data_3EOV
# 
_entry.id   3EOV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3EOV         
RCSB  RCSB049590   
WWPDB D_1000049590 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1BCK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN C'                                
PDB 1C5F unspecified 'CRYSTAL STRUCTURE OF THE CYCLOPHILIN-LIKE DOMAIN FROM BRUGIA MALAYI COMPLEXED WITH CYCLOSPORIN A'     
PDB 1CSA unspecified 'SOLUTION STRUCTURE OF E.COLI CYCLOPHILIN (F112W) COMPLEXED WITH CYCLOSPORIN A'                        
PDB 1CWA unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A'                                
PDB 1CWB unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 5'         
PDB 1CWC unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8'         
PDB 1CWF unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN D'                                
PDB 1CWH unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A MODIFIED AT POSITION 7'         
PDB 1CWI unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITION 7'         
PDB 1CWJ unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITIONS 5 AND 7.' 
PDB 1CWK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITIONS 5 AND 7.' 
PDB 1CWL unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8'         
PDB 1CWM unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8'         
PDB 1CWO unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH NODIFIED CYCLOSPORIN C AT POSITIONS 1, AND 9' 
PDB 1CYA unspecified 'SOLUTION STRUCTURE OF HUMAN CYCLOPHILIN COMPLEXED WIYH CYCLOSPORIN A'                                 
PDB 1CYB unspecified 'SOLUTION STRUCTURE OF HUMAN CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A'                                 
PDB 1CYN unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN B COMPLEXED WITH MODIFIED CYCLOSPORIN A'                       
PDB 1IKF unspecified 'CRYSTAL STRUCTURE OF CTCLOSPORIN-FAB COMPLEX'                                                         
PDB 1M63 unspecified 'CRYSTAL STRUCTURE OF CALCINEURIN-CYCLOPHILIN-CYCLOSPORIN COMPLEX'                                     
PDB 1MF8 unspecified 'CRYSTAL STRUCTURE OF HUMAN CALCINEURIN COMPLEXED WITH HUMAN CYCLOPHILIN AND CYCLOSPORIN A'            
PDB 1MIK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 6'         
PDB 1QNG unspecified 'CRYSTAL STRUCTURE OF PLASMODIUM FALCIPARUM CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A'                  
PDB 1QNH unspecified 'CRYSTAL STRUCTURE OF PLASMODIUM FALCIPARUM CYCLOPHILIN (DOUBLE MUTANT) COMPLEXED WITH CYCLOSPORIN A'  
PDB 1XQ7 unspecified 'CRYSTAL STRUCTURE OF TRYPANOSOMA CRUZI CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A'                      
PDB 2ESL unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN C COMPLEXED WITH CYCLOSPORIN A'                                
PDB 2OJU unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN J COMPLEXED WITH CYCLOSPORIN A'                                
PDB 2POY unspecified 'CRYSTAL STRUCTURE OF CRYPTOSPORIDIUM PARVUM IOWA II CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A'       
PDB 2RMA unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A'                                
PDB 2RMB unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 5'         
PDB 2RMC unspecified 'CRYSTAL STRUCTURE OF MURINE CYCLOPHILIN C COMPLEXED WITH CYCLOSPORIN A'                               
PDB 2WFJ unspecified 'CRYSTAL STRUCTURE OF THE PPIASE DOMAIN OF HUMAN CYCLOPHILIN G COMPLEXED WITH CYCLOSPORIN A'           
PDB 2X2C unspecified 'CRYSTAL STRUCTURE OF HUMAN ACETYL-CYPA COMPLEXED WITH CYCLOSPORINE A'                                 
PDB 2X7K unspecified 'CRYSTAL STRUCTURE OF PPIL1 COMPLEXED WITH CYCLOSPORINE A'                                             
PDB 2Z6W unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN D IN COMPLEX WITH CYCLOSPORIN A'                               
PDB 3BO7 unspecified 'CRYSTAL STRUCTURE OF CYCLOSPHILIN A FROM TOXOPLASMA GONDII COMPLEXED WIT CYCLOSPORIN A'               
PDB 3CYS unspecified 'SOLUTION STRUCTURE OF THE HUMAN CYCLOSPORIN A COMPLEXED WITH CYCLOSPORIN A'                           
PDB 2HAQ unspecified 'CRYSTAL STRUCTURE OF NATIVE CYCLOPHILIN FROM LEISHMANIA DONOVANI AT 1.97 A RESOLUTION'                
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3EOV 
_pdbx_database_status.recvd_initial_deposition_date   2008-09-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Venugopal, V.' 1 
'Dasgupta, D.'  2 
'Datta, A.K.'   3 
'Banerjee, R.'  4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structure of Cyclophilin from Leishmania Donovani Bound to Cyclosporin at 2.6 A Resolution: Correlation between Structure and Thermodynamic Data.
;
'Acta Crystallogr.,Sect.D' 65  1187  ? 2009 ABCRE6 DK 0907-4449 0766 ? 19923714 10.1107/S0907444909034234 
1       'Structure of Cyclophilin from Leishmania Donovani at 1.97 A Resolution.' 'Acta Crystallogr.,Sect.F' 63  60    ? 2007 ? DK 
1744-3091 ?    ? 17277440 10.1107/S1744309106056351 
2       
'Lack of Abundance of Cytoplasmic Cyclosporin A- Binding Protein Renders Free-Living Leishmania Donovani Resistant to Cyclosporin A.' 
J.Biol.Chem.               276 19294 ? 2001 JBCHA3 US 0021-9258 0071 ? 11278494 10.1074/JBC.M009379200    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Venugopal, V.'     1  
primary 'Datta, A.K.'       2  
primary 'Bhattacharyya, D.' 3  
primary 'Dasgupta, D.'      4  
primary 'Banerjee, R.'      5  
1       'Venugopal, V.'     6  
1       'Sen, B.'           7  
1       'Datta, A.K.'       8  
1       'Banerjee, R.'      9  
2       'Dutta, M.'         10 
2       'Delhi, P.'         11 
2       'Sinha, K.M.'       12 
2       'Banerjee, R.'      13 
2       'Datta, A.K.'       14 
# 
_cell.entry_id           3EOV 
_cell.length_a           69.810 
_cell.length_b           83.125 
_cell.length_c           73.580 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.03 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3EOV 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE' 19090.541 2  5.2.1.8 ? ? ? 
2 polymer syn 'CYCLOSPORIN A'                       1220.625  2  ?       ? ? ? 
3 water   nat water                                 18.015    76 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PPIASE, ROTAMASE, CYCLOPHILIN' 
2 'CICLOSPORIN, CICLOSPORINE'     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;HHHHHHEPEVTAKVYFDVMIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIQNFMIQGGDFTNFDG
TGGKSIYGEKFADENLNVKHFVGALSMANAGPNTNGSQFFITTAPTPWLDGRHVVFGKVLDGMDVVLRIEKTKTNSHDRP
VKPVKIVASGEL
;
;HHHHHHEPEVTAKVYFDVMIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIQNFMIQGGDFTNFDG
TGGKSIYGEKFADENLNVKHFVGALSMANAGPNTNGSQFFITTAPTPWLDGRHVVFGKVLDGMDVVLRIEKTKTNSHDRP
VKPVKIVASGEL
;
A,B ? 
2 'polypeptide(L)' no yes '(DAL)(MLE)(MLE)(MVA)(BMT)(ABA)(SAR)(MLE)V(MLE)A' ALLVTAGLVLA C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   GLU n 
1 8   PRO n 
1 9   GLU n 
1 10  VAL n 
1 11  THR n 
1 12  ALA n 
1 13  LYS n 
1 14  VAL n 
1 15  TYR n 
1 16  PHE n 
1 17  ASP n 
1 18  VAL n 
1 19  MET n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  GLU n 
1 24  PRO n 
1 25  LEU n 
1 26  GLY n 
1 27  ARG n 
1 28  ILE n 
1 29  THR n 
1 30  ILE n 
1 31  GLY n 
1 32  LEU n 
1 33  PHE n 
1 34  GLY n 
1 35  LYS n 
1 36  ASP n 
1 37  ALA n 
1 38  PRO n 
1 39  LEU n 
1 40  THR n 
1 41  THR n 
1 42  GLU n 
1 43  ASN n 
1 44  PHE n 
1 45  ARG n 
1 46  GLN n 
1 47  LEU n 
1 48  CYS n 
1 49  THR n 
1 50  GLY n 
1 51  GLU n 
1 52  HIS n 
1 53  GLY n 
1 54  PHE n 
1 55  GLY n 
1 56  TYR n 
1 57  LYS n 
1 58  ASP n 
1 59  SER n 
1 60  ILE n 
1 61  PHE n 
1 62  HIS n 
1 63  ARG n 
1 64  VAL n 
1 65  ILE n 
1 66  GLN n 
1 67  ASN n 
1 68  PHE n 
1 69  MET n 
1 70  ILE n 
1 71  GLN n 
1 72  GLY n 
1 73  GLY n 
1 74  ASP n 
1 75  PHE n 
1 76  THR n 
1 77  ASN n 
1 78  PHE n 
1 79  ASP n 
1 80  GLY n 
1 81  THR n 
1 82  GLY n 
1 83  GLY n 
1 84  LYS n 
1 85  SER n 
1 86  ILE n 
1 87  TYR n 
1 88  GLY n 
1 89  GLU n 
1 90  LYS n 
1 91  PHE n 
1 92  ALA n 
1 93  ASP n 
1 94  GLU n 
1 95  ASN n 
1 96  LEU n 
1 97  ASN n 
1 98  VAL n 
1 99  LYS n 
1 100 HIS n 
1 101 PHE n 
1 102 VAL n 
1 103 GLY n 
1 104 ALA n 
1 105 LEU n 
1 106 SER n 
1 107 MET n 
1 108 ALA n 
1 109 ASN n 
1 110 ALA n 
1 111 GLY n 
1 112 PRO n 
1 113 ASN n 
1 114 THR n 
1 115 ASN n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 PHE n 
1 120 PHE n 
1 121 ILE n 
1 122 THR n 
1 123 THR n 
1 124 ALA n 
1 125 PRO n 
1 126 THR n 
1 127 PRO n 
1 128 TRP n 
1 129 LEU n 
1 130 ASP n 
1 131 GLY n 
1 132 ARG n 
1 133 HIS n 
1 134 VAL n 
1 135 VAL n 
1 136 PHE n 
1 137 GLY n 
1 138 LYS n 
1 139 VAL n 
1 140 LEU n 
1 141 ASP n 
1 142 GLY n 
1 143 MET n 
1 144 ASP n 
1 145 VAL n 
1 146 VAL n 
1 147 LEU n 
1 148 ARG n 
1 149 ILE n 
1 150 GLU n 
1 151 LYS n 
1 152 THR n 
1 153 LYS n 
1 154 THR n 
1 155 ASN n 
1 156 SER n 
1 157 HIS n 
1 158 ASP n 
1 159 ARG n 
1 160 PRO n 
1 161 VAL n 
1 162 LYS n 
1 163 PRO n 
1 164 VAL n 
1 165 LYS n 
1 166 ILE n 
1 167 VAL n 
1 168 ALA n 
1 169 SER n 
1 170 GLY n 
1 171 GLU n 
1 172 LEU n 
2 1   DAL n 
2 2   MLE n 
2 3   MLE n 
2 4   MVA n 
2 5   BMT n 
2 6   ABA n 
2 7   SAR n 
2 8   MLE n 
2 9   VAL n 
2 10  MLE n 
2 11  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CYP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'LEISHMANIA DONOVANI' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5661 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               M15 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PQE32 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'TOLYPOCLADIUM INFLATUM' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       29910 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP Q9U9R3_LEIDO 1 ? ? Q9U9R3   ? 
2 NOR NOR00033     2 ? ? NOR00033 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3EOV A 7 ? 172 ? Q9U9R3   22 ? 187 ? 22 187 
2 1 3EOV B 7 ? 172 ? Q9U9R3   22 ? 187 ? 22 187 
3 2 3EOV C 1 ? 11  ? NOR00033 1  ? 11  ? 1  11  
4 2 3EOV D 1 ? 11  ? NOR00033 1  ? 11  ? 1  11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3EOV HIS A 1 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 16 1  
1 3EOV HIS A 2 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 17 2  
1 3EOV HIS A 3 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 18 3  
1 3EOV HIS A 4 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 19 4  
1 3EOV HIS A 5 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 20 5  
1 3EOV HIS A 6 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 21 6  
2 3EOV HIS B 1 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 16 7  
2 3EOV HIS B 2 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 17 8  
2 3EOV HIS B 3 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 18 9  
2 3EOV HIS B 4 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 19 10 
2 3EOV HIS B 5 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 20 11 
2 3EOV HIS B 6 ? UNP Q9U9R3 ? ? 'EXPRESSION TAG' 21 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID'                         ? 'C4 H9 N O2'     103.120 
ALA 'L-peptide linking' y ALANINE                                           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                   ? 'C4 H7 N O4'     133.103 
BMT 'L-peptide linking' n '4-METHYL-4-[(E)-2-BUTENYL]-4,N-METHYL-THREONINE' ? 'C10 H19 N O3'   201.263 
CYS 'L-peptide linking' y CYSTEINE                                          ? 'C3 H7 N O2 S'   121.158 
DAL 'D-peptide linking' . D-ALANINE                                         ? 'C3 H7 N O2'     89.093  
GLN 'L-peptide linking' y GLUTAMINE                                         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                        ? 'C5 H11 N O2 S'  149.211 
MLE 'L-peptide linking' n N-METHYLLEUCINE                                   ? 'C7 H15 N O2'    145.199 
MVA 'L-peptide linking' n N-METHYLVALINE                                    ? 'C6 H13 N O2'    131.173 
PHE 'L-peptide linking' y PHENYLALANINE                                     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                           ? 'C5 H9 N O2'     115.130 
SAR 'peptide linking'   n SARCOSINE                                         ? 'C3 H7 N O2'     89.093  
SER 'L-peptide linking' y SERINE                                            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3EOV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   52.22 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;0.02M TRIS, 15% PEG3350, 0.1M NACL, 0.02% AZIDE, PH 8.5, 6% ETHYL ALCOHOL, CONCENTRATION: 10 MG/ML 1:1 CYCLOPHILIN-CYCLOSPORIN COMPLEX, TEMPERATURE 292K, BATCH METHOD, PH 8.50, SMALL TUBES
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2008-01-01 
_diffrn_detector.details                'OSMIC MAXFLUX CONFOCAL MULTILAY' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3EOV 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   12040 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            0.05200 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.1000 
_reflns.B_iso_Wilson_estimate        52.40 
_reflns.pdbx_redundancy              4.110 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   96.5 
_reflns_shell.Rmerge_I_obs           0.25100 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.600 
_reflns_shell.pdbx_redundancy        5.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3EOV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     12040 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               780102.190 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.48 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    95.1 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_factor_R_free                       0.251 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  623 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.60 
_refine.aniso_B[1][1]                            12.41000 
_refine.aniso_B[2][2]                            2.40000 
_refine.aniso_B[3][3]                            -14.81000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            1.40000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 57.60 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2HAQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3EOV 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.43 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.53 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2728 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             76 
_refine_hist.number_atoms_total               2804 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        27.48 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.40  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.10 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.78  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             1968 
_refine_ls_shell.R_factor_R_work                  0.3150 
_refine_ls_shell.percent_reflns_obs               94.20 
_refine_ls_shell.R_factor_R_free                  0.2110 
_refine_ls_shell.R_factor_R_free_error            0.149 
_refine_ls_shell.percent_reflns_R_free            0.10 
_refine_ls_shell.number_reflns_R_free             2 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 3 CSA.PARAM         CSA.TOP     
# 
_struct.entry_id                  3EOV 
_struct.title                     'Crystal structure of cyclophilin from Leishmania donovani ligated with cyclosporin A' 
_struct.pdbx_descriptor           'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (E.C.5.2.1.8), CYCLOSPORIN A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3EOV 
_struct_keywords.pdbx_keywords   ISOMERASE/IMMUNOSUPPRESSANT 
_struct_keywords.text            
'ISOMERASE-IMMUNOSUPPRESSANT COMPLEX, CYCLOPHILIN-CYCLOSPORIN COMPLEX, CYCLOSPORIN A, IMMUNOSUPPRESSANT, CYCLOPHILIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 37  ? GLY A 50  ? ALA A 52  GLY A 65  1 ? 14 
HELX_P HELX_P2 2 THR A 126 ? ASP A 130 ? THR A 141 ASP A 145 5 ? 5  
HELX_P HELX_P3 3 GLY A 142 ? GLU A 150 ? GLY A 157 GLU A 165 1 ? 9  
HELX_P HELX_P4 4 ASN A 155 ? ARG A 159 ? ASN A 170 ARG A 174 5 ? 5  
HELX_P HELX_P5 5 ALA B 37  ? GLY B 50  ? ALA B 52  GLY B 65  1 ? 14 
HELX_P HELX_P6 6 THR B 126 ? ASP B 130 ? THR B 141 ASP B 145 5 ? 5  
HELX_P HELX_P7 7 GLY B 142 ? GLU B 150 ? GLY B 157 GLU B 165 1 ? 9  
HELX_P HELX_P8 8 ASN B 155 ? ARG B 159 ? ASN B 170 ARG B 174 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C DAL 1  N ? ? ? 1_555 C ALA 11 C ? ? C DAL 1  C ALA 11 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2  covale ? ? C DAL 1  C ? ? ? 1_555 C MLE 2  N ? ? C DAL 1  C MLE 2  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3  covale ? ? C MLE 2  C ? ? ? 1_555 C MLE 3  N ? ? C MLE 2  C MLE 3  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale4  covale ? ? C MLE 3  C ? ? ? 1_555 C MVA 4  N ? ? C MLE 3  C MVA 4  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale5  covale ? ? C MVA 4  C ? ? ? 1_555 C BMT 5  N ? ? C MVA 4  C BMT 5  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale6  covale ? ? C BMT 5  C ? ? ? 1_555 C ABA 6  N ? ? C BMT 5  C ABA 6  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7  covale ? ? C ABA 6  C ? ? ? 1_555 C SAR 7  N ? ? C ABA 6  C SAR 7  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale8  covale ? ? C SAR 7  C ? ? ? 1_555 C MLE 8  N ? ? C SAR 7  C MLE 8  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale9  covale ? ? C MLE 8  C ? ? ? 1_555 C VAL 9  N ? ? C MLE 8  C VAL 9  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale10 covale ? ? C VAL 9  C ? ? ? 1_555 C MLE 10 N ? ? C VAL 9  C MLE 10 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale11 covale ? ? C MLE 10 C ? ? ? 1_555 C ALA 11 N ? ? C MLE 10 C ALA 11 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale12 covale ? ? D DAL 1  N ? ? ? 1_555 D ALA 11 C ? ? D DAL 1  D ALA 11 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale13 covale ? ? D DAL 1  C ? ? ? 1_555 D MLE 2  N ? ? D DAL 1  D MLE 2  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale14 covale ? ? D MLE 2  C ? ? ? 1_555 D MLE 3  N ? ? D MLE 2  D MLE 3  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale15 covale ? ? D MLE 3  C ? ? ? 1_555 D MVA 4  N ? ? D MLE 3  D MVA 4  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale16 covale ? ? D MVA 4  C ? ? ? 1_555 D BMT 5  N ? ? D MVA 4  D BMT 5  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale17 covale ? ? D BMT 5  C ? ? ? 1_555 D ABA 6  N ? ? D BMT 5  D ABA 6  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale18 covale ? ? D ABA 6  C ? ? ? 1_555 D SAR 7  N ? ? D ABA 6  D SAR 7  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale19 covale ? ? D SAR 7  C ? ? ? 1_555 D MLE 8  N ? ? D SAR 7  D MLE 8  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale20 covale ? ? D MLE 8  C ? ? ? 1_555 D VAL 9  N ? ? D MLE 8  D VAL 9  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale21 covale ? ? D VAL 9  C ? ? ? 1_555 D MLE 10 N ? ? D VAL 9  D MLE 10 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale22 covale ? ? D MLE 10 C ? ? ? 1_555 D ALA 11 N ? ? D MLE 10 D ALA 11 1_555 ? ? ? ? ? ? ? 1.330 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
BA ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BA 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 63  ? ILE A 65  ? ARG A 78  ILE A 80  
AA 2 MET A 69  ? GLY A 72  ? MET A 84  GLY A 87  
AA 3 PHE A 119 ? THR A 122 ? PHE A 134 THR A 137 
AA 4 ALA A 104 ? MET A 107 ? ALA A 119 MET A 122 
AA 5 VAL A 135 ? ASP A 141 ? VAL A 150 ASP A 156 
AA 6 GLU A 23  ? LEU A 32  ? GLU A 38  LEU A 47  
AA 7 LYS A 13  ? ILE A 20  ? LYS A 28  ILE A 35  
AA 8 VAL A 164 ? GLU A 171 ? VAL A 179 GLU A 186 
BA 1 ARG B 63  ? ILE B 65  ? ARG B 78  ILE B 80  
BA 2 MET B 69  ? GLY B 72  ? MET B 84  GLY B 87  
BA 3 PHE B 119 ? THR B 122 ? PHE B 134 THR B 137 
BA 4 ALA B 104 ? MET B 107 ? ALA B 119 MET B 122 
BA 5 VAL B 135 ? ASP B 141 ? VAL B 150 ASP B 156 
BA 6 PRO B 24  ? LEU B 32  ? PRO B 39  LEU B 47  
BA 7 LYS B 13  ? MET B 19  ? LYS B 28  MET B 34  
BA 8 LYS B 165 ? GLU B 171 ? LYS B 180 GLU B 186 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 65  ? N ILE A 80  O MET A 69  ? O MET A 84  
AA 2 3 N GLY A 72  ? N GLY A 87  O PHE A 119 ? O PHE A 134 
AA 3 4 N THR A 122 ? N THR A 137 O ALA A 104 ? O ALA A 119 
AA 4 5 O LEU A 105 ? O LEU A 120 N PHE A 136 ? N PHE A 151 
AA 5 6 N LEU A 140 ? N LEU A 155 O THR A 29  ? O THR A 44  
AA 6 7 N ILE A 30  ? N ILE A 45  O VAL A 14  ? O VAL A 29  
AA 7 8 N MET A 19  ? N MET A 34  O LYS A 165 ? O LYS A 180 
BA 1 2 N ILE B 65  ? N ILE B 80  O MET B 69  ? O MET B 84  
BA 2 3 N GLY B 72  ? N GLY B 87  O PHE B 119 ? O PHE B 134 
BA 3 4 N THR B 122 ? N THR B 137 O ALA B 104 ? O ALA B 119 
BA 4 5 O LEU B 105 ? O LEU B 120 N PHE B 136 ? N PHE B 151 
BA 5 6 N LEU B 140 ? N LEU B 155 O THR B 29  ? O THR B 44  
BA 6 7 N ILE B 30  ? N ILE B 45  O VAL B 14  ? O VAL B 29  
BA 7 8 N MET B 19  ? N MET B 34  O LYS B 165 ? O LYS B 180 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR CHAIN C OF CYCLOSPORIN A' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR CHAIN D OF CYCLOSPORIN A' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ARG A 63  ? ARG A 78   . ? 1_555 ? 
2  AC1 17 PHE A 68  ? PHE A 83   . ? 1_555 ? 
3  AC1 17 GLN A 71  ? GLN A 86   . ? 1_555 ? 
4  AC1 17 GLY A 80  ? GLY A 95   . ? 1_555 ? 
5  AC1 17 ALA A 108 ? ALA A 123  . ? 1_555 ? 
6  AC1 17 ASN A 109 ? ASN A 124  . ? 1_555 ? 
7  AC1 17 GLN A 118 ? GLN A 133  . ? 1_555 ? 
8  AC1 17 TRP A 128 ? TRP A 143  . ? 1_555 ? 
9  AC1 17 HIS A 133 ? HIS A 148  . ? 1_555 ? 
10 AC1 17 PRO B 112 ? PRO B 127  . ? 1_555 ? 
11 AC1 17 TRP B 128 ? TRP B 143  . ? 1_555 ? 
12 AC1 17 ARG B 132 ? ARG B 147  . ? 1_555 ? 
13 AC1 17 HOH G .   ? HOH C 2001 . ? 1_555 ? 
14 AC1 17 MLE D 3   ? MLE D 3    . ? 1_555 ? 
15 AC1 17 BMT D 5   ? BMT D 5    . ? 1_555 ? 
16 AC1 17 MLE D 10  ? MLE D 10   . ? 1_555 ? 
17 AC1 17 ALA D 11  ? ALA D 11   . ? 1_555 ? 
18 AC2 17 PRO A 112 ? PRO A 127  . ? 1_555 ? 
19 AC2 17 TRP A 128 ? TRP A 143  . ? 1_555 ? 
20 AC2 17 ARG A 132 ? ARG A 147  . ? 1_555 ? 
21 AC2 17 ARG B 63  ? ARG B 78   . ? 1_555 ? 
22 AC2 17 PHE B 68  ? PHE B 83   . ? 1_555 ? 
23 AC2 17 GLN B 71  ? GLN B 86   . ? 1_555 ? 
24 AC2 17 GLY B 80  ? GLY B 95   . ? 1_555 ? 
25 AC2 17 ALA B 108 ? ALA B 123  . ? 1_555 ? 
26 AC2 17 ASN B 109 ? ASN B 124  . ? 1_555 ? 
27 AC2 17 GLN B 118 ? GLN B 133  . ? 1_555 ? 
28 AC2 17 PHE B 120 ? PHE B 135  . ? 1_555 ? 
29 AC2 17 TRP B 128 ? TRP B 143  . ? 1_555 ? 
30 AC2 17 HIS B 133 ? HIS B 148  . ? 1_555 ? 
31 AC2 17 MLE C 3   ? MLE C 3    . ? 1_555 ? 
32 AC2 17 BMT C 5   ? BMT C 5    . ? 1_555 ? 
33 AC2 17 MLE C 10  ? MLE C 10   . ? 1_555 ? 
34 AC2 17 ALA C 11  ? ALA C 11   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3EOV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3EOV 
_atom_sites.fract_transf_matrix[1][1]   0.014325 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003315 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012030 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013950 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 7   ? 6.128   9.284   -9.340  1.00 81.03  ? 22   GLU A N   1 
ATOM   2    C CA  . GLU A 1 7   ? 7.031   8.400   -8.539  1.00 77.34  ? 22   GLU A CA  1 
ATOM   3    C C   . GLU A 1 7   ? 8.297   8.060   -9.331  1.00 72.44  ? 22   GLU A C   1 
ATOM   4    O O   . GLU A 1 7   ? 8.250   7.840   -10.546 1.00 72.03  ? 22   GLU A O   1 
ATOM   5    C CB  . GLU A 1 7   ? 6.290   7.114   -8.134  1.00 78.73  ? 22   GLU A CB  1 
ATOM   6    N N   . PRO A 1 8   ? 9.451   8.016   -8.646  1.00 66.71  ? 23   PRO A N   1 
ATOM   7    C CA  . PRO A 1 8   ? 10.725  7.703   -9.301  1.00 61.88  ? 23   PRO A CA  1 
ATOM   8    C C   . PRO A 1 8   ? 10.758  6.316   -9.950  1.00 57.50  ? 23   PRO A C   1 
ATOM   9    O O   . PRO A 1 8   ? 9.946   5.437   -9.638  1.00 48.17  ? 23   PRO A O   1 
ATOM   10   C CB  . PRO A 1 8   ? 11.747  7.832   -8.163  1.00 60.28  ? 23   PRO A CB  1 
ATOM   11   C CG  . PRO A 1 8   ? 11.106  8.813   -7.224  1.00 57.11  ? 23   PRO A CG  1 
ATOM   12   C CD  . PRO A 1 8   ? 9.663   8.353   -7.226  1.00 63.83  ? 23   PRO A CD  1 
ATOM   13   N N   . GLU A 1 9   ? 11.714  6.142   -10.855 1.00 55.68  ? 24   GLU A N   1 
ATOM   14   C CA  . GLU A 1 9   ? 11.904  4.891   -11.567 1.00 57.23  ? 24   GLU A CA  1 
ATOM   15   C C   . GLU A 1 9   ? 12.703  3.910   -10.715 1.00 53.47  ? 24   GLU A C   1 
ATOM   16   O O   . GLU A 1 9   ? 13.632  4.294   -10.011 1.00 53.63  ? 24   GLU A O   1 
ATOM   17   C CB  . GLU A 1 9   ? 12.633  5.170   -12.879 1.00 65.40  ? 24   GLU A CB  1 
ATOM   18   C CG  . GLU A 1 9   ? 13.247  3.958   -13.550 1.00 74.94  ? 24   GLU A CG  1 
ATOM   19   C CD  . GLU A 1 9   ? 14.136  4.350   -14.719 1.00 78.86  ? 24   GLU A CD  1 
ATOM   20   O OE1 . GLU A 1 9   ? 13.611  4.916   -15.704 1.00 81.18  ? 24   GLU A OE1 1 
ATOM   21   O OE2 . GLU A 1 9   ? 15.357  4.100   -14.649 1.00 80.59  ? 24   GLU A OE2 1 
ATOM   22   N N   . VAL A 1 10  ? 12.334  2.639   -10.777 1.00 51.43  ? 25   VAL A N   1 
ATOM   23   C CA  . VAL A 1 10  ? 13.026  1.613   -10.010 1.00 46.28  ? 25   VAL A CA  1 
ATOM   24   C C   . VAL A 1 10  ? 14.223  1.075   -10.809 1.00 46.94  ? 25   VAL A C   1 
ATOM   25   O O   . VAL A 1 10  ? 14.080  0.644   -11.953 1.00 44.98  ? 25   VAL A O   1 
ATOM   26   C CB  . VAL A 1 10  ? 12.044  0.470   -9.643  1.00 41.34  ? 25   VAL A CB  1 
ATOM   27   C CG1 . VAL A 1 10  ? 12.773  -0.663  -8.974  1.00 41.03  ? 25   VAL A CG1 1 
ATOM   28   C CG2 . VAL A 1 10  ? 10.968  1.006   -8.711  1.00 41.72  ? 25   VAL A CG2 1 
ATOM   29   N N   . THR A 1 11  ? 15.407  1.110   -10.205 1.00 45.58  ? 26   THR A N   1 
ATOM   30   C CA  . THR A 1 11  ? 16.611  0.637   -10.876 1.00 43.01  ? 26   THR A CA  1 
ATOM   31   C C   . THR A 1 11  ? 17.086  -0.733  -10.391 1.00 46.82  ? 26   THR A C   1 
ATOM   32   O O   . THR A 1 11  ? 17.633  -1.506  -11.171 1.00 54.17  ? 26   THR A O   1 
ATOM   33   C CB  . THR A 1 11  ? 17.755  1.652   -10.734 1.00 45.18  ? 26   THR A CB  1 
ATOM   34   O OG1 . THR A 1 11  ? 18.128  1.775   -9.354  1.00 39.38  ? 26   THR A OG1 1 
ATOM   35   C CG2 . THR A 1 11  ? 17.313  3.015   -11.271 1.00 39.63  ? 26   THR A CG2 1 
ATOM   36   N N   . ALA A 1 12  ? 16.884  -1.042  -9.117  1.00 43.29  ? 27   ALA A N   1 
ATOM   37   C CA  . ALA A 1 12  ? 17.287  -2.341  -8.597  1.00 40.61  ? 27   ALA A CA  1 
ATOM   38   C C   . ALA A 1 12  ? 16.181  -2.918  -7.716  1.00 45.16  ? 27   ALA A C   1 
ATOM   39   O O   . ALA A 1 12  ? 15.217  -2.226  -7.384  1.00 44.88  ? 27   ALA A O   1 
ATOM   40   C CB  . ALA A 1 12  ? 18.568  -2.211  -7.810  1.00 36.77  ? 27   ALA A CB  1 
ATOM   41   N N   . LYS A 1 13  ? 16.318  -4.190  -7.346  1.00 48.90  ? 28   LYS A N   1 
ATOM   42   C CA  . LYS A 1 13  ? 15.327  -4.860  -6.504  1.00 48.67  ? 28   LYS A CA  1 
ATOM   43   C C   . LYS A 1 13  ? 15.980  -5.701  -5.409  1.00 50.62  ? 28   LYS A C   1 
ATOM   44   O O   . LYS A 1 13  ? 16.830  -6.548  -5.691  1.00 56.68  ? 28   LYS A O   1 
ATOM   45   C CB  . LYS A 1 13  ? 14.444  -5.776  -7.343  1.00 48.32  ? 28   LYS A CB  1 
ATOM   46   C CG  . LYS A 1 13  ? 13.557  -5.091  -8.349  1.00 51.84  ? 28   LYS A CG  1 
ATOM   47   C CD  . LYS A 1 13  ? 12.681  -6.119  -9.043  1.00 58.23  ? 28   LYS A CD  1 
ATOM   48   C CE  . LYS A 1 13  ? 11.844  -5.496  -10.141 1.00 65.09  ? 28   LYS A CE  1 
ATOM   49   N NZ  . LYS A 1 13  ? 11.103  -6.540  -10.904 1.00 72.55  ? 28   LYS A NZ  1 
ATOM   50   N N   . VAL A 1 14  ? 15.578  -5.467  -4.164  1.00 46.73  ? 29   VAL A N   1 
ATOM   51   C CA  . VAL A 1 14  ? 16.103  -6.226  -3.032  1.00 40.42  ? 29   VAL A CA  1 
ATOM   52   C C   . VAL A 1 14  ? 14.927  -6.924  -2.363  1.00 39.75  ? 29   VAL A C   1 
ATOM   53   O O   . VAL A 1 14  ? 13.786  -6.677  -2.726  1.00 42.83  ? 29   VAL A O   1 
ATOM   54   C CB  . VAL A 1 14  ? 16.784  -5.315  -2.006  1.00 38.31  ? 29   VAL A CB  1 
ATOM   55   C CG1 . VAL A 1 14  ? 18.072  -4.749  -2.585  1.00 34.84  ? 29   VAL A CG1 1 
ATOM   56   C CG2 . VAL A 1 14  ? 15.833  -4.196  -1.594  1.00 37.81  ? 29   VAL A CG2 1 
ATOM   57   N N   . TYR A 1 15  ? 15.193  -7.788  -1.389  1.00 37.77  ? 30   TYR A N   1 
ATOM   58   C CA  . TYR A 1 15  ? 14.114  -8.496  -0.717  1.00 36.71  ? 30   TYR A CA  1 
ATOM   59   C C   . TYR A 1 15  ? 14.464  -8.854  0.724   1.00 41.43  ? 30   TYR A C   1 
ATOM   60   O O   . TYR A 1 15  ? 15.635  -8.931  1.081   1.00 42.84  ? 30   TYR A O   1 
ATOM   61   C CB  . TYR A 1 15  ? 13.784  -9.772  -1.493  1.00 40.46  ? 30   TYR A CB  1 
ATOM   62   C CG  . TYR A 1 15  ? 14.857  -10.836 -1.400  1.00 46.17  ? 30   TYR A CG  1 
ATOM   63   C CD1 . TYR A 1 15  ? 14.926  -11.700 -0.296  1.00 51.98  ? 30   TYR A CD1 1 
ATOM   64   C CD2 . TYR A 1 15  ? 15.815  -10.972 -2.403  1.00 44.89  ? 30   TYR A CD2 1 
ATOM   65   C CE1 . TYR A 1 15  ? 15.932  -12.678 -0.200  1.00 49.79  ? 30   TYR A CE1 1 
ATOM   66   C CE2 . TYR A 1 15  ? 16.816  -11.936 -2.319  1.00 46.61  ? 30   TYR A CE2 1 
ATOM   67   C CZ  . TYR A 1 15  ? 16.870  -12.787 -1.222  1.00 50.63  ? 30   TYR A CZ  1 
ATOM   68   O OH  . TYR A 1 15  ? 17.837  -13.767 -1.171  1.00 55.09  ? 30   TYR A OH  1 
ATOM   69   N N   . PHE A 1 16  ? 13.437  -9.063  1.545   1.00 43.19  ? 31   PHE A N   1 
ATOM   70   C CA  . PHE A 1 16  ? 13.602  -9.460  2.945   1.00 36.82  ? 31   PHE A CA  1 
ATOM   71   C C   . PHE A 1 16  ? 12.680  -10.622 3.204   1.00 37.65  ? 31   PHE A C   1 
ATOM   72   O O   . PHE A 1 16  ? 11.481  -10.520 2.974   1.00 37.95  ? 31   PHE A O   1 
ATOM   73   C CB  . PHE A 1 16  ? 13.154  -8.389  3.945   1.00 36.62  ? 31   PHE A CB  1 
ATOM   74   C CG  . PHE A 1 16  ? 14.056  -7.204  4.044   1.00 31.73  ? 31   PHE A CG  1 
ATOM   75   C CD1 . PHE A 1 16  ? 15.426  -7.335  3.901   1.00 30.46  ? 31   PHE A CD1 1 
ATOM   76   C CD2 . PHE A 1 16  ? 13.528  -5.961  4.375   1.00 29.53  ? 31   PHE A CD2 1 
ATOM   77   C CE1 . PHE A 1 16  ? 16.264  -6.241  4.091   1.00 37.46  ? 31   PHE A CE1 1 
ATOM   78   C CE2 . PHE A 1 16  ? 14.343  -4.867  4.568   1.00 37.33  ? 31   PHE A CE2 1 
ATOM   79   C CZ  . PHE A 1 16  ? 15.722  -5.001  4.427   1.00 40.25  ? 31   PHE A CZ  1 
ATOM   80   N N   . ASP A 1 17  ? 13.225  -11.723 3.688   1.00 35.81  ? 32   ASP A N   1 
ATOM   81   C CA  . ASP A 1 17  ? 12.379  -12.839 4.040   1.00 39.49  ? 32   ASP A CA  1 
ATOM   82   C C   . ASP A 1 17  ? 12.187  -12.597 5.538   1.00 40.43  ? 32   ASP A C   1 
ATOM   83   O O   . ASP A 1 17  ? 13.152  -12.509 6.294   1.00 39.38  ? 32   ASP A O   1 
ATOM   84   C CB  . ASP A 1 17  ? 13.093  -14.149 3.718   1.00 45.04  ? 32   ASP A CB  1 
ATOM   85   C CG  . ASP A 1 17  ? 13.191  -14.390 2.221   1.00 48.89  ? 32   ASP A CG  1 
ATOM   86   O OD1 . ASP A 1 17  ? 14.246  -14.851 1.744   1.00 56.92  ? 32   ASP A OD1 1 
ATOM   87   O OD2 . ASP A 1 17  ? 12.198  -14.114 1.518   1.00 49.07  ? 32   ASP A OD2 1 
ATOM   88   N N   . VAL A 1 18  ? 10.938  -12.430 5.956   1.00 45.87  ? 33   VAL A N   1 
ATOM   89   C CA  . VAL A 1 18  ? 10.650  -12.123 7.352   1.00 47.39  ? 33   VAL A CA  1 
ATOM   90   C C   . VAL A 1 18  ? 10.019  -13.260 8.134   1.00 50.45  ? 33   VAL A C   1 
ATOM   91   O O   . VAL A 1 18  ? 9.209   -14.026 7.605   1.00 49.02  ? 33   VAL A O   1 
ATOM   92   C CB  . VAL A 1 18  ? 9.726   -10.873 7.460   1.00 47.39  ? 33   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 18  ? 9.318   -10.651 8.907   1.00 49.13  ? 33   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 18  ? 10.443  -9.637  6.909   1.00 41.11  ? 33   VAL A CG2 1 
ATOM   95   N N   . MET A 1 19  ? 10.387  -13.343 9.409   1.00 53.48  ? 34   MET A N   1 
ATOM   96   C CA  . MET A 1 19  ? 9.878   -14.378 10.295  1.00 56.97  ? 34   MET A CA  1 
ATOM   97   C C   . MET A 1 19  ? 9.687   -13.850 11.710  1.00 56.49  ? 34   MET A C   1 
ATOM   98   O O   . MET A 1 19  ? 10.532  -13.121 12.224  1.00 58.90  ? 34   MET A O   1 
ATOM   99   C CB  . MET A 1 19  ? 10.852  -15.553 10.324  1.00 61.47  ? 34   MET A CB  1 
ATOM   100  C CG  . MET A 1 19  ? 10.361  -16.744 11.117  1.00 69.94  ? 34   MET A CG  1 
ATOM   101  S SD  . MET A 1 19  ? 11.633  -18.010 11.289  1.00 80.82  ? 34   MET A SD  1 
ATOM   102  C CE  . MET A 1 19  ? 12.423  -17.480 12.844  1.00 71.37  ? 34   MET A CE  1 
ATOM   103  N N   . ILE A 1 20  ? 8.570   -14.216 12.332  1.00 57.98  ? 35   ILE A N   1 
ATOM   104  C CA  . ILE A 1 20  ? 8.290   -13.803 13.701  1.00 62.39  ? 35   ILE A CA  1 
ATOM   105  C C   . ILE A 1 20  ? 8.365   -15.013 14.628  1.00 67.95  ? 35   ILE A C   1 
ATOM   106  O O   . ILE A 1 20  ? 7.403   -15.770 14.752  1.00 67.34  ? 35   ILE A O   1 
ATOM   107  C CB  . ILE A 1 20  ? 6.881   -13.189 13.855  1.00 56.66  ? 35   ILE A CB  1 
ATOM   108  C CG1 . ILE A 1 20  ? 6.707   -12.023 12.887  1.00 57.37  ? 35   ILE A CG1 1 
ATOM   109  C CG2 . ILE A 1 20  ? 6.679   -12.713 15.300  1.00 50.98  ? 35   ILE A CG2 1 
ATOM   110  C CD1 . ILE A 1 20  ? 5.315   -11.407 12.918  1.00 58.84  ? 35   ILE A CD1 1 
ATOM   111  N N   . ASP A 1 21  ? 9.510   -15.199 15.276  1.00 73.37  ? 36   ASP A N   1 
ATOM   112  C CA  . ASP A 1 21  ? 9.659   -16.313 16.199  1.00 78.18  ? 36   ASP A CA  1 
ATOM   113  C C   . ASP A 1 21  ? 9.293   -17.643 15.528  1.00 80.65  ? 36   ASP A C   1 
ATOM   114  O O   . ASP A 1 21  ? 8.176   -18.146 15.682  1.00 81.59  ? 36   ASP A O   1 
ATOM   115  C CB  . ASP A 1 21  ? 8.775   -16.052 17.425  1.00 79.99  ? 36   ASP A CB  1 
ATOM   116  C CG  . ASP A 1 21  ? 8.727   -17.223 18.377  1.00 84.64  ? 36   ASP A CG  1 
ATOM   117  O OD1 . ASP A 1 21  ? 9.804   -17.709 18.777  1.00 87.45  ? 36   ASP A OD1 1 
ATOM   118  O OD2 . ASP A 1 21  ? 7.605   -17.651 18.733  1.00 86.85  ? 36   ASP A OD2 1 
ATOM   119  N N   . SER A 1 22  ? 10.252  -18.185 14.773  1.00 81.08  ? 37   SER A N   1 
ATOM   120  C CA  . SER A 1 22  ? 10.127  -19.457 14.044  1.00 79.92  ? 37   SER A CA  1 
ATOM   121  C C   . SER A 1 22  ? 9.034   -19.539 12.971  1.00 78.17  ? 37   SER A C   1 
ATOM   122  O O   . SER A 1 22  ? 9.081   -20.417 12.105  1.00 76.49  ? 37   SER A O   1 
ATOM   123  C CB  . SER A 1 22  ? 9.955   -20.628 15.025  1.00 78.86  ? 37   SER A CB  1 
ATOM   124  O OG  . SER A 1 22  ? 8.642   -20.684 15.549  1.00 80.43  ? 37   SER A OG  1 
ATOM   125  N N   . GLU A 1 23  ? 8.058   -18.636 13.017  1.00 76.51  ? 38   GLU A N   1 
ATOM   126  C CA  . GLU A 1 23  ? 6.976   -18.654 12.034  1.00 73.74  ? 38   GLU A CA  1 
ATOM   127  C C   . GLU A 1 23  ? 7.245   -17.730 10.850  1.00 68.70  ? 38   GLU A C   1 
ATOM   128  O O   . GLU A 1 23  ? 7.311   -16.512 11.002  1.00 65.62  ? 38   GLU A O   1 
ATOM   129  C CB  . GLU A 1 23  ? 5.657   -18.242 12.684  1.00 78.99  ? 38   GLU A CB  1 
ATOM   130  C CG  . GLU A 1 23  ? 4.474   -18.313 11.733  1.00 87.72  ? 38   GLU A CG  1 
ATOM   131  C CD  . GLU A 1 23  ? 3.298   -17.483 12.206  1.00 92.47  ? 38   GLU A CD  1 
ATOM   132  O OE1 . GLU A 1 23  ? 2.855   -17.683 13.358  1.00 97.18  ? 38   GLU A OE1 1 
ATOM   133  O OE2 . GLU A 1 23  ? 2.817   -16.633 11.424  1.00 91.31  ? 38   GLU A OE2 1 
ATOM   134  N N   . PRO A 1 24  ? 7.384   -18.302 9.645   1.00 65.81  ? 39   PRO A N   1 
ATOM   135  C CA  . PRO A 1 24  ? 7.645   -17.523 8.428   1.00 64.45  ? 39   PRO A CA  1 
ATOM   136  C C   . PRO A 1 24  ? 6.447   -16.679 7.994   1.00 61.87  ? 39   PRO A C   1 
ATOM   137  O O   . PRO A 1 24  ? 5.333   -17.188 7.864   1.00 61.29  ? 39   PRO A O   1 
ATOM   138  C CB  . PRO A 1 24  ? 7.989   -18.600 7.405   1.00 63.41  ? 39   PRO A CB  1 
ATOM   139  C CG  . PRO A 1 24  ? 7.089   -19.728 7.826   1.00 63.33  ? 39   PRO A CG  1 
ATOM   140  C CD  . PRO A 1 24  ? 7.262   -19.738 9.334   1.00 64.00  ? 39   PRO A CD  1 
ATOM   141  N N   . LEU A 1 25  ? 6.679   -15.388 7.770   1.00 60.54  ? 40   LEU A N   1 
ATOM   142  C CA  . LEU A 1 25  ? 5.609   -14.487 7.344   1.00 58.21  ? 40   LEU A CA  1 
ATOM   143  C C   . LEU A 1 25  ? 5.559   -14.379 5.831   1.00 54.59  ? 40   LEU A C   1 
ATOM   144  O O   . LEU A 1 25  ? 4.476   -14.311 5.235   1.00 52.74  ? 40   LEU A O   1 
ATOM   145  C CB  . LEU A 1 25  ? 5.809   -13.088 7.924   1.00 59.71  ? 40   LEU A CB  1 
ATOM   146  C CG  . LEU A 1 25  ? 5.665   -12.882 9.428   1.00 58.13  ? 40   LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 25  ? 5.726   -11.389 9.715   1.00 61.02  ? 40   LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 25  ? 4.350   -13.457 9.912   1.00 58.78  ? 40   LEU A CD2 1 
ATOM   149  N N   . GLY A 1 26  ? 6.739   -14.362 5.218   1.00 46.72  ? 41   GLY A N   1 
ATOM   150  C CA  . GLY A 1 26  ? 6.825   -14.251 3.775   1.00 44.57  ? 41   GLY A CA  1 
ATOM   151  C C   . GLY A 1 26  ? 7.944   -13.322 3.353   1.00 44.73  ? 41   GLY A C   1 
ATOM   152  O O   . GLY A 1 26  ? 8.855   -13.027 4.132   1.00 46.87  ? 41   GLY A O   1 
ATOM   153  N N   . ARG A 1 27  ? 7.867   -12.837 2.122   1.00 42.95  ? 42   ARG A N   1 
ATOM   154  C CA  . ARG A 1 27  ? 8.902   -11.956 1.596   1.00 43.96  ? 42   ARG A CA  1 
ATOM   155  C C   . ARG A 1 27  ? 8.455   -10.565 1.154   1.00 43.97  ? 42   ARG A C   1 
ATOM   156  O O   . ARG A 1 27  ? 7.430   -10.397 0.483   1.00 42.81  ? 42   ARG A O   1 
ATOM   157  C CB  . ARG A 1 27  ? 9.599   -12.644 0.425   1.00 41.73  ? 42   ARG A CB  1 
ATOM   158  C CG  . ARG A 1 27  ? 10.285  -11.703 -0.534  1.00 47.67  ? 42   ARG A CG  1 
ATOM   159  C CD  . ARG A 1 27  ? 10.934  -12.480 -1.656  1.00 49.34  ? 42   ARG A CD  1 
ATOM   160  N NE  . ARG A 1 27  ? 11.857  -13.467 -1.111  1.00 53.31  ? 42   ARG A NE  1 
ATOM   161  C CZ  . ARG A 1 27  ? 12.707  -14.176 -1.838  1.00 50.83  ? 42   ARG A CZ  1 
ATOM   162  N NH1 . ARG A 1 27  ? 12.751  -14.007 -3.151  1.00 47.70  ? 42   ARG A NH1 1 
ATOM   163  N NH2 . ARG A 1 27  ? 13.520  -15.041 -1.246  1.00 53.53  ? 42   ARG A NH2 1 
ATOM   164  N N   . ILE A 1 28  ? 9.259   -9.573  1.521   1.00 40.38  ? 43   ILE A N   1 
ATOM   165  C CA  . ILE A 1 28  ? 9.005   -8.193  1.146   1.00 40.39  ? 43   ILE A CA  1 
ATOM   166  C C   . ILE A 1 28  ? 9.969   -7.839  -0.003  1.00 41.17  ? 43   ILE A C   1 
ATOM   167  O O   . ILE A 1 28  ? 11.182  -7.788  0.201   1.00 38.13  ? 43   ILE A O   1 
ATOM   168  C CB  . ILE A 1 28  ? 9.272   -7.223  2.332   1.00 36.39  ? 43   ILE A CB  1 
ATOM   169  C CG1 . ILE A 1 28  ? 8.544   -7.703  3.594   1.00 38.64  ? 43   ILE A CG1 1 
ATOM   170  C CG2 . ILE A 1 28  ? 8.807   -5.825  1.969   1.00 28.48  ? 43   ILE A CG2 1 
ATOM   171  C CD1 . ILE A 1 28  ? 8.875   -6.892  4.877   1.00 28.66  ? 43   ILE A CD1 1 
ATOM   172  N N   . THR A 1 29  ? 9.437   -7.626  -1.208  1.00 41.80  ? 44   THR A N   1 
ATOM   173  C CA  . THR A 1 29  ? 10.268  -7.240  -2.354  1.00 41.20  ? 44   THR A CA  1 
ATOM   174  C C   . THR A 1 29  ? 10.269  -5.712  -2.460  1.00 41.71  ? 44   THR A C   1 
ATOM   175  O O   . THR A 1 29  ? 9.216   -5.082  -2.607  1.00 38.80  ? 44   THR A O   1 
ATOM   176  C CB  . THR A 1 29  ? 9.744   -7.808  -3.691  1.00 41.66  ? 44   THR A CB  1 
ATOM   177  O OG1 . THR A 1 29  ? 9.741   -9.238  -3.642  1.00 45.02  ? 44   THR A OG1 1 
ATOM   178  C CG2 . THR A 1 29  ? 10.629  -7.355  -4.835  1.00 33.52  ? 44   THR A CG2 1 
ATOM   179  N N   . ILE A 1 30  ? 11.463  -5.131  -2.401  1.00 40.65  ? 45   ILE A N   1 
ATOM   180  C CA  . ILE A 1 30  ? 11.640  -3.686  -2.450  1.00 40.90  ? 45   ILE A CA  1 
ATOM   181  C C   . ILE A 1 30  ? 12.295  -3.170  -3.734  1.00 40.64  ? 45   ILE A C   1 
ATOM   182  O O   . ILE A 1 30  ? 13.214  -3.800  -4.279  1.00 41.72  ? 45   ILE A O   1 
ATOM   183  C CB  . ILE A 1 30  ? 12.464  -3.236  -1.220  1.00 36.85  ? 45   ILE A CB  1 
ATOM   184  C CG1 . ILE A 1 30  ? 11.670  -3.558  0.050   1.00 33.43  ? 45   ILE A CG1 1 
ATOM   185  C CG2 . ILE A 1 30  ? 12.805  -1.757  -1.314  1.00 33.19  ? 45   ILE A CG2 1 
ATOM   186  C CD1 . ILE A 1 30  ? 12.504  -3.659  1.310   1.00 45.25  ? 45   ILE A CD1 1 
ATOM   187  N N   . GLY A 1 31  ? 11.806  -2.024  -4.210  1.00 38.71  ? 46   GLY A N   1 
ATOM   188  C CA  . GLY A 1 31  ? 12.346  -1.409  -5.412  1.00 38.78  ? 46   GLY A CA  1 
ATOM   189  C C   . GLY A 1 31  ? 13.155  -0.200  -5.005  1.00 38.91  ? 46   GLY A C   1 
ATOM   190  O O   . GLY A 1 31  ? 12.759  0.521   -4.100  1.00 47.63  ? 46   GLY A O   1 
ATOM   191  N N   . LEU A 1 32  ? 14.277  0.035   -5.671  1.00 42.97  ? 47   LEU A N   1 
ATOM   192  C CA  . LEU A 1 32  ? 15.159  1.147   -5.325  1.00 40.93  ? 47   LEU A CA  1 
ATOM   193  C C   . LEU A 1 32  ? 15.342  2.260   -6.362  1.00 43.56  ? 47   LEU A C   1 
ATOM   194  O O   . LEU A 1 32  ? 15.782  2.016   -7.476  1.00 44.80  ? 47   LEU A O   1 
ATOM   195  C CB  . LEU A 1 32  ? 16.526  0.583   -4.957  1.00 38.20  ? 47   LEU A CB  1 
ATOM   196  C CG  . LEU A 1 32  ? 16.535  -0.403  -3.789  1.00 38.42  ? 47   LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 32  ? 17.940  -1.008  -3.650  1.00 30.29  ? 47   LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 32  ? 16.094  0.321   -2.503  1.00 35.00  ? 47   LEU A CD2 1 
ATOM   199  N N   . PHE A 1 33  ? 15.026  3.492   -5.975  1.00 46.24  ? 48   PHE A N   1 
ATOM   200  C CA  . PHE A 1 33  ? 15.172  4.641   -6.863  1.00 46.43  ? 48   PHE A CA  1 
ATOM   201  C C   . PHE A 1 33  ? 16.651  4.986   -7.016  1.00 48.75  ? 48   PHE A C   1 
ATOM   202  O O   . PHE A 1 33  ? 17.127  5.967   -6.435  1.00 48.29  ? 48   PHE A O   1 
ATOM   203  C CB  . PHE A 1 33  ? 14.448  5.845   -6.275  1.00 46.03  ? 48   PHE A CB  1 
ATOM   204  C CG  . PHE A 1 33  ? 13.033  5.563   -5.873  1.00 45.09  ? 48   PHE A CG  1 
ATOM   205  C CD1 . PHE A 1 33  ? 12.431  6.300   -4.849  1.00 40.97  ? 48   PHE A CD1 1 
ATOM   206  C CD2 . PHE A 1 33  ? 12.296  4.563   -6.505  1.00 41.82  ? 48   PHE A CD2 1 
ATOM   207  C CE1 . PHE A 1 33  ? 11.124  6.040   -4.463  1.00 35.26  ? 48   PHE A CE1 1 
ATOM   208  C CE2 . PHE A 1 33  ? 10.982  4.299   -6.123  1.00 40.28  ? 48   PHE A CE2 1 
ATOM   209  C CZ  . PHE A 1 33  ? 10.397  5.037   -5.102  1.00 40.23  ? 48   PHE A CZ  1 
ATOM   210  N N   . GLY A 1 34  ? 17.371  4.189   -7.801  1.00 48.21  ? 49   GLY A N   1 
ATOM   211  C CA  . GLY A 1 34  ? 18.794  4.425   -7.999  1.00 47.69  ? 49   GLY A CA  1 
ATOM   212  C C   . GLY A 1 34  ? 19.221  5.763   -8.592  1.00 50.04  ? 49   GLY A C   1 
ATOM   213  O O   . GLY A 1 34  ? 20.295  6.263   -8.273  1.00 53.76  ? 49   GLY A O   1 
ATOM   214  N N   . LYS A 1 35  ? 18.397  6.357   -9.445  1.00 49.27  ? 50   LYS A N   1 
ATOM   215  C CA  . LYS A 1 35  ? 18.759  7.626   -10.066 1.00 49.45  ? 50   LYS A CA  1 
ATOM   216  C C   . LYS A 1 35  ? 18.569  8.866   -9.211  1.00 47.01  ? 50   LYS A C   1 
ATOM   217  O O   . LYS A 1 35  ? 19.307  9.840   -9.369  1.00 50.86  ? 50   LYS A O   1 
ATOM   218  C CB  . LYS A 1 35  ? 17.980  7.825   -11.376 1.00 55.15  ? 50   LYS A CB  1 
ATOM   219  C CG  . LYS A 1 35  ? 18.480  6.997   -12.545 1.00 59.66  ? 50   LYS A CG  1 
ATOM   220  C CD  . LYS A 1 35  ? 17.690  7.298   -13.805 1.00 70.05  ? 50   LYS A CD  1 
ATOM   221  C CE  . LYS A 1 35  ? 18.060  6.334   -14.931 1.00 76.62  ? 50   LYS A CE  1 
ATOM   222  N NZ  . LYS A 1 35  ? 17.244  6.562   -16.160 1.00 79.55  ? 50   LYS A NZ  1 
ATOM   223  N N   . ASP A 1 36  ? 17.587  8.846   -8.316  1.00 40.93  ? 51   ASP A N   1 
ATOM   224  C CA  . ASP A 1 36  ? 17.302  10.015  -7.490  1.00 43.85  ? 51   ASP A CA  1 
ATOM   225  C C   . ASP A 1 36  ? 18.052  10.039  -6.177  1.00 44.86  ? 51   ASP A C   1 
ATOM   226  O O   . ASP A 1 36  ? 18.101  11.071  -5.510  1.00 45.70  ? 51   ASP A O   1 
ATOM   227  C CB  . ASP A 1 36  ? 15.804  10.116  -7.202  1.00 46.59  ? 51   ASP A CB  1 
ATOM   228  C CG  . ASP A 1 36  ? 14.960  10.017  -8.455  1.00 49.86  ? 51   ASP A CG  1 
ATOM   229  O OD1 . ASP A 1 36  ? 14.953  8.940   -9.090  1.00 55.68  ? 51   ASP A OD1 1 
ATOM   230  O OD2 . ASP A 1 36  ? 14.300  11.016  -8.806  1.00 47.77  ? 51   ASP A OD2 1 
ATOM   231  N N   . ALA A 1 37  ? 18.630  8.898   -5.813  1.00 47.08  ? 52   ALA A N   1 
ATOM   232  C CA  . ALA A 1 37  ? 19.388  8.750   -4.573  1.00 45.41  ? 52   ALA A CA  1 
ATOM   233  C C   . ALA A 1 37  ? 20.295  7.533   -4.735  1.00 47.00  ? 52   ALA A C   1 
ATOM   234  O O   . ALA A 1 37  ? 20.013  6.457   -4.211  1.00 47.37  ? 52   ALA A O   1 
ATOM   235  C CB  . ALA A 1 37  ? 18.433  8.549   -3.401  1.00 45.53  ? 52   ALA A CB  1 
ATOM   236  N N   . PRO A 1 38  ? 21.386  7.693   -5.494  1.00 51.71  ? 53   PRO A N   1 
ATOM   237  C CA  . PRO A 1 38  ? 22.400  6.671   -5.796  1.00 49.73  ? 53   PRO A CA  1 
ATOM   238  C C   . PRO A 1 38  ? 23.269  6.235   -4.615  1.00 45.36  ? 53   PRO A C   1 
ATOM   239  O O   . PRO A 1 38  ? 23.497  5.044   -4.412  1.00 44.39  ? 53   PRO A O   1 
ATOM   240  C CB  . PRO A 1 38  ? 23.206  7.318   -6.925  1.00 56.15  ? 53   PRO A CB  1 
ATOM   241  C CG  . PRO A 1 38  ? 23.084  8.800   -6.624  1.00 55.99  ? 53   PRO A CG  1 
ATOM   242  C CD  . PRO A 1 38  ? 21.630  8.923   -6.273  1.00 53.66  ? 53   PRO A CD  1 
ATOM   243  N N   . LEU A 1 39  ? 23.764  7.197   -3.845  1.00 46.00  ? 54   LEU A N   1 
ATOM   244  C CA  . LEU A 1 39  ? 24.579  6.893   -2.672  1.00 43.97  ? 54   LEU A CA  1 
ATOM   245  C C   . LEU A 1 39  ? 23.738  6.110   -1.669  1.00 44.17  ? 54   LEU A C   1 
ATOM   246  O O   . LEU A 1 39  ? 24.165  5.075   -1.156  1.00 47.26  ? 54   LEU A O   1 
ATOM   247  C CB  . LEU A 1 39  ? 25.067  8.187   -2.009  1.00 44.75  ? 54   LEU A CB  1 
ATOM   248  C CG  . LEU A 1 39  ? 26.035  9.045   -2.830  1.00 49.00  ? 54   LEU A CG  1 
ATOM   249  C CD1 . LEU A 1 39  ? 26.322  10.348  -2.102  1.00 48.42  ? 54   LEU A CD1 1 
ATOM   250  C CD2 . LEU A 1 39  ? 27.324  8.271   -3.067  1.00 47.48  ? 54   LEU A CD2 1 
ATOM   251  N N   . THR A 1 40  ? 22.533  6.614   -1.409  1.00 41.72  ? 55   THR A N   1 
ATOM   252  C CA  . THR A 1 40  ? 21.613  6.010   -0.458  1.00 37.62  ? 55   THR A CA  1 
ATOM   253  C C   . THR A 1 40  ? 21.142  4.620   -0.848  1.00 37.96  ? 55   THR A C   1 
ATOM   254  O O   . THR A 1 40  ? 21.117  3.730   -0.004  1.00 41.93  ? 55   THR A O   1 
ATOM   255  C CB  . THR A 1 40  ? 20.392  6.922   -0.227  1.00 38.38  ? 55   THR A CB  1 
ATOM   256  O OG1 . THR A 1 40  ? 20.838  8.178   0.290   1.00 38.75  ? 55   THR A OG1 1 
ATOM   257  C CG2 . THR A 1 40  ? 19.426  6.303   0.776   1.00 38.84  ? 55   THR A CG2 1 
ATOM   258  N N   . THR A 1 41  ? 20.778  4.414   -2.111  1.00 40.64  ? 56   THR A N   1 
ATOM   259  C CA  . THR A 1 41  ? 20.322  3.088   -2.545  1.00 42.13  ? 56   THR A CA  1 
ATOM   260  C C   . THR A 1 41  ? 21.476  2.089   -2.601  1.00 42.97  ? 56   THR A C   1 
ATOM   261  O O   . THR A 1 41  ? 21.278  0.881   -2.460  1.00 41.69  ? 56   THR A O   1 
ATOM   262  C CB  . THR A 1 41  ? 19.679  3.113   -3.940  1.00 42.71  ? 56   THR A CB  1 
ATOM   263  O OG1 . THR A 1 41  ? 20.669  3.465   -4.912  1.00 51.31  ? 56   THR A OG1 1 
ATOM   264  C CG2 . THR A 1 41  ? 18.529  4.087   -3.982  1.00 34.76  ? 56   THR A CG2 1 
ATOM   265  N N   . GLU A 1 42  ? 22.678  2.593   -2.839  1.00 43.03  ? 57   GLU A N   1 
ATOM   266  C CA  . GLU A 1 42  ? 23.848  1.737   -2.878  1.00 46.05  ? 57   GLU A CA  1 
ATOM   267  C C   . GLU A 1 42  ? 24.134  1.222   -1.474  1.00 49.11  ? 57   GLU A C   1 
ATOM   268  O O   . GLU A 1 42  ? 24.415  0.038   -1.274  1.00 52.75  ? 57   GLU A O   1 
ATOM   269  C CB  . GLU A 1 42  ? 25.038  2.513   -3.430  1.00 45.71  ? 57   GLU A CB  1 
ATOM   270  C CG  . GLU A 1 42  ? 25.078  2.465   -4.939  1.00 47.81  ? 57   GLU A CG  1 
ATOM   271  C CD  . GLU A 1 42  ? 25.095  1.041   -5.428  1.00 48.66  ? 57   GLU A CD  1 
ATOM   272  O OE1 . GLU A 1 42  ? 26.077  0.329   -5.129  1.00 51.41  ? 57   GLU A OE1 1 
ATOM   273  O OE2 . GLU A 1 42  ? 24.122  0.626   -6.089  1.00 52.74  ? 57   GLU A OE2 1 
ATOM   274  N N   . ASN A 1 43  ? 24.052  2.125   -0.502  1.00 49.50  ? 58   ASN A N   1 
ATOM   275  C CA  . ASN A 1 43  ? 24.250  1.777   0.895   1.00 46.02  ? 58   ASN A CA  1 
ATOM   276  C C   . ASN A 1 43  ? 23.258  0.652   1.224   1.00 42.72  ? 58   ASN A C   1 
ATOM   277  O O   . ASN A 1 43  ? 23.639  -0.423  1.685   1.00 44.04  ? 58   ASN A O   1 
ATOM   278  C CB  . ASN A 1 43  ? 23.961  3.001   1.769   1.00 47.87  ? 58   ASN A CB  1 
ATOM   279  C CG  . ASN A 1 43  ? 24.168  2.732   3.240   1.00 47.80  ? 58   ASN A CG  1 
ATOM   280  O OD1 . ASN A 1 43  ? 23.516  3.331   4.092   1.00 48.66  ? 58   ASN A OD1 1 
ATOM   281  N ND2 . ASN A 1 43  ? 25.090  1.840   3.548   1.00 46.93  ? 58   ASN A ND2 1 
ATOM   282  N N   . PHE A 1 44  ? 21.979  0.904   0.959   1.00 40.15  ? 59   PHE A N   1 
ATOM   283  C CA  . PHE A 1 44  ? 20.934  -0.071  1.239   1.00 38.00  ? 59   PHE A CA  1 
ATOM   284  C C   . PHE A 1 44  ? 21.215  -1.414  0.580   1.00 37.96  ? 59   PHE A C   1 
ATOM   285  O O   . PHE A 1 44  ? 21.243  -2.450  1.245   1.00 42.85  ? 59   PHE A O   1 
ATOM   286  C CB  . PHE A 1 44  ? 19.567  0.450   0.763   1.00 36.52  ? 59   PHE A CB  1 
ATOM   287  C CG  . PHE A 1 44  ? 18.399  -0.229  1.424   1.00 34.78  ? 59   PHE A CG  1 
ATOM   288  C CD1 . PHE A 1 44  ? 18.049  0.078   2.742   1.00 33.99  ? 59   PHE A CD1 1 
ATOM   289  C CD2 . PHE A 1 44  ? 17.683  -1.211  0.755   1.00 28.33  ? 59   PHE A CD2 1 
ATOM   290  C CE1 . PHE A 1 44  ? 17.008  -0.588  3.379   1.00 33.46  ? 59   PHE A CE1 1 
ATOM   291  C CE2 . PHE A 1 44  ? 16.636  -1.886  1.384   1.00 31.89  ? 59   PHE A CE2 1 
ATOM   292  C CZ  . PHE A 1 44  ? 16.299  -1.569  2.704   1.00 35.24  ? 59   PHE A CZ  1 
ATOM   293  N N   . ARG A 1 45  ? 21.420  -1.394  -0.731  1.00 41.70  ? 60   ARG A N   1 
ATOM   294  C CA  . ARG A 1 45  ? 21.679  -2.609  -1.506  1.00 39.98  ? 60   ARG A CA  1 
ATOM   295  C C   . ARG A 1 45  ? 22.800  -3.481  -0.925  1.00 40.57  ? 60   ARG A C   1 
ATOM   296  O O   . ARG A 1 45  ? 22.624  -4.691  -0.727  1.00 36.72  ? 60   ARG A O   1 
ATOM   297  C CB  . ARG A 1 45  ? 22.029  -2.227  -2.946  1.00 40.06  ? 60   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 45  ? 21.712  -3.274  -3.976  1.00 34.27  ? 60   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 45  ? 22.449  -2.973  -5.263  1.00 43.10  ? 60   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 45  ? 23.719  -3.702  -5.327  1.00 54.89  ? 60   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 45  ? 24.915  -3.133  -5.443  1.00 53.60  ? 60   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 45  ? 25.017  -1.813  -5.509  1.00 53.45  ? 60   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 45  ? 26.007  -3.885  -5.494  1.00 47.43  ? 60   ARG A NH2 1 
ATOM   304  N N   . GLN A 1 46  ? 23.945  -2.861  -0.651  1.00 41.61  ? 61   GLN A N   1 
ATOM   305  C CA  . GLN A 1 46  ? 25.095  -3.580  -0.117  1.00 47.83  ? 61   GLN A CA  1 
ATOM   306  C C   . GLN A 1 46  ? 24.925  -4.114  1.299   1.00 52.03  ? 61   GLN A C   1 
ATOM   307  O O   . GLN A 1 46  ? 25.668  -5.013  1.710   1.00 53.76  ? 61   GLN A O   1 
ATOM   308  C CB  . GLN A 1 46  ? 26.348  -2.710  -0.210  1.00 47.71  ? 61   GLN A CB  1 
ATOM   309  C CG  . GLN A 1 46  ? 26.895  -2.640  -1.621  1.00 45.88  ? 61   GLN A CG  1 
ATOM   310  C CD  . GLN A 1 46  ? 27.925  -1.565  -1.788  1.00 47.91  ? 61   GLN A CD  1 
ATOM   311  O OE1 . GLN A 1 46  ? 28.921  -1.536  -1.075  1.00 49.16  ? 61   GLN A OE1 1 
ATOM   312  N NE2 . GLN A 1 46  ? 27.693  -0.662  -2.739  1.00 48.17  ? 61   GLN A NE2 1 
ATOM   313  N N   . LEU A 1 47  ? 23.958  -3.570  2.043   1.00 47.44  ? 62   LEU A N   1 
ATOM   314  C CA  . LEU A 1 47  ? 23.696  -4.048  3.395   1.00 43.12  ? 62   LEU A CA  1 
ATOM   315  C C   . LEU A 1 47  ? 22.763  -5.247  3.276   1.00 47.82  ? 62   LEU A C   1 
ATOM   316  O O   . LEU A 1 47  ? 22.740  -6.133  4.137   1.00 48.51  ? 62   LEU A O   1 
ATOM   317  C CB  . LEU A 1 47  ? 23.060  -2.951  4.242   1.00 38.71  ? 62   LEU A CB  1 
ATOM   318  C CG  . LEU A 1 47  ? 23.980  -1.773  4.565   1.00 39.37  ? 62   LEU A CG  1 
ATOM   319  C CD1 . LEU A 1 47  ? 23.192  -0.645  5.215   1.00 41.85  ? 62   LEU A CD1 1 
ATOM   320  C CD2 . LEU A 1 47  ? 25.089  -2.247  5.481   1.00 40.96  ? 62   LEU A CD2 1 
ATOM   321  N N   . CYS A 1 48  ? 22.004  -5.281  2.187   1.00 51.63  ? 63   CYS A N   1 
ATOM   322  C CA  . CYS A 1 48  ? 21.089  -6.388  1.944   1.00 52.64  ? 63   CYS A CA  1 
ATOM   323  C C   . CYS A 1 48  ? 21.884  -7.631  1.560   1.00 55.88  ? 63   CYS A C   1 
ATOM   324  O O   . CYS A 1 48  ? 21.580  -8.735  2.007   1.00 60.62  ? 63   CYS A O   1 
ATOM   325  C CB  . CYS A 1 48  ? 20.093  -6.032  0.827   1.00 51.35  ? 63   CYS A CB  1 
ATOM   326  S SG  . CYS A 1 48  ? 18.589  -5.139  1.359   1.00 41.84  ? 63   CYS A SG  1 
ATOM   327  N N   . THR A 1 49  ? 22.911  -7.456  0.736   1.00 59.18  ? 64   THR A N   1 
ATOM   328  C CA  . THR A 1 49  ? 23.720  -8.593  0.321   1.00 59.07  ? 64   THR A CA  1 
ATOM   329  C C   . THR A 1 49  ? 24.665  -9.027  1.442   1.00 63.41  ? 64   THR A C   1 
ATOM   330  O O   . THR A 1 49  ? 24.786  -10.220 1.729   1.00 69.86  ? 64   THR A O   1 
ATOM   331  C CB  . THR A 1 49  ? 24.531  -8.288  -0.980  1.00 54.29  ? 64   THR A CB  1 
ATOM   332  O OG1 . THR A 1 49  ? 25.476  -7.236  -0.744  1.00 56.26  ? 64   THR A OG1 1 
ATOM   333  C CG2 . THR A 1 49  ? 23.594  -7.868  -2.108  1.00 46.13  ? 64   THR A CG2 1 
ATOM   334  N N   . GLY A 1 50  ? 25.319  -8.070  2.092   1.00 62.41  ? 65   GLY A N   1 
ATOM   335  C CA  . GLY A 1 50  ? 26.235  -8.419  3.166   1.00 62.28  ? 65   GLY A CA  1 
ATOM   336  C C   . GLY A 1 50  ? 27.696  -8.345  2.755   1.00 63.96  ? 65   GLY A C   1 
ATOM   337  O O   . GLY A 1 50  ? 28.583  -8.650  3.546   1.00 66.41  ? 65   GLY A O   1 
ATOM   338  N N   . GLU A 1 51  ? 27.938  -7.933  1.514   1.00 65.40  ? 66   GLU A N   1 
ATOM   339  C CA  . GLU A 1 51  ? 29.277  -7.796  0.944   1.00 63.69  ? 66   GLU A CA  1 
ATOM   340  C C   . GLU A 1 51  ? 30.399  -7.390  1.903   1.00 65.97  ? 66   GLU A C   1 
ATOM   341  O O   . GLU A 1 51  ? 31.470  -7.996  1.904   1.00 70.20  ? 66   GLU A O   1 
ATOM   342  C CB  . GLU A 1 51  ? 29.249  -6.778  -0.189  1.00 67.06  ? 66   GLU A CB  1 
ATOM   343  C CG  . GLU A 1 51  ? 28.361  -7.129  -1.349  1.00 68.10  ? 66   GLU A CG  1 
ATOM   344  C CD  . GLU A 1 51  ? 28.211  -5.960  -2.289  1.00 72.09  ? 66   GLU A CD  1 
ATOM   345  O OE1 . GLU A 1 51  ? 29.249  -5.426  -2.739  1.00 68.40  ? 66   GLU A OE1 1 
ATOM   346  O OE2 . GLU A 1 51  ? 27.059  -5.573  -2.571  1.00 75.01  ? 66   GLU A OE2 1 
ATOM   347  N N   . HIS A 1 52  ? 30.163  -6.358  2.703   1.00 64.05  ? 67   HIS A N   1 
ATOM   348  C CA  . HIS A 1 52  ? 31.177  -5.867  3.634   1.00 63.12  ? 67   HIS A CA  1 
ATOM   349  C C   . HIS A 1 52  ? 31.292  -6.609  4.966   1.00 63.56  ? 67   HIS A C   1 
ATOM   350  O O   . HIS A 1 52  ? 32.047  -6.191  5.843   1.00 67.57  ? 67   HIS A O   1 
ATOM   351  C CB  . HIS A 1 52  ? 30.922  -4.392  3.897   1.00 62.49  ? 67   HIS A CB  1 
ATOM   352  C CG  . HIS A 1 52  ? 30.691  -3.607  2.649   1.00 68.95  ? 67   HIS A CG  1 
ATOM   353  N ND1 . HIS A 1 52  ? 31.703  -3.314  1.762   1.00 72.75  ? 67   HIS A ND1 1 
ATOM   354  C CD2 . HIS A 1 52  ? 29.556  -3.107  2.108   1.00 70.78  ? 67   HIS A CD2 1 
ATOM   355  C CE1 . HIS A 1 52  ? 31.202  -2.667  0.726   1.00 73.83  ? 67   HIS A CE1 1 
ATOM   356  N NE2 . HIS A 1 52  ? 29.902  -2.529  0.911   1.00 77.37  ? 67   HIS A NE2 1 
ATOM   357  N N   . GLY A 1 53  ? 30.557  -7.705  5.126   1.00 60.50  ? 68   GLY A N   1 
ATOM   358  C CA  . GLY A 1 53  ? 30.627  -8.442  6.377   1.00 64.07  ? 68   GLY A CA  1 
ATOM   359  C C   . GLY A 1 53  ? 29.403  -8.253  7.258   1.00 66.53  ? 68   GLY A C   1 
ATOM   360  O O   . GLY A 1 53  ? 28.918  -9.208  7.871   1.00 70.14  ? 68   GLY A O   1 
ATOM   361  N N   . PHE A 1 54  ? 28.910  -7.021  7.347   1.00 61.95  ? 69   PHE A N   1 
ATOM   362  C CA  . PHE A 1 54  ? 27.719  -6.754  8.138   1.00 58.76  ? 69   PHE A CA  1 
ATOM   363  C C   . PHE A 1 54  ? 26.532  -6.581  7.195   1.00 58.85  ? 69   PHE A C   1 
ATOM   364  O O   . PHE A 1 54  ? 26.702  -6.540  5.970   1.00 61.17  ? 69   PHE A O   1 
ATOM   365  C CB  . PHE A 1 54  ? 27.917  -5.510  9.007   1.00 55.77  ? 69   PHE A CB  1 
ATOM   366  C CG  . PHE A 1 54  ? 28.520  -4.353  8.282   1.00 55.75  ? 69   PHE A CG  1 
ATOM   367  C CD1 . PHE A 1 54  ? 27.716  -3.358  7.743   1.00 58.99  ? 69   PHE A CD1 1 
ATOM   368  C CD2 . PHE A 1 54  ? 29.893  -4.251  8.143   1.00 56.67  ? 69   PHE A CD2 1 
ATOM   369  C CE1 . PHE A 1 54  ? 28.268  -2.277  7.075   1.00 58.84  ? 69   PHE A CE1 1 
ATOM   370  C CE2 . PHE A 1 54  ? 30.462  -3.169  7.473   1.00 64.76  ? 69   PHE A CE2 1 
ATOM   371  C CZ  . PHE A 1 54  ? 29.644  -2.177  6.939   1.00 60.12  ? 69   PHE A CZ  1 
ATOM   372  N N   . GLY A 1 55  ? 25.332  -6.499  7.759   1.00 54.59  ? 70   GLY A N   1 
ATOM   373  C CA  . GLY A 1 55  ? 24.153  -6.346  6.931   1.00 51.46  ? 70   GLY A CA  1 
ATOM   374  C C   . GLY A 1 55  ? 22.844  -6.580  7.663   1.00 50.97  ? 70   GLY A C   1 
ATOM   375  O O   . GLY A 1 55  ? 22.822  -6.932  8.839   1.00 51.35  ? 70   GLY A O   1 
ATOM   376  N N   . TYR A 1 56  ? 21.748  -6.391  6.941   1.00 47.88  ? 71   TYR A N   1 
ATOM   377  C CA  . TYR A 1 56  ? 20.417  -6.553  7.487   1.00 44.90  ? 71   TYR A CA  1 
ATOM   378  C C   . TYR A 1 56  ? 20.040  -7.979  7.808   1.00 47.10  ? 71   TYR A C   1 
ATOM   379  O O   . TYR A 1 56  ? 19.003  -8.206  8.423   1.00 49.37  ? 71   TYR A O   1 
ATOM   380  C CB  . TYR A 1 56  ? 19.389  -5.978  6.523   1.00 41.97  ? 71   TYR A CB  1 
ATOM   381  C CG  . TYR A 1 56  ? 19.520  -4.492  6.337   1.00 42.52  ? 71   TYR A CG  1 
ATOM   382  C CD1 . TYR A 1 56  ? 19.637  -3.937  5.060   1.00 41.88  ? 71   TYR A CD1 1 
ATOM   383  C CD2 . TYR A 1 56  ? 19.543  -3.638  7.433   1.00 38.25  ? 71   TYR A CD2 1 
ATOM   384  C CE1 . TYR A 1 56  ? 19.781  -2.565  4.885   1.00 33.81  ? 71   TYR A CE1 1 
ATOM   385  C CE2 . TYR A 1 56  ? 19.682  -2.269  7.269   1.00 41.96  ? 71   TYR A CE2 1 
ATOM   386  C CZ  . TYR A 1 56  ? 19.803  -1.740  5.993   1.00 39.39  ? 71   TYR A CZ  1 
ATOM   387  O OH  . TYR A 1 56  ? 19.953  -0.384  5.835   1.00 45.45  ? 71   TYR A OH  1 
ATOM   388  N N   . LYS A 1 57  ? 20.862  -8.941  7.396   1.00 51.21  ? 72   LYS A N   1 
ATOM   389  C CA  . LYS A 1 57  ? 20.555  -10.346 7.666   1.00 47.48  ? 72   LYS A CA  1 
ATOM   390  C C   . LYS A 1 57  ? 20.575  -10.675 9.157   1.00 43.38  ? 72   LYS A C   1 
ATOM   391  O O   . LYS A 1 57  ? 21.587  -10.496 9.814   1.00 45.74  ? 72   LYS A O   1 
ATOM   392  C CB  . LYS A 1 57  ? 21.543  -11.265 6.962   1.00 45.30  ? 72   LYS A CB  1 
ATOM   393  C CG  . LYS A 1 57  ? 21.163  -12.717 7.132   1.00 52.43  ? 72   LYS A CG  1 
ATOM   394  C CD  . LYS A 1 57  ? 22.340  -13.656 6.993   1.00 54.11  ? 72   LYS A CD  1 
ATOM   395  C CE  . LYS A 1 57  ? 21.865  -15.098 7.142   1.00 62.80  ? 72   LYS A CE  1 
ATOM   396  N NZ  . LYS A 1 57  ? 21.054  -15.324 8.393   1.00 60.18  ? 72   LYS A NZ  1 
ATOM   397  N N   . ASP A 1 58  ? 19.452  -11.161 9.672   1.00 45.30  ? 73   ASP A N   1 
ATOM   398  C CA  . ASP A 1 58  ? 19.294  -11.544 11.077  1.00 51.51  ? 73   ASP A CA  1 
ATOM   399  C C   . ASP A 1 58  ? 18.847  -10.407 11.992  1.00 54.41  ? 73   ASP A C   1 
ATOM   400  O O   . ASP A 1 58  ? 18.537  -10.633 13.169  1.00 57.30  ? 73   ASP A O   1 
ATOM   401  C CB  . ASP A 1 58  ? 20.578  -12.185 11.620  1.00 53.78  ? 73   ASP A CB  1 
ATOM   402  C CG  . ASP A 1 58  ? 20.722  -13.648 11.207  1.00 62.63  ? 73   ASP A CG  1 
ATOM   403  O OD1 . ASP A 1 58  ? 21.871  -14.149 11.190  1.00 63.38  ? 73   ASP A OD1 1 
ATOM   404  O OD2 . ASP A 1 58  ? 19.685  -14.297 10.915  1.00 57.78  ? 73   ASP A OD2 1 
ATOM   405  N N   . SER A 1 59  ? 18.797  -9.194  11.446  1.00 51.61  ? 74   SER A N   1 
ATOM   406  C CA  . SER A 1 59  ? 18.371  -8.023  12.204  1.00 45.77  ? 74   SER A CA  1 
ATOM   407  C C   . SER A 1 59  ? 16.867  -8.061  12.450  1.00 44.59  ? 74   SER A C   1 
ATOM   408  O O   . SER A 1 59  ? 16.163  -8.957  11.982  1.00 41.00  ? 74   SER A O   1 
ATOM   409  C CB  . SER A 1 59  ? 18.745  -6.738  11.457  1.00 45.26  ? 74   SER A CB  1 
ATOM   410  O OG  . SER A 1 59  ? 18.146  -6.698  10.178  1.00 40.05  ? 74   SER A OG  1 
ATOM   411  N N   . ILE A 1 60  ? 16.382  -7.075  13.191  1.00 44.15  ? 75   ILE A N   1 
ATOM   412  C CA  . ILE A 1 60  ? 14.968  -7.005  13.524  1.00 44.64  ? 75   ILE A CA  1 
ATOM   413  C C   . ILE A 1 60  ? 14.348  -5.620  13.333  1.00 42.81  ? 75   ILE A C   1 
ATOM   414  O O   . ILE A 1 60  ? 15.029  -4.632  13.035  1.00 41.96  ? 75   ILE A O   1 
ATOM   415  C CB  . ILE A 1 60  ? 14.740  -7.403  14.991  1.00 47.74  ? 75   ILE A CB  1 
ATOM   416  C CG1 . ILE A 1 60  ? 15.555  -6.468  15.892  1.00 50.63  ? 75   ILE A CG1 1 
ATOM   417  C CG2 . ILE A 1 60  ? 15.139  -8.857  15.207  1.00 50.82  ? 75   ILE A CG2 1 
ATOM   418  C CD1 . ILE A 1 60  ? 15.140  -6.482  17.328  1.00 53.74  ? 75   ILE A CD1 1 
ATOM   419  N N   . PHE A 1 61  ? 13.035  -5.582  13.526  1.00 36.91  ? 76   PHE A N   1 
ATOM   420  C CA  . PHE A 1 61  ? 12.239  -4.376  13.433  1.00 39.91  ? 76   PHE A CA  1 
ATOM   421  C C   . PHE A 1 61  ? 11.941  -3.965  14.879  1.00 42.20  ? 76   PHE A C   1 
ATOM   422  O O   . PHE A 1 61  ? 10.906  -4.320  15.424  1.00 53.12  ? 76   PHE A O   1 
ATOM   423  C CB  . PHE A 1 61  ? 10.951  -4.697  12.671  1.00 41.37  ? 76   PHE A CB  1 
ATOM   424  C CG  . PHE A 1 61  ? 11.155  -4.882  11.196  1.00 41.94  ? 76   PHE A CG  1 
ATOM   425  C CD1 . PHE A 1 61  ? 11.092  -3.795  10.336  1.00 43.95  ? 76   PHE A CD1 1 
ATOM   426  C CD2 . PHE A 1 61  ? 11.466  -6.133  10.671  1.00 44.25  ? 76   PHE A CD2 1 
ATOM   427  C CE1 . PHE A 1 61  ? 11.343  -3.944  8.968   1.00 48.99  ? 76   PHE A CE1 1 
ATOM   428  C CE2 . PHE A 1 61  ? 11.719  -6.300  9.303   1.00 44.63  ? 76   PHE A CE2 1 
ATOM   429  C CZ  . PHE A 1 61  ? 11.659  -5.204  8.451   1.00 47.59  ? 76   PHE A CZ  1 
ATOM   430  N N   . HIS A 1 62  ? 12.852  -3.216  15.494  1.00 40.17  ? 77   HIS A N   1 
ATOM   431  C CA  . HIS A 1 62  ? 12.715  -2.805  16.894  1.00 35.78  ? 77   HIS A CA  1 
ATOM   432  C C   . HIS A 1 62  ? 11.620  -1.816  17.251  1.00 37.16  ? 77   HIS A C   1 
ATOM   433  O O   . HIS A 1 62  ? 11.378  -1.568  18.438  1.00 35.28  ? 77   HIS A O   1 
ATOM   434  C CB  . HIS A 1 62  ? 14.022  -2.220  17.377  1.00 29.44  ? 77   HIS A CB  1 
ATOM   435  C CG  . HIS A 1 62  ? 14.427  -1.004  16.621  1.00 30.88  ? 77   HIS A CG  1 
ATOM   436  N ND1 . HIS A 1 62  ? 14.906  -1.062  15.331  1.00 31.09  ? 77   HIS A ND1 1 
ATOM   437  C CD2 . HIS A 1 62  ? 14.376  0.307   16.950  1.00 27.70  ? 77   HIS A CD2 1 
ATOM   438  C CE1 . HIS A 1 62  ? 15.136  0.163   14.898  1.00 29.64  ? 77   HIS A CE1 1 
ATOM   439  N NE2 . HIS A 1 62  ? 14.822  1.011   15.860  1.00 30.27  ? 77   HIS A NE2 1 
ATOM   440  N N   . ARG A 1 63  ? 10.988  -1.223  16.245  1.00 38.11  ? 78   ARG A N   1 
ATOM   441  C CA  . ARG A 1 63  ? 9.919   -0.262  16.495  1.00 41.30  ? 78   ARG A CA  1 
ATOM   442  C C   . ARG A 1 63  ? 8.814   -0.366  15.447  1.00 43.62  ? 78   ARG A C   1 
ATOM   443  O O   . ARG A 1 63  ? 9.026   -0.104  14.266  1.00 45.53  ? 78   ARG A O   1 
ATOM   444  C CB  . ARG A 1 63  ? 10.490  1.154   16.538  1.00 39.37  ? 78   ARG A CB  1 
ATOM   445  C CG  . ARG A 1 63  ? 9.534   2.203   17.050  1.00 34.88  ? 78   ARG A CG  1 
ATOM   446  C CD  . ARG A 1 63  ? 10.316  3.394   17.563  1.00 37.15  ? 78   ARG A CD  1 
ATOM   447  N NE  . ARG A 1 63  ? 9.458   4.550   17.780  1.00 36.98  ? 78   ARG A NE  1 
ATOM   448  C CZ  . ARG A 1 63  ? 9.223   5.487   16.870  1.00 41.23  ? 78   ARG A CZ  1 
ATOM   449  N NH1 . ARG A 1 63  ? 9.790   5.416   15.673  1.00 34.81  ? 78   ARG A NH1 1 
ATOM   450  N NH2 . ARG A 1 63  ? 8.406   6.491   17.157  1.00 45.64  ? 78   ARG A NH2 1 
ATOM   451  N N   . VAL A 1 64  ? 7.634   -0.774  15.901  1.00 46.59  ? 79   VAL A N   1 
ATOM   452  C CA  . VAL A 1 64  ? 6.467   -0.948  15.040  1.00 47.88  ? 79   VAL A CA  1 
ATOM   453  C C   . VAL A 1 64  ? 5.320   -0.168  15.659  1.00 42.00  ? 79   VAL A C   1 
ATOM   454  O O   . VAL A 1 64  ? 5.008   -0.358  16.833  1.00 44.84  ? 79   VAL A O   1 
ATOM   455  C CB  . VAL A 1 64  ? 6.048   -2.438  14.968  1.00 53.12  ? 79   VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 64  ? 4.805   -2.586  14.095  1.00 56.98  ? 79   VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 64  ? 7.204   -3.286  14.439  1.00 49.65  ? 79   VAL A CG2 1 
ATOM   458  N N   . ILE A 1 65  ? 4.699   0.709   14.880  1.00 39.17  ? 80   ILE A N   1 
ATOM   459  C CA  . ILE A 1 65  ? 3.586   1.512   15.381  1.00 36.35  ? 80   ILE A CA  1 
ATOM   460  C C   . ILE A 1 65  ? 2.419   1.430   14.404  1.00 40.72  ? 80   ILE A C   1 
ATOM   461  O O   . ILE A 1 65  ? 2.536   1.849   13.254  1.00 38.89  ? 80   ILE A O   1 
ATOM   462  C CB  . ILE A 1 65  ? 4.008   2.978   15.555  1.00 32.07  ? 80   ILE A CB  1 
ATOM   463  C CG1 . ILE A 1 65  ? 5.025   3.093   16.690  1.00 36.41  ? 80   ILE A CG1 1 
ATOM   464  C CG2 . ILE A 1 65  ? 2.817   3.837   15.816  1.00 30.94  ? 80   ILE A CG2 1 
ATOM   465  C CD1 . ILE A 1 65  ? 5.347   4.503   17.087  1.00 33.86  ? 80   ILE A CD1 1 
ATOM   466  N N   . GLN A 1 66  ? 1.295   0.877   14.853  1.00 42.75  ? 81   GLN A N   1 
ATOM   467  C CA  . GLN A 1 66  ? 0.139   0.759   13.969  1.00 42.92  ? 81   GLN A CA  1 
ATOM   468  C C   . GLN A 1 66  ? -0.231  2.114   13.355  1.00 41.80  ? 81   GLN A C   1 
ATOM   469  O O   . GLN A 1 66  ? -0.090  3.152   13.994  1.00 43.30  ? 81   GLN A O   1 
ATOM   470  C CB  . GLN A 1 66  ? -1.042  0.184   14.732  1.00 34.42  ? 81   GLN A CB  1 
ATOM   471  N N   . ASN A 1 67  ? -0.690  2.090   12.107  1.00 46.06  ? 82   ASN A N   1 
ATOM   472  C CA  . ASN A 1 67  ? -1.103  3.297   11.382  1.00 46.10  ? 82   ASN A CA  1 
ATOM   473  C C   . ASN A 1 67  ? -0.011  4.335   11.237  1.00 43.30  ? 82   ASN A C   1 
ATOM   474  O O   . ASN A 1 67  ? -0.289  5.533   11.204  1.00 48.94  ? 82   ASN A O   1 
ATOM   475  C CB  . ASN A 1 67  ? -2.289  3.967   12.072  1.00 48.70  ? 82   ASN A CB  1 
ATOM   476  C CG  . ASN A 1 67  ? -3.501  3.094   12.108  1.00 46.37  ? 82   ASN A CG  1 
ATOM   477  O OD1 . ASN A 1 67  ? -4.013  2.683   11.069  1.00 52.23  ? 82   ASN A OD1 1 
ATOM   478  N ND2 . ASN A 1 67  ? -3.976  2.800   13.312  1.00 46.48  ? 82   ASN A ND2 1 
ATOM   479  N N   . PHE A 1 68  ? 1.229   3.886   11.153  1.00 38.69  ? 83   PHE A N   1 
ATOM   480  C CA  . PHE A 1 68  ? 2.329   4.806   11.013  1.00 33.80  ? 83   PHE A CA  1 
ATOM   481  C C   . PHE A 1 68  ? 3.455   4.147   10.233  1.00 31.61  ? 83   PHE A C   1 
ATOM   482  O O   . PHE A 1 68  ? 3.611   4.411   9.044   1.00 37.43  ? 83   PHE A O   1 
ATOM   483  C CB  . PHE A 1 68  ? 2.776   5.278   12.410  1.00 36.91  ? 83   PHE A CB  1 
ATOM   484  C CG  . PHE A 1 68  ? 3.945   6.223   12.401  1.00 40.82  ? 83   PHE A CG  1 
ATOM   485  C CD1 . PHE A 1 68  ? 4.101   7.159   11.387  1.00 44.79  ? 83   PHE A CD1 1 
ATOM   486  C CD2 . PHE A 1 68  ? 4.896   6.171   13.416  1.00 44.64  ? 83   PHE A CD2 1 
ATOM   487  C CE1 . PHE A 1 68  ? 5.184   8.022   11.381  1.00 47.32  ? 83   PHE A CE1 1 
ATOM   488  C CE2 . PHE A 1 68  ? 5.981   7.031   13.422  1.00 44.88  ? 83   PHE A CE2 1 
ATOM   489  C CZ  . PHE A 1 68  ? 6.127   7.959   12.399  1.00 52.31  ? 83   PHE A CZ  1 
ATOM   490  N N   . MET A 1 69  ? 4.215   3.263   10.871  1.00 28.90  ? 84   MET A N   1 
ATOM   491  C CA  . MET A 1 69  ? 5.332   2.626   10.182  1.00 31.49  ? 84   MET A CA  1 
ATOM   492  C C   . MET A 1 69  ? 5.986   1.509   10.968  1.00 30.14  ? 84   MET A C   1 
ATOM   493  O O   . MET A 1 69  ? 5.645   1.258   12.115  1.00 29.55  ? 84   MET A O   1 
ATOM   494  C CB  . MET A 1 69  ? 6.401   3.677   9.833   1.00 31.34  ? 84   MET A CB  1 
ATOM   495  C CG  . MET A 1 69  ? 7.044   4.422   11.020  1.00 34.07  ? 84   MET A CG  1 
ATOM   496  S SD  . MET A 1 69  ? 8.332   3.537   11.956  1.00 44.27  ? 84   MET A SD  1 
ATOM   497  C CE  . MET A 1 69  ? 7.610   3.437   13.562  1.00 33.48  ? 84   MET A CE  1 
ATOM   498  N N   . ILE A 1 70  ? 6.918   0.821   10.320  1.00 35.38  ? 85   ILE A N   1 
ATOM   499  C CA  . ILE A 1 70  ? 7.673   -0.241  10.970  1.00 37.17  ? 85   ILE A CA  1 
ATOM   500  C C   . ILE A 1 70  ? 9.124   0.164   10.738  1.00 33.25  ? 85   ILE A C   1 
ATOM   501  O O   . ILE A 1 70  ? 9.485   0.583   9.642   1.00 35.62  ? 85   ILE A O   1 
ATOM   502  C CB  . ILE A 1 70  ? 7.319   -1.660  10.395  1.00 36.28  ? 85   ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 70  ? 7.892   -1.863  9.000   1.00 36.62  ? 85   ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 70  ? 5.799   -1.825  10.353  1.00 29.18  ? 85   ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 70  ? 7.615   -3.254  8.435   1.00 30.70  ? 85   ILE A CD1 1 
ATOM   506  N N   . GLN A 1 71  ? 9.940   0.081   11.780  1.00 31.71  ? 86   GLN A N   1 
ATOM   507  C CA  . GLN A 1 71  ? 11.340  0.509   11.706  1.00 37.66  ? 86   GLN A CA  1 
ATOM   508  C C   . GLN A 1 71  ? 12.336  -0.622  11.913  1.00 38.96  ? 86   GLN A C   1 
ATOM   509  O O   . GLN A 1 71  ? 12.071  -1.555  12.665  1.00 44.20  ? 86   GLN A O   1 
ATOM   510  C CB  . GLN A 1 71  ? 11.568  1.582   12.775  1.00 37.42  ? 86   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 71  ? 12.890  2.295   12.754  1.00 25.78  ? 86   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 71  ? 12.928  3.406   13.806  1.00 38.63  ? 86   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 71  ? 11.880  3.834   14.298  1.00 28.36  ? 86   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 71  ? 14.134  3.884   14.145  1.00 30.54  ? 86   GLN A NE2 1 
ATOM   515  N N   . GLY A 1 72  ? 13.489  -0.531  11.259  1.00 37.02  ? 87   GLY A N   1 
ATOM   516  C CA  . GLY A 1 72  ? 14.502  -1.563  11.421  1.00 36.78  ? 87   GLY A CA  1 
ATOM   517  C C   . GLY A 1 72  ? 15.874  -1.100  10.985  1.00 37.35  ? 87   GLY A C   1 
ATOM   518  O O   . GLY A 1 72  ? 16.081  0.088   10.755  1.00 36.98  ? 87   GLY A O   1 
ATOM   519  N N   . GLY A 1 73  ? 16.818  -2.036  10.887  1.00 44.09  ? 88   GLY A N   1 
ATOM   520  C CA  . GLY A 1 73  ? 18.159  -1.698  10.438  1.00 46.05  ? 88   GLY A CA  1 
ATOM   521  C C   . GLY A 1 73  ? 19.233  -1.477  11.489  1.00 49.03  ? 88   GLY A C   1 
ATOM   522  O O   . GLY A 1 73  ? 20.359  -1.120  11.142  1.00 44.85  ? 88   GLY A O   1 
ATOM   523  N N   . ASP A 1 74  ? 18.900  -1.651  12.767  1.00 55.33  ? 89   ASP A N   1 
ATOM   524  C CA  . ASP A 1 74  ? 19.900  -1.494  13.828  1.00 54.92  ? 89   ASP A CA  1 
ATOM   525  C C   . ASP A 1 74  ? 20.505  -2.892  13.994  1.00 54.08  ? 89   ASP A C   1 
ATOM   526  O O   . ASP A 1 74  ? 20.069  -3.678  14.835  1.00 53.52  ? 89   ASP A O   1 
ATOM   527  C CB  . ASP A 1 74  ? 19.251  -1.041  15.148  1.00 53.43  ? 89   ASP A CB  1 
ATOM   528  C CG  . ASP A 1 74  ? 20.261  -0.406  16.107  1.00 55.96  ? 89   ASP A CG  1 
ATOM   529  O OD1 . ASP A 1 74  ? 21.400  -0.902  16.193  1.00 53.91  ? 89   ASP A OD1 1 
ATOM   530  O OD2 . ASP A 1 74  ? 19.923  0.584   16.785  1.00 52.52  ? 89   ASP A OD2 1 
ATOM   531  N N   . PHE A 1 75  ? 21.490  -3.210  13.161  1.00 54.56  ? 90   PHE A N   1 
ATOM   532  C CA  . PHE A 1 75  ? 22.125  -4.516  13.207  1.00 53.88  ? 90   PHE A CA  1 
ATOM   533  C C   . PHE A 1 75  ? 23.385  -4.509  14.058  1.00 55.57  ? 90   PHE A C   1 
ATOM   534  O O   . PHE A 1 75  ? 24.168  -5.452  14.008  1.00 59.70  ? 90   PHE A O   1 
ATOM   535  C CB  . PHE A 1 75  ? 22.441  -5.009  11.782  1.00 54.76  ? 90   PHE A CB  1 
ATOM   536  C CG  . PHE A 1 75  ? 23.345  -4.091  11.000  1.00 55.05  ? 90   PHE A CG  1 
ATOM   537  C CD1 . PHE A 1 75  ? 24.706  -4.014  11.285  1.00 53.47  ? 90   PHE A CD1 1 
ATOM   538  C CD2 . PHE A 1 75  ? 22.828  -3.280  9.997   1.00 52.80  ? 90   PHE A CD2 1 
ATOM   539  C CE1 . PHE A 1 75  ? 25.536  -3.141  10.585  1.00 53.96  ? 90   PHE A CE1 1 
ATOM   540  C CE2 . PHE A 1 75  ? 23.648  -2.406  9.293   1.00 53.76  ? 90   PHE A CE2 1 
ATOM   541  C CZ  . PHE A 1 75  ? 25.005  -2.336  9.589   1.00 51.07  ? 90   PHE A CZ  1 
ATOM   542  N N   . THR A 1 76  ? 23.580  -3.443  14.835  1.00 55.03  ? 91   THR A N   1 
ATOM   543  C CA  . THR A 1 76  ? 24.745  -3.350  15.717  1.00 55.19  ? 91   THR A CA  1 
ATOM   544  C C   . THR A 1 76  ? 24.383  -3.096  17.182  1.00 56.20  ? 91   THR A C   1 
ATOM   545  O O   . THR A 1 76  ? 25.267  -3.094  18.040  1.00 60.10  ? 91   THR A O   1 
ATOM   546  C CB  . THR A 1 76  ? 25.746  -2.253  15.262  1.00 52.71  ? 91   THR A CB  1 
ATOM   547  O OG1 . THR A 1 76  ? 25.039  -1.049  14.961  1.00 55.51  ? 91   THR A OG1 1 
ATOM   548  C CG2 . THR A 1 76  ? 26.521  -2.705  14.035  1.00 55.33  ? 91   THR A CG2 1 
ATOM   549  N N   . ASN A 1 77  ? 23.097  -2.886  17.471  1.00 54.17  ? 92   ASN A N   1 
ATOM   550  C CA  . ASN A 1 77  ? 22.634  -2.648  18.848  1.00 52.73  ? 92   ASN A CA  1 
ATOM   551  C C   . ASN A 1 77  ? 21.213  -3.177  19.071  1.00 52.27  ? 92   ASN A C   1 
ATOM   552  O O   . ASN A 1 77  ? 20.806  -3.408  20.206  1.00 54.62  ? 92   ASN A O   1 
ATOM   553  C CB  . ASN A 1 77  ? 22.662  -1.156  19.191  1.00 51.61  ? 92   ASN A CB  1 
ATOM   554  C CG  . ASN A 1 77  ? 24.028  -0.529  18.988  1.00 54.59  ? 92   ASN A CG  1 
ATOM   555  O OD1 . ASN A 1 77  ? 24.705  -0.173  19.947  1.00 52.02  ? 92   ASN A OD1 1 
ATOM   556  N ND2 . ASN A 1 77  ? 24.438  -0.389  17.728  1.00 51.34  ? 92   ASN A ND2 1 
ATOM   557  N N   . PHE A 1 78  ? 20.456  -3.341  17.991  1.00 49.86  ? 93   PHE A N   1 
ATOM   558  C CA  . PHE A 1 78  ? 19.096  -3.872  18.062  1.00 53.12  ? 93   PHE A CA  1 
ATOM   559  C C   . PHE A 1 78  ? 18.102  -3.107  18.942  1.00 54.70  ? 93   PHE A C   1 
ATOM   560  O O   . PHE A 1 78  ? 17.080  -3.659  19.365  1.00 56.50  ? 93   PHE A O   1 
ATOM   561  C CB  . PHE A 1 78  ? 19.136  -5.337  18.517  1.00 52.27  ? 93   PHE A CB  1 
ATOM   562  C CG  . PHE A 1 78  ? 19.832  -6.256  17.551  1.00 57.09  ? 93   PHE A CG  1 
ATOM   563  C CD1 . PHE A 1 78  ? 21.191  -6.093  17.263  1.00 57.68  ? 93   PHE A CD1 1 
ATOM   564  C CD2 . PHE A 1 78  ? 19.131  -7.289  16.928  1.00 56.77  ? 93   PHE A CD2 1 
ATOM   565  C CE1 . PHE A 1 78  ? 21.842  -6.940  16.371  1.00 51.63  ? 93   PHE A CE1 1 
ATOM   566  C CE2 . PHE A 1 78  ? 19.768  -8.143  16.036  1.00 55.72  ? 93   PHE A CE2 1 
ATOM   567  C CZ  . PHE A 1 78  ? 21.131  -7.968  15.754  1.00 56.33  ? 93   PHE A CZ  1 
ATOM   568  N N   . ASP A 1 79  ? 18.380  -1.846  19.228  1.00 54.85  ? 94   ASP A N   1 
ATOM   569  C CA  . ASP A 1 79  ? 17.451  -1.085  20.048  1.00 54.06  ? 94   ASP A CA  1 
ATOM   570  C C   . ASP A 1 79  ? 17.057  0.221   19.376  1.00 52.92  ? 94   ASP A C   1 
ATOM   571  O O   . ASP A 1 79  ? 16.107  0.869   19.795  1.00 52.98  ? 94   ASP A O   1 
ATOM   572  C CB  . ASP A 1 79  ? 18.040  -0.818  21.442  1.00 57.81  ? 94   ASP A CB  1 
ATOM   573  C CG  . ASP A 1 79  ? 19.359  -0.039  21.404  1.00 58.68  ? 94   ASP A CG  1 
ATOM   574  O OD1 . ASP A 1 79  ? 19.779  0.446   22.479  1.00 63.35  ? 94   ASP A OD1 1 
ATOM   575  O OD2 . ASP A 1 79  ? 19.979  0.083   20.327  1.00 51.75  ? 94   ASP A OD2 1 
ATOM   576  N N   . GLY A 1 80  ? 17.779  0.585   18.318  1.00 52.39  ? 95   GLY A N   1 
ATOM   577  C CA  . GLY A 1 80  ? 17.486  1.814   17.598  1.00 51.07  ? 95   GLY A CA  1 
ATOM   578  C C   . GLY A 1 80  ? 18.550  2.883   17.782  1.00 51.68  ? 95   GLY A C   1 
ATOM   579  O O   . GLY A 1 80  ? 18.458  3.975   17.223  1.00 52.69  ? 95   GLY A O   1 
ATOM   580  N N   . THR A 1 81  ? 19.580  2.562   18.553  1.00 52.16  ? 96   THR A N   1 
ATOM   581  C CA  . THR A 1 81  ? 20.650  3.509   18.813  1.00 51.82  ? 96   THR A CA  1 
ATOM   582  C C   . THR A 1 81  ? 21.861  3.273   17.917  1.00 51.65  ? 96   THR A C   1 
ATOM   583  O O   . THR A 1 81  ? 22.776  4.100   17.879  1.00 52.14  ? 96   THR A O   1 
ATOM   584  C CB  . THR A 1 81  ? 21.102  3.435   20.293  1.00 49.06  ? 96   THR A CB  1 
ATOM   585  O OG1 . THR A 1 81  ? 21.821  2.215   20.515  1.00 48.60  ? 96   THR A OG1 1 
ATOM   586  C CG2 . THR A 1 81  ? 19.885  3.465   21.225  1.00 51.00  ? 96   THR A CG2 1 
ATOM   587  N N   . GLY A 1 82  ? 21.856  2.163   17.182  1.00 53.73  ? 97   GLY A N   1 
ATOM   588  C CA  . GLY A 1 82  ? 22.990  1.847   16.327  1.00 55.03  ? 97   GLY A CA  1 
ATOM   589  C C   . GLY A 1 82  ? 22.803  1.724   14.823  1.00 55.39  ? 97   GLY A C   1 
ATOM   590  O O   . GLY A 1 82  ? 21.832  2.217   14.246  1.00 56.25  ? 97   GLY A O   1 
ATOM   591  N N   . GLY A 1 83  ? 23.768  1.055   14.196  1.00 56.99  ? 98   GLY A N   1 
ATOM   592  C CA  . GLY A 1 83  ? 23.767  0.857   12.760  1.00 56.38  ? 98   GLY A CA  1 
ATOM   593  C C   . GLY A 1 83  ? 24.852  1.725   12.152  1.00 58.28  ? 98   GLY A C   1 
ATOM   594  O O   . GLY A 1 83  ? 25.277  2.698   12.769  1.00 56.35  ? 98   GLY A O   1 
ATOM   595  N N   . LYS A 1 84  ? 25.313  1.377   10.953  1.00 59.84  ? 99   LYS A N   1 
ATOM   596  C CA  . LYS A 1 84  ? 26.348  2.161   10.274  1.00 60.23  ? 99   LYS A CA  1 
ATOM   597  C C   . LYS A 1 84  ? 26.255  1.983   8.759   1.00 58.00  ? 99   LYS A C   1 
ATOM   598  O O   . LYS A 1 84  ? 25.931  0.897   8.273   1.00 56.53  ? 99   LYS A O   1 
ATOM   599  C CB  . LYS A 1 84  ? 27.747  1.746   10.749  1.00 65.25  ? 99   LYS A CB  1 
ATOM   600  C CG  . LYS A 1 84  ? 28.137  0.315   10.397  1.00 68.01  ? 99   LYS A CG  1 
ATOM   601  C CD  . LYS A 1 84  ? 29.623  0.053   10.641  1.00 72.98  ? 99   LYS A CD  1 
ATOM   602  C CE  . LYS A 1 84  ? 29.981  -1.407  10.352  1.00 76.70  ? 99   LYS A CE  1 
ATOM   603  N NZ  . LYS A 1 84  ? 31.443  -1.702  10.454  1.00 75.47  ? 99   LYS A NZ  1 
ATOM   604  N N   . SER A 1 85  ? 26.531  3.053   8.018   1.00 57.12  ? 100  SER A N   1 
ATOM   605  C CA  . SER A 1 85  ? 26.483  3.000   6.560   1.00 57.90  ? 100  SER A CA  1 
ATOM   606  C C   . SER A 1 85  ? 27.756  2.338   6.044   1.00 59.42  ? 100  SER A C   1 
ATOM   607  O O   . SER A 1 85  ? 28.625  1.948   6.826   1.00 59.50  ? 100  SER A O   1 
ATOM   608  C CB  . SER A 1 85  ? 26.374  4.404   5.967   1.00 53.67  ? 100  SER A CB  1 
ATOM   609  O OG  . SER A 1 85  ? 27.606  5.098   6.059   1.00 54.85  ? 100  SER A OG  1 
ATOM   610  N N   . ILE A 1 86  ? 27.858  2.203   4.727   1.00 59.96  ? 101  ILE A N   1 
ATOM   611  C CA  . ILE A 1 86  ? 29.037  1.599   4.121   1.00 57.29  ? 101  ILE A CA  1 
ATOM   612  C C   . ILE A 1 86  ? 30.053  2.700   3.813   1.00 56.61  ? 101  ILE A C   1 
ATOM   613  O O   . ILE A 1 86  ? 31.086  2.445   3.212   1.00 58.40  ? 101  ILE A O   1 
ATOM   614  C CB  . ILE A 1 86  ? 28.680  0.846   2.814   1.00 53.23  ? 101  ILE A CB  1 
ATOM   615  C CG1 . ILE A 1 86  ? 28.049  1.824   1.814   1.00 50.40  ? 101  ILE A CG1 1 
ATOM   616  C CG2 . ILE A 1 86  ? 27.752  -0.334  3.123   1.00 36.29  ? 101  ILE A CG2 1 
ATOM   617  C CD1 . ILE A 1 86  ? 27.673  1.208   0.496   1.00 56.40  ? 101  ILE A CD1 1 
ATOM   618  N N   . TYR A 1 87  ? 29.747  3.920   4.243   1.00 57.26  ? 102  TYR A N   1 
ATOM   619  C CA  . TYR A 1 87  ? 30.618  5.075   4.025   1.00 61.13  ? 102  TYR A CA  1 
ATOM   620  C C   . TYR A 1 87  ? 31.132  5.583   5.373   1.00 66.06  ? 102  TYR A C   1 
ATOM   621  O O   . TYR A 1 87  ? 31.394  6.780   5.547   1.00 69.29  ? 102  TYR A O   1 
ATOM   622  C CB  . TYR A 1 87  ? 29.844  6.208   3.344   1.00 58.33  ? 102  TYR A CB  1 
ATOM   623  C CG  . TYR A 1 87  ? 28.955  5.782   2.195   1.00 61.42  ? 102  TYR A CG  1 
ATOM   624  C CD1 . TYR A 1 87  ? 29.449  4.987   1.165   1.00 58.17  ? 102  TYR A CD1 1 
ATOM   625  C CD2 . TYR A 1 87  ? 27.631  6.233   2.105   1.00 60.30  ? 102  TYR A CD2 1 
ATOM   626  C CE1 . TYR A 1 87  ? 28.652  4.651   0.066   1.00 61.35  ? 102  TYR A CE1 1 
ATOM   627  C CE2 . TYR A 1 87  ? 26.826  5.906   1.008   1.00 60.85  ? 102  TYR A CE2 1 
ATOM   628  C CZ  . TYR A 1 87  ? 27.345  5.116   -0.011  1.00 61.59  ? 102  TYR A CZ  1 
ATOM   629  O OH  . TYR A 1 87  ? 26.585  4.812   -1.119  1.00 56.91  ? 102  TYR A OH  1 
ATOM   630  N N   . GLY A 1 88  ? 31.263  4.673   6.331   1.00 68.30  ? 103  GLY A N   1 
ATOM   631  C CA  . GLY A 1 88  ? 31.722  5.068   7.643   1.00 72.81  ? 103  GLY A CA  1 
ATOM   632  C C   . GLY A 1 88  ? 30.533  5.186   8.569   1.00 80.98  ? 103  GLY A C   1 
ATOM   633  O O   . GLY A 1 88  ? 29.570  4.429   8.445   1.00 84.40  ? 103  GLY A O   1 
ATOM   634  N N   . GLU A 1 89  ? 30.582  6.151   9.482   1.00 84.21  ? 104  GLU A N   1 
ATOM   635  C CA  . GLU A 1 89  ? 29.511  6.348   10.453  1.00 86.63  ? 104  GLU A CA  1 
ATOM   636  C C   . GLU A 1 89  ? 28.181  6.857   9.904   1.00 83.72  ? 104  GLU A C   1 
ATOM   637  O O   . GLU A 1 89  ? 27.158  6.177   10.011  1.00 82.64  ? 104  GLU A O   1 
ATOM   638  C CB  . GLU A 1 89  ? 29.986  7.291   11.561  1.00 94.86  ? 104  GLU A CB  1 
ATOM   639  C CG  . GLU A 1 89  ? 31.037  6.693   12.482  1.00 101.98 ? 104  GLU A CG  1 
ATOM   640  C CD  . GLU A 1 89  ? 30.538  5.455   13.209  1.00 107.53 ? 104  GLU A CD  1 
ATOM   641  O OE1 . GLU A 1 89  ? 29.333  5.137   13.093  1.00 107.22 ? 104  GLU A OE1 1 
ATOM   642  O OE2 . GLU A 1 89  ? 31.352  4.804   13.901  1.00 111.56 ? 104  GLU A OE2 1 
ATOM   643  N N   . LYS A 1 90  ? 28.192  8.058   9.336   1.00 78.62  ? 105  LYS A N   1 
ATOM   644  C CA  . LYS A 1 90  ? 26.975  8.654   8.799   1.00 72.89  ? 105  LYS A CA  1 
ATOM   645  C C   . LYS A 1 90  ? 27.238  9.314   7.452   1.00 67.17  ? 105  LYS A C   1 
ATOM   646  O O   . LYS A 1 90  ? 28.389  9.468   7.044   1.00 67.71  ? 105  LYS A O   1 
ATOM   647  C CB  . LYS A 1 90  ? 26.444  9.708   9.771   1.00 76.83  ? 105  LYS A CB  1 
ATOM   648  C CG  . LYS A 1 90  ? 26.220  9.207   11.184  1.00 83.41  ? 105  LYS A CG  1 
ATOM   649  C CD  . LYS A 1 90  ? 25.832  10.355  12.097  1.00 91.80  ? 105  LYS A CD  1 
ATOM   650  C CE  . LYS A 1 90  ? 25.464  9.860   13.484  1.00 95.64  ? 105  LYS A CE  1 
ATOM   651  N NZ  . LYS A 1 90  ? 24.995  10.977  14.352  1.00 102.87 ? 105  LYS A NZ  1 
ATOM   652  N N   . PHE A 1 91  ? 26.168  9.685   6.753   1.00 56.98  ? 106  PHE A N   1 
ATOM   653  C CA  . PHE A 1 91  ? 26.322  10.369  5.480   1.00 52.66  ? 106  PHE A CA  1 
ATOM   654  C C   . PHE A 1 91  ? 25.210  11.377  5.233   1.00 50.07  ? 106  PHE A C   1 
ATOM   655  O O   . PHE A 1 91  ? 24.077  11.188  5.656   1.00 53.49  ? 106  PHE A O   1 
ATOM   656  C CB  . PHE A 1 91  ? 26.449  9.381   4.300   1.00 45.17  ? 106  PHE A CB  1 
ATOM   657  C CG  . PHE A 1 91  ? 25.264  8.470   4.095   1.00 42.19  ? 106  PHE A CG  1 
ATOM   658  C CD1 . PHE A 1 91  ? 25.093  7.332   4.877   1.00 43.54  ? 106  PHE A CD1 1 
ATOM   659  C CD2 . PHE A 1 91  ? 24.355  8.714   3.068   1.00 42.74  ? 106  PHE A CD2 1 
ATOM   660  C CE1 . PHE A 1 91  ? 24.040  6.444   4.630   1.00 41.67  ? 106  PHE A CE1 1 
ATOM   661  C CE2 . PHE A 1 91  ? 23.301  7.836   2.813   1.00 41.80  ? 106  PHE A CE2 1 
ATOM   662  C CZ  . PHE A 1 91  ? 23.143  6.698   3.596   1.00 40.17  ? 106  PHE A CZ  1 
ATOM   663  N N   . ALA A 1 92  ? 25.561  12.466  4.565   1.00 47.66  ? 107  ALA A N   1 
ATOM   664  C CA  . ALA A 1 92  ? 24.616  13.526  4.257   1.00 47.24  ? 107  ALA A CA  1 
ATOM   665  C C   . ALA A 1 92  ? 23.360  13.002  3.578   1.00 46.98  ? 107  ALA A C   1 
ATOM   666  O O   . ALA A 1 92  ? 23.345  11.890  3.062   1.00 49.42  ? 107  ALA A O   1 
ATOM   667  C CB  . ALA A 1 92  ? 25.285  14.555  3.360   1.00 50.52  ? 107  ALA A CB  1 
ATOM   668  N N   . ASP A 1 93  ? 22.306  13.811  3.586   1.00 44.78  ? 108  ASP A N   1 
ATOM   669  C CA  . ASP A 1 93  ? 21.055  13.446  2.931   1.00 46.04  ? 108  ASP A CA  1 
ATOM   670  C C   . ASP A 1 93  ? 21.194  13.857  1.457   1.00 46.79  ? 108  ASP A C   1 
ATOM   671  O O   . ASP A 1 93  ? 21.328  15.043  1.160   1.00 49.49  ? 108  ASP A O   1 
ATOM   672  C CB  . ASP A 1 93  ? 19.869  14.204  3.558   1.00 47.52  ? 108  ASP A CB  1 
ATOM   673  C CG  . ASP A 1 93  ? 19.713  13.948  5.061   1.00 48.63  ? 108  ASP A CG  1 
ATOM   674  O OD1 . ASP A 1 93  ? 19.819  12.782  5.511   1.00 47.39  ? 108  ASP A OD1 1 
ATOM   675  O OD2 . ASP A 1 93  ? 19.458  14.924  5.797   1.00 43.71  ? 108  ASP A OD2 1 
ATOM   676  N N   . GLU A 1 94  ? 21.162  12.891  0.539   1.00 47.08  ? 109  GLU A N   1 
ATOM   677  C CA  . GLU A 1 94  ? 21.300  13.179  -0.896  1.00 46.72  ? 109  GLU A CA  1 
ATOM   678  C C   . GLU A 1 94  ? 20.167  13.987  -1.490  1.00 51.46  ? 109  GLU A C   1 
ATOM   679  O O   . GLU A 1 94  ? 20.379  15.048  -2.079  1.00 55.99  ? 109  GLU A O   1 
ATOM   680  C CB  . GLU A 1 94  ? 21.322  11.911  -1.723  1.00 46.11  ? 109  GLU A CB  1 
ATOM   681  C CG  . GLU A 1 94  ? 22.479  11.012  -1.585  1.00 47.50  ? 109  GLU A CG  1 
ATOM   682  C CD  . GLU A 1 94  ? 22.294  9.839   -2.497  1.00 49.54  ? 109  GLU A CD  1 
ATOM   683  O OE1 . GLU A 1 94  ? 21.259  9.162   -2.367  1.00 51.14  ? 109  GLU A OE1 1 
ATOM   684  O OE2 . GLU A 1 94  ? 23.160  9.601   -3.355  1.00 54.36  ? 109  GLU A OE2 1 
ATOM   685  N N   . ASN A 1 95  ? 18.964  13.434  -1.366  1.00 51.50  ? 110  ASN A N   1 
ATOM   686  C CA  . ASN A 1 95  ? 17.762  14.029  -1.932  1.00 51.17  ? 110  ASN A CA  1 
ATOM   687  C C   . ASN A 1 95  ? 16.600  14.070  -0.920  1.00 51.18  ? 110  ASN A C   1 
ATOM   688  O O   . ASN A 1 95  ? 16.243  13.054  -0.324  1.00 55.32  ? 110  ASN A O   1 
ATOM   689  C CB  . ASN A 1 95  ? 17.380  13.206  -3.170  1.00 47.92  ? 110  ASN A CB  1 
ATOM   690  C CG  . ASN A 1 95  ? 16.280  13.837  -3.982  1.00 53.58  ? 110  ASN A CG  1 
ATOM   691  O OD1 . ASN A 1 95  ? 15.622  14.769  -3.534  1.00 56.39  ? 110  ASN A OD1 1 
ATOM   692  N ND2 . ASN A 1 95  ? 16.058  13.315  -5.186  1.00 54.89  ? 110  ASN A ND2 1 
ATOM   693  N N   . LEU A 1 96  ? 16.019  15.253  -0.735  1.00 49.69  ? 111  LEU A N   1 
ATOM   694  C CA  . LEU A 1 96  ? 14.904  15.453  0.194   1.00 45.41  ? 111  LEU A CA  1 
ATOM   695  C C   . LEU A 1 96  ? 13.732  16.077  -0.563  1.00 45.57  ? 111  LEU A C   1 
ATOM   696  O O   . LEU A 1 96  ? 12.908  16.794  0.003   1.00 48.52  ? 111  LEU A O   1 
ATOM   697  C CB  . LEU A 1 96  ? 15.335  16.378  1.346   1.00 41.87  ? 111  LEU A CB  1 
ATOM   698  C CG  . LEU A 1 96  ? 16.469  15.929  2.286   1.00 43.10  ? 111  LEU A CG  1 
ATOM   699  C CD1 . LEU A 1 96  ? 16.939  17.106  3.114   1.00 33.22  ? 111  LEU A CD1 1 
ATOM   700  C CD2 . LEU A 1 96  ? 16.003  14.804  3.201   1.00 38.47  ? 111  LEU A CD2 1 
ATOM   701  N N   . ASN A 1 97  ? 13.668  15.800  -1.857  1.00 46.47  ? 112  ASN A N   1 
ATOM   702  C CA  . ASN A 1 97  ? 12.606  16.330  -2.706  1.00 49.56  ? 112  ASN A CA  1 
ATOM   703  C C   . ASN A 1 97  ? 11.508  15.292  -2.866  1.00 50.49  ? 112  ASN A C   1 
ATOM   704  O O   . ASN A 1 97  ? 10.337  15.634  -3.007  1.00 56.33  ? 112  ASN A O   1 
ATOM   705  C CB  . ASN A 1 97  ? 13.167  16.702  -4.084  1.00 52.79  ? 112  ASN A CB  1 
ATOM   706  C CG  . ASN A 1 97  ? 14.134  17.883  -4.026  1.00 67.29  ? 112  ASN A CG  1 
ATOM   707  O OD1 . ASN A 1 97  ? 14.957  18.081  -4.933  1.00 72.74  ? 112  ASN A OD1 1 
ATOM   708  N ND2 . ASN A 1 97  ? 14.028  18.684  -2.966  1.00 69.79  ? 112  ASN A ND2 1 
ATOM   709  N N   . VAL A 1 98  ? 11.892  14.021  -2.848  1.00 48.83  ? 113  VAL A N   1 
ATOM   710  C CA  . VAL A 1 98  ? 10.933  12.935  -2.994  1.00 45.83  ? 113  VAL A CA  1 
ATOM   711  C C   . VAL A 1 98  ? 10.057  12.871  -1.756  1.00 44.40  ? 113  VAL A C   1 
ATOM   712  O O   . VAL A 1 98  ? 10.555  12.909  -0.633  1.00 46.27  ? 113  VAL A O   1 
ATOM   713  C CB  . VAL A 1 98  ? 11.655  11.580  -3.185  1.00 48.99  ? 113  VAL A CB  1 
ATOM   714  C CG1 . VAL A 1 98  ? 10.648  10.442  -3.210  1.00 45.26  ? 113  VAL A CG1 1 
ATOM   715  C CG2 . VAL A 1 98  ? 12.469  11.608  -4.471  1.00 35.52  ? 113  VAL A CG2 1 
ATOM   716  N N   . LYS A 1 99  ? 8.750   12.775  -1.962  1.00 40.78  ? 114  LYS A N   1 
ATOM   717  C CA  . LYS A 1 99  ? 7.820   12.717  -0.848  1.00 39.52  ? 114  LYS A CA  1 
ATOM   718  C C   . LYS A 1 99  ? 7.404   11.309  -0.430  1.00 43.49  ? 114  LYS A C   1 
ATOM   719  O O   . LYS A 1 99  ? 7.449   10.356  -1.215  1.00 40.98  ? 114  LYS A O   1 
ATOM   720  C CB  . LYS A 1 99  ? 6.570   13.515  -1.179  1.00 40.35  ? 114  LYS A CB  1 
ATOM   721  C CG  . LYS A 1 99  ? 6.827   14.956  -1.510  1.00 41.98  ? 114  LYS A CG  1 
ATOM   722  C CD  . LYS A 1 99  ? 5.525   15.684  -1.673  1.00 44.96  ? 114  LYS A CD  1 
ATOM   723  C CE  . LYS A 1 99  ? 5.570   16.566  -2.903  1.00 60.88  ? 114  LYS A CE  1 
ATOM   724  N NZ  . LYS A 1 99  ? 4.320   17.369  -3.052  1.00 68.29  ? 114  LYS A NZ  1 
ATOM   725  N N   . HIS A 1 100 ? 6.986   11.201  0.825   1.00 45.00  ? 115  HIS A N   1 
ATOM   726  C CA  . HIS A 1 100 ? 6.532   9.943   1.400   1.00 42.57  ? 115  HIS A CA  1 
ATOM   727  C C   . HIS A 1 100 ? 5.157   9.577   0.893   1.00 42.64  ? 115  HIS A C   1 
ATOM   728  O O   . HIS A 1 100 ? 4.365   10.448  0.560   1.00 41.33  ? 115  HIS A O   1 
ATOM   729  C CB  . HIS A 1 100 ? 6.448   10.043  2.921   1.00 47.37  ? 115  HIS A CB  1 
ATOM   730  C CG  . HIS A 1 100 ? 7.773   10.208  3.586   1.00 41.76  ? 115  HIS A CG  1 
ATOM   731  N ND1 . HIS A 1 100 ? 8.468   11.395  3.570   1.00 39.59  ? 115  HIS A ND1 1 
ATOM   732  C CD2 . HIS A 1 100 ? 8.558   9.316   4.231   1.00 37.16  ? 115  HIS A CD2 1 
ATOM   733  C CE1 . HIS A 1 100 ? 9.629   11.224  4.173   1.00 41.32  ? 115  HIS A CE1 1 
ATOM   734  N NE2 . HIS A 1 100 ? 9.708   9.971   4.583   1.00 35.33  ? 115  HIS A NE2 1 
ATOM   735  N N   . PHE A 1 101 ? 4.891   8.276   0.865   1.00 42.51  ? 116  PHE A N   1 
ATOM   736  C CA  . PHE A 1 101 ? 3.618   7.707   0.442   1.00 38.08  ? 116  PHE A CA  1 
ATOM   737  C C   . PHE A 1 101 ? 3.576   6.325   1.090   1.00 39.68  ? 116  PHE A C   1 
ATOM   738  O O   . PHE A 1 101 ? 4.607   5.825   1.535   1.00 39.02  ? 116  PHE A O   1 
ATOM   739  C CB  . PHE A 1 101 ? 3.540   7.609   -1.102  1.00 37.61  ? 116  PHE A CB  1 
ATOM   740  C CG  . PHE A 1 101 ? 4.734   6.961   -1.740  1.00 36.24  ? 116  PHE A CG  1 
ATOM   741  C CD1 . PHE A 1 101 ? 4.756   5.587   -1.975  1.00 36.57  ? 116  PHE A CD1 1 
ATOM   742  C CD2 . PHE A 1 101 ? 5.858   7.722   -2.078  1.00 37.08  ? 116  PHE A CD2 1 
ATOM   743  C CE1 . PHE A 1 101 ? 5.874   4.972   -2.534  1.00 31.52  ? 116  PHE A CE1 1 
ATOM   744  C CE2 . PHE A 1 101 ? 6.993   7.118   -2.641  1.00 35.26  ? 116  PHE A CE2 1 
ATOM   745  C CZ  . PHE A 1 101 ? 6.999   5.738   -2.868  1.00 41.07  ? 116  PHE A CZ  1 
ATOM   746  N N   . VAL A 1 102 ? 2.392   5.722   1.171   1.00 37.56  ? 117  VAL A N   1 
ATOM   747  C CA  . VAL A 1 102 ? 2.261   4.402   1.770   1.00 34.70  ? 117  VAL A CA  1 
ATOM   748  C C   . VAL A 1 102 ? 3.070   3.392   0.943   1.00 39.27  ? 117  VAL A C   1 
ATOM   749  O O   . VAL A 1 102 ? 2.932   3.322   -0.293  1.00 36.18  ? 117  VAL A O   1 
ATOM   750  C CB  . VAL A 1 102 ? 0.776   3.964   1.832   1.00 34.24  ? 117  VAL A CB  1 
ATOM   751  C CG1 . VAL A 1 102 ? 0.636   2.676   2.634   1.00 33.06  ? 117  VAL A CG1 1 
ATOM   752  C CG2 . VAL A 1 102 ? -0.058  5.051   2.460   1.00 30.07  ? 117  VAL A CG2 1 
ATOM   753  N N   . GLY A 1 103 ? 3.925   2.628   1.620   1.00 33.85  ? 118  GLY A N   1 
ATOM   754  C CA  . GLY A 1 103 ? 4.742   1.650   0.921   1.00 33.11  ? 118  GLY A CA  1 
ATOM   755  C C   . GLY A 1 103 ? 6.127   2.160   0.553   1.00 33.79  ? 118  GLY A C   1 
ATOM   756  O O   . GLY A 1 103 ? 6.872   1.496   -0.168  1.00 34.55  ? 118  GLY A O   1 
ATOM   757  N N   . ALA A 1 104 ? 6.470   3.340   1.058   1.00 31.57  ? 119  ALA A N   1 
ATOM   758  C CA  . ALA A 1 104 ? 7.763   3.963   0.807   1.00 34.21  ? 119  ALA A CA  1 
ATOM   759  C C   . ALA A 1 104 ? 8.865   3.502   1.765   1.00 34.37  ? 119  ALA A C   1 
ATOM   760  O O   . ALA A 1 104 ? 8.597   3.128   2.904   1.00 41.83  ? 119  ALA A O   1 
ATOM   761  C CB  . ALA A 1 104 ? 7.626   5.474   0.906   1.00 29.50  ? 119  ALA A CB  1 
ATOM   762  N N   . LEU A 1 105 ? 10.103  3.533   1.279   1.00 36.77  ? 120  LEU A N   1 
ATOM   763  C CA  . LEU A 1 105 ? 11.289  3.188   2.058   1.00 35.14  ? 120  LEU A CA  1 
ATOM   764  C C   . LEU A 1 105 ? 11.935  4.536   2.345   1.00 33.75  ? 120  LEU A C   1 
ATOM   765  O O   . LEU A 1 105 ? 12.219  5.309   1.430   1.00 33.23  ? 120  LEU A O   1 
ATOM   766  C CB  . LEU A 1 105 ? 12.246  2.309   1.243   1.00 41.59  ? 120  LEU A CB  1 
ATOM   767  C CG  . LEU A 1 105 ? 12.340  0.819   1.594   1.00 45.74  ? 120  LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 105 ? 13.145  0.649   2.870   1.00 48.26  ? 120  LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 105 ? 10.939  0.225   1.753   1.00 46.45  ? 120  LEU A CD2 1 
ATOM   770  N N   . SER A 1 106 ? 12.153  4.836   3.616   1.00 33.45  ? 121  SER A N   1 
ATOM   771  C CA  . SER A 1 106 ? 12.726  6.122   3.963   1.00 36.54  ? 121  SER A CA  1 
ATOM   772  C C   . SER A 1 106 ? 13.836  5.969   4.996   1.00 39.83  ? 121  SER A C   1 
ATOM   773  O O   . SER A 1 106 ? 13.853  4.993   5.747   1.00 37.99  ? 121  SER A O   1 
ATOM   774  C CB  . SER A 1 106 ? 11.613  7.025   4.488   1.00 31.15  ? 121  SER A CB  1 
ATOM   775  O OG  . SER A 1 106 ? 12.028  8.361   4.568   1.00 37.13  ? 121  SER A OG  1 
ATOM   776  N N   . MET A 1 107 ? 14.766  6.924   5.033   1.00 36.58  ? 122  MET A N   1 
ATOM   777  C CA  . MET A 1 107 ? 15.842  6.839   5.994   1.00 34.24  ? 122  MET A CA  1 
ATOM   778  C C   . MET A 1 107 ? 15.456  7.472   7.305   1.00 38.94  ? 122  MET A C   1 
ATOM   779  O O   . MET A 1 107 ? 14.897  8.570   7.342   1.00 35.43  ? 122  MET A O   1 
ATOM   780  C CB  . MET A 1 107 ? 17.124  7.503   5.472   1.00 42.26  ? 122  MET A CB  1 
ATOM   781  C CG  . MET A 1 107 ? 17.864  6.742   4.358   1.00 37.64  ? 122  MET A CG  1 
ATOM   782  S SD  . MET A 1 107 ? 18.260  5.003   4.722   1.00 42.80  ? 122  MET A SD  1 
ATOM   783  C CE  . MET A 1 107 ? 19.601  5.190   5.859   1.00 37.80  ? 122  MET A CE  1 
ATOM   784  N N   . ALA A 1 108 ? 15.741  6.734   8.376   1.00 43.42  ? 123  ALA A N   1 
ATOM   785  C CA  . ALA A 1 108 ? 15.508  7.161   9.751   1.00 45.44  ? 123  ALA A CA  1 
ATOM   786  C C   . ALA A 1 108 ? 16.808  7.881   10.120  1.00 45.20  ? 123  ALA A C   1 
ATOM   787  O O   . ALA A 1 108 ? 17.859  7.579   9.554   1.00 48.97  ? 123  ALA A O   1 
ATOM   788  C CB  . ALA A 1 108 ? 15.292  5.936   10.660  1.00 35.64  ? 123  ALA A CB  1 
ATOM   789  N N   . ASN A 1 109 ? 16.757  8.841   11.035  1.00 42.17  ? 124  ASN A N   1 
ATOM   790  C CA  . ASN A 1 109 ? 17.980  9.545   11.392  1.00 38.62  ? 124  ASN A CA  1 
ATOM   791  C C   . ASN A 1 109 ? 17.966  10.223  12.755  1.00 43.34  ? 124  ASN A C   1 
ATOM   792  O O   . ASN A 1 109 ? 17.118  9.934   13.594  1.00 49.95  ? 124  ASN A O   1 
ATOM   793  C CB  . ASN A 1 109 ? 18.346  10.568  10.303  1.00 36.33  ? 124  ASN A CB  1 
ATOM   794  C CG  . ASN A 1 109 ? 17.232  11.575  10.011  1.00 38.95  ? 124  ASN A CG  1 
ATOM   795  O OD1 . ASN A 1 109 ? 16.663  12.198  10.913  1.00 31.16  ? 124  ASN A OD1 1 
ATOM   796  N ND2 . ASN A 1 109 ? 16.935  11.750  8.726   1.00 36.92  ? 124  ASN A ND2 1 
ATOM   797  N N   . ALA A 1 110 ? 18.927  11.117  12.968  1.00 43.59  ? 125  ALA A N   1 
ATOM   798  C CA  . ALA A 1 110 ? 19.054  11.860  14.213  1.00 37.93  ? 125  ALA A CA  1 
ATOM   799  C C   . ALA A 1 110 ? 19.375  13.299  13.847  1.00 36.69  ? 125  ALA A C   1 
ATOM   800  O O   . ALA A 1 110 ? 20.384  13.844  14.270  1.00 39.72  ? 125  ALA A O   1 
ATOM   801  C CB  . ALA A 1 110 ? 20.173  11.272  15.047  1.00 32.05  ? 125  ALA A CB  1 
ATOM   802  N N   . GLY A 1 111 ? 18.515  13.915  13.050  1.00 38.30  ? 126  GLY A N   1 
ATOM   803  C CA  . GLY A 1 111 ? 18.759  15.281  12.634  1.00 38.16  ? 126  GLY A CA  1 
ATOM   804  C C   . GLY A 1 111 ? 19.325  15.247  11.237  1.00 35.90  ? 126  GLY A C   1 
ATOM   805  O O   . GLY A 1 111 ? 19.604  14.162  10.735  1.00 44.54  ? 126  GLY A O   1 
ATOM   806  N N   . PRO A 1 112 ? 19.519  16.395  10.575  1.00 40.58  ? 127  PRO A N   1 
ATOM   807  C CA  . PRO A 1 112 ? 20.065  16.355  9.215   1.00 41.56  ? 127  PRO A CA  1 
ATOM   808  C C   . PRO A 1 112 ? 21.454  15.728  9.094   1.00 42.56  ? 127  PRO A C   1 
ATOM   809  O O   . PRO A 1 112 ? 22.250  15.767  10.027  1.00 43.04  ? 127  PRO A O   1 
ATOM   810  C CB  . PRO A 1 112 ? 20.024  17.827  8.779   1.00 37.39  ? 127  PRO A CB  1 
ATOM   811  C CG  . PRO A 1 112 ? 20.175  18.561  10.061  1.00 42.53  ? 127  PRO A CG  1 
ATOM   812  C CD  . PRO A 1 112 ? 19.288  17.786  11.006  1.00 43.12  ? 127  PRO A CD  1 
ATOM   813  N N   . ASN A 1 113 ? 21.706  15.123  7.935   1.00 46.80  ? 128  ASN A N   1 
ATOM   814  C CA  . ASN A 1 113 ? 22.971  14.476  7.595   1.00 45.80  ? 128  ASN A CA  1 
ATOM   815  C C   . ASN A 1 113 ? 23.512  13.460  8.586   1.00 46.85  ? 128  ASN A C   1 
ATOM   816  O O   . ASN A 1 113 ? 24.710  13.449  8.878   1.00 48.34  ? 128  ASN A O   1 
ATOM   817  C CB  . ASN A 1 113 ? 24.031  15.540  7.330   1.00 49.94  ? 128  ASN A CB  1 
ATOM   818  C CG  . ASN A 1 113 ? 23.593  16.531  6.281   1.00 52.51  ? 128  ASN A CG  1 
ATOM   819  O OD1 . ASN A 1 113 ? 23.300  16.156  5.139   1.00 54.81  ? 128  ASN A OD1 1 
ATOM   820  N ND2 . ASN A 1 113 ? 23.534  17.802  6.659   1.00 45.47  ? 128  ASN A ND2 1 
ATOM   821  N N   . THR A 1 114 ? 22.637  12.589  9.077   1.00 47.94  ? 129  THR A N   1 
ATOM   822  C CA  . THR A 1 114 ? 23.032  11.563  10.035  1.00 45.57  ? 129  THR A CA  1 
ATOM   823  C C   . THR A 1 114 ? 22.499  10.180  9.653   1.00 43.88  ? 129  THR A C   1 
ATOM   824  O O   . THR A 1 114 ? 22.191  9.347   10.512  1.00 43.94  ? 129  THR A O   1 
ATOM   825  C CB  . THR A 1 114 ? 22.545  11.928  11.442  1.00 42.96  ? 129  THR A CB  1 
ATOM   826  O OG1 . THR A 1 114 ? 21.120  12.059  11.428  1.00 46.29  ? 129  THR A OG1 1 
ATOM   827  C CG2 . THR A 1 114 ? 23.163  13.252  11.885  1.00 39.86  ? 129  THR A CG2 1 
ATOM   828  N N   . ASN A 1 115 ? 22.398  9.942   8.352   1.00 41.33  ? 130  ASN A N   1 
ATOM   829  C CA  . ASN A 1 115 ? 21.925  8.665   7.846   1.00 41.01  ? 130  ASN A CA  1 
ATOM   830  C C   . ASN A 1 115 ? 22.940  7.581   8.186   1.00 40.44  ? 130  ASN A C   1 
ATOM   831  O O   . ASN A 1 115 ? 24.146  7.807   8.102   1.00 41.85  ? 130  ASN A O   1 
ATOM   832  C CB  . ASN A 1 115 ? 21.736  8.745   6.332   1.00 44.45  ? 130  ASN A CB  1 
ATOM   833  C CG  . ASN A 1 115 ? 20.581  9.646   5.930   1.00 48.63  ? 130  ASN A CG  1 
ATOM   834  O OD1 . ASN A 1 115 ? 20.608  10.261  4.870   1.00 52.05  ? 130  ASN A OD1 1 
ATOM   835  N ND2 . ASN A 1 115 ? 19.554  9.711   6.767   1.00 52.28  ? 130  ASN A ND2 1 
ATOM   836  N N   . GLY A 1 116 ? 22.444  6.408   8.572   1.00 37.96  ? 131  GLY A N   1 
ATOM   837  C CA  . GLY A 1 116 ? 23.310  5.296   8.919   1.00 33.87  ? 131  GLY A CA  1 
ATOM   838  C C   . GLY A 1 116 ? 22.839  4.032   8.226   1.00 38.99  ? 131  GLY A C   1 
ATOM   839  O O   . GLY A 1 116 ? 23.166  3.803   7.060   1.00 39.52  ? 131  GLY A O   1 
ATOM   840  N N   . SER A 1 117 ? 22.071  3.204   8.932   1.00 42.12  ? 132  SER A N   1 
ATOM   841  C CA  . SER A 1 117 ? 21.549  1.975   8.335   1.00 45.64  ? 132  SER A CA  1 
ATOM   842  C C   . SER A 1 117 ? 20.066  1.735   8.642   1.00 43.10  ? 132  SER A C   1 
ATOM   843  O O   . SER A 1 117 ? 19.437  0.867   8.035   1.00 41.19  ? 132  SER A O   1 
ATOM   844  C CB  . SER A 1 117 ? 22.376  0.754   8.782   1.00 42.87  ? 132  SER A CB  1 
ATOM   845  O OG  . SER A 1 117 ? 22.162  0.441   10.145  1.00 42.02  ? 132  SER A OG  1 
ATOM   846  N N   . GLN A 1 118 ? 19.518  2.506   9.579   1.00 44.63  ? 133  GLN A N   1 
ATOM   847  C CA  . GLN A 1 118 ? 18.113  2.376   9.974   1.00 42.94  ? 133  GLN A CA  1 
ATOM   848  C C   . GLN A 1 118 ? 17.178  2.995   8.941   1.00 42.05  ? 133  GLN A C   1 
ATOM   849  O O   . GLN A 1 118 ? 17.402  4.108   8.461   1.00 42.19  ? 133  GLN A O   1 
ATOM   850  C CB  . GLN A 1 118 ? 17.884  3.021   11.336  1.00 37.43  ? 133  GLN A CB  1 
ATOM   851  C CG  . GLN A 1 118 ? 18.478  2.251   12.484  1.00 31.01  ? 133  GLN A CG  1 
ATOM   852  C CD  . GLN A 1 118 ? 18.105  2.866   13.802  1.00 42.87  ? 133  GLN A CD  1 
ATOM   853  O OE1 . GLN A 1 118 ? 16.925  3.051   14.096  1.00 44.71  ? 133  GLN A OE1 1 
ATOM   854  N NE2 . GLN A 1 118 ? 19.104  3.195   14.607  1.00 45.55  ? 133  GLN A NE2 1 
ATOM   855  N N   . PHE A 1 119 ? 16.127  2.255   8.610   1.00 38.94  ? 134  PHE A N   1 
ATOM   856  C CA  . PHE A 1 119 ? 15.160  2.669   7.603   1.00 35.34  ? 134  PHE A CA  1 
ATOM   857  C C   . PHE A 1 119 ? 13.761  2.367   8.116   1.00 31.85  ? 134  PHE A C   1 
ATOM   858  O O   . PHE A 1 119 ? 13.595  1.647   9.095   1.00 38.21  ? 134  PHE A O   1 
ATOM   859  C CB  . PHE A 1 119 ? 15.382  1.853   6.313   1.00 33.39  ? 134  PHE A CB  1 
ATOM   860  C CG  . PHE A 1 119 ? 15.089  0.376   6.483   1.00 38.77  ? 134  PHE A CG  1 
ATOM   861  C CD1 . PHE A 1 119 ? 16.006  -0.463  7.122   1.00 31.89  ? 134  PHE A CD1 1 
ATOM   862  C CD2 . PHE A 1 119 ? 13.830  -0.145  6.138   1.00 37.29  ? 134  PHE A CD2 1 
ATOM   863  C CE1 . PHE A 1 119 ? 15.673  -1.798  7.426   1.00 32.21  ? 134  PHE A CE1 1 
ATOM   864  C CE2 . PHE A 1 119 ? 13.482  -1.475  6.436   1.00 27.36  ? 134  PHE A CE2 1 
ATOM   865  C CZ  . PHE A 1 119 ? 14.406  -2.304  7.086   1.00 31.98  ? 134  PHE A CZ  1 
ATOM   866  N N   . PHE A 1 120 ? 12.751  2.918   7.462   1.00 32.64  ? 135  PHE A N   1 
ATOM   867  C CA  . PHE A 1 120 ? 11.385  2.596   7.838   1.00 36.59  ? 135  PHE A CA  1 
ATOM   868  C C   . PHE A 1 120 ? 10.494  2.437   6.607   1.00 33.97  ? 135  PHE A C   1 
ATOM   869  O O   . PHE A 1 120 ? 10.783  2.960   5.534   1.00 34.53  ? 135  PHE A O   1 
ATOM   870  C CB  . PHE A 1 120 ? 10.797  3.618   8.847   1.00 34.58  ? 135  PHE A CB  1 
ATOM   871  C CG  . PHE A 1 120 ? 10.657  5.019   8.328   1.00 35.39  ? 135  PHE A CG  1 
ATOM   872  C CD1 . PHE A 1 120 ? 11.766  5.841   8.185   1.00 40.58  ? 135  PHE A CD1 1 
ATOM   873  C CD2 . PHE A 1 120 ? 9.403   5.531   8.005   1.00 42.41  ? 135  PHE A CD2 1 
ATOM   874  C CE1 . PHE A 1 120 ? 11.629  7.161   7.726   1.00 35.21  ? 135  PHE A CE1 1 
ATOM   875  C CE2 . PHE A 1 120 ? 9.257   6.844   7.546   1.00 31.28  ? 135  PHE A CE2 1 
ATOM   876  C CZ  . PHE A 1 120 ? 10.377  7.655   7.409   1.00 34.12  ? 135  PHE A CZ  1 
ATOM   877  N N   . ILE A 1 121 ? 9.438   1.651   6.757   1.00 35.67  ? 136  ILE A N   1 
ATOM   878  C CA  . ILE A 1 121 ? 8.480   1.433   5.682   1.00 34.40  ? 136  ILE A CA  1 
ATOM   879  C C   . ILE A 1 121 ? 7.166   1.996   6.199   1.00 31.66  ? 136  ILE A C   1 
ATOM   880  O O   . ILE A 1 121 ? 6.671   1.562   7.236   1.00 31.15  ? 136  ILE A O   1 
ATOM   881  C CB  . ILE A 1 121 ? 8.324   -0.062  5.387   1.00 38.45  ? 136  ILE A CB  1 
ATOM   882  C CG1 . ILE A 1 121 ? 9.661   -0.609  4.871   1.00 37.24  ? 136  ILE A CG1 1 
ATOM   883  C CG2 . ILE A 1 121 ? 7.151   -0.292  4.400   1.00 33.43  ? 136  ILE A CG2 1 
ATOM   884  C CD1 . ILE A 1 121 ? 9.718   -2.110  4.788   1.00 45.03  ? 136  ILE A CD1 1 
ATOM   885  N N   . THR A 1 122 ? 6.608   2.974   5.498   1.00 30.37  ? 137  THR A N   1 
ATOM   886  C CA  . THR A 1 122 ? 5.363   3.584   5.958   1.00 30.59  ? 137  THR A CA  1 
ATOM   887  C C   . THR A 1 122 ? 4.113   2.759   5.650   1.00 31.17  ? 137  THR A C   1 
ATOM   888  O O   . THR A 1 122 ? 3.993   2.155   4.583   1.00 36.62  ? 137  THR A O   1 
ATOM   889  C CB  . THR A 1 122 ? 5.214   5.013   5.385   1.00 28.36  ? 137  THR A CB  1 
ATOM   890  O OG1 . THR A 1 122 ? 5.200   4.966   3.953   1.00 32.77  ? 137  THR A OG1 1 
ATOM   891  C CG2 . THR A 1 122 ? 6.380   5.880   5.835   1.00 18.69  ? 137  THR A CG2 1 
ATOM   892  N N   . THR A 1 123 ? 3.188   2.725   6.603   1.00 33.17  ? 138  THR A N   1 
ATOM   893  C CA  . THR A 1 123 ? 1.946   1.973   6.439   1.00 29.89  ? 138  THR A CA  1 
ATOM   894  C C   . THR A 1 123 ? 0.744   2.912   6.482   1.00 32.63  ? 138  THR A C   1 
ATOM   895  O O   . THR A 1 123 ? -0.378  2.485   6.704   1.00 30.29  ? 138  THR A O   1 
ATOM   896  C CB  . THR A 1 123 ? 1.801   0.892   7.539   1.00 30.61  ? 138  THR A CB  1 
ATOM   897  O OG1 . THR A 1 123 ? 1.794   1.508   8.828   1.00 34.07  ? 138  THR A OG1 1 
ATOM   898  C CG2 . THR A 1 123 ? 2.968   -0.087  7.484   1.00 30.34  ? 138  THR A CG2 1 
ATOM   899  N N   . ALA A 1 124 ? 1.003   4.198   6.262   1.00 36.72  ? 139  ALA A N   1 
ATOM   900  C CA  . ALA A 1 124 ? -0.015  5.243   6.261   1.00 36.97  ? 139  ALA A CA  1 
ATOM   901  C C   . ALA A 1 124 ? 0.639   6.546   5.809   1.00 35.70  ? 139  ALA A C   1 
ATOM   902  O O   . ALA A 1 124 ? 1.861   6.652   5.777   1.00 36.29  ? 139  ALA A O   1 
ATOM   903  C CB  . ALA A 1 124 ? -0.595  5.411   7.650   1.00 28.33  ? 139  ALA A CB  1 
ATOM   904  N N   . PRO A 1 125 ? -0.168  7.557   5.453   1.00 36.25  ? 140  PRO A N   1 
ATOM   905  C CA  . PRO A 1 125 ? 0.386   8.839   5.006   1.00 37.91  ? 140  PRO A CA  1 
ATOM   906  C C   . PRO A 1 125 ? 1.175   9.547   6.112   1.00 42.18  ? 140  PRO A C   1 
ATOM   907  O O   . PRO A 1 125 ? 0.644   9.789   7.193   1.00 42.83  ? 140  PRO A O   1 
ATOM   908  C CB  . PRO A 1 125 ? -0.858  9.639   4.604   1.00 37.89  ? 140  PRO A CB  1 
ATOM   909  C CG  . PRO A 1 125 ? -1.891  8.591   4.308   1.00 39.51  ? 140  PRO A CG  1 
ATOM   910  C CD  . PRO A 1 125 ? -1.640  7.578   5.394   1.00 39.20  ? 140  PRO A CD  1 
ATOM   911  N N   . THR A 1 126 ? 2.433   9.888   5.823   1.00 46.16  ? 141  THR A N   1 
ATOM   912  C CA  . THR A 1 126 ? 3.310   10.580  6.772   1.00 39.45  ? 141  THR A CA  1 
ATOM   913  C C   . THR A 1 126 ? 3.912   11.840  6.129   1.00 39.67  ? 141  THR A C   1 
ATOM   914  O O   . THR A 1 126 ? 5.128   11.994  6.093   1.00 40.79  ? 141  THR A O   1 
ATOM   915  C CB  . THR A 1 126 ? 4.485   9.670   7.212   1.00 37.74  ? 141  THR A CB  1 
ATOM   916  O OG1 . THR A 1 126 ? 5.317   9.402   6.081   1.00 40.00  ? 141  THR A OG1 1 
ATOM   917  C CG2 . THR A 1 126 ? 3.985   8.347   7.779   1.00 33.39  ? 141  THR A CG2 1 
ATOM   918  N N   . PRO A 1 127 ? 3.068   12.765  5.632   1.00 42.95  ? 142  PRO A N   1 
ATOM   919  C CA  . PRO A 1 127 ? 3.524   14.010  4.986   1.00 38.30  ? 142  PRO A CA  1 
ATOM   920  C C   . PRO A 1 127 ? 4.355   14.950  5.867   1.00 39.40  ? 142  PRO A C   1 
ATOM   921  O O   . PRO A 1 127 ? 5.255   15.655  5.385   1.00 38.23  ? 142  PRO A O   1 
ATOM   922  C CB  . PRO A 1 127 ? 2.222   14.662  4.546   1.00 34.57  ? 142  PRO A CB  1 
ATOM   923  C CG  . PRO A 1 127 ? 1.261   14.250  5.638   1.00 36.07  ? 142  PRO A CG  1 
ATOM   924  C CD  . PRO A 1 127 ? 1.599   12.781  5.822   1.00 43.23  ? 142  PRO A CD  1 
ATOM   925  N N   . TRP A 1 128 ? 4.046   14.965  7.157   1.00 38.38  ? 143  TRP A N   1 
ATOM   926  C CA  . TRP A 1 128 ? 4.752   15.820  8.098   1.00 35.91  ? 143  TRP A CA  1 
ATOM   927  C C   . TRP A 1 128 ? 6.232   15.443  8.185   1.00 36.79  ? 143  TRP A C   1 
ATOM   928  O O   . TRP A 1 128 ? 7.005   16.087  8.888   1.00 38.58  ? 143  TRP A O   1 
ATOM   929  C CB  . TRP A 1 128 ? 4.083   15.709  9.468   1.00 32.46  ? 143  TRP A CB  1 
ATOM   930  C CG  . TRP A 1 128 ? 4.243   14.377  10.101  1.00 41.27  ? 143  TRP A CG  1 
ATOM   931  C CD1 . TRP A 1 128 ? 5.328   13.920  10.798  1.00 42.06  ? 143  TRP A CD1 1 
ATOM   932  C CD2 . TRP A 1 128 ? 3.291   13.308  10.095  1.00 43.18  ? 143  TRP A CD2 1 
ATOM   933  N NE1 . TRP A 1 128 ? 5.108   12.637  11.229  1.00 38.85  ? 143  TRP A NE1 1 
ATOM   934  C CE2 . TRP A 1 128 ? 3.867   12.233  10.812  1.00 40.25  ? 143  TRP A CE2 1 
ATOM   935  C CE3 . TRP A 1 128 ? 2.006   13.153  9.554   1.00 38.98  ? 143  TRP A CE3 1 
ATOM   936  C CZ2 . TRP A 1 128 ? 3.200   11.018  11.006  1.00 42.33  ? 143  TRP A CZ2 1 
ATOM   937  C CZ3 . TRP A 1 128 ? 1.343   11.944  9.750   1.00 37.56  ? 143  TRP A CZ3 1 
ATOM   938  C CH2 . TRP A 1 128 ? 1.942   10.892  10.471  1.00 37.70  ? 143  TRP A CH2 1 
ATOM   939  N N   . LEU A 1 129 ? 6.610   14.397  7.455   1.00 40.80  ? 144  LEU A N   1 
ATOM   940  C CA  . LEU A 1 129 ? 7.983   13.897  7.424   1.00 39.02  ? 144  LEU A CA  1 
ATOM   941  C C   . LEU A 1 129 ? 8.774   14.294  6.170   1.00 38.19  ? 144  LEU A C   1 
ATOM   942  O O   . LEU A 1 129 ? 9.991   14.103  6.114   1.00 37.32  ? 144  LEU A O   1 
ATOM   943  C CB  . LEU A 1 129 ? 7.984   12.372  7.554   1.00 36.23  ? 144  LEU A CB  1 
ATOM   944  C CG  . LEU A 1 129 ? 7.689   11.768  8.932   1.00 31.12  ? 144  LEU A CG  1 
ATOM   945  C CD1 . LEU A 1 129 ? 7.821   10.245  8.868   1.00 27.00  ? 144  LEU A CD1 1 
ATOM   946  C CD2 . LEU A 1 129 ? 8.663   12.334  9.947   1.00 36.27  ? 144  LEU A CD2 1 
ATOM   947  N N   . ASP A 1 130 ? 8.087   14.845  5.172   1.00 38.53  ? 145  ASP A N   1 
ATOM   948  C CA  . ASP A 1 130 ? 8.742   15.262  3.931   1.00 41.61  ? 145  ASP A CA  1 
ATOM   949  C C   . ASP A 1 130 ? 9.762   16.381  4.159   1.00 39.06  ? 145  ASP A C   1 
ATOM   950  O O   . ASP A 1 130 ? 9.550   17.274  4.973   1.00 40.76  ? 145  ASP A O   1 
ATOM   951  C CB  . ASP A 1 130 ? 7.705   15.730  2.904   1.00 42.42  ? 145  ASP A CB  1 
ATOM   952  C CG  . ASP A 1 130 ? 6.852   14.606  2.386   1.00 45.18  ? 145  ASP A CG  1 
ATOM   953  O OD1 . ASP A 1 130 ? 7.382   13.492  2.186   1.00 49.62  ? 145  ASP A OD1 1 
ATOM   954  O OD2 . ASP A 1 130 ? 5.654   14.837  2.161   1.00 48.91  ? 145  ASP A OD2 1 
ATOM   955  N N   . GLY A 1 131 ? 10.868  16.329  3.432   1.00 36.62  ? 146  GLY A N   1 
ATOM   956  C CA  . GLY A 1 131 ? 11.884  17.343  3.592   1.00 33.58  ? 146  GLY A CA  1 
ATOM   957  C C   . GLY A 1 131 ? 12.912  16.990  4.646   1.00 41.96  ? 146  GLY A C   1 
ATOM   958  O O   . GLY A 1 131 ? 13.970  17.611  4.711   1.00 46.86  ? 146  GLY A O   1 
ATOM   959  N N   . ARG A 1 132 ? 12.625  15.983  5.466   1.00 43.34  ? 147  ARG A N   1 
ATOM   960  C CA  . ARG A 1 132 ? 13.560  15.594  6.516   1.00 38.60  ? 147  ARG A CA  1 
ATOM   961  C C   . ARG A 1 132 ? 14.069  14.152  6.459   1.00 37.24  ? 147  ARG A C   1 
ATOM   962  O O   . ARG A 1 132 ? 15.001  13.793  7.170   1.00 37.98  ? 147  ARG A O   1 
ATOM   963  C CB  . ARG A 1 132 ? 12.935  15.863  7.878   1.00 34.80  ? 147  ARG A CB  1 
ATOM   964  C CG  . ARG A 1 132 ? 12.681  17.318  8.138   1.00 39.33  ? 147  ARG A CG  1 
ATOM   965  C CD  . ARG A 1 132 ? 12.488  17.554  9.612   1.00 48.99  ? 147  ARG A CD  1 
ATOM   966  N NE  . ARG A 1 132 ? 13.001  18.856  10.026  1.00 47.34  ? 147  ARG A NE  1 
ATOM   967  C CZ  . ARG A 1 132 ? 12.263  19.955  10.125  1.00 56.85  ? 147  ARG A CZ  1 
ATOM   968  N NH1 . ARG A 1 132 ? 10.968  19.913  9.837   1.00 54.84  ? 147  ARG A NH1 1 
ATOM   969  N NH2 . ARG A 1 132 ? 12.821  21.093  10.532  1.00 59.36  ? 147  ARG A NH2 1 
ATOM   970  N N   . HIS A 1 133 ? 13.475  13.334  5.598   1.00 38.82  ? 148  HIS A N   1 
ATOM   971  C CA  . HIS A 1 133 ? 13.885  11.940  5.476   1.00 34.42  ? 148  HIS A CA  1 
ATOM   972  C C   . HIS A 1 133 ? 13.985  11.582  4.023   1.00 30.21  ? 148  HIS A C   1 
ATOM   973  O O   . HIS A 1 133 ? 13.088  11.886  3.254   1.00 39.51  ? 148  HIS A O   1 
ATOM   974  C CB  . HIS A 1 133 ? 12.867  11.049  6.174   1.00 33.47  ? 148  HIS A CB  1 
ATOM   975  C CG  . HIS A 1 133 ? 12.842  11.238  7.654   1.00 34.35  ? 148  HIS A CG  1 
ATOM   976  N ND1 . HIS A 1 133 ? 13.688  10.555  8.500   1.00 35.46  ? 148  HIS A ND1 1 
ATOM   977  C CD2 . HIS A 1 133 ? 12.174  12.126  8.425   1.00 32.98  ? 148  HIS A CD2 1 
ATOM   978  C CE1 . HIS A 1 133 ? 13.545  11.020  9.729   1.00 31.36  ? 148  HIS A CE1 1 
ATOM   979  N NE2 . HIS A 1 133 ? 12.634  11.974  9.710   1.00 26.83  ? 148  HIS A NE2 1 
ATOM   980  N N   . VAL A 1 134 ? 15.082  10.938  3.647   1.00 37.78  ? 149  VAL A N   1 
ATOM   981  C CA  . VAL A 1 134 ? 15.314  10.550  2.252   1.00 38.21  ? 149  VAL A CA  1 
ATOM   982  C C   . VAL A 1 134 ? 14.518  9.322   1.837   1.00 42.51  ? 149  VAL A C   1 
ATOM   983  O O   . VAL A 1 134 ? 14.847  8.199   2.224   1.00 47.02  ? 149  VAL A O   1 
ATOM   984  C CB  . VAL A 1 134 ? 16.831  10.268  1.981   1.00 33.42  ? 149  VAL A CB  1 
ATOM   985  C CG1 . VAL A 1 134 ? 17.048  9.892   0.525   1.00 30.50  ? 149  VAL A CG1 1 
ATOM   986  C CG2 . VAL A 1 134 ? 17.667  11.491  2.335   1.00 28.10  ? 149  VAL A CG2 1 
ATOM   987  N N   . VAL A 1 135 ? 13.458  9.543   1.064   1.00 43.18  ? 150  VAL A N   1 
ATOM   988  C CA  . VAL A 1 135 ? 12.640  8.443   0.558   1.00 39.32  ? 150  VAL A CA  1 
ATOM   989  C C   . VAL A 1 135 ? 13.486  7.869   -0.573  1.00 36.67  ? 150  VAL A C   1 
ATOM   990  O O   . VAL A 1 135 ? 13.899  8.604   -1.467  1.00 40.20  ? 150  VAL A O   1 
ATOM   991  C CB  . VAL A 1 135 ? 11.297  8.952   -0.005  1.00 34.25  ? 150  VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 135 ? 10.397  7.773   -0.354  1.00 39.94  ? 150  VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 135 ? 10.624  9.842   1.004   1.00 24.22  ? 150  VAL A CG2 1 
ATOM   994  N N   . PHE A 1 136 ? 13.766  6.570   -0.533  1.00 36.71  ? 151  PHE A N   1 
ATOM   995  C CA  . PHE A 1 136 ? 14.602  5.968   -1.567  1.00 35.49  ? 151  PHE A CA  1 
ATOM   996  C C   . PHE A 1 136 ? 14.101  4.667   -2.175  1.00 36.24  ? 151  PHE A C   1 
ATOM   997  O O   . PHE A 1 136 ? 14.869  3.929   -2.791  1.00 38.10  ? 151  PHE A O   1 
ATOM   998  C CB  . PHE A 1 136 ? 16.017  5.741   -1.032  1.00 41.65  ? 151  PHE A CB  1 
ATOM   999  C CG  . PHE A 1 136 ? 16.088  4.763   0.100   1.00 41.47  ? 151  PHE A CG  1 
ATOM   1000 C CD1 . PHE A 1 136 ? 15.724  5.145   1.389   1.00 40.26  ? 151  PHE A CD1 1 
ATOM   1001 C CD2 . PHE A 1 136 ? 16.514  3.453   -0.123  1.00 36.69  ? 151  PHE A CD2 1 
ATOM   1002 C CE1 . PHE A 1 136 ? 15.780  4.235   2.442   1.00 44.67  ? 151  PHE A CE1 1 
ATOM   1003 C CE2 . PHE A 1 136 ? 16.573  2.536   0.923   1.00 40.13  ? 151  PHE A CE2 1 
ATOM   1004 C CZ  . PHE A 1 136 ? 16.207  2.924   2.205   1.00 40.41  ? 151  PHE A CZ  1 
ATOM   1005 N N   . GLY A 1 137 ? 12.818  4.378   -2.017  1.00 37.10  ? 152  GLY A N   1 
ATOM   1006 C CA  . GLY A 1 137 ? 12.300  3.161   -2.600  1.00 33.43  ? 152  GLY A CA  1 
ATOM   1007 C C   . GLY A 1 137 ? 10.863  2.908   -2.226  1.00 36.04  ? 152  GLY A C   1 
ATOM   1008 O O   . GLY A 1 137 ? 10.234  3.711   -1.544  1.00 35.10  ? 152  GLY A O   1 
ATOM   1009 N N   . LYS A 1 138 ? 10.342  1.781   -2.688  1.00 38.26  ? 153  LYS A N   1 
ATOM   1010 C CA  . LYS A 1 138 ? 8.979   1.394   -2.388  1.00 35.02  ? 153  LYS A CA  1 
ATOM   1011 C C   . LYS A 1 138 ? 8.850   -0.116  -2.376  1.00 34.85  ? 153  LYS A C   1 
ATOM   1012 O O   . LYS A 1 138 ? 9.662   -0.824  -2.971  1.00 37.08  ? 153  LYS A O   1 
ATOM   1013 C CB  . LYS A 1 138 ? 8.023   1.982   -3.420  1.00 42.45  ? 153  LYS A CB  1 
ATOM   1014 C CG  . LYS A 1 138 ? 8.449   1.763   -4.847  1.00 36.27  ? 153  LYS A CG  1 
ATOM   1015 C CD  . LYS A 1 138 ? 7.381   2.254   -5.797  1.00 44.72  ? 153  LYS A CD  1 
ATOM   1016 C CE  . LYS A 1 138 ? 6.136   1.386   -5.753  1.00 50.49  ? 153  LYS A CE  1 
ATOM   1017 N NZ  . LYS A 1 138 ? 5.152   1.826   -6.784  1.00 54.67  ? 153  LYS A NZ  1 
ATOM   1018 N N   . VAL A 1 139 ? 7.839   -0.599  -1.664  1.00 37.25  ? 154  VAL A N   1 
ATOM   1019 C CA  . VAL A 1 139 ? 7.553   -2.020  -1.593  1.00 37.18  ? 154  VAL A CA  1 
ATOM   1020 C C   . VAL A 1 139 ? 6.815   -2.371  -2.882  1.00 40.25  ? 154  VAL A C   1 
ATOM   1021 O O   . VAL A 1 139 ? 5.713   -1.875  -3.136  1.00 39.20  ? 154  VAL A O   1 
ATOM   1022 C CB  . VAL A 1 139 ? 6.647   -2.348  -0.388  1.00 38.05  ? 154  VAL A CB  1 
ATOM   1023 C CG1 . VAL A 1 139 ? 6.187   -3.785  -0.458  1.00 37.93  ? 154  VAL A CG1 1 
ATOM   1024 C CG2 . VAL A 1 139 ? 7.397   -2.094  0.908   1.00 37.48  ? 154  VAL A CG2 1 
ATOM   1025 N N   . LEU A 1 140 ? 7.440   -3.206  -3.705  1.00 44.69  ? 155  LEU A N   1 
ATOM   1026 C CA  . LEU A 1 140 ? 6.849   -3.627  -4.969  1.00 46.77  ? 155  LEU A CA  1 
ATOM   1027 C C   . LEU A 1 140 ? 5.889   -4.793  -4.778  1.00 45.30  ? 155  LEU A C   1 
ATOM   1028 O O   . LEU A 1 140 ? 4.982   -4.993  -5.578  1.00 50.83  ? 155  LEU A O   1 
ATOM   1029 C CB  . LEU A 1 140 ? 7.943   -4.033  -5.953  1.00 44.73  ? 155  LEU A CB  1 
ATOM   1030 C CG  . LEU A 1 140 ? 8.939   -2.936  -6.307  1.00 50.22  ? 155  LEU A CG  1 
ATOM   1031 C CD1 . LEU A 1 140 ? 10.015  -3.492  -7.248  1.00 45.95  ? 155  LEU A CD1 1 
ATOM   1032 C CD2 . LEU A 1 140 ? 8.195   -1.775  -6.938  1.00 47.42  ? 155  LEU A CD2 1 
ATOM   1033 N N   . ASP A 1 141 ? 6.093   -5.547  -3.704  1.00 47.07  ? 156  ASP A N   1 
ATOM   1034 C CA  . ASP A 1 141 ? 5.273   -6.708  -3.396  1.00 43.96  ? 156  ASP A CA  1 
ATOM   1035 C C   . ASP A 1 141 ? 5.628   -7.186  -1.981  1.00 46.11  ? 156  ASP A C   1 
ATOM   1036 O O   . ASP A 1 141 ? 6.779   -7.088  -1.546  1.00 46.97  ? 156  ASP A O   1 
ATOM   1037 C CB  . ASP A 1 141 ? 5.562   -7.790  -4.443  1.00 49.84  ? 156  ASP A CB  1 
ATOM   1038 C CG  . ASP A 1 141 ? 4.789   -9.071  -4.209  1.00 54.41  ? 156  ASP A CG  1 
ATOM   1039 O OD1 . ASP A 1 141 ? 3.547   -9.024  -4.038  1.00 57.61  ? 156  ASP A OD1 1 
ATOM   1040 O OD2 . ASP A 1 141 ? 5.441   -10.136 -4.218  1.00 52.22  ? 156  ASP A OD2 1 
ATOM   1041 N N   . GLY A 1 142 ? 4.635   -7.697  -1.261  1.00 46.26  ? 157  GLY A N   1 
ATOM   1042 C CA  . GLY A 1 142 ? 4.864   -8.152  0.098   1.00 40.33  ? 157  GLY A CA  1 
ATOM   1043 C C   . GLY A 1 142 ? 4.372   -7.080  1.041   1.00 38.58  ? 157  GLY A C   1 
ATOM   1044 O O   . GLY A 1 142 ? 4.812   -6.974  2.190   1.00 35.75  ? 157  GLY A O   1 
ATOM   1045 N N   . MET A 1 143 ? 3.457   -6.263  0.530   1.00 39.70  ? 158  MET A N   1 
ATOM   1046 C CA  . MET A 1 143 ? 2.883   -5.184  1.307   1.00 39.10  ? 158  MET A CA  1 
ATOM   1047 C C   . MET A 1 143 ? 1.988   -5.777  2.364   1.00 40.08  ? 158  MET A C   1 
ATOM   1048 O O   . MET A 1 143 ? 1.805   -5.193  3.430   1.00 47.96  ? 158  MET A O   1 
ATOM   1049 C CB  . MET A 1 143 ? 2.071   -4.248  0.424   1.00 39.24  ? 158  MET A CB  1 
ATOM   1050 C CG  . MET A 1 143 ? 1.623   -2.969  1.128   1.00 42.74  ? 158  MET A CG  1 
ATOM   1051 S SD  . MET A 1 143 ? 2.993   -1.893  1.676   1.00 45.12  ? 158  MET A SD  1 
ATOM   1052 C CE  . MET A 1 143 ? 2.201   -0.994  3.006   1.00 40.40  ? 158  MET A CE  1 
ATOM   1053 N N   . ASP A 1 144 ? 1.431   -6.946  2.073   1.00 42.68  ? 159  ASP A N   1 
ATOM   1054 C CA  . ASP A 1 144 ? 0.565   -7.613  3.035   1.00 43.14  ? 159  ASP A CA  1 
ATOM   1055 C C   . ASP A 1 144 ? 1.381   -8.188  4.177   1.00 36.27  ? 159  ASP A C   1 
ATOM   1056 O O   . ASP A 1 144 ? 0.882   -8.348  5.281   1.00 34.27  ? 159  ASP A O   1 
ATOM   1057 C CB  . ASP A 1 144 ? -0.259  -8.696  2.346   1.00 45.49  ? 159  ASP A CB  1 
ATOM   1058 C CG  . ASP A 1 144 ? -1.237  -8.114  1.350   1.00 50.43  ? 159  ASP A CG  1 
ATOM   1059 O OD1 . ASP A 1 144 ? -1.789  -7.030  1.645   1.00 47.28  ? 159  ASP A OD1 1 
ATOM   1060 O OD2 . ASP A 1 144 ? -1.455  -8.732  0.286   1.00 55.55  ? 159  ASP A OD2 1 
ATOM   1061 N N   . VAL A 1 145 ? 2.648   -8.472  3.899   1.00 39.59  ? 160  VAL A N   1 
ATOM   1062 C CA  . VAL A 1 145 ? 3.582   -8.992  4.899   1.00 38.76  ? 160  VAL A CA  1 
ATOM   1063 C C   . VAL A 1 145 ? 3.913   -7.830  5.837   1.00 37.32  ? 160  VAL A C   1 
ATOM   1064 O O   . VAL A 1 145 ? 4.123   -8.020  7.026   1.00 39.56  ? 160  VAL A O   1 
ATOM   1065 C CB  . VAL A 1 145 ? 4.879   -9.523  4.214   1.00 39.07  ? 160  VAL A CB  1 
ATOM   1066 C CG1 . VAL A 1 145 ? 5.894   -9.978  5.249   1.00 34.41  ? 160  VAL A CG1 1 
ATOM   1067 C CG2 . VAL A 1 145 ? 4.529   -10.679 3.283   1.00 23.73  ? 160  VAL A CG2 1 
ATOM   1068 N N   . VAL A 1 146 ? 3.934   -6.621  5.282   1.00 39.67  ? 161  VAL A N   1 
ATOM   1069 C CA  . VAL A 1 146 ? 4.215   -5.400  6.040   1.00 34.20  ? 161  VAL A CA  1 
ATOM   1070 C C   . VAL A 1 146 ? 3.011   -5.013  6.890   1.00 37.96  ? 161  VAL A C   1 
ATOM   1071 O O   . VAL A 1 146 ? 3.164   -4.518  8.006   1.00 43.44  ? 161  VAL A O   1 
ATOM   1072 C CB  . VAL A 1 146 ? 4.580   -4.238  5.085   1.00 35.75  ? 161  VAL A CB  1 
ATOM   1073 C CG1 . VAL A 1 146 ? 4.457   -2.900  5.797   1.00 32.90  ? 161  VAL A CG1 1 
ATOM   1074 C CG2 . VAL A 1 146 ? 6.004   -4.433  4.567   1.00 25.98  ? 161  VAL A CG2 1 
ATOM   1075 N N   . LEU A 1 147 ? 1.812   -5.247  6.367   1.00 37.40  ? 162  LEU A N   1 
ATOM   1076 C CA  . LEU A 1 147 ? 0.588   -4.932  7.098   1.00 36.33  ? 162  LEU A CA  1 
ATOM   1077 C C   . LEU A 1 147 ? 0.315   -6.010  8.141   1.00 41.22  ? 162  LEU A C   1 
ATOM   1078 O O   . LEU A 1 147 ? -0.583  -5.882  8.969   1.00 43.90  ? 162  LEU A O   1 
ATOM   1079 C CB  . LEU A 1 147 ? -0.584  -4.815  6.123   1.00 33.75  ? 162  LEU A CB  1 
ATOM   1080 C CG  . LEU A 1 147 ? -0.356  -3.695  5.107   1.00 31.73  ? 162  LEU A CG  1 
ATOM   1081 C CD1 . LEU A 1 147 ? -1.371  -3.754  3.987   1.00 27.99  ? 162  LEU A CD1 1 
ATOM   1082 C CD2 . LEU A 1 147 ? -0.411  -2.363  5.832   1.00 30.07  ? 162  LEU A CD2 1 
ATOM   1083 N N   . ARG A 1 148 ? 1.103   -7.074  8.092   1.00 45.03  ? 163  ARG A N   1 
ATOM   1084 C CA  . ARG A 1 148 ? 0.982   -8.172  9.039   1.00 46.50  ? 163  ARG A CA  1 
ATOM   1085 C C   . ARG A 1 148 ? 1.818   -7.781  10.255  1.00 47.02  ? 163  ARG A C   1 
ATOM   1086 O O   . ARG A 1 148 ? 1.341   -7.804  11.394  1.00 48.07  ? 163  ARG A O   1 
ATOM   1087 C CB  . ARG A 1 148 ? 1.541   -9.453  8.420   1.00 52.07  ? 163  ARG A CB  1 
ATOM   1088 C CG  . ARG A 1 148 ? 1.484   -10.669 9.317   1.00 57.31  ? 163  ARG A CG  1 
ATOM   1089 C CD  . ARG A 1 148 ? 0.090   -11.254 9.374   1.00 67.50  ? 163  ARG A CD  1 
ATOM   1090 N NE  . ARG A 1 148 ? 0.096   -12.654 8.951   1.00 78.80  ? 163  ARG A NE  1 
ATOM   1091 C CZ  . ARG A 1 148 ? 0.718   -13.634 9.605   1.00 84.41  ? 163  ARG A CZ  1 
ATOM   1092 N NH1 . ARG A 1 148 ? 1.383   -13.373 10.724  1.00 87.10  ? 163  ARG A NH1 1 
ATOM   1093 N NH2 . ARG A 1 148 ? 0.688   -14.874 9.133   1.00 86.36  ? 163  ARG A NH2 1 
ATOM   1094 N N   . ILE A 1 149 ? 3.075   -7.426  9.997   1.00 44.86  ? 164  ILE A N   1 
ATOM   1095 C CA  . ILE A 1 149 ? 3.998   -7.011  11.046  1.00 46.26  ? 164  ILE A CA  1 
ATOM   1096 C C   . ILE A 1 149 ? 3.427   -5.847  11.849  1.00 49.95  ? 164  ILE A C   1 
ATOM   1097 O O   . ILE A 1 149 ? 3.458   -5.846  13.080  1.00 54.84  ? 164  ILE A O   1 
ATOM   1098 C CB  . ILE A 1 149 ? 5.342   -6.555  10.456  1.00 44.58  ? 164  ILE A CB  1 
ATOM   1099 C CG1 . ILE A 1 149 ? 6.020   -7.727  9.738   1.00 46.37  ? 164  ILE A CG1 1 
ATOM   1100 C CG2 . ILE A 1 149 ? 6.219   -5.987  11.563  1.00 44.79  ? 164  ILE A CG2 1 
ATOM   1101 C CD1 . ILE A 1 149 ? 7.302   -7.362  8.975   1.00 38.50  ? 164  ILE A CD1 1 
ATOM   1102 N N   . GLU A 1 150 ? 2.908   -4.858  11.134  1.00 52.10  ? 165  GLU A N   1 
ATOM   1103 C CA  . GLU A 1 150 ? 2.338   -3.675  11.750  1.00 51.58  ? 165  GLU A CA  1 
ATOM   1104 C C   . GLU A 1 150 ? 1.408   -3.979  12.920  1.00 51.89  ? 165  GLU A C   1 
ATOM   1105 O O   . GLU A 1 150 ? 1.341   -3.184  13.860  1.00 51.14  ? 165  GLU A O   1 
ATOM   1106 C CB  . GLU A 1 150 ? 1.577   -2.849  10.703  1.00 49.89  ? 165  GLU A CB  1 
ATOM   1107 C CG  . GLU A 1 150 ? 0.955   -1.589  11.271  1.00 50.87  ? 165  GLU A CG  1 
ATOM   1108 C CD  . GLU A 1 150 ? -0.017  -0.918  10.320  1.00 49.73  ? 165  GLU A CD  1 
ATOM   1109 O OE1 . GLU A 1 150 ? -0.809  -1.627  9.677   1.00 48.00  ? 165  GLU A OE1 1 
ATOM   1110 O OE2 . GLU A 1 150 ? -0.004  0.325   10.230  1.00 52.73  ? 165  GLU A OE2 1 
ATOM   1111 N N   . LYS A 1 151 ? 0.700   -5.113  12.883  1.00 49.74  ? 166  LYS A N   1 
ATOM   1112 C CA  . LYS A 1 151 ? -0.231  -5.436  13.972  1.00 49.57  ? 166  LYS A CA  1 
ATOM   1113 C C   . LYS A 1 151 ? 0.360   -6.236  15.134  1.00 47.46  ? 166  LYS A C   1 
ATOM   1114 O O   . LYS A 1 151 ? -0.283  -6.363  16.181  1.00 46.53  ? 166  LYS A O   1 
ATOM   1115 C CB  . LYS A 1 151 ? -1.470  -6.206  13.474  1.00 49.34  ? 166  LYS A CB  1 
ATOM   1116 C CG  . LYS A 1 151 ? -1.848  -6.090  12.006  1.00 51.75  ? 166  LYS A CG  1 
ATOM   1117 C CD  . LYS A 1 151 ? -2.387  -4.726  11.573  1.00 46.43  ? 166  LYS A CD  1 
ATOM   1118 C CE  . LYS A 1 151 ? -2.988  -4.879  10.165  1.00 45.93  ? 166  LYS A CE  1 
ATOM   1119 N NZ  . LYS A 1 151 ? -2.972  -3.674  9.302   1.00 38.95  ? 166  LYS A NZ  1 
ATOM   1120 N N   . THR A 1 152 ? 1.563   -6.778  14.956  1.00 45.65  ? 167  THR A N   1 
ATOM   1121 C CA  . THR A 1 152 ? 2.208   -7.576  16.002  1.00 48.22  ? 167  THR A CA  1 
ATOM   1122 C C   . THR A 1 152 ? 2.102   -6.869  17.365  1.00 50.48  ? 167  THR A C   1 
ATOM   1123 O O   . THR A 1 152 ? 1.972   -5.645  17.423  1.00 52.79  ? 167  THR A O   1 
ATOM   1124 C CB  . THR A 1 152 ? 3.709   -7.824  15.670  1.00 51.28  ? 167  THR A CB  1 
ATOM   1125 O OG1 . THR A 1 152 ? 4.115   -9.098  16.189  1.00 46.30  ? 167  THR A OG1 1 
ATOM   1126 C CG2 . THR A 1 152 ? 4.590   -6.736  16.295  1.00 48.50  ? 167  THR A CG2 1 
ATOM   1127 N N   . LYS A 1 153 ? 2.165   -7.626  18.457  1.00 51.12  ? 168  LYS A N   1 
ATOM   1128 C CA  . LYS A 1 153 ? 2.060   -7.021  19.783  1.00 56.15  ? 168  LYS A CA  1 
ATOM   1129 C C   . LYS A 1 153 ? 3.372   -6.423  20.303  1.00 57.20  ? 168  LYS A C   1 
ATOM   1130 O O   . LYS A 1 153 ? 4.412   -7.089  20.359  1.00 53.15  ? 168  LYS A O   1 
ATOM   1131 C CB  . LYS A 1 153 ? 1.513   -8.028  20.801  1.00 58.24  ? 168  LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 153 ? 1.272   -7.402  22.159  1.00 60.29  ? 168  LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 153 ? 0.822   -8.406  23.190  1.00 68.37  ? 168  LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 153 ? 0.624   -7.720  24.526  1.00 73.04  ? 168  LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 153 ? 0.199   -8.671  25.584  1.00 83.62  ? 168  LYS A NZ  1 
ATOM   1136 N N   . THR A 1 154 ? 3.301   -5.153  20.691  1.00 57.28  ? 169  THR A N   1 
ATOM   1137 C CA  . THR A 1 154 ? 4.462   -4.428  21.190  1.00 56.64  ? 169  THR A CA  1 
ATOM   1138 C C   . THR A 1 154 ? 4.276   -4.017  22.652  1.00 56.99  ? 169  THR A C   1 
ATOM   1139 O O   . THR A 1 154 ? 3.152   -3.978  23.161  1.00 57.30  ? 169  THR A O   1 
ATOM   1140 C CB  . THR A 1 154 ? 4.727   -3.142  20.326  1.00 59.97  ? 169  THR A CB  1 
ATOM   1141 O OG1 . THR A 1 154 ? 3.629   -2.228  20.457  1.00 54.72  ? 169  THR A OG1 1 
ATOM   1142 C CG2 . THR A 1 154 ? 4.890   -3.506  18.846  1.00 53.43  ? 169  THR A CG2 1 
ATOM   1143 N N   . ASN A 1 155 ? 5.377   -3.727  23.334  1.00 51.87  ? 170  ASN A N   1 
ATOM   1144 C CA  . ASN A 1 155 ? 5.293   -3.297  24.722  1.00 55.85  ? 170  ASN A CA  1 
ATOM   1145 C C   . ASN A 1 155 ? 5.417   -1.783  24.745  1.00 54.45  ? 170  ASN A C   1 
ATOM   1146 O O   . ASN A 1 155 ? 5.233   -1.138  23.717  1.00 59.58  ? 170  ASN A O   1 
ATOM   1147 C CB  . ASN A 1 155 ? 6.418   -3.915  25.556  1.00 58.86  ? 170  ASN A CB  1 
ATOM   1148 C CG  . ASN A 1 155 ? 7.800   -3.660  24.972  1.00 59.06  ? 170  ASN A CG  1 
ATOM   1149 O OD1 . ASN A 1 155 ? 8.040   -2.663  24.302  1.00 48.88  ? 170  ASN A OD1 1 
ATOM   1150 N ND2 . ASN A 1 155 ? 8.723   -4.566  25.249  1.00 63.54  ? 170  ASN A ND2 1 
ATOM   1151 N N   . SER A 1 156 ? 5.720   -1.213  25.909  1.00 51.59  ? 171  SER A N   1 
ATOM   1152 C CA  . SER A 1 156 ? 5.905   0.228   25.992  1.00 50.09  ? 171  SER A CA  1 
ATOM   1153 C C   . SER A 1 156 ? 7.011   0.460   24.966  1.00 55.56  ? 171  SER A C   1 
ATOM   1154 O O   . SER A 1 156 ? 7.601   -0.499  24.472  1.00 63.67  ? 171  SER A O   1 
ATOM   1155 C CB  . SER A 1 156 ? 6.419   0.635   27.376  1.00 51.07  ? 171  SER A CB  1 
ATOM   1156 O OG  . SER A 1 156 ? 5.813   -0.118  28.408  1.00 49.11  ? 171  SER A OG  1 
ATOM   1157 N N   . HIS A 1 157 ? 7.316   1.705   24.636  1.00 48.42  ? 172  HIS A N   1 
ATOM   1158 C CA  . HIS A 1 157 ? 8.381   1.968   23.662  1.00 52.01  ? 172  HIS A CA  1 
ATOM   1159 C C   . HIS A 1 157 ? 8.094   1.382   22.267  1.00 49.24  ? 172  HIS A C   1 
ATOM   1160 O O   . HIS A 1 157 ? 8.925   1.489   21.375  1.00 48.89  ? 172  HIS A O   1 
ATOM   1161 C CB  . HIS A 1 157 ? 9.723   1.416   24.176  1.00 48.97  ? 172  HIS A CB  1 
ATOM   1162 C CG  . HIS A 1 157 ? 9.920   1.580   25.652  1.00 51.89  ? 172  HIS A CG  1 
ATOM   1163 N ND1 . HIS A 1 157 ? 10.007  0.507   26.514  1.00 56.69  ? 172  HIS A ND1 1 
ATOM   1164 C CD2 . HIS A 1 157 ? 9.999   2.689   26.425  1.00 52.40  ? 172  HIS A CD2 1 
ATOM   1165 C CE1 . HIS A 1 157 ? 10.126  0.948   27.754  1.00 57.78  ? 172  HIS A CE1 1 
ATOM   1166 N NE2 . HIS A 1 157 ? 10.124  2.268   27.728  1.00 53.98  ? 172  HIS A NE2 1 
ATOM   1167 N N   . ASP A 1 158 ? 6.930   0.755   22.099  1.00 48.85  ? 173  ASP A N   1 
ATOM   1168 C CA  . ASP A 1 158 ? 6.498   0.166   20.822  1.00 46.19  ? 173  ASP A CA  1 
ATOM   1169 C C   . ASP A 1 158 ? 7.415   -0.898  20.237  1.00 42.88  ? 173  ASP A C   1 
ATOM   1170 O O   . ASP A 1 158 ? 7.605   -0.974  19.026  1.00 37.23  ? 173  ASP A O   1 
ATOM   1171 C CB  . ASP A 1 158 ? 6.307   1.271   19.796  1.00 43.76  ? 173  ASP A CB  1 
ATOM   1172 C CG  . ASP A 1 158 ? 5.545   2.426   20.354  1.00 49.09  ? 173  ASP A CG  1 
ATOM   1173 O OD1 . ASP A 1 158 ? 4.322   2.269   20.578  1.00 47.07  ? 173  ASP A OD1 1 
ATOM   1174 O OD2 . ASP A 1 158 ? 6.179   3.481   20.587  1.00 45.22  ? 173  ASP A OD2 1 
ATOM   1175 N N   . ARG A 1 159 ? 7.979   -1.725  21.101  1.00 45.10  ? 174  ARG A N   1 
ATOM   1176 C CA  . ARG A 1 159 ? 8.865   -2.770  20.647  1.00 42.01  ? 174  ARG A CA  1 
ATOM   1177 C C   . ARG A 1 159 ? 8.140   -4.104  20.619  1.00 40.61  ? 174  ARG A C   1 
ATOM   1178 O O   . ARG A 1 159 ? 7.403   -4.437  21.544  1.00 42.18  ? 174  ARG A O   1 
ATOM   1179 C CB  . ARG A 1 159 ? 10.092  -2.852  21.554  1.00 43.11  ? 174  ARG A CB  1 
ATOM   1180 C CG  . ARG A 1 159 ? 11.021  -3.970  21.144  1.00 50.52  ? 174  ARG A CG  1 
ATOM   1181 C CD  . ARG A 1 159 ? 12.396  -3.821  21.722  1.00 60.15  ? 174  ARG A CD  1 
ATOM   1182 N NE  . ARG A 1 159 ? 13.322  -4.671  20.986  1.00 77.80  ? 174  ARG A NE  1 
ATOM   1183 C CZ  . ARG A 1 159 ? 14.601  -4.839  21.296  1.00 82.97  ? 174  ARG A CZ  1 
ATOM   1184 N NH1 . ARG A 1 159 ? 15.118  -4.209  22.343  1.00 90.68  ? 174  ARG A NH1 1 
ATOM   1185 N NH2 . ARG A 1 159 ? 15.361  -5.640  20.560  1.00 82.30  ? 174  ARG A NH2 1 
ATOM   1186 N N   . PRO A 1 160 ? 8.328   -4.881  19.542  1.00 40.92  ? 175  PRO A N   1 
ATOM   1187 C CA  . PRO A 1 160 ? 7.696   -6.192  19.375  1.00 47.56  ? 175  PRO A CA  1 
ATOM   1188 C C   . PRO A 1 160 ? 8.006   -7.199  20.486  1.00 51.65  ? 175  PRO A C   1 
ATOM   1189 O O   . PRO A 1 160 ? 9.169   -7.540  20.721  1.00 49.34  ? 175  PRO A O   1 
ATOM   1190 C CB  . PRO A 1 160 ? 8.234   -6.663  18.025  1.00 45.02  ? 175  PRO A CB  1 
ATOM   1191 C CG  . PRO A 1 160 ? 8.399   -5.417  17.280  1.00 41.25  ? 175  PRO A CG  1 
ATOM   1192 C CD  . PRO A 1 160 ? 9.013   -4.483  18.303  1.00 37.98  ? 175  PRO A CD  1 
ATOM   1193 N N   . VAL A 1 161 ? 6.954   -7.671  21.154  1.00 55.91  ? 176  VAL A N   1 
ATOM   1194 C CA  . VAL A 1 161 ? 7.065   -8.668  22.225  1.00 56.20  ? 176  VAL A CA  1 
ATOM   1195 C C   . VAL A 1 161 ? 7.799   -9.905  21.693  1.00 59.49  ? 176  VAL A C   1 
ATOM   1196 O O   . VAL A 1 161 ? 8.755   -10.391 22.301  1.00 62.20  ? 176  VAL A O   1 
ATOM   1197 C CB  . VAL A 1 161 ? 5.656   -9.068  22.727  1.00 53.37  ? 176  VAL A CB  1 
ATOM   1198 C CG1 . VAL A 1 161 ? 5.713   -10.373 23.497  1.00 53.60  ? 176  VAL A CG1 1 
ATOM   1199 C CG2 . VAL A 1 161 ? 5.094   -7.952  23.599  1.00 49.48  ? 176  VAL A CG2 1 
ATOM   1200 N N   . LYS A 1 162 ? 7.327   -10.416 20.559  1.00 61.25  ? 177  LYS A N   1 
ATOM   1201 C CA  . LYS A 1 162 ? 7.941   -11.557 19.894  1.00 56.32  ? 177  LYS A CA  1 
ATOM   1202 C C   . LYS A 1 162 ? 8.766   -10.874 18.817  1.00 54.48  ? 177  LYS A C   1 
ATOM   1203 O O   . LYS A 1 162 ? 8.246   -10.068 18.057  1.00 53.92  ? 177  LYS A O   1 
ATOM   1204 C CB  . LYS A 1 162 ? 6.875   -12.441 19.246  1.00 63.63  ? 177  LYS A CB  1 
ATOM   1205 C CG  . LYS A 1 162 ? 6.045   -13.267 20.214  1.00 64.95  ? 177  LYS A CG  1 
ATOM   1206 C CD  . LYS A 1 162 ? 6.905   -14.315 20.885  1.00 71.65  ? 177  LYS A CD  1 
ATOM   1207 C CE  . LYS A 1 162 ? 6.054   -15.453 21.418  1.00 80.93  ? 177  LYS A CE  1 
ATOM   1208 N NZ  . LYS A 1 162 ? 6.897   -16.575 21.920  1.00 85.94  ? 177  LYS A NZ  1 
ATOM   1209 N N   . PRO A 1 163 ? 10.065  -11.173 18.745  1.00 52.52  ? 178  PRO A N   1 
ATOM   1210 C CA  . PRO A 1 163 ? 10.944  -10.558 17.746  1.00 50.26  ? 178  PRO A CA  1 
ATOM   1211 C C   . PRO A 1 163 ? 10.612  -10.852 16.287  1.00 49.76  ? 178  PRO A C   1 
ATOM   1212 O O   . PRO A 1 163 ? 10.449  -12.014 15.905  1.00 45.91  ? 178  PRO A O   1 
ATOM   1213 C CB  . PRO A 1 163 ? 12.327  -11.088 18.131  1.00 54.44  ? 178  PRO A CB  1 
ATOM   1214 C CG  . PRO A 1 163 ? 12.204  -11.318 19.603  1.00 54.15  ? 178  PRO A CG  1 
ATOM   1215 C CD  . PRO A 1 163 ? 10.845  -11.954 19.718  1.00 53.33  ? 178  PRO A CD  1 
ATOM   1216 N N   . VAL A 1 164 ? 10.517  -9.783  15.491  1.00 51.15  ? 179  VAL A N   1 
ATOM   1217 C CA  . VAL A 1 164 ? 10.244  -9.856  14.052  1.00 50.10  ? 179  VAL A CA  1 
ATOM   1218 C C   . VAL A 1 164 ? 11.610  -9.788  13.375  1.00 49.48  ? 179  VAL A C   1 
ATOM   1219 O O   . VAL A 1 164 ? 12.227  -8.727  13.295  1.00 51.17  ? 179  VAL A O   1 
ATOM   1220 C CB  . VAL A 1 164 ? 9.391   -8.674  13.584  1.00 48.41  ? 179  VAL A CB  1 
ATOM   1221 C CG1 . VAL A 1 164 ? 9.202   -8.734  12.082  1.00 47.68  ? 179  VAL A CG1 1 
ATOM   1222 C CG2 . VAL A 1 164 ? 8.050   -8.702  14.290  1.00 49.58  ? 179  VAL A CG2 1 
ATOM   1223 N N   . LYS A 1 165 ? 12.059  -10.923 12.860  1.00 49.05  ? 180  LYS A N   1 
ATOM   1224 C CA  . LYS A 1 165 ? 13.387  -11.033 12.279  1.00 51.47  ? 180  LYS A CA  1 
ATOM   1225 C C   . LYS A 1 165 ? 13.522  -11.207 10.766  1.00 48.23  ? 180  LYS A C   1 
ATOM   1226 O O   . LYS A 1 165 ? 12.691  -11.841 10.120  1.00 48.92  ? 180  LYS A O   1 
ATOM   1227 C CB  . LYS A 1 165 ? 14.081  -12.172 13.034  1.00 57.76  ? 180  LYS A CB  1 
ATOM   1228 C CG  . LYS A 1 165 ? 15.342  -12.763 12.460  1.00 67.41  ? 180  LYS A CG  1 
ATOM   1229 C CD  . LYS A 1 165 ? 15.762  -13.901 13.385  1.00 69.49  ? 180  LYS A CD  1 
ATOM   1230 C CE  . LYS A 1 165 ? 16.907  -14.727 12.837  1.00 78.66  ? 180  LYS A CE  1 
ATOM   1231 N NZ  . LYS A 1 165 ? 17.239  -15.830 13.786  1.00 77.96  ? 180  LYS A NZ  1 
ATOM   1232 N N   . ILE A 1 166 ? 14.579  -10.616 10.211  1.00 45.01  ? 181  ILE A N   1 
ATOM   1233 C CA  . ILE A 1 166 ? 14.873  -10.717 8.784   1.00 44.45  ? 181  ILE A CA  1 
ATOM   1234 C C   . ILE A 1 166 ? 15.842  -11.891 8.645   1.00 46.73  ? 181  ILE A C   1 
ATOM   1235 O O   . ILE A 1 166 ? 17.058  -11.724 8.684   1.00 40.62  ? 181  ILE A O   1 
ATOM   1236 C CB  . ILE A 1 166 ? 15.526  -9.414  8.245   1.00 40.50  ? 181  ILE A CB  1 
ATOM   1237 C CG1 . ILE A 1 166 ? 14.525  -8.257  8.350   1.00 38.83  ? 181  ILE A CG1 1 
ATOM   1238 C CG2 . ILE A 1 166 ? 15.983  -9.609  6.795   1.00 32.85  ? 181  ILE A CG2 1 
ATOM   1239 C CD1 . ILE A 1 166 ? 15.109  -6.892  8.003   1.00 30.38  ? 181  ILE A CD1 1 
ATOM   1240 N N   . VAL A 1 167 ? 15.273  -13.085 8.501   1.00 49.81  ? 182  VAL A N   1 
ATOM   1241 C CA  . VAL A 1 167 ? 16.033  -14.328 8.394   1.00 48.56  ? 182  VAL A CA  1 
ATOM   1242 C C   . VAL A 1 167 ? 16.927  -14.374 7.170   1.00 51.50  ? 182  VAL A C   1 
ATOM   1243 O O   . VAL A 1 167 ? 17.967  -15.030 7.177   1.00 59.94  ? 182  VAL A O   1 
ATOM   1244 C CB  . VAL A 1 167 ? 15.086  -15.545 8.363   1.00 49.09  ? 182  VAL A CB  1 
ATOM   1245 C CG1 . VAL A 1 167 ? 14.211  -15.568 9.617   1.00 42.29  ? 182  VAL A CG1 1 
ATOM   1246 C CG2 . VAL A 1 167 ? 14.209  -15.485 7.130   1.00 49.28  ? 182  VAL A CG2 1 
ATOM   1247 N N   . ALA A 1 168 ? 16.521  -13.677 6.117   1.00 51.39  ? 183  ALA A N   1 
ATOM   1248 C CA  . ALA A 1 168 ? 17.293  -13.639 4.882   1.00 46.13  ? 183  ALA A CA  1 
ATOM   1249 C C   . ALA A 1 168 ? 16.965  -12.387 4.087   1.00 46.87  ? 183  ALA A C   1 
ATOM   1250 O O   . ALA A 1 168 ? 15.799  -12.008 3.951   1.00 44.68  ? 183  ALA A O   1 
ATOM   1251 C CB  . ALA A 1 168 ? 17.002  -14.869 4.042   1.00 42.72  ? 183  ALA A CB  1 
ATOM   1252 N N   . SER A 1 169 ? 18.006  -11.750 3.573   1.00 43.27  ? 184  SER A N   1 
ATOM   1253 C CA  . SER A 1 169 ? 17.859  -10.551 2.771   1.00 45.84  ? 184  SER A CA  1 
ATOM   1254 C C   . SER A 1 169 ? 18.792  -10.722 1.588   1.00 50.18  ? 184  SER A C   1 
ATOM   1255 O O   . SER A 1 169 ? 19.852  -11.336 1.710   1.00 54.57  ? 184  SER A O   1 
ATOM   1256 C CB  . SER A 1 169 ? 18.273  -9.314  3.562   1.00 45.88  ? 184  SER A CB  1 
ATOM   1257 O OG  . SER A 1 169 ? 19.670  -9.304  3.799   1.00 44.56  ? 184  SER A OG  1 
ATOM   1258 N N   . GLY A 1 170 ? 18.410  -10.184 0.441   1.00 50.84  ? 185  GLY A N   1 
ATOM   1259 C CA  . GLY A 1 170 ? 19.271  -10.331 -0.702  1.00 48.52  ? 185  GLY A CA  1 
ATOM   1260 C C   . GLY A 1 170 ? 19.020  -9.363  -1.826  1.00 49.14  ? 185  GLY A C   1 
ATOM   1261 O O   . GLY A 1 170 ? 18.697  -8.199  -1.628  1.00 48.70  ? 185  GLY A O   1 
ATOM   1262 N N   . GLU A 1 171 ? 19.158  -9.873  -3.034  1.00 50.03  ? 186  GLU A N   1 
ATOM   1263 C CA  . GLU A 1 171 ? 18.993  -9.056  -4.199  1.00 49.48  ? 186  GLU A CA  1 
ATOM   1264 C C   . GLU A 1 171 ? 18.380  -9.873  -5.325  1.00 50.85  ? 186  GLU A C   1 
ATOM   1265 O O   . GLU A 1 171 ? 18.519  -11.093 -5.379  1.00 49.93  ? 186  GLU A O   1 
ATOM   1266 C CB  . GLU A 1 171 ? 20.363  -8.540  -4.573  1.00 53.05  ? 186  GLU A CB  1 
ATOM   1267 C CG  . GLU A 1 171 ? 20.408  -7.537  -5.659  1.00 57.87  ? 186  GLU A CG  1 
ATOM   1268 C CD  . GLU A 1 171 ? 21.808  -7.032  -5.824  1.00 64.96  ? 186  GLU A CD  1 
ATOM   1269 O OE1 . GLU A 1 171 ? 22.736  -7.865  -5.746  1.00 62.38  ? 186  GLU A OE1 1 
ATOM   1270 O OE2 . GLU A 1 171 ? 21.982  -5.814  -6.027  1.00 74.03  ? 186  GLU A OE2 1 
ATOM   1271 N N   . LEU A 1 172 ? 17.680  -9.194  -6.217  1.00 53.69  ? 187  LEU A N   1 
ATOM   1272 C CA  . LEU A 1 172 ? 17.049  -9.865  -7.338  1.00 58.41  ? 187  LEU A CA  1 
ATOM   1273 C C   . LEU A 1 172 ? 17.662  -9.335  -8.618  1.00 58.60  ? 187  LEU A C   1 
ATOM   1274 O O   . LEU A 1 172 ? 17.613  -10.049 -9.643  1.00 58.24  ? 187  LEU A O   1 
ATOM   1275 C CB  . LEU A 1 172 ? 15.537  -9.621  -7.330  1.00 59.05  ? 187  LEU A CB  1 
ATOM   1276 C CG  . LEU A 1 172 ? 14.809  -10.153 -6.097  1.00 57.72  ? 187  LEU A CG  1 
ATOM   1277 C CD1 . LEU A 1 172 ? 13.315  -10.120 -6.346  1.00 54.61  ? 187  LEU A CD1 1 
ATOM   1278 C CD2 . LEU A 1 172 ? 15.263  -11.578 -5.806  1.00 57.42  ? 187  LEU A CD2 1 
ATOM   1279 O OXT . LEU A 1 172 ? 18.176  -8.199  -8.560  1.00 57.36  ? 187  LEU A OXT 1 
ATOM   1280 N N   . GLU B 1 7   ? 4.932   21.858  -38.766 1.00 90.40  ? 22   GLU B N   1 
ATOM   1281 C CA  . GLU B 1 7   ? 3.621   22.553  -38.585 1.00 89.28  ? 22   GLU B CA  1 
ATOM   1282 C C   . GLU B 1 7   ? 2.945   22.789  -39.937 1.00 87.33  ? 22   GLU B C   1 
ATOM   1283 O O   . GLU B 1 7   ? 3.621   22.989  -40.952 1.00 89.18  ? 22   GLU B O   1 
ATOM   1284 C CB  . GLU B 1 7   ? 3.832   23.884  -37.864 1.00 90.75  ? 22   GLU B CB  1 
ATOM   1285 N N   . PRO B 1 8   ? 1.597   22.765  -39.965 1.00 83.54  ? 23   PRO B N   1 
ATOM   1286 C CA  . PRO B 1 8   ? 0.783   22.967  -41.172 1.00 77.07  ? 23   PRO B CA  1 
ATOM   1287 C C   . PRO B 1 8   ? 1.002   24.289  -41.910 1.00 71.86  ? 23   PRO B C   1 
ATOM   1288 O O   . PRO B 1 8   ? 1.783   25.148  -41.483 1.00 67.10  ? 23   PRO B O   1 
ATOM   1289 C CB  . PRO B 1 8   ? -0.648  22.835  -40.651 1.00 77.80  ? 23   PRO B CB  1 
ATOM   1290 C CG  . PRO B 1 8   ? -0.504  21.883  -39.510 1.00 76.97  ? 23   PRO B CG  1 
ATOM   1291 C CD  . PRO B 1 8   ? 0.734   22.411  -38.823 1.00 82.77  ? 23   PRO B CD  1 
ATOM   1292 N N   . GLU B 1 9   ? 0.281   24.430  -43.020 1.00 67.27  ? 24   GLU B N   1 
ATOM   1293 C CA  . GLU B 1 9   ? 0.343   25.602  -43.890 1.00 65.80  ? 24   GLU B CA  1 
ATOM   1294 C C   . GLU B 1 9   ? -0.601  26.725  -43.460 1.00 59.92  ? 24   GLU B C   1 
ATOM   1295 O O   . GLU B 1 9   ? -1.791  26.497  -43.270 1.00 57.10  ? 24   GLU B O   1 
ATOM   1296 C CB  . GLU B 1 9   ? 0.004   25.171  -45.321 1.00 72.82  ? 24   GLU B CB  1 
ATOM   1297 C CG  . GLU B 1 9   ? -0.305  26.298  -46.293 1.00 76.03  ? 24   GLU B CG  1 
ATOM   1298 C CD  . GLU B 1 9   ? -0.941  25.784  -47.574 1.00 81.41  ? 24   GLU B CD  1 
ATOM   1299 O OE1 . GLU B 1 9   ? -1.235  26.608  -48.467 1.00 87.50  ? 24   GLU B OE1 1 
ATOM   1300 O OE2 . GLU B 1 9   ? -1.151  24.556  -47.687 1.00 76.24  ? 24   GLU B OE2 1 
ATOM   1301 N N   . VAL B 1 10  ? -0.068  27.936  -43.323 1.00 54.95  ? 25   VAL B N   1 
ATOM   1302 C CA  . VAL B 1 10  ? -0.881  29.081  -42.933 1.00 49.97  ? 25   VAL B CA  1 
ATOM   1303 C C   . VAL B 1 10  ? -1.544  29.707  -44.157 1.00 55.39  ? 25   VAL B C   1 
ATOM   1304 O O   . VAL B 1 10  ? -0.870  30.163  -45.079 1.00 52.08  ? 25   VAL B O   1 
ATOM   1305 C CB  . VAL B 1 10  ? -0.047  30.145  -42.211 1.00 43.00  ? 25   VAL B CB  1 
ATOM   1306 C CG1 . VAL B 1 10  ? -0.823  31.431  -42.120 1.00 38.19  ? 25   VAL B CG1 1 
ATOM   1307 C CG2 . VAL B 1 10  ? 0.306   29.662  -40.817 1.00 35.05  ? 25   VAL B CG2 1 
ATOM   1308 N N   . THR B 1 11  ? -2.877  29.733  -44.143 1.00 58.41  ? 26   THR B N   1 
ATOM   1309 C CA  . THR B 1 11  ? -3.670  30.265  -45.242 1.00 55.18  ? 26   THR B CA  1 
ATOM   1310 C C   . THR B 1 11  ? -4.312  31.634  -44.979 1.00 58.69  ? 26   THR B C   1 
ATOM   1311 O O   . THR B 1 11  ? -4.523  32.408  -45.909 1.00 65.62  ? 26   THR B O   1 
ATOM   1312 C CB  . THR B 1 11  ? -4.760  29.282  -45.597 1.00 56.97  ? 26   THR B CB  1 
ATOM   1313 O OG1 . THR B 1 11  ? -5.721  29.239  -44.535 1.00 58.50  ? 26   THR B OG1 1 
ATOM   1314 C CG2 . THR B 1 11  ? -4.164  27.901  -45.770 1.00 57.20  ? 26   THR B CG2 1 
ATOM   1315 N N   . ALA B 1 12  ? -4.635  31.939  -43.728 1.00 55.69  ? 27   ALA B N   1 
ATOM   1316 C CA  . ALA B 1 12  ? -5.232  33.234  -43.417 1.00 52.60  ? 27   ALA B CA  1 
ATOM   1317 C C   . ALA B 1 12  ? -4.648  33.775  -42.113 1.00 53.00  ? 27   ALA B C   1 
ATOM   1318 O O   . ALA B 1 12  ? -4.066  33.026  -41.336 1.00 54.60  ? 27   ALA B O   1 
ATOM   1319 C CB  . ALA B 1 12  ? -6.737  33.100  -43.313 1.00 51.03  ? 27   ALA B CB  1 
ATOM   1320 N N   . LYS B 1 13  ? -4.796  35.075  -41.877 1.00 52.20  ? 28   LYS B N   1 
ATOM   1321 C CA  . LYS B 1 13  ? -4.263  35.697  -40.668 1.00 48.13  ? 28   LYS B CA  1 
ATOM   1322 C C   . LYS B 1 13  ? -5.305  36.535  -39.940 1.00 49.48  ? 28   LYS B C   1 
ATOM   1323 O O   . LYS B 1 13  ? -6.024  37.319  -40.565 1.00 50.12  ? 28   LYS B O   1 
ATOM   1324 C CB  . LYS B 1 13  ? -3.083  36.607  -41.010 1.00 43.84  ? 28   LYS B CB  1 
ATOM   1325 C CG  . LYS B 1 13  ? -1.876  35.915  -41.606 1.00 49.53  ? 28   LYS B CG  1 
ATOM   1326 C CD  . LYS B 1 13  ? -0.708  36.893  -41.747 1.00 53.75  ? 28   LYS B CD  1 
ATOM   1327 C CE  . LYS B 1 13  ? 0.576   36.180  -42.167 1.00 59.82  ? 28   LYS B CE  1 
ATOM   1328 N NZ  . LYS B 1 13  ? 1.789   37.042  -42.020 1.00 61.11  ? 28   LYS B NZ  1 
ATOM   1329 N N   . VAL B 1 14  ? -5.388  36.374  -38.622 1.00 47.19  ? 29   VAL B N   1 
ATOM   1330 C CA  . VAL B 1 14  ? -6.323  37.164  -37.828 1.00 43.07  ? 29   VAL B CA  1 
ATOM   1331 C C   . VAL B 1 14  ? -5.553  37.809  -36.681 1.00 43.91  ? 29   VAL B C   1 
ATOM   1332 O O   . VAL B 1 14  ? -4.349  37.591  -36.555 1.00 43.91  ? 29   VAL B O   1 
ATOM   1333 C CB  . VAL B 1 14  ? -7.479  36.305  -37.281 1.00 41.74  ? 29   VAL B CB  1 
ATOM   1334 C CG1 . VAL B 1 14  ? -8.367  35.861  -38.424 1.00 34.19  ? 29   VAL B CG1 1 
ATOM   1335 C CG2 . VAL B 1 14  ? -6.940  35.106  -36.516 1.00 43.44  ? 29   VAL B CG2 1 
ATOM   1336 N N   . TYR B 1 15  ? -6.225  38.609  -35.855 1.00 44.05  ? 30   TYR B N   1 
ATOM   1337 C CA  . TYR B 1 15  ? -5.536  39.259  -34.744 1.00 46.47  ? 30   TYR B CA  1 
ATOM   1338 C C   . TYR B 1 15  ? -6.435  39.669  -33.584 1.00 47.62  ? 30   TYR B C   1 
ATOM   1339 O O   . TYR B 1 15  ? -7.653  39.776  -33.730 1.00 49.42  ? 30   TYR B O   1 
ATOM   1340 C CB  . TYR B 1 15  ? -4.780  40.494  -35.249 1.00 48.88  ? 30   TYR B CB  1 
ATOM   1341 C CG  . TYR B 1 15  ? -5.676  41.620  -35.720 1.00 51.48  ? 30   TYR B CG  1 
ATOM   1342 C CD1 . TYR B 1 15  ? -6.180  42.568  -34.824 1.00 51.58  ? 30   TYR B CD1 1 
ATOM   1343 C CD2 . TYR B 1 15  ? -6.059  41.710  -37.059 1.00 53.68  ? 30   TYR B CD2 1 
ATOM   1344 C CE1 . TYR B 1 15  ? -7.051  43.578  -35.258 1.00 57.00  ? 30   TYR B CE1 1 
ATOM   1345 C CE2 . TYR B 1 15  ? -6.923  42.708  -37.503 1.00 51.56  ? 30   TYR B CE2 1 
ATOM   1346 C CZ  . TYR B 1 15  ? -7.417  43.636  -36.605 1.00 56.09  ? 30   TYR B CZ  1 
ATOM   1347 O OH  . TYR B 1 15  ? -8.274  44.614  -37.063 1.00 55.61  ? 30   TYR B OH  1 
ATOM   1348 N N   . PHE B 1 16  ? -5.815  39.881  -32.425 1.00 49.88  ? 31   PHE B N   1 
ATOM   1349 C CA  . PHE B 1 16  ? -6.516  40.333  -31.223 1.00 46.82  ? 31   PHE B CA  1 
ATOM   1350 C C   . PHE B 1 16  ? -5.759  41.512  -30.640 1.00 46.42  ? 31   PHE B C   1 
ATOM   1351 O O   . PHE B 1 16  ? -4.554  41.436  -30.429 1.00 44.80  ? 31   PHE B O   1 
ATOM   1352 C CB  . PHE B 1 16  ? -6.558  39.266  -30.114 1.00 47.03  ? 31   PHE B CB  1 
ATOM   1353 C CG  . PHE B 1 16  ? -7.378  38.052  -30.442 1.00 49.43  ? 31   PHE B CG  1 
ATOM   1354 C CD1 . PHE B 1 16  ? -8.625  38.169  -31.050 1.00 42.17  ? 31   PHE B CD1 1 
ATOM   1355 C CD2 . PHE B 1 16  ? -6.906  36.783  -30.119 1.00 47.43  ? 31   PHE B CD2 1 
ATOM   1356 C CE1 . PHE B 1 16  ? -9.380  37.044  -31.330 1.00 39.55  ? 31   PHE B CE1 1 
ATOM   1357 C CE2 . PHE B 1 16  ? -7.658  35.656  -30.398 1.00 47.20  ? 31   PHE B CE2 1 
ATOM   1358 C CZ  . PHE B 1 16  ? -8.898  35.789  -31.006 1.00 43.97  ? 31   PHE B CZ  1 
ATOM   1359 N N   . ASP B 1 17  ? -6.456  42.608  -30.396 1.00 48.64  ? 32   ASP B N   1 
ATOM   1360 C CA  . ASP B 1 17  ? -5.816  43.745  -29.755 1.00 56.00  ? 32   ASP B CA  1 
ATOM   1361 C C   . ASP B 1 17  ? -6.244  43.536  -28.308 1.00 54.17  ? 32   ASP B C   1 
ATOM   1362 O O   . ASP B 1 17  ? -7.435  43.547  -28.001 1.00 53.59  ? 32   ASP B O   1 
ATOM   1363 C CB  . ASP B 1 17  ? -6.350  45.069  -30.324 1.00 63.81  ? 32   ASP B CB  1 
ATOM   1364 C CG  . ASP B 1 17  ? -5.529  45.569  -31.516 1.00 66.69  ? 32   ASP B CG  1 
ATOM   1365 O OD1 . ASP B 1 17  ? -5.971  46.533  -32.181 1.00 69.48  ? 32   ASP B OD1 1 
ATOM   1366 O OD2 . ASP B 1 17  ? -4.439  45.005  -31.777 1.00 63.25  ? 32   ASP B OD2 1 
ATOM   1367 N N   . VAL B 1 18  ? -5.279  43.324  -27.422 1.00 56.57  ? 33   VAL B N   1 
ATOM   1368 C CA  . VAL B 1 18  ? -5.590  43.047  -26.019 1.00 58.06  ? 33   VAL B CA  1 
ATOM   1369 C C   . VAL B 1 18  ? -5.362  44.162  -25.002 1.00 58.56  ? 33   VAL B C   1 
ATOM   1370 O O   . VAL B 1 18  ? -4.446  44.976  -25.139 1.00 58.75  ? 33   VAL B O   1 
ATOM   1371 C CB  . VAL B 1 18  ? -4.819  41.775  -25.550 1.00 55.18  ? 33   VAL B CB  1 
ATOM   1372 C CG1 . VAL B 1 18  ? -5.010  41.553  -24.067 1.00 54.98  ? 33   VAL B CG1 1 
ATOM   1373 C CG2 . VAL B 1 18  ? -5.310  40.564  -26.327 1.00 50.36  ? 33   VAL B CG2 1 
ATOM   1374 N N   . MET B 1 19  ? -6.216  44.176  -23.979 1.00 63.00  ? 34   MET B N   1 
ATOM   1375 C CA  . MET B 1 19  ? -6.149  45.146  -22.884 1.00 69.70  ? 34   MET B CA  1 
ATOM   1376 C C   . MET B 1 19  ? -6.468  44.496  -21.541 1.00 70.47  ? 34   MET B C   1 
ATOM   1377 O O   . MET B 1 19  ? -7.187  43.498  -21.473 1.00 70.53  ? 34   MET B O   1 
ATOM   1378 C CB  . MET B 1 19  ? -7.148  46.294  -23.085 1.00 70.61  ? 34   MET B CB  1 
ATOM   1379 C CG  . MET B 1 19  ? -6.738  47.351  -24.092 1.00 74.70  ? 34   MET B CG  1 
ATOM   1380 S SD  . MET B 1 19  ? -7.473  48.958  -23.701 1.00 77.86  ? 34   MET B SD  1 
ATOM   1381 C CE  . MET B 1 19  ? -6.011  49.875  -23.207 1.00 67.10  ? 34   MET B CE  1 
ATOM   1382 N N   . ILE B 1 20  ? -5.924  45.073  -20.474 1.00 74.65  ? 35   ILE B N   1 
ATOM   1383 C CA  . ILE B 1 20  ? -6.184  44.596  -19.122 1.00 75.32  ? 35   ILE B CA  1 
ATOM   1384 C C   . ILE B 1 20  ? -6.730  45.780  -18.333 1.00 78.49  ? 35   ILE B C   1 
ATOM   1385 O O   . ILE B 1 20  ? -6.088  46.275  -17.405 1.00 79.69  ? 35   ILE B O   1 
ATOM   1386 C CB  . ILE B 1 20  ? -4.912  44.076  -18.410 1.00 71.18  ? 35   ILE B CB  1 
ATOM   1387 C CG1 . ILE B 1 20  ? -4.264  42.962  -19.229 1.00 66.96  ? 35   ILE B CG1 1 
ATOM   1388 C CG2 . ILE B 1 20  ? -5.284  43.530  -17.025 1.00 70.12  ? 35   ILE B CG2 1 
ATOM   1389 C CD1 . ILE B 1 20  ? -3.021  42.396  -18.595 1.00 61.11  ? 35   ILE B CD1 1 
ATOM   1390 N N   . ASP B 1 21  ? -7.905  46.250  -18.734 1.00 79.35  ? 36   ASP B N   1 
ATOM   1391 C CA  . ASP B 1 21  ? -8.555  47.361  -18.058 1.00 84.24  ? 36   ASP B CA  1 
ATOM   1392 C C   . ASP B 1 21  ? -7.736  48.645  -18.172 1.00 86.75  ? 36   ASP B C   1 
ATOM   1393 O O   . ASP B 1 21  ? -6.897  48.927  -17.318 1.00 90.50  ? 36   ASP B O   1 
ATOM   1394 C CB  . ASP B 1 21  ? -8.771  47.002  -16.579 1.00 85.18  ? 36   ASP B CB  1 
ATOM   1395 C CG  . ASP B 1 21  ? -10.009 47.657  -15.983 1.00 87.13  ? 36   ASP B CG  1 
ATOM   1396 O OD1 . ASP B 1 21  ? -10.818 46.931  -15.370 1.00 86.94  ? 36   ASP B OD1 1 
ATOM   1397 O OD2 . ASP B 1 21  ? -10.176 48.889  -16.119 1.00 85.78  ? 36   ASP B OD2 1 
ATOM   1398 N N   . SER B 1 22  ? -7.981  49.400  -19.241 1.00 88.07  ? 37   SER B N   1 
ATOM   1399 C CA  . SER B 1 22  ? -7.318  50.685  -19.502 1.00 88.88  ? 37   SER B CA  1 
ATOM   1400 C C   . SER B 1 22  ? -5.852  50.662  -19.961 1.00 87.61  ? 37   SER B C   1 
ATOM   1401 O O   . SER B 1 22  ? -5.354  51.660  -20.488 1.00 87.20  ? 37   SER B O   1 
ATOM   1402 C CB  . SER B 1 22  ? -7.448  51.608  -18.277 1.00 88.60  ? 37   SER B CB  1 
ATOM   1403 O OG  . SER B 1 22  ? -6.573  51.226  -17.228 1.00 89.92  ? 37   SER B OG  1 
ATOM   1404 N N   . GLU B 1 23  ? -5.157  49.545  -19.766 1.00 83.57  ? 38   GLU B N   1 
ATOM   1405 C CA  . GLU B 1 23  ? -3.763  49.465  -20.190 1.00 80.48  ? 38   GLU B CA  1 
ATOM   1406 C C   . GLU B 1 23  ? -3.625  48.538  -21.396 1.00 76.60  ? 38   GLU B C   1 
ATOM   1407 O O   . GLU B 1 23  ? -3.984  47.363  -21.330 1.00 73.65  ? 38   GLU B O   1 
ATOM   1408 C CB  . GLU B 1 23  ? -2.880  48.952  -19.048 1.00 86.11  ? 38   GLU B CB  1 
ATOM   1409 C CG  . GLU B 1 23  ? -1.381  49.088  -19.313 1.00 89.88  ? 38   GLU B CG  1 
ATOM   1410 C CD  . GLU B 1 23  ? -0.602  47.826  -18.963 1.00 96.02  ? 38   GLU B CD  1 
ATOM   1411 O OE1 . GLU B 1 23  ? -0.747  47.323  -17.827 1.00 95.04  ? 38   GLU B OE1 1 
ATOM   1412 O OE2 . GLU B 1 23  ? 0.161   47.340  -19.826 1.00 100.48 ? 38   GLU B OE2 1 
ATOM   1413 N N   . PRO B 1 24  ? -3.102  49.060  -22.517 1.00 73.60  ? 39   PRO B N   1 
ATOM   1414 C CA  . PRO B 1 24  ? -2.916  48.272  -23.740 1.00 72.04  ? 39   PRO B CA  1 
ATOM   1415 C C   . PRO B 1 24  ? -1.690  47.355  -23.671 1.00 72.02  ? 39   PRO B C   1 
ATOM   1416 O O   . PRO B 1 24  ? -0.572  47.814  -23.408 1.00 74.64  ? 39   PRO B O   1 
ATOM   1417 C CB  . PRO B 1 24  ? -2.770  49.348  -24.808 1.00 71.68  ? 39   PRO B CB  1 
ATOM   1418 C CG  . PRO B 1 24  ? -2.008  50.410  -24.076 1.00 70.26  ? 39   PRO B CG  1 
ATOM   1419 C CD  . PRO B 1 24  ? -2.721  50.468  -22.739 1.00 71.01  ? 39   PRO B CD  1 
ATOM   1420 N N   . LEU B 1 25  ? -1.901  46.060  -23.899 1.00 69.39  ? 40   LEU B N   1 
ATOM   1421 C CA  . LEU B 1 25  ? -0.804  45.096  -23.874 1.00 67.31  ? 40   LEU B CA  1 
ATOM   1422 C C   . LEU B 1 25  ? -0.226  44.947  -25.267 1.00 66.15  ? 40   LEU B C   1 
ATOM   1423 O O   . LEU B 1 25  ? 0.989   44.830  -25.441 1.00 63.93  ? 40   LEU B O   1 
ATOM   1424 C CB  . LEU B 1 25  ? -1.284  43.731  -23.385 1.00 68.80  ? 40   LEU B CB  1 
ATOM   1425 C CG  . LEU B 1 25  ? -1.499  43.536  -21.884 1.00 67.62  ? 40   LEU B CG  1 
ATOM   1426 C CD1 . LEU B 1 25  ? -2.463  44.583  -21.350 1.00 67.41  ? 40   LEU B CD1 1 
ATOM   1427 C CD2 . LEU B 1 25  ? -2.029  42.130  -21.648 1.00 65.11  ? 40   LEU B CD2 1 
ATOM   1428 N N   . GLY B 1 26  ? -1.109  44.943  -26.260 1.00 63.39  ? 41   GLY B N   1 
ATOM   1429 C CA  . GLY B 1 26  ? -0.656  44.815  -27.631 1.00 62.08  ? 41   GLY B CA  1 
ATOM   1430 C C   . GLY B 1 26  ? -1.540  43.962  -28.518 1.00 60.84  ? 41   GLY B C   1 
ATOM   1431 O O   . GLY B 1 26  ? -2.696  43.676  -28.196 1.00 61.16  ? 41   GLY B O   1 
ATOM   1432 N N   . ARG B 1 27  ? -0.979  43.555  -29.648 1.00 58.16  ? 42   ARG B N   1 
ATOM   1433 C CA  . ARG B 1 27  ? -1.687  42.735  -30.613 1.00 57.45  ? 42   ARG B CA  1 
ATOM   1434 C C   . ARG B 1 27  ? -1.116  41.322  -30.677 1.00 57.22  ? 42   ARG B C   1 
ATOM   1435 O O   . ARG B 1 27  ? 0.092   41.116  -30.519 1.00 57.95  ? 42   ARG B O   1 
ATOM   1436 C CB  . ARG B 1 27  ? -1.613  43.395  -31.998 1.00 55.45  ? 42   ARG B CB  1 
ATOM   1437 C CG  . ARG B 1 27  ? -2.001  42.490  -33.170 1.00 56.12  ? 42   ARG B CG  1 
ATOM   1438 C CD  . ARG B 1 27  ? -2.189  43.283  -34.447 1.00 48.64  ? 42   ARG B CD  1 
ATOM   1439 N NE  . ARG B 1 27  ? -3.212  44.304  -34.264 1.00 50.84  ? 42   ARG B NE  1 
ATOM   1440 C CZ  . ARG B 1 27  ? -3.671  45.095  -35.227 1.00 50.37  ? 42   ARG B CZ  1 
ATOM   1441 N NH1 . ARG B 1 27  ? -3.195  44.982  -36.463 1.00 47.50  ? 42   ARG B NH1 1 
ATOM   1442 N NH2 . ARG B 1 27  ? -4.609  45.999  -34.951 1.00 42.56  ? 42   ARG B NH2 1 
ATOM   1443 N N   . ILE B 1 28  ? -2.002  40.353  -30.886 1.00 52.97  ? 43   ILE B N   1 
ATOM   1444 C CA  . ILE B 1 28  ? -1.609  38.955  -31.024 1.00 50.70  ? 43   ILE B CA  1 
ATOM   1445 C C   . ILE B 1 28  ? -1.984  38.585  -32.462 1.00 49.31  ? 43   ILE B C   1 
ATOM   1446 O O   . ILE B 1 28  ? -3.170  38.534  -32.801 1.00 49.14  ? 43   ILE B O   1 
ATOM   1447 C CB  . ILE B 1 28  ? -2.394  38.023  -30.053 1.00 49.48  ? 43   ILE B CB  1 
ATOM   1448 C CG1 . ILE B 1 28  ? -2.194  38.459  -28.604 1.00 45.89  ? 43   ILE B CG1 1 
ATOM   1449 C CG2 . ILE B 1 28  ? -1.927  36.585  -30.214 1.00 44.50  ? 43   ILE B CG2 1 
ATOM   1450 C CD1 . ILE B 1 28  ? -2.934  37.573  -27.615 1.00 41.37  ? 43   ILE B CD1 1 
ATOM   1451 N N   . THR B 1 29  ? -0.981  38.359  -33.306 1.00 46.54  ? 44   THR B N   1 
ATOM   1452 C CA  . THR B 1 29  ? -1.217  37.990  -34.700 1.00 47.19  ? 44   THR B CA  1 
ATOM   1453 C C   . THR B 1 29  ? -1.220  36.470  -34.812 1.00 48.27  ? 44   THR B C   1 
ATOM   1454 O O   . THR B 1 29  ? -0.230  35.815  -34.482 1.00 44.21  ? 44   THR B O   1 
ATOM   1455 C CB  . THR B 1 29  ? -0.120  38.583  -35.645 1.00 48.90  ? 44   THR B CB  1 
ATOM   1456 O OG1 . THR B 1 29  ? -0.282  40.007  -35.730 1.00 53.53  ? 44   THR B OG1 1 
ATOM   1457 C CG2 . THR B 1 29  ? -0.219  37.985  -37.053 1.00 41.64  ? 44   THR B CG2 1 
ATOM   1458 N N   . ILE B 1 30  ? -2.343  35.922  -35.278 1.00 48.60  ? 45   ILE B N   1 
ATOM   1459 C CA  . ILE B 1 30  ? -2.515  34.477  -35.430 1.00 44.38  ? 45   ILE B CA  1 
ATOM   1460 C C   . ILE B 1 30  ? -2.608  34.006  -36.880 1.00 45.69  ? 45   ILE B C   1 
ATOM   1461 O O   . ILE B 1 30  ? -3.241  34.654  -37.722 1.00 47.52  ? 45   ILE B O   1 
ATOM   1462 C CB  . ILE B 1 30  ? -3.774  34.010  -34.673 1.00 40.54  ? 45   ILE B CB  1 
ATOM   1463 C CG1 . ILE B 1 30  ? -3.578  34.274  -33.181 1.00 41.91  ? 45   ILE B CG1 1 
ATOM   1464 C CG2 . ILE B 1 30  ? -4.053  32.535  -34.951 1.00 33.19  ? 45   ILE B CG2 1 
ATOM   1465 C CD1 . ILE B 1 30  ? -4.768  33.954  -32.330 1.00 53.73  ? 45   ILE B CD1 1 
ATOM   1466 N N   . GLY B 1 31  ? -1.960  32.874  -37.155 1.00 46.22  ? 46   GLY B N   1 
ATOM   1467 C CA  . GLY B 1 31  ? -1.976  32.292  -38.485 1.00 42.41  ? 46   GLY B CA  1 
ATOM   1468 C C   . GLY B 1 31  ? -2.849  31.055  -38.455 1.00 43.75  ? 46   GLY B C   1 
ATOM   1469 O O   . GLY B 1 31  ? -2.773  30.268  -37.521 1.00 47.84  ? 46   GLY B O   1 
ATOM   1470 N N   . LEU B 1 32  ? -3.680  30.882  -39.473 1.00 42.44  ? 47   LEU B N   1 
ATOM   1471 C CA  . LEU B 1 32  ? -4.586  29.746  -39.547 1.00 45.39  ? 47   LEU B CA  1 
ATOM   1472 C C   . LEU B 1 32  ? -4.176  28.665  -40.552 1.00 46.13  ? 47   LEU B C   1 
ATOM   1473 O O   . LEU B 1 32  ? -3.637  28.957  -41.606 1.00 50.09  ? 47   LEU B O   1 
ATOM   1474 C CB  . LEU B 1 32  ? -5.994  30.252  -39.867 1.00 42.12  ? 47   LEU B CB  1 
ATOM   1475 C CG  . LEU B 1 32  ? -6.526  31.248  -38.834 1.00 37.86  ? 47   LEU B CG  1 
ATOM   1476 C CD1 . LEU B 1 32  ? -7.763  31.932  -39.364 1.00 30.97  ? 47   LEU B CD1 1 
ATOM   1477 C CD2 . LEU B 1 32  ? -6.813  30.523  -37.529 1.00 37.96  ? 47   LEU B CD2 1 
ATOM   1478 N N   . PHE B 1 33  ? -4.442  27.411  -40.201 1.00 50.08  ? 48   PHE B N   1 
ATOM   1479 C CA  . PHE B 1 33  ? -4.122  26.270  -41.046 1.00 52.54  ? 48   PHE B CA  1 
ATOM   1480 C C   . PHE B 1 33  ? -5.356  25.936  -41.875 1.00 58.33  ? 48   PHE B C   1 
ATOM   1481 O O   . PHE B 1 33  ? -6.007  24.912  -41.643 1.00 59.94  ? 48   PHE B O   1 
ATOM   1482 C CB  . PHE B 1 33  ? -3.760  25.067  -40.180 1.00 53.87  ? 48   PHE B CB  1 
ATOM   1483 C CG  . PHE B 1 33  ? -2.645  25.325  -39.204 1.00 52.94  ? 48   PHE B CG  1 
ATOM   1484 C CD1 . PHE B 1 33  ? -2.432  24.456  -38.137 1.00 51.32  ? 48   PHE B CD1 1 
ATOM   1485 C CD2 . PHE B 1 33  ? -1.799  26.418  -39.355 1.00 51.20  ? 48   PHE B CD2 1 
ATOM   1486 C CE1 . PHE B 1 33  ? -1.394  24.674  -37.238 1.00 55.71  ? 48   PHE B CE1 1 
ATOM   1487 C CE2 . PHE B 1 33  ? -0.754  26.644  -38.459 1.00 54.06  ? 48   PHE B CE2 1 
ATOM   1488 C CZ  . PHE B 1 33  ? -0.551  25.772  -37.399 1.00 56.83  ? 48   PHE B CZ  1 
ATOM   1489 N N   . GLY B 1 34  ? -5.670  26.800  -42.839 1.00 59.10  ? 49   GLY B N   1 
ATOM   1490 C CA  . GLY B 1 34  ? -6.841  26.606  -43.678 1.00 56.77  ? 49   GLY B CA  1 
ATOM   1491 C C   . GLY B 1 34  ? -7.029  25.277  -44.392 1.00 58.80  ? 49   GLY B C   1 
ATOM   1492 O O   . GLY B 1 34  ? -8.155  24.783  -44.487 1.00 62.16  ? 49   GLY B O   1 
ATOM   1493 N N   . LYS B 1 35  ? -5.949  24.687  -44.891 1.00 56.96  ? 50   LYS B N   1 
ATOM   1494 C CA  . LYS B 1 35  ? -6.050  23.427  -45.620 1.00 58.80  ? 50   LYS B CA  1 
ATOM   1495 C C   . LYS B 1 35  ? -6.142  22.152  -44.780 1.00 57.22  ? 50   LYS B C   1 
ATOM   1496 O O   . LYS B 1 35  ? -6.488  21.087  -45.303 1.00 54.24  ? 50   LYS B O   1 
ATOM   1497 C CB  . LYS B 1 35  ? -4.874  23.291  -46.596 1.00 65.14  ? 50   LYS B CB  1 
ATOM   1498 C CG  . LYS B 1 35  ? -4.894  24.266  -47.763 1.00 70.62  ? 50   LYS B CG  1 
ATOM   1499 C CD  . LYS B 1 35  ? -3.777  23.940  -48.745 1.00 81.22  ? 50   LYS B CD  1 
ATOM   1500 C CE  . LYS B 1 35  ? -3.773  24.881  -49.947 1.00 87.37  ? 50   LYS B CE  1 
ATOM   1501 N NZ  . LYS B 1 35  ? -2.647  24.584  -50.886 1.00 87.79  ? 50   LYS B NZ  1 
ATOM   1502 N N   . ASP B 1 36  ? -5.832  22.245  -43.491 1.00 57.37  ? 51   ASP B N   1 
ATOM   1503 C CA  . ASP B 1 36  ? -5.878  21.069  -42.623 1.00 57.54  ? 51   ASP B CA  1 
ATOM   1504 C C   . ASP B 1 36  ? -7.161  20.979  -41.816 1.00 58.99  ? 51   ASP B C   1 
ATOM   1505 O O   . ASP B 1 36  ? -7.498  19.921  -41.295 1.00 60.86  ? 51   ASP B O   1 
ATOM   1506 C CB  . ASP B 1 36  ? -4.691  21.063  -41.664 1.00 61.98  ? 51   ASP B CB  1 
ATOM   1507 C CG  . ASP B 1 36  ? -3.361  21.081  -42.383 1.00 67.61  ? 51   ASP B CG  1 
ATOM   1508 O OD1 . ASP B 1 36  ? -2.925  22.177  -42.807 1.00 70.32  ? 51   ASP B OD1 1 
ATOM   1509 O OD2 . ASP B 1 36  ? -2.759  19.995  -42.527 1.00 65.68  ? 51   ASP B OD2 1 
ATOM   1510 N N   . ALA B 1 37  ? -7.870  22.098  -41.711 1.00 59.86  ? 52   ALA B N   1 
ATOM   1511 C CA  . ALA B 1 37  ? -9.121  22.167  -40.963 1.00 54.43  ? 52   ALA B CA  1 
ATOM   1512 C C   . ALA B 1 37  ? -9.842  23.435  -41.402 1.00 52.69  ? 52   ALA B C   1 
ATOM   1513 O O   . ALA B 1 37  ? -9.818  24.449  -40.709 1.00 49.44  ? 52   ALA B O   1 
ATOM   1514 C CB  . ALA B 1 37  ? -8.828  22.211  -39.472 1.00 54.77  ? 52   ALA B CB  1 
ATOM   1515 N N   . PRO B 1 38  ? -10.488 23.389  -42.577 1.00 56.39  ? 53   PRO B N   1 
ATOM   1516 C CA  . PRO B 1 38  ? -11.232 24.500  -43.180 1.00 57.08  ? 53   PRO B CA  1 
ATOM   1517 C C   . PRO B 1 38  ? -12.463 24.958  -42.403 1.00 54.19  ? 53   PRO B C   1 
ATOM   1518 O O   . PRO B 1 38  ? -12.671 26.157  -42.210 1.00 53.97  ? 53   PRO B O   1 
ATOM   1519 C CB  . PRO B 1 38  ? -11.581 23.957  -44.561 1.00 59.27  ? 53   PRO B CB  1 
ATOM   1520 C CG  . PRO B 1 38  ? -11.780 22.505  -44.289 1.00 58.10  ? 53   PRO B CG  1 
ATOM   1521 C CD  . PRO B 1 38  ? -10.586 22.187  -43.424 1.00 58.82  ? 53   PRO B CD  1 
ATOM   1522 N N   . LEU B 1 39  ? -13.282 24.004  -41.973 1.00 50.50  ? 54   LEU B N   1 
ATOM   1523 C CA  . LEU B 1 39  ? -14.479 24.316  -41.210 1.00 46.44  ? 54   LEU B CA  1 
ATOM   1524 C C   . LEU B 1 39  ? -14.080 25.019  -39.919 1.00 47.24  ? 54   LEU B C   1 
ATOM   1525 O O   . LEU B 1 39  ? -14.636 26.057  -39.554 1.00 49.35  ? 54   LEU B O   1 
ATOM   1526 C CB  . LEU B 1 39  ? -15.236 23.029  -40.887 1.00 49.01  ? 54   LEU B CB  1 
ATOM   1527 C CG  . LEU B 1 39  ? -15.780 22.282  -42.103 1.00 52.72  ? 54   LEU B CG  1 
ATOM   1528 C CD1 . LEU B 1 39  ? -16.493 21.020  -41.661 1.00 50.91  ? 54   LEU B CD1 1 
ATOM   1529 C CD2 . LEU B 1 39  ? -16.725 23.197  -42.871 1.00 50.07  ? 54   LEU B CD2 1 
ATOM   1530 N N   . THR B 1 40  ? -13.101 24.442  -39.235 1.00 43.28  ? 55   THR B N   1 
ATOM   1531 C CA  . THR B 1 40  ? -12.618 24.988  -37.982 1.00 41.88  ? 55   THR B CA  1 
ATOM   1532 C C   . THR B 1 40  ? -12.080 26.418  -38.168 1.00 42.59  ? 55   THR B C   1 
ATOM   1533 O O   . THR B 1 40  ? -12.503 27.340  -37.476 1.00 44.37  ? 55   THR B O   1 
ATOM   1534 C CB  . THR B 1 40  ? -11.528 24.051  -37.379 1.00 36.40  ? 55   THR B CB  1 
ATOM   1535 O OG1 . THR B 1 40  ? -12.091 22.757  -37.158 1.00 38.65  ? 55   THR B OG1 1 
ATOM   1536 C CG2 . THR B 1 40  ? -11.023 24.571  -36.054 1.00 38.90  ? 55   THR B CG2 1 
ATOM   1537 N N   . THR B 1 41  ? -11.170 26.610  -39.117 1.00 44.82  ? 56   THR B N   1 
ATOM   1538 C CA  . THR B 1 41  ? -10.597 27.932  -39.355 1.00 41.29  ? 56   THR B CA  1 
ATOM   1539 C C   . THR B 1 41  ? -11.636 28.933  -39.825 1.00 43.06  ? 56   THR B C   1 
ATOM   1540 O O   . THR B 1 41  ? -11.537 30.116  -39.517 1.00 43.57  ? 56   THR B O   1 
ATOM   1541 C CB  . THR B 1 41  ? -9.468  27.894  -40.403 1.00 41.74  ? 56   THR B CB  1 
ATOM   1542 O OG1 . THR B 1 41  ? -9.985  27.418  -41.653 1.00 52.99  ? 56   THR B OG1 1 
ATOM   1543 C CG2 . THR B 1 41  ? -8.336  27.001  -39.935 1.00 24.19  ? 56   THR B CG2 1 
ATOM   1544 N N   . GLU B 1 42  ? -12.624 28.465  -40.579 1.00 46.33  ? 57   GLU B N   1 
ATOM   1545 C CA  . GLU B 1 42  ? -13.677 29.343  -41.063 1.00 47.96  ? 57   GLU B CA  1 
ATOM   1546 C C   . GLU B 1 42  ? -14.436 29.925  -39.891 1.00 47.87  ? 57   GLU B C   1 
ATOM   1547 O O   . GLU B 1 42  ? -14.669 31.135  -39.820 1.00 50.88  ? 57   GLU B O   1 
ATOM   1548 C CB  . GLU B 1 42  ? -14.625 28.584  -41.993 1.00 52.11  ? 57   GLU B CB  1 
ATOM   1549 C CG  . GLU B 1 42  ? -14.129 28.569  -43.425 1.00 55.83  ? 57   GLU B CG  1 
ATOM   1550 C CD  . GLU B 1 42  ? -13.804 29.970  -43.916 1.00 57.61  ? 57   GLU B CD  1 
ATOM   1551 O OE1 . GLU B 1 42  ? -14.740 30.784  -44.058 1.00 54.30  ? 57   GLU B OE1 1 
ATOM   1552 O OE2 . GLU B 1 42  ? -12.611 30.264  -44.139 1.00 59.42  ? 57   GLU B OE2 1 
ATOM   1553 N N   . ASN B 1 43  ? -14.807 29.051  -38.963 1.00 48.72  ? 58   ASN B N   1 
ATOM   1554 C CA  . ASN B 1 43  ? -15.515 29.454  -37.755 1.00 46.13  ? 58   ASN B CA  1 
ATOM   1555 C C   . ASN B 1 43  ? -14.711 30.551  -37.047 1.00 42.21  ? 58   ASN B C   1 
ATOM   1556 O O   . ASN B 1 43  ? -15.237 31.612  -36.729 1.00 44.61  ? 58   ASN B O   1 
ATOM   1557 C CB  . ASN B 1 43  ? -15.672 28.235  -36.846 1.00 49.07  ? 58   ASN B CB  1 
ATOM   1558 C CG  . ASN B 1 43  ? -16.386 28.550  -35.562 1.00 47.39  ? 58   ASN B CG  1 
ATOM   1559 O OD1 . ASN B 1 43  ? -15.889 28.256  -34.478 1.00 49.44  ? 58   ASN B OD1 1 
ATOM   1560 N ND2 . ASN B 1 43  ? -17.558 29.144  -35.672 1.00 42.52  ? 58   ASN B ND2 1 
ATOM   1561 N N   . PHE B 1 44  ? -13.428 30.295  -36.823 1.00 39.99  ? 59   PHE B N   1 
ATOM   1562 C CA  . PHE B 1 44  ? -12.563 31.258  -36.149 1.00 45.51  ? 59   PHE B CA  1 
ATOM   1563 C C   . PHE B 1 44  ? -12.431 32.569  -36.933 1.00 46.51  ? 59   PHE B C   1 
ATOM   1564 O O   . PHE B 1 44  ? -12.488 33.655  -36.359 1.00 48.62  ? 59   PHE B O   1 
ATOM   1565 C CB  . PHE B 1 44  ? -11.163 30.651  -35.929 1.00 40.36  ? 59   PHE B CB  1 
ATOM   1566 C CG  . PHE B 1 44  ? -10.355 31.347  -34.859 1.00 32.30  ? 59   PHE B CG  1 
ATOM   1567 C CD1 . PHE B 1 44  ? -10.561 31.059  -33.514 1.00 33.72  ? 59   PHE B CD1 1 
ATOM   1568 C CD2 . PHE B 1 44  ? -9.384  32.275  -35.195 1.00 31.89  ? 59   PHE B CD2 1 
ATOM   1569 C CE1 . PHE B 1 44  ? -9.805  31.691  -32.518 1.00 35.08  ? 59   PHE B CE1 1 
ATOM   1570 C CE2 . PHE B 1 44  ? -8.622  32.914  -34.213 1.00 32.39  ? 59   PHE B CE2 1 
ATOM   1571 C CZ  . PHE B 1 44  ? -8.831  32.617  -32.870 1.00 27.74  ? 59   PHE B CZ  1 
ATOM   1572 N N   . ARG B 1 45  ? -12.250 32.457  -38.246 1.00 48.80  ? 60   ARG B N   1 
ATOM   1573 C CA  . ARG B 1 45  ? -12.089 33.622  -39.114 1.00 48.88  ? 60   ARG B CA  1 
ATOM   1574 C C   . ARG B 1 45  ? -13.279 34.579  -39.005 1.00 48.20  ? 60   ARG B C   1 
ATOM   1575 O O   . ARG B 1 45  ? -13.115 35.777  -38.726 1.00 43.20  ? 60   ARG B O   1 
ATOM   1576 C CB  . ARG B 1 45  ? -11.924 33.173  -40.574 1.00 48.14  ? 60   ARG B CB  1 
ATOM   1577 C CG  . ARG B 1 45  ? -11.185 34.162  -41.457 1.00 45.03  ? 60   ARG B CG  1 
ATOM   1578 C CD  . ARG B 1 45  ? -11.205 33.756  -42.936 1.00 50.04  ? 60   ARG B CD  1 
ATOM   1579 N NE  . ARG B 1 45  ? -12.265 34.422  -43.702 1.00 50.64  ? 60   ARG B NE  1 
ATOM   1580 C CZ  . ARG B 1 45  ? -13.496 33.943  -43.860 1.00 52.86  ? 60   ARG B CZ  1 
ATOM   1581 N NH1 . ARG B 1 45  ? -13.832 32.784  -43.308 1.00 54.47  ? 60   ARG B NH1 1 
ATOM   1582 N NH2 . ARG B 1 45  ? -14.391 34.619  -44.566 1.00 51.57  ? 60   ARG B NH2 1 
ATOM   1583 N N   . GLN B 1 46  ? -14.477 34.042  -39.214 1.00 47.28  ? 61   GLN B N   1 
ATOM   1584 C CA  . GLN B 1 46  ? -15.688 34.845  -39.156 1.00 49.61  ? 61   GLN B CA  1 
ATOM   1585 C C   . GLN B 1 46  ? -16.026 35.410  -37.778 1.00 51.99  ? 61   GLN B C   1 
ATOM   1586 O O   . GLN B 1 46  ? -16.662 36.462  -37.689 1.00 56.70  ? 61   GLN B O   1 
ATOM   1587 C CB  . GLN B 1 46  ? -16.859 34.041  -39.716 1.00 51.87  ? 61   GLN B CB  1 
ATOM   1588 C CG  . GLN B 1 46  ? -16.726 33.818  -41.216 1.00 51.81  ? 61   GLN B CG  1 
ATOM   1589 C CD  . GLN B 1 46  ? -17.705 32.804  -41.747 1.00 49.25  ? 61   GLN B CD  1 
ATOM   1590 O OE1 . GLN B 1 46  ? -18.904 32.901  -41.502 1.00 48.90  ? 61   GLN B OE1 1 
ATOM   1591 N NE2 . GLN B 1 46  ? -17.199 31.823  -42.486 1.00 50.08  ? 61   GLN B NE2 1 
ATOM   1592 N N   . LEU B 1 47  ? -15.606 34.734  -36.709 1.00 47.61  ? 62   LEU B N   1 
ATOM   1593 C CA  . LEU B 1 47  ? -15.870 35.233  -35.361 1.00 41.83  ? 62   LEU B CA  1 
ATOM   1594 C C   . LEU B 1 47  ? -14.967 36.439  -35.039 1.00 45.81  ? 62   LEU B C   1 
ATOM   1595 O O   . LEU B 1 47  ? -15.329 37.308  -34.233 1.00 42.88  ? 62   LEU B O   1 
ATOM   1596 C CB  . LEU B 1 47  ? -15.645 34.129  -34.334 1.00 38.68  ? 62   LEU B CB  1 
ATOM   1597 C CG  . LEU B 1 47  ? -16.647 32.980  -34.342 1.00 37.26  ? 62   LEU B CG  1 
ATOM   1598 C CD1 . LEU B 1 47  ? -16.245 31.936  -33.302 1.00 40.05  ? 62   LEU B CD1 1 
ATOM   1599 C CD2 . LEU B 1 47  ? -18.029 33.528  -34.047 1.00 38.58  ? 62   LEU B CD2 1 
ATOM   1600 N N   . CYS B 1 48  ? -13.799 36.491  -35.676 1.00 44.77  ? 63   CYS B N   1 
ATOM   1601 C CA  . CYS B 1 48  ? -12.857 37.589  -35.473 1.00 45.49  ? 63   CYS B CA  1 
ATOM   1602 C C   . CYS B 1 48  ? -13.347 38.863  -36.142 1.00 49.04  ? 63   CYS B C   1 
ATOM   1603 O O   . CYS B 1 48  ? -13.283 39.943  -35.564 1.00 52.68  ? 63   CYS B O   1 
ATOM   1604 C CB  . CYS B 1 48  ? -11.475 37.226  -36.035 1.00 45.62  ? 63   CYS B CB  1 
ATOM   1605 S SG  . CYS B 1 48  ? -10.507 36.083  -35.024 1.00 44.54  ? 63   CYS B SG  1 
ATOM   1606 N N   . THR B 1 49  ? -13.832 38.732  -37.372 1.00 55.27  ? 64   THR B N   1 
ATOM   1607 C CA  . THR B 1 49  ? -14.336 39.883  -38.113 1.00 57.12  ? 64   THR B CA  1 
ATOM   1608 C C   . THR B 1 49  ? -15.598 40.413  -37.437 1.00 60.09  ? 64   THR B C   1 
ATOM   1609 O O   . THR B 1 49  ? -15.743 41.622  -37.227 1.00 64.21  ? 64   THR B O   1 
ATOM   1610 C CB  . THR B 1 49  ? -14.675 39.509  -39.569 1.00 55.30  ? 64   THR B CB  1 
ATOM   1611 O OG1 . THR B 1 49  ? -15.738 38.556  -39.576 1.00 54.70  ? 64   THR B OG1 1 
ATOM   1612 C CG2 . THR B 1 49  ? -13.467 38.904  -40.268 1.00 55.57  ? 64   THR B CG2 1 
ATOM   1613 N N   . GLY B 1 50  ? -16.503 39.501  -37.094 1.00 57.12  ? 65   GLY B N   1 
ATOM   1614 C CA  . GLY B 1 50  ? -17.737 39.891  -36.440 1.00 56.57  ? 65   GLY B CA  1 
ATOM   1615 C C   . GLY B 1 50  ? -18.928 39.835  -37.374 1.00 59.62  ? 65   GLY B C   1 
ATOM   1616 O O   . GLY B 1 50  ? -20.043 40.169  -36.984 1.00 62.75  ? 65   GLY B O   1 
ATOM   1617 N N   . GLU B 1 51  ? -18.685 39.402  -38.608 1.00 61.96  ? 66   GLU B N   1 
ATOM   1618 C CA  . GLU B 1 51  ? -19.712 39.294  -39.649 1.00 62.03  ? 66   GLU B CA  1 
ATOM   1619 C C   . GLU B 1 51  ? -21.143 39.019  -39.205 1.00 61.86  ? 66   GLU B C   1 
ATOM   1620 O O   . GLU B 1 51  ? -22.045 39.810  -39.470 1.00 69.53  ? 66   GLU B O   1 
ATOM   1621 C CB  . GLU B 1 51  ? -19.322 38.214  -40.652 1.00 59.16  ? 66   GLU B CB  1 
ATOM   1622 C CG  . GLU B 1 51  ? -18.116 38.539  -41.468 1.00 59.93  ? 66   GLU B CG  1 
ATOM   1623 C CD  . GLU B 1 51  ? -17.499 37.310  -42.070 1.00 65.65  ? 66   GLU B CD  1 
ATOM   1624 O OE1 . GLU B 1 51  ? -18.245 36.493  -42.655 1.00 67.67  ? 66   GLU B OE1 1 
ATOM   1625 O OE2 . GLU B 1 51  ? -16.265 37.166  -41.960 1.00 70.48  ? 66   GLU B OE2 1 
ATOM   1626 N N   . HIS B 1 52  ? -21.345 37.891  -38.541 1.00 60.42  ? 67   HIS B N   1 
ATOM   1627 C CA  . HIS B 1 52  ? -22.670 37.476  -38.098 1.00 59.61  ? 67   HIS B CA  1 
ATOM   1628 C C   . HIS B 1 52  ? -23.244 38.186  -36.872 1.00 59.13  ? 67   HIS B C   1 
ATOM   1629 O O   . HIS B 1 52  ? -24.187 37.693  -36.251 1.00 62.55  ? 67   HIS B O   1 
ATOM   1630 C CB  . HIS B 1 52  ? -22.640 35.973  -37.865 1.00 60.61  ? 67   HIS B CB  1 
ATOM   1631 C CG  . HIS B 1 52  ? -22.014 35.219  -38.993 1.00 57.66  ? 67   HIS B CG  1 
ATOM   1632 N ND1 . HIS B 1 52  ? -22.693 34.920  -40.152 1.00 58.65  ? 67   HIS B ND1 1 
ATOM   1633 C CD2 . HIS B 1 52  ? -20.749 34.772  -39.170 1.00 58.77  ? 67   HIS B CD2 1 
ATOM   1634 C CE1 . HIS B 1 52  ? -21.872 34.324  -40.998 1.00 60.35  ? 67   HIS B CE1 1 
ATOM   1635 N NE2 . HIS B 1 52  ? -20.687 34.223  -40.427 1.00 56.47  ? 67   HIS B NE2 1 
ATOM   1636 N N   . GLY B 1 53  ? -22.686 39.338  -36.521 1.00 57.13  ? 68   GLY B N   1 
ATOM   1637 C CA  . GLY B 1 53  ? -23.201 40.072  -35.378 1.00 62.82  ? 68   GLY B CA  1 
ATOM   1638 C C   . GLY B 1 53  ? -22.531 39.726  -34.065 1.00 65.53  ? 68   GLY B C   1 
ATOM   1639 O O   . GLY B 1 53  ? -22.364 40.578  -33.194 1.00 68.03  ? 68   GLY B O   1 
ATOM   1640 N N   . PHE B 1 54  ? -22.165 38.461  -33.910 1.00 65.79  ? 69   PHE B N   1 
ATOM   1641 C CA  . PHE B 1 54  ? -21.495 38.015  -32.704 1.00 61.29  ? 69   PHE B CA  1 
ATOM   1642 C C   . PHE B 1 54  ? -20.073 37.646  -33.091 1.00 59.59  ? 69   PHE B C   1 
ATOM   1643 O O   . PHE B 1 54  ? -19.835 37.138  -34.186 1.00 59.98  ? 69   PHE B O   1 
ATOM   1644 C CB  . PHE B 1 54  ? -22.230 36.812  -32.109 1.00 60.39  ? 69   PHE B CB  1 
ATOM   1645 C CG  . PHE B 1 54  ? -22.471 35.704  -33.086 1.00 58.61  ? 69   PHE B CG  1 
ATOM   1646 C CD1 . PHE B 1 54  ? -21.468 34.792  -33.386 1.00 60.29  ? 69   PHE B CD1 1 
ATOM   1647 C CD2 . PHE B 1 54  ? -23.702 35.575  -33.713 1.00 59.37  ? 69   PHE B CD2 1 
ATOM   1648 C CE1 . PHE B 1 54  ? -21.686 33.766  -34.302 1.00 61.13  ? 69   PHE B CE1 1 
ATOM   1649 C CE2 . PHE B 1 54  ? -23.930 34.553  -34.632 1.00 63.20  ? 69   PHE B CE2 1 
ATOM   1650 C CZ  . PHE B 1 54  ? -22.921 33.646  -34.925 1.00 59.54  ? 69   PHE B CZ  1 
ATOM   1651 N N   . GLY B 1 55  ? -19.129 37.921  -32.201 1.00 57.47  ? 70   GLY B N   1 
ATOM   1652 C CA  . GLY B 1 55  ? -17.743 37.607  -32.483 1.00 51.83  ? 70   GLY B CA  1 
ATOM   1653 C C   . GLY B 1 55  ? -16.880 37.720  -31.247 1.00 49.51  ? 70   GLY B C   1 
ATOM   1654 O O   . GLY B 1 55  ? -17.376 37.956  -30.147 1.00 46.72  ? 70   GLY B O   1 
ATOM   1655 N N   . TYR B 1 56  ? -15.576 37.566  -31.431 1.00 48.88  ? 71   TYR B N   1 
ATOM   1656 C CA  . TYR B 1 56  ? -14.642 37.638  -30.322 1.00 45.62  ? 71   TYR B CA  1 
ATOM   1657 C C   . TYR B 1 56  ? -14.462 39.044  -29.779 1.00 46.81  ? 71   TYR B C   1 
ATOM   1658 O O   . TYR B 1 56  ? -14.041 39.215  -28.636 1.00 50.89  ? 71   TYR B O   1 
ATOM   1659 C CB  . TYR B 1 56  ? -13.292 37.041  -30.741 1.00 40.24  ? 71   TYR B CB  1 
ATOM   1660 C CG  . TYR B 1 56  ? -13.352 35.542  -30.978 1.00 40.58  ? 71   TYR B CG  1 
ATOM   1661 C CD1 . TYR B 1 56  ? -12.940 34.986  -32.187 1.00 42.59  ? 71   TYR B CD1 1 
ATOM   1662 C CD2 . TYR B 1 56  ? -13.834 34.675  -29.992 1.00 40.75  ? 71   TYR B CD2 1 
ATOM   1663 C CE1 . TYR B 1 56  ? -13.007 33.601  -32.410 1.00 37.47  ? 71   TYR B CE1 1 
ATOM   1664 C CE2 . TYR B 1 56  ? -13.901 33.292  -30.209 1.00 38.23  ? 71   TYR B CE2 1 
ATOM   1665 C CZ  . TYR B 1 56  ? -13.484 32.766  -31.417 1.00 37.88  ? 71   TYR B CZ  1 
ATOM   1666 O OH  . TYR B 1 56  ? -13.525 31.404  -31.625 1.00 43.21  ? 71   TYR B OH  1 
ATOM   1667 N N   . LYS B 1 57  ? -14.803 40.053  -30.576 1.00 48.99  ? 72   LYS B N   1 
ATOM   1668 C CA  . LYS B 1 57  ? -14.648 41.437  -30.137 1.00 47.18  ? 72   LYS B CA  1 
ATOM   1669 C C   . LYS B 1 57  ? -15.296 41.724  -28.785 1.00 45.67  ? 72   LYS B C   1 
ATOM   1670 O O   . LYS B 1 57  ? -16.461 41.391  -28.556 1.00 40.66  ? 72   LYS B O   1 
ATOM   1671 C CB  . LYS B 1 57  ? -15.225 42.403  -31.168 1.00 51.47  ? 72   LYS B CB  1 
ATOM   1672 C CG  . LYS B 1 57  ? -14.893 43.851  -30.856 1.00 53.34  ? 72   LYS B CG  1 
ATOM   1673 C CD  . LYS B 1 57  ? -15.518 44.801  -31.846 1.00 53.84  ? 72   LYS B CD  1 
ATOM   1674 C CE  . LYS B 1 57  ? -14.988 46.220  -31.654 1.00 59.67  ? 72   LYS B CE  1 
ATOM   1675 N NZ  . LYS B 1 57  ? -15.281 46.763  -30.290 1.00 60.36  ? 72   LYS B NZ  1 
ATOM   1676 N N   . ASP B 1 58  ? -14.520 42.353  -27.903 1.00 47.35  ? 73   ASP B N   1 
ATOM   1677 C CA  . ASP B 1 58  ? -14.953 42.732  -26.558 1.00 49.35  ? 73   ASP B CA  1 
ATOM   1678 C C   . ASP B 1 58  ? -15.058 41.581  -25.541 1.00 50.27  ? 73   ASP B C   1 
ATOM   1679 O O   . ASP B 1 58  ? -15.361 41.810  -24.371 1.00 48.53  ? 73   ASP B O   1 
ATOM   1680 C CB  . ASP B 1 58  ? -16.280 43.505  -26.637 1.00 56.67  ? 73   ASP B CB  1 
ATOM   1681 C CG  . ASP B 1 58  ? -16.098 44.940  -27.147 1.00 64.11  ? 73   ASP B CG  1 
ATOM   1682 O OD1 . ASP B 1 58  ? -16.975 45.434  -27.901 1.00 61.69  ? 73   ASP B OD1 1 
ATOM   1683 O OD2 . ASP B 1 58  ? -15.081 45.577  -26.781 1.00 64.94  ? 73   ASP B OD2 1 
ATOM   1684 N N   . SER B 1 59  ? -14.794 40.349  -25.978 1.00 49.36  ? 74   SER B N   1 
ATOM   1685 C CA  . SER B 1 59  ? -14.843 39.199  -25.077 1.00 46.28  ? 74   SER B CA  1 
ATOM   1686 C C   . SER B 1 59  ? -13.563 39.130  -24.240 1.00 45.36  ? 74   SER B C   1 
ATOM   1687 O O   . SER B 1 59  ? -12.668 39.958  -24.392 1.00 44.60  ? 74   SER B O   1 
ATOM   1688 C CB  . SER B 1 59  ? -15.012 37.904  -25.873 1.00 44.37  ? 74   SER B CB  1 
ATOM   1689 O OG  . SER B 1 59  ? -13.908 37.691  -26.727 1.00 49.71  ? 74   SER B OG  1 
ATOM   1690 N N   . ILE B 1 60  ? -13.468 38.139  -23.363 1.00 44.83  ? 75   ILE B N   1 
ATOM   1691 C CA  . ILE B 1 60  ? -12.290 38.014  -22.507 1.00 44.75  ? 75   ILE B CA  1 
ATOM   1692 C C   . ILE B 1 60  ? -11.692 36.604  -22.381 1.00 47.84  ? 75   ILE B C   1 
ATOM   1693 O O   . ILE B 1 60  ? -12.211 35.613  -22.914 1.00 47.45  ? 75   ILE B O   1 
ATOM   1694 C CB  . ILE B 1 60  ? -12.592 38.487  -21.057 1.00 42.82  ? 75   ILE B CB  1 
ATOM   1695 C CG1 . ILE B 1 60  ? -13.563 37.506  -20.383 1.00 39.45  ? 75   ILE B CG1 1 
ATOM   1696 C CG2 . ILE B 1 60  ? -13.162 39.890  -21.068 1.00 40.91  ? 75   ILE B CG2 1 
ATOM   1697 C CD1 . ILE B 1 60  ? -13.607 37.603  -18.873 1.00 40.17  ? 75   ILE B CD1 1 
ATOM   1698 N N   . PHE B 1 61  ? -10.583 36.550  -21.651 1.00 44.69  ? 76   PHE B N   1 
ATOM   1699 C CA  . PHE B 1 61  ? -9.872  35.320  -21.351 1.00 45.14  ? 76   PHE B CA  1 
ATOM   1700 C C   . PHE B 1 61  ? -10.328 34.990  -19.935 1.00 43.41  ? 76   PHE B C   1 
ATOM   1701 O O   . PHE B 1 61  ? -9.850  35.581  -18.976 1.00 47.66  ? 76   PHE B O   1 
ATOM   1702 C CB  . PHE B 1 61  ? -8.367  35.583  -21.409 1.00 42.43  ? 76   PHE B CB  1 
ATOM   1703 C CG  . PHE B 1 61  ? -7.811  35.585  -22.806 1.00 40.62  ? 76   PHE B CG  1 
ATOM   1704 C CD1 . PHE B 1 61  ? -7.434  34.395  -23.415 1.00 43.39  ? 76   PHE B CD1 1 
ATOM   1705 C CD2 . PHE B 1 61  ? -7.707  36.767  -23.525 1.00 49.88  ? 76   PHE B CD2 1 
ATOM   1706 C CE1 . PHE B 1 61  ? -6.963  34.373  -24.726 1.00 44.90  ? 76   PHE B CE1 1 
ATOM   1707 C CE2 . PHE B 1 61  ? -7.235  36.766  -24.841 1.00 49.79  ? 76   PHE B CE2 1 
ATOM   1708 C CZ  . PHE B 1 61  ? -6.863  35.565  -25.443 1.00 49.41  ? 76   PHE B CZ  1 
ATOM   1709 N N   . HIS B 1 62  ? -11.265 34.053  -19.809 1.00 42.63  ? 77   HIS B N   1 
ATOM   1710 C CA  . HIS B 1 62  ? -11.833 33.702  -18.507 1.00 41.07  ? 77   HIS B CA  1 
ATOM   1711 C C   . HIS B 1 62  ? -11.121 32.652  -17.671 1.00 46.11  ? 77   HIS B C   1 
ATOM   1712 O O   . HIS B 1 62  ? -11.642 32.250  -16.627 1.00 45.10  ? 77   HIS B O   1 
ATOM   1713 C CB  . HIS B 1 62  ? -13.253 33.219  -18.688 1.00 28.96  ? 77   HIS B CB  1 
ATOM   1714 C CG  . HIS B 1 62  ? -13.339 31.906  -19.390 1.00 30.15  ? 77   HIS B CG  1 
ATOM   1715 N ND1 . HIS B 1 62  ? -13.358 31.796  -20.762 1.00 34.94  ? 77   HIS B ND1 1 
ATOM   1716 C CD2 . HIS B 1 62  ? -13.404 30.643  -18.911 1.00 27.80  ? 77   HIS B CD2 1 
ATOM   1717 C CE1 . HIS B 1 62  ? -13.439 30.521  -21.098 1.00 28.37  ? 77   HIS B CE1 1 
ATOM   1718 N NE2 . HIS B 1 62  ? -13.469 29.802  -19.993 1.00 31.90  ? 77   HIS B NE2 1 
ATOM   1719 N N   . ARG B 1 63  ? -9.963  32.185  -18.128 1.00 46.81  ? 78   ARG B N   1 
ATOM   1720 C CA  . ARG B 1 63  ? -9.216  31.174  -17.399 1.00 48.06  ? 78   ARG B CA  1 
ATOM   1721 C C   . ARG B 1 63  ? -7.784  31.114  -17.911 1.00 52.71  ? 78   ARG B C   1 
ATOM   1722 O O   . ARG B 1 63  ? -7.534  30.746  -19.060 1.00 55.32  ? 78   ARG B O   1 
ATOM   1723 C CB  . ARG B 1 63  ? -9.898  29.813  -17.545 1.00 46.54  ? 78   ARG B CB  1 
ATOM   1724 C CG  . ARG B 1 63  ? -9.156  28.658  -16.911 1.00 40.56  ? 78   ARG B CG  1 
ATOM   1725 C CD  . ARG B 1 63  ? -10.014 27.407  -16.963 1.00 45.91  ? 78   ARG B CD  1 
ATOM   1726 N NE  . ARG B 1 63  ? -9.288  26.197  -16.572 1.00 47.46  ? 78   ARG B NE  1 
ATOM   1727 C CZ  . ARG B 1 63  ? -8.795  25.301  -17.422 1.00 46.56  ? 78   ARG B CZ  1 
ATOM   1728 N NH1 . ARG B 1 63  ? -8.934  25.458  -18.732 1.00 48.67  ? 78   ARG B NH1 1 
ATOM   1729 N NH2 . ARG B 1 63  ? -8.176  24.226  -16.958 1.00 53.72  ? 78   ARG B NH2 1 
ATOM   1730 N N   . VAL B 1 64  ? -6.852  31.496  -17.040 1.00 55.40  ? 79   VAL B N   1 
ATOM   1731 C CA  . VAL B 1 64  ? -5.425  31.518  -17.349 1.00 51.50  ? 79   VAL B CA  1 
ATOM   1732 C C   . VAL B 1 64  ? -4.716  30.652  -16.315 1.00 47.91  ? 79   VAL B C   1 
ATOM   1733 O O   . VAL B 1 64  ? -4.884  30.860  -15.118 1.00 51.98  ? 79   VAL B O   1 
ATOM   1734 C CB  . VAL B 1 64  ? -4.857  32.956  -17.245 1.00 52.61  ? 79   VAL B CB  1 
ATOM   1735 C CG1 . VAL B 1 64  ? -3.454  32.996  -17.790 1.00 56.77  ? 79   VAL B CG1 1 
ATOM   1736 C CG2 . VAL B 1 64  ? -5.757  33.937  -17.978 1.00 50.98  ? 79   VAL B CG2 1 
ATOM   1737 N N   . ILE B 1 65  ? -3.934  29.678  -16.765 1.00 46.63  ? 80   ILE B N   1 
ATOM   1738 C CA  . ILE B 1 65  ? -3.205  28.810  -15.839 1.00 46.51  ? 80   ILE B CA  1 
ATOM   1739 C C   . ILE B 1 65  ? -1.718  28.856  -16.166 1.00 46.24  ? 80   ILE B C   1 
ATOM   1740 O O   . ILE B 1 65  ? -1.280  28.288  -17.166 1.00 49.19  ? 80   ILE B O   1 
ATOM   1741 C CB  . ILE B 1 65  ? -3.704  27.360  -15.924 1.00 43.60  ? 80   ILE B CB  1 
ATOM   1742 C CG1 . ILE B 1 65  ? -5.141  27.282  -15.406 1.00 43.88  ? 80   ILE B CG1 1 
ATOM   1743 C CG2 . ILE B 1 65  ? -2.803  26.452  -15.117 1.00 48.02  ? 80   ILE B CG2 1 
ATOM   1744 C CD1 . ILE B 1 65  ? -5.740  25.908  -15.465 1.00 41.19  ? 80   ILE B CD1 1 
ATOM   1745 N N   . GLN B 1 66  ? -0.942  29.536  -15.326 1.00 43.79  ? 81   GLN B N   1 
ATOM   1746 C CA  . GLN B 1 66  ? 0.489   29.658  -15.576 1.00 45.18  ? 81   GLN B CA  1 
ATOM   1747 C C   . GLN B 1 66  ? 1.121   28.322  -15.984 1.00 46.56  ? 81   GLN B C   1 
ATOM   1748 O O   . GLN B 1 66  ? 0.798   27.271  -15.430 1.00 51.52  ? 81   GLN B O   1 
ATOM   1749 C CB  . GLN B 1 66  ? 1.178   30.222  -14.351 1.00 37.44  ? 81   GLN B CB  1 
ATOM   1750 N N   . ASN B 1 67  ? 1.999   28.369  -16.980 1.00 47.76  ? 82   ASN B N   1 
ATOM   1751 C CA  . ASN B 1 67  ? 2.696   27.181  -17.471 1.00 48.83  ? 82   ASN B CA  1 
ATOM   1752 C C   . ASN B 1 67  ? 1.828   26.190  -18.208 1.00 48.63  ? 82   ASN B C   1 
ATOM   1753 O O   . ASN B 1 67  ? 2.254   25.061  -18.464 1.00 53.37  ? 82   ASN B O   1 
ATOM   1754 C CB  . ASN B 1 67  ? 3.397   26.447  -16.320 1.00 53.65  ? 82   ASN B CB  1 
ATOM   1755 C CG  . ASN B 1 67  ? 4.648   27.163  -15.843 1.00 59.30  ? 82   ASN B CG  1 
ATOM   1756 O OD1 . ASN B 1 67  ? 5.511   27.530  -16.646 1.00 61.18  ? 82   ASN B OD1 1 
ATOM   1757 N ND2 . ASN B 1 67  ? 4.761   27.354  -14.530 1.00 63.43  ? 82   ASN B ND2 1 
ATOM   1758 N N   . PHE B 1 68  ? 0.618   26.600  -18.568 1.00 47.96  ? 83   PHE B N   1 
ATOM   1759 C CA  . PHE B 1 68  ? -0.294  25.701  -19.263 1.00 44.93  ? 83   PHE B CA  1 
ATOM   1760 C C   . PHE B 1 68  ? -0.914  26.342  -20.503 1.00 45.33  ? 83   PHE B C   1 
ATOM   1761 O O   . PHE B 1 68  ? -0.613  25.945  -21.628 1.00 46.44  ? 83   PHE B O   1 
ATOM   1762 C CB  . PHE B 1 68  ? -1.382  25.229  -18.279 1.00 37.94  ? 83   PHE B CB  1 
ATOM   1763 C CG  . PHE B 1 68  ? -2.402  24.312  -18.884 1.00 39.74  ? 83   PHE B CG  1 
ATOM   1764 C CD1 . PHE B 1 68  ? -2.051  23.426  -19.899 1.00 42.42  ? 83   PHE B CD1 1 
ATOM   1765 C CD2 . PHE B 1 68  ? -3.715  24.326  -18.430 1.00 44.67  ? 83   PHE B CD2 1 
ATOM   1766 C CE1 . PHE B 1 68  ? -2.995  22.569  -20.457 1.00 47.10  ? 83   PHE B CE1 1 
ATOM   1767 C CE2 . PHE B 1 68  ? -4.666  23.478  -18.974 1.00 48.49  ? 83   PHE B CE2 1 
ATOM   1768 C CZ  . PHE B 1 68  ? -4.306  22.593  -19.995 1.00 51.54  ? 83   PHE B CZ  1 
ATOM   1769 N N   . MET B 1 69  ? -1.776  27.333  -20.298 1.00 46.70  ? 84   MET B N   1 
ATOM   1770 C CA  . MET B 1 69  ? -2.436  28.007  -21.413 1.00 43.41  ? 84   MET B CA  1 
ATOM   1771 C C   . MET B 1 69  ? -3.365  29.116  -20.947 1.00 41.58  ? 84   MET B C   1 
ATOM   1772 O O   . MET B 1 69  ? -3.533  29.327  -19.744 1.00 39.01  ? 84   MET B O   1 
ATOM   1773 C CB  . MET B 1 69  ? -3.236  26.990  -22.241 1.00 39.21  ? 84   MET B CB  1 
ATOM   1774 C CG  . MET B 1 69  ? -4.321  26.208  -21.491 1.00 40.78  ? 84   MET B CG  1 
ATOM   1775 S SD  . MET B 1 69  ? -5.885  27.070  -21.167 1.00 50.96  ? 84   MET B SD  1 
ATOM   1776 C CE  . MET B 1 69  ? -5.764  27.379  -19.413 1.00 40.65  ? 84   MET B CE  1 
ATOM   1777 N N   . ILE B 1 70  ? -3.930  29.845  -21.913 1.00 42.37  ? 85   ILE B N   1 
ATOM   1778 C CA  . ILE B 1 70  ? -4.903  30.901  -21.634 1.00 40.82  ? 85   ILE B CA  1 
ATOM   1779 C C   . ILE B 1 70  ? -6.098  30.517  -22.494 1.00 37.35  ? 85   ILE B C   1 
ATOM   1780 O O   . ILE B 1 70  ? -5.931  30.127  -23.645 1.00 40.65  ? 85   ILE B O   1 
ATOM   1781 C CB  . ILE B 1 70  ? -4.388  32.341  -21.990 1.00 39.50  ? 85   ILE B CB  1 
ATOM   1782 C CG1 . ILE B 1 70  ? -4.177  32.500  -23.496 1.00 44.35  ? 85   ILE B CG1 1 
ATOM   1783 C CG2 . ILE B 1 70  ? -3.101  32.628  -21.232 1.00 38.70  ? 85   ILE B CG2 1 
ATOM   1784 C CD1 . ILE B 1 70  ? -3.756  33.922  -23.909 1.00 40.96  ? 85   ILE B CD1 1 
ATOM   1785 N N   . GLN B 1 71  ? -7.297  30.602  -21.926 1.00 38.66  ? 86   GLN B N   1 
ATOM   1786 C CA  . GLN B 1 71  ? -8.517  30.204  -22.628 1.00 41.69  ? 86   GLN B CA  1 
ATOM   1787 C C   . GLN B 1 71  ? -9.437  31.387  -22.856 1.00 44.11  ? 86   GLN B C   1 
ATOM   1788 O O   . GLN B 1 71  ? -9.517  32.288  -22.022 1.00 48.15  ? 86   GLN B O   1 
ATOM   1789 C CB  . GLN B 1 71  ? -9.239  29.141  -21.796 1.00 38.68  ? 86   GLN B CB  1 
ATOM   1790 C CG  . GLN B 1 71  ? -10.415 28.433  -22.442 1.00 35.09  ? 86   GLN B CG  1 
ATOM   1791 C CD  . GLN B 1 71  ? -11.008 27.394  -21.493 1.00 42.52  ? 86   GLN B CD  1 
ATOM   1792 O OE1 . GLN B 1 71  ? -10.341 26.954  -20.561 1.00 39.10  ? 86   GLN B OE1 1 
ATOM   1793 N NE2 . GLN B 1 71  ? -12.254 26.999  -21.729 1.00 40.39  ? 86   GLN B NE2 1 
ATOM   1794 N N   . GLY B 1 72  ? -10.141 31.379  -23.982 1.00 40.16  ? 87   GLY B N   1 
ATOM   1795 C CA  . GLY B 1 72  ? -11.046 32.470  -24.276 1.00 40.19  ? 87   GLY B CA  1 
ATOM   1796 C C   . GLY B 1 72  ? -12.115 32.054  -25.258 1.00 42.00  ? 87   GLY B C   1 
ATOM   1797 O O   . GLY B 1 72  ? -12.293 30.866  -25.509 1.00 41.99  ? 87   GLY B O   1 
ATOM   1798 N N   . GLY B 1 73  ? -12.841 33.034  -25.794 1.00 46.45  ? 88   GLY B N   1 
ATOM   1799 C CA  . GLY B 1 73  ? -13.876 32.750  -26.770 1.00 41.17  ? 88   GLY B CA  1 
ATOM   1800 C C   . GLY B 1 73  ? -15.291 32.549  -26.270 1.00 39.04  ? 88   GLY B C   1 
ATOM   1801 O O   . GLY B 1 73  ? -16.160 32.185  -27.064 1.00 36.98  ? 88   GLY B O   1 
ATOM   1802 N N   . ASP B 1 74  ? -15.536 32.760  -24.977 1.00 45.09  ? 89   ASP B N   1 
ATOM   1803 C CA  . ASP B 1 74  ? -16.895 32.608  -24.426 1.00 49.55  ? 89   ASP B CA  1 
ATOM   1804 C C   . ASP B 1 74  ? -17.588 33.978  -24.414 1.00 51.28  ? 89   ASP B C   1 
ATOM   1805 O O   . ASP B 1 74  ? -17.718 34.625  -23.370 1.00 48.49  ? 89   ASP B O   1 
ATOM   1806 C CB  . ASP B 1 74  ? -16.863 32.046  -23.002 1.00 45.72  ? 89   ASP B CB  1 
ATOM   1807 C CG  . ASP B 1 74  ? -18.244 31.619  -22.523 1.00 52.27  ? 89   ASP B CG  1 
ATOM   1808 O OD1 . ASP B 1 74  ? -19.202 32.412  -22.669 1.00 54.49  ? 89   ASP B OD1 1 
ATOM   1809 O OD2 . ASP B 1 74  ? -18.377 30.492  -22.001 1.00 46.31  ? 89   ASP B OD2 1 
ATOM   1810 N N   . PHE B 1 75  ? -18.042 34.402  -25.591 1.00 53.97  ? 90   PHE B N   1 
ATOM   1811 C CA  . PHE B 1 75  ? -18.678 35.696  -25.752 1.00 55.65  ? 90   PHE B CA  1 
ATOM   1812 C C   . PHE B 1 75  ? -20.162 35.765  -25.412 1.00 57.41  ? 90   PHE B C   1 
ATOM   1813 O O   . PHE B 1 75  ? -20.823 36.744  -25.751 1.00 59.19  ? 90   PHE B O   1 
ATOM   1814 C CB  . PHE B 1 75  ? -18.430 36.209  -27.177 1.00 53.17  ? 90   PHE B CB  1 
ATOM   1815 C CG  . PHE B 1 75  ? -18.924 35.289  -28.261 1.00 49.72  ? 90   PHE B CG  1 
ATOM   1816 C CD1 . PHE B 1 75  ? -20.281 35.213  -28.570 1.00 50.61  ? 90   PHE B CD1 1 
ATOM   1817 C CD2 . PHE B 1 75  ? -18.026 34.527  -29.003 1.00 48.33  ? 90   PHE B CD2 1 
ATOM   1818 C CE1 . PHE B 1 75  ? -20.735 34.396  -29.603 1.00 45.78  ? 90   PHE B CE1 1 
ATOM   1819 C CE2 . PHE B 1 75  ? -18.469 33.707  -30.039 1.00 46.54  ? 90   PHE B CE2 1 
ATOM   1820 C CZ  . PHE B 1 75  ? -19.827 33.643  -30.339 1.00 47.07  ? 90   PHE B CZ  1 
ATOM   1821 N N   . THR B 1 76  ? -20.687 34.742  -24.740 1.00 57.15  ? 91   THR B N   1 
ATOM   1822 C CA  . THR B 1 76  ? -22.095 34.752  -24.364 1.00 54.44  ? 91   THR B CA  1 
ATOM   1823 C C   . THR B 1 76  ? -22.300 34.708  -22.844 1.00 59.15  ? 91   THR B C   1 
ATOM   1824 O O   . THR B 1 76  ? -23.119 35.460  -22.318 1.00 63.24  ? 91   THR B O   1 
ATOM   1825 C CB  . THR B 1 76  ? -22.878 33.602  -25.051 1.00 50.73  ? 91   THR B CB  1 
ATOM   1826 O OG1 . THR B 1 76  ? -22.473 32.338  -24.517 1.00 57.76  ? 91   THR B OG1 1 
ATOM   1827 C CG2 . THR B 1 76  ? -22.608 33.608  -26.547 1.00 49.72  ? 91   THR B CG2 1 
ATOM   1828 N N   . ASN B 1 77  ? -21.555 33.858  -22.129 1.00 61.94  ? 92   ASN B N   1 
ATOM   1829 C CA  . ASN B 1 77  ? -21.696 33.769  -20.664 1.00 56.85  ? 92   ASN B CA  1 
ATOM   1830 C C   . ASN B 1 77  ? -20.467 34.267  -19.887 1.00 56.80  ? 92   ASN B C   1 
ATOM   1831 O O   . ASN B 1 77  ? -20.549 34.453  -18.676 1.00 59.99  ? 92   ASN B O   1 
ATOM   1832 C CB  . ASN B 1 77  ? -21.998 32.328  -20.205 1.00 54.15  ? 92   ASN B CB  1 
ATOM   1833 C CG  . ASN B 1 77  ? -23.154 31.679  -20.966 1.00 57.43  ? 92   ASN B CG  1 
ATOM   1834 O OD1 . ASN B 1 77  ? -23.702 30.657  -20.541 1.00 59.52  ? 92   ASN B OD1 1 
ATOM   1835 N ND2 . ASN B 1 77  ? -23.512 32.256  -22.101 1.00 58.35  ? 92   ASN B ND2 1 
ATOM   1836 N N   . PHE B 1 78  ? -19.337 34.469  -20.569 1.00 54.01  ? 93   PHE B N   1 
ATOM   1837 C CA  . PHE B 1 78  ? -18.100 34.946  -19.925 1.00 54.71  ? 93   PHE B CA  1 
ATOM   1838 C C   . PHE B 1 78  ? -17.628 34.163  -18.691 1.00 54.10  ? 93   PHE B C   1 
ATOM   1839 O O   . PHE B 1 78  ? -16.955 34.714  -17.820 1.00 52.57  ? 93   PHE B O   1 
ATOM   1840 C CB  . PHE B 1 78  ? -18.234 36.421  -19.527 1.00 54.91  ? 93   PHE B CB  1 
ATOM   1841 C CG  . PHE B 1 78  ? -18.282 37.367  -20.691 1.00 57.75  ? 93   PHE B CG  1 
ATOM   1842 C CD1 . PHE B 1 78  ? -19.336 37.320  -21.602 1.00 58.65  ? 93   PHE B CD1 1 
ATOM   1843 C CD2 . PHE B 1 78  ? -17.265 38.299  -20.884 1.00 55.13  ? 93   PHE B CD2 1 
ATOM   1844 C CE1 . PHE B 1 78  ? -19.378 38.184  -22.689 1.00 53.61  ? 93   PHE B CE1 1 
ATOM   1845 C CE2 . PHE B 1 78  ? -17.294 39.169  -21.966 1.00 51.40  ? 93   PHE B CE2 1 
ATOM   1846 C CZ  . PHE B 1 78  ? -18.353 39.112  -22.873 1.00 55.95  ? 93   PHE B CZ  1 
ATOM   1847 N N   . ASP B 1 79  ? -17.966 32.883  -18.612 1.00 53.90  ? 94   ASP B N   1 
ATOM   1848 C CA  . ASP B 1 79  ? -17.553 32.074  -17.470 1.00 52.05  ? 94   ASP B CA  1 
ATOM   1849 C C   . ASP B 1 79  ? -16.900 30.761  -17.914 1.00 50.16  ? 94   ASP B C   1 
ATOM   1850 O O   . ASP B 1 79  ? -16.231 30.088  -17.134 1.00 44.11  ? 94   ASP B O   1 
ATOM   1851 C CB  . ASP B 1 79  ? -18.764 31.797  -16.568 1.00 53.75  ? 94   ASP B CB  1 
ATOM   1852 C CG  . ASP B 1 79  ? -19.927 31.157  -17.317 1.00 52.31  ? 94   ASP B CG  1 
ATOM   1853 O OD1 . ASP B 1 79  ? -21.031 31.040  -16.736 1.00 58.51  ? 94   ASP B OD1 1 
ATOM   1854 O OD2 . ASP B 1 79  ? -19.743 30.766  -18.482 1.00 50.82  ? 94   ASP B OD2 1 
ATOM   1855 N N   . GLY B 1 80  ? -17.084 30.420  -19.185 1.00 53.80  ? 95   GLY B N   1 
ATOM   1856 C CA  . GLY B 1 80  ? -16.525 29.192  -19.720 1.00 53.64  ? 95   GLY B CA  1 
ATOM   1857 C C   . GLY B 1 80  ? -17.610 28.156  -19.945 1.00 52.52  ? 95   GLY B C   1 
ATOM   1858 O O   . GLY B 1 80  ? -17.329 26.979  -20.134 1.00 54.48  ? 95   GLY B O   1 
ATOM   1859 N N   . THR B 1 81  ? -18.863 28.598  -19.936 1.00 52.49  ? 96   THR B N   1 
ATOM   1860 C CA  . THR B 1 81  ? -19.979 27.693  -20.131 1.00 53.07  ? 96   THR B CA  1 
ATOM   1861 C C   . THR B 1 81  ? -20.711 27.979  -21.433 1.00 54.70  ? 96   THR B C   1 
ATOM   1862 O O   . THR B 1 81  ? -21.507 27.161  -21.893 1.00 55.37  ? 96   THR B O   1 
ATOM   1863 C CB  . THR B 1 81  ? -20.975 27.791  -18.954 1.00 56.34  ? 96   THR B CB  1 
ATOM   1864 O OG1 . THR B 1 81  ? -21.515 29.118  -18.890 1.00 55.01  ? 96   THR B OG1 1 
ATOM   1865 C CG2 . THR B 1 81  ? -20.271 27.471  -17.628 1.00 51.71  ? 96   THR B CG2 1 
ATOM   1866 N N   . GLY B 1 82  ? -20.420 29.125  -22.042 1.00 57.79  ? 97   GLY B N   1 
ATOM   1867 C CA  . GLY B 1 82  ? -21.088 29.493  -23.280 1.00 58.45  ? 97   GLY B CA  1 
ATOM   1868 C C   . GLY B 1 82  ? -20.279 29.501  -24.565 1.00 57.67  ? 97   GLY B C   1 
ATOM   1869 O O   . GLY B 1 82  ? -19.297 28.773  -24.709 1.00 56.17  ? 97   GLY B O   1 
ATOM   1870 N N   . GLY B 1 83  ? -20.714 30.345  -25.499 1.00 59.04  ? 98   GLY B N   1 
ATOM   1871 C CA  . GLY B 1 83  ? -20.073 30.461  -26.795 1.00 57.15  ? 98   GLY B CA  1 
ATOM   1872 C C   . GLY B 1 83  ? -20.863 29.658  -27.809 1.00 56.48  ? 98   GLY B C   1 
ATOM   1873 O O   . GLY B 1 83  ? -21.616 28.769  -27.431 1.00 57.35  ? 98   GLY B O   1 
ATOM   1874 N N   . LYS B 1 84  ? -20.712 29.970  -29.091 1.00 56.40  ? 99   LYS B N   1 
ATOM   1875 C CA  . LYS B 1 84  ? -21.422 29.238  -30.147 1.00 58.63  ? 99   LYS B CA  1 
ATOM   1876 C C   . LYS B 1 84  ? -20.675 29.381  -31.466 1.00 52.57  ? 99   LYS B C   1 
ATOM   1877 O O   . LYS B 1 84  ? -20.001 30.386  -31.696 1.00 50.14  ? 99   LYS B O   1 
ATOM   1878 C CB  . LYS B 1 84  ? -22.867 29.754  -30.309 1.00 64.51  ? 99   LYS B CB  1 
ATOM   1879 C CG  . LYS B 1 84  ? -22.989 31.222  -30.714 1.00 70.27  ? 99   LYS B CG  1 
ATOM   1880 C CD  . LYS B 1 84  ? -24.444 31.669  -30.810 1.00 71.04  ? 99   LYS B CD  1 
ATOM   1881 C CE  . LYS B 1 84  ? -24.542 33.165  -31.111 1.00 77.47  ? 99   LYS B CE  1 
ATOM   1882 N NZ  . LYS B 1 84  ? -25.941 33.680  -31.021 1.00 76.41  ? 99   LYS B NZ  1 
ATOM   1883 N N   . SER B 1 85  ? -20.782 28.376  -32.328 1.00 49.56  ? 100  SER B N   1 
ATOM   1884 C CA  . SER B 1 85  ? -20.102 28.437  -33.616 1.00 52.84  ? 100  SER B CA  1 
ATOM   1885 C C   . SER B 1 85  ? -20.977 29.163  -34.626 1.00 55.31  ? 100  SER B C   1 
ATOM   1886 O O   . SER B 1 85  ? -22.046 29.674  -34.285 1.00 57.80  ? 100  SER B O   1 
ATOM   1887 C CB  . SER B 1 85  ? -19.793 27.038  -34.137 1.00 47.67  ? 100  SER B CB  1 
ATOM   1888 O OG  . SER B 1 85  ? -20.970 26.406  -34.585 1.00 47.07  ? 100  SER B OG  1 
ATOM   1889 N N   . ILE B 1 86  ? -20.512 29.218  -35.868 1.00 55.87  ? 101  ILE B N   1 
ATOM   1890 C CA  . ILE B 1 86  ? -21.260 29.871  -36.930 1.00 53.15  ? 101  ILE B CA  1 
ATOM   1891 C C   . ILE B 1 86  ? -22.204 28.835  -37.551 1.00 57.06  ? 101  ILE B C   1 
ATOM   1892 O O   . ILE B 1 86  ? -23.210 29.185  -38.171 1.00 58.51  ? 101  ILE B O   1 
ATOM   1893 C CB  . ILE B 1 86  ? -20.309 30.431  -37.993 1.00 48.56  ? 101  ILE B CB  1 
ATOM   1894 C CG1 . ILE B 1 86  ? -19.403 29.305  -38.511 1.00 46.32  ? 101  ILE B CG1 1 
ATOM   1895 C CG2 . ILE B 1 86  ? -19.505 31.589  -37.397 1.00 41.41  ? 101  ILE B CG2 1 
ATOM   1896 C CD1 . ILE B 1 86  ? -18.444 29.712  -39.607 1.00 39.69  ? 101  ILE B CD1 1 
ATOM   1897 N N   . TYR B 1 87  ? -21.880 27.559  -37.349 1.00 55.35  ? 102  TYR B N   1 
ATOM   1898 C CA  . TYR B 1 87  ? -22.684 26.456  -37.862 1.00 57.41  ? 102  TYR B CA  1 
ATOM   1899 C C   . TYR B 1 87  ? -23.762 26.037  -36.856 1.00 61.44  ? 102  TYR B C   1 
ATOM   1900 O O   . TYR B 1 87  ? -24.472 25.056  -37.072 1.00 63.74  ? 102  TYR B O   1 
ATOM   1901 C CB  . TYR B 1 87  ? -21.797 25.244  -38.146 1.00 53.26  ? 102  TYR B CB  1 
ATOM   1902 C CG  . TYR B 1 87  ? -20.505 25.563  -38.857 1.00 54.78  ? 102  TYR B CG  1 
ATOM   1903 C CD1 . TYR B 1 87  ? -20.503 26.050  -40.163 1.00 49.85  ? 102  TYR B CD1 1 
ATOM   1904 C CD2 . TYR B 1 87  ? -19.276 25.372  -38.220 1.00 52.75  ? 102  TYR B CD2 1 
ATOM   1905 C CE1 . TYR B 1 87  ? -19.306 26.336  -40.817 1.00 55.59  ? 102  TYR B CE1 1 
ATOM   1906 C CE2 . TYR B 1 87  ? -18.079 25.653  -38.865 1.00 53.89  ? 102  TYR B CE2 1 
ATOM   1907 C CZ  . TYR B 1 87  ? -18.099 26.132  -40.162 1.00 52.70  ? 102  TYR B CZ  1 
ATOM   1908 O OH  . TYR B 1 87  ? -16.915 26.378  -40.806 1.00 54.43  ? 102  TYR B OH  1 
ATOM   1909 N N   . GLY B 1 88  ? -23.881 26.766  -35.754 1.00 63.51  ? 103  GLY B N   1 
ATOM   1910 C CA  . GLY B 1 88  ? -24.872 26.410  -34.755 1.00 67.82  ? 103  GLY B CA  1 
ATOM   1911 C C   . GLY B 1 88  ? -24.254 26.212  -33.384 1.00 72.68  ? 103  GLY B C   1 
ATOM   1912 O O   . GLY B 1 88  ? -23.182 26.746  -33.096 1.00 77.13  ? 103  GLY B O   1 
ATOM   1913 N N   . GLU B 1 89  ? -24.913 25.431  -32.537 1.00 75.50  ? 104  GLU B N   1 
ATOM   1914 C CA  . GLU B 1 89  ? -24.421 25.194  -31.180 1.00 78.12  ? 104  GLU B CA  1 
ATOM   1915 C C   . GLU B 1 89  ? -23.059 24.506  -31.087 1.00 74.94  ? 104  GLU B C   1 
ATOM   1916 O O   . GLU B 1 89  ? -22.155 25.001  -30.412 1.00 77.18  ? 104  GLU B O   1 
ATOM   1917 C CB  . GLU B 1 89  ? -25.444 24.381  -30.381 1.00 83.69  ? 104  GLU B CB  1 
ATOM   1918 C CG  . GLU B 1 89  ? -25.072 24.195  -28.915 1.00 87.47  ? 104  GLU B CG  1 
ATOM   1919 C CD  . GLU B 1 89  ? -26.086 23.364  -28.154 1.00 88.86  ? 104  GLU B CD  1 
ATOM   1920 O OE1 . GLU B 1 89  ? -26.207 22.152  -28.441 1.00 87.31  ? 104  GLU B OE1 1 
ATOM   1921 O OE2 . GLU B 1 89  ? -26.763 23.928  -27.270 1.00 90.00  ? 104  GLU B OE2 1 
ATOM   1922 N N   . LYS B 1 90  ? -22.913 23.366  -31.751 1.00 69.08  ? 105  LYS B N   1 
ATOM   1923 C CA  . LYS B 1 90  ? -21.656 22.631  -31.704 1.00 63.87  ? 105  LYS B CA  1 
ATOM   1924 C C   . LYS B 1 90  ? -21.395 21.891  -33.014 1.00 59.55  ? 105  LYS B C   1 
ATOM   1925 O O   . LYS B 1 90  ? -22.323 21.585  -33.759 1.00 59.76  ? 105  LYS B O   1 
ATOM   1926 C CB  . LYS B 1 90  ? -21.691 21.621  -30.560 1.00 63.78  ? 105  LYS B CB  1 
ATOM   1927 C CG  . LYS B 1 90  ? -22.614 20.448  -30.838 1.00 71.01  ? 105  LYS B CG  1 
ATOM   1928 C CD  . LYS B 1 90  ? -22.608 19.450  -29.705 1.00 76.61  ? 105  LYS B CD  1 
ATOM   1929 C CE  . LYS B 1 90  ? -23.538 18.295  -30.006 1.00 81.76  ? 105  LYS B CE  1 
ATOM   1930 N NZ  . LYS B 1 90  ? -23.580 17.344  -28.866 1.00 87.20  ? 105  LYS B NZ  1 
ATOM   1931 N N   . PHE B 1 91  ? -20.130 21.604  -33.292 1.00 53.31  ? 106  PHE B N   1 
ATOM   1932 C CA  . PHE B 1 91  ? -19.794 20.885  -34.501 1.00 50.98  ? 106  PHE B CA  1 
ATOM   1933 C C   . PHE B 1 91  ? -18.676 19.847  -34.313 1.00 50.98  ? 106  PHE B C   1 
ATOM   1934 O O   . PHE B 1 91  ? -17.841 19.955  -33.417 1.00 51.54  ? 106  PHE B O   1 
ATOM   1935 C CB  . PHE B 1 91  ? -19.456 21.870  -35.631 1.00 45.25  ? 106  PHE B CB  1 
ATOM   1936 C CG  . PHE B 1 91  ? -18.277 22.756  -35.354 1.00 42.96  ? 106  PHE B CG  1 
ATOM   1937 C CD1 . PHE B 1 91  ? -18.403 23.871  -34.532 1.00 40.33  ? 106  PHE B CD1 1 
ATOM   1938 C CD2 . PHE B 1 91  ? -17.045 22.499  -35.956 1.00 38.46  ? 106  PHE B CD2 1 
ATOM   1939 C CE1 . PHE B 1 91  ? -17.321 24.720  -34.316 1.00 41.61  ? 106  PHE B CE1 1 
ATOM   1940 C CE2 . PHE B 1 91  ? -15.956 23.340  -35.747 1.00 40.85  ? 106  PHE B CE2 1 
ATOM   1941 C CZ  . PHE B 1 91  ? -16.093 24.454  -34.926 1.00 41.53  ? 106  PHE B CZ  1 
ATOM   1942 N N   . ALA B 1 92  ? -18.692 18.836  -35.174 1.00 49.58  ? 107  ALA B N   1 
ATOM   1943 C CA  . ALA B 1 92  ? -17.738 17.739  -35.149 1.00 50.98  ? 107  ALA B CA  1 
ATOM   1944 C C   . ALA B 1 92  ? -16.273 18.158  -35.179 1.00 54.05  ? 107  ALA B C   1 
ATOM   1945 O O   . ALA B 1 92  ? -15.935 19.260  -35.611 1.00 56.54  ? 107  ALA B O   1 
ATOM   1946 C CB  . ALA B 1 92  ? -18.022 16.810  -36.318 1.00 50.01  ? 107  ALA B CB  1 
ATOM   1947 N N   . ASP B 1 93  ? -15.409 17.253  -34.721 1.00 52.34  ? 108  ASP B N   1 
ATOM   1948 C CA  . ASP B 1 93  ? -13.970 17.481  -34.709 1.00 45.76  ? 108  ASP B CA  1 
ATOM   1949 C C   . ASP B 1 93  ? -13.465 17.167  -36.110 1.00 48.49  ? 108  ASP B C   1 
ATOM   1950 O O   . ASP B 1 93  ? -13.479 16.019  -36.539 1.00 51.28  ? 108  ASP B O   1 
ATOM   1951 C CB  . ASP B 1 93  ? -13.284 16.556  -33.703 1.00 45.58  ? 108  ASP B CB  1 
ATOM   1952 C CG  . ASP B 1 93  ? -13.825 16.713  -32.291 1.00 49.96  ? 108  ASP B CG  1 
ATOM   1953 O OD1 . ASP B 1 93  ? -13.829 17.846  -31.765 1.00 48.56  ? 108  ASP B OD1 1 
ATOM   1954 O OD2 . ASP B 1 93  ? -14.244 15.694  -31.702 1.00 53.43  ? 108  ASP B OD2 1 
ATOM   1955 N N   . GLU B 1 94  ? -13.021 18.196  -36.815 1.00 50.29  ? 109  GLU B N   1 
ATOM   1956 C CA  . GLU B 1 94  ? -12.534 18.069  -38.180 1.00 51.98  ? 109  GLU B CA  1 
ATOM   1957 C C   . GLU B 1 94  ? -11.315 17.193  -38.372 1.00 57.05  ? 109  GLU B C   1 
ATOM   1958 O O   . GLU B 1 94  ? -11.346 16.210  -39.114 1.00 59.24  ? 109  GLU B O   1 
ATOM   1959 C CB  . GLU B 1 94  ? -12.171 19.440  -38.723 1.00 56.22  ? 109  GLU B CB  1 
ATOM   1960 C CG  . GLU B 1 94  ? -13.159 20.069  -39.634 1.00 55.24  ? 109  GLU B CG  1 
ATOM   1961 C CD  . GLU B 1 94  ? -12.502 21.160  -40.418 1.00 54.37  ? 109  GLU B CD  1 
ATOM   1962 O OE1 . GLU B 1 94  ? -11.822 21.985  -39.784 1.00 52.98  ? 109  GLU B OE1 1 
ATOM   1963 O OE2 . GLU B 1 94  ? -12.654 21.190  -41.654 1.00 58.42  ? 109  GLU B OE2 1 
ATOM   1964 N N   . ASN B 1 95  ? -10.229 17.592  -37.721 1.00 58.74  ? 110  ASN B N   1 
ATOM   1965 C CA  . ASN B 1 95  ? -8.954  16.907  -37.841 1.00 60.45  ? 110  ASN B CA  1 
ATOM   1966 C C   . ASN B 1 95  ? -8.203  16.930  -36.507 1.00 61.81  ? 110  ASN B C   1 
ATOM   1967 O O   . ASN B 1 95  ? -7.850  17.994  -35.998 1.00 62.28  ? 110  ASN B O   1 
ATOM   1968 C CB  . ASN B 1 95  ? -8.163  17.593  -38.966 1.00 59.60  ? 110  ASN B CB  1 
ATOM   1969 C CG  . ASN B 1 95  ? -6.692  17.264  -38.948 1.00 59.76  ? 110  ASN B CG  1 
ATOM   1970 O OD1 . ASN B 1 95  ? -6.301  16.139  -38.653 1.00 67.07  ? 110  ASN B OD1 1 
ATOM   1971 N ND2 . ASN B 1 95  ? -5.863  18.248  -39.284 1.00 58.40  ? 110  ASN B ND2 1 
ATOM   1972 N N   . LEU B 1 96  ? -7.970  15.740  -35.955 1.00 62.79  ? 111  LEU B N   1 
ATOM   1973 C CA  . LEU B 1 96  ? -7.291  15.565  -34.667 1.00 60.25  ? 111  LEU B CA  1 
ATOM   1974 C C   . LEU B 1 96  ? -5.911  14.912  -34.807 1.00 58.66  ? 111  LEU B C   1 
ATOM   1975 O O   . LEU B 1 96  ? -5.451  14.211  -33.903 1.00 60.30  ? 111  LEU B O   1 
ATOM   1976 C CB  . LEU B 1 96  ? -8.162  14.696  -33.752 1.00 55.51  ? 111  LEU B CB  1 
ATOM   1977 C CG  . LEU B 1 96  ? -9.635  15.094  -33.595 1.00 55.94  ? 111  LEU B CG  1 
ATOM   1978 C CD1 . LEU B 1 96  ? -10.415 13.967  -32.929 1.00 50.95  ? 111  LEU B CD1 1 
ATOM   1979 C CD2 . LEU B 1 96  ? -9.735  16.369  -32.779 1.00 51.48  ? 111  LEU B CD2 1 
ATOM   1980 N N   . ASN B 1 97  ? -5.254  15.134  -35.936 1.00 55.31  ? 112  ASN B N   1 
ATOM   1981 C CA  . ASN B 1 97  ? -3.945  14.540  -36.163 1.00 57.15  ? 112  ASN B CA  1 
ATOM   1982 C C   . ASN B 1 97  ? -2.845  15.564  -35.984 1.00 56.19  ? 112  ASN B C   1 
ATOM   1983 O O   . ASN B 1 97  ? -1.666  15.226  -35.928 1.00 57.81  ? 112  ASN B O   1 
ATOM   1984 C CB  . ASN B 1 97  ? -3.889  13.935  -37.564 1.00 63.36  ? 112  ASN B CB  1 
ATOM   1985 C CG  . ASN B 1 97  ? -4.823  12.746  -37.715 1.00 72.16  ? 112  ASN B CG  1 
ATOM   1986 O OD1 . ASN B 1 97  ? -5.250  12.407  -38.822 1.00 76.50  ? 112  ASN B OD1 1 
ATOM   1987 N ND2 . ASN B 1 97  ? -5.138  12.098  -36.597 1.00 77.91  ? 112  ASN B ND2 1 
ATOM   1988 N N   . VAL B 1 98  ? -3.233  16.825  -35.895 1.00 55.18  ? 113  VAL B N   1 
ATOM   1989 C CA  . VAL B 1 98  ? -2.256  17.877  -35.696 1.00 54.64  ? 113  VAL B CA  1 
ATOM   1990 C C   . VAL B 1 98  ? -2.003  17.986  -34.200 1.00 54.74  ? 113  VAL B C   1 
ATOM   1991 O O   . VAL B 1 98  ? -2.916  18.233  -33.413 1.00 53.46  ? 113  VAL B O   1 
ATOM   1992 C CB  . VAL B 1 98  ? -2.766  19.207  -36.257 1.00 55.60  ? 113  VAL B CB  1 
ATOM   1993 C CG1 . VAL B 1 98  ? -1.788  20.328  -35.925 1.00 50.13  ? 113  VAL B CG1 1 
ATOM   1994 C CG2 . VAL B 1 98  ? -2.957  19.072  -37.764 1.00 46.71  ? 113  VAL B CG2 1 
ATOM   1995 N N   . LYS B 1 99  ? -0.752  17.778  -33.817 1.00 55.23  ? 114  LYS B N   1 
ATOM   1996 C CA  . LYS B 1 99  ? -0.363  17.819  -32.419 1.00 54.80  ? 114  LYS B CA  1 
ATOM   1997 C C   . LYS B 1 99  ? -0.215  19.244  -31.915 1.00 55.84  ? 114  LYS B C   1 
ATOM   1998 O O   . LYS B 1 99  ? -0.145  20.193  -32.700 1.00 53.62  ? 114  LYS B O   1 
ATOM   1999 C CB  . LYS B 1 99  ? 0.956   17.065  -32.229 1.00 58.09  ? 114  LYS B CB  1 
ATOM   2000 C CG  . LYS B 1 99  ? 0.927   15.632  -32.743 1.00 60.38  ? 114  LYS B CG  1 
ATOM   2001 C CD  . LYS B 1 99  ? 2.278   14.959  -32.566 1.00 67.73  ? 114  LYS B CD  1 
ATOM   2002 C CE  . LYS B 1 99  ? 2.311   13.586  -33.234 1.00 76.35  ? 114  LYS B CE  1 
ATOM   2003 N NZ  . LYS B 1 99  ? 3.698   13.013  -33.311 1.00 74.93  ? 114  LYS B NZ  1 
ATOM   2004 N N   . HIS B 1 100 ? -0.174  19.382  -30.595 1.00 52.91  ? 115  HIS B N   1 
ATOM   2005 C CA  . HIS B 1 100 ? -0.021  20.684  -29.971 1.00 49.61  ? 115  HIS B CA  1 
ATOM   2006 C C   . HIS B 1 100 ? 1.440   21.081  -29.921 1.00 48.45  ? 115  HIS B C   1 
ATOM   2007 O O   . HIS B 1 100 ? 2.326   20.239  -30.045 1.00 51.29  ? 115  HIS B O   1 
ATOM   2008 C CB  . HIS B 1 100 ? -0.582  20.668  -28.545 1.00 52.87  ? 115  HIS B CB  1 
ATOM   2009 C CG  . HIS B 1 100 ? -2.073  20.617  -28.487 1.00 46.95  ? 115  HIS B CG  1 
ATOM   2010 N ND1 . HIS B 1 100 ? -2.793  19.498  -28.840 1.00 48.24  ? 115  HIS B ND1 1 
ATOM   2011 C CD2 . HIS B 1 100 ? -2.983  21.564  -28.164 1.00 48.20  ? 115  HIS B CD2 1 
ATOM   2012 C CE1 . HIS B 1 100 ? -4.083  19.757  -28.737 1.00 49.00  ? 115  HIS B CE1 1 
ATOM   2013 N NE2 . HIS B 1 100 ? -4.226  21.004  -28.329 1.00 46.78  ? 115  HIS B NE2 1 
ATOM   2014 N N   . PHE B 1 101 ? 1.676   22.374  -29.739 1.00 45.32  ? 116  PHE B N   1 
ATOM   2015 C CA  . PHE B 1 101 ? 3.015   22.927  -29.638 1.00 41.73  ? 116  PHE B CA  1 
ATOM   2016 C C   . PHE B 1 101 ? 2.876   24.270  -28.960 1.00 45.01  ? 116  PHE B C   1 
ATOM   2017 O O   . PHE B 1 101 ? 1.780   24.817  -28.891 1.00 51.24  ? 116  PHE B O   1 
ATOM   2018 C CB  . PHE B 1 101 ? 3.664   23.065  -31.032 1.00 47.37  ? 116  PHE B CB  1 
ATOM   2019 C CG  . PHE B 1 101 ? 2.772   23.689  -32.097 1.00 47.42  ? 116  PHE B CG  1 
ATOM   2020 C CD1 . PHE B 1 101 ? 2.804   25.059  -32.344 1.00 47.65  ? 116  PHE B CD1 1 
ATOM   2021 C CD2 . PHE B 1 101 ? 1.940   22.893  -32.885 1.00 45.01  ? 116  PHE B CD2 1 
ATOM   2022 C CE1 . PHE B 1 101 ? 2.024   25.621  -33.363 1.00 43.70  ? 116  PHE B CE1 1 
ATOM   2023 C CE2 . PHE B 1 101 ? 1.158   23.449  -33.904 1.00 41.70  ? 116  PHE B CE2 1 
ATOM   2024 C CZ  . PHE B 1 101 ? 1.202   24.810  -34.141 1.00 41.01  ? 116  PHE B CZ  1 
ATOM   2025 N N   . VAL B 1 102 ? 3.961   24.800  -28.420 1.00 48.74  ? 117  VAL B N   1 
ATOM   2026 C CA  . VAL B 1 102 ? 3.867   26.092  -27.760 1.00 48.80  ? 117  VAL B CA  1 
ATOM   2027 C C   . VAL B 1 102 ? 3.429   27.092  -28.829 1.00 50.31  ? 117  VAL B C   1 
ATOM   2028 O O   . VAL B 1 102 ? 3.947   27.070  -29.951 1.00 50.98  ? 117  VAL B O   1 
ATOM   2029 C CB  . VAL B 1 102 ? 5.230   26.519  -27.166 1.00 49.74  ? 117  VAL B CB  1 
ATOM   2030 C CG1 . VAL B 1 102 ? 5.042   27.668  -26.176 1.00 44.99  ? 117  VAL B CG1 1 
ATOM   2031 C CG2 . VAL B 1 102 ? 5.890   25.327  -26.488 1.00 51.32  ? 117  VAL B CG2 1 
ATOM   2032 N N   . GLY B 1 103 ? 2.455   27.936  -28.492 1.00 47.00  ? 118  GLY B N   1 
ATOM   2033 C CA  . GLY B 1 103 ? 1.972   28.937  -29.429 1.00 46.70  ? 118  GLY B CA  1 
ATOM   2034 C C   . GLY B 1 103 ? 0.858   28.496  -30.368 1.00 46.74  ? 118  GLY B C   1 
ATOM   2035 O O   . GLY B 1 103 ? 0.452   29.257  -31.249 1.00 45.54  ? 118  GLY B O   1 
ATOM   2036 N N   . ALA B 1 104 ? 0.357   27.278  -30.184 1.00 45.51  ? 119  ALA B N   1 
ATOM   2037 C CA  . ALA B 1 104 ? -0.714  26.750  -31.024 1.00 46.51  ? 119  ALA B CA  1 
ATOM   2038 C C   . ALA B 1 104 ? -2.117  27.147  -30.549 1.00 45.76  ? 119  ALA B C   1 
ATOM   2039 O O   . ALA B 1 104 ? -2.340  27.375  -29.360 1.00 45.58  ? 119  ALA B O   1 
ATOM   2040 C CB  . ALA B 1 104 ? -0.614  25.232  -31.095 1.00 46.28  ? 119  ALA B CB  1 
ATOM   2041 N N   . LEU B 1 105 ? -3.047  27.233  -31.501 1.00 46.83  ? 120  LEU B N   1 
ATOM   2042 C CA  . LEU B 1 105 ? -4.446  27.567  -31.238 1.00 44.56  ? 120  LEU B CA  1 
ATOM   2043 C C   . LEU B 1 105 ? -5.197  26.252  -31.316 1.00 43.68  ? 120  LEU B C   1 
ATOM   2044 O O   . LEU B 1 105 ? -5.111  25.535  -32.315 1.00 42.67  ? 120  LEU B O   1 
ATOM   2045 C CB  . LEU B 1 105 ? -5.010  28.523  -32.301 1.00 46.22  ? 120  LEU B CB  1 
ATOM   2046 C CG  . LEU B 1 105 ? -5.195  29.995  -31.940 1.00 51.33  ? 120  LEU B CG  1 
ATOM   2047 C CD1 . LEU B 1 105 ? -5.922  30.094  -30.612 1.00 56.02  ? 120  LEU B CD1 1 
ATOM   2048 C CD2 . LEU B 1 105 ? -3.850  30.683  -31.841 1.00 57.19  ? 120  LEU B CD2 1 
ATOM   2049 N N   . SER B 1 106 ? -5.947  25.933  -30.273 1.00 39.99  ? 121  SER B N   1 
ATOM   2050 C CA  . SER B 1 106 ? -6.664  24.675  -30.263 1.00 41.05  ? 121  SER B CA  1 
ATOM   2051 C C   . SER B 1 106 ? -8.077  24.893  -29.747 1.00 43.59  ? 121  SER B C   1 
ATOM   2052 O O   . SER B 1 106 ? -8.322  25.830  -28.980 1.00 43.91  ? 121  SER B O   1 
ATOM   2053 C CB  . SER B 1 106 ? -5.902  23.687  -29.379 1.00 35.76  ? 121  SER B CB  1 
ATOM   2054 O OG  . SER B 1 106 ? -6.424  22.385  -29.473 1.00 43.66  ? 121  SER B OG  1 
ATOM   2055 N N   . MET B 1 107 ? -9.006  24.038  -30.171 1.00 38.51  ? 122  MET B N   1 
ATOM   2056 C CA  . MET B 1 107 ? -10.382 24.165  -29.731 1.00 37.98  ? 122  MET B CA  1 
ATOM   2057 C C   . MET B 1 107 ? -10.599 23.558  -28.348 1.00 41.04  ? 122  MET B C   1 
ATOM   2058 O O   . MET B 1 107 ? -10.058 22.497  -28.033 1.00 41.07  ? 122  MET B O   1 
ATOM   2059 C CB  . MET B 1 107 ? -11.346 23.498  -30.731 1.00 41.68  ? 122  MET B CB  1 
ATOM   2060 C CG  . MET B 1 107 ? -11.624 24.277  -32.032 1.00 32.37  ? 122  MET B CG  1 
ATOM   2061 S SD  . MET B 1 107 ? -12.095 26.027  -31.814 1.00 42.14  ? 122  MET B SD  1 
ATOM   2062 C CE  . MET B 1 107 ? -13.810 25.914  -31.324 1.00 36.66  ? 122  MET B CE  1 
ATOM   2063 N N   . ALA B 1 108 ? -11.382 24.258  -27.527 1.00 39.06  ? 123  ALA B N   1 
ATOM   2064 C CA  . ALA B 1 108 ? -11.745 23.807  -26.183 1.00 38.22  ? 123  ALA B CA  1 
ATOM   2065 C C   . ALA B 1 108 ? -13.076 23.098  -26.388 1.00 38.54  ? 123  ALA B C   1 
ATOM   2066 O O   . ALA B 1 108 ? -13.785 23.393  -27.345 1.00 45.51  ? 123  ALA B O   1 
ATOM   2067 C CB  . ALA B 1 108 ? -11.933 25.002  -25.246 1.00 32.60  ? 123  ALA B CB  1 
ATOM   2068 N N   . ASN B 1 109 ? -13.426 22.161  -25.520 1.00 38.36  ? 124  ASN B N   1 
ATOM   2069 C CA  . ASN B 1 109 ? -14.690 21.473  -25.699 1.00 36.76  ? 124  ASN B CA  1 
ATOM   2070 C C   . ASN B 1 109 ? -15.226 20.762  -24.472 1.00 38.77  ? 124  ASN B C   1 
ATOM   2071 O O   . ASN B 1 109 ? -14.767 20.985  -23.361 1.00 45.30  ? 124  ASN B O   1 
ATOM   2072 C CB  . ASN B 1 109 ? -14.593 20.483  -26.860 1.00 38.65  ? 124  ASN B CB  1 
ATOM   2073 C CG  . ASN B 1 109 ? -13.440 19.502  -26.717 1.00 39.34  ? 124  ASN B CG  1 
ATOM   2074 O OD1 . ASN B 1 109 ? -13.231 18.893  -25.664 1.00 34.78  ? 124  ASN B OD1 1 
ATOM   2075 N ND2 . ASN B 1 109 ? -12.698 19.327  -27.801 1.00 40.49  ? 124  ASN B ND2 1 
ATOM   2076 N N   . ALA B 1 110 ? -16.219 19.908  -24.693 1.00 41.67  ? 125  ALA B N   1 
ATOM   2077 C CA  . ALA B 1 110 ? -16.846 19.141  -23.628 1.00 41.30  ? 125  ALA B CA  1 
ATOM   2078 C C   . ALA B 1 110 ? -16.969 17.708  -24.104 1.00 42.12  ? 125  ALA B C   1 
ATOM   2079 O O   . ALA B 1 110 ? -18.039 17.111  -24.043 1.00 46.65  ? 125  ALA B O   1 
ATOM   2080 C CB  . ALA B 1 110 ? -18.224 19.709  -23.317 1.00 36.84  ? 125  ALA B CB  1 
ATOM   2081 N N   . GLY B 1 111 ? -15.865 17.155  -24.587 1.00 43.35  ? 126  GLY B N   1 
ATOM   2082 C CA  . GLY B 1 111 ? -15.893 15.793  -25.077 1.00 42.66  ? 126  GLY B CA  1 
ATOM   2083 C C   . GLY B 1 111 ? -15.917 15.789  -26.589 1.00 39.99  ? 126  GLY B C   1 
ATOM   2084 O O   . GLY B 1 111 ? -15.958 16.851  -27.211 1.00 45.41  ? 126  GLY B O   1 
ATOM   2085 N N   . PRO B 1 112 ? -15.917 14.611  -27.217 1.00 42.54  ? 127  PRO B N   1 
ATOM   2086 C CA  . PRO B 1 112 ? -15.932 14.569  -28.683 1.00 42.02  ? 127  PRO B CA  1 
ATOM   2087 C C   . PRO B 1 112 ? -17.101 15.288  -29.351 1.00 45.88  ? 127  PRO B C   1 
ATOM   2088 O O   . PRO B 1 112 ? -18.230 15.285  -28.847 1.00 48.80  ? 127  PRO B O   1 
ATOM   2089 C CB  . PRO B 1 112 ? -15.885 13.068  -28.990 1.00 36.53  ? 127  PRO B CB  1 
ATOM   2090 C CG  . PRO B 1 112 ? -16.546 12.451  -27.793 1.00 45.51  ? 127  PRO B CG  1 
ATOM   2091 C CD  . PRO B 1 112 ? -16.014 13.258  -26.637 1.00 41.93  ? 127  PRO B CD  1 
ATOM   2092 N N   . ASN B 1 113 ? -16.785 15.929  -30.477 1.00 48.23  ? 128  ASN B N   1 
ATOM   2093 C CA  . ASN B 1 113 ? -17.725 16.664  -31.318 1.00 45.19  ? 128  ASN B CA  1 
ATOM   2094 C C   . ASN B 1 113 ? -18.580 17.720  -30.658 1.00 46.71  ? 128  ASN B C   1 
ATOM   2095 O O   . ASN B 1 113 ? -19.770 17.831  -30.954 1.00 49.42  ? 128  ASN B O   1 
ATOM   2096 C CB  . ASN B 1 113 ? -18.622 15.677  -32.047 1.00 50.28  ? 128  ASN B CB  1 
ATOM   2097 C CG  . ASN B 1 113 ? -17.828 14.638  -32.794 1.00 53.00  ? 128  ASN B CG  1 
ATOM   2098 O OD1 . ASN B 1 113 ? -16.932 14.975  -33.578 1.00 52.13  ? 128  ASN B OD1 1 
ATOM   2099 N ND2 . ASN B 1 113 ? -18.140 13.366  -32.553 1.00 46.83  ? 128  ASN B ND2 1 
ATOM   2100 N N   . THR B 1 114 ? -17.972 18.511  -29.784 1.00 46.86  ? 129  THR B N   1 
ATOM   2101 C CA  . THR B 1 114 ? -18.687 19.570  -29.089 1.00 46.05  ? 129  THR B CA  1 
ATOM   2102 C C   . THR B 1 114 ? -17.990 20.914  -29.263 1.00 42.95  ? 129  THR B C   1 
ATOM   2103 O O   . THR B 1 114 ? -17.949 21.735  -28.344 1.00 39.86  ? 129  THR B O   1 
ATOM   2104 C CB  . THR B 1 114 ? -18.819 19.254  -27.591 1.00 45.70  ? 129  THR B CB  1 
ATOM   2105 O OG1 . THR B 1 114 ? -17.535 18.902  -27.061 1.00 51.47  ? 129  THR B OG1 1 
ATOM   2106 C CG2 . THR B 1 114 ? -19.785 18.105  -27.381 1.00 44.38  ? 129  THR B CG2 1 
ATOM   2107 N N   . ASN B 1 115 ? -17.457 21.133  -30.459 1.00 41.84  ? 130  ASN B N   1 
ATOM   2108 C CA  . ASN B 1 115 ? -16.765 22.374  -30.777 1.00 42.78  ? 130  ASN B CA  1 
ATOM   2109 C C   . ASN B 1 115 ? -17.720 23.573  -30.902 1.00 40.56  ? 130  ASN B C   1 
ATOM   2110 O O   . ASN B 1 115 ? -18.758 23.499  -31.574 1.00 37.16  ? 130  ASN B O   1 
ATOM   2111 C CB  . ASN B 1 115 ? -15.957 22.196  -32.070 1.00 40.51  ? 130  ASN B CB  1 
ATOM   2112 C CG  . ASN B 1 115 ? -14.776 21.248  -31.895 1.00 42.28  ? 130  ASN B CG  1 
ATOM   2113 O OD1 . ASN B 1 115 ? -13.853 21.528  -31.134 1.00 45.24  ? 130  ASN B OD1 1 
ATOM   2114 N ND2 . ASN B 1 115 ? -14.804 20.125  -32.597 1.00 38.93  ? 130  ASN B ND2 1 
ATOM   2115 N N   . GLY B 1 116 ? -17.357 24.675  -30.249 1.00 38.09  ? 131  GLY B N   1 
ATOM   2116 C CA  . GLY B 1 116 ? -18.175 25.877  -30.291 1.00 36.97  ? 131  GLY B CA  1 
ATOM   2117 C C   . GLY B 1 116 ? -17.399 27.110  -30.724 1.00 41.03  ? 131  GLY B C   1 
ATOM   2118 O O   . GLY B 1 116 ? -17.144 27.296  -31.913 1.00 41.22  ? 131  GLY B O   1 
ATOM   2119 N N   . SER B 1 117 ? -17.023 27.955  -29.765 1.00 41.53  ? 132  SER B N   1 
ATOM   2120 C CA  . SER B 1 117 ? -16.261 29.166  -30.070 1.00 40.67  ? 132  SER B CA  1 
ATOM   2121 C C   . SER B 1 117 ? -15.083 29.339  -29.116 1.00 42.42  ? 132  SER B C   1 
ATOM   2122 O O   . SER B 1 117 ? -14.217 30.199  -29.327 1.00 43.15  ? 132  SER B O   1 
ATOM   2123 C CB  . SER B 1 117 ? -17.151 30.409  -29.985 1.00 40.45  ? 132  SER B CB  1 
ATOM   2124 O OG  . SER B 1 117 ? -17.498 30.704  -28.643 1.00 38.96  ? 132  SER B OG  1 
ATOM   2125 N N   . GLN B 1 118 ? -15.053 28.530  -28.062 1.00 41.79  ? 133  GLN B N   1 
ATOM   2126 C CA  . GLN B 1 118 ? -13.968 28.623  -27.098 1.00 43.31  ? 133  GLN B CA  1 
ATOM   2127 C C   . GLN B 1 118 ? -12.699 27.979  -27.637 1.00 44.25  ? 133  GLN B C   1 
ATOM   2128 O O   . GLN B 1 118 ? -12.722 26.874  -28.187 1.00 42.96  ? 133  GLN B O   1 
ATOM   2129 C CB  . GLN B 1 118 ? -14.369 27.995  -25.763 1.00 40.85  ? 133  GLN B CB  1 
ATOM   2130 C CG  . GLN B 1 118 ? -15.261 28.875  -24.932 1.00 28.73  ? 133  GLN B CG  1 
ATOM   2131 C CD  . GLN B 1 118 ? -15.538 28.273  -23.585 1.00 43.46  ? 133  GLN B CD  1 
ATOM   2132 O OE1 . GLN B 1 118 ? -14.628 28.063  -22.790 1.00 46.35  ? 133  GLN B OE1 1 
ATOM   2133 N NE2 . GLN B 1 118 ? -16.802 27.982  -23.318 1.00 46.24  ? 133  GLN B NE2 1 
ATOM   2134 N N   . PHE B 1 119 ? -11.600 28.704  -27.475 1.00 40.86  ? 134  PHE B N   1 
ATOM   2135 C CA  . PHE B 1 119 ? -10.296 28.281  -27.953 1.00 41.35  ? 134  PHE B CA  1 
ATOM   2136 C C   . PHE B 1 119 ? -9.289  28.501  -26.838 1.00 39.54  ? 134  PHE B C   1 
ATOM   2137 O O   . PHE B 1 119 ? -9.633  29.033  -25.786 1.00 43.51  ? 134  PHE B O   1 
ATOM   2138 C CB  . PHE B 1 119 ? -9.886  29.140  -29.168 1.00 39.57  ? 134  PHE B CB  1 
ATOM   2139 C CG  . PHE B 1 119 ? -9.663  30.598  -28.832 1.00 35.63  ? 134  PHE B CG  1 
ATOM   2140 C CD1 . PHE B 1 119 ? -10.735 31.477  -28.738 1.00 32.85  ? 134  PHE B CD1 1 
ATOM   2141 C CD2 . PHE B 1 119 ? -8.382  31.071  -28.526 1.00 32.64  ? 134  PHE B CD2 1 
ATOM   2142 C CE1 . PHE B 1 119 ? -10.538 32.812  -28.337 1.00 33.13  ? 134  PHE B CE1 1 
ATOM   2143 C CE2 . PHE B 1 119 ? -8.176  32.396  -28.125 1.00 27.19  ? 134  PHE B CE2 1 
ATOM   2144 C CZ  . PHE B 1 119 ? -9.255  33.267  -28.029 1.00 29.75  ? 134  PHE B CZ  1 
ATOM   2145 N N   . PHE B 1 120 ? -8.044  28.098  -27.074 1.00 38.34  ? 135  PHE B N   1 
ATOM   2146 C CA  . PHE B 1 120 ? -6.978  28.320  -26.105 1.00 37.34  ? 135  PHE B CA  1 
ATOM   2147 C C   . PHE B 1 120 ? -5.628  28.359  -26.809 1.00 37.65  ? 135  PHE B C   1 
ATOM   2148 O O   . PHE B 1 120 ? -5.418  27.711  -27.836 1.00 39.70  ? 135  PHE B O   1 
ATOM   2149 C CB  . PHE B 1 120 ? -7.007  27.258  -24.978 1.00 34.08  ? 135  PHE B CB  1 
ATOM   2150 C CG  . PHE B 1 120 ? -6.602  25.871  -25.400 1.00 37.92  ? 135  PHE B CG  1 
ATOM   2151 C CD1 . PHE B 1 120 ? -5.266  25.478  -25.378 1.00 44.85  ? 135  PHE B CD1 1 
ATOM   2152 C CD2 . PHE B 1 120 ? -7.557  24.938  -25.784 1.00 42.50  ? 135  PHE B CD2 1 
ATOM   2153 C CE1 . PHE B 1 120 ? -4.890  24.169  -25.730 1.00 36.94  ? 135  PHE B CE1 1 
ATOM   2154 C CE2 . PHE B 1 120 ? -7.188  23.628  -26.138 1.00 39.96  ? 135  PHE B CE2 1 
ATOM   2155 C CZ  . PHE B 1 120 ? -5.852  23.250  -26.107 1.00 33.97  ? 135  PHE B CZ  1 
ATOM   2156 N N   . ILE B 1 121 ? -4.730  29.175  -26.279 1.00 38.53  ? 136  ILE B N   1 
ATOM   2157 C CA  . ILE B 1 121 ? -3.392  29.294  -26.826 1.00 39.27  ? 136  ILE B CA  1 
ATOM   2158 C C   . ILE B 1 121 ? -2.501  28.694  -25.757 1.00 40.89  ? 136  ILE B C   1 
ATOM   2159 O O   . ILE B 1 121 ? -2.542  29.130  -24.614 1.00 41.29  ? 136  ILE B O   1 
ATOM   2160 C CB  . ILE B 1 121 ? -3.000  30.765  -27.033 1.00 44.30  ? 136  ILE B CB  1 
ATOM   2161 C CG1 . ILE B 1 121 ? -3.946  31.420  -28.042 1.00 44.85  ? 136  ILE B CG1 1 
ATOM   2162 C CG2 . ILE B 1 121 ? -1.546  30.861  -27.505 1.00 45.67  ? 136  ILE B CG2 1 
ATOM   2163 C CD1 . ILE B 1 121 ? -3.655  32.893  -28.261 1.00 49.84  ? 136  ILE B CD1 1 
ATOM   2164 N N   . THR B 1 122 ? -1.707  27.690  -26.116 1.00 43.24  ? 137  THR B N   1 
ATOM   2165 C CA  . THR B 1 122 ? -0.824  27.038  -25.153 1.00 39.26  ? 137  THR B CA  1 
ATOM   2166 C C   . THR B 1 122 ? 0.466   27.825  -24.947 1.00 41.30  ? 137  THR B C   1 
ATOM   2167 O O   . THR B 1 122 ? 0.942   28.485  -25.857 1.00 43.25  ? 137  THR B O   1 
ATOM   2168 C CB  . THR B 1 122 ? -0.476  25.634  -25.623 1.00 36.53  ? 137  THR B CB  1 
ATOM   2169 O OG1 . THR B 1 122 ? 0.415   25.719  -26.736 1.00 43.43  ? 137  THR B OG1 1 
ATOM   2170 C CG2 . THR B 1 122 ? -1.737  24.893  -26.048 1.00 30.00  ? 137  THR B CG2 1 
ATOM   2171 N N   . THR B 1 123 ? 1.024   27.770  -23.742 1.00 44.01  ? 138  THR B N   1 
ATOM   2172 C CA  . THR B 1 123 ? 2.271   28.479  -23.454 1.00 44.87  ? 138  THR B CA  1 
ATOM   2173 C C   . THR B 1 123 ? 3.327   27.487  -23.013 1.00 48.14  ? 138  THR B C   1 
ATOM   2174 O O   . THR B 1 123 ? 4.380   27.864  -22.507 1.00 51.03  ? 138  THR B O   1 
ATOM   2175 C CB  . THR B 1 123 ? 2.096   29.498  -22.334 1.00 41.96  ? 138  THR B CB  1 
ATOM   2176 O OG1 . THR B 1 123 ? 1.338   28.903  -21.279 1.00 47.86  ? 138  THR B OG1 1 
ATOM   2177 C CG2 . THR B 1 123 ? 1.380   30.737  -22.842 1.00 48.58  ? 138  THR B CG2 1 
ATOM   2178 N N   . ALA B 1 124 ? 3.033   26.209  -23.206 1.00 48.40  ? 139  ALA B N   1 
ATOM   2179 C CA  . ALA B 1 124 ? 3.948   25.162  -22.819 1.00 46.44  ? 139  ALA B CA  1 
ATOM   2180 C C   . ALA B 1 124 ? 3.536   23.876  -23.516 1.00 48.29  ? 139  ALA B C   1 
ATOM   2181 O O   . ALA B 1 124 ? 2.472   23.811  -24.139 1.00 44.54  ? 139  ALA B O   1 
ATOM   2182 C CB  . ALA B 1 124 ? 3.913   24.983  -21.309 1.00 44.57  ? 139  ALA B CB  1 
ATOM   2183 N N   . PRO B 1 125 ? 4.387   22.840  -23.440 1.00 51.13  ? 140  PRO B N   1 
ATOM   2184 C CA  . PRO B 1 125 ? 4.088   21.552  -24.073 1.00 53.57  ? 140  PRO B CA  1 
ATOM   2185 C C   . PRO B 1 125 ? 2.868   20.905  -23.422 1.00 55.20  ? 140  PRO B C   1 
ATOM   2186 O O   . PRO B 1 125 ? 2.848   20.664  -22.214 1.00 57.89  ? 140  PRO B O   1 
ATOM   2187 C CB  . PRO B 1 125 ? 5.371   20.746  -23.838 1.00 53.15  ? 140  PRO B CB  1 
ATOM   2188 C CG  . PRO B 1 125 ? 6.431   21.801  -23.802 1.00 51.95  ? 140  PRO B CG  1 
ATOM   2189 C CD  . PRO B 1 125 ? 5.781   22.872  -22.959 1.00 49.89  ? 140  PRO B CD  1 
ATOM   2190 N N   . THR B 1 126 ? 1.851   20.631  -24.228 1.00 54.51  ? 141  THR B N   1 
ATOM   2191 C CA  . THR B 1 126 ? 0.624   20.020  -23.733 1.00 51.35  ? 141  THR B CA  1 
ATOM   2192 C C   . THR B 1 126 ? 0.304   18.790  -24.579 1.00 53.68  ? 141  THR B C   1 
ATOM   2193 O O   . THR B 1 126 ? -0.780  18.689  -25.155 1.00 54.76  ? 141  THR B O   1 
ATOM   2194 C CB  . THR B 1 126 ? -0.555  21.008  -23.829 1.00 47.51  ? 141  THR B CB  1 
ATOM   2195 O OG1 . THR B 1 126 ? -0.794  21.323  -25.203 1.00 52.50  ? 141  THR B OG1 1 
ATOM   2196 C CG2 . THR B 1 126 ? -0.247  22.298  -23.075 1.00 43.38  ? 141  THR B CG2 1 
ATOM   2197 N N   . PRO B 1 127 ? 1.250   17.836  -24.663 1.00 55.45  ? 142  PRO B N   1 
ATOM   2198 C CA  . PRO B 1 127 ? 1.082   16.601  -25.445 1.00 51.08  ? 142  PRO B CA  1 
ATOM   2199 C C   . PRO B 1 127 ? -0.032  15.656  -24.995 1.00 46.93  ? 142  PRO B C   1 
ATOM   2200 O O   . PRO B 1 127 ? -0.525  14.853  -25.781 1.00 45.03  ? 142  PRO B O   1 
ATOM   2201 C CB  . PRO B 1 127 ? 2.460   15.952  -25.358 1.00 51.68  ? 142  PRO B CB  1 
ATOM   2202 C CG  . PRO B 1 127 ? 2.958   16.405  -24.007 1.00 51.83  ? 142  PRO B CG  1 
ATOM   2203 C CD  . PRO B 1 127 ? 2.575   17.862  -24.011 1.00 51.86  ? 142  PRO B CD  1 
ATOM   2204 N N   . TRP B 1 128 ? -0.433  15.748  -23.735 1.00 46.36  ? 143  TRP B N   1 
ATOM   2205 C CA  . TRP B 1 128 ? -1.487  14.877  -23.229 1.00 43.14  ? 143  TRP B CA  1 
ATOM   2206 C C   . TRP B 1 128 ? -2.863  15.267  -23.773 1.00 42.03  ? 143  TRP B C   1 
ATOM   2207 O O   . TRP B 1 128 ? -3.840  14.571  -23.537 1.00 47.33  ? 143  TRP B O   1 
ATOM   2208 C CB  . TRP B 1 128 ? -1.482  14.897  -21.697 1.00 40.97  ? 143  TRP B CB  1 
ATOM   2209 C CG  . TRP B 1 128 ? -1.809  16.218  -21.132 1.00 41.76  ? 143  TRP B CG  1 
ATOM   2210 C CD1 . TRP B 1 128 ? -3.055  16.733  -20.922 1.00 39.87  ? 143  TRP B CD1 1 
ATOM   2211 C CD2 . TRP B 1 128 ? -0.882  17.240  -20.765 1.00 40.52  ? 143  TRP B CD2 1 
ATOM   2212 N NE1 . TRP B 1 128 ? -2.960  18.016  -20.449 1.00 42.55  ? 143  TRP B NE1 1 
ATOM   2213 C CE2 . TRP B 1 128 ? -1.638  18.355  -20.343 1.00 39.59  ? 143  TRP B CE2 1 
ATOM   2214 C CE3 . TRP B 1 128 ? 0.517   17.324  -20.751 1.00 40.00  ? 143  TRP B CE3 1 
ATOM   2215 C CZ2 . TRP B 1 128 ? -1.042  19.547  -19.909 1.00 41.86  ? 143  TRP B CZ2 1 
ATOM   2216 C CZ3 . TRP B 1 128 ? 1.112   18.511  -20.314 1.00 35.80  ? 143  TRP B CZ3 1 
ATOM   2217 C CH2 . TRP B 1 128 ? 0.328   19.606  -19.901 1.00 41.05  ? 143  TRP B CH2 1 
ATOM   2218 N N   . LEU B 1 129 ? -2.922  16.373  -24.513 1.00 45.97  ? 144  LEU B N   1 
ATOM   2219 C CA  . LEU B 1 129 ? -4.162  16.870  -25.116 1.00 45.61  ? 144  LEU B CA  1 
ATOM   2220 C C   . LEU B 1 129 ? -4.300  16.427  -26.587 1.00 47.11  ? 144  LEU B C   1 
ATOM   2221 O O   . LEU B 1 129 ? -5.373  16.547  -27.191 1.00 44.66  ? 144  LEU B O   1 
ATOM   2222 C CB  . LEU B 1 129 ? -4.208  18.406  -25.045 1.00 43.69  ? 144  LEU B CB  1 
ATOM   2223 C CG  . LEU B 1 129 ? -4.282  19.107  -23.682 1.00 38.31  ? 144  LEU B CG  1 
ATOM   2224 C CD1 . LEU B 1 129 ? -4.381  20.613  -23.876 1.00 35.42  ? 144  LEU B CD1 1 
ATOM   2225 C CD2 . LEU B 1 129 ? -5.491  18.613  -22.914 1.00 39.08  ? 144  LEU B CD2 1 
ATOM   2226 N N   . ASP B 1 130 ? -3.211  15.919  -27.157 1.00 46.74  ? 145  ASP B N   1 
ATOM   2227 C CA  . ASP B 1 130 ? -3.209  15.470  -28.546 1.00 46.05  ? 145  ASP B CA  1 
ATOM   2228 C C   . ASP B 1 130 ? -4.277  14.417  -28.861 1.00 44.06  ? 145  ASP B C   1 
ATOM   2229 O O   . ASP B 1 130 ? -4.440  13.442  -28.138 1.00 46.84  ? 145  ASP B O   1 
ATOM   2230 C CB  . ASP B 1 130 ? -1.827  14.919  -28.925 1.00 44.11  ? 145  ASP B CB  1 
ATOM   2231 C CG  . ASP B 1 130 ? -0.777  16.005  -29.056 1.00 49.38  ? 145  ASP B CG  1 
ATOM   2232 O OD1 . ASP B 1 130 ? -1.140  17.204  -29.040 1.00 51.30  ? 145  ASP B OD1 1 
ATOM   2233 O OD2 . ASP B 1 130 ? 0.416   15.658  -29.186 1.00 48.05  ? 145  ASP B OD2 1 
ATOM   2234 N N   . GLY B 1 131 ? -4.997  14.620  -29.955 1.00 45.18  ? 146  GLY B N   1 
ATOM   2235 C CA  . GLY B 1 131 ? -6.024  13.679  -30.345 1.00 41.94  ? 146  GLY B CA  1 
ATOM   2236 C C   . GLY B 1 131 ? -7.407  13.968  -29.795 1.00 43.87  ? 146  GLY B C   1 
ATOM   2237 O O   . GLY B 1 131 ? -8.364  13.303  -30.177 1.00 47.45  ? 146  GLY B O   1 
ATOM   2238 N N   . ARG B 1 132 ? -7.532  14.944  -28.900 1.00 44.86  ? 147  ARG B N   1 
ATOM   2239 C CA  . ARG B 1 132 ? -8.845  15.272  -28.336 1.00 45.07  ? 147  ARG B CA  1 
ATOM   2240 C C   . ARG B 1 132 ? -9.242  16.707  -28.658 1.00 43.15  ? 147  ARG B C   1 
ATOM   2241 O O   . ARG B 1 132 ? -10.418 17.059  -28.634 1.00 44.42  ? 147  ARG B O   1 
ATOM   2242 C CB  . ARG B 1 132 ? -8.860  15.092  -26.814 1.00 41.62  ? 147  ARG B CB  1 
ATOM   2243 C CG  . ARG B 1 132 ? -8.346  13.761  -26.327 1.00 48.03  ? 147  ARG B CG  1 
ATOM   2244 C CD  . ARG B 1 132 ? -9.346  13.076  -25.405 1.00 47.67  ? 147  ARG B CD  1 
ATOM   2245 N NE  . ARG B 1 132 ? -8.716  11.984  -24.672 1.00 55.42  ? 147  ARG B NE  1 
ATOM   2246 C CZ  . ARG B 1 132 ? -9.346  10.882  -24.287 1.00 61.48  ? 147  ARG B CZ  1 
ATOM   2247 N NH1 . ARG B 1 132 ? -10.632 10.719  -24.571 1.00 64.38  ? 147  ARG B NH1 1 
ATOM   2248 N NH2 . ARG B 1 132 ? -8.690  9.944   -23.617 1.00 62.83  ? 147  ARG B NH2 1 
ATOM   2249 N N   . HIS B 1 133 ? -8.258  17.537  -28.961 1.00 42.75  ? 148  HIS B N   1 
ATOM   2250 C CA  . HIS B 1 133 ? -8.528  18.928  -29.272 1.00 42.28  ? 148  HIS B CA  1 
ATOM   2251 C C   . HIS B 1 133 ? -7.982  19.250  -30.655 1.00 43.19  ? 148  HIS B C   1 
ATOM   2252 O O   . HIS B 1 133 ? -6.841  18.902  -30.970 1.00 47.60  ? 148  HIS B O   1 
ATOM   2253 C CB  . HIS B 1 133 ? -7.893  19.802  -28.192 1.00 37.31  ? 148  HIS B CB  1 
ATOM   2254 C CG  . HIS B 1 133 ? -8.514  19.613  -26.846 1.00 41.63  ? 148  HIS B CG  1 
ATOM   2255 N ND1 . HIS B 1 133 ? -9.615  20.331  -26.428 1.00 42.83  ? 148  HIS B ND1 1 
ATOM   2256 C CD2 . HIS B 1 133 ? -8.262  18.710  -25.868 1.00 39.82  ? 148  HIS B CD2 1 
ATOM   2257 C CE1 . HIS B 1 133 ? -10.015 19.874  -25.255 1.00 41.77  ? 148  HIS B CE1 1 
ATOM   2258 N NE2 . HIS B 1 133 ? -9.213  18.889  -24.894 1.00 32.76  ? 148  HIS B NE2 1 
ATOM   2259 N N   . VAL B 1 134 ? -8.811  19.891  -31.482 1.00 43.22  ? 149  VAL B N   1 
ATOM   2260 C CA  . VAL B 1 134 ? -8.429  20.262  -32.851 1.00 41.03  ? 149  VAL B CA  1 
ATOM   2261 C C   . VAL B 1 134 ? -7.516  21.482  -32.882 1.00 43.33  ? 149  VAL B C   1 
ATOM   2262 O O   . VAL B 1 134 ? -7.923  22.583  -32.495 1.00 43.51  ? 149  VAL B O   1 
ATOM   2263 C CB  . VAL B 1 134 ? -9.675  20.571  -33.729 1.00 40.43  ? 149  VAL B CB  1 
ATOM   2264 C CG1 . VAL B 1 134 ? -9.249  20.951  -35.132 1.00 41.96  ? 149  VAL B CG1 1 
ATOM   2265 C CG2 . VAL B 1 134 ? -10.597 19.368  -33.783 1.00 35.28  ? 149  VAL B CG2 1 
ATOM   2266 N N   . VAL B 1 135 ? -6.274  21.275  -33.321 1.00 47.41  ? 150  VAL B N   1 
ATOM   2267 C CA  . VAL B 1 135 ? -5.291  22.356  -33.433 1.00 40.68  ? 150  VAL B CA  1 
ATOM   2268 C C   . VAL B 1 135 ? -5.524  22.995  -34.787 1.00 42.27  ? 150  VAL B C   1 
ATOM   2269 O O   . VAL B 1 135 ? -5.555  22.286  -35.804 1.00 44.12  ? 150  VAL B O   1 
ATOM   2270 C CB  . VAL B 1 135 ? -3.865  21.820  -33.389 1.00 38.86  ? 150  VAL B CB  1 
ATOM   2271 C CG1 . VAL B 1 135 ? -2.875  22.978  -33.455 1.00 42.37  ? 150  VAL B CG1 1 
ATOM   2272 C CG2 . VAL B 1 135 ? -3.665  20.999  -32.123 1.00 28.96  ? 150  VAL B CG2 1 
ATOM   2273 N N   . PHE B 1 136 ? -5.691  24.319  -34.804 1.00 40.85  ? 151  PHE B N   1 
ATOM   2274 C CA  . PHE B 1 136 ? -5.958  25.023  -36.050 1.00 40.30  ? 151  PHE B CA  1 
ATOM   2275 C C   . PHE B 1 136 ? -5.176  26.297  -36.309 1.00 44.73  ? 151  PHE B C   1 
ATOM   2276 O O   . PHE B 1 136 ? -5.629  27.148  -37.080 1.00 49.97  ? 151  PHE B O   1 
ATOM   2277 C CB  . PHE B 1 136 ? -7.448  25.350  -36.160 1.00 42.89  ? 151  PHE B CB  1 
ATOM   2278 C CG  . PHE B 1 136 ? -7.944  26.289  -35.103 1.00 37.85  ? 151  PHE B CG  1 
ATOM   2279 C CD1 . PHE B 1 136 ? -8.277  25.817  -33.833 1.00 41.57  ? 151  PHE B CD1 1 
ATOM   2280 C CD2 . PHE B 1 136 ? -8.065  27.647  -35.367 1.00 33.16  ? 151  PHE B CD2 1 
ATOM   2281 C CE1 . PHE B 1 136 ? -8.724  26.689  -32.837 1.00 41.05  ? 151  PHE B CE1 1 
ATOM   2282 C CE2 . PHE B 1 136 ? -8.512  28.531  -34.376 1.00 37.42  ? 151  PHE B CE2 1 
ATOM   2283 C CZ  . PHE B 1 136 ? -8.842  28.050  -33.109 1.00 38.22  ? 151  PHE B CZ  1 
ATOM   2284 N N   . GLY B 1 137 ? -4.011  26.447  -35.691 1.00 43.85  ? 152  GLY B N   1 
ATOM   2285 C CA  . GLY B 1 137 ? -3.243  27.650  -35.942 1.00 36.74  ? 152  GLY B CA  1 
ATOM   2286 C C   . GLY B 1 137 ? -2.151  27.915  -34.940 1.00 42.25  ? 152  GLY B C   1 
ATOM   2287 O O   . GLY B 1 137 ? -1.994  27.186  -33.967 1.00 39.59  ? 152  GLY B O   1 
ATOM   2288 N N   . LYS B 1 138 ? -1.369  28.956  -35.192 1.00 47.00  ? 153  LYS B N   1 
ATOM   2289 C CA  . LYS B 1 138 ? -0.308  29.309  -34.276 1.00 49.78  ? 153  LYS B CA  1 
ATOM   2290 C C   . LYS B 1 138 ? -0.137  30.812  -34.188 1.00 49.49  ? 153  LYS B C   1 
ATOM   2291 O O   . LYS B 1 138 ? -0.520  31.546  -35.095 1.00 53.74  ? 153  LYS B O   1 
ATOM   2292 C CB  . LYS B 1 138 ? 1.013   28.638  -34.686 1.00 56.60  ? 153  LYS B CB  1 
ATOM   2293 C CG  . LYS B 1 138 ? 1.757   29.245  -35.852 1.00 57.48  ? 153  LYS B CG  1 
ATOM   2294 C CD  . LYS B 1 138 ? 3.158   28.634  -35.923 1.00 65.21  ? 153  LYS B CD  1 
ATOM   2295 C CE  . LYS B 1 138 ? 4.049   29.305  -36.972 1.00 66.46  ? 153  LYS B CE  1 
ATOM   2296 N NZ  . LYS B 1 138 ? 5.379   28.632  -37.106 1.00 57.42  ? 153  LYS B NZ  1 
ATOM   2297 N N   . VAL B 1 139 ? 0.414   31.263  -33.070 1.00 52.52  ? 154  VAL B N   1 
ATOM   2298 C CA  . VAL B 1 139 ? 0.665   32.679  -32.844 1.00 52.30  ? 154  VAL B CA  1 
ATOM   2299 C C   . VAL B 1 139 ? 1.910   33.059  -33.650 1.00 53.44  ? 154  VAL B C   1 
ATOM   2300 O O   . VAL B 1 139 ? 3.000   32.553  -33.404 1.00 50.62  ? 154  VAL B O   1 
ATOM   2301 C CB  . VAL B 1 139 ? 0.903   32.957  -31.337 1.00 52.22  ? 154  VAL B CB  1 
ATOM   2302 C CG1 . VAL B 1 139 ? 1.282   34.408  -31.116 1.00 45.94  ? 154  VAL B CG1 1 
ATOM   2303 C CG2 . VAL B 1 139 ? -0.351  32.591  -30.543 1.00 48.08  ? 154  VAL B CG2 1 
ATOM   2304 N N   . LEU B 1 140 ? 1.729   33.941  -34.627 1.00 55.07  ? 155  LEU B N   1 
ATOM   2305 C CA  . LEU B 1 140 ? 2.817   34.380  -35.480 1.00 54.02  ? 155  LEU B CA  1 
ATOM   2306 C C   . LEU B 1 140 ? 3.596   35.500  -34.835 1.00 53.76  ? 155  LEU B C   1 
ATOM   2307 O O   . LEU B 1 140 ? 4.810   35.601  -34.997 1.00 60.49  ? 155  LEU B O   1 
ATOM   2308 C CB  . LEU B 1 140 ? 2.266   34.853  -36.821 1.00 58.14  ? 155  LEU B CB  1 
ATOM   2309 C CG  . LEU B 1 140 ? 1.499   33.790  -37.606 1.00 61.22  ? 155  LEU B CG  1 
ATOM   2310 C CD1 . LEU B 1 140 ? 0.962   34.401  -38.896 1.00 59.89  ? 155  LEU B CD1 1 
ATOM   2311 C CD2 . LEU B 1 140 ? 2.418   32.604  -37.891 1.00 58.02  ? 155  LEU B CD2 1 
ATOM   2312 N N   . ASP B 1 141 ? 2.887   36.342  -34.101 1.00 53.01  ? 156  ASP B N   1 
ATOM   2313 C CA  . ASP B 1 141 ? 3.503   37.472  -33.428 1.00 53.46  ? 156  ASP B CA  1 
ATOM   2314 C C   . ASP B 1 141 ? 2.669   37.808  -32.192 1.00 53.63  ? 156  ASP B C   1 
ATOM   2315 O O   . ASP B 1 141 ? 1.461   37.549  -32.155 1.00 50.97  ? 156  ASP B O   1 
ATOM   2316 C CB  . ASP B 1 141 ? 3.529   38.676  -34.376 1.00 53.72  ? 156  ASP B CB  1 
ATOM   2317 C CG  . ASP B 1 141 ? 4.667   39.641  -34.077 1.00 62.59  ? 156  ASP B CG  1 
ATOM   2318 O OD1 . ASP B 1 141 ? 4.837   40.063  -32.910 1.00 58.61  ? 156  ASP B OD1 1 
ATOM   2319 O OD2 . ASP B 1 141 ? 5.397   39.983  -35.029 1.00 67.87  ? 156  ASP B OD2 1 
ATOM   2320 N N   . GLY B 1 142 ? 3.311   38.389  -31.186 1.00 53.75  ? 157  GLY B N   1 
ATOM   2321 C CA  . GLY B 1 142 ? 2.598   38.757  -29.980 1.00 51.50  ? 157  GLY B CA  1 
ATOM   2322 C C   . GLY B 1 142 ? 2.619   37.657  -28.943 1.00 53.69  ? 157  GLY B C   1 
ATOM   2323 O O   . GLY B 1 142 ? 1.748   37.601  -28.066 1.00 52.82  ? 157  GLY B O   1 
ATOM   2324 N N   . MET B 1 143 ? 3.603   36.768  -29.046 1.00 51.13  ? 158  MET B N   1 
ATOM   2325 C CA  . MET B 1 143 ? 3.722   35.689  -28.082 1.00 51.18  ? 158  MET B CA  1 
ATOM   2326 C C   . MET B 1 143 ? 4.153   36.318  -26.771 1.00 51.89  ? 158  MET B C   1 
ATOM   2327 O O   . MET B 1 143 ? 4.009   35.719  -25.707 1.00 56.11  ? 158  MET B O   1 
ATOM   2328 C CB  . MET B 1 143 ? 4.756   34.664  -28.534 1.00 51.24  ? 158  MET B CB  1 
ATOM   2329 C CG  . MET B 1 143 ? 4.741   33.379  -27.721 1.00 54.39  ? 158  MET B CG  1 
ATOM   2330 S SD  . MET B 1 143 ? 3.153   32.491  -27.778 1.00 61.87  ? 158  MET B SD  1 
ATOM   2331 C CE  . MET B 1 143 ? 3.334   31.375  -26.375 1.00 61.34  ? 158  MET B CE  1 
ATOM   2332 N N   . ASP B 1 144 ? 4.693   37.532  -26.858 1.00 54.67  ? 159  ASP B N   1 
ATOM   2333 C CA  . ASP B 1 144 ? 5.119   38.275  -25.676 1.00 58.99  ? 159  ASP B CA  1 
ATOM   2334 C C   . ASP B 1 144 ? 3.858   38.748  -24.958 1.00 55.97  ? 159  ASP B C   1 
ATOM   2335 O O   . ASP B 1 144 ? 3.807   38.808  -23.731 1.00 56.94  ? 159  ASP B O   1 
ATOM   2336 C CB  . ASP B 1 144 ? 5.974   39.486  -26.076 1.00 66.09  ? 159  ASP B CB  1 
ATOM   2337 C CG  . ASP B 1 144 ? 7.308   39.085  -26.705 1.00 79.04  ? 159  ASP B CG  1 
ATOM   2338 O OD1 . ASP B 1 144 ? 8.067   38.319  -26.064 1.00 82.97  ? 159  ASP B OD1 1 
ATOM   2339 O OD2 . ASP B 1 144 ? 7.603   39.538  -27.838 1.00 83.21  ? 159  ASP B OD2 1 
ATOM   2340 N N   . VAL B 1 145 ? 2.840   39.076  -25.746 1.00 56.80  ? 160  VAL B N   1 
ATOM   2341 C CA  . VAL B 1 145 ? 1.553   39.522  -25.227 1.00 56.28  ? 160  VAL B CA  1 
ATOM   2342 C C   . VAL B 1 145 ? 0.829   38.352  -24.559 1.00 56.11  ? 160  VAL B C   1 
ATOM   2343 O O   . VAL B 1 145 ? 0.134   38.528  -23.557 1.00 55.72  ? 160  VAL B O   1 
ATOM   2344 C CB  . VAL B 1 145 ? 0.675   40.085  -26.361 1.00 55.93  ? 160  VAL B CB  1 
ATOM   2345 C CG1 . VAL B 1 145 ? -0.718  40.391  -25.850 1.00 58.63  ? 160  VAL B CG1 1 
ATOM   2346 C CG2 . VAL B 1 145 ? 1.315   41.340  -26.921 1.00 55.27  ? 160  VAL B CG2 1 
ATOM   2347 N N   . VAL B 1 146 ? 1.001   37.160  -25.126 1.00 54.43  ? 161  VAL B N   1 
ATOM   2348 C CA  . VAL B 1 146 ? 0.391   35.949  -24.591 1.00 49.47  ? 161  VAL B CA  1 
ATOM   2349 C C   . VAL B 1 146 ? 1.000   35.598  -23.239 1.00 50.51  ? 161  VAL B C   1 
ATOM   2350 O O   . VAL B 1 146 ? 0.278   35.237  -22.309 1.00 53.30  ? 161  VAL B O   1 
ATOM   2351 C CB  . VAL B 1 146 ? 0.597   34.741  -25.532 1.00 45.95  ? 161  VAL B CB  1 
ATOM   2352 C CG1 . VAL B 1 146 ? 0.157   33.467  -24.849 1.00 41.00  ? 161  VAL B CG1 1 
ATOM   2353 C CG2 . VAL B 1 146 ? -0.177  34.942  -26.808 1.00 49.90  ? 161  VAL B CG2 1 
ATOM   2354 N N   . LEU B 1 147 ? 2.325   35.698  -23.135 1.00 49.72  ? 162  LEU B N   1 
ATOM   2355 C CA  . LEU B 1 147 ? 3.024   35.373  -21.892 1.00 49.00  ? 162  LEU B CA  1 
ATOM   2356 C C   . LEU B 1 147 ? 2.881   36.478  -20.869 1.00 49.75  ? 162  LEU B C   1 
ATOM   2357 O O   . LEU B 1 147 ? 3.207   36.295  -19.697 1.00 49.60  ? 162  LEU B O   1 
ATOM   2358 C CB  . LEU B 1 147 ? 4.501   35.107  -22.157 1.00 44.73  ? 162  LEU B CB  1 
ATOM   2359 C CG  . LEU B 1 147 ? 4.773   33.910  -23.059 1.00 45.76  ? 162  LEU B CG  1 
ATOM   2360 C CD1 . LEU B 1 147 ? 6.263   33.759  -23.187 1.00 53.43  ? 162  LEU B CD1 1 
ATOM   2361 C CD2 . LEU B 1 147 ? 4.162   32.637  -22.488 1.00 44.53  ? 162  LEU B CD2 1 
ATOM   2362 N N   . ARG B 1 148 ? 2.400   37.629  -21.319 1.00 53.27  ? 163  ARG B N   1 
ATOM   2363 C CA  . ARG B 1 148 ? 2.168   38.749  -20.422 1.00 59.58  ? 163  ARG B CA  1 
ATOM   2364 C C   . ARG B 1 148 ? 0.882   38.432  -19.666 1.00 60.98  ? 163  ARG B C   1 
ATOM   2365 O O   . ARG B 1 148 ? 0.781   38.652  -18.458 1.00 65.14  ? 163  ARG B O   1 
ATOM   2366 C CB  . ARG B 1 148 ? 1.982   40.046  -21.219 1.00 63.34  ? 163  ARG B CB  1 
ATOM   2367 C CG  . ARG B 1 148 ? 1.395   41.193  -20.402 1.00 65.54  ? 163  ARG B CG  1 
ATOM   2368 C CD  . ARG B 1 148 ? 2.399   41.730  -19.401 1.00 73.33  ? 163  ARG B CD  1 
ATOM   2369 N NE  . ARG B 1 148 ? 3.288   42.721  -20.003 1.00 81.95  ? 163  ARG B NE  1 
ATOM   2370 C CZ  . ARG B 1 148 ? 2.919   43.956  -20.335 1.00 86.60  ? 163  ARG B CZ  1 
ATOM   2371 N NH1 . ARG B 1 148 ? 1.670   44.359  -20.122 1.00 88.34  ? 163  ARG B NH1 1 
ATOM   2372 N NH2 . ARG B 1 148 ? 3.798   44.791  -20.874 1.00 86.85  ? 163  ARG B NH2 1 
ATOM   2373 N N   . ILE B 1 149 ? -0.097  37.907  -20.397 1.00 58.96  ? 164  ILE B N   1 
ATOM   2374 C CA  . ILE B 1 149 ? -1.397  37.557  -19.833 1.00 59.86  ? 164  ILE B CA  1 
ATOM   2375 C C   . ILE B 1 149 ? -1.319  36.350  -18.897 1.00 61.11  ? 164  ILE B C   1 
ATOM   2376 O O   . ILE B 1 149 ? -1.982  36.312  -17.856 1.00 64.04  ? 164  ILE B O   1 
ATOM   2377 C CB  . ILE B 1 149 ? -2.415  37.250  -20.959 1.00 58.66  ? 164  ILE B CB  1 
ATOM   2378 C CG1 . ILE B 1 149 ? -2.596  38.486  -21.843 1.00 56.63  ? 164  ILE B CG1 1 
ATOM   2379 C CG2 . ILE B 1 149 ? -3.753  36.827  -20.361 1.00 54.87  ? 164  ILE B CG2 1 
ATOM   2380 C CD1 . ILE B 1 149 ? -3.363  38.227  -23.122 1.00 55.89  ? 164  ILE B CD1 1 
ATOM   2381 N N   . GLU B 1 150 ? -0.502  35.372  -19.273 1.00 52.10  ? 165  GLU B N   1 
ATOM   2382 C CA  . GLU B 1 150 ? -0.345  34.164  -18.484 1.00 51.58  ? 165  GLU B CA  1 
ATOM   2383 C C   . GLU B 1 150 ? 0.100   34.426  -17.044 1.00 51.89  ? 165  GLU B C   1 
ATOM   2384 O O   . GLU B 1 150 ? -0.102  33.568  -16.176 1.00 51.14  ? 165  GLU B O   1 
ATOM   2385 C CB  . GLU B 1 150 ? 0.656   33.222  -19.151 1.00 49.89  ? 165  GLU B CB  1 
ATOM   2386 C CG  . GLU B 1 150 ? 0.904   31.970  -18.343 1.00 50.87  ? 165  GLU B CG  1 
ATOM   2387 C CD  . GLU B 1 150 ? 2.232   31.321  -18.651 1.00 49.73  ? 165  GLU B CD  1 
ATOM   2388 O OE1 . GLU B 1 150 ? 3.253   32.041  -18.679 1.00 48.00  ? 165  GLU B OE1 1 
ATOM   2389 O OE2 . GLU B 1 150 ? 2.257   30.092  -18.849 1.00 52.73  ? 165  GLU B OE2 1 
ATOM   2390 N N   . LYS B 1 151 ? 0.701   35.593  -16.787 1.00 49.56  ? 166  LYS B N   1 
ATOM   2391 C CA  . LYS B 1 151 ? 1.171   35.934  -15.433 1.00 49.39  ? 166  LYS B CA  1 
ATOM   2392 C C   . LYS B 1 151 ? 0.165   36.767  -14.656 1.00 47.28  ? 166  LYS B C   1 
ATOM   2393 O O   . LYS B 1 151 ? 0.246   36.847  -13.425 1.00 46.35  ? 166  LYS B O   1 
ATOM   2394 C CB  . LYS B 1 151 ? 2.472   36.744  -15.454 1.00 49.16  ? 166  LYS B CB  1 
ATOM   2395 C CG  . LYS B 1 151 ? 3.455   36.401  -16.538 1.00 51.57  ? 166  LYS B CG  1 
ATOM   2396 C CD  . LYS B 1 151 ? 4.109   35.057  -16.332 1.00 46.25  ? 166  LYS B CD  1 
ATOM   2397 C CE  . LYS B 1 151 ? 5.076   34.812  -17.476 1.00 45.75  ? 166  LYS B CE  1 
ATOM   2398 N NZ  . LYS B 1 151 ? 5.550   33.401  -17.473 1.00 38.77  ? 166  LYS B NZ  1 
ATOM   2399 N N   . THR B 1 152 ? -0.758  37.411  -15.365 1.00 45.47  ? 167  THR B N   1 
ATOM   2400 C CA  . THR B 1 152 ? -1.755  38.251  -14.704 1.00 48.04  ? 167  THR B CA  1 
ATOM   2401 C C   . THR B 1 152 ? -2.208  37.537  -13.423 1.00 50.30  ? 167  THR B C   1 
ATOM   2402 O O   . THR B 1 152 ? -2.083  36.310  -13.313 1.00 52.61  ? 167  THR B O   1 
ATOM   2403 C CB  . THR B 1 152 ? -2.970  38.517  -15.645 1.00 51.10  ? 167  THR B CB  1 
ATOM   2404 O OG1 . THR B 1 152 ? -3.496  39.825  -15.386 1.00 46.12  ? 167  THR B OG1 1 
ATOM   2405 C CG2 . THR B 1 152 ? -4.079  37.478  -15.437 1.00 48.32  ? 167  THR B CG2 1 
ATOM   2406 N N   . LYS B 1 153 ? -2.712  38.285  -12.445 1.00 51.12  ? 168  LYS B N   1 
ATOM   2407 C CA  . LYS B 1 153 ? -3.151  37.657  -11.200 1.00 56.15  ? 168  LYS B CA  1 
ATOM   2408 C C   . LYS B 1 153 ? -4.569  37.092  -11.301 1.00 57.20  ? 168  LYS B C   1 
ATOM   2409 O O   . LYS B 1 153 ? -5.512  37.795  -11.693 1.00 53.15  ? 168  LYS B O   1 
ATOM   2410 C CB  . LYS B 1 153 ? -3.075  38.644  -10.024 1.00 58.24  ? 168  LYS B CB  1 
ATOM   2411 C CG  . LYS B 1 153 ? -3.454  38.021  -8.683  1.00 60.29  ? 168  LYS B CG  1 
ATOM   2412 C CD  . LYS B 1 153 ? -3.422  39.026  -7.546  1.00 68.37  ? 168  LYS B CD  1 
ATOM   2413 C CE  . LYS B 1 153 ? -3.811  38.364  -6.226  1.00 73.04  ? 168  LYS B CE  1 
ATOM   2414 N NZ  . LYS B 1 153 ? -3.725  39.284  -5.059  1.00 83.62  ? 168  LYS B NZ  1 
ATOM   2415 N N   . THR B 1 154 ? -4.716  35.820  -10.940 1.00 62.32  ? 169  THR B N   1 
ATOM   2416 C CA  . THR B 1 154 ? -6.022  35.179  -10.983 1.00 61.23  ? 169  THR B CA  1 
ATOM   2417 C C   . THR B 1 154 ? -6.458  34.772  -9.573  1.00 60.02  ? 169  THR B C   1 
ATOM   2418 O O   . THR B 1 154 ? -5.728  34.983  -8.605  1.00 63.45  ? 169  THR B O   1 
ATOM   2419 C CB  . THR B 1 154 ? -6.003  33.934  -11.905 1.00 59.91  ? 169  THR B CB  1 
ATOM   2420 O OG1 . THR B 1 154 ? -5.274  32.880  -11.281 1.00 58.07  ? 169  THR B OG1 1 
ATOM   2421 C CG2 . THR B 1 154 ? -5.337  34.263  -13.231 1.00 58.65  ? 169  THR B CG2 1 
ATOM   2422 N N   . ASN B 1 155 ? -7.657  34.214  -9.458  1.00 51.87  ? 170  ASN B N   1 
ATOM   2423 C CA  . ASN B 1 155 ? -8.179  33.766  -8.169  1.00 55.85  ? 170  ASN B CA  1 
ATOM   2424 C C   . ASN B 1 155 ? -8.619  32.313  -8.302  1.00 54.45  ? 170  ASN B C   1 
ATOM   2425 O O   . ASN B 1 155 ? -8.308  31.659  -9.300  1.00 59.58  ? 170  ASN B O   1 
ATOM   2426 C CB  . ASN B 1 155 ? -9.379  34.619  -7.753  1.00 58.86  ? 170  ASN B CB  1 
ATOM   2427 C CG  . ASN B 1 155 ? -10.566 34.445  -8.679  1.00 59.06  ? 170  ASN B CG  1 
ATOM   2428 O OD1 . ASN B 1 155 ? -10.494 33.723  -9.666  1.00 48.88  ? 170  ASN B OD1 1 
ATOM   2429 N ND2 . ASN B 1 155 ? -11.666 35.112  -8.362  1.00 63.54  ? 170  ASN B ND2 1 
ATOM   2430 N N   . SER B 1 156 ? -9.337  31.805  -7.304  1.00 51.59  ? 171  SER B N   1 
ATOM   2431 C CA  . SER B 1 156 ? -9.833  30.436  -7.370  1.00 50.09  ? 171  SER B CA  1 
ATOM   2432 C C   . SER B 1 156 ? -10.429 30.334  -8.766  1.00 55.56  ? 171  SER B C   1 
ATOM   2433 O O   . SER B 1 156 ? -10.789 31.351  -9.359  1.00 63.67  ? 171  SER B O   1 
ATOM   2434 C CB  . SER B 1 156 ? -10.946 30.216  -6.343  1.00 51.07  ? 171  SER B CB  1 
ATOM   2435 O OG  . SER B 1 156 ? -10.599 30.756  -5.084  1.00 49.11  ? 171  SER B OG  1 
ATOM   2436 N N   . HIS B 1 157 ? -10.533 29.134  -9.311  1.00 48.42  ? 172  HIS B N   1 
ATOM   2437 C CA  . HIS B 1 157 ? -11.114 28.988  -10.647 1.00 52.01  ? 172  HIS B CA  1 
ATOM   2438 C C   . HIS B 1 157 ? -10.230 29.549  -11.760 1.00 49.24  ? 172  HIS B C   1 
ATOM   2439 O O   . HIS B 1 157 ? -10.558 29.416  -12.935 1.00 48.89  ? 172  HIS B O   1 
ATOM   2440 C CB  . HIS B 1 157 ? -12.489 29.663  -10.701 1.00 48.97  ? 172  HIS B CB  1 
ATOM   2441 C CG  . HIS B 1 157 ? -13.334 29.393  -9.498  1.00 51.89  ? 172  HIS B CG  1 
ATOM   2442 N ND1 . HIS B 1 157 ? -13.783 30.397  -8.667  1.00 56.69  ? 172  HIS B ND1 1 
ATOM   2443 C CD2 . HIS B 1 157 ? -13.793 28.233  -8.972  1.00 52.40  ? 172  HIS B CD2 1 
ATOM   2444 C CE1 . HIS B 1 157 ? -14.483 29.867  -7.680  1.00 57.78  ? 172  HIS B CE1 1 
ATOM   2445 N NE2 . HIS B 1 157 ? -14.504 28.555  -7.841  1.00 53.98  ? 172  HIS B NE2 1 
ATOM   2446 N N   . ASP B 1 158 ? -9.135  30.203  -11.387 1.00 48.85  ? 173  ASP B N   1 
ATOM   2447 C CA  . ASP B 1 158 ? -8.177  30.730  -12.361 1.00 46.19  ? 173  ASP B CA  1 
ATOM   2448 C C   . ASP B 1 158 ? -8.664  31.833  -13.304 1.00 42.88  ? 173  ASP B C   1 
ATOM   2449 O O   . ASP B 1 158 ? -8.119  32.012  -14.391 1.00 37.23  ? 173  ASP B O   1 
ATOM   2450 C CB  . ASP B 1 158 ? -7.622  29.562  -13.170 1.00 43.76  ? 173  ASP B CB  1 
ATOM   2451 C CG  . ASP B 1 158 ? -7.173  28.427  -12.282 1.00 49.09  ? 173  ASP B CG  1 
ATOM   2452 O OD1 . ASP B 1 158 ? -6.177  28.616  -11.547 1.00 47.07  ? 173  ASP B OD1 1 
ATOM   2453 O OD2 . ASP B 1 158 ? -7.829  27.361  -12.299 1.00 45.22  ? 173  ASP B OD2 1 
ATOM   2454 N N   . ARG B 1 159 ? -9.687  32.567  -12.881 1.00 51.07  ? 174  ARG B N   1 
ATOM   2455 C CA  . ARG B 1 159 ? -10.217 33.673  -13.662 1.00 47.74  ? 174  ARG B CA  1 
ATOM   2456 C C   . ARG B 1 159 ? -9.443  34.941  -13.265 1.00 47.45  ? 174  ARG B C   1 
ATOM   2457 O O   . ARG B 1 159 ? -9.260  35.234  -12.076 1.00 42.66  ? 174  ARG B O   1 
ATOM   2458 C CB  . ARG B 1 159 ? -11.709 33.849  -13.379 1.00 50.86  ? 174  ARG B CB  1 
ATOM   2459 C CG  . ARG B 1 159 ? -12.314 35.036  -14.104 1.00 60.00  ? 174  ARG B CG  1 
ATOM   2460 C CD  . ARG B 1 159 ? -13.772 35.215  -13.785 1.00 64.98  ? 174  ARG B CD  1 
ATOM   2461 N NE  . ARG B 1 159 ? -14.287 36.417  -14.429 1.00 85.25  ? 174  ARG B NE  1 
ATOM   2462 C CZ  . ARG B 1 159 ? -15.563 36.792  -14.418 1.00 93.41  ? 174  ARG B CZ  1 
ATOM   2463 N NH1 . ARG B 1 159 ? -16.472 36.053  -13.789 1.00 99.33  ? 174  ARG B NH1 1 
ATOM   2464 N NH2 . ARG B 1 159 ? -15.933 37.906  -15.042 1.00 93.63  ? 174  ARG B NH2 1 
ATOM   2465 N N   . PRO B 1 160 ? -8.975  35.713  -14.257 1.00 48.42  ? 175  PRO B N   1 
ATOM   2466 C CA  . PRO B 1 160 ? -8.217  36.941  -13.975 1.00 51.46  ? 175  PRO B CA  1 
ATOM   2467 C C   . PRO B 1 160 ? -8.947  37.911  -13.049 1.00 50.62  ? 175  PRO B C   1 
ATOM   2468 O O   . PRO B 1 160 ? -10.140 38.165  -13.231 1.00 49.27  ? 175  PRO B O   1 
ATOM   2469 C CB  . PRO B 1 160 ? -8.003  37.551  -15.365 1.00 50.03  ? 175  PRO B CB  1 
ATOM   2470 C CG  . PRO B 1 160 ? -8.094  36.380  -16.285 1.00 49.94  ? 175  PRO B CG  1 
ATOM   2471 C CD  . PRO B 1 160 ? -9.217  35.569  -15.701 1.00 44.00  ? 175  PRO B CD  1 
ATOM   2472 N N   . VAL B 1 161 ? -8.233  38.450  -12.062 1.00 53.63  ? 176  VAL B N   1 
ATOM   2473 C CA  . VAL B 1 161 ? -8.822  39.429  -11.139 1.00 53.88  ? 176  VAL B CA  1 
ATOM   2474 C C   . VAL B 1 161 ? -9.285  40.610  -11.991 1.00 56.52  ? 176  VAL B C   1 
ATOM   2475 O O   . VAL B 1 161 ? -10.471 40.947  -12.011 1.00 55.26  ? 176  VAL B O   1 
ATOM   2476 C CB  . VAL B 1 161 ? -7.789  39.929  -10.108 1.00 52.60  ? 176  VAL B CB  1 
ATOM   2477 C CG1 . VAL B 1 161 ? -8.361  41.082  -9.309  1.00 53.67  ? 176  VAL B CG1 1 
ATOM   2478 C CG2 . VAL B 1 161 ? -7.392  38.796  -9.185  1.00 49.64  ? 176  VAL B CG2 1 
ATOM   2479 N N   . LYS B 1 162 ? -8.342  41.237  -12.694 1.00 59.88  ? 177  LYS B N   1 
ATOM   2480 C CA  . LYS B 1 162 ? -8.668  42.350  -13.585 1.00 60.49  ? 177  LYS B CA  1 
ATOM   2481 C C   . LYS B 1 162 ? -8.964  41.708  -14.936 1.00 56.51  ? 177  LYS B C   1 
ATOM   2482 O O   . LYS B 1 162 ? -8.192  40.886  -15.420 1.00 55.70  ? 177  LYS B O   1 
ATOM   2483 C CB  . LYS B 1 162 ? -7.481  43.309  -13.735 1.00 66.57  ? 177  LYS B CB  1 
ATOM   2484 C CG  . LYS B 1 162 ? -6.977  43.921  -12.442 1.00 68.13  ? 177  LYS B CG  1 
ATOM   2485 C CD  . LYS B 1 162 ? -7.993  44.855  -11.816 1.00 74.66  ? 177  LYS B CD  1 
ATOM   2486 C CE  . LYS B 1 162 ? -7.438  45.442  -10.522 1.00 80.01  ? 177  LYS B CE  1 
ATOM   2487 N NZ  . LYS B 1 162 ? -8.337  46.465  -9.924  1.00 84.39  ? 177  LYS B NZ  1 
ATOM   2488 N N   . PRO B 1 163 ? -10.087 42.076  -15.562 1.00 56.70  ? 178  PRO B N   1 
ATOM   2489 C CA  . PRO B 1 163 ? -10.516 41.546  -16.864 1.00 58.43  ? 178  PRO B CA  1 
ATOM   2490 C C   . PRO B 1 163 ? -9.543  41.762  -18.018 1.00 58.42  ? 178  PRO B C   1 
ATOM   2491 O O   . PRO B 1 163 ? -9.199  42.904  -18.333 1.00 58.64  ? 178  PRO B O   1 
ATOM   2492 C CB  . PRO B 1 163 ? -11.838 42.267  -17.112 1.00 60.09  ? 178  PRO B CB  1 
ATOM   2493 C CG  . PRO B 1 163 ? -12.340 42.536  -15.726 1.00 58.03  ? 178  PRO B CG  1 
ATOM   2494 C CD  . PRO B 1 163 ? -11.098 42.991  -15.014 1.00 58.23  ? 178  PRO B CD  1 
ATOM   2495 N N   . VAL B 1 164 ? -9.110  40.658  -18.634 1.00 55.68  ? 179  VAL B N   1 
ATOM   2496 C CA  . VAL B 1 164 ? -8.207  40.680  -19.784 1.00 51.23  ? 179  VAL B CA  1 
ATOM   2497 C C   . VAL B 1 164 ? -9.124  40.623  -21.004 1.00 53.69  ? 179  VAL B C   1 
ATOM   2498 O O   . VAL B 1 164 ? -9.547  39.549  -21.425 1.00 52.47  ? 179  VAL B O   1 
ATOM   2499 C CB  . VAL B 1 164 ? -7.284  39.459  -19.787 1.00 50.07  ? 179  VAL B CB  1 
ATOM   2500 C CG1 . VAL B 1 164 ? -6.359  39.504  -20.991 1.00 49.56  ? 179  VAL B CG1 1 
ATOM   2501 C CG2 . VAL B 1 164 ? -6.485  39.420  -18.505 1.00 52.74  ? 179  VAL B CG2 1 
ATOM   2502 N N   . LYS B 1 165 ? -9.414  41.792  -21.567 1.00 54.77  ? 180  LYS B N   1 
ATOM   2503 C CA  . LYS B 1 165 ? -10.342 41.930  -22.686 1.00 55.90  ? 180  LYS B CA  1 
ATOM   2504 C C   . LYS B 1 165 ? -9.737  42.049  -24.084 1.00 53.01  ? 180  LYS B C   1 
ATOM   2505 O O   . LYS B 1 165 ? -8.645  42.587  -24.251 1.00 53.59  ? 180  LYS B O   1 
ATOM   2506 C CB  . LYS B 1 165 ? -11.234 43.150  -22.403 1.00 59.32  ? 180  LYS B CB  1 
ATOM   2507 C CG  . LYS B 1 165 ? -12.350 43.419  -23.397 1.00 65.28  ? 180  LYS B CG  1 
ATOM   2508 C CD  . LYS B 1 165 ? -13.264 44.510  -22.847 1.00 69.56  ? 180  LYS B CD  1 
ATOM   2509 C CE  . LYS B 1 165 ? -14.552 44.658  -23.652 1.00 73.53  ? 180  LYS B CE  1 
ATOM   2510 N NZ  . LYS B 1 165 ? -15.552 45.543  -22.968 1.00 68.12  ? 180  LYS B NZ  1 
ATOM   2511 N N   . ILE B 1 166 ? -10.460 41.529  -25.077 1.00 50.36  ? 181  ILE B N   1 
ATOM   2512 C CA  . ILE B 1 166 ? -10.057 41.597  -26.485 1.00 49.34  ? 181  ILE B CA  1 
ATOM   2513 C C   . ILE B 1 166 ? -10.828 42.793  -27.063 1.00 51.13  ? 181  ILE B C   1 
ATOM   2514 O O   . ILE B 1 166 ? -11.903 42.639  -27.644 1.00 45.90  ? 181  ILE B O   1 
ATOM   2515 C CB  . ILE B 1 166 ? -10.461 40.313  -27.265 1.00 46.56  ? 181  ILE B CB  1 
ATOM   2516 C CG1 . ILE B 1 166 ? -9.749  39.092  -26.679 1.00 46.14  ? 181  ILE B CG1 1 
ATOM   2517 C CG2 . ILE B 1 166 ? -10.103 40.460  -28.743 1.00 41.23  ? 181  ILE B CG2 1 
ATOM   2518 C CD1 . ILE B 1 166 ? -10.084 37.789  -27.396 1.00 39.38  ? 181  ILE B CD1 1 
ATOM   2519 N N   . VAL B 1 167 ? -10.271 43.986  -26.879 1.00 53.65  ? 182  VAL B N   1 
ATOM   2520 C CA  . VAL B 1 167 ? -10.895 45.231  -27.326 1.00 55.71  ? 182  VAL B CA  1 
ATOM   2521 C C   . VAL B 1 167 ? -11.241 45.301  -28.807 1.00 56.58  ? 182  VAL B C   1 
ATOM   2522 O O   . VAL B 1 167 ? -12.138 46.045  -29.204 1.00 57.77  ? 182  VAL B O   1 
ATOM   2523 C CB  . VAL B 1 167 ? -10.006 46.443  -26.985 1.00 56.11  ? 182  VAL B CB  1 
ATOM   2524 C CG1 . VAL B 1 167 ? -9.946  46.634  -25.478 1.00 50.55  ? 182  VAL B CG1 1 
ATOM   2525 C CG2 . VAL B 1 167 ? -8.604  46.242  -27.564 1.00 52.57  ? 182  VAL B CG2 1 
ATOM   2526 N N   . ALA B 1 168 ? -10.523 44.534  -29.618 1.00 56.87  ? 183  ALA B N   1 
ATOM   2527 C CA  . ALA B 1 168 ? -10.755 44.508  -31.055 1.00 51.60  ? 183  ALA B CA  1 
ATOM   2528 C C   . ALA B 1 168 ? -10.016 43.353  -31.733 1.00 49.73  ? 183  ALA B C   1 
ATOM   2529 O O   . ALA B 1 168 ? -8.906  42.969  -31.335 1.00 40.70  ? 183  ALA B O   1 
ATOM   2530 C CB  . ALA B 1 168 ? -10.336 45.831  -31.669 1.00 48.27  ? 183  ALA B CB  1 
ATOM   2531 N N   . SER B 1 169 ? -10.656 42.811  -32.762 1.00 45.73  ? 184  SER B N   1 
ATOM   2532 C CA  . SER B 1 169 ? -10.120 41.701  -33.531 1.00 46.62  ? 184  SER B CA  1 
ATOM   2533 C C   . SER B 1 169 ? -10.531 41.872  -34.978 1.00 50.03  ? 184  SER B C   1 
ATOM   2534 O O   . SER B 1 169 ? -11.360 42.720  -35.314 1.00 50.64  ? 184  SER B O   1 
ATOM   2535 C CB  . SER B 1 169 ? -10.699 40.385  -33.039 1.00 47.86  ? 184  SER B CB  1 
ATOM   2536 O OG  . SER B 1 169 ? -12.098 40.362  -33.280 1.00 47.73  ? 184  SER B OG  1 
ATOM   2537 N N   . GLY B 1 170 ? -9.958  41.041  -35.833 1.00 50.98  ? 185  GLY B N   1 
ATOM   2538 C CA  . GLY B 1 170 ? -10.297 41.110  -37.233 1.00 51.01  ? 185  GLY B CA  1 
ATOM   2539 C C   . GLY B 1 170 ? -9.408  40.230  -38.069 1.00 51.01  ? 185  GLY B C   1 
ATOM   2540 O O   . GLY B 1 170 ? -8.642  39.420  -37.566 1.00 51.23  ? 185  GLY B O   1 
ATOM   2541 N N   . GLU B 1 171 ? -9.520  40.412  -39.370 1.00 53.17  ? 186  GLU B N   1 
ATOM   2542 C CA  . GLU B 1 171 ? -8.739  39.658  -40.324 1.00 53.09  ? 186  GLU B CA  1 
ATOM   2543 C C   . GLU B 1 171 ? -7.564  40.536  -40.779 1.00 51.40  ? 186  GLU B C   1 
ATOM   2544 O O   . GLU B 1 171 ? -7.512  41.725  -40.483 1.00 49.42  ? 186  GLU B O   1 
ATOM   2545 C CB  . GLU B 1 171 ? -9.658  39.289  -41.478 1.00 49.60  ? 186  GLU B CB  1 
ATOM   2546 C CG  . GLU B 1 171 ? -9.114  38.293  -42.424 1.00 55.94  ? 186  GLU B CG  1 
ATOM   2547 C CD  . GLU B 1 171 ? -10.210 37.713  -43.271 1.00 59.18  ? 186  GLU B CD  1 
ATOM   2548 O OE1 . GLU B 1 171 ? -11.243 38.403  -43.432 1.00 57.19  ? 186  GLU B OE1 1 
ATOM   2549 O OE2 . GLU B 1 171 ? -10.034 36.581  -43.772 1.00 61.29  ? 186  GLU B OE2 1 
ATOM   2550 N N   . LEU B 1 172 ? -6.614  39.959  -41.494 1.00 55.28  ? 187  LEU B N   1 
ATOM   2551 C CA  . LEU B 1 172 ? -5.467  40.744  -41.930 1.00 61.03  ? 187  LEU B CA  1 
ATOM   2552 C C   . LEU B 1 172 ? -5.105  40.426  -43.384 1.00 64.08  ? 187  LEU B C   1 
ATOM   2553 O O   . LEU B 1 172 ? -3.904  40.206  -43.654 1.00 67.79  ? 187  LEU B O   1 
ATOM   2554 C CB  . LEU B 1 172 ? -4.277  40.453  -41.003 1.00 61.37  ? 187  LEU B CB  1 
ATOM   2555 C CG  . LEU B 1 172 ? -3.352  41.574  -40.520 1.00 61.24  ? 187  LEU B CG  1 
ATOM   2556 C CD1 . LEU B 1 172 ? -4.158  42.709  -39.891 1.00 59.31  ? 187  LEU B CD1 1 
ATOM   2557 C CD2 . LEU B 1 172 ? -2.377  40.989  -39.509 1.00 56.68  ? 187  LEU B CD2 1 
ATOM   2558 O OXT . LEU B 1 172 ? -6.025  40.410  -44.237 1.00 59.93  ? 187  LEU B OXT 1 
HETATM 2559 N N   . DAL C 2 1   ? 5.226   13.107  19.517  1.00 43.61  ? 1    DAL C N   1 
HETATM 2560 C CA  . DAL C 2 1   ? 4.610   13.211  18.206  1.00 39.22  ? 1    DAL C CA  1 
HETATM 2561 C CB  . DAL C 2 1   ? 3.136   13.488  18.357  1.00 37.27  ? 1    DAL C CB  1 
HETATM 2562 C C   . DAL C 2 1   ? 4.828   11.911  17.445  1.00 41.86  ? 1    DAL C C   1 
HETATM 2563 O O   . DAL C 2 1   ? 4.842   10.826  18.033  1.00 43.80  ? 1    DAL C O   1 
HETATM 2564 N N   . MLE C 2 2   ? 4.998   12.011  16.133  1.00 40.03  ? 2    MLE C N   1 
HETATM 2565 C CN  . MLE C 2 2   ? 4.911   13.197  15.273  1.00 29.09  ? 2    MLE C CN  1 
HETATM 2566 C CA  . MLE C 2 2   ? 5.224   10.813  15.324  1.00 39.60  ? 2    MLE C CA  1 
HETATM 2567 C CB  . MLE C 2 2   ? 3.992   10.529  14.448  1.00 43.77  ? 2    MLE C CB  1 
HETATM 2568 C CG  . MLE C 2 2   ? 2.742   10.090  15.242  1.00 43.70  ? 2    MLE C CG  1 
HETATM 2569 C CD1 . MLE C 2 2   ? 1.615   9.825   14.284  1.00 42.33  ? 2    MLE C CD1 1 
HETATM 2570 C CD2 . MLE C 2 2   ? 3.030   8.829   16.046  1.00 43.13  ? 2    MLE C CD2 1 
HETATM 2571 C C   . MLE C 2 2   ? 6.499   10.890  14.483  1.00 38.76  ? 2    MLE C C   1 
HETATM 2572 O O   . MLE C 2 2   ? 6.463   11.162  13.283  1.00 39.57  ? 2    MLE C O   1 
HETATM 2573 N N   . MLE C 2 3   ? 7.628   10.618  15.130  1.00 38.75  ? 3    MLE C N   1 
HETATM 2574 C CN  . MLE C 2 3   ? 7.765   10.153  16.510  1.00 35.36  ? 3    MLE C CN  1 
HETATM 2575 C CA  . MLE C 2 3   ? 8.938   10.675  14.471  1.00 39.19  ? 3    MLE C CA  1 
HETATM 2576 C CB  . MLE C 2 3   ? 9.811   11.724  15.196  1.00 38.43  ? 3    MLE C CB  1 
HETATM 2577 C CG  . MLE C 2 3   ? 9.338   13.190  15.257  1.00 42.92  ? 3    MLE C CG  1 
HETATM 2578 C CD1 . MLE C 2 3   ? 10.338  14.025  16.051  1.00 41.97  ? 3    MLE C CD1 1 
HETATM 2579 C CD2 . MLE C 2 3   ? 9.179   13.756  13.851  1.00 39.79  ? 3    MLE C CD2 1 
HETATM 2580 C C   . MLE C 2 3   ? 9.710   9.332   14.346  1.00 36.76  ? 3    MLE C C   1 
HETATM 2581 O O   . MLE C 2 3   ? 9.505   8.393   15.119  1.00 38.19  ? 3    MLE C O   1 
HETATM 2582 N N   . MVA C 2 4   ? 10.593  9.243   13.361  1.00 33.34  ? 4    MVA C N   1 
HETATM 2583 C CN  . MVA C 2 4   ? 11.090  10.306  12.487  1.00 28.50  ? 4    MVA C CN  1 
HETATM 2584 C CA  . MVA C 2 4   ? 11.392  8.033   13.203  1.00 38.13  ? 4    MVA C CA  1 
HETATM 2585 C CB  . MVA C 2 4   ? 11.199  7.317   11.816  1.00 38.57  ? 4    MVA C CB  1 
HETATM 2586 C CG1 . MVA C 2 4   ? 11.740  5.910   11.918  1.00 36.12  ? 4    MVA C CG1 1 
HETATM 2587 C CG2 . MVA C 2 4   ? 9.719   7.274   11.404  1.00 44.21  ? 4    MVA C CG2 1 
HETATM 2588 C C   . MVA C 2 4   ? 12.884  8.373   13.359  1.00 37.70  ? 4    MVA C C   1 
HETATM 2589 O O   . MVA C 2 4   ? 13.639  8.422   12.373  1.00 39.60  ? 4    MVA C O   1 
HETATM 2590 N N   . BMT C 2 5   ? 13.310  8.630   14.595  1.00 42.10  ? 5    BMT C N   1 
HETATM 2591 C CN  . BMT C 2 5   ? 12.635  8.274   15.837  1.00 52.21  ? 5    BMT C CN  1 
HETATM 2592 C CA  . BMT C 2 5   ? 14.711  8.961   14.853  1.00 41.58  ? 5    BMT C CA  1 
HETATM 2593 C C   . BMT C 2 5   ? 15.560  7.761   15.276  1.00 44.49  ? 5    BMT C C   1 
HETATM 2594 O O   . BMT C 2 5   ? 15.041  6.664   15.456  1.00 47.70  ? 5    BMT C O   1 
HETATM 2595 C CB  . BMT C 2 5   ? 14.887  10.203  15.759  1.00 33.16  ? 5    BMT C CB  1 
HETATM 2596 O OG1 . BMT C 2 5   ? 14.522  9.884   17.099  1.00 39.73  ? 5    BMT C OG1 1 
HETATM 2597 C CG2 . BMT C 2 5   ? 14.080  11.421  15.299  1.00 36.74  ? 5    BMT C CG2 1 
HETATM 2598 C CD1 . BMT C 2 5   ? 14.358  11.726  13.816  1.00 30.77  ? 5    BMT C CD1 1 
HETATM 2599 C CD2 . BMT C 2 5   ? 14.395  12.618  16.189  1.00 39.19  ? 5    BMT C CD2 1 
HETATM 2600 C CE  . BMT C 2 5   ? 15.872  12.948  16.157  1.00 42.37  ? 5    BMT C CE  1 
HETATM 2601 C CZ  . BMT C 2 5   ? 16.387  13.022  17.443  1.00 41.83  ? 5    BMT C CZ  1 
HETATM 2602 C CH  . BMT C 2 5   ? 17.651  13.812  17.472  1.00 36.01  ? 5    BMT C CH  1 
HETATM 2603 N N   . ABA C 2 6   ? 16.865  7.963   15.404  1.00 43.04  ? 6    ABA C N   1 
HETATM 2604 C CA  . ABA C 2 6   ? 17.768  6.889   15.785  1.00 39.58  ? 6    ABA C CA  1 
HETATM 2605 C C   . ABA C 2 6   ? 18.543  7.310   17.020  1.00 39.79  ? 6    ABA C C   1 
HETATM 2606 O O   . ABA C 2 6   ? 19.618  7.887   16.910  1.00 40.46  ? 6    ABA C O   1 
HETATM 2607 C CB  . ABA C 2 6   ? 18.745  6.627   14.636  1.00 39.98  ? 6    ABA C CB  1 
HETATM 2608 C CG  . ABA C 2 6   ? 18.105  5.966   13.454  1.00 40.83  ? 6    ABA C CG  1 
HETATM 2609 N N   . SAR C 2 7   ? 17.982  7.026   18.190  1.00 39.37  ? 7    SAR C N   1 
HETATM 2610 C CA  . SAR C 2 7   ? 18.645  7.395   19.424  1.00 42.36  ? 7    SAR C CA  1 
HETATM 2611 C C   . SAR C 2 7   ? 17.762  8.042   20.483  1.00 48.42  ? 7    SAR C C   1 
HETATM 2612 O O   . SAR C 2 7   ? 17.588  7.496   21.583  1.00 47.21  ? 7    SAR C O   1 
HETATM 2613 C CN  . SAR C 2 7   ? 16.737  6.320   18.489  1.00 40.66  ? 7    SAR C CN  1 
HETATM 2614 N N   . MLE C 2 8   ? 17.203  9.207   20.175  1.00 49.24  ? 8    MLE C N   1 
HETATM 2615 C CN  . MLE C 2 8   ? 17.664  10.136  19.143  1.00 48.68  ? 8    MLE C CN  1 
HETATM 2616 C CA  . MLE C 2 8   ? 16.340  9.878   21.142  1.00 52.42  ? 8    MLE C CA  1 
HETATM 2617 C CB  . MLE C 2 8   ? 16.373  11.407  20.976  1.00 52.95  ? 8    MLE C CB  1 
HETATM 2618 C CG  . MLE C 2 8   ? 17.068  12.165  22.130  1.00 55.98  ? 8    MLE C CG  1 
HETATM 2619 C CD1 . MLE C 2 8   ? 16.230  12.066  23.394  1.00 59.63  ? 8    MLE C CD1 1 
HETATM 2620 C CD2 . MLE C 2 8   ? 18.449  11.595  22.397  1.00 50.66  ? 8    MLE C CD2 1 
HETATM 2621 C C   . MLE C 2 8   ? 14.896  9.368   21.127  1.00 56.63  ? 8    MLE C C   1 
HETATM 2622 O O   . MLE C 2 8   ? 14.469  8.736   22.092  1.00 66.13  ? 8    MLE C O   1 
ATOM   2623 N N   . VAL C 2 9   ? 14.153  9.597   20.047  1.00 50.49  ? 9    VAL C N   1 
ATOM   2624 C CA  . VAL C 2 9   ? 12.749  9.158   19.989  1.00 44.75  ? 9    VAL C CA  1 
ATOM   2625 C C   . VAL C 2 9   ? 11.984  10.106  20.917  1.00 46.17  ? 9    VAL C C   1 
ATOM   2626 O O   . VAL C 2 9   ? 11.965  9.912   22.138  1.00 43.00  ? 9    VAL C O   1 
ATOM   2627 C CB  . VAL C 2 9   ? 12.541  7.690   20.512  1.00 40.87  ? 9    VAL C CB  1 
ATOM   2628 C CG1 . VAL C 2 9   ? 11.078  7.296   20.396  1.00 32.81  ? 9    VAL C CG1 1 
ATOM   2629 C CG2 . VAL C 2 9   ? 13.394  6.716   19.726  1.00 34.58  ? 9    VAL C CG2 1 
HETATM 2630 N N   . MLE C 2 10  ? 11.342  11.118  20.334  1.00 40.24  ? 10   MLE C N   1 
HETATM 2631 C CN  . MLE C 2 10  ? 10.907  11.197  18.944  1.00 37.85  ? 10   MLE C CN  1 
HETATM 2632 C CA  . MLE C 2 10  ? 10.635  12.112  21.120  1.00 39.58  ? 10   MLE C CA  1 
HETATM 2633 C CB  . MLE C 2 10  ? 11.133  13.508  20.723  1.00 35.46  ? 10   MLE C CB  1 
HETATM 2634 C CG  . MLE C 2 10  ? 12.662  13.619  20.843  1.00 36.62  ? 10   MLE C CG  1 
HETATM 2635 C CD1 . MLE C 2 10  ? 13.196  14.854  20.140  1.00 33.65  ? 10   MLE C CD1 1 
HETATM 2636 C CD2 . MLE C 2 10  ? 13.035  13.629  22.298  1.00 28.74  ? 10   MLE C CD2 1 
HETATM 2637 C C   . MLE C 2 10  ? 9.120   12.030  21.022  1.00 44.09  ? 10   MLE C C   1 
HETATM 2638 O O   . MLE C 2 10  ? 8.569   10.962  20.796  1.00 51.26  ? 10   MLE C O   1 
ATOM   2639 N N   . ALA C 2 11  ? 8.449   13.161  21.210  1.00 45.11  ? 11   ALA C N   1 
ATOM   2640 C CA  . ALA C 2 11  ? 6.996   13.210  21.157  1.00 43.17  ? 11   ALA C CA  1 
ATOM   2641 C C   . ALA C 2 11  ? 6.510   13.377  19.725  1.00 43.47  ? 11   ALA C C   1 
ATOM   2642 O O   . ALA C 2 11  ? 7.275   13.736  18.837  1.00 43.69  ? 11   ALA C O   1 
ATOM   2643 C CB  . ALA C 2 11  ? 6.472   14.355  22.030  1.00 34.96  ? 11   ALA C CB  1 
HETATM 2644 N N   . DAL D 2 1   ? -6.536  17.570  -13.058 1.00 45.24  ? 1    DAL D N   1 
HETATM 2645 C CA  . DAL D 2 1   ? -5.449  17.454  -14.014 1.00 41.64  ? 1    DAL D CA  1 
HETATM 2646 C CB  . DAL D 2 1   ? -4.175  17.118  -13.301 1.00 39.13  ? 1    DAL D CB  1 
HETATM 2647 C C   . DAL D 2 1   ? -5.292  18.757  -14.785 1.00 46.93  ? 1    DAL D C   1 
HETATM 2648 O O   . DAL D 2 1   ? -5.550  19.840  -14.248 1.00 47.82  ? 1    DAL D O   1 
HETATM 2649 N N   . MLE D 2 2   ? -4.864  18.655  -16.043 1.00 46.11  ? 2    MLE D N   1 
HETATM 2650 C CN  . MLE D 2 2   ? -4.607  17.452  -16.848 1.00 36.61  ? 2    MLE D CN  1 
HETATM 2651 C CA  . MLE D 2 2   ? -4.678  19.843  -16.877 1.00 43.27  ? 2    MLE D CA  1 
HETATM 2652 C CB  . MLE D 2 2   ? -3.190  20.032  -17.199 1.00 39.42  ? 2    MLE D CB  1 
HETATM 2653 C CG  . MLE D 2 2   ? -2.326  20.417  -15.990 1.00 36.18  ? 2    MLE D CG  1 
HETATM 2654 C CD1 . MLE D 2 2   ? -0.908  20.636  -16.457 1.00 35.10  ? 2    MLE D CD1 1 
HETATM 2655 C CD2 . MLE D 2 2   ? -2.843  21.686  -15.347 1.00 29.94  ? 2    MLE D CD2 1 
HETATM 2656 C C   . MLE D 2 2   ? -5.485  19.763  -18.167 1.00 44.27  ? 2    MLE D C   1 
HETATM 2657 O O   . MLE D 2 2   ? -4.941  19.495  -19.241 1.00 47.40  ? 2    MLE D O   1 
HETATM 2658 N N   . MLE D 2 3   ? -6.783  20.012  -18.059 1.00 39.64  ? 3    MLE D N   1 
HETATM 2659 C CN  . MLE D 2 3   ? -7.514  20.476  -16.882 1.00 36.22  ? 3    MLE D CN  1 
HETATM 2660 C CA  . MLE D 2 3   ? -7.668  19.953  -19.223 1.00 39.29  ? 3    MLE D CA  1 
HETATM 2661 C CB  . MLE D 2 3   ? -8.824  18.973  -18.938 1.00 39.11  ? 3    MLE D CB  1 
HETATM 2662 C CG  . MLE D 2 3   ? -8.460  17.521  -18.588 1.00 38.85  ? 3    MLE D CG  1 
HETATM 2663 C CD1 . MLE D 2 3   ? -9.721  16.684  -18.523 1.00 37.83  ? 3    MLE D CD1 1 
HETATM 2664 C CD2 . MLE D 2 3   ? -7.508  16.937  -19.627 1.00 31.69  ? 3    MLE D CD2 1 
HETATM 2665 C C   . MLE D 2 3   ? -8.228  21.322  -19.660 1.00 37.25  ? 3    MLE D C   1 
HETATM 2666 O O   . MLE D 2 3   ? -8.124  22.307  -18.933 1.00 39.92  ? 3    MLE D O   1 
HETATM 2667 N N   . MVA D 2 4   ? -8.794  21.398  -20.860 1.00 34.54  ? 4    MVA D N   1 
HETATM 2668 C CN  . MVA D 2 4   ? -8.912  20.380  -21.907 1.00 32.69  ? 4    MVA D CN  1 
HETATM 2669 C CA  . MVA D 2 4   ? -9.395  22.653  -21.309 1.00 34.51  ? 4    MVA D CA  1 
HETATM 2670 C CB  . MVA D 2 4   ? -8.623  23.318  -22.510 1.00 31.76  ? 4    MVA D CB  1 
HETATM 2671 C CG1 . MVA D 2 4   ? -9.133  24.719  -22.694 1.00 32.36  ? 4    MVA D CG1 1 
HETATM 2672 C CG2 . MVA D 2 4   ? -7.102  23.360  -22.250 1.00 36.25  ? 4    MVA D CG2 1 
HETATM 2673 C C   . MVA D 2 4   ? -10.851 22.375  -21.745 1.00 34.02  ? 4    MVA D C   1 
HETATM 2674 O O   . MVA D 2 4   ? -11.150 22.336  -22.940 1.00 33.18  ? 4    MVA D O   1 
HETATM 2675 N N   . BMT D 2 5   ? -11.761 22.173  -20.789 1.00 42.59  ? 5    BMT D N   1 
HETATM 2676 C CN  . BMT D 2 5   ? -11.674 22.628  -19.405 1.00 49.83  ? 5    BMT D CN  1 
HETATM 2677 C CA  . BMT D 2 5   ? -13.159 21.893  -21.137 1.00 40.42  ? 5    BMT D CA  1 
HETATM 2678 C C   . BMT D 2 5   ? -14.074 23.120  -21.174 1.00 43.87  ? 5    BMT D C   1 
HETATM 2679 O O   . BMT D 2 5   ? -13.700 24.218  -20.765 1.00 42.60  ? 5    BMT D O   1 
HETATM 2680 C CB  . BMT D 2 5   ? -13.789 20.746  -20.301 1.00 35.78  ? 5    BMT D CB  1 
HETATM 2681 O OG1 . BMT D 2 5   ? -14.010 21.180  -18.959 1.00 40.00  ? 5    BMT D OG1 1 
HETATM 2682 C CG2 . BMT D 2 5   ? -13.000 19.409  -20.282 1.00 40.14  ? 5    BMT D CG2 1 
HETATM 2683 C CD1 . BMT D 2 5   ? -12.517 19.015  -21.708 1.00 34.11  ? 5    BMT D CD1 1 
HETATM 2684 C CD2 . BMT D 2 5   ? -13.869 18.300  -19.681 1.00 36.42  ? 5    BMT D CD2 1 
HETATM 2685 C CE  . BMT D 2 5   ? -15.203 18.217  -20.396 1.00 36.66  ? 5    BMT D CE  1 
HETATM 2686 C CZ  . BMT D 2 5   ? -16.024 17.249  -19.827 1.00 39.58  ? 5    BMT D CZ  1 
HETATM 2687 C CH  . BMT D 2 5   ? -17.434 17.734  -19.712 1.00 33.91  ? 5    BMT D CH  1 
HETATM 2688 N N   . ABA D 2 6   ? -15.284 22.919  -21.673 1.00 44.45  ? 6    ABA D N   1 
HETATM 2689 C CA  . ABA D 2 6   ? -16.268 23.984  -21.771 1.00 44.16  ? 6    ABA D CA  1 
HETATM 2690 C C   . ABA D 2 6   ? -17.505 23.669  -20.922 1.00 45.84  ? 6    ABA D C   1 
HETATM 2691 O O   . ABA D 2 6   ? -18.509 23.213  -21.460 1.00 44.89  ? 6    ABA D O   1 
HETATM 2692 C CB  . ABA D 2 6   ? -16.682 24.132  -23.235 1.00 39.75  ? 6    ABA D CB  1 
HETATM 2693 C CG  . ABA D 2 6   ? -16.010 25.271  -23.931 1.00 37.57  ? 6    ABA D CG  1 
HETATM 2694 N N   . SAR D 2 7   ? -17.432 23.907  -19.609 1.00 44.35  ? 7    SAR D N   1 
HETATM 2695 C CA  . SAR D 2 7   ? -18.579 23.618  -18.769 1.00 46.71  ? 7    SAR D CA  1 
HETATM 2696 C C   . SAR D 2 7   ? -18.272 22.977  -17.423 1.00 51.32  ? 7    SAR D C   1 
HETATM 2697 O O   . SAR D 2 7   ? -18.494 23.590  -16.371 1.00 50.67  ? 7    SAR D O   1 
HETATM 2698 C CN  . SAR D 2 7   ? -16.461 24.669  -18.820 1.00 38.61  ? 7    SAR D CN  1 
HETATM 2699 N N   . MLE D 2 8   ? -17.786 21.739  -17.431 1.00 50.18  ? 8    MLE D N   1 
HETATM 2700 C CN  . MLE D 2 8   ? -17.660 20.803  -18.550 1.00 41.40  ? 8    MLE D CN  1 
HETATM 2701 C CA  . MLE D 2 8   ? -17.462 21.085  -16.166 1.00 52.36  ? 8    MLE D CA  1 
HETATM 2702 C CB  . MLE D 2 8   ? -17.434 19.557  -16.316 1.00 56.57  ? 8    MLE D CB  1 
HETATM 2703 C CG  . MLE D 2 8   ? -18.503 18.816  -15.490 1.00 65.31  ? 8    MLE D CG  1 
HETATM 2704 C CD1 . MLE D 2 8   ? -18.094 18.779  -14.020 1.00 69.83  ? 8    MLE D CD1 1 
HETATM 2705 C CD2 . MLE D 2 8   ? -19.857 19.504  -15.642 1.00 61.99  ? 8    MLE D CD2 1 
HETATM 2706 C C   . MLE D 2 8   ? -16.150 21.602  -15.546 1.00 55.94  ? 8    MLE D C   1 
HETATM 2707 O O   . MLE D 2 8   ? -16.190 22.262  -14.501 1.00 63.23  ? 8    MLE D O   1 
ATOM   2708 N N   . VAL D 2 9   ? -15.007 21.347  -16.186 1.00 47.45  ? 9    VAL D N   1 
ATOM   2709 C CA  . VAL D 2 9   ? -13.696 21.781  -15.654 1.00 42.48  ? 9    VAL D CA  1 
ATOM   2710 C C   . VAL D 2 9   ? -13.333 20.829  -14.520 1.00 43.76  ? 9    VAL D C   1 
ATOM   2711 O O   . VAL D 2 9   ? -13.802 20.984  -13.388 1.00 41.32  ? 9    VAL D O   1 
ATOM   2712 C CB  . VAL D 2 9   ? -13.718 23.230  -15.098 1.00 37.29  ? 9    VAL D CB  1 
ATOM   2713 C CG1 . VAL D 2 9   ? -12.333 23.624  -14.611 1.00 29.63  ? 9    VAL D CG1 1 
ATOM   2714 C CG2 . VAL D 2 9   ? -14.179 24.195  -16.174 1.00 34.91  ? 9    VAL D CG2 1 
HETATM 2715 N N   . MLE D 2 10  ? -12.477 19.856  -14.823 1.00 41.53  ? 10   MLE D N   1 
HETATM 2716 C CN  . MLE D 2 10  ? -11.627 19.722  -16.005 1.00 35.14  ? 10   MLE D CN  1 
HETATM 2717 C CA  . MLE D 2 10  ? -12.126 18.838  -13.845 1.00 40.79  ? 10   MLE D CA  1 
HETATM 2718 C CB  . MLE D 2 10  ? -12.421 17.459  -14.448 1.00 39.74  ? 10   MLE D CB  1 
HETATM 2719 C CG  . MLE D 2 10  ? -13.862 17.298  -14.964 1.00 36.48  ? 10   MLE D CG  1 
HETATM 2720 C CD1 . MLE D 2 10  ? -14.054 15.959  -15.632 1.00 37.60  ? 10   MLE D CD1 1 
HETATM 2721 C CD2 . MLE D 2 10  ? -14.810 17.440  -13.814 1.00 32.86  ? 10   MLE D CD2 1 
HETATM 2722 C C   . MLE D 2 10  ? -10.728 18.867  -13.250 1.00 43.28  ? 10   MLE D C   1 
HETATM 2723 O O   . MLE D 2 10  ? -10.165 19.929  -13.018 1.00 47.91  ? 10   MLE D O   1 
ATOM   2724 N N   . ALA D 2 11  ? -10.186 17.684  -12.977 1.00 42.76  ? 11   ALA D N   1 
ATOM   2725 C CA  . ALA D 2 11  ? -8.862  17.561  -12.378 1.00 42.98  ? 11   ALA D CA  1 
ATOM   2726 C C   . ALA D 2 11  ? -7.795  17.421  -13.448 1.00 44.57  ? 11   ALA D C   1 
ATOM   2727 O O   . ALA D 2 11  ? -8.101  17.180  -14.609 1.00 50.02  ? 11   ALA D O   1 
ATOM   2728 C CB  . ALA D 2 11  ? -8.829  16.360  -11.443 1.00 37.17  ? 11   ALA D CB  1 
HETATM 2729 O O   . HOH E 3 .   ? 4.431   11.011  -8.420  1.00 58.15  ? 2001 HOH A O   1 
HETATM 2730 O O   . HOH E 3 .   ? 3.813   8.029   -10.164 1.00 53.31  ? 2002 HOH A O   1 
HETATM 2731 O O   . HOH E 3 .   ? 14.798  7.202   -14.675 1.00 52.38  ? 2003 HOH A O   1 
HETATM 2732 O O   . HOH E 3 .   ? 11.227  -17.478 20.758  1.00 55.58  ? 2004 HOH A O   1 
HETATM 2733 O O   . HOH E 3 .   ? 7.699   -10.484 -2.239  1.00 46.08  ? 2005 HOH A O   1 
HETATM 2734 O O   . HOH E 3 .   ? 11.002  -12.838 -5.133  1.00 53.59  ? 2006 HOH A O   1 
HETATM 2735 O O   . HOH E 3 .   ? 15.440  6.413   -9.668  1.00 51.29  ? 2007 HOH A O   1 
HETATM 2736 O O   . HOH E 3 .   ? 13.745  8.438   -11.309 1.00 49.38  ? 2008 HOH A O   1 
HETATM 2737 O O   . HOH E 3 .   ? 27.472  -5.116  4.112   1.00 57.48  ? 2009 HOH A O   1 
HETATM 2738 O O   . HOH E 3 .   ? 17.682  -12.200 15.569  1.00 56.46  ? 2010 HOH A O   1 
HETATM 2739 O O   . HOH E 3 .   ? 8.392   4.682   20.001  1.00 44.75  ? 2011 HOH A O   1 
HETATM 2740 O O   . HOH E 3 .   ? -4.006  3.321   8.688   1.00 55.51  ? 2012 HOH A O   1 
HETATM 2741 O O   . HOH E 3 .   ? 16.392  -4.536  10.363  1.00 46.24  ? 2013 HOH A O   1 
HETATM 2742 O O   . HOH E 3 .   ? 18.141  -5.155  14.819  1.00 60.49  ? 2014 HOH A O   1 
HETATM 2743 O O   . HOH E 3 .   ? 28.077  -4.591  19.444  1.00 41.18  ? 2015 HOH A O   1 
HETATM 2744 O O   . HOH E 3 .   ? 20.134  17.731  5.223   1.00 39.37  ? 2016 HOH A O   1 
HETATM 2745 O O   . HOH E 3 .   ? 19.901  12.653  7.981   1.00 47.08  ? 2017 HOH A O   1 
HETATM 2746 O O   . HOH E 3 .   ? 23.031  15.128  -3.536  1.00 49.24  ? 2018 HOH A O   1 
HETATM 2747 O O   . HOH E 3 .   ? 10.072  16.287  0.040   1.00 55.39  ? 2019 HOH A O   1 
HETATM 2748 O O   . HOH E 3 .   ? 13.005  12.499  -0.345  1.00 35.29  ? 2020 HOH A O   1 
HETATM 2749 O O   . HOH E 3 .   ? 3.408   1.534   -2.360  1.00 46.75  ? 2021 HOH A O   1 
HETATM 2750 O O   . HOH E 3 .   ? 19.687  5.926   9.593   1.00 44.82  ? 2022 HOH A O   1 
HETATM 2751 O O   . HOH E 3 .   ? 17.046  10.937  6.258   1.00 60.20  ? 2023 HOH A O   1 
HETATM 2752 O O   . HOH E 3 .   ? 21.511  6.975   12.199  1.00 47.44  ? 2024 HOH A O   1 
HETATM 2753 O O   . HOH E 3 .   ? -2.167  1.046   7.945   1.00 46.75  ? 2025 HOH A O   1 
HETATM 2754 O O   . HOH E 3 .   ? 3.820   7.478   4.331   1.00 47.34  ? 2026 HOH A O   1 
HETATM 2755 O O   . HOH E 3 .   ? 15.994  18.757  10.585  1.00 43.37  ? 2027 HOH A O   1 
HETATM 2756 O O   . HOH E 3 .   ? 3.069   -6.949  -6.965  1.00 48.69  ? 2028 HOH A O   1 
HETATM 2757 O O   . HOH E 3 .   ? 0.709   -10.335 13.114  1.00 45.49  ? 2029 HOH A O   1 
HETATM 2758 O O   . HOH E 3 .   ? 5.275   2.579   24.996  1.00 49.51  ? 2030 HOH A O   1 
HETATM 2759 O O   . HOH E 3 .   ? 10.916  0.617   20.480  1.00 35.77  ? 2031 HOH A O   1 
HETATM 2760 O O   . HOH E 3 .   ? 3.425   0.357   19.256  1.00 43.09  ? 2032 HOH A O   1 
HETATM 2761 O O   . HOH E 3 .   ? 11.310  -7.279  19.382  1.00 34.80  ? 2033 HOH A O   1 
HETATM 2762 O O   . HOH E 3 .   ? 5.780   -9.492  18.233  1.00 53.04  ? 2034 HOH A O   1 
HETATM 2763 O O   . HOH E 3 .   ? 11.220  -7.633  16.565  1.00 52.03  ? 2035 HOH A O   1 
HETATM 2764 O O   . HOH E 3 .   ? 21.622  -11.616 -2.971  1.00 40.78  ? 2036 HOH A O   1 
HETATM 2765 O O   . HOH F 3 .   ? 3.792   36.009  -40.179 1.00 51.71  ? 2001 HOH B O   1 
HETATM 2766 O O   . HOH F 3 .   ? 2.218   48.015  -21.845 1.00 58.06  ? 2002 HOH B O   1 
HETATM 2767 O O   . HOH F 3 .   ? -8.649  26.039  -47.487 1.00 52.16  ? 2003 HOH B O   1 
HETATM 2768 O O   . HOH F 3 .   ? 0.306   20.182  -43.587 1.00 49.14  ? 2004 HOH B O   1 
HETATM 2769 O O   . HOH F 3 .   ? -3.542  24.275  -44.024 1.00 55.38  ? 2005 HOH B O   1 
HETATM 2770 O O   . HOH F 3 .   ? -10.025 29.440  -43.548 1.00 59.43  ? 2006 HOH B O   1 
HETATM 2771 O O   . HOH F 3 .   ? -13.381 27.400  -34.609 1.00 34.77  ? 2007 HOH B O   1 
HETATM 2772 O O   . HOH F 3 .   ? -18.932 36.821  -36.634 1.00 58.22  ? 2008 HOH B O   1 
HETATM 2773 O O   . HOH F 3 .   ? -17.161 35.656  -44.954 1.00 57.33  ? 2009 HOH B O   1 
HETATM 2774 O O   . HOH F 3 .   ? -20.491 38.859  -29.803 1.00 57.86  ? 2010 HOH B O   1 
HETATM 2775 O O   . HOH F 3 .   ? -15.557 40.413  -33.250 1.00 53.16  ? 2011 HOH B O   1 
HETATM 2776 O O   . HOH F 3 .   ? -14.061 33.854  -22.559 1.00 43.31  ? 2012 HOH B O   1 
HETATM 2777 O O   . HOH F 3 .   ? -4.618  30.597  -12.612 1.00 60.94  ? 2013 HOH B O   1 
HETATM 2778 O O   . HOH F 3 .   ? -15.950 36.198  -22.618 1.00 60.23  ? 2014 HOH B O   1 
HETATM 2779 O O   . HOH F 3 .   ? -14.843 27.524  -16.449 1.00 42.69  ? 2015 HOH B O   1 
HETATM 2780 O O   . HOH F 3 .   ? -13.926 20.670  -35.816 1.00 44.73  ? 2016 HOH B O   1 
HETATM 2781 O O   . HOH F 3 .   ? -14.300 13.212  -32.351 1.00 48.18  ? 2017 HOH B O   1 
HETATM 2782 O O   . HOH F 3 .   ? -12.382 15.573  -41.908 1.00 34.43  ? 2018 HOH B O   1 
HETATM 2783 O O   . HOH F 3 .   ? -5.563  18.820  -34.709 1.00 48.56  ? 2019 HOH B O   1 
HETATM 2784 O O   . HOH F 3 .   ? -15.508 25.128  -28.109 1.00 41.75  ? 2020 HOH B O   1 
HETATM 2785 O O   . HOH F 3 .   ? -15.140 18.292  -29.382 1.00 53.85  ? 2021 HOH B O   1 
HETATM 2786 O O   . HOH F 3 .   ? -17.940 24.422  -26.492 1.00 52.19  ? 2022 HOH B O   1 
HETATM 2787 O O   . HOH F 3 .   ? -17.788 27.492  -27.021 1.00 55.35  ? 2023 HOH B O   1 
HETATM 2788 O O   . HOH F 3 .   ? 3.335   20.253  -26.826 1.00 48.92  ? 2024 HOH B O   1 
HETATM 2789 O O   . HOH F 3 .   ? -5.594  13.190  -25.126 1.00 51.96  ? 2025 HOH B O   1 
HETATM 2790 O O   . HOH F 3 .   ? 6.045   36.337  -37.525 1.00 56.14  ? 2026 HOH B O   1 
HETATM 2791 O O   . HOH F 3 .   ? 6.501   36.379  -31.143 1.00 56.50  ? 2027 HOH B O   1 
HETATM 2792 O O   . HOH F 3 .   ? 5.927   38.930  -29.609 1.00 56.96  ? 2028 HOH B O   1 
HETATM 2793 O O   . HOH F 3 .   ? 9.033   36.188  -28.387 1.00 50.81  ? 2029 HOH B O   1 
HETATM 2794 O O   . HOH F 3 .   ? -1.589  33.865  -13.564 1.00 51.18  ? 2030 HOH B O   1 
HETATM 2795 O O   . HOH F 3 .   ? -3.737  41.152  -11.695 1.00 44.12  ? 2031 HOH B O   1 
HETATM 2796 O O   . HOH F 3 .   ? -12.838 33.714  -9.995  1.00 53.62  ? 2032 HOH B O   1 
HETATM 2797 O O   . HOH F 3 .   ? -12.625 37.477  -8.333  1.00 49.64  ? 2033 HOH B O   1 
HETATM 2798 O O   . HOH F 3 .   ? -8.748  28.096  -7.905  1.00 61.53  ? 2034 HOH B O   1 
HETATM 2799 O O   . HOH F 3 .   ? -9.489  25.967  -13.788 1.00 41.11  ? 2035 HOH B O   1 
HETATM 2800 O O   . HOH F 3 .   ? -13.312 40.245  -14.472 1.00 53.59  ? 2036 HOH B O   1 
HETATM 2801 O O   . HOH F 3 .   ? -10.156 38.560  -18.267 1.00 48.56  ? 2037 HOH B O   1 
HETATM 2802 O O   . HOH F 3 .   ? -13.494 43.899  -33.895 1.00 52.42  ? 2038 HOH B O   1 
HETATM 2803 O O   . HOH F 3 .   ? -3.427  43.549  -43.868 1.00 43.87  ? 2039 HOH B O   1 
HETATM 2804 O O   . HOH G 3 .   ? 6.237   9.902   19.967  1.00 53.73  ? 2001 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   16  ?   ?   ?   A . n 
A 1 2   HIS 2   17  ?   ?   ?   A . n 
A 1 3   HIS 3   18  ?   ?   ?   A . n 
A 1 4   HIS 4   19  ?   ?   ?   A . n 
A 1 5   HIS 5   20  ?   ?   ?   A . n 
A 1 6   HIS 6   21  ?   ?   ?   A . n 
A 1 7   GLU 7   22  22  GLU GLU A . n 
A 1 8   PRO 8   23  23  PRO PRO A . n 
A 1 9   GLU 9   24  24  GLU GLU A . n 
A 1 10  VAL 10  25  25  VAL VAL A . n 
A 1 11  THR 11  26  26  THR THR A . n 
A 1 12  ALA 12  27  27  ALA ALA A . n 
A 1 13  LYS 13  28  28  LYS LYS A . n 
A 1 14  VAL 14  29  29  VAL VAL A . n 
A 1 15  TYR 15  30  30  TYR TYR A . n 
A 1 16  PHE 16  31  31  PHE PHE A . n 
A 1 17  ASP 17  32  32  ASP ASP A . n 
A 1 18  VAL 18  33  33  VAL VAL A . n 
A 1 19  MET 19  34  34  MET MET A . n 
A 1 20  ILE 20  35  35  ILE ILE A . n 
A 1 21  ASP 21  36  36  ASP ASP A . n 
A 1 22  SER 22  37  37  SER SER A . n 
A 1 23  GLU 23  38  38  GLU GLU A . n 
A 1 24  PRO 24  39  39  PRO PRO A . n 
A 1 25  LEU 25  40  40  LEU LEU A . n 
A 1 26  GLY 26  41  41  GLY GLY A . n 
A 1 27  ARG 27  42  42  ARG ARG A . n 
A 1 28  ILE 28  43  43  ILE ILE A . n 
A 1 29  THR 29  44  44  THR THR A . n 
A 1 30  ILE 30  45  45  ILE ILE A . n 
A 1 31  GLY 31  46  46  GLY GLY A . n 
A 1 32  LEU 32  47  47  LEU LEU A . n 
A 1 33  PHE 33  48  48  PHE PHE A . n 
A 1 34  GLY 34  49  49  GLY GLY A . n 
A 1 35  LYS 35  50  50  LYS LYS A . n 
A 1 36  ASP 36  51  51  ASP ASP A . n 
A 1 37  ALA 37  52  52  ALA ALA A . n 
A 1 38  PRO 38  53  53  PRO PRO A . n 
A 1 39  LEU 39  54  54  LEU LEU A . n 
A 1 40  THR 40  55  55  THR THR A . n 
A 1 41  THR 41  56  56  THR THR A . n 
A 1 42  GLU 42  57  57  GLU GLU A . n 
A 1 43  ASN 43  58  58  ASN ASN A . n 
A 1 44  PHE 44  59  59  PHE PHE A . n 
A 1 45  ARG 45  60  60  ARG ARG A . n 
A 1 46  GLN 46  61  61  GLN GLN A . n 
A 1 47  LEU 47  62  62  LEU LEU A . n 
A 1 48  CYS 48  63  63  CYS CYS A . n 
A 1 49  THR 49  64  64  THR THR A . n 
A 1 50  GLY 50  65  65  GLY GLY A . n 
A 1 51  GLU 51  66  66  GLU GLU A . n 
A 1 52  HIS 52  67  67  HIS HIS A . n 
A 1 53  GLY 53  68  68  GLY GLY A . n 
A 1 54  PHE 54  69  69  PHE PHE A . n 
A 1 55  GLY 55  70  70  GLY GLY A . n 
A 1 56  TYR 56  71  71  TYR TYR A . n 
A 1 57  LYS 57  72  72  LYS LYS A . n 
A 1 58  ASP 58  73  73  ASP ASP A . n 
A 1 59  SER 59  74  74  SER SER A . n 
A 1 60  ILE 60  75  75  ILE ILE A . n 
A 1 61  PHE 61  76  76  PHE PHE A . n 
A 1 62  HIS 62  77  77  HIS HIS A . n 
A 1 63  ARG 63  78  78  ARG ARG A . n 
A 1 64  VAL 64  79  79  VAL VAL A . n 
A 1 65  ILE 65  80  80  ILE ILE A . n 
A 1 66  GLN 66  81  81  GLN GLN A . n 
A 1 67  ASN 67  82  82  ASN ASN A . n 
A 1 68  PHE 68  83  83  PHE PHE A . n 
A 1 69  MET 69  84  84  MET MET A . n 
A 1 70  ILE 70  85  85  ILE ILE A . n 
A 1 71  GLN 71  86  86  GLN GLN A . n 
A 1 72  GLY 72  87  87  GLY GLY A . n 
A 1 73  GLY 73  88  88  GLY GLY A . n 
A 1 74  ASP 74  89  89  ASP ASP A . n 
A 1 75  PHE 75  90  90  PHE PHE A . n 
A 1 76  THR 76  91  91  THR THR A . n 
A 1 77  ASN 77  92  92  ASN ASN A . n 
A 1 78  PHE 78  93  93  PHE PHE A . n 
A 1 79  ASP 79  94  94  ASP ASP A . n 
A 1 80  GLY 80  95  95  GLY GLY A . n 
A 1 81  THR 81  96  96  THR THR A . n 
A 1 82  GLY 82  97  97  GLY GLY A . n 
A 1 83  GLY 83  98  98  GLY GLY A . n 
A 1 84  LYS 84  99  99  LYS LYS A . n 
A 1 85  SER 85  100 100 SER SER A . n 
A 1 86  ILE 86  101 101 ILE ILE A . n 
A 1 87  TYR 87  102 102 TYR TYR A . n 
A 1 88  GLY 88  103 103 GLY GLY A . n 
A 1 89  GLU 89  104 104 GLU GLU A . n 
A 1 90  LYS 90  105 105 LYS LYS A . n 
A 1 91  PHE 91  106 106 PHE PHE A . n 
A 1 92  ALA 92  107 107 ALA ALA A . n 
A 1 93  ASP 93  108 108 ASP ASP A . n 
A 1 94  GLU 94  109 109 GLU GLU A . n 
A 1 95  ASN 95  110 110 ASN ASN A . n 
A 1 96  LEU 96  111 111 LEU LEU A . n 
A 1 97  ASN 97  112 112 ASN ASN A . n 
A 1 98  VAL 98  113 113 VAL VAL A . n 
A 1 99  LYS 99  114 114 LYS LYS A . n 
A 1 100 HIS 100 115 115 HIS HIS A . n 
A 1 101 PHE 101 116 116 PHE PHE A . n 
A 1 102 VAL 102 117 117 VAL VAL A . n 
A 1 103 GLY 103 118 118 GLY GLY A . n 
A 1 104 ALA 104 119 119 ALA ALA A . n 
A 1 105 LEU 105 120 120 LEU LEU A . n 
A 1 106 SER 106 121 121 SER SER A . n 
A 1 107 MET 107 122 122 MET MET A . n 
A 1 108 ALA 108 123 123 ALA ALA A . n 
A 1 109 ASN 109 124 124 ASN ASN A . n 
A 1 110 ALA 110 125 125 ALA ALA A . n 
A 1 111 GLY 111 126 126 GLY GLY A . n 
A 1 112 PRO 112 127 127 PRO PRO A . n 
A 1 113 ASN 113 128 128 ASN ASN A . n 
A 1 114 THR 114 129 129 THR THR A . n 
A 1 115 ASN 115 130 130 ASN ASN A . n 
A 1 116 GLY 116 131 131 GLY GLY A . n 
A 1 117 SER 117 132 132 SER SER A . n 
A 1 118 GLN 118 133 133 GLN GLN A . n 
A 1 119 PHE 119 134 134 PHE PHE A . n 
A 1 120 PHE 120 135 135 PHE PHE A . n 
A 1 121 ILE 121 136 136 ILE ILE A . n 
A 1 122 THR 122 137 137 THR THR A . n 
A 1 123 THR 123 138 138 THR THR A . n 
A 1 124 ALA 124 139 139 ALA ALA A . n 
A 1 125 PRO 125 140 140 PRO PRO A . n 
A 1 126 THR 126 141 141 THR THR A . n 
A 1 127 PRO 127 142 142 PRO PRO A . n 
A 1 128 TRP 128 143 143 TRP TRP A . n 
A 1 129 LEU 129 144 144 LEU LEU A . n 
A 1 130 ASP 130 145 145 ASP ASP A . n 
A 1 131 GLY 131 146 146 GLY GLY A . n 
A 1 132 ARG 132 147 147 ARG ARG A . n 
A 1 133 HIS 133 148 148 HIS HIS A . n 
A 1 134 VAL 134 149 149 VAL VAL A . n 
A 1 135 VAL 135 150 150 VAL VAL A . n 
A 1 136 PHE 136 151 151 PHE PHE A . n 
A 1 137 GLY 137 152 152 GLY GLY A . n 
A 1 138 LYS 138 153 153 LYS LYS A . n 
A 1 139 VAL 139 154 154 VAL VAL A . n 
A 1 140 LEU 140 155 155 LEU LEU A . n 
A 1 141 ASP 141 156 156 ASP ASP A . n 
A 1 142 GLY 142 157 157 GLY GLY A . n 
A 1 143 MET 143 158 158 MET MET A . n 
A 1 144 ASP 144 159 159 ASP ASP A . n 
A 1 145 VAL 145 160 160 VAL VAL A . n 
A 1 146 VAL 146 161 161 VAL VAL A . n 
A 1 147 LEU 147 162 162 LEU LEU A . n 
A 1 148 ARG 148 163 163 ARG ARG A . n 
A 1 149 ILE 149 164 164 ILE ILE A . n 
A 1 150 GLU 150 165 165 GLU GLU A . n 
A 1 151 LYS 151 166 166 LYS LYS A . n 
A 1 152 THR 152 167 167 THR THR A . n 
A 1 153 LYS 153 168 168 LYS LYS A . n 
A 1 154 THR 154 169 169 THR THR A . n 
A 1 155 ASN 155 170 170 ASN ASN A . n 
A 1 156 SER 156 171 171 SER SER A . n 
A 1 157 HIS 157 172 172 HIS HIS A . n 
A 1 158 ASP 158 173 173 ASP ASP A . n 
A 1 159 ARG 159 174 174 ARG ARG A . n 
A 1 160 PRO 160 175 175 PRO PRO A . n 
A 1 161 VAL 161 176 176 VAL VAL A . n 
A 1 162 LYS 162 177 177 LYS LYS A . n 
A 1 163 PRO 163 178 178 PRO PRO A . n 
A 1 164 VAL 164 179 179 VAL VAL A . n 
A 1 165 LYS 165 180 180 LYS LYS A . n 
A 1 166 ILE 166 181 181 ILE ILE A . n 
A 1 167 VAL 167 182 182 VAL VAL A . n 
A 1 168 ALA 168 183 183 ALA ALA A . n 
A 1 169 SER 169 184 184 SER SER A . n 
A 1 170 GLY 170 185 185 GLY GLY A . n 
A 1 171 GLU 171 186 186 GLU GLU A . n 
A 1 172 LEU 172 187 187 LEU LEU A . n 
B 1 1   HIS 1   16  ?   ?   ?   B . n 
B 1 2   HIS 2   17  ?   ?   ?   B . n 
B 1 3   HIS 3   18  ?   ?   ?   B . n 
B 1 4   HIS 4   19  ?   ?   ?   B . n 
B 1 5   HIS 5   20  ?   ?   ?   B . n 
B 1 6   HIS 6   21  ?   ?   ?   B . n 
B 1 7   GLU 7   22  22  GLU GLU B . n 
B 1 8   PRO 8   23  23  PRO PRO B . n 
B 1 9   GLU 9   24  24  GLU GLU B . n 
B 1 10  VAL 10  25  25  VAL VAL B . n 
B 1 11  THR 11  26  26  THR THR B . n 
B 1 12  ALA 12  27  27  ALA ALA B . n 
B 1 13  LYS 13  28  28  LYS LYS B . n 
B 1 14  VAL 14  29  29  VAL VAL B . n 
B 1 15  TYR 15  30  30  TYR TYR B . n 
B 1 16  PHE 16  31  31  PHE PHE B . n 
B 1 17  ASP 17  32  32  ASP ASP B . n 
B 1 18  VAL 18  33  33  VAL VAL B . n 
B 1 19  MET 19  34  34  MET MET B . n 
B 1 20  ILE 20  35  35  ILE ILE B . n 
B 1 21  ASP 21  36  36  ASP ASP B . n 
B 1 22  SER 22  37  37  SER SER B . n 
B 1 23  GLU 23  38  38  GLU GLU B . n 
B 1 24  PRO 24  39  39  PRO PRO B . n 
B 1 25  LEU 25  40  40  LEU LEU B . n 
B 1 26  GLY 26  41  41  GLY GLY B . n 
B 1 27  ARG 27  42  42  ARG ARG B . n 
B 1 28  ILE 28  43  43  ILE ILE B . n 
B 1 29  THR 29  44  44  THR THR B . n 
B 1 30  ILE 30  45  45  ILE ILE B . n 
B 1 31  GLY 31  46  46  GLY GLY B . n 
B 1 32  LEU 32  47  47  LEU LEU B . n 
B 1 33  PHE 33  48  48  PHE PHE B . n 
B 1 34  GLY 34  49  49  GLY GLY B . n 
B 1 35  LYS 35  50  50  LYS LYS B . n 
B 1 36  ASP 36  51  51  ASP ASP B . n 
B 1 37  ALA 37  52  52  ALA ALA B . n 
B 1 38  PRO 38  53  53  PRO PRO B . n 
B 1 39  LEU 39  54  54  LEU LEU B . n 
B 1 40  THR 40  55  55  THR THR B . n 
B 1 41  THR 41  56  56  THR THR B . n 
B 1 42  GLU 42  57  57  GLU GLU B . n 
B 1 43  ASN 43  58  58  ASN ASN B . n 
B 1 44  PHE 44  59  59  PHE PHE B . n 
B 1 45  ARG 45  60  60  ARG ARG B . n 
B 1 46  GLN 46  61  61  GLN GLN B . n 
B 1 47  LEU 47  62  62  LEU LEU B . n 
B 1 48  CYS 48  63  63  CYS CYS B . n 
B 1 49  THR 49  64  64  THR THR B . n 
B 1 50  GLY 50  65  65  GLY GLY B . n 
B 1 51  GLU 51  66  66  GLU GLU B . n 
B 1 52  HIS 52  67  67  HIS HIS B . n 
B 1 53  GLY 53  68  68  GLY GLY B . n 
B 1 54  PHE 54  69  69  PHE PHE B . n 
B 1 55  GLY 55  70  70  GLY GLY B . n 
B 1 56  TYR 56  71  71  TYR TYR B . n 
B 1 57  LYS 57  72  72  LYS LYS B . n 
B 1 58  ASP 58  73  73  ASP ASP B . n 
B 1 59  SER 59  74  74  SER SER B . n 
B 1 60  ILE 60  75  75  ILE ILE B . n 
B 1 61  PHE 61  76  76  PHE PHE B . n 
B 1 62  HIS 62  77  77  HIS HIS B . n 
B 1 63  ARG 63  78  78  ARG ARG B . n 
B 1 64  VAL 64  79  79  VAL VAL B . n 
B 1 65  ILE 65  80  80  ILE ILE B . n 
B 1 66  GLN 66  81  81  GLN GLN B . n 
B 1 67  ASN 67  82  82  ASN ASN B . n 
B 1 68  PHE 68  83  83  PHE PHE B . n 
B 1 69  MET 69  84  84  MET MET B . n 
B 1 70  ILE 70  85  85  ILE ILE B . n 
B 1 71  GLN 71  86  86  GLN GLN B . n 
B 1 72  GLY 72  87  87  GLY GLY B . n 
B 1 73  GLY 73  88  88  GLY GLY B . n 
B 1 74  ASP 74  89  89  ASP ASP B . n 
B 1 75  PHE 75  90  90  PHE PHE B . n 
B 1 76  THR 76  91  91  THR THR B . n 
B 1 77  ASN 77  92  92  ASN ASN B . n 
B 1 78  PHE 78  93  93  PHE PHE B . n 
B 1 79  ASP 79  94  94  ASP ASP B . n 
B 1 80  GLY 80  95  95  GLY GLY B . n 
B 1 81  THR 81  96  96  THR THR B . n 
B 1 82  GLY 82  97  97  GLY GLY B . n 
B 1 83  GLY 83  98  98  GLY GLY B . n 
B 1 84  LYS 84  99  99  LYS LYS B . n 
B 1 85  SER 85  100 100 SER SER B . n 
B 1 86  ILE 86  101 101 ILE ILE B . n 
B 1 87  TYR 87  102 102 TYR TYR B . n 
B 1 88  GLY 88  103 103 GLY GLY B . n 
B 1 89  GLU 89  104 104 GLU GLU B . n 
B 1 90  LYS 90  105 105 LYS LYS B . n 
B 1 91  PHE 91  106 106 PHE PHE B . n 
B 1 92  ALA 92  107 107 ALA ALA B . n 
B 1 93  ASP 93  108 108 ASP ASP B . n 
B 1 94  GLU 94  109 109 GLU GLU B . n 
B 1 95  ASN 95  110 110 ASN ASN B . n 
B 1 96  LEU 96  111 111 LEU LEU B . n 
B 1 97  ASN 97  112 112 ASN ASN B . n 
B 1 98  VAL 98  113 113 VAL VAL B . n 
B 1 99  LYS 99  114 114 LYS LYS B . n 
B 1 100 HIS 100 115 115 HIS HIS B . n 
B 1 101 PHE 101 116 116 PHE PHE B . n 
B 1 102 VAL 102 117 117 VAL VAL B . n 
B 1 103 GLY 103 118 118 GLY GLY B . n 
B 1 104 ALA 104 119 119 ALA ALA B . n 
B 1 105 LEU 105 120 120 LEU LEU B . n 
B 1 106 SER 106 121 121 SER SER B . n 
B 1 107 MET 107 122 122 MET MET B . n 
B 1 108 ALA 108 123 123 ALA ALA B . n 
B 1 109 ASN 109 124 124 ASN ASN B . n 
B 1 110 ALA 110 125 125 ALA ALA B . n 
B 1 111 GLY 111 126 126 GLY GLY B . n 
B 1 112 PRO 112 127 127 PRO PRO B . n 
B 1 113 ASN 113 128 128 ASN ASN B . n 
B 1 114 THR 114 129 129 THR THR B . n 
B 1 115 ASN 115 130 130 ASN ASN B . n 
B 1 116 GLY 116 131 131 GLY GLY B . n 
B 1 117 SER 117 132 132 SER SER B . n 
B 1 118 GLN 118 133 133 GLN GLN B . n 
B 1 119 PHE 119 134 134 PHE PHE B . n 
B 1 120 PHE 120 135 135 PHE PHE B . n 
B 1 121 ILE 121 136 136 ILE ILE B . n 
B 1 122 THR 122 137 137 THR THR B . n 
B 1 123 THR 123 138 138 THR THR B . n 
B 1 124 ALA 124 139 139 ALA ALA B . n 
B 1 125 PRO 125 140 140 PRO PRO B . n 
B 1 126 THR 126 141 141 THR THR B . n 
B 1 127 PRO 127 142 142 PRO PRO B . n 
B 1 128 TRP 128 143 143 TRP TRP B . n 
B 1 129 LEU 129 144 144 LEU LEU B . n 
B 1 130 ASP 130 145 145 ASP ASP B . n 
B 1 131 GLY 131 146 146 GLY GLY B . n 
B 1 132 ARG 132 147 147 ARG ARG B . n 
B 1 133 HIS 133 148 148 HIS HIS B . n 
B 1 134 VAL 134 149 149 VAL VAL B . n 
B 1 135 VAL 135 150 150 VAL VAL B . n 
B 1 136 PHE 136 151 151 PHE PHE B . n 
B 1 137 GLY 137 152 152 GLY GLY B . n 
B 1 138 LYS 138 153 153 LYS LYS B . n 
B 1 139 VAL 139 154 154 VAL VAL B . n 
B 1 140 LEU 140 155 155 LEU LEU B . n 
B 1 141 ASP 141 156 156 ASP ASP B . n 
B 1 142 GLY 142 157 157 GLY GLY B . n 
B 1 143 MET 143 158 158 MET MET B . n 
B 1 144 ASP 144 159 159 ASP ASP B . n 
B 1 145 VAL 145 160 160 VAL VAL B . n 
B 1 146 VAL 146 161 161 VAL VAL B . n 
B 1 147 LEU 147 162 162 LEU LEU B . n 
B 1 148 ARG 148 163 163 ARG ARG B . n 
B 1 149 ILE 149 164 164 ILE ILE B . n 
B 1 150 GLU 150 165 165 GLU GLU B . n 
B 1 151 LYS 151 166 166 LYS LYS B . n 
B 1 152 THR 152 167 167 THR THR B . n 
B 1 153 LYS 153 168 168 LYS LYS B . n 
B 1 154 THR 154 169 169 THR THR B . n 
B 1 155 ASN 155 170 170 ASN ASN B . n 
B 1 156 SER 156 171 171 SER SER B . n 
B 1 157 HIS 157 172 172 HIS HIS B . n 
B 1 158 ASP 158 173 173 ASP ASP B . n 
B 1 159 ARG 159 174 174 ARG ARG B . n 
B 1 160 PRO 160 175 175 PRO PRO B . n 
B 1 161 VAL 161 176 176 VAL VAL B . n 
B 1 162 LYS 162 177 177 LYS LYS B . n 
B 1 163 PRO 163 178 178 PRO PRO B . n 
B 1 164 VAL 164 179 179 VAL VAL B . n 
B 1 165 LYS 165 180 180 LYS LYS B . n 
B 1 166 ILE 166 181 181 ILE ILE B . n 
B 1 167 VAL 167 182 182 VAL VAL B . n 
B 1 168 ALA 168 183 183 ALA ALA B . n 
B 1 169 SER 169 184 184 SER SER B . n 
B 1 170 GLY 170 185 185 GLY GLY B . n 
B 1 171 GLU 171 186 186 GLU GLU B . n 
B 1 172 LEU 172 187 187 LEU LEU B . n 
C 2 1   DAL 1   1   1   DAL DAL C . n 
C 2 2   MLE 2   2   2   MLE MLE C . n 
C 2 3   MLE 3   3   3   MLE MLE C . n 
C 2 4   MVA 4   4   4   MVA MVA C . n 
C 2 5   BMT 5   5   5   BMT BMT C . n 
C 2 6   ABA 6   6   6   ABA ABA C . n 
C 2 7   SAR 7   7   7   SAR SAR C . n 
C 2 8   MLE 8   8   8   MLE MLE C . n 
C 2 9   VAL 9   9   9   VAL VAL C . n 
C 2 10  MLE 10  10  10  MLE MLE C . n 
C 2 11  ALA 11  11  11  ALA ALA C . n 
D 2 1   DAL 1   1   1   DAL DAL D . n 
D 2 2   MLE 2   2   2   MLE MLE D . n 
D 2 3   MLE 3   3   3   MLE MLE D . n 
D 2 4   MVA 4   4   4   MVA MVA D . n 
D 2 5   BMT 5   5   5   BMT BMT D . n 
D 2 6   ABA 6   6   6   ABA ABA D . n 
D 2 7   SAR 7   7   7   SAR SAR D . n 
D 2 8   MLE 8   8   8   MLE MLE D . n 
D 2 9   VAL 9   9   9   VAL VAL D . n 
D 2 10  MLE 10  10  10  MLE MLE D . n 
D 2 11  ALA 11  11  11  ALA ALA D . n 
# 
_pdbx_molecule_features.prd_id    PRD_000142 
_pdbx_molecule_features.name      'Cyclosporin A' 
_pdbx_molecule_features.type      'Cyclic peptide' 
_pdbx_molecule_features.class     Immunosuppressant 
_pdbx_molecule_features.details   
;CYCLOSPORIN IS A CYCLIC UNDECAPEPTIDE.
  CYCLIZATION IS ACHIEVED BY LINKING THE N- AND
  THE C- TERMINI.
;
# 
loop_
_pdbx_molecule.instance_id 
_pdbx_molecule.prd_id 
_pdbx_molecule.asym_id 
1 PRD_000142 C 
2 PRD_000142 D 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA dimeric 2 
2 software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 980  ? 
1 MORE         -7.6 ? 
1 'SSA (A^2)'  7930 ? 
2 'ABSA (A^2)' 980  ? 
2 MORE         -7.6 ? 
2 'SSA (A^2)'  8020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-11 
2 'Structure model' 1 1 2011-06-14 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-07-27 
5 'Structure model' 1 4 2012-12-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Non-polymer description'   
7 4 'Structure model' 'Structure summary'         
8 5 'Structure model' Other                       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       1.2 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_entry_details.entry_id             3EOV 
_pdbx_entry_details.compound_details     
;CYCLOSPORIN IS A CYCLIC UNDECAPEPTIDE.
  HERE, CYCLOSPORIN A IS REPRESENTED BY THE SEQUENCE (SEQRES)
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE N-TERMINAL 5 RESIDUES 'HHHHHH' IN CHAINS A AND B IS AN
ENGINEERED EXPRESSION TAG
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 36  ? ? 53.34   81.17   
2  1 SER A 37  ? ? 61.19   -18.14  
3  1 ALA A 52  ? ? -159.68 76.10   
4  1 ASP A 73  ? ? 88.28   -7.03   
5  1 PHE A 83  ? ? -150.11 -76.64  
6  1 ASN A 92  ? ? -148.84 -21.69  
7  1 ASP A 156 ? ? -170.33 145.85  
8  1 THR A 167 ? ? -46.19  155.32  
9  1 SER A 171 ? ? -57.02  170.77  
10 1 PRO B 23  ? ? -57.68  178.16  
11 1 ASP B 36  ? ? 63.90   88.70   
12 1 SER B 37  ? ? 73.73   -17.31  
13 1 ALA B 52  ? ? -163.25 78.34   
14 1 GLU B 66  ? ? -29.60  -60.40  
15 1 ASP B 73  ? ? 74.66   -2.23   
16 1 ARG B 78  ? ? -163.84 113.75  
17 1 PHE B 83  ? ? -131.33 -68.67  
18 1 ASN B 124 ? ? -161.13 -166.41 
19 1 THR B 167 ? ? -40.19  156.07  
20 1 ASN B 170 ? ? -127.12 -168.38 
21 1 SER B 171 ? ? -46.83  156.49  
22 1 HIS B 172 ? ? 69.63   -6.38   
23 1 MVA C 4   ? ? -118.35 73.73   
24 1 VAL C 9   ? ? 72.85   98.72   
25 1 MLE C 10  ? ? -108.96 -152.29 
26 1 VAL D 9   ? ? 76.43   99.63   
27 1 MLE D 10  ? ? -108.99 -145.39 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 22 ? CG  ? A GLU 7  CG  
2  1 Y 1 A GLU 22 ? CD  ? A GLU 7  CD  
3  1 Y 1 A GLU 22 ? OE1 ? A GLU 7  OE1 
4  1 Y 1 A GLU 22 ? OE2 ? A GLU 7  OE2 
5  1 Y 1 A GLN 81 ? CG  ? A GLN 66 CG  
6  1 Y 1 A GLN 81 ? CD  ? A GLN 66 CD  
7  1 Y 1 A GLN 81 ? OE1 ? A GLN 66 OE1 
8  1 Y 1 A GLN 81 ? NE2 ? A GLN 66 NE2 
9  1 Y 1 B GLU 22 ? CG  ? B GLU 7  CG  
10 1 Y 1 B GLU 22 ? CD  ? B GLU 7  CD  
11 1 Y 1 B GLU 22 ? OE1 ? B GLU 7  OE1 
12 1 Y 1 B GLU 22 ? OE2 ? B GLU 7  OE2 
13 1 Y 1 B GLN 81 ? CG  ? B GLN 66 CG  
14 1 Y 1 B GLN 81 ? CD  ? B GLN 66 CD  
15 1 Y 1 B GLN 81 ? OE1 ? B GLN 66 OE1 
16 1 Y 1 B GLN 81 ? NE2 ? B GLN 66 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 16 ? A HIS 1 
2  1 Y 1 A HIS 17 ? A HIS 2 
3  1 Y 1 A HIS 18 ? A HIS 3 
4  1 Y 1 A HIS 19 ? A HIS 4 
5  1 Y 1 A HIS 20 ? A HIS 5 
6  1 Y 1 A HIS 21 ? A HIS 6 
7  1 Y 1 B HIS 16 ? B HIS 1 
8  1 Y 1 B HIS 17 ? B HIS 2 
9  1 Y 1 B HIS 18 ? B HIS 3 
10 1 Y 1 B HIS 19 ? B HIS 4 
11 1 Y 1 B HIS 20 ? B HIS 5 
12 1 Y 1 B HIS 21 ? B HIS 6 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  2001 2001 HOH HOH A . 
E 3 HOH 2  2002 2002 HOH HOH A . 
E 3 HOH 3  2003 2003 HOH HOH A . 
E 3 HOH 4  2004 2004 HOH HOH A . 
E 3 HOH 5  2005 2005 HOH HOH A . 
E 3 HOH 6  2006 2006 HOH HOH A . 
E 3 HOH 7  2007 2007 HOH HOH A . 
E 3 HOH 8  2008 2008 HOH HOH A . 
E 3 HOH 9  2009 2009 HOH HOH A . 
E 3 HOH 10 2010 2010 HOH HOH A . 
E 3 HOH 11 2011 2011 HOH HOH A . 
E 3 HOH 12 2012 2012 HOH HOH A . 
E 3 HOH 13 2013 2013 HOH HOH A . 
E 3 HOH 14 2014 2014 HOH HOH A . 
E 3 HOH 15 2015 2015 HOH HOH A . 
E 3 HOH 16 2016 2016 HOH HOH A . 
E 3 HOH 17 2017 2017 HOH HOH A . 
E 3 HOH 18 2018 2018 HOH HOH A . 
E 3 HOH 19 2019 2019 HOH HOH A . 
E 3 HOH 20 2020 2020 HOH HOH A . 
E 3 HOH 21 2021 2021 HOH HOH A . 
E 3 HOH 22 2022 2022 HOH HOH A . 
E 3 HOH 23 2023 2023 HOH HOH A . 
E 3 HOH 24 2024 2024 HOH HOH A . 
E 3 HOH 25 2025 2025 HOH HOH A . 
E 3 HOH 26 2026 2026 HOH HOH A . 
E 3 HOH 27 2027 2027 HOH HOH A . 
E 3 HOH 28 2028 2028 HOH HOH A . 
E 3 HOH 29 2029 2029 HOH HOH A . 
E 3 HOH 30 2030 2030 HOH HOH A . 
E 3 HOH 31 2031 2031 HOH HOH A . 
E 3 HOH 32 2032 2032 HOH HOH A . 
E 3 HOH 33 2033 2033 HOH HOH A . 
E 3 HOH 34 2034 2034 HOH HOH A . 
E 3 HOH 35 2035 2035 HOH HOH A . 
E 3 HOH 36 2036 2036 HOH HOH A . 
F 3 HOH 1  2001 2001 HOH HOH B . 
F 3 HOH 2  2002 2002 HOH HOH B . 
F 3 HOH 3  2003 2003 HOH HOH B . 
F 3 HOH 4  2004 2004 HOH HOH B . 
F 3 HOH 5  2005 2005 HOH HOH B . 
F 3 HOH 6  2006 2006 HOH HOH B . 
F 3 HOH 7  2007 2007 HOH HOH B . 
F 3 HOH 8  2008 2008 HOH HOH B . 
F 3 HOH 9  2009 2009 HOH HOH B . 
F 3 HOH 10 2010 2010 HOH HOH B . 
F 3 HOH 11 2011 2011 HOH HOH B . 
F 3 HOH 12 2012 2012 HOH HOH B . 
F 3 HOH 13 2013 2013 HOH HOH B . 
F 3 HOH 14 2014 2014 HOH HOH B . 
F 3 HOH 15 2015 2015 HOH HOH B . 
F 3 HOH 16 2016 2016 HOH HOH B . 
F 3 HOH 17 2017 2017 HOH HOH B . 
F 3 HOH 18 2018 2018 HOH HOH B . 
F 3 HOH 19 2019 2019 HOH HOH B . 
F 3 HOH 20 2020 2020 HOH HOH B . 
F 3 HOH 21 2021 2021 HOH HOH B . 
F 3 HOH 22 2022 2022 HOH HOH B . 
F 3 HOH 23 2023 2023 HOH HOH B . 
F 3 HOH 24 2024 2024 HOH HOH B . 
F 3 HOH 25 2025 2025 HOH HOH B . 
F 3 HOH 26 2026 2026 HOH HOH B . 
F 3 HOH 27 2027 2027 HOH HOH B . 
F 3 HOH 28 2028 2028 HOH HOH B . 
F 3 HOH 29 2029 2029 HOH HOH B . 
F 3 HOH 30 2030 2030 HOH HOH B . 
F 3 HOH 31 2031 2031 HOH HOH B . 
F 3 HOH 32 2032 2032 HOH HOH B . 
F 3 HOH 33 2033 2033 HOH HOH B . 
F 3 HOH 34 2034 2034 HOH HOH B . 
F 3 HOH 35 2035 2035 HOH HOH B . 
F 3 HOH 36 2036 2036 HOH HOH B . 
F 3 HOH 37 2037 2037 HOH HOH B . 
F 3 HOH 38 2038 2038 HOH HOH B . 
F 3 HOH 39 2039 2039 HOH HOH B . 
G 3 HOH 1  2001 2001 HOH HOH C . 
#