data_3EB6
# 
_entry.id   3EB6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3EB6         
RCSB  RCSB049104   
WWPDB D_1000049104 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3EB5 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3EB6 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mace, P.D.'        1 
'Linke, K.'         2 
'Schumacher, F.-R.' 3 
'Smith, C.A.'       4 
'Day, C.L.'         5 
# 
_citation.id                        primary 
_citation.title                     
'Structures of the cIAP2 RING Domain Reveal Conformational Changes Associated with Ubiquitin-conjugating Enzyme (E2) Recruitment.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            283 
_citation.page_first                31633 
_citation.page_last                 31640 
_citation.year                      2008 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18784070 
_citation.pdbx_database_id_DOI      10.1074/jbc.M804753200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mace, P.D.'       1 
primary 'Linke, K.'        2 
primary 'Feltham, R.'      3 
primary 'Schumacher, F.R.' 4 
primary 'Smith, C.A.'      5 
primary 'Vaux, D.L.'       6 
primary 'Silke, J.'        7 
primary 'Day, C.L.'        8 
# 
_cell.length_a           137.226 
_cell.length_b           137.226 
_cell.length_c           111.870 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3EB6 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.entry_id                         3EB6 
_symmetry.Int_Tables_number                182 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Baculoviral IAP repeat-containing protein 3' 8238.674  1 ?        ? 'RING domain (RESIDUES 536 TO 604)' ? 
2 polymer     man 'Ubiquitin-conjugating enzyme E2 D2'          16899.357 1 6.3.2.19 ? ?                                   ? 
3 non-polymer syn 'ZINC ION'                                    65.409    2 ?        ? ?                                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Inhibitor of apoptosis protein 1, HIAP-1, HIAP1, C-IAP2, TNFR2-TRAF-signaling complex protein 1, IAP homolog C, Apoptosis inhibitor 2, API2, RING finger protein 49
;
2 'Ubiquitin-protein ligase D2, Ubiquitin carrier protein D2, Xubc4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no LGSGTTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS 
LGSGTTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS A ? 
2 'polypeptide(L)' no no 
;GSMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI
NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
;
;GSMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI
NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   GLY n 
1 3   SER n 
1 4   GLY n 
1 5   THR n 
1 6   THR n 
1 7   GLU n 
1 8   ASP n 
1 9   VAL n 
1 10  SER n 
1 11  ASP n 
1 12  LEU n 
1 13  PRO n 
1 14  VAL n 
1 15  GLU n 
1 16  GLU n 
1 17  GLN n 
1 18  LEU n 
1 19  ARG n 
1 20  ARG n 
1 21  LEU n 
1 22  GLN n 
1 23  GLU n 
1 24  GLU n 
1 25  ARG n 
1 26  THR n 
1 27  CYS n 
1 28  LYS n 
1 29  VAL n 
1 30  CYS n 
1 31  MET n 
1 32  ASP n 
1 33  LYS n 
1 34  GLU n 
1 35  VAL n 
1 36  SER n 
1 37  ILE n 
1 38  VAL n 
1 39  PHE n 
1 40  ILE n 
1 41  PRO n 
1 42  CYS n 
1 43  GLY n 
1 44  HIS n 
1 45  LEU n 
1 46  VAL n 
1 47  VAL n 
1 48  CYS n 
1 49  LYS n 
1 50  ASP n 
1 51  CYS n 
1 52  ALA n 
1 53  PRO n 
1 54  SER n 
1 55  LEU n 
1 56  ARG n 
1 57  LYS n 
1 58  CYS n 
1 59  PRO n 
1 60  ILE n 
1 61  CYS n 
1 62  ARG n 
1 63  SER n 
1 64  THR n 
1 65  ILE n 
1 66  LYS n 
1 67  GLY n 
1 68  THR n 
1 69  VAL n 
1 70  ARG n 
1 71  THR n 
1 72  PHE n 
1 73  LEU n 
1 74  SER n 
2 1   GLY n 
2 2   SER n 
2 3   MET n 
2 4   ALA n 
2 5   LEU n 
2 6   LYS n 
2 7   ARG n 
2 8   ILE n 
2 9   HIS n 
2 10  LYS n 
2 11  GLU n 
2 12  LEU n 
2 13  ASN n 
2 14  ASP n 
2 15  LEU n 
2 16  ALA n 
2 17  ARG n 
2 18  ASP n 
2 19  PRO n 
2 20  PRO n 
2 21  ALA n 
2 22  GLN n 
2 23  CYS n 
2 24  SER n 
2 25  ALA n 
2 26  GLY n 
2 27  PRO n 
2 28  VAL n 
2 29  GLY n 
2 30  ASP n 
2 31  ASP n 
2 32  MET n 
2 33  PHE n 
2 34  HIS n 
2 35  TRP n 
2 36  GLN n 
2 37  ALA n 
2 38  THR n 
2 39  ILE n 
2 40  MET n 
2 41  GLY n 
2 42  PRO n 
2 43  ASN n 
2 44  ASP n 
2 45  SER n 
2 46  PRO n 
2 47  TYR n 
2 48  GLN n 
2 49  GLY n 
2 50  GLY n 
2 51  VAL n 
2 52  PHE n 
2 53  PHE n 
2 54  LEU n 
2 55  THR n 
2 56  ILE n 
2 57  HIS n 
2 58  PHE n 
2 59  PRO n 
2 60  THR n 
2 61  ASP n 
2 62  TYR n 
2 63  PRO n 
2 64  PHE n 
2 65  LYS n 
2 66  PRO n 
2 67  PRO n 
2 68  LYS n 
2 69  VAL n 
2 70  ALA n 
2 71  PHE n 
2 72  THR n 
2 73  THR n 
2 74  ARG n 
2 75  ILE n 
2 76  TYR n 
2 77  HIS n 
2 78  PRO n 
2 79  ASN n 
2 80  ILE n 
2 81  ASN n 
2 82  SER n 
2 83  ASN n 
2 84  GLY n 
2 85  SER n 
2 86  ILE n 
2 87  CYS n 
2 88  LEU n 
2 89  ASP n 
2 90  ILE n 
2 91  LEU n 
2 92  ARG n 
2 93  SER n 
2 94  GLN n 
2 95  TRP n 
2 96  SER n 
2 97  PRO n 
2 98  ALA n 
2 99  LEU n 
2 100 THR n 
2 101 ILE n 
2 102 SER n 
2 103 LYS n 
2 104 VAL n 
2 105 LEU n 
2 106 LEU n 
2 107 SER n 
2 108 ILE n 
2 109 CYS n 
2 110 SER n 
2 111 LEU n 
2 112 LEU n 
2 113 CYS n 
2 114 ASP n 
2 115 PRO n 
2 116 ASN n 
2 117 PRO n 
2 118 ASP n 
2 119 ASP n 
2 120 PRO n 
2 121 LEU n 
2 122 VAL n 
2 123 PRO n 
2 124 GLU n 
2 125 ILE n 
2 126 ALA n 
2 127 ARG n 
2 128 ILE n 
2 129 TYR n 
2 130 LYS n 
2 131 THR n 
2 132 ASP n 
2 133 ARG n 
2 134 GLU n 
2 135 LYS n 
2 136 TYR n 
2 137 ASN n 
2 138 ARG n 
2 139 ILE n 
2 140 ALA n 
2 141 ARG n 
2 142 GLU n 
2 143 TRP n 
2 144 THR n 
2 145 GLN n 
2 146 LYS n 
2 147 TYR n 
2 148 ALA n 
2 149 MET n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                   ? 'BIRC3, API2, IAP1, MIHC, RNF49' ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pGex6p3 ? ? 
2 1 sample ? ? ? 'clawed frog, platanna' ? 'ube2d2, ubc4'                   ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pGex6p3 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP BIRC3_HUMAN Q13489 1 TEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS 536 ? 
2 UNP UB2D2_XENLA P62840 2 
;MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS
NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
;
1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3EB6 A 6 ? 74  ? Q13489 536 ? 604 ? 536 604 
2 2 3EB6 B 3 ? 149 ? P62840 1   ? 147 ? 1   147 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3EB6 LEU A 1 ? UNP Q13489 ? ? 'EXPRESSION TAG' 531 1 
1 3EB6 GLY A 2 ? UNP Q13489 ? ? 'EXPRESSION TAG' 532 2 
1 3EB6 SER A 3 ? UNP Q13489 ? ? 'EXPRESSION TAG' 533 3 
1 3EB6 GLY A 4 ? UNP Q13489 ? ? 'EXPRESSION TAG' 534 4 
1 3EB6 THR A 5 ? UNP Q13489 ? ? 'EXPRESSION TAG' 535 5 
2 3EB6 GLY B 1 ? UNP P62840 ? ? 'EXPRESSION TAG' -1  6 
2 3EB6 SER B 2 ? UNP P62840 ? ? 'EXPRESSION TAG' 0   7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3EB6 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      6.05 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   79.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    '3.3 M NaCl, 0.1 M HEPES, pH 7.3, vapor diffusion, hanging drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2007-07-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3EB6 
_reflns.d_resolution_high            3.401 
_reflns.d_resolution_low             58.521 
_reflns.number_all                   8950 
_reflns.number_obs                   8512 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_netI_over_sigmaI        7.331 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_redundancy              6.900 
_reflns.percent_possible_obs         99.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.40  3.58  ? 8853 ? 0.010 0.8  1.032 ? 7.00 ? 1263 99.60 1  1 
3.58  3.80  ? 8404 ? 0.010 1.5  0.521 ? 7.00 ? 1204 99.40 2  1 
3.80  4.06  ? 7858 ? 0.010 2.7  0.283 ? 7.00 ? 1124 99.40 3  1 
4.06  4.39  ? 7435 ? 0.010 5.3  0.142 ? 7.00 ? 1065 99.70 4  1 
4.39  4.81  ? 6823 ? 0.010 7.8  0.097 ? 6.90 ? 987  99.80 5  1 
4.81  5.38  ? 6240 ? 0.010 10.3 0.071 ? 6.90 ? 900  99.50 6  1 
5.38  6.21  ? 5411 ? 0.010 11.8 0.060 ? 6.80 ? 793  99.20 7  1 
6.21  7.60  ? 4657 ? 0.010 16.1 0.044 ? 6.80 ? 680  98.60 8  1 
7.60  10.75 ? 3560 ? 0.010 18.5 0.029 ? 6.80 ? 526  97.30 9  1 
10.75 58.52 ? 1912 ? 0.010 17.6 0.032 ? 6.20 ? 309  93.10 10 1 
# 
_refine.entry_id                                 3EB6 
_refine.ls_d_res_high                            3.400 
_refine.ls_d_res_low                             58.520 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.340 
_refine.ls_number_reflns_obs                     8512 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.283 
_refine.ls_R_factor_R_work                       0.281 
_refine.ls_R_factor_R_free                       0.320 
_refine.ls_percent_reflns_R_free                 4.800 
_refine.ls_number_reflns_R_free                  433 
_refine.B_iso_mean                               102.875 
_refine.aniso_B[1][1]                            3.330 
_refine.aniso_B[2][2]                            3.330 
_refine.aniso_B[3][3]                            -5.000 
_refine.aniso_B[1][2]                            1.670 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.901 
_refine.correlation_coeff_Fo_to_Fc_free          0.884 
_refine.pdbx_overall_ESU_R                       0.959 
_refine.pdbx_overall_ESU_R_Free                  0.494 
_refine.overall_SU_ML                            0.362 
_refine.overall_SU_B                             48.459 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                123.11 
_refine.B_iso_min                                73.93 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1691 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1693 
_refine_hist.d_res_high                       3.400 
_refine_hist.d_res_low                        58.520 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1740 0.008  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2361 1.340  1.983  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 211  6.825  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 73   38.548 23.151 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 301  19.891 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 14   19.032 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         262  0.087  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1310 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined          878  0.240  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined        1218 0.311  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined  45   0.173  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined    1    0.196  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined 24   0.242  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            1097 0.250  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1761 0.468  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            717  0.706  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           600  1.129  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       3.400 
_refine_ls_shell.d_res_low                        3.488 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.840 
_refine_ls_shell.number_reflns_R_work             609 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.428 
_refine_ls_shell.R_factor_R_free                  0.520 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                640 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3EB6 
_struct.title                     'Structure of the cIAP2 RING domain bound to UbcH5b' 
_struct.pdbx_descriptor           'Baculoviral IAP repeat-containing protein 3, Ubiquitin-conjugating enzyme E2 D2 (E.C.6.3.2.19)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3EB6 
_struct_keywords.text            'RING domain, E2, Apoptosis, Metal-binding, Zinc-finger, Ligase, Ubl conjugation pathway' 
_struct_keywords.pdbx_keywords   'APOPTOSIS, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 18  ? THR A 26  ? LEU A 548 THR A 556 1 ? 9  
HELX_P HELX_P2 2 CYS A 51  ? LEU A 55  ? CYS A 581 LEU A 585 5 ? 5  
HELX_P HELX_P3 3 MET B 3   ? ASP B 18  ? MET B 1   ASP B 16  1 ? 16 
HELX_P HELX_P4 4 THR B 100 ? ASP B 114 ? THR B 98  ASP B 112 1 ? 15 
HELX_P HELX_P5 5 VAL B 122 ? ASP B 132 ? VAL B 120 ASP B 130 1 ? 11 
HELX_P HELX_P6 6 ASP B 132 ? ALA B 148 ? ASP B 130 ALA B 146 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 27 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 557 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc2 metalc ? ? A CYS 30 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 560 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc3 metalc ? ? A CYS 42 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 572 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc4 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 574 A ZN 1002 1_555 ? ? ? ? ? ? ? 1.863 ? 
metalc5 metalc ? ? A CYS 48 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 578 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc6 metalc ? ? A CYS 51 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 581 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc7 metalc ? ? A CYS 58 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 588 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc8 metalc ? ? A CYS 61 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 591 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.327 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 16 A . ? GLU 546 A GLN 17 A ? GLN 547 A 1 -3.32  
2 ILE 40 A . ? ILE 570 A PRO 41 A ? PRO 571 A 1 8.73   
3 GLY 1  B . ? GLY -1  B SER 2  B ? SER 0   B 1 -1.13  
4 SER 2  B . ? SER 0   B MET 3  B ? MET 1   B 1 -17.76 
5 TYR 62 B . ? TYR 60  B PRO 63 B ? PRO 61  B 1 11.98  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 45 ? VAL A 47 ? LEU A 575 VAL A 577 
A 2 ILE A 37 ? ILE A 40 ? ILE A 567 ILE A 570 
A 3 GLY A 67 ? ARG A 70 ? GLY A 597 ARG A 600 
B 1 CYS B 23 ? PRO B 27 ? CYS B 21  PRO B 25  
B 2 HIS B 34 ? ILE B 39 ? HIS B 32  ILE B 37  
B 3 PHE B 52 ? HIS B 57 ? PHE B 50  HIS B 55  
B 4 LYS B 68 ? PHE B 71 ? LYS B 66  PHE B 69  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 47 ? O VAL A 577 N ILE A 37 ? N ILE A 567 
A 2 3 N VAL A 38 ? N VAL A 568 O VAL A 69 ? O VAL A 599 
B 1 2 N SER B 24 ? N SER B 22  O THR B 38 ? O THR B 36  
B 2 3 N ILE B 39 ? N ILE B 37  O PHE B 52 ? O PHE B 50  
B 3 4 N HIS B 57 ? N HIS B 55  O LYS B 68 ? O LYS B 66  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1001' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 27 ? CYS A 557 . ? 1_555 ? 
2 AC1 4 CYS A 30 ? CYS A 560 . ? 1_555 ? 
3 AC1 4 CYS A 48 ? CYS A 578 . ? 1_555 ? 
4 AC1 4 CYS A 51 ? CYS A 581 . ? 1_555 ? 
5 AC2 4 CYS A 42 ? CYS A 572 . ? 1_555 ? 
6 AC2 4 HIS A 44 ? HIS A 574 . ? 1_555 ? 
7 AC2 4 CYS A 58 ? CYS A 588 . ? 1_555 ? 
8 AC2 4 CYS A 61 ? CYS A 591 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3EB6 
_atom_sites.fract_transf_matrix[1][1]   0.007287 
_atom_sites.fract_transf_matrix[1][2]   0.004207 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008415 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008939 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 11  ? 41.201 -62.311 -17.882 1.00 89.45  ? 541  ASP A N   1 
ATOM   2    C  CA  . ASP A 1 11  ? 40.436 -62.506 -19.153 1.00 89.43  ? 541  ASP A CA  1 
ATOM   3    C  C   . ASP A 1 11  ? 39.070 -63.174 -18.934 1.00 89.46  ? 541  ASP A C   1 
ATOM   4    O  O   . ASP A 1 11  ? 38.984 -64.389 -18.723 1.00 89.44  ? 541  ASP A O   1 
ATOM   5    C  CB  . ASP A 1 11  ? 41.279 -63.268 -20.196 1.00 89.41  ? 541  ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 11  ? 42.174 -64.341 -19.569 1.00 89.34  ? 541  ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 11  ? 41.656 -65.357 -19.043 1.00 89.21  ? 541  ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 11  ? 43.470 -64.166 -19.586 1.00 89.12  ? 541  ASP A OD2 1 
ATOM   9    N  N   . LEU A 1 12  ? 38.010 -62.367 -18.975 1.00 89.42  ? 542  LEU A N   1 
ATOM   10   C  CA  . LEU A 1 12  ? 36.637 -62.870 -18.887 1.00 89.46  ? 542  LEU A CA  1 
ATOM   11   C  C   . LEU A 1 12  ? 35.825 -62.471 -20.129 1.00 89.45  ? 542  LEU A C   1 
ATOM   12   O  O   . LEU A 1 12  ? 35.866 -61.309 -20.534 1.00 89.29  ? 542  LEU A O   1 
ATOM   13   C  CB  . LEU A 1 12  ? 35.956 -62.396 -17.590 1.00 89.47  ? 542  LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 12  ? 35.875 -63.303 -16.341 1.00 89.48  ? 542  LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 12  ? 34.805 -64.397 -16.467 1.00 89.12  ? 542  LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 12  ? 37.222 -63.910 -15.931 1.00 89.49  ? 542  LEU A CD2 1 
ATOM   17   N  N   . PRO A 1 13  ? 35.083 -63.441 -20.721 1.00 89.50  ? 543  PRO A N   1 
ATOM   18   C  CA  . PRO A 1 13  ? 34.357 -63.466 -22.005 1.00 89.54  ? 543  PRO A CA  1 
ATOM   19   C  C   . PRO A 1 13  ? 33.976 -62.146 -22.715 1.00 89.62  ? 543  PRO A C   1 
ATOM   20   O  O   . PRO A 1 13  ? 34.706 -61.154 -22.635 1.00 89.52  ? 543  PRO A O   1 
ATOM   21   C  CB  . PRO A 1 13  ? 33.103 -64.291 -21.663 1.00 89.49  ? 543  PRO A CB  1 
ATOM   22   C  CG  . PRO A 1 13  ? 33.542 -65.202 -20.528 1.00 89.40  ? 543  PRO A CG  1 
ATOM   23   C  CD  . PRO A 1 13  ? 34.899 -64.733 -20.034 1.00 89.48  ? 543  PRO A CD  1 
ATOM   24   N  N   . VAL A 1 14  ? 32.840 -62.184 -23.422 1.00 89.70  ? 544  VAL A N   1 
ATOM   25   C  CA  . VAL A 1 14  ? 32.368 -61.143 -24.364 1.00 89.73  ? 544  VAL A CA  1 
ATOM   26   C  C   . VAL A 1 14  ? 33.265 -59.901 -24.483 1.00 89.73  ? 544  VAL A C   1 
ATOM   27   O  O   . VAL A 1 14  ? 34.252 -59.917 -25.222 1.00 89.65  ? 544  VAL A O   1 
ATOM   28   C  CB  . VAL A 1 14  ? 30.870 -60.764 -24.114 1.00 89.74  ? 544  VAL A CB  1 
ATOM   29   C  CG1 . VAL A 1 14  ? 30.298 -60.000 -25.304 1.00 89.76  ? 544  VAL A CG1 1 
ATOM   30   C  CG2 . VAL A 1 14  ? 30.031 -62.016 -23.852 1.00 89.62  ? 544  VAL A CG2 1 
ATOM   31   N  N   . GLU A 1 15  ? 32.917 -58.834 -23.766 1.00 89.83  ? 545  GLU A N   1 
ATOM   32   C  CA  . GLU A 1 15  ? 33.706 -57.601 -23.772 1.00 89.96  ? 545  GLU A CA  1 
ATOM   33   C  C   . GLU A 1 15  ? 34.824 -57.698 -22.734 1.00 90.03  ? 545  GLU A C   1 
ATOM   34   O  O   . GLU A 1 15  ? 34.737 -58.500 -21.800 1.00 90.11  ? 545  GLU A O   1 
ATOM   35   C  CB  . GLU A 1 15  ? 32.804 -56.387 -23.502 1.00 89.98  ? 545  GLU A CB  1 
ATOM   36   C  CG  . GLU A 1 15  ? 33.500 -55.016 -23.554 1.00 89.79  ? 545  GLU A CG  1 
ATOM   37   C  CD  . GLU A 1 15  ? 33.626 -54.438 -24.959 1.00 89.63  ? 545  GLU A CD  1 
ATOM   38   O  OE1 . GLU A 1 15  ? 33.495 -55.189 -25.949 1.00 89.52  ? 545  GLU A OE1 1 
ATOM   39   O  OE2 . GLU A 1 15  ? 33.862 -53.216 -25.069 0.50 89.61  ? 545  GLU A OE2 1 
ATOM   40   N  N   . GLU A 1 16  ? 35.864 -56.880 -22.910 1.00 90.07  ? 546  GLU A N   1 
ATOM   41   C  CA  . GLU A 1 16  ? 37.048 -56.857 -22.037 1.00 90.11  ? 546  GLU A CA  1 
ATOM   42   C  C   . GLU A 1 16  ? 37.832 -58.173 -22.070 1.00 90.13  ? 546  GLU A C   1 
ATOM   43   O  O   . GLU A 1 16  ? 37.272 -59.249 -21.827 1.00 90.18  ? 546  GLU A O   1 
ATOM   44   C  CB  . GLU A 1 16  ? 36.692 -56.481 -20.596 1.00 90.11  ? 546  GLU A CB  1 
ATOM   45   C  CG  . GLU A 1 16  ? 36.145 -55.082 -20.439 1.00 90.25  ? 546  GLU A CG  1 
ATOM   46   C  CD  . GLU A 1 16  ? 35.423 -54.891 -19.127 1.00 90.33  ? 546  GLU A CD  1 
ATOM   47   O  OE1 . GLU A 1 16  ? 34.192 -54.690 -19.155 1.00 90.16  ? 546  GLU A OE1 1 
ATOM   48   O  OE2 . GLU A 1 16  ? 36.083 -54.953 -18.067 1.00 90.51  ? 546  GLU A OE2 1 
ATOM   49   N  N   . GLN A 1 17  ? 39.123 -58.102 -22.387 1.00 90.05  ? 547  GLN A N   1 
ATOM   50   C  CA  . GLN A 1 17  ? 39.815 -56.872 -22.769 1.00 89.89  ? 547  GLN A CA  1 
ATOM   51   C  C   . GLN A 1 17  ? 39.298 -56.401 -24.128 1.00 89.67  ? 547  GLN A C   1 
ATOM   52   O  O   . GLN A 1 17  ? 39.013 -57.214 -25.010 1.00 89.72  ? 547  GLN A O   1 
ATOM   53   C  CB  . GLN A 1 17  ? 41.331 -57.112 -22.843 1.00 89.97  ? 547  GLN A CB  1 
ATOM   54   C  CG  . GLN A 1 17  ? 41.858 -58.278 -21.977 1.00 90.43  ? 547  GLN A CG  1 
ATOM   55   C  CD  . GLN A 1 17  ? 41.467 -59.669 -22.511 1.00 91.06  ? 547  GLN A CD  1 
ATOM   56   O  OE1 . GLN A 1 17  ? 40.860 -60.475 -21.794 1.00 90.81  ? 547  GLN A OE1 1 
ATOM   57   N  NE2 . GLN A 1 17  ? 41.804 -59.942 -23.773 1.00 91.41  ? 547  GLN A NE2 1 
ATOM   58   N  N   . LEU A 1 18  ? 39.166 -55.086 -24.270 1.00 89.34  ? 548  LEU A N   1 
ATOM   59   C  CA  . LEU A 1 18  ? 38.656 -54.436 -25.479 1.00 89.16  ? 548  LEU A CA  1 
ATOM   60   C  C   . LEU A 1 18  ? 38.291 -53.042 -25.025 1.00 89.08  ? 548  LEU A C   1 
ATOM   61   O  O   . LEU A 1 18  ? 38.848 -52.055 -25.501 1.00 89.05  ? 548  LEU A O   1 
ATOM   62   C  CB  . LEU A 1 18  ? 37.429 -55.158 -26.060 1.00 89.09  ? 548  LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 18  ? 36.969 -54.845 -27.492 1.00 89.10  ? 548  LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 18  ? 36.041 -53.646 -27.549 1.00 89.01  ? 548  LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 18  ? 38.150 -54.628 -28.417 1.00 88.89  ? 548  LEU A CD2 1 
ATOM   66   N  N   . ARG A 1 19  ? 37.343 -52.982 -24.093 1.00 88.98  ? 549  ARG A N   1 
ATOM   67   C  CA  . ARG A 1 19  ? 37.146 -51.812 -23.259 1.00 88.87  ? 549  ARG A CA  1 
ATOM   68   C  C   . ARG A 1 19  ? 38.480 -51.563 -22.548 1.00 88.86  ? 549  ARG A C   1 
ATOM   69   O  O   . ARG A 1 19  ? 39.023 -50.458 -22.599 1.00 88.90  ? 549  ARG A O   1 
ATOM   70   C  CB  . ARG A 1 19  ? 36.002 -52.070 -22.261 1.00 88.81  ? 549  ARG A CB  1 
ATOM   71   C  CG  . ARG A 1 19  ? 35.890 -51.094 -21.091 1.00 88.55  ? 549  ARG A CG  1 
ATOM   72   C  CD  . ARG A 1 19  ? 35.240 -49.788 -21.508 1.00 88.47  ? 549  ARG A CD  1 
ATOM   73   N  NE  . ARG A 1 19  ? 35.710 -48.664 -20.702 1.00 88.74  ? 549  ARG A NE  1 
ATOM   74   C  CZ  . ARG A 1 19  ? 36.757 -47.901 -21.016 1.00 88.73  ? 549  ARG A CZ  1 
ATOM   75   N  NH1 . ARG A 1 19  ? 37.118 -46.899 -20.222 1.00 88.47  ? 549  ARG A NH1 1 
ATOM   76   N  NH2 . ARG A 1 19  ? 37.451 -48.133 -22.124 1.00 88.69  ? 549  ARG A NH2 1 
ATOM   77   N  N   . ARG A 1 20  ? 39.018 -52.617 -21.936 1.00 88.77  ? 550  ARG A N   1 
ATOM   78   C  CA  . ARG A 1 20  ? 40.258 -52.546 -21.167 1.00 88.64  ? 550  ARG A CA  1 
ATOM   79   C  C   . ARG A 1 20  ? 41.497 -52.459 -22.043 1.00 88.48  ? 550  ARG A C   1 
ATOM   80   O  O   . ARG A 1 20  ? 42.438 -51.725 -21.723 1.00 88.53  ? 550  ARG A O   1 
ATOM   81   C  CB  . ARG A 1 20  ? 40.370 -53.753 -20.239 1.00 88.73  ? 550  ARG A CB  1 
ATOM   82   C  CG  . ARG A 1 20  ? 39.448 -53.691 -19.039 1.00 88.97  ? 550  ARG A CG  1 
ATOM   83   C  CD  . ARG A 1 20  ? 39.407 -55.015 -18.315 1.00 89.19  ? 550  ARG A CD  1 
ATOM   84   N  NE  . ARG A 1 20  ? 39.086 -54.826 -16.905 1.00 89.48  ? 550  ARG A NE  1 
ATOM   85   C  CZ  . ARG A 1 20  ? 38.653 -55.787 -16.095 1.00 89.84  ? 550  ARG A CZ  1 
ATOM   86   N  NH1 . ARG A 1 20  ? 38.470 -57.022 -16.549 1.00 89.90  ? 550  ARG A NH1 1 
ATOM   87   N  NH2 . ARG A 1 20  ? 38.393 -55.509 -14.825 1.00 90.19  ? 550  ARG A NH2 1 
ATOM   88   N  N   . LEU A 1 21  ? 41.501 -53.216 -23.137 1.00 88.28  ? 551  LEU A N   1 
ATOM   89   C  CA  . LEU A 1 21  ? 42.632 -53.213 -24.056 1.00 88.13  ? 551  LEU A CA  1 
ATOM   90   C  C   . LEU A 1 21  ? 42.822 -51.834 -24.676 1.00 88.02  ? 551  LEU A C   1 
ATOM   91   O  O   . LEU A 1 21  ? 43.936 -51.314 -24.699 1.00 87.97  ? 551  LEU A O   1 
ATOM   92   C  CB  . LEU A 1 21  ? 42.476 -54.286 -25.138 1.00 88.14  ? 551  LEU A CB  1 
ATOM   93   C  CG  . LEU A 1 21  ? 43.604 -54.415 -26.172 1.00 88.09  ? 551  LEU A CG  1 
ATOM   94   C  CD1 . LEU A 1 21  ? 44.989 -54.521 -25.521 1.00 87.99  ? 551  LEU A CD1 1 
ATOM   95   C  CD2 . LEU A 1 21  ? 43.344 -55.598 -27.091 1.00 88.08  ? 551  LEU A CD2 1 
ATOM   96   N  N   . GLN A 1 22  ? 41.733 -51.246 -25.162 1.00 87.86  ? 552  GLN A N   1 
ATOM   97   C  CA  . GLN A 1 22  ? 41.773 -49.880 -25.655 1.00 87.78  ? 552  GLN A CA  1 
ATOM   98   C  C   . GLN A 1 22  ? 42.159 -48.935 -24.535 1.00 87.88  ? 552  GLN A C   1 
ATOM   99   O  O   . GLN A 1 22  ? 42.954 -48.028 -24.745 1.00 87.96  ? 552  GLN A O   1 
ATOM   100  C  CB  . GLN A 1 22  ? 40.437 -49.468 -26.259 1.00 87.69  ? 552  GLN A CB  1 
ATOM   101  C  CG  . GLN A 1 22  ? 40.247 -49.949 -27.682 1.00 87.50  ? 552  GLN A CG  1 
ATOM   102  C  CD  . GLN A 1 22  ? 38.826 -49.778 -28.174 1.00 87.22  ? 552  GLN A CD  1 
ATOM   103  O  OE1 . GLN A 1 22  ? 37.887 -50.347 -27.614 1.00 87.04  ? 552  GLN A OE1 1 
ATOM   104  N  NE2 . GLN A 1 22  ? 38.662 -49.000 -29.237 1.00 87.10  ? 552  GLN A NE2 1 
ATOM   105  N  N   . GLU A 1 23  ? 41.624 -49.168 -23.340 1.00 88.03  ? 553  GLU A N   1 
ATOM   106  C  CA  . GLU A 1 23  ? 41.919 -48.308 -22.197 1.00 88.36  ? 553  GLU A CA  1 
ATOM   107  C  C   . GLU A 1 23  ? 43.398 -48.341 -21.796 1.00 88.31  ? 553  GLU A C   1 
ATOM   108  O  O   . GLU A 1 23  ? 43.924 -47.361 -21.262 1.00 88.32  ? 553  GLU A O   1 
ATOM   109  C  CB  . GLU A 1 23  ? 41.010 -48.631 -21.002 1.00 88.52  ? 553  GLU A CB  1 
ATOM   110  C  CG  . GLU A 1 23  ? 40.779 -47.450 -20.037 1.00 89.58  ? 553  GLU A CG  1 
ATOM   111  C  CD  . GLU A 1 23  ? 40.319 -46.165 -20.741 1.00 90.83  ? 553  GLU A CD  1 
ATOM   112  O  OE1 . GLU A 1 23  ? 39.293 -46.211 -21.452 1.00 91.28  ? 553  GLU A OE1 1 
ATOM   113  O  OE2 . GLU A 1 23  ? 40.981 -45.109 -20.583 1.00 90.92  ? 553  GLU A OE2 1 
ATOM   114  N  N   . GLU A 1 24  ? 44.071 -49.454 -22.065 1.00 88.32  ? 554  GLU A N   1 
ATOM   115  C  CA  . GLU A 1 24  ? 45.512 -49.524 -21.840 1.00 88.48  ? 554  GLU A CA  1 
ATOM   116  C  C   . GLU A 1 24  ? 46.270 -48.753 -22.924 1.00 88.20  ? 554  GLU A C   1 
ATOM   117  O  O   . GLU A 1 24  ? 47.404 -48.329 -22.719 1.00 88.21  ? 554  GLU A O   1 
ATOM   118  C  CB  . GLU A 1 24  ? 45.990 -50.979 -21.784 1.00 88.55  ? 554  GLU A CB  1 
ATOM   119  C  CG  . GLU A 1 24  ? 47.450 -51.146 -21.322 1.00 88.92  ? 554  GLU A CG  1 
ATOM   120  C  CD  . GLU A 1 24  ? 48.049 -52.507 -21.676 1.00 89.02  ? 554  GLU A CD  1 
ATOM   121  O  OE1 . GLU A 1 24  ? 47.342 -53.536 -21.530 1.00 89.41  ? 554  GLU A OE1 1 
ATOM   122  O  OE2 . GLU A 1 24  ? 49.234 -52.542 -22.093 1.00 89.27  ? 554  GLU A OE2 1 
ATOM   123  N  N   . ARG A 1 25  ? 45.629 -48.566 -24.071 1.00 88.00  ? 555  ARG A N   1 
ATOM   124  C  CA  . ARG A 1 25  ? 46.293 -47.964 -25.222 1.00 87.85  ? 555  ARG A CA  1 
ATOM   125  C  C   . ARG A 1 25  ? 45.945 -46.487 -25.421 1.00 87.42  ? 555  ARG A C   1 
ATOM   126  O  O   . ARG A 1 25  ? 46.577 -45.820 -26.237 1.00 87.51  ? 555  ARG A O   1 
ATOM   127  C  CB  . ARG A 1 25  ? 45.997 -48.771 -26.497 1.00 87.91  ? 555  ARG A CB  1 
ATOM   128  C  CG  . ARG A 1 25  ? 46.250 -50.280 -26.359 1.00 88.35  ? 555  ARG A CG  1 
ATOM   129  C  CD  . ARG A 1 25  ? 46.057 -51.053 -27.665 1.00 88.45  ? 555  ARG A CD  1 
ATOM   130  N  NE  . ARG A 1 25  ? 47.180 -50.850 -28.580 1.00 90.59  ? 555  ARG A NE  1 
ATOM   131  C  CZ  . ARG A 1 25  ? 47.118 -50.178 -29.731 1.00 91.62  ? 555  ARG A CZ  1 
ATOM   132  N  NH1 . ARG A 1 25  ? 45.968 -49.652 -30.143 1.00 92.13  ? 555  ARG A NH1 1 
ATOM   133  N  NH2 . ARG A 1 25  ? 48.210 -50.044 -30.483 1.00 91.83  ? 555  ARG A NH2 1 
ATOM   134  N  N   . THR A 1 26  ? 44.953 -45.975 -24.685 1.00 86.94  ? 556  THR A N   1 
ATOM   135  C  CA  . THR A 1 26  ? 44.549 -44.563 -24.816 1.00 86.40  ? 556  THR A CA  1 
ATOM   136  C  C   . THR A 1 26  ? 45.351 -43.631 -23.914 1.00 86.14  ? 556  THR A C   1 
ATOM   137  O  O   . THR A 1 26  ? 45.784 -44.023 -22.828 1.00 86.02  ? 556  THR A O   1 
ATOM   138  C  CB  . THR A 1 26  ? 43.033 -44.315 -24.556 1.00 86.34  ? 556  THR A CB  1 
ATOM   139  O  OG1 . THR A 1 26  ? 42.711 -44.597 -23.187 1.00 86.05  ? 556  THR A OG1 1 
ATOM   140  C  CG2 . THR A 1 26  ? 42.158 -45.146 -25.492 1.00 86.34  ? 556  THR A CG2 1 
ATOM   141  N  N   . CYS A 1 27  ? 45.532 -42.396 -24.382 1.00 85.87  ? 557  CYS A N   1 
ATOM   142  C  CA  . CYS A 1 27  ? 46.229 -41.344 -23.641 1.00 85.67  ? 557  CYS A CA  1 
ATOM   143  C  C   . CYS A 1 27  ? 45.736 -41.259 -22.214 1.00 85.46  ? 557  CYS A C   1 
ATOM   144  O  O   . CYS A 1 27  ? 44.558 -41.454 -21.930 1.00 85.15  ? 557  CYS A O   1 
ATOM   145  C  CB  . CYS A 1 27  ? 46.070 -39.989 -24.338 1.00 85.74  ? 557  CYS A CB  1 
ATOM   146  S  SG  . CYS A 1 27  ? 46.614 -38.513 -23.426 1.00 85.76  ? 557  CYS A SG  1 
ATOM   147  N  N   . LYS A 1 28  ? 46.665 -40.956 -21.324 1.00 85.46  ? 558  LYS A N   1 
ATOM   148  C  CA  . LYS A 1 28  ? 46.400 -41.028 -19.910 1.00 85.53  ? 558  LYS A CA  1 
ATOM   149  C  C   . LYS A 1 28  ? 45.846 -39.725 -19.328 1.00 85.39  ? 558  LYS A C   1 
ATOM   150  O  O   . LYS A 1 28  ? 45.414 -39.707 -18.172 1.00 85.57  ? 558  LYS A O   1 
ATOM   151  C  CB  . LYS A 1 28  ? 47.665 -41.490 -19.174 1.00 85.48  ? 558  LYS A CB  1 
ATOM   152  C  CG  . LYS A 1 28  ? 47.434 -42.458 -18.000 1.00 86.55  ? 558  LYS A CG  1 
ATOM   153  C  CD  . LYS A 1 28  ? 46.668 -43.747 -18.379 1.00 87.67  ? 558  LYS A CD  1 
ATOM   154  C  CE  . LYS A 1 28  ? 47.451 -44.673 -19.319 1.00 87.88  ? 558  LYS A CE  1 
ATOM   155  N  NZ  . LYS A 1 28  ? 46.697 -45.936 -19.621 1.00 87.73  ? 558  LYS A NZ  1 
ATOM   156  N  N   . VAL A 1 29  ? 45.832 -38.643 -20.111 1.00 85.21  ? 559  VAL A N   1 
ATOM   157  C  CA  . VAL A 1 29  ? 45.342 -37.356 -19.579 1.00 85.01  ? 559  VAL A CA  1 
ATOM   158  C  C   . VAL A 1 29  ? 44.111 -36.798 -20.301 1.00 84.84  ? 559  VAL A C   1 
ATOM   159  O  O   . VAL A 1 29  ? 43.130 -36.431 -19.640 1.00 84.84  ? 559  VAL A O   1 
ATOM   160  C  CB  . VAL A 1 29  ? 46.458 -36.268 -19.417 1.00 85.14  ? 559  VAL A CB  1 
ATOM   161  C  CG1 . VAL A 1 29  ? 47.864 -36.854 -19.630 1.00 85.08  ? 559  VAL A CG1 1 
ATOM   162  C  CG2 . VAL A 1 29  ? 46.224 -35.082 -20.337 1.00 85.15  ? 559  VAL A CG2 1 
ATOM   163  N  N   . CYS A 1 30  ? 44.154 -36.728 -21.635 1.00 84.45  ? 560  CYS A N   1 
ATOM   164  C  CA  . CYS A 1 30  ? 42.948 -36.372 -22.394 1.00 84.06  ? 560  CYS A CA  1 
ATOM   165  C  C   . CYS A 1 30  ? 41.992 -37.551 -22.377 1.00 83.69  ? 560  CYS A C   1 
ATOM   166  O  O   . CYS A 1 30  ? 40.798 -37.404 -22.612 1.00 83.42  ? 560  CYS A O   1 
ATOM   167  C  CB  . CYS A 1 30  ? 43.270 -35.969 -23.842 1.00 84.13  ? 560  CYS A CB  1 
ATOM   168  S  SG  . CYS A 1 30  ? 43.960 -37.261 -24.913 1.00 83.79  ? 560  CYS A SG  1 
ATOM   169  N  N   . MET A 1 31  ? 42.555 -38.713 -22.060 1.00 83.47  ? 561  MET A N   1 
ATOM   170  C  CA  . MET A 1 31  ? 41.911 -40.008 -22.220 1.00 83.36  ? 561  MET A CA  1 
ATOM   171  C  C   . MET A 1 31  ? 40.890 -40.064 -23.355 1.00 83.13  ? 561  MET A C   1 
ATOM   172  O  O   . MET A 1 31  ? 39.751 -40.497 -23.179 1.00 83.17  ? 561  MET A O   1 
ATOM   173  C  CB  . MET A 1 31  ? 41.381 -40.573 -20.892 1.00 83.39  ? 561  MET A CB  1 
ATOM   174  C  CG  . MET A 1 31  ? 40.840 -39.585 -19.875 1.00 83.29  ? 561  MET A CG  1 
ATOM   175  S  SD  . MET A 1 31  ? 40.061 -40.555 -18.566 1.00 83.73  ? 561  MET A SD  1 
ATOM   176  C  CE  . MET A 1 31  ? 39.192 -39.313 -17.615 1.00 83.45  ? 561  MET A CE  1 
ATOM   177  N  N   . ASP A 1 32  ? 41.332 -39.612 -24.522 1.00 82.94  ? 562  ASP A N   1 
ATOM   178  C  CA  . ASP A 1 32  ? 40.560 -39.712 -25.742 1.00 82.88  ? 562  ASP A CA  1 
ATOM   179  C  C   . ASP A 1 32  ? 41.463 -40.208 -26.841 1.00 82.88  ? 562  ASP A C   1 
ATOM   180  O  O   . ASP A 1 32  ? 41.200 -41.244 -27.445 1.00 82.83  ? 562  ASP A O   1 
ATOM   181  C  CB  . ASP A 1 32  ? 39.986 -38.354 -26.135 1.00 82.91  ? 562  ASP A CB  1 
ATOM   182  C  CG  . ASP A 1 32  ? 39.518 -38.313 -27.584 1.00 82.95  ? 562  ASP A CG  1 
ATOM   183  O  OD1 . ASP A 1 32  ? 38.529 -38.998 -27.924 1.00 83.13  ? 562  ASP A OD1 1 
ATOM   184  O  OD2 . ASP A 1 32  ? 40.143 -37.590 -28.383 1.00 83.02  ? 562  ASP A OD2 1 
ATOM   185  N  N   . LYS A 1 33  ? 42.530 -39.457 -27.093 1.00 82.99  ? 563  LYS A N   1 
ATOM   186  C  CA  . LYS A 1 33  ? 43.441 -39.766 -28.180 1.00 83.27  ? 563  LYS A CA  1 
ATOM   187  C  C   . LYS A 1 33  ? 44.379 -40.879 -27.774 1.00 83.10  ? 563  LYS A C   1 
ATOM   188  O  O   . LYS A 1 33  ? 44.687 -41.028 -26.600 1.00 83.12  ? 563  LYS A O   1 
ATOM   189  C  CB  . LYS A 1 33  ? 44.217 -38.522 -28.600 1.00 83.24  ? 563  LYS A CB  1 
ATOM   190  C  CG  . LYS A 1 33  ? 43.400 -37.556 -29.468 1.00 83.83  ? 563  LYS A CG  1 
ATOM   191  C  CD  . LYS A 1 33  ? 44.268 -36.503 -30.162 1.00 84.02  ? 563  LYS A CD  1 
ATOM   192  C  CE  . LYS A 1 33  ? 45.216 -37.114 -31.218 1.00 85.47  ? 563  LYS A CE  1 
ATOM   193  N  NZ  . LYS A 1 33  ? 44.539 -37.466 -32.508 1.00 85.62  ? 563  LYS A NZ  1 
ATOM   194  N  N   . GLU A 1 34  ? 44.815 -41.665 -28.752 1.00 83.11  ? 564  GLU A N   1 
ATOM   195  C  CA  . GLU A 1 34  ? 45.682 -42.815 -28.510 1.00 83.23  ? 564  GLU A CA  1 
ATOM   196  C  C   . GLU A 1 34  ? 47.128 -42.395 -28.215 1.00 82.99  ? 564  GLU A C   1 
ATOM   197  O  O   . GLU A 1 34  ? 47.652 -41.487 -28.860 1.00 83.15  ? 564  GLU A O   1 
ATOM   198  C  CB  . GLU A 1 34  ? 45.636 -43.732 -29.726 1.00 83.37  ? 564  GLU A CB  1 
ATOM   199  C  CG  . GLU A 1 34  ? 46.377 -45.037 -29.560 1.00 84.62  ? 564  GLU A CG  1 
ATOM   200  C  CD  . GLU A 1 34  ? 46.633 -45.723 -30.886 1.00 86.58  ? 564  GLU A CD  1 
ATOM   201  O  OE1 . GLU A 1 34  ? 47.773 -46.204 -31.092 1.00 87.78  ? 564  GLU A OE1 1 
ATOM   202  O  OE2 . GLU A 1 34  ? 45.702 -45.776 -31.725 1.00 87.06  ? 564  GLU A OE2 1 
ATOM   203  N  N   . VAL A 1 35  ? 47.768 -43.061 -27.251 1.00 82.66  ? 565  VAL A N   1 
ATOM   204  C  CA  . VAL A 1 35  ? 49.157 -42.752 -26.878 1.00 82.43  ? 565  VAL A CA  1 
ATOM   205  C  C   . VAL A 1 35  ? 50.109 -42.886 -28.052 1.00 82.34  ? 565  VAL A C   1 
ATOM   206  O  O   . VAL A 1 35  ? 49.992 -43.815 -28.860 1.00 82.43  ? 565  VAL A O   1 
ATOM   207  C  CB  . VAL A 1 35  ? 49.692 -43.641 -25.745 1.00 82.37  ? 565  VAL A CB  1 
ATOM   208  C  CG1 . VAL A 1 35  ? 48.841 -43.493 -24.514 1.00 82.87  ? 565  VAL A CG1 1 
ATOM   209  C  CG2 . VAL A 1 35  ? 49.762 -45.096 -26.178 1.00 82.50  ? 565  VAL A CG2 1 
ATOM   210  N  N   . SER A 1 36  ? 51.063 -41.961 -28.126 1.00 82.18  ? 566  SER A N   1 
ATOM   211  C  CA  . SER A 1 36  ? 51.930 -41.850 -29.291 1.00 81.90  ? 566  SER A CA  1 
ATOM   212  C  C   . SER A 1 36  ? 53.361 -41.470 -28.926 1.00 81.53  ? 566  SER A C   1 
ATOM   213  O  O   . SER A 1 36  ? 54.264 -41.576 -29.751 1.00 81.57  ? 566  SER A O   1 
ATOM   214  C  CB  . SER A 1 36  ? 51.343 -40.819 -30.261 1.00 81.98  ? 566  SER A CB  1 
ATOM   215  O  OG  . SER A 1 36  ? 51.746 -41.083 -31.592 1.00 82.69  ? 566  SER A OG  1 
ATOM   216  N  N   . ILE A 1 37  ? 53.563 -41.036 -27.688 1.00 81.27  ? 567  ILE A N   1 
ATOM   217  C  CA  . ILE A 1 37  ? 54.816 -40.404 -27.290 1.00 81.15  ? 567  ILE A CA  1 
ATOM   218  C  C   . ILE A 1 37  ? 55.537 -41.097 -26.138 1.00 81.16  ? 567  ILE A C   1 
ATOM   219  O  O   . ILE A 1 37  ? 55.006 -41.204 -25.012 1.00 81.47  ? 567  ILE A O   1 
ATOM   220  C  CB  . ILE A 1 37  ? 54.576 -38.940 -26.871 1.00 81.11  ? 567  ILE A CB  1 
ATOM   221  C  CG1 . ILE A 1 37  ? 53.745 -38.196 -27.919 1.00 81.89  ? 567  ILE A CG1 1 
ATOM   222  C  CG2 . ILE A 1 37  ? 55.891 -38.238 -26.611 1.00 80.95  ? 567  ILE A CG2 1 
ATOM   223  C  CD1 . ILE A 1 37  ? 54.379 -38.129 -29.328 1.00 83.31  ? 567  ILE A CD1 1 
ATOM   224  N  N   . VAL A 1 38  ? 56.762 -41.538 -26.408 1.00 80.87  ? 568  VAL A N   1 
ATOM   225  C  CA  . VAL A 1 38  ? 57.634 -42.008 -25.341 1.00 80.80  ? 568  VAL A CA  1 
ATOM   226  C  C   . VAL A 1 38  ? 58.318 -40.813 -24.696 1.00 80.98  ? 568  VAL A C   1 
ATOM   227  O  O   . VAL A 1 38  ? 58.865 -39.958 -25.406 1.00 81.41  ? 568  VAL A O   1 
ATOM   228  C  CB  . VAL A 1 38  ? 58.730 -42.913 -25.857 1.00 80.56  ? 568  VAL A CB  1 
ATOM   229  C  CG1 . VAL A 1 38  ? 59.204 -43.784 -24.732 1.00 80.70  ? 568  VAL A CG1 1 
ATOM   230  C  CG2 . VAL A 1 38  ? 58.229 -43.752 -27.001 1.00 80.53  ? 568  VAL A CG2 1 
ATOM   231  N  N   . PHE A 1 39  ? 58.298 -40.748 -23.366 1.00 80.79  ? 569  PHE A N   1 
ATOM   232  C  CA  . PHE A 1 39  ? 59.007 -39.690 -22.657 1.00 80.80  ? 569  PHE A CA  1 
ATOM   233  C  C   . PHE A 1 39  ? 60.506 -39.938 -22.601 1.00 80.92  ? 569  PHE A C   1 
ATOM   234  O  O   . PHE A 1 39  ? 60.953 -41.079 -22.506 1.00 81.09  ? 569  PHE A O   1 
ATOM   235  C  CB  . PHE A 1 39  ? 58.499 -39.547 -21.230 1.00 81.07  ? 569  PHE A CB  1 
ATOM   236  C  CG  . PHE A 1 39  ? 57.139 -38.930 -21.121 1.00 81.19  ? 569  PHE A CG  1 
ATOM   237  C  CD1 . PHE A 1 39  ? 56.860 -37.716 -21.733 1.00 81.49  ? 569  PHE A CD1 1 
ATOM   238  C  CD2 . PHE A 1 39  ? 56.148 -39.547 -20.361 1.00 81.67  ? 569  PHE A CD2 1 
ATOM   239  C  CE1 . PHE A 1 39  ? 55.607 -37.140 -21.619 1.00 82.34  ? 569  PHE A CE1 1 
ATOM   240  C  CE2 . PHE A 1 39  ? 54.893 -38.984 -20.231 1.00 82.49  ? 569  PHE A CE2 1 
ATOM   241  C  CZ  . PHE A 1 39  ? 54.612 -37.779 -20.859 1.00 82.74  ? 569  PHE A CZ  1 
ATOM   242  N  N   . ILE A 1 40  ? 61.272 -38.853 -22.660 1.00 80.92  ? 570  ILE A N   1 
ATOM   243  C  CA  . ILE A 1 40  ? 62.696 -38.874 -22.374 1.00 80.98  ? 570  ILE A CA  1 
ATOM   244  C  C   . ILE A 1 40  ? 62.883 -38.143 -21.056 1.00 81.23  ? 570  ILE A C   1 
ATOM   245  O  O   . ILE A 1 40  ? 62.487 -36.988 -20.948 1.00 81.58  ? 570  ILE A O   1 
ATOM   246  C  CB  . ILE A 1 40  ? 63.475 -38.135 -23.456 1.00 80.85  ? 570  ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 40  ? 63.209 -38.754 -24.830 1.00 81.39  ? 570  ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 40  ? 64.959 -38.107 -23.133 1.00 81.31  ? 570  ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 40  ? 63.406 -40.267 -24.886 1.00 82.87  ? 570  ILE A CD1 1 
ATOM   250  N  N   . PRO A 1 41  ? 63.510 -38.787 -20.054 1.00 81.43  ? 571  PRO A N   1 
ATOM   251  C  CA  . PRO A 1 41  ? 64.204 -40.061 -20.104 1.00 81.72  ? 571  PRO A CA  1 
ATOM   252  C  C   . PRO A 1 41  ? 63.403 -41.217 -19.519 1.00 82.08  ? 571  PRO A C   1 
ATOM   253  O  O   . PRO A 1 41  ? 63.864 -42.363 -19.567 1.00 82.42  ? 571  PRO A O   1 
ATOM   254  C  CB  . PRO A 1 41  ? 65.409 -39.800 -19.203 1.00 81.74  ? 571  PRO A CB  1 
ATOM   255  C  CG  . PRO A 1 41  ? 64.875 -38.789 -18.160 1.00 81.52  ? 571  PRO A CG  1 
ATOM   256  C  CD  . PRO A 1 41  ? 63.586 -38.209 -18.700 1.00 81.34  ? 571  PRO A CD  1 
ATOM   257  N  N   . CYS A 1 42  ? 62.223 -40.922 -18.978 1.00 82.29  ? 572  CYS A N   1 
ATOM   258  C  CA  . CYS A 1 42  ? 61.507 -41.882 -18.142 1.00 82.39  ? 572  CYS A CA  1 
ATOM   259  C  C   . CYS A 1 42  ? 60.957 -43.066 -18.934 1.00 82.69  ? 572  CYS A C   1 
ATOM   260  O  O   . CYS A 1 42  ? 60.641 -44.108 -18.365 1.00 82.77  ? 572  CYS A O   1 
ATOM   261  C  CB  . CYS A 1 42  ? 60.421 -41.178 -17.324 1.00 82.40  ? 572  CYS A CB  1 
ATOM   262  S  SG  . CYS A 1 42  ? 58.754 -41.363 -17.901 1.00 81.02  ? 572  CYS A SG  1 
ATOM   263  N  N   . GLY A 1 43  ? 60.854 -42.903 -20.246 1.00 82.94  ? 573  GLY A N   1 
ATOM   264  C  CA  . GLY A 1 43  ? 60.553 -44.021 -21.125 1.00 83.42  ? 573  GLY A CA  1 
ATOM   265  C  C   . GLY A 1 43  ? 59.105 -44.463 -21.117 1.00 83.67  ? 573  GLY A C   1 
ATOM   266  O  O   . GLY A 1 43  ? 58.777 -45.517 -21.651 1.00 83.95  ? 573  GLY A O   1 
ATOM   267  N  N   . HIS A 1 44  ? 58.234 -43.670 -20.510 1.00 83.87  ? 574  HIS A N   1 
ATOM   268  C  CA  . HIS A 1 44  ? 56.819 -43.986 -20.515 1.00 84.35  ? 574  HIS A CA  1 
ATOM   269  C  C   . HIS A 1 44  ? 56.163 -43.646 -21.849 1.00 85.16  ? 574  HIS A C   1 
ATOM   270  O  O   . HIS A 1 44  ? 56.324 -42.532 -22.386 1.00 85.87  ? 574  HIS A O   1 
ATOM   271  C  CB  . HIS A 1 44  ? 56.110 -43.251 -19.391 1.00 84.05  ? 574  HIS A CB  1 
ATOM   272  C  CG  . HIS A 1 44  ? 56.397 -43.815 -18.045 1.00 83.48  ? 574  HIS A CG  1 
ATOM   273  N  ND1 . HIS A 1 44  ? 56.985 -43.082 -17.039 1.00 82.53  ? 574  HIS A ND1 1 
ATOM   274  C  CD2 . HIS A 1 44  ? 56.194 -45.055 -17.544 1.00 82.64  ? 574  HIS A CD2 1 
ATOM   275  C  CE1 . HIS A 1 44  ? 57.121 -43.846 -15.971 1.00 82.55  ? 574  HIS A CE1 1 
ATOM   276  N  NE2 . HIS A 1 44  ? 56.648 -45.046 -16.251 1.00 82.40  ? 574  HIS A NE2 1 
ATOM   277  N  N   . LEU A 1 45  ? 55.427 -44.613 -22.390 1.00 85.56  ? 575  LEU A N   1 
ATOM   278  C  CA  . LEU A 1 45  ? 54.605 -44.374 -23.572 1.00 85.60  ? 575  LEU A CA  1 
ATOM   279  C  C   . LEU A 1 45  ? 53.177 -44.285 -23.058 1.00 85.96  ? 575  LEU A C   1 
ATOM   280  O  O   . LEU A 1 45  ? 52.467 -45.286 -22.971 1.00 86.08  ? 575  LEU A O   1 
ATOM   281  C  CB  . LEU A 1 45  ? 54.801 -45.491 -24.601 1.00 85.27  ? 575  LEU A CB  1 
ATOM   282  C  CG  . LEU A 1 45  ? 53.877 -45.621 -25.807 1.00 84.77  ? 575  LEU A CG  1 
ATOM   283  C  CD1 . LEU A 1 45  ? 53.667 -44.308 -26.519 1.00 85.06  ? 575  LEU A CD1 1 
ATOM   284  C  CD2 . LEU A 1 45  ? 54.462 -46.637 -26.750 1.00 85.35  ? 575  LEU A CD2 1 
ATOM   285  N  N   . VAL A 1 46  ? 52.766 -43.077 -22.690 1.00 86.32  ? 576  VAL A N   1 
ATOM   286  C  CA  . VAL A 1 46  ? 51.609 -42.951 -21.814 1.00 86.75  ? 576  VAL A CA  1 
ATOM   287  C  C   . VAL A 1 46  ? 50.670 -41.761 -22.109 1.00 86.95  ? 576  VAL A C   1 
ATOM   288  O  O   . VAL A 1 46  ? 49.573 -41.674 -21.545 1.00 87.07  ? 576  VAL A O   1 
ATOM   289  C  CB  . VAL A 1 46  ? 52.066 -43.013 -20.322 1.00 86.66  ? 576  VAL A CB  1 
ATOM   290  C  CG1 . VAL A 1 46  ? 52.815 -41.760 -19.926 1.00 87.18  ? 576  VAL A CG1 1 
ATOM   291  C  CG2 . VAL A 1 46  ? 50.899 -43.252 -19.399 1.00 86.93  ? 576  VAL A CG2 1 
ATOM   292  N  N   . VAL A 1 47  ? 51.084 -40.861 -22.999 1.00 87.15  ? 577  VAL A N   1 
ATOM   293  C  CA  . VAL A 1 47  ? 50.214 -39.752 -23.426 1.00 87.19  ? 577  VAL A CA  1 
ATOM   294  C  C   . VAL A 1 47  ? 50.184 -39.643 -24.952 1.00 87.23  ? 577  VAL A C   1 
ATOM   295  O  O   . VAL A 1 47  ? 51.032 -40.217 -25.648 1.00 87.27  ? 577  VAL A O   1 
ATOM   296  C  CB  . VAL A 1 47  ? 50.651 -38.386 -22.819 1.00 87.13  ? 577  VAL A CB  1 
ATOM   297  C  CG1 . VAL A 1 47  ? 50.814 -38.477 -21.313 1.00 86.98  ? 577  VAL A CG1 1 
ATOM   298  C  CG2 . VAL A 1 47  ? 51.952 -37.897 -23.452 1.00 87.57  ? 577  VAL A CG2 1 
ATOM   299  N  N   . CYS A 1 48  ? 49.210 -38.903 -25.469 1.00 87.22  ? 578  CYS A N   1 
ATOM   300  C  CA  . CYS A 1 48  ? 49.174 -38.609 -26.897 1.00 87.16  ? 578  CYS A CA  1 
ATOM   301  C  C   . CYS A 1 48  ? 49.959 -37.336 -27.207 1.00 87.39  ? 578  CYS A C   1 
ATOM   302  O  O   . CYS A 1 48  ? 50.183 -36.494 -26.323 1.00 87.26  ? 578  CYS A O   1 
ATOM   303  C  CB  . CYS A 1 48  ? 47.731 -38.486 -27.397 1.00 87.09  ? 578  CYS A CB  1 
ATOM   304  S  SG  . CYS A 1 48  ? 46.946 -36.885 -27.111 1.00 85.87  ? 578  CYS A SG  1 
ATOM   305  N  N   . LYS A 1 49  ? 50.360 -37.206 -28.470 1.00 87.56  ? 579  LYS A N   1 
ATOM   306  C  CA  . LYS A 1 49  ? 51.098 -36.037 -28.956 1.00 87.90  ? 579  LYS A CA  1 
ATOM   307  C  C   . LYS A 1 49  ? 50.594 -34.712 -28.379 1.00 87.71  ? 579  LYS A C   1 
ATOM   308  O  O   . LYS A 1 49  ? 51.388 -33.886 -27.926 1.00 87.77  ? 579  LYS A O   1 
ATOM   309  C  CB  . LYS A 1 49  ? 51.097 -35.995 -30.494 1.00 88.02  ? 579  LYS A CB  1 
ATOM   310  C  CG  . LYS A 1 49  ? 49.777 -36.451 -31.137 1.00 88.61  ? 579  LYS A CG  1 
ATOM   311  C  CD  . LYS A 1 49  ? 49.713 -36.147 -32.645 1.00 88.43  ? 579  LYS A CD  1 
ATOM   312  C  CE  . LYS A 1 49  ? 48.957 -34.844 -32.934 1.00 88.53  ? 579  LYS A CE  1 
ATOM   313  N  NZ  . LYS A 1 49  ? 48.566 -34.671 -34.366 1.00 88.15  ? 579  LYS A NZ  1 
ATOM   314  N  N   . ASP A 1 50  ? 49.277 -34.527 -28.374 1.00 87.50  ? 580  ASP A N   1 
ATOM   315  C  CA  . ASP A 1 50  ? 48.687 -33.262 -27.953 1.00 87.35  ? 580  ASP A CA  1 
ATOM   316  C  C   . ASP A 1 50  ? 48.844 -32.920 -26.469 1.00 87.25  ? 580  ASP A C   1 
ATOM   317  O  O   . ASP A 1 50  ? 49.112 -31.769 -26.135 1.00 87.34  ? 580  ASP A O   1 
ATOM   318  C  CB  . ASP A 1 50  ? 47.217 -33.185 -28.369 1.00 87.37  ? 580  ASP A CB  1 
ATOM   319  C  CG  . ASP A 1 50  ? 47.042 -32.974 -29.860 1.00 87.44  ? 580  ASP A CG  1 
ATOM   320  O  OD1 . ASP A 1 50  ? 45.883 -32.906 -30.317 1.00 87.48  ? 580  ASP A OD1 1 
ATOM   321  O  OD2 . ASP A 1 50  ? 48.058 -32.872 -30.577 1.00 87.78  ? 580  ASP A OD2 1 
ATOM   322  N  N   . CYS A 1 51  ? 48.677 -33.895 -25.579 1.00 87.10  ? 581  CYS A N   1 
ATOM   323  C  CA  . CYS A 1 51  ? 48.718 -33.592 -24.146 1.00 86.88  ? 581  CYS A CA  1 
ATOM   324  C  C   . CYS A 1 51  ? 50.122 -33.233 -23.650 1.00 87.60  ? 581  CYS A C   1 
ATOM   325  O  O   . CYS A 1 51  ? 50.270 -32.457 -22.697 1.00 87.57  ? 581  CYS A O   1 
ATOM   326  C  CB  . CYS A 1 51  ? 48.146 -34.739 -23.316 1.00 86.57  ? 581  CYS A CB  1 
ATOM   327  S  SG  . CYS A 1 51  ? 46.367 -34.986 -23.441 1.00 83.59  ? 581  CYS A SG  1 
ATOM   328  N  N   . ALA A 1 52  ? 51.137 -33.784 -24.318 1.00 88.28  ? 582  ALA A N   1 
ATOM   329  C  CA  . ALA A 1 52  ? 52.547 -33.673 -23.897 1.00 88.95  ? 582  ALA A CA  1 
ATOM   330  C  C   . ALA A 1 52  ? 53.023 -32.283 -23.431 1.00 89.48  ? 582  ALA A C   1 
ATOM   331  O  O   . ALA A 1 52  ? 53.456 -32.137 -22.280 1.00 89.34  ? 582  ALA A O   1 
ATOM   332  C  CB  . ALA A 1 52  ? 53.472 -34.228 -24.982 1.00 88.95  ? 582  ALA A CB  1 
ATOM   333  N  N   . PRO A 1 53  ? 52.932 -31.262 -24.313 1.00 90.11  ? 583  PRO A N   1 
ATOM   334  C  CA  . PRO A 1 53  ? 53.438 -29.915 -24.018 1.00 90.62  ? 583  PRO A CA  1 
ATOM   335  C  C   . PRO A 1 53  ? 53.001 -29.336 -22.673 1.00 91.04  ? 583  PRO A C   1 
ATOM   336  O  O   . PRO A 1 53  ? 53.752 -28.581 -22.048 1.00 91.14  ? 583  PRO A O   1 
ATOM   337  C  CB  . PRO A 1 53  ? 52.855 -29.075 -25.155 1.00 90.59  ? 583  PRO A CB  1 
ATOM   338  C  CG  . PRO A 1 53  ? 52.772 -30.021 -26.286 1.00 90.42  ? 583  PRO A CG  1 
ATOM   339  C  CD  . PRO A 1 53  ? 52.336 -31.315 -25.663 1.00 90.17  ? 583  PRO A CD  1 
ATOM   340  N  N   . SER A 1 54  ? 51.807 -29.695 -22.223 1.00 91.49  ? 584  SER A N   1 
ATOM   341  C  CA  . SER A 1 54  ? 51.277 -29.122 -20.998 1.00 91.95  ? 584  SER A CA  1 
ATOM   342  C  C   . SER A 1 54  ? 51.886 -29.746 -19.748 1.00 92.17  ? 584  SER A C   1 
ATOM   343  O  O   . SER A 1 54  ? 51.529 -29.364 -18.633 1.00 92.24  ? 584  SER A O   1 
ATOM   344  C  CB  . SER A 1 54  ? 49.760 -29.252 -20.977 1.00 91.92  ? 584  SER A CB  1 
ATOM   345  O  OG  . SER A 1 54  ? 49.218 -28.901 -22.237 1.00 92.42  ? 584  SER A OG  1 
ATOM   346  N  N   . LEU A 1 55  ? 52.815 -30.682 -19.938 1.00 92.48  ? 585  LEU A N   1 
ATOM   347  C  CA  . LEU A 1 55  ? 53.383 -31.449 -18.828 1.00 92.92  ? 585  LEU A CA  1 
ATOM   348  C  C   . LEU A 1 55  ? 54.862 -31.188 -18.615 1.00 93.04  ? 585  LEU A C   1 
ATOM   349  O  O   . LEU A 1 55  ? 55.626 -31.127 -19.578 1.00 93.14  ? 585  LEU A O   1 
ATOM   350  C  CB  . LEU A 1 55  ? 53.186 -32.939 -19.072 1.00 92.97  ? 585  LEU A CB  1 
ATOM   351  C  CG  . LEU A 1 55  ? 51.762 -33.364 -19.417 1.00 93.66  ? 585  LEU A CG  1 
ATOM   352  C  CD1 . LEU A 1 55  ? 51.791 -34.608 -20.293 1.00 94.45  ? 585  LEU A CD1 1 
ATOM   353  C  CD2 . LEU A 1 55  ? 50.910 -33.571 -18.150 1.00 93.63  ? 585  LEU A CD2 1 
ATOM   354  N  N   . ARG A 1 56  ? 55.258 -31.047 -17.351 1.00 93.16  ? 586  ARG A N   1 
ATOM   355  C  CA  . ARG A 1 56  ? 56.665 -30.915 -16.991 1.00 93.55  ? 586  ARG A CA  1 
ATOM   356  C  C   . ARG A 1 56  ? 57.221 -32.247 -16.539 1.00 93.28  ? 586  ARG A C   1 
ATOM   357  O  O   . ARG A 1 56  ? 58.354 -32.623 -16.876 1.00 93.42  ? 586  ARG A O   1 
ATOM   358  C  CB  . ARG A 1 56  ? 56.868 -29.865 -15.896 1.00 93.81  ? 586  ARG A CB  1 
ATOM   359  C  CG  . ARG A 1 56  ? 56.970 -28.446 -16.428 1.00 96.50  ? 586  ARG A CG  1 
ATOM   360  C  CD  . ARG A 1 56  ? 58.002 -28.351 -17.586 1.00 101.72 ? 586  ARG A CD  1 
ATOM   361  N  NE  . ARG A 1 56  ? 57.697 -27.345 -18.619 1.00 104.65 ? 586  ARG A NE  1 
ATOM   362  C  CZ  . ARG A 1 56  ? 56.481 -27.020 -19.083 1.00 106.46 ? 586  ARG A CZ  1 
ATOM   363  N  NH1 . ARG A 1 56  ? 55.364 -27.614 -18.643 1.00 106.24 ? 586  ARG A NH1 1 
ATOM   364  N  NH2 . ARG A 1 56  ? 56.387 -26.081 -20.019 1.00 107.49 ? 586  ARG A NH2 1 
ATOM   365  N  N   . LYS A 1 57  ? 56.408 -32.957 -15.769 1.00 92.95  ? 587  LYS A N   1 
ATOM   366  C  CA  . LYS A 1 57  ? 56.783 -34.257 -15.254 1.00 92.53  ? 587  LYS A CA  1 
ATOM   367  C  C   . LYS A 1 57  ? 55.865 -35.290 -15.856 1.00 92.05  ? 587  LYS A C   1 
ATOM   368  O  O   . LYS A 1 57  ? 54.682 -35.024 -16.090 1.00 92.11  ? 587  LYS A O   1 
ATOM   369  C  CB  . LYS A 1 57  ? 56.679 -34.278 -13.730 1.00 92.58  ? 587  LYS A CB  1 
ATOM   370  C  CG  . LYS A 1 57  ? 57.654 -33.333 -13.043 1.00 93.22  ? 587  LYS A CG  1 
ATOM   371  C  CD  . LYS A 1 57  ? 57.275 -33.097 -11.591 1.00 94.25  ? 587  LYS A CD  1 
ATOM   372  C  CE  . LYS A 1 57  ? 58.417 -32.437 -10.827 1.00 94.97  ? 587  LYS A CE  1 
ATOM   373  N  NZ  . LYS A 1 57  ? 58.194 -32.489 -9.350  1.00 95.48  ? 587  LYS A NZ  1 
ATOM   374  N  N   . CYS A 1 58  ? 56.424 -36.459 -16.139 1.00 91.36  ? 588  CYS A N   1 
ATOM   375  C  CA  . CYS A 1 58  ? 55.624 -37.598 -16.547 1.00 91.05  ? 588  CYS A CA  1 
ATOM   376  C  C   . CYS A 1 58  ? 54.609 -37.882 -15.452 1.00 90.84  ? 588  CYS A C   1 
ATOM   377  O  O   . CYS A 1 58  ? 54.957 -37.963 -14.276 1.00 90.84  ? 588  CYS A O   1 
ATOM   378  C  CB  . CYS A 1 58  ? 56.504 -38.813 -16.813 1.00 90.90  ? 588  CYS A CB  1 
ATOM   379  S  SG  . CYS A 1 58  ? 55.736 -40.420 -16.569 1.00 90.42  ? 588  CYS A SG  1 
ATOM   380  N  N   . PRO A 1 59  ? 53.339 -38.000 -15.841 1.00 90.70  ? 589  PRO A N   1 
ATOM   381  C  CA  . PRO A 1 59  ? 52.241 -38.147 -14.895 1.00 90.55  ? 589  PRO A CA  1 
ATOM   382  C  C   . PRO A 1 59  ? 52.300 -39.443 -14.096 1.00 90.30  ? 589  PRO A C   1 
ATOM   383  O  O   . PRO A 1 59  ? 51.641 -39.550 -13.064 1.00 90.21  ? 589  PRO A O   1 
ATOM   384  C  CB  . PRO A 1 59  ? 51.006 -38.148 -15.798 1.00 90.62  ? 589  PRO A CB  1 
ATOM   385  C  CG  . PRO A 1 59  ? 51.517 -38.596 -17.131 1.00 90.81  ? 589  PRO A CG  1 
ATOM   386  C  CD  . PRO A 1 59  ? 52.872 -37.995 -17.239 1.00 90.67  ? 589  PRO A CD  1 
ATOM   387  N  N   . ILE A 1 60  ? 53.080 -40.413 -14.565 1.00 90.03  ? 590  ILE A N   1 
ATOM   388  C  CA  . ILE A 1 60  ? 53.118 -41.719 -13.922 1.00 89.82  ? 590  ILE A CA  1 
ATOM   389  C  C   . ILE A 1 60  ? 54.157 -41.748 -12.813 1.00 89.62  ? 590  ILE A C   1 
ATOM   390  O  O   . ILE A 1 60  ? 53.797 -41.747 -11.640 1.00 89.77  ? 590  ILE A O   1 
ATOM   391  C  CB  . ILE A 1 60  ? 53.266 -42.866 -14.945 1.00 89.79  ? 590  ILE A CB  1 
ATOM   392  C  CG1 . ILE A 1 60  ? 51.893 -43.436 -15.292 1.00 89.97  ? 590  ILE A CG1 1 
ATOM   393  C  CG2 . ILE A 1 60  ? 54.045 -44.010 -14.370 1.00 90.31  ? 590  ILE A CG2 1 
ATOM   394  C  CD1 . ILE A 1 60  ? 50.897 -42.430 -15.812 1.00 90.80  ? 590  ILE A CD1 1 
ATOM   395  N  N   . CYS A 1 61  ? 55.436 -41.777 -13.172 1.00 89.45  ? 591  CYS A N   1 
ATOM   396  C  CA  . CYS A 1 61  ? 56.484 -41.512 -12.201 1.00 89.23  ? 591  CYS A CA  1 
ATOM   397  C  C   . CYS A 1 61  ? 56.674 -40.023 -12.335 1.00 89.42  ? 591  CYS A C   1 
ATOM   398  O  O   . CYS A 1 61  ? 56.709 -39.507 -13.461 1.00 89.85  ? 591  CYS A O   1 
ATOM   399  C  CB  . CYS A 1 61  ? 57.777 -42.251 -12.546 1.00 88.91  ? 591  CYS A CB  1 
ATOM   400  S  SG  . CYS A 1 61  ? 58.727 -41.547 -13.931 1.00 88.24  ? 591  CYS A SG  1 
ATOM   401  N  N   . ARG A 1 62  ? 56.775 -39.320 -11.215 1.00 89.28  ? 592  ARG A N   1 
ATOM   402  C  CA  . ARG A 1 62  ? 56.884 -37.869 -11.289 1.00 89.32  ? 592  ARG A CA  1 
ATOM   403  C  C   . ARG A 1 62  ? 58.240 -37.413 -11.848 1.00 88.93  ? 592  ARG A C   1 
ATOM   404  O  O   . ARG A 1 62  ? 58.637 -36.261 -11.693 1.00 89.01  ? 592  ARG A O   1 
ATOM   405  C  CB  . ARG A 1 62  ? 56.536 -37.213 -9.951  1.00 89.59  ? 592  ARG A CB  1 
ATOM   406  C  CG  . ARG A 1 62  ? 55.022 -37.061 -9.728  1.00 90.82  ? 592  ARG A CG  1 
ATOM   407  C  CD  . ARG A 1 62  ? 54.719 -36.064 -8.618  1.00 92.75  ? 592  ARG A CD  1 
ATOM   408  N  NE  . ARG A 1 62  ? 55.311 -36.472 -7.342  1.00 94.41  ? 592  ARG A NE  1 
ATOM   409  C  CZ  . ARG A 1 62  ? 55.889 -35.641 -6.477  1.00 95.42  ? 592  ARG A CZ  1 
ATOM   410  N  NH1 . ARG A 1 62  ? 55.966 -34.340 -6.744  1.00 95.99  ? 592  ARG A NH1 1 
ATOM   411  N  NH2 . ARG A 1 62  ? 56.397 -36.109 -5.340  1.00 95.54  ? 592  ARG A NH2 1 
ATOM   412  N  N   . SER A 1 63  ? 58.929 -38.331 -12.522 1.00 88.47  ? 593  SER A N   1 
ATOM   413  C  CA  . SER A 1 63  ? 60.126 -38.002 -13.270 1.00 87.93  ? 593  SER A CA  1 
ATOM   414  C  C   . SER A 1 63  ? 59.808 -36.896 -14.236 1.00 87.23  ? 593  SER A C   1 
ATOM   415  O  O   . SER A 1 63  ? 58.809 -36.944 -14.945 1.00 86.97  ? 593  SER A O   1 
ATOM   416  C  CB  . SER A 1 63  ? 60.641 -39.209 -14.048 1.00 88.25  ? 593  SER A CB  1 
ATOM   417  O  OG  . SER A 1 63  ? 61.810 -38.893 -14.788 1.00 89.12  ? 593  SER A OG  1 
ATOM   418  N  N   . THR A 1 64  ? 60.682 -35.899 -14.233 1.00 86.79  ? 594  THR A N   1 
ATOM   419  C  CA  . THR A 1 64  ? 60.590 -34.726 -15.088 1.00 86.09  ? 594  THR A CA  1 
ATOM   420  C  C   . THR A 1 64  ? 60.978 -35.043 -16.540 1.00 85.52  ? 594  THR A C   1 
ATOM   421  O  O   . THR A 1 64  ? 61.996 -35.708 -16.803 1.00 85.37  ? 594  THR A O   1 
ATOM   422  C  CB  . THR A 1 64  ? 61.465 -33.578 -14.527 1.00 86.19  ? 594  THR A CB  1 
ATOM   423  O  OG1 . THR A 1 64  ? 61.527 -32.521 -15.483 1.00 86.61  ? 594  THR A OG1 1 
ATOM   424  C  CG2 . THR A 1 64  ? 62.898 -34.060 -14.191 1.00 85.73  ? 594  THR A CG2 1 
ATOM   425  N  N   . ILE A 1 65  ? 60.154 -34.560 -17.468 1.00 84.61  ? 595  ILE A N   1 
ATOM   426  C  CA  . ILE A 1 65  ? 60.339 -34.814 -18.897 1.00 83.82  ? 595  ILE A CA  1 
ATOM   427  C  C   . ILE A 1 65  ? 61.428 -33.915 -19.443 1.00 83.20  ? 595  ILE A C   1 
ATOM   428  O  O   . ILE A 1 65  ? 61.488 -32.746 -19.094 1.00 83.41  ? 595  ILE A O   1 
ATOM   429  C  CB  . ILE A 1 65  ? 59.044 -34.551 -19.682 1.00 83.87  ? 595  ILE A CB  1 
ATOM   430  C  CG1 . ILE A 1 65  ? 57.895 -35.383 -19.104 1.00 84.38  ? 595  ILE A CG1 1 
ATOM   431  C  CG2 . ILE A 1 65  ? 59.239 -34.868 -21.153 1.00 83.30  ? 595  ILE A CG2 1 
ATOM   432  C  CD1 . ILE A 1 65  ? 56.553 -34.692 -19.162 1.00 85.69  ? 595  ILE A CD1 1 
ATOM   433  N  N   . LYS A 1 66  ? 62.281 -34.464 -20.299 1.00 82.41  ? 596  LYS A N   1 
ATOM   434  C  CA  . LYS A 1 66  ? 63.403 -33.724 -20.868 1.00 81.88  ? 596  LYS A CA  1 
ATOM   435  C  C   . LYS A 1 66  ? 63.425 -33.859 -22.385 1.00 81.37  ? 596  LYS A C   1 
ATOM   436  O  O   . LYS A 1 66  ? 64.319 -33.338 -23.059 1.00 81.47  ? 596  LYS A O   1 
ATOM   437  C  CB  . LYS A 1 66  ? 64.737 -34.223 -20.287 1.00 81.96  ? 596  LYS A CB  1 
ATOM   438  C  CG  . LYS A 1 66  ? 64.803 -34.306 -18.755 1.00 82.66  ? 596  LYS A CG  1 
ATOM   439  C  CD  . LYS A 1 66  ? 64.793 -32.937 -18.067 1.00 83.00  ? 596  LYS A CD  1 
ATOM   440  C  CE  . LYS A 1 66  ? 66.201 -32.425 -17.803 1.00 83.02  ? 596  LYS A CE  1 
ATOM   441  N  NZ  . LYS A 1 66  ? 66.140 -31.087 -17.158 1.00 83.59  ? 596  LYS A NZ  1 
ATOM   442  N  N   . GLY A 1 67  ? 62.437 -34.567 -22.919 1.00 80.78  ? 597  GLY A N   1 
ATOM   443  C  CA  . GLY A 1 67  ? 62.363 -34.836 -24.353 1.00 79.80  ? 597  GLY A CA  1 
ATOM   444  C  C   . GLY A 1 67  ? 61.234 -35.797 -24.670 1.00 79.14  ? 597  GLY A C   1 
ATOM   445  O  O   . GLY A 1 67  ? 60.530 -36.282 -23.771 1.00 78.87  ? 597  GLY A O   1 
ATOM   446  N  N   . THR A 1 68  ? 61.055 -36.068 -25.957 1.00 78.36  ? 598  THR A N   1 
ATOM   447  C  CA  . THR A 1 68  ? 60.037 -37.006 -26.399 1.00 77.48  ? 598  THR A CA  1 
ATOM   448  C  C   . THR A 1 68  ? 60.575 -37.781 -27.576 1.00 77.00  ? 598  THR A C   1 
ATOM   449  O  O   . THR A 1 68  ? 61.353 -37.247 -28.382 1.00 77.02  ? 598  THR A O   1 
ATOM   450  C  CB  . THR A 1 68  ? 58.750 -36.298 -26.872 1.00 77.46  ? 598  THR A CB  1 
ATOM   451  O  OG1 . THR A 1 68  ? 58.938 -35.772 -28.195 1.00 77.75  ? 598  THR A OG1 1 
ATOM   452  C  CG2 . THR A 1 68  ? 58.352 -35.168 -25.940 1.00 77.39  ? 598  THR A CG2 1 
ATOM   453  N  N   . VAL A 1 69  ? 60.172 -39.042 -27.670 1.00 76.29  ? 599  VAL A N   1 
ATOM   454  C  CA  . VAL A 1 69  ? 60.293 -39.768 -28.921 1.00 75.78  ? 599  VAL A CA  1 
ATOM   455  C  C   . VAL A 1 69  ? 58.892 -40.081 -29.414 1.00 75.75  ? 599  VAL A C   1 
ATOM   456  O  O   . VAL A 1 69  ? 58.021 -40.476 -28.633 1.00 76.04  ? 599  VAL A O   1 
ATOM   457  C  CB  . VAL A 1 69  ? 61.134 -41.037 -28.797 1.00 75.47  ? 599  VAL A CB  1 
ATOM   458  C  CG1 . VAL A 1 69  ? 61.162 -41.769 -30.119 1.00 75.34  ? 599  VAL A CG1 1 
ATOM   459  C  CG2 . VAL A 1 69  ? 62.543 -40.682 -28.401 1.00 75.19  ? 599  VAL A CG2 1 
ATOM   460  N  N   . ARG A 1 70  ? 58.679 -39.867 -30.706 1.00 75.55  ? 600  ARG A N   1 
ATOM   461  C  CA  . ARG A 1 70  ? 57.397 -40.109 -31.338 1.00 75.52  ? 600  ARG A CA  1 
ATOM   462  C  C   . ARG A 1 70  ? 57.371 -41.537 -31.864 1.00 75.56  ? 600  ARG A C   1 
ATOM   463  O  O   . ARG A 1 70  ? 58.384 -42.023 -32.377 1.00 75.65  ? 600  ARG A O   1 
ATOM   464  C  CB  . ARG A 1 70  ? 57.199 -39.109 -32.478 1.00 75.57  ? 600  ARG A CB  1 
ATOM   465  C  CG  . ARG A 1 70  ? 56.999 -37.667 -32.007 1.00 75.70  ? 600  ARG A CG  1 
ATOM   466  C  CD  . ARG A 1 70  ? 57.017 -36.713 -33.180 1.00 75.24  ? 600  ARG A CD  1 
ATOM   467  N  NE  . ARG A 1 70  ? 56.412 -35.416 -32.875 1.00 74.60  ? 600  ARG A NE  1 
ATOM   468  C  CZ  . ARG A 1 70  ? 56.145 -34.485 -33.794 1.00 74.97  ? 600  ARG A CZ  1 
ATOM   469  N  NH1 . ARG A 1 70  ? 56.419 -34.697 -35.084 1.00 73.93  ? 600  ARG A NH1 1 
ATOM   470  N  NH2 . ARG A 1 70  ? 55.596 -33.334 -33.424 1.00 75.27  ? 600  ARG A NH2 1 
ATOM   471  N  N   . THR A 1 71  ? 56.225 -42.209 -31.733 1.00 75.48  ? 601  THR A N   1 
ATOM   472  C  CA  . THR A 1 71  ? 56.094 -43.599 -32.179 1.00 75.50  ? 601  THR A CA  1 
ATOM   473  C  C   . THR A 1 71  ? 55.260 -43.749 -33.425 1.00 75.69  ? 601  THR A C   1 
ATOM   474  O  O   . THR A 1 71  ? 54.200 -43.137 -33.571 1.00 75.81  ? 601  THR A O   1 
ATOM   475  C  CB  . THR A 1 71  ? 55.454 -44.483 -31.134 1.00 75.48  ? 601  THR A CB  1 
ATOM   476  O  OG1 . THR A 1 71  ? 54.205 -43.906 -30.725 1.00 75.92  ? 601  THR A OG1 1 
ATOM   477  C  CG2 . THR A 1 71  ? 56.378 -44.651 -29.950 1.00 75.47  ? 601  THR A CG2 1 
ATOM   478  N  N   . PHE A 1 72  ? 55.752 -44.601 -34.309 1.00 76.00  ? 602  PHE A N   1 
ATOM   479  C  CA  . PHE A 1 72  ? 55.154 -44.822 -35.605 1.00 76.37  ? 602  PHE A CA  1 
ATOM   480  C  C   . PHE A 1 72  ? 54.835 -46.305 -35.704 1.00 76.56  ? 602  PHE A C   1 
ATOM   481  O  O   . PHE A 1 72  ? 55.698 -47.135 -36.020 1.00 76.52  ? 602  PHE A O   1 
ATOM   482  C  CB  . PHE A 1 72  ? 56.124 -44.387 -36.708 1.00 76.52  ? 602  PHE A CB  1 
ATOM   483  C  CG  . PHE A 1 72  ? 56.348 -42.896 -36.780 1.00 76.53  ? 602  PHE A CG  1 
ATOM   484  C  CD1 . PHE A 1 72  ? 56.461 -42.128 -35.623 1.00 76.06  ? 602  PHE A CD1 1 
ATOM   485  C  CD2 . PHE A 1 72  ? 56.480 -42.266 -38.014 1.00 77.34  ? 602  PHE A CD2 1 
ATOM   486  C  CE1 . PHE A 1 72  ? 56.672 -40.764 -35.683 1.00 76.18  ? 602  PHE A CE1 1 
ATOM   487  C  CE2 . PHE A 1 72  ? 56.698 -40.891 -38.093 1.00 77.53  ? 602  PHE A CE2 1 
ATOM   488  C  CZ  . PHE A 1 72  ? 56.791 -40.139 -36.919 1.00 77.21  ? 602  PHE A CZ  1 
ATOM   489  N  N   . LEU A 1 73  ? 53.581 -46.624 -35.413 1.00 76.74  ? 603  LEU A N   1 
ATOM   490  C  CA  . LEU A 1 73  ? 53.109 -47.999 -35.361 1.00 76.97  ? 603  LEU A CA  1 
ATOM   491  C  C   . LEU A 1 73  ? 52.749 -48.494 -36.771 1.00 76.99  ? 603  LEU A C   1 
ATOM   492  O  O   . LEU A 1 73  ? 51.911 -49.384 -36.932 1.00 77.09  ? 603  LEU A O   1 
ATOM   493  C  CB  . LEU A 1 73  ? 51.906 -48.098 -34.406 1.00 77.03  ? 603  LEU A CB  1 
ATOM   494  C  CG  . LEU A 1 73  ? 51.828 -47.113 -33.220 1.00 77.75  ? 603  LEU A CG  1 
ATOM   495  C  CD1 . LEU A 1 73  ? 51.098 -45.797 -33.587 1.00 77.79  ? 603  LEU A CD1 1 
ATOM   496  C  CD2 . LEU A 1 73  ? 51.215 -47.753 -31.959 1.00 78.34  ? 603  LEU A CD2 1 
ATOM   497  N  N   . SER A 1 74  ? 53.418 -47.927 -37.778 1.00 76.98  ? 604  SER A N   1 
ATOM   498  C  CA  . SER A 1 74  ? 53.068 -48.102 -39.195 1.00 77.00  ? 604  SER A CA  1 
ATOM   499  C  C   . SER A 1 74  ? 53.132 -49.546 -39.695 1.00 76.99  ? 604  SER A C   1 
ATOM   500  O  O   . SER A 1 74  ? 53.379 -50.483 -38.934 1.00 76.92  ? 604  SER A O   1 
ATOM   501  C  CB  . SER A 1 74  ? 53.956 -47.210 -40.076 1.00 77.04  ? 604  SER A CB  1 
ATOM   502  O  OG  . SER A 1 74  ? 53.845 -45.845 -39.710 1.00 77.12  ? 604  SER A OG  1 
ATOM   503  O  OXT . SER A 1 74  ? 52.933 -49.805 -40.886 1.00 76.96  ? 604  SER A OXT 1 
ATOM   504  N  N   . GLY B 2 1   ? 32.879 -29.491 -26.860 1.00 115.55 ? -1   GLY B N   1 
ATOM   505  C  CA  . GLY B 2 1   ? 33.731 -28.764 -25.873 1.00 115.50 ? -1   GLY B CA  1 
ATOM   506  C  C   . GLY B 2 1   ? 35.008 -28.253 -26.516 1.00 115.44 ? -1   GLY B C   1 
ATOM   507  O  O   . GLY B 2 1   ? 34.951 -27.568 -27.538 1.00 115.56 ? -1   GLY B O   1 
ATOM   508  N  N   . SER B 2 2   ? 36.165 -28.579 -25.938 1.00 115.25 ? 0    SER B N   1 
ATOM   509  C  CA  . SER B 2 2   ? 36.261 -29.379 -24.710 1.00 115.06 ? 0    SER B CA  1 
ATOM   510  C  C   . SER B 2 2   ? 37.067 -28.617 -23.625 1.00 114.81 ? 0    SER B C   1 
ATOM   511  O  O   . SER B 2 2   ? 36.562 -27.602 -23.144 1.00 114.70 ? 0    SER B O   1 
ATOM   512  C  CB  . SER B 2 2   ? 36.761 -30.801 -25.018 1.00 115.12 ? 0    SER B CB  1 
ATOM   513  O  OG  . SER B 2 2   ? 37.629 -30.829 -26.144 1.00 115.37 ? 0    SER B OG  1 
ATOM   514  N  N   . MET B 2 3   ? 38.256 -29.060 -23.188 1.00 114.57 ? 1    MET B N   1 
ATOM   515  C  CA  . MET B 2 3   ? 38.797 -30.411 -23.341 1.00 114.27 ? 1    MET B CA  1 
ATOM   516  C  C   . MET B 2 3   ? 38.548 -31.122 -22.022 1.00 114.21 ? 1    MET B C   1 
ATOM   517  O  O   . MET B 2 3   ? 38.146 -32.292 -21.988 1.00 114.11 ? 1    MET B O   1 
ATOM   518  C  CB  . MET B 2 3   ? 40.292 -30.377 -23.656 1.00 114.10 ? 1    MET B CB  1 
ATOM   519  C  CG  . MET B 2 3   ? 40.898 -31.749 -23.964 1.00 113.87 ? 1    MET B CG  1 
ATOM   520  S  SD  . MET B 2 3   ? 41.218 -32.820 -22.531 1.00 113.25 ? 1    MET B SD  1 
ATOM   521  C  CE  . MET B 2 3   ? 42.833 -32.257 -22.000 1.00 112.67 ? 1    MET B CE  1 
ATOM   522  N  N   . ALA B 2 4   ? 38.797 -30.393 -20.935 1.00 114.15 ? 2    ALA B N   1 
ATOM   523  C  CA  . ALA B 2 4   ? 38.342 -30.787 -19.615 1.00 114.01 ? 2    ALA B CA  1 
ATOM   524  C  C   . ALA B 2 4   ? 36.955 -31.391 -19.759 1.00 113.91 ? 2    ALA B C   1 
ATOM   525  O  O   . ALA B 2 4   ? 36.687 -32.463 -19.225 1.00 113.98 ? 2    ALA B O   1 
ATOM   526  C  CB  . ALA B 2 4   ? 38.303 -29.581 -18.691 1.00 114.04 ? 2    ALA B CB  1 
ATOM   527  N  N   . LEU B 2 5   ? 36.097 -30.703 -20.515 1.00 113.74 ? 3    LEU B N   1 
ATOM   528  C  CA  . LEU B 2 5   ? 34.739 -31.158 -20.797 1.00 113.66 ? 3    LEU B CA  1 
ATOM   529  C  C   . LEU B 2 5   ? 34.710 -32.595 -21.321 1.00 113.53 ? 3    LEU B C   1 
ATOM   530  O  O   . LEU B 2 5   ? 34.290 -33.504 -20.604 1.00 113.64 ? 3    LEU B O   1 
ATOM   531  C  CB  . LEU B 2 5   ? 34.043 -30.200 -21.771 1.00 113.75 ? 3    LEU B CB  1 
ATOM   532  C  CG  . LEU B 2 5   ? 32.531 -30.316 -22.008 1.00 113.73 ? 3    LEU B CG  1 
ATOM   533  C  CD1 . LEU B 2 5   ? 31.941 -28.933 -22.199 1.00 114.02 ? 3    LEU B CD1 1 
ATOM   534  C  CD2 . LEU B 2 5   ? 32.195 -31.207 -23.205 1.00 113.66 ? 3    LEU B CD2 1 
ATOM   535  N  N   . LYS B 2 6   ? 35.165 -32.805 -22.554 1.00 113.30 ? 4    LYS B N   1 
ATOM   536  C  CA  . LYS B 2 6   ? 35.148 -34.142 -23.144 1.00 113.22 ? 4    LYS B CA  1 
ATOM   537  C  C   . LYS B 2 6   ? 35.842 -35.185 -22.243 1.00 113.00 ? 4    LYS B C   1 
ATOM   538  O  O   . LYS B 2 6   ? 35.433 -36.350 -22.211 1.00 113.08 ? 4    LYS B O   1 
ATOM   539  C  CB  . LYS B 2 6   ? 35.671 -34.106 -24.594 1.00 113.31 ? 4    LYS B CB  1 
ATOM   540  C  CG  . LYS B 2 6   ? 36.860 -35.003 -24.925 1.00 114.28 ? 4    LYS B CG  1 
ATOM   541  C  CD  . LYS B 2 6   ? 38.186 -34.319 -24.558 1.00 115.77 ? 4    LYS B CD  1 
ATOM   542  C  CE  . LYS B 2 6   ? 39.409 -35.106 -25.025 1.00 116.17 ? 4    LYS B CE  1 
ATOM   543  N  NZ  . LYS B 2 6   ? 39.631 -35.008 -26.503 1.00 116.24 ? 4    LYS B NZ  1 
ATOM   544  N  N   . ARG B 2 7   ? 36.857 -34.744 -21.493 1.00 112.61 ? 5    ARG B N   1 
ATOM   545  C  CA  . ARG B 2 7   ? 37.511 -35.569 -20.470 1.00 112.20 ? 5    ARG B CA  1 
ATOM   546  C  C   . ARG B 2 7   ? 36.551 -35.955 -19.343 1.00 111.91 ? 5    ARG B C   1 
ATOM   547  O  O   . ARG B 2 7   ? 36.362 -37.137 -19.064 1.00 111.78 ? 5    ARG B O   1 
ATOM   548  C  CB  . ARG B 2 7   ? 38.730 -34.836 -19.901 1.00 112.25 ? 5    ARG B CB  1 
ATOM   549  C  CG  . ARG B 2 7   ? 39.004 -35.074 -18.409 1.00 112.40 ? 5    ARG B CG  1 
ATOM   550  C  CD  . ARG B 2 7   ? 40.131 -36.067 -18.165 1.00 112.74 ? 5    ARG B CD  1 
ATOM   551  N  NE  . ARG B 2 7   ? 40.445 -36.196 -16.738 1.00 113.03 ? 5    ARG B NE  1 
ATOM   552  C  CZ  . ARG B 2 7   ? 41.488 -36.861 -16.243 1.00 112.85 ? 5    ARG B CZ  1 
ATOM   553  N  NH1 . ARG B 2 7   ? 41.681 -36.911 -14.930 1.00 112.44 ? 5    ARG B NH1 1 
ATOM   554  N  NH2 . ARG B 2 7   ? 42.342 -37.473 -17.055 1.00 113.18 ? 5    ARG B NH2 1 
ATOM   555  N  N   . ILE B 2 8   ? 35.953 -34.946 -18.709 1.00 111.67 ? 6    ILE B N   1 
ATOM   556  C  CA  . ILE B 2 8   ? 35.047 -35.137 -17.578 1.00 111.44 ? 6    ILE B CA  1 
ATOM   557  C  C   . ILE B 2 8   ? 33.856 -35.992 -17.962 1.00 111.61 ? 6    ILE B C   1 
ATOM   558  O  O   . ILE B 2 8   ? 33.380 -36.784 -17.158 1.00 111.62 ? 6    ILE B O   1 
ATOM   559  C  CB  . ILE B 2 8   ? 34.584 -33.789 -16.979 1.00 111.25 ? 6    ILE B CB  1 
ATOM   560  C  CG1 . ILE B 2 8   ? 35.711 -33.186 -16.137 1.00 110.99 ? 6    ILE B CG1 1 
ATOM   561  C  CG2 . ILE B 2 8   ? 33.327 -33.960 -16.130 1.00 110.82 ? 6    ILE B CG2 1 
ATOM   562  C  CD1 . ILE B 2 8   ? 35.577 -31.705 -15.883 1.00 110.58 ? 6    ILE B CD1 1 
ATOM   563  N  N   . HIS B 2 9   ? 33.393 -35.848 -19.197 1.00 111.96 ? 7    HIS B N   1 
ATOM   564  C  CA  . HIS B 2 9   ? 32.319 -36.694 -19.701 1.00 112.45 ? 7    HIS B CA  1 
ATOM   565  C  C   . HIS B 2 9   ? 32.682 -38.172 -19.678 1.00 112.68 ? 7    HIS B C   1 
ATOM   566  O  O   . HIS B 2 9   ? 31.851 -39.009 -19.318 1.00 112.85 ? 7    HIS B O   1 
ATOM   567  C  CB  . HIS B 2 9   ? 31.890 -36.272 -21.101 1.00 112.49 ? 7    HIS B CB  1 
ATOM   568  C  CG  . HIS B 2 9   ? 30.795 -35.258 -21.102 1.00 112.70 ? 7    HIS B CG  1 
ATOM   569  N  ND1 . HIS B 2 9   ? 29.540 -35.523 -20.601 1.00 112.93 ? 7    HIS B ND1 1 
ATOM   570  C  CD2 . HIS B 2 9   ? 30.769 -33.974 -21.528 1.00 113.08 ? 7    HIS B CD2 1 
ATOM   571  C  CE1 . HIS B 2 9   ? 28.784 -34.448 -20.727 1.00 113.41 ? 7    HIS B CE1 1 
ATOM   572  N  NE2 . HIS B 2 9   ? 29.506 -33.493 -21.285 1.00 113.49 ? 7    HIS B NE2 1 
ATOM   573  N  N   . LYS B 2 10  ? 33.917 -38.489 -20.054 1.00 112.86 ? 8    LYS B N   1 
ATOM   574  C  CA  . LYS B 2 10  ? 34.393 -39.856 -19.938 1.00 113.04 ? 8    LYS B CA  1 
ATOM   575  C  C   . LYS B 2 10  ? 34.453 -40.244 -18.467 1.00 112.93 ? 8    LYS B C   1 
ATOM   576  O  O   . LYS B 2 10  ? 33.894 -41.265 -18.076 1.00 112.93 ? 8    LYS B O   1 
ATOM   577  C  CB  . LYS B 2 10  ? 35.753 -40.039 -20.617 1.00 113.20 ? 8    LYS B CB  1 
ATOM   578  C  CG  . LYS B 2 10  ? 36.306 -41.448 -20.459 1.00 113.93 ? 8    LYS B CG  1 
ATOM   579  C  CD  . LYS B 2 10  ? 37.025 -41.929 -21.699 1.00 115.25 ? 8    LYS B CD  1 
ATOM   580  C  CE  . LYS B 2 10  ? 37.264 -43.431 -21.615 1.00 116.19 ? 8    LYS B CE  1 
ATOM   581  N  NZ  . LYS B 2 10  ? 38.163 -43.914 -22.705 1.00 117.40 ? 8    LYS B NZ  1 
ATOM   582  N  N   . GLU B 2 11  ? 35.119 -39.413 -17.666 1.00 112.93 ? 9    GLU B N   1 
ATOM   583  C  CA  . GLU B 2 11  ? 35.219 -39.602 -16.222 1.00 113.06 ? 9    GLU B CA  1 
ATOM   584  C  C   . GLU B 2 11  ? 33.914 -40.130 -15.669 1.00 112.99 ? 9    GLU B C   1 
ATOM   585  O  O   . GLU B 2 11  ? 33.846 -41.244 -15.145 1.00 112.99 ? 9    GLU B O   1 
ATOM   586  C  CB  . GLU B 2 11  ? 35.522 -38.270 -15.544 1.00 113.22 ? 9    GLU B CB  1 
ATOM   587  C  CG  . GLU B 2 11  ? 36.968 -37.832 -15.590 1.00 114.01 ? 9    GLU B CG  1 
ATOM   588  C  CD  . GLU B 2 11  ? 37.770 -38.341 -14.405 1.00 115.21 ? 9    GLU B CD  1 
ATOM   589  O  OE1 . GLU B 2 11  ? 37.372 -39.362 -13.784 1.00 115.48 ? 9    GLU B OE1 1 
ATOM   590  O  OE2 . GLU B 2 11  ? 38.805 -37.710 -14.099 1.00 115.39 ? 9    GLU B OE2 1 
ATOM   591  N  N   . LEU B 2 12  ? 32.889 -39.295 -15.810 1.00 112.99 ? 10   LEU B N   1 
ATOM   592  C  CA  . LEU B 2 12  ? 31.522 -39.575 -15.406 1.00 113.02 ? 10   LEU B CA  1 
ATOM   593  C  C   . LEU B 2 12  ? 31.031 -40.872 -16.028 1.00 113.11 ? 10   LEU B C   1 
ATOM   594  O  O   . LEU B 2 12  ? 30.563 -41.761 -15.327 1.00 113.15 ? 10   LEU B O   1 
ATOM   595  C  CB  . LEU B 2 12  ? 30.643 -38.381 -15.810 1.00 113.05 ? 10   LEU B CB  1 
ATOM   596  C  CG  . LEU B 2 12  ? 29.120 -38.312 -16.004 1.00 113.19 ? 10   LEU B CG  1 
ATOM   597  C  CD1 . LEU B 2 12  ? 28.713 -38.712 -17.433 1.00 113.35 ? 10   LEU B CD1 1 
ATOM   598  C  CD2 . LEU B 2 12  ? 28.332 -39.086 -14.940 1.00 113.37 ? 10   LEU B CD2 1 
ATOM   599  N  N   . ASN B 2 13  ? 31.167 -40.982 -17.343 1.00 113.30 ? 11   ASN B N   1 
ATOM   600  C  CA  . ASN B 2 13  ? 30.686 -42.145 -18.069 1.00 113.58 ? 11   ASN B CA  1 
ATOM   601  C  C   . ASN B 2 13  ? 31.349 -43.448 -17.624 1.00 113.67 ? 11   ASN B C   1 
ATOM   602  O  O   . ASN B 2 13  ? 30.768 -44.521 -17.777 1.00 113.69 ? 11   ASN B O   1 
ATOM   603  C  CB  . ASN B 2 13  ? 30.883 -41.938 -19.569 1.00 113.73 ? 11   ASN B CB  1 
ATOM   604  C  CG  . ASN B 2 13  ? 29.774 -42.556 -20.395 1.00 114.17 ? 11   ASN B CG  1 
ATOM   605  O  OD1 . ASN B 2 13  ? 30.035 -43.150 -21.439 1.00 114.94 ? 11   ASN B OD1 1 
ATOM   606  N  ND2 . ASN B 2 13  ? 28.528 -42.415 -19.939 1.00 114.16 ? 11   ASN B ND2 1 
ATOM   607  N  N   . ASP B 2 14  ? 32.557 -43.345 -17.072 1.00 113.85 ? 12   ASP B N   1 
ATOM   608  C  CA  . ASP B 2 14  ? 33.293 -44.503 -16.565 1.00 114.05 ? 12   ASP B CA  1 
ATOM   609  C  C   . ASP B 2 14  ? 32.929 -44.824 -15.134 1.00 114.10 ? 12   ASP B C   1 
ATOM   610  O  O   . ASP B 2 14  ? 32.769 -45.986 -14.765 1.00 114.07 ? 12   ASP B O   1 
ATOM   611  C  CB  . ASP B 2 14  ? 34.794 -44.278 -16.678 1.00 114.04 ? 12   ASP B CB  1 
ATOM   612  C  CG  . ASP B 2 14  ? 35.316 -44.609 -18.052 1.00 114.90 ? 12   ASP B CG  1 
ATOM   613  O  OD1 . ASP B 2 14  ? 34.597 -45.319 -18.797 1.00 115.63 ? 12   ASP B OD1 1 
ATOM   614  O  OD2 . ASP B 2 14  ? 36.439 -44.167 -18.389 1.00 115.85 ? 12   ASP B OD2 1 
ATOM   615  N  N   . LEU B 2 15  ? 32.795 -43.777 -14.333 1.00 114.26 ? 13   LEU B N   1 
ATOM   616  C  CA  . LEU B 2 15  ? 32.367 -43.911 -12.956 1.00 114.49 ? 13   LEU B CA  1 
ATOM   617  C  C   . LEU B 2 15  ? 31.008 -44.606 -12.867 1.00 114.72 ? 13   LEU B C   1 
ATOM   618  O  O   . LEU B 2 15  ? 30.651 -45.140 -11.825 1.00 114.84 ? 13   LEU B O   1 
ATOM   619  C  CB  . LEU B 2 15  ? 32.322 -42.532 -12.301 1.00 114.52 ? 13   LEU B CB  1 
ATOM   620  C  CG  . LEU B 2 15  ? 32.294 -42.458 -10.777 1.00 114.56 ? 13   LEU B CG  1 
ATOM   621  C  CD1 . LEU B 2 15  ? 33.256 -41.396 -10.275 1.00 114.56 ? 13   LEU B CD1 1 
ATOM   622  C  CD2 . LEU B 2 15  ? 30.880 -42.199 -10.280 1.00 114.97 ? 13   LEU B CD2 1 
ATOM   623  N  N   . ALA B 2 16  ? 30.254 -44.600 -13.962 1.00 115.05 ? 14   ALA B N   1 
ATOM   624  C  CA  . ALA B 2 16  ? 29.021 -45.373 -14.043 1.00 115.32 ? 14   ALA B CA  1 
ATOM   625  C  C   . ALA B 2 16  ? 29.333 -46.862 -14.207 1.00 115.65 ? 14   ALA B C   1 
ATOM   626  O  O   . ALA B 2 16  ? 28.818 -47.684 -13.451 1.00 115.73 ? 14   ALA B O   1 
ATOM   627  C  CB  . ALA B 2 16  ? 28.141 -44.873 -15.177 1.00 115.22 ? 14   ALA B CB  1 
ATOM   628  N  N   . ARG B 2 17  ? 30.187 -47.198 -15.177 1.00 115.98 ? 15   ARG B N   1 
ATOM   629  C  CA  . ARG B 2 17  ? 30.562 -48.593 -15.453 1.00 116.52 ? 15   ARG B CA  1 
ATOM   630  C  C   . ARG B 2 17  ? 31.200 -49.260 -14.245 1.00 116.19 ? 15   ARG B C   1 
ATOM   631  O  O   . ARG B 2 17  ? 30.834 -50.370 -13.872 1.00 116.21 ? 15   ARG B O   1 
ATOM   632  C  CB  . ARG B 2 17  ? 31.543 -48.679 -16.624 1.00 116.44 ? 15   ARG B CB  1 
ATOM   633  C  CG  . ARG B 2 17  ? 30.996 -48.189 -17.944 1.00 117.48 ? 15   ARG B CG  1 
ATOM   634  C  CD  . ARG B 2 17  ? 32.105 -48.053 -18.997 1.00 117.96 ? 15   ARG B CD  1 
ATOM   635  N  NE  . ARG B 2 17  ? 32.555 -49.347 -19.524 1.00 121.42 ? 15   ARG B NE  1 
ATOM   636  C  CZ  . ARG B 2 17  ? 31.900 -50.079 -20.431 1.00 122.54 ? 15   ARG B CZ  1 
ATOM   637  N  NH1 . ARG B 2 17  ? 32.409 -51.238 -20.839 1.00 122.94 ? 15   ARG B NH1 1 
ATOM   638  N  NH2 . ARG B 2 17  ? 30.735 -49.670 -20.931 1.00 123.11 ? 15   ARG B NH2 1 
ATOM   639  N  N   . ASP B 2 18  ? 32.157 -48.564 -13.643 1.00 116.14 ? 16   ASP B N   1 
ATOM   640  C  CA  . ASP B 2 18  ? 32.961 -49.116 -12.566 1.00 116.10 ? 16   ASP B CA  1 
ATOM   641  C  C   . ASP B 2 18  ? 33.112 -48.080 -11.449 1.00 115.74 ? 16   ASP B C   1 
ATOM   642  O  O   . ASP B 2 18  ? 34.149 -47.417 -11.331 1.00 115.83 ? 16   ASP B O   1 
ATOM   643  C  CB  . ASP B 2 18  ? 34.327 -49.564 -13.111 1.00 116.43 ? 16   ASP B CB  1 
ATOM   644  C  CG  . ASP B 2 18  ? 35.180 -50.288 -12.072 1.00 117.37 ? 16   ASP B CG  1 
ATOM   645  O  OD1 . ASP B 2 18  ? 34.629 -50.789 -11.062 1.00 118.49 ? 16   ASP B OD1 1 
ATOM   646  O  OD2 . ASP B 2 18  ? 36.413 -50.362 -12.277 1.00 118.21 ? 16   ASP B OD2 1 
ATOM   647  N  N   . PRO B 2 19  ? 32.065 -47.935 -10.625 1.00 115.31 ? 17   PRO B N   1 
ATOM   648  C  CA  . PRO B 2 19  ? 32.039 -46.973 -9.530  1.00 115.02 ? 17   PRO B CA  1 
ATOM   649  C  C   . PRO B 2 19  ? 32.968 -47.409 -8.417  1.00 114.77 ? 17   PRO B C   1 
ATOM   650  O  O   . PRO B 2 19  ? 33.157 -48.607 -8.222  1.00 114.99 ? 17   PRO B O   1 
ATOM   651  C  CB  . PRO B 2 19  ? 30.592 -47.035 -9.040  1.00 115.06 ? 17   PRO B CB  1 
ATOM   652  C  CG  . PRO B 2 19  ? 29.844 -47.777 -10.107 1.00 115.31 ? 17   PRO B CG  1 
ATOM   653  C  CD  . PRO B 2 19  ? 30.819 -48.709 -10.695 1.00 115.28 ? 17   PRO B CD  1 
ATOM   654  N  N   . PRO B 2 20  ? 33.546 -46.449 -7.683  1.00 114.50 ? 18   PRO B N   1 
ATOM   655  C  CA  . PRO B 2 20  ? 34.500 -46.805 -6.647  1.00 114.28 ? 18   PRO B CA  1 
ATOM   656  C  C   . PRO B 2 20  ? 33.813 -47.306 -5.382  1.00 114.07 ? 18   PRO B C   1 
ATOM   657  O  O   . PRO B 2 20  ? 33.509 -46.532 -4.473  1.00 113.93 ? 18   PRO B O   1 
ATOM   658  C  CB  . PRO B 2 20  ? 35.261 -45.496 -6.383  1.00 114.21 ? 18   PRO B CB  1 
ATOM   659  C  CG  . PRO B 2 20  ? 34.674 -44.473 -7.308  1.00 114.55 ? 18   PRO B CG  1 
ATOM   660  C  CD  . PRO B 2 20  ? 33.352 -44.996 -7.762  1.00 114.59 ? 18   PRO B CD  1 
ATOM   661  N  N   . ALA B 2 21  ? 33.547 -48.607 -5.364  1.00 113.93 ? 19   ALA B N   1 
ATOM   662  C  CA  . ALA B 2 21  ? 33.224 -49.327 -4.145  1.00 113.79 ? 19   ALA B CA  1 
ATOM   663  C  C   . ALA B 2 21  ? 32.180 -48.650 -3.263  1.00 113.68 ? 19   ALA B C   1 
ATOM   664  O  O   . ALA B 2 21  ? 31.018 -49.084 -3.201  1.00 113.93 ? 19   ALA B O   1 
ATOM   665  C  CB  . ALA B 2 21  ? 34.504 -49.580 -3.342  1.00 113.83 ? 19   ALA B CB  1 
ATOM   666  N  N   . GLN B 2 22  ? 32.595 -47.586 -2.584  1.00 113.17 ? 20   GLN B N   1 
ATOM   667  C  CA  . GLN B 2 22  ? 31.812 -47.084 -1.473  1.00 112.82 ? 20   GLN B CA  1 
ATOM   668  C  C   . GLN B 2 22  ? 30.861 -45.932 -1.779  1.00 112.41 ? 20   GLN B C   1 
ATOM   669  O  O   . GLN B 2 22  ? 30.092 -45.526 -0.915  1.00 112.35 ? 20   GLN B O   1 
ATOM   670  C  CB  . GLN B 2 22  ? 32.735 -46.746 -0.299  1.00 112.88 ? 20   GLN B CB  1 
ATOM   671  C  CG  . GLN B 2 22  ? 32.095 -46.969 1.083   1.00 113.29 ? 20   GLN B CG  1 
ATOM   672  C  CD  . GLN B 2 22  ? 31.490 -48.370 1.287   1.00 113.33 ? 20   GLN B CD  1 
ATOM   673  O  OE1 . GLN B 2 22  ? 31.895 -49.099 2.194   1.00 113.52 ? 20   GLN B OE1 1 
ATOM   674  N  NE2 . GLN B 2 22  ? 30.516 -48.737 0.452   1.00 113.05 ? 20   GLN B NE2 1 
ATOM   675  N  N   . CYS B 2 23  ? 30.879 -45.426 -3.006  1.00 112.02 ? 21   CYS B N   1 
ATOM   676  C  CA  . CYS B 2 23  ? 30.254 -44.132 -3.266  1.00 111.56 ? 21   CYS B CA  1 
ATOM   677  C  C   . CYS B 2 23  ? 29.826 -43.891 -4.701  1.00 111.33 ? 21   CYS B C   1 
ATOM   678  O  O   . CYS B 2 23  ? 30.045 -44.734 -5.573  1.00 111.32 ? 21   CYS B O   1 
ATOM   679  C  CB  . CYS B 2 23  ? 31.224 -43.028 -2.852  1.00 111.61 ? 21   CYS B CB  1 
ATOM   680  S  SG  . CYS B 2 23  ? 32.950 -43.457 -3.121  1.00 110.80 ? 21   CYS B SG  1 
ATOM   681  N  N   . SER B 2 24  ? 29.200 -42.732 -4.918  1.00 110.98 ? 22   SER B N   1 
ATOM   682  C  CA  . SER B 2 24  ? 28.959 -42.199 -6.255  1.00 110.78 ? 22   SER B CA  1 
ATOM   683  C  C   . SER B 2 24  ? 28.914 -40.674 -6.277  1.00 110.81 ? 22   SER B C   1 
ATOM   684  O  O   . SER B 2 24  ? 28.629 -40.019 -5.265  1.00 110.78 ? 22   SER B O   1 
ATOM   685  C  CB  . SER B 2 24  ? 27.671 -42.750 -6.852  1.00 110.66 ? 22   SER B CB  1 
ATOM   686  O  OG  . SER B 2 24  ? 26.575 -41.903 -6.570  1.00 110.55 ? 22   SER B OG  1 
ATOM   687  N  N   . ALA B 2 25  ? 29.186 -40.130 -7.461  1.00 110.79 ? 23   ALA B N   1 
ATOM   688  C  CA  . ALA B 2 25  ? 29.205 -38.696 -7.706  1.00 110.70 ? 23   ALA B CA  1 
ATOM   689  C  C   . ALA B 2 25  ? 28.541 -38.380 -9.044  1.00 110.76 ? 23   ALA B C   1 
ATOM   690  O  O   . ALA B 2 25  ? 28.060 -39.280 -9.745  1.00 110.59 ? 23   ALA B O   1 
ATOM   691  C  CB  . ALA B 2 25  ? 30.632 -38.184 -7.690  1.00 110.57 ? 23   ALA B CB  1 
ATOM   692  N  N   . GLY B 2 26  ? 28.520 -37.095 -9.389  1.00 110.92 ? 24   GLY B N   1 
ATOM   693  C  CA  . GLY B 2 26  ? 27.931 -36.638 -10.642 1.00 111.12 ? 24   GLY B CA  1 
ATOM   694  C  C   . GLY B 2 26  ? 27.706 -35.138 -10.695 1.00 111.21 ? 24   GLY B C   1 
ATOM   695  O  O   . GLY B 2 26  ? 27.886 -34.443 -9.688  1.00 111.21 ? 24   GLY B O   1 
ATOM   696  N  N   . PRO B 2 27  ? 27.306 -34.626 -11.875 1.00 111.25 ? 25   PRO B N   1 
ATOM   697  C  CA  . PRO B 2 27  ? 27.018 -33.212 -12.009 1.00 111.34 ? 25   PRO B CA  1 
ATOM   698  C  C   . PRO B 2 27  ? 25.779 -32.873 -11.209 1.00 111.61 ? 25   PRO B C   1 
ATOM   699  O  O   . PRO B 2 27  ? 24.883 -33.711 -11.071 1.00 111.67 ? 25   PRO B O   1 
ATOM   700  C  CB  . PRO B 2 27  ? 26.742 -33.052 -13.505 1.00 111.30 ? 25   PRO B CB  1 
ATOM   701  C  CG  . PRO B 2 27  ? 26.300 -34.387 -13.956 1.00 111.09 ? 25   PRO B CG  1 
ATOM   702  C  CD  . PRO B 2 27  ? 27.089 -35.352 -13.140 1.00 111.25 ? 25   PRO B CD  1 
ATOM   703  N  N   . VAL B 2 28  ? 25.743 -31.665 -10.666 1.00 111.91 ? 26   VAL B N   1 
ATOM   704  C  CA  . VAL B 2 28  ? 24.571 -31.200 -9.944  1.00 112.24 ? 26   VAL B CA  1 
ATOM   705  C  C   . VAL B 2 28  ? 23.588 -30.616 -10.962 1.00 112.56 ? 26   VAL B C   1 
ATOM   706  O  O   . VAL B 2 28  ? 22.468 -31.115 -11.118 1.00 112.63 ? 26   VAL B O   1 
ATOM   707  C  CB  . VAL B 2 28  ? 24.941 -30.170 -8.845  1.00 112.21 ? 26   VAL B CB  1 
ATOM   708  C  CG1 . VAL B 2 28  ? 23.770 -29.961 -7.889  1.00 112.37 ? 26   VAL B CG1 1 
ATOM   709  C  CG2 . VAL B 2 28  ? 26.178 -30.624 -8.073  1.00 112.06 ? 26   VAL B CG2 1 
ATOM   710  N  N   . GLY B 2 29  ? 24.022 -29.570 -11.661 1.00 112.90 ? 27   GLY B N   1 
ATOM   711  C  CA  . GLY B 2 29  ? 23.240 -28.983 -12.741 1.00 113.25 ? 27   GLY B CA  1 
ATOM   712  C  C   . GLY B 2 29  ? 23.813 -29.439 -14.062 1.00 113.49 ? 27   GLY B C   1 
ATOM   713  O  O   . GLY B 2 29  ? 24.452 -30.488 -14.136 1.00 113.40 ? 27   GLY B O   1 
ATOM   714  N  N   . ASP B 2 30  ? 23.586 -28.650 -15.107 1.00 113.83 ? 28   ASP B N   1 
ATOM   715  C  CA  . ASP B 2 30  ? 24.194 -28.917 -16.408 1.00 114.22 ? 28   ASP B CA  1 
ATOM   716  C  C   . ASP B 2 30  ? 25.648 -28.445 -16.429 1.00 114.38 ? 28   ASP B C   1 
ATOM   717  O  O   . ASP B 2 30  ? 26.413 -28.791 -17.337 1.00 114.49 ? 28   ASP B O   1 
ATOM   718  C  CB  . ASP B 2 30  ? 23.378 -28.279 -17.534 1.00 114.25 ? 28   ASP B CB  1 
ATOM   719  C  CG  . ASP B 2 30  ? 21.941 -28.780 -17.566 1.00 114.65 ? 28   ASP B CG  1 
ATOM   720  O  OD1 . ASP B 2 30  ? 21.619 -29.740 -16.830 1.00 114.76 ? 28   ASP B OD1 1 
ATOM   721  O  OD2 . ASP B 2 30  ? 21.129 -28.212 -18.326 1.00 115.25 ? 28   ASP B OD2 1 
ATOM   722  N  N   . ASP B 2 31  ? 26.017 -27.660 -15.417 1.00 114.50 ? 29   ASP B N   1 
ATOM   723  C  CA  . ASP B 2 31  ? 27.405 -27.280 -15.193 1.00 114.53 ? 29   ASP B CA  1 
ATOM   724  C  C   . ASP B 2 31  ? 28.189 -28.532 -14.814 1.00 114.56 ? 29   ASP B C   1 
ATOM   725  O  O   . ASP B 2 31  ? 28.158 -28.986 -13.667 1.00 114.65 ? 29   ASP B O   1 
ATOM   726  C  CB  . ASP B 2 31  ? 27.511 -26.203 -14.104 1.00 114.50 ? 29   ASP B CB  1 
ATOM   727  C  CG  . ASP B 2 31  ? 28.948 -25.757 -13.847 1.00 114.40 ? 29   ASP B CG  1 
ATOM   728  O  OD1 . ASP B 2 31  ? 29.211 -25.247 -12.737 1.00 114.27 ? 29   ASP B OD1 1 
ATOM   729  O  OD2 . ASP B 2 31  ? 29.813 -25.912 -14.741 1.00 114.02 ? 29   ASP B OD2 1 
ATOM   730  N  N   . MET B 2 32  ? 28.877 -29.089 -15.804 1.00 114.50 ? 30   MET B N   1 
ATOM   731  C  CA  . MET B 2 32  ? 29.660 -30.302 -15.634 1.00 114.48 ? 30   MET B CA  1 
ATOM   732  C  C   . MET B 2 32  ? 30.848 -30.115 -14.697 1.00 114.32 ? 30   MET B C   1 
ATOM   733  O  O   . MET B 2 32  ? 31.479 -31.086 -14.295 1.00 114.30 ? 30   MET B O   1 
ATOM   734  C  CB  . MET B 2 32  ? 30.154 -30.779 -16.997 1.00 114.76 ? 30   MET B CB  1 
ATOM   735  C  CG  . MET B 2 32  ? 29.141 -31.590 -17.763 1.00 115.25 ? 30   MET B CG  1 
ATOM   736  S  SD  . MET B 2 32  ? 29.250 -33.337 -17.336 1.00 116.80 ? 30   MET B SD  1 
ATOM   737  C  CE  . MET B 2 32  ? 27.528 -33.823 -17.532 1.00 116.04 ? 30   MET B CE  1 
ATOM   738  N  N   . PHE B 2 33  ? 31.150 -28.869 -14.355 1.00 114.28 ? 31   PHE B N   1 
ATOM   739  C  CA  . PHE B 2 33  ? 32.332 -28.558 -13.560 1.00 114.34 ? 31   PHE B CA  1 
ATOM   740  C  C   . PHE B 2 33  ? 32.027 -28.495 -12.071 1.00 114.34 ? 31   PHE B C   1 
ATOM   741  O  O   . PHE B 2 33  ? 32.942 -28.503 -11.246 1.00 114.29 ? 31   PHE B O   1 
ATOM   742  C  CB  . PHE B 2 33  ? 32.982 -27.258 -14.051 1.00 114.44 ? 31   PHE B CB  1 
ATOM   743  C  CG  . PHE B 2 33  ? 33.654 -27.391 -15.397 1.00 114.58 ? 31   PHE B CG  1 
ATOM   744  C  CD1 . PHE B 2 33  ? 34.984 -27.798 -15.489 1.00 114.41 ? 31   PHE B CD1 1 
ATOM   745  C  CD2 . PHE B 2 33  ? 32.955 -27.123 -16.572 1.00 114.57 ? 31   PHE B CD2 1 
ATOM   746  C  CE1 . PHE B 2 33  ? 35.606 -27.933 -16.727 1.00 114.27 ? 31   PHE B CE1 1 
ATOM   747  C  CE2 . PHE B 2 33  ? 33.570 -27.259 -17.815 1.00 114.36 ? 31   PHE B CE2 1 
ATOM   748  C  CZ  . PHE B 2 33  ? 34.898 -27.664 -17.891 1.00 114.33 ? 31   PHE B CZ  1 
ATOM   749  N  N   . HIS B 2 34  ? 30.739 -28.440 -11.741 1.00 114.42 ? 32   HIS B N   1 
ATOM   750  C  CA  . HIS B 2 34  ? 30.281 -28.468 -10.355 1.00 114.58 ? 32   HIS B CA  1 
ATOM   751  C  C   . HIS B 2 34  ? 29.620 -29.811 -10.064 1.00 114.32 ? 32   HIS B C   1 
ATOM   752  O  O   . HIS B 2 34  ? 28.519 -30.099 -10.538 1.00 114.26 ? 32   HIS B O   1 
ATOM   753  C  CB  . HIS B 2 34  ? 29.334 -27.293 -10.077 1.00 114.88 ? 32   HIS B CB  1 
ATOM   754  C  CG  . HIS B 2 34  ? 28.752 -27.282 -8.694  1.00 116.18 ? 32   HIS B CG  1 
ATOM   755  N  ND1 . HIS B 2 34  ? 27.526 -26.712 -8.411  1.00 117.29 ? 32   HIS B ND1 1 
ATOM   756  C  CD2 . HIS B 2 34  ? 29.220 -27.768 -7.518  1.00 117.05 ? 32   HIS B CD2 1 
ATOM   757  C  CE1 . HIS B 2 34  ? 27.266 -26.846 -7.121  1.00 117.48 ? 32   HIS B CE1 1 
ATOM   758  N  NE2 . HIS B 2 34  ? 28.276 -27.485 -6.557  1.00 117.78 ? 32   HIS B NE2 1 
ATOM   759  N  N   . TRP B 2 35  ? 30.318 -30.632 -9.289  1.00 114.14 ? 33   TRP B N   1 
ATOM   760  C  CA  . TRP B 2 35  ? 29.872 -31.984 -8.992  1.00 113.94 ? 33   TRP B CA  1 
ATOM   761  C  C   . TRP B 2 35  ? 29.535 -32.159 -7.527  1.00 114.03 ? 33   TRP B C   1 
ATOM   762  O  O   . TRP B 2 35  ? 30.036 -31.427 -6.671  1.00 114.22 ? 33   TRP B O   1 
ATOM   763  C  CB  . TRP B 2 35  ? 30.950 -32.991 -9.386  1.00 113.69 ? 33   TRP B CB  1 
ATOM   764  C  CG  . TRP B 2 35  ? 30.862 -33.434 -10.804 1.00 113.42 ? 33   TRP B CG  1 
ATOM   765  C  CD1 . TRP B 2 35  ? 30.380 -32.717 -11.857 1.00 113.62 ? 33   TRP B CD1 1 
ATOM   766  C  CD2 . TRP B 2 35  ? 31.288 -34.688 -11.337 1.00 112.93 ? 33   TRP B CD2 1 
ATOM   767  N  NE1 . TRP B 2 35  ? 30.466 -33.452 -13.012 1.00 113.44 ? 33   TRP B NE1 1 
ATOM   768  C  CE2 . TRP B 2 35  ? 31.024 -34.666 -12.721 1.00 113.00 ? 33   TRP B CE2 1 
ATOM   769  C  CE3 . TRP B 2 35  ? 31.865 -35.831 -10.779 1.00 113.21 ? 33   TRP B CE3 1 
ATOM   770  C  CZ2 . TRP B 2 35  ? 31.314 -35.742 -13.556 1.00 113.32 ? 33   TRP B CZ2 1 
ATOM   771  C  CZ3 . TRP B 2 35  ? 32.155 -36.905 -11.613 1.00 113.53 ? 33   TRP B CZ3 1 
ATOM   772  C  CH2 . TRP B 2 35  ? 31.879 -36.851 -12.986 1.00 113.38 ? 33   TRP B CH2 1 
ATOM   773  N  N   . GLN B 2 36  ? 28.676 -33.130 -7.245  1.00 113.96 ? 34   GLN B N   1 
ATOM   774  C  CA  . GLN B 2 36  ? 28.422 -33.534 -5.877  1.00 113.85 ? 34   GLN B CA  1 
ATOM   775  C  C   . GLN B 2 36  ? 28.634 -35.025 -5.749  1.00 113.72 ? 34   GLN B C   1 
ATOM   776  O  O   . GLN B 2 36  ? 28.048 -35.811 -6.494  1.00 113.76 ? 34   GLN B O   1 
ATOM   777  C  CB  . GLN B 2 36  ? 27.006 -33.183 -5.450  1.00 113.94 ? 34   GLN B CB  1 
ATOM   778  C  CG  . GLN B 2 36  ? 26.734 -33.485 -3.988  1.00 114.33 ? 34   GLN B CG  1 
ATOM   779  C  CD  . GLN B 2 36  ? 25.379 -34.117 -3.776  1.00 114.86 ? 34   GLN B CD  1 
ATOM   780  O  OE1 . GLN B 2 36  ? 25.028 -35.099 -4.434  1.00 115.23 ? 34   GLN B OE1 1 
ATOM   781  N  NE2 . GLN B 2 36  ? 24.609 -33.565 -2.848  1.00 115.07 ? 34   GLN B NE2 1 
ATOM   782  N  N   . ALA B 2 37  ? 29.483 -35.400 -4.801  1.00 113.59 ? 35   ALA B N   1 
ATOM   783  C  CA  . ALA B 2 37  ? 29.698 -36.798 -4.467  1.00 113.43 ? 35   ALA B CA  1 
ATOM   784  C  C   . ALA B 2 37  ? 28.954 -37.138 -3.192  1.00 113.31 ? 35   ALA B C   1 
ATOM   785  O  O   . ALA B 2 37  ? 28.826 -36.306 -2.289  1.00 113.43 ? 35   ALA B O   1 
ATOM   786  C  CB  . ALA B 2 37  ? 31.173 -37.078 -4.295  1.00 113.35 ? 35   ALA B CB  1 
ATOM   787  N  N   . THR B 2 38  ? 28.445 -38.357 -3.124  1.00 113.09 ? 36   THR B N   1 
ATOM   788  C  CA  . THR B 2 38  ? 27.963 -38.875 -1.857  1.00 112.94 ? 36   THR B CA  1 
ATOM   789  C  C   . THR B 2 38  ? 28.823 -40.090 -1.530  1.00 112.74 ? 36   THR B C   1 
ATOM   790  O  O   . THR B 2 38  ? 28.979 -40.991 -2.355  1.00 112.65 ? 36   THR B O   1 
ATOM   791  C  CB  . THR B 2 38  ? 26.439 -39.206 -1.863  1.00 112.95 ? 36   THR B CB  1 
ATOM   792  O  OG1 . THR B 2 38  ? 26.236 -40.615 -1.992  1.00 113.00 ? 36   THR B OG1 1 
ATOM   793  C  CG2 . THR B 2 38  ? 25.695 -38.469 -2.987  1.00 113.01 ? 36   THR B CG2 1 
ATOM   794  N  N   . ILE B 2 39  ? 29.409 -40.083 -0.340  1.00 112.58 ? 37   ILE B N   1 
ATOM   795  C  CA  . ILE B 2 39  ? 30.300 -41.153 0.084   1.00 112.50 ? 37   ILE B CA  1 
ATOM   796  C  C   . ILE B 2 39  ? 29.687 -41.881 1.275   1.00 112.43 ? 37   ILE B C   1 
ATOM   797  O  O   . ILE B 2 39  ? 29.253 -41.264 2.251   1.00 112.43 ? 37   ILE B O   1 
ATOM   798  C  CB  . ILE B 2 39  ? 31.728 -40.622 0.381   1.00 112.47 ? 37   ILE B CB  1 
ATOM   799  C  CG1 . ILE B 2 39  ? 32.784 -41.553 -0.188  1.00 112.33 ? 37   ILE B CG1 1 
ATOM   800  C  CG2 . ILE B 2 39  ? 31.969 -40.418 1.871   1.00 112.85 ? 37   ILE B CG2 1 
ATOM   801  C  CD1 . ILE B 2 39  ? 34.093 -40.858 -0.447  1.00 112.81 ? 37   ILE B CD1 1 
ATOM   802  N  N   . MET B 2 40  ? 29.649 -43.201 1.178   1.00 112.43 ? 38   MET B N   1 
ATOM   803  C  CA  . MET B 2 40  ? 28.862 -44.008 2.090   1.00 112.44 ? 38   MET B CA  1 
ATOM   804  C  C   . MET B 2 40  ? 29.742 -44.586 3.197   1.00 112.33 ? 38   MET B C   1 
ATOM   805  O  O   . MET B 2 40  ? 30.207 -45.717 3.100   1.00 112.21 ? 38   MET B O   1 
ATOM   806  C  CB  . MET B 2 40  ? 28.118 -45.080 1.280   1.00 112.58 ? 38   MET B CB  1 
ATOM   807  C  CG  . MET B 2 40  ? 27.461 -46.169 2.067   1.00 113.13 ? 38   MET B CG  1 
ATOM   808  S  SD  . MET B 2 40  ? 26.377 -45.529 3.336   1.00 114.95 ? 38   MET B SD  1 
ATOM   809  C  CE  . MET B 2 40  ? 26.372 -46.929 4.472   1.00 113.88 ? 38   MET B CE  1 
ATOM   810  N  N   . GLY B 2 41  ? 29.965 -43.784 4.238   1.00 112.39 ? 39   GLY B N   1 
ATOM   811  C  CA  . GLY B 2 41  ? 30.812 -44.142 5.388   1.00 112.65 ? 39   GLY B CA  1 
ATOM   812  C  C   . GLY B 2 41  ? 31.284 -45.588 5.447   1.00 112.90 ? 39   GLY B C   1 
ATOM   813  O  O   . GLY B 2 41  ? 30.479 -46.492 5.698   1.00 113.03 ? 39   GLY B O   1 
ATOM   814  N  N   . PRO B 2 42  ? 32.597 -45.816 5.235   1.00 113.00 ? 40   PRO B N   1 
ATOM   815  C  CA  . PRO B 2 42  ? 33.156 -47.157 5.024   1.00 113.09 ? 40   PRO B CA  1 
ATOM   816  C  C   . PRO B 2 42  ? 33.147 -48.051 6.263   1.00 113.25 ? 40   PRO B C   1 
ATOM   817  O  O   . PRO B 2 42  ? 33.477 -47.598 7.361   1.00 113.24 ? 40   PRO B O   1 
ATOM   818  C  CB  . PRO B 2 42  ? 34.595 -46.869 4.590   1.00 113.04 ? 40   PRO B CB  1 
ATOM   819  C  CG  . PRO B 2 42  ? 34.916 -45.559 5.205   1.00 112.96 ? 40   PRO B CG  1 
ATOM   820  C  CD  . PRO B 2 42  ? 33.641 -44.775 5.201   1.00 112.98 ? 40   PRO B CD  1 
ATOM   821  N  N   . ASN B 2 43  ? 32.770 -49.315 6.073   1.00 113.52 ? 41   ASN B N   1 
ATOM   822  C  CA  . ASN B 2 43  ? 32.788 -50.300 7.152   1.00 113.86 ? 41   ASN B CA  1 
ATOM   823  C  C   . ASN B 2 43  ? 34.194 -50.505 7.700   1.00 113.90 ? 41   ASN B C   1 
ATOM   824  O  O   . ASN B 2 43  ? 35.176 -50.466 6.952   1.00 114.03 ? 41   ASN B O   1 
ATOM   825  C  CB  . ASN B 2 43  ? 32.181 -51.637 6.705   1.00 114.01 ? 41   ASN B CB  1 
ATOM   826  C  CG  . ASN B 2 43  ? 30.664 -51.573 6.546   1.00 114.56 ? 41   ASN B CG  1 
ATOM   827  O  OD1 . ASN B 2 43  ? 30.155 -51.007 5.575   1.00 115.50 ? 41   ASN B OD1 1 
ATOM   828  N  ND2 . ASN B 2 43  ? 29.937 -52.165 7.497   1.00 114.32 ? 41   ASN B ND2 1 
ATOM   829  N  N   . ASP B 2 44  ? 34.272 -50.724 9.011   1.00 113.90 ? 42   ASP B N   1 
ATOM   830  C  CA  . ASP B 2 44  ? 35.538 -50.764 9.758   1.00 113.88 ? 42   ASP B CA  1 
ATOM   831  C  C   . ASP B 2 44  ? 36.384 -49.496 9.570   1.00 113.56 ? 42   ASP B C   1 
ATOM   832  O  O   . ASP B 2 44  ? 37.604 -49.533 9.365   1.00 113.51 ? 42   ASP B O   1 
ATOM   833  C  CB  . ASP B 2 44  ? 36.335 -52.055 9.503   1.00 114.11 ? 42   ASP B CB  1 
ATOM   834  C  CG  . ASP B 2 44  ? 37.050 -52.554 10.759  1.00 114.68 ? 42   ASP B CG  1 
ATOM   835  O  OD1 . ASP B 2 44  ? 38.022 -51.896 11.198  1.00 115.23 ? 42   ASP B OD1 1 
ATOM   836  O  OD2 . ASP B 2 44  ? 36.637 -53.602 11.311  1.00 115.02 ? 42   ASP B OD2 1 
ATOM   837  N  N   . SER B 2 45  ? 35.674 -48.378 9.589   1.00 113.10 ? 43   SER B N   1 
ATOM   838  C  CA  . SER B 2 45  ? 36.202 -47.108 10.009  1.00 112.68 ? 43   SER B CA  1 
ATOM   839  C  C   . SER B 2 45  ? 35.241 -46.774 11.139  1.00 112.48 ? 43   SER B C   1 
ATOM   840  O  O   . SER B 2 45  ? 34.230 -47.463 11.303  1.00 112.52 ? 43   SER B O   1 
ATOM   841  C  CB  . SER B 2 45  ? 36.101 -46.082 8.884   1.00 112.70 ? 43   SER B CB  1 
ATOM   842  O  OG  . SER B 2 45  ? 34.785 -45.570 8.769   1.00 112.54 ? 43   SER B OG  1 
ATOM   843  N  N   . PRO B 2 46  ? 35.537 -45.737 11.936  1.00 112.27 ? 44   PRO B N   1 
ATOM   844  C  CA  . PRO B 2 46  ? 34.527 -45.354 12.924  1.00 112.00 ? 44   PRO B CA  1 
ATOM   845  C  C   . PRO B 2 46  ? 33.431 -44.474 12.308  1.00 111.60 ? 44   PRO B C   1 
ATOM   846  O  O   . PRO B 2 46  ? 32.731 -43.760 13.026  1.00 111.62 ? 44   PRO B O   1 
ATOM   847  C  CB  . PRO B 2 46  ? 35.337 -44.571 13.954  1.00 112.04 ? 44   PRO B CB  1 
ATOM   848  C  CG  . PRO B 2 46  ? 36.435 -43.942 13.144  1.00 112.34 ? 44   PRO B CG  1 
ATOM   849  C  CD  . PRO B 2 46  ? 36.745 -44.894 12.017  1.00 112.33 ? 44   PRO B CD  1 
ATOM   850  N  N   . TYR B 2 47  ? 33.290 -44.533 10.987  1.00 111.06 ? 45   TYR B N   1 
ATOM   851  C  CA  . TYR B 2 47  ? 32.300 -43.731 10.278  1.00 110.50 ? 45   TYR B CA  1 
ATOM   852  C  C   . TYR B 2 47  ? 31.245 -44.589 9.607   1.00 110.08 ? 45   TYR B C   1 
ATOM   853  O  O   . TYR B 2 47  ? 30.330 -44.058 8.969   1.00 110.14 ? 45   TYR B O   1 
ATOM   854  C  CB  . TYR B 2 47  ? 32.975 -42.862 9.226   1.00 110.58 ? 45   TYR B CB  1 
ATOM   855  C  CG  . TYR B 2 47  ? 34.092 -42.024 9.774   1.00 110.65 ? 45   TYR B CG  1 
ATOM   856  C  CD1 . TYR B 2 47  ? 35.417 -42.430 9.642   1.00 110.76 ? 45   TYR B CD1 1 
ATOM   857  C  CD2 . TYR B 2 47  ? 33.826 -40.827 10.433  1.00 110.85 ? 45   TYR B CD2 1 
ATOM   858  C  CE1 . TYR B 2 47  ? 36.453 -41.660 10.150  1.00 110.99 ? 45   TYR B CE1 1 
ATOM   859  C  CE2 . TYR B 2 47  ? 34.853 -40.048 10.944  1.00 111.15 ? 45   TYR B CE2 1 
ATOM   860  C  CZ  . TYR B 2 47  ? 36.165 -40.468 10.798  1.00 111.02 ? 45   TYR B CZ  1 
ATOM   861  O  OH  . TYR B 2 47  ? 37.186 -39.698 11.305  1.00 110.92 ? 45   TYR B OH  1 
ATOM   862  N  N   . GLN B 2 48  ? 31.377 -45.910 9.749   1.00 109.42 ? 46   GLN B N   1 
ATOM   863  C  CA  . GLN B 2 48  ? 30.452 -46.851 9.118   1.00 108.69 ? 46   GLN B CA  1 
ATOM   864  C  C   . GLN B 2 48  ? 29.028 -46.537 9.534   1.00 108.27 ? 46   GLN B C   1 
ATOM   865  O  O   . GLN B 2 48  ? 28.790 -46.038 10.634  1.00 108.14 ? 46   GLN B O   1 
ATOM   866  C  CB  . GLN B 2 48  ? 30.813 -48.307 9.435   1.00 108.74 ? 46   GLN B CB  1 
ATOM   867  C  CG  . GLN B 2 48  ? 30.836 -48.675 10.918  1.00 108.69 ? 46   GLN B CG  1 
ATOM   868  C  CD  . GLN B 2 48  ? 30.797 -50.177 11.163  1.00 108.53 ? 46   GLN B CD  1 
ATOM   869  O  OE1 . GLN B 2 48  ? 30.380 -50.624 12.230  1.00 108.37 ? 46   GLN B OE1 1 
ATOM   870  N  NE2 . GLN B 2 48  ? 31.229 -50.961 10.179  1.00 108.19 ? 46   GLN B NE2 1 
ATOM   871  N  N   . GLY B 2 49  ? 28.088 -46.809 8.641   1.00 107.84 ? 47   GLY B N   1 
ATOM   872  C  CA  . GLY B 2 49  ? 26.703 -46.454 8.890   1.00 107.45 ? 47   GLY B CA  1 
ATOM   873  C  C   . GLY B 2 49  ? 26.377 -45.125 8.258   1.00 107.13 ? 47   GLY B C   1 
ATOM   874  O  O   . GLY B 2 49  ? 25.755 -45.082 7.205   1.00 107.30 ? 47   GLY B O   1 
ATOM   875  N  N   . GLY B 2 50  ? 26.816 -44.039 8.887   1.00 106.69 ? 48   GLY B N   1 
ATOM   876  C  CA  . GLY B 2 50  ? 26.546 -42.699 8.378   1.00 106.16 ? 48   GLY B CA  1 
ATOM   877  C  C   . GLY B 2 50  ? 26.896 -42.482 6.916   1.00 105.85 ? 48   GLY B C   1 
ATOM   878  O  O   . GLY B 2 50  ? 27.767 -43.158 6.364   1.00 105.75 ? 48   GLY B O   1 
ATOM   879  N  N   . VAL B 2 51  ? 26.201 -41.534 6.296   1.00 105.65 ? 49   VAL B N   1 
ATOM   880  C  CA  . VAL B 2 51  ? 26.436 -41.145 4.907   1.00 105.49 ? 49   VAL B CA  1 
ATOM   881  C  C   . VAL B 2 51  ? 27.055 -39.748 4.860   1.00 105.55 ? 49   VAL B C   1 
ATOM   882  O  O   . VAL B 2 51  ? 26.681 -38.878 5.649   1.00 105.62 ? 49   VAL B O   1 
ATOM   883  C  CB  . VAL B 2 51  ? 25.119 -41.141 4.114   1.00 105.34 ? 49   VAL B CB  1 
ATOM   884  C  CG1 . VAL B 2 51  ? 25.318 -40.575 2.727   1.00 105.33 ? 49   VAL B CG1 1 
ATOM   885  C  CG2 . VAL B 2 51  ? 24.568 -42.533 4.022   1.00 105.44 ? 49   VAL B CG2 1 
ATOM   886  N  N   . PHE B 2 52  ? 27.994 -39.537 3.936   1.00 105.58 ? 50   PHE B N   1 
ATOM   887  C  CA  . PHE B 2 52  ? 28.682 -38.246 3.808   1.00 105.65 ? 50   PHE B CA  1 
ATOM   888  C  C   . PHE B 2 52  ? 28.605 -37.664 2.395   1.00 105.75 ? 50   PHE B C   1 
ATOM   889  O  O   . PHE B 2 52  ? 28.682 -38.390 1.405   1.00 105.71 ? 50   PHE B O   1 
ATOM   890  C  CB  . PHE B 2 52  ? 30.141 -38.363 4.255   1.00 105.51 ? 50   PHE B CB  1 
ATOM   891  C  CG  . PHE B 2 52  ? 30.313 -38.947 5.637   1.00 105.35 ? 50   PHE B CG  1 
ATOM   892  C  CD1 . PHE B 2 52  ? 30.506 -38.117 6.737   1.00 105.33 ? 50   PHE B CD1 1 
ATOM   893  C  CD2 . PHE B 2 52  ? 30.292 -40.327 5.836   1.00 104.87 ? 50   PHE B CD2 1 
ATOM   894  C  CE1 . PHE B 2 52  ? 30.670 -38.649 8.013   1.00 105.00 ? 50   PHE B CE1 1 
ATOM   895  C  CE2 . PHE B 2 52  ? 30.456 -40.868 7.107   1.00 104.86 ? 50   PHE B CE2 1 
ATOM   896  C  CZ  . PHE B 2 52  ? 30.648 -40.027 8.196   1.00 105.09 ? 50   PHE B CZ  1 
ATOM   897  N  N   . PHE B 2 53  ? 28.449 -36.347 2.318   1.00 105.91 ? 51   PHE B N   1 
ATOM   898  C  CA  . PHE B 2 53  ? 28.321 -35.661 1.040   1.00 106.17 ? 51   PHE B CA  1 
ATOM   899  C  C   . PHE B 2 53  ? 29.459 -34.688 0.833   1.00 106.31 ? 51   PHE B C   1 
ATOM   900  O  O   . PHE B 2 53  ? 29.803 -33.906 1.727   1.00 106.51 ? 51   PHE B O   1 
ATOM   901  C  CB  . PHE B 2 53  ? 27.008 -34.897 0.962   1.00 106.24 ? 51   PHE B CB  1 
ATOM   902  C  CG  . PHE B 2 53  ? 25.798 -35.760 1.086   1.00 106.53 ? 51   PHE B CG  1 
ATOM   903  C  CD1 . PHE B 2 53  ? 25.172 -35.927 2.317   1.00 106.76 ? 51   PHE B CD1 1 
ATOM   904  C  CD2 . PHE B 2 53  ? 25.270 -36.398 -0.030  1.00 106.69 ? 51   PHE B CD2 1 
ATOM   905  C  CE1 . PHE B 2 53  ? 24.040 -36.721 2.438   1.00 106.79 ? 51   PHE B CE1 1 
ATOM   906  C  CE2 . PHE B 2 53  ? 24.138 -37.194 0.076   1.00 106.68 ? 51   PHE B CE2 1 
ATOM   907  C  CZ  . PHE B 2 53  ? 23.521 -37.357 1.314   1.00 106.77 ? 51   PHE B CZ  1 
ATOM   908  N  N   . LEU B 2 54  ? 30.032 -34.729 -0.362  1.00 106.35 ? 52   LEU B N   1 
ATOM   909  C  CA  . LEU B 2 54  ? 31.159 -33.875 -0.689  1.00 106.19 ? 52   LEU B CA  1 
ATOM   910  C  C   . LEU B 2 54  ? 30.867 -33.050 -1.920  1.00 106.17 ? 52   LEU B C   1 
ATOM   911  O  O   . LEU B 2 54  ? 30.035 -33.411 -2.759  1.00 106.04 ? 52   LEU B O   1 
ATOM   912  C  CB  . LEU B 2 54  ? 32.430 -34.699 -0.895  1.00 106.11 ? 52   LEU B CB  1 
ATOM   913  C  CG  . LEU B 2 54  ? 32.944 -35.468 0.320   1.00 105.99 ? 52   LEU B CG  1 
ATOM   914  C  CD1 . LEU B 2 54  ? 32.277 -36.827 0.415   1.00 106.20 ? 52   LEU B CD1 1 
ATOM   915  C  CD2 . LEU B 2 54  ? 34.431 -35.639 0.214   1.00 106.40 ? 52   LEU B CD2 1 
ATOM   916  N  N   . THR B 2 55  ? 31.560 -31.928 -2.015  1.00 106.25 ? 53   THR B N   1 
ATOM   917  C  CA  . THR B 2 55  ? 31.404 -31.068 -3.154  1.00 106.36 ? 53   THR B CA  1 
ATOM   918  C  C   . THR B 2 55  ? 32.671 -31.069 -4.010  1.00 106.43 ? 53   THR B C   1 
ATOM   919  O  O   . THR B 2 55  ? 33.783 -30.847 -3.522  1.00 106.34 ? 53   THR B O   1 
ATOM   920  C  CB  . THR B 2 55  ? 30.950 -29.663 -2.737  1.00 106.33 ? 53   THR B CB  1 
ATOM   921  O  OG1 . THR B 2 55  ? 30.440 -28.980 -3.886  1.00 106.86 ? 53   THR B OG1 1 
ATOM   922  C  CG2 . THR B 2 55  ? 32.088 -28.861 -2.091  1.00 106.38 ? 53   THR B CG2 1 
ATOM   923  N  N   . ILE B 2 56  ? 32.478 -31.355 -5.292  1.00 106.59 ? 54   ILE B N   1 
ATOM   924  C  CA  . ILE B 2 56  ? 33.558 -31.371 -6.255  1.00 106.75 ? 54   ILE B CA  1 
ATOM   925  C  C   . ILE B 2 56  ? 33.420 -30.196 -7.209  1.00 107.11 ? 54   ILE B C   1 
ATOM   926  O  O   . ILE B 2 56  ? 32.331 -29.898 -7.711  1.00 107.14 ? 54   ILE B O   1 
ATOM   927  C  CB  . ILE B 2 56  ? 33.590 -32.686 -7.032  1.00 106.62 ? 54   ILE B CB  1 
ATOM   928  C  CG1 . ILE B 2 56  ? 34.053 -33.808 -6.112  1.00 106.56 ? 54   ILE B CG1 1 
ATOM   929  C  CG2 . ILE B 2 56  ? 34.526 -32.589 -8.231  1.00 106.71 ? 54   ILE B CG2 1 
ATOM   930  C  CD1 . ILE B 2 56  ? 33.501 -35.154 -6.487  1.00 106.72 ? 54   ILE B CD1 1 
ATOM   931  N  N   . HIS B 2 57  ? 34.545 -29.529 -7.440  1.00 107.45 ? 55   HIS B N   1 
ATOM   932  C  CA  . HIS B 2 57  ? 34.605 -28.423 -8.365  1.00 107.64 ? 55   HIS B CA  1 
ATOM   933  C  C   . HIS B 2 57  ? 35.847 -28.553 -9.230  1.00 107.27 ? 55   HIS B C   1 
ATOM   934  O  O   . HIS B 2 57  ? 36.974 -28.441 -8.744  1.00 107.12 ? 55   HIS B O   1 
ATOM   935  C  CB  . HIS B 2 57  ? 34.612 -27.113 -7.597  1.00 108.00 ? 55   HIS B CB  1 
ATOM   936  C  CG  . HIS B 2 57  ? 33.490 -26.203 -7.969  1.00 109.65 ? 55   HIS B CG  1 
ATOM   937  N  ND1 . HIS B 2 57  ? 32.235 -26.305 -7.404  1.00 110.53 ? 55   HIS B ND1 1 
ATOM   938  C  CD2 . HIS B 2 57  ? 33.426 -25.180 -8.858  1.00 110.91 ? 55   HIS B CD2 1 
ATOM   939  C  CE1 . HIS B 2 57  ? 31.449 -25.375 -7.922  1.00 111.45 ? 55   HIS B CE1 1 
ATOM   940  N  NE2 . HIS B 2 57  ? 32.146 -24.681 -8.807  1.00 111.73 ? 55   HIS B NE2 1 
ATOM   941  N  N   . PHE B 2 58  ? 35.630 -28.818 -10.512 1.00 107.04 ? 56   PHE B N   1 
ATOM   942  C  CA  . PHE B 2 58  ? 36.728 -28.960 -11.457 1.00 106.94 ? 56   PHE B CA  1 
ATOM   943  C  C   . PHE B 2 58  ? 37.225 -27.597 -11.909 1.00 106.69 ? 56   PHE B C   1 
ATOM   944  O  O   . PHE B 2 58  ? 36.420 -26.738 -12.273 1.00 106.84 ? 56   PHE B O   1 
ATOM   945  C  CB  . PHE B 2 58  ? 36.292 -29.761 -12.683 1.00 107.08 ? 56   PHE B CB  1 
ATOM   946  C  CG  . PHE B 2 58  ? 35.890 -31.168 -12.377 1.00 107.36 ? 56   PHE B CG  1 
ATOM   947  C  CD1 . PHE B 2 58  ? 34.544 -31.528 -12.359 1.00 107.52 ? 56   PHE B CD1 1 
ATOM   948  C  CD2 . PHE B 2 58  ? 36.854 -32.138 -12.111 1.00 107.39 ? 56   PHE B CD2 1 
ATOM   949  C  CE1 . PHE B 2 58  ? 34.162 -32.835 -12.078 1.00 107.50 ? 56   PHE B CE1 1 
ATOM   950  C  CE2 . PHE B 2 58  ? 36.483 -33.449 -11.823 1.00 107.40 ? 56   PHE B CE2 1 
ATOM   951  C  CZ  . PHE B 2 58  ? 35.134 -33.798 -11.808 1.00 107.46 ? 56   PHE B CZ  1 
ATOM   952  N  N   . PRO B 2 59  ? 38.554 -27.390 -11.889 1.00 106.37 ? 57   PRO B N   1 
ATOM   953  C  CA  . PRO B 2 59  ? 39.109 -26.175 -12.462 1.00 106.12 ? 57   PRO B CA  1 
ATOM   954  C  C   . PRO B 2 59  ? 38.925 -26.196 -13.974 1.00 105.89 ? 57   PRO B C   1 
ATOM   955  O  O   . PRO B 2 59  ? 38.790 -27.272 -14.561 1.00 105.90 ? 57   PRO B O   1 
ATOM   956  C  CB  . PRO B 2 59  ? 40.597 -26.269 -12.108 1.00 106.23 ? 57   PRO B CB  1 
ATOM   957  C  CG  . PRO B 2 59  ? 40.681 -27.285 -11.022 1.00 106.11 ? 57   PRO B CG  1 
ATOM   958  C  CD  . PRO B 2 59  ? 39.607 -28.256 -11.335 1.00 106.37 ? 57   PRO B CD  1 
ATOM   959  N  N   . THR B 2 60  ? 38.920 -25.020 -14.595 1.00 105.49 ? 58   THR B N   1 
ATOM   960  C  CA  . THR B 2 60  ? 38.679 -24.902 -16.032 1.00 105.18 ? 58   THR B CA  1 
ATOM   961  C  C   . THR B 2 60  ? 39.792 -25.550 -16.853 1.00 104.79 ? 58   THR B C   1 
ATOM   962  O  O   . THR B 2 60  ? 39.595 -25.911 -18.016 1.00 104.70 ? 58   THR B O   1 
ATOM   963  C  CB  . THR B 2 60  ? 38.556 -23.436 -16.447 1.00 105.29 ? 58   THR B CB  1 
ATOM   964  O  OG1 . THR B 2 60  ? 39.784 -22.764 -16.148 1.00 105.72 ? 58   THR B OG1 1 
ATOM   965  C  CG2 . THR B 2 60  ? 37.404 -22.755 -15.700 1.00 105.47 ? 58   THR B CG2 1 
ATOM   966  N  N   . ASP B 2 61  ? 40.958 -25.693 -16.229 1.00 104.40 ? 59   ASP B N   1 
ATOM   967  C  CA  . ASP B 2 61  ? 42.116 -26.320 -16.856 1.00 104.03 ? 59   ASP B CA  1 
ATOM   968  C  C   . ASP B 2 61  ? 42.473 -27.663 -16.214 1.00 103.54 ? 59   ASP B C   1 
ATOM   969  O  O   . ASP B 2 61  ? 43.629 -28.091 -16.246 1.00 103.36 ? 59   ASP B O   1 
ATOM   970  C  CB  . ASP B 2 61  ? 43.312 -25.367 -16.816 1.00 104.27 ? 59   ASP B CB  1 
ATOM   971  C  CG  . ASP B 2 61  ? 43.675 -24.930 -15.400 1.00 104.82 ? 59   ASP B CG  1 
ATOM   972  O  OD1 . ASP B 2 61  ? 44.811 -24.434 -15.232 1.00 105.90 ? 59   ASP B OD1 1 
ATOM   973  O  OD2 . ASP B 2 61  ? 42.842 -25.070 -14.468 1.00 104.40 ? 59   ASP B OD2 1 
ATOM   974  N  N   . TYR B 2 62  ? 41.471 -28.301 -15.610 1.00 103.04 ? 60   TYR B N   1 
ATOM   975  C  CA  . TYR B 2 62  ? 41.534 -29.708 -15.228 1.00 102.55 ? 60   TYR B CA  1 
ATOM   976  C  C   . TYR B 2 62  ? 41.781 -30.477 -16.534 1.00 102.27 ? 60   TYR B C   1 
ATOM   977  O  O   . TYR B 2 62  ? 41.216 -30.108 -17.567 1.00 102.39 ? 60   TYR B O   1 
ATOM   978  C  CB  . TYR B 2 62  ? 40.202 -30.102 -14.578 1.00 102.47 ? 60   TYR B CB  1 
ATOM   979  C  CG  . TYR B 2 62  ? 40.028 -31.569 -14.237 1.00 102.46 ? 60   TYR B CG  1 
ATOM   980  C  CD1 . TYR B 2 62  ? 40.541 -32.097 -13.051 1.00 102.56 ? 60   TYR B CD1 1 
ATOM   981  C  CD2 . TYR B 2 62  ? 39.323 -32.422 -15.089 1.00 102.43 ? 60   TYR B CD2 1 
ATOM   982  C  CE1 . TYR B 2 62  ? 40.383 -33.448 -12.733 1.00 102.40 ? 60   TYR B CE1 1 
ATOM   983  C  CE2 . TYR B 2 62  ? 39.153 -33.773 -14.779 1.00 102.65 ? 60   TYR B CE2 1 
ATOM   984  C  CZ  . TYR B 2 62  ? 39.687 -34.280 -13.600 1.00 102.61 ? 60   TYR B CZ  1 
ATOM   985  O  OH  . TYR B 2 62  ? 39.521 -35.612 -13.288 1.00 102.37 ? 60   TYR B OH  1 
ATOM   986  N  N   . PRO B 2 63  ? 42.611 -31.545 -16.511 1.00 101.85 ? 61   PRO B N   1 
ATOM   987  C  CA  . PRO B 2 63  ? 43.194 -32.299 -15.404 1.00 101.65 ? 61   PRO B CA  1 
ATOM   988  C  C   . PRO B 2 63  ? 44.535 -31.805 -14.883 1.00 101.45 ? 61   PRO B C   1 
ATOM   989  O  O   . PRO B 2 63  ? 45.117 -32.438 -14.008 1.00 101.26 ? 61   PRO B O   1 
ATOM   990  C  CB  . PRO B 2 63  ? 43.387 -33.684 -16.018 1.00 101.69 ? 61   PRO B CB  1 
ATOM   991  C  CG  . PRO B 2 63  ? 43.702 -33.410 -17.439 1.00 101.63 ? 61   PRO B CG  1 
ATOM   992  C  CD  . PRO B 2 63  ? 43.044 -32.098 -17.808 1.00 101.71 ? 61   PRO B CD  1 
ATOM   993  N  N   . PHE B 2 64  ? 45.019 -30.691 -15.409 1.00 101.51 ? 62   PHE B N   1 
ATOM   994  C  CA  . PHE B 2 64  ? 46.354 -30.219 -15.062 1.00 101.69 ? 62   PHE B CA  1 
ATOM   995  C  C   . PHE B 2 64  ? 46.390 -29.583 -13.675 1.00 102.11 ? 62   PHE B C   1 
ATOM   996  O  O   . PHE B 2 64  ? 47.429 -29.572 -13.013 1.00 102.02 ? 62   PHE B O   1 
ATOM   997  C  CB  . PHE B 2 64  ? 46.889 -29.288 -16.152 1.00 101.43 ? 62   PHE B CB  1 
ATOM   998  C  CG  . PHE B 2 64  ? 46.844 -29.897 -17.528 1.00 100.82 ? 62   PHE B CG  1 
ATOM   999  C  CD1 . PHE B 2 64  ? 45.801 -29.603 -18.399 1.00 100.45 ? 62   PHE B CD1 1 
ATOM   1000 C  CD2 . PHE B 2 64  ? 47.824 -30.792 -17.939 1.00 100.05 ? 62   PHE B CD2 1 
ATOM   1001 C  CE1 . PHE B 2 64  ? 45.746 -30.178 -19.667 1.00 99.92  ? 62   PHE B CE1 1 
ATOM   1002 C  CE2 . PHE B 2 64  ? 47.773 -31.372 -19.201 1.00 99.63  ? 62   PHE B CE2 1 
ATOM   1003 C  CZ  . PHE B 2 64  ? 46.734 -31.062 -20.066 1.00 99.86  ? 62   PHE B CZ  1 
ATOM   1004 N  N   . LYS B 2 65  ? 45.246 -29.070 -13.239 1.00 102.73 ? 63   LYS B N   1 
ATOM   1005 C  CA  . LYS B 2 65  ? 45.076 -28.649 -11.859 1.00 103.42 ? 63   LYS B CA  1 
ATOM   1006 C  C   . LYS B 2 65  ? 44.107 -29.610 -11.180 1.00 103.85 ? 63   LYS B C   1 
ATOM   1007 O  O   . LYS B 2 65  ? 43.191 -30.119 -11.830 1.00 103.77 ? 63   LYS B O   1 
ATOM   1008 C  CB  . LYS B 2 65  ? 44.559 -27.210 -11.779 1.00 103.45 ? 63   LYS B CB  1 
ATOM   1009 C  CG  . LYS B 2 65  ? 45.425 -26.183 -12.502 1.00 104.22 ? 63   LYS B CG  1 
ATOM   1010 C  CD  . LYS B 2 65  ? 46.886 -26.189 -12.026 1.00 105.52 ? 63   LYS B CD  1 
ATOM   1011 C  CE  . LYS B 2 65  ? 47.141 -25.186 -10.900 1.00 105.95 ? 63   LYS B CE  1 
ATOM   1012 N  NZ  . LYS B 2 65  ? 47.323 -23.790 -11.401 1.00 105.68 ? 63   LYS B NZ  1 
ATOM   1013 N  N   . PRO B 2 66  ? 44.317 -29.872 -9.875  1.00 104.38 ? 64   PRO B N   1 
ATOM   1014 C  CA  . PRO B 2 66  ? 43.451 -30.759 -9.086  1.00 104.71 ? 64   PRO B CA  1 
ATOM   1015 C  C   . PRO B 2 66  ? 42.080 -30.142 -8.809  1.00 105.09 ? 64   PRO B C   1 
ATOM   1016 O  O   . PRO B 2 66  ? 41.975 -28.919 -8.697  1.00 105.17 ? 64   PRO B O   1 
ATOM   1017 C  CB  . PRO B 2 66  ? 44.218 -30.922 -7.771  1.00 104.69 ? 64   PRO B CB  1 
ATOM   1018 C  CG  . PRO B 2 66  ? 45.061 -29.698 -7.665  1.00 104.73 ? 64   PRO B CG  1 
ATOM   1019 C  CD  . PRO B 2 66  ? 45.426 -29.320 -9.071  1.00 104.50 ? 64   PRO B CD  1 
ATOM   1020 N  N   . PRO B 2 67  ? 41.033 -30.981 -8.697  1.00 105.42 ? 65   PRO B N   1 
ATOM   1021 C  CA  . PRO B 2 67  ? 39.691 -30.476 -8.411  1.00 105.79 ? 65   PRO B CA  1 
ATOM   1022 C  C   . PRO B 2 67  ? 39.553 -30.009 -6.968  1.00 106.25 ? 65   PRO B C   1 
ATOM   1023 O  O   . PRO B 2 67  ? 40.300 -30.455 -6.095  1.00 106.27 ? 65   PRO B O   1 
ATOM   1024 C  CB  . PRO B 2 67  ? 38.807 -31.695 -8.651  1.00 105.76 ? 65   PRO B CB  1 
ATOM   1025 C  CG  . PRO B 2 67  ? 39.690 -32.846 -8.351  1.00 105.51 ? 65   PRO B CG  1 
ATOM   1026 C  CD  . PRO B 2 67  ? 41.045 -32.446 -8.837  1.00 105.32 ? 65   PRO B CD  1 
ATOM   1027 N  N   . LYS B 2 68  ? 38.611 -29.102 -6.736  1.00 106.81 ? 66   LYS B N   1 
ATOM   1028 C  CA  . LYS B 2 68  ? 38.316 -28.619 -5.396  1.00 107.46 ? 66   LYS B CA  1 
ATOM   1029 C  C   . LYS B 2 68  ? 37.318 -29.579 -4.758  1.00 107.81 ? 66   LYS B C   1 
ATOM   1030 O  O   . LYS B 2 68  ? 36.180 -29.699 -5.217  1.00 107.97 ? 66   LYS B O   1 
ATOM   1031 C  CB  . LYS B 2 68  ? 37.728 -27.206 -5.456  1.00 107.52 ? 66   LYS B CB  1 
ATOM   1032 C  CG  . LYS B 2 68  ? 38.656 -26.142 -6.036  1.00 107.99 ? 66   LYS B CG  1 
ATOM   1033 C  CD  . LYS B 2 68  ? 39.346 -25.345 -4.931  1.00 108.92 ? 66   LYS B CD  1 
ATOM   1034 C  CE  . LYS B 2 68  ? 40.499 -24.497 -5.468  1.00 109.24 ? 66   LYS B CE  1 
ATOM   1035 N  NZ  . LYS B 2 68  ? 41.713 -25.315 -5.779  1.00 109.31 ? 66   LYS B NZ  1 
ATOM   1036 N  N   . VAL B 2 69  ? 37.743 -30.277 -3.711  1.00 108.18 ? 67   VAL B N   1 
ATOM   1037 C  CA  . VAL B 2 69  ? 36.839 -31.197 -3.022  1.00 108.57 ? 67   VAL B CA  1 
ATOM   1038 C  C   . VAL B 2 69  ? 36.765 -30.906 -1.525  1.00 108.91 ? 67   VAL B C   1 
ATOM   1039 O  O   . VAL B 2 69  ? 37.797 -30.750 -0.867  1.00 109.17 ? 67   VAL B O   1 
ATOM   1040 C  CB  . VAL B 2 69  ? 37.226 -32.664 -3.261  1.00 108.47 ? 67   VAL B CB  1 
ATOM   1041 C  CG1 . VAL B 2 69  ? 36.108 -33.584 -2.803  1.00 108.37 ? 67   VAL B CG1 1 
ATOM   1042 C  CG2 . VAL B 2 69  ? 37.511 -32.896 -4.730  1.00 108.68 ? 67   VAL B CG2 1 
ATOM   1043 N  N   . ALA B 2 70  ? 35.541 -30.821 -1.000  1.00 109.10 ? 68   ALA B N   1 
ATOM   1044 C  CA  . ALA B 2 70  ? 35.323 -30.559 0.421   1.00 109.31 ? 68   ALA B CA  1 
ATOM   1045 C  C   . ALA B 2 70  ? 33.962 -31.058 0.894   1.00 109.51 ? 68   ALA B C   1 
ATOM   1046 O  O   . ALA B 2 70  ? 32.949 -30.856 0.222   1.00 109.59 ? 68   ALA B O   1 
ATOM   1047 C  CB  . ALA B 2 70  ? 35.481 -29.075 0.718   1.00 109.34 ? 68   ALA B CB  1 
ATOM   1048 N  N   . PHE B 2 71  ? 33.959 -31.710 2.056   1.00 109.76 ? 69   PHE B N   1 
ATOM   1049 C  CA  . PHE B 2 71  ? 32.746 -32.239 2.685   1.00 109.96 ? 69   PHE B CA  1 
ATOM   1050 C  C   . PHE B 2 71  ? 31.768 -31.129 3.026   1.00 110.12 ? 69   PHE B C   1 
ATOM   1051 O  O   . PHE B 2 71  ? 32.140 -30.153 3.681   1.00 110.24 ? 69   PHE B O   1 
ATOM   1052 C  CB  . PHE B 2 71  ? 33.094 -32.938 3.997   1.00 109.96 ? 69   PHE B CB  1 
ATOM   1053 C  CG  . PHE B 2 71  ? 33.825 -34.233 3.833   1.00 109.98 ? 69   PHE B CG  1 
ATOM   1054 C  CD1 . PHE B 2 71  ? 33.149 -35.441 3.954   1.00 110.36 ? 69   PHE B CD1 1 
ATOM   1055 C  CD2 . PHE B 2 71  ? 35.193 -34.252 3.602   1.00 109.87 ? 69   PHE B CD2 1 
ATOM   1056 C  CE1 . PHE B 2 71  ? 33.823 -36.652 3.823   1.00 110.33 ? 69   PHE B CE1 1 
ATOM   1057 C  CE2 . PHE B 2 71  ? 35.875 -35.455 3.466   1.00 110.04 ? 69   PHE B CE2 1 
ATOM   1058 C  CZ  . PHE B 2 71  ? 35.189 -36.658 3.578   1.00 110.11 ? 69   PHE B CZ  1 
ATOM   1059 N  N   . THR B 2 72  ? 30.522 -31.277 2.589   1.00 110.24 ? 70   THR B N   1 
ATOM   1060 C  CA  . THR B 2 72  ? 29.457 -30.400 3.066   1.00 110.47 ? 70   THR B CA  1 
ATOM   1061 C  C   . THR B 2 72  ? 28.936 -30.943 4.390   1.00 110.52 ? 70   THR B C   1 
ATOM   1062 O  O   . THR B 2 72  ? 28.543 -30.177 5.272   1.00 110.57 ? 70   THR B O   1 
ATOM   1063 C  CB  . THR B 2 72  ? 28.305 -30.246 2.049   1.00 110.50 ? 70   THR B CB  1 
ATOM   1064 O  OG1 . THR B 2 72  ? 28.047 -31.502 1.411   1.00 110.83 ? 70   THR B OG1 1 
ATOM   1065 C  CG2 . THR B 2 72  ? 28.661 -29.207 0.992   1.00 110.53 ? 70   THR B CG2 1 
ATOM   1066 N  N   . THR B 2 73  ? 28.956 -32.271 4.515   1.00 110.66 ? 71   THR B N   1 
ATOM   1067 C  CA  . THR B 2 73  ? 28.588 -32.979 5.746   1.00 110.72 ? 71   THR B CA  1 
ATOM   1068 C  C   . THR B 2 73  ? 29.592 -32.678 6.863   1.00 110.86 ? 71   THR B C   1 
ATOM   1069 O  O   . THR B 2 73  ? 30.778 -32.431 6.600   1.00 110.98 ? 71   THR B O   1 
ATOM   1070 C  CB  . THR B 2 73  ? 28.529 -34.513 5.516   1.00 110.64 ? 71   THR B CB  1 
ATOM   1071 O  OG1 . THR B 2 73  ? 27.766 -34.799 4.337   1.00 110.48 ? 71   THR B OG1 1 
ATOM   1072 C  CG2 . THR B 2 73  ? 27.894 -35.222 6.701   1.00 110.57 ? 71   THR B CG2 1 
ATOM   1073 N  N   . ARG B 2 74  ? 29.108 -32.691 8.104   1.00 110.80 ? 72   ARG B N   1 
ATOM   1074 C  CA  . ARG B 2 74  ? 29.964 -32.514 9.271   1.00 110.80 ? 72   ARG B CA  1 
ATOM   1075 C  C   . ARG B 2 74  ? 30.708 -33.817 9.526   1.00 110.73 ? 72   ARG B C   1 
ATOM   1076 O  O   . ARG B 2 74  ? 30.173 -34.895 9.264   1.00 110.74 ? 72   ARG B O   1 
ATOM   1077 C  CB  . ARG B 2 74  ? 29.124 -32.142 10.489  1.00 110.79 ? 72   ARG B CB  1 
ATOM   1078 C  CG  . ARG B 2 74  ? 29.855 -31.311 11.534  1.00 111.07 ? 72   ARG B CG  1 
ATOM   1079 C  CD  . ARG B 2 74  ? 29.340 -31.665 12.909  1.00 111.26 ? 72   ARG B CD  1 
ATOM   1080 N  NE  . ARG B 2 74  ? 29.558 -30.645 13.930  1.00 111.58 ? 72   ARG B NE  1 
ATOM   1081 C  CZ  . ARG B 2 74  ? 28.689 -29.682 14.231  1.00 111.86 ? 72   ARG B CZ  1 
ATOM   1082 N  NH1 . ARG B 2 74  ? 27.540 -29.582 13.576  1.00 111.92 ? 72   ARG B NH1 1 
ATOM   1083 N  NH2 . ARG B 2 74  ? 28.974 -28.807 15.185  1.00 112.20 ? 72   ARG B NH2 1 
ATOM   1084 N  N   . ILE B 2 75  ? 31.939 -33.720 10.026  1.00 110.72 ? 73   ILE B N   1 
ATOM   1085 C  CA  . ILE B 2 75  ? 32.755 -34.909 10.288  1.00 110.80 ? 73   ILE B CA  1 
ATOM   1086 C  C   . ILE B 2 75  ? 33.917 -34.688 11.263  1.00 110.87 ? 73   ILE B C   1 
ATOM   1087 O  O   . ILE B 2 75  ? 34.560 -33.634 11.262  1.00 110.93 ? 73   ILE B O   1 
ATOM   1088 C  CB  . ILE B 2 75  ? 33.277 -35.545 8.974   1.00 110.78 ? 73   ILE B CB  1 
ATOM   1089 C  CG1 . ILE B 2 75  ? 34.051 -36.838 9.272   1.00 110.79 ? 73   ILE B CG1 1 
ATOM   1090 C  CG2 . ILE B 2 75  ? 34.102 -34.533 8.173   1.00 110.98 ? 73   ILE B CG2 1 
ATOM   1091 C  CD1 . ILE B 2 75  ? 34.149 -37.799 8.106   1.00 111.15 ? 73   ILE B CD1 1 
ATOM   1092 N  N   . TYR B 2 76  ? 34.174 -35.709 12.080  1.00 110.95 ? 74   TYR B N   1 
ATOM   1093 C  CA  . TYR B 2 76  ? 35.250 -35.700 13.067  1.00 110.98 ? 74   TYR B CA  1 
ATOM   1094 C  C   . TYR B 2 76  ? 36.448 -36.507 12.559  1.00 110.92 ? 74   TYR B C   1 
ATOM   1095 O  O   . TYR B 2 76  ? 36.471 -37.733 12.661  1.00 110.90 ? 74   TYR B O   1 
ATOM   1096 C  CB  . TYR B 2 76  ? 34.731 -36.266 14.396  1.00 111.02 ? 74   TYR B CB  1 
ATOM   1097 C  CG  . TYR B 2 76  ? 35.686 -36.142 15.567  1.00 111.06 ? 74   TYR B CG  1 
ATOM   1098 C  CD1 . TYR B 2 76  ? 36.380 -37.253 16.042  1.00 111.10 ? 74   TYR B CD1 1 
ATOM   1099 C  CD2 . TYR B 2 76  ? 35.884 -34.918 16.209  1.00 110.93 ? 74   TYR B CD2 1 
ATOM   1100 C  CE1 . TYR B 2 76  ? 37.253 -37.150 17.119  1.00 110.91 ? 74   TYR B CE1 1 
ATOM   1101 C  CE2 . TYR B 2 76  ? 36.757 -34.805 17.287  1.00 110.79 ? 74   TYR B CE2 1 
ATOM   1102 C  CZ  . TYR B 2 76  ? 37.435 -35.926 17.735  1.00 110.82 ? 74   TYR B CZ  1 
ATOM   1103 O  OH  . TYR B 2 76  ? 38.299 -35.827 18.797  1.00 110.93 ? 74   TYR B OH  1 
ATOM   1104 N  N   . HIS B 2 77  ? 37.434 -35.804 12.007  1.00 110.88 ? 75   HIS B N   1 
ATOM   1105 C  CA  . HIS B 2 77  ? 38.626 -36.424 11.423  1.00 110.90 ? 75   HIS B CA  1 
ATOM   1106 C  C   . HIS B 2 77  ? 39.772 -35.413 11.437  1.00 110.84 ? 75   HIS B C   1 
ATOM   1107 O  O   . HIS B 2 77  ? 39.594 -34.272 10.999  1.00 110.91 ? 75   HIS B O   1 
ATOM   1108 C  CB  . HIS B 2 77  ? 38.346 -36.881 9.984   1.00 110.94 ? 75   HIS B CB  1 
ATOM   1109 C  CG  . HIS B 2 77  ? 39.414 -37.755 9.397   1.00 111.06 ? 75   HIS B CG  1 
ATOM   1110 N  ND1 . HIS B 2 77  ? 40.648 -37.274 9.015   1.00 111.28 ? 75   HIS B ND1 1 
ATOM   1111 C  CD2 . HIS B 2 77  ? 39.421 -39.078 9.102   1.00 110.95 ? 75   HIS B CD2 1 
ATOM   1112 C  CE1 . HIS B 2 77  ? 41.375 -38.264 8.528   1.00 111.20 ? 75   HIS B CE1 1 
ATOM   1113 N  NE2 . HIS B 2 77  ? 40.653 -39.369 8.567   1.00 110.81 ? 75   HIS B NE2 1 
ATOM   1114 N  N   . PRO B 2 78  ? 40.961 -35.833 11.917  1.00 110.67 ? 76   PRO B N   1 
ATOM   1115 C  CA  . PRO B 2 78  ? 42.077 -34.908 12.111  1.00 110.54 ? 76   PRO B CA  1 
ATOM   1116 C  C   . PRO B 2 78  ? 42.498 -34.206 10.831  1.00 110.49 ? 76   PRO B C   1 
ATOM   1117 O  O   . PRO B 2 78  ? 43.093 -33.131 10.890  1.00 110.60 ? 76   PRO B O   1 
ATOM   1118 C  CB  . PRO B 2 78  ? 43.207 -35.820 12.598  1.00 110.53 ? 76   PRO B CB  1 
ATOM   1119 C  CG  . PRO B 2 78  ? 42.815 -37.181 12.160  1.00 110.51 ? 76   PRO B CG  1 
ATOM   1120 C  CD  . PRO B 2 78  ? 41.336 -37.208 12.286  1.00 110.62 ? 76   PRO B CD  1 
ATOM   1121 N  N   . ASN B 2 79  ? 42.182 -34.805 9.687   1.00 110.40 ? 77   ASN B N   1 
ATOM   1122 C  CA  . ASN B 2 79  ? 42.586 -34.255 8.395   1.00 110.38 ? 77   ASN B CA  1 
ATOM   1123 C  C   . ASN B 2 79  ? 41.460 -33.529 7.630   1.00 110.21 ? 77   ASN B C   1 
ATOM   1124 O  O   . ASN B 2 79  ? 41.587 -33.245 6.436   1.00 110.18 ? 77   ASN B O   1 
ATOM   1125 C  CB  . ASN B 2 79  ? 43.264 -35.339 7.540   1.00 110.43 ? 77   ASN B CB  1 
ATOM   1126 C  CG  . ASN B 2 79  ? 44.549 -35.880 8.178   1.00 110.55 ? 77   ASN B CG  1 
ATOM   1127 O  OD1 . ASN B 2 79  ? 44.684 -37.084 8.399   1.00 110.68 ? 77   ASN B OD1 1 
ATOM   1128 N  ND2 . ASN B 2 79  ? 45.493 -34.987 8.477   1.00 110.40 ? 77   ASN B ND2 1 
ATOM   1129 N  N   . ILE B 2 80  ? 40.366 -33.231 8.329   1.00 109.99 ? 78   ILE B N   1 
ATOM   1130 C  CA  . ILE B 2 80  ? 39.260 -32.461 7.757   1.00 109.75 ? 78   ILE B CA  1 
ATOM   1131 C  C   . ILE B 2 80  ? 38.842 -31.369 8.743   1.00 109.80 ? 78   ILE B C   1 
ATOM   1132 O  O   . ILE B 2 80  ? 38.545 -31.662 9.903   1.00 109.86 ? 78   ILE B O   1 
ATOM   1133 C  CB  . ILE B 2 80  ? 38.044 -33.357 7.415   1.00 109.61 ? 78   ILE B CB  1 
ATOM   1134 C  CG1 . ILE B 2 80  ? 38.497 -34.638 6.711   1.00 109.33 ? 78   ILE B CG1 1 
ATOM   1135 C  CG2 . ILE B 2 80  ? 37.043 -32.592 6.552   1.00 109.49 ? 78   ILE B CG2 1 
ATOM   1136 C  CD1 . ILE B 2 80  ? 37.458 -35.726 6.667   1.00 108.93 ? 78   ILE B CD1 1 
ATOM   1137 N  N   . ASN B 2 81  ? 38.820 -30.117 8.283   1.00 109.76 ? 79   ASN B N   1 
ATOM   1138 C  CA  . ASN B 2 81  ? 38.513 -28.978 9.160   1.00 109.71 ? 79   ASN B CA  1 
ATOM   1139 C  C   . ASN B 2 81  ? 37.018 -28.735 9.370   1.00 109.66 ? 79   ASN B C   1 
ATOM   1140 O  O   . ASN B 2 81  ? 36.184 -29.278 8.641   1.00 109.55 ? 79   ASN B O   1 
ATOM   1141 C  CB  . ASN B 2 81  ? 39.221 -27.695 8.683   1.00 109.77 ? 79   ASN B CB  1 
ATOM   1142 C  CG  . ASN B 2 81  ? 38.462 -26.960 7.579   1.00 109.81 ? 79   ASN B CG  1 
ATOM   1143 O  OD1 . ASN B 2 81  ? 37.741 -27.563 6.784   1.00 109.94 ? 79   ASN B OD1 1 
ATOM   1144 N  ND2 . ASN B 2 81  ? 38.638 -25.644 7.526   1.00 109.72 ? 79   ASN B ND2 1 
ATOM   1145 N  N   . SER B 2 82  ? 36.695 -27.903 10.360  1.00 109.68 ? 80   SER B N   1 
ATOM   1146 C  CA  . SER B 2 82  ? 35.305 -27.590 10.708  1.00 109.71 ? 80   SER B CA  1 
ATOM   1147 C  C   . SER B 2 82  ? 34.536 -26.898 9.575   1.00 109.74 ? 80   SER B C   1 
ATOM   1148 O  O   . SER B 2 82  ? 33.307 -26.791 9.627   1.00 109.79 ? 80   SER B O   1 
ATOM   1149 C  CB  . SER B 2 82  ? 35.249 -26.742 11.985  1.00 109.68 ? 80   SER B CB  1 
ATOM   1150 O  OG  . SER B 2 82  ? 35.802 -25.456 11.774  1.00 109.52 ? 80   SER B OG  1 
ATOM   1151 N  N   . ASN B 2 83  ? 35.260 -26.438 8.557   1.00 109.70 ? 81   ASN B N   1 
ATOM   1152 C  CA  . ASN B 2 83  ? 34.644 -25.766 7.418   1.00 109.61 ? 81   ASN B CA  1 
ATOM   1153 C  C   . ASN B 2 83  ? 34.471 -26.672 6.196   1.00 109.53 ? 81   ASN B C   1 
ATOM   1154 O  O   . ASN B 2 83  ? 33.831 -26.282 5.216   1.00 109.48 ? 81   ASN B O   1 
ATOM   1155 C  CB  . ASN B 2 83  ? 35.422 -24.500 7.055   1.00 109.61 ? 81   ASN B CB  1 
ATOM   1156 C  CG  . ASN B 2 83  ? 34.524 -23.398 6.531   1.00 109.69 ? 81   ASN B CG  1 
ATOM   1157 O  OD1 . ASN B 2 83  ? 34.797 -22.805 5.488   1.00 109.93 ? 81   ASN B OD1 1 
ATOM   1158 N  ND2 . ASN B 2 83  ? 33.443 -23.117 7.253   1.00 109.77 ? 81   ASN B ND2 1 
ATOM   1159 N  N   . GLY B 2 84  ? 35.044 -27.873 6.262   1.00 109.49 ? 82   GLY B N   1 
ATOM   1160 C  CA  . GLY B 2 84  ? 34.837 -28.895 5.232   1.00 109.49 ? 82   GLY B CA  1 
ATOM   1161 C  C   . GLY B 2 84  ? 36.052 -29.334 4.428   1.00 109.48 ? 82   GLY B C   1 
ATOM   1162 O  O   . GLY B 2 84  ? 36.048 -30.423 3.847   1.00 109.44 ? 82   GLY B O   1 
ATOM   1163 N  N   . SER B 2 85  ? 37.084 -28.490 4.389   1.00 109.43 ? 83   SER B N   1 
ATOM   1164 C  CA  . SER B 2 85  ? 38.294 -28.747 3.602   1.00 109.39 ? 83   SER B CA  1 
ATOM   1165 C  C   . SER B 2 85  ? 38.978 -30.057 3.957   1.00 109.32 ? 83   SER B C   1 
ATOM   1166 O  O   . SER B 2 85  ? 39.053 -30.437 5.126   1.00 109.21 ? 83   SER B O   1 
ATOM   1167 C  CB  . SER B 2 85  ? 39.297 -27.601 3.755   1.00 109.46 ? 83   SER B CB  1 
ATOM   1168 O  OG  . SER B 2 85  ? 38.843 -26.430 3.103   1.00 109.73 ? 83   SER B OG  1 
ATOM   1169 N  N   . ILE B 2 86  ? 39.485 -30.729 2.930   1.00 109.36 ? 84   ILE B N   1 
ATOM   1170 C  CA  . ILE B 2 86  ? 40.192 -31.995 3.091   1.00 109.44 ? 84   ILE B CA  1 
ATOM   1171 C  C   . ILE B 2 86  ? 41.705 -31.790 2.997   1.00 109.67 ? 84   ILE B C   1 
ATOM   1172 O  O   . ILE B 2 86  ? 42.186 -31.023 2.158   1.00 109.79 ? 84   ILE B O   1 
ATOM   1173 C  CB  . ILE B 2 86  ? 39.753 -33.025 2.031   1.00 109.27 ? 84   ILE B CB  1 
ATOM   1174 C  CG1 . ILE B 2 86  ? 38.226 -33.061 1.915   1.00 108.98 ? 84   ILE B CG1 1 
ATOM   1175 C  CG2 . ILE B 2 86  ? 40.306 -34.405 2.366   1.00 109.31 ? 84   ILE B CG2 1 
ATOM   1176 C  CD1 . ILE B 2 86  ? 37.710 -33.776 0.683   1.00 108.28 ? 84   ILE B CD1 1 
ATOM   1177 N  N   . CYS B 2 87  ? 42.441 -32.481 3.865   1.00 109.92 ? 85   CYS B N   1 
ATOM   1178 C  CA  . CYS B 2 87  ? 43.901 -32.428 3.885   1.00 110.05 ? 85   CYS B CA  1 
ATOM   1179 C  C   . CYS B 2 87  ? 44.482 -33.713 3.301   1.00 110.14 ? 85   CYS B C   1 
ATOM   1180 O  O   . CYS B 2 87  ? 44.779 -34.664 4.030   1.00 110.21 ? 85   CYS B O   1 
ATOM   1181 C  CB  . CYS B 2 87  ? 44.401 -32.201 5.315   1.00 110.08 ? 85   CYS B CB  1 
ATOM   1182 S  SG  . CYS B 2 87  ? 46.175 -32.397 5.560   1.00 110.16 ? 85   CYS B SG  1 
ATOM   1183 N  N   . LEU B 2 88  ? 44.640 -33.733 1.980   1.00 110.21 ? 86   LEU B N   1 
ATOM   1184 C  CA  . LEU B 2 88  ? 45.083 -34.931 1.273   1.00 110.24 ? 86   LEU B CA  1 
ATOM   1185 C  C   . LEU B 2 88  ? 46.180 -34.613 0.262   1.00 110.32 ? 86   LEU B C   1 
ATOM   1186 O  O   . LEU B 2 88  ? 46.106 -33.603 -0.440  1.00 110.44 ? 86   LEU B O   1 
ATOM   1187 C  CB  . LEU B 2 88  ? 43.892 -35.602 0.586   1.00 110.13 ? 86   LEU B CB  1 
ATOM   1188 C  CG  . LEU B 2 88  ? 44.098 -36.988 -0.031  1.00 110.28 ? 86   LEU B CG  1 
ATOM   1189 C  CD1 . LEU B 2 88  ? 44.771 -37.958 0.946   1.00 110.60 ? 86   LEU B CD1 1 
ATOM   1190 C  CD2 . LEU B 2 88  ? 42.776 -37.553 -0.536  1.00 110.22 ? 86   LEU B CD2 1 
ATOM   1191 N  N   . ASP B 2 89  ? 47.188 -35.483 0.191   1.00 110.38 ? 87   ASP B N   1 
ATOM   1192 C  CA  . ASP B 2 89  ? 48.380 -35.240 -0.628  1.00 110.48 ? 87   ASP B CA  1 
ATOM   1193 C  C   . ASP B 2 89  ? 48.081 -34.938 -2.097  1.00 110.28 ? 87   ASP B C   1 
ATOM   1194 O  O   . ASP B 2 89  ? 48.561 -33.935 -2.639  1.00 110.14 ? 87   ASP B O   1 
ATOM   1195 C  CB  . ASP B 2 89  ? 49.385 -36.392 -0.495  1.00 110.70 ? 87   ASP B CB  1 
ATOM   1196 C  CG  . ASP B 2 89  ? 50.539 -36.062 0.461   1.00 111.44 ? 87   ASP B CG  1 
ATOM   1197 O  OD1 . ASP B 2 89  ? 50.280 -35.618 1.604   1.00 111.98 ? 87   ASP B OD1 1 
ATOM   1198 O  OD2 . ASP B 2 89  ? 51.714 -36.251 0.066   1.00 112.21 ? 87   ASP B OD2 1 
ATOM   1199 N  N   . ILE B 2 90  ? 47.280 -35.801 -2.721  1.00 110.17 ? 88   ILE B N   1 
ATOM   1200 C  CA  . ILE B 2 90  ? 46.891 -35.635 -4.128  1.00 110.18 ? 88   ILE B CA  1 
ATOM   1201 C  C   . ILE B 2 90  ? 46.049 -34.392 -4.398  1.00 109.99 ? 88   ILE B C   1 
ATOM   1202 O  O   . ILE B 2 90  ? 46.165 -33.779 -5.459  1.00 110.10 ? 88   ILE B O   1 
ATOM   1203 C  CB  . ILE B 2 90  ? 46.160 -36.875 -4.732  1.00 110.22 ? 88   ILE B CB  1 
ATOM   1204 C  CG1 . ILE B 2 90  ? 45.325 -37.623 -3.684  1.00 110.23 ? 88   ILE B CG1 1 
ATOM   1205 C  CG2 . ILE B 2 90  ? 47.165 -37.782 -5.447  1.00 110.64 ? 88   ILE B CG2 1 
ATOM   1206 C  CD1 . ILE B 2 90  ? 46.084 -38.723 -2.906  1.00 111.31 ? 88   ILE B CD1 1 
ATOM   1207 N  N   . LEU B 2 91  ? 45.204 -34.021 -3.443  1.00 109.60 ? 89   LEU B N   1 
ATOM   1208 C  CA  . LEU B 2 91  ? 44.405 -32.808 -3.581  1.00 109.28 ? 89   LEU B CA  1 
ATOM   1209 C  C   . LEU B 2 91  ? 45.262 -31.552 -3.755  1.00 108.94 ? 89   LEU B C   1 
ATOM   1210 O  O   . LEU B 2 91  ? 44.797 -30.553 -4.305  1.00 108.90 ? 89   LEU B O   1 
ATOM   1211 C  CB  . LEU B 2 91  ? 43.461 -32.654 -2.391  1.00 109.41 ? 89   LEU B CB  1 
ATOM   1212 C  CG  . LEU B 2 91  ? 42.056 -33.249 -2.533  1.00 109.86 ? 89   LEU B CG  1 
ATOM   1213 C  CD1 . LEU B 2 91  ? 41.254 -32.514 -3.604  1.00 110.98 ? 89   LEU B CD1 1 
ATOM   1214 C  CD2 . LEU B 2 91  ? 42.082 -34.742 -2.822  1.00 110.47 ? 89   LEU B CD2 1 
ATOM   1215 N  N   . ARG B 2 92  ? 46.510 -31.623 -3.292  1.00 108.45 ? 90   ARG B N   1 
ATOM   1216 C  CA  . ARG B 2 92  ? 47.447 -30.511 -3.381  1.00 107.99 ? 90   ARG B CA  1 
ATOM   1217 C  C   . ARG B 2 92  ? 48.689 -30.932 -4.151  1.00 107.33 ? 90   ARG B C   1 
ATOM   1218 O  O   . ARG B 2 92  ? 48.618 -31.167 -5.357  1.00 107.34 ? 90   ARG B O   1 
ATOM   1219 C  CB  . ARG B 2 92  ? 47.805 -29.985 -1.983  1.00 108.25 ? 90   ARG B CB  1 
ATOM   1220 C  CG  . ARG B 2 92  ? 46.607 -29.404 -1.230  1.00 109.45 ? 90   ARG B CG  1 
ATOM   1221 C  CD  . ARG B 2 92  ? 46.840 -29.302 0.274   1.00 111.08 ? 90   ARG B CD  1 
ATOM   1222 N  NE  . ARG B 2 92  ? 45.591 -29.472 1.025   1.00 111.96 ? 90   ARG B NE  1 
ATOM   1223 C  CZ  . ARG B 2 92  ? 45.368 -28.991 2.249   1.00 112.56 ? 90   ARG B CZ  1 
ATOM   1224 N  NH1 . ARG B 2 92  ? 46.302 -28.286 2.879   1.00 112.76 ? 90   ARG B NH1 1 
ATOM   1225 N  NH2 . ARG B 2 92  ? 44.199 -29.205 2.843   1.00 112.68 ? 90   ARG B NH2 1 
ATOM   1226 N  N   . SER B 2 93  ? 49.810 -31.054 -3.445  1.00 106.51 ? 91   SER B N   1 
ATOM   1227 C  CA  . SER B 2 93  ? 51.129 -31.226 -4.066  1.00 105.62 ? 91   SER B CA  1 
ATOM   1228 C  C   . SER B 2 93  ? 51.269 -32.438 -4.989  1.00 104.88 ? 91   SER B C   1 
ATOM   1229 O  O   . SER B 2 93  ? 51.949 -32.363 -6.012  1.00 104.90 ? 91   SER B O   1 
ATOM   1230 C  CB  . SER B 2 93  ? 52.219 -31.271 -2.991  1.00 105.70 ? 91   SER B CB  1 
ATOM   1231 O  OG  . SER B 2 93  ? 51.998 -32.338 -2.082  1.00 105.75 ? 91   SER B OG  1 
ATOM   1232 N  N   . GLN B 2 94  ? 50.626 -33.544 -4.630  1.00 103.85 ? 92   GLN B N   1 
ATOM   1233 C  CA  . GLN B 2 94  ? 50.855 -34.810 -5.317  1.00 102.81 ? 92   GLN B CA  1 
ATOM   1234 C  C   . GLN B 2 94  ? 49.917 -35.077 -6.482  1.00 102.01 ? 92   GLN B C   1 
ATOM   1235 O  O   . GLN B 2 94  ? 50.003 -36.128 -7.108  1.00 101.99 ? 92   GLN B O   1 
ATOM   1236 C  CB  . GLN B 2 94  ? 50.799 -35.978 -4.326  1.00 102.96 ? 92   GLN B CB  1 
ATOM   1237 C  CG  . GLN B 2 94  ? 51.944 -36.023 -3.313  1.00 103.01 ? 92   GLN B CG  1 
ATOM   1238 C  CD  . GLN B 2 94  ? 53.317 -36.055 -3.959  1.00 102.88 ? 92   GLN B CD  1 
ATOM   1239 O  OE1 . GLN B 2 94  ? 53.785 -35.053 -4.497  1.00 102.66 ? 92   GLN B OE1 1 
ATOM   1240 N  NE2 . GLN B 2 94  ? 53.977 -37.207 -3.891  1.00 102.91 ? 92   GLN B NE2 1 
ATOM   1241 N  N   . TRP B 2 95  ? 49.028 -34.136 -6.781  1.00 101.03 ? 93   TRP B N   1 
ATOM   1242 C  CA  . TRP B 2 95  ? 48.070 -34.327 -7.866  1.00 100.13 ? 93   TRP B CA  1 
ATOM   1243 C  C   . TRP B 2 95  ? 48.747 -34.659 -9.178  1.00 99.82  ? 93   TRP B C   1 
ATOM   1244 O  O   . TRP B 2 95  ? 49.817 -34.150 -9.475  1.00 99.96  ? 93   TRP B O   1 
ATOM   1245 C  CB  . TRP B 2 95  ? 47.223 -33.084 -8.073  1.00 99.80  ? 93   TRP B CB  1 
ATOM   1246 C  CG  . TRP B 2 95  ? 46.481 -33.133 -9.353  1.00 99.20  ? 93   TRP B CG  1 
ATOM   1247 C  CD1 . TRP B 2 95  ? 46.851 -32.569 -10.532 1.00 98.92  ? 93   TRP B CD1 1 
ATOM   1248 C  CD2 . TRP B 2 95  ? 45.255 -33.817 -9.601  1.00 99.05  ? 93   TRP B CD2 1 
ATOM   1249 N  NE1 . TRP B 2 95  ? 45.922 -32.839 -11.501 1.00 98.83  ? 93   TRP B NE1 1 
ATOM   1250 C  CE2 . TRP B 2 95  ? 44.925 -33.602 -10.955 1.00 99.16  ? 93   TRP B CE2 1 
ATOM   1251 C  CE3 . TRP B 2 95  ? 44.389 -34.575 -8.808  1.00 98.92  ? 93   TRP B CE3 1 
ATOM   1252 C  CZ2 . TRP B 2 95  ? 43.765 -34.126 -11.538 1.00 99.53  ? 93   TRP B CZ2 1 
ATOM   1253 C  CZ3 . TRP B 2 95  ? 43.236 -35.100 -9.391  1.00 99.00  ? 93   TRP B CZ3 1 
ATOM   1254 C  CH2 . TRP B 2 95  ? 42.937 -34.872 -10.741 1.00 99.13  ? 93   TRP B CH2 1 
ATOM   1255 N  N   . SER B 2 96  ? 48.104 -35.502 -9.968  1.00 99.42  ? 94   SER B N   1 
ATOM   1256 C  CA  . SER B 2 96  ? 48.565 -35.795 -11.304 1.00 99.11  ? 94   SER B CA  1 
ATOM   1257 C  C   . SER B 2 96  ? 47.361 -35.941 -12.203 1.00 99.17  ? 94   SER B C   1 
ATOM   1258 O  O   . SER B 2 96  ? 46.370 -36.551 -11.804 1.00 99.41  ? 94   SER B O   1 
ATOM   1259 C  CB  . SER B 2 96  ? 49.362 -37.088 -11.313 1.00 98.98  ? 94   SER B CB  1 
ATOM   1260 O  OG  . SER B 2 96  ? 49.359 -37.652 -12.608 1.00 98.88  ? 94   SER B OG  1 
ATOM   1261 N  N   . PRO B 2 97  ? 47.435 -35.397 -13.429 1.00 99.13  ? 95   PRO B N   1 
ATOM   1262 C  CA  . PRO B 2 97  ? 46.328 -35.518 -14.383 1.00 99.29  ? 95   PRO B CA  1 
ATOM   1263 C  C   . PRO B 2 97  ? 45.994 -36.978 -14.681 1.00 99.43  ? 95   PRO B C   1 
ATOM   1264 O  O   . PRO B 2 97  ? 44.831 -37.315 -14.940 1.00 99.46  ? 95   PRO B O   1 
ATOM   1265 C  CB  . PRO B 2 97  ? 46.863 -34.826 -15.636 1.00 99.10  ? 95   PRO B CB  1 
ATOM   1266 C  CG  . PRO B 2 97  ? 48.332 -34.807 -15.460 1.00 99.19  ? 95   PRO B CG  1 
ATOM   1267 C  CD  . PRO B 2 97  ? 48.558 -34.648 -14.001 1.00 99.07  ? 95   PRO B CD  1 
ATOM   1268 N  N   . ALA B 2 98  ? 47.013 -37.832 -14.610 1.00 99.48  ? 96   ALA B N   1 
ATOM   1269 C  CA  . ALA B 2 98  ? 46.854 -39.263 -14.819 1.00 99.55  ? 96   ALA B CA  1 
ATOM   1270 C  C   . ALA B 2 98  ? 45.773 -39.868 -13.936 1.00 99.59  ? 96   ALA B C   1 
ATOM   1271 O  O   . ALA B 2 98  ? 45.210 -40.905 -14.282 1.00 99.73  ? 96   ALA B O   1 
ATOM   1272 C  CB  . ALA B 2 98  ? 48.172 -39.977 -14.591 1.00 99.63  ? 96   ALA B CB  1 
ATOM   1273 N  N   . LEU B 2 99  ? 45.479 -39.229 -12.805 1.00 99.65  ? 97   LEU B N   1 
ATOM   1274 C  CA  . LEU B 2 99  ? 44.495 -39.787 -11.879 1.00 99.71  ? 97   LEU B CA  1 
ATOM   1275 C  C   . LEU B 2 99  ? 43.136 -39.096 -11.886 1.00 99.84  ? 97   LEU B C   1 
ATOM   1276 O  O   . LEU B 2 99  ? 43.040 -37.872 -12.018 1.00 99.61  ? 97   LEU B O   1 
ATOM   1277 C  CB  . LEU B 2 99  ? 45.057 -39.975 -10.456 1.00 99.77  ? 97   LEU B CB  1 
ATOM   1278 C  CG  . LEU B 2 99  ? 45.999 -38.990 -9.760  1.00 99.64  ? 97   LEU B CG  1 
ATOM   1279 C  CD1 . LEU B 2 99  ? 45.210 -37.903 -9.075  1.00 99.41  ? 97   LEU B CD1 1 
ATOM   1280 C  CD2 . LEU B 2 99  ? 46.876 -39.720 -8.747  1.00 99.44  ? 97   LEU B CD2 1 
ATOM   1281 N  N   . THR B 2 100 ? 42.106 -39.930 -11.732 1.00 100.15 ? 98   THR B N   1 
ATOM   1282 C  CA  . THR B 2 100 ? 40.695 -39.574 -11.919 1.00 100.56 ? 98   THR B CA  1 
ATOM   1283 C  C   . THR B 2 100 ? 39.976 -39.183 -10.643 1.00 100.47 ? 98   THR B C   1 
ATOM   1284 O  O   . THR B 2 100 ? 40.407 -39.531 -9.542  1.00 100.65 ? 98   THR B O   1 
ATOM   1285 C  CB  . THR B 2 100 ? 39.894 -40.778 -12.465 1.00 100.63 ? 98   THR B CB  1 
ATOM   1286 O  OG1 . THR B 2 100 ? 40.111 -41.920 -11.621 1.00 101.38 ? 98   THR B OG1 1 
ATOM   1287 C  CG2 . THR B 2 100 ? 40.313 -41.113 -13.884 1.00 101.12 ? 98   THR B CG2 1 
ATOM   1288 N  N   . ILE B 2 101 ? 38.848 -38.497 -10.811 1.00 100.47 ? 99   ILE B N   1 
ATOM   1289 C  CA  . ILE B 2 101 ? 37.940 -38.194 -9.704  1.00 100.38 ? 99   ILE B CA  1 
ATOM   1290 C  C   . ILE B 2 101 ? 37.583 -39.463 -8.931  1.00 100.14 ? 99   ILE B C   1 
ATOM   1291 O  O   . ILE B 2 101 ? 37.628 -39.497 -7.698  1.00 99.97  ? 99   ILE B O   1 
ATOM   1292 C  CB  . ILE B 2 101 ? 36.652 -37.455 -10.193 1.00 100.49 ? 99   ILE B CB  1 
ATOM   1293 C  CG1 . ILE B 2 101 ? 35.782 -37.042 -9.006  1.00 100.59 ? 99   ILE B CG1 1 
ATOM   1294 C  CG2 . ILE B 2 101 ? 35.854 -38.287 -11.204 1.00 100.43 ? 99   ILE B CG2 1 
ATOM   1295 C  CD1 . ILE B 2 101 ? 36.441 -35.995 -8.133  1.00 101.55 ? 99   ILE B CD1 1 
ATOM   1296 N  N   . SER B 2 102 ? 37.249 -40.508 -9.679  1.00 99.98  ? 100  SER B N   1 
ATOM   1297 C  CA  . SER B 2 102 ? 37.003 -41.810 -9.108  1.00 100.02 ? 100  SER B CA  1 
ATOM   1298 C  C   . SER B 2 102 ? 38.123 -42.161 -8.125  1.00 99.97  ? 100  SER B C   1 
ATOM   1299 O  O   . SER B 2 102 ? 37.866 -42.513 -6.972  1.00 100.02 ? 100  SER B O   1 
ATOM   1300 C  CB  . SER B 2 102 ? 36.893 -42.845 -10.231 1.00 100.02 ? 100  SER B CB  1 
ATOM   1301 O  OG  . SER B 2 102 ? 37.268 -44.139 -9.794  1.00 100.23 ? 100  SER B OG  1 
ATOM   1302 N  N   . LYS B 2 103 ? 39.363 -42.018 -8.574  1.00 99.93  ? 101  LYS B N   1 
ATOM   1303 C  CA  . LYS B 2 103 ? 40.503 -42.430 -7.778  1.00 100.03 ? 101  LYS B CA  1 
ATOM   1304 C  C   . LYS B 2 103 ? 40.678 -41.590 -6.521  1.00 99.79  ? 101  LYS B C   1 
ATOM   1305 O  O   . LYS B 2 103 ? 41.171 -42.088 -5.502  1.00 99.83  ? 101  LYS B O   1 
ATOM   1306 C  CB  . LYS B 2 103 ? 41.781 -42.411 -8.612  1.00 100.20 ? 101  LYS B CB  1 
ATOM   1307 C  CG  . LYS B 2 103 ? 42.820 -43.440 -8.158  1.00 101.18 ? 101  LYS B CG  1 
ATOM   1308 C  CD  . LYS B 2 103 ? 43.885 -43.665 -9.224  1.00 103.08 ? 101  LYS B CD  1 
ATOM   1309 C  CE  . LYS B 2 103 ? 43.256 -43.983 -10.581 1.00 104.26 ? 101  LYS B CE  1 
ATOM   1310 N  NZ  . LYS B 2 103 ? 44.186 -43.675 -11.705 1.00 105.63 ? 101  LYS B NZ  1 
ATOM   1311 N  N   . VAL B 2 104 ? 40.276 -40.325 -6.584  1.00 99.47  ? 102  VAL B N   1 
ATOM   1312 C  CA  . VAL B 2 104 ? 40.431 -39.465 -5.421  1.00 99.35  ? 102  VAL B CA  1 
ATOM   1313 C  C   . VAL B 2 104 ? 39.445 -39.862 -4.329  1.00 99.48  ? 102  VAL B C   1 
ATOM   1314 O  O   . VAL B 2 104 ? 39.830 -40.003 -3.166  1.00 99.78  ? 102  VAL B O   1 
ATOM   1315 C  CB  . VAL B 2 104 ? 40.359 -37.957 -5.755  1.00 99.21  ? 102  VAL B CB  1 
ATOM   1316 C  CG1 . VAL B 2 104 ? 41.105 -37.673 -7.033  1.00 99.08  ? 102  VAL B CG1 1 
ATOM   1317 C  CG2 . VAL B 2 104 ? 38.931 -37.468 -5.858  1.00 99.18  ? 102  VAL B CG2 1 
ATOM   1318 N  N   . LEU B 2 105 ? 38.192 -40.091 -4.710  1.00 99.38  ? 103  LEU B N   1 
ATOM   1319 C  CA  . LEU B 2 105 ? 37.186 -40.554 -3.762  1.00 99.28  ? 103  LEU B CA  1 
ATOM   1320 C  C   . LEU B 2 105 ? 37.721 -41.731 -2.959  1.00 99.55  ? 103  LEU B C   1 
ATOM   1321 O  O   . LEU B 2 105 ? 37.653 -41.737 -1.729  1.00 99.49  ? 103  LEU B O   1 
ATOM   1322 C  CB  . LEU B 2 105 ? 35.911 -40.949 -4.494  1.00 99.06  ? 103  LEU B CB  1 
ATOM   1323 C  CG  . LEU B 2 105 ? 35.233 -39.827 -5.269  1.00 98.38  ? 103  LEU B CG  1 
ATOM   1324 C  CD1 . LEU B 2 105 ? 34.255 -40.417 -6.254  1.00 98.34  ? 103  LEU B CD1 1 
ATOM   1325 C  CD2 . LEU B 2 105 ? 34.538 -38.869 -4.329  1.00 97.38  ? 103  LEU B CD2 1 
ATOM   1326 N  N   . LEU B 2 106 ? 38.276 -42.709 -3.668  1.00 99.85  ? 104  LEU B N   1 
ATOM   1327 C  CA  . LEU B 2 106 ? 38.867 -43.874 -3.045  1.00 100.33 ? 104  LEU B CA  1 
ATOM   1328 C  C   . LEU B 2 106 ? 39.849 -43.489 -1.958  1.00 100.67 ? 104  LEU B C   1 
ATOM   1329 O  O   . LEU B 2 106 ? 39.751 -43.969 -0.830  1.00 100.81 ? 104  LEU B O   1 
ATOM   1330 C  CB  . LEU B 2 106 ? 39.587 -44.716 -4.084  1.00 100.44 ? 104  LEU B CB  1 
ATOM   1331 C  CG  . LEU B 2 106 ? 38.742 -45.591 -5.000  1.00 100.98 ? 104  LEU B CG  1 
ATOM   1332 C  CD1 . LEU B 2 106 ? 39.552 -45.936 -6.247  1.00 102.01 ? 104  LEU B CD1 1 
ATOM   1333 C  CD2 . LEU B 2 106 ? 38.273 -46.856 -4.280  1.00 101.19 ? 104  LEU B CD2 1 
ATOM   1334 N  N   . SER B 2 107 ? 40.795 -42.620 -2.295  1.00 101.07 ? 105  SER B N   1 
ATOM   1335 C  CA  . SER B 2 107 ? 41.825 -42.244 -1.339  1.00 101.66 ? 105  SER B CA  1 
ATOM   1336 C  C   . SER B 2 107 ? 41.234 -41.472 -0.164  1.00 101.92 ? 105  SER B C   1 
ATOM   1337 O  O   . SER B 2 107 ? 41.761 -41.530 0.945   1.00 102.00 ? 105  SER B O   1 
ATOM   1338 C  CB  . SER B 2 107 ? 42.933 -41.451 -2.012  1.00 101.58 ? 105  SER B CB  1 
ATOM   1339 O  OG  . SER B 2 107 ? 42.385 -40.332 -2.672  1.00 102.19 ? 105  SER B OG  1 
ATOM   1340 N  N   . ILE B 2 108 ? 40.137 -40.763 -0.407  1.00 102.39 ? 106  ILE B N   1 
ATOM   1341 C  CA  . ILE B 2 108 ? 39.409 -40.113 0.676   1.00 103.05 ? 106  ILE B CA  1 
ATOM   1342 C  C   . ILE B 2 108 ? 38.875 -41.191 1.609   1.00 103.51 ? 106  ILE B C   1 
ATOM   1343 O  O   . ILE B 2 108 ? 39.081 -41.131 2.825   1.00 103.55 ? 106  ILE B O   1 
ATOM   1344 C  CB  . ILE B 2 108 ? 38.237 -39.263 0.159   1.00 103.04 ? 106  ILE B CB  1 
ATOM   1345 C  CG1 . ILE B 2 108 ? 38.742 -38.197 -0.806  1.00 103.25 ? 106  ILE B CG1 1 
ATOM   1346 C  CG2 . ILE B 2 108 ? 37.482 -38.613 1.322   1.00 102.96 ? 106  ILE B CG2 1 
ATOM   1347 C  CD1 . ILE B 2 108 ? 37.686 -37.707 -1.757  1.00 104.21 ? 106  ILE B CD1 1 
ATOM   1348 N  N   . CYS B 2 109 ? 38.196 -42.177 1.031   1.00 103.98 ? 107  CYS B N   1 
ATOM   1349 C  CA  . CYS B 2 109 ? 37.717 -43.306 1.799   1.00 104.57 ? 107  CYS B CA  1 
ATOM   1350 C  C   . CYS B 2 109 ? 38.845 -43.841 2.660   1.00 104.95 ? 107  CYS B C   1 
ATOM   1351 O  O   . CYS B 2 109 ? 38.740 -43.838 3.886   1.00 105.17 ? 107  CYS B O   1 
ATOM   1352 C  CB  . CYS B 2 109 ? 37.193 -44.408 0.886   1.00 104.64 ? 107  CYS B CB  1 
ATOM   1353 S  SG  . CYS B 2 109 ? 35.727 -43.962 -0.037  1.00 105.00 ? 107  CYS B SG  1 
ATOM   1354 N  N   . SER B 2 110 ? 39.934 -44.268 2.025   1.00 105.35 ? 108  SER B N   1 
ATOM   1355 C  CA  . SER B 2 110 ? 41.037 -44.883 2.758   1.00 105.88 ? 108  SER B CA  1 
ATOM   1356 C  C   . SER B 2 110 ? 41.637 -43.928 3.793   1.00 106.09 ? 108  SER B C   1 
ATOM   1357 O  O   . SER B 2 110 ? 42.177 -44.372 4.812   1.00 106.21 ? 108  SER B O   1 
ATOM   1358 C  CB  . SER B 2 110 ? 42.107 -45.421 1.808   1.00 105.83 ? 108  SER B CB  1 
ATOM   1359 O  OG  . SER B 2 110 ? 42.667 -44.374 1.046   1.00 106.34 ? 108  SER B OG  1 
ATOM   1360 N  N   . LEU B 2 111 ? 41.518 -42.626 3.537   1.00 106.30 ? 109  LEU B N   1 
ATOM   1361 C  CA  . LEU B 2 111 ? 41.925 -41.613 4.508   1.00 106.63 ? 109  LEU B CA  1 
ATOM   1362 C  C   . LEU B 2 111 ? 41.022 -41.631 5.746   1.00 107.01 ? 109  LEU B C   1 
ATOM   1363 O  O   . LEU B 2 111 ? 41.495 -41.444 6.871   1.00 107.25 ? 109  LEU B O   1 
ATOM   1364 C  CB  . LEU B 2 111 ? 41.954 -40.219 3.870   1.00 106.51 ? 109  LEU B CB  1 
ATOM   1365 C  CG  . LEU B 2 111 ? 42.077 -38.979 4.767   1.00 106.37 ? 109  LEU B CG  1 
ATOM   1366 C  CD1 . LEU B 2 111 ? 43.370 -38.958 5.586   1.00 106.21 ? 109  LEU B CD1 1 
ATOM   1367 C  CD2 . LEU B 2 111 ? 41.959 -37.729 3.927   1.00 106.52 ? 109  LEU B CD2 1 
ATOM   1368 N  N   . LEU B 2 112 ? 39.730 -41.861 5.541   1.00 107.29 ? 110  LEU B N   1 
ATOM   1369 C  CA  . LEU B 2 112 ? 38.811 -41.984 6.664   1.00 107.67 ? 110  LEU B CA  1 
ATOM   1370 C  C   . LEU B 2 112 ? 39.135 -43.219 7.492   1.00 107.97 ? 110  LEU B C   1 
ATOM   1371 O  O   . LEU B 2 112 ? 38.959 -43.220 8.708   1.00 108.08 ? 110  LEU B O   1 
ATOM   1372 C  CB  . LEU B 2 112 ? 37.366 -42.044 6.181   1.00 107.67 ? 110  LEU B CB  1 
ATOM   1373 C  CG  . LEU B 2 112 ? 36.900 -40.904 5.279   1.00 107.89 ? 110  LEU B CG  1 
ATOM   1374 C  CD1 . LEU B 2 112 ? 35.532 -41.225 4.712   1.00 108.16 ? 110  LEU B CD1 1 
ATOM   1375 C  CD2 . LEU B 2 112 ? 36.880 -39.578 6.027   1.00 108.29 ? 110  LEU B CD2 1 
ATOM   1376 N  N   . CYS B 2 113 ? 39.615 -44.265 6.831   1.00 108.36 ? 111  CYS B N   1 
ATOM   1377 C  CA  . CYS B 2 113 ? 39.985 -45.492 7.519   1.00 108.92 ? 111  CYS B CA  1 
ATOM   1378 C  C   . CYS B 2 113 ? 41.314 -45.353 8.246   1.00 109.33 ? 111  CYS B C   1 
ATOM   1379 O  O   . CYS B 2 113 ? 41.529 -45.989 9.286   1.00 109.41 ? 111  CYS B O   1 
ATOM   1380 C  CB  . CYS B 2 113 ? 40.055 -46.650 6.534   1.00 108.91 ? 111  CYS B CB  1 
ATOM   1381 S  SG  . CYS B 2 113 ? 38.514 -46.934 5.684   1.00 109.09 ? 111  CYS B SG  1 
ATOM   1382 N  N   . ASP B 2 114 ? 42.203 -44.533 7.685   1.00 109.73 ? 112  ASP B N   1 
ATOM   1383 C  CA  . ASP B 2 114 ? 43.533 -44.318 8.248   1.00 110.20 ? 112  ASP B CA  1 
ATOM   1384 C  C   . ASP B 2 114 ? 43.976 -42.859 8.136   1.00 110.50 ? 112  ASP B C   1 
ATOM   1385 O  O   . ASP B 2 114 ? 44.565 -42.463 7.129   1.00 110.60 ? 112  ASP B O   1 
ATOM   1386 C  CB  . ASP B 2 114 ? 44.562 -45.239 7.580   1.00 110.24 ? 112  ASP B CB  1 
ATOM   1387 C  CG  . ASP B 2 114 ? 44.351 -46.701 7.926   1.00 110.57 ? 112  ASP B CG  1 
ATOM   1388 O  OD1 . ASP B 2 114 ? 45.050 -47.209 8.831   1.00 110.77 ? 112  ASP B OD1 1 
ATOM   1389 O  OD2 . ASP B 2 114 ? 43.478 -47.341 7.301   1.00 111.01 ? 112  ASP B OD2 1 
ATOM   1390 N  N   . PRO B 2 115 ? 43.678 -42.050 9.168   1.00 110.80 ? 113  PRO B N   1 
ATOM   1391 C  CA  . PRO B 2 115 ? 44.142 -40.664 9.285   1.00 111.21 ? 113  PRO B CA  1 
ATOM   1392 C  C   . PRO B 2 115 ? 45.674 -40.551 9.391   1.00 111.70 ? 113  PRO B C   1 
ATOM   1393 O  O   . PRO B 2 115 ? 46.376 -41.547 9.200   1.00 111.77 ? 113  PRO B O   1 
ATOM   1394 C  CB  . PRO B 2 115 ? 43.475 -40.188 10.577  1.00 111.15 ? 113  PRO B CB  1 
ATOM   1395 C  CG  . PRO B 2 115 ? 42.338 -41.109 10.783  1.00 110.90 ? 113  PRO B CG  1 
ATOM   1396 C  CD  . PRO B 2 115 ? 42.818 -42.423 10.299  1.00 110.73 ? 113  PRO B CD  1 
ATOM   1397 N  N   . ASN B 2 116 ? 46.183 -39.356 9.706   1.00 112.24 ? 114  ASN B N   1 
ATOM   1398 C  CA  . ASN B 2 116 ? 47.628 -39.090 9.627   1.00 112.68 ? 114  ASN B CA  1 
ATOM   1399 C  C   . ASN B 2 116 ? 48.320 -38.478 10.863  1.00 113.14 ? 114  ASN B C   1 
ATOM   1400 O  O   . ASN B 2 116 ? 47.669 -37.830 11.690  1.00 112.98 ? 114  ASN B O   1 
ATOM   1401 C  CB  . ASN B 2 116 ? 47.939 -38.285 8.359   1.00 112.58 ? 114  ASN B CB  1 
ATOM   1402 C  CG  . ASN B 2 116 ? 47.772 -39.112 7.094   1.00 112.34 ? 114  ASN B CG  1 
ATOM   1403 O  OD1 . ASN B 2 116 ? 48.382 -40.172 6.942   1.00 111.81 ? 114  ASN B OD1 1 
ATOM   1404 N  ND2 . ASN B 2 116 ? 46.940 -38.632 6.183   1.00 112.21 ? 114  ASN B ND2 1 
ATOM   1405 N  N   . PRO B 2 117 ? 49.649 -38.707 10.990  1.00 113.72 ? 115  PRO B N   1 
ATOM   1406 C  CA  . PRO B 2 117 ? 50.485 -38.237 12.107  1.00 114.10 ? 115  PRO B CA  1 
ATOM   1407 C  C   . PRO B 2 117 ? 51.234 -36.911 11.874  1.00 114.36 ? 115  PRO B C   1 
ATOM   1408 O  O   . PRO B 2 117 ? 51.418 -36.135 12.817  1.00 114.37 ? 115  PRO B O   1 
ATOM   1409 C  CB  . PRO B 2 117 ? 51.503 -39.375 12.265  1.00 114.14 ? 115  PRO B CB  1 
ATOM   1410 C  CG  . PRO B 2 117 ? 51.610 -40.004 10.871  1.00 114.06 ? 115  PRO B CG  1 
ATOM   1411 C  CD  . PRO B 2 117 ? 50.445 -39.508 10.035  1.00 113.75 ? 115  PRO B CD  1 
ATOM   1412 N  N   . ASP B 2 118 ? 51.664 -36.670 10.637  1.00 114.62 ? 116  ASP B N   1 
ATOM   1413 C  CA  . ASP B 2 118 ? 52.459 -35.495 10.283  1.00 114.86 ? 116  ASP B CA  1 
ATOM   1414 C  C   . ASP B 2 118 ? 51.569 -34.383 9.727   1.00 114.95 ? 116  ASP B C   1 
ATOM   1415 O  O   . ASP B 2 118 ? 51.919 -33.203 9.794   1.00 114.99 ? 116  ASP B O   1 
ATOM   1416 C  CB  . ASP B 2 118 ? 53.524 -35.889 9.250   1.00 114.94 ? 116  ASP B CB  1 
ATOM   1417 C  CG  . ASP B 2 118 ? 54.689 -34.908 9.187   1.00 115.15 ? 116  ASP B CG  1 
ATOM   1418 O  OD1 . ASP B 2 118 ? 54.503 -33.778 8.688   1.00 115.50 ? 116  ASP B OD1 1 
ATOM   1419 O  OD2 . ASP B 2 118 ? 55.804 -35.280 9.613   1.00 115.34 ? 116  ASP B OD2 1 
ATOM   1420 N  N   . ASP B 2 119 ? 50.405 -34.772 9.209   1.00 115.03 ? 117  ASP B N   1 
ATOM   1421 C  CA  . ASP B 2 119 ? 49.514 -33.865 8.477   1.00 115.09 ? 117  ASP B CA  1 
ATOM   1422 C  C   . ASP B 2 119 ? 48.493 -33.037 9.284   1.00 114.87 ? 117  ASP B C   1 
ATOM   1423 O  O   . ASP B 2 119 ? 47.995 -32.034 8.768   1.00 114.83 ? 117  ASP B O   1 
ATOM   1424 C  CB  . ASP B 2 119 ? 48.784 -34.636 7.367   1.00 115.29 ? 117  ASP B CB  1 
ATOM   1425 C  CG  . ASP B 2 119 ? 49.705 -35.034 6.216   1.00 115.82 ? 117  ASP B CG  1 
ATOM   1426 O  OD1 . ASP B 2 119 ? 50.760 -34.382 6.017   1.00 116.29 ? 117  ASP B OD1 1 
ATOM   1427 O  OD2 . ASP B 2 119 ? 49.360 -36.000 5.501   1.00 116.34 ? 117  ASP B OD2 1 
ATOM   1428 N  N   . PRO B 2 120 ? 48.185 -33.435 10.540  1.00 114.69 ? 118  PRO B N   1 
ATOM   1429 C  CA  . PRO B 2 120 ? 47.122 -32.822 11.329  1.00 114.52 ? 118  PRO B CA  1 
ATOM   1430 C  C   . PRO B 2 120 ? 46.613 -31.460 10.848  1.00 114.29 ? 118  PRO B C   1 
ATOM   1431 O  O   . PRO B 2 120 ? 47.261 -30.435 11.075  1.00 114.30 ? 118  PRO B O   1 
ATOM   1432 C  CB  . PRO B 2 120 ? 47.772 -32.709 12.713  1.00 114.56 ? 118  PRO B CB  1 
ATOM   1433 C  CG  . PRO B 2 120 ? 48.820 -33.852 12.739  1.00 114.63 ? 118  PRO B CG  1 
ATOM   1434 C  CD  . PRO B 2 120 ? 48.850 -34.464 11.354  1.00 114.69 ? 118  PRO B CD  1 
ATOM   1435 N  N   . LEU B 2 121 ? 45.463 -31.470 10.176  1.00 114.03 ? 119  LEU B N   1 
ATOM   1436 C  CA  . LEU B 2 121 ? 44.765 -30.243 9.806   1.00 113.85 ? 119  LEU B CA  1 
ATOM   1437 C  C   . LEU B 2 121 ? 44.191 -29.609 11.070  1.00 113.75 ? 119  LEU B C   1 
ATOM   1438 O  O   . LEU B 2 121 ? 44.366 -28.412 11.311  1.00 113.78 ? 119  LEU B O   1 
ATOM   1439 C  CB  . LEU B 2 121 ? 43.639 -30.538 8.807   1.00 113.83 ? 119  LEU B CB  1 
ATOM   1440 C  CG  . LEU B 2 121 ? 43.224 -29.481 7.771   1.00 113.93 ? 119  LEU B CG  1 
ATOM   1441 C  CD1 . LEU B 2 121 ? 42.018 -29.970 6.980   1.00 113.91 ? 119  LEU B CD1 1 
ATOM   1442 C  CD2 . LEU B 2 121 ? 42.929 -28.108 8.375   1.00 114.09 ? 119  LEU B CD2 1 
ATOM   1443 N  N   . VAL B 2 122 ? 43.507 -30.427 11.869  1.00 113.63 ? 120  VAL B N   1 
ATOM   1444 C  CA  . VAL B 2 122 ? 42.967 -30.006 13.163  1.00 113.49 ? 120  VAL B CA  1 
ATOM   1445 C  C   . VAL B 2 122 ? 43.778 -30.664 14.291  1.00 113.33 ? 120  VAL B C   1 
ATOM   1446 O  O   . VAL B 2 122 ? 43.546 -31.833 14.629  1.00 113.31 ? 120  VAL B O   1 
ATOM   1447 C  CB  . VAL B 2 122 ? 41.448 -30.332 13.303  1.00 113.48 ? 120  VAL B CB  1 
ATOM   1448 C  CG1 . VAL B 2 122 ? 40.888 -29.751 14.591  1.00 113.46 ? 120  VAL B CG1 1 
ATOM   1449 C  CG2 . VAL B 2 122 ? 40.665 -29.796 12.111  1.00 113.44 ? 120  VAL B CG2 1 
ATOM   1450 N  N   . PRO B 2 123 ? 44.736 -29.910 14.874  1.00 113.13 ? 121  PRO B N   1 
ATOM   1451 C  CA  . PRO B 2 123 ? 45.639 -30.416 15.911  1.00 112.97 ? 121  PRO B CA  1 
ATOM   1452 C  C   . PRO B 2 123 ? 44.880 -30.844 17.156  1.00 112.84 ? 121  PRO B C   1 
ATOM   1453 O  O   . PRO B 2 123 ? 45.349 -31.710 17.896  1.00 112.85 ? 121  PRO B O   1 
ATOM   1454 C  CB  . PRO B 2 123 ? 46.525 -29.208 16.225  1.00 112.98 ? 121  PRO B CB  1 
ATOM   1455 C  CG  . PRO B 2 123 ? 46.419 -28.334 15.023  1.00 113.07 ? 121  PRO B CG  1 
ATOM   1456 C  CD  . PRO B 2 123 ? 45.010 -28.495 14.571  1.00 113.08 ? 121  PRO B CD  1 
ATOM   1457 N  N   . GLU B 2 124 ? 43.716 -30.228 17.366  1.00 112.68 ? 122  GLU B N   1 
ATOM   1458 C  CA  . GLU B 2 124 ? 42.770 -30.598 18.421  1.00 112.46 ? 122  GLU B CA  1 
ATOM   1459 C  C   . GLU B 2 124 ? 42.439 -32.091 18.395  1.00 112.21 ? 122  GLU B C   1 
ATOM   1460 O  O   . GLU B 2 124 ? 42.424 -32.749 19.437  1.00 112.12 ? 122  GLU B O   1 
ATOM   1461 C  CB  . GLU B 2 124 ? 41.469 -29.806 18.251  1.00 112.52 ? 122  GLU B CB  1 
ATOM   1462 C  CG  . GLU B 2 124 ? 41.611 -28.296 18.330  1.00 112.71 ? 122  GLU B CG  1 
ATOM   1463 C  CD  . GLU B 2 124 ? 41.219 -27.748 19.686  1.00 113.13 ? 122  GLU B CD  1 
ATOM   1464 O  OE1 . GLU B 2 124 ? 41.875 -26.789 20.148  1.00 113.45 ? 122  GLU B OE1 1 
ATOM   1465 O  OE2 . GLU B 2 124 ? 40.256 -28.275 20.289  1.00 113.03 ? 122  GLU B OE2 1 
ATOM   1466 N  N   . ILE B 2 125 ? 42.171 -32.608 17.196  1.00 111.91 ? 123  ILE B N   1 
ATOM   1467 C  CA  . ILE B 2 125 ? 41.737 -33.991 17.012  1.00 111.61 ? 123  ILE B CA  1 
ATOM   1468 C  C   . ILE B 2 125 ? 42.928 -34.948 16.969  1.00 111.41 ? 123  ILE B C   1 
ATOM   1469 O  O   . ILE B 2 125 ? 42.896 -36.015 17.589  1.00 111.37 ? 123  ILE B O   1 
ATOM   1470 C  CB  . ILE B 2 125 ? 40.866 -34.151 15.734  1.00 111.62 ? 123  ILE B CB  1 
ATOM   1471 C  CG1 . ILE B 2 125 ? 39.704 -33.148 15.740  1.00 111.55 ? 123  ILE B CG1 1 
ATOM   1472 C  CG2 . ILE B 2 125 ? 40.339 -35.583 15.611  1.00 111.65 ? 123  ILE B CG2 1 
ATOM   1473 C  CD1 . ILE B 2 125 ? 38.930 -33.063 14.428  1.00 111.59 ? 123  ILE B CD1 1 
ATOM   1474 N  N   . ALA B 2 126 ? 43.976 -34.553 16.249  1.00 111.16 ? 124  ALA B N   1 
ATOM   1475 C  CA  . ALA B 2 126 ? 45.165 -35.385 16.063  1.00 110.95 ? 124  ALA B CA  1 
ATOM   1476 C  C   . ALA B 2 126 ? 45.732 -35.921 17.375  1.00 110.81 ? 124  ALA B C   1 
ATOM   1477 O  O   . ALA B 2 126 ? 46.011 -37.114 17.488  1.00 110.73 ? 124  ALA B O   1 
ATOM   1478 C  CB  . ALA B 2 126 ? 46.227 -34.621 15.303  1.00 110.95 ? 124  ALA B CB  1 
ATOM   1479 N  N   . ARG B 2 127 ? 45.884 -35.036 18.359  1.00 110.70 ? 125  ARG B N   1 
ATOM   1480 C  CA  . ARG B 2 127 ? 46.449 -35.391 19.666  1.00 110.63 ? 125  ARG B CA  1 
ATOM   1481 C  C   . ARG B 2 127 ? 45.674 -36.507 20.372  1.00 110.47 ? 125  ARG B C   1 
ATOM   1482 O  O   . ARG B 2 127 ? 46.275 -37.442 20.909  1.00 110.48 ? 125  ARG B O   1 
ATOM   1483 C  CB  . ARG B 2 127 ? 46.572 -34.154 20.573  1.00 110.67 ? 125  ARG B CB  1 
ATOM   1484 C  CG  . ARG B 2 127 ? 45.283 -33.358 20.755  1.00 110.77 ? 125  ARG B CG  1 
ATOM   1485 C  CD  . ARG B 2 127 ? 45.455 -32.181 21.706  1.00 110.75 ? 125  ARG B CD  1 
ATOM   1486 N  NE  . ARG B 2 127 ? 44.283 -31.303 21.688  1.00 111.00 ? 125  ARG B NE  1 
ATOM   1487 C  CZ  . ARG B 2 127 ? 43.208 -31.449 22.461  1.00 111.06 ? 125  ARG B CZ  1 
ATOM   1488 N  NH1 . ARG B 2 127 ? 43.132 -32.444 23.339  1.00 110.99 ? 125  ARG B NH1 1 
ATOM   1489 N  NH2 . ARG B 2 127 ? 42.200 -30.594 22.355  1.00 111.09 ? 125  ARG B NH2 1 
ATOM   1490 N  N   . ILE B 2 128 ? 44.346 -36.404 20.359  1.00 110.28 ? 126  ILE B N   1 
ATOM   1491 C  CA  . ILE B 2 128 ? 43.473 -37.424 20.941  1.00 110.07 ? 126  ILE B CA  1 
ATOM   1492 C  C   . ILE B 2 128 ? 43.662 -38.741 20.191  1.00 109.92 ? 126  ILE B C   1 
ATOM   1493 O  O   . ILE B 2 128 ? 43.697 -39.814 20.795  1.00 109.94 ? 126  ILE B O   1 
ATOM   1494 C  CB  . ILE B 2 128 ? 41.973 -36.987 20.912  1.00 110.05 ? 126  ILE B CB  1 
ATOM   1495 C  CG1 . ILE B 2 128 ? 41.750 -35.687 21.709  1.00 110.03 ? 126  ILE B CG1 1 
ATOM   1496 C  CG2 . ILE B 2 128 ? 41.049 -38.115 21.395  1.00 109.99 ? 126  ILE B CG2 1 
ATOM   1497 C  CD1 . ILE B 2 128 ? 42.001 -35.777 23.225  1.00 110.05 ? 126  ILE B CD1 1 
ATOM   1498 N  N   . TYR B 2 129 ? 43.807 -38.637 18.874  1.00 109.66 ? 127  TYR B N   1 
ATOM   1499 C  CA  . TYR B 2 129 ? 43.993 -39.794 18.015  1.00 109.43 ? 127  TYR B CA  1 
ATOM   1500 C  C   . TYR B 2 129 ? 45.323 -40.497 18.282  1.00 109.34 ? 127  TYR B C   1 
ATOM   1501 O  O   . TYR B 2 129 ? 45.377 -41.725 18.318  1.00 109.28 ? 127  TYR B O   1 
ATOM   1502 C  CB  . TYR B 2 129 ? 43.888 -39.370 16.547  1.00 109.37 ? 127  TYR B CB  1 
ATOM   1503 C  CG  . TYR B 2 129 ? 44.045 -40.496 15.555  1.00 109.32 ? 127  TYR B CG  1 
ATOM   1504 C  CD1 . TYR B 2 129 ? 42.999 -41.382 15.300  1.00 109.28 ? 127  TYR B CD1 1 
ATOM   1505 C  CD2 . TYR B 2 129 ? 45.236 -40.669 14.858  1.00 109.57 ? 127  TYR B CD2 1 
ATOM   1506 C  CE1 . TYR B 2 129 ? 43.140 -42.420 14.380  1.00 109.28 ? 127  TYR B CE1 1 
ATOM   1507 C  CE2 . TYR B 2 129 ? 45.387 -41.701 13.936  1.00 109.67 ? 127  TYR B CE2 1 
ATOM   1508 C  CZ  . TYR B 2 129 ? 44.338 -42.572 13.702  1.00 109.40 ? 127  TYR B CZ  1 
ATOM   1509 O  OH  . TYR B 2 129 ? 44.496 -43.592 12.792  1.00 109.32 ? 127  TYR B OH  1 
ATOM   1510 N  N   . LYS B 2 130 ? 46.377 -39.711 18.495  1.00 109.27 ? 128  LYS B N   1 
ATOM   1511 C  CA  . LYS B 2 130 ? 47.749 -40.225 18.592  1.00 109.24 ? 128  LYS B CA  1 
ATOM   1512 C  C   . LYS B 2 130 ? 47.895 -41.502 19.424  1.00 109.13 ? 128  LYS B C   1 
ATOM   1513 O  O   . LYS B 2 130 ? 48.299 -42.539 18.896  1.00 109.14 ? 128  LYS B O   1 
ATOM   1514 C  CB  . LYS B 2 130 ? 48.711 -39.139 19.095  1.00 109.29 ? 128  LYS B CB  1 
ATOM   1515 C  CG  . LYS B 2 130 ? 48.878 -37.940 18.155  1.00 109.51 ? 128  LYS B CG  1 
ATOM   1516 C  CD  . LYS B 2 130 ? 49.455 -38.319 16.790  1.00 109.79 ? 128  LYS B CD  1 
ATOM   1517 C  CE  . LYS B 2 130 ? 50.976 -38.379 16.820  1.00 109.96 ? 128  LYS B CE  1 
ATOM   1518 N  NZ  . LYS B 2 130 ? 51.544 -38.695 15.481  1.00 110.04 ? 128  LYS B NZ  1 
ATOM   1519 N  N   . THR B 2 131 ? 47.567 -41.428 20.712  1.00 109.03 ? 129  THR B N   1 
ATOM   1520 C  CA  . THR B 2 131 ? 47.680 -42.592 21.597  1.00 108.96 ? 129  THR B CA  1 
ATOM   1521 C  C   . THR B 2 131 ? 46.468 -42.716 22.533  1.00 108.88 ? 129  THR B C   1 
ATOM   1522 O  O   . THR B 2 131 ? 46.600 -43.054 23.713  1.00 108.86 ? 129  THR B O   1 
ATOM   1523 C  CB  . THR B 2 131 ? 49.020 -42.589 22.391  1.00 108.96 ? 129  THR B CB  1 
ATOM   1524 O  OG1 . THR B 2 131 ? 50.071 -42.070 21.568  1.00 108.95 ? 129  THR B OG1 1 
ATOM   1525 C  CG2 . THR B 2 131 ? 49.395 -44.002 22.842  1.00 108.92 ? 129  THR B CG2 1 
ATOM   1526 N  N   . ASP B 2 132 ? 45.286 -42.437 21.987  1.00 108.79 ? 130  ASP B N   1 
ATOM   1527 C  CA  . ASP B 2 132 ? 44.026 -42.600 22.706  1.00 108.65 ? 130  ASP B CA  1 
ATOM   1528 C  C   . ASP B 2 132 ? 42.890 -42.829 21.707  1.00 108.64 ? 130  ASP B C   1 
ATOM   1529 O  O   . ASP B 2 132 ? 41.930 -42.054 21.640  1.00 108.60 ? 130  ASP B O   1 
ATOM   1530 C  CB  . ASP B 2 132 ? 43.746 -41.385 23.602  1.00 108.60 ? 130  ASP B CB  1 
ATOM   1531 C  CG  . ASP B 2 132 ? 42.686 -41.660 24.659  1.00 108.52 ? 130  ASP B CG  1 
ATOM   1532 O  OD1 . ASP B 2 132 ? 42.207 -40.689 25.279  1.00 108.42 ? 130  ASP B OD1 1 
ATOM   1533 O  OD2 . ASP B 2 132 ? 42.331 -42.838 24.877  1.00 108.50 ? 130  ASP B OD2 1 
ATOM   1534 N  N   . ARG B 2 133 ? 43.023 -43.898 20.924  1.00 108.65 ? 131  ARG B N   1 
ATOM   1535 C  CA  . ARG B 2 133 ? 42.027 -44.274 19.921  1.00 108.66 ? 131  ARG B CA  1 
ATOM   1536 C  C   . ARG B 2 133 ? 40.677 -44.498 20.583  1.00 108.73 ? 131  ARG B C   1 
ATOM   1537 O  O   . ARG B 2 133 ? 39.668 -43.955 20.138  1.00 108.70 ? 131  ARG B O   1 
ATOM   1538 C  CB  . ARG B 2 133 ? 42.458 -45.540 19.170  1.00 108.65 ? 131  ARG B CB  1 
ATOM   1539 C  CG  . ARG B 2 133 ? 43.806 -45.447 18.473  1.00 108.50 ? 131  ARG B CG  1 
ATOM   1540 C  CD  . ARG B 2 133 ? 43.757 -44.513 17.280  1.00 108.35 ? 131  ARG B CD  1 
ATOM   1541 N  NE  . ARG B 2 133 ? 45.093 -44.053 16.916  1.00 108.48 ? 131  ARG B NE  1 
ATOM   1542 C  CZ  . ARG B 2 133 ? 45.809 -44.529 15.901  1.00 108.48 ? 131  ARG B CZ  1 
ATOM   1543 N  NH1 . ARG B 2 133 ? 47.019 -44.038 15.662  1.00 108.55 ? 131  ARG B NH1 1 
ATOM   1544 N  NH2 . ARG B 2 133 ? 45.321 -45.482 15.117  1.00 108.43 ? 131  ARG B NH2 1 
ATOM   1545 N  N   . GLU B 2 134 ? 40.681 -45.301 21.646  1.00 108.88 ? 132  GLU B N   1 
ATOM   1546 C  CA  . GLU B 2 134 ? 39.528 -45.493 22.520  1.00 109.08 ? 132  GLU B CA  1 
ATOM   1547 C  C   . GLU B 2 134 ? 38.618 -44.265 22.484  1.00 109.25 ? 132  GLU B C   1 
ATOM   1548 O  O   . GLU B 2 134 ? 37.486 -44.333 21.996  1.00 109.28 ? 132  GLU B O   1 
ATOM   1549 C  CB  . GLU B 2 134 ? 40.015 -45.753 23.955  1.00 109.09 ? 132  GLU B CB  1 
ATOM   1550 C  CG  . GLU B 2 134 ? 38.922 -45.989 25.002  1.00 108.92 ? 132  GLU B CG  1 
ATOM   1551 C  CD  . GLU B 2 134 ? 38.774 -47.449 25.383  1.00 108.70 ? 132  GLU B CD  1 
ATOM   1552 O  OE1 . GLU B 2 134 ? 38.916 -47.763 26.583  1.00 108.66 ? 132  GLU B OE1 1 
ATOM   1553 O  OE2 . GLU B 2 134 ? 38.524 -48.283 24.488  1.00 108.71 ? 132  GLU B OE2 1 
ATOM   1554 N  N   . LYS B 2 135 ? 39.143 -43.145 22.979  1.00 109.44 ? 133  LYS B N   1 
ATOM   1555 C  CA  . LYS B 2 135 ? 38.412 -41.885 23.055  1.00 109.60 ? 133  LYS B CA  1 
ATOM   1556 C  C   . LYS B 2 135 ? 38.059 -41.379 21.661  1.00 109.76 ? 133  LYS B C   1 
ATOM   1557 O  O   . LYS B 2 135 ? 36.894 -41.112 21.373  1.00 109.76 ? 133  LYS B O   1 
ATOM   1558 C  CB  . LYS B 2 135 ? 39.232 -40.843 23.829  1.00 109.57 ? 133  LYS B CB  1 
ATOM   1559 C  CG  . LYS B 2 135 ? 38.445 -39.623 24.304  1.00 109.47 ? 133  LYS B CG  1 
ATOM   1560 C  CD  . LYS B 2 135 ? 39.063 -38.984 25.551  1.00 109.24 ? 133  LYS B CD  1 
ATOM   1561 C  CE  . LYS B 2 135 ? 38.684 -39.739 26.826  1.00 109.06 ? 133  LYS B CE  1 
ATOM   1562 N  NZ  . LYS B 2 135 ? 39.072 -39.007 28.062  1.00 108.90 ? 133  LYS B NZ  1 
ATOM   1563 N  N   . TYR B 2 136 ? 39.066 -41.282 20.797  1.00 110.00 ? 134  TYR B N   1 
ATOM   1564 C  CA  . TYR B 2 136 ? 38.889 -40.783 19.437  1.00 110.26 ? 134  TYR B CA  1 
ATOM   1565 C  C   . TYR B 2 136 ? 37.649 -41.357 18.749  1.00 110.41 ? 134  TYR B C   1 
ATOM   1566 O  O   . TYR B 2 136 ? 36.748 -40.615 18.352  1.00 110.34 ? 134  TYR B O   1 
ATOM   1567 C  CB  . TYR B 2 136 ? 40.142 -41.070 18.601  1.00 110.29 ? 134  TYR B CB  1 
ATOM   1568 C  CG  . TYR B 2 136 ? 39.925 -40.928 17.112  1.00 110.40 ? 134  TYR B CG  1 
ATOM   1569 C  CD1 . TYR B 2 136 ? 39.661 -42.043 16.319  1.00 110.48 ? 134  TYR B CD1 1 
ATOM   1570 C  CD2 . TYR B 2 136 ? 39.973 -39.677 16.497  1.00 110.50 ? 134  TYR B CD2 1 
ATOM   1571 C  CE1 . TYR B 2 136 ? 39.453 -41.918 14.953  1.00 110.65 ? 134  TYR B CE1 1 
ATOM   1572 C  CE2 . TYR B 2 136 ? 39.768 -39.541 15.128  1.00 110.43 ? 134  TYR B CE2 1 
ATOM   1573 C  CZ  . TYR B 2 136 ? 39.510 -40.666 14.364  1.00 110.50 ? 134  TYR B CZ  1 
ATOM   1574 O  OH  . TYR B 2 136 ? 39.304 -40.543 13.011  1.00 110.58 ? 134  TYR B OH  1 
ATOM   1575 N  N   . ASN B 2 137 ? 37.616 -42.682 18.632  1.00 110.70 ? 135  ASN B N   1 
ATOM   1576 C  CA  . ASN B 2 137 ? 36.576 -43.389 17.888  1.00 110.96 ? 135  ASN B CA  1 
ATOM   1577 C  C   . ASN B 2 137 ? 35.171 -43.160 18.430  1.00 111.09 ? 135  ASN B C   1 
ATOM   1578 O  O   . ASN B 2 137 ? 34.206 -43.111 17.664  1.00 111.15 ? 135  ASN B O   1 
ATOM   1579 C  CB  . ASN B 2 137 ? 36.890 -44.886 17.819  1.00 110.98 ? 135  ASN B CB  1 
ATOM   1580 C  CG  . ASN B 2 137 ? 38.106 -45.186 16.958  1.00 110.97 ? 135  ASN B CG  1 
ATOM   1581 O  OD1 . ASN B 2 137 ? 38.117 -44.913 15.759  1.00 110.52 ? 135  ASN B OD1 1 
ATOM   1582 N  ND2 . ASN B 2 137 ? 39.137 -45.756 17.569  1.00 111.30 ? 135  ASN B ND2 1 
ATOM   1583 N  N   . ARG B 2 138 ? 35.064 -43.018 19.748  1.00 111.24 ? 136  ARG B N   1 
ATOM   1584 C  CA  . ARG B 2 138 ? 33.795 -42.685 20.376  1.00 111.43 ? 136  ARG B CA  1 
ATOM   1585 C  C   . ARG B 2 138 ? 33.239 -41.385 19.792  1.00 111.63 ? 136  ARG B C   1 
ATOM   1586 O  O   . ARG B 2 138 ? 32.125 -41.374 19.272  1.00 111.57 ? 136  ARG B O   1 
ATOM   1587 C  CB  . ARG B 2 138 ? 33.946 -42.607 21.898  1.00 111.39 ? 136  ARG B CB  1 
ATOM   1588 C  CG  . ARG B 2 138 ? 32.757 -42.000 22.629  1.00 111.30 ? 136  ARG B CG  1 
ATOM   1589 C  CD  . ARG B 2 138 ? 32.753 -42.362 24.111  1.00 111.39 ? 136  ARG B CD  1 
ATOM   1590 N  NE  . ARG B 2 138 ? 34.084 -42.339 24.721  1.00 111.32 ? 136  ARG B NE  1 
ATOM   1591 C  CZ  . ARG B 2 138 ? 34.697 -41.249 25.179  1.00 111.27 ? 136  ARG B CZ  1 
ATOM   1592 N  NH1 . ARG B 2 138 ? 34.116 -40.057 25.098  1.00 111.18 ? 136  ARG B NH1 1 
ATOM   1593 N  NH2 . ARG B 2 138 ? 35.904 -41.355 25.719  1.00 111.22 ? 136  ARG B NH2 1 
ATOM   1594 N  N   . ILE B 2 139 ? 34.028 -40.311 19.847  1.00 111.95 ? 137  ILE B N   1 
ATOM   1595 C  CA  . ILE B 2 139 ? 33.608 -39.016 19.302  1.00 112.30 ? 137  ILE B CA  1 
ATOM   1596 C  C   . ILE B 2 139 ? 33.390 -39.119 17.798  1.00 112.60 ? 137  ILE B C   1 
ATOM   1597 O  O   . ILE B 2 139 ? 32.489 -38.481 17.249  1.00 112.66 ? 137  ILE B O   1 
ATOM   1598 C  CB  . ILE B 2 139 ? 34.614 -37.872 19.607  1.00 112.24 ? 137  ILE B CB  1 
ATOM   1599 C  CG1 . ILE B 2 139 ? 34.861 -37.732 21.109  1.00 112.31 ? 137  ILE B CG1 1 
ATOM   1600 C  CG2 . ILE B 2 139 ? 34.103 -36.540 19.073  1.00 112.20 ? 137  ILE B CG2 1 
ATOM   1601 C  CD1 . ILE B 2 139 ? 36.226 -38.195 21.549  1.00 112.24 ? 137  ILE B CD1 1 
ATOM   1602 N  N   . ALA B 2 140 ? 34.213 -39.935 17.145  1.00 113.03 ? 138  ALA B N   1 
ATOM   1603 C  CA  . ALA B 2 140 ? 34.107 -40.163 15.706  1.00 113.44 ? 138  ALA B CA  1 
ATOM   1604 C  C   . ALA B 2 140 ? 32.747 -40.756 15.328  1.00 113.67 ? 138  ALA B C   1 
ATOM   1605 O  O   . ALA B 2 140 ? 32.030 -40.195 14.492  1.00 113.78 ? 138  ALA B O   1 
ATOM   1606 C  CB  . ALA B 2 140 ? 35.246 -41.052 15.221  1.00 113.39 ? 138  ALA B CB  1 
ATOM   1607 N  N   . ARG B 2 141 ? 32.394 -41.875 15.960  1.00 113.85 ? 139  ARG B N   1 
ATOM   1608 C  CA  . ARG B 2 141 ? 31.107 -42.527 15.731  1.00 114.11 ? 139  ARG B CA  1 
ATOM   1609 C  C   . ARG B 2 141 ? 29.956 -41.664 16.232  1.00 114.16 ? 139  ARG B C   1 
ATOM   1610 O  O   . ARG B 2 141 ? 28.873 -41.659 15.643  1.00 114.25 ? 139  ARG B O   1 
ATOM   1611 C  CB  . ARG B 2 141 ? 31.070 -43.907 16.397  1.00 114.09 ? 139  ARG B CB  1 
ATOM   1612 C  CG  . ARG B 2 141 ? 31.801 -44.995 15.617  1.00 114.26 ? 139  ARG B CG  1 
ATOM   1613 C  CD  . ARG B 2 141 ? 31.893 -46.301 16.390  1.00 114.37 ? 139  ARG B CD  1 
ATOM   1614 N  NE  . ARG B 2 141 ? 32.906 -46.252 17.445  1.00 115.12 ? 139  ARG B NE  1 
ATOM   1615 C  CZ  . ARG B 2 141 ? 32.646 -46.138 18.748  1.00 115.32 ? 139  ARG B CZ  1 
ATOM   1616 N  NH1 . ARG B 2 141 ? 33.648 -46.100 19.619  1.00 115.51 ? 139  ARG B NH1 1 
ATOM   1617 N  NH2 . ARG B 2 141 ? 31.395 -46.063 19.188  1.00 115.27 ? 139  ARG B NH2 1 
ATOM   1618 N  N   . GLU B 2 142 ? 30.207 -40.931 17.315  1.00 114.23 ? 140  GLU B N   1 
ATOM   1619 C  CA  . GLU B 2 142 ? 29.208 -40.063 17.932  1.00 114.31 ? 140  GLU B CA  1 
ATOM   1620 C  C   . GLU B 2 142 ? 28.734 -39.014 16.937  1.00 114.35 ? 140  GLU B C   1 
ATOM   1621 O  O   . GLU B 2 142 ? 27.538 -38.759 16.806  1.00 114.39 ? 140  GLU B O   1 
ATOM   1622 C  CB  . GLU B 2 142 ? 29.801 -39.382 19.164  1.00 114.31 ? 140  GLU B CB  1 
ATOM   1623 C  CG  . GLU B 2 142 ? 28.883 -39.338 20.368  1.00 114.27 ? 140  GLU B CG  1 
ATOM   1624 C  CD  . GLU B 2 142 ? 29.658 -39.282 21.670  1.00 114.15 ? 140  GLU B CD  1 
ATOM   1625 O  OE1 . GLU B 2 142 ? 29.611 -40.272 22.427  1.00 114.07 ? 140  GLU B OE1 1 
ATOM   1626 O  OE2 . GLU B 2 142 ? 30.330 -38.260 21.927  1.00 114.14 ? 140  GLU B OE2 1 
ATOM   1627 N  N   . TRP B 2 143 ? 29.689 -38.419 16.235  1.00 114.44 ? 141  TRP B N   1 
ATOM   1628 C  CA  . TRP B 2 143 ? 29.401 -37.431 15.211  1.00 114.58 ? 141  TRP B CA  1 
ATOM   1629 C  C   . TRP B 2 143 ? 28.694 -38.078 14.028  1.00 114.70 ? 141  TRP B C   1 
ATOM   1630 O  O   . TRP B 2 143 ? 27.762 -37.501 13.462  1.00 114.75 ? 141  TRP B O   1 
ATOM   1631 C  CB  . TRP B 2 143 ? 30.697 -36.752 14.769  1.00 114.59 ? 141  TRP B CB  1 
ATOM   1632 C  CG  . TRP B 2 143 ? 31.159 -35.685 15.719  1.00 114.55 ? 141  TRP B CG  1 
ATOM   1633 C  CD1 . TRP B 2 143 ? 31.128 -35.728 17.086  1.00 114.46 ? 141  TRP B CD1 1 
ATOM   1634 C  CD2 . TRP B 2 143 ? 31.733 -34.420 15.372  1.00 114.62 ? 141  TRP B CD2 1 
ATOM   1635 N  NE1 . TRP B 2 143 ? 31.638 -34.566 17.609  1.00 114.50 ? 141  TRP B NE1 1 
ATOM   1636 C  CE2 . TRP B 2 143 ? 32.018 -33.746 16.580  1.00 114.63 ? 141  TRP B CE2 1 
ATOM   1637 C  CE3 . TRP B 2 143 ? 32.033 -33.788 14.156  1.00 114.45 ? 141  TRP B CE3 1 
ATOM   1638 C  CZ2 . TRP B 2 143 ? 32.590 -32.469 16.609  1.00 114.67 ? 141  TRP B CZ2 1 
ATOM   1639 C  CZ3 . TRP B 2 143 ? 32.601 -32.521 14.185  1.00 114.48 ? 141  TRP B CZ3 1 
ATOM   1640 C  CH2 . TRP B 2 143 ? 32.873 -31.875 15.405  1.00 114.58 ? 141  TRP B CH2 1 
ATOM   1641 N  N   . THR B 2 144 ? 29.135 -39.283 13.672  1.00 114.78 ? 142  THR B N   1 
ATOM   1642 C  CA  . THR B 2 144 ? 28.496 -40.066 12.621  1.00 114.88 ? 142  THR B CA  1 
ATOM   1643 C  C   . THR B 2 144 ? 27.010 -40.185 12.942  1.00 114.90 ? 142  THR B C   1 
ATOM   1644 O  O   . THR B 2 144 ? 26.158 -39.889 12.101  1.00 114.89 ? 142  THR B O   1 
ATOM   1645 C  CB  . THR B 2 144 ? 29.139 -41.469 12.484  1.00 114.92 ? 142  THR B CB  1 
ATOM   1646 O  OG1 . THR B 2 144 ? 30.562 -41.338 12.387  1.00 115.18 ? 142  THR B OG1 1 
ATOM   1647 C  CG2 . THR B 2 144 ? 28.625 -42.193 11.249  1.00 114.90 ? 142  THR B CG2 1 
ATOM   1648 N  N   . GLN B 2 145 ? 26.715 -40.590 14.176  1.00 114.94 ? 143  GLN B N   1 
ATOM   1649 C  CA  . GLN B 2 145 ? 25.348 -40.649 14.675  1.00 115.02 ? 143  GLN B CA  1 
ATOM   1650 C  C   . GLN B 2 145 ? 24.626 -39.329 14.431  1.00 115.01 ? 143  GLN B C   1 
ATOM   1651 O  O   . GLN B 2 145 ? 23.596 -39.295 13.760  1.00 115.02 ? 143  GLN B O   1 
ATOM   1652 C  CB  . GLN B 2 145 ? 25.338 -40.986 16.172  1.00 115.07 ? 143  GLN B CB  1 
ATOM   1653 C  CG  . GLN B 2 145 ? 25.536 -42.464 16.507  1.00 115.46 ? 143  GLN B CG  1 
ATOM   1654 C  CD  . GLN B 2 145 ? 24.227 -43.200 16.805  1.00 116.04 ? 143  GLN B CD  1 
ATOM   1655 O  OE1 . GLN B 2 145 ? 23.154 -42.811 16.339  1.00 116.20 ? 143  GLN B OE1 1 
ATOM   1656 N  NE2 . GLN B 2 145 ? 24.320 -44.271 17.587  1.00 116.22 ? 143  GLN B NE2 1 
ATOM   1657 N  N   . LYS B 2 146 ? 25.205 -38.246 14.942  1.00 115.02 ? 144  LYS B N   1 
ATOM   1658 C  CA  . LYS B 2 146 ? 24.519 -36.960 15.035  1.00 115.09 ? 144  LYS B CA  1 
ATOM   1659 C  C   . LYS B 2 146 ? 24.310 -36.237 13.708  1.00 114.97 ? 144  LYS B C   1 
ATOM   1660 O  O   . LYS B 2 146 ? 23.282 -35.591 13.507  1.00 114.89 ? 144  LYS B O   1 
ATOM   1661 C  CB  . LYS B 2 146 ? 25.239 -36.042 16.029  1.00 115.05 ? 144  LYS B CB  1 
ATOM   1662 C  CG  . LYS B 2 146 ? 25.140 -36.507 17.486  1.00 115.44 ? 144  LYS B CG  1 
ATOM   1663 C  CD  . LYS B 2 146 ? 25.529 -35.411 18.482  1.00 115.42 ? 144  LYS B CD  1 
ATOM   1664 C  CE  . LYS B 2 146 ? 27.040 -35.301 18.660  1.00 115.89 ? 144  LYS B CE  1 
ATOM   1665 N  NZ  . LYS B 2 146 ? 27.404 -34.275 19.678  1.00 115.99 ? 144  LYS B NZ  1 
ATOM   1666 N  N   . TYR B 2 147 ? 25.275 -36.350 12.804  1.00 115.04 ? 145  TYR B N   1 
ATOM   1667 C  CA  . TYR B 2 147 ? 25.276 -35.517 11.605  1.00 115.03 ? 145  TYR B CA  1 
ATOM   1668 C  C   . TYR B 2 147 ? 25.254 -36.309 10.309  1.00 115.00 ? 145  TYR B C   1 
ATOM   1669 O  O   . TYR B 2 147 ? 24.700 -35.847 9.309   1.00 115.02 ? 145  TYR B O   1 
ATOM   1670 C  CB  . TYR B 2 147 ? 26.478 -34.573 11.619  1.00 115.03 ? 145  TYR B CB  1 
ATOM   1671 C  CG  . TYR B 2 147 ? 26.721 -33.915 12.960  1.00 115.14 ? 145  TYR B CG  1 
ATOM   1672 C  CD1 . TYR B 2 147 ? 25.974 -32.809 13.361  1.00 115.24 ? 145  TYR B CD1 1 
ATOM   1673 C  CD2 . TYR B 2 147 ? 27.698 -34.402 13.830  1.00 115.24 ? 145  TYR B CD2 1 
ATOM   1674 C  CE1 . TYR B 2 147 ? 26.193 -32.203 14.598  1.00 115.45 ? 145  TYR B CE1 1 
ATOM   1675 C  CE2 . TYR B 2 147 ? 27.930 -33.801 15.068  1.00 115.32 ? 145  TYR B CE2 1 
ATOM   1676 C  CZ  . TYR B 2 147 ? 27.175 -32.700 15.443  1.00 115.35 ? 145  TYR B CZ  1 
ATOM   1677 O  OH  . TYR B 2 147 ? 27.396 -32.099 16.662  1.00 115.32 ? 145  TYR B OH  1 
ATOM   1678 N  N   . ALA B 2 148 ? 25.850 -37.499 10.333  1.00 114.95 ? 146  ALA B N   1 
ATOM   1679 C  CA  . ALA B 2 148 ? 25.997 -38.308 9.127   1.00 114.88 ? 146  ALA B CA  1 
ATOM   1680 C  C   . ALA B 2 148 ? 24.709 -39.015 8.720   1.00 114.85 ? 146  ALA B C   1 
ATOM   1681 O  O   . ALA B 2 148 ? 24.263 -38.885 7.582   1.00 114.87 ? 146  ALA B O   1 
ATOM   1682 C  CB  . ALA B 2 148 ? 27.132 -39.295 9.284   1.00 114.91 ? 146  ALA B CB  1 
ATOM   1683 N  N   . MET B 2 149 ? 24.114 -39.764 9.641   1.00 114.82 ? 147  MET B N   1 
ATOM   1684 C  CA  . MET B 2 149 ? 22.882 -40.490 9.335   1.00 114.97 ? 147  MET B CA  1 
ATOM   1685 C  C   . MET B 2 149 ? 21.638 -39.699 9.729   1.00 114.94 ? 147  MET B C   1 
ATOM   1686 O  O   . MET B 2 149 ? 20.527 -40.232 9.833   1.00 114.86 ? 147  MET B O   1 
ATOM   1687 C  CB  . MET B 2 149 ? 22.885 -41.881 9.977   1.00 115.06 ? 147  MET B CB  1 
ATOM   1688 C  CG  . MET B 2 149 ? 23.633 -41.986 11.297  1.00 115.13 ? 147  MET B CG  1 
ATOM   1689 S  SD  . MET B 2 149 ? 23.710 -43.693 11.867  1.00 115.21 ? 147  MET B SD  1 
ATOM   1690 C  CE  . MET B 2 149 ? 25.214 -43.662 12.837  1.00 115.24 ? 147  MET B CE  1 
ATOM   1691 O  OXT . MET B 2 149 ? 21.729 -38.489 9.937   1.00 115.00 ? 147  MET B OXT 1 
HETATM 1692 ZN ZN  . ZN  C 3 .   ? 46.214 -36.758 -24.909 1.00 82.87  ? 1001 ZN  A ZN  1 
HETATM 1693 ZN ZN  . ZN  D 3 .   ? 57.573 -41.692 -15.946 1.00 82.28  ? 1002 ZN  A ZN  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LEU 1   531 ?   ?   ?   A . n 
A 1 2   GLY 2   532 ?   ?   ?   A . n 
A 1 3   SER 3   533 ?   ?   ?   A . n 
A 1 4   GLY 4   534 ?   ?   ?   A . n 
A 1 5   THR 5   535 ?   ?   ?   A . n 
A 1 6   THR 6   536 ?   ?   ?   A . n 
A 1 7   GLU 7   537 ?   ?   ?   A . n 
A 1 8   ASP 8   538 ?   ?   ?   A . n 
A 1 9   VAL 9   539 ?   ?   ?   A . n 
A 1 10  SER 10  540 ?   ?   ?   A . n 
A 1 11  ASP 11  541 541 ASP ASP A . n 
A 1 12  LEU 12  542 542 LEU LEU A . n 
A 1 13  PRO 13  543 543 PRO PRO A . n 
A 1 14  VAL 14  544 544 VAL VAL A . n 
A 1 15  GLU 15  545 545 GLU GLU A . n 
A 1 16  GLU 16  546 546 GLU GLU A . n 
A 1 17  GLN 17  547 547 GLN GLN A . n 
A 1 18  LEU 18  548 548 LEU LEU A . n 
A 1 19  ARG 19  549 549 ARG ARG A . n 
A 1 20  ARG 20  550 550 ARG ARG A . n 
A 1 21  LEU 21  551 551 LEU LEU A . n 
A 1 22  GLN 22  552 552 GLN GLN A . n 
A 1 23  GLU 23  553 553 GLU GLU A . n 
A 1 24  GLU 24  554 554 GLU GLU A . n 
A 1 25  ARG 25  555 555 ARG ARG A . n 
A 1 26  THR 26  556 556 THR THR A . n 
A 1 27  CYS 27  557 557 CYS CYS A . n 
A 1 28  LYS 28  558 558 LYS LYS A . n 
A 1 29  VAL 29  559 559 VAL VAL A . n 
A 1 30  CYS 30  560 560 CYS CYS A . n 
A 1 31  MET 31  561 561 MET MET A . n 
A 1 32  ASP 32  562 562 ASP ASP A . n 
A 1 33  LYS 33  563 563 LYS LYS A . n 
A 1 34  GLU 34  564 564 GLU GLU A . n 
A 1 35  VAL 35  565 565 VAL VAL A . n 
A 1 36  SER 36  566 566 SER SER A . n 
A 1 37  ILE 37  567 567 ILE ILE A . n 
A 1 38  VAL 38  568 568 VAL VAL A . n 
A 1 39  PHE 39  569 569 PHE PHE A . n 
A 1 40  ILE 40  570 570 ILE ILE A . n 
A 1 41  PRO 41  571 571 PRO PRO A . n 
A 1 42  CYS 42  572 572 CYS CYS A . n 
A 1 43  GLY 43  573 573 GLY GLY A . n 
A 1 44  HIS 44  574 574 HIS HIS A . n 
A 1 45  LEU 45  575 575 LEU LEU A . n 
A 1 46  VAL 46  576 576 VAL VAL A . n 
A 1 47  VAL 47  577 577 VAL VAL A . n 
A 1 48  CYS 48  578 578 CYS CYS A . n 
A 1 49  LYS 49  579 579 LYS LYS A . n 
A 1 50  ASP 50  580 580 ASP ASP A . n 
A 1 51  CYS 51  581 581 CYS CYS A . n 
A 1 52  ALA 52  582 582 ALA ALA A . n 
A 1 53  PRO 53  583 583 PRO PRO A . n 
A 1 54  SER 54  584 584 SER SER A . n 
A 1 55  LEU 55  585 585 LEU LEU A . n 
A 1 56  ARG 56  586 586 ARG ARG A . n 
A 1 57  LYS 57  587 587 LYS LYS A . n 
A 1 58  CYS 58  588 588 CYS CYS A . n 
A 1 59  PRO 59  589 589 PRO PRO A . n 
A 1 60  ILE 60  590 590 ILE ILE A . n 
A 1 61  CYS 61  591 591 CYS CYS A . n 
A 1 62  ARG 62  592 592 ARG ARG A . n 
A 1 63  SER 63  593 593 SER SER A . n 
A 1 64  THR 64  594 594 THR THR A . n 
A 1 65  ILE 65  595 595 ILE ILE A . n 
A 1 66  LYS 66  596 596 LYS LYS A . n 
A 1 67  GLY 67  597 597 GLY GLY A . n 
A 1 68  THR 68  598 598 THR THR A . n 
A 1 69  VAL 69  599 599 VAL VAL A . n 
A 1 70  ARG 70  600 600 ARG ARG A . n 
A 1 71  THR 71  601 601 THR THR A . n 
A 1 72  PHE 72  602 602 PHE PHE A . n 
A 1 73  LEU 73  603 603 LEU LEU A . n 
A 1 74  SER 74  604 604 SER SER A . n 
B 2 1   GLY 1   -1  -1  GLY GLY B . n 
B 2 2   SER 2   0   0   SER SER B . n 
B 2 3   MET 3   1   1   MET MET B . n 
B 2 4   ALA 4   2   2   ALA ALA B . n 
B 2 5   LEU 5   3   3   LEU LEU B . n 
B 2 6   LYS 6   4   4   LYS LYS B . n 
B 2 7   ARG 7   5   5   ARG ARG B . n 
B 2 8   ILE 8   6   6   ILE ILE B . n 
B 2 9   HIS 9   7   7   HIS HIS B . n 
B 2 10  LYS 10  8   8   LYS LYS B . n 
B 2 11  GLU 11  9   9   GLU GLU B . n 
B 2 12  LEU 12  10  10  LEU LEU B . n 
B 2 13  ASN 13  11  11  ASN ASN B . n 
B 2 14  ASP 14  12  12  ASP ASP B . n 
B 2 15  LEU 15  13  13  LEU LEU B . n 
B 2 16  ALA 16  14  14  ALA ALA B . n 
B 2 17  ARG 17  15  15  ARG ARG B . n 
B 2 18  ASP 18  16  16  ASP ASP B . n 
B 2 19  PRO 19  17  17  PRO PRO B . n 
B 2 20  PRO 20  18  18  PRO PRO B . n 
B 2 21  ALA 21  19  19  ALA ALA B . n 
B 2 22  GLN 22  20  20  GLN GLN B . n 
B 2 23  CYS 23  21  21  CYS CYS B . n 
B 2 24  SER 24  22  22  SER SER B . n 
B 2 25  ALA 25  23  23  ALA ALA B . n 
B 2 26  GLY 26  24  24  GLY GLY B . n 
B 2 27  PRO 27  25  25  PRO PRO B . n 
B 2 28  VAL 28  26  26  VAL VAL B . n 
B 2 29  GLY 29  27  27  GLY GLY B . n 
B 2 30  ASP 30  28  28  ASP ASP B . n 
B 2 31  ASP 31  29  29  ASP ASP B . n 
B 2 32  MET 32  30  30  MET MET B . n 
B 2 33  PHE 33  31  31  PHE PHE B . n 
B 2 34  HIS 34  32  32  HIS HIS B . n 
B 2 35  TRP 35  33  33  TRP TRP B . n 
B 2 36  GLN 36  34  34  GLN GLN B . n 
B 2 37  ALA 37  35  35  ALA ALA B . n 
B 2 38  THR 38  36  36  THR THR B . n 
B 2 39  ILE 39  37  37  ILE ILE B . n 
B 2 40  MET 40  38  38  MET MET B . n 
B 2 41  GLY 41  39  39  GLY GLY B . n 
B 2 42  PRO 42  40  40  PRO PRO B . n 
B 2 43  ASN 43  41  41  ASN ASN B . n 
B 2 44  ASP 44  42  42  ASP ASP B . n 
B 2 45  SER 45  43  43  SER SER B . n 
B 2 46  PRO 46  44  44  PRO PRO B . n 
B 2 47  TYR 47  45  45  TYR TYR B . n 
B 2 48  GLN 48  46  46  GLN GLN B . n 
B 2 49  GLY 49  47  47  GLY GLY B . n 
B 2 50  GLY 50  48  48  GLY GLY B . n 
B 2 51  VAL 51  49  49  VAL VAL B . n 
B 2 52  PHE 52  50  50  PHE PHE B . n 
B 2 53  PHE 53  51  51  PHE PHE B . n 
B 2 54  LEU 54  52  52  LEU LEU B . n 
B 2 55  THR 55  53  53  THR THR B . n 
B 2 56  ILE 56  54  54  ILE ILE B . n 
B 2 57  HIS 57  55  55  HIS HIS B . n 
B 2 58  PHE 58  56  56  PHE PHE B . n 
B 2 59  PRO 59  57  57  PRO PRO B . n 
B 2 60  THR 60  58  58  THR THR B . n 
B 2 61  ASP 61  59  59  ASP ASP B . n 
B 2 62  TYR 62  60  60  TYR TYR B . n 
B 2 63  PRO 63  61  61  PRO PRO B . n 
B 2 64  PHE 64  62  62  PHE PHE B . n 
B 2 65  LYS 65  63  63  LYS LYS B . n 
B 2 66  PRO 66  64  64  PRO PRO B . n 
B 2 67  PRO 67  65  65  PRO PRO B . n 
B 2 68  LYS 68  66  66  LYS LYS B . n 
B 2 69  VAL 69  67  67  VAL VAL B . n 
B 2 70  ALA 70  68  68  ALA ALA B . n 
B 2 71  PHE 71  69  69  PHE PHE B . n 
B 2 72  THR 72  70  70  THR THR B . n 
B 2 73  THR 73  71  71  THR THR B . n 
B 2 74  ARG 74  72  72  ARG ARG B . n 
B 2 75  ILE 75  73  73  ILE ILE B . n 
B 2 76  TYR 76  74  74  TYR TYR B . n 
B 2 77  HIS 77  75  75  HIS HIS B . n 
B 2 78  PRO 78  76  76  PRO PRO B . n 
B 2 79  ASN 79  77  77  ASN ASN B . n 
B 2 80  ILE 80  78  78  ILE ILE B . n 
B 2 81  ASN 81  79  79  ASN ASN B . n 
B 2 82  SER 82  80  80  SER SER B . n 
B 2 83  ASN 83  81  81  ASN ASN B . n 
B 2 84  GLY 84  82  82  GLY GLY B . n 
B 2 85  SER 85  83  83  SER SER B . n 
B 2 86  ILE 86  84  84  ILE ILE B . n 
B 2 87  CYS 87  85  85  CYS CYS B . n 
B 2 88  LEU 88  86  86  LEU LEU B . n 
B 2 89  ASP 89  87  87  ASP ASP B . n 
B 2 90  ILE 90  88  88  ILE ILE B . n 
B 2 91  LEU 91  89  89  LEU LEU B . n 
B 2 92  ARG 92  90  90  ARG ARG B . n 
B 2 93  SER 93  91  91  SER SER B . n 
B 2 94  GLN 94  92  92  GLN GLN B . n 
B 2 95  TRP 95  93  93  TRP TRP B . n 
B 2 96  SER 96  94  94  SER SER B . n 
B 2 97  PRO 97  95  95  PRO PRO B . n 
B 2 98  ALA 98  96  96  ALA ALA B . n 
B 2 99  LEU 99  97  97  LEU LEU B . n 
B 2 100 THR 100 98  98  THR THR B . n 
B 2 101 ILE 101 99  99  ILE ILE B . n 
B 2 102 SER 102 100 100 SER SER B . n 
B 2 103 LYS 103 101 101 LYS LYS B . n 
B 2 104 VAL 104 102 102 VAL VAL B . n 
B 2 105 LEU 105 103 103 LEU LEU B . n 
B 2 106 LEU 106 104 104 LEU LEU B . n 
B 2 107 SER 107 105 105 SER SER B . n 
B 2 108 ILE 108 106 106 ILE ILE B . n 
B 2 109 CYS 109 107 107 CYS CYS B . n 
B 2 110 SER 110 108 108 SER SER B . n 
B 2 111 LEU 111 109 109 LEU LEU B . n 
B 2 112 LEU 112 110 110 LEU LEU B . n 
B 2 113 CYS 113 111 111 CYS CYS B . n 
B 2 114 ASP 114 112 112 ASP ASP B . n 
B 2 115 PRO 115 113 113 PRO PRO B . n 
B 2 116 ASN 116 114 114 ASN ASN B . n 
B 2 117 PRO 117 115 115 PRO PRO B . n 
B 2 118 ASP 118 116 116 ASP ASP B . n 
B 2 119 ASP 119 117 117 ASP ASP B . n 
B 2 120 PRO 120 118 118 PRO PRO B . n 
B 2 121 LEU 121 119 119 LEU LEU B . n 
B 2 122 VAL 122 120 120 VAL VAL B . n 
B 2 123 PRO 123 121 121 PRO PRO B . n 
B 2 124 GLU 124 122 122 GLU GLU B . n 
B 2 125 ILE 125 123 123 ILE ILE B . n 
B 2 126 ALA 126 124 124 ALA ALA B . n 
B 2 127 ARG 127 125 125 ARG ARG B . n 
B 2 128 ILE 128 126 126 ILE ILE B . n 
B 2 129 TYR 129 127 127 TYR TYR B . n 
B 2 130 LYS 130 128 128 LYS LYS B . n 
B 2 131 THR 131 129 129 THR THR B . n 
B 2 132 ASP 132 130 130 ASP ASP B . n 
B 2 133 ARG 133 131 131 ARG ARG B . n 
B 2 134 GLU 134 132 132 GLU GLU B . n 
B 2 135 LYS 135 133 133 LYS LYS B . n 
B 2 136 TYR 136 134 134 TYR TYR B . n 
B 2 137 ASN 137 135 135 ASN ASN B . n 
B 2 138 ARG 138 136 136 ARG ARG B . n 
B 2 139 ILE 139 137 137 ILE ILE B . n 
B 2 140 ALA 140 138 138 ALA ALA B . n 
B 2 141 ARG 141 139 139 ARG ARG B . n 
B 2 142 GLU 142 140 140 GLU GLU B . n 
B 2 143 TRP 143 141 141 TRP TRP B . n 
B 2 144 THR 144 142 142 THR THR B . n 
B 2 145 GLN 145 143 143 GLN GLN B . n 
B 2 146 LYS 146 144 144 LYS LYS B . n 
B 2 147 TYR 147 145 145 TYR TYR B . n 
B 2 148 ALA 148 146 146 ALA ALA B . n 
B 2 149 MET 149 147 147 MET MET B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_544 x,x-y-1,-z-1/2 0.5000000000 0.8660254038 0.0000000000 68.6130000000 0.8660254038 
-0.5000000000 0.0000000000 -118.8412020597 0.0000000000 0.0000000000 -1.0000000000 -55.9350000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 27 ? A CYS 557 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 30 ? A CYS 560 ? 1_555 90.3  ? 
2  SG  ? A CYS 27 ? A CYS 557 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 48 ? A CYS 578 ? 1_555 120.5 ? 
3  SG  ? A CYS 30 ? A CYS 560 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 48 ? A CYS 578 ? 1_555 107.1 ? 
4  SG  ? A CYS 27 ? A CYS 557 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 51 ? A CYS 581 ? 1_555 99.3  ? 
5  SG  ? A CYS 30 ? A CYS 560 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 51 ? A CYS 581 ? 1_555 103.5 ? 
6  SG  ? A CYS 48 ? A CYS 578 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG  ? A CYS 51 ? A CYS 581 ? 1_555 128.6 ? 
7  SG  ? A CYS 42 ? A CYS 572 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 ND1 ? A HIS 44 ? A HIS 574 ? 1_555 76.8  ? 
8  SG  ? A CYS 42 ? A CYS 572 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG  ? A CYS 58 ? A CYS 588 ? 1_555 95.7  ? 
9  ND1 ? A HIS 44 ? A HIS 574 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG  ? A CYS 58 ? A CYS 588 ? 1_555 90.1  ? 
10 SG  ? A CYS 42 ? A CYS 572 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG  ? A CYS 61 ? A CYS 591 ? 1_555 118.1 ? 
11 ND1 ? A HIS 44 ? A HIS 574 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG  ? A CYS 61 ? A CYS 591 ? 1_555 135.3 ? 
12 SG  ? A CYS 58 ? A CYS 588 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG  ? A CYS 61 ? A CYS 591 ? 1_555 126.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 49.9410 -43.2690 -23.0150 -0.4013 -0.2021 -0.0913 0.0456  0.2371 0.2450 18.0630 17.7598 11.7175 -0.8516 -3.8596 5.7239 
0.3500 -0.9336 0.5837  0.8026  -1.3207 1.3514 -0.1691 1.4768  -1.2708 'X-RAY DIFFRACTION' 
2 ? refined 36.8120 -36.9740 0.5450   -0.4161 -0.5668 0.0455  -0.1971 0.3855 0.0803 7.5131  4.5737  13.5543 1.0291  -4.0150 
-1.2449 0.8172 -0.4740 -0.3433 -0.5809 0.9427  0.2024 1.0390  -0.4252 0.3926  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 541 A 604 ? A 11 A 74  'X-RAY DIFFRACTION' ? 
2 2 B 0   B 147 ? B 2  B 149 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA       3.2.21   7/4/2006        other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk 'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 1 
REFMAC      5.3.0037 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 2 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 3 
MOSFLM      .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A LEU 542 ? ? N  A PRO 543 ? ? CA A PRO 543 ? ? 131.36 119.30 12.06 1.50 Y 
2 1 CA B LEU 10  ? ? CB B LEU 10  ? ? CG B LEU 10  ? ? 129.41 115.30 14.11 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 543 ? ? -19.60  -148.04 
2  1 VAL A 544 ? ? -2.05   -97.75  
3  1 GLU A 546 ? ? 63.62   124.42  
4  1 LEU A 548 ? ? 162.97  -61.84  
5  1 MET A 561 ? ? 28.86   50.65   
6  1 ASP A 562 ? ? -134.29 -58.58  
7  1 SER A 566 ? ? -143.34 -13.12  
8  1 VAL A 576 ? ? -142.54 -8.99   
9  1 ILE A 590 ? ? -88.15  -73.21  
10 1 SER B 0   ? ? -124.28 -114.11 
11 1 LEU B 3   ? ? -51.39  -71.38  
12 1 ALA B 19  ? ? 47.49   -74.37  
13 1 ASP B 29  ? ? -66.48  99.11   
14 1 ARG B 90  ? ? -121.88 -109.90 
15 1 PRO B 113 ? ? -63.40  -169.99 
16 1 PRO B 118 ? ? -16.41  101.29  
17 1 ASP B 130 ? ? -154.28 59.58   
18 1 GLU B 132 ? ? -26.21  -65.46  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LEU 531 ? A LEU 1  
2  1 Y 1 A GLY 532 ? A GLY 2  
3  1 Y 1 A SER 533 ? A SER 3  
4  1 Y 1 A GLY 534 ? A GLY 4  
5  1 Y 1 A THR 535 ? A THR 5  
6  1 Y 1 A THR 536 ? A THR 6  
7  1 Y 1 A GLU 537 ? A GLU 7  
8  1 Y 1 A ASP 538 ? A ASP 8  
9  1 Y 1 A VAL 539 ? A VAL 9  
10 1 Y 1 A SER 540 ? A SER 10 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN 1 1001 1001 ZN ZN A . 
D 3 ZN 1 1002 1002 ZN ZN A . 
#