057 26.586 1.00 35.63 ? 245  ASP A CA    1 
ATOM   1424 C  C     . ASP A 1 185 ? 38.783 30.042 25.921 1.00 35.64 ? 245  ASP A C     1 
ATOM   1425 O  O     . ASP A 1 185 ? 38.921 31.173 26.382 1.00 33.57 ? 245  ASP A O     1 
ATOM   1426 C  CB    . ASP A 1 185 ? 38.555 28.192 27.627 1.00 37.15 ? 245  ASP A CB    1 
ATOM   1427 C  CG    . ASP A 1 185 ? 37.609 27.431 28.582 1.00 40.06 ? 245  ASP A CG    1 
ATOM   1428 O  OD1   . ASP A 1 185 ? 36.490 27.930 28.878 1.00 37.40 ? 245  ASP A OD1   1 
ATOM   1429 O  OD2   . ASP A 1 185 ? 37.999 26.332 29.051 1.00 39.68 ? 245  ASP A OD2   1 
ATOM   1430 N  N     . ILE A 1 186 ? 39.436 29.635 24.831 1.00 35.80 ? 246  ILE A N     1 
ATOM   1431 C  CA    . ILE A 1 186 ? 40.390 30.533 24.169 1.00 35.53 ? 246  ILE A CA    1 
ATOM   1432 C  C     . ILE A 1 186 ? 39.688 31.798 23.689 1.00 36.39 ? 246  ILE A C     1 
ATOM   1433 O  O     . ILE A 1 186 ? 40.210 32.912 23.837 1.00 36.23 ? 246  ILE A O     1 
ATOM   1434 C  CB    . ILE A 1 186 ? 41.099 29.874 22.941 1.00 36.60 ? 246  ILE A CB    1 
ATOM   1435 C  CG1   . ILE A 1 186 ? 41.868 28.619 23.376 1.00 37.44 ? 246  ILE A CG1   1 
ATOM   1436 C  CG2   . ILE A 1 186 ? 42.054 30.880 22.289 1.00 35.08 ? 246  ILE A CG2   1 
ATOM   1437 C  CD1   . ILE A 1 186 ? 42.833 28.836 24.541 1.00 38.69 ? 246  ILE A CD1   1 
ATOM   1438 N  N     . TRP A 1 187 ? 38.508 31.630 23.101 1.00 35.42 ? 247  TRP A N     1 
ATOM   1439 C  CA    . TRP A 1 187 ? 37.738 32.778 22.628 1.00 33.90 ? 247  TRP A CA    1 
ATOM   1440 C  C     . TRP A 1 187 ? 37.444 33.722 23.801 1.00 34.13 ? 247  TRP A C     1 
ATOM   1441 O  O     . TRP A 1 187 ? 37.581 34.947 23.678 1.00 30.87 ? 247  TRP A O     1 
ATOM   1442 C  CB    . TRP A 1 187 ? 36.427 32.315 21.975 1.00 34.61 ? 247  TRP A CB    1 
ATOM   1443 C  CG    . TRP A 1 187 ? 35.464 33.420 21.723 1.00 37.08 ? 247  TRP A CG    1 
ATOM   1444 C  CD1   . TRP A 1 187 ? 34.640 34.015 22.639 1.00 35.81 ? 247  TRP A CD1   1 
ATOM   1445 C  CD2   . TRP A 1 187 ? 35.288 34.139 20.499 1.00 38.68 ? 247  TRP A CD2   1 
ATOM   1446 N  NE1   . TRP A 1 187 ? 33.970 35.063 22.064 1.00 37.40 ? 247  TRP A NE1   1 
ATOM   1447 C  CE2   . TRP A 1 187 ? 34.344 35.163 20.750 1.00 39.85 ? 247  TRP A CE2   1 
ATOM   1448 C  CE3   . TRP A 1 187 ? 35.833 34.019 19.215 1.00 38.64 ? 247  TRP A CE3   1 
ATOM   1449 C  CZ2   . TRP A 1 187 ? 33.937 36.066 19.765 1.00 40.58 ? 247  TRP A CZ2   1 
ATOM   1450 C  CZ3   . TRP A 1 187 ? 35.434 34.913 18.236 1.00 41.35 ? 247  TRP A CZ3   1 
ATOM   1451 C  CH2   . TRP A 1 187 ? 34.490 35.927 18.516 1.00 42.80 ? 247  TRP A CH2   1 
ATOM   1452 N  N     . SER A 1 188 ? 37.062 33.158 24.947 1.00 34.02 ? 248  SER A N     1 
ATOM   1453 C  CA    . SER A 1 188 ? 36.749 33.999 26.109 1.00 34.92 ? 248  SER A CA    1 
ATOM   1454 C  C     . SER A 1 188 ? 37.968 34.788 26.591 1.00 34.68 ? 248  SER A C     1 
ATOM   1455 O  O     . SER A 1 188 ? 37.863 35.967 26.944 1.00 36.31 ? 248  SER A O     1 
ATOM   1456 C  CB    . SER A 1 188 ? 36.186 33.151 27.264 1.00 32.70 ? 248  SER A CB    1 
ATOM   1457 O  OG    . SER A 1 188 ? 35.040 32.440 26.852 1.00 30.46 ? 248  SER A OG    1 
ATOM   1458 N  N     . MET A 1 189 ? 39.122 34.137 26.611 1.00 34.06 ? 249  MET A N     1 
ATOM   1459 C  CA    . MET A 1 189 ? 40.341 34.805 27.045 1.00 35.29 ? 249  MET A CA    1 
ATOM   1460 C  C     . MET A 1 189 ? 40.657 35.961 26.098 1.00 34.87 ? 249  MET A C     1 
ATOM   1461 O  O     . MET A 1 189 ? 40.970 37.069 26.537 1.00 32.50 ? 249  MET A O     1 
ATOM   1462 C  CB    . MET A 1 189 ? 41.505 33.823 27.072 1.00 34.46 ? 249  MET A CB    1 
ATOM   1463 C  CG    . MET A 1 189 ? 42.825 34.466 27.420 1.00 37.58 ? 249  MET A CG    1 
ATOM   1464 S  SD    . MET A 1 189 ? 44.145 33.240 27.423 1.00 41.61 ? 249  MET A SD    1 
ATOM   1465 C  CE    . MET A 1 189 ? 44.195 32.809 25.690 1.00 41.60 ? 249  MET A CE    1 
ATOM   1466 N  N     . GLY A 1 190 ? 40.561 35.693 24.801 1.00 34.68 ? 250  GLY A N     1 
ATOM   1467 C  CA    . GLY A 1 190 ? 40.820 36.731 23.830 1.00 36.28 ? 250  GLY A CA    1 
ATOM   1468 C  C     . GLY A 1 190 ? 39.931 37.931 24.091 1.00 39.41 ? 250  GLY A C     1 
ATOM   1469 O  O     . GLY A 1 190 ? 40.418 39.064 24.259 1.00 38.24 ? 250  GLY A O     1 
ATOM   1470 N  N     . LEU A 1 191 ? 38.621 37.687 24.146 1.00 38.64 ? 251  LEU A N     1 
ATOM   1471 C  CA    . LEU A 1 191 ? 37.672 38.776 24.377 1.00 38.70 ? 251  LEU A CA    1 
ATOM   1472 C  C     . LEU A 1 191 ? 37.976 39.507 25.686 1.00 38.30 ? 251  LEU A C     1 
ATOM   1473 O  O     . LEU A 1 191 ? 37.966 40.744 25.726 1.00 36.63 ? 251  LEU A O     1 
ATOM   1474 C  CB    . LEU A 1 191 ? 36.219 38.257 24.371 1.00 38.04 ? 251  LEU A CB    1 
ATOM   1475 C  CG    . LEU A 1 191 ? 35.134 39.339 24.257 1.00 38.88 ? 251  LEU A CG    1 
ATOM   1476 C  CD1   . LEU A 1 191 ? 35.292 40.057 22.922 1.00 38.85 ? 251  LEU A CD1   1 
ATOM   1477 C  CD2   . LEU A 1 191 ? 33.739 38.718 24.353 1.00 37.99 ? 251  LEU A CD2   1 
ATOM   1478 N  N     . SER A 1 192 ? 38.258 38.754 26.750 1.00 37.78 ? 252  SER A N     1 
ATOM   1479 C  CA    . SER A 1 192 ? 38.575 39.380 28.042 1.00 39.07 ? 252  SER A CA    1 
ATOM   1480 C  C     . SER A 1 192 ? 39.823 40.271 27.947 1.00 40.85 ? 252  SER A C     1 
ATOM   1481 O  O     . SER A 1 192 ? 39.899 41.320 28.598 1.00 39.70 ? 252  SER A O     1 
ATOM   1482 C  CB    . SER A 1 192 ? 38.805 38.320 29.126 1.00 37.75 ? 252  SER A CB    1 
ATOM   1483 O  OG    . SER A 1 192 ? 37.677 37.479 29.261 1.00 39.32 ? 252  SER A OG    1 
ATOM   1484 N  N     . LEU A 1 193 ? 40.800 39.850 27.141 1.00 40.12 ? 253  LEU A N     1 
ATOM   1485 C  CA    . LEU A 1 193 ? 42.014 40.636 26.989 1.00 41.91 ? 253  LEU A CA    1 
ATOM   1486 C  C     . LEU A 1 193 ? 41.704 41.950 26.276 1.00 43.18 ? 253  LEU A C     1 
ATOM   1487 O  O     . LEU A 1 193 ? 42.209 43.008 26.654 1.00 44.52 ? 253  LEU A O     1 
ATOM   1488 C  CB    . LEU A 1 193 ? 43.085 39.861 26.215 1.00 40.92 ? 253  LEU A CB    1 
ATOM   1489 C  CG    . LEU A 1 193 ? 43.765 38.702 26.948 1.00 41.30 ? 253  LEU A CG    1 
ATOM   1490 C  CD1   . LEU A 1 193 ? 44.555 37.884 25.950 1.00 40.85 ? 253  LEU A CD1   1 
ATOM   1491 C  CD2   . LEU A 1 193 ? 44.654 39.226 28.068 1.00 40.26 ? 253  LEU A CD2   1 
ATOM   1492 N  N     . VAL A 1 194 ? 40.875 41.887 25.242 1.00 43.93 ? 254  VAL A N     1 
ATOM   1493 C  CA    . VAL A 1 194 ? 40.511 43.093 24.516 1.00 45.78 ? 254  VAL A CA    1 
ATOM   1494 C  C     . VAL A 1 194 ? 39.772 44.048 25.456 1.00 47.12 ? 254  VAL A C     1 
ATOM   1495 O  O     . VAL A 1 194 ? 40.053 45.246 25.483 1.00 47.18 ? 254  VAL A O     1 
ATOM   1496 C  CB    . VAL A 1 194 ? 39.608 42.773 23.308 1.00 46.43 ? 254  VAL A CB    1 
ATOM   1497 C  CG1   . VAL A 1 194 ? 39.151 44.070 22.645 1.00 45.48 ? 254  VAL A CG1   1 
ATOM   1498 C  CG2   . VAL A 1 194 ? 40.373 41.898 22.317 1.00 45.40 ? 254  VAL A CG2   1 
ATOM   1499 N  N     . GLU A 1 195 ? 38.843 43.511 26.242 1.00 46.75 ? 255  GLU A N     1 
ATOM   1500 C  CA    . GLU A 1 195 ? 38.089 44.331 27.176 1.00 47.81 ? 255  GLU A CA    1 
ATOM   1501 C  C     . GLU A 1 195 ? 39.022 45.064 28.122 1.00 48.68 ? 255  GLU A C     1 
ATOM   1502 O  O     . GLU A 1 195 ? 38.921 46.282 28.304 1.00 48.82 ? 255  GLU A O     1 
ATOM   1503 C  CB    . GLU A 1 195 ? 37.128 43.479 28.005 1.00 46.86 ? 255  GLU A CB    1 
ATOM   1504 C  CG    . GLU A 1 195 ? 36.241 44.295 28.937 1.00 47.35 ? 255  GLU A CG    1 
ATOM   1505 C  CD    . GLU A 1 195 ? 35.265 43.435 29.703 1.00 48.89 ? 255  GLU A CD    1 
ATOM   1506 O  OE1   . GLU A 1 195 ? 34.673 42.527 29.090 1.00 51.18 ? 255  GLU A OE1   1 
ATOM   1507 O  OE2   . GLU A 1 195 ? 35.080 43.661 30.916 1.00 51.79 ? 255  GLU A OE2   1 
ATOM   1508 N  N     . MET A 1 196 ? 39.933 44.314 28.729 1.00 48.72 ? 256  MET A N     1 
ATOM   1509 C  CA    . MET A 1 196 ? 40.875 44.895 29.677 1.00 49.33 ? 256  MET A CA    1 
ATOM   1510 C  C     . MET A 1 196 ? 41.871 45.824 29.003 1.00 50.66 ? 256  MET A C     1 
ATOM   1511 O  O     . MET A 1 196 ? 42.408 46.731 29.635 1.00 50.37 ? 256  MET A O     1 
ATOM   1512 C  CB    . MET A 1 196 ? 41.617 43.782 30.415 1.00 47.73 ? 256  MET A CB    1 
ATOM   1513 C  CG    . MET A 1 196 ? 40.684 42.866 31.179 1.00 45.51 ? 256  MET A CG    1 
ATOM   1514 S  SD    . MET A 1 196 ? 41.536 41.664 32.174 1.00 42.33 ? 256  MET A SD    1 
ATOM   1515 C  CE    . MET A 1 196 ? 42.064 40.488 30.922 1.00 38.83 ? 256  MET A CE    1 
ATOM   1516 N  N     . ALA A 1 197 ? 42.106 45.603 27.717 1.00 50.99 ? 257  ALA A N     1 
ATOM   1517 C  CA    . ALA A 1 197 ? 43.046 46.429 26.985 1.00 54.00 ? 257  ALA A CA    1 
ATOM   1518 C  C     . ALA A 1 197 ? 42.419 47.718 26.463 1.00 56.29 ? 257  ALA A C     1 
ATOM   1519 O  O     . ALA A 1 197 ? 43.105 48.723 26.303 1.00 58.14 ? 257  ALA A O     1 
ATOM   1520 C  CB    . ALA A 1 197 ? 43.641 45.637 25.830 1.00 52.88 ? 257  ALA A CB    1 
ATOM   1521 N  N     . VAL A 1 198 ? 41.119 47.691 26.196 1.00 57.94 ? 258  VAL A N     1 
ATOM   1522 C  CA    . VAL A 1 198 ? 40.440 48.866 25.673 1.00 59.75 ? 258  VAL A CA    1 
ATOM   1523 C  C     . VAL A 1 198 ? 39.722 49.660 26.750 1.00 59.72 ? 258  VAL A C     1 
ATOM   1524 O  O     . VAL A 1 198 ? 39.628 50.883 26.672 1.00 60.75 ? 258  VAL A O     1 
ATOM   1525 C  CB    . VAL A 1 198 ? 39.436 48.471 24.586 1.00 61.73 ? 258  VAL A CB    1 
ATOM   1526 C  CG1   . VAL A 1 198 ? 38.669 49.690 24.112 1.00 64.67 ? 258  VAL A CG1   1 
ATOM   1527 C  CG2   . VAL A 1 198 ? 40.182 47.842 23.419 1.00 62.78 ? 258  VAL A CG2   1 
ATOM   1528 N  N     . GLY A 1 199 ? 39.212 48.971 27.759 1.00 59.27 ? 259  GLY A N     1 
ATOM   1529 C  CA    . GLY A 1 199 ? 38.524 49.676 28.820 1.00 58.43 ? 259  GLY A CA    1 
ATOM   1530 C  C     . GLY A 1 199 ? 37.024 49.448 28.894 1.00 58.62 ? 259  GLY A C     1 
ATOM   1531 O  O     . GLY A 1 199 ? 36.356 50.094 29.700 1.00 58.57 ? 259  GLY A O     1 
ATOM   1532 N  N     . ARG A 1 200 ? 36.491 48.555 28.056 1.00 57.93 ? 260  ARG A N     1 
ATOM   1533 C  CA    . ARG A 1 200 ? 35.058 48.236 28.062 1.00 57.18 ? 260  ARG A CA    1 
ATOM   1534 C  C     . ARG A 1 200 ? 34.755 46.997 27.221 1.00 55.28 ? 260  ARG A C     1 
ATOM   1535 O  O     . ARG A 1 200 ? 35.585 46.558 26.426 1.00 55.52 ? 260  ARG A O     1 
ATOM   1536 C  CB    . ARG A 1 200 ? 34.227 49.412 27.528 1.00 58.79 ? 260  ARG A CB    1 
ATOM   1537 C  CG    . ARG A 1 200 ? 34.297 49.607 26.012 1.00 60.63 ? 260  ARG A CG    1 
ATOM   1538 C  CD    . ARG A 1 200 ? 33.400 50.756 25.543 1.00 61.86 ? 260  ARG A CD    1 
ATOM   1539 N  NE    . ARG A 1 200 ? 33.425 50.955 24.089 1.00 64.93 ? 260  ARG A NE    1 
ATOM   1540 C  CZ    . ARG A 1 200 ? 32.835 50.157 23.198 1.00 65.73 ? 260  ARG A CZ    1 
ATOM   1541 N  NH1   . ARG A 1 200 ? 32.158 49.085 23.594 1.00 65.70 ? 260  ARG A NH1   1 
ATOM   1542 N  NH2   . ARG A 1 200 ? 32.913 50.440 21.905 1.00 65.64 ? 260  ARG A NH2   1 
ATOM   1543 N  N     . TYR A 1 201 ? 33.562 46.440 27.405 1.00 52.03 ? 261  TYR A N     1 
ATOM   1544 C  CA    . TYR A 1 201 ? 33.138 45.266 26.656 1.00 50.13 ? 261  TYR A CA    1 
ATOM   1545 C  C     . TYR A 1 201 ? 33.345 45.577 25.159 1.00 49.49 ? 261  TYR A C     1 
ATOM   1546 O  O     . TYR A 1 201 ? 32.773 46.521 24.622 1.00 49.56 ? 261  TYR A O     1 
ATOM   1547 C  CB    . TYR A 1 201 ? 31.668 44.961 26.987 1.00 47.10 ? 261  TYR A CB    1 
ATOM   1548 C  CG    . TYR A 1 201 ? 31.162 43.674 26.384 1.00 46.26 ? 261  TYR A CG    1 
ATOM   1549 C  CD1   . TYR A 1 201 ? 31.686 42.441 26.771 1.00 43.39 ? 261  TYR A CD1   1 
ATOM   1550 C  CD2   . TYR A 1 201 ? 30.211 43.692 25.372 1.00 44.03 ? 261  TYR A CD2   1 
ATOM   1551 C  CE1   . TYR A 1 201 ? 31.280 41.268 26.154 1.00 40.05 ? 261  TYR A CE1   1 
ATOM   1552 C  CE2   . TYR A 1 201 ? 29.806 42.526 24.754 1.00 43.47 ? 261  TYR A CE2   1 
ATOM   1553 C  CZ    . TYR A 1 201 ? 30.345 41.324 25.147 1.00 39.58 ? 261  TYR A CZ    1 
ATOM   1554 O  OH    . TYR A 1 201 ? 29.952 40.189 24.498 1.00 38.85 ? 261  TYR A OH    1 
ATOM   1555 N  N     . PRO A 1 202 ? 34.199 44.791 24.485 1.00 48.81 ? 262  PRO A N     1 
ATOM   1556 C  CA    . PRO A 1 202 ? 34.599 44.855 23.077 1.00 49.88 ? 262  PRO A CA    1 
ATOM   1557 C  C     . PRO A 1 202 ? 33.503 44.899 22.027 1.00 51.53 ? 262  PRO A C     1 
ATOM   1558 O  O     . PRO A 1 202 ? 33.759 45.258 20.880 1.00 51.98 ? 262  PRO A O     1 
ATOM   1559 C  CB    . PRO A 1 202 ? 35.459 43.606 22.904 1.00 48.11 ? 262  PRO A CB    1 
ATOM   1560 C  CG    . PRO A 1 202 ? 36.042 43.415 24.232 1.00 49.46 ? 262  PRO A CG    1 
ATOM   1561 C  CD    . PRO A 1 202 ? 34.864 43.658 25.142 1.00 49.05 ? 262  PRO A CD    1 
ATOM   1562 N  N     . ILE A 1 203 ? 32.289 44.522 22.394 1.00 53.26 ? 263  ILE A N     1 
ATOM   1563 C  CA    . ILE A 1 203 ? 31.219 44.509 21.415 1.00 55.61 ? 263  ILE A CA    1 
ATOM   1564 C  C     . ILE A 1 203 ? 30.050 45.399 21.797 1.00 57.13 ? 263  ILE A C     1 
ATOM   1565 O  O     . ILE A 1 203 ? 29.543 45.330 22.909 1.00 58.13 ? 263  ILE A O     1 
ATOM   1566 C  CB    . ILE A 1 203 ? 30.708 43.079 21.207 1.00 56.39 ? 263  ILE A CB    1 
ATOM   1567 C  CG1   . ILE A 1 203 ? 31.887 42.157 20.873 1.00 56.18 ? 263  ILE A CG1   1 
ATOM   1568 C  CG2   . ILE A 1 203 ? 29.682 43.054 20.090 1.00 56.91 ? 263  ILE A CG2   1 
ATOM   1569 C  CD1   . ILE A 1 203 ? 31.553 40.692 20.938 1.00 54.99 ? 263  ILE A CD1   1 
ATOM   1570 N  N     . PRO A 1 204 ? 29.626 46.282 20.880 1.00 59.16 ? 264  PRO A N     1 
ATOM   1571 C  CA    . PRO A 1 204 ? 30.181 46.465 19.536 1.00 59.69 ? 264  PRO A CA    1 
ATOM   1572 C  C     . PRO A 1 204 ? 31.494 47.224 19.616 1.00 61.38 ? 264  PRO A C     1 
ATOM   1573 O  O     . PRO A 1 204 ? 31.729 47.999 20.544 1.00 62.01 ? 264  PRO A O     1 
ATOM   1574 C  CB    . PRO A 1 204 ? 29.109 47.276 18.836 1.00 57.34 ? 264  PRO A CB    1 
ATOM   1575 C  CG    . PRO A 1 204 ? 28.650 48.166 19.938 1.00 59.15 ? 264  PRO A CG    1 
ATOM   1576 C  CD    . PRO A 1 204 ? 28.485 47.192 21.085 1.00 59.96 ? 264  PRO A CD    1 
ATOM   1577 N  N     . PRO A 1 205 ? 32.364 47.014 18.630 1.00 63.84 ? 265  PRO A N     1 
ATOM   1578 C  CA    . PRO A 1 205 ? 33.671 47.672 18.574 1.00 66.63 ? 265  PRO A CA    1 
ATOM   1579 C  C     . PRO A 1 205 ? 33.563 49.190 18.497 1.00 69.09 ? 265  PRO A C     1 
ATOM   1580 O  O     . PRO A 1 205 ? 32.606 49.733 17.941 1.00 68.59 ? 265  PRO A O     1 
ATOM   1581 C  CB    . PRO A 1 205 ? 34.309 47.061 17.328 1.00 65.85 ? 265  PRO A CB    1 
ATOM   1582 C  CG    . PRO A 1 205 ? 33.120 46.772 16.454 1.00 65.89 ? 265  PRO A CG    1 
ATOM   1583 C  CD    . PRO A 1 205 ? 32.117 46.205 17.425 1.00 64.40 ? 265  PRO A CD    1 
ATOM   1584 N  N     . PRO A 1 206 ? 34.536 49.896 19.089 1.00 71.79 ? 266  PRO A N     1 
ATOM   1585 C  CA    . PRO A 1 206 ? 34.550 51.361 19.081 1.00 73.53 ? 266  PRO A CA    1 
ATOM   1586 C  C     . PRO A 1 206 ? 34.900 51.881 17.689 1.00 75.17 ? 266  PRO A C     1 
ATOM   1587 O  O     . PRO A 1 206 ? 35.633 51.224 16.939 1.00 74.55 ? 266  PRO A O     1 
ATOM   1588 C  CB    . PRO A 1 206 ? 35.619 51.696 20.119 1.00 73.88 ? 266  PRO A CB    1 
ATOM   1589 C  CG    . PRO A 1 206 ? 36.578 50.547 19.977 1.00 73.32 ? 266  PRO A CG    1 
ATOM   1590 C  CD    . PRO A 1 206 ? 35.643 49.363 19.902 1.00 72.06 ? 266  PRO A CD    1 
ATOM   1591 N  N     . ASP A 1 207 ? 34.370 53.055 17.347 1.00 76.79 ? 267  ASP A N     1 
ATOM   1592 C  CA    . ASP A 1 207 ? 34.624 53.668 16.042 1.00 78.28 ? 267  ASP A CA    1 
ATOM   1593 C  C     . ASP A 1 207 ? 35.886 54.539 16.071 1.00 78.92 ? 267  ASP A C     1 
ATOM   1594 O  O     . ASP A 1 207 ? 36.501 54.725 17.127 1.00 78.58 ? 267  ASP A O     1 
ATOM   1595 C  CB    . ASP A 1 207 ? 33.403 54.499 15.592 1.00 77.86 ? 267  ASP A CB    1 
ATOM   1596 C  CG    . ASP A 1 207 ? 32.959 55.519 16.641 1.00 78.81 ? 267  ASP A CG    1 
ATOM   1597 O  OD1   . ASP A 1 207 ? 33.711 56.484 16.906 1.00 78.60 ? 267  ASP A OD1   1 
ATOM   1598 O  OD2   . ASP A 1 207 ? 31.855 55.353 17.204 1.00 79.17 ? 267  ASP A OD2   1 
ATOM   1599 N  N     . ALA A 1 208 ? 36.272 55.058 14.907 1.00 79.30 ? 268  ALA A N     1 
ATOM   1600 C  CA    . ALA A 1 208 ? 37.460 55.901 14.788 1.00 78.94 ? 268  ALA A CA    1 
ATOM   1601 C  C     . ALA A 1 208 ? 37.451 57.025 15.819 1.00 78.85 ? 268  ALA A C     1 
ATOM   1602 O  O     . ALA A 1 208 ? 38.438 57.239 16.526 1.00 78.21 ? 268  ALA A O     1 
ATOM   1603 C  CB    . ALA A 1 208 ? 37.542 56.487 13.381 1.00 79.19 ? 268  ALA A CB    1 
ATOM   1604 N  N     . LYS A 1 209 ? 36.329 57.735 15.902 1.00 79.30 ? 269  LYS A N     1 
ATOM   1605 C  CA    . LYS A 1 209 ? 36.187 58.845 16.842 1.00 80.49 ? 269  LYS A CA    1 
ATOM   1606 C  C     . LYS A 1 209 ? 36.236 58.418 18.304 1.00 81.02 ? 269  LYS A C     1 
ATOM   1607 O  O     . LYS A 1 209 ? 36.713 59.167 19.162 1.00 81.24 ? 269  LYS A O     1 
ATOM   1608 C  CB    . LYS A 1 209 ? 34.878 59.598 16.576 1.00 80.81 ? 269  LYS A CB    1 
ATOM   1609 C  CG    . LYS A 1 209 ? 34.870 60.367 15.264 1.00 80.97 ? 269  LYS A CG    1 
ATOM   1610 C  CD    . LYS A 1 209 ? 33.548 61.076 15.031 1.00 81.08 ? 269  LYS A CD    1 
ATOM   1611 C  CE    . LYS A 1 209 ? 33.596 61.893 13.745 1.00 81.29 ? 269  LYS A CE    1 
ATOM   1612 N  NZ    . LYS A 1 209 ? 33.962 61.059 12.561 1.00 80.58 ? 269  LYS A NZ    1 
ATOM   1613 N  N     . GLU A 1 210 ? 35.743 57.215 18.585 1.00 81.78 ? 270  GLU A N     1 
ATOM   1614 C  CA    . GLU A 1 210 ? 35.725 56.696 19.951 1.00 82.18 ? 270  GLU A CA    1 
ATOM   1615 C  C     . GLU A 1 210 ? 37.137 56.338 20.420 1.00 81.97 ? 270  GLU A C     1 
ATOM   1616 O  O     . GLU A 1 210 ? 37.521 56.644 21.553 1.00 81.11 ? 270  GLU A O     1 
ATOM   1617 C  CB    . GLU A 1 210 ? 34.814 55.464 20.030 1.00 82.62 ? 270  GLU A CB    1 
ATOM   1618 C  CG    . GLU A 1 210 ? 34.367 55.103 21.443 1.00 83.10 ? 270  GLU A CG    1 
ATOM   1619 C  CD    . GLU A 1 210 ? 33.458 53.883 21.472 1.00 83.34 ? 270  GLU A CD    1 
ATOM   1620 O  OE1   . GLU A 1 210 ? 32.536 53.805 20.625 1.00 82.88 ? 270  GLU A OE1   1 
ATOM   1621 O  OE2   . GLU A 1 210 ? 33.662 53.010 22.344 1.00 82.18 ? 270  GLU A OE2   1 
ATOM   1622 N  N     . LEU A 1 211 ? 37.903 55.691 19.544 1.00 81.82 ? 271  LEU A N     1 
ATOM   1623 C  CA    . LEU A 1 211 ? 39.278 55.305 19.860 1.00 82.41 ? 271  LEU A CA    1 
ATOM   1624 C  C     . LEU A 1 211 ? 40.142 56.537 20.100 1.00 83.05 ? 271  LEU A C     1 
ATOM   1625 O  O     . LEU A 1 211 ? 40.998 56.547 20.992 1.00 82.96 ? 271  LEU A O     1 
ATOM   1626 C  CB    . LEU A 1 211 ? 39.881 54.483 18.716 1.00 81.72 ? 271  LEU A CB    1 
ATOM   1627 C  CG    . LEU A 1 211 ? 39.536 52.993 18.672 1.00 80.91 ? 271  LEU A CG    1 
ATOM   1628 C  CD1   . LEU A 1 211 ? 40.045 52.369 17.371 1.00 78.66 ? 271  LEU A CD1   1 
ATOM   1629 C  CD2   . LEU A 1 211 ? 40.155 52.312 19.887 1.00 79.46 ? 271  LEU A CD2   1 
ATOM   1630 N  N     . GLU A 1 212 ? 39.911 57.570 19.294 1.00 84.11 ? 272  GLU A N     1 
ATOM   1631 C  CA    . GLU A 1 212 ? 40.655 58.824 19.401 1.00 85.03 ? 272  GLU A CA    1 
ATOM   1632 C  C     . GLU A 1 212 ? 40.488 59.438 20.794 1.00 84.40 ? 272  GLU A C     1 
ATOM   1633 O  O     . GLU A 1 212 ? 41.416 60.054 21.327 1.00 83.18 ? 272  GLU A O     1 
ATOM   1634 C  CB    . GLU A 1 212 ? 40.176 59.809 18.328 1.00 86.60 ? 272  GLU A CB    1 
ATOM   1635 C  CG    . GLU A 1 212 ? 41.022 61.075 18.223 1.00 89.84 ? 272  GLU A CG    1 
ATOM   1636 C  CD    . GLU A 1 212 ? 40.594 61.982 17.069 1.00 91.35 ? 272  GLU A CD    1 
ATOM   1637 O  OE1   . GLU A 1 212 ? 40.593 61.513 15.904 1.00 91.83 ? 272  GLU A OE1   1 
ATOM   1638 O  OE2   . GLU A 1 212 ? 40.262 63.165 17.329 1.00 92.03 ? 272  GLU A OE2   1 
ATOM   1639 N  N     . LEU A 1 213 ? 39.302 59.256 21.373 1.00 83.80 ? 273  LEU A N     1 
ATOM   1640 C  CA    . LEU A 1 213 ? 38.998 59.772 22.701 1.00 83.68 ? 273  LEU A CA    1 
ATOM   1641 C  C     . LEU A 1 213 ? 39.662 58.910 23.767 1.00 84.39 ? 273  LEU A C     1 
ATOM   1642 O  O     . LEU A 1 213 ? 40.311 59.426 24.678 1.00 85.07 ? 273  LEU A O     1 
ATOM   1643 C  CB    . LEU A 1 213 ? 37.488 59.785 22.940 1.00 82.95 ? 273  LEU A CB    1 
ATOM   1644 C  CG    . LEU A 1 213 ? 36.645 60.530 21.909 1.00 82.65 ? 273  LEU A CG    1 
ATOM   1645 C  CD1   . LEU A 1 213 ? 35.185 60.577 22.368 1.00 82.16 ? 273  LEU A CD1   1 
ATOM   1646 C  CD2   . LEU A 1 213 ? 37.199 61.936 21.738 1.00 81.73 ? 273  LEU A CD2   1 
ATOM   1647 N  N     . MET A 1 214 ? 39.495 57.594 23.657 1.00 84.44 ? 274  MET A N     1 
ATOM   1648 C  CA    . MET A 1 214 ? 40.093 56.684 24.627 1.00 84.59 ? 274  MET A CA    1 
ATOM   1649 C  C     . MET A 1 214 ? 41.604 56.906 24.693 1.00 84.58 ? 274  MET A C     1 
ATOM   1650 O  O     . MET A 1 214 ? 42.137 57.233 25.754 1.00 84.91 ? 274  MET A O     1 
ATOM   1651 C  CB    . MET A 1 214 ? 39.798 55.224 24.259 1.00 85.13 ? 274  MET A CB    1 
ATOM   1652 C  CG    . MET A 1 214 ? 38.318 54.904 24.073 1.00 85.83 ? 274  MET A CG    1 
ATOM   1653 S  SD    . MET A 1 214 ? 37.979 53.126 23.847 1.00 86.81 ? 274  MET A SD    1 
ATOM   1654 C  CE    . MET A 1 214 ? 37.308 52.703 25.470 1.00 84.94 ? 274  MET A CE    1 
ATOM   1655 N  N     . PHE A 1 215 ? 42.289 56.742 23.561 1.00 84.28 ? 275  PHE A N     1 
ATOM   1656 C  CA    . PHE A 1 215 ? 43.742 56.928 23.511 1.00 83.86 ? 275  PHE A CA    1 
ATOM   1657 C  C     . PHE A 1 215 ? 44.111 58.302 22.938 1.00 83.71 ? 275  PHE A C     1 
ATOM   1658 O  O     . PHE A 1 215 ? 45.154 58.470 22.299 1.00 82.76 ? 275  PHE A O     1 
ATOM   1659 C  CB    . PHE A 1 215 ? 44.400 55.820 22.669 1.00 82.61 ? 275  PHE A CB    1 
ATOM   1660 C  CG    . PHE A 1 215 ? 43.985 54.419 23.061 1.00 81.66 ? 275  PHE A CG    1 
ATOM   1661 C  CD1   . PHE A 1 215 ? 42.969 53.764 22.377 1.00 81.13 ? 275  PHE A CD1   1 
ATOM   1662 C  CD2   . PHE A 1 215 ? 44.611 53.756 24.108 1.00 80.97 ? 275  PHE A CD2   1 
ATOM   1663 C  CE1   . PHE A 1 215 ? 42.584 52.479 22.729 1.00 79.94 ? 275  PHE A CE1   1 
ATOM   1664 C  CE2   . PHE A 1 215 ? 44.230 52.468 24.466 1.00 80.50 ? 275  PHE A CE2   1 
ATOM   1665 C  CZ    . PHE A 1 215 ? 43.217 51.830 23.774 1.00 80.32 ? 275  PHE A CZ    1 
ATOM   1666 N  N     . PRO A 1 246 ? 23.964 53.399 24.194 1.00 82.34 ? 306  PRO A N     1 
ATOM   1667 C  CA    . PRO A 1 246 ? 23.042 52.473 24.863 1.00 81.34 ? 306  PRO A CA    1 
ATOM   1668 C  C     . PRO A 1 246 ? 23.357 51.006 24.558 1.00 79.85 ? 306  PRO A C     1 
ATOM   1669 O  O     . PRO A 1 246 ? 23.644 50.647 23.413 1.00 79.96 ? 306  PRO A O     1 
ATOM   1670 C  CB    . PRO A 1 246 ? 21.678 52.895 24.314 1.00 81.80 ? 306  PRO A CB    1 
ATOM   1671 C  CG    . PRO A 1 246 ? 21.845 54.374 24.120 1.00 82.39 ? 306  PRO A CG    1 
ATOM   1672 C  CD    . PRO A 1 246 ? 23.221 54.459 23.484 1.00 82.77 ? 306  PRO A CD    1 
ATOM   1673 N  N     . PRO A 1 247 ? 23.301 50.140 25.587 1.00 77.80 ? 307  PRO A N     1 
ATOM   1674 C  CA    . PRO A 1 247 ? 23.573 48.699 25.459 1.00 74.96 ? 307  PRO A CA    1 
ATOM   1675 C  C     . PRO A 1 247 ? 22.744 48.087 24.324 1.00 71.73 ? 307  PRO A C     1 
ATOM   1676 O  O     . PRO A 1 247 ? 21.637 48.550 24.048 1.00 72.46 ? 307  PRO A O     1 
ATOM   1677 C  CB    . PRO A 1 247 ? 23.168 48.149 26.827 1.00 75.53 ? 307  PRO A CB    1 
ATOM   1678 C  CG    . PRO A 1 247 ? 23.458 49.298 27.748 1.00 76.15 ? 307  PRO A CG    1 
ATOM   1679 C  CD    . PRO A 1 247 ? 22.931 50.486 26.973 1.00 77.41 ? 307  PRO A CD    1 
ATOM   1680 N  N     . MET A 1 248 ? 23.274 47.060 23.666 1.00 67.39 ? 308  MET A N     1 
ATOM   1681 C  CA    . MET A 1 248 ? 22.550 46.415 22.573 1.00 63.21 ? 308  MET A CA    1 
ATOM   1682 C  C     . MET A 1 248 ? 21.467 45.501 23.135 1.00 59.35 ? 308  MET A C     1 
ATOM   1683 O  O     . MET A 1 248 ? 21.505 45.143 24.309 1.00 59.52 ? 308  MET A O     1 
ATOM   1684 C  CB    . MET A 1 248 ? 23.502 45.585 21.716 1.00 64.26 ? 308  MET A CB    1 
ATOM   1685 C  CG    . MET A 1 248 ? 24.577 46.376 21.007 1.00 66.53 ? 308  MET A CG    1 
ATOM   1686 S  SD    . MET A 1 248 ? 25.514 45.294 19.895 1.00 68.91 ? 308  MET A SD    1 
ATOM   1687 C  CE    . MET A 1 248 ? 24.879 45.822 18.306 1.00 66.50 ? 308  MET A CE    1 
ATOM   1688 N  N     . ALA A 1 249 ? 20.497 45.122 22.310 1.00 54.67 ? 309  ALA A N     1 
ATOM   1689 C  CA    . ALA A 1 249 ? 19.447 44.226 22.786 1.00 50.96 ? 309  ALA A CA    1 
ATOM   1690 C  C     . ALA A 1 249 ? 20.027 42.812 22.855 1.00 49.01 ? 309  ALA A C     1 
ATOM   1691 O  O     . ALA A 1 249 ? 21.022 42.517 22.204 1.00 48.06 ? 309  ALA A O     1 
ATOM   1692 C  CB    . ALA A 1 249 ? 18.246 44.269 21.851 1.00 48.23 ? 309  ALA A CB    1 
ATOM   1693 N  N     . ILE A 1 250 ? 19.402 41.940 23.635 1.00 48.44 ? 310  ILE A N     1 
ATOM   1694 C  CA    . ILE A 1 250 ? 19.888 40.574 23.787 1.00 48.06 ? 310  ILE A CA    1 
ATOM   1695 C  C     . ILE A 1 250 ? 20.280 39.889 22.472 1.00 49.50 ? 310  ILE A C     1 
ATOM   1696 O  O     . ILE A 1 250 ? 21.430 39.478 22.303 1.00 50.72 ? 310  ILE A O     1 
ATOM   1697 C  CB    . ILE A 1 250 ? 18.856 39.719 24.535 1.00 47.38 ? 310  ILE A CB    1 
ATOM   1698 C  CG1   . ILE A 1 250 ? 18.653 40.289 25.945 1.00 48.09 ? 310  ILE A CG1   1 
ATOM   1699 C  CG2   . ILE A 1 250 ? 19.333 38.283 24.627 1.00 45.49 ? 310  ILE A CG2   1 
ATOM   1700 C  CD1   . ILE A 1 250 ? 17.497 39.682 26.698 1.00 49.05 ? 310  ILE A CD1   1 
ATOM   1701 N  N     . PHE A 1 251 ? 19.341 39.771 21.539 1.00 50.25 ? 311  PHE A N     1 
ATOM   1702 C  CA    . PHE A 1 251 ? 19.619 39.134 20.250 1.00 49.74 ? 311  PHE A CA    1 
ATOM   1703 C  C     . PHE A 1 251 ? 20.637 39.928 19.430 1.00 49.95 ? 311  PHE A C     1 
ATOM   1704 O  O     . PHE A 1 251 ? 21.568 39.360 18.862 1.00 50.04 ? 311  PHE A O     1 
ATOM   1705 C  CB    . PHE A 1 251 ? 18.325 38.987 19.446 1.00 48.50 ? 311  PHE A CB    1 
ATOM   1706 C  CG    . PHE A 1 251 ? 18.522 38.380 18.083 1.00 46.49 ? 311  PHE A CG    1 
ATOM   1707 C  CD1   . PHE A 1 251 ? 18.663 37.010 17.930 1.00 44.23 ? 311  PHE A CD1   1 
ATOM   1708 C  CD2   . PHE A 1 251 ? 18.574 39.187 16.955 1.00 46.47 ? 311  PHE A CD2   1 
ATOM   1709 C  CE1   . PHE A 1 251 ? 18.858 36.457 16.679 1.00 46.18 ? 311  PHE A CE1   1 
ATOM   1710 C  CE2   . PHE A 1 251 ? 18.769 38.640 15.701 1.00 45.62 ? 311  PHE A CE2   1 
ATOM   1711 C  CZ    . PHE A 1 251 ? 18.908 37.274 15.562 1.00 45.01 ? 311  PHE A CZ    1 
ATOM   1712 N  N     . GLU A 1 252 ? 20.450 41.241 19.376 1.00 50.83 ? 312  GLU A N     1 
ATOM   1713 C  CA    . GLU A 1 252 ? 21.336 42.126 18.626 1.00 52.30 ? 312  GLU A CA    1 
ATOM   1714 C  C     . GLU A 1 252 ? 22.816 41.874 18.935 1.00 52.11 ? 312  GLU A C     1 
ATOM   1715 O  O     . GLU A 1 252 ? 23.658 41.874 18.037 1.00 52.74 ? 312  GLU A O     1 
ATOM   1716 C  CB    . GLU A 1 252 ? 20.992 43.578 18.950 1.00 53.94 ? 312  GLU A CB    1 
ATOM   1717 C  CG    . GLU A 1 252 ? 21.610 44.596 18.020 1.00 57.90 ? 312  GLU A CG    1 
ATOM   1718 C  CD    . GLU A 1 252 ? 21.397 46.017 18.515 1.00 62.31 ? 312  GLU A CD    1 
ATOM   1719 O  OE1   . GLU A 1 252 ? 21.765 46.968 17.787 1.00 63.99 ? 312  GLU A OE1   1 
ATOM   1720 O  OE2   . GLU A 1 252 ? 20.862 46.180 19.638 1.00 63.13 ? 312  GLU A OE2   1 
ATOM   1721 N  N     . LEU A 1 253 ? 23.127 41.662 20.209 1.00 50.36 ? 313  LEU A N     1 
ATOM   1722 C  CA    . LEU A 1 253 ? 24.499 41.419 20.630 1.00 50.06 ? 313  LEU A CA    1 
ATOM   1723 C  C     . LEU A 1 253 ? 25.002 40.024 20.232 1.00 49.40 ? 313  LEU A C     1 
ATOM   1724 O  O     . LEU A 1 253 ? 26.127 39.877 19.757 1.00 47.32 ? 313  LEU A O     1 
ATOM   1725 C  CB    . LEU A 1 253 ? 24.624 41.599 22.151 1.00 49.81 ? 313  LEU A CB    1 
ATOM   1726 C  CG    . LEU A 1 253 ? 25.939 41.132 22.783 1.00 49.14 ? 313  LEU A CG    1 
ATOM   1727 C  CD1   . LEU A 1 253 ? 27.078 41.907 22.170 1.00 52.40 ? 313  LEU A CD1   1 
ATOM   1728 C  CD2   . LEU A 1 253 ? 25.907 41.321 24.280 1.00 50.21 ? 313  LEU A CD2   1 
ATOM   1729 N  N     . LEU A 1 254 ? 24.166 39.008 20.429 1.00 48.56 ? 314  LEU A N     1 
ATOM   1730 C  CA    . LEU A 1 254 ? 24.541 37.642 20.101 1.00 47.69 ? 314  LEU A CA    1 
ATOM   1731 C  C     . LEU A 1 254 ? 24.644 37.421 18.606 1.00 48.22 ? 314  LEU A C     1 
ATOM   1732 O  O     . LEU A 1 254 ? 25.441 36.606 18.149 1.00 47.37 ? 314  LEU A O     1 
ATOM   1733 C  CB    . LEU A 1 254 ? 23.535 36.656 20.688 1.00 46.40 ? 314  LEU A CB    1 
ATOM   1734 C  CG    . LEU A 1 254 ? 23.363 36.726 22.203 1.00 46.36 ? 314  LEU A CG    1 
ATOM   1735 C  CD1   . LEU A 1 254 ? 22.633 35.477 22.676 1.00 46.39 ? 314  LEU A CD1   1 
ATOM   1736 C  CD2   . LEU A 1 254 ? 24.730 36.816 22.875 1.00 45.92 ? 314  LEU A CD2   1 
ATOM   1737 N  N     . ASP A 1 255 ? 23.831 38.143 17.843 1.00 50.50 ? 315  ASP A N     1 
ATOM   1738 C  CA    . ASP A 1 255 ? 23.852 38.013 16.391 1.00 52.21 ? 315  ASP A CA    1 
ATOM   1739 C  C     . ASP A 1 255 ? 25.156 38.592 15.882 1.00 52.31 ? 315  ASP A C     1 
ATOM   1740 O  O     . ASP A 1 255 ? 25.755 38.069 14.941 1.00 51.37 ? 315  ASP A O     1 
ATOM   1741 C  CB    . ASP A 1 255 ? 22.684 38.769 15.753 1.00 54.68 ? 315  ASP A CB    1 
ATOM   1742 C  CG    . ASP A 1 255 ? 22.661 38.620 14.242 1.00 56.55 ? 315  ASP A CG    1 
ATOM   1743 O  OD1   . ASP A 1 255 ? 22.354 37.506 13.753 1.00 58.94 ? 315  ASP A OD1   1 
ATOM   1744 O  OD2   . ASP A 1 255 ? 22.962 39.609 13.540 1.00 58.37 ? 315  ASP A OD2   1 
ATOM   1745 N  N     . TYR A 1 256 ? 25.581 39.683 16.516 1.00 51.57 ? 316  TYR A N     1 
ATOM   1746 C  CA    . TYR A 1 256 ? 26.820 40.348 16.156 1.00 51.63 ? 316  TYR A CA    1 
ATOM   1747 C  C     . TYR A 1 256 ? 27.973 39.364 16.359 1.00 51.13 ? 316  TYR A C     1 
ATOM   1748 O  O     . TYR A 1 256 ? 28.727 39.081 15.433 1.00 51.99 ? 316  TYR A O     1 
ATOM   1749 C  CB    . TYR A 1 256 ? 27.033 41.585 17.034 1.00 53.69 ? 316  TYR A CB    1 
ATOM   1750 C  CG    . TYR A 1 256 ? 28.059 42.557 16.493 1.00 58.01 ? 316  TYR A CG    1 
ATOM   1751 C  CD1   . TYR A 1 256 ? 27.679 43.630 15.691 1.00 60.02 ? 316  TYR A CD1   1 
ATOM   1752 C  CD2   . TYR A 1 256 ? 29.409 42.390 16.766 1.00 60.37 ? 316  TYR A CD2   1 
ATOM   1753 C  CE1   . TYR A 1 256 ? 28.621 44.510 15.176 1.00 62.58 ? 316  TYR A CE1   1 
ATOM   1754 C  CE2   . TYR A 1 256 ? 30.359 43.260 16.256 1.00 61.73 ? 316  TYR A CE2   1 
ATOM   1755 C  CZ    . TYR A 1 256 ? 29.964 44.316 15.464 1.00 63.73 ? 316  TYR A CZ    1 
ATOM   1756 O  OH    . TYR A 1 256 ? 30.915 45.181 14.965 1.00 65.69 ? 316  TYR A OH    1 
ATOM   1757 N  N     . ILE A 1 257 ? 28.090 38.837 17.574 1.00 49.42 ? 317  ILE A N     1 
ATOM   1758 C  CA    . ILE A 1 257 ? 29.139 37.888 17.916 1.00 48.12 ? 317  ILE A CA    1 
ATOM   1759 C  C     . ILE A 1 257 ? 29.244 36.727 16.927 1.00 49.06 ? 317  ILE A C     1 
ATOM   1760 O  O     . ILE A 1 257 ? 30.339 36.364 16.492 1.00 49.00 ? 317  ILE A O     1 
ATOM   1761 C  CB    . ILE A 1 257 ? 28.902 37.319 19.342 1.00 47.25 ? 317  ILE A CB    1 
ATOM   1762 C  CG1   . ILE A 1 257 ? 29.073 38.447 20.362 1.00 46.20 ? 317  ILE A CG1   1 
ATOM   1763 C  CG2   . ILE A 1 257 ? 29.837 36.137 19.631 1.00 43.76 ? 317  ILE A CG2   1 
ATOM   1764 C  CD1   . ILE A 1 257 ? 28.879 38.033 21.796 1.00 44.30 ? 317  ILE A CD1   1 
ATOM   1765 N  N     . VAL A 1 258 ? 28.106 36.156 16.561 1.00 48.59 ? 318  VAL A N     1 
ATOM   1766 C  CA    . VAL A 1 258 ? 28.085 35.015 15.659 1.00 50.29 ? 318  VAL A CA    1 
ATOM   1767 C  C     . VAL A 1 258 ? 28.301 35.316 14.179 1.00 50.96 ? 318  VAL A C     1 
ATOM   1768 O  O     . VAL A 1 258 ? 28.962 34.554 13.481 1.00 49.61 ? 318  VAL A O     1 
ATOM   1769 C  CB    . VAL A 1 258 ? 26.752 34.241 15.814 1.00 50.80 ? 318  VAL A CB    1 
ATOM   1770 C  CG1   . VAL A 1 258 ? 26.694 33.084 14.832 1.00 50.34 ? 318  VAL A CG1   1 
ATOM   1771 C  CG2   . VAL A 1 258 ? 26.620 33.731 17.241 1.00 51.21 ? 318  VAL A CG2   1 
ATOM   1772 N  N     . ASN A 1 259 ? 27.752 36.428 13.707 1.00 54.50 ? 319  ASN A N     1 
ATOM   1773 C  CA    . ASN A 1 259 ? 27.858 36.790 12.300 1.00 56.93 ? 319  ASN A CA    1 
ATOM   1774 C  C     . ASN A 1 259 ? 28.875 37.863 11.958 1.00 58.51 ? 319  ASN A C     1 
ATOM   1775 O  O     . ASN A 1 259 ? 29.670 37.693 11.033 1.00 60.30 ? 319  ASN A O     1 
ATOM   1776 C  CB    . ASN A 1 259 ? 26.487 37.200 11.786 1.00 56.61 ? 319  ASN A CB    1 
ATOM   1777 C  CG    . ASN A 1 259 ? 25.492 36.066 11.866 1.00 58.07 ? 319  ASN A CG    1 
ATOM   1778 O  OD1   . ASN A 1 259 ? 25.765 34.963 11.393 1.00 57.90 ? 319  ASN A OD1   1 
ATOM   1779 N  ND2   . ASN A 1 259 ? 24.333 36.324 12.463 1.00 58.61 ? 319  ASN A ND2   1 
ATOM   1780 N  N     . GLU A 1 260 ? 28.858 38.968 12.687 1.00 59.43 ? 320  GLU A N     1 
ATOM   1781 C  CA    . GLU A 1 260 ? 29.804 40.036 12.413 1.00 61.80 ? 320  GLU A CA    1 
ATOM   1782 C  C     . GLU A 1 260 ? 31.230 39.583 12.752 1.00 62.93 ? 320  GLU A C     1 
ATOM   1783 O  O     . GLU A 1 260 ? 31.437 38.700 13.582 1.00 62.95 ? 320  GLU A O     1 
ATOM   1784 C  CB    . GLU A 1 260 ? 29.432 41.288 13.216 1.00 63.11 ? 320  GLU A CB    1 
ATOM   1785 C  CG    . GLU A 1 260 ? 28.065 41.883 12.867 1.00 65.72 ? 320  GLU A CG    1 
ATOM   1786 C  CD    . GLU A 1 260 ? 27.940 42.274 11.396 1.00 67.89 ? 320  GLU A CD    1 
ATOM   1787 O  OE1   . GLU A 1 260 ? 28.793 43.047 10.905 1.00 66.39 ? 320  GLU A OE1   1 
ATOM   1788 O  OE2   . GLU A 1 260 ? 26.980 41.808 10.735 1.00 70.68 ? 320  GLU A OE2   1 
ATOM   1789 N  N     . PRO A 1 261 ? 32.235 40.176 12.093 1.00 63.79 ? 321  PRO A N     1 
ATOM   1790 C  CA    . PRO A 1 261 ? 33.638 39.821 12.339 1.00 63.37 ? 321  PRO A CA    1 
ATOM   1791 C  C     . PRO A 1 261 ? 34.034 40.093 13.787 1.00 62.06 ? 321  PRO A C     1 
ATOM   1792 O  O     . PRO A 1 261 ? 33.516 41.019 14.416 1.00 63.23 ? 321  PRO A O     1 
ATOM   1793 C  CB    . PRO A 1 261 ? 34.391 40.709 11.348 1.00 63.95 ? 321  PRO A CB    1 
ATOM   1794 C  CG    . PRO A 1 261 ? 33.499 41.916 11.234 1.00 64.18 ? 321  PRO A CG    1 
ATOM   1795 C  CD    . PRO A 1 261 ? 32.137 41.278 11.119 1.00 63.57 ? 321  PRO A CD    1 
ATOM   1796 N  N     . PRO A 1 262 ? 34.969 39.295 14.324 1.00 60.07 ? 322  PRO A N     1 
ATOM   1797 C  CA    . PRO A 1 262 ? 35.475 39.398 15.697 1.00 59.87 ? 322  PRO A CA    1 
ATOM   1798 C  C     . PRO A 1 262 ? 36.100 40.744 16.029 1.00 60.50 ? 322  PRO A C     1 
ATOM   1799 O  O     . PRO A 1 262 ? 36.518 41.486 15.149 1.00 60.52 ? 322  PRO A O     1 
ATOM   1800 C  CB    . PRO A 1 262 ? 36.487 38.261 15.774 1.00 59.80 ? 322  PRO A CB    1 
ATOM   1801 C  CG    . PRO A 1 262 ? 37.016 38.207 14.384 1.00 58.93 ? 322  PRO A CG    1 
ATOM   1802 C  CD    . PRO A 1 262 ? 35.752 38.313 13.560 1.00 59.37 ? 322  PRO A CD    1 
ATOM   1803 N  N     . PRO A 1 263 ? 36.164 41.078 17.319 1.00 60.94 ? 323  PRO A N     1 
ATOM   1804 C  CA    . PRO A 1 263 ? 36.744 42.348 17.762 1.00 62.18 ? 323  PRO A CA    1 
ATOM   1805 C  C     . PRO A 1 263 ? 38.252 42.407 17.608 1.00 63.99 ? 323  PRO A C     1 
ATOM   1806 O  O     . PRO A 1 263 ? 38.972 41.600 18.185 1.00 65.54 ? 323  PRO A O     1 
ATOM   1807 C  CB    . PRO A 1 263 ? 36.307 42.442 19.223 1.00 61.86 ? 323  PRO A CB    1 
ATOM   1808 C  CG    . PRO A 1 263 ? 36.219 41.003 19.642 1.00 62.07 ? 323  PRO A CG    1 
ATOM   1809 C  CD    . PRO A 1 263 ? 35.563 40.342 18.443 1.00 61.39 ? 323  PRO A CD    1 
ATOM   1810 N  N     . LYS A 1 264 ? 38.733 43.355 16.815 1.00 65.76 ? 324  LYS A N     1 
ATOM   1811 C  CA    . LYS A 1 264 ? 40.169 43.498 16.631 1.00 66.70 ? 324  LYS A CA    1 
ATOM   1812 C  C     . LYS A 1 264 ? 40.693 44.479 17.657 1.00 66.91 ? 324  LYS A C     1 
ATOM   1813 O  O     . LYS A 1 264 ? 39.930 45.215 18.274 1.00 67.45 ? 324  LYS A O     1 
ATOM   1814 C  CB    . LYS A 1 264 ? 40.490 44.011 15.229 1.00 66.67 ? 324  LYS A CB    1 
ATOM   1815 C  CG    . LYS A 1 264 ? 40.407 42.955 14.150 1.00 68.82 ? 324  LYS A CG    1 
ATOM   1816 C  CD    . LYS A 1 264 ? 40.545 43.583 12.773 1.00 70.91 ? 324  LYS A CD    1 
ATOM   1817 C  CE    . LYS A 1 264 ? 40.562 42.527 11.682 1.00 72.19 ? 324  LYS A CE    1 
ATOM   1818 N  NZ    . LYS A 1 264 ? 40.488 43.143 10.327 1.00 72.57 ? 324  LYS A NZ    1 
ATOM   1819 N  N     . LEU A 1 265 ? 42.002 44.479 17.840 1.00 68.40 ? 325  LEU A N     1 
ATOM   1820 C  CA    . LEU A 1 265 ? 42.638 45.385 18.782 1.00 68.92 ? 325  LEU A CA    1 
ATOM   1821 C  C     . LEU A 1 265 ? 43.125 46.586 17.963 1.00 69.67 ? 325  LEU A C     1 
ATOM   1822 O  O     . LEU A 1 265 ? 43.617 46.429 16.847 1.00 69.94 ? 325  LEU A O     1 
ATOM   1823 C  CB    . LEU A 1 265 ? 43.811 44.665 19.455 1.00 68.15 ? 325  LEU A CB    1 
ATOM   1824 C  CG    . LEU A 1 265 ? 44.293 45.116 20.833 1.00 68.17 ? 325  LEU A CG    1 
ATOM   1825 C  CD1   . LEU A 1 265 ? 43.141 45.093 21.826 1.00 67.63 ? 325  LEU A CD1   1 
ATOM   1826 C  CD2   . LEU A 1 265 ? 45.401 44.184 21.303 1.00 67.02 ? 325  LEU A CD2   1 
ATOM   1827 N  N     . PRO A 1 266 ? 42.971 47.804 18.497 1.00 70.49 ? 326  PRO A N     1 
ATOM   1828 C  CA    . PRO A 1 266 ? 43.404 49.018 17.796 1.00 71.19 ? 326  PRO A CA    1 
ATOM   1829 C  C     . PRO A 1 266 ? 44.901 49.022 17.491 1.00 72.02 ? 326  PRO A C     1 
ATOM   1830 O  O     . PRO A 1 266 ? 45.725 48.895 18.395 1.00 73.20 ? 326  PRO A O     1 
ATOM   1831 C  CB    . PRO A 1 266 ? 42.997 50.136 18.760 1.00 71.29 ? 326  PRO A CB    1 
ATOM   1832 C  CG    . PRO A 1 266 ? 43.065 49.476 20.104 1.00 70.74 ? 326  PRO A CG    1 
ATOM   1833 C  CD    . PRO A 1 266 ? 42.436 48.127 19.829 1.00 71.14 ? 326  PRO A CD    1 
ATOM   1834 N  N     . SER A 1 267 ? 45.249 49.168 16.214 1.00 73.51 ? 327  SER A N     1 
ATOM   1835 C  CA    . SER A 1 267 ? 46.653 49.184 15.796 1.00 74.10 ? 327  SER A CA    1 
ATOM   1836 C  C     . SER A 1 267 ? 47.351 50.482 16.174 1.00 73.76 ? 327  SER A C     1 
ATOM   1837 O  O     . SER A 1 267 ? 46.712 51.522 16.312 1.00 74.49 ? 327  SER A O     1 
ATOM   1838 C  CB    . SER A 1 267 ? 46.771 48.990 14.283 1.00 74.18 ? 327  SER A CB    1 
ATOM   1839 O  OG    . SER A 1 267 ? 48.130 49.076 13.884 1.00 75.06 ? 327  SER A OG    1 
ATOM   1840 N  N     . GLY A 1 268 ? 48.669 50.420 16.329 1.00 73.32 ? 328  GLY A N     1 
ATOM   1841 C  CA    . GLY A 1 268 ? 49.412 51.613 16.691 1.00 71.82 ? 328  GLY A CA    1 
ATOM   1842 C  C     . GLY A 1 268 ? 49.646 51.746 18.184 1.00 70.70 ? 328  GLY A C     1 
ATOM   1843 O  O     . GLY A 1 268 ? 50.790 51.793 18.630 1.00 71.81 ? 328  GLY A O     1 
ATOM   1844 N  N     . VAL A 1 269 ? 48.565 51.805 18.958 1.00 68.81 ? 329  VAL A N     1 
ATOM   1845 C  CA    . VAL A 1 269 ? 48.660 51.940 20.409 1.00 66.70 ? 329  VAL A CA    1 
ATOM   1846 C  C     . VAL A 1 269 ? 49.069 50.627 21.089 1.00 64.69 ? 329  VAL A C     1 
ATOM   1847 O  O     . VAL A 1 269 ? 49.529 50.622 22.233 1.00 64.96 ? 329  VAL A O     1 
ATOM   1848 C  CB    . VAL A 1 269 ? 47.319 52.424 21.002 1.00 68.30 ? 329  VAL A CB    1 
ATOM   1849 C  CG1   . VAL A 1 269 ? 46.191 51.514 20.542 1.00 69.69 ? 329  VAL A CG1   1 
ATOM   1850 C  CG2   . VAL A 1 269 ? 47.390 52.443 22.526 1.00 69.68 ? 329  VAL A CG2   1 
ATOM   1851 N  N     . PHE A 1 270 ? 48.897 49.512 20.386 1.00 61.25 ? 330  PHE A N     1 
ATOM   1852 C  CA    . PHE A 1 270 ? 49.267 48.216 20.933 1.00 58.61 ? 330  PHE A CA    1 
ATOM   1853 C  C     . PHE A 1 270 ? 50.262 47.511 20.037 1.00 58.33 ? 330  PHE A C     1 
ATOM   1854 O  O     . PHE A 1 270 ? 50.261 47.692 18.818 1.00 57.19 ? 330  PHE A O     1 
ATOM   1855 C  CB    . PHE A 1 270 ? 48.028 47.328 21.124 1.00 57.74 ? 330  PHE A CB    1 
ATOM   1856 C  CG    . PHE A 1 270 ? 47.161 47.755 22.265 1.00 54.64 ? 330  PHE A CG    1 
ATOM   1857 C  CD1   . PHE A 1 270 ? 47.594 47.598 23.572 1.00 53.35 ? 330  PHE A CD1   1 
ATOM   1858 C  CD2   . PHE A 1 270 ? 45.945 48.372 22.033 1.00 53.00 ? 330  PHE A CD2   1 
ATOM   1859 C  CE1   . PHE A 1 270 ? 46.836 48.069 24.630 1.00 54.03 ? 330  PHE A CE1   1 
ATOM   1860 C  CE2   . PHE A 1 270 ? 45.181 48.847 23.084 1.00 52.55 ? 330  PHE A CE2   1 
ATOM   1861 C  CZ    . PHE A 1 270 ? 45.623 48.692 24.387 1.00 54.24 ? 330  PHE A CZ    1 
ATOM   1862 N  N     . SER A 1 271 ? 51.114 46.710 20.667 1.00 58.70 ? 331  SER A N     1 
ATOM   1863 C  CA    . SER A 1 271 ? 52.142 45.938 19.984 1.00 58.38 ? 331  SER A CA    1 
ATOM   1864 C  C     . SER A 1 271 ? 51.587 45.109 18.841 1.00 59.71 ? 331  SER A C     1 
ATOM   1865 O  O     . SER A 1 271 ? 50.404 44.778 18.818 1.00 61.38 ? 331  SER A O     1 
ATOM   1866 C  CB    . SER A 1 271 ? 52.821 45.001 20.975 1.00 57.82 ? 331  SER A CB    1 
ATOM   1867 O  OG    . SER A 1 271 ? 53.210 43.798 20.335 1.00 57.59 ? 331  SER A OG    1 
ATOM   1868 N  N     . LEU A 1 272 ? 52.456 44.765 17.899 1.00 60.71 ? 332  LEU A N     1 
ATOM   1869 C  CA    . LEU A 1 272 ? 52.064 43.953 16.760 1.00 61.71 ? 332  LEU A CA    1 
ATOM   1870 C  C     . LEU A 1 272 ? 51.940 42.492 17.202 1.00 62.54 ? 332  LEU A C     1 
ATOM   1871 O  O     . LEU A 1 272 ? 51.120 41.739 16.669 1.00 62.05 ? 332  LEU A O     1 
ATOM   1872 C  CB    . LEU A 1 272 ? 53.101 44.084 15.634 1.00 62.40 ? 332  LEU A CB    1 
ATOM   1873 C  CG    . LEU A 1 272 ? 53.164 45.431 14.890 1.00 63.81 ? 332  LEU A CG    1 
ATOM   1874 C  CD1   . LEU A 1 272 ? 54.418 45.517 14.025 1.00 63.55 ? 332  LEU A CD1   1 
ATOM   1875 C  CD2   . LEU A 1 272 ? 51.919 45.583 14.029 1.00 62.85 ? 332  LEU A CD2   1 
ATOM   1876 N  N     . GLU A 1 273 ? 52.747 42.099 18.186 1.00 62.12 ? 333  GLU A N     1 
ATOM   1877 C  CA    . GLU A 1 273 ? 52.718 40.727 18.689 1.00 62.39 ? 333  GLU A CA    1 
ATOM   1878 C  C     . GLU A 1 273 ? 51.448 40.466 19.496 1.00 61.02 ? 333  GLU A C     1 
ATOM   1879 O  O     . GLU A 1 273 ? 50.842 39.394 19.399 1.00 59.71 ? 333  GLU A O     1 
ATOM   1880 C  CB    . GLU A 1 273 ? 53.955 40.445 19.550 1.00 63.58 ? 333  GLU A CB    1 
ATOM   1881 C  CG    . GLU A 1 273 ? 55.267 40.631 18.807 1.00 68.74 ? 333  GLU A CG    1 
ATOM   1882 C  CD    . GLU A 1 273 ? 55.915 41.984 19.092 1.00 72.46 ? 333  GLU A CD    1 
ATOM   1883 O  OE1   . GLU A 1 273 ? 56.380 42.191 20.241 1.00 73.11 ? 333  GLU A OE1   1 
ATOM   1884 O  OE2   . GLU A 1 273 ? 55.956 42.840 18.174 1.00 73.58 ? 333  GLU A OE2   1 
ATOM   1885 N  N     . PHE A 1 274 ? 51.054 41.455 20.291 1.00 59.87 ? 334  PHE A N     1 
ATOM   1886 C  CA    . PHE A 1 274 ? 49.850 41.350 21.101 1.00 59.79 ? 334  PHE A CA    1 
ATOM   1887 C  C     . PHE A 1 274 ? 48.619 41.344 20.201 1.00 59.30 ? 334  PHE A C     1 
ATOM   1888 O  O     . PHE A 1 274 ? 47.642 40.664 20.492 1.00 60.82 ? 334  PHE A O     1 
ATOM   1889 C  CB    . PHE A 1 274 ? 49.772 42.512 22.092 1.00 60.39 ? 334  PHE A CB    1 
ATOM   1890 C  CG    . PHE A 1 274 ? 48.639 42.406 23.066 1.00 60.03 ? 334  PHE A CG    1 
ATOM   1891 C  CD1   . PHE A 1 274 ? 48.157 41.169 23.455 1.00 59.39 ? 334  PHE A CD1   1 
ATOM   1892 C  CD2   . PHE A 1 274 ? 48.064 43.546 23.606 1.00 60.43 ? 334  PHE A CD2   1 
ATOM   1893 C  CE1   . PHE A 1 274 ? 47.137 41.068 24.380 1.00 60.64 ? 334  PHE A CE1   1 
ATOM   1894 C  CE2   . PHE A 1 274 ? 47.040 43.453 24.535 1.00 60.43 ? 334  PHE A CE2   1 
ATOM   1895 C  CZ    . PHE A 1 274 ? 46.570 42.212 24.916 1.00 60.80 ? 334  PHE A CZ    1 
ATOM   1896 N  N     . GLN A 1 275 ? 48.671 42.091 19.104 1.00 57.78 ? 335  GLN A N     1 
ATOM   1897 C  CA    . GLN A 1 275 ? 47.549 42.127 18.183 1.00 56.77 ? 335  GLN A CA    1 
ATOM   1898 C  C     . GLN A 1 275 ? 47.344 40.749 17.574 1.00 55.42 ? 335  GLN A C     1 
ATOM   1899 O  O     . GLN A 1 275 ? 46.218 40.263 17.459 1.00 57.31 ? 335  GLN A O     1 
ATOM   1900 C  CB    . GLN A 1 275 ? 47.792 43.148 17.073 1.00 57.40 ? 335  GLN A CB    1 
ATOM   1901 C  CG    . GLN A 1 275 ? 47.675 44.591 17.529 1.00 60.05 ? 335  GLN A CG    1 
ATOM   1902 C  CD    . GLN A 1 275 ? 48.071 45.574 16.445 1.00 60.61 ? 335  GLN A CD    1 
ATOM   1903 O  OE1   . GLN A 1 275 ? 47.543 45.536 15.332 1.00 61.38 ? 335  GLN A OE1   1 
ATOM   1904 N  NE2   . GLN A 1 275 ? 49.005 46.462 16.765 1.00 60.30 ? 335  GLN A NE2   1 
ATOM   1905 N  N     . ASP A 1 276 ? 48.440 40.110 17.194 1.00 52.41 ? 336  ASP A N     1 
ATOM   1906 C  CA    . ASP A 1 276 ? 48.356 38.792 16.592 1.00 49.36 ? 336  ASP A CA    1 
ATOM   1907 C  C     . ASP A 1 276 ? 47.861 37.754 17.595 1.00 48.29 ? 336  ASP A C     1 
ATOM   1908 O  O     . ASP A 1 276 ? 47.177 36.791 17.231 1.00 46.27 ? 336  ASP A O     1 
ATOM   1909 C  CB    . ASP A 1 276 ? 49.720 38.362 16.069 1.00 47.54 ? 336  ASP A CB    1 
ATOM   1910 C  CG    . ASP A 1 276 ? 49.634 37.122 15.230 1.00 47.54 ? 336  ASP A CG    1 
ATOM   1911 O  OD1   . ASP A 1 276 ? 49.027 37.210 14.139 1.00 47.37 ? 336  ASP A OD1   1 
ATOM   1912 O  OD2   . ASP A 1 276 ? 50.148 36.062 15.664 1.00 46.81 ? 336  ASP A OD2   1 
ATOM   1913 N  N     . PHE A 1 277 ? 48.231 37.957 18.855 1.00 47.10 ? 337  PHE A N     1 
ATOM   1914 C  CA    . PHE A 1 277 ? 47.849 37.060 19.934 1.00 46.58 ? 337  PHE A CA    1 
ATOM   1915 C  C     . PHE A 1 277 ? 46.320 36.972 20.058 1.00 46.63 ? 337  PHE A C     1 
ATOM   1916 O  O     . PHE A 1 277 ? 45.747 35.882 19.989 1.00 44.11 ? 337  PHE A O     1 
ATOM   1917 C  CB    . PHE A 1 277 ? 48.456 37.546 21.255 1.00 45.65 ? 337  PHE A CB    1 
ATOM   1918 C  CG    . PHE A 1 277 ? 48.258 36.583 22.385 1.00 47.02 ? 337  PHE A CG    1 
ATOM   1919 C  CD1   . PHE A 1 277 ? 49.054 35.454 22.500 1.00 46.03 ? 337  PHE A CD1   1 
ATOM   1920 C  CD2   . PHE A 1 277 ? 47.278 36.811 23.341 1.00 47.48 ? 337  PHE A CD2   1 
ATOM   1921 C  CE1   . PHE A 1 277 ? 48.843 34.541 23.519 1.00 46.22 ? 337  PHE A CE1   1 
ATOM   1922 C  CE2   . PHE A 1 277 ? 47.060 35.905 24.362 1.00 47.69 ? 337  PHE A CE2   1 
ATOM   1923 C  CZ    . PHE A 1 277 ? 47.859 34.778 24.464 1.00 48.52 ? 337  PHE A CZ    1 
ATOM   1924 N  N     . VAL A 1 278 ? 45.665 38.116 20.228 1.00 45.46 ? 338  VAL A N     1 
ATOM   1925 C  CA    . VAL A 1 278 ? 44.216 38.118 20.355 1.00 46.63 ? 338  VAL A CA    1 
ATOM   1926 C  C     . VAL A 1 278 ? 43.562 37.653 19.057 1.00 46.75 ? 338  VAL A C     1 
ATOM   1927 O  O     . VAL A 1 278 ? 42.529 36.993 19.083 1.00 46.32 ? 338  VAL A O     1 
ATOM   1928 C  CB    . VAL A 1 278 ? 43.668 39.518 20.745 1.00 46.47 ? 338  VAL A CB    1 
ATOM   1929 C  CG1   . VAL A 1 278 ? 44.426 40.040 21.951 1.00 46.15 ? 338  VAL A CG1   1 
ATOM   1930 C  CG2   . VAL A 1 278 ? 43.772 40.478 19.580 1.00 47.99 ? 338  VAL A CG2   1 
ATOM   1931 N  N     . ASN A 1 279 ? 44.159 37.987 17.919 1.00 47.86 ? 339  ASN A N     1 
ATOM   1932 C  CA    . ASN A 1 279 ? 43.597 37.553 16.647 1.00 49.32 ? 339  ASN A CA    1 
ATOM   1933 C  C     . ASN A 1 279 ? 43.558 36.037 16.573 1.00 49.85 ? 339  ASN A C     1 
ATOM   1934 O  O     . ASN A 1 279 ? 42.589 35.455 16.088 1.00 52.00 ? 339  ASN A O     1 
ATOM   1935 C  CB    . ASN A 1 279 ? 44.417 38.093 15.482 1.00 49.96 ? 339  ASN A CB    1 
ATOM   1936 C  CG    . ASN A 1 279 ? 44.046 39.510 15.133 1.00 52.57 ? 339  ASN A CG    1 
ATOM   1937 O  OD1   . ASN A 1 279 ? 43.666 40.295 16.006 1.00 52.59 ? 339  ASN A OD1   1 
ATOM   1938 N  ND2   . ASN A 1 279 ? 44.161 39.855 13.860 1.00 53.09 ? 339  ASN A ND2   1 
ATOM   1939 N  N     . LYS A 1 280 ? 44.615 35.401 17.061 1.00 49.19 ? 340  LYS A N     1 
ATOM   1940 C  CA    . LYS A 1 280 ? 44.697 33.953 17.044 1.00 49.42 ? 340  LYS A CA    1 
ATOM   1941 C  C     . LYS A 1 280 ? 43.644 33.380 17.990 1.00 48.18 ? 340  LYS A C     1 
ATOM   1942 O  O     . LYS A 1 280 ? 43.214 32.233 17.846 1.00 47.77 ? 340  LYS A O     1 
ATOM   1943 C  CB    . LYS A 1 280 ? 46.091 33.505 17.491 1.00 50.55 ? 340  LYS A CB    1 
ATOM   1944 C  CG    . LYS A 1 280 ? 47.214 33.838 16.525 1.00 51.72 ? 340  LYS A CG    1 
ATOM   1945 C  CD    . LYS A 1 280 ? 47.219 32.890 15.342 1.00 54.89 ? 340  LYS A CD    1 
ATOM   1946 C  CE    . LYS A 1 280 ? 48.579 32.898 14.625 1.00 56.22 ? 340  LYS A CE    1 
ATOM   1947 N  NZ    . LYS A 1 280 ? 48.984 34.265 14.179 1.00 57.46 ? 340  LYS A NZ    1 
ATOM   1948 N  N     . CYS A 1 281 ? 43.245 34.199 18.955 1.00 46.04 ? 341  CYS A N     1 
ATOM   1949 C  CA    . CYS A 1 281 ? 42.258 33.829 19.959 1.00 46.10 ? 341  CYS A CA    1 
ATOM   1950 C  C     . CYS A 1 281 ? 40.828 33.988 19.468 1.00 46.72 ? 341  CYS A C     1 
ATOM   1951 O  O     . CYS A 1 281 ? 39.964 33.145 19.725 1.00 43.36 ? 341  CYS A O     1 
ATOM   1952 C  CB    . CYS A 1 281 ? 42.404 34.717 21.196 1.00 46.04 ? 341  CYS A CB    1 
ATOM   1953 S  SG    . CYS A 1 281 ? 43.758 34.313 22.285 1.00 41.79 ? 341  CYS A SG    1 
ATOM   1954 N  N     . LEU A 1 282 ? 40.600 35.093 18.767 1.00 46.71 ? 342  LEU A N     1 
ATOM   1955 C  CA    . LEU A 1 282 ? 39.282 35.443 18.282 1.00 46.39 ? 342  LEU A CA    1 
ATOM   1956 C  C     . LEU A 1 282 ? 38.914 34.956 16.897 1.00 47.54 ? 342  LEU A C     1 
ATOM   1957 O  O     . LEU A 1 282 ? 38.198 35.634 16.163 1.00 49.09 ? 342  LEU A O     1 
ATOM   1958 C  CB    . LEU A 1 282 ? 39.111 36.956 18.379 1.00 44.36 ? 342  LEU A CB    1 
ATOM   1959 C  CG    . LEU A 1 282 ? 39.350 37.512 19.785 1.00 44.55 ? 342  LEU A CG    1 
ATOM   1960 C  CD1   . LEU A 1 282 ? 39.005 39.003 19.809 1.00 45.23 ? 342  LEU A CD1   1 
ATOM   1961 C  CD2   . LEU A 1 282 ? 38.484 36.762 20.779 1.00 44.39 ? 342  LEU A CD2   1 
ATOM   1962 N  N     . ILE A 1 283 ? 39.399 33.776 16.537 1.00 49.27 ? 343  ILE A N     1 
ATOM   1963 C  CA    . ILE A 1 283 ? 39.074 33.185 15.244 1.00 49.50 ? 343  ILE A CA    1 
ATOM   1964 C  C     . ILE A 1 283 ? 37.733 32.473 15.456 1.00 48.51 ? 343  ILE A C     1 
ATOM   1965 O  O     . ILE A 1 283 ? 37.600 31.650 16.363 1.00 47.75 ? 343  ILE A O     1 
ATOM   1966 C  CB    . ILE A 1 283 ? 40.177 32.187 14.829 1.00 51.99 ? 343  ILE A CB    1 
ATOM   1967 C  CG1   . ILE A 1 283 ? 41.422 32.956 14.413 1.00 53.35 ? 343  ILE A CG1   1 
ATOM   1968 C  CG2   . ILE A 1 283 ? 39.724 31.318 13.679 1.00 51.62 ? 343  ILE A CG2   1 
ATOM   1969 C  CD1   . ILE A 1 283 ? 42.524 32.055 13.923 1.00 55.78 ? 343  ILE A CD1   1 
ATOM   1970 N  N     . LYS A 1 284 ? 36.738 32.805 14.640 1.00 47.88 ? 344  LYS A N     1 
ATOM   1971 C  CA    . LYS A 1 284 ? 35.420 32.205 14.794 1.00 48.39 ? 344  LYS A CA    1 
ATOM   1972 C  C     . LYS A 1 284 ? 35.398 30.688 14.729 1.00 47.98 ? 344  LYS A C     1 
ATOM   1973 O  O     . LYS A 1 284 ? 34.681 30.039 15.492 1.00 48.34 ? 344  LYS A O     1 
ATOM   1974 C  CB    . LYS A 1 284 ? 34.443 32.774 13.771 1.00 47.30 ? 344  LYS A CB    1 
ATOM   1975 C  CG    . LYS A 1 284 ? 34.021 34.186 14.090 1.00 49.37 ? 344  LYS A CG    1 
ATOM   1976 C  CD    . LYS A 1 284 ? 32.669 34.516 13.481 1.00 49.94 ? 344  LYS A CD    1 
ATOM   1977 C  CE    . LYS A 1 284 ? 32.349 35.969 13.736 1.00 52.79 ? 344  LYS A CE    1 
ATOM   1978 N  NZ    . LYS A 1 284 ? 30.995 36.350 13.267 1.00 53.48 ? 344  LYS A NZ    1 
ATOM   1979 N  N     . ASN A 1 285 ? 36.176 30.118 13.822 1.00 47.46 ? 345  ASN A N     1 
ATOM   1980 C  CA    . ASN A 1 285 ? 36.218 28.675 13.707 1.00 48.13 ? 345  ASN A CA    1 
ATOM   1981 C  C     . ASN A 1 285 ? 37.110 28.113 14.813 1.00 46.75 ? 345  ASN A C     1 
ATOM   1982 O  O     . ASN A 1 285 ? 38.304 28.398 14.863 1.00 46.57 ? 345  ASN A O     1 
ATOM   1983 C  CB    . ASN A 1 285 ? 36.764 28.279 12.345 1.00 51.26 ? 345  ASN A CB    1 
ATOM   1984 C  CG    . ASN A 1 285 ? 36.818 26.789 12.166 1.00 54.53 ? 345  ASN A CG    1 
ATOM   1985 O  OD1   . ASN A 1 285 ? 37.496 26.088 12.919 1.00 56.40 ? 345  ASN A OD1   1 
ATOM   1986 N  ND2   . ASN A 1 285 ? 36.097 26.287 11.168 1.00 57.35 ? 345  ASN A ND2   1 
ATOM   1987 N  N     . PRO A 1 286 ? 36.539 27.299 15.712 1.00 45.61 ? 346  PRO A N     1 
ATOM   1988 C  CA    . PRO A 1 286 ? 37.290 26.704 16.826 1.00 44.39 ? 346  PRO A CA    1 
ATOM   1989 C  C     . PRO A 1 286 ? 38.433 25.763 16.444 1.00 44.01 ? 346  PRO A C     1 
ATOM   1990 O  O     . PRO A 1 286 ? 39.391 25.598 17.203 1.00 41.93 ? 346  PRO A O     1 
ATOM   1991 C  CB    . PRO A 1 286 ? 36.205 26.000 17.635 1.00 43.27 ? 346  PRO A CB    1 
ATOM   1992 C  CG    . PRO A 1 286 ? 35.214 25.599 16.581 1.00 45.16 ? 346  PRO A CG    1 
ATOM   1993 C  CD    . PRO A 1 286 ? 35.143 26.834 15.707 1.00 43.52 ? 346  PRO A CD    1 
ATOM   1994 N  N     . ALA A 1 287 ? 38.330 25.146 15.275 1.00 44.77 ? 347  ALA A N     1 
ATOM   1995 C  CA    . ALA A 1 287 ? 39.363 24.224 14.823 1.00 46.63 ? 347  ALA A CA    1 
ATOM   1996 C  C     . ALA A 1 287 ? 40.535 25.012 14.247 1.00 47.75 ? 347  ALA A C     1 
ATOM   1997 O  O     . ALA A 1 287 ? 41.688 24.594 14.347 1.00 46.21 ? 347  ALA A O     1 
ATOM   1998 C  CB    . ALA A 1 287 ? 38.791 23.258 13.783 1.00 43.83 ? 347  ALA A CB    1 
ATOM   1999 N  N     . GLU A 1 288 ? 40.241 26.163 13.655 1.00 49.13 ? 348  GLU A N     1 
ATOM   2000 C  CA    . GLU A 1 288 ? 41.297 26.989 13.097 1.00 52.12 ? 348  GLU A CA    1 
ATOM   2001 C  C     . GLU A 1 288 ? 41.896 27.901 14.180 1.00 51.29 ? 348  GLU A C     1 
ATOM   2002 O  O     . GLU A 1 288 ? 43.043 28.340 14.080 1.00 51.97 ? 348  GLU A O     1 
ATOM   2003 C  CB    . GLU A 1 288 ? 40.749 27.814 11.931 1.00 56.27 ? 348  GLU A CB    1 
ATOM   2004 C  CG    . GLU A 1 288 ? 41.777 28.714 11.268 1.00 64.34 ? 348  GLU A CG    1 
ATOM   2005 C  CD    . GLU A 1 288 ? 41.196 29.496 10.097 1.00 68.81 ? 348  GLU A CD    1 
ATOM   2006 O  OE1   . GLU A 1 288 ? 41.835 30.498 9.682  1.00 70.44 ? 348  GLU A OE1   1 
ATOM   2007 O  OE2   . GLU A 1 288 ? 40.108 29.107 9.595  1.00 69.26 ? 348  GLU A OE2   1 
ATOM   2008 N  N     . ARG A 1 289 ? 41.120 28.156 15.229 1.00 49.40 ? 349  ARG A N     1 
ATOM   2009 C  CA    . ARG A 1 289 ? 41.545 29.004 16.347 1.00 47.19 ? 349  ARG A CA    1 
ATOM   2010 C  C     . ARG A 1 289 ? 42.738 28.385 17.074 1.00 45.07 ? 349  ARG A C     1 
ATOM   2011 O  O     . ARG A 1 289 ? 42.850 27.168 17.165 1.00 44.12 ? 349  ARG A O     1 
ATOM   2012 C  CB    . ARG A 1 289 ? 40.375 29.163 17.321 1.00 48.32 ? 349  ARG A CB    1 
ATOM   2013 C  CG    . ARG A 1 289 ? 40.503 30.250 18.368 1.00 45.45 ? 349  ARG A CG    1 
ATOM   2014 C  CD    . ARG A 1 289 ? 39.100 30.794 18.673 1.00 44.51 ? 349  ARG A CD    1 
ATOM   2015 N  NE    . ARG A 1 289 ? 38.315 29.930 19.547 1.00 42.19 ? 349  ARG A NE    1 
ATOM   2016 C  CZ    . ARG A 1 289 ? 37.023 29.655 19.379 1.00 39.71 ? 349  ARG A CZ    1 
ATOM   2017 N  NH1   . ARG A 1 289 ? 36.355 30.166 18.354 1.00 37.37 ? 349  ARG A NH1   1 
ATOM   2018 N  NH2   . ARG A 1 289 ? 36.386 28.892 20.261 1.00 37.09 ? 349  ARG A NH2   1 
ATOM   2019 N  N     . ALA A 1 290 ? 43.623 29.222 17.597 1.00 42.33 ? 350  ALA A N     1 
ATOM   2020 C  CA    . ALA A 1 290 ? 44.794 28.720 18.305 1.00 42.35 ? 350  ALA A CA    1 
ATOM   2021 C  C     . ALA A 1 290 ? 44.393 27.973 19.574 1.00 42.32 ? 350  ALA A C     1 
ATOM   2022 O  O     . ALA A 1 290 ? 43.340 28.239 20.144 1.00 42.08 ? 350  ALA A O     1 
ATOM   2023 C  CB    . ALA A 1 290 ? 45.731 29.874 18.656 1.00 39.37 ? 350  ALA A CB    1 
ATOM   2024 N  N     . ASP A 1 291 ? 45.238 27.040 20.008 1.00 42.45 ? 351  ASP A N     1 
ATOM   2025 C  CA    . ASP A 1 291 ? 44.976 26.280 21.225 1.00 43.58 ? 351  ASP A CA    1 
ATOM   2026 C  C     . ASP A 1 291 ? 46.041 26.616 22.274 1.00 42.93 ? 351  ASP A C     1 
ATOM   2027 O  O     . ASP A 1 291 ? 46.996 27.338 21.985 1.00 42.61 ? 351  ASP A O     1 
ATOM   2028 C  CB    . ASP A 1 291 ? 44.922 24.768 20.925 1.00 46.40 ? 351  ASP A CB    1 
ATOM   2029 C  CG    . ASP A 1 291 ? 46.285 24.172 20.551 1.00 49.10 ? 351  ASP A CG    1 
ATOM   2030 O  OD1   . ASP A 1 291 ? 47.198 24.927 20.153 1.00 51.19 ? 351  ASP A OD1   1 
ATOM   2031 O  OD2   . ASP A 1 291 ? 46.426 22.933 20.644 1.00 49.03 ? 351  ASP A OD2   1 
ATOM   2032 N  N     . LEU A 1 292 ? 45.863 26.113 23.491 1.00 42.29 ? 352  LEU A N     1 
ATOM   2033 C  CA    . LEU A 1 292 ? 46.787 26.386 24.588 1.00 42.27 ? 352  LEU A CA    1 
ATOM   2034 C  C     . LEU A 1 292 ? 48.248 26.118 24.214 1.00 43.96 ? 352  LEU A C     1 
ATOM   2035 O  O     . LEU A 1 292 ? 49.129 26.924 24.504 1.00 42.24 ? 352  LEU A O     1 
ATOM   2036 C  CB    . LEU A 1 292 ? 46.390 25.561 25.820 1.00 37.32 ? 352  LEU A CB    1 
ATOM   2037 C  CG    . LEU A 1 292 ? 45.031 25.916 26.436 1.00 34.64 ? 352  LEU A CG    1 
ATOM   2038 C  CD1   . LEU A 1 292 ? 44.617 24.872 27.464 1.00 32.09 ? 352  LEU A CD1   1 
ATOM   2039 C  CD2   . LEU A 1 292 ? 45.104 27.273 27.075 1.00 33.04 ? 352  LEU A CD2   1 
ATOM   2040 N  N     . LYS A 1 293 ? 48.492 24.980 23.574 1.00 46.59 ? 353  LYS A N     1 
ATOM   2041 C  CA    . LYS A 1 293 ? 49.833 24.603 23.152 1.00 50.00 ? 353  LYS A CA    1 
ATOM   2042 C  C     . LYS A 1 293 ? 50.474 25.703 22.301 1.00 51.04 ? 353  LYS A C     1 
ATOM   2043 O  O     . LYS A 1 293 ? 51.572 26.186 22.612 1.00 50.42 ? 353  LYS A O     1 
ATOM   2044 C  CB    . LYS A 1 293 ? 49.783 23.286 22.369 1.00 52.34 ? 353  LYS A CB    1 
ATOM   2045 C  CG    . LYS A 1 293 ? 50.994 23.026 21.499 1.00 58.13 ? 353  LYS A CG    1 
ATOM   2046 C  CD    . LYS A 1 293 ? 50.788 21.816 20.582 1.00 62.80 ? 353  LYS A CD    1 
ATOM   2047 C  CE    . LYS A 1 293 ? 51.775 21.838 19.403 1.00 64.44 ? 353  LYS A CE    1 
ATOM   2048 N  NZ    . LYS A 1 293 ? 51.601 23.059 18.537 1.00 64.03 ? 353  LYS A NZ    1 
ATOM   2049 N  N     . GLN A 1 294 ? 49.784 26.117 21.242 1.00 50.70 ? 354  GLN A N     1 
ATOM   2050 C  CA    . GLN A 1 294 ? 50.301 27.166 20.361 1.00 51.43 ? 354  GLN A CA    1 
ATOM   2051 C  C     . GLN A 1 294 ? 50.500 28.527 21.045 1.00 52.50 ? 354  GLN A C     1 
ATOM   2052 O  O     . GLN A 1 294 ? 51.564 29.146 20.917 1.00 52.52 ? 354  GLN A O     1 
ATOM   2053 C  CB    . GLN A 1 294 ? 49.386 27.318 19.136 1.00 49.34 ? 354  GLN A CB    1 
ATOM   2054 C  CG    . GLN A 1 294 ? 49.383 26.087 18.240 1.00 49.90 ? 354  GLN A CG    1 
ATOM   2055 C  CD    . GLN A 1 294 ? 48.372 26.172 17.112 1.00 51.85 ? 354  GLN A CD    1 
ATOM   2056 O  OE1   . GLN A 1 294 ? 48.314 25.295 16.248 1.00 53.87 ? 354  GLN A OE1   1 
ATOM   2057 N  NE2   . GLN A 1 294 ? 47.566 27.225 17.116 1.00 52.14 ? 354  GLN A NE2   1 
ATOM   2058 N  N     . LEU A 1 295 ? 49.491 28.991 21.776 1.00 51.78 ? 355  LEU A N     1 
ATOM   2059 C  CA    . LEU A 1 295 ? 49.588 30.284 22.453 1.00 51.51 ? 355  LEU A CA    1 
ATOM   2060 C  C     . LEU A 1 295 ? 50.716 30.285 23.486 1.00 51.73 ? 355  LEU A C     1 
ATOM   2061 O  O     . LEU A 1 295 ? 51.329 31.315 23.768 1.00 50.34 ? 355  LEU A O     1 
ATOM   2062 C  CB    . LEU A 1 295 ? 48.268 30.618 23.155 1.00 50.67 ? 355  LEU A CB    1 
ATOM   2063 C  CG    . LEU A 1 295 ? 47.001 30.709 22.302 1.00 51.56 ? 355  LEU A CG    1 
ATOM   2064 C  CD1   . LEU A 1 295 ? 45.807 30.801 23.221 1.00 51.42 ? 355  LEU A CD1   1 
ATOM   2065 C  CD2   . LEU A 1 295 ? 47.063 31.911 21.369 1.00 50.14 ? 355  LEU A CD2   1 
ATOM   2066 N  N     . MET A 1 296 ? 50.978 29.120 24.057 1.00 52.25 ? 356  MET A N     1 
ATOM   2067 C  CA    . MET A 1 296 ? 52.014 29.008 25.061 1.00 54.14 ? 356  MET A CA    1 
ATOM   2068 C  C     . MET A 1 296 ? 53.387 29.410 24.488 1.00 54.66 ? 356  MET A C     1 
ATOM   2069 O  O     . MET A 1 296 ? 54.219 29.982 25.191 1.00 55.86 ? 356  MET A O     1 
ATOM   2070 C  CB    . MET A 1 296 ? 52.043 27.575 25.596 1.00 55.04 ? 356  MET A CB    1 
ATOM   2071 C  CG    . MET A 1 296 ? 52.937 27.369 26.787 1.00 58.03 ? 356  MET A CG    1 
ATOM   2072 S  SD    . MET A 1 296 ? 52.429 28.316 28.237 1.00 64.51 ? 356  MET A SD    1 
ATOM   2073 C  CE    . MET A 1 296 ? 51.428 27.073 29.144 1.00 61.71 ? 356  MET A CE    1 
ATOM   2074 N  N     . VAL A 1 297 ? 53.610 29.137 23.207 1.00 52.28 ? 357  VAL A N     1 
ATOM   2075 C  CA    . VAL A 1 297 ? 54.879 29.468 22.574 1.00 50.88 ? 357  VAL A CA    1 
ATOM   2076 C  C     . VAL A 1 297 ? 54.753 30.586 21.543 1.00 52.27 ? 357  VAL A C     1 
ATOM   2077 O  O     . VAL A 1 297 ? 55.545 30.657 20.602 1.00 52.21 ? 357  VAL A O     1 
ATOM   2078 C  CB    . VAL A 1 297 ? 55.470 28.237 21.869 1.00 50.06 ? 357  VAL A CB    1 
ATOM   2079 C  CG1   . VAL A 1 297 ? 55.650 27.103 22.873 1.00 47.32 ? 357  VAL A CG1   1 
ATOM   2080 C  CG2   . VAL A 1 297 ? 54.554 27.812 20.732 1.00 45.56 ? 357  VAL A CG2   1 
ATOM   2081 N  N     . HIS A 1 298 ? 53.757 31.450 21.720 1.00 52.12 ? 358  HIS A N     1 
ATOM   2082 C  CA    . HIS A 1 298 ? 53.511 32.565 20.803 1.00 51.54 ? 358  HIS A CA    1 
ATOM   2083 C  C     . HIS A 1 298 ? 54.421 33.748 21.133 1.00 52.27 ? 358  HIS A C     1 
ATOM   2084 O  O     . HIS A 1 298 ? 54.748 33.990 22.299 1.00 52.78 ? 358  HIS A O     1 
ATOM   2085 C  CB    . HIS A 1 298 ? 52.028 32.975 20.883 1.00 51.15 ? 358  HIS A CB    1 
ATOM   2086 C  CG    . HIS A 1 298 ? 51.640 34.084 19.949 1.00 48.29 ? 358  HIS A CG    1 
ATOM   2087 N  ND1   . HIS A 1 298 ? 51.968 35.406 20.176 1.00 46.98 ? 358  HIS A ND1   1 
ATOM   2088 C  CD2   . HIS A 1 298 ? 50.943 34.065 18.787 1.00 46.54 ? 358  HIS A CD2   1 
ATOM   2089 C  CE1   . HIS A 1 298 ? 51.489 36.151 19.195 1.00 46.54 ? 358  HIS A CE1   1 
ATOM   2090 N  NE2   . HIS A 1 298 ? 50.864 35.361 18.338 1.00 44.82 ? 358  HIS A NE2   1 
ATOM   2091 N  N     . ALA A 1 299 ? 54.825 34.486 20.104 1.00 51.42 ? 359  ALA A N     1 
ATOM   2092 C  CA    . ALA A 1 299 ? 55.724 35.625 20.283 1.00 52.52 ? 359  ALA A CA    1 
ATOM   2093 C  C     . ALA A 1 299 ? 55.380 36.534 21.456 1.00 53.24 ? 359  ALA A C     1 
ATOM   2094 O  O     . ALA A 1 299 ? 56.273 36.922 22.219 1.00 54.67 ? 359  ALA A O     1 
ATOM   2095 C  CB    . ALA A 1 299 ? 55.791 36.439 19.001 1.00 53.45 ? 359  ALA A CB    1 
ATOM   2096 N  N     . PHE A 1 300 ? 54.095 36.867 21.599 1.00 52.20 ? 360  PHE A N     1 
ATOM   2097 C  CA    . PHE A 1 300 ? 53.628 37.744 22.678 1.00 51.54 ? 360  PHE A CA    1 
ATOM   2098 C  C     . PHE A 1 300 ? 53.904 37.184 24.078 1.00 51.38 ? 360  PHE A C     1 
ATOM   2099 O  O     . PHE A 1 300 ? 54.227 37.935 25.009 1.00 51.44 ? 360  PHE A O     1 
ATOM   2100 C  CB    . PHE A 1 300 ? 52.123 38.041 22.516 1.00 52.17 ? 360  PHE A CB    1 
ATOM   2101 C  CG    . PHE A 1 300 ? 51.535 38.841 23.652 1.00 51.73 ? 360  PHE A CG    1 
ATOM   2102 C  CD1   . PHE A 1 300 ? 50.838 38.215 24.673 1.00 52.53 ? 360  PHE A CD1   1 
ATOM   2103 C  CD2   . PHE A 1 300 ? 51.722 40.212 23.722 1.00 52.71 ? 360  PHE A CD2   1 
ATOM   2104 C  CE1   . PHE A 1 300 ? 50.347 38.940 25.749 1.00 54.24 ? 360  PHE A CE1   1 
ATOM   2105 C  CE2   . PHE A 1 300 ? 51.235 40.946 24.794 1.00 53.22 ? 360  PHE A CE2   1 
ATOM   2106 C  CZ    . PHE A 1 300 ? 50.544 40.309 25.809 1.00 54.34 ? 360  PHE A CZ    1 
ATOM   2107 N  N     . ILE A 1 301 ? 53.781 35.868 24.222 1.00 50.88 ? 361  ILE A N     1 
ATOM   2108 C  CA    . ILE A 1 301 ? 54.014 35.211 25.506 1.00 50.80 ? 361  ILE A CA    1 
ATOM   2109 C  C     . ILE A 1 301 ? 55.521 35.127 25.768 1.00 52.01 ? 361  ILE A C     1 
ATOM   2110 O  O     . ILE A 1 301 ? 55.985 35.477 26.852 1.00 51.86 ? 361  ILE A O     1 
ATOM   2111 C  CB    . ILE A 1 301 ? 53.389 33.776 25.526 1.00 49.52 ? 361  ILE A CB    1 
ATOM   2112 C  CG1   . ILE A 1 301 ? 51.889 33.851 25.195 1.00 50.41 ? 361  ILE A CG1   1 
ATOM   2113 C  CG2   . ILE A 1 301 ? 53.579 33.135 26.892 1.00 45.28 ? 361  ILE A CG2   1 
ATOM   2114 C  CD1   . ILE A 1 301 ? 51.041 34.607 26.227 1.00 48.74 ? 361  ILE A CD1   1 
ATOM   2115 N  N     . LYS A 1 302 ? 56.279 34.661 24.774 1.00 53.11 ? 362  LYS A N     1 
ATOM   2116 C  CA    . LYS A 1 302 ? 57.730 34.563 24.907 1.00 54.27 ? 362  LYS A CA    1 
ATOM   2117 C  C     . LYS A 1 302 ? 58.254 35.938 25.326 1.00 54.53 ? 362  LYS A C     1 
ATOM   2118 O  O     . LYS A 1 302 ? 59.017 36.064 26.288 1.00 53.06 ? 362  LYS A O     1 
ATOM   2119 C  CB    . LYS A 1 302 ? 58.355 34.127 23.579 1.00 55.24 ? 362  LYS A CB    1 
ATOM   2120 C  CG    . LYS A 1 302 ? 57.988 32.697 23.143 1.00 59.69 ? 362  LYS A CG    1 
ATOM   2121 C  CD    . LYS A 1 302 ? 58.473 32.404 21.713 1.00 62.00 ? 362  LYS A CD    1 
ATOM   2122 C  CE    . LYS A 1 302 ? 59.983 32.625 21.597 1.00 67.77 ? 362  LYS A CE    1 
ATOM   2123 N  NZ    . LYS A 1 302 ? 60.474 32.996 20.229 1.00 68.29 ? 362  LYS A NZ    1 
ATOM   2124 N  N     . ARG A 1 303 ? 57.814 36.974 24.621 1.00 54.99 ? 363  ARG A N     1 
ATOM   2125 C  CA    . ARG A 1 303 ? 58.243 38.320 24.951 1.00 56.42 ? 363  ARG A CA    1 
ATOM   2126 C  C     . ARG A 1 303 ? 57.826 38.691 26.374 1.00 57.49 ? 363  ARG A C     1 
ATOM   2127 O  O     . ARG A 1 303 ? 58.661 39.127 27.168 1.00 59.47 ? 363  ARG A O     1 
ATOM   2128 C  CB    . ARG A 1 303 ? 57.662 39.336 23.963 1.00 58.23 ? 363  ARG A CB    1 
ATOM   2129 C  CG    . ARG A 1 303 ? 58.300 40.729 24.057 1.00 58.71 ? 363  ARG A CG    1 
ATOM   2130 C  CD    . ARG A 1 303 ? 57.421 41.800 23.414 1.00 59.45 ? 363  ARG A CD    1 
ATOM   2131 N  NE    . ARG A 1 303 ? 56.317 42.186 24.294 1.00 60.09 ? 363  ARG A NE    1 
ATOM   2132 C  CZ    . ARG A 1 303 ? 55.188 42.761 23.886 1.00 59.62 ? 363  ARG A CZ    1 
ATOM   2133 N  NH1   . ARG A 1 303 ? 54.993 43.022 22.599 1.00 58.42 ? 363  ARG A NH1   1 
ATOM   2134 N  NH2   . ARG A 1 303 ? 54.251 43.077 24.770 1.00 57.60 ? 363  ARG A NH2   1 
ATOM   2135 N  N     . SER A 1 304 ? 56.548 38.514 26.714 1.00 56.96 ? 364  SER A N     1 
ATOM   2136 C  CA    . SER A 1 304 ? 56.078 38.860 28.065 1.00 57.04 ? 364  SER A CA    1 
ATOM   2137 C  C     . SER A 1 304 ? 56.776 38.033 29.145 1.00 56.28 ? 364  SER A C     1 
ATOM   2138 O  O     . SER A 1 304 ? 57.027 38.507 30.259 1.00 56.39 ? 364  SER A O     1 
ATOM   2139 C  CB    . SER A 1 304 ? 54.559 38.661 28.177 1.00 56.50 ? 364  SER A CB    1 
ATOM   2140 O  OG    . SER A 1 304 ? 53.882 39.372 27.155 1.00 56.33 ? 364  SER A OG    1 
ATOM   2141 N  N     . ASP A 1 305 ? 57.082 36.790 28.808 1.00 56.83 ? 365  ASP A N     1 
ATOM   2142 C  CA    . ASP A 1 305 ? 57.742 35.890 29.733 1.00 59.29 ? 365  ASP A CA    1 
ATOM   2143 C  C     . ASP A 1 305 ? 59.071 36.471 30.210 1.00 61.14 ? 365  ASP A C     1 
ATOM   2144 O  O     . ASP A 1 305 ? 59.371 36.474 31.412 1.00 60.08 ? 365  ASP A O     1 
ATOM   2145 C  CB    . ASP A 1 305 ? 57.988 34.552 29.049 1.00 60.32 ? 365  ASP A CB    1 
ATOM   2146 C  CG    . ASP A 1 305 ? 57.595 33.382 29.915 1.00 61.07 ? 365  ASP A CG    1 
ATOM   2147 O  OD1   . ASP A 1 305 ? 57.580 33.541 31.159 1.00 61.43 ? 365  ASP A OD1   1 
ATOM   2148 O  OD2   . ASP A 1 305 ? 57.316 32.306 29.348 1.00 61.52 ? 365  ASP A OD2   1 
ATOM   2149 N  N     . ALA A 1 306 ? 59.862 36.964 29.257 1.00 62.39 ? 366  ALA A N     1 
ATOM   2150 C  CA    . ALA A 1 306 ? 61.163 37.549 29.565 1.00 64.15 ? 366  ALA A CA    1 
ATOM   2151 C  C     . ALA A 1 306 ? 61.066 38.891 30.291 1.00 65.77 ? 366  ALA A C     1 
ATOM   2152 O  O     . ALA A 1 306 ? 61.818 39.150 31.242 1.00 65.78 ? 366  ALA A O     1 
ATOM   2153 C  CB    . ALA A 1 306 ? 61.976 37.708 28.287 1.00 62.26 ? 366  ALA A CB    1 
ATOM   2154 N  N     . GLU A 1 307 ? 60.132 39.735 29.861 1.00 66.57 ? 367  GLU A N     1 
ATOM   2155 C  CA    . GLU A 1 307 ? 59.968 41.057 30.469 1.00 68.29 ? 367  GLU A CA    1 
ATOM   2156 C  C     . GLU A 1 307 ? 59.903 41.040 31.995 1.00 68.67 ? 367  GLU A C     1 
ATOM   2157 O  O     . GLU A 1 307 ? 59.336 40.130 32.599 1.00 69.05 ? 367  GLU A O     1 
ATOM   2158 C  CB    . GLU A 1 307 ? 58.725 41.753 29.908 1.00 68.28 ? 367  GLU A CB    1 
ATOM   2159 C  CG    . GLU A 1 307 ? 58.768 41.958 28.404 1.00 71.48 ? 367  GLU A CG    1 
ATOM   2160 C  CD    . GLU A 1 307 ? 57.473 42.535 27.855 1.00 74.36 ? 367  GLU A CD    1 
ATOM   2161 O  OE1   . GLU A 1 307 ? 56.392 42.082 28.295 1.00 74.27 ? 367  GLU A OE1   1 
ATOM   2162 O  OE2   . GLU A 1 307 ? 57.536 43.429 26.977 1.00 75.23 ? 367  GLU A OE2   1 
ATOM   2163 N  N     . GLU A 1 308 ? 60.512 42.053 32.606 1.00 69.83 ? 368  GLU A N     1 
ATOM   2164 C  CA    . GLU A 1 308 ? 60.536 42.203 34.057 1.00 70.42 ? 368  GLU A CA    1 
ATOM   2165 C  C     . GLU A 1 308 ? 59.452 43.218 34.414 1.00 69.30 ? 368  GLU A C     1 
ATOM   2166 O  O     . GLU A 1 308 ? 59.595 44.415 34.158 1.00 69.11 ? 368  GLU A O     1 
ATOM   2167 C  CB    . GLU A 1 308 ? 61.914 42.708 34.522 1.00 72.84 ? 368  GLU A CB    1 
ATOM   2168 C  CG    . GLU A 1 308 ? 63.094 41.781 34.173 1.00 76.67 ? 368  GLU A CG    1 
ATOM   2169 C  CD    . GLU A 1 308 ? 64.472 42.447 34.349 1.00 77.88 ? 368  GLU A CD    1 
ATOM   2170 O  OE1   . GLU A 1 308 ? 64.789 42.905 35.470 1.00 78.54 ? 368  GLU A OE1   1 
ATOM   2171 O  OE2   . GLU A 1 308 ? 65.238 42.506 33.362 1.00 78.16 ? 368  GLU A OE2   1 
ATOM   2172 N  N     . VAL A 1 309 ? 58.359 42.729 34.987 1.00 68.24 ? 369  VAL A N     1 
ATOM   2173 C  CA    . VAL A 1 309 ? 57.249 43.592 35.360 1.00 65.81 ? 369  VAL A CA    1 
ATOM   2174 C  C     . VAL A 1 309 ? 56.910 43.408 36.822 1.00 65.12 ? 369  VAL A C     1 
ATOM   2175 O  O     . VAL A 1 309 ? 56.864 42.285 37.322 1.00 65.47 ? 369  VAL A O     1 
ATOM   2176 C  CB    . VAL A 1 309 ? 55.992 43.262 34.550 1.00 65.01 ? 369  VAL A CB    1 
ATOM   2177 C  CG1   . VAL A 1 309 ? 54.911 44.277 34.850 1.00 65.12 ? 369  VAL A CG1   1 
ATOM   2178 C  CG2   . VAL A 1 309 ? 56.317 43.227 33.075 1.00 63.85 ? 369  VAL A CG2   1 
ATOM   2179 N  N     . ASP A 1 310 ? 56.668 44.515 37.510 1.00 64.40 ? 370  ASP A N     1 
ATOM   2180 C  CA    . ASP A 1 310 ? 56.317 44.454 38.918 1.00 64.05 ? 370  ASP A CA    1 
ATOM   2181 C  C     . ASP A 1 310 ? 54.799 44.573 39.063 1.00 63.06 ? 370  ASP A C     1 
ATOM   2182 O  O     . ASP A 1 310 ? 54.259 45.641 39.385 1.00 61.54 ? 370  ASP A O     1 
ATOM   2183 C  CB    . ASP A 1 310 ? 57.028 45.567 39.685 1.00 64.28 ? 370  ASP A CB    1 
ATOM   2184 C  CG    . ASP A 1 310 ? 56.775 45.495 41.174 1.00 66.96 ? 370  ASP A CG    1 
ATOM   2185 O  OD1   . ASP A 1 310 ? 56.593 44.366 41.689 1.00 67.53 ? 370  ASP A OD1   1 
ATOM   2186 O  OD2   . ASP A 1 310 ? 56.770 46.562 41.832 1.00 67.41 ? 370  ASP A OD2   1 
ATOM   2187 N  N     . PHE A 1 311 ? 54.124 43.457 38.802 1.00 61.25 ? 371  PHE A N     1 
ATOM   2188 C  CA    . PHE A 1 311 ? 52.674 43.389 38.884 1.00 59.87 ? 371  PHE A CA    1 
ATOM   2189 C  C     . PHE A 1 311 ? 52.170 43.831 40.255 1.00 58.43 ? 371  PHE A C     1 
ATOM   2190 O  O     . PHE A 1 311 ? 51.299 44.699 40.349 1.00 56.87 ? 371  PHE A O     1 
ATOM   2191 C  CB    . PHE A 1 311 ? 52.196 41.961 38.570 1.00 58.64 ? 371  PHE A CB    1 
ATOM   2192 C  CG    . PHE A 1 311 ? 50.704 41.804 38.614 1.00 57.24 ? 371  PHE A CG    1 
ATOM   2193 C  CD1   . PHE A 1 311 ? 50.076 41.328 39.750 1.00 56.19 ? 371  PHE A CD1   1 
ATOM   2194 C  CD2   . PHE A 1 311 ? 49.923 42.178 37.533 1.00 57.14 ? 371  PHE A CD2   1 
ATOM   2195 C  CE1   . PHE A 1 311 ? 48.696 41.246 39.815 1.00 55.06 ? 371  PHE A CE1   1 
ATOM   2196 C  CE2   . PHE A 1 311 ? 48.544 42.097 37.595 1.00 54.33 ? 371  PHE A CE2   1 
ATOM   2197 C  CZ    . PHE A 1 311 ? 47.934 41.627 38.734 1.00 54.91 ? 371  PHE A CZ    1 
ATOM   2198 N  N     . ALA A 1 312 ? 52.722 43.255 41.317 1.00 57.04 ? 372  ALA A N     1 
ATOM   2199 C  CA    . ALA A 1 312 ? 52.283 43.627 42.659 1.00 58.17 ? 372  ALA A CA    1 
ATOM   2200 C  C     . ALA A 1 312 ? 52.260 45.139 42.855 1.00 59.33 ? 372  ALA A C     1 
ATOM   2201 O  O     . ALA A 1 312 ? 51.265 45.698 43.322 1.00 59.89 ? 372  ALA A O     1 
ATOM   2202 C  CB    . ALA A 1 312 ? 53.175 42.989 43.700 1.00 57.05 ? 372  ALA A CB    1 
ATOM   2203 N  N     . GLY A 1 313 ? 53.358 45.796 42.490 1.00 60.71 ? 373  GLY A N     1 
ATOM   2204 C  CA    . GLY A 1 313 ? 53.437 47.237 42.642 1.00 60.90 ? 373  GLY A CA    1 
ATOM   2205 C  C     . GLY A 1 313 ? 52.340 47.957 41.887 1.00 62.28 ? 373  GLY A C     1 
ATOM   2206 O  O     . GLY A 1 313 ? 51.672 48.842 42.431 1.00 62.14 ? 373  GLY A O     1 
ATOM   2207 N  N     . TRP A 1 314 ? 52.152 47.578 40.626 1.00 62.27 ? 374  TRP A N     1 
ATOM   2208 C  CA    . TRP A 1 314 ? 51.129 48.196 39.792 1.00 62.69 ? 374  TRP A CA    1 
ATOM   2209 C  C     . TRP A 1 314 ? 49.731 47.963 40.361 1.00 63.00 ? 374  TRP A C     1 
ATOM   2210 O  O     . TRP A 1 314 ? 48.951 48.899 40.534 1.00 61.42 ? 374  TRP A O     1 
ATOM   2211 C  CB    . TRP A 1 314 ? 51.189 47.629 38.377 1.00 62.89 ? 374  TRP A CB    1 
ATOM   2212 C  CG    . TRP A 1 314 ? 50.113 48.163 37.499 1.00 64.75 ? 374  TRP A CG    1 
ATOM   2213 C  CD1   . TRP A 1 314 ? 50.118 49.343 36.818 1.00 64.64 ? 374  TRP A CD1   1 
ATOM   2214 C  CD2   . TRP A 1 314 ? 48.842 47.556 37.242 1.00 65.97 ? 374  TRP A CD2   1 
ATOM   2215 N  NE1   . TRP A 1 314 ? 48.932 49.509 36.151 1.00 65.28 ? 374  TRP A NE1   1 
ATOM   2216 C  CE2   . TRP A 1 314 ? 48.132 48.422 36.391 1.00 66.36 ? 374  TRP A CE2   1 
ATOM   2217 C  CE3   . TRP A 1 314 ? 48.239 46.358 37.643 1.00 66.74 ? 374  TRP A CE3   1 
ATOM   2218 C  CZ2   . TRP A 1 314 ? 46.841 48.135 35.943 1.00 65.91 ? 374  TRP A CZ2   1 
ATOM   2219 C  CZ3   . TRP A 1 314 ? 46.957 46.077 37.195 1.00 65.18 ? 374  TRP A CZ3   1 
ATOM   2220 C  CH2   . TRP A 1 314 ? 46.278 46.958 36.352 1.00 65.61 ? 374  TRP A CH2   1 
ATOM   2221 N  N     . LEU A 1 315 ? 49.429 46.701 40.640 1.00 63.21 ? 375  LEU A N     1 
ATOM   2222 C  CA    . LEU A 1 315 ? 48.136 46.312 41.174 1.00 63.13 ? 375  LEU A CA    1 
ATOM   2223 C  C     . LEU A 1 315 ? 47.815 47.036 42.470 1.00 64.59 ? 375  LEU A C     1 
ATOM   2224 O  O     . LEU A 1 315 ? 46.681 47.473 42.687 1.00 64.01 ? 375  LEU A O     1 
ATOM   2225 C  CB    . LEU A 1 315 ? 48.106 44.793 41.398 1.00 61.91 ? 375  LEU A CB    1 
ATOM   2226 C  CG    . LEU A 1 315 ? 46.878 44.130 42.036 1.00 60.08 ? 375  LEU A CG    1 
ATOM   2227 C  CD1   . LEU A 1 315 ? 47.002 44.137 43.543 1.00 59.74 ? 375  LEU A CD1   1 
ATOM   2228 C  CD2   . LEU A 1 315 ? 45.608 44.846 41.586 1.00 60.03 ? 375  LEU A CD2   1 
ATOM   2229 N  N     . CYS A 1 316 ? 48.814 47.170 43.332 1.00 65.59 ? 376  CYS A N     1 
ATOM   2230 C  CA    . CYS A 1 316 ? 48.599 47.825 44.612 1.00 67.76 ? 376  CYS A CA    1 
ATOM   2231 C  C     . CYS A 1 316 ? 48.451 49.335 44.530 1.00 68.11 ? 376  CYS A C     1 
ATOM   2232 O  O     . CYS A 1 316 ? 47.654 49.917 45.261 1.00 68.63 ? 376  CYS A O     1 
ATOM   2233 C  CB    . CYS A 1 316 ? 49.725 47.462 45.577 1.00 69.07 ? 376  CYS A CB    1 
ATOM   2234 S  SG    . CYS A 1 316 ? 49.653 45.745 46.156 1.00 72.90 ? 376  CYS A SG    1 
ATOM   2235 N  N     . SER A 1 317 ? 49.205 49.973 43.640 1.00 69.05 ? 377  SER A N     1 
ATOM   2236 C  CA    . SER A 1 317 ? 49.122 51.422 43.508 1.00 69.38 ? 377  SER A CA    1 
ATOM   2237 C  C     . SER A 1 317 ? 47.832 51.841 42.792 1.00 69.69 ? 377  SER A C     1 
ATOM   2238 O  O     . SER A 1 317 ? 47.168 52.788 43.212 1.00 70.30 ? 377  SER A O     1 
ATOM   2239 C  CB    . SER A 1 317 ? 50.347 51.969 42.759 1.00 68.82 ? 377  SER A CB    1 
ATOM   2240 O  OG    . SER A 1 317 ? 50.224 51.801 41.357 1.00 70.11 ? 377  SER A OG    1 
ATOM   2241 N  N     . THR A 1 318 ? 47.475 51.132 41.722 1.00 69.48 ? 378  THR A N     1 
ATOM   2242 C  CA    . THR A 1 318 ? 46.261 51.442 40.966 1.00 69.99 ? 378  THR A CA    1 
ATOM   2243 C  C     . THR A 1 318 ? 44.975 51.287 41.792 1.00 69.99 ? 378  THR A C     1 
ATOM   2244 O  O     . THR A 1 318 ? 44.009 52.029 41.588 1.00 70.40 ? 378  THR A O     1 
ATOM   2245 C  CB    . THR A 1 318 ? 46.141 50.570 39.687 1.00 69.61 ? 378  THR A CB    1 
ATOM   2246 O  OG1   . THR A 1 318 ? 46.367 49.202 40.026 1.00 73.16 ? 378  THR A OG1   1 
ATOM   2247 C  CG2   . THR A 1 318 ? 47.153 51.000 38.633 1.00 69.64 ? 378  THR A CG2   1 
ATOM   2248 N  N     . ILE A 1 319 ? 44.954 50.341 42.728 1.00 69.01 ? 379  ILE A N     1 
ATOM   2249 C  CA    . ILE A 1 319 ? 43.759 50.146 43.550 1.00 68.83 ? 379  ILE A CA    1 
ATOM   2250 C  C     . ILE A 1 319 ? 43.991 50.565 44.994 1.00 69.54 ? 379  ILE A C     1 
ATOM   2251 O  O     . ILE A 1 319 ? 43.167 50.291 45.870 1.00 69.70 ? 379  ILE A O     1 
ATOM   2252 C  CB    . ILE A 1 319 ? 43.289 48.675 43.543 1.00 67.27 ? 379  ILE A CB    1 
ATOM   2253 C  CG1   . ILE A 1 319 ? 44.043 47.866 44.602 1.00 66.61 ? 379  ILE A CG1   1 
ATOM   2254 C  CG2   . ILE A 1 319 ? 43.510 48.078 42.167 1.00 66.32 ? 379  ILE A CG2   1 
ATOM   2255 C  CD1   . ILE A 1 319 ? 43.587 46.418 44.714 1.00 64.57 ? 379  ILE A CD1   1 
ATOM   2256 N  N     . GLY A 1 320 ? 45.120 51.228 45.232 1.00 69.92 ? 380  GLY A N     1 
ATOM   2257 C  CA    . GLY A 1 320 ? 45.454 51.688 46.568 1.00 70.45 ? 380  GLY A CA    1 
ATOM   2258 C  C     . GLY A 1 320 ? 45.334 50.607 47.625 1.00 71.03 ? 380  GLY A C     1 
ATOM   2259 O  O     . GLY A 1 320 ? 44.434 50.648 48.465 1.00 70.00 ? 380  GLY A O     1 
ATOM   2260 N  N     . LEU A 1 321 ? 46.254 49.646 47.594 1.00 72.42 ? 381  LEU A N     1 
ATOM   2261 C  CA    . LEU A 1 321 ? 46.245 48.542 48.546 1.00 74.72 ? 381  LEU A CA    1 
ATOM   2262 C  C     . LEU A 1 321 ? 47.485 48.549 49.447 1.00 76.80 ? 381  LEU A C     1 
ATOM   2263 O  O     . LEU A 1 321 ? 47.384 48.792 50.653 1.00 77.09 ? 381  LEU A O     1 
ATOM   2264 C  CB    . LEU A 1 321 ? 46.169 47.213 47.790 1.00 73.42 ? 381  LEU A CB    1 
ATOM   2265 C  CG    . LEU A 1 321 ? 45.320 46.124 48.442 1.00 72.58 ? 381  LEU A CG    1 
ATOM   2266 C  CD1   . LEU A 1 321 ? 45.521 44.814 47.687 1.00 73.12 ? 381  LEU A CD1   1 
ATOM   2267 C  CD2   . LEU A 1 321 ? 45.708 45.972 49.903 1.00 71.44 ? 381  LEU A CD2   1 
ATOM   2268 N  N     . ASN A 1 322 ? 48.647 48.272 48.855 1.00 78.84 ? 382  ASN A N     1 
ATOM   2269 C  CA    . ASN A 1 322 ? 49.921 48.240 49.586 1.00 80.65 ? 382  ASN A CA    1 
ATOM   2270 C  C     . ASN A 1 322 ? 50.336 49.654 50.013 1.00 81.21 ? 382  ASN A C     1 
ATOM   2271 O  O     . ASN A 1 322 ? 51.294 50.192 49.410 1.00 81.49 ? 382  ASN A O     1 
ATOM   2272 C  CB    . ASN A 1 322 ? 51.022 47.621 48.702 1.00 81.30 ? 382  ASN A CB    1 
ATOM   2273 C  CG    . ASN A 1 322 ? 51.713 46.424 49.358 1.00 82.24 ? 382  ASN A CG    1 
ATOM   2274 O  OD1   . ASN A 1 322 ? 51.053 45.506 49.856 1.00 83.03 ? 382  ASN A OD1   1 
ATOM   2275 N  ND2   . ASN A 1 322 ? 53.047 46.424 49.344 1.00 81.68 ? 382  ASN A ND2   1 
HETATM 2276 MG MG    . MG  B 2 .   ? 33.205 34.687 39.238 1.00 44.04 ? 500  MG  A MG    1 
HETATM 2277 P  PG    . ATP C 3 .   ? 28.949 36.182 37.391 1.00 50.63 ? 600  ATP A PG    1 
HETATM 2278 O  O1G   . ATP C 3 .   ? 27.666 36.892 37.038 1.00 52.32 ? 600  ATP A O1G   1 
HETATM 2279 O  O2G   . ATP C 3 .   ? 29.706 35.679 36.184 1.00 50.41 ? 600  ATP A O2G   1 
HETATM 2280 O  O3G   . ATP C 3 .   ? 28.701 35.124 38.405 1.00 43.75 ? 600  ATP A O3G   1 
HETATM 2281 P  PB    . ATP C 3 .   ? 30.990 37.222 39.137 1.00 43.56 ? 600  ATP A PB    1 
HETATM 2282 O  O1B   . ATP C 3 .   ? 32.012 36.255 38.645 1.00 44.90 ? 600  ATP A O1B   1 
HETATM 2283 O  O2B   . ATP C 3 .   ? 31.404 38.613 39.474 1.00 44.62 ? 600  ATP A O2B   1 
HETATM 2284 O  O3B   . ATP C 3 .   ? 29.822 37.368 38.059 1.00 48.99 ? 600  ATP A O3B   1 
HETATM 2285 P  PA    . ATP C 3 .   ? 30.865 35.739 41.589 1.00 44.26 ? 600  ATP A PA    1 
HETATM 2286 O  O1A   . ATP C 3 .   ? 29.753 35.355 42.528 1.00 43.06 ? 600  ATP A O1A   1 
HETATM 2287 O  O2A   . ATP C 3 .   ? 31.701 34.635 41.001 1.00 42.94 ? 600  ATP A O2A   1 
HETATM 2288 O  O3A   . ATP C 3 .   ? 30.219 36.603 40.397 1.00 43.72 ? 600  ATP A O3A   1 
HETATM 2289 O  "O5'" . ATP C 3 .   ? 31.818 36.749 42.382 1.00 42.41 ? 600  ATP A "O5'" 1 
HETATM 2290 C  "C5'" . ATP C 3 .   ? 31.389 38.050 42.778 1.00 43.01 ? 600  ATP A "C5'" 1 
HETATM 2291 C  "C4'" . ATP C 3 .   ? 32.578 38.950 43.133 1.00 45.58 ? 600  ATP A "C4'" 1 
HETATM 2292 O  "O4'" . ATP C 3 .   ? 33.199 38.459 44.333 1.00 45.15 ? 600  ATP A "O4'" 1 
HETATM 2293 C  "C3'" . ATP C 3 .   ? 33.698 38.995 42.077 1.00 46.92 ? 600  ATP A "C3'" 1 
HETATM 2294 O  "O3'" . ATP C 3 .   ? 33.551 40.055 41.115 1.00 47.52 ? 600  ATP A "O3'" 1 
HETATM 2295 C  "C2'" . ATP C 3 .   ? 34.976 39.093 42.890 1.00 46.26 ? 600  ATP A "C2'" 1 
HETATM 2296 O  "O2'" . ATP C 3 .   ? 35.488 40.415 42.901 1.00 49.07 ? 600  ATP A "O2'" 1 
HETATM 2297 C  "C1'" . ATP C 3 .   ? 34.622 38.636 44.291 1.00 44.34 ? 600  ATP A "C1'" 1 
HETATM 2298 N  N9    . ATP C 3 .   ? 35.311 37.353 44.625 1.00 42.79 ? 600  ATP A N9    1 
HETATM 2299 C  C8    . ATP C 3 .   ? 34.946 36.117 44.221 1.00 43.68 ? 600  ATP A C8    1 
HETATM 2300 N  N7    . ATP C 3 .   ? 35.798 35.182 44.700 1.00 43.49 ? 600  ATP A N7    1 
HETATM 2301 C  C5    . ATP C 3 .   ? 36.730 35.798 45.418 1.00 42.47 ? 600  ATP A C5    1 
HETATM 2302 C  C6    . ATP C 3 .   ? 37.947 35.403 46.208 1.00 43.36 ? 600  ATP A C6    1 
HETATM 2303 N  N6    . ATP C 3 .   ? 38.323 34.098 46.314 1.00 37.64 ? 600  ATP A N6    1 
HETATM 2304 N  N1    . ATP C 3 .   ? 38.662 36.390 46.818 1.00 40.51 ? 600  ATP A N1    1 
HETATM 2305 C  C2    . ATP C 3 .   ? 38.324 37.698 46.738 1.00 39.16 ? 600  ATP A C2    1 
HETATM 2306 N  N3    . ATP C 3 .   ? 37.232 38.111 46.040 1.00 44.29 ? 600  ATP A N3    1 
HETATM 2307 C  C4    . ATP C 3 .   ? 36.422 37.241 45.369 1.00 43.02 ? 600  ATP A C4    1 
HETATM 2308 C  C1    . VRA D 4 .   ? 34.340 28.455 42.853 1.00 42.33 ? 1001 VRA A C1    1 
HETATM 2309 C  C2    . VRA D 4 .   ? 33.964 27.619 41.701 1.00 41.89 ? 1001 VRA A C2    1 
HETATM 2310 C  C3    . VRA D 4 .   ? 35.017 26.780 41.033 1.00 40.37 ? 1001 VRA A C3    1 
HETATM 2311 C  C4    . VRA D 4 .   ? 36.314 26.747 41.472 1.00 42.10 ? 1001 VRA A C4    1 
HETATM 2312 C  C5    . VRA D 4 .   ? 36.682 27.586 42.623 1.00 43.07 ? 1001 VRA A C5    1 
HETATM 2313 C  C6    . VRA D 4 .   ? 35.701 28.417 43.312 1.00 43.16 ? 1001 VRA A C6    1 
HETATM 2314 N  N7    . VRA D 4 .   ? 32.569 27.713 41.286 1.00 39.38 ? 1001 VRA A N7    1 
HETATM 2315 C  C8    . VRA D 4 .   ? 31.918 26.820 40.334 1.00 40.55 ? 1001 VRA A C8    1 
HETATM 2316 C  C9    . VRA D 4 .   ? 31.168 27.414 39.235 1.00 39.34 ? 1001 VRA A C9    1 
HETATM 2317 C  C10   . VRA D 4 .   ? 30.501 26.555 38.280 1.00 41.36 ? 1001 VRA A C10   1 
HETATM 2318 C  C11   . VRA D 4 .   ? 30.593 25.110 38.411 1.00 42.49 ? 1001 VRA A C11   1 
HETATM 2319 C  C12   . VRA D 4 .   ? 31.347 24.532 39.503 1.00 42.63 ? 1001 VRA A C12   1 
HETATM 2320 C  C13   . VRA D 4 .   ? 31.998 25.366 40.452 1.00 41.71 ? 1001 VRA A C13   1 
HETATM 2321 I  I14   . VRA D 4 .   ? 38.722 27.571 43.310 1.00 55.61 ? 1001 VRA A I14   1 
HETATM 2322 F  F15   . VRA D 4 .   ? 33.418 29.241 43.482 1.00 43.77 ? 1001 VRA A F15   1 
HETATM 2323 F  F16   . VRA D 4 .   ? 32.703 24.762 41.479 1.00 40.99 ? 1001 VRA A F16   1 
HETATM 2324 F  F17   . VRA D 4 .   ? 31.441 23.171 39.625 1.00 46.59 ? 1001 VRA A F17   1 
HETATM 2325 N  N18   . VRA D 4 .   ? 31.076 28.842 39.055 1.00 37.40 ? 1001 VRA A N18   1 
HETATM 2326 S  S19   . VRA D 4 .   ? 30.193 29.839 39.981 1.00 37.81 ? 1001 VRA A S19   1 
HETATM 2327 O  O20   . VRA D 4 .   ? 30.630 31.332 39.660 1.00 35.24 ? 1001 VRA A O20   1 
HETATM 2328 O  O21   . VRA D 4 .   ? 30.453 29.545 41.498 1.00 37.26 ? 1001 VRA A O21   1 
HETATM 2329 C  C22   . VRA D 4 .   ? 28.424 29.611 39.608 1.00 36.87 ? 1001 VRA A C22   1 
HETATM 2330 C  C23   . VRA D 4 .   ? 27.754 28.442 40.308 1.00 35.22 ? 1001 VRA A C23   1 
HETATM 2331 C  C24   . VRA D 4 .   ? 27.476 29.854 40.758 1.00 35.45 ? 1001 VRA A C24   1 
HETATM 2332 C  C25   . VRA D 4 .   ? 27.919 29.954 38.160 1.00 39.37 ? 1001 VRA A C25   1 
HETATM 2333 C  C26   . VRA D 4 .   ? 28.158 31.464 37.800 1.00 45.53 ? 1001 VRA A C26   1 
HETATM 2334 C  C27   . VRA D 4 .   ? 27.662 31.760 36.358 1.00 48.26 ? 1001 VRA A C27   1 
HETATM 2335 O  O28   . VRA D 4 .   ? 28.581 32.657 35.693 1.00 51.51 ? 1001 VRA A O28   1 
HETATM 2336 O  O29   . VRA D 4 .   ? 27.444 32.313 38.724 1.00 45.17 ? 1001 VRA A O29   1 
HETATM 2337 O  O30   . VRA D 4 .   ? 29.757 27.153 37.203 1.00 41.88 ? 1001 VRA A O30   1 
HETATM 2338 C  C31   . VRA D 4 .   ? 28.515 26.459 36.972 1.00 41.53 ? 1001 VRA A C31   1 
HETATM 2339 O  O     . HOH E 5 .   ? 31.267 33.792 38.409 1.00 32.08 ? 1002 HOH A O     1 
HETATM 2340 O  O     . HOH E 5 .   ? 34.342 35.244 40.760 1.00 32.08 ? 1003 HOH A O     1 
HETATM 2341 O  O     . HOH E 5 .   ? 29.360 34.998 28.953 1.00 41.27 ? 1004 HOH A O     1 
HETATM 2342 O  O     . HOH E 5 .   ? 34.745 24.089 60.379 1.00 34.68 ? 1005 HOH A O     1 
HETATM 2343 O  O     . HOH E 5 .   ? 34.788 19.838 51.616 1.00 38.59 ? 1006 HOH A O     1 
HETATM 2344 O  O     . HOH E 5 .   ? 33.903 39.910 33.849 1.00 36.77 ? 1007 HOH A O     1 
HETATM 2345 O  O     . HOH E 5 .   ? 43.895 42.623 17.274 1.00 42.21 ? 1008 HOH A O     1 
HETATM 2346 O  O     . HOH E 5 .   ? 33.302 30.422 25.471 1.00 31.32 ? 1009 HOH A O     1 
HETATM 2347 O  O     . HOH E 5 .   ? 35.333 30.306 28.872 1.00 35.72 ? 1010 HOH A O     1 
HETATM 2348 O  O     . HOH E 5 .   ? 45.080 28.360 64.561 1.00 30.72 ? 1011 HOH A O     1 
HETATM 2349 O  O     . HOH E 5 .   ? 26.052 26.972 52.892 1.00 36.93 ? 1012 HOH A O     1 
HETATM 2350 O  O     . HOH E 5 .   ? 29.053 36.032 61.126 1.00 41.00 ? 1013 HOH A O     1 
HETATM 2351 O  O     . HOH E 5 .   ? 34.617 33.208 42.846 1.00 41.09 ? 1014 HOH A O     1 
HETATM 2352 O  O     . HOH E 5 .   ? 45.453 37.984 49.248 1.00 36.80 ? 1015 HOH A O     1 
HETATM 2353 O  O     . HOH E 5 .   ? 18.886 19.998 51.577 1.00 46.89 ? 1016 HOH A O     1 
HETATM 2354 O  O     . HOH E 5 .   ? 40.418 17.910 56.493 1.00 46.45 ? 1017 HOH A O     1 
HETATM 2355 O  O     . HOH E 5 .   ? 56.058 39.260 32.957 1.00 51.34 ? 1018 HOH A O     1 
HETATM 2356 O  O     . HOH E 5 .   ? 50.184 33.573 39.057 1.00 46.54 ? 1019 HOH A O     1 
HETATM 2357 O  O     . HOH E 5 .   ? 40.701 25.356 29.225 1.00 42.27 ? 1020 HOH A O     1 
HETATM 2358 O  O     . HOH E 5 .   ? 31.591 36.200 23.161 1.00 38.23 ? 1021 HOH A O     1 
HETATM 2359 O  O     . HOH E 5 .   ? 31.352 29.741 36.422 1.00 28.87 ? 1022 HOH A O     1 
HETATM 2360 O  O     . HOH E 5 .   ? 54.242 34.434 17.726 1.00 38.43 ? 1023 HOH A O     1 
HETATM 2361 O  O     . HOH E 5 .   ? 50.331 24.775 34.013 1.00 37.58 ? 1024 HOH A O     1 
HETATM 2362 O  O     . HOH E 5 .   ? 55.619 27.890 36.327 1.00 54.98 ? 1025 HOH A O     1 
HETATM 2363 O  O     . HOH E 5 .   ? 54.616 40.940 30.291 1.00 42.55 ? 1026 HOH A O     1 
HETATM 2364 O  O     . HOH E 5 .   ? 39.651 15.800 38.344 1.00 48.48 ? 1027 HOH A O     1 
HETATM 2365 O  O     . HOH E 5 .   ? 47.932 22.740 17.970 1.00 44.10 ? 1028 HOH A O     1 
HETATM 2366 O  O     . HOH E 5 .   ? 22.966 32.807 45.323 1.00 38.31 ? 1029 HOH A O     1 
HETATM 2367 O  O     . HOH E 5 .   ? 36.738 41.026 45.578 1.00 47.85 ? 1030 HOH A O     1 
HETATM 2368 O  O     . HOH E 5 .   ? 31.068 57.122 19.130 1.00 59.17 ? 1031 HOH A O     1 
HETATM 2369 O  O     . HOH E 5 .   ? 16.591 42.328 24.534 1.00 43.67 ? 1032 HOH A O     1 
HETATM 2370 O  O     . HOH E 5 .   ? 52.046 35.801 35.055 1.00 37.57 ? 1033 HOH A O     1 
HETATM 2371 O  O     . HOH E 5 .   ? 34.917 20.005 61.724 1.00 34.07 ? 1034 HOH A O     1 
HETATM 2372 O  O     . HOH E 5 .   ? 28.731 38.121 31.484 1.00 49.55 ? 1035 HOH A O     1 
HETATM 2373 O  O     . HOH E 5 .   ? 30.153 44.667 53.378 1.00 63.11 ? 1036 HOH A O     1 
HETATM 2374 O  O     . HOH E 5 .   ? 31.208 18.682 53.011 1.00 50.74 ? 1037 HOH A O     1 
HETATM 2375 O  O     . HOH E 5 .   ? 26.169 22.395 26.757 1.00 52.39 ? 1038 HOH A O     1 
HETATM 2376 O  O     . HOH E 5 .   ? 25.706 25.960 33.525 1.00 51.51 ? 1039 HOH A O     1 
HETATM 2377 O  O     . HOH E 5 .   ? 46.116 34.826 49.431 1.00 50.84 ? 1040 HOH A O     1 
HETATM 2378 O  O     . HOH E 5 .   ? 32.453 38.390 16.464 1.00 55.08 ? 1041 HOH A O     1 
HETATM 2379 O  O     . HOH E 5 .   ? 54.022 42.488 27.449 1.00 53.76 ? 1042 HOH A O     1 
HETATM 2380 O  O     . HOH E 5 .   ? 41.138 36.748 13.877 1.00 48.48 ? 1043 HOH A O     1 
HETATM 2381 O  O     . HOH E 5 .   ? 28.806 32.548 41.933 1.00 37.68 ? 1044 HOH A O     1 
HETATM 2382 O  O     . HOH E 5 .   ? 32.715 33.292 30.367 1.00 54.84 ? 1045 HOH A O     1 
HETATM 2383 O  O     . HOH E 5 .   ? 49.122 24.009 27.089 1.00 50.54 ? 1046 HOH A O     1 
HETATM 2384 O  O     . HOH E 5 .   ? 36.919 15.623 50.541 1.00 60.53 ? 1047 HOH A O     1 
HETATM 2385 O  O     . HOH E 5 .   ? 43.066 32.664 52.141 1.00 46.19 ? 1048 HOH A O     1 
HETATM 2386 O  O     . HOH E 5 .   ? 20.651 40.629 12.826 1.00 46.72 ? 1049 HOH A O     1 
HETATM 2387 O  O     . HOH E 5 .   ? 42.990 24.942 24.026 1.00 40.72 ? 1050 HOH A O     1 
HETATM 2388 O  O     . HOH E 5 .   ? 37.158 34.884 64.390 1.00 51.21 ? 1051 HOH A O     1 
HETATM 2389 O  O     . HOH E 5 .   ? 19.451 48.457 20.453 1.00 51.73 ? 1052 HOH A O     1 
HETATM 2390 O  O     . HOH E 5 .   ? 46.713 22.981 23.248 1.00 37.40 ? 1053 HOH A O     1 
HETATM 2391 O  O     . HOH E 5 .   ? 48.619 38.444 49.141 1.00 52.89 ? 1054 HOH A O     1 
HETATM 2392 O  O     . HOH E 5 .   ? 43.675 42.858 13.079 1.00 60.73 ? 1055 HOH A O     1 
HETATM 2393 O  O     . HOH E 5 .   ? 32.234 27.126 34.824 1.00 49.17 ? 1056 HOH A O     1 
HETATM 2394 O  O     . HOH E 5 .   ? 37.588 41.353 12.898 1.00 53.13 ? 1057 HOH A O     1 
HETATM 2395 O  O     . HOH E 5 .   ? 40.165 45.043 43.586 1.00 55.13 ? 1058 HOH A O     1 
HETATM 2396 O  O     . HOH E 5 .   ? 57.822 30.570 31.368 1.00 58.09 ? 1059 HOH A O     1 
HETATM 2397 O  O     . HOH E 5 .   ? 29.407 31.667 12.597 1.00 48.17 ? 1060 HOH A O     1 
HETATM 2398 O  O     . HOH E 5 .   ? 45.302 26.146 43.800 1.00 39.12 ? 1061 HOH A O     1 
HETATM 2399 O  O     . HOH E 5 .   ? 22.832 28.129 16.033 1.00 42.69 ? 1062 HOH A O     1 
HETATM 2400 O  O     . HOH E 5 .   ? 39.133 54.966 36.752 1.00 53.70 ? 1063 HOH A O     1 
HETATM 2401 O  O     . HOH E 5 .   ? 39.253 42.148 49.658 1.00 48.58 ? 1064 HOH A O     1 
HETATM 2402 O  O     . HOH E 5 .   ? 41.340 22.808 54.103 1.00 50.28 ? 1065 HOH A O     1 
HETATM 2403 O  O     . HOH E 5 .   ? 27.882 34.841 40.631 1.00 48.87 ? 1066 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   61  61  MET MET A . n 
A 1 2   GLU 2   62  62  GLU GLU A . n 
A 1 3   LEU 3   63  63  LEU LEU A . n 
A 1 4   LYS 4   64  64  LYS LYS A . n 
A 1 5   ASP 5   65  65  ASP ASP A . n 
A 1 6   ASP 6   66  66  ASP ASP A . n 
A 1 7   ASP 7   67  67  ASP ASP A . n 
A 1 8   PHE 8   68  68  PHE PHE A . n 
A 1 9   GLU 9   69  69  GLU GLU A . n 
A 1 10  LYS 10  70  70  LYS LYS A . n 
A 1 11  ILE 11  71  71  ILE ILE A . n 
A 1 12  SER 12  72  72  SER SER A . n 
A 1 13  GLU 13  73  73  GLU GLU A . n 
A 1 14  LEU 14  74  74  LEU LEU A . n 
A 1 15  GLY 15  75  75  GLY GLY A . n 
A 1 16  ALA 16  76  76  ALA ALA A . n 
A 1 17  GLY 17  77  77  GLY GLY A . n 
A 1 18  ASN 18  78  78  ASN ASN A . n 
A 1 19  GLY 19  79  79  GLY GLY A . n 
A 1 20  GLY 20  80  80  GLY GLY A . n 
A 1 21  VAL 21  81  81  VAL VAL A . n 
A 1 22  VAL 22  82  82  VAL VAL A . n 
A 1 23  PHE 23  83  83  PHE PHE A . n 
A 1 24  LYS 24  84  84  LYS LYS A . n 
A 1 25  VAL 25  85  85  VAL VAL A . n 
A 1 26  SER 26  86  86  SER SER A . n 
A 1 27  HIS 27  87  87  HIS HIS A . n 
A 1 28  LYS 28  88  88  LYS LYS A . n 
A 1 29  PRO 29  89  89  PRO PRO A . n 
A 1 30  SER 30  90  90  SER SER A . n 
A 1 31  GLY 31  91  91  GLY GLY A . n 
A 1 32  LEU 32  92  92  LEU LEU A . n 
A 1 33  VAL 33  93  93  VAL VAL A . n 
A 1 34  MET 34  94  94  MET MET A . n 
A 1 35  ALA 35  95  95  ALA ALA A . n 
A 1 36  ARG 36  96  96  ARG ARG A . n 
A 1 37  LYS 37  97  97  LYS LYS A . n 
A 1 38  LEU 38  98  98  LEU LEU A . n 
A 1 39  ILE 39  99  99  ILE ILE A . n 
A 1 40  HIS 40  100 100 HIS HIS A . n 
A 1 41  LEU 41  101 101 LEU LEU A . n 
A 1 42  GLU 42  102 102 GLU GLU A . n 
A 1 43  ILE 43  103 103 ILE ILE A . n 
A 1 44  LYS 44  104 104 LYS LYS A . n 
A 1 45  PRO 45  105 105 PRO PRO A . n 
A 1 46  ALA 46  106 106 ALA ALA A . n 
A 1 47  ILE 47  107 107 ILE ILE A . n 
A 1 48  ARG 48  108 108 ARG ARG A . n 
A 1 49  ASN 49  109 109 ASN ASN A . n 
A 1 50  GLN 50  110 110 GLN GLN A . n 
A 1 51  ILE 51  111 111 ILE ILE A . n 
A 1 52  ILE 52  112 112 ILE ILE A . n 
A 1 53  ARG 53  113 113 ARG ARG A . n 
A 1 54  GLU 54  114 114 GLU GLU A . n 
A 1 55  LEU 55  115 115 LEU LEU A . n 
A 1 56  GLN 56  116 116 GLN GLN A . n 
A 1 57  VAL 57  117 117 VAL VAL A . n 
A 1 58  LEU 58  118 118 LEU LEU A . n 
A 1 59  HIS 59  119 119 HIS HIS A . n 
A 1 60  GLU 60  120 120 GLU GLU A . n 
A 1 61  CYS 61  121 121 CYS CYS A . n 
A 1 62  ASN 62  122 122 ASN ASN A . n 
A 1 63  SER 63  123 123 SER SER A . n 
A 1 64  PRO 64  124 124 PRO PRO A . n 
A 1 65  TYR 65  125 125 TYR TYR A . n 
A 1 66  ILE 66  126 126 ILE ILE A . n 
A 1 67  VAL 67  127 127 VAL VAL A . n 
A 1 68  GLY 68  128 128 GLY GLY A . n 
A 1 69  PHE 69  129 129 PHE PHE A . n 
A 1 70  TYR 70  130 130 TYR TYR A . n 
A 1 71  GLY 71  131 131 GLY GLY A . n 
A 1 72  ALA 72  132 132 ALA ALA A . n 
A 1 73  PHE 73  133 133 PHE PHE A . n 
A 1 74  TYR 74  134 134 TYR TYR A . n 
A 1 75  SER 75  135 135 SER SER A . n 
A 1 76  ASP 76  136 136 ASP ASP A . n 
A 1 77  GLY 77  137 137 GLY GLY A . n 
A 1 78  GLU 78  138 138 GLU GLU A . n 
A 1 79  ILE 79  139 139 ILE ILE A . n 
A 1 80  SER 80  140 140 SER SER A . n 
A 1 81  ILE 81  141 141 ILE ILE A . n 
A 1 82  CYS 82  142 142 CYS CYS A . n 
A 1 83  MET 83  143 143 MET MET A . n 
A 1 84  GLU 84  144 144 GLU GLU A . n 
A 1 85  HIS 85  145 145 HIS HIS A . n 
A 1 86  MET 86  146 146 MET MET A . n 
A 1 87  ASP 87  147 147 ASP ASP A . n 
A 1 88  GLY 88  148 148 GLY GLY A . n 
A 1 89  GLY 89  149 149 GLY GLY A . n 
A 1 90  SER 90  150 150 SER SER A . n 
A 1 91  LEU 91  151 151 LEU LEU A . n 
A 1 92  ASP 92  152 152 ASP ASP A . n 
A 1 93  GLN 93  153 153 GLN GLN A . n 
A 1 94  VAL 94  154 154 VAL VAL A . n 
A 1 95  LEU 95  155 155 LEU LEU A . n 
A 1 96  LYS 96  156 156 LYS LYS A . n 
A 1 97  LYS 97  157 157 LYS LYS A . n 
A 1 98  ALA 98  158 158 ALA ALA A . n 
A 1 99  GLY 99  159 159 GLY GLY A . n 
A 1 100 ARG 100 160 160 ARG ARG A . n 
A 1 101 ILE 101 161 161 ILE ILE A . n 
A 1 102 PRO 102 162 162 PRO PRO A . n 
A 1 103 GLU 103 163 163 GLU GLU A . n 
A 1 104 GLN 104 164 164 GLN GLN A . n 
A 1 105 ILE 105 165 165 ILE ILE A . n 
A 1 106 LEU 106 166 166 LEU LEU A . n 
A 1 107 GLY 107 167 167 GLY GLY A . n 
A 1 108 LYS 108 168 168 LYS LYS A . n 
A 1 109 VAL 109 169 169 VAL VAL A . n 
A 1 110 SER 110 170 170 SER SER A . n 
A 1 111 ILE 111 171 171 ILE ILE A . n 
A 1 112 ALA 112 172 172 ALA ALA A . n 
A 1 113 VAL 113 173 173 VAL VAL A . n 
A 1 114 ILE 114 174 174 ILE ILE A . n 
A 1 115 LYS 115 175 175 LYS LYS A . n 
A 1 116 GLY 116 176 176 GLY GLY A . n 
A 1 117 LEU 117 177 177 LEU LEU A . n 
A 1 118 THR 118 178 178 THR THR A . n 
A 1 119 TYR 119 179 179 TYR TYR A . n 
A 1 120 LEU 120 180 180 LEU LEU A . n 
A 1 121 ARG 121 181 181 ARG ARG A . n 
A 1 122 GLU 122 182 182 GLU GLU A . n 
A 1 123 LYS 123 183 183 LYS LYS A . n 
A 1 124 HIS 124 184 184 HIS HIS A . n 
A 1 125 LYS 125 185 185 LYS LYS A . n 
A 1 126 ILE 126 186 186 ILE ILE A . n 
A 1 127 MET 127 187 187 MET MET A . n 
A 1 128 HIS 128 188 188 HIS HIS A . n 
A 1 129 ARG 129 189 189 ARG ARG A . n 
A 1 130 ASP 130 190 190 ASP ASP A . n 
A 1 131 VAL 131 191 191 VAL VAL A . n 
A 1 132 LYS 132 192 192 LYS LYS A . n 
A 1 133 PRO 133 193 193 PRO PRO A . n 
A 1 134 SER 134 194 194 SER SER A . n 
A 1 135 ASN 135 195 195 ASN ASN A . n 
A 1 136 ILE 136 196 196 ILE ILE A . n 
A 1 137 LEU 137 197 197 LEU LEU A . n 
A 1 138 VAL 138 198 198 VAL VAL A . n 
A 1 139 ASN 139 199 199 ASN ASN A . n 
A 1 140 SER 140 200 200 SER SER A . n 
A 1 141 ARG 141 201 201 ARG ARG A . n 
A 1 142 GLY 142 202 202 GLY GLY A . n 
A 1 143 GLU 143 203 203 GLU GLU A . n 
A 1 144 ILE 144 204 204 ILE ILE A . n 
A 1 145 LYS 145 205 205 LYS LYS A . n 
A 1 146 LEU 146 206 206 LEU LEU A . n 
A 1 147 CYS 147 207 207 CYS CYS A . n 
A 1 148 ASP 148 208 208 ASP ASP A . n 
A 1 149 PHE 149 209 209 PHE PHE A . n 
A 1 150 GLY 150 210 210 GLY GLY A . n 
A 1 151 VAL 151 211 211 VAL VAL A . n 
A 1 152 SER 152 212 212 SER SER A . n 
A 1 153 GLY 153 213 213 GLY GLY A . n 
A 1 154 GLN 154 214 214 GLN GLN A . n 
A 1 155 LEU 155 215 215 LEU LEU A . n 
A 1 156 ILE 156 216 216 ILE ILE A . n 
A 1 157 ASP 157 217 217 ASP ASP A . n 
A 1 158 SER 158 218 218 SER SER A . n 
A 1 159 MET 159 219 219 MET MET A . n 
A 1 160 ALA 160 220 220 ALA ALA A . n 
A 1 161 ASN 161 221 221 ASN ASN A . n 
A 1 162 SER 162 222 222 SER SER A . n 
A 1 163 PHE 163 223 ?   ?   ?   A . n 
A 1 164 VAL 164 224 224 VAL VAL A . n 
A 1 165 GLY 165 225 225 GLY GLY A . n 
A 1 166 THR 166 226 226 THR THR A . n 
A 1 167 ARG 167 227 227 ARG ARG A . n 
A 1 168 SER 168 228 228 SER SER A . n 
A 1 169 TYR 169 229 229 TYR TYR A . n 
A 1 170 MET 170 230 230 MET MET A . n 
A 1 171 SER 171 231 231 SER SER A . n 
A 1 172 PRO 172 232 232 PRO PRO A . n 
A 1 173 GLU 173 233 233 GLU GLU A . n 
A 1 174 ARG 174 234 234 ARG ARG A . n 
A 1 175 LEU 175 235 235 LEU LEU A . n 
A 1 176 GLN 176 236 236 GLN GLN A . n 
A 1 177 GLY 177 237 237 GLY GLY A . n 
A 1 178 THR 178 238 238 THR THR A . n 
A 1 179 HIS 179 239 239 HIS HIS A . n 
A 1 180 TYR 180 240 240 TYR TYR A . n 
A 1 181 SER 181 241 241 SER SER A . n 
A 1 182 VAL 182 242 242 VAL VAL A . n 
A 1 183 GLN 183 243 243 GLN GLN A . n 
A 1 184 SER 184 244 244 SER SER A . n 
A 1 185 ASP 185 245 245 ASP ASP A . n 
A 1 186 ILE 186 246 246 ILE ILE A . n 
A 1 187 TRP 187 247 247 TRP TRP A . n 
A 1 188 SER 188 248 248 SER SER A . n 
A 1 189 MET 189 249 249 MET MET A . n 
A 1 190 GLY 190 250 250 GLY GLY A . n 
A 1 191 LEU 191 251 251 LEU LEU A . n 
A 1 192 SER 192 252 252 SER SER A . n 
A 1 193 LEU 193 253 253 LEU LEU A . n 
A 1 194 VAL 194 254 254 VAL VAL A . n 
A 1 195 GLU 195 255 255 GLU GLU A . n 
A 1 196 MET 196 256 256 MET MET A . n 
A 1 197 ALA 197 257 257 ALA ALA A . n 
A 1 198 VAL 198 258 258 VAL VAL A . n 
A 1 199 GLY 199 259 259 GLY GLY A . n 
A 1 200 ARG 200 260 260 ARG ARG A . n 
A 1 201 TYR 201 261 261 TYR TYR A . n 
A 1 202 PRO 202 262 262 PRO PRO A . n 
A 1 203 ILE 203 263 263 ILE ILE A . n 
A 1 204 PRO 204 264 264 PRO PRO A . n 
A 1 205 PRO 205 265 265 PRO PRO A . n 
A 1 206 PRO 206 266 266 PRO PRO A . n 
A 1 207 ASP 207 267 267 ASP ASP A . n 
A 1 208 ALA 208 268 268 ALA ALA A . n 
A 1 209 LYS 209 269 269 LYS LYS A . n 
A 1 210 GLU 210 270 270 GLU GLU A . n 
A 1 211 LEU 211 271 271 LEU LEU A . n 
A 1 212 GLU 212 272 272 GLU GLU A . n 
A 1 213 LEU 213 273 273 LEU LEU A . n 
A 1 214 MET 214 274 274 MET MET A . n 
A 1 215 PHE 215 275 275 PHE PHE A . n 
A 1 216 GLY 216 276 ?   ?   ?   A . n 
A 1 217 CYS 217 277 ?   ?   ?   A . n 
A 1 218 GLN 218 278 ?   ?   ?   A . n 
A 1 219 VAL 219 279 ?   ?   ?   A . n 
A 1 220 GLU 220 280 ?   ?   ?   A . n 
A 1 221 GLY 221 281 ?   ?   ?   A . n 
A 1 222 ASP 222 282 ?   ?   ?   A . n 
A 1 223 ALA 223 283 ?   ?   ?   A . n 
A 1 224 ALA 224 284 ?   ?   ?   A . n 
A 1 225 GLU 225 285 ?   ?   ?   A . n 
A 1 226 THR 226 286 ?   ?   ?   A . n 
A 1 227 PRO 227 287 ?   ?   ?   A . n 
A 1 228 PRO 228 288 ?   ?   ?   A . n 
A 1 229 ARG 229 289 ?   ?   ?   A . n 
A 1 230 PRO 230 290 ?   ?   ?   A . n 
A 1 231 ARG 231 291 ?   ?   ?   A . n 
A 1 232 THR 232 292 ?   ?   ?   A . n 
A 1 233 PRO 233 293 ?   ?   ?   A . n 
A 1 234 GLY 234 294 ?   ?   ?   A . n 
A 1 235 ARG 235 295 ?   ?   ?   A . n 
A 1 236 PRO 236 296 ?   ?   ?   A . n 
A 1 237 LEU 237 297 ?   ?   ?   A . n 
A 1 238 SER 238 298 ?   ?   ?   A . n 
A 1 239 SER 239 299 ?   ?   ?   A . n 
A 1 240 TYR 240 300 ?   ?   ?   A . n 
A 1 241 GLY 241 301 ?   ?   ?   A . n 
A 1 242 MET 242 302 ?   ?   ?   A . n 
A 1 243 ASP 243 303 ?   ?   ?   A . n 
A 1 244 SER 244 304 ?   ?   ?   A . n 
A 1 245 ARG 245 305 ?   ?   ?   A . n 
A 1 246 PRO 246 306 306 PRO PRO A . n 
A 1 247 PRO 247 307 307 PRO PRO A . n 
A 1 248 MET 248 308 308 MET MET A . n 
A 1 249 ALA 249 309 309 ALA ALA A . n 
A 1 250 ILE 250 310 310 ILE ILE A . n 
A 1 251 PHE 251 311 311 PHE PHE A . n 
A 1 252 GLU 252 312 312 GLU GLU A . n 
A 1 253 LEU 253 313 313 LEU LEU A . n 
A 1 254 LEU 254 314 314 LEU LEU A . n 
A 1 255 ASP 255 315 315 ASP ASP A . n 
A 1 256 TYR 256 316 316 TYR TYR A . n 
A 1 257 ILE 257 317 317 ILE ILE A . n 
A 1 258 VAL 258 318 318 VAL VAL A . n 
A 1 259 ASN 259 319 319 ASN ASN A . n 
A 1 260 GLU 260 320 320 GLU GLU A . n 
A 1 261 PRO 261 321 321 PRO PRO A . n 
A 1 262 PRO 262 322 322 PRO PRO A . n 
A 1 263 PRO 263 323 323 PRO PRO A . n 
A 1 264 LYS 264 324 324 LYS LYS A . n 
A 1 265 LEU 265 325 325 LEU LEU A . n 
A 1 266 PRO 266 326 326 PRO PRO A . n 
A 1 267 SER 267 327 327 SER SER A . n 
A 1 268 GLY 268 328 328 GLY GLY A . n 
A 1 269 VAL 269 329 329 VAL VAL A . n 
A 1 270 PHE 270 330 330 PHE PHE A . n 
A 1 271 SER 271 331 331 SER SER A . n 
A 1 272 LEU 272 332 332 LEU LEU A . n 
A 1 273 GLU 273 333 333 GLU GLU A . n 
A 1 274 PHE 274 334 334 PHE PHE A . n 
A 1 275 GLN 275 335 335 GLN GLN A . n 
A 1 276 ASP 276 336 336 ASP ASP A . n 
A 1 277 PHE 277 337 337 PHE PHE A . n 
A 1 278 VAL 278 338 338 VAL VAL A . n 
A 1 279 ASN 279 339 339 ASN ASN A . n 
A 1 280 LYS 280 340 340 LYS LYS A . n 
A 1 281 CYS 281 341 341 CYS CYS A . n 
A 1 282 LEU 282 342 342 LEU LEU A . n 
A 1 283 ILE 283 343 343 ILE ILE A . n 
A 1 284 LYS 284 344 344 LYS LYS A . n 
A 1 285 ASN 285 345 345 ASN ASN A . n 
A 1 286 PRO 286 346 346 PRO PRO A . n 
A 1 287 ALA 287 347 347 ALA ALA A . n 
A 1 288 GLU 288 348 348 GLU GLU A . n 
A 1 289 ARG 289 349 349 ARG ARG A . n 
A 1 290 ALA 290 350 350 ALA ALA A . n 
A 1 291 ASP 291 351 351 ASP ASP A . n 
A 1 292 LEU 292 352 352 LEU LEU A . n 
A 1 293 LYS 293 353 353 LYS LYS A . n 
A 1 294 GLN 294 354 354 GLN GLN A . n 
A 1 295 LEU 295 355 355 LEU LEU A . n 
A 1 296 MET 296 356 356 MET MET A . n 
A 1 297 VAL 297 357 357 VAL VAL A . n 
A 1 298 HIS 298 358 358 HIS HIS A . n 
A 1 299 ALA 299 359 359 ALA ALA A . n 
A 1 300 PHE 300 360 360 PHE PHE A . n 
A 1 301 ILE 301 361 361 ILE ILE A . n 
A 1 302 LYS 302 362 362 LYS LYS A . n 
A 1 303 ARG 303 363 363 ARG ARG A . n 
A 1 304 SER 304 364 364 SER SER A . n 
A 1 305 ASP 305 365 365 ASP ASP A . n 
A 1 306 ALA 306 366 366 ALA ALA A . n 
A 1 307 GLU 307 367 367 GLU GLU A . n 
A 1 308 GLU 308 368 368 GLU GLU A . n 
A 1 309 VAL 309 369 369 VAL VAL A . n 
A 1 310 ASP 310 370 370 ASP ASP A . n 
A 1 311 PHE 311 371 371 PHE PHE A . n 
A 1 312 ALA 312 372 372 ALA ALA A . n 
A 1 313 GLY 313 373 373 GLY GLY A . n 
A 1 314 TRP 314 374 374 TRP TRP A . n 
A 1 315 LEU 315 375 375 LEU LEU A . n 
A 1 316 CYS 316 376 376 CYS CYS A . n 
A 1 317 SER 317 377 377 SER SER A . n 
A 1 318 THR 318 378 378 THR THR A . n 
A 1 319 ILE 319 379 379 ILE ILE A . n 
A 1 320 GLY 320 380 380 GLY GLY A . n 
A 1 321 LEU 321 381 381 LEU LEU A . n 
A 1 322 ASN 322 382 382 ASN ASN A . n 
A 1 323 GLN 323 383 ?   ?   ?   A . n 
A 1 324 PRO 324 384 ?   ?   ?   A . n 
A 1 325 SER 325 385 ?   ?   ?   A . n 
A 1 326 THR 326 386 ?   ?   ?   A . n 
A 1 327 PRO 327 387 ?   ?   ?   A . n 
A 1 328 THR 328 388 ?   ?   ?   A . n 
A 1 329 HIS 329 389 ?   ?   ?   A . n 
A 1 330 ALA 330 390 ?   ?   ?   A . n 
A 1 331 ALA 331 391 ?   ?   ?   A . n 
A 1 332 GLY 332 392 ?   ?   ?   A . n 
A 1 333 VAL 333 393 ?   ?   ?   A . n 
A 1 334 LEU 334 394 ?   ?   ?   A . n 
A 1 335 GLU 335 395 ?   ?   ?   A . n 
A 1 336 HIS 336 396 ?   ?   ?   A . n 
A 1 337 HIS 337 397 ?   ?   ?   A . n 
A 1 338 HIS 338 398 ?   ?   ?   A . n 
A 1 339 HIS 339 399 ?   ?   ?   A . n 
A 1 340 HIS 340 400 ?   ?   ?   A . n 
A 1 341 HIS 341 401 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E 
2 1,2 A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 2080  ? 
2 MORE         -17   ? 
2 'SSA (A^2)'  27060 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 41.1305000000 0.0000000000 -1.0000000000 
0.0000000000 71.2401157407 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 135 ? A ASN 195  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 148 ? A ASP 208  ? 1_555 103.2 ? 
2  OD1 ? A ASN 135 ? A ASN 195  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O   ? E HOH .   ? A HOH 1002 ? 1_555 92.9  ? 
3  OD1 ? A ASP 148 ? A ASP 208  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O   ? E HOH .   ? A HOH 1002 ? 1_555 82.9  ? 
4  OD1 ? A ASN 135 ? A ASN 195  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O2A ? C ATP .   ? A ATP 600  ? 1_555 166.5 ? 
5  OD1 ? A ASP 148 ? A ASP 208  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O2A ? C ATP .   ? A ATP 600  ? 1_555 75.3  ? 
6  O   ? E HOH .   ? A HOH 1002 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O2A ? C ATP .   ? A ATP 600  ? 1_555 73.6  ? 
7  OD1 ? A ASN 135 ? A ASN 195  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O1B ? C ATP .   ? A ATP 600  ? 1_555 94.5  ? 
8  OD1 ? A ASP 148 ? A ASP 208  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O1B ? C ATP .   ? A ATP 600  ? 1_555 150.5 ? 
9  O   ? E HOH .   ? A HOH 1002 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O1B ? C ATP .   ? A ATP 600  ? 1_555 72.7  ? 
10 O2A ? C ATP .   ? A ATP 600  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O1B ? C ATP .   ? A ATP 600  ? 1_555 82.0  ? 
11 OD1 ? A ASN 135 ? A ASN 195  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O   ? E HOH .   ? A HOH 1003 ? 1_555 115.2 ? 
12 OD1 ? A ASP 148 ? A ASP 208  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O   ? E HOH .   ? A HOH 1003 ? 1_555 83.7  ? 
13 O   ? E HOH .   ? A HOH 1002 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O   ? E HOH .   ? A HOH 1003 ? 1_555 151.0 ? 
14 O2A ? C ATP .   ? A ATP 600  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O   ? E HOH .   ? A HOH 1003 ? 1_555 78.1  ? 
15 O1B ? C ATP .   ? A ATP 600  ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O   ? E HOH .   ? A HOH 1003 ? 1_555 109.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-09-01 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' . ? 1 
CNS          refinement        . ? 2 
DENZO        'data reduction'  . ? 3 
SCALEPACK    'data scaling'    . ? 4 
CNS          phasing           . ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              261 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              262 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              262 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.10 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.80 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 135 ? ? -108.98 -105.97 
2 1 GLU A 138 ? ? -175.26 144.34  
3 1 ARG A 189 ? ? 83.67   -13.10  
4 1 ASP A 190 ? ? -148.43 53.11   
5 1 SER A 241 ? ? -158.36 -151.33 
6 1 LEU A 342 ? ? -91.25  34.55   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PHE 223 ? A PHE 163 
2  1 Y 1 A GLY 276 ? A GLY 216 
3  1 Y 1 A CYS 277 ? A CYS 217 
4  1 Y 1 A GLN 278 ? A GLN 218 
5  1 Y 1 A VAL 279 ? A VAL 219 
6  1 Y 1 A GLU 280 ? A GLU 220 
7  1 Y 1 A GLY 281 ? A GLY 221 
8  1 Y 1 A ASP 282 ? A ASP 222 
9  1 Y 1 A ALA 283 ? A ALA 223 
10 1 Y 1 A ALA 284 ? A ALA 224 
11 1 Y 1 A GLU 285 ? A GLU 225 
12 1 Y 1 A THR 286 ? A THR 226 
13 1 Y 1 A PRO 287 ? A PRO 227 
14 1 Y 1 A PRO 288 ? A PRO 228 
15 1 Y 1 A ARG 289 ? A ARG 229 
16 1 Y 1 A PRO 290 ? A PRO 230 
17 1 Y 1 A ARG 291 ? A ARG 231 
18 1 Y 1 A THR 292 ? A THR 232 
19 1 Y 1 A PRO 293 ? A PRO 233 
20 1 Y 1 A GLY 294 ? A GLY 234 
21 1 Y 1 A ARG 295 ? A ARG 235 
22 1 Y 1 A PRO 296 ? A PRO 236 
23 1 Y 1 A LEU 297 ? A LEU 237 
24 1 Y 1 A SER 298 ? A SER 238 
25 1 Y 1 A SER 299 ? A SER 239 
26 1 Y 1 A TYR 300 ? A TYR 240 
27 1 Y 1 A GLY 301 ? A GLY 241 
28 1 Y 1 A MET 302 ? A MET 242 
29 1 Y 1 A ASP 303 ? A ASP 243 
30 1 Y 1 A SER 304 ? A SER 244 
31 1 Y 1 A ARG 305 ? A ARG 245 
32 1 Y 1 A GLN 383 ? A GLN 323 
33 1 Y 1 A PRO 384 ? A PRO 324 
34 1 Y 1 A SER 385 ? A SER 325 
35 1 Y 1 A THR 386 ? A THR 326 
36 1 Y 1 A PRO 387 ? A PRO 327 
37 1 Y 1 A THR 388 ? A THR 328 
38 1 Y 1 A HIS 389 ? A HIS 329 
39 1 Y 1 A ALA 390 ? A ALA 330 
40 1 Y 1 A ALA 391 ? A ALA 331 
41 1 Y 1 A GLY 392 ? A GLY 332 
42 1 Y 1 A VAL 393 ? A VAL 333 
43 1 Y 1 A LEU 394 ? A LEU 334 
44 1 Y 1 A GLU 395 ? A GLU 335 
45 1 Y 1 A HIS 396 ? A HIS 336 
46 1 Y 1 A HIS 397 ? A HIS 337 
47 1 Y 1 A HIS 398 ? A HIS 338 
48 1 Y 1 A HIS 399 ? A HIS 339 
49 1 Y 1 A HIS 400 ? A HIS 340 
50 1 Y 1 A HIS 401 ? A HIS 341 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                                                                                         MG  
3 "ADENOSINE-5'-TRIPHOSPHATE"                                                                                             ATP 
4 'N-{3,4-difluoro-2-[(2-fluoro-4-iodophenyl)amino]-6-methoxyphenyl}-1-[(2S)-2,3-dihydroxypropyl]cyclopropanesulfonamide' VRA 
5 water                                                                                                                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  500  500  MG  MG  A . 
C 3 ATP 1  600  600  ATP ATP A . 
D 4 VRA 1  1001 1001 VRA VRX A . 
E 5 HOH 1  1002 1    HOH TIP A . 
E 5 HOH 2  1003 2    HOH TIP A . 
E 5 HOH 3  1004 3    HOH TIP A . 
E 5 HOH 4  1005 4    HOH TIP A . 
E 5 HOH 5  1006 5    HOH TIP A . 
E 5 HOH 6  1007 6    HOH TIP A . 
E 5 HOH 7  1008 7    HOH TIP A . 
E 5 HOH 8  1009 8    HOH TIP A . 
E 5 HOH 9  1010 9    HOH TIP A . 
E 5 HOH 10 1011 10   HOH TIP A . 
E 5 HOH 11 1012 11   HOH TIP A . 
E 5 HOH 12 1013 12   HOH TIP A . 
E 5 HOH 13 1014 13   HOH TIP A . 
E 5 HOH 14 1015 14   HOH TIP A . 
E 5 HOH 15 1016 15   HOH TIP A . 
E 5 HOH 16 1017 16   HOH TIP A . 
E 5 HOH 17 1018 17   HOH TIP A . 
E 5 HOH 18 1019 18   HOH TIP A . 
E 5 HOH 19 1020 19   HOH TIP A . 
E 5 HOH 20 1021 20   HOH TIP A . 
E 5 HOH 21 1022 21   HOH TIP A . 
E 5 HOH 22 1023 22   HOH TIP A . 
E 5 HOH 23 1024 23   HOH TIP A . 
E 5 HOH 24 1025 24   HOH TIP A . 
E 5 HOH 25 1026 25   HOH TIP A . 
E 5 HOH 26 1027 26   HOH TIP A . 
E 5 HOH 27 1028 27   HOH TIP A . 
E 5 HOH 28 1029 28   HOH TIP A . 
E 5 HOH 29 1030 29   HOH TIP A . 
E 5 HOH 30 1031 30   HOH TIP A . 
E 5 HOH 31 1032 31   HOH TIP A . 
E 5 HOH 32 1033 32   HOH TIP A . 
E 5 HOH 33 1034 33   HOH TIP A . 
E 5 HOH 34 1035 34   HOH TIP A . 
E 5 HOH 35 1036 35   HOH TIP A . 
E 5 HOH 36 1037 36   HOH TIP A . 
E 5 HOH 37 1038 37   HOH TIP A . 
E 5 HOH 38 1039 38   HOH TIP A . 
E 5 HOH 39 1040 39   HOH TIP A . 
E 5 HOH 40 1041 40   HOH TIP A . 
E 5 HOH 41 1042 41   HOH TIP A . 
E 5 HOH 42 1043 42   HOH TIP A . 
E 5 HOH 43 1044 43   HOH TIP A . 
E 5 HOH 44 1045 44   HOH TIP A . 
E 5 HOH 45 1046 45   HOH TIP A . 
E 5 HOH 46 1047 46   HOH TIP A . 
E 5 HOH 47 1048 47   HOH TIP A . 
E 5 HOH 48 1049 48   HOH TIP A . 
E 5 HOH 49 1050 49   HOH TIP A . 
E 5 HOH 50 1051 50   HOH TIP A . 
E 5 HOH 51 1052 51   HOH TIP A . 
E 5 HOH 52 1053 52   HOH TIP A . 
E 5 HOH 53 1054 53   HOH TIP A . 
E 5 HOH 54 1055 54   HOH TIP A . 
E 5 HOH 55 1056 55   HOH TIP A . 
E 5 HOH 56 1057 56   HOH TIP A . 
E 5 HOH 57 1058 57   HOH TIP A . 
E 5 HOH 58 1059 58   HOH TIP A . 
E 5 HOH 59 1060 59   HOH TIP A . 
E 5 HOH 60 1061 60   HOH TIP A . 
E 5 HOH 61 1062 61   HOH TIP A . 
E 5 HOH 62 1063 62   HOH TIP A . 
E 5 HOH 63 1064 63   HOH TIP A . 
E 5 HOH 64 1065 64   HOH TIP A . 
E 5 HOH 65 1066 65   HOH TIP A . 
#