data_3EUG
# 
_entry.id   3EUG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3EUG         
RCSB  RCSB007031   
WWPDB D_1000007031 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EUG . unspecified 
PDB 2EUG . unspecified 
PDB 4EUG . unspecified 
PDB 5EUG . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3EUG 
_pdbx_database_status.recvd_initial_deposition_date   1998-10-13 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xiao, G.'        1 
'Tordova, M.'     2 
'Jagadeesh, J.'   3 
'Drohat, A.C.'    4 
'Stivers, J.T.'   5 
'Gilliland, G.L.' 6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of Escherichia coli uracil DNA glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited.
;
_citation.journal_abbrev            Proteins 
_citation.journal_volume            35 
_citation.page_first                13 
_citation.page_last                 24 
_citation.year                      1999 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10090282 
_citation.pdbx_database_id_DOI      '10.1002/(SICI)1097-0134(19990401)35:1<13::AID-PROT2>3.3.CO;2-U' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xiao, G.'        1 
primary 'Tordova, M.'     2 
primary 'Jagadeesh, J.'   3 
primary 'Drohat, A.C.'    4 
primary 'Stivers, J.T.'   5 
primary 'Gilliland, G.L.' 6 
# 
_cell.entry_id           3EUG 
_cell.length_a           54.850 
_cell.length_b           58.930 
_cell.length_c           63.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3EUG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (GLYCOSYLASE)' 25681.107 1   3.2.2.3 Y19H ? 'THE PROTEIN IS COMPLEXED WITH URACIL' 
2 non-polymer syn GLYCEROL                92.094    2   ?       ?    ? ?                                      
3 water       nat water                   18.015    347 ?       ?    ? ?                                      
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'UDG, UNG' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MANELTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVR
PGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVV
FLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MANELTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVR
PGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVV
FLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASN n 
1 4   GLU n 
1 5   LEU n 
1 6   THR n 
1 7   TRP n 
1 8   HIS n 
1 9   ASP n 
1 10  VAL n 
1 11  LEU n 
1 12  ALA n 
1 13  GLU n 
1 14  GLU n 
1 15  LYS n 
1 16  GLN n 
1 17  GLN n 
1 18  PRO n 
1 19  HIS n 
1 20  PHE n 
1 21  LEU n 
1 22  ASN n 
1 23  THR n 
1 24  LEU n 
1 25  GLN n 
1 26  THR n 
1 27  VAL n 
1 28  ALA n 
1 29  SER n 
1 30  GLU n 
1 31  ARG n 
1 32  GLN n 
1 33  SER n 
1 34  GLY n 
1 35  VAL n 
1 36  THR n 
1 37  ILE n 
1 38  TYR n 
1 39  PRO n 
1 40  PRO n 
1 41  GLN n 
1 42  LYS n 
1 43  ASP n 
1 44  VAL n 
1 45  PHE n 
1 46  ASN n 
1 47  ALA n 
1 48  PHE n 
1 49  ARG n 
1 50  PHE n 
1 51  THR n 
1 52  GLU n 
1 53  LEU n 
1 54  GLY n 
1 55  ASP n 
1 56  VAL n 
1 57  LYS n 
1 58  VAL n 
1 59  VAL n 
1 60  ILE n 
1 61  LEU n 
1 62  GLY n 
1 63  GLN n 
1 64  ASP n 
1 65  PRO n 
1 66  TYR n 
1 67  HIS n 
1 68  GLY n 
1 69  PRO n 
1 70  GLY n 
1 71  GLN n 
1 72  ALA n 
1 73  HIS n 
1 74  GLY n 
1 75  LEU n 
1 76  ALA n 
1 77  PHE n 
1 78  SER n 
1 79  VAL n 
1 80  ARG n 
1 81  PRO n 
1 82  GLY n 
1 83  ILE n 
1 84  ALA n 
1 85  ILE n 
1 86  PRO n 
1 87  PRO n 
1 88  SER n 
1 89  LEU n 
1 90  LEU n 
1 91  ASN n 
1 92  MET n 
1 93  TYR n 
1 94  LYS n 
1 95  GLU n 
1 96  LEU n 
1 97  GLU n 
1 98  ASN n 
1 99  THR n 
1 100 ILE n 
1 101 PRO n 
1 102 GLY n 
1 103 PHE n 
1 104 THR n 
1 105 ARG n 
1 106 PRO n 
1 107 ASN n 
1 108 HIS n 
1 109 GLY n 
1 110 TYR n 
1 111 LEU n 
1 112 GLU n 
1 113 SER n 
1 114 TRP n 
1 115 ALA n 
1 116 ARG n 
1 117 GLN n 
1 118 GLY n 
1 119 VAL n 
1 120 LEU n 
1 121 LEU n 
1 122 LEU n 
1 123 ASN n 
1 124 THR n 
1 125 VAL n 
1 126 LEU n 
1 127 THR n 
1 128 VAL n 
1 129 ARG n 
1 130 ALA n 
1 131 GLY n 
1 132 GLN n 
1 133 ALA n 
1 134 HIS n 
1 135 SER n 
1 136 HIS n 
1 137 ALA n 
1 138 SER n 
1 139 LEU n 
1 140 GLY n 
1 141 TRP n 
1 142 GLU n 
1 143 THR n 
1 144 PHE n 
1 145 THR n 
1 146 ASP n 
1 147 LYS n 
1 148 VAL n 
1 149 ILE n 
1 150 SER n 
1 151 LEU n 
1 152 ILE n 
1 153 ASN n 
1 154 GLN n 
1 155 HIS n 
1 156 ARG n 
1 157 GLU n 
1 158 GLY n 
1 159 VAL n 
1 160 VAL n 
1 161 PHE n 
1 162 LEU n 
1 163 LEU n 
1 164 TRP n 
1 165 GLY n 
1 166 SER n 
1 167 HIS n 
1 168 ALA n 
1 169 GLN n 
1 170 LYS n 
1 171 LYS n 
1 172 GLY n 
1 173 ALA n 
1 174 ILE n 
1 175 ILE n 
1 176 ASP n 
1 177 LYS n 
1 178 GLN n 
1 179 ARG n 
1 180 HIS n 
1 181 HIS n 
1 182 VAL n 
1 183 LEU n 
1 184 LYS n 
1 185 ALA n 
1 186 PRO n 
1 187 HIS n 
1 188 PRO n 
1 189 SER n 
1 190 PRO n 
1 191 LEU n 
1 192 SER n 
1 193 ALA n 
1 194 HIS n 
1 195 ARG n 
1 196 GLY n 
1 197 PHE n 
1 198 PHE n 
1 199 GLY n 
1 200 CYS n 
1 201 ASN n 
1 202 HIS n 
1 203 PHE n 
1 204 VAL n 
1 205 LEU n 
1 206 ALA n 
1 207 ASN n 
1 208 GLN n 
1 209 TRP n 
1 210 LEU n 
1 211 GLU n 
1 212 GLN n 
1 213 HIS n 
1 214 GLY n 
1 215 GLU n 
1 216 THR n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 TRP n 
1 221 MET n 
1 222 PRO n 
1 223 VAL n 
1 224 LEU n 
1 225 PRO n 
1 226 ALA n 
1 227 GLU n 
1 228 SER n 
1 229 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 UNG 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    B 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     37762 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'SIGMA CHEMICAL' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    UNG_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P12295 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3EUG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 229 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12295 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  229 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       229 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3EUG HIS A 19  ? UNP P12295 TYR 19  ENGINEERED            19  1 
1 3EUG HIS A 213 ? UNP P12295 ARG 213 'ENGINEERED MUTATION' 213 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3EUG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   39.9 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;PROTEIN CONCENTRATION 14.9 MG/ML, 0.2 M SODIUM ACETATE, 30% PEG4000, 0.1 M 
TRIS BUFFER, PH 8.5 USING HANGING DROP AT 293K.
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   BRUKER 
_diffrn_detector.pdbx_collection_date   1997-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        BRUKER 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3EUG 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             99.0 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   32361 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.0 
_reflns.pdbx_Rmerge_I_obs            0.0850000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.59 
_reflns_shell.percent_possible_all   91.1 
_reflns_shell.Rmerge_I_obs           0.2900000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3EUG 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     36241 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             99 
_refine.ls_d_res_high                            1.43 
_refine.ls_percent_reflns_obs                    92.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          0.1620000 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     8639 
_refine.ls_number_restraints                     7478 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EUG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3EUG 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          0 
_refine_analyze.occupancy_sum_non_hydrogen      2155 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1788 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             347 
_refine_hist.number_atoms_total               2147 
_refine_hist.d_res_high                       1.43 
_refine_hist.d_res_low                        99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.026 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.026 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.048 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.063 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.056 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    3EUG 
_pdbx_refine.R_factor_all_no_cutoff                      0.1620000 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1550000 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               32990 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  3EUG 
_struct.title                     
;CRYSTAL STRUCTURE OF ESCHERICHIA COLI URACIL DNA GLYCOSYLASE AND ITS COMPLEXES WITH URACIL AND GLYCEROL: STRUCTURE AND GLYCOSYLASE MECHANISM REVISITED
;
_struct.pdbx_descriptor           'PROTEIN (GLYCOSYLASE) (3.2.2.3) MUTANT (Y19H)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3EUG 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'GLYCOSYLASE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TRP A 7   ? LEU A 11  ? TRP A 7   LEU A 11  1 ? 5  
HELX_P HELX_P2  2  GLU A 14  ? GLN A 16  ? GLU A 14  GLN A 16  5 ? 3  
HELX_P HELX_P3  3  PRO A 18  ? SER A 33  ? PRO A 18  SER A 33  1 ? 16 
HELX_P HELX_P4  4  GLN A 41  ? ASP A 43  ? GLN A 41  ASP A 43  5 ? 3  
HELX_P HELX_P5  5  ASN A 46  ? PHE A 50  ? ASN A 46  PHE A 50  1 ? 5  
HELX_P HELX_P6  6  LEU A 53  ? ASP A 55  ? LEU A 53  ASP A 55  5 ? 3  
HELX_P HELX_P7  7  PRO A 87  ? GLU A 97  ? PRO A 87  GLU A 97  1 ? 11 
HELX_P HELX_P8  8  GLU A 112 ? GLN A 117 ? GLU A 112 GLN A 117 1 ? 6  
HELX_P HELX_P9  9  TRP A 141 ? HIS A 155 ? TRP A 141 HIS A 155 1 ? 15 
HELX_P HELX_P10 10 SER A 166 ? LYS A 171 ? SER A 166 LYS A 171 1 ? 6  
HELX_P HELX_P11 11 ALA A 193 ? ARG A 195 ? ALA A 193 ARG A 195 5 ? 3  
HELX_P HELX_P12 12 HIS A 202 ? GLN A 212 ? HIS A 202 GLN A 212 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           38 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            38 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    39 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     39 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.24 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 119 ? ASN A 123 ? VAL A 119 ASN A 123 
A 2 VAL A 58  ? GLY A 62  ? VAL A 58  GLY A 62  
A 3 VAL A 160 ? TRP A 164 ? VAL A 160 TRP A 164 
A 4 HIS A 181 ? ALA A 185 ? HIS A 181 ALA A 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 120 ? O LEU A 120 N VAL A 58  ? N VAL A 58  
A 2 3 O VAL A 59  ? O VAL A 59  N VAL A 160 ? N VAL A 160 
A 3 4 O PHE A 161 ? O PHE A 161 N HIS A 181 ? N HIS A 181 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
URA Author   ? ? ? ? 1 'URACIL BINDING SITE'                
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 230' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL A 231' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  URA 1 ASP A 64  ? ASP A 64  . ? 1_555 ? 
2  AC1 8 GLN A 63  ? GLN A 63  . ? 1_555 ? 
3  AC1 8 ASP A 64  ? ASP A 64  . ? 1_555 ? 
4  AC1 8 ALA A 76  ? ALA A 76  . ? 1_555 ? 
5  AC1 8 PHE A 77  ? PHE A 77  . ? 1_555 ? 
6  AC1 8 ASN A 123 ? ASN A 123 . ? 1_555 ? 
7  AC1 8 HIS A 187 ? HIS A 187 . ? 1_555 ? 
8  AC1 8 HOH D .   ? HOH A 309 . ? 1_555 ? 
9  AC1 8 HOH D .   ? HOH A 384 . ? 1_555 ? 
10 AC2 9 LYS A 15  ? LYS A 15  . ? 1_555 ? 
11 AC2 9 PHE A 45  ? PHE A 45  . ? 1_555 ? 
12 AC2 9 PHE A 48  ? PHE A 48  . ? 1_555 ? 
13 AC2 9 GLN A 212 ? GLN A 212 . ? 4_456 ? 
14 AC2 9 HIS A 213 ? HIS A 213 . ? 4_456 ? 
15 AC2 9 HOH D .   ? HOH A 397 . ? 1_555 ? 
16 AC2 9 HOH D .   ? HOH A 454 . ? 1_555 ? 
17 AC2 9 HOH D .   ? HOH A 529 . ? 1_555 ? 
18 AC2 9 HOH D .   ? HOH A 565 . ? 4_456 ? 
# 
_database_PDB_matrix.entry_id          3EUG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3EUG 
_atom_sites.fract_transf_matrix[1][1]   0.018232 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016969 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 5   ? 20.905  24.210  33.353 1.00 16.46 ? 5   LEU A N   1 
ATOM   2    C CA  . LEU A 1 5   ? 20.012  24.473  32.227 1.00 16.12 ? 5   LEU A CA  1 
ATOM   3    C C   . LEU A 1 5   ? 18.957  23.379  32.091 1.00 14.70 ? 5   LEU A C   1 
ATOM   4    O O   . LEU A 1 5   ? 19.304  22.210  32.265 1.00 16.57 ? 5   LEU A O   1 
ATOM   5    C CB  . LEU A 1 5   ? 20.710  24.531  30.868 1.00 21.88 ? 5   LEU A CB  1 
ATOM   6    C CG  . LEU A 1 5   ? 21.227  25.876  30.369 1.00 35.08 ? 5   LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 5   ? 21.187  26.929  31.467 1.00 34.83 ? 5   LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 5   ? 22.635  25.731  29.814 1.00 32.84 ? 5   LEU A CD2 1 
ATOM   9    N N   . THR A 1 6   ? 17.729  23.757  31.778 1.00 11.02 ? 6   THR A N   1 
ATOM   10   C CA  . THR A 1 6   ? 16.703  22.763  31.512 1.00 8.46  ? 6   THR A CA  1 
ATOM   11   C C   . THR A 1 6   ? 16.479  22.614  30.006 1.00 7.80  ? 6   THR A C   1 
ATOM   12   O O   . THR A 1 6   ? 16.966  23.456  29.239 1.00 8.89  ? 6   THR A O   1 
ATOM   13   C CB  . THR A 1 6   ? 15.341  23.156  32.099 1.00 8.53  ? 6   THR A CB  1 
ATOM   14   O OG1 . THR A 1 6   ? 14.901  24.370  31.457 1.00 10.73 ? 6   THR A OG1 1 
ATOM   15   C CG2 . THR A 1 6   ? 15.486  23.441  33.587 1.00 12.94 ? 6   THR A CG2 1 
ATOM   16   N N   . TRP A 1 7   ? 15.706  21.601  29.640 1.00 6.33  ? 7   TRP A N   1 
ATOM   17   C CA  . TRP A 1 7   ? 15.327  21.478  28.235 1.00 9.18  ? 7   TRP A CA  1 
ATOM   18   C C   . TRP A 1 7   ? 14.690  22.759  27.718 1.00 12.32 ? 7   TRP A C   1 
ATOM   19   O O   . TRP A 1 7   ? 15.021  23.217  26.625 1.00 9.63  ? 7   TRP A O   1 
ATOM   20   C CB  . TRP A 1 7   ? 14.289  20.369  28.022 1.00 7.29  ? 7   TRP A CB  1 
ATOM   21   C CG  . TRP A 1 7   ? 14.897  19.002  28.055 1.00 5.58  ? 7   TRP A CG  1 
ATOM   22   C CD1 . TRP A 1 7   ? 14.528  17.996  28.920 1.00 5.79  ? 7   TRP A CD1 1 
ATOM   23   C CD2 . TRP A 1 7   ? 15.931  18.478  27.225 1.00 4.71  ? 7   TRP A CD2 1 
ATOM   24   N NE1 . TRP A 1 7   ? 15.291  16.882  28.664 1.00 8.58  ? 7   TRP A NE1 1 
ATOM   25   C CE2 . TRP A 1 7   ? 16.162  17.144  27.632 1.00 6.70  ? 7   TRP A CE2 1 
ATOM   26   C CE3 . TRP A 1 7   ? 16.692  19.000  26.181 1.00 6.29  ? 7   TRP A CE3 1 
ATOM   27   C CZ2 . TRP A 1 7   ? 17.127  16.332  27.016 1.00 7.64  ? 7   TRP A CZ2 1 
ATOM   28   C CZ3 . TRP A 1 7   ? 17.654  18.191  25.575 1.00 8.85  ? 7   TRP A CZ3 1 
ATOM   29   C CH2 . TRP A 1 7   ? 17.866  16.865  25.997 1.00 6.27  ? 7   TRP A CH2 1 
ATOM   30   N N   . HIS A 1 8   ? 13.778  23.341  28.507 1.00 7.37  ? 8   HIS A N   1 
ATOM   31   C CA  . HIS A 1 8   ? 13.103  24.510  27.974 1.00 7.38  ? 8   HIS A CA  1 
ATOM   32   C C   . HIS A 1 8   ? 14.063  25.678  27.844 1.00 11.60 ? 8   HIS A C   1 
ATOM   33   O O   . HIS A 1 8   ? 13.995  26.456  26.888 1.00 9.57  ? 8   HIS A O   1 
ATOM   34   C CB  . HIS A 1 8   ? 11.923  24.893  28.884 1.00 8.95  ? 8   HIS A CB  1 
ATOM   35   C CG  . HIS A 1 8   ? 11.242  26.083  28.274 1.00 10.51 ? 8   HIS A CG  1 
ATOM   36   N ND1 . HIS A 1 8   ? 11.284  27.318  28.911 1.00 15.39 ? 8   HIS A ND1 1 
ATOM   37   C CD2 . HIS A 1 8   ? 10.493  26.216  27.158 1.00 13.27 ? 8   HIS A CD2 1 
ATOM   38   C CE1 . HIS A 1 8   ? 10.590  28.171  28.181 1.00 18.62 ? 8   HIS A CE1 1 
ATOM   39   N NE2 . HIS A 1 8   ? 10.116  27.537  27.121 1.00 13.53 ? 8   HIS A NE2 1 
ATOM   40   N N   . ASP A 1 9   ? 15.002  25.792  28.786 1.00 8.99  ? 9   ASP A N   1 
ATOM   41   C CA  . ASP A 1 9   ? 16.049  26.793  28.627 1.00 8.45  ? 9   ASP A CA  1 
ATOM   42   C C   . ASP A 1 9   ? 16.748  26.691  27.270 1.00 16.53 ? 9   ASP A C   1 
ATOM   43   O O   . ASP A 1 9   ? 16.874  27.720  26.580 1.00 15.33 ? 9   ASP A O   1 
ATOM   44   C CB  . ASP A 1 9   ? 17.152  26.650  29.679 1.00 10.47 ? 9   ASP A CB  1 
ATOM   45   C CG  . ASP A 1 9   ? 16.700  27.064  31.077 1.00 16.07 ? 9   ASP A CG  1 
ATOM   46   O OD1 . ASP A 1 9   ? 15.819  27.948  31.161 1.00 15.84 ? 9   ASP A OD1 1 
ATOM   47   O OD2 . ASP A 1 9   ? 17.218  26.464  32.043 1.00 13.17 ? 9   ASP A OD2 1 
ATOM   48   N N   . VAL A 1 10  ? 17.183  25.473  26.924 1.00 7.88  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 10  ? 17.997  25.390  25.700 1.00 7.77  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 10  ? 17.171  25.219  24.427 1.00 8.90  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 10  ? 17.712  25.472  23.331 1.00 8.93  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 10  ? 19.060  24.281  25.837 1.00 8.45  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 10  ? 20.003  24.595  26.993 1.00 6.57  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 10  ? 18.458  22.888  26.031 1.00 10.00 ? 10  VAL A CG2 1 
ATOM   55   N N   . LEU A 1 11  ? 15.899  24.854  24.504 1.00 8.46  ? 11  LEU A N   1 
ATOM   56   C CA  . LEU A 1 11  ? 15.066  24.634  23.315 1.00 5.95  ? 11  LEU A CA  1 
ATOM   57   C C   . LEU A 1 11  ? 14.017  25.725  23.148 1.00 9.26  ? 11  LEU A C   1 
ATOM   58   O O   . LEU A 1 11  ? 13.278  25.643  22.156 1.00 8.29  ? 11  LEU A O   1 
ATOM   59   C CB  . LEU A 1 11  ? 14.347  23.283  23.385 1.00 9.91  ? 11  LEU A CB  1 
ATOM   60   C CG  . LEU A 1 11  ? 15.197  22.029  23.203 1.00 8.84  ? 11  LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 11  ? 14.470  20.779  23.712 1.00 9.75  ? 11  LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 11  ? 15.603  21.829  21.748 1.00 9.51  ? 11  LEU A CD2 1 
ATOM   63   N N   . ALA A 1 12  ? 13.938  26.703  24.042 1.00 9.89  ? 12  ALA A N   1 
ATOM   64   C CA  . ALA A 1 12  ? 12.862  27.685  23.917 1.00 9.97  ? 12  ALA A CA  1 
ATOM   65   C C   . ALA A 1 12  ? 12.858  28.361  22.550 1.00 11.85 ? 12  ALA A C   1 
ATOM   66   O O   . ALA A 1 12  ? 11.787  28.474  21.931 1.00 12.15 ? 12  ALA A O   1 
ATOM   67   C CB  . ALA A 1 12  ? 12.983  28.717  25.046 1.00 10.88 ? 12  ALA A CB  1 
ATOM   68   N N   . GLU A 1 13  ? 14.046  28.727  22.069 1.00 10.06 ? 13  GLU A N   1 
ATOM   69   C CA  . GLU A 1 13  ? 14.111  29.362  20.736 1.00 9.46  ? 13  GLU A CA  1 
ATOM   70   C C   . GLU A 1 13  ? 13.762  28.408  19.601 1.00 13.37 ? 13  GLU A C   1 
ATOM   71   O O   . GLU A 1 13  ? 12.996  28.728  18.675 1.00 10.74 ? 13  GLU A O   1 
ATOM   72   C CB  . GLU A 1 13  ? 15.508  29.939  20.514 1.00 11.27 ? 13  GLU A CB  1 
ATOM   73   C CG  . GLU A 1 13  ? 15.702  30.423  19.079 1.00 27.06 ? 13  GLU A CG  1 
ATOM   74   C CD  . GLU A 1 13  ? 16.902  31.357  19.009 1.00 52.43 ? 13  GLU A CD  1 
ATOM   75   O OE1 . GLU A 1 13  ? 18.032  30.829  18.974 1.00 97.48 ? 13  GLU A OE1 1 
ATOM   76   O OE2 . GLU A 1 13  ? 16.679  32.585  18.996 1.00 88.68 ? 13  GLU A OE2 1 
ATOM   77   N N   . GLU A 1 14  ? 14.301  27.193  19.682 1.00 9.45  ? 14  GLU A N   1 
ATOM   78   C CA  . GLU A 1 14  ? 13.914  26.189  18.713 1.00 8.51  ? 14  GLU A CA  1 
ATOM   79   C C   . GLU A 1 14  ? 12.419  25.982  18.652 1.00 10.64 ? 14  GLU A C   1 
ATOM   80   O O   . GLU A 1 14  ? 11.820  25.811  17.586 1.00 10.38 ? 14  GLU A O   1 
ATOM   81   C CB  . GLU A 1 14  ? 14.635  24.895  19.146 1.00 7.64  ? 14  GLU A CB  1 
ATOM   82   C CG  . GLU A 1 14  ? 14.107  23.691  18.380 1.00 13.69 ? 14  GLU A CG  1 
ATOM   83   C CD  . GLU A 1 14  ? 14.559  23.562  16.950 1.00 15.69 ? 14  GLU A CD  1 
ATOM   84   O OE1 . GLU A 1 14  ? 15.380  24.371  16.487 1.00 12.97 ? 14  GLU A OE1 1 
ATOM   85   O OE2 . GLU A 1 14  ? 14.099  22.583  16.301 1.00 13.75 ? 14  GLU A OE2 1 
ATOM   86   N N   . LYS A 1 15  ? 11.721  25.976  19.795 1.00 8.12  ? 15  LYS A N   1 
ATOM   87   C CA  . LYS A 1 15  ? 10.296  25.698  19.779 1.00 9.16  ? 15  LYS A CA  1 
ATOM   88   C C   . LYS A 1 15  ? 9.440   26.875  19.326 1.00 11.76 ? 15  LYS A C   1 
ATOM   89   O O   . LYS A 1 15  ? 8.191   26.771  19.261 1.00 10.66 ? 15  LYS A O   1 
ATOM   90   C CB  . LYS A 1 15  ? 9.866   25.267  21.195 1.00 9.66  ? 15  LYS A CB  1 
ATOM   91   C CG  . LYS A 1 15  ? 10.477  23.947  21.618 1.00 10.05 ? 15  LYS A CG  1 
ATOM   92   C CD  . LYS A 1 15  ? 9.902   23.404  22.927 1.00 10.33 ? 15  LYS A CD  1 
ATOM   93   C CE  . LYS A 1 15  ? 10.415  24.254  24.082 1.00 12.13 ? 15  LYS A CE  1 
ATOM   94   N NZ  . LYS A 1 15  ? 9.854   23.739  25.373 1.00 12.74 ? 15  LYS A NZ  1 
ATOM   95   N N   . GLN A 1 16  ? 10.055  28.001  18.978 1.00 8.40  ? 16  GLN A N   1 
ATOM   96   C CA  . GLN A 1 16  ? 9.331   29.087  18.312 1.00 10.25 ? 16  GLN A CA  1 
ATOM   97   C C   . GLN A 1 16  ? 9.588   29.112  16.810 1.00 10.89 ? 16  GLN A C   1 
ATOM   98   O O   . GLN A 1 16  ? 9.139   30.032  16.111 1.00 12.77 ? 16  GLN A O   1 
ATOM   99   C CB  . GLN A 1 16  ? 9.759   30.446  18.867 1.00 9.57  ? 16  GLN A CB  1 
ATOM   100  C CG  . GLN A 1 16  ? 9.450   30.630  20.354 1.00 13.44 ? 16  GLN A CG  1 
ATOM   101  C CD  . GLN A 1 16  ? 7.947   30.615  20.593 1.00 21.16 ? 16  GLN A CD  1 
ATOM   102  O OE1 . GLN A 1 16  ? 7.172   31.136  19.775 1.00 22.81 ? 16  GLN A OE1 1 
ATOM   103  N NE2 . GLN A 1 16  ? 7.566   30.012  21.718 1.00 18.22 ? 16  GLN A NE2 1 
ATOM   104  N N   . GLN A 1 17  ? 10.335  28.134  16.306 1.00 9.99  ? 17  GLN A N   1 
ATOM   105  C CA  . GLN A 1 17  ? 10.623  28.115  14.869 1.00 11.71 ? 17  GLN A CA  1 
ATOM   106  C C   . GLN A 1 17  ? 9.461   27.496  14.109 1.00 8.54  ? 17  GLN A C   1 
ATOM   107  O O   . GLN A 1 17  ? 8.830   26.545  14.560 1.00 9.16  ? 17  GLN A O   1 
ATOM   108  C CB  . GLN A 1 17  ? 11.871  27.296  14.559 1.00 10.14 ? 17  GLN A CB  1 
ATOM   109  C CG  . GLN A 1 17  ? 13.118  27.861  15.272 1.00 16.98 ? 17  GLN A CG  1 
ATOM   110  C CD  . GLN A 1 17  ? 13.181  29.368  15.083 1.00 19.53 ? 17  GLN A CD  1 
ATOM   111  O OE1 . GLN A 1 17  ? 13.222  29.833  13.942 1.00 22.17 ? 17  GLN A OE1 1 
ATOM   112  N NE2 . GLN A 1 17  ? 13.152  30.168  16.134 1.00 14.31 ? 17  GLN A NE2 1 
ATOM   113  N N   . PRO A 1 18  ? 9.174   28.024  12.926 1.00 10.43 ? 18  PRO A N   1 
ATOM   114  C CA  . PRO A 1 18  ? 8.080   27.459  12.142 1.00 8.51  ? 18  PRO A CA  1 
ATOM   115  C C   . PRO A 1 18  ? 8.212   25.971  11.879 1.00 10.56 ? 18  PRO A C   1 
ATOM   116  O O   . PRO A 1 18  ? 7.195   25.293  11.884 1.00 8.91  ? 18  PRO A O   1 
ATOM   117  C CB  . PRO A 1 18  ? 8.173   28.234  10.813 1.00 13.90 ? 18  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 18  ? 8.830   29.518  11.204 1.00 21.27 ? 18  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 18  ? 9.808   29.191  12.311 1.00 11.42 ? 18  PRO A CD  1 
ATOM   120  N N   . HIS A 1 19  ? 9.412   25.435  11.651 1.00 8.85  ? 19  HIS A N   1 
ATOM   121  C CA  . HIS A 1 19  ? 9.415   23.988  11.406 1.00 8.41  ? 19  HIS A CA  1 
ATOM   122  C C   . HIS A 1 19  ? 8.866   23.201  12.592 1.00 9.28  ? 19  HIS A C   1 
ATOM   123  O O   . HIS A 1 19  ? 8.357   22.107  12.390 1.00 9.75  ? 19  HIS A O   1 
ATOM   124  C CB  . HIS A 1 19  ? 10.819  23.524  11.043 1.00 8.64  ? 19  HIS A CB  1 
ATOM   125  C CG  . HIS A 1 19  ? 11.796  23.574  12.187 1.00 12.67 ? 19  HIS A CG  1 
ATOM   126  N ND1 . HIS A 1 19  ? 12.657  24.630  12.361 1.00 12.59 ? 19  HIS A ND1 1 
ATOM   127  C CD2 . HIS A 1 19  ? 12.072  22.678  13.164 1.00 12.12 ? 19  HIS A CD2 1 
ATOM   128  C CE1 . HIS A 1 19  ? 13.419  24.403  13.427 1.00 13.61 ? 19  HIS A CE1 1 
ATOM   129  N NE2 . HIS A 1 19  ? 13.084  23.230  13.936 1.00 11.13 ? 19  HIS A NE2 1 
ATOM   130  N N   . PHE A 1 20  ? 8.957   23.782  13.787 1.00 8.42  ? 20  PHE A N   1 
ATOM   131  C CA  . PHE A 1 20  ? 8.440   23.108  14.972 1.00 7.59  ? 20  PHE A CA  1 
ATOM   132  C C   . PHE A 1 20  ? 6.942   23.352  15.088 1.00 8.48  ? 20  PHE A C   1 
ATOM   133  O O   . PHE A 1 20  ? 6.086   22.475  15.210 1.00 8.12  ? 20  PHE A O   1 
ATOM   134  C CB  . PHE A 1 20  ? 9.235   23.615  16.181 1.00 8.58  ? 20  PHE A CB  1 
ATOM   135  C CG  . PHE A 1 20  ? 8.786   22.965  17.500 1.00 11.24 ? 20  PHE A CG  1 
ATOM   136  C CD1 . PHE A 1 20  ? 9.290   21.735  17.896 1.00 8.93  ? 20  PHE A CD1 1 
ATOM   137  C CD2 . PHE A 1 20  ? 7.871   23.621  18.308 1.00 7.45  ? 20  PHE A CD2 1 
ATOM   138  C CE1 . PHE A 1 20  ? 8.899   21.150  19.071 1.00 9.82  ? 20  PHE A CE1 1 
ATOM   139  C CE2 . PHE A 1 20  ? 7.467   23.026  19.492 1.00 11.66 ? 20  PHE A CE2 1 
ATOM   140  C CZ  . PHE A 1 20  ? 7.984   21.796  19.878 1.00 10.45 ? 20  PHE A CZ  1 
ATOM   141  N N   . LEU A 1 21  ? 6.587   24.645  15.040 1.00 8.27  ? 21  LEU A N   1 
ATOM   142  C CA  . LEU A 1 21  ? 5.165   24.963  15.262 1.00 7.27  ? 21  LEU A CA  1 
ATOM   143  C C   . LEU A 1 21  ? 4.249   24.491  14.149 1.00 5.31  ? 21  LEU A C   1 
ATOM   144  O O   . LEU A 1 21  ? 3.110   24.113  14.446 1.00 9.40  ? 21  LEU A O   1 
ATOM   145  C CB  . LEU A 1 21  ? 5.059   26.488  15.465 1.00 6.80  ? 21  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 21  ? 5.630   26.963  16.818 1.00 11.26 ? 21  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 21  ? 5.618   28.484  16.912 1.00 10.72 ? 21  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 21  ? 4.867   26.360  17.983 1.00 10.38 ? 21  LEU A CD2 1 
ATOM   149  N N   . ASN A 1 22  ? 4.717   24.525  12.918 1.00 8.16  ? 22  ASN A N   1 
ATOM   150  C CA  . ASN A 1 22  ? 3.902   24.058  11.796 1.00 10.05 ? 22  ASN A CA  1 
ATOM   151  C C   . ASN A 1 22  ? 3.712   22.561  11.911 1.00 12.20 ? 22  ASN A C   1 
ATOM   152  O O   . ASN A 1 22  ? 2.685   22.016  11.544 1.00 10.37 ? 22  ASN A O   1 
ATOM   153  C CB  . ASN A 1 22  ? 4.550   24.411  10.459 1.00 10.78 ? 22  ASN A CB  1 
ATOM   154  C CG  . ASN A 1 22  ? 4.391   25.890  10.163 1.00 14.80 ? 22  ASN A CG  1 
ATOM   155  O OD1 . ASN A 1 22  ? 5.258   26.533  9.566  1.00 15.02 ? 22  ASN A OD1 1 
ATOM   156  N ND2 . ASN A 1 22  ? 3.249   26.383  10.611 1.00 14.66 ? 22  ASN A ND2 1 
ATOM   157  N N   . THR A 1 23  ? 4.732   21.880  12.462 1.00 8.02  ? 23  THR A N   1 
ATOM   158  C CA  . THR A 1 23  ? 4.559   20.445  12.704 1.00 8.16  ? 23  THR A CA  1 
ATOM   159  C C   . THR A 1 23  ? 3.413   20.187  13.649 1.00 6.25  ? 23  THR A C   1 
ATOM   160  O O   . THR A 1 23  ? 2.526   19.393  13.394 1.00 9.10  ? 23  THR A O   1 
ATOM   161  C CB  . THR A 1 23  ? 5.897   19.867  13.230 1.00 10.12 ? 23  THR A CB  1 
ATOM   162  O OG1 . THR A 1 23  ? 6.869   19.960  12.176 1.00 8.11  ? 23  THR A OG1 1 
ATOM   163  C CG2 . THR A 1 23  ? 5.768   18.388  13.605 1.00 8.85  ? 23  THR A CG2 1 
ATOM   164  N N   . LEU A 1 24  ? 3.383   20.884  14.771 1.00 8.81  ? 24  LEU A N   1 
ATOM   165  C CA  . LEU A 1 24  ? 2.325   20.728  15.757 1.00 7.32  ? 24  LEU A CA  1 
ATOM   166  C C   . LEU A 1 24  ? 0.964   21.129  15.193 1.00 10.68 ? 24  LEU A C   1 
ATOM   167  O O   . LEU A 1 24  ? -0.034  20.538  15.602 1.00 10.47 ? 24  LEU A O   1 
ATOM   168  C CB  . LEU A 1 24  ? 2.679   21.588  16.960 1.00 10.73 ? 24  LEU A CB  1 
ATOM   169  C CG  . LEU A 1 24  ? 3.861   21.066  17.792 1.00 11.45 ? 24  LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 24  ? 3.934   21.871  19.079 1.00 16.32 ? 24  LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 24  ? 3.648   19.589  18.039 1.00 20.31 ? 24  LEU A CD2 1 
ATOM   172  N N   . GLN A 1 25  ? 0.940   22.109  14.292 1.00 8.82  ? 25  GLN A N   1 
ATOM   173  C CA  . GLN A 1 25  ? -0.301  22.486  13.620 1.00 6.78  ? 25  GLN A CA  1 
ATOM   174  C C   . GLN A 1 25  ? -0.843  21.349  12.768 1.00 8.44  ? 25  GLN A C   1 
ATOM   175  O O   . GLN A 1 25  ? -2.030  21.051  12.751 1.00 8.27  ? 25  GLN A O   1 
ATOM   176  C CB  . GLN A 1 25  ? -0.081  23.691  12.677 1.00 7.02  ? 25  GLN A CB  1 
ATOM   177  C CG  . GLN A 1 25  ? 0.017   25.018  13.438 1.00 7.83  ? 25  GLN A CG  1 
ATOM   178  C CD  . GLN A 1 25  ? 0.577   26.079  12.516 1.00 10.96 ? 25  GLN A CD  1 
ATOM   179  O OE1 . GLN A 1 25  ? 0.731   25.829  11.323 1.00 17.90 ? 25  GLN A OE1 1 
ATOM   180  N NE2 . GLN A 1 25  ? 0.920   27.248  13.034 1.00 9.62  ? 25  GLN A NE2 1 
ATOM   181  N N   . THR A 1 26  ? 0.108   20.757  12.039 1.00 8.97  ? 26  THR A N   1 
ATOM   182  C CA  . THR A 1 26  ? -0.273  19.634  11.187 1.00 6.96  ? 26  THR A CA  1 
ATOM   183  C C   . THR A 1 26  ? -0.838  18.499  12.020 1.00 7.35  ? 26  THR A C   1 
ATOM   184  O O   . THR A 1 26  ? -1.863  17.907  11.669 1.00 8.66  ? 26  THR A O   1 
ATOM   185  C CB  . THR A 1 26  ? 0.936   19.200  10.348 1.00 8.73  ? 26  THR A CB  1 
ATOM   186  O OG1 . THR A 1 26  ? 1.160   20.247  9.394  1.00 10.60 ? 26  THR A OG1 1 
ATOM   187  C CG2 . THR A 1 26  ? 0.665   17.899  9.612  1.00 11.22 ? 26  THR A CG2 1 
ATOM   188  N N   . VAL A 1 27  ? -0.146  18.208  13.124 1.00 8.80  ? 27  VAL A N   1 
ATOM   189  C CA  . VAL A 1 27  ? -0.632  17.098  13.955 1.00 7.72  ? 27  VAL A CA  1 
ATOM   190  C C   . VAL A 1 27  ? -2.027  17.371  14.492 1.00 10.00 ? 27  VAL A C   1 
ATOM   191  O O   . VAL A 1 27  ? -2.963  16.577  14.470 1.00 10.16 ? 27  VAL A O   1 
ATOM   192  C CB  . VAL A 1 27  ? 0.391   16.903  15.095 1.00 9.56  ? 27  VAL A CB  1 
ATOM   193  C CG1 . VAL A 1 27  ? -0.173  15.959  16.150 1.00 9.56  ? 27  VAL A CG1 1 
ATOM   194  C CG2 . VAL A 1 27  ? 1.737   16.375  14.564 1.00 10.72 ? 27  VAL A CG2 1 
ATOM   195  N N   . ALA A 1 28  ? -2.214  18.583  15.017 1.00 9.30  ? 28  ALA A N   1 
ATOM   196  C CA  . ALA A 1 28  ? -3.494  18.940  15.610 1.00 10.97 ? 28  ALA A CA  1 
ATOM   197  C C   . ALA A 1 28  ? -4.615  18.903  14.569 1.00 7.18  ? 28  ALA A C   1 
ATOM   198  O O   . ALA A 1 28  ? -5.714  18.486  14.845 1.00 9.88  ? 28  ALA A O   1 
ATOM   199  C CB  . ALA A 1 28  ? -3.413  20.321  16.250 1.00 10.31 ? 28  ALA A CB  1 
ATOM   200  N N   . SER A 1 29  ? -4.302  19.343  13.358 1.00 10.89 ? 29  SER A N   1 
ATOM   201  C CA  . SER A 1 29  ? -5.276  19.264  12.254 1.00 11.88 ? 29  SER A CA  1 
ATOM   202  C C   . SER A 1 29  ? -5.666  17.822  11.935 1.00 10.08 ? 29  SER A C   1 
ATOM   203  O O   . SER A 1 29  ? -6.839  17.421  11.821 1.00 10.12 ? 29  SER A O   1 
ATOM   204  C CB  . SER A 1 29  ? -4.687  19.958  11.029 1.00 9.64  ? 29  SER A CB  1 
ATOM   205  O OG  . SER A 1 29  ? -5.585  19.890  9.912  1.00 12.32 ? 29  SER A OG  1 
ATOM   206  N N   . GLU A 1 30  ? -4.647  16.980  11.755 1.00 8.21  ? 30  GLU A N   1 
ATOM   207  C CA  . GLU A 1 30  ? -4.977  15.588  11.433 1.00 9.39  ? 30  GLU A CA  1 
ATOM   208  C C   . GLU A 1 30  ? -5.791  14.936  12.537 1.00 9.79  ? 30  GLU A C   1 
ATOM   209  O O   . GLU A 1 30  ? -6.738  14.184  12.266 1.00 13.16 ? 30  GLU A O   1 
ATOM   210  C CB  . GLU A 1 30  ? -3.674  14.831  11.145 1.00 9.90  ? 30  GLU A CB  1 
ATOM   211  C CG  . GLU A 1 30  ? -2.918  15.446  9.966  1.00 7.58  ? 30  GLU A CG  1 
ATOM   212  C CD  . GLU A 1 30  ? -1.872  14.534  9.371  1.00 11.46 ? 30  GLU A CD  1 
ATOM   213  O OE1 . GLU A 1 30  ? -1.606  13.425  9.861  1.00 8.24  ? 30  GLU A OE1 1 
ATOM   214  O OE2 . GLU A 1 30  ? -1.291  14.926  8.338  1.00 9.45  ? 30  GLU A OE2 1 
ATOM   215  N N   . ARG A 1 31  ? -5.469  15.230  13.799 1.00 9.43  ? 31  ARG A N   1 
ATOM   216  C CA  . ARG A 1 31  ? -6.263  14.612  14.861 1.00 9.27  ? 31  ARG A CA  1 
ATOM   217  C C   . ARG A 1 31  ? -7.740  14.985  14.742 1.00 11.41 ? 31  ARG A C   1 
ATOM   218  O O   . ARG A 1 31  ? -8.612  14.193  15.063 1.00 16.42 ? 31  ARG A O   1 
ATOM   219  C CB  . ARG A 1 31  ? -5.758  15.028  16.240 1.00 9.28  ? 31  ARG A CB  1 
ATOM   220  C CG  . ARG A 1 31  ? -4.352  14.538  16.609 1.00 9.94  ? 31  ARG A CG  1 
ATOM   221  C CD  . ARG A 1 31  ? -4.152  14.764  18.107 1.00 9.92  ? 31  ARG A CD  1 
ATOM   222  N NE  . ARG A 1 31  ? -2.729  14.831  18.473 1.00 10.52 ? 31  ARG A NE  1 
ATOM   223  C CZ  . ARG A 1 31  ? -2.050  13.735  18.836 1.00 10.62 ? 31  ARG A CZ  1 
ATOM   224  N NH1 . ARG A 1 31  ? -2.655  12.556  18.877 1.00 11.21 ? 31  ARG A NH1 1 
ATOM   225  N NH2 . ARG A 1 31  ? -0.761  13.892  19.144 1.00 9.49  ? 31  ARG A NH2 1 
ATOM   226  N N   . GLN A 1 32  ? -8.034  16.195  14.280 1.00 10.80 ? 32  GLN A N   1 
ATOM   227  C CA  . GLN A 1 32  ? -9.445  16.576  14.147 1.00 12.41 ? 32  GLN A CA  1 
ATOM   228  C C   . GLN A 1 32  ? -10.013 16.177  12.802 1.00 16.00 ? 32  GLN A C   1 
ATOM   229  O O   . GLN A 1 32  ? -11.209 16.353  12.566 1.00 27.46 ? 32  GLN A O   1 
ATOM   230  C CB  . GLN A 1 32  ? -9.555  18.083  14.361 1.00 12.32 ? 32  GLN A CB  1 
ATOM   231  C CG  . GLN A 1 32  ? -9.286  18.456  15.812 1.00 19.08 ? 32  GLN A CG  1 
ATOM   232  C CD  . GLN A 1 32  ? -10.364 18.051  16.794 1.00 35.23 ? 32  GLN A CD  1 
ATOM   233  O OE1 . GLN A 1 32  ? -11.549 17.998  16.481 1.00 41.57 ? 32  GLN A OE1 1 
ATOM   234  N NE2 . GLN A 1 32  ? -9.956  17.754  18.024 1.00 45.12 ? 32  GLN A NE2 1 
ATOM   235  N N   . SER A 1 33  ? -9.236  15.653  11.865 1.00 13.43 ? 33  SER A N   1 
ATOM   236  C CA  . SER A 1 33  ? -9.782  15.347  10.558 1.00 19.51 ? 33  SER A CA  1 
ATOM   237  C C   . SER A 1 33  ? -10.120 13.866  10.410 1.00 36.36 ? 33  SER A C   1 
ATOM   238  O O   . SER A 1 33  ? -10.269 13.358  9.295  1.00 47.40 ? 33  SER A O   1 
ATOM   239  C CB  . SER A 1 33  ? -8.772  15.779  9.492  1.00 25.79 ? 33  SER A CB  1 
ATOM   240  O OG  . SER A 1 33  ? -7.817  14.741  9.343  1.00 32.88 ? 33  SER A OG  1 
ATOM   241  N N   . GLY A 1 34  ? -10.237 13.163  11.546 1.00 32.46 ? 34  GLY A N   1 
ATOM   242  C CA  . GLY A 1 34  ? -10.617 11.762  11.473 1.00 34.95 ? 34  GLY A CA  1 
ATOM   243  C C   . GLY A 1 34  ? -9.436  10.815  11.417 1.00 32.76 ? 34  GLY A C   1 
ATOM   244  O O   . GLY A 1 34  ? -9.641  9.626   11.160 1.00 35.84 ? 34  GLY A O   1 
ATOM   245  N N   . VAL A 1 35  ? -8.230  11.324  11.641 1.00 18.70 ? 35  VAL A N   1 
ATOM   246  C CA  . VAL A 1 35  ? -7.019  10.522  11.679 1.00 13.20 ? 35  VAL A CA  1 
ATOM   247  C C   . VAL A 1 35  ? -6.574  10.322  13.115 1.00 12.48 ? 35  VAL A C   1 
ATOM   248  O O   . VAL A 1 35  ? -6.511  11.282  13.887 1.00 24.53 ? 35  VAL A O   1 
ATOM   249  C CB  . VAL A 1 35  ? -5.841  11.184  10.925 1.00 18.54 ? 35  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 35  ? -4.673  10.210  10.787 1.00 23.02 ? 35  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 35  ? -6.293  11.690  9.564  1.00 19.91 ? 35  VAL A CG2 1 
ATOM   252  N N   . THR A 1 36  ? -6.267  9.091   13.504 1.00 7.53  ? 36  THR A N   1 
ATOM   253  C CA  . THR A 1 36  ? -5.730  8.875   14.843 1.00 8.48  ? 36  THR A CA  1 
ATOM   254  C C   . THR A 1 36  ? -4.220  9.094   14.788 1.00 8.00  ? 36  THR A C   1 
ATOM   255  O O   . THR A 1 36  ? -3.569  8.467   13.958 1.00 8.42  ? 36  THR A O   1 
ATOM   256  C CB  . THR A 1 36  ? -6.077  7.452   15.285 1.00 16.02 ? 36  THR A CB  1 
ATOM   257  O OG1 . THR A 1 36  ? -7.512  7.431   15.501 1.00 13.52 ? 36  THR A OG1 1 
ATOM   258  C CG2 . THR A 1 36  ? -5.379  7.081   16.582 1.00 16.02 ? 36  THR A CG2 1 
ATOM   259  N N   . ILE A 1 37  ? -3.683  9.949   15.635 1.00 8.74  ? 37  ILE A N   1 
ATOM   260  C CA  . ILE A 1 37  ? -2.243  10.219  15.652 1.00 7.71  ? 37  ILE A CA  1 
ATOM   261  C C   . ILE A 1 37  ? -1.672  9.721   16.967 1.00 9.05  ? 37  ILE A C   1 
ATOM   262  O O   . ILE A 1 37  ? -2.284  9.923   18.011 1.00 10.27 ? 37  ILE A O   1 
ATOM   263  C CB  . ILE A 1 37  ? -1.963  11.713  15.540 1.00 8.29  ? 37  ILE A CB  1 
ATOM   264  C CG1 . ILE A 1 37  ? -2.423  12.389  14.241 1.00 9.94  ? 37  ILE A CG1 1 
ATOM   265  C CG2 . ILE A 1 37  ? -0.460  11.986  15.742 1.00 10.09 ? 37  ILE A CG2 1 
ATOM   266  C CD1 . ILE A 1 37  ? -1.896  11.705  12.999 1.00 15.02 ? 37  ILE A CD1 1 
ATOM   267  N N   . TYR A 1 38  ? -0.512  9.088   16.925 1.00 7.19  ? 38  TYR A N   1 
ATOM   268  C CA  . TYR A 1 38  ? 0.150   8.560   18.113 1.00 8.92  ? 38  TYR A CA  1 
ATOM   269  C C   . TYR A 1 38  ? 1.517   9.213   18.311 1.00 8.27  ? 38  TYR A C   1 
ATOM   270  O O   . TYR A 1 38  ? 2.191   9.551   17.343 1.00 7.40  ? 38  TYR A O   1 
ATOM   271  C CB  . TYR A 1 38  ? 0.343   7.066   17.935 1.00 8.38  ? 38  TYR A CB  1 
ATOM   272  C CG  . TYR A 1 38  ? -0.929  6.240   17.938 1.00 5.22  ? 38  TYR A CG  1 
ATOM   273  C CD1 . TYR A 1 38  ? -1.901  6.451   18.913 1.00 8.10  ? 38  TYR A CD1 1 
ATOM   274  C CD2 . TYR A 1 38  ? -1.141  5.249   16.981 1.00 8.19  ? 38  TYR A CD2 1 
ATOM   275  C CE1 . TYR A 1 38  ? -3.059  5.674   18.904 1.00 11.41 ? 38  TYR A CE1 1 
ATOM   276  C CE2 . TYR A 1 38  ? -2.292  4.467   16.950 1.00 9.02  ? 38  TYR A CE2 1 
ATOM   277  C CZ  . TYR A 1 38  ? -3.238  4.699   17.933 1.00 13.14 ? 38  TYR A CZ  1 
ATOM   278  O OH  . TYR A 1 38  ? -4.399  3.950   17.959 1.00 12.37 ? 38  TYR A OH  1 
ATOM   279  N N   . PRO A 1 39  ? 1.951   9.410   19.557 1.00 7.70  ? 39  PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? 1.140   9.135   20.741 1.00 6.82  ? 39  PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? 0.133   10.260  20.941 1.00 9.83  ? 39  PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? 0.102   11.229  20.163 1.00 10.51 ? 39  PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? 2.218   9.163   21.846 1.00 9.48  ? 39  PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? 3.147   10.244  21.362 1.00 8.41  ? 39  PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? 3.277   9.968   19.877 1.00 7.93  ? 39  PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? -0.702  10.164  21.983 1.00 10.27 ? 40  PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? -1.564  11.289  22.344 1.00 8.95  ? 40  PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? -0.782  12.561  22.546 1.00 12.97 ? 40  PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? 0.392   12.543  22.928 1.00 12.23 ? 40  PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? -2.146  10.828  23.694 1.00 9.34  ? 40  PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? -2.208  9.344   23.560 1.00 11.10 ? 40  PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? -0.895  8.997   22.868 1.00 12.14 ? 40  PRO A CD  1 
ATOM   293  N N   . GLN A 1 41  ? -1.406  13.716  22.334 1.00 11.40 ? 41  GLN A N   1 
ATOM   294  C CA  . GLN A 1 41  ? -0.703  14.977  22.446 1.00 12.40 ? 41  GLN A CA  1 
ATOM   295  C C   . GLN A 1 41  ? 0.009   15.161  23.798 1.00 11.18 ? 41  GLN A C   1 
ATOM   296  O O   . GLN A 1 41  ? 1.117   15.674  23.801 1.00 14.41 ? 41  GLN A O   1 
ATOM   297  C CB  . GLN A 1 41  ? -1.704  16.117  22.207 1.00 20.79 ? 41  GLN A CB  1 
ATOM   298  C CG  . GLN A 1 41  ? -1.201  17.452  22.718 1.00 20.26 ? 41  GLN A CG  1 
ATOM   299  C CD  . GLN A 1 41  ? -1.756  18.649  21.982 1.00 37.81 ? 41  GLN A CD  1 
ATOM   300  O OE1 . GLN A 1 41  ? -2.975  18.811  21.906 1.00 37.93 ? 41  GLN A OE1 1 
ATOM   301  N NE2 . GLN A 1 41  ? -0.865  19.482  21.450 1.00 71.59 ? 41  GLN A NE2 1 
ATOM   302  N N   . LYS A 1 42  ? -0.602  14.730  24.894 1.00 10.09 ? 42  LYS A N   1 
ATOM   303  C CA  . LYS A 1 42  ? 0.011   14.966  26.194 1.00 13.22 ? 42  LYS A CA  1 
ATOM   304  C C   . LYS A 1 42  ? 1.280   14.144  26.418 1.00 15.41 ? 42  LYS A C   1 
ATOM   305  O O   . LYS A 1 42  ? 2.017   14.397  27.375 1.00 10.67 ? 42  LYS A O   1 
ATOM   306  C CB  . LYS A 1 42  ? -1.003  14.622  27.276 1.00 13.70 ? 42  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 42  ? -1.280  13.143  27.507 1.00 18.52 ? 42  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 42  ? -2.453  13.020  28.475 1.00 25.71 ? 42  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 42  ? -2.910  11.615  28.775 1.00 27.29 ? 42  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 42  ? -2.459  10.596  27.779 1.00 26.75 ? 42  LYS A NZ  1 
ATOM   311  N N   . ASP A 1 43  ? 1.515   13.159  25.547 1.00 10.73 ? 43  ASP A N   1 
ATOM   312  C CA  . ASP A 1 43  ? 2.640   12.246  25.707 1.00 6.09  ? 43  ASP A CA  1 
ATOM   313  C C   . ASP A 1 43  ? 3.778   12.522  24.739 1.00 6.81  ? 43  ASP A C   1 
ATOM   314  O O   . ASP A 1 43  ? 4.847   11.895  24.832 1.00 5.95  ? 43  ASP A O   1 
ATOM   315  C CB  . ASP A 1 43  ? 2.151   10.792  25.497 1.00 8.85  ? 43  ASP A CB  1 
ATOM   316  C CG  . ASP A 1 43  ? 1.137   10.429  26.585 1.00 12.00 ? 43  ASP A CG  1 
ATOM   317  O OD1 . ASP A 1 43  ? 1.425   10.808  27.740 1.00 10.70 ? 43  ASP A OD1 1 
ATOM   318  O OD2 . ASP A 1 43  ? 0.108   9.820   26.267 1.00 15.45 ? 43  ASP A OD2 1 
ATOM   319  N N   . VAL A 1 44  ? 3.578   13.444  23.789 1.00 7.94  ? 44  VAL A N   1 
ATOM   320  C CA  . VAL A 1 44  ? 4.548   13.573  22.696 1.00 6.66  ? 44  VAL A CA  1 
ATOM   321  C C   . VAL A 1 44  ? 5.965   13.852  23.200 1.00 8.30  ? 44  VAL A C   1 
ATOM   322  O O   . VAL A 1 44  ? 6.954   13.392  22.596 1.00 7.29  ? 44  VAL A O   1 
ATOM   323  C CB  . VAL A 1 44  ? 4.085   14.666  21.715 1.00 6.73  ? 44  VAL A CB  1 
ATOM   324  C CG1 . VAL A 1 44  ? 5.188   15.118  20.769 1.00 5.90  ? 44  VAL A CG1 1 
ATOM   325  C CG2 . VAL A 1 44  ? 2.894   14.110  20.912 1.00 7.91  ? 44  VAL A CG2 1 
ATOM   326  N N   . PHE A 1 45  ? 6.038   14.594  24.312 1.00 6.98  ? 45  PHE A N   1 
ATOM   327  C CA  . PHE A 1 45  ? 7.363   15.000  24.776 1.00 5.75  ? 45  PHE A CA  1 
ATOM   328  C C   . PHE A 1 45  ? 7.758   14.289  26.057 1.00 8.05  ? 45  PHE A C   1 
ATOM   329  O O   . PHE A 1 45  ? 8.598   14.813  26.808 1.00 7.45  ? 45  PHE A O   1 
ATOM   330  C CB  . PHE A 1 45  ? 7.349   16.523  25.022 1.00 10.25 ? 45  PHE A CB  1 
ATOM   331  C CG  . PHE A 1 45  ? 7.102   17.262  23.705 1.00 10.41 ? 45  PHE A CG  1 
ATOM   332  C CD1 . PHE A 1 45  ? 8.166   17.432  22.837 1.00 9.14  ? 45  PHE A CD1 1 
ATOM   333  C CD2 . PHE A 1 45  ? 5.866   17.778  23.384 1.00 12.03 ? 45  PHE A CD2 1 
ATOM   334  C CE1 . PHE A 1 45  ? 8.059   18.107  21.623 1.00 11.25 ? 45  PHE A CE1 1 
ATOM   335  C CE2 . PHE A 1 45  ? 5.736   18.408  22.148 1.00 12.56 ? 45  PHE A CE2 1 
ATOM   336  C CZ  . PHE A 1 45  ? 6.798   18.578  21.285 1.00 9.47  ? 45  PHE A CZ  1 
ATOM   337  N N   . ASN A 1 46  ? 7.183   13.109  26.301 1.00 7.67  ? 46  ASN A N   1 
ATOM   338  C CA  . ASN A 1 46  ? 7.461   12.466  27.590 1.00 6.31  ? 46  ASN A CA  1 
ATOM   339  C C   . ASN A 1 46  ? 8.936   12.159  27.733 1.00 7.79  ? 46  ASN A C   1 
ATOM   340  O O   . ASN A 1 46  ? 9.381   12.083  28.882 1.00 7.17  ? 46  ASN A O   1 
ATOM   341  C CB  . ASN A 1 46  ? 6.653   11.197  27.760 1.00 5.18  ? 46  ASN A CB  1 
ATOM   342  C CG  . ASN A 1 46  ? 5.208   11.479  28.128 1.00 6.37  ? 46  ASN A CG  1 
ATOM   343  O OD1 . ASN A 1 46  ? 4.881   12.632  28.457 1.00 9.30  ? 46  ASN A OD1 1 
ATOM   344  N ND2 . ASN A 1 46  ? 4.356   10.473  28.088 1.00 6.12  ? 46  ASN A ND2 1 
ATOM   345  N N   . ALA A 1 47  ? 9.730   11.987  26.673 1.00 7.81  ? 47  ALA A N   1 
ATOM   346  C CA  . ALA A 1 47  ? 11.140  11.659  26.951 1.00 9.92  ? 47  ALA A CA  1 
ATOM   347  C C   . ALA A 1 47  ? 11.828  12.794  27.687 1.00 6.67  ? 47  ALA A C   1 
ATOM   348  O O   . ALA A 1 47  ? 12.704  12.543  28.530 1.00 6.70  ? 47  ALA A O   1 
ATOM   349  C CB  . ALA A 1 47  ? 11.935  11.363  25.675 1.00 10.97 ? 47  ALA A CB  1 
ATOM   350  N N   . PHE A 1 48  ? 11.429  14.009  27.300 1.00 6.65  ? 48  PHE A N   1 
ATOM   351  C CA  . PHE A 1 48  ? 11.955  15.220  27.941 1.00 8.12  ? 48  PHE A CA  1 
ATOM   352  C C   . PHE A 1 48  ? 11.399  15.366  29.351 1.00 6.67  ? 48  PHE A C   1 
ATOM   353  O O   . PHE A 1 48  ? 12.112  15.813  30.269 1.00 7.60  ? 48  PHE A O   1 
ATOM   354  C CB  . PHE A 1 48  ? 11.592  16.490  27.134 1.00 7.93  ? 48  PHE A CB  1 
ATOM   355  C CG  . PHE A 1 48  ? 12.115  16.362  25.701 1.00 5.69  ? 48  PHE A CG  1 
ATOM   356  C CD1 . PHE A 1 48  ? 11.315  15.772  24.735 1.00 5.98  ? 48  PHE A CD1 1 
ATOM   357  C CD2 . PHE A 1 48  ? 13.377  16.779  25.365 1.00 7.01  ? 48  PHE A CD2 1 
ATOM   358  C CE1 . PHE A 1 48  ? 11.821  15.651  23.442 1.00 9.32  ? 48  PHE A CE1 1 
ATOM   359  C CE2 . PHE A 1 48  ? 13.896  16.642  24.093 1.00 9.07  ? 48  PHE A CE2 1 
ATOM   360  C CZ  . PHE A 1 48  ? 13.105  16.061  23.106 1.00 6.91  ? 48  PHE A CZ  1 
ATOM   361  N N   . ARG A 1 49  ? 10.139  15.006  29.527 1.00 7.01  ? 49  ARG A N   1 
ATOM   362  C CA  . ARG A 1 49  ? 9.541   15.143  30.859 1.00 5.78  ? 49  ARG A CA  1 
ATOM   363  C C   . ARG A 1 49  ? 10.225  14.251  31.878 1.00 8.09  ? 49  ARG A C   1 
ATOM   364  O O   . ARG A 1 49  ? 10.435  14.594  33.054 1.00 9.30  ? 49  ARG A O   1 
ATOM   365  C CB  . ARG A 1 49  ? 8.076   14.690  30.836 1.00 11.16 ? 49  ARG A CB  1 
ATOM   366  C CG  . ARG A 1 49  ? 7.035   15.588  30.240 1.00 20.61 ? 49  ARG A CG  1 
ATOM   367  C CD  . ARG A 1 49  ? 5.673   15.097  30.783 1.00 17.26 ? 49  ARG A CD  1 
ATOM   368  N NE  . ARG A 1 49  ? 4.613   15.589  29.925 1.00 21.88 ? 49  ARG A NE  1 
ATOM   369  C CZ  . ARG A 1 49  ? 3.980   16.722  30.194 1.00 21.80 ? 49  ARG A CZ  1 
ATOM   370  N NH1 . ARG A 1 49  ? 4.345   17.386  31.275 1.00 14.92 ? 49  ARG A NH1 1 
ATOM   371  N NH2 . ARG A 1 49  ? 3.025   17.121  29.374 1.00 32.35 ? 49  ARG A NH2 1 
ATOM   372  N N   . PHE A 1 50  ? 10.561  13.044  31.420 1.00 5.97  ? 50  PHE A N   1 
ATOM   373  C CA  . PHE A 1 50  ? 11.076  12.032  32.335 1.00 7.77  ? 50  PHE A CA  1 
ATOM   374  C C   . PHE A 1 50  ? 12.599  12.046  32.448 1.00 8.25  ? 50  PHE A C   1 
ATOM   375  O O   . PHE A 1 50  ? 13.155  11.457  33.396 1.00 7.94  ? 50  PHE A O   1 
ATOM   376  C CB  . PHE A 1 50  ? 10.637  10.618  31.926 1.00 10.67 ? 50  PHE A CB  1 
ATOM   377  C CG  . PHE A 1 50  ? 9.139   10.359  31.801 1.00 6.04  ? 50  PHE A CG  1 
ATOM   378  C CD1 . PHE A 1 50  ? 8.230   11.266  32.321 1.00 6.95  ? 50  PHE A CD1 1 
ATOM   379  C CD2 . PHE A 1 50  ? 8.664   9.228   31.154 1.00 8.36  ? 50  PHE A CD2 1 
ATOM   380  C CE1 . PHE A 1 50  ? 6.856   11.014  32.210 1.00 10.93 ? 50  PHE A CE1 1 
ATOM   381  C CE2 . PHE A 1 50  ? 7.298   8.989   31.019 1.00 8.68  ? 50  PHE A CE2 1 
ATOM   382  C CZ  . PHE A 1 50  ? 6.384   9.879   31.556 1.00 8.83  ? 50  PHE A CZ  1 
ATOM   383  N N   . THR A 1 51  ? 13.292  12.695  31.526 1.00 6.05  ? 51  THR A N   1 
ATOM   384  C CA  . THR A 1 51  ? 14.762  12.752  31.580 1.00 6.44  ? 51  THR A CA  1 
ATOM   385  C C   . THR A 1 51  ? 15.191  14.175  31.284 1.00 6.32  ? 51  THR A C   1 
ATOM   386  O O   . THR A 1 51  ? 15.323  14.586  30.127 1.00 7.81  ? 51  THR A O   1 
ATOM   387  C CB  . THR A 1 51  ? 15.447  11.809  30.567 1.00 6.64  ? 51  THR A CB  1 
ATOM   388  O OG1 . THR A 1 51  ? 14.932  10.476  30.704 1.00 6.84  ? 51  THR A OG1 1 
ATOM   389  C CG2 . THR A 1 51  ? 16.960  11.794  30.806 1.00 7.88  ? 51  THR A CG2 1 
ATOM   390  N N   . GLU A 1 52  ? 15.360  14.971  32.349 1.00 7.62  ? 52  GLU A N   1 
ATOM   391  C CA  . GLU A 1 52  ? 15.778  16.346  32.166 1.00 7.59  ? 52  GLU A CA  1 
ATOM   392  C C   . GLU A 1 52  ? 17.196  16.403  31.595 1.00 6.78  ? 52  GLU A C   1 
ATOM   393  O O   . GLU A 1 52  ? 17.962  15.453  31.773 1.00 7.77  ? 52  GLU A O   1 
ATOM   394  C CB  . GLU A 1 52  ? 15.707  17.134  33.498 1.00 10.50 ? 52  GLU A CB  1 
ATOM   395  C CG  . GLU A 1 52  ? 14.595  18.169  33.440 1.00 29.08 ? 52  GLU A CG  1 
ATOM   396  C CD  . GLU A 1 52  ? 14.503  19.257  32.396 1.00 41.23 ? 52  GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 52  ? 15.494  19.616  31.699 1.00 10.64 ? 52  GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 52  ? 13.353  19.822  32.258 1.00 19.35 ? 52  GLU A OE2 1 
ATOM   399  N N   . LEU A 1 53  ? 17.476  17.519  30.934 1.00 9.10  ? 53  LEU A N   1 
ATOM   400  C CA  . LEU A 1 53  ? 18.765  17.691  30.264 1.00 7.62  ? 53  LEU A CA  1 
ATOM   401  C C   . LEU A 1 53  ? 19.930  17.345  31.198 1.00 7.76  ? 53  LEU A C   1 
ATOM   402  O O   . LEU A 1 53  ? 20.827  16.588  30.837 1.00 8.66  ? 53  LEU A O   1 
ATOM   403  C CB  . LEU A 1 53  ? 18.879  19.134  29.764 1.00 5.93  ? 53  LEU A CB  1 
ATOM   404  C CG  . LEU A 1 53  ? 20.230  19.458  29.135 1.00 7.86  ? 53  LEU A CG  1 
ATOM   405  C CD1 . LEU A 1 53  ? 20.520  18.593  27.903 1.00 8.80  ? 53  LEU A CD1 1 
ATOM   406  C CD2 . LEU A 1 53  ? 20.299  20.914  28.716 1.00 11.77 ? 53  LEU A CD2 1 
ATOM   407  N N   . GLY A 1 54  ? 19.880  17.895  32.407 1.00 7.49  ? 54  GLY A N   1 
ATOM   408  C CA  . GLY A 1 54  ? 21.023  17.709  33.309 1.00 9.51  ? 54  GLY A CA  1 
ATOM   409  C C   . GLY A 1 54  ? 21.122  16.306  33.859 1.00 10.53 ? 54  GLY A C   1 
ATOM   410  O O   . GLY A 1 54  ? 22.167  15.952  34.428 1.00 11.97 ? 54  GLY A O   1 
ATOM   411  N N   . ASP A 1 55  ? 20.075  15.510  33.657 1.00 7.74  ? 55  ASP A N   1 
ATOM   412  C CA  . ASP A 1 55  ? 20.036  14.135  34.134 1.00 5.91  ? 55  ASP A CA  1 
ATOM   413  C C   . ASP A 1 55  ? 20.328  13.124  33.029 1.00 7.14  ? 55  ASP A C   1 
ATOM   414  O O   . ASP A 1 55  ? 20.391  11.929  33.306 1.00 8.87  ? 55  ASP A O   1 
ATOM   415  C CB  . ASP A 1 55  ? 18.640  13.871  34.693 1.00 7.08  ? 55  ASP A CB  1 
ATOM   416  C CG  . ASP A 1 55  ? 18.421  14.647  35.984 1.00 12.61 ? 55  ASP A CG  1 
ATOM   417  O OD1 . ASP A 1 55  ? 19.446  15.013  36.603 1.00 15.61 ? 55  ASP A OD1 1 
ATOM   418  O OD2 . ASP A 1 55  ? 17.246  14.837  36.334 1.00 14.70 ? 55  ASP A OD2 1 
ATOM   419  N N   . VAL A 1 56  ? 20.575  13.567  31.793 1.00 7.42  ? 56  VAL A N   1 
ATOM   420  C CA  . VAL A 1 56  ? 20.805  12.589  30.710 1.00 5.93  ? 56  VAL A CA  1 
ATOM   421  C C   . VAL A 1 56  ? 22.139  11.893  30.916 1.00 9.63  ? 56  VAL A C   1 
ATOM   422  O O   . VAL A 1 56  ? 23.188  12.544  31.022 1.00 10.90 ? 56  VAL A O   1 
ATOM   423  C CB  . VAL A 1 56  ? 20.855  13.270  29.338 1.00 8.05  ? 56  VAL A CB  1 
ATOM   424  C CG1 . VAL A 1 56  ? 21.299  12.286  28.245 1.00 6.79  ? 56  VAL A CG1 1 
ATOM   425  C CG2 . VAL A 1 56  ? 19.514  13.904  28.955 1.00 6.95  ? 56  VAL A CG2 1 
ATOM   426  N N   . LYS A 1 57  ? 22.115  10.563  30.975 1.00 8.03  ? 57  LYS A N   1 
ATOM   427  C CA  . LYS A 1 57  ? 23.337  9.787   31.103 1.00 7.94  ? 57  LYS A CA  1 
ATOM   428  C C   . LYS A 1 57  ? 23.581  8.927   29.859 1.00 7.77  ? 57  LYS A C   1 
ATOM   429  O O   . LYS A 1 57  ? 24.745  8.753   29.457 1.00 6.66  ? 57  LYS A O   1 
ATOM   430  C CB  . LYS A 1 57  ? 23.255  8.835   32.294 1.00 10.80 ? 57  LYS A CB  1 
ATOM   431  C CG  . LYS A 1 57  ? 23.390  9.547   33.643 1.00 10.70 ? 57  LYS A CG  1 
ATOM   432  C CD  . LYS A 1 57  ? 23.012  8.572   34.730 1.00 11.67 ? 57  LYS A CD  1 
ATOM   433  C CE  . LYS A 1 57  ? 24.134  7.884   35.456 1.00 22.91 ? 57  LYS A CE  1 
ATOM   434  N NZ  . LYS A 1 57  ? 23.692  7.537   36.847 1.00 18.44 ? 57  LYS A NZ  1 
ATOM   435  N N   . VAL A 1 58  ? 22.470  8.425   29.310 1.00 6.28  ? 58  VAL A N   1 
ATOM   436  C CA  . VAL A 1 58  ? 22.519  7.530   28.145 1.00 5.96  ? 58  VAL A CA  1 
ATOM   437  C C   . VAL A 1 58  ? 21.441  8.038   27.183 1.00 7.12  ? 58  VAL A C   1 
ATOM   438  O O   . VAL A 1 58  ? 20.334  8.321   27.628 1.00 9.72  ? 58  VAL A O   1 
ATOM   439  C CB  . VAL A 1 58  ? 22.245  6.061   28.452 1.00 6.66  ? 58  VAL A CB  1 
ATOM   440  C CG1 . VAL A 1 58  ? 22.425  5.142   27.242 1.00 6.31  ? 58  VAL A CG1 1 
ATOM   441  C CG2 . VAL A 1 58  ? 23.165  5.584   29.567 1.00 8.20  ? 58  VAL A CG2 1 
ATOM   442  N N   . VAL A 1 59  ? 21.800  8.144   25.892 1.00 5.89  ? 59  VAL A N   1 
ATOM   443  C CA  . VAL A 1 59  ? 20.789  8.497   24.897 1.00 4.53  ? 59  VAL A CA  1 
ATOM   444  C C   . VAL A 1 59  ? 20.606  7.290   24.000 1.00 5.64  ? 59  VAL A C   1 
ATOM   445  O O   . VAL A 1 59  ? 21.614  6.821   23.475 1.00 7.24  ? 59  VAL A O   1 
ATOM   446  C CB  . VAL A 1 59  ? 21.245  9.704   24.068 1.00 5.70  ? 59  VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 59  ? 20.239  9.939   22.936 1.00 6.62  ? 59  VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 59  ? 21.382  10.931  24.957 1.00 7.12  ? 59  VAL A CG2 1 
ATOM   449  N N   . ILE A 1 60  ? 19.369  6.828   23.871 1.00 5.36  ? 60  ILE A N   1 
ATOM   450  C CA  . ILE A 1 60  ? 19.071  5.772   22.915 1.00 6.08  ? 60  ILE A CA  1 
ATOM   451  C C   . ILE A 1 60  ? 18.075  6.359   21.918 1.00 6.13  ? 60  ILE A C   1 
ATOM   452  O O   . ILE A 1 60  ? 16.973  6.722   22.293 1.00 6.64  ? 60  ILE A O   1 
ATOM   453  C CB  . ILE A 1 60  ? 18.507  4.505   23.582 1.00 7.24  ? 60  ILE A CB  1 
ATOM   454  C CG1 . ILE A 1 60  ? 19.395  3.966   24.696 1.00 6.96  ? 60  ILE A CG1 1 
ATOM   455  C CG2 . ILE A 1 60  ? 18.256  3.420   22.539 1.00 10.00 ? 60  ILE A CG2 1 
ATOM   456  C CD1 . ILE A 1 60  ? 18.777  2.765   25.383 1.00 8.17  ? 60  ILE A CD1 1 
ATOM   457  N N   . LEU A 1 61  ? 18.504  6.460   20.662 1.00 6.35  ? 61  LEU A N   1 
ATOM   458  C CA  . LEU A 1 61  ? 17.580  6.936   19.648 1.00 6.48  ? 61  LEU A CA  1 
ATOM   459  C C   . LEU A 1 61  ? 16.702  5.840   19.068 1.00 5.60  ? 61  LEU A C   1 
ATOM   460  O O   . LEU A 1 61  ? 17.195  4.750   18.766 1.00 7.14  ? 61  LEU A O   1 
ATOM   461  C CB  . LEU A 1 61  ? 18.394  7.503   18.473 1.00 7.04  ? 61  LEU A CB  1 
ATOM   462  C CG  . LEU A 1 61  ? 19.339  8.635   18.874 1.00 8.11  ? 61  LEU A CG  1 
ATOM   463  C CD1 . LEU A 1 61  ? 19.950  9.280   17.636 1.00 6.87  ? 61  LEU A CD1 1 
ATOM   464  C CD2 . LEU A 1 61  ? 18.566  9.642   19.723 1.00 7.01  ? 61  LEU A CD2 1 
ATOM   465  N N   . GLY A 1 62  ? 15.429  6.191   18.936 1.00 6.16  ? 62  GLY A N   1 
ATOM   466  C CA  . GLY A 1 62  ? 14.499  5.441   18.073 1.00 5.86  ? 62  GLY A CA  1 
ATOM   467  C C   . GLY A 1 62  ? 14.352  6.262   16.806 1.00 8.46  ? 62  GLY A C   1 
ATOM   468  O O   . GLY A 1 62  ? 14.997  7.285   16.614 1.00 11.35 ? 62  GLY A O   1 
ATOM   469  N N   . GLN A 1 63  ? 13.475  5.820   15.911 1.00 7.57  ? 63  GLN A N   1 
ATOM   470  C CA  . GLN A 1 63  ? 13.234  6.640   14.722 1.00 8.53  ? 63  GLN A CA  1 
ATOM   471  C C   . GLN A 1 63  ? 11.781  7.086   14.817 1.00 6.96  ? 63  GLN A C   1 
ATOM   472  O O   . GLN A 1 63  ? 11.487  8.201   15.271 1.00 7.98  ? 63  GLN A O   1 
ATOM   473  C CB  . GLN A 1 63  ? 13.542  5.860   13.432 1.00 9.79  ? 63  GLN A CB  1 
ATOM   474  C CG  . GLN A 1 63  ? 13.395  6.750   12.191 1.00 10.58 ? 63  GLN A CG  1 
ATOM   475  C CD  . GLN A 1 63  ? 13.847  6.064   10.905 1.00 15.27 ? 63  GLN A CD  1 
ATOM   476  O OE1 . GLN A 1 63  ? 14.170  4.875   10.942 1.00 16.27 ? 63  GLN A OE1 1 
ATOM   477  N NE2 . GLN A 1 63  ? 13.833  6.801   9.798  1.00 13.33 ? 63  GLN A NE2 1 
ATOM   478  N N   . ASP A 1 64  ? 10.857  6.216   14.427 1.00 8.48  ? 64  ASP A N   1 
ATOM   479  C CA  . ASP A 1 64  ? 9.438   6.540   14.393 1.00 8.40  ? 64  ASP A CA  1 
ATOM   480  C C   . ASP A 1 64  ? 8.725   6.126   15.664 1.00 10.70 ? 64  ASP A C   1 
ATOM   481  O O   . ASP A 1 64  ? 9.090   5.073   16.191 1.00 9.24  ? 64  ASP A O   1 
ATOM   482  C CB  . ASP A 1 64  ? 8.771   5.722   13.251 1.00 10.27 ? 64  ASP A CB  1 
ATOM   483  C CG  . ASP A 1 64  ? 7.709   6.497   12.503 1.00 10.41 ? 64  ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 64  ? 7.971   7.692   12.293 1.00 11.39 ? 64  ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 64  ? 6.680   5.882   12.147 1.00 11.71 ? 64  ASP A OD2 1 
ATOM   486  N N   . PRO A 1 65  ? 7.710   6.783   16.179 1.00 7.64  ? 65  PRO A N   1 
ATOM   487  C CA  . PRO A 1 65  ? 6.939   6.186   17.264 1.00 6.59  ? 65  PRO A CA  1 
ATOM   488  C C   . PRO A 1 65  ? 6.230   4.933   16.783 1.00 8.86  ? 65  PRO A C   1 
ATOM   489  O O   . PRO A 1 65  ? 5.891   4.802   15.601 1.00 8.60  ? 65  PRO A O   1 
ATOM   490  C CB  . PRO A 1 65  ? 5.899   7.239   17.614 1.00 8.23  ? 65  PRO A CB  1 
ATOM   491  C CG  . PRO A 1 65  ? 6.381   8.516   16.997 1.00 8.75  ? 65  PRO A CG  1 
ATOM   492  C CD  . PRO A 1 65  ? 7.186   8.097   15.792 1.00 7.99  ? 65  PRO A CD  1 
ATOM   493  N N   . TYR A 1 66  ? 5.979   3.989   17.700 1.00 6.32  ? 66  TYR A N   1 
ATOM   494  C CA  . TYR A 1 66  ? 5.116   2.871   17.328 1.00 6.77  ? 66  TYR A CA  1 
ATOM   495  C C   . TYR A 1 66  ? 3.757   3.404   16.871 1.00 6.27  ? 66  TYR A C   1 
ATOM   496  O O   . TYR A 1 66  ? 3.304   4.448   17.349 1.00 8.57  ? 66  TYR A O   1 
ATOM   497  C CB  . TYR A 1 66  ? 4.890   1.962   18.513 1.00 6.78  ? 66  TYR A CB  1 
ATOM   498  C CG  . TYR A 1 66  ? 6.083   1.224   19.051 1.00 8.94  ? 66  TYR A CG  1 
ATOM   499  C CD1 . TYR A 1 66  ? 6.802   0.338   18.245 1.00 8.24  ? 66  TYR A CD1 1 
ATOM   500  C CD2 . TYR A 1 66  ? 6.486   1.393   20.363 1.00 6.66  ? 66  TYR A CD2 1 
ATOM   501  C CE1 . TYR A 1 66  ? 7.902   -0.341  18.741 1.00 8.97  ? 66  TYR A CE1 1 
ATOM   502  C CE2 . TYR A 1 66  ? 7.581   0.707   20.875 1.00 4.84  ? 66  TYR A CE2 1 
ATOM   503  C CZ  . TYR A 1 66  ? 8.287   -0.163  20.068 1.00 7.60  ? 66  TYR A CZ  1 
ATOM   504  O OH  . TYR A 1 66  ? 9.390   -0.875  20.526 1.00 8.47  ? 66  TYR A OH  1 
ATOM   505  N N   . HIS A 1 67  ? 3.109   2.698   15.942 1.00 5.64  ? 67  HIS A N   1 
ATOM   506  C CA  . HIS A 1 67  ? 1.924   3.277   15.321 1.00 7.23  ? 67  HIS A CA  1 
ATOM   507  C C   . HIS A 1 67  ? 0.605   2.552   15.613 1.00 9.48  ? 67  HIS A C   1 
ATOM   508  O O   . HIS A 1 67  ? -0.410  2.836   14.953 1.00 7.87  ? 67  HIS A O   1 
ATOM   509  C CB  . HIS A 1 67  ? 2.135   3.383   13.801 1.00 9.56  ? 67  HIS A CB  1 
ATOM   510  C CG  . HIS A 1 67  ? 2.419   2.088   13.117 1.00 9.55  ? 67  HIS A CG  1 
ATOM   511  N ND1 . HIS A 1 67  ? 1.505   1.063   12.970 1.00 13.21 ? 67  HIS A ND1 1 
ATOM   512  C CD2 . HIS A 1 67  ? 3.549   1.695   12.476 1.00 8.30  ? 67  HIS A CD2 1 
ATOM   513  C CE1 . HIS A 1 67  ? 2.067   0.068   12.296 1.00 8.54  ? 67  HIS A CE1 1 
ATOM   514  N NE2 . HIS A 1 67  ? 3.297   0.433   11.997 1.00 9.69  ? 67  HIS A NE2 1 
ATOM   515  N N   . GLY A 1 68  ? 0.574   1.675   16.626 1.00 7.79  ? 68  GLY A N   1 
ATOM   516  C CA  . GLY A 1 68  ? -0.632  0.954   16.997 1.00 7.89  ? 68  GLY A CA  1 
ATOM   517  C C   . GLY A 1 68  ? -1.249  1.390   18.306 1.00 8.63  ? 68  GLY A C   1 
ATOM   518  O O   . GLY A 1 68  ? -0.575  2.056   19.110 1.00 8.09  ? 68  GLY A O   1 
ATOM   519  N N   . PRO A 1 69  ? -2.497  1.027   18.561 1.00 7.40  ? 69  PRO A N   1 
ATOM   520  C CA  . PRO A 1 69  ? -3.128  1.456   19.827 1.00 8.61  ? 69  PRO A CA  1 
ATOM   521  C C   . PRO A 1 69  ? -2.376  0.891   21.028 1.00 7.98  ? 69  PRO A C   1 
ATOM   522  O O   . PRO A 1 69  ? -1.998  -0.274  21.018 1.00 8.97  ? 69  PRO A O   1 
ATOM   523  C CB  . PRO A 1 69  ? -4.561  0.897   19.768 1.00 9.59  ? 69  PRO A CB  1 
ATOM   524  C CG  . PRO A 1 69  ? -4.479  -0.213  18.764 1.00 10.79 ? 69  PRO A CG  1 
ATOM   525  C CD  . PRO A 1 69  ? -3.434  0.238   17.753 1.00 8.22  ? 69  PRO A CD  1 
ATOM   526  N N   . GLY A 1 70  ? -2.193  1.777   22.018 1.00 10.26 ? 70  GLY A N   1 
ATOM   527  C CA  . GLY A 1 70  ? -1.586  1.360   23.268 1.00 10.32 ? 70  GLY A CA  1 
ATOM   528  C C   . GLY A 1 70  ? -0.071  1.380   23.257 1.00 8.53  ? 70  GLY A C   1 
ATOM   529  O O   . GLY A 1 70  ? 0.551   1.184   24.309 1.00 10.24 ? 70  GLY A O   1 
ATOM   530  N N   . GLN A 1 71  ? 0.577   1.605   22.122 1.00 7.26  ? 71  GLN A N   1 
ATOM   531  C CA  . GLN A 1 71  ? 2.022   1.411   22.018 1.00 5.87  ? 71  GLN A CA  1 
ATOM   532  C C   . GLN A 1 71  ? 2.750   2.704   22.356 1.00 9.64  ? 71  GLN A C   1 
ATOM   533  O O   . GLN A 1 71  ? 3.347   2.820   23.436 1.00 10.35 ? 71  GLN A O   1 
ATOM   534  C CB  . GLN A 1 71  ? 2.423   0.924   20.615 1.00 5.95  ? 71  GLN A CB  1 
ATOM   535  C CG  . GLN A 1 71  ? 1.916   -0.497  20.342 1.00 8.40  ? 71  GLN A CG  1 
ATOM   536  C CD  . GLN A 1 71  ? 2.392   -0.948  18.957 1.00 11.25 ? 71  GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 71  ? 2.282   -0.182  17.987 1.00 8.09  ? 71  GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 71  ? 2.891   -2.165  18.880 1.00 7.96  ? 71  GLN A NE2 1 
ATOM   539  N N   . ALA A 1 72  ? 2.740   3.690   21.470 1.00 5.89  ? 72  ALA A N   1 
ATOM   540  C CA  . ALA A 1 72  ? 3.522   4.887   21.689 1.00 6.35  ? 72  ALA A CA  1 
ATOM   541  C C   . ALA A 1 72  ? 2.993   5.671   22.886 1.00 8.84  ? 72  ALA A C   1 
ATOM   542  O O   . ALA A 1 72  ? 1.791   5.910   23.013 1.00 9.27  ? 72  ALA A O   1 
ATOM   543  C CB  . ALA A 1 72  ? 3.518   5.766   20.431 1.00 7.78  ? 72  ALA A CB  1 
ATOM   544  N N   . HIS A 1 73  ? 3.930   6.065   23.750 1.00 6.57  ? 73  HIS A N   1 
ATOM   545  C CA  . HIS A 1 73  ? 3.563   6.979   24.824 1.00 4.50  ? 73  HIS A CA  1 
ATOM   546  C C   . HIS A 1 73  ? 4.727   7.930   25.051 1.00 8.11  ? 73  HIS A C   1 
ATOM   547  O O   . HIS A 1 73  ? 4.852   8.502   26.129 1.00 7.40  ? 73  HIS A O   1 
ATOM   548  C CB  . HIS A 1 73  ? 3.196   6.213   26.109 1.00 6.72  ? 73  HIS A CB  1 
ATOM   549  C CG  . HIS A 1 73  ? 4.354   5.423   26.623 1.00 6.44  ? 73  HIS A CG  1 
ATOM   550  N ND1 . HIS A 1 73  ? 5.091   5.863   27.709 1.00 8.48  ? 73  HIS A ND1 1 
ATOM   551  C CD2 . HIS A 1 73  ? 4.933   4.263   26.257 1.00 7.12  ? 73  HIS A CD2 1 
ATOM   552  C CE1 . HIS A 1 73  ? 6.068   5.002   27.946 1.00 9.96  ? 73  HIS A CE1 1 
ATOM   553  N NE2 . HIS A 1 73  ? 6.006   3.999   27.104 1.00 7.62  ? 73  HIS A NE2 1 
ATOM   554  N N   . GLY A 1 74  ? 5.578   8.189   24.062 1.00 6.59  ? 74  GLY A N   1 
ATOM   555  C CA  . GLY A 1 74  ? 6.512   9.294   24.104 1.00 5.51  ? 74  GLY A CA  1 
ATOM   556  C C   . GLY A 1 74  ? 7.925   8.883   24.452 1.00 5.97  ? 74  GLY A C   1 
ATOM   557  O O   . GLY A 1 74  ? 8.798   9.748   24.575 1.00 7.81  ? 74  GLY A O   1 
ATOM   558  N N   . LEU A 1 75  ? 8.144   7.572   24.582 1.00 4.45  ? 75  LEU A N   1 
ATOM   559  C CA  . LEU A 1 75  ? 9.495   7.094   24.833 1.00 6.23  ? 75  LEU A CA  1 
ATOM   560  C C   . LEU A 1 75  ? 9.933   6.124   23.754 1.00 6.45  ? 75  LEU A C   1 
ATOM   561  O O   . LEU A 1 75  ? 9.188   5.170   23.479 1.00 7.17  ? 75  LEU A O   1 
ATOM   562  C CB  . LEU A 1 75  ? 9.572   6.328   26.162 1.00 6.81  ? 75  LEU A CB  1 
ATOM   563  C CG  . LEU A 1 75  ? 9.189   7.131   27.402 1.00 4.89  ? 75  LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 75  ? 9.390   6.233   28.642 1.00 5.38  ? 75  LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 75  ? 10.021  8.389   27.542 1.00 5.32  ? 75  LEU A CD2 1 
ATOM   566  N N   . ALA A 1 76  ? 11.142  6.300   23.195 1.00 4.33  ? 76  ALA A N   1 
ATOM   567  C CA  . ALA A 1 76  ? 11.599  5.332   22.205 1.00 4.57  ? 76  ALA A CA  1 
ATOM   568  C C   . ALA A 1 76  ? 11.579  3.922   22.756 1.00 5.93  ? 76  ALA A C   1 
ATOM   569  O O   . ALA A 1 76  ? 11.981  3.703   23.892 1.00 5.09  ? 76  ALA A O   1 
ATOM   570  C CB  . ALA A 1 76  ? 13.014  5.697   21.747 1.00 5.05  ? 76  ALA A CB  1 
ATOM   571  N N   . PHE A 1 77  ? 11.097  3.006   21.936 1.00 4.82  ? 77  PHE A N   1 
ATOM   572  C CA  . PHE A 1 77  ? 11.079  1.568   22.131 1.00 5.20  ? 77  PHE A CA  1 
ATOM   573  C C   . PHE A 1 77  ? 10.067  1.068   23.162 1.00 6.38  ? 77  PHE A C   1 
ATOM   574  O O   . PHE A 1 77  ? 9.805   -0.137  23.203 1.00 6.29  ? 77  PHE A O   1 
ATOM   575  C CB  . PHE A 1 77  ? 12.500  1.074   22.480 1.00 5.26  ? 77  PHE A CB  1 
ATOM   576  C CG  . PHE A 1 77  ? 13.433  1.250   21.265 1.00 6.56  ? 77  PHE A CG  1 
ATOM   577  C CD1 . PHE A 1 77  ? 13.313  0.414   20.172 1.00 5.88  ? 77  PHE A CD1 1 
ATOM   578  C CD2 . PHE A 1 77  ? 14.405  2.242   21.269 1.00 8.82  ? 77  PHE A CD2 1 
ATOM   579  C CE1 . PHE A 1 77  ? 14.157  0.581   19.088 1.00 10.58 ? 77  PHE A CE1 1 
ATOM   580  C CE2 . PHE A 1 77  ? 15.265  2.393   20.185 1.00 9.80  ? 77  PHE A CE2 1 
ATOM   581  C CZ  . PHE A 1 77  ? 15.118  1.570   19.078 1.00 8.53  ? 77  PHE A CZ  1 
ATOM   582  N N   . SER A 1 78  ? 9.485   1.954   23.964 1.00 5.30  ? 78  SER A N   1 
ATOM   583  C CA  . SER A 1 78  ? 8.565   1.547   25.022 1.00 3.34  ? 78  SER A CA  1 
ATOM   584  C C   . SER A 1 78  ? 7.114   1.428   24.634 1.00 5.79  ? 78  SER A C   1 
ATOM   585  O O   . SER A 1 78  ? 6.623   2.071   23.726 1.00 7.13  ? 78  SER A O   1 
ATOM   586  C CB  . SER A 1 78  ? 8.681   2.644   26.086 1.00 4.96  ? 78  SER A CB  1 
ATOM   587  O OG  . SER A 1 78  ? 8.059   2.346   27.317 1.00 5.57  ? 78  SER A OG  1 
ATOM   588  N N   . VAL A 1 79  ? 6.406   0.592   25.388 1.00 4.71  ? 79  VAL A N   1 
ATOM   589  C CA  . VAL A 1 79  ? 4.943   0.556   25.226 1.00 4.29  ? 79  VAL A CA  1 
ATOM   590  C C   . VAL A 1 79  ? 4.225   0.626   26.566 1.00 6.77  ? 79  VAL A C   1 
ATOM   591  O O   . VAL A 1 79  ? 4.797   0.403   27.622 1.00 8.16  ? 79  VAL A O   1 
ATOM   592  C CB  . VAL A 1 79  ? 4.465   -0.718  24.501 1.00 6.78  ? 79  VAL A CB  1 
ATOM   593  C CG1 . VAL A 1 79  ? 5.037   -0.705  23.079 1.00 4.10  ? 79  VAL A CG1 1 
ATOM   594  C CG2 . VAL A 1 79  ? 4.838   -1.950  25.291 1.00 5.41  ? 79  VAL A CG2 1 
ATOM   595  N N   . ARG A 1 80  ? 2.926   0.928   26.518 1.00 5.72  ? 80  ARG A N   1 
ATOM   596  C CA  . ARG A 1 80  ? 2.220   1.088   27.785 1.00 7.33  ? 80  ARG A CA  1 
ATOM   597  C C   . ARG A 1 80  ? 2.052   -0.216  28.515 1.00 7.38  ? 80  ARG A C   1 
ATOM   598  O O   . ARG A 1 80  ? 2.132   -1.299  27.918 1.00 7.16  ? 80  ARG A O   1 
ATOM   599  C CB  . ARG A 1 80  ? 0.825   1.663   27.486 1.00 9.96  ? 80  ARG A CB  1 
ATOM   600  C CG  . ARG A 1 80  ? 0.909   3.112   27.010 1.00 9.97  ? 80  ARG A CG  1 
ATOM   601  C CD  . ARG A 1 80  ? -0.510  3.594   26.703 1.00 15.07 ? 80  ARG A CD  1 
ATOM   602  N NE  . ARG A 1 80  ? -0.457  4.808   25.903 1.00 14.73 ? 80  ARG A NE  1 
ATOM   603  C CZ  . ARG A 1 80  ? -0.213  6.014   26.415 1.00 16.48 ? 80  ARG A CZ  1 
ATOM   604  N NH1 . ARG A 1 80  ? -0.004  6.154   27.711 1.00 13.45 ? 80  ARG A NH1 1 
ATOM   605  N NH2 . ARG A 1 80  ? -0.186  7.047   25.572 1.00 17.97 ? 80  ARG A NH2 1 
ATOM   606  N N   . PRO A 1 81  ? 1.764   -0.175  29.811 1.00 8.20  ? 81  PRO A N   1 
ATOM   607  C CA  . PRO A 1 81  ? 1.502   -1.413  30.539 1.00 11.10 ? 81  PRO A CA  1 
ATOM   608  C C   . PRO A 1 81  ? 0.347   -2.200  29.906 1.00 8.73  ? 81  PRO A C   1 
ATOM   609  O O   . PRO A 1 81  ? -0.618  -1.577  29.449 1.00 10.77 ? 81  PRO A O   1 
ATOM   610  C CB  . PRO A 1 81  ? 1.095   -0.906  31.930 1.00 11.99 ? 81  PRO A CB  1 
ATOM   611  C CG  . PRO A 1 81  ? 1.835   0.395   32.056 1.00 10.04 ? 81  PRO A CG  1 
ATOM   612  C CD  . PRO A 1 81  ? 1.664   1.021   30.683 1.00 10.66 ? 81  PRO A CD  1 
ATOM   613  N N   . GLY A 1 82  ? 0.505   -3.517  29.876 1.00 11.20 ? 82  GLY A N   1 
ATOM   614  C CA  . GLY A 1 82  ? -0.580  -4.338  29.366 1.00 14.83 ? 82  GLY A CA  1 
ATOM   615  C C   . GLY A 1 82  ? -0.563  -4.527  27.862 1.00 19.41 ? 82  GLY A C   1 
ATOM   616  O O   . GLY A 1 82  ? -1.409  -5.245  27.316 1.00 17.48 ? 82  GLY A O   1 
ATOM   617  N N   . ILE A 1 83  ? 0.404   -3.882  27.212 1.00 8.67  ? 83  ILE A N   1 
ATOM   618  C CA  . ILE A 1 83  ? 0.540   -4.008  25.765 1.00 10.22 ? 83  ILE A CA  1 
ATOM   619  C C   . ILE A 1 83  ? 1.676   -4.962  25.438 1.00 9.63  ? 83  ILE A C   1 
ATOM   620  O O   . ILE A 1 83  ? 2.688   -5.044  26.143 1.00 7.23  ? 83  ILE A O   1 
ATOM   621  C CB  . ILE A 1 83  ? 0.782   -2.623  25.153 1.00 8.02  ? 83  ILE A CB  1 
ATOM   622  C CG1 . ILE A 1 83  ? -0.392  -1.662  25.416 1.00 11.00 ? 83  ILE A CG1 1 
ATOM   623  C CG2 . ILE A 1 83  ? 1.102   -2.742  23.662 1.00 6.62  ? 83  ILE A CG2 1 
ATOM   624  C CD1 . ILE A 1 83  ? -1.671  -2.139  24.725 1.00 14.83 ? 83  ILE A CD1 1 
ATOM   625  N N   . ALA A 1 84  ? 1.525   -5.721  24.354 1.00 6.91  ? 84  ALA A N   1 
ATOM   626  C CA  . ALA A 1 84  ? 2.575   -6.669  24.009 1.00 7.10  ? 84  ALA A CA  1 
ATOM   627  C C   . ALA A 1 84  ? 3.917   -5.967  23.777 1.00 6.87  ? 84  ALA A C   1 
ATOM   628  O O   . ALA A 1 84  ? 3.949   -4.871  23.212 1.00 6.60  ? 84  ALA A O   1 
ATOM   629  C CB  . ALA A 1 84  ? 2.210   -7.401  22.723 1.00 8.74  ? 84  ALA A CB  1 
ATOM   630  N N   . ILE A 1 85  ? 4.978   -6.651  24.207 1.00 6.01  ? 85  ILE A N   1 
ATOM   631  C CA  . ILE A 1 85  ? 6.308   -6.114  23.960 1.00 6.94  ? 85  ILE A CA  1 
ATOM   632  C C   . ILE A 1 85  ? 6.643   -6.167  22.469 1.00 6.37  ? 85  ILE A C   1 
ATOM   633  O O   . ILE A 1 85  ? 6.712   -7.265  21.909 1.00 7.38  ? 85  ILE A O   1 
ATOM   634  C CB  . ILE A 1 85  ? 7.334   -6.920  24.782 1.00 5.00  ? 85  ILE A CB  1 
ATOM   635  C CG1 . ILE A 1 85  ? 7.072   -6.907  26.290 1.00 6.02  ? 85  ILE A CG1 1 
ATOM   636  C CG2 . ILE A 1 85  ? 8.745   -6.430  24.450 1.00 6.99  ? 85  ILE A CG2 1 
ATOM   637  C CD1 . ILE A 1 85  ? 7.666   -8.128  26.967 1.00 5.74  ? 85  ILE A CD1 1 
ATOM   638  N N   . PRO A 1 86  ? 6.868   -5.054  21.790 1.00 5.37  ? 86  PRO A N   1 
ATOM   639  C CA  . PRO A 1 86  ? 7.138   -5.136  20.333 1.00 6.09  ? 86  PRO A CA  1 
ATOM   640  C C   . PRO A 1 86  ? 8.452   -5.813  20.012 1.00 9.79  ? 86  PRO A C   1 
ATOM   641  O O   . PRO A 1 86  ? 9.386   -5.826  20.828 1.00 8.85  ? 86  PRO A O   1 
ATOM   642  C CB  . PRO A 1 86  ? 7.214   -3.674  19.922 1.00 7.18  ? 86  PRO A CB  1 
ATOM   643  C CG  . PRO A 1 86  ? 6.442   -2.925  20.970 1.00 4.53  ? 86  PRO A CG  1 
ATOM   644  C CD  . PRO A 1 86  ? 6.853   -3.652  22.238 1.00 8.11  ? 86  PRO A CD  1 
ATOM   645  N N   . PRO A 1 87  ? 8.584   -6.454  18.855 1.00 10.33 ? 87  PRO A N   1 
ATOM   646  C CA  . PRO A 1 87  ? 9.808   -7.206  18.518 1.00 7.70  ? 87  PRO A CA  1 
ATOM   647  C C   . PRO A 1 87  ? 11.120  -6.472  18.748 1.00 7.23  ? 87  PRO A C   1 
ATOM   648  O O   . PRO A 1 87  ? 12.102  -7.083  19.247 1.00 7.79  ? 87  PRO A O   1 
ATOM   649  C CB  . PRO A 1 87  ? 9.577   -7.501  17.009 1.00 6.59  ? 87  PRO A CB  1 
ATOM   650  C CG  . PRO A 1 87  ? 8.064   -7.723  17.008 1.00 9.32  ? 87  PRO A CG  1 
ATOM   651  C CD  . PRO A 1 87  ? 7.537   -6.551  17.809 1.00 8.80  ? 87  PRO A CD  1 
ATOM   652  N N   . SER A 1 88  ? 11.215  -5.186  18.437 1.00 6.34  ? 88  SER A N   1 
ATOM   653  C CA  . SER A 1 88  ? 12.485  -4.511  18.658 1.00 5.98  ? 88  SER A CA  1 
ATOM   654  C C   . SER A 1 88  ? 12.893  -4.542  20.137 1.00 6.41  ? 88  SER A C   1 
ATOM   655  O O   . SER A 1 88  ? 14.055  -4.749  20.497 1.00 7.26  ? 88  SER A O   1 
ATOM   656  C CB  . SER A 1 88  ? 12.391  -3.052  18.186 1.00 9.61  ? 88  SER A CB  1 
ATOM   657  O OG  . SER A 1 88  ? 12.573  -2.994  16.798 1.00 11.72 ? 88  SER A OG  1 
ATOM   658  N N   . LEU A 1 89  ? 11.905  -4.292  20.998 1.00 6.38  ? 89  LEU A N   1 
ATOM   659  C CA  . LEU A 1 89  ? 12.184  -4.269  22.445 1.00 6.49  ? 89  LEU A CA  1 
ATOM   660  C C   . LEU A 1 89  ? 12.460  -5.654  22.949 1.00 7.06  ? 89  LEU A C   1 
ATOM   661  O O   . LEU A 1 89  ? 13.300  -5.885  23.835 1.00 7.77  ? 89  LEU A O   1 
ATOM   662  C CB  . LEU A 1 89  ? 10.977  -3.659  23.175 1.00 5.69  ? 89  LEU A CB  1 
ATOM   663  C CG  . LEU A 1 89  ? 11.170  -3.533  24.706 1.00 5.37  ? 89  LEU A CG  1 
ATOM   664  C CD1 . LEU A 1 89  ? 12.462  -2.841  25.107 1.00 6.25  ? 89  LEU A CD1 1 
ATOM   665  C CD2 . LEU A 1 89  ? 9.984   -2.742  25.270 1.00 6.60  ? 89  LEU A CD2 1 
ATOM   666  N N   . LEU A 1 90  ? 11.782  -6.668  22.395 1.00 6.41  ? 90  LEU A N   1 
ATOM   667  C CA  . LEU A 1 90  ? 12.095  -8.042  22.763 1.00 7.17  ? 90  LEU A CA  1 
ATOM   668  C C   . LEU A 1 90  ? 13.555  -8.326  22.429 1.00 6.26  ? 90  LEU A C   1 
ATOM   669  O O   . LEU A 1 90  ? 14.246  -8.972  23.227 1.00 6.47  ? 90  LEU A O   1 
ATOM   670  C CB  . LEU A 1 90  ? 11.203  -9.053  22.041 1.00 11.15 ? 90  LEU A CB  1 
ATOM   671  C CG  . LEU A 1 90  ? 9.776   -9.261  22.538 1.00 18.87 ? 90  LEU A CG  1 
ATOM   672  C CD1 . LEU A 1 90  ? 8.972   -10.044 21.495 1.00 12.64 ? 90  LEU A CD1 1 
ATOM   673  C CD2 . LEU A 1 90  ? 9.752   -9.966  23.892 1.00 12.69 ? 90  LEU A CD2 1 
ATOM   674  N N   . ASN A 1 91  ? 14.049  -7.842  21.292 1.00 6.36  ? 91  ASN A N   1 
ATOM   675  C CA  . ASN A 1 91  ? 15.454  -8.132  20.989 1.00 7.71  ? 91  ASN A CA  1 
ATOM   676  C C   . ASN A 1 91  ? 16.387  -7.363  21.919 1.00 7.11  ? 91  ASN A C   1 
ATOM   677  O O   . ASN A 1 91  ? 17.443  -7.869  22.298 1.00 6.14  ? 91  ASN A O   1 
ATOM   678  C CB  . ASN A 1 91  ? 15.720  -7.821  19.522 1.00 6.66  ? 91  ASN A CB  1 
ATOM   679  C CG  . ASN A 1 91  ? 15.095  -8.924  18.670 1.00 8.94  ? 91  ASN A CG  1 
ATOM   680  O OD1 . ASN A 1 91  ? 14.856  -10.044 19.118 1.00 8.24  ? 91  ASN A OD1 1 
ATOM   681  N ND2 . ASN A 1 91  ? 14.830  -8.582  17.414 1.00 11.02 ? 91  ASN A ND2 1 
ATOM   682  N N   . MET A 1 92  ? 16.003  -6.154  22.304 1.00 5.72  ? 92  MET A N   1 
ATOM   683  C CA  . MET A 1 92  ? 16.794  -5.477  23.332 1.00 5.76  ? 92  MET A CA  1 
ATOM   684  C C   . MET A 1 92  ? 16.826  -6.289  24.615 1.00 5.43  ? 92  MET A C   1 
ATOM   685  O O   . MET A 1 92  ? 17.867  -6.455  25.257 1.00 6.12  ? 92  MET A O   1 
ATOM   686  C CB  . MET A 1 92  ? 16.164  -4.104  23.593 1.00 4.47  ? 92  MET A CB  1 
ATOM   687  C CG  . MET A 1 92  ? 16.392  -3.152  22.409 1.00 4.04  ? 92  MET A CG  1 
ATOM   688  S SD  . MET A 1 92  ? 15.192  -1.810  22.369 1.00 7.07  ? 92  MET A SD  1 
ATOM   689  C CE  . MET A 1 92  ? 15.616  -0.942  23.885 1.00 7.10  ? 92  MET A CE  1 
ATOM   690  N N   . TYR A 1 93  ? 15.674  -6.794  25.007 1.00 5.93  ? 93  TYR A N   1 
ATOM   691  C CA  . TYR A 1 93  ? 15.611  -7.600  26.228 1.00 5.79  ? 93  TYR A CA  1 
ATOM   692  C C   . TYR A 1 93  ? 16.514  -8.815  26.139 1.00 8.96  ? 93  TYR A C   1 
ATOM   693  O O   . TYR A 1 93  ? 17.152  -9.259  27.096 1.00 8.50  ? 93  TYR A O   1 
ATOM   694  C CB  . TYR A 1 93  ? 14.146  -8.005  26.408 1.00 7.64  ? 93  TYR A CB  1 
ATOM   695  C CG  . TYR A 1 93  ? 13.235  -6.974  27.052 1.00 7.26  ? 93  TYR A CG  1 
ATOM   696  C CD1 . TYR A 1 93  ? 13.701  -5.771  27.569 1.00 7.35  ? 93  TYR A CD1 1 
ATOM   697  C CD2 . TYR A 1 93  ? 11.878  -7.256  27.138 1.00 6.06  ? 93  TYR A CD2 1 
ATOM   698  C CE1 . TYR A 1 93  ? 12.846  -4.853  28.161 1.00 4.91  ? 93  TYR A CE1 1 
ATOM   699  C CE2 . TYR A 1 93  ? 11.006  -6.331  27.720 1.00 6.03  ? 93  TYR A CE2 1 
ATOM   700  C CZ  . TYR A 1 93  ? 11.494  -5.150  28.236 1.00 5.99  ? 93  TYR A CZ  1 
ATOM   701  O OH  . TYR A 1 93  ? 10.651  -4.233  28.832 1.00 6.34  ? 93  TYR A OH  1 
ATOM   702  N N   . LYS A 1 94  ? 16.594  -9.464  24.959 1.00 6.84  ? 94  LYS A N   1 
ATOM   703  C CA  . LYS A 1 94  ? 17.421  -10.640 24.763 1.00 6.47  ? 94  LYS A CA  1 
ATOM   704  C C   . LYS A 1 94  ? 18.910  -10.292 24.903 1.00 8.24  ? 94  LYS A C   1 
ATOM   705  O O   . LYS A 1 94  ? 19.654  -11.044 25.564 1.00 8.44  ? 94  LYS A O   1 
ATOM   706  C CB  . LYS A 1 94  ? 17.181  -11.262 23.368 1.00 11.03 ? 94  LYS A CB  1 
ATOM   707  C CG  . LYS A 1 94  ? 15.766  -11.841 23.194 1.00 10.99 ? 94  LYS A CG  1 
ATOM   708  C CD  . LYS A 1 94  ? 15.640  -12.496 21.810 1.00 16.51 ? 94  LYS A CD  1 
ATOM   709  C CE  . LYS A 1 94  ? 14.170  -12.766 21.478 1.00 22.50 ? 94  LYS A CE  1 
ATOM   710  N NZ  . LYS A 1 94  ? 13.899  -12.483 20.035 1.00 39.64 ? 94  LYS A NZ  1 
ATOM   711  N N   . GLU A 1 95  ? 19.313  -9.166  24.311 1.00 6.28  ? 95  GLU A N   1 
ATOM   712  C CA  . GLU A 1 95  ? 20.707  -8.745  24.499 1.00 6.39  ? 95  GLU A CA  1 
ATOM   713  C C   . GLU A 1 95  ? 21.003  -8.442  25.983 1.00 8.52  ? 95  GLU A C   1 
ATOM   714  O O   . GLU A 1 95  ? 22.052  -8.818  26.506 1.00 7.98  ? 95  GLU A O   1 
ATOM   715  C CB  . GLU A 1 95  ? 21.065  -7.547  23.635 1.00 6.31  ? 95  GLU A CB  1 
ATOM   716  C CG  . GLU A 1 95  ? 22.506  -7.028  23.725 1.00 7.86  ? 95  GLU A CG  1 
ATOM   717  C CD  . GLU A 1 95  ? 23.584  -7.959  23.215 1.00 5.61  ? 95  GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 95  ? 23.261  -8.975  22.578 1.00 7.99  ? 95  GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 95  ? 24.779  -7.654  23.476 1.00 10.65 ? 95  GLU A OE2 1 
ATOM   720  N N   . LEU A 1 96  ? 20.057  -7.794  26.656 1.00 5.84  ? 96  LEU A N   1 
ATOM   721  C CA  . LEU A 1 96  ? 20.165  -7.546  28.089 1.00 4.89  ? 96  LEU A CA  1 
ATOM   722  C C   . LEU A 1 96  ? 20.280  -8.840  28.880 1.00 7.37  ? 96  LEU A C   1 
ATOM   723  O O   . LEU A 1 96  ? 21.151  -8.959  29.745 1.00 7.87  ? 96  LEU A O   1 
ATOM   724  C CB  . LEU A 1 96  ? 18.931  -6.763  28.583 1.00 7.41  ? 96  LEU A CB  1 
ATOM   725  C CG  . LEU A 1 96  ? 19.042  -5.279  28.221 1.00 8.51  ? 96  LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 96  ? 17.676  -4.610  28.269 1.00 5.36  ? 96  LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 96  ? 19.996  -4.556  29.161 1.00 8.49  ? 96  LEU A CD2 1 
ATOM   728  N N   . GLU A 1 97  ? 19.423  -9.802  28.577 1.00 5.47  ? 97  GLU A N   1 
ATOM   729  C CA  . GLU A 1 97  ? 19.445  -11.067 29.291 1.00 6.39  ? 97  GLU A CA  1 
ATOM   730  C C   . GLU A 1 97  ? 20.777  -11.778 29.092 1.00 10.98 ? 97  GLU A C   1 
ATOM   731  O O   . GLU A 1 97  ? 21.312  -12.455 29.983 1.00 9.73  ? 97  GLU A O   1 
ATOM   732  C CB  . GLU A 1 97  ? 18.298  -11.997 28.879 1.00 9.64  ? 97  GLU A CB  1 
ATOM   733  C CG  . GLU A 1 97  ? 18.260  -13.144 29.910 1.00 19.54 ? 97  GLU A CG  1 
ATOM   734  C CD  . GLU A 1 97  ? 16.888  -13.759 30.046 1.00 33.94 ? 97  GLU A CD  1 
ATOM   735  O OE1 . GLU A 1 97  ? 15.988  -13.441 29.242 1.00 27.88 ? 97  GLU A OE1 1 
ATOM   736  O OE2 . GLU A 1 97  ? 16.717  -14.570 30.979 1.00 24.46 ? 97  GLU A OE2 1 
ATOM   737  N N   . ASN A 1 98  ? 21.366  -11.630 27.896 1.00 7.76  ? 98  ASN A N   1 
ATOM   738  C CA  . ASN A 1 98  ? 22.636  -12.293 27.670 1.00 8.19  ? 98  ASN A CA  1 
ATOM   739  C C   . ASN A 1 98  ? 23.829  -11.561 28.222 1.00 8.15  ? 98  ASN A C   1 
ATOM   740  O O   . ASN A 1 98  ? 24.950  -12.090 28.145 1.00 13.13 ? 98  ASN A O   1 
ATOM   741  C CB  . ASN A 1 98  ? 22.845  -12.467 26.156 1.00 14.37 ? 98  ASN A CB  1 
ATOM   742  C CG  . ASN A 1 98  ? 21.864  -13.471 25.571 1.00 17.39 ? 98  ASN A CG  1 
ATOM   743  O OD1 . ASN A 1 98  ? 21.346  -14.383 26.223 1.00 22.16 ? 98  ASN A OD1 1 
ATOM   744  N ND2 . ASN A 1 98  ? 21.614  -13.276 24.280 1.00 18.49 ? 98  ASN A ND2 1 
ATOM   745  N N   . THR A 1 99  ? 23.704  -10.363 28.763 1.00 7.54  ? 99  THR A N   1 
ATOM   746  C CA  . THR A 1 99  ? 24.888  -9.585  29.128 1.00 8.09  ? 99  THR A CA  1 
ATOM   747  C C   . THR A 1 99  ? 24.833  -9.009  30.536 1.00 10.04 ? 99  THR A C   1 
ATOM   748  O O   . THR A 1 99  ? 25.842  -8.904  31.234 1.00 11.57 ? 99  THR A O   1 
ATOM   749  C CB  . THR A 1 99  ? 25.089  -8.390  28.156 1.00 7.88  ? 99  THR A CB  1 
ATOM   750  O OG1 . THR A 1 99  ? 23.886  -7.613  28.042 1.00 7.20  ? 99  THR A OG1 1 
ATOM   751  C CG2 . THR A 1 99  ? 25.475  -8.936  26.792 1.00 8.20  ? 99  THR A CG2 1 
ATOM   752  N N   . ILE A 1 100 ? 23.666  -8.543  30.983 1.00 10.29 ? 100 ILE A N   1 
ATOM   753  C CA  . ILE A 1 100 ? 23.622  -7.923  32.303 1.00 7.76  ? 100 ILE A CA  1 
ATOM   754  C C   . ILE A 1 100 ? 23.376  -8.956  33.399 1.00 7.42  ? 100 ILE A C   1 
ATOM   755  O O   . ILE A 1 100 ? 22.336  -9.645  33.383 1.00 10.22 ? 100 ILE A O   1 
ATOM   756  C CB  . ILE A 1 100 ? 22.482  -6.895  32.323 1.00 6.88  ? 100 ILE A CB  1 
ATOM   757  C CG1 . ILE A 1 100 ? 22.805  -5.671  31.471 1.00 8.69  ? 100 ILE A CG1 1 
ATOM   758  C CG2 . ILE A 1 100 ? 22.103  -6.488  33.738 1.00 7.70  ? 100 ILE A CG2 1 
ATOM   759  C CD1 . ILE A 1 100 ? 23.878  -4.730  31.972 1.00 8.10  ? 100 ILE A CD1 1 
ATOM   760  N N   . PRO A 1 101 ? 24.290  -9.042  34.339 1.00 8.78  ? 101 PRO A N   1 
ATOM   761  C CA  . PRO A 1 101 ? 24.123  -10.036 35.419 1.00 9.75  ? 101 PRO A CA  1 
ATOM   762  C C   . PRO A 1 101 ? 22.777  -9.890  36.130 1.00 8.89  ? 101 PRO A C   1 
ATOM   763  O O   . PRO A 1 101 ? 22.359  -8.792  36.521 1.00 9.50  ? 101 PRO A O   1 
ATOM   764  C CB  . PRO A 1 101 ? 25.304  -9.685  36.342 1.00 11.01 ? 101 PRO A CB  1 
ATOM   765  C CG  . PRO A 1 101 ? 26.339  -9.162  35.364 1.00 15.01 ? 101 PRO A CG  1 
ATOM   766  C CD  . PRO A 1 101 ? 25.524  -8.240  34.466 1.00 11.48 ? 101 PRO A CD  1 
ATOM   767  N N   . GLY A 1 102 ? 22.076  -11.018 36.245 1.00 10.75 ? 102 GLY A N   1 
ATOM   768  C CA  . GLY A 1 102 ? 20.799  -11.055 36.937 1.00 9.92  ? 102 GLY A CA  1 
ATOM   769  C C   . GLY A 1 102 ? 19.592  -10.641 36.149 1.00 10.29 ? 102 GLY A C   1 
ATOM   770  O O   . GLY A 1 102 ? 18.425  -10.730 36.590 1.00 10.42 ? 102 GLY A O   1 
ATOM   771  N N   . PHE A 1 103 ? 19.792  -10.142 34.921 1.00 6.16  ? 103 PHE A N   1 
ATOM   772  C CA  . PHE A 1 103 ? 18.617  -9.696  34.152 1.00 8.21  ? 103 PHE A CA  1 
ATOM   773  C C   . PHE A 1 103 ? 17.745  -10.864 33.732 1.00 9.21  ? 103 PHE A C   1 
ATOM   774  O O   . PHE A 1 103 ? 18.279  -11.859 33.260 1.00 11.05 ? 103 PHE A O   1 
ATOM   775  C CB  . PHE A 1 103 ? 19.127  -8.906  32.924 1.00 7.61  ? 103 PHE A CB  1 
ATOM   776  C CG  . PHE A 1 103 ? 18.036  -8.213  32.126 1.00 5.67  ? 103 PHE A CG  1 
ATOM   777  C CD1 . PHE A 1 103 ? 17.259  -8.882  31.177 1.00 7.07  ? 103 PHE A CD1 1 
ATOM   778  C CD2 . PHE A 1 103 ? 17.788  -6.860  32.317 1.00 6.80  ? 103 PHE A CD2 1 
ATOM   779  C CE1 . PHE A 1 103 ? 16.250  -8.248  30.471 1.00 8.39  ? 103 PHE A CE1 1 
ATOM   780  C CE2 . PHE A 1 103 ? 16.793  -6.214  31.616 1.00 5.88  ? 103 PHE A CE2 1 
ATOM   781  C CZ  . PHE A 1 103 ? 16.035  -6.902  30.694 1.00 8.66  ? 103 PHE A CZ  1 
ATOM   782  N N   . THR A 1 104 ? 16.428  -10.749 33.803 1.00 9.24  ? 104 THR A N   1 
ATOM   783  C CA  . THR A 1 104 ? 15.462  -11.716 33.302 1.00 8.52  ? 104 THR A CA  1 
ATOM   784  C C   . THR A 1 104 ? 14.388  -10.996 32.493 1.00 8.71  ? 104 THR A C   1 
ATOM   785  O O   . THR A 1 104 ? 14.166  -9.806  32.623 1.00 8.49  ? 104 THR A O   1 
ATOM   786  C CB  . THR A 1 104 ? 14.773  -12.537 34.420 1.00 9.75  ? 104 THR A CB  1 
ATOM   787  O OG1 . THR A 1 104 ? 14.073  -11.663 35.318 1.00 10.17 ? 104 THR A OG1 1 
ATOM   788  C CG2 . THR A 1 104 ? 15.818  -13.309 35.199 1.00 12.22 ? 104 THR A CG2 1 
ATOM   789  N N   . ARG A 1 105 ? 13.719  -11.760 31.640 1.00 12.85 ? 105 ARG A N   1 
ATOM   790  C CA  . ARG A 1 105 ? 12.738  -11.195 30.717 1.00 12.72 ? 105 ARG A CA  1 
ATOM   791  C C   . ARG A 1 105 ? 11.646  -10.473 31.477 1.00 8.61  ? 105 ARG A C   1 
ATOM   792  O O   . ARG A 1 105 ? 10.928  -11.078 32.276 1.00 9.51  ? 105 ARG A O   1 
ATOM   793  C CB  . ARG A 1 105 ? 12.168  -12.345 29.891 1.00 11.82 ? 105 ARG A CB  1 
ATOM   794  C CG  . ARG A 1 105 ? 10.972  -11.865 29.067 1.00 17.04 ? 105 ARG A CG  1 
ATOM   795  C CD  . ARG A 1 105 ? 11.408  -11.005 27.899 1.00 16.75 ? 105 ARG A CD  1 
ATOM   796  N NE  . ARG A 1 105 ? 12.467  -11.644 27.117 1.00 18.03 ? 105 ARG A NE  1 
ATOM   797  C CZ  . ARG A 1 105 ? 12.269  -12.590 26.200 1.00 21.52 ? 105 ARG A CZ  1 
ATOM   798  N NH1 . ARG A 1 105 ? 11.051  -13.041 25.898 1.00 26.68 ? 105 ARG A NH1 1 
ATOM   799  N NH2 . ARG A 1 105 ? 13.315  -13.105 25.556 1.00 18.81 ? 105 ARG A NH2 1 
ATOM   800  N N   . PRO A 1 106 ? 11.491  -9.179  31.270 1.00 9.06  ? 106 PRO A N   1 
ATOM   801  C CA  . PRO A 1 106 ? 10.364  -8.483  31.929 1.00 8.58  ? 106 PRO A CA  1 
ATOM   802  C C   . PRO A 1 106 ? 9.000   -8.914  31.389 1.00 7.93  ? 106 PRO A C   1 
ATOM   803  O O   . PRO A 1 106 ? 8.954   -9.437  30.275 1.00 10.23 ? 106 PRO A O   1 
ATOM   804  C CB  . PRO A 1 106 ? 10.622  -7.015  31.578 1.00 9.83  ? 106 PRO A CB  1 
ATOM   805  C CG  . PRO A 1 106 ? 12.057  -6.959  31.183 1.00 8.89  ? 106 PRO A CG  1 
ATOM   806  C CD  . PRO A 1 106 ? 12.355  -8.273  30.484 1.00 8.25  ? 106 PRO A CD  1 
ATOM   807  N N   . ASN A 1 107 ? 7.942   -8.698  32.179 1.00 9.74  ? 107 ASN A N   1 
ATOM   808  C CA  . ASN A 1 107 ? 6.629   -9.131  31.681 1.00 9.62  ? 107 ASN A CA  1 
ATOM   809  C C   . ASN A 1 107 ? 5.849   -7.954  31.124 1.00 9.37  ? 107 ASN A C   1 
ATOM   810  O O   . ASN A 1 107 ? 4.620   -7.919  31.081 1.00 11.83 ? 107 ASN A O   1 
ATOM   811  C CB  . ASN A 1 107 ? 5.781   -9.831  32.734 1.00 14.10 ? 107 ASN A CB  1 
ATOM   812  C CG  . ASN A 1 107 ? 5.384   -8.908  33.864 1.00 35.73 ? 107 ASN A CG  1 
ATOM   813  O OD1 . ASN A 1 107 ? 5.856   -7.777  33.991 1.00 22.73 ? 107 ASN A OD1 1 
ATOM   814  N ND2 . ASN A 1 107 ? 4.481   -9.392  34.715 1.00 58.76 ? 107 ASN A ND2 1 
ATOM   815  N N   . HIS A 1 108 ? 6.587   -6.940  30.712 1.00 8.44  ? 108 HIS A N   1 
ATOM   816  C CA  . HIS A 1 108 ? 5.938   -5.741  30.169 1.00 6.32  ? 108 HIS A CA  1 
ATOM   817  C C   . HIS A 1 108 ? 6.970   -5.002  29.314 1.00 6.09  ? 108 HIS A C   1 
ATOM   818  O O   . HIS A 1 108 ? 8.168   -5.332  29.414 1.00 6.08  ? 108 HIS A O   1 
ATOM   819  C CB  . HIS A 1 108 ? 5.368   -4.867  31.311 1.00 5.24  ? 108 HIS A CB  1 
ATOM   820  C CG  . HIS A 1 108 ? 6.499   -4.222  32.078 1.00 7.95  ? 108 HIS A CG  1 
ATOM   821  N ND1 . HIS A 1 108 ? 7.132   -4.808  33.162 1.00 11.85 ? 108 HIS A ND1 1 
ATOM   822  C CD2 . HIS A 1 108 ? 7.117   -3.025  31.905 1.00 4.25  ? 108 HIS A CD2 1 
ATOM   823  C CE1 . HIS A 1 108 ? 8.094   -3.999  33.620 1.00 4.27  ? 108 HIS A CE1 1 
ATOM   824  N NE2 . HIS A 1 108 ? 8.094   -2.936  32.865 1.00 9.91  ? 108 HIS A NE2 1 
ATOM   825  N N   . GLY A 1 109 ? 6.528   -3.993  28.560 1.00 6.66  ? 109 GLY A N   1 
ATOM   826  C CA  . GLY A 1 109 ? 7.444   -3.251  27.699 1.00 4.34  ? 109 GLY A CA  1 
ATOM   827  C C   . GLY A 1 109 ? 7.536   -1.805  28.113 1.00 6.90  ? 109 GLY A C   1 
ATOM   828  O O   . GLY A 1 109 ? 7.859   -0.964  27.277 1.00 6.06  ? 109 GLY A O   1 
ATOM   829  N N   . TYR A 1 110 ? 7.245   -1.440  29.365 1.00 4.09  ? 110 TYR A N   1 
ATOM   830  C CA  . TYR A 1 110 ? 7.113   -0.055  29.785 1.00 3.57  ? 110 TYR A CA  1 
ATOM   831  C C   . TYR A 1 110 ? 8.428   0.455   30.353 1.00 6.94  ? 110 TYR A C   1 
ATOM   832  O O   . TYR A 1 110 ? 8.898   -0.073  31.375 1.00 7.50  ? 110 TYR A O   1 
ATOM   833  C CB  . TYR A 1 110 ? 5.969   0.021   30.836 1.00 5.50  ? 110 TYR A CB  1 
ATOM   834  C CG  . TYR A 1 110 ? 5.633   1.454   31.175 1.00 5.84  ? 110 TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 110 ? 5.045   2.303   30.252 1.00 8.59  ? 110 TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 110 ? 5.901   1.975   32.424 1.00 8.06  ? 110 TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 110 ? 4.734   3.610   30.586 1.00 9.05  ? 110 TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 110 ? 5.596   3.284   32.744 1.00 7.09  ? 110 TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 110 ? 5.008   4.116   31.831 1.00 6.51  ? 110 TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 110 ? 4.705   5.422   32.073 1.00 8.33  ? 110 TYR A OH  1 
ATOM   841  N N   . LEU A 1 111 ? 9.068   1.417   29.707 1.00 6.03  ? 111 LEU A N   1 
ATOM   842  C CA  . LEU A 1 111 ? 10.440  1.806   30.044 1.00 4.90  ? 111 LEU A CA  1 
ATOM   843  C C   . LEU A 1 111 ? 10.586  3.148   30.757 1.00 5.71  ? 111 LEU A C   1 
ATOM   844  O O   . LEU A 1 111 ? 11.698  3.705   30.784 1.00 5.58  ? 111 LEU A O   1 
ATOM   845  C CB  . LEU A 1 111 ? 11.301  1.828   28.765 1.00 5.49  ? 111 LEU A CB  1 
ATOM   846  C CG  . LEU A 1 111 ? 11.199  0.572   27.886 1.00 5.40  ? 111 LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 111 ? 12.075  0.727   26.633 1.00 5.70  ? 111 LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 111 ? 11.589  -0.676  28.657 1.00 5.46  ? 111 LEU A CD2 1 
ATOM   849  N N   . GLU A 1 112 ? 9.499   3.675   31.331 1.00 5.75  ? 112 GLU A N   1 
ATOM   850  C CA  . GLU A 1 112 ? 9.626   4.882   32.133 1.00 4.92  ? 112 GLU A CA  1 
ATOM   851  C C   . GLU A 1 112 ? 10.759  4.798   33.151 1.00 6.96  ? 112 GLU A C   1 
ATOM   852  O O   . GLU A 1 112 ? 11.503  5.752   33.341 1.00 5.96  ? 112 GLU A O   1 
ATOM   853  C CB  . GLU A 1 112 ? 8.305   5.153   32.886 1.00 5.45  ? 112 GLU A CB  1 
ATOM   854  C CG  . GLU A 1 112 ? 8.433   6.485   33.603 1.00 5.35  ? 112 GLU A CG  1 
ATOM   855  C CD  . GLU A 1 112 ? 7.200   6.887   34.397 1.00 8.88  ? 112 GLU A CD  1 
ATOM   856  O OE1 . GLU A 1 112 ? 6.095   6.375   34.128 1.00 11.00 ? 112 GLU A OE1 1 
ATOM   857  O OE2 . GLU A 1 112 ? 7.328   7.751   35.295 1.00 7.96  ? 112 GLU A OE2 1 
ATOM   858  N N   . SER A 1 113 ? 10.934  3.645   33.806 1.00 6.69  ? 113 SER A N   1 
ATOM   859  C CA  . SER A 1 113 ? 11.987  3.612   34.819 1.00 8.42  ? 113 SER A CA  1 
ATOM   860  C C   . SER A 1 113 ? 13.405  3.712   34.257 1.00 7.74  ? 113 SER A C   1 
ATOM   861  O O   . SER A 1 113 ? 14.329  4.122   34.996 1.00 7.49  ? 113 SER A O   1 
ATOM   862  C CB  . SER A 1 113 ? 11.823  2.337   35.659 1.00 6.31  ? 113 SER A CB  1 
ATOM   863  O OG  . SER A 1 113 ? 12.172  1.154   34.994 1.00 7.02  ? 113 SER A OG  1 
ATOM   864  N N   . TRP A 1 114 ? 13.620  3.385   32.967 1.00 6.10  ? 114 TRP A N   1 
ATOM   865  C CA  . TRP A 1 114 ? 14.909  3.745   32.370 1.00 5.08  ? 114 TRP A CA  1 
ATOM   866  C C   . TRP A 1 114 ? 15.064  5.259   32.275 1.00 4.77  ? 114 TRP A C   1 
ATOM   867  O O   . TRP A 1 114 ? 16.068  5.853   32.634 1.00 5.80  ? 114 TRP A O   1 
ATOM   868  C CB  . TRP A 1 114 ? 15.029  3.181   30.947 1.00 4.78  ? 114 TRP A CB  1 
ATOM   869  C CG  . TRP A 1 114 ? 15.125  1.700   30.856 1.00 6.46  ? 114 TRP A CG  1 
ATOM   870  C CD1 . TRP A 1 114 ? 14.999  0.764   31.842 1.00 6.09  ? 114 TRP A CD1 1 
ATOM   871  C CD2 . TRP A 1 114 ? 15.398  0.963   29.643 1.00 6.30  ? 114 TRP A CD2 1 
ATOM   872  N NE1 . TRP A 1 114 ? 15.157  -0.499  31.328 1.00 6.02  ? 114 TRP A NE1 1 
ATOM   873  C CE2 . TRP A 1 114 ? 15.409  -0.381  29.973 1.00 4.43  ? 114 TRP A CE2 1 
ATOM   874  C CE3 . TRP A 1 114 ? 15.620  1.393   28.327 1.00 6.49  ? 114 TRP A CE3 1 
ATOM   875  C CZ2 . TRP A 1 114 ? 15.641  -1.378  29.023 1.00 7.74  ? 114 TRP A CZ2 1 
ATOM   876  C CZ3 . TRP A 1 114 ? 15.855  0.409   27.374 1.00 5.66  ? 114 TRP A CZ3 1 
ATOM   877  C CH2 . TRP A 1 114 ? 15.863  -0.948  27.735 1.00 7.13  ? 114 TRP A CH2 1 
ATOM   878  N N   . ALA A 1 115 ? 13.995  5.890   31.747 1.00 4.40  ? 115 ALA A N   1 
ATOM   879  C CA  . ALA A 1 115 ? 14.059  7.351   31.581 1.00 5.94  ? 115 ALA A CA  1 
ATOM   880  C C   . ALA A 1 115 ? 14.321  8.036   32.930 1.00 6.19  ? 115 ALA A C   1 
ATOM   881  O O   . ALA A 1 115 ? 15.060  8.995   33.003 1.00 7.09  ? 115 ALA A O   1 
ATOM   882  C CB  . ALA A 1 115 ? 12.773  7.901   30.961 1.00 6.17  ? 115 ALA A CB  1 
ATOM   883  N N   . ARG A 1 116 ? 13.697  7.471   33.978 1.00 5.08  ? 116 ARG A N   1 
ATOM   884  C CA  . ARG A 1 116 ? 13.850  8.102   35.287 1.00 8.26  ? 116 ARG A CA  1 
ATOM   885  C C   . ARG A 1 116 ? 15.263  7.937   35.810 1.00 8.93  ? 116 ARG A C   1 
ATOM   886  O O   . ARG A 1 116 ? 15.639  8.627   36.762 1.00 7.39  ? 116 ARG A O   1 
ATOM   887  C CB  . ARG A 1 116 ? 12.847  7.514   36.295 1.00 5.80  ? 116 ARG A CB  1 
ATOM   888  C CG  . ARG A 1 116 ? 11.385  7.785   35.911 1.00 6.90  ? 116 ARG A CG  1 
ATOM   889  C CD  . ARG A 1 116 ? 11.066  9.278   35.952 1.00 7.20  ? 116 ARG A CD  1 
ATOM   890  N NE  . ARG A 1 116 ? 9.607   9.417   35.746 1.00 9.29  ? 116 ARG A NE  1 
ATOM   891  C CZ  . ARG A 1 116 ? 8.960   10.584  35.740 1.00 10.44 ? 116 ARG A CZ  1 
ATOM   892  N NH1 . ARG A 1 116 ? 9.640   11.709  35.914 1.00 8.41  ? 116 ARG A NH1 1 
ATOM   893  N NH2 . ARG A 1 116 ? 7.640   10.610  35.548 1.00 8.10  ? 116 ARG A NH2 1 
ATOM   894  N N   . GLN A 1 117 ? 16.049  7.042   35.220 1.00 6.29  ? 117 GLN A N   1 
ATOM   895  C CA  . GLN A 1 117 ? 17.451  6.902   35.636 1.00 6.28  ? 117 GLN A CA  1 
ATOM   896  C C   . GLN A 1 117 ? 18.423  7.640   34.738 1.00 6.57  ? 117 GLN A C   1 
ATOM   897  O O   . GLN A 1 117 ? 19.651  7.494   34.879 1.00 9.39  ? 117 GLN A O   1 
ATOM   898  C CB  . GLN A 1 117 ? 17.813  5.426   35.596 1.00 5.26  ? 117 GLN A CB  1 
ATOM   899  C CG  . GLN A 1 117 ? 17.093  4.611   36.692 1.00 6.35  ? 117 GLN A CG  1 
ATOM   900  C CD  . GLN A 1 117 ? 17.547  3.163   36.447 1.00 10.48 ? 117 GLN A CD  1 
ATOM   901  O OE1 . GLN A 1 117 ? 18.680  2.820   36.804 1.00 8.23  ? 117 GLN A OE1 1 
ATOM   902  N NE2 . GLN A 1 117 ? 16.680  2.408   35.800 1.00 7.64  ? 117 GLN A NE2 1 
ATOM   903  N N   . GLY A 1 118 ? 17.906  8.422   33.780 1.00 6.50  ? 118 GLY A N   1 
ATOM   904  C CA  . GLY A 1 118 ? 18.846  9.116   32.937 1.00 6.69  ? 118 GLY A CA  1 
ATOM   905  C C   . GLY A 1 118 ? 18.927  8.587   31.525 1.00 6.25  ? 118 GLY A C   1 
ATOM   906  O O   . GLY A 1 118 ? 19.791  9.079   30.769 1.00 7.52  ? 118 GLY A O   1 
ATOM   907  N N   . VAL A 1 119 ? 18.092  7.624   31.176 1.00 5.61  ? 119 VAL A N   1 
ATOM   908  C CA  . VAL A 1 119 ? 18.125  7.146   29.766 1.00 4.56  ? 119 VAL A CA  1 
ATOM   909  C C   . VAL A 1 119 ? 17.159  7.966   28.937 1.00 5.52  ? 119 VAL A C   1 
ATOM   910  O O   . VAL A 1 119 ? 15.948  7.825   29.061 1.00 5.31  ? 119 VAL A O   1 
ATOM   911  C CB  . VAL A 1 119 ? 17.798  5.658   29.660 1.00 5.97  ? 119 VAL A CB  1 
ATOM   912  C CG1 . VAL A 1 119 ? 18.026  5.215   28.210 1.00 6.35  ? 119 VAL A CG1 1 
ATOM   913  C CG2 . VAL A 1 119 ? 18.670  4.832   30.597 1.00 8.72  ? 119 VAL A CG2 1 
ATOM   914  N N   . LEU A 1 120 ? 17.685  8.859   28.096 1.00 7.16  ? 120 LEU A N   1 
ATOM   915  C CA  . LEU A 1 120 ? 16.826  9.632   27.194 1.00 4.62  ? 120 LEU A CA  1 
ATOM   916  C C   . LEU A 1 120 ? 16.374  8.760   26.034 1.00 5.71  ? 120 LEU A C   1 
ATOM   917  O O   . LEU A 1 120 ? 17.199  8.397   25.185 1.00 7.61  ? 120 LEU A O   1 
ATOM   918  C CB  . LEU A 1 120 ? 17.611  10.830  26.669 1.00 4.81  ? 120 LEU A CB  1 
ATOM   919  C CG  . LEU A 1 120 ? 16.783  11.817  25.851 1.00 6.41  ? 120 LEU A CG  1 
ATOM   920  C CD1 . LEU A 1 120 ? 15.752  12.515  26.748 1.00 7.35  ? 120 LEU A CD1 1 
ATOM   921  C CD2 . LEU A 1 120 ? 17.671  12.796  25.118 1.00 10.11 ? 120 LEU A CD2 1 
ATOM   922  N N   . LEU A 1 121 ? 15.108  8.434   25.956 1.00 4.07  ? 121 LEU A N   1 
ATOM   923  C CA  . LEU A 1 121 ? 14.548  7.515   24.977 1.00 3.71  ? 121 LEU A CA  1 
ATOM   924  C C   . LEU A 1 121 ? 13.867  8.335   23.872 1.00 7.42  ? 121 LEU A C   1 
ATOM   925  O O   . LEU A 1 121 ? 12.662  8.566   23.872 1.00 5.95  ? 121 LEU A O   1 
ATOM   926  C CB  . LEU A 1 121 ? 13.556  6.574   25.673 1.00 5.80  ? 121 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 121 ? 14.267  5.542   26.566 1.00 4.23  ? 121 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 121 ? 13.241  4.796   27.437 1.00 6.74  ? 121 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 121 ? 15.079  4.560   25.732 1.00 7.71  ? 121 LEU A CD2 1 
ATOM   930  N N   . LEU A 1 122 ? 14.722  8.774   22.954 1.00 5.13  ? 122 LEU A N   1 
ATOM   931  C CA  . LEU A 1 122 ? 14.365  9.816   22.010 1.00 5.79  ? 122 LEU A CA  1 
ATOM   932  C C   . LEU A 1 122 ? 14.116  9.227   20.628 1.00 5.64  ? 122 LEU A C   1 
ATOM   933  O O   . LEU A 1 122 ? 15.061  8.792   19.983 1.00 6.03  ? 122 LEU A O   1 
ATOM   934  C CB  . LEU A 1 122 ? 15.512  10.824  21.927 1.00 5.27  ? 122 LEU A CB  1 
ATOM   935  C CG  . LEU A 1 122 ? 15.259  12.008  20.997 1.00 6.44  ? 122 LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 122 ? 14.056  12.768  21.514 1.00 7.69  ? 122 LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 122 ? 16.494  12.885  20.894 1.00 6.97  ? 122 LEU A CD2 1 
ATOM   938  N N   . ASN A 1 123 ? 12.854  9.239   20.203 1.00 6.87  ? 123 ASN A N   1 
ATOM   939  C CA  . ASN A 1 123 ? 12.576  8.959   18.794 1.00 4.39  ? 123 ASN A CA  1 
ATOM   940  C C   . ASN A 1 123 ? 13.003  10.169  17.989 1.00 4.40  ? 123 ASN A C   1 
ATOM   941  O O   . ASN A 1 123 ? 12.878  11.291  18.485 1.00 8.26  ? 123 ASN A O   1 
ATOM   942  C CB  . ASN A 1 123 ? 11.074  8.716   18.603 1.00 4.38  ? 123 ASN A CB  1 
ATOM   943  C CG  . ASN A 1 123 ? 10.662  7.302   18.987 1.00 5.69  ? 123 ASN A CG  1 
ATOM   944  O OD1 . ASN A 1 123 ? 11.407  6.339   18.763 1.00 5.92  ? 123 ASN A OD1 1 
ATOM   945  N ND2 . ASN A 1 123 ? 9.455   7.194   19.565 1.00 7.03  ? 123 ASN A ND2 1 
ATOM   946  N N   . THR A 1 124 ? 13.471  9.979   16.757 1.00 5.41  ? 124 THR A N   1 
ATOM   947  C CA  . THR A 1 124 ? 13.831  11.177  15.999 1.00 6.54  ? 124 THR A CA  1 
ATOM   948  C C   . THR A 1 124 ? 12.642  11.858  15.319 1.00 7.34  ? 124 THR A C   1 
ATOM   949  O O   . THR A 1 124 ? 12.771  13.050  14.983 1.00 7.07  ? 124 THR A O   1 
ATOM   950  C CB  . THR A 1 124 ? 14.903  10.847  14.951 1.00 5.87  ? 124 THR A CB  1 
ATOM   951  O OG1 . THR A 1 124 ? 14.423  9.837   14.070 1.00 7.97  ? 124 THR A OG1 1 
ATOM   952  C CG2 . THR A 1 124 ? 16.132  10.273  15.661 1.00 8.49  ? 124 THR A CG2 1 
ATOM   953  N N   . VAL A 1 125 ? 11.550  11.131  15.159 1.00 5.87  ? 125 VAL A N   1 
ATOM   954  C CA  . VAL A 1 125 ? 10.252  11.654  14.729 1.00 5.41  ? 125 VAL A CA  1 
ATOM   955  C C   . VAL A 1 125 ? 9.271   11.445  15.879 1.00 7.65  ? 125 VAL A C   1 
ATOM   956  O O   . VAL A 1 125 ? 9.266   10.337  16.433 1.00 7.03  ? 125 VAL A O   1 
ATOM   957  C CB  . VAL A 1 125 ? 9.738   10.958  13.463 1.00 4.74  ? 125 VAL A CB  1 
ATOM   958  C CG1 . VAL A 1 125 ? 8.301   11.329  13.090 1.00 6.51  ? 125 VAL A CG1 1 
ATOM   959  C CG2 . VAL A 1 125 ? 10.699  11.342  12.334 1.00 9.43  ? 125 VAL A CG2 1 
ATOM   960  N N   . LEU A 1 126 ? 8.485   12.435  16.283 1.00 4.83  ? 126 LEU A N   1 
ATOM   961  C CA  . LEU A 1 126 ? 7.755   12.292  17.558 1.00 6.14  ? 126 LEU A CA  1 
ATOM   962  C C   . LEU A 1 126 ? 6.274   12.021  17.414 1.00 6.07  ? 126 LEU A C   1 
ATOM   963  O O   . LEU A 1 126 ? 5.583   11.835  18.429 1.00 7.18  ? 126 LEU A O   1 
ATOM   964  C CB  . LEU A 1 126 ? 8.012   13.558  18.406 1.00 4.77  ? 126 LEU A CB  1 
ATOM   965  C CG  . LEU A 1 126 ? 9.472   13.680  18.863 1.00 6.46  ? 126 LEU A CG  1 
ATOM   966  C CD1 . LEU A 1 126 ? 9.648   14.888  19.778 1.00 8.44  ? 126 LEU A CD1 1 
ATOM   967  C CD2 . LEU A 1 126 ? 9.951   12.452  19.607 1.00 7.13  ? 126 LEU A CD2 1 
ATOM   968  N N   . THR A 1 127 ? 5.710   11.957  16.191 1.00 6.00  ? 127 THR A N   1 
ATOM   969  C CA  . THR A 1 127 ? 4.321   11.578  16.021 1.00 5.53  ? 127 THR A CA  1 
ATOM   970  C C   . THR A 1 127 ? 4.218   10.666  14.775 1.00 6.20  ? 127 THR A C   1 
ATOM   971  O O   . THR A 1 127 ? 5.119   10.660  13.943 1.00 5.59  ? 127 THR A O   1 
ATOM   972  C CB  . THR A 1 127 ? 3.334   12.735  15.797 1.00 7.46  ? 127 THR A CB  1 
ATOM   973  O OG1 . THR A 1 127 ? 3.798   13.545  14.702 1.00 6.95  ? 127 THR A OG1 1 
ATOM   974  C CG2 . THR A 1 127 ? 3.314   13.637  17.024 1.00 5.41  ? 127 THR A CG2 1 
ATOM   975  N N   . VAL A 1 128 ? 3.103   9.955   14.684 1.00 5.71  ? 128 VAL A N   1 
ATOM   976  C CA  . VAL A 1 128 ? 2.871   9.124   13.491 1.00 5.87  ? 128 VAL A CA  1 
ATOM   977  C C   . VAL A 1 128 ? 1.372   8.903   13.310 1.00 6.09  ? 128 VAL A C   1 
ATOM   978  O O   . VAL A 1 128 ? 0.576   8.814   14.258 1.00 7.80  ? 128 VAL A O   1 
ATOM   979  C CB  . VAL A 1 128 ? 3.605   7.794   13.649 1.00 4.39  ? 128 VAL A CB  1 
ATOM   980  C CG1 . VAL A 1 128 ? 3.027   6.997   14.822 1.00 7.56  ? 128 VAL A CG1 1 
ATOM   981  C CG2 . VAL A 1 128 ? 3.558   6.938   12.382 1.00 6.43  ? 128 VAL A CG2 1 
ATOM   982  N N   . ARG A 1 129 ? 0.891   8.767   12.065 1.00 6.65  ? 129 ARG A N   1 
ATOM   983  C CA  . ARG A 1 129 ? -0.507  8.375   11.901 1.00 8.10  ? 129 ARG A CA  1 
ATOM   984  C C   . ARG A 1 129 ? -0.715  6.897   12.228 1.00 4.62  ? 129 ARG A C   1 
ATOM   985  O O   . ARG A 1 129 ? 0.128   6.095   11.870 1.00 7.81  ? 129 ARG A O   1 
ATOM   986  C CB  . ARG A 1 129 ? -0.952  8.565   10.453 1.00 7.74  ? 129 ARG A CB  1 
ATOM   987  C CG  . ARG A 1 129 ? -0.978  10.010  9.994  1.00 8.89  ? 129 ARG A CG  1 
ATOM   988  C CD  . ARG A 1 129 ? -1.262  10.055  8.487  1.00 7.57  ? 129 ARG A CD  1 
ATOM   989  N NE  . ARG A 1 129 ? -1.235  11.421  7.997  1.00 10.07 ? 129 ARG A NE  1 
ATOM   990  C CZ  . ARG A 1 129 ? -1.267  11.716  6.680  1.00 13.15 ? 129 ARG A CZ  1 
ATOM   991  N NH1 . ARG A 1 129 ? -1.339  10.742  5.772  1.00 11.22 ? 129 ARG A NH1 1 
ATOM   992  N NH2 . ARG A 1 129 ? -1.249  12.984  6.312  1.00 11.72 ? 129 ARG A NH2 1 
ATOM   993  N N   . ALA A 1 130 ? -1.812  6.549   12.886 1.00 6.71  ? 130 ALA A N   1 
ATOM   994  C CA  . ALA A 1 130 ? -2.121  5.170   13.213 1.00 6.60  ? 130 ALA A CA  1 
ATOM   995  C C   . ALA A 1 130 ? -1.942  4.254   12.016 1.00 6.45  ? 130 ALA A C   1 
ATOM   996  O O   . ALA A 1 130 ? -2.442  4.566   10.929 1.00 9.14  ? 130 ALA A O   1 
ATOM   997  C CB  . ALA A 1 130 ? -3.569  5.056   13.742 1.00 10.26 ? 130 ALA A CB  1 
ATOM   998  N N   . GLY A 1 131 ? -1.196  3.180   12.191 1.00 6.50  ? 131 GLY A N   1 
ATOM   999  C CA  . GLY A 1 131 ? -1.046  2.187   11.155 1.00 8.13  ? 131 GLY A CA  1 
ATOM   1000 C C   . GLY A 1 131 ? -0.124  2.594   10.030 1.00 12.20 ? 131 GLY A C   1 
ATOM   1001 O O   . GLY A 1 131 ? 0.093   1.746   9.137  1.00 14.77 ? 131 GLY A O   1 
ATOM   1002 N N   . GLN A 1 132 ? 0.430   3.797   10.021 1.00 10.15 ? 132 GLN A N   1 
ATOM   1003 C CA  . GLN A 1 132 ? 1.239   4.248   8.881  1.00 10.28 ? 132 GLN A CA  1 
ATOM   1004 C C   . GLN A 1 132 ? 2.627   4.715   9.273  1.00 7.09  ? 132 GLN A C   1 
ATOM   1005 O O   . GLN A 1 132 ? 2.856   5.883   9.552  1.00 8.83  ? 132 GLN A O   1 
ATOM   1006 C CB  . GLN A 1 132 ? 0.501   5.402   8.170  1.00 13.28 ? 132 GLN A CB  1 
ATOM   1007 C CG  . GLN A 1 132 ? -0.962  5.033   7.915  1.00 14.61 ? 132 GLN A CG  1 
ATOM   1008 C CD  . GLN A 1 132 ? -1.062  3.902   6.907  1.00 28.60 ? 132 GLN A CD  1 
ATOM   1009 O OE1 . GLN A 1 132 ? -0.244  3.875   5.974  1.00 19.22 ? 132 GLN A OE1 1 
ATOM   1010 N NE2 . GLN A 1 132 ? -2.020  2.994   7.083  1.00 21.85 ? 132 GLN A NE2 1 
ATOM   1011 N N   . ALA A 1 133 ? 3.574   3.788   9.300  1.00 10.26 ? 133 ALA A N   1 
ATOM   1012 C CA  . ALA A 1 133 ? 4.943   4.108   9.698  1.00 10.88 ? 133 ALA A CA  1 
ATOM   1013 C C   . ALA A 1 133 ? 5.554   5.216   8.832  1.00 14.04 ? 133 ALA A C   1 
ATOM   1014 O O   . ALA A 1 133 ? 5.363   5.219   7.613  1.00 8.90  ? 133 ALA A O   1 
ATOM   1015 C CB  . ALA A 1 133 ? 5.800   2.847   9.617  1.00 11.57 ? 133 ALA A CB  1 
ATOM   1016 N N   . HIS A 1 134 ? 6.281   6.121   9.476  1.00 9.29  ? 134 HIS A N   1 
ATOM   1017 C CA  . HIS A 1 134 ? 7.017   7.225   8.902  1.00 7.02  ? 134 HIS A CA  1 
ATOM   1018 C C   . HIS A 1 134 ? 6.127   8.292   8.277  1.00 6.09  ? 134 HIS A C   1 
ATOM   1019 O O   . HIS A 1 134 ? 6.624   9.179   7.581  1.00 7.93  ? 134 HIS A O   1 
ATOM   1020 C CB  . HIS A 1 134 ? 8.002   6.748   7.816  1.00 7.50  ? 134 HIS A CB  1 
ATOM   1021 C CG  . HIS A 1 134 ? 8.952   5.744   8.371  1.00 9.98  ? 134 HIS A CG  1 
ATOM   1022 N ND1 . HIS A 1 134 ? 9.981   6.001   9.241  1.00 17.12 ? 134 HIS A ND1 1 
ATOM   1023 C CD2 . HIS A 1 134 ? 8.986   4.417   8.115  1.00 7.09  ? 134 HIS A CD2 1 
ATOM   1024 C CE1 . HIS A 1 134 ? 10.626  4.873   9.515  1.00 9.47  ? 134 HIS A CE1 1 
ATOM   1025 N NE2 . HIS A 1 134 ? 10.023  3.893   8.840  1.00 15.04 ? 134 HIS A NE2 1 
ATOM   1026 N N   . SER A 1 135 ? 4.820   8.213   8.548  1.00 8.19  ? 135 SER A N   1 
ATOM   1027 C CA  . SER A 1 135 ? 3.924   9.161   7.892  1.00 7.58  ? 135 SER A CA  1 
ATOM   1028 C C   . SER A 1 135 ? 4.150   10.606  8.300  1.00 9.25  ? 135 SER A C   1 
ATOM   1029 O O   . SER A 1 135 ? 3.712   11.500  7.545  1.00 9.18  ? 135 SER A O   1 
ATOM   1030 C CB  . SER A 1 135 ? 2.472   8.782   8.154  1.00 9.73  ? 135 SER A CB  1 
ATOM   1031 O OG  . SER A 1 135 ? 2.252   8.435   9.510  1.00 8.58  ? 135 SER A OG  1 
ATOM   1032 N N   . HIS A 1 136 ? 4.829   10.901  9.421  1.00 6.36  ? 136 HIS A N   1 
ATOM   1033 C CA  . HIS A 1 136 ? 5.137   12.277  9.775  1.00 5.60  ? 136 HIS A CA  1 
ATOM   1034 C C   . HIS A 1 136 ? 6.628   12.546  9.676  1.00 8.68  ? 136 HIS A C   1 
ATOM   1035 O O   . HIS A 1 136 ? 7.129   13.526  10.256 1.00 8.76  ? 136 HIS A O   1 
ATOM   1036 C CB  . HIS A 1 136 ? 4.650   12.613  11.196 1.00 7.17  ? 136 HIS A CB  1 
ATOM   1037 C CG  . HIS A 1 136 ? 3.165   12.835  11.260 1.00 7.26  ? 136 HIS A CG  1 
ATOM   1038 N ND1 . HIS A 1 136 ? 2.508   13.043  12.461 1.00 9.20  ? 136 HIS A ND1 1 
ATOM   1039 C CD2 . HIS A 1 136 ? 2.207   12.840  10.307 1.00 6.77  ? 136 HIS A CD2 1 
ATOM   1040 C CE1 . HIS A 1 136 ? 1.208   13.203  12.226 1.00 9.01  ? 136 HIS A CE1 1 
ATOM   1041 N NE2 . HIS A 1 136 ? 0.988   13.091  10.915 1.00 6.21  ? 136 HIS A NE2 1 
ATOM   1042 N N   . ALA A 1 137 ? 7.327   11.700  8.927  1.00 7.35  ? 137 ALA A N   1 
ATOM   1043 C CA  . ALA A 1 137 ? 8.783   11.866  8.873  1.00 9.65  ? 137 ALA A CA  1 
ATOM   1044 C C   . ALA A 1 137 ? 9.225   13.059  8.045  1.00 15.61 ? 137 ALA A C   1 
ATOM   1045 O O   . ALA A 1 137 ? 10.378  13.494  8.133  1.00 14.89 ? 137 ALA A O   1 
ATOM   1046 C CB  . ALA A 1 137 ? 9.429   10.603  8.317  1.00 12.71 ? 137 ALA A CB  1 
ATOM   1047 N N   . SER A 1 138 ? 8.311   13.601  7.243  1.00 7.82  ? 138 SER A N   1 
ATOM   1048 C CA  . SER A 1 138 ? 8.792   14.718  6.428  1.00 12.09 ? 138 SER A CA  1 
ATOM   1049 C C   . SER A 1 138 ? 8.230   16.021  6.968  1.00 9.49  ? 138 SER A C   1 
ATOM   1050 O O   . SER A 1 138 ? 8.246   17.043  6.267  1.00 12.23 ? 138 SER A O   1 
ATOM   1051 C CB  . SER A 1 138 ? 8.475   14.530  4.931  1.00 9.83  ? 138 SER A CB  1 
ATOM   1052 O OG  . SER A 1 138 ? 7.089   14.427  4.694  1.00 12.91 ? 138 SER A OG  1 
ATOM   1053 N N   . LEU A 1 139 ? 7.747   16.030  8.208  1.00 8.98  ? 139 LEU A N   1 
ATOM   1054 C CA  . LEU A 1 139 ? 7.457   17.286  8.885  1.00 8.11  ? 139 LEU A CA  1 
ATOM   1055 C C   . LEU A 1 139 ? 8.760   17.844  9.446  1.00 9.07  ? 139 LEU A C   1 
ATOM   1056 O O   . LEU A 1 139 ? 9.819   17.595  8.871  1.00 9.50  ? 139 LEU A O   1 
ATOM   1057 C CB  . LEU A 1 139 ? 6.378   17.080  9.953  1.00 8.43  ? 139 LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 139 ? 5.114   16.379  9.409  1.00 11.02 ? 139 LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 139 ? 4.053   16.254  10.481 1.00 8.72  ? 139 LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 139 ? 4.591   17.124  8.185  1.00 14.16 ? 139 LEU A CD2 1 
ATOM   1061 N N   . GLY A 1 140 ? 8.706   18.599  10.540 1.00 9.22  ? 140 GLY A N   1 
ATOM   1062 C CA  . GLY A 1 140 ? 9.899   19.236  11.099 1.00 6.69  ? 140 GLY A CA  1 
ATOM   1063 C C   . GLY A 1 140 ? 10.464  18.465  12.277 1.00 7.08  ? 140 GLY A C   1 
ATOM   1064 O O   . GLY A 1 140 ? 11.317  19.020  12.982 1.00 8.90  ? 140 GLY A O   1 
ATOM   1065 N N   . TRP A 1 141 ? 10.044  17.217  12.513 1.00 5.86  ? 141 TRP A N   1 
ATOM   1066 C CA  . TRP A 1 141 ? 10.586  16.582  13.728 1.00 7.09  ? 141 TRP A CA  1 
ATOM   1067 C C   . TRP A 1 141 ? 12.059  16.226  13.615 1.00 6.30  ? 141 TRP A C   1 
ATOM   1068 O O   . TRP A 1 141 ? 12.797  16.322  14.621 1.00 8.62  ? 141 TRP A O   1 
ATOM   1069 C CB  . TRP A 1 141 ? 9.819   15.298  14.035 1.00 9.16  ? 141 TRP A CB  1 
ATOM   1070 C CG  . TRP A 1 141 ? 8.431   15.430  14.559 1.00 6.61  ? 141 TRP A CG  1 
ATOM   1071 C CD1 . TRP A 1 141 ? 7.317   14.854  13.991 1.00 6.47  ? 141 TRP A CD1 1 
ATOM   1072 C CD2 . TRP A 1 141 ? 7.973   16.153  15.706 1.00 9.48  ? 141 TRP A CD2 1 
ATOM   1073 N NE1 . TRP A 1 141 ? 6.197   15.177  14.729 1.00 6.33  ? 141 TRP A NE1 1 
ATOM   1074 C CE2 . TRP A 1 141 ? 6.581   15.973  15.781 1.00 5.32  ? 141 TRP A CE2 1 
ATOM   1075 C CE3 . TRP A 1 141 ? 8.641   16.935  16.669 1.00 7.13  ? 141 TRP A CE3 1 
ATOM   1076 C CZ2 . TRP A 1 141 ? 5.813   16.548  16.791 1.00 6.96  ? 141 TRP A CZ2 1 
ATOM   1077 C CZ3 . TRP A 1 141 ? 7.863   17.504  17.677 1.00 4.76  ? 141 TRP A CZ3 1 
ATOM   1078 C CH2 . TRP A 1 141 ? 6.469   17.309  17.733 1.00 7.13  ? 141 TRP A CH2 1 
ATOM   1079 N N   . GLU A 1 142 ? 12.585  15.784  12.465 1.00 6.81  ? 142 GLU A N   1 
ATOM   1080 C CA  . GLU A 1 142 ? 14.018  15.473  12.432 1.00 7.07  ? 142 GLU A CA  1 
ATOM   1081 C C   . GLU A 1 142 ? 14.879  16.702  12.686 1.00 7.10  ? 142 GLU A C   1 
ATOM   1082 O O   . GLU A 1 142 ? 15.950  16.636  13.292 1.00 6.96  ? 142 GLU A O   1 
ATOM   1083 C CB  . GLU A 1 142 ? 14.431  14.837  11.089 1.00 7.09  ? 142 GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 142 ? 13.813  13.445  10.905 1.00 9.01  ? 142 GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 142 ? 14.546  12.364  11.683 1.00 8.17  ? 142 GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 142 ? 15.695  12.586  12.144 1.00 8.48  ? 142 GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 142 ? 14.000  11.263  11.799 1.00 7.21  ? 142 GLU A OE2 1 
ATOM   1088 N N   . THR A 1 143 ? 14.388  17.857  12.207 1.00 6.90  ? 143 THR A N   1 
ATOM   1089 C CA  . THR A 1 143 ? 15.121  19.095  12.459 1.00 8.99  ? 143 THR A CA  1 
ATOM   1090 C C   . THR A 1 143 ? 15.140  19.340  13.970 1.00 7.59  ? 143 THR A C   1 
ATOM   1091 O O   . THR A 1 143 ? 16.184  19.685  14.512 1.00 8.48  ? 143 THR A O   1 
ATOM   1092 C CB  . THR A 1 143 ? 14.478  20.256  11.680 1.00 11.08 ? 143 THR A CB  1 
ATOM   1093 O OG1 . THR A 1 143 ? 14.493  19.867  10.290 1.00 11.51 ? 143 THR A OG1 1 
ATOM   1094 C CG2 . THR A 1 143 ? 15.249  21.545  11.808 1.00 9.61  ? 143 THR A CG2 1 
ATOM   1095 N N   . PHE A 1 144 ? 13.987  19.140  14.593 1.00 6.71  ? 144 PHE A N   1 
ATOM   1096 C CA  . PHE A 1 144 ? 13.881  19.372  16.037 1.00 9.31  ? 144 PHE A CA  1 
ATOM   1097 C C   . PHE A 1 144 ? 14.807  18.431  16.788 1.00 5.52  ? 144 PHE A C   1 
ATOM   1098 O O   . PHE A 1 144 ? 15.550  18.840  17.702 1.00 7.06  ? 144 PHE A O   1 
ATOM   1099 C CB  . PHE A 1 144 ? 12.430  19.170  16.491 1.00 7.08  ? 144 PHE A CB  1 
ATOM   1100 C CG  . PHE A 1 144 ? 12.260  19.264  17.991 1.00 7.62  ? 144 PHE A CG  1 
ATOM   1101 C CD1 . PHE A 1 144 ? 12.496  20.473  18.635 1.00 8.94  ? 144 PHE A CD1 1 
ATOM   1102 C CD2 . PHE A 1 144 ? 11.881  18.134  18.703 1.00 6.17  ? 144 PHE A CD2 1 
ATOM   1103 C CE1 . PHE A 1 144 ? 12.336  20.517  20.014 1.00 9.13  ? 144 PHE A CE1 1 
ATOM   1104 C CE2 . PHE A 1 144 ? 11.718  18.213  20.086 1.00 11.18 ? 144 PHE A CE2 1 
ATOM   1105 C CZ  . PHE A 1 144 ? 11.941  19.404  20.753 1.00 9.58  ? 144 PHE A CZ  1 
ATOM   1106 N N   . THR A 1 145 ? 14.783  17.161  16.410 1.00 6.17  ? 145 THR A N   1 
ATOM   1107 C CA  . THR A 1 145 ? 15.640  16.245  17.206 1.00 5.53  ? 145 THR A CA  1 
ATOM   1108 C C   . THR A 1 145 ? 17.102  16.392  16.812 1.00 9.25  ? 145 THR A C   1 
ATOM   1109 O O   . THR A 1 145 ? 17.994  16.073  17.626 1.00 6.06  ? 145 THR A O   1 
ATOM   1110 C CB  . THR A 1 145 ? 15.086  14.822  17.114 1.00 8.43  ? 145 THR A CB  1 
ATOM   1111 O OG1 . THR A 1 145 ? 14.992  14.389  15.749 1.00 8.67  ? 145 THR A OG1 1 
ATOM   1112 C CG2 . THR A 1 145 ? 13.653  14.762  17.654 1.00 5.10  ? 145 THR A CG2 1 
ATOM   1113 N N   . ASP A 1 146 ? 17.447  16.917  15.635 1.00 6.98  ? 146 ASP A N   1 
ATOM   1114 C CA  . ASP A 1 146 ? 18.851  17.252  15.357 1.00 5.27  ? 146 ASP A CA  1 
ATOM   1115 C C   . ASP A 1 146 ? 19.324  18.284  16.386 1.00 6.04  ? 146 ASP A C   1 
ATOM   1116 O O   . ASP A 1 146 ? 20.413  18.206  16.972 1.00 7.05  ? 146 ASP A O   1 
ATOM   1117 C CB  . ASP A 1 146 ? 19.071  17.870  13.978 1.00 8.43  ? 146 ASP A CB  1 
ATOM   1118 C CG  . ASP A 1 146 ? 19.062  16.884  12.825 1.00 8.31  ? 146 ASP A CG  1 
ATOM   1119 O OD1 . ASP A 1 146 ? 19.149  15.663  13.013 1.00 8.91  ? 146 ASP A OD1 1 
ATOM   1120 O OD2 . ASP A 1 146 ? 18.944  17.435  11.704 1.00 11.04 ? 146 ASP A OD2 1 
ATOM   1121 N N   . LYS A 1 147 ? 18.444  19.273  16.601 1.00 7.03  ? 147 LYS A N   1 
ATOM   1122 C CA  . LYS A 1 147 ? 18.811  20.319  17.552 1.00 7.77  ? 147 LYS A CA  1 
ATOM   1123 C C   . LYS A 1 147 ? 18.948  19.733  18.962 1.00 10.51 ? 147 LYS A C   1 
ATOM   1124 O O   . LYS A 1 147 ? 19.881  20.135  19.674 1.00 8.54  ? 147 LYS A O   1 
ATOM   1125 C CB  . LYS A 1 147 ? 17.789  21.456  17.541 1.00 8.72  ? 147 LYS A CB  1 
ATOM   1126 C CG  . LYS A 1 147 ? 18.122  22.611  18.484 1.00 8.79  ? 147 LYS A CG  1 
ATOM   1127 C CD  . LYS A 1 147 ? 19.407  23.292  18.011 1.00 10.95 ? 147 LYS A CD  1 
ATOM   1128 C CE  . LYS A 1 147 ? 19.671  24.517  18.891 1.00 19.49 ? 147 LYS A CE  1 
ATOM   1129 N NZ  . LYS A 1 147 ? 21.066  25.006  18.638 1.00 26.11 ? 147 LYS A NZ  1 
ATOM   1130 N N   . VAL A 1 148 ? 18.030  18.847  19.368 1.00 6.57  ? 148 VAL A N   1 
ATOM   1131 C CA  . VAL A 1 148 ? 18.115  18.220  20.702 1.00 6.94  ? 148 VAL A CA  1 
ATOM   1132 C C   . VAL A 1 148 ? 19.476  17.575  20.838 1.00 8.42  ? 148 VAL A C   1 
ATOM   1133 O O   . VAL A 1 148 ? 20.203  17.720  21.824 1.00 7.93  ? 148 VAL A O   1 
ATOM   1134 C CB  . VAL A 1 148 ? 16.964  17.224  20.880 1.00 5.47  ? 148 VAL A CB  1 
ATOM   1135 C CG1 . VAL A 1 148 ? 17.153  16.382  22.137 1.00 6.75  ? 148 VAL A CG1 1 
ATOM   1136 C CG2 . VAL A 1 148 ? 15.614  17.954  20.908 1.00 7.27  ? 148 VAL A CG2 1 
ATOM   1137 N N   . ILE A 1 149 ? 19.895  16.815  19.816 1.00 6.71  ? 149 ILE A N   1 
ATOM   1138 C CA  . ILE A 1 149 ? 21.154  16.058  19.936 1.00 8.21  ? 149 ILE A CA  1 
ATOM   1139 C C   . ILE A 1 149 ? 22.345  16.990  19.996 1.00 6.85  ? 149 ILE A C   1 
ATOM   1140 O O   . ILE A 1 149 ? 23.277  16.804  20.776 1.00 7.66  ? 149 ILE A O   1 
ATOM   1141 C CB  . ILE A 1 149 ? 21.270  15.042  18.781 1.00 8.23  ? 149 ILE A CB  1 
ATOM   1142 C CG1 . ILE A 1 149 ? 20.196  13.971  18.985 1.00 10.54 ? 149 ILE A CG1 1 
ATOM   1143 C CG2 . ILE A 1 149 ? 22.676  14.476  18.668 1.00 8.67  ? 149 ILE A CG2 1 
ATOM   1144 C CD1 . ILE A 1 149 ? 20.039  13.014  17.822 1.00 15.75 ? 149 ILE A CD1 1 
ATOM   1145 N N   . SER A 1 150 ? 22.299  18.024  19.160 1.00 7.24  ? 150 SER A N   1 
ATOM   1146 C CA  . SER A 1 150 ? 23.345  19.038  19.151 1.00 7.78  ? 150 SER A CA  1 
ATOM   1147 C C   . SER A 1 150 ? 23.510  19.676  20.521 1.00 7.21  ? 150 SER A C   1 
ATOM   1148 O O   . SER A 1 150 ? 24.632  19.869  21.023 1.00 8.49  ? 150 SER A O   1 
ATOM   1149 C CB  . SER A 1 150 ? 23.010  20.078  18.065 1.00 8.45  ? 150 SER A CB  1 
ATOM   1150 O OG  . SER A 1 150 ? 24.082  21.023  18.104 1.00 17.97 ? 150 SER A OG  1 
ATOM   1151 N N   . LEU A 1 151 ? 22.392  19.974  21.178 1.00 6.84  ? 151 LEU A N   1 
ATOM   1152 C CA  . LEU A 1 151 ? 22.456  20.620  22.483 1.00 7.13  ? 151 LEU A CA  1 
ATOM   1153 C C   . LEU A 1 151 ? 23.017  19.680  23.529 1.00 7.43  ? 151 LEU A C   1 
ATOM   1154 O O   . LEU A 1 151 ? 23.758  20.129  24.418 1.00 9.86  ? 151 LEU A O   1 
ATOM   1155 C CB  . LEU A 1 151 ? 21.043  21.074  22.871 1.00 8.94  ? 151 LEU A CB  1 
ATOM   1156 C CG  . LEU A 1 151 ? 20.531  22.277  22.079 1.00 11.91 ? 151 LEU A CG  1 
ATOM   1157 C CD1 . LEU A 1 151 ? 19.046  22.487  22.334 1.00 9.28  ? 151 LEU A CD1 1 
ATOM   1158 C CD2 . LEU A 1 151 ? 21.375  23.504  22.429 1.00 12.13 ? 151 LEU A CD2 1 
ATOM   1159 N N   . ILE A 1 152 ? 22.687  18.380  23.450 1.00 6.31  ? 152 ILE A N   1 
ATOM   1160 C CA  . ILE A 1 152 ? 23.250  17.470  24.449 1.00 7.33  ? 152 ILE A CA  1 
ATOM   1161 C C   . ILE A 1 152 ? 24.757  17.412  24.241 1.00 7.83  ? 152 ILE A C   1 
ATOM   1162 O O   . ILE A 1 152 ? 25.539  17.475  25.181 1.00 8.95  ? 152 ILE A O   1 
ATOM   1163 C CB  . ILE A 1 152 ? 22.629  16.073  24.356 1.00 8.66  ? 152 ILE A CB  1 
ATOM   1164 C CG1 . ILE A 1 152 ? 21.114  16.076  24.577 1.00 6.86  ? 152 ILE A CG1 1 
ATOM   1165 C CG2 . ILE A 1 152 ? 23.322  15.141  25.334 1.00 9.42  ? 152 ILE A CG2 1 
ATOM   1166 C CD1 . ILE A 1 152 ? 20.465  14.766  24.148 1.00 9.04  ? 152 ILE A CD1 1 
ATOM   1167 N N   . ASN A 1 153 ? 25.142  17.338  22.964 1.00 8.25  ? 153 ASN A N   1 
ATOM   1168 C CA  . ASN A 1 153 ? 26.573  17.294  22.662 1.00 10.18 ? 153 ASN A CA  1 
ATOM   1169 C C   . ASN A 1 153 ? 27.333  18.468  23.276 1.00 12.96 ? 153 ASN A C   1 
ATOM   1170 O O   . ASN A 1 153 ? 28.459  18.257  23.759 1.00 9.29  ? 153 ASN A O   1 
ATOM   1171 C CB  . ASN A 1 153 ? 26.799  17.305  21.140 1.00 7.96  ? 153 ASN A CB  1 
ATOM   1172 C CG  . ASN A 1 153 ? 28.258  17.141  20.757 1.00 6.92  ? 153 ASN A CG  1 
ATOM   1173 O OD1 . ASN A 1 153 ? 28.895  16.167  21.112 1.00 8.86  ? 153 ASN A OD1 1 
ATOM   1174 N ND2 . ASN A 1 153 ? 28.788  18.119  20.018 1.00 10.25 ? 153 ASN A ND2 1 
ATOM   1175 N N   . GLN A 1 154 ? 26.735  19.650  23.235 1.00 8.63  ? 154 GLN A N   1 
ATOM   1176 C CA  . GLN A 1 154 ? 27.424  20.864  23.640 1.00 9.37  ? 154 GLN A CA  1 
ATOM   1177 C C   . GLN A 1 154 ? 27.318  21.120  25.129 1.00 12.25 ? 154 GLN A C   1 
ATOM   1178 O O   . GLN A 1 154 ? 28.271  21.534  25.815 1.00 15.61 ? 154 GLN A O   1 
ATOM   1179 C CB  . GLN A 1 154 ? 26.806  22.038  22.867 1.00 11.99 ? 154 GLN A CB  1 
ATOM   1180 C CG  . GLN A 1 154 ? 27.200  22.029  21.398 1.00 35.26 ? 154 GLN A CG  1 
ATOM   1181 C CD  . GLN A 1 154 ? 26.345  22.981  20.571 1.00 57.09 ? 154 GLN A CD  1 
ATOM   1182 O OE1 . GLN A 1 154 ? 25.398  23.588  21.082 1.00 66.61 ? 154 GLN A OE1 1 
ATOM   1183 N NE2 . GLN A 1 154 ? 26.688  23.098  19.288 1.00 38.71 ? 154 GLN A NE2 1 
ATOM   1184 N N   . HIS A 1 155 ? 26.125  20.878  25.667 1.00 11.81 ? 155 HIS A N   1 
ATOM   1185 C CA  . HIS A 1 155 ? 25.879  21.277  27.041 1.00 11.70 ? 155 HIS A CA  1 
ATOM   1186 C C   . HIS A 1 155 ? 26.183  20.193  28.057 1.00 14.84 ? 155 HIS A C   1 
ATOM   1187 O O   . HIS A 1 155 ? 26.350  20.469  29.248 1.00 21.76 ? 155 HIS A O   1 
ATOM   1188 C CB  . HIS A 1 155 ? 24.399  21.662  27.244 1.00 10.33 ? 155 HIS A CB  1 
ATOM   1189 C CG  . HIS A 1 155 ? 24.110  23.023  26.740 1.00 16.94 ? 155 HIS A CG  1 
ATOM   1190 N ND1 . HIS A 1 155 ? 23.644  23.296  25.478 1.00 20.45 ? 155 HIS A ND1 1 
ATOM   1191 C CD2 . HIS A 1 155 ? 24.251  24.219  27.374 1.00 17.23 ? 155 HIS A CD2 1 
ATOM   1192 C CE1 . HIS A 1 155 ? 23.509  24.597  25.351 1.00 16.80 ? 155 HIS A CE1 1 
ATOM   1193 N NE2 . HIS A 1 155 ? 23.863  25.179  26.487 1.00 22.80 ? 155 HIS A NE2 1 
ATOM   1194 N N   . ARG A 1 156 ? 26.234  18.946  27.612 1.00 11.45 ? 156 ARG A N   1 
ATOM   1195 C CA  . ARG A 1 156 ? 26.516  17.874  28.560 1.00 8.72  ? 156 ARG A CA  1 
ATOM   1196 C C   . ARG A 1 156 ? 27.921  17.332  28.339 1.00 9.11  ? 156 ARG A C   1 
ATOM   1197 O O   . ARG A 1 156 ? 28.576  17.623  27.353 1.00 8.32  ? 156 ARG A O   1 
ATOM   1198 C CB  . ARG A 1 156 ? 25.459  16.773  28.472 1.00 11.52 ? 156 ARG A CB  1 
ATOM   1199 C CG  . ARG A 1 156 ? 24.052  17.290  28.806 1.00 13.27 ? 156 ARG A CG  1 
ATOM   1200 C CD  . ARG A 1 156 ? 23.985  17.748  30.282 1.00 24.67 ? 156 ARG A CD  1 
ATOM   1201 N NE  . ARG A 1 156 ? 24.933  16.903  31.027 1.00 23.81 ? 156 ARG A NE  1 
ATOM   1202 C CZ  . ARG A 1 156 ? 24.567  15.711  31.483 1.00 17.00 ? 156 ARG A CZ  1 
ATOM   1203 N NH1 . ARG A 1 156 ? 23.328  15.295  31.290 1.00 16.62 ? 156 ARG A NH1 1 
ATOM   1204 N NH2 . ARG A 1 156 ? 25.442  14.960  32.130 1.00 14.52 ? 156 ARG A NH2 1 
ATOM   1205 N N   . GLU A 1 157 ? 28.399  16.538  29.290 1.00 11.78 ? 157 GLU A N   1 
ATOM   1206 C CA  . GLU A 1 157 ? 29.692  15.889  29.247 1.00 8.18  ? 157 GLU A CA  1 
ATOM   1207 C C   . GLU A 1 157 ? 29.561  14.423  29.622 1.00 7.72  ? 157 GLU A C   1 
ATOM   1208 O O   . GLU A 1 157 ? 28.855  14.102  30.586 1.00 11.85 ? 157 GLU A O   1 
ATOM   1209 C CB  . GLU A 1 157 ? 30.686  16.491  30.249 1.00 9.10  ? 157 GLU A CB  1 
ATOM   1210 C CG  . GLU A 1 157 ? 31.001  17.950  30.001 1.00 11.17 ? 157 GLU A CG  1 
ATOM   1211 C CD  . GLU A 1 157 ? 32.014  18.087  28.857 1.00 9.13  ? 157 GLU A CD  1 
ATOM   1212 O OE1 . GLU A 1 157 ? 32.780  17.133  28.643 1.00 9.76  ? 157 GLU A OE1 1 
ATOM   1213 O OE2 . GLU A 1 157 ? 31.977  19.175  28.240 1.00 10.57 ? 157 GLU A OE2 1 
ATOM   1214 N N   . GLY A 1 158 ? 30.216  13.536  28.872 1.00 7.60  ? 158 GLY A N   1 
ATOM   1215 C CA  . GLY A 1 158 ? 30.258  12.162  29.319 1.00 5.58  ? 158 GLY A CA  1 
ATOM   1216 C C   . GLY A 1 158 ? 28.987  11.375  29.148 1.00 10.35 ? 158 GLY A C   1 
ATOM   1217 O O   . GLY A 1 158 ? 28.780  10.385  29.861 1.00 12.59 ? 158 GLY A O   1 
ATOM   1218 N N   . VAL A 1 159 ? 28.129  11.744  28.217 1.00 8.13  ? 159 VAL A N   1 
ATOM   1219 C CA  . VAL A 1 159 ? 26.918  11.007  27.886 1.00 5.71  ? 159 VAL A CA  1 
ATOM   1220 C C   . VAL A 1 159 ? 27.274  9.838   26.980 1.00 8.58  ? 159 VAL A C   1 
ATOM   1221 O O   . VAL A 1 159 ? 28.142  9.941   26.105 1.00 7.94  ? 159 VAL A O   1 
ATOM   1222 C CB  . VAL A 1 159 ? 25.919  11.946  27.200 1.00 8.10  ? 159 VAL A CB  1 
ATOM   1223 C CG1 . VAL A 1 159 ? 24.680  11.209  26.739 1.00 9.43  ? 159 VAL A CG1 1 
ATOM   1224 C CG2 . VAL A 1 159 ? 25.558  13.039  28.206 1.00 9.35  ? 159 VAL A CG2 1 
ATOM   1225 N N   . VAL A 1 160 ? 26.649  8.686   27.202 1.00 7.21  ? 160 VAL A N   1 
ATOM   1226 C CA  . VAL A 1 160 ? 26.811  7.538   26.335 1.00 6.43  ? 160 VAL A CA  1 
ATOM   1227 C C   . VAL A 1 160 ? 25.701  7.587   25.272 1.00 8.58  ? 160 VAL A C   1 
ATOM   1228 O O   . VAL A 1 160 ? 24.530  7.603   25.669 1.00 9.94  ? 160 VAL A O   1 
ATOM   1229 C CB  . VAL A 1 160 ? 26.652  6.192   27.049 1.00 9.82  ? 160 VAL A CB  1 
ATOM   1230 C CG1 . VAL A 1 160 ? 26.811  5.029   26.058 1.00 12.03 ? 160 VAL A CG1 1 
ATOM   1231 C CG2 . VAL A 1 160 ? 27.644  6.020   28.173 1.00 14.23 ? 160 VAL A CG2 1 
ATOM   1232 N N   . PHE A 1 161 ? 26.069  7.577   24.004 1.00 7.14  ? 161 PHE A N   1 
ATOM   1233 C CA  . PHE A 1 161 ? 24.999  7.498   22.996 1.00 6.40  ? 161 PHE A CA  1 
ATOM   1234 C C   . PHE A 1 161 ? 25.012  6.130   22.353 1.00 7.02  ? 161 PHE A C   1 
ATOM   1235 O O   . PHE A 1 161 ? 26.089  5.715   21.924 1.00 8.61  ? 161 PHE A O   1 
ATOM   1236 C CB  . PHE A 1 161 ? 25.267  8.510   21.900 1.00 7.57  ? 161 PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 161 ? 25.111  9.949   22.324 1.00 9.37  ? 161 PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 161 ? 26.109  10.588  23.056 1.00 8.58  ? 161 PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 161 ? 23.951  10.611  21.944 1.00 7.88  ? 161 PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 161 ? 25.910  11.909  23.400 1.00 8.32  ? 161 PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 161 ? 23.770  11.926  22.305 1.00 11.45 ? 161 PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 161 ? 24.758  12.576  23.019 1.00 9.54  ? 161 PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 162 ? 23.875  5.469   22.312 1.00 5.81  ? 162 LEU A N   1 
ATOM   1244 C CA  . LEU A 1 162 ? 23.733  4.170   21.700 1.00 5.70  ? 162 LEU A CA  1 
ATOM   1245 C C   . LEU A 1 162 ? 23.017  4.379   20.368 1.00 8.74  ? 162 LEU A C   1 
ATOM   1246 O O   . LEU A 1 162 ? 21.827  4.718   20.313 1.00 8.11  ? 162 LEU A O   1 
ATOM   1247 C CB  . LEU A 1 162 ? 22.979  3.190   22.597 1.00 7.17  ? 162 LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 162 ? 23.577  3.100   24.025 1.00 8.80  ? 162 LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 162 ? 22.847  2.087   24.881 1.00 8.55  ? 162 LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 162 ? 25.059  2.782   23.989 1.00 7.11  ? 162 LEU A CD2 1 
ATOM   1251 N N   . LEU A 1 163 ? 23.780  4.219   19.296 1.00 7.53  ? 163 LEU A N   1 
ATOM   1252 C CA  . LEU A 1 163 ? 23.250  4.526   17.967 1.00 6.74  ? 163 LEU A CA  1 
ATOM   1253 C C   . LEU A 1 163 ? 23.014  3.233   17.202 1.00 8.84  ? 163 LEU A C   1 
ATOM   1254 O O   . LEU A 1 163 ? 23.958  2.578   16.749 1.00 7.99  ? 163 LEU A O   1 
ATOM   1255 C CB  . LEU A 1 163 ? 24.240  5.393   17.196 1.00 5.49  ? 163 LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 163 ? 24.632  6.714   17.887 1.00 7.68  ? 163 LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 163 ? 25.511  7.539   16.962 1.00 7.25  ? 163 LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 163 ? 23.385  7.482   18.316 1.00 11.95 ? 163 LEU A CD2 1 
ATOM   1259 N N   . TRP A 1 164 ? 21.748  2.871   17.057 1.00 7.35  ? 164 TRP A N   1 
ATOM   1260 C CA  . TRP A 1 164 ? 21.325  1.619   16.503 1.00 4.96  ? 164 TRP A CA  1 
ATOM   1261 C C   . TRP A 1 164 ? 20.679  1.807   15.139 1.00 8.57  ? 164 TRP A C   1 
ATOM   1262 O O   . TRP A 1 164 ? 19.633  2.449   15.053 1.00 9.34  ? 164 TRP A O   1 
ATOM   1263 C CB  . TRP A 1 164 ? 20.297  1.010   17.464 1.00 7.75  ? 164 TRP A CB  1 
ATOM   1264 C CG  . TRP A 1 164 ? 20.912  0.652   18.794 1.00 5.61  ? 164 TRP A CG  1 
ATOM   1265 C CD1 . TRP A 1 164 ? 22.220  0.503   19.153 1.00 7.28  ? 164 TRP A CD1 1 
ATOM   1266 C CD2 . TRP A 1 164 ? 20.125  0.399   19.975 1.00 5.73  ? 164 TRP A CD2 1 
ATOM   1267 N NE1 . TRP A 1 164 ? 22.298  0.167   20.499 1.00 7.68  ? 164 TRP A NE1 1 
ATOM   1268 C CE2 . TRP A 1 164 ? 21.036  0.096   21.024 1.00 7.11  ? 164 TRP A CE2 1 
ATOM   1269 C CE3 . TRP A 1 164 ? 18.758  0.398   20.241 1.00 6.03  ? 164 TRP A CE3 1 
ATOM   1270 C CZ2 . TRP A 1 164 ? 20.557  -0.199  22.303 1.00 4.86  ? 164 TRP A CZ2 1 
ATOM   1271 C CZ3 . TRP A 1 164 ? 18.292  0.103   21.524 1.00 7.11  ? 164 TRP A CZ3 1 
ATOM   1272 C CH2 . TRP A 1 164 ? 19.207  -0.193  22.549 1.00 6.62  ? 164 TRP A CH2 1 
ATOM   1273 N N   . GLY A 1 165 ? 21.313  1.208   14.129 1.00 8.57  ? 165 GLY A N   1 
ATOM   1274 C CA  . GLY A 1 165 ? 20.813  1.348   12.753 1.00 8.08  ? 165 GLY A CA  1 
ATOM   1275 C C   . GLY A 1 165 ? 21.461  2.512   12.032 1.00 5.83  ? 165 GLY A C   1 
ATOM   1276 O O   . GLY A 1 165 ? 21.997  3.445   12.610 1.00 5.89  ? 165 GLY A O   1 
ATOM   1277 N N   . SER A 1 166 ? 21.399  2.496   10.684 1.00 8.29  ? 166 SER A N   1 
ATOM   1278 C CA  . SER A 1 166 ? 22.078  3.553   9.951  1.00 5.60  ? 166 SER A CA  1 
ATOM   1279 C C   . SER A 1 166 ? 21.511  4.940   10.204 1.00 6.48  ? 166 SER A C   1 
ATOM   1280 O O   . SER A 1 166 ? 22.225  5.935   10.226 1.00 7.90  ? 166 SER A O   1 
ATOM   1281 C CB  . SER A 1 166 ? 22.003  3.248   8.436  1.00 9.73  ? 166 SER A CB  1 
ATOM   1282 O OG  . SER A 1 166 ? 22.763  2.075   8.166  1.00 14.11 ? 166 SER A OG  1 
ATOM   1283 N N   . HIS A 1 167 ? 20.183  5.017   10.375 1.00 7.93  ? 167 HIS A N   1 
ATOM   1284 C CA  . HIS A 1 167 ? 19.532  6.306   10.558 1.00 6.47  ? 167 HIS A CA  1 
ATOM   1285 C C   . HIS A 1 167 ? 20.058  6.982   11.826 1.00 5.05  ? 167 HIS A C   1 
ATOM   1286 O O   . HIS A 1 167 ? 20.481  8.128   11.791 1.00 7.53  ? 167 HIS A O   1 
ATOM   1287 C CB  . HIS A 1 167 ? 17.999  6.123   10.636 1.00 9.30  ? 167 HIS A CB  1 
ATOM   1288 C CG  . HIS A 1 167 ? 17.319  7.462   10.760 1.00 11.74 ? 167 HIS A CG  1 
ATOM   1289 N ND1 . HIS A 1 167 ? 16.945  8.258   9.711  1.00 15.97 ? 167 HIS A ND1 1 
ATOM   1290 C CD2 . HIS A 1 167 ? 16.932  8.127   11.871 1.00 12.08 ? 167 HIS A CD2 1 
ATOM   1291 C CE1 . HIS A 1 167 ? 16.370  9.350   10.155 1.00 11.89 ? 167 HIS A CE1 1 
ATOM   1292 N NE2 . HIS A 1 167 ? 16.355  9.298   11.475 1.00 16.64 ? 167 HIS A NE2 1 
ATOM   1293 N N   . ALA A 1 168 ? 20.028  6.207   12.908 1.00 7.59  ? 168 ALA A N   1 
ATOM   1294 C CA  . ALA A 1 168 ? 20.547  6.720   14.187 1.00 9.62  ? 168 ALA A CA  1 
ATOM   1295 C C   . ALA A 1 168 ? 22.023  7.061   14.111 1.00 6.89  ? 168 ALA A C   1 
ATOM   1296 O O   . ALA A 1 168 ? 22.496  8.045   14.679 1.00 7.98  ? 168 ALA A O   1 
ATOM   1297 C CB  . ALA A 1 168 ? 20.315  5.702   15.302 1.00 5.96  ? 168 ALA A CB  1 
ATOM   1298 N N   . GLN A 1 169 ? 22.753  6.211   13.377 1.00 6.48  ? 169 GLN A N   1 
ATOM   1299 C CA  . GLN A 1 169 ? 24.197  6.459   13.280 1.00 7.74  ? 169 GLN A CA  1 
ATOM   1300 C C   . GLN A 1 169 ? 24.490  7.744   12.553 1.00 8.68  ? 169 GLN A C   1 
ATOM   1301 O O   . GLN A 1 169 ? 25.384  8.512   12.934 1.00 9.97  ? 169 GLN A O   1 
ATOM   1302 C CB  . GLN A 1 169 ? 24.819  5.238   12.583 1.00 8.73  ? 169 GLN A CB  1 
ATOM   1303 C CG  . GLN A 1 169 ? 24.887  4.103   13.618 1.00 8.36  ? 169 GLN A CG  1 
ATOM   1304 C CD  . GLN A 1 169 ? 25.305  2.781   13.016 1.00 13.02 ? 169 GLN A CD  1 
ATOM   1305 O OE1 . GLN A 1 169 ? 25.756  2.698   11.870 1.00 13.99 ? 169 GLN A OE1 1 
ATOM   1306 N NE2 . GLN A 1 169 ? 25.158  1.726   13.821 1.00 10.66 ? 169 GLN A NE2 1 
ATOM   1307 N N   . LYS A 1 170 ? 23.693  7.986   11.501 1.00 8.64  ? 170 LYS A N   1 
ATOM   1308 C CA  . LYS A 1 170 ? 23.882  9.244   10.801 1.00 11.11 ? 170 LYS A CA  1 
ATOM   1309 C C   . LYS A 1 170 ? 23.492  10.440  11.653 1.00 10.71 ? 170 LYS A C   1 
ATOM   1310 O O   . LYS A 1 170 ? 24.158  11.473  11.751 1.00 10.19 ? 170 LYS A O   1 
ATOM   1311 C CB  . LYS A 1 170 ? 23.042  9.190   9.498  1.00 10.56 ? 170 LYS A CB  1 
ATOM   1312 C CG  . LYS A 1 170 ? 23.322  10.458  8.693  1.00 27.76 ? 170 LYS A CG  1 
ATOM   1313 C CD  . LYS A 1 170 ? 22.913  10.371  7.234  1.00 52.33 ? 170 LYS A CD  1 
ATOM   1314 C CE  . LYS A 1 170 ? 23.379  11.585  6.437  1.00 52.80 ? 170 LYS A CE  1 
ATOM   1315 N NZ  . LYS A 1 170 ? 22.399  12.710  6.513  1.00 46.92 ? 170 LYS A NZ  1 
ATOM   1316 N N   . LYS A 1 171 ? 22.349  10.289  12.331 1.00 10.15 ? 171 LYS A N   1 
ATOM   1317 C CA  . LYS A 1 171 ? 21.857  11.293  13.262 1.00 7.57  ? 171 LYS A CA  1 
ATOM   1318 C C   . LYS A 1 171 ? 22.924  11.694  14.263 1.00 10.08 ? 171 LYS A C   1 
ATOM   1319 O O   . LYS A 1 171 ? 23.068  12.834  14.712 1.00 10.93 ? 171 LYS A O   1 
ATOM   1320 C CB  . LYS A 1 171 ? 20.653  10.667  13.975 1.00 8.44  ? 171 LYS A CB  1 
ATOM   1321 C CG  . LYS A 1 171 ? 19.787  11.608  14.795 1.00 16.66 ? 171 LYS A CG  1 
ATOM   1322 C CD  . LYS A 1 171 ? 18.831  12.356  13.866 1.00 14.09 ? 171 LYS A CD  1 
ATOM   1323 C CE  . LYS A 1 171 ? 17.948  13.267  14.690 1.00 8.72  ? 171 LYS A CE  1 
ATOM   1324 N NZ  . LYS A 1 171 ? 17.126  14.134  13.793 1.00 6.12  ? 171 LYS A NZ  1 
ATOM   1325 N N   . GLY A 1 172 ? 23.744  10.739  14.695 1.00 9.75  ? 172 GLY A N   1 
ATOM   1326 C CA  . GLY A 1 172 ? 24.678  11.075  15.769 1.00 9.43  ? 172 GLY A CA  1 
ATOM   1327 C C   . GLY A 1 172 ? 26.095  11.142  15.291 1.00 13.14 ? 172 GLY A C   1 
ATOM   1328 O O   . GLY A 1 172 ? 27.031  11.137  16.076 1.00 13.21 ? 172 GLY A O   1 
ATOM   1329 N N   . ALA A 1 173 ? 26.263  11.194  13.964 1.00 13.80 ? 173 ALA A N   1 
ATOM   1330 C CA  . ALA A 1 173 ? 27.597  11.118  13.398 1.00 18.90 ? 173 ALA A CA  1 
ATOM   1331 C C   . ALA A 1 173 ? 28.463  12.288  13.803 1.00 16.68 ? 173 ALA A C   1 
ATOM   1332 O O   . ALA A 1 173 ? 29.691  12.132  13.712 1.00 29.60 ? 173 ALA A O   1 
ATOM   1333 C CB  . ALA A 1 173 ? 27.475  11.067  11.878 1.00 20.15 ? 173 ALA A CB  1 
ATOM   1334 N N   . ILE A 1 174 ? 27.944  13.427  14.230 1.00 13.05 ? 174 ILE A N   1 
ATOM   1335 C CA  . ILE A 1 174 ? 28.822  14.541  14.586 1.00 18.17 ? 174 ILE A CA  1 
ATOM   1336 C C   . ILE A 1 174 ? 28.967  14.742  16.097 1.00 17.58 ? 174 ILE A C   1 
ATOM   1337 O O   . ILE A 1 174 ? 29.496  15.748  16.561 1.00 17.55 ? 174 ILE A O   1 
ATOM   1338 C CB  . ILE A 1 174 ? 28.350  15.878  13.980 1.00 18.52 ? 174 ILE A CB  1 
ATOM   1339 C CG1 . ILE A 1 174 ? 27.055  16.449  14.537 1.00 27.10 ? 174 ILE A CG1 1 
ATOM   1340 C CG2 . ILE A 1 174 ? 28.216  15.762  12.464 1.00 56.78 ? 174 ILE A CG2 1 
ATOM   1341 C CD1 . ILE A 1 174 ? 26.544  17.638  13.726 1.00 25.35 ? 174 ILE A CD1 1 
ATOM   1342 N N   . ILE A 1 175 ? 28.505  13.787  16.888 1.00 13.54 ? 175 ILE A N   1 
ATOM   1343 C CA  . ILE A 1 175 ? 28.734  13.845  18.335 1.00 10.16 ? 175 ILE A CA  1 
ATOM   1344 C C   . ILE A 1 175 ? 30.225  13.771  18.639 1.00 8.86  ? 175 ILE A C   1 
ATOM   1345 O O   . ILE A 1 175 ? 30.969  13.031  17.991 1.00 9.92  ? 175 ILE A O   1 
ATOM   1346 C CB  . ILE A 1 175 ? 27.981  12.681  19.010 1.00 7.71  ? 175 ILE A CB  1 
ATOM   1347 C CG1 . ILE A 1 175 ? 26.462  12.860  18.888 1.00 11.53 ? 175 ILE A CG1 1 
ATOM   1348 C CG2 . ILE A 1 175 ? 28.378  12.435  20.459 1.00 13.04 ? 175 ILE A CG2 1 
ATOM   1349 C CD1 . ILE A 1 175 ? 25.811  11.481  19.023 1.00 12.92 ? 175 ILE A CD1 1 
ATOM   1350 N N   . ASP A 1 176 ? 30.634  14.530  19.655 1.00 7.20  ? 176 ASP A N   1 
ATOM   1351 C CA  . ASP A 1 176 ? 32.022  14.546  20.096 1.00 6.33  ? 176 ASP A CA  1 
ATOM   1352 C C   . ASP A 1 176 ? 32.396  13.231  20.756 1.00 10.71 ? 176 ASP A C   1 
ATOM   1353 O O   . ASP A 1 176 ? 31.931  12.964  21.871 1.00 9.48  ? 176 ASP A O   1 
ATOM   1354 C CB  . ASP A 1 176 ? 32.160  15.705  21.085 1.00 6.13  ? 176 ASP A CB  1 
ATOM   1355 C CG  . ASP A 1 176 ? 33.586  15.936  21.583 1.00 9.29  ? 176 ASP A CG  1 
ATOM   1356 O OD1 . ASP A 1 176 ? 34.412  15.027  21.460 1.00 9.41  ? 176 ASP A OD1 1 
ATOM   1357 O OD2 . ASP A 1 176 ? 33.826  17.055  22.078 1.00 9.02  ? 176 ASP A OD2 1 
ATOM   1358 N N   . LYS A 1 177 ? 33.224  12.449  20.076 1.00 7.44  ? 177 LYS A N   1 
ATOM   1359 C CA  . LYS A 1 177 ? 33.543  11.132  20.579 1.00 8.91  ? 177 LYS A CA  1 
ATOM   1360 C C   . LYS A 1 177 ? 34.646  11.136  21.621 1.00 9.30  ? 177 LYS A C   1 
ATOM   1361 O O   . LYS A 1 177 ? 35.021  10.070  22.113 1.00 13.39 ? 177 LYS A O   1 
ATOM   1362 C CB  . LYS A 1 177 ? 33.918  10.218  19.397 1.00 12.28 ? 177 LYS A CB  1 
ATOM   1363 C CG  . LYS A 1 177 ? 32.638  9.913   18.604 1.00 14.15 ? 177 LYS A CG  1 
ATOM   1364 C CD  . LYS A 1 177 ? 32.818  8.652   17.763 1.00 32.92 ? 177 LYS A CD  1 
ATOM   1365 C CE  . LYS A 1 177 ? 33.075  9.013   16.313 1.00 42.80 ? 177 LYS A CE  1 
ATOM   1366 N NZ  . LYS A 1 177 ? 34.534  9.000   16.009 1.00 74.37 ? 177 LYS A NZ  1 
ATOM   1367 N N   . GLN A 1 178 ? 35.135  12.295  22.000 1.00 9.58  ? 178 GLN A N   1 
ATOM   1368 C CA  . GLN A 1 178 ? 36.105  12.334  23.099 1.00 15.98 ? 178 GLN A CA  1 
ATOM   1369 C C   . GLN A 1 178 ? 35.406  12.752  24.390 1.00 13.49 ? 178 GLN A C   1 
ATOM   1370 O O   . GLN A 1 178 ? 35.545  12.114  25.445 1.00 14.21 ? 178 GLN A O   1 
ATOM   1371 C CB  . GLN A 1 178 ? 37.232  13.302  22.718 1.00 15.24 ? 178 GLN A CB  1 
ATOM   1372 C CG  . GLN A 1 178 ? 37.830  12.973  21.340 1.00 36.48 ? 178 GLN A CG  1 
ATOM   1373 C CD  . GLN A 1 178 ? 37.621  14.089  20.333 1.00 48.32 ? 178 GLN A CD  1 
ATOM   1374 O OE1 . GLN A 1 178 ? 38.464  14.980  20.163 1.00 26.74 ? 178 GLN A OE1 1 
ATOM   1375 N NE2 . GLN A 1 178 ? 36.477  14.046  19.645 1.00 44.05 ? 178 GLN A NE2 1 
ATOM   1376 N N   . ARG A 1 179 ? 34.597  13.802  24.318 1.00 8.21  ? 179 ARG A N   1 
ATOM   1377 C CA  . ARG A 1 179 ? 33.850  14.232  25.488 1.00 7.15  ? 179 ARG A CA  1 
ATOM   1378 C C   . ARG A 1 179 ? 32.655  13.326  25.765 1.00 10.00 ? 179 ARG A C   1 
ATOM   1379 O O   . ARG A 1 179 ? 32.233  13.282  26.916 1.00 8.05  ? 179 ARG A O   1 
ATOM   1380 C CB  . ARG A 1 179 ? 33.354  15.684  25.374 1.00 8.82  ? 179 ARG A CB  1 
ATOM   1381 C CG  . ARG A 1 179 ? 34.505  16.690  25.478 1.00 6.32  ? 179 ARG A CG  1 
ATOM   1382 C CD  . ARG A 1 179 ? 34.112  18.055  24.924 1.00 8.25  ? 179 ARG A CD  1 
ATOM   1383 N NE  . ARG A 1 179 ? 32.856  18.486  25.561 1.00 9.93  ? 179 ARG A NE  1 
ATOM   1384 C CZ  . ARG A 1 179 ? 31.676  18.507  24.922 1.00 15.40 ? 179 ARG A CZ  1 
ATOM   1385 N NH1 . ARG A 1 179 ? 31.588  18.133  23.650 1.00 9.50  ? 179 ARG A NH1 1 
ATOM   1386 N NH2 . ARG A 1 179 ? 30.645  18.923  25.661 1.00 10.25 ? 179 ARG A NH2 1 
ATOM   1387 N N   . HIS A 1 180 ? 32.119  12.662  24.738 1.00 8.24  ? 180 HIS A N   1 
ATOM   1388 C CA  . HIS A 1 180 ? 31.033  11.707  24.970 1.00 6.38  ? 180 HIS A CA  1 
ATOM   1389 C C   . HIS A 1 180 ? 31.488  10.352  24.513 1.00 9.03  ? 180 HIS A C   1 
ATOM   1390 O O   . HIS A 1 180 ? 32.590  10.151  23.978 1.00 11.17 ? 180 HIS A O   1 
ATOM   1391 C CB  . HIS A 1 180 ? 29.785  12.120  24.170 1.00 7.51  ? 180 HIS A CB  1 
ATOM   1392 C CG  . HIS A 1 180 ? 29.251  13.404  24.731 1.00 8.22  ? 180 HIS A CG  1 
ATOM   1393 N ND1 . HIS A 1 180 ? 29.255  14.631  24.124 1.00 10.09 ? 180 HIS A ND1 1 
ATOM   1394 C CD2 . HIS A 1 180 ? 28.665  13.588  25.938 1.00 5.01  ? 180 HIS A CD2 1 
ATOM   1395 C CE1 . HIS A 1 180 ? 28.703  15.522  24.938 1.00 4.73  ? 180 HIS A CE1 1 
ATOM   1396 N NE2 . HIS A 1 180 ? 28.329  14.907  26.056 1.00 10.34 ? 180 HIS A NE2 1 
ATOM   1397 N N   . HIS A 1 181 ? 30.611  9.374   24.709 1.00 6.97  ? 181 HIS A N   1 
ATOM   1398 C CA  . HIS A 1 181 ? 30.976  8.010   24.372 1.00 8.24  ? 181 HIS A CA  1 
ATOM   1399 C C   . HIS A 1 181 ? 29.977  7.464   23.374 1.00 12.36 ? 181 HIS A C   1 
ATOM   1400 O O   . HIS A 1 181 ? 28.800  7.308   23.710 1.00 9.95  ? 181 HIS A O   1 
ATOM   1401 C CB  . HIS A 1 181 ? 30.995  7.195   25.674 1.00 9.07  ? 181 HIS A CB  1 
ATOM   1402 C CG  . HIS A 1 181 ? 31.716  5.914   25.488 1.00 11.03 ? 181 HIS A CG  1 
ATOM   1403 N ND1 . HIS A 1 181 ? 33.023  5.843   25.080 1.00 20.10 ? 181 HIS A ND1 1 
ATOM   1404 C CD2 . HIS A 1 181 ? 31.282  4.640   25.666 1.00 16.62 ? 181 HIS A CD2 1 
ATOM   1405 C CE1 . HIS A 1 181 ? 33.381  4.574   25.012 1.00 17.13 ? 181 HIS A CE1 1 
ATOM   1406 N NE2 . HIS A 1 181 ? 32.347  3.820   25.361 1.00 21.55 ? 181 HIS A NE2 1 
ATOM   1407 N N   . VAL A 1 182 ? 30.404  7.187   22.154 1.00 9.29  ? 182 VAL A N   1 
ATOM   1408 C CA  . VAL A 1 182 ? 29.459  6.792   21.110 1.00 9.87  ? 182 VAL A CA  1 
ATOM   1409 C C   . VAL A 1 182 ? 29.663  5.346   20.765 1.00 11.16 ? 182 VAL A C   1 
ATOM   1410 O O   . VAL A 1 182 ? 30.767  4.936   20.405 1.00 14.40 ? 182 VAL A O   1 
ATOM   1411 C CB  . VAL A 1 182 ? 29.625  7.706   19.873 1.00 9.70  ? 182 VAL A CB  1 
ATOM   1412 C CG1 . VAL A 1 182 ? 28.735  7.198   18.745 1.00 15.95 ? 182 VAL A CG1 1 
ATOM   1413 C CG2 . VAL A 1 182 ? 29.306  9.136   20.251 1.00 13.36 ? 182 VAL A CG2 1 
ATOM   1414 N N   . LEU A 1 183 ? 28.586  4.574   20.918 1.00 8.20  ? 183 LEU A N   1 
ATOM   1415 C CA  . LEU A 1 183 ? 28.611  3.171   20.563 1.00 7.50  ? 183 LEU A CA  1 
ATOM   1416 C C   . LEU A 1 183 ? 27.622  2.864   19.454 1.00 12.07 ? 183 LEU A C   1 
ATOM   1417 O O   . LEU A 1 183 ? 26.458  3.241   19.502 1.00 10.88 ? 183 LEU A O   1 
ATOM   1418 C CB  . LEU A 1 183 ? 28.282  2.361   21.813 1.00 9.72  ? 183 LEU A CB  1 
ATOM   1419 C CG  . LEU A 1 183 ? 29.378  2.480   22.880 1.00 11.51 ? 183 LEU A CG  1 
ATOM   1420 C CD1 . LEU A 1 183 ? 28.925  1.811   24.166 1.00 12.52 ? 183 LEU A CD1 1 
ATOM   1421 C CD2 . LEU A 1 183 ? 30.670  1.860   22.360 1.00 20.56 ? 183 LEU A CD2 1 
ATOM   1422 N N   . LYS A 1 184 ? 28.073  2.175   18.414 1.00 9.38  ? 184 LYS A N   1 
ATOM   1423 C CA  . LYS A 1 184 ? 27.209  1.895   17.267 1.00 7.77  ? 184 LYS A CA  1 
ATOM   1424 C C   . LYS A 1 184 ? 26.886  0.416   17.133 1.00 7.47  ? 184 LYS A C   1 
ATOM   1425 O O   . LYS A 1 184 ? 27.717  -0.461  17.439 1.00 7.77  ? 184 LYS A O   1 
ATOM   1426 C CB  . LYS A 1 184 ? 27.980  2.295   16.007 1.00 13.33 ? 184 LYS A CB  1 
ATOM   1427 C CG  . LYS A 1 184 ? 28.363  3.758   15.891 1.00 14.16 ? 184 LYS A CG  1 
ATOM   1428 C CD  . LYS A 1 184 ? 29.192  3.927   14.607 1.00 15.55 ? 184 LYS A CD  1 
ATOM   1429 C CE  . LYS A 1 184 ? 30.596  3.395   14.907 1.00 29.66 ? 184 LYS A CE  1 
ATOM   1430 N NZ  . LYS A 1 184 ? 31.296  2.965   13.661 1.00 62.74 ? 184 LYS A NZ  1 
ATOM   1431 N N   . ALA A 1 185 ? 25.704  0.105   16.623 1.00 7.79  ? 185 ALA A N   1 
ATOM   1432 C CA  . ALA A 1 185 ? 25.388  -1.260  16.271 1.00 6.83  ? 185 ALA A CA  1 
ATOM   1433 C C   . ALA A 1 185 ? 24.196  -1.283  15.315 1.00 6.34  ? 185 ALA A C   1 
ATOM   1434 O O   . ALA A 1 185 ? 23.534  -0.254  15.274 1.00 8.81  ? 185 ALA A O   1 
ATOM   1435 C CB  . ALA A 1 185 ? 25.022  -2.088  17.489 1.00 9.58  ? 185 ALA A CB  1 
ATOM   1436 N N   . PRO A 1 186 ? 23.980  -2.382  14.624 1.00 8.75  ? 186 PRO A N   1 
ATOM   1437 C CA  . PRO A 1 186 ? 22.725  -2.549  13.865 1.00 9.97  ? 186 PRO A CA  1 
ATOM   1438 C C   . PRO A 1 186 ? 21.515  -2.439  14.778 1.00 11.54 ? 186 PRO A C   1 
ATOM   1439 O O   . PRO A 1 186 ? 21.657  -2.536  15.998 1.00 10.78 ? 186 PRO A O   1 
ATOM   1440 C CB  . PRO A 1 186 ? 22.861  -3.950  13.248 1.00 10.27 ? 186 PRO A CB  1 
ATOM   1441 C CG  . PRO A 1 186 ? 24.372  -4.024  13.069 1.00 12.61 ? 186 PRO A CG  1 
ATOM   1442 C CD  . PRO A 1 186 ? 24.877  -3.539  14.426 1.00 12.40 ? 186 PRO A CD  1 
ATOM   1443 N N   . HIS A 1 187 ? 20.345  -2.222  14.211 1.00 7.61  ? 187 HIS A N   1 
ATOM   1444 C CA  . HIS A 1 187 ? 19.119  -1.963  14.949 1.00 6.23  ? 187 HIS A CA  1 
ATOM   1445 C C   . HIS A 1 187 ? 18.555  -3.234  15.519 1.00 7.16  ? 187 HIS A C   1 
ATOM   1446 O O   . HIS A 1 187 ? 18.716  -4.333  14.944 1.00 7.97  ? 187 HIS A O   1 
ATOM   1447 C CB  . HIS A 1 187 ? 18.146  -1.282  13.975 1.00 8.02  ? 187 HIS A CB  1 
ATOM   1448 C CG  . HIS A 1 187 ? 16.890  -0.743  14.559 1.00 5.79  ? 187 HIS A CG  1 
ATOM   1449 N ND1 . HIS A 1 187 ? 15.824  -1.477  14.915 1.00 7.18  ? 187 HIS A ND1 1 
ATOM   1450 C CD2 . HIS A 1 187 ? 16.550  0.551   14.850 1.00 12.13 ? 187 HIS A CD2 1 
ATOM   1451 C CE1 . HIS A 1 187 ? 14.841  -0.712  15.403 1.00 10.10 ? 187 HIS A CE1 1 
ATOM   1452 N NE2 . HIS A 1 187 ? 15.277  0.526   15.374 1.00 10.05 ? 187 HIS A NE2 1 
ATOM   1453 N N   . PRO A 1 188 ? 17.877  -3.176  16.669 1.00 5.58  ? 188 PRO A N   1 
ATOM   1454 C CA  . PRO A 1 188 ? 17.303  -4.389  17.241 1.00 5.93  ? 188 PRO A CA  1 
ATOM   1455 C C   . PRO A 1 188 ? 16.051  -4.924  16.583 1.00 5.63  ? 188 PRO A C   1 
ATOM   1456 O O   . PRO A 1 188 ? 15.540  -5.966  16.982 1.00 9.12  ? 188 PRO A O   1 
ATOM   1457 C CB  . PRO A 1 188 ? 16.947  -3.944  18.679 1.00 5.58  ? 188 PRO A CB  1 
ATOM   1458 C CG  . PRO A 1 188 ? 16.690  -2.482  18.555 1.00 7.45  ? 188 PRO A CG  1 
ATOM   1459 C CD  . PRO A 1 188 ? 17.706  -1.986  17.525 1.00 6.44  ? 188 PRO A CD  1 
ATOM   1460 N N   . SER A 1 189 ? 15.535  -4.239  15.570 1.00 5.30  ? 189 SER A N   1 
ATOM   1461 C CA  . SER A 1 189 ? 14.422  -4.813  14.830 1.00 7.33  ? 189 SER A CA  1 
ATOM   1462 C C   . SER A 1 189 ? 14.756  -6.194  14.289 1.00 7.24  ? 189 SER A C   1 
ATOM   1463 O O   . SER A 1 189 ? 15.939  -6.435  13.987 1.00 9.66  ? 189 SER A O   1 
ATOM   1464 C CB  . SER A 1 189 ? 14.101  -3.892  13.637 1.00 19.05 ? 189 SER A CB  1 
ATOM   1465 O OG  . SER A 1 189 ? 13.658  -4.742  12.577 1.00 32.38 ? 189 SER A OG  1 
ATOM   1466 N N   . PRO A 1 190 ? 13.775  -7.068  14.180 1.00 11.24 ? 190 PRO A N   1 
ATOM   1467 C CA  . PRO A 1 190 ? 14.039  -8.406  13.610 1.00 9.91  ? 190 PRO A CA  1 
ATOM   1468 C C   . PRO A 1 190 ? 14.752  -8.317  12.259 1.00 7.03  ? 190 PRO A C   1 
ATOM   1469 O O   . PRO A 1 190 ? 15.475  -9.261  11.937 1.00 10.51 ? 190 PRO A O   1 
ATOM   1470 C CB  . PRO A 1 190 ? 12.641  -9.009  13.465 1.00 15.77 ? 190 PRO A CB  1 
ATOM   1471 C CG  . PRO A 1 190 ? 11.832  -8.326  14.534 1.00 14.94 ? 190 PRO A CG  1 
ATOM   1472 C CD  . PRO A 1 190 ? 12.356  -6.906  14.567 1.00 9.45  ? 190 PRO A CD  1 
ATOM   1473 N N   . LEU A 1 191 ? 14.590  -7.244  11.480 1.00 10.11 ? 191 LEU A N   1 
ATOM   1474 C CA  . LEU A 1 191 ? 15.237  -7.157  10.162 1.00 12.37 ? 191 LEU A CA  1 
ATOM   1475 C C   . LEU A 1 191 ? 16.748  -7.004  10.278 1.00 15.67 ? 191 LEU A C   1 
ATOM   1476 O O   . LEU A 1 191 ? 17.489  -7.296  9.317  1.00 14.22 ? 191 LEU A O   1 
ATOM   1477 C CB  . LEU A 1 191 ? 14.699  -5.979  9.337  1.00 18.81 ? 191 LEU A CB  1 
ATOM   1478 C CG  . LEU A 1 191 ? 13.268  -6.059  8.793  1.00 35.43 ? 191 LEU A CG  1 
ATOM   1479 C CD1 . LEU A 1 191 ? 13.072  -5.064  7.655  1.00 48.46 ? 191 LEU A CD1 1 
ATOM   1480 C CD2 . LEU A 1 191 ? 12.918  -7.457  8.305  1.00 24.44 ? 191 LEU A CD2 1 
ATOM   1481 N N   . SER A 1 192 ? 17.240  -6.540  11.424 1.00 8.64  ? 192 SER A N   1 
ATOM   1482 C CA  . SER A 1 192 ? 18.683  -6.312  11.531 1.00 8.74  ? 192 SER A CA  1 
ATOM   1483 C C   . SER A 1 192 ? 19.336  -6.862  12.786 1.00 8.84  ? 192 SER A C   1 
ATOM   1484 O O   . SER A 1 192 ? 20.568  -6.826  12.855 1.00 10.12 ? 192 SER A O   1 
ATOM   1485 C CB  . SER A 1 192 ? 18.989  -4.798  11.492 1.00 11.59 ? 192 SER A CB  1 
ATOM   1486 O OG  . SER A 1 192 ? 18.101  -4.132  12.406 1.00 11.88 ? 192 SER A OG  1 
ATOM   1487 N N   . ALA A 1 193 ? 18.575  -7.328  13.780 1.00 7.49  ? 193 ALA A N   1 
ATOM   1488 C CA  . ALA A 1 193 ? 19.207  -7.618  15.068 1.00 6.83  ? 193 ALA A CA  1 
ATOM   1489 C C   . ALA A 1 193 ? 20.298  -8.661  14.980 1.00 9.12  ? 193 ALA A C   1 
ATOM   1490 O O   . ALA A 1 193 ? 21.289  -8.617  15.709 1.00 8.88  ? 193 ALA A O   1 
ATOM   1491 C CB  . ALA A 1 193 ? 18.144  -8.074  16.056 1.00 8.87  ? 193 ALA A CB  1 
ATOM   1492 N N   . HIS A 1 194 ? 20.127  -9.627  14.083 1.00 7.10  ? 194 HIS A N   1 
ATOM   1493 C CA  . HIS A 1 194 ? 21.125  -10.717 14.028 1.00 7.89  ? 194 HIS A CA  1 
ATOM   1494 C C   . HIS A 1 194 ? 22.293  -10.313 13.139 1.00 7.40  ? 194 HIS A C   1 
ATOM   1495 O O   . HIS A 1 194 ? 23.209  -11.121 12.916 1.00 9.30  ? 194 HIS A O   1 
ATOM   1496 C CB  . HIS A 1 194 ? 20.479  -11.970 13.477 1.00 11.09 ? 194 HIS A CB  1 
ATOM   1497 C CG  . HIS A 1 194 ? 19.355  -12.486 14.298 1.00 11.28 ? 194 HIS A CG  1 
ATOM   1498 N ND1 . HIS A 1 194 ? 19.637  -13.395 15.293 1.00 16.40 ? 194 HIS A ND1 1 
ATOM   1499 C CD2 . HIS A 1 194 ? 18.027  -12.251 14.291 1.00 12.42 ? 194 HIS A CD2 1 
ATOM   1500 C CE1 . HIS A 1 194 ? 18.480  -13.701 15.877 1.00 23.89 ? 194 HIS A CE1 1 
ATOM   1501 N NE2 . HIS A 1 194 ? 17.498  -13.036 15.299 1.00 19.77 ? 194 HIS A NE2 1 
ATOM   1502 N N   . ARG A 1 195 ? 22.271  -9.075  12.647 1.00 9.17  ? 195 ARG A N   1 
ATOM   1503 C CA  . ARG A 1 195 ? 23.368  -8.594  11.797 1.00 9.94  ? 195 ARG A CA  1 
ATOM   1504 C C   . ARG A 1 195 ? 24.364  -7.811  12.637 1.00 15.61 ? 195 ARG A C   1 
ATOM   1505 O O   . ARG A 1 195 ? 25.168  -7.052  12.089 1.00 16.21 ? 195 ARG A O   1 
ATOM   1506 C CB  . ARG A 1 195 ? 22.818  -7.745  10.636 1.00 10.75 ? 195 ARG A CB  1 
ATOM   1507 C CG  . ARG A 1 195 ? 21.726  -8.508  9.883  1.00 17.91 ? 195 ARG A CG  1 
ATOM   1508 C CD  . ARG A 1 195 ? 21.050  -7.613  8.828  1.00 24.12 ? 195 ARG A CD  1 
ATOM   1509 N NE  . ARG A 1 195 ? 22.005  -7.375  7.759  1.00 32.71 ? 195 ARG A NE  1 
ATOM   1510 C CZ  . ARG A 1 195 ? 21.745  -7.485  6.449  1.00 18.26 ? 195 ARG A CZ  1 
ATOM   1511 N NH1 . ARG A 1 195 ? 20.527  -7.835  6.065  1.00 16.23 ? 195 ARG A NH1 1 
ATOM   1512 N NH2 . ARG A 1 195 ? 22.790  -7.221  5.670  1.00 21.27 ? 195 ARG A NH2 1 
ATOM   1513 N N   . GLY A 1 196 ? 24.326  -7.976  13.969 1.00 9.27  ? 196 GLY A N   1 
ATOM   1514 C CA  . GLY A 1 196 ? 25.298  -7.303  14.813 1.00 10.39 ? 196 GLY A CA  1 
ATOM   1515 C C   . GLY A 1 196 ? 24.727  -6.550  15.999 1.00 8.40  ? 196 GLY A C   1 
ATOM   1516 O O   . GLY A 1 196 ? 25.512  -6.037  16.821 1.00 10.76 ? 196 GLY A O   1 
ATOM   1517 N N   . PHE A 1 197 ? 23.400  -6.477  16.114 1.00 6.85  ? 197 PHE A N   1 
ATOM   1518 C CA  . PHE A 1 197 ? 22.838  -5.966  17.368 1.00 8.52  ? 197 PHE A CA  1 
ATOM   1519 C C   . PHE A 1 197 ? 23.122  -6.974  18.477 1.00 8.99  ? 197 PHE A C   1 
ATOM   1520 O O   . PHE A 1 197 ? 23.670  -6.595  19.532 1.00 8.69  ? 197 PHE A O   1 
ATOM   1521 C CB  . PHE A 1 197 ? 21.314  -5.709  17.325 1.00 8.46  ? 197 PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 197 ? 20.830  -5.193  18.679 1.00 6.75  ? 197 PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 197 ? 21.087  -3.893  19.046 1.00 6.97  ? 197 PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 197 ? 20.151  -6.041  19.546 1.00 8.30  ? 197 PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 197 ? 20.680  -3.424  20.293 1.00 9.11  ? 197 PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 197 ? 19.744  -5.590  20.800 1.00 7.11  ? 197 PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 197 ? 20.016  -4.288  21.165 1.00 6.81  ? 197 PHE A CZ  1 
ATOM   1528 N N   . PHE A 1 198 ? 22.770  -8.228  18.275 1.00 8.56  ? 198 PHE A N   1 
ATOM   1529 C CA  . PHE A 1 198 ? 23.170  -9.243  19.257 1.00 7.79  ? 198 PHE A CA  1 
ATOM   1530 C C   . PHE A 1 198 ? 24.689  -9.300  19.322 1.00 13.38 ? 198 PHE A C   1 
ATOM   1531 O O   . PHE A 1 198 ? 25.319  -9.408  18.270 1.00 12.15 ? 198 PHE A O   1 
ATOM   1532 C CB  . PHE A 1 198 ? 22.563  -10.576 18.877 1.00 6.70  ? 198 PHE A CB  1 
ATOM   1533 C CG  . PHE A 1 198 ? 21.050  -10.565 19.010 1.00 8.89  ? 198 PHE A CG  1 
ATOM   1534 C CD1 . PHE A 1 198 ? 20.447  -10.039 20.152 1.00 11.09 ? 198 PHE A CD1 1 
ATOM   1535 C CD2 . PHE A 1 198 ? 20.270  -11.096 17.999 1.00 10.54 ? 198 PHE A CD2 1 
ATOM   1536 C CE1 . PHE A 1 198 ? 19.057  -10.045 20.269 1.00 11.67 ? 198 PHE A CE1 1 
ATOM   1537 C CE2 . PHE A 1 198 ? 18.892  -11.102 18.140 1.00 12.65 ? 198 PHE A CE2 1 
ATOM   1538 C CZ  . PHE A 1 198 ? 18.286  -10.588 19.270 1.00 9.43  ? 198 PHE A CZ  1 
ATOM   1539 N N   . GLY A 1 199 ? 25.266  -9.213  20.528 1.00 9.35  ? 199 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 199 ? 26.721  -9.194  20.627 1.00 7.50  ? 199 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 199 ? 27.282  -7.818  20.795 1.00 11.08 ? 199 GLY A C   1 
ATOM   1542 O O   . GLY A 1 199 ? 28.464  -7.619  21.119 1.00 12.94 ? 199 GLY A O   1 
ATOM   1543 N N   . CYS A 1 200 ? 26.487  -6.768  20.583 1.00 8.19  ? 200 CYS A N   1 
ATOM   1544 C CA  . CYS A 1 200 ? 27.016  -5.406  20.676 1.00 8.53  ? 200 CYS A CA  1 
ATOM   1545 C C   . CYS A 1 200 ? 27.367  -5.086  22.131 1.00 10.15 ? 200 CYS A C   1 
ATOM   1546 O O   . CYS A 1 200 ? 28.227  -4.244  22.337 1.00 10.59 ? 200 CYS A O   1 
ATOM   1547 C CB  . CYS A 1 200 ? 26.050  -4.409  20.086 1.00 6.32  ? 200 CYS A CB  1 
ATOM   1548 S SG  . CYS A 1 200 ? 24.601  -3.906  21.063 1.00 9.03  ? 200 CYS A SG  1 
ATOM   1549 N N   . ASN A 1 201 ? 26.696  -5.753  23.066 1.00 10.88 ? 201 ASN A N   1 
ATOM   1550 C CA  . ASN A 1 201 ? 27.025  -5.559  24.484 1.00 11.26 ? 201 ASN A CA  1 
ATOM   1551 C C   . ASN A 1 201 ? 26.886  -4.132  24.953 1.00 8.25  ? 201 ASN A C   1 
ATOM   1552 O O   . ASN A 1 201 ? 27.563  -3.687  25.900 1.00 9.91  ? 201 ASN A O   1 
ATOM   1553 C CB  . ASN A 1 201 ? 28.481  -6.015  24.736 1.00 10.32 ? 201 ASN A CB  1 
ATOM   1554 C CG  . ASN A 1 201 ? 28.742  -6.241  26.221 1.00 14.59 ? 201 ASN A CG  1 
ATOM   1555 O OD1 . ASN A 1 201 ? 29.878  -6.131  26.686 1.00 12.47 ? 201 ASN A OD1 1 
ATOM   1556 N ND2 . ASN A 1 201 ? 27.676  -6.551  26.959 1.00 12.48 ? 201 ASN A ND2 1 
ATOM   1557 N N   . HIS A 1 202 ? 26.042  -3.304  24.367 1.00 6.72  ? 202 HIS A N   1 
ATOM   1558 C CA  . HIS A 1 202 ? 26.028  -1.884  24.662 1.00 6.15  ? 202 HIS A CA  1 
ATOM   1559 C C   . HIS A 1 202 ? 25.571  -1.518  26.064 1.00 5.52  ? 202 HIS A C   1 
ATOM   1560 O O   . HIS A 1 202 ? 25.930  -0.459  26.558 1.00 8.19  ? 202 HIS A O   1 
ATOM   1561 C CB  . HIS A 1 202 ? 25.090  -1.175  23.679 1.00 7.29  ? 202 HIS A CB  1 
ATOM   1562 C CG  . HIS A 1 202 ? 25.722  -0.904  22.355 1.00 8.59  ? 202 HIS A CG  1 
ATOM   1563 N ND1 . HIS A 1 202 ? 26.945  -1.289  21.869 1.00 13.37 ? 202 HIS A ND1 1 
ATOM   1564 C CD2 . HIS A 1 202 ? 25.116  -0.165  21.388 1.00 4.61  ? 202 HIS A CD2 1 
ATOM   1565 C CE1 . HIS A 1 202 ? 27.099  -0.817  20.621 1.00 6.15  ? 202 HIS A CE1 1 
ATOM   1566 N NE2 . HIS A 1 202 ? 26.001  -0.133  20.332 1.00 12.41 ? 202 HIS A NE2 1 
ATOM   1567 N N   . PHE A 1 203 ? 24.744  -2.399  26.648 1.00 7.90  ? 203 PHE A N   1 
ATOM   1568 C CA  . PHE A 1 203 ? 24.199  -2.013  27.954 1.00 7.80  ? 203 PHE A CA  1 
ATOM   1569 C C   . PHE A 1 203 ? 25.287  -2.099  29.041 1.00 6.21  ? 203 PHE A C   1 
ATOM   1570 O O   . PHE A 1 203 ? 25.379  -1.168  29.838 1.00 7.77  ? 203 PHE A O   1 
ATOM   1571 C CB  . PHE A 1 203 ? 22.986  -2.898  28.253 1.00 7.33  ? 203 PHE A CB  1 
ATOM   1572 C CG  . PHE A 1 203 ? 21.913  -2.803  27.152 1.00 6.32  ? 203 PHE A CG  1 
ATOM   1573 C CD1 . PHE A 1 203 ? 21.038  -1.751  27.093 1.00 5.63  ? 203 PHE A CD1 1 
ATOM   1574 C CD2 . PHE A 1 203 ? 21.864  -3.844  26.215 1.00 5.84  ? 203 PHE A CD2 1 
ATOM   1575 C CE1 . PHE A 1 203 ? 20.079  -1.707  26.077 1.00 9.47  ? 203 PHE A CE1 1 
ATOM   1576 C CE2 . PHE A 1 203 ? 20.893  -3.793  25.217 1.00 8.87  ? 203 PHE A CE2 1 
ATOM   1577 C CZ  . PHE A 1 203 ? 20.013  -2.725  25.144 1.00 7.31  ? 203 PHE A CZ  1 
ATOM   1578 N N   . VAL A 1 204 ? 26.051  -3.171  29.007 1.00 6.78  ? 204 VAL A N   1 
ATOM   1579 C CA  . VAL A 1 204 ? 27.219  -3.269  29.911 1.00 8.50  ? 204 VAL A CA  1 
ATOM   1580 C C   . VAL A 1 204 ? 28.251  -2.203  29.602 1.00 9.88  ? 204 VAL A C   1 
ATOM   1581 O O   . VAL A 1 204 ? 28.766  -1.513  30.475 1.00 11.57 ? 204 VAL A O   1 
ATOM   1582 C CB  . VAL A 1 204 ? 27.859  -4.668  29.775 1.00 9.15  ? 204 VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 204 ? 29.231  -4.698  30.451 1.00 9.22  ? 204 VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 204 ? 26.939  -5.739  30.331 1.00 7.92  ? 204 VAL A CG2 1 
ATOM   1585 N N   . LEU A 1 205 ? 28.594  -2.030  28.301 1.00 8.07  ? 205 LEU A N   1 
ATOM   1586 C CA  . LEU A 1 205 ? 29.628  -1.053  27.987 1.00 10.94 ? 205 LEU A CA  1 
ATOM   1587 C C   . LEU A 1 205 ? 29.250  0.328   28.436 1.00 7.48  ? 205 LEU A C   1 
ATOM   1588 O O   . LEU A 1 205 ? 30.047  1.126   28.920 1.00 11.84 ? 205 LEU A O   1 
ATOM   1589 C CB  . LEU A 1 205 ? 29.904  -1.054  26.468 1.00 7.53  ? 205 LEU A CB  1 
ATOM   1590 C CG  . LEU A 1 205 ? 30.504  -2.347  25.939 1.00 10.59 ? 205 LEU A CG  1 
ATOM   1591 C CD1 . LEU A 1 205 ? 30.572  -2.270  24.425 1.00 10.31 ? 205 LEU A CD1 1 
ATOM   1592 C CD2 . LEU A 1 205 ? 31.887  -2.571  26.552 1.00 11.93 ? 205 LEU A CD2 1 
ATOM   1593 N N   . ALA A 1 206 ? 27.968  0.680   28.315 1.00 7.85  ? 206 ALA A N   1 
ATOM   1594 C CA  . ALA A 1 206 ? 27.502  1.979   28.738 1.00 7.98  ? 206 ALA A CA  1 
ATOM   1595 C C   . ALA A 1 206 ? 27.697  2.115   30.256 1.00 7.15  ? 206 ALA A C   1 
ATOM   1596 O O   . ALA A 1 206 ? 28.160  3.131   30.741 1.00 9.90  ? 206 ALA A O   1 
ATOM   1597 C CB  . ALA A 1 206 ? 26.023  2.157   28.355 1.00 10.60 ? 206 ALA A CB  1 
ATOM   1598 N N   . ASN A 1 207 ? 27.273  1.060   30.947 1.00 7.55  ? 207 ASN A N   1 
ATOM   1599 C CA  . ASN A 1 207 ? 27.411  1.141   32.405 1.00 9.57  ? 207 ASN A CA  1 
ATOM   1600 C C   . ASN A 1 207 ? 28.893  1.220   32.801 1.00 9.31  ? 207 ASN A C   1 
ATOM   1601 O O   . ASN A 1 207 ? 29.201  1.994   33.724 1.00 11.19 ? 207 ASN A O   1 
ATOM   1602 C CB  . ASN A 1 207 ? 26.719  -0.052  33.042 1.00 7.53  ? 207 ASN A CB  1 
ATOM   1603 C CG  . ASN A 1 207 ? 25.213  0.147   33.186 1.00 6.26  ? 207 ASN A CG  1 
ATOM   1604 O OD1 . ASN A 1 207 ? 24.704  1.239   32.960 1.00 8.77  ? 207 ASN A OD1 1 
ATOM   1605 N ND2 . ASN A 1 207 ? 24.545  -0.937  33.572 1.00 6.44  ? 207 ASN A ND2 1 
ATOM   1606 N N   . GLN A 1 208 ? 29.751  0.474   32.130 1.00 9.22  ? 208 GLN A N   1 
ATOM   1607 C CA  . GLN A 1 208 ? 31.184  0.600   32.504 1.00 12.88 ? 208 GLN A CA  1 
ATOM   1608 C C   . GLN A 1 208 ? 31.725  1.989   32.264 1.00 16.81 ? 208 GLN A C   1 
ATOM   1609 O O   . GLN A 1 208 ? 32.481  2.517   33.087 1.00 11.69 ? 208 GLN A O   1 
ATOM   1610 C CB  . GLN A 1 208 ? 32.022  -0.451  31.773 1.00 10.66 ? 208 GLN A CB  1 
ATOM   1611 C CG  . GLN A 1 208 ? 31.629  -1.818  32.308 1.00 11.85 ? 208 GLN A CG  1 
ATOM   1612 C CD  . GLN A 1 208 ? 32.269  -2.984  31.594 1.00 17.27 ? 208 GLN A CD  1 
ATOM   1613 O OE1 . GLN A 1 208 ? 32.882  -2.789  30.548 1.00 24.71 ? 208 GLN A OE1 1 
ATOM   1614 N NE2 . GLN A 1 208 ? 32.120  -4.174  32.165 1.00 20.40 ? 208 GLN A NE2 1 
ATOM   1615 N N   . TRP A 1 209 ? 31.354  2.610   31.143 1.00 11.91 ? 209 TRP A N   1 
ATOM   1616 C CA  . TRP A 1 209 ? 31.794  4.004   30.931 1.00 12.20 ? 209 TRP A CA  1 
ATOM   1617 C C   . TRP A 1 209 ? 31.274  4.869   32.061 1.00 17.68 ? 209 TRP A C   1 
ATOM   1618 O O   . TRP A 1 209 ? 31.972  5.703   32.626 1.00 16.48 ? 209 TRP A O   1 
ATOM   1619 C CB  . TRP A 1 209 ? 31.301  4.552   29.587 1.00 15.12 ? 209 TRP A CB  1 
ATOM   1620 C CG  . TRP A 1 209 ? 31.297  6.047   29.424 1.00 19.08 ? 209 TRP A CG  1 
ATOM   1621 C CD1 . TRP A 1 209 ? 30.362  6.989   29.734 1.00 21.00 ? 209 TRP A CD1 1 
ATOM   1622 C CD2 . TRP A 1 209 ? 32.376  6.797   28.858 1.00 14.11 ? 209 TRP A CD2 1 
ATOM   1623 N NE1 . TRP A 1 209 ? 30.760  8.268   29.415 1.00 22.94 ? 209 TRP A NE1 1 
ATOM   1624 C CE2 . TRP A 1 209 ? 32.013  8.165   28.868 1.00 21.78 ? 209 TRP A CE2 1 
ATOM   1625 C CE3 . TRP A 1 209 ? 33.618  6.406   28.348 1.00 20.53 ? 209 TRP A CE3 1 
ATOM   1626 C CZ2 . TRP A 1 209 ? 32.841  9.176   28.386 1.00 23.05 ? 209 TRP A CZ2 1 
ATOM   1627 C CZ3 . TRP A 1 209 ? 34.431  7.405   27.874 1.00 25.63 ? 209 TRP A CZ3 1 
ATOM   1628 C CH2 . TRP A 1 209 ? 34.051  8.752   27.894 1.00 27.42 ? 209 TRP A CH2 1 
ATOM   1629 N N   . LEU A 1 210 ? 29.983  4.746   32.394 1.00 10.19 ? 210 LEU A N   1 
ATOM   1630 C CA  . LEU A 1 210 ? 29.435  5.595   33.422 1.00 9.56  ? 210 LEU A CA  1 
ATOM   1631 C C   . LEU A 1 210 ? 30.173  5.420   34.750 1.00 14.57 ? 210 LEU A C   1 
ATOM   1632 O O   . LEU A 1 210 ? 30.505  6.388   35.432 1.00 13.07 ? 210 LEU A O   1 
ATOM   1633 C CB  . LEU A 1 210 ? 27.948  5.259   33.620 1.00 12.53 ? 210 LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 210 ? 27.031  5.721   32.485 1.00 11.24 ? 210 LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 210 ? 25.627  5.197   32.811 1.00 14.99 ? 210 LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 210 ? 27.006  7.223   32.276 1.00 13.14 ? 210 LEU A CD2 1 
ATOM   1637 N N   . GLU A 1 211 ? 30.426  4.170   35.107 1.00 14.10 ? 211 GLU A N   1 
ATOM   1638 C CA  . GLU A 1 211 ? 31.182  3.847   36.310 1.00 13.89 ? 211 GLU A CA  1 
ATOM   1639 C C   . GLU A 1 211 ? 32.567  4.455   36.368 1.00 14.00 ? 211 GLU A C   1 
ATOM   1640 O O   . GLU A 1 211 ? 32.870  5.083   37.403 1.00 23.57 ? 211 GLU A O   1 
ATOM   1641 C CB  . GLU A 1 211 ? 31.325  2.305   36.412 1.00 17.23 ? 211 GLU A CB  1 
ATOM   1642 C CG  . GLU A 1 211 ? 29.974  1.705   36.753 1.00 16.05 ? 211 GLU A CG  1 
ATOM   1643 C CD  . GLU A 1 211 ? 29.969  0.194   36.689 1.00 21.68 ? 211 GLU A CD  1 
ATOM   1644 O OE1 . GLU A 1 211 ? 30.740  -0.465  35.968 1.00 21.35 ? 211 GLU A OE1 1 
ATOM   1645 O OE2 . GLU A 1 211 ? 29.109  -0.351  37.404 1.00 20.81 ? 211 GLU A OE2 1 
ATOM   1646 N N   . GLN A 1 212 ? 33.352  4.252   35.333 1.00 16.45 ? 212 GLN A N   1 
ATOM   1647 C CA  . GLN A 1 212 ? 34.692  4.795   35.135 1.00 18.95 ? 212 GLN A CA  1 
ATOM   1648 C C   . GLN A 1 212 ? 34.717  6.283   35.511 1.00 24.17 ? 212 GLN A C   1 
ATOM   1649 O O   . GLN A 1 212 ? 35.724  6.728   36.073 1.00 18.77 ? 212 GLN A O   1 
ATOM   1650 C CB  . GLN A 1 212 ? 35.159  4.657   33.696 1.00 21.65 ? 212 GLN A CB  1 
ATOM   1651 C CG  . GLN A 1 212 ? 36.120  3.537   33.375 1.00 39.35 ? 212 GLN A CG  1 
ATOM   1652 C CD  . GLN A 1 212 ? 35.503  2.158   33.492 1.00 44.96 ? 212 GLN A CD  1 
ATOM   1653 O OE1 . GLN A 1 212 ? 35.830  1.275   32.696 1.00 57.04 ? 212 GLN A OE1 1 
ATOM   1654 N NE2 . GLN A 1 212 ? 34.618  1.960   34.464 1.00 43.74 ? 212 GLN A NE2 1 
ATOM   1655 N N   . HIS A 1 213 ? 33.635  6.992   35.192 1.00 18.39 ? 213 HIS A N   1 
ATOM   1656 C CA  . HIS A 1 213 ? 33.472  8.413   35.496 1.00 21.71 ? 213 HIS A CA  1 
ATOM   1657 C C   . HIS A 1 213 ? 32.681  8.739   36.746 1.00 20.02 ? 213 HIS A C   1 
ATOM   1658 O O   . HIS A 1 213 ? 32.230  9.879   36.927 1.00 20.77 ? 213 HIS A O   1 
ATOM   1659 C CB  . HIS A 1 213 ? 32.787  9.143   34.305 1.00 25.23 ? 213 HIS A CB  1 
ATOM   1660 C CG  . HIS A 1 213 ? 33.655  8.957   33.099 1.00 24.77 ? 213 HIS A CG  1 
ATOM   1661 N ND1 . HIS A 1 213 ? 33.487  7.919   32.212 1.00 29.50 ? 213 HIS A ND1 1 
ATOM   1662 C CD2 . HIS A 1 213 ? 34.721  9.666   32.665 1.00 33.43 ? 213 HIS A CD2 1 
ATOM   1663 C CE1 . HIS A 1 213 ? 34.403  8.005   31.270 1.00 31.93 ? 213 HIS A CE1 1 
ATOM   1664 N NE2 . HIS A 1 213 ? 35.164  9.059   31.519 1.00 36.96 ? 213 HIS A NE2 1 
ATOM   1665 N N   . GLY A 1 214 ? 32.479  7.833   37.686 1.00 19.17 ? 214 GLY A N   1 
ATOM   1666 C CA  . GLY A 1 214 ? 31.839  8.206   38.931 1.00 24.03 ? 214 GLY A CA  1 
ATOM   1667 C C   . GLY A 1 214 ? 30.340  8.304   38.842 1.00 30.03 ? 214 GLY A C   1 
ATOM   1668 O O   . GLY A 1 214 ? 29.655  8.718   39.788 1.00 37.11 ? 214 GLY A O   1 
ATOM   1669 N N   . GLU A 1 215 ? 29.750  7.927   37.696 1.00 17.51 ? 215 GLU A N   1 
ATOM   1670 C CA  . GLU A 1 215 ? 28.289  7.909   37.681 1.00 17.05 ? 215 GLU A CA  1 
ATOM   1671 C C   . GLU A 1 215 ? 27.764  6.498   37.968 1.00 11.71 ? 215 GLU A C   1 
ATOM   1672 O O   . GLU A 1 215 ? 28.418  5.514   37.666 1.00 23.04 ? 215 GLU A O   1 
ATOM   1673 C CB  . GLU A 1 215 ? 27.768  8.418   36.330 1.00 15.01 ? 215 GLU A CB  1 
ATOM   1674 C CG  . GLU A 1 215 ? 28.288  9.843   36.164 1.00 20.40 ? 215 GLU A CG  1 
ATOM   1675 C CD  . GLU A 1 215 ? 27.418  10.759  35.356 1.00 35.77 ? 215 GLU A CD  1 
ATOM   1676 O OE1 . GLU A 1 215 ? 26.220  10.852  35.668 1.00 37.33 ? 215 GLU A OE1 1 
ATOM   1677 O OE2 . GLU A 1 215 ? 27.980  11.379  34.422 1.00 42.20 ? 215 GLU A OE2 1 
ATOM   1678 N N   . THR A 1 216 ? 26.584  6.467   38.578 1.00 15.41 ? 216 THR A N   1 
ATOM   1679 C CA  . THR A 1 216 ? 25.979  5.156   38.822 1.00 17.54 ? 216 THR A CA  1 
ATOM   1680 C C   . THR A 1 216 ? 25.506  4.555   37.498 1.00 19.92 ? 216 THR A C   1 
ATOM   1681 O O   . THR A 1 216 ? 25.047  5.271   36.606 1.00 20.21 ? 216 THR A O   1 
ATOM   1682 C CB  . THR A 1 216 ? 24.767  5.269   39.748 1.00 21.11 ? 216 THR A CB  1 
ATOM   1683 O OG1 . THR A 1 216 ? 23.881  6.245   39.180 1.00 25.64 ? 216 THR A OG1 1 
ATOM   1684 C CG2 . THR A 1 216 ? 25.160  5.801   41.117 1.00 26.61 ? 216 THR A CG2 1 
ATOM   1685 N N   . PRO A 1 217 ? 25.617  3.248   37.408 1.00 13.57 ? 217 PRO A N   1 
ATOM   1686 C CA  . PRO A 1 217 ? 25.129  2.527   36.232 1.00 11.15 ? 217 PRO A CA  1 
ATOM   1687 C C   . PRO A 1 217 ? 23.613  2.538   36.196 1.00 12.01 ? 217 PRO A C   1 
ATOM   1688 O O   . PRO A 1 217 ? 22.922  2.814   37.174 1.00 13.02 ? 217 PRO A O   1 
ATOM   1689 C CB  . PRO A 1 217 ? 25.638  1.110   36.451 1.00 13.71 ? 217 PRO A CB  1 
ATOM   1690 C CG  . PRO A 1 217 ? 25.795  1.001   37.940 1.00 12.13 ? 217 PRO A CG  1 
ATOM   1691 C CD  . PRO A 1 217 ? 26.223  2.353   38.411 1.00 10.19 ? 217 PRO A CD  1 
ATOM   1692 N N   . ILE A 1 218 ? 23.116  2.222   35.001 1.00 9.91  ? 218 ILE A N   1 
ATOM   1693 C CA  . ILE A 1 218 ? 21.679  2.068   34.769 1.00 8.69  ? 218 ILE A CA  1 
ATOM   1694 C C   . ILE A 1 218 ? 21.249  0.669   35.196 1.00 6.25  ? 218 ILE A C   1 
ATOM   1695 O O   . ILE A 1 218 ? 21.893  -0.316  34.857 1.00 7.69  ? 218 ILE A O   1 
ATOM   1696 C CB  . ILE A 1 218 ? 21.351  2.224   33.272 1.00 6.27  ? 218 ILE A CB  1 
ATOM   1697 C CG1 . ILE A 1 218 ? 21.900  3.536   32.706 1.00 8.20  ? 218 ILE A CG1 1 
ATOM   1698 C CG2 . ILE A 1 218 ? 19.858  2.082   32.993 1.00 6.82  ? 218 ILE A CG2 1 
ATOM   1699 C CD1 . ILE A 1 218 ? 21.440  4.757   33.486 1.00 9.80  ? 218 ILE A CD1 1 
ATOM   1700 N N   . ASP A 1 219 ? 20.144  0.589   35.941 1.00 7.80  ? 219 ASP A N   1 
ATOM   1701 C CA  . ASP A 1 219 ? 19.463  -0.674  36.187 1.00 5.59  ? 219 ASP A CA  1 
ATOM   1702 C C   . ASP A 1 219 ? 18.526  -0.910  35.007 1.00 6.20  ? 219 ASP A C   1 
ATOM   1703 O O   . ASP A 1 219 ? 17.468  -0.275  34.890 1.00 7.26  ? 219 ASP A O   1 
ATOM   1704 C CB  . ASP A 1 219 ? 18.695  -0.566  37.500 1.00 9.15  ? 219 ASP A CB  1 
ATOM   1705 C CG  . ASP A 1 219 ? 17.768  -1.737  37.741 1.00 18.08 ? 219 ASP A CG  1 
ATOM   1706 O OD1 . ASP A 1 219 ? 17.732  -2.705  36.943 1.00 12.15 ? 219 ASP A OD1 1 
ATOM   1707 O OD2 . ASP A 1 219 ? 17.015  -1.673  38.755 1.00 14.98 ? 219 ASP A OD2 1 
ATOM   1708 N N   . TRP A 1 220 ? 18.922  -1.812  34.114 1.00 7.86  ? 220 TRP A N   1 
ATOM   1709 C CA  . TRP A 1 220 ? 18.181  -1.966  32.863 1.00 8.02  ? 220 TRP A CA  1 
ATOM   1710 C C   . TRP A 1 220 ? 16.911  -2.783  33.001 1.00 8.60  ? 220 TRP A C   1 
ATOM   1711 O O   . TRP A 1 220 ? 16.167  -2.965  32.043 1.00 9.08  ? 220 TRP A O   1 
ATOM   1712 C CB  . TRP A 1 220 ? 19.122  -2.640  31.845 1.00 6.80  ? 220 TRP A CB  1 
ATOM   1713 C CG  . TRP A 1 220 ? 20.251  -1.753  31.410 1.00 7.72  ? 220 TRP A CG  1 
ATOM   1714 C CD1 . TRP A 1 220 ? 21.577  -1.887  31.741 1.00 7.36  ? 220 TRP A CD1 1 
ATOM   1715 C CD2 . TRP A 1 220 ? 20.175  -0.599  30.546 1.00 6.15  ? 220 TRP A CD2 1 
ATOM   1716 N NE1 . TRP A 1 220 ? 22.327  -0.892  31.156 1.00 6.50  ? 220 TRP A NE1 1 
ATOM   1717 C CE2 . TRP A 1 220 ? 21.475  -0.085  30.415 1.00 6.10  ? 220 TRP A CE2 1 
ATOM   1718 C CE3 . TRP A 1 220 ? 19.114  0.044   29.885 1.00 6.35  ? 220 TRP A CE3 1 
ATOM   1719 C CZ2 . TRP A 1 220 ? 21.764  1.043   29.652 1.00 6.31  ? 220 TRP A CZ2 1 
ATOM   1720 C CZ3 . TRP A 1 220 ? 19.399  1.172   29.122 1.00 6.68  ? 220 TRP A CZ3 1 
ATOM   1721 C CH2 . TRP A 1 220 ? 20.721  1.661   29.010 1.00 9.19  ? 220 TRP A CH2 1 
ATOM   1722 N N   . MET A 1 221 ? 16.612  -3.349  34.180 1.00 7.23  ? 221 MET A N   1 
ATOM   1723 C CA  . MET A 1 221 ? 15.364  -4.080  34.369 1.00 6.96  ? 221 MET A CA  1 
ATOM   1724 C C   . MET A 1 221 ? 14.237  -3.090  34.623 1.00 6.65  ? 221 MET A C   1 
ATOM   1725 O O   . MET A 1 221 ? 14.172  -2.442  35.675 1.00 7.31  ? 221 MET A O   1 
ATOM   1726 C CB  . MET A 1 221 ? 15.511  -5.018  35.562 1.00 7.23  ? 221 MET A CB  1 
ATOM   1727 C CG  . MET A 1 221 ? 14.309  -5.940  35.738 1.00 8.12  ? 221 MET A CG  1 
ATOM   1728 S SD  . MET A 1 221 ? 14.423  -7.303  34.561 1.00 11.50 ? 221 MET A SD  1 
ATOM   1729 C CE  . MET A 1 221 ? 13.106  -8.351  35.212 1.00 13.52 ? 221 MET A CE  1 
ATOM   1730 N N   . PRO A 1 222 ? 13.314  -2.941  33.671 1.00 8.73  ? 222 PRO A N   1 
ATOM   1731 C CA  . PRO A 1 222 ? 12.300  -1.891  33.785 1.00 6.86  ? 222 PRO A CA  1 
ATOM   1732 C C   . PRO A 1 222 ? 11.159  -2.295  34.716 1.00 6.35  ? 222 PRO A C   1 
ATOM   1733 O O   . PRO A 1 222 ? 10.783  -3.466  34.833 1.00 8.88  ? 222 PRO A O   1 
ATOM   1734 C CB  . PRO A 1 222 ? 11.817  -1.769  32.320 1.00 5.97  ? 222 PRO A CB  1 
ATOM   1735 C CG  . PRO A 1 222 ? 11.893  -3.188  31.834 1.00 6.92  ? 222 PRO A CG  1 
ATOM   1736 C CD  . PRO A 1 222 ? 13.139  -3.779  32.448 1.00 6.91  ? 222 PRO A CD  1 
ATOM   1737 N N   . VAL A 1 223 ? 10.618  -1.298  35.429 1.00 6.23  ? 223 VAL A N   1 
ATOM   1738 C CA  . VAL A 1 223 ? 9.582   -1.699  36.389 1.00 7.43  ? 223 VAL A CA  1 
ATOM   1739 C C   . VAL A 1 223 ? 8.328   -0.867  36.222 1.00 7.71  ? 223 VAL A C   1 
ATOM   1740 O O   . VAL A 1 223 ? 8.382   0.319   35.913 1.00 9.03  ? 223 VAL A O   1 
ATOM   1741 C CB  . VAL A 1 223 ? 10.087  -1.623  37.840 1.00 16.90 ? 223 VAL A CB  1 
ATOM   1742 C CG1 . VAL A 1 223 ? 11.373  -2.422  38.025 1.00 16.65 ? 223 VAL A CG1 1 
ATOM   1743 C CG2 . VAL A 1 223 ? 10.327  -0.185  38.242 1.00 17.23 ? 223 VAL A CG2 1 
ATOM   1744 N N   . LEU A 1 224 ? 7.193   -1.521  36.443 1.00 9.68  ? 224 LEU A N   1 
ATOM   1745 C CA  . LEU A 1 224 ? 5.897   -0.848  36.334 1.00 13.22 ? 224 LEU A CA  1 
ATOM   1746 C C   . LEU A 1 224 ? 5.553   0.041   37.511 1.00 11.27 ? 224 LEU A C   1 
ATOM   1747 O O   . LEU A 1 224 ? 5.961   -0.319  38.621 1.00 10.52 ? 224 LEU A O   1 
ATOM   1748 C CB  . LEU A 1 224 ? 4.793   -1.910  36.258 1.00 10.81 ? 224 LEU A CB  1 
ATOM   1749 C CG  . LEU A 1 224 ? 4.772   -2.622  34.891 1.00 13.88 ? 224 LEU A CG  1 
ATOM   1750 C CD1 . LEU A 1 224 ? 3.803   -3.788  34.971 1.00 13.75 ? 224 LEU A CD1 1 
ATOM   1751 C CD2 . LEU A 1 224 ? 4.447   -1.648  33.778 1.00 11.01 ? 224 LEU A CD2 1 
ATOM   1752 N N   . PRO A 1 225 ? 4.814   1.107   37.352 1.00 14.86 ? 225 PRO A N   1 
ATOM   1753 C CA  . PRO A 1 225 ? 4.299   1.814   38.532 1.00 16.40 ? 225 PRO A CA  1 
ATOM   1754 C C   . PRO A 1 225 ? 3.503   0.850   39.401 1.00 13.63 ? 225 PRO A C   1 
ATOM   1755 O O   . PRO A 1 225 ? 2.848   -0.064  38.918 1.00 16.44 ? 225 PRO A O   1 
ATOM   1756 C CB  . PRO A 1 225 ? 3.397   2.902   37.932 1.00 21.18 ? 225 PRO A CB  1 
ATOM   1757 C CG  . PRO A 1 225 ? 4.086   3.183   36.634 1.00 21.44 ? 225 PRO A CG  1 
ATOM   1758 C CD  . PRO A 1 225 ? 4.376   1.772   36.112 1.00 15.46 ? 225 PRO A CD  1 
ATOM   1759 N N   . ALA A 1 226 ? 3.598   1.075   40.717 1.00 10.48 ? 226 ALA A N   1 
ATOM   1760 C CA  . ALA A 1 226 ? 2.960   0.211   41.691 1.00 9.28  ? 226 ALA A CA  1 
ATOM   1761 C C   . ALA A 1 226 ? 1.522   0.624   42.010 1.00 14.01 ? 226 ALA A C   1 
ATOM   1762 O O   . ALA A 1 226 ? 1.120   1.734   41.682 1.00 14.54 ? 226 ALA A O   1 
ATOM   1763 C CB  . ALA A 1 226 ? 3.755   0.288   43.000 1.00 11.74 ? 226 ALA A CB  1 
ATOM   1764 N N   . GLU A 1 227 ? 0.810   -0.264  42.675 1.00 13.34 ? 227 GLU A N   1 
ATOM   1765 C CA  . GLU A 1 227 ? -0.523  -0.001  43.218 1.00 15.88 ? 227 GLU A CA  1 
ATOM   1766 C C   . GLU A 1 227 ? -0.450  0.724   44.557 1.00 18.16 ? 227 GLU A C   1 
ATOM   1767 O O   . GLU A 1 227 ? 0.539   0.584   45.285 1.00 10.44 ? 227 GLU A O   1 
ATOM   1768 C CB  . GLU A 1 227 ? -1.257  -1.329  43.414 1.00 12.49 ? 227 GLU A CB  1 
ATOM   1769 C CG  . GLU A 1 227 ? -1.700  -2.063  42.151 1.00 21.45 ? 227 GLU A CG  1 
ATOM   1770 C CD  . GLU A 1 227 ? -2.245  -3.454  42.442 1.00 27.73 ? 227 GLU A CD  1 
ATOM   1771 O OE1 . GLU A 1 227 ? -3.388  -3.566  42.932 1.00 49.22 ? 227 GLU A OE1 1 
ATOM   1772 O OE2 . GLU A 1 227 ? -1.531  -4.452  42.191 1.00 47.05 ? 227 GLU A OE2 1 
ATOM   1773 N N   . SER A 1 228 ? -1.487  1.482   44.938 1.00 18.96 ? 228 SER A N   1 
ATOM   1774 C CA  . SER A 1 228 ? -1.629  1.928   46.332 1.00 14.87 ? 228 SER A CA  1 
ATOM   1775 C C   . SER A 1 228 ? -2.940  1.377   46.873 1.00 22.10 ? 228 SER A C   1 
ATOM   1776 O O   . SER A 1 228 ? -3.720  0.761   46.148 1.00 22.44 ? 228 SER A O   1 
ATOM   1777 C CB  . SER A 1 228 ? -1.638  3.439   46.515 1.00 24.32 ? 228 SER A CB  1 
ATOM   1778 O OG  . SER A 1 228 ? -0.590  4.040   45.782 1.00 29.33 ? 228 SER A OG  1 
ATOM   1779 N N   . GLU A 1 229 ? -3.191  1.636   48.153 1.00 19.16 ? 229 GLU A N   1 
ATOM   1780 C CA  . GLU A 1 229 ? -4.476  1.230   48.704 1.00 17.59 ? 229 GLU A CA  1 
ATOM   1781 C C   . GLU A 1 229 ? -5.604  2.017   48.036 1.00 31.71 ? 229 GLU A C   1 
ATOM   1782 O O   . GLU A 1 229 ? -5.444  3.232   47.863 1.00 27.22 ? 229 GLU A O   1 
ATOM   1783 C CB  . GLU A 1 229 ? -4.467  1.451   50.221 1.00 21.07 ? 229 GLU A CB  1 
ATOM   1784 C CG  . GLU A 1 229 ? -3.537  0.454   50.938 1.00 19.15 ? 229 GLU A CG  1 
ATOM   1785 C CD  . GLU A 1 229 ? -4.087  -0.933  50.649 1.00 16.85 ? 229 GLU A CD  1 
ATOM   1786 O OE1 . GLU A 1 229 ? -5.303  -1.143  50.930 1.00 29.55 ? 229 GLU A OE1 1 
ATOM   1787 O OE2 . GLU A 1 229 ? -3.432  -1.834  50.113 1.00 14.53 ? 229 GLU A OE2 1 
ATOM   1788 O OXT . GLU A 1 229 ? -6.974  1.491   47.516 1.00 41.90 ? 229 GLU A OXT 1 
HETATM 1789 C C1  . GOL B 2 .   ? 10.875  1.436   16.931 1.00 17.54 ? 230 GOL A C1  1 
HETATM 1790 O O1  . GOL B 2 .   ? 12.041  1.313   16.105 1.00 31.57 ? 230 GOL A O1  1 
HETATM 1791 C C2  . GOL B 2 .   ? 11.150  2.698   17.771 1.00 9.33  ? 230 GOL A C2  1 
HETATM 1792 O O2  . GOL B 2 .   ? 11.408  3.792   16.869 1.00 11.28 ? 230 GOL A O2  1 
HETATM 1793 C C3  . GOL B 2 .   ? 9.774   2.951   18.419 1.00 9.23  ? 230 GOL A C3  1 
HETATM 1794 O O3  . GOL B 2 .   ? 10.068  3.981   19.375 1.00 7.94  ? 230 GOL A O3  1 
HETATM 1795 C C1  . GOL C 2 .   ? 8.659   19.628  26.577 1.00 33.16 ? 231 GOL A C1  1 
HETATM 1796 O O1  . GOL C 2 .   ? 8.851   18.453  27.371 1.00 19.65 ? 231 GOL A O1  1 
HETATM 1797 C C2  . GOL C 2 .   ? 9.792   19.701  25.539 1.00 31.91 ? 231 GOL A C2  1 
HETATM 1798 O O2  . GOL C 2 .   ? 9.214   20.310  24.373 1.00 35.33 ? 231 GOL A O2  1 
HETATM 1799 C C3  . GOL C 2 .   ? 11.269  20.129  25.570 1.00 27.94 ? 231 GOL A C3  1 
HETATM 1800 O O3  . GOL C 2 .   ? 11.304  21.472  26.089 1.00 16.25 ? 231 GOL A O3  1 
HETATM 1801 O O   . HOH D 3 .   ? 8.421   9.372   21.079 1.00 5.97  ? 301 HOH A O   1 
HETATM 1802 O O   . HOH D 3 .   ? 13.588  9.690   28.243 1.00 6.36  ? 302 HOH A O   1 
HETATM 1803 O O   . HOH D 3 .   ? 6.457   7.447   21.406 1.00 6.44  ? 303 HOH A O   1 
HETATM 1804 O O   . HOH D 3 .   ? 6.573   11.296  20.889 1.00 6.53  ? 304 HOH A O   1 
HETATM 1805 O O   . HOH D 3 .   ? 6.580   4.664   23.130 1.00 6.78  ? 305 HOH A O   1 
HETATM 1806 O O   . HOH D 3 .   ? 9.249   12.143  23.685 1.00 6.78  ? 306 HOH A O   1 
HETATM 1807 O O   . HOH D 3 .   ? 5.878   9.361   11.530 1.00 6.79  ? 307 HOH A O   1 
HETATM 1808 O O   . HOH D 3 .   ? 10.887  10.212  22.197 1.00 7.07  ? 308 HOH A O   1 
HETATM 1809 O O   . HOH D 3 .   ? 7.409   4.767   20.366 1.00 7.34  ? 309 HOH A O   1 
HETATM 1810 O O   . HOH D 3 .   ? 9.159   1.516   33.532 1.00 7.38  ? 310 HOH A O   1 
HETATM 1811 O O   . HOH D 3 .   ? 3.726   -3.583  28.280 1.00 7.40  ? 311 HOH A O   1 
HETATM 1812 O O   . HOH D 3 .   ? 1.143   4.058   19.131 1.00 7.58  ? 312 HOH A O   1 
HETATM 1813 O O   . HOH D 3 .   ? 9.333   -3.510  16.772 1.00 7.94  ? 313 HOH A O   1 
HETATM 1814 O O   . HOH D 3 .   ? 19.959  4.370   18.450 1.00 7.94  ? 314 HOH A O   1 
HETATM 1815 O O   . HOH D 3 .   ? 2.948   -4.300  20.732 1.00 8.04  ? 315 HOH A O   1 
HETATM 1816 O O   . HOH D 3 .   ? 5.563   13.656  6.921  1.00 8.24  ? 316 HOH A O   1 
HETATM 1817 O O   . HOH D 3 .   ? 20.517  -1.740  11.393 1.00 8.85  ? 317 HOH A O   1 
HETATM 1818 O O   . HOH D 3 .   ? 10.297  8.149   10.936 1.00 9.23  ? 318 HOH A O   1 
HETATM 1819 O O   . HOH D 3 .   ? 16.180  11.213  34.562 1.00 9.84  ? 319 HOH A O   1 
HETATM 1820 O O   . HOH D 3 .   ? 25.300  -5.335  27.277 1.00 9.89  ? 320 HOH A O   1 
HETATM 1821 O O   . HOH D 3 .   ? 5.479   3.639   41.574 1.00 10.12 ? 321 HOH A O   1 
HETATM 1822 O O   . HOH D 3 .   ? 18.053  19.926  33.316 1.00 10.18 ? 322 HOH A O   1 
HETATM 1823 O O   . HOH D 3 .   ? -3.956  23.149  12.989 1.00 10.62 ? 323 HOH A O   1 
HETATM 1824 O O   . HOH D 3 .   ? 12.682  9.474   10.098 1.00 10.71 ? 324 HOH A O   1 
HETATM 1825 O O   . HOH D 3 .   ? 13.740  5.294   7.114  1.00 11.05 ? 325 HOH A O   1 
HETATM 1826 O O   . HOH D 3 .   ? 18.454  3.731   12.954 1.00 11.17 ? 326 HOH A O   1 
HETATM 1827 O O   . HOH D 3 .   ? -0.895  -5.694  22.677 1.00 11.28 ? 327 HOH A O   1 
HETATM 1828 O O   . HOH D 3 .   ? 36.304  17.781  22.141 1.00 11.30 ? 328 HOH A O   1 
HETATM 1829 O O   . HOH D 3 .   ? 10.691  -5.999  35.425 1.00 11.44 ? 329 HOH A O   1 
HETATM 1830 O O   . HOH D 3 .   ? 14.499  0.284   35.921 1.00 11.45 ? 330 HOH A O   1 
HETATM 1831 O O   . HOH D 3 .   ? 4.396   7.392   30.011 1.00 11.48 ? 331 HOH A O   1 
HETATM 1832 O O   . HOH D 3 .   ? 15.152  13.812  34.876 1.00 11.58 ? 332 HOH A O   1 
HETATM 1833 O O   . HOH D 3 .   ? 6.110   3.546   13.214 1.00 11.60 ? 333 HOH A O   1 
HETATM 1834 O O   . HOH D 3 .   ? 8.764   -7.806  34.828 1.00 11.64 ? 334 HOH A O   1 
HETATM 1835 O O   . HOH D 3 .   ? 12.597  12.092  36.169 1.00 11.73 ? 335 HOH A O   1 
HETATM 1836 O O   . HOH D 3 .   ? 19.968  26.971  22.834 1.00 11.88 ? 336 HOH A O   1 
HETATM 1837 O O   . HOH D 3 .   ? 12.419  22.039  30.699 1.00 11.94 ? 337 HOH A O   1 
HETATM 1838 O O   . HOH D 3 .   ? 8.816   14.224  35.513 1.00 11.96 ? 338 HOH A O   1 
HETATM 1839 O O   . HOH D 3 .   ? 9.217   15.112  10.849 1.00 11.98 ? 339 HOH A O   1 
HETATM 1840 O O   . HOH D 3 .   ? 7.095   13.348  2.185  1.00 12.05 ? 340 HOH A O   1 
HETATM 1841 O O   . HOH D 3 .   ? 33.561  14.572  28.796 1.00 12.22 ? 341 HOH A O   1 
HETATM 1842 O O   . HOH D 3 .   ? 16.633  26.792  21.174 1.00 12.48 ? 342 HOH A O   1 
HETATM 1843 O O   . HOH D 3 .   ? 22.560  17.033  15.654 1.00 12.61 ? 343 HOH A O   1 
HETATM 1844 O O   . HOH D 3 .   ? 7.590   -4.149  36.870 1.00 12.69 ? 344 HOH A O   1 
HETATM 1845 O O   . HOH D 3 .   ? 18.321  -9.852  11.916 1.00 12.78 ? 345 HOH A O   1 
HETATM 1846 O O   . HOH D 3 .   ? 14.257  10.740  37.898 1.00 12.80 ? 346 HOH A O   1 
HETATM 1847 O O   . HOH D 3 .   ? 11.627  7.160   7.164  1.00 12.94 ? 347 HOH A O   1 
HETATM 1848 O O   . HOH D 3 .   ? 18.218  21.516  13.835 1.00 12.94 ? 348 HOH A O   1 
HETATM 1849 O O   . HOH D 3 .   ? -0.030  5.716   21.225 1.00 13.35 ? 349 HOH A O   1 
HETATM 1850 O O   . HOH D 3 .   ? 6.337   26.532  21.142 1.00 13.60 ? 350 HOH A O   1 
HETATM 1851 O O   . HOH D 3 .   ? 11.363  -6.162  38.178 1.00 13.63 ? 351 HOH A O   1 
HETATM 1852 O O   . HOH D 3 .   ? 20.795  4.310   37.925 1.00 13.74 ? 352 HOH A O   1 
HETATM 1853 O O   . HOH D 3 .   ? 14.899  -11.162 28.201 1.00 13.87 ? 353 HOH A O   1 
HETATM 1854 O O   . HOH D 3 .   ? 7.302   30.727  14.302 1.00 13.94 ? 354 HOH A O   1 
HETATM 1855 O O   . HOH D 3 .   ? 14.752  -2.877  38.364 1.00 14.07 ? 355 HOH A O   1 
HETATM 1856 O O   . HOH D 3 .   ? -2.241  17.522  18.503 1.00 14.11 ? 356 HOH A O   1 
HETATM 1857 O O   . HOH D 3 .   ? 17.314  3.202   16.486 1.00 14.20 ? 357 HOH A O   1 
HETATM 1858 O O   . HOH D 3 .   ? 8.911   -5.043  39.029 1.00 14.20 ? 358 HOH A O   1 
HETATM 1859 O O   . HOH D 3 .   ? 0.983   27.307  16.080 1.00 14.26 ? 359 HOH A O   1 
HETATM 1860 O O   . HOH D 3 .   ? -1.783  -1.907  11.781 1.00 14.35 ? 360 HOH A O   1 
HETATM 1861 O O   . HOH D 3 .   ? 31.304  21.677  29.075 1.00 14.36 ? 361 HOH A O   1 
HETATM 1862 O O   . HOH D 3 .   ? 19.780  -7.182  36.383 1.00 14.52 ? 362 HOH A O   1 
HETATM 1863 O O   . HOH D 3 .   ? 4.512   -9.130  25.413 1.00 14.61 ? 363 HOH A O   1 
HETATM 1864 O O   . HOH D 3 .   ? -5.333  2.524   15.930 1.00 14.66 ? 364 HOH A O   1 
HETATM 1865 O O   . HOH D 3 .   ? 17.891  10.616  36.685 1.00 14.67 ? 365 HOH A O   1 
HETATM 1866 O O   . HOH D 3 .   ? 1.413   15.183  7.405  1.00 14.67 ? 366 HOH A O   1 
HETATM 1867 O O   . HOH D 3 .   ? 21.528  -3.167  34.805 1.00 14.67 ? 367 HOH A O   1 
HETATM 1868 O O   . HOH D 3 .   ? -5.234  11.373  17.718 1.00 14.67 ? 368 HOH A O   1 
HETATM 1869 O O   . HOH D 3 .   ? -1.066  -0.291  13.882 1.00 14.74 ? 369 HOH A O   1 
HETATM 1870 O O   . HOH D 3 .   ? 20.706  11.041  35.875 1.00 14.76 ? 370 HOH A O   1 
HETATM 1871 O O   . HOH D 3 .   ? 1.597   24.959  16.861 1.00 14.84 ? 371 HOH A O   1 
HETATM 1872 O O   . HOH D 3 .   ? 23.407  -11.635 22.573 1.00 14.88 ? 372 HOH A O   1 
HETATM 1873 O O   . HOH D 3 .   ? 26.591  -9.612  23.808 1.00 14.96 ? 373 HOH A O   1 
HETATM 1874 O O   . HOH D 3 .   ? 20.987  6.908   37.136 1.00 14.98 ? 374 HOH A O   1 
HETATM 1875 O O   . HOH D 3 .   ? 12.338  17.310  9.866  1.00 15.00 ? 375 HOH A O   1 
HETATM 1876 O O   . HOH D 3 .   ? -4.101  6.507   10.041 1.00 15.16 ? 376 HOH A O   1 
HETATM 1877 O O   . HOH D 3 .   ? 22.230  -12.208 32.465 1.00 15.23 ? 377 HOH A O   1 
HETATM 1878 O O   . HOH D 3 .   ? 34.905  2.755   40.339 1.00 15.52 ? 378 HOH A O   1 
HETATM 1879 O O   . HOH D 3 .   ? 2.797   1.187   8.449  1.00 15.53 ? 379 HOH A O   1 
HETATM 1880 O O   . HOH D 3 .   ? 4.314   28.511  21.130 1.00 15.67 ? 380 HOH A O   1 
HETATM 1881 O O   . HOH D 3 .   ? 23.597  -6.542  37.491 1.00 15.85 ? 381 HOH A O   1 
HETATM 1882 O O   . HOH D 3 .   ? 16.452  28.835  23.877 1.00 15.90 ? 382 HOH A O   1 
HETATM 1883 O O   . HOH D 3 .   ? 26.150  -3.238  34.315 1.00 15.94 ? 383 HOH A O   1 
HETATM 1884 O O   . HOH D 3 .   ? 14.024  2.880   15.535 1.00 15.97 ? 384 HOH A O   1 
HETATM 1885 O O   . HOH D 3 .   ? 12.044  26.730  10.769 1.00 16.09 ? 385 HOH A O   1 
HETATM 1886 O O   . HOH D 3 .   ? 20.884  21.211  15.054 1.00 16.10 ? 386 HOH A O   1 
HETATM 1887 O O   . HOH D 3 .   ? 19.818  0.766   9.039  1.00 16.13 ? 387 HOH A O   1 
HETATM 1888 O O   . HOH D 3 .   ? 27.720  7.344   13.823 1.00 16.16 ? 388 HOH A O   1 
HETATM 1889 O O   . HOH D 3 .   ? 2.116   24.969  19.577 1.00 16.20 ? 389 HOH A O   1 
HETATM 1890 O O   . HOH D 3 .   ? -3.632  13.912  24.722 1.00 16.30 ? 390 HOH A O   1 
HETATM 1891 O O   . HOH D 3 .   ? 3.968   -0.115  15.875 1.00 16.30 ? 391 HOH A O   1 
HETATM 1892 O O   . HOH D 3 .   ? 28.806  -2.979  17.879 1.00 16.36 ? 392 HOH A O   1 
HETATM 1893 O O   . HOH D 3 .   ? 23.357  -13.422 35.952 1.00 16.44 ? 393 HOH A O   1 
HETATM 1894 O O   . HOH D 3 .   ? 11.465  17.948  31.816 1.00 16.48 ? 394 HOH A O   1 
HETATM 1895 O O   . HOH D 3 .   ? 7.355   -11.058 28.826 1.00 16.50 ? 395 HOH A O   1 
HETATM 1896 O O   . HOH D 3 .   ? 4.682   15.306  26.754 1.00 16.63 ? 396 HOH A O   1 
HETATM 1897 O O   . HOH D 3 .   ? 10.561  21.305  28.732 1.00 16.66 ? 397 HOH A O   1 
HETATM 1898 O O   . HOH D 3 .   ? 34.700  5.336   39.286 1.00 16.73 ? 398 HOH A O   1 
HETATM 1899 O O   . HOH D 3 .   ? 9.585   28.628  23.406 1.00 16.82 ? 399 HOH A O   1 
HETATM 1900 O O   . HOH D 3 .   ? -4.376  13.739  21.953 1.00 16.87 ? 400 HOH A O   1 
HETATM 1901 O O   . HOH D 3 .   ? 24.081  -4.102  36.037 1.00 17.07 ? 401 HOH A O   1 
HETATM 1902 O O   . HOH D 3 .   ? 17.003  23.950  14.234 1.00 17.21 ? 402 HOH A O   1 
HETATM 1903 O O   . HOH D 3 .   ? 26.081  3.895   9.381  1.00 17.23 ? 403 HOH A O   1 
HETATM 1904 O O   . HOH D 3 .   ? 21.243  15.072  14.747 1.00 17.41 ? 404 HOH A O   1 
HETATM 1905 O O   . HOH D 3 .   ? 33.242  7.681   21.759 1.00 17.53 ? 405 HOH A O   1 
HETATM 1906 O O   . HOH D 3 .   ? 32.939  1.122   25.598 1.00 17.83 ? 406 HOH A O   1 
HETATM 1907 O O   . HOH D 3 .   ? -0.250  19.162  18.200 1.00 18.02 ? 407 HOH A O   1 
HETATM 1908 O O   . HOH D 3 .   ? -3.363  1.513   14.313 1.00 18.04 ? 408 HOH A O   1 
HETATM 1909 O O   . HOH D 3 .   ? 24.301  -9.995  15.761 1.00 18.11 ? 409 HOH A O   1 
HETATM 1910 O O   . HOH D 3 .   ? 8.312   -12.085 26.505 1.00 18.19 ? 410 HOH A O   1 
HETATM 1911 O O   . HOH D 3 .   ? 14.577  1.539   38.493 1.00 18.20 ? 411 HOH A O   1 
HETATM 1912 O O   . HOH D 3 .   ? 29.670  -2.826  20.585 1.00 18.36 ? 412 HOH A O   1 
HETATM 1913 O O   . HOH D 3 .   ? -3.424  23.966  15.777 1.00 18.48 ? 413 HOH A O   1 
HETATM 1914 O O   . HOH D 3 .   ? 6.209   16.970  33.569 1.00 18.49 ? 414 HOH A O   1 
HETATM 1915 O O   . HOH D 3 .   ? 18.326  3.042   9.269  1.00 18.54 ? 415 HOH A O   1 
HETATM 1916 O O   . HOH D 3 .   ? 15.622  3.096   9.587  1.00 18.63 ? 416 HOH A O   1 
HETATM 1917 O O   . HOH D 3 .   ? 11.487  -11.642 34.805 1.00 18.65 ? 417 HOH A O   1 
HETATM 1918 O O   . HOH D 3 .   ? 13.109  9.403   7.640  1.00 18.74 ? 418 HOH A O   1 
HETATM 1919 O O   . HOH D 3 .   ? 14.942  -11.748 13.084 1.00 18.75 ? 419 HOH A O   1 
HETATM 1920 O O   . HOH D 3 .   ? 23.212  13.461  35.159 1.00 18.82 ? 420 HOH A O   1 
HETATM 1921 O O   . HOH D 3 .   ? 2.144   13.044  5.931  1.00 18.83 ? 421 HOH A O   1 
HETATM 1922 O O   . HOH D 3 .   ? 4.761   28.961  8.658  1.00 18.89 ? 422 HOH A O   1 
HETATM 1923 O O   . HOH D 3 .   ? 11.126  3.336   13.711 1.00 18.98 ? 423 HOH A O   1 
HETATM 1924 O O   . HOH D 3 .   ? -6.415  18.598  17.551 1.00 19.09 ? 424 HOH A O   1 
HETATM 1925 O O   . HOH D 3 .   ? -2.165  16.857  6.829  1.00 19.23 ? 425 HOH A O   1 
HETATM 1926 O O   . HOH D 3 .   ? -6.431  6.976   11.626 1.00 19.27 ? 426 HOH A O   1 
HETATM 1927 O O   . HOH D 3 .   ? 17.327  -7.849  37.361 1.00 19.44 ? 427 HOH A O   1 
HETATM 1928 O O   . HOH D 3 .   ? 19.708  -4.452  36.194 1.00 19.56 ? 428 HOH A O   1 
HETATM 1929 O O   . HOH D 3 .   ? 24.522  6.069   8.719  1.00 19.56 ? 429 HOH A O   1 
HETATM 1930 O O   . HOH D 3 .   ? 0.361   16.505  19.700 1.00 19.58 ? 430 HOH A O   1 
HETATM 1931 O O   . HOH D 3 .   ? 25.320  13.955  15.184 1.00 19.64 ? 431 HOH A O   1 
HETATM 1932 O O   . HOH D 3 .   ? 28.134  14.138  33.144 1.00 19.64 ? 432 HOH A O   1 
HETATM 1933 O O   . HOH D 3 .   ? 4.605   30.959  20.077 1.00 19.65 ? 433 HOH A O   1 
HETATM 1934 O O   . HOH D 3 .   ? 30.143  9.957   32.258 1.00 19.84 ? 434 HOH A O   1 
HETATM 1935 O O   . HOH D 3 .   ? -1.291  -0.297  7.991  1.00 20.00 ? 435 HOH A O   1 
HETATM 1936 O O   . HOH D 3 .   ? 34.582  8.293   24.501 1.00 20.53 ? 436 HOH A O   1 
HETATM 1937 O O   . HOH D 3 .   ? 29.634  9.966   16.520 1.00 20.55 ? 437 HOH A O   1 
HETATM 1938 O O   . HOH D 3 .   ? 27.416  17.630  32.026 1.00 20.63 ? 438 HOH A O   1 
HETATM 1939 O O   . HOH D 3 .   ? 3.317   -7.083  27.949 1.00 20.67 ? 439 HOH A O   1 
HETATM 1940 O O   . HOH D 3 .   ? 0.264   4.278   30.191 1.00 20.76 ? 440 HOH A O   1 
HETATM 1941 O O   . HOH D 3 .   ? -5.252  23.030  17.632 1.00 21.08 ? 441 HOH A O   1 
HETATM 1942 O O   . HOH D 3 .   ? 9.539   -10.237 36.033 1.00 21.17 ? 442 HOH A O   1 
HETATM 1943 O O   . HOH D 3 .   ? 26.973  20.133  19.038 1.00 21.27 ? 443 HOH A O   1 
HETATM 1944 O O   . HOH D 3 .   ? 24.915  12.599  33.620 1.00 21.30 ? 444 HOH A O   1 
HETATM 1945 O O   . HOH D 3 .   ? 13.466  -1.374  40.326 1.00 21.35 ? 445 HOH A O   1 
HETATM 1946 O O   . HOH D 3 .   ? 12.480  21.188  8.808  1.00 21.48 ? 446 HOH A O   1 
HETATM 1947 O O   . HOH D 3 .   ? 19.779  10.288  10.086 1.00 21.58 ? 447 HOH A O   1 
HETATM 1948 O O   . HOH D 3 .   ? 32.134  -5.828  24.527 1.00 21.59 ? 448 HOH A O   1 
HETATM 1949 O O   . HOH D 3 .   ? 0.782   8.495   29.065 1.00 21.70 ? 449 HOH A O   1 
HETATM 1950 O O   . HOH D 3 .   ? 3.867   -2.893  16.188 1.00 21.73 ? 450 HOH A O   1 
HETATM 1951 O O   . HOH D 3 .   ? 34.446  13.073  17.480 1.00 21.76 ? 451 HOH A O   1 
HETATM 1952 O O   . HOH D 3 .   ? -1.146  23.567  16.981 1.00 21.89 ? 452 HOH A O   1 
HETATM 1953 O O   . HOH D 3 .   ? -1.254  7.906   5.757  1.00 21.95 ? 453 HOH A O   1 
HETATM 1954 O O   . HOH D 3 .   ? 9.870   18.941  29.808 1.00 21.96 ? 454 HOH A O   1 
HETATM 1955 O O   . HOH D 3 .   ? 14.520  -10.986 15.626 1.00 21.99 ? 455 HOH A O   1 
HETATM 1956 O O   . HOH D 3 .   ? -4.223  2.677   8.961  1.00 22.14 ? 456 HOH A O   1 
HETATM 1957 O O   . HOH D 3 .   ? 30.040  20.335  32.979 1.00 22.20 ? 457 HOH A O   1 
HETATM 1958 O O   . HOH D 3 .   ? 1.886   17.410  21.410 1.00 22.20 ? 458 HOH A O   1 
HETATM 1959 O O   . HOH D 3 .   ? 0.566   6.280   4.867  1.00 22.32 ? 459 HOH A O   1 
HETATM 1960 O O   . HOH D 3 .   ? 21.814  20.765  32.279 1.00 22.48 ? 460 HOH A O   1 
HETATM 1961 O O   . HOH D 3 .   ? 23.095  23.235  19.146 1.00 22.86 ? 461 HOH A O   1 
HETATM 1962 O O   . HOH D 3 .   ? 7.240   32.982  17.902 1.00 22.90 ? 462 HOH A O   1 
HETATM 1963 O O   . HOH D 3 .   ? 16.761  6.826   14.582 1.00 22.94 ? 463 HOH A O   1 
HETATM 1964 O O   . HOH D 3 .   ? 4.372   24.454  21.269 1.00 23.24 ? 464 HOH A O   1 
HETATM 1965 O O   . HOH D 3 .   ? 34.197  -1.244  29.244 1.00 23.25 ? 465 HOH A O   1 
HETATM 1966 O O   . HOH D 3 .   ? 21.217  27.132  20.367 1.00 23.46 ? 466 HOH A O   1 
HETATM 1967 O O   . HOH D 3 .   ? 24.168  23.965  32.930 1.00 23.53 ? 467 HOH A O   1 
HETATM 1968 O O   . HOH D 3 .   ? -4.047  9.421   20.014 1.00 23.54 ? 468 HOH A O   1 
HETATM 1969 O O   . HOH D 3 .   ? 18.917  29.317  22.986 1.00 23.55 ? 469 HOH A O   1 
HETATM 1970 O O   . HOH D 3 .   ? 16.908  1.517   11.725 1.00 23.61 ? 470 HOH A O   1 
HETATM 1971 O O   . HOH D 3 .   ? 14.394  -14.507 31.703 1.00 24.06 ? 471 HOH A O   1 
HETATM 1972 O O   . HOH D 3 .   ? -0.223  -2.148  9.503  1.00 24.26 ? 472 HOH A O   1 
HETATM 1973 O O   . HOH D 3 .   ? 16.514  -4.935  6.067  1.00 24.27 ? 473 HOH A O   1 
HETATM 1974 O O   . HOH D 3 .   ? 22.426  19.495  14.000 1.00 24.35 ? 474 HOH A O   1 
HETATM 1975 O O   . HOH D 3 .   ? 25.045  16.443  16.832 1.00 24.40 ? 475 HOH A O   1 
HETATM 1976 O O   . HOH D 3 .   ? 2.275   -6.323  30.413 1.00 24.66 ? 476 HOH A O   1 
HETATM 1977 O O   . HOH D 3 .   ? 6.257   3.234   6.081  1.00 24.71 ? 477 HOH A O   1 
HETATM 1978 O O   . HOH D 3 .   ? 15.633  -10.797 37.543 1.00 24.80 ? 478 HOH A O   1 
HETATM 1979 O O   . HOH D 3 .   ? 30.190  22.708  24.128 1.00 24.81 ? 479 HOH A O   1 
HETATM 1980 O O   . HOH D 3 .   ? 31.953  -7.121  28.858 1.00 24.87 ? 480 HOH A O   1 
HETATM 1981 O O   . HOH D 3 .   ? 1.596   0.146   36.325 1.00 24.89 ? 481 HOH A O   1 
HETATM 1982 O O   . HOH D 3 .   ? -1.861  26.856  17.363 1.00 24.91 ? 482 HOH A O   1 
HETATM 1983 O O   . HOH D 3 .   ? -2.900  -5.874  24.844 1.00 25.26 ? 483 HOH A O   1 
HETATM 1984 O O   . HOH D 3 .   ? 7.910   2.918   37.031 1.00 25.37 ? 484 HOH A O   1 
HETATM 1985 O O   . HOH D 3 .   ? 32.708  1.097   28.140 1.00 25.40 ? 485 HOH A O   1 
HETATM 1986 O O   . HOH D 3 .   ? 2.449   2.155   5.629  1.00 25.50 ? 486 HOH A O   1 
HETATM 1987 O O   . HOH D 3 .   ? 12.894  25.764  32.509 1.00 25.60 ? 487 HOH A O   1 
HETATM 1988 O O   . HOH D 3 .   ? 24.304  5.587   6.193  1.00 25.68 ? 488 HOH A O   1 
HETATM 1989 O O   . HOH D 3 .   ? 16.588  26.826  16.835 1.00 25.69 ? 489 HOH A O   1 
HETATM 1990 O O   . HOH D 3 .   ? 15.666  8.985   6.697  1.00 25.75 ? 490 HOH A O   1 
HETATM 1991 O O   . HOH D 3 .   ? 17.562  12.876  10.139 1.00 25.83 ? 491 HOH A O   1 
HETATM 1992 O O   . HOH D 3 .   ? 14.325  -15.210 28.382 1.00 25.84 ? 492 HOH A O   1 
HETATM 1993 O O   . HOH D 3 .   ? 28.130  -5.386  17.005 1.00 25.84 ? 493 HOH A O   1 
HETATM 1994 O O   . HOH D 3 .   ? 1.544   17.162  5.774  1.00 25.90 ? 494 HOH A O   1 
HETATM 1995 O O   . HOH D 3 .   ? 13.014  1.345   40.320 1.00 25.94 ? 495 HOH A O   1 
HETATM 1996 O O   . HOH D 3 .   ? 29.288  -7.604  33.222 1.00 25.94 ? 496 HOH A O   1 
HETATM 1997 O O   . HOH D 3 .   ? 7.049   -7.021  39.168 1.00 26.12 ? 497 HOH A O   1 
HETATM 1998 O O   . HOH D 3 .   ? -7.683  11.890  16.405 1.00 26.16 ? 498 HOH A O   1 
HETATM 1999 O O   . HOH D 3 .   ? 18.273  -0.415  10.600 1.00 26.40 ? 499 HOH A O   1 
HETATM 2000 O O   . HOH D 3 .   ? 26.612  7.958   9.286  1.00 26.49 ? 500 HOH A O   1 
HETATM 2001 O O   . HOH D 3 .   ? 36.826  9.760   25.652 1.00 26.61 ? 501 HOH A O   1 
HETATM 2002 O O   . HOH D 3 .   ? -2.040  0.741   30.061 1.00 26.66 ? 502 HOH A O   1 
HETATM 2003 O O   . HOH D 3 .   ? 1.658   12.914  30.055 1.00 26.84 ? 503 HOH A O   1 
HETATM 2004 O O   . HOH D 3 .   ? -0.533  5.694   2.178  1.00 26.94 ? 504 HOH A O   1 
HETATM 2005 O O   . HOH D 3 .   ? -5.995  18.068  7.666  1.00 26.99 ? 505 HOH A O   1 
HETATM 2006 O O   . HOH D 3 .   ? 25.496  11.686  37.914 1.00 27.00 ? 506 HOH A O   1 
HETATM 2007 O O   . HOH D 3 .   ? 10.501  32.421  11.281 1.00 27.05 ? 507 HOH A O   1 
HETATM 2008 O O   . HOH D 3 .   ? 17.701  16.025  9.800  1.00 27.06 ? 508 HOH A O   1 
HETATM 2009 O O   . HOH D 3 .   ? 28.651  -9.234  28.156 1.00 27.13 ? 509 HOH A O   1 
HETATM 2010 O O   . HOH D 3 .   ? -6.338  4.587   19.533 1.00 27.16 ? 510 HOH A O   1 
HETATM 2011 O O   . HOH D 3 .   ? -0.214  2.084   4.128  1.00 27.32 ? 511 HOH A O   1 
HETATM 2012 O O   . HOH D 3 .   ? 3.283   17.228  25.725 1.00 27.42 ? 512 HOH A O   1 
HETATM 2013 O O   . HOH D 3 .   ? 16.499  4.382   14.543 1.00 27.74 ? 513 HOH A O   1 
HETATM 2014 O O   . HOH D 3 .   ? -3.392  2.498   42.820 1.00 27.79 ? 514 HOH A O   1 
HETATM 2015 O O   . HOH D 3 .   ? 3.213   24.940  23.673 1.00 28.04 ? 515 HOH A O   1 
HETATM 2016 O O   . HOH D 3 .   ? 33.784  -0.291  23.381 1.00 28.21 ? 516 HOH A O   1 
HETATM 2017 O O   . HOH D 3 .   ? 2.378   -3.778  12.247 1.00 28.35 ? 517 HOH A O   1 
HETATM 2018 O O   . HOH D 3 .   ? 13.635  28.820  11.438 1.00 28.43 ? 518 HOH A O   1 
HETATM 2019 O O   . HOH D 3 .   ? 9.069   4.977   36.513 1.00 28.50 ? 519 HOH A O   1 
HETATM 2020 O O   . HOH D 3 .   ? 7.887   32.224  12.224 1.00 28.73 ? 520 HOH A O   1 
HETATM 2021 O O   . HOH D 3 .   ? 28.566  -9.184  31.087 1.00 28.80 ? 521 HOH A O   1 
HETATM 2022 O O   . HOH D 3 .   ? 16.271  -2.901  10.998 1.00 28.93 ? 522 HOH A O   1 
HETATM 2023 O O   . HOH D 3 .   ? 25.662  -12.400 32.359 1.00 29.08 ? 523 HOH A O   1 
HETATM 2024 O O   . HOH D 3 .   ? 5.929   -0.599  11.338 1.00 29.19 ? 524 HOH A O   1 
HETATM 2025 O O   . HOH D 3 .   ? 35.357  11.704  28.192 1.00 29.29 ? 525 HOH A O   1 
HETATM 2026 O O   . HOH D 3 .   ? 12.514  13.460  6.953  1.00 29.70 ? 526 HOH A O   1 
HETATM 2027 O O   . HOH D 3 .   ? 2.168   -2.234  9.999  1.00 29.87 ? 527 HOH A O   1 
HETATM 2028 O O   . HOH D 3 .   ? 0.172   -1.729  35.546 1.00 29.88 ? 528 HOH A O   1 
HETATM 2029 O O   . HOH D 3 .   ? 6.275   17.400  27.893 1.00 29.98 ? 529 HOH A O   1 
HETATM 2030 O O   . HOH D 3 .   ? 3.449   20.977  8.497  1.00 30.15 ? 530 HOH A O   1 
HETATM 2031 O O   . HOH D 3 .   ? 6.118   17.032  4.080  1.00 30.19 ? 531 HOH A O   1 
HETATM 2032 O O   . HOH D 3 .   ? 21.842  -14.371 15.937 1.00 30.26 ? 532 HOH A O   1 
HETATM 2033 O O   . HOH D 3 .   ? 24.540  -4.759  9.753  1.00 30.34 ? 533 HOH A O   1 
HETATM 2034 O O   . HOH D 3 .   ? -4.484  3.894   21.963 1.00 30.48 ? 534 HOH A O   1 
HETATM 2035 O O   . HOH D 3 .   ? 22.061  0.852   39.134 1.00 30.49 ? 535 HOH A O   1 
HETATM 2036 O O   . HOH D 3 .   ? -5.286  11.197  21.239 1.00 30.54 ? 536 HOH A O   1 
HETATM 2037 O O   . HOH D 3 .   ? -3.803  21.532  19.683 1.00 30.69 ? 537 HOH A O   1 
HETATM 2038 O O   . HOH D 3 .   ? 7.645   21.817  8.634  1.00 30.72 ? 538 HOH A O   1 
HETATM 2039 O O   . HOH D 3 .   ? 25.855  2.513   7.335  1.00 30.78 ? 539 HOH A O   1 
HETATM 2040 O O   . HOH D 3 .   ? 4.389   -9.259  27.854 1.00 30.94 ? 540 HOH A O   1 
HETATM 2041 O O   . HOH D 3 .   ? 15.270  17.860  36.432 1.00 30.96 ? 541 HOH A O   1 
HETATM 2042 O O   . HOH D 3 .   ? 29.895  7.752   15.605 1.00 31.23 ? 542 HOH A O   1 
HETATM 2043 O O   . HOH D 3 .   ? 25.821  21.599  33.344 1.00 31.33 ? 543 HOH A O   1 
HETATM 2044 O O   . HOH D 3 .   ? 9.514   30.542  25.318 1.00 31.36 ? 544 HOH A O   1 
HETATM 2045 O O   . HOH D 3 .   ? -4.758  11.824  26.014 1.00 31.37 ? 545 HOH A O   1 
HETATM 2046 O O   . HOH D 3 .   ? 7.546   24.733  8.412  1.00 31.41 ? 546 HOH A O   1 
HETATM 2047 O O   . HOH D 3 .   ? 18.747  20.024  11.212 1.00 31.42 ? 547 HOH A O   1 
HETATM 2048 O O   . HOH D 3 .   ? 35.045  -2.261  24.194 1.00 31.45 ? 548 HOH A O   1 
HETATM 2049 O O   . HOH D 3 .   ? 17.023  20.060  8.988  1.00 31.56 ? 549 HOH A O   1 
HETATM 2050 O O   . HOH D 3 .   ? 8.792   -12.557 32.564 1.00 31.65 ? 550 HOH A O   1 
HETATM 2051 O O   . HOH D 3 .   ? 16.770  2.460   39.764 1.00 31.70 ? 551 HOH A O   1 
HETATM 2052 O O   . HOH D 3 .   ? 22.253  27.076  24.182 1.00 31.86 ? 552 HOH A O   1 
HETATM 2053 O O   . HOH D 3 .   ? 6.010   -6.499  36.484 1.00 31.87 ? 553 HOH A O   1 
HETATM 2054 O O   . HOH D 3 .   ? 12.945  17.261  36.164 1.00 31.91 ? 554 HOH A O   1 
HETATM 2055 O O   . HOH D 3 .   ? 32.409  -2.116  21.185 1.00 31.96 ? 555 HOH A O   1 
HETATM 2056 O O   . HOH D 3 .   ? 26.593  10.412  31.999 1.00 32.26 ? 556 HOH A O   1 
HETATM 2057 O O   . HOH D 3 .   ? 19.318  3.082   39.974 1.00 32.31 ? 557 HOH A O   1 
HETATM 2058 O O   . HOH D 3 .   ? -1.398  22.698  19.324 1.00 32.72 ? 558 HOH A O   1 
HETATM 2059 O O   . HOH D 3 .   ? -4.522  5.848   48.903 1.00 32.73 ? 559 HOH A O   1 
HETATM 2060 O O   . HOH D 3 .   ? 11.312  15.154  9.604  1.00 32.73 ? 560 HOH A O   1 
HETATM 2061 O O   . HOH D 3 .   ? 12.494  20.848  35.014 1.00 32.92 ? 561 HOH A O   1 
HETATM 2062 O O   . HOH D 3 .   ? 14.100  -1.795  10.828 1.00 33.13 ? 562 HOH A O   1 
HETATM 2063 O O   . HOH D 3 .   ? 17.468  19.236  35.845 1.00 33.14 ? 563 HOH A O   1 
HETATM 2064 O O   . HOH D 3 .   ? 21.165  14.601  11.466 1.00 33.15 ? 564 HOH A O   1 
HETATM 2065 O O   . HOH D 3 .   ? 34.527  7.718   40.253 1.00 33.47 ? 565 HOH A O   1 
HETATM 2066 O O   . HOH D 3 .   ? 12.220  9.896   39.536 1.00 33.51 ? 566 HOH A O   1 
HETATM 2067 O O   . HOH D 3 .   ? 7.296   3.685   39.897 1.00 33.68 ? 567 HOH A O   1 
HETATM 2068 O O   . HOH D 3 .   ? 22.693  -1.437  37.492 1.00 34.06 ? 568 HOH A O   1 
HETATM 2069 O O   . HOH D 3 .   ? 9.964   21.417  7.949  1.00 34.07 ? 569 HOH A O   1 
HETATM 2070 O O   . HOH D 3 .   ? -4.701  18.641  19.388 1.00 34.30 ? 570 HOH A O   1 
HETATM 2071 O O   . HOH D 3 .   ? 37.812  18.189  24.329 1.00 34.34 ? 571 HOH A O   1 
HETATM 2072 O O   . HOH D 3 .   ? 14.411  16.735  8.102  1.00 34.44 ? 572 HOH A O   1 
HETATM 2073 O O   . HOH D 3 .   ? -1.199  -6.459  43.263 1.00 34.51 ? 573 HOH A O   1 
HETATM 2074 O O   . HOH D 3 .   ? 1.044   22.527  20.793 1.00 34.58 ? 574 HOH A O   1 
HETATM 2075 O O   . HOH D 3 .   ? -3.953  7.283   7.394  1.00 34.60 ? 575 HOH A O   1 
HETATM 2076 O O   . HOH D 3 .   ? 28.914  21.248  30.555 1.00 34.83 ? 576 HOH A O   1 
HETATM 2077 O O   . HOH D 3 .   ? 34.474  2.474   28.829 1.00 34.95 ? 577 HOH A O   1 
HETATM 2078 O O   . HOH D 3 .   ? -8.499  5.335   17.143 1.00 34.98 ? 578 HOH A O   1 
HETATM 2079 O O   . HOH D 3 .   ? -0.173  -3.750  34.043 1.00 35.09 ? 579 HOH A O   1 
HETATM 2080 O O   . HOH D 3 .   ? 31.312  5.106   17.575 1.00 35.14 ? 580 HOH A O   1 
HETATM 2081 O O   . HOH D 3 .   ? 26.369  19.328  16.839 1.00 35.15 ? 581 HOH A O   1 
HETATM 2082 O O   . HOH D 3 .   ? 36.652  11.272  30.131 1.00 35.39 ? 582 HOH A O   1 
HETATM 2083 O O   . HOH D 3 .   ? 18.631  -15.168 32.765 1.00 35.41 ? 583 HOH A O   1 
HETATM 2084 O O   . HOH D 3 .   ? 16.489  12.852  7.497  1.00 35.57 ? 584 HOH A O   1 
HETATM 2085 O O   . HOH D 3 .   ? 7.814   -9.340  39.261 1.00 35.71 ? 585 HOH A O   1 
HETATM 2086 O O   . HOH D 3 .   ? 13.033  14.338  35.982 1.00 35.87 ? 586 HOH A O   1 
HETATM 2087 O O   . HOH D 3 .   ? 24.946  9.015   38.679 1.00 35.90 ? 587 HOH A O   1 
HETATM 2088 O O   . HOH D 3 .   ? 20.243  17.127  37.036 1.00 36.11 ? 588 HOH A O   1 
HETATM 2089 O O   . HOH D 3 .   ? 28.214  -8.625  17.431 1.00 36.20 ? 589 HOH A O   1 
HETATM 2090 O O   . HOH D 3 .   ? 29.261  -9.596  24.532 1.00 36.24 ? 590 HOH A O   1 
HETATM 2091 O O   . HOH D 3 .   ? -3.265  8.711   3.237  1.00 36.64 ? 591 HOH A O   1 
HETATM 2092 O O   . HOH D 3 .   ? 18.493  5.225   40.010 1.00 36.82 ? 592 HOH A O   1 
HETATM 2093 O O   . HOH D 3 .   ? 11.150  16.901  34.468 1.00 37.72 ? 593 HOH A O   1 
HETATM 2094 O O   . HOH D 3 .   ? 13.140  32.278  12.906 1.00 37.90 ? 594 HOH A O   1 
HETATM 2095 O O   . HOH D 3 .   ? 25.928  -12.585 23.805 1.00 37.96 ? 595 HOH A O   1 
HETATM 2096 O O   . HOH D 3 .   ? 17.304  0.215   40.524 1.00 38.12 ? 596 HOH A O   1 
HETATM 2097 O O   . HOH D 3 .   ? -2.146  11.096  3.221  1.00 38.25 ? 597 HOH A O   1 
HETATM 2098 O O   . HOH D 3 .   ? -8.372  7.432   9.666  1.00 38.58 ? 598 HOH A O   1 
HETATM 2099 O O   . HOH D 3 .   ? 17.962  8.786   39.063 1.00 38.58 ? 599 HOH A O   1 
HETATM 2100 O O   . HOH D 3 .   ? -7.875  16.618  18.813 1.00 38.63 ? 600 HOH A O   1 
HETATM 2101 O O   . HOH D 3 .   ? -4.681  6.215   24.214 1.00 38.89 ? 601 HOH A O   1 
HETATM 2102 O O   . HOH D 3 .   ? 1.133   4.667   32.513 1.00 39.36 ? 602 HOH A O   1 
HETATM 2103 O O   . HOH D 3 .   ? 30.324  -3.444  35.361 1.00 39.37 ? 603 HOH A O   1 
HETATM 2104 O O   . HOH D 3 .   ? 4.480   15.998  1.769  1.00 39.38 ? 604 HOH A O   1 
HETATM 2105 O O   . HOH D 3 .   ? 6.587   31.647  9.345  1.00 39.50 ? 605 HOH A O   1 
HETATM 2106 O O   . HOH D 3 .   ? -5.926  7.167   20.965 1.00 39.55 ? 606 HOH A O   1 
HETATM 2107 O O   . HOH D 3 .   ? 24.998  22.509  15.787 1.00 39.78 ? 607 HOH A O   1 
HETATM 2108 O O   . HOH D 3 .   ? 18.799  -13.701 25.787 1.00 39.82 ? 608 HOH A O   1 
HETATM 2109 O O   . HOH D 3 .   ? 26.406  4.242   5.496  1.00 39.83 ? 609 HOH A O   1 
HETATM 2110 O O   . HOH D 3 .   ? 26.653  26.411  25.350 1.00 40.34 ? 610 HOH A O   1 
HETATM 2111 O O   . HOH D 3 .   ? 22.584  24.124  35.530 1.00 40.39 ? 611 HOH A O   1 
HETATM 2112 O O   . HOH D 3 .   ? 18.296  27.762  18.932 1.00 40.46 ? 612 HOH A O   1 
HETATM 2113 O O   . HOH D 3 .   ? -8.012  21.161  18.504 1.00 40.55 ? 613 HOH A O   1 
HETATM 2114 O O   . HOH D 3 .   ? 16.698  26.996  34.356 1.00 40.77 ? 614 HOH A O   1 
HETATM 2115 O O   . HOH D 3 .   ? 35.465  -2.399  27.316 1.00 40.83 ? 615 HOH A O   1 
HETATM 2116 O O   . HOH D 3 .   ? 32.075  7.559   41.892 1.00 40.88 ? 616 HOH A O   1 
HETATM 2117 O O   . HOH D 3 .   ? 6.297   -2.691  15.748 1.00 41.18 ? 617 HOH A O   1 
HETATM 2118 O O   . HOH D 3 .   ? 23.296  22.341  37.200 1.00 42.37 ? 618 HOH A O   1 
HETATM 2119 O O   . HOH D 3 .   ? 20.415  16.465  7.943  1.00 42.39 ? 619 HOH A O   1 
HETATM 2120 O O   . HOH D 3 .   ? 29.879  22.939  27.329 1.00 43.55 ? 620 HOH A O   1 
HETATM 2121 O O   . HOH D 3 .   ? 31.322  -6.895  20.789 1.00 43.73 ? 621 HOH A O   1 
HETATM 2122 O O   . HOH D 3 .   ? -1.603  5.871   23.537 1.00 43.92 ? 622 HOH A O   1 
HETATM 2123 O O   . HOH D 3 .   ? -3.309  1.538   28.068 1.00 43.93 ? 623 HOH A O   1 
HETATM 2124 O O   . HOH D 3 .   ? -0.239  20.092  6.695  1.00 44.00 ? 624 HOH A O   1 
HETATM 2125 O O   . HOH D 3 .   ? 37.328  14.685  26.378 1.00 44.49 ? 625 HOH A O   1 
HETATM 2126 O O   . HOH D 3 .   ? 33.960  -0.897  35.326 1.00 45.10 ? 626 HOH A O   1 
HETATM 2127 O O   . HOH D 3 .   ? 37.011  11.982  17.205 1.00 45.24 ? 627 HOH A O   1 
HETATM 2128 O O   . HOH D 3 .   ? -5.823  -5.269  26.417 1.00 45.36 ? 628 HOH A O   1 
HETATM 2129 O O   . HOH D 3 .   ? 16.230  -2.873  7.819  1.00 46.50 ? 629 HOH A O   1 
HETATM 2130 O O   . HOH D 3 .   ? 12.767  -15.512 23.729 1.00 47.06 ? 630 HOH A O   1 
HETATM 2131 O O   . HOH D 3 .   ? 33.406  4.653   21.075 1.00 47.27 ? 631 HOH A O   1 
HETATM 2132 O O   . HOH D 3 .   ? 9.651   32.893  15.986 1.00 47.43 ? 632 HOH A O   1 
HETATM 2133 O O   . HOH D 3 .   ? 20.981  12.534  9.899  1.00 47.61 ? 633 HOH A O   1 
HETATM 2134 O O   . HOH D 3 .   ? 24.054  22.437  30.863 1.00 48.13 ? 634 HOH A O   1 
HETATM 2135 O O   . HOH D 3 .   ? 11.639  1.461   10.015 1.00 50.35 ? 635 HOH A O   1 
HETATM 2136 O O   . HOH D 3 .   ? -4.235  -3.744  27.531 1.00 50.36 ? 636 HOH A O   1 
HETATM 2137 O O   . HOH D 3 .   ? 14.217  0.631   12.622 1.00 50.39 ? 637 HOH A O   1 
HETATM 2138 O O   . HOH D 3 .   ? -2.295  19.255  7.779  1.00 50.49 ? 638 HOH A O   1 
HETATM 2139 O O   . HOH D 3 .   ? 17.372  -8.275  6.784  1.00 50.67 ? 639 HOH A O   1 
HETATM 2140 O O   . HOH D 3 .   ? -5.795  17.054  22.035 1.00 50.76 ? 640 HOH A O   1 
HETATM 2141 O O   . HOH D 3 .   ? 10.480  24.150  32.449 1.00 52.15 ? 641 HOH A O   1 
HETATM 2142 O O   . HOH D 3 .   ? -4.596  -5.701  43.622 1.00 52.16 ? 642 HOH A O   1 
HETATM 2143 O O   . HOH D 3 .   ? 5.032   29.739  24.293 1.00 52.69 ? 643 HOH A O   1 
HETATM 2144 O O   . HOH D 3 .   ? 15.037  3.112   12.760 1.00 54.03 ? 644 HOH A O   1 
HETATM 2145 O O   . HOH D 3 .   ? 21.981  13.096  38.075 1.00 54.52 ? 645 HOH A O   1 
HETATM 2146 O O   . HOH D 3 .   ? 30.808  9.654   13.189 1.00 55.54 ? 646 HOH A O   1 
HETATM 2147 O O   . HOH D 3 .   ? -11.692 17.679  19.802 1.00 58.95 ? 647 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   TRP 7   7   7   TRP TRP A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 HIS 134 134 134 HIS HIS A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 HIS 136 136 136 HIS HIS A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 HIS 155 155 155 HIS HIS A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 HIS 194 194 194 HIS HIS A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 CYS 200 200 200 CYS CYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 HIS 202 202 202 HIS HIS A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ASN 207 207 207 ASN ASN A . n 
A 1 208 GLN 208 208 208 GLN GLN A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 GLN 212 212 212 GLN GLN A . n 
A 1 213 HIS 213 213 213 HIS HIS A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 TRP 220 220 220 TRP TRP A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   230 230 GOL GOL A . 
C 2 GOL 1   231 231 GOL GOL A . 
D 3 HOH 1   301 301 HOH HOH A . 
D 3 HOH 2   302 302 HOH HOH A . 
D 3 HOH 3   303 303 HOH HOH A . 
D 3 HOH 4   304 304 HOH HOH A . 
D 3 HOH 5   305 305 HOH HOH A . 
D 3 HOH 6   306 306 HOH HOH A . 
D 3 HOH 7   307 307 HOH HOH A . 
D 3 HOH 8   308 308 HOH HOH A . 
D 3 HOH 9   309 309 HOH HOH A . 
D 3 HOH 10  310 310 HOH HOH A . 
D 3 HOH 11  311 311 HOH HOH A . 
D 3 HOH 12  312 312 HOH HOH A . 
D 3 HOH 13  313 313 HOH HOH A . 
D 3 HOH 14  314 314 HOH HOH A . 
D 3 HOH 15  315 315 HOH HOH A . 
D 3 HOH 16  316 316 HOH HOH A . 
D 3 HOH 17  317 317 HOH HOH A . 
D 3 HOH 18  318 318 HOH HOH A . 
D 3 HOH 19  319 319 HOH HOH A . 
D 3 HOH 20  320 320 HOH HOH A . 
D 3 HOH 21  321 321 HOH HOH A . 
D 3 HOH 22  322 322 HOH HOH A . 
D 3 HOH 23  323 323 HOH HOH A . 
D 3 HOH 24  324 324 HOH HOH A . 
D 3 HOH 25  325 325 HOH HOH A . 
D 3 HOH 26  326 326 HOH HOH A . 
D 3 HOH 27  327 327 HOH HOH A . 
D 3 HOH 28  328 328 HOH HOH A . 
D 3 HOH 29  329 329 HOH HOH A . 
D 3 HOH 30  330 330 HOH HOH A . 
D 3 HOH 31  331 331 HOH HOH A . 
D 3 HOH 32  332 332 HOH HOH A . 
D 3 HOH 33  333 333 HOH HOH A . 
D 3 HOH 34  334 334 HOH HOH A . 
D 3 HOH 35  335 335 HOH HOH A . 
D 3 HOH 36  336 336 HOH HOH A . 
D 3 HOH 37  337 337 HOH HOH A . 
D 3 HOH 38  338 338 HOH HOH A . 
D 3 HOH 39  339 339 HOH HOH A . 
D 3 HOH 40  340 340 HOH HOH A . 
D 3 HOH 41  341 341 HOH HOH A . 
D 3 HOH 42  342 342 HOH HOH A . 
D 3 HOH 43  343 343 HOH HOH A . 
D 3 HOH 44  344 344 HOH HOH A . 
D 3 HOH 45  345 345 HOH HOH A . 
D 3 HOH 46  346 346 HOH HOH A . 
D 3 HOH 47  347 347 HOH HOH A . 
D 3 HOH 48  348 348 HOH HOH A . 
D 3 HOH 49  349 349 HOH HOH A . 
D 3 HOH 50  350 350 HOH HOH A . 
D 3 HOH 51  351 351 HOH HOH A . 
D 3 HOH 52  352 352 HOH HOH A . 
D 3 HOH 53  353 353 HOH HOH A . 
D 3 HOH 54  354 354 HOH HOH A . 
D 3 HOH 55  355 355 HOH HOH A . 
D 3 HOH 56  356 356 HOH HOH A . 
D 3 HOH 57  357 357 HOH HOH A . 
D 3 HOH 58  358 358 HOH HOH A . 
D 3 HOH 59  359 359 HOH HOH A . 
D 3 HOH 60  360 360 HOH HOH A . 
D 3 HOH 61  361 361 HOH HOH A . 
D 3 HOH 62  362 362 HOH HOH A . 
D 3 HOH 63  363 363 HOH HOH A . 
D 3 HOH 64  364 364 HOH HOH A . 
D 3 HOH 65  365 365 HOH HOH A . 
D 3 HOH 66  366 366 HOH HOH A . 
D 3 HOH 67  367 367 HOH HOH A . 
D 3 HOH 68  368 368 HOH HOH A . 
D 3 HOH 69  369 369 HOH HOH A . 
D 3 HOH 70  370 370 HOH HOH A . 
D 3 HOH 71  371 371 HOH HOH A . 
D 3 HOH 72  372 372 HOH HOH A . 
D 3 HOH 73  373 373 HOH HOH A . 
D 3 HOH 74  374 374 HOH HOH A . 
D 3 HOH 75  375 375 HOH HOH A . 
D 3 HOH 76  376 376 HOH HOH A . 
D 3 HOH 77  377 377 HOH HOH A . 
D 3 HOH 78  378 378 HOH HOH A . 
D 3 HOH 79  379 379 HOH HOH A . 
D 3 HOH 80  380 380 HOH HOH A . 
D 3 HOH 81  381 381 HOH HOH A . 
D 3 HOH 82  382 382 HOH HOH A . 
D 3 HOH 83  383 383 HOH HOH A . 
D 3 HOH 84  384 384 HOH HOH A . 
D 3 HOH 85  385 385 HOH HOH A . 
D 3 HOH 86  386 386 HOH HOH A . 
D 3 HOH 87  387 387 HOH HOH A . 
D 3 HOH 88  388 388 HOH HOH A . 
D 3 HOH 89  389 389 HOH HOH A . 
D 3 HOH 90  390 390 HOH HOH A . 
D 3 HOH 91  391 391 HOH HOH A . 
D 3 HOH 92  392 392 HOH HOH A . 
D 3 HOH 93  393 393 HOH HOH A . 
D 3 HOH 94  394 394 HOH HOH A . 
D 3 HOH 95  395 395 HOH HOH A . 
D 3 HOH 96  396 396 HOH HOH A . 
D 3 HOH 97  397 397 HOH HOH A . 
D 3 HOH 98  398 398 HOH HOH A . 
D 3 HOH 99  399 399 HOH HOH A . 
D 3 HOH 100 400 400 HOH HOH A . 
D 3 HOH 101 401 401 HOH HOH A . 
D 3 HOH 102 402 402 HOH HOH A . 
D 3 HOH 103 403 403 HOH HOH A . 
D 3 HOH 104 404 404 HOH HOH A . 
D 3 HOH 105 405 405 HOH HOH A . 
D 3 HOH 106 406 406 HOH HOH A . 
D 3 HOH 107 407 407 HOH HOH A . 
D 3 HOH 108 408 408 HOH HOH A . 
D 3 HOH 109 409 409 HOH HOH A . 
D 3 HOH 110 410 410 HOH HOH A . 
D 3 HOH 111 411 411 HOH HOH A . 
D 3 HOH 112 412 412 HOH HOH A . 
D 3 HOH 113 413 413 HOH HOH A . 
D 3 HOH 114 414 414 HOH HOH A . 
D 3 HOH 115 415 415 HOH HOH A . 
D 3 HOH 116 416 416 HOH HOH A . 
D 3 HOH 117 417 417 HOH HOH A . 
D 3 HOH 118 418 418 HOH HOH A . 
D 3 HOH 119 419 419 HOH HOH A . 
D 3 HOH 120 420 420 HOH HOH A . 
D 3 HOH 121 421 421 HOH HOH A . 
D 3 HOH 122 422 422 HOH HOH A . 
D 3 HOH 123 423 423 HOH HOH A . 
D 3 HOH 124 424 424 HOH HOH A . 
D 3 HOH 125 425 425 HOH HOH A . 
D 3 HOH 126 426 426 HOH HOH A . 
D 3 HOH 127 427 427 HOH HOH A . 
D 3 HOH 128 428 428 HOH HOH A . 
D 3 HOH 129 429 429 HOH HOH A . 
D 3 HOH 130 430 430 HOH HOH A . 
D 3 HOH 131 431 431 HOH HOH A . 
D 3 HOH 132 432 432 HOH HOH A . 
D 3 HOH 133 433 433 HOH HOH A . 
D 3 HOH 134 434 434 HOH HOH A . 
D 3 HOH 135 435 435 HOH HOH A . 
D 3 HOH 136 436 436 HOH HOH A . 
D 3 HOH 137 437 437 HOH HOH A . 
D 3 HOH 138 438 438 HOH HOH A . 
D 3 HOH 139 439 439 HOH HOH A . 
D 3 HOH 140 440 440 HOH HOH A . 
D 3 HOH 141 441 441 HOH HOH A . 
D 3 HOH 142 442 442 HOH HOH A . 
D 3 HOH 143 443 443 HOH HOH A . 
D 3 HOH 144 444 444 HOH HOH A . 
D 3 HOH 145 445 445 HOH HOH A . 
D 3 HOH 146 446 446 HOH HOH A . 
D 3 HOH 147 447 447 HOH HOH A . 
D 3 HOH 148 448 448 HOH HOH A . 
D 3 HOH 149 449 449 HOH HOH A . 
D 3 HOH 150 450 450 HOH HOH A . 
D 3 HOH 151 451 451 HOH HOH A . 
D 3 HOH 152 452 452 HOH HOH A . 
D 3 HOH 153 453 453 HOH HOH A . 
D 3 HOH 154 454 454 HOH HOH A . 
D 3 HOH 155 455 455 HOH HOH A . 
D 3 HOH 156 456 456 HOH HOH A . 
D 3 HOH 157 457 457 HOH HOH A . 
D 3 HOH 158 458 458 HOH HOH A . 
D 3 HOH 159 459 459 HOH HOH A . 
D 3 HOH 160 460 460 HOH HOH A . 
D 3 HOH 161 461 461 HOH HOH A . 
D 3 HOH 162 462 462 HOH HOH A . 
D 3 HOH 163 463 463 HOH HOH A . 
D 3 HOH 164 464 464 HOH HOH A . 
D 3 HOH 165 465 465 HOH HOH A . 
D 3 HOH 166 466 466 HOH HOH A . 
D 3 HOH 167 467 467 HOH HOH A . 
D 3 HOH 168 468 468 HOH HOH A . 
D 3 HOH 169 469 469 HOH HOH A . 
D 3 HOH 170 470 470 HOH HOH A . 
D 3 HOH 171 471 471 HOH HOH A . 
D 3 HOH 172 472 472 HOH HOH A . 
D 3 HOH 173 473 473 HOH HOH A . 
D 3 HOH 174 474 474 HOH HOH A . 
D 3 HOH 175 475 475 HOH HOH A . 
D 3 HOH 176 476 476 HOH HOH A . 
D 3 HOH 177 477 477 HOH HOH A . 
D 3 HOH 178 478 478 HOH HOH A . 
D 3 HOH 179 479 479 HOH HOH A . 
D 3 HOH 180 480 480 HOH HOH A . 
D 3 HOH 181 481 481 HOH HOH A . 
D 3 HOH 182 482 482 HOH HOH A . 
D 3 HOH 183 483 483 HOH HOH A . 
D 3 HOH 184 484 484 HOH HOH A . 
D 3 HOH 185 485 485 HOH HOH A . 
D 3 HOH 186 486 486 HOH HOH A . 
D 3 HOH 187 487 487 HOH HOH A . 
D 3 HOH 188 488 488 HOH HOH A . 
D 3 HOH 189 489 489 HOH HOH A . 
D 3 HOH 190 490 490 HOH HOH A . 
D 3 HOH 191 491 491 HOH HOH A . 
D 3 HOH 192 492 492 HOH HOH A . 
D 3 HOH 193 493 493 HOH HOH A . 
D 3 HOH 194 494 494 HOH HOH A . 
D 3 HOH 195 495 495 HOH HOH A . 
D 3 HOH 196 496 496 HOH HOH A . 
D 3 HOH 197 497 497 HOH HOH A . 
D 3 HOH 198 498 498 HOH HOH A . 
D 3 HOH 199 499 499 HOH HOH A . 
D 3 HOH 200 500 500 HOH HOH A . 
D 3 HOH 201 501 501 HOH HOH A . 
D 3 HOH 202 502 502 HOH HOH A . 
D 3 HOH 203 503 503 HOH HOH A . 
D 3 HOH 204 504 504 HOH HOH A . 
D 3 HOH 205 505 505 HOH HOH A . 
D 3 HOH 206 506 506 HOH HOH A . 
D 3 HOH 207 507 507 HOH HOH A . 
D 3 HOH 208 508 508 HOH HOH A . 
D 3 HOH 209 509 509 HOH HOH A . 
D 3 HOH 210 510 510 HOH HOH A . 
D 3 HOH 211 511 511 HOH HOH A . 
D 3 HOH 212 512 512 HOH HOH A . 
D 3 HOH 213 513 513 HOH HOH A . 
D 3 HOH 214 514 514 HOH HOH A . 
D 3 HOH 215 515 515 HOH HOH A . 
D 3 HOH 216 516 516 HOH HOH A . 
D 3 HOH 217 517 517 HOH HOH A . 
D 3 HOH 218 518 518 HOH HOH A . 
D 3 HOH 219 519 519 HOH HOH A . 
D 3 HOH 220 520 520 HOH HOH A . 
D 3 HOH 221 521 521 HOH HOH A . 
D 3 HOH 222 522 522 HOH HOH A . 
D 3 HOH 223 523 523 HOH HOH A . 
D 3 HOH 224 524 524 HOH HOH A . 
D 3 HOH 225 525 525 HOH HOH A . 
D 3 HOH 226 526 526 HOH HOH A . 
D 3 HOH 227 527 527 HOH HOH A . 
D 3 HOH 228 528 528 HOH HOH A . 
D 3 HOH 229 529 529 HOH HOH A . 
D 3 HOH 230 530 530 HOH HOH A . 
D 3 HOH 231 531 531 HOH HOH A . 
D 3 HOH 232 532 532 HOH HOH A . 
D 3 HOH 233 533 533 HOH HOH A . 
D 3 HOH 234 534 534 HOH HOH A . 
D 3 HOH 235 535 535 HOH HOH A . 
D 3 HOH 236 536 536 HOH HOH A . 
D 3 HOH 237 537 537 HOH HOH A . 
D 3 HOH 238 538 538 HOH HOH A . 
D 3 HOH 239 539 539 HOH HOH A . 
D 3 HOH 240 540 540 HOH HOH A . 
D 3 HOH 241 541 541 HOH HOH A . 
D 3 HOH 242 542 542 HOH HOH A . 
D 3 HOH 243 543 543 HOH HOH A . 
D 3 HOH 244 544 544 HOH HOH A . 
D 3 HOH 245 545 545 HOH HOH A . 
D 3 HOH 246 546 546 HOH HOH A . 
D 3 HOH 247 547 547 HOH HOH A . 
D 3 HOH 248 548 548 HOH HOH A . 
D 3 HOH 249 549 549 HOH HOH A . 
D 3 HOH 250 550 550 HOH HOH A . 
D 3 HOH 251 551 551 HOH HOH A . 
D 3 HOH 252 552 552 HOH HOH A . 
D 3 HOH 253 553 553 HOH HOH A . 
D 3 HOH 254 554 554 HOH HOH A . 
D 3 HOH 255 555 555 HOH HOH A . 
D 3 HOH 256 556 556 HOH HOH A . 
D 3 HOH 257 557 557 HOH HOH A . 
D 3 HOH 258 558 558 HOH HOH A . 
D 3 HOH 259 559 559 HOH HOH A . 
D 3 HOH 260 560 560 HOH HOH A . 
D 3 HOH 261 561 561 HOH HOH A . 
D 3 HOH 262 562 562 HOH HOH A . 
D 3 HOH 263 563 563 HOH HOH A . 
D 3 HOH 264 564 564 HOH HOH A . 
D 3 HOH 265 565 565 HOH HOH A . 
D 3 HOH 266 566 566 HOH HOH A . 
D 3 HOH 267 567 567 HOH HOH A . 
D 3 HOH 268 568 568 HOH HOH A . 
D 3 HOH 269 569 569 HOH HOH A . 
D 3 HOH 270 570 570 HOH HOH A . 
D 3 HOH 271 571 571 HOH HOH A . 
D 3 HOH 272 572 572 HOH HOH A . 
D 3 HOH 273 573 573 HOH HOH A . 
D 3 HOH 274 574 574 HOH HOH A . 
D 3 HOH 275 575 575 HOH HOH A . 
D 3 HOH 276 576 576 HOH HOH A . 
D 3 HOH 277 577 577 HOH HOH A . 
D 3 HOH 278 578 578 HOH HOH A . 
D 3 HOH 279 579 579 HOH HOH A . 
D 3 HOH 280 580 580 HOH HOH A . 
D 3 HOH 281 581 581 HOH HOH A . 
D 3 HOH 282 582 582 HOH HOH A . 
D 3 HOH 283 583 583 HOH HOH A . 
D 3 HOH 284 584 584 HOH HOH A . 
D 3 HOH 285 585 585 HOH HOH A . 
D 3 HOH 286 586 586 HOH HOH A . 
D 3 HOH 287 587 587 HOH HOH A . 
D 3 HOH 288 588 588 HOH HOH A . 
D 3 HOH 289 589 589 HOH HOH A . 
D 3 HOH 290 590 590 HOH HOH A . 
D 3 HOH 291 591 591 HOH HOH A . 
D 3 HOH 292 592 592 HOH HOH A . 
D 3 HOH 293 593 593 HOH HOH A . 
D 3 HOH 294 594 594 HOH HOH A . 
D 3 HOH 295 595 595 HOH HOH A . 
D 3 HOH 296 596 596 HOH HOH A . 
D 3 HOH 297 597 597 HOH HOH A . 
D 3 HOH 298 598 598 HOH HOH A . 
D 3 HOH 299 599 599 HOH HOH A . 
D 3 HOH 300 600 600 HOH HOH A . 
D 3 HOH 301 601 601 HOH HOH A . 
D 3 HOH 302 602 602 HOH HOH A . 
D 3 HOH 303 603 603 HOH HOH A . 
D 3 HOH 304 604 604 HOH HOH A . 
D 3 HOH 305 605 605 HOH HOH A . 
D 3 HOH 306 606 606 HOH HOH A . 
D 3 HOH 307 607 607 HOH HOH A . 
D 3 HOH 308 608 608 HOH HOH A . 
D 3 HOH 309 609 609 HOH HOH A . 
D 3 HOH 310 610 610 HOH HOH A . 
D 3 HOH 311 611 611 HOH HOH A . 
D 3 HOH 312 612 612 HOH HOH A . 
D 3 HOH 313 613 613 HOH HOH A . 
D 3 HOH 314 614 614 HOH HOH A . 
D 3 HOH 315 615 615 HOH HOH A . 
D 3 HOH 316 616 616 HOH HOH A . 
D 3 HOH 317 617 617 HOH HOH A . 
D 3 HOH 318 618 618 HOH HOH A . 
D 3 HOH 319 619 619 HOH HOH A . 
D 3 HOH 320 620 620 HOH HOH A . 
D 3 HOH 321 621 621 HOH HOH A . 
D 3 HOH 322 622 622 HOH HOH A . 
D 3 HOH 323 623 623 HOH HOH A . 
D 3 HOH 324 624 624 HOH HOH A . 
D 3 HOH 325 625 625 HOH HOH A . 
D 3 HOH 326 626 626 HOH HOH A . 
D 3 HOH 327 627 627 HOH HOH A . 
D 3 HOH 328 628 628 HOH HOH A . 
D 3 HOH 329 629 629 HOH HOH A . 
D 3 HOH 330 630 630 HOH HOH A . 
D 3 HOH 331 631 631 HOH HOH A . 
D 3 HOH 332 632 632 HOH HOH A . 
D 3 HOH 333 633 633 HOH HOH A . 
D 3 HOH 334 634 634 HOH HOH A . 
D 3 HOH 335 635 635 HOH HOH A . 
D 3 HOH 336 636 636 HOH HOH A . 
D 3 HOH 337 637 637 HOH HOH A . 
D 3 HOH 338 638 638 HOH HOH A . 
D 3 HOH 339 639 639 HOH HOH A . 
D 3 HOH 340 640 640 HOH HOH A . 
D 3 HOH 341 641 641 HOH HOH A . 
D 3 HOH 342 642 642 HOH HOH A . 
D 3 HOH 343 643 643 HOH HOH A . 
D 3 HOH 344 644 644 HOH HOH A . 
D 3 HOH 345 645 645 HOH HOH A . 
D 3 HOH 346 646 646 HOH HOH A . 
D 3 HOH 347 647 647 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-10-13 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-03-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'              
2 5 'Structure model' '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 'model building' . ? 1 
SHELXL-97 refinement       . ? 2 
X-GEN     'data reduction' . ? 3 
X-GEN     'data scaling'   . ? 4 
SHELXL-97 phasing          . ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             229 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OXT 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             229 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.557 
_pdbx_validate_rmsd_bond.bond_target_value         1.229 
_pdbx_validate_rmsd_bond.bond_deviation            0.328 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE  A ARG 31  ? ? CZ A ARG 31  ? ? NH2 A ARG 31  ? ? 117.12 120.30 -3.18 0.50 N 
2 1 NE  A ARG 179 ? ? CZ A ARG 179 ? ? NH2 A ARG 179 ? ? 114.86 120.30 -5.44 0.50 N 
3 1 NH1 A ARG 195 ? ? CZ A ARG 195 ? ? NH2 A ARG 195 ? ? 127.26 119.40 7.86  1.10 N 
4 1 NE  A ARG 195 ? ? CZ A ARG 195 ? ? NH2 A ARG 195 ? ? 113.82 120.30 -6.48 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 63  ? ? -115.31 -80.84  
2 1 GLN A 71  ? ? -90.59  -74.23  
3 1 HIS A 73  ? ? -143.59 25.66   
4 1 PHE A 77  ? ? 73.22   -12.61  
5 1 THR A 99  ? ? -131.37 -38.65  
6 1 LEU A 139 ? ? -81.05  -150.95 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
3 1 Y 1 A ASN 3 ? A ASN 3 
4 1 Y 1 A GLU 4 ? A GLU 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
#