data_3EWS
# 
_entry.id   3EWS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3EWS         
RCSB  RCSB049864   
WWPDB D_1000049864 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3EWS 
_pdbx_database_status.recvd_initial_deposition_date   2008-10-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lehtio, l.'                           1  
'Karlberg, t.'                         2  
'Andersson, j.'                        3  
'Arrowsmith, c.h.'                     4  
'Berglund, h.'                         5  
'Bountra, c.'                          6  
'Collins, r.'                          7  
'Dahlgren, l.g.'                       8  
'Edwards, a.m.'                        9  
'Flodin, s.'                           10 
'Flores, a.'                           11 
'Graslund, s.'                         12 
'Hammarstrom, m.'                      13 
'Johansson, a.'                        14 
'Johansson, i.'                        15 
'Kotenyova, t.'                        16 
'Moche, m.'                            17 
'Nilsson, m.e.'                        18 
'Nordlund, p.'                         19 
'Nyman, t.'                            20 
'Olesen, k.'                           21 
'Persson, c.'                          22 
'Sagemark, j.'                         23 
'Thorsell, a.g.'                       24 
'Tresaugues, l.'                       25 
'Van den berg, s.'                     26 
'Weigelt, j.'                          27 
'Welin, m.'                            28 
'Wikstrom, m.'                         29 
'Wisniewska, m.'                       30 
'Schueler, h.'                         31 
'Structural Genomics Consortium (SGC)' 32 
# 
_citation.id                        primary 
_citation.title                     'The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                10296 
_citation.page_last                 10300 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19244245 
_citation.pdbx_database_id_DOI      10.1074/jbc.C900018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Collins, R.'      1 
primary 'Karlberg, T.'     2 
primary 'Lehtio, L.'       3 
primary 'Schutz, P.'       4 
primary 'van den Berg, S.' 5 
primary 'Dahlgren, L.G.'   6 
primary 'Hammarstrom, M.'  7 
primary 'Weigelt, J.'      8 
primary 'Schuler, H.'      9 
# 
_cell.entry_id           3EWS 
_cell.length_a           81.580 
_cell.length_b           47.610 
_cell.length_c           124.690 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3EWS 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-dependent RNA helicase DDX19B' 50496.910 2  3.6.1.- ? 
'Helicase ATP-binding domain, Helicase C-terminal domain, UNP residues 54-475' ? 
2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"          427.201   2  ?       ? ? ? 
3 water       nat water                               18.015    26 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DEAD box protein 19B, DEAD box RNA helicase DEAD5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAM
GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYP
ELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQM
LLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLA
AELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRT
GRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAM
GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYP
ELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQM
LLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLA
AELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRT
GRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  GLU n 
1 25  ASP n 
1 26  ARG n 
1 27  ALA n 
1 28  ALA n 
1 29  GLN n 
1 30  SER n 
1 31  LEU n 
1 32  LEU n 
1 33  ASN n 
1 34  LYS n 
1 35  LEU n 
1 36  ILE n 
1 37  ARG n 
1 38  SER n 
1 39  ASN n 
1 40  LEU n 
1 41  VAL n 
1 42  ASP n 
1 43  ASN n 
1 44  THR n 
1 45  ASN n 
1 46  GLN n 
1 47  VAL n 
1 48  GLU n 
1 49  VAL n 
1 50  LEU n 
1 51  GLN n 
1 52  ARG n 
1 53  ASP n 
1 54  PRO n 
1 55  ASN n 
1 56  SER n 
1 57  PRO n 
1 58  LEU n 
1 59  TYR n 
1 60  SER n 
1 61  VAL n 
1 62  LYS n 
1 63  SER n 
1 64  PHE n 
1 65  GLU n 
1 66  GLU n 
1 67  LEU n 
1 68  ARG n 
1 69  LEU n 
1 70  LYS n 
1 71  PRO n 
1 72  GLN n 
1 73  LEU n 
1 74  LEU n 
1 75  GLN n 
1 76  GLY n 
1 77  VAL n 
1 78  TYR n 
1 79  ALA n 
1 80  MET n 
1 81  GLY n 
1 82  PHE n 
1 83  ASN n 
1 84  ARG n 
1 85  PRO n 
1 86  SER n 
1 87  LYS n 
1 88  ILE n 
1 89  GLN n 
1 90  GLU n 
1 91  ASN n 
1 92  ALA n 
1 93  LEU n 
1 94  PRO n 
1 95  LEU n 
1 96  MET n 
1 97  LEU n 
1 98  ALA n 
1 99  GLU n 
1 100 PRO n 
1 101 PRO n 
1 102 GLN n 
1 103 ASN n 
1 104 LEU n 
1 105 ILE n 
1 106 ALA n 
1 107 GLN n 
1 108 SER n 
1 109 GLN n 
1 110 SER n 
1 111 GLY n 
1 112 THR n 
1 113 GLY n 
1 114 LYS n 
1 115 THR n 
1 116 ALA n 
1 117 ALA n 
1 118 PHE n 
1 119 VAL n 
1 120 LEU n 
1 121 ALA n 
1 122 MET n 
1 123 LEU n 
1 124 SER n 
1 125 GLN n 
1 126 VAL n 
1 127 GLU n 
1 128 PRO n 
1 129 ALA n 
1 130 ASN n 
1 131 LYS n 
1 132 TYR n 
1 133 PRO n 
1 134 GLN n 
1 135 CYS n 
1 136 LEU n 
1 137 CYS n 
1 138 LEU n 
1 139 SER n 
1 140 PRO n 
1 141 THR n 
1 142 TYR n 
1 143 GLU n 
1 144 LEU n 
1 145 ALA n 
1 146 LEU n 
1 147 GLN n 
1 148 THR n 
1 149 GLY n 
1 150 LYS n 
1 151 VAL n 
1 152 ILE n 
1 153 GLU n 
1 154 GLN n 
1 155 MET n 
1 156 GLY n 
1 157 LYS n 
1 158 PHE n 
1 159 TYR n 
1 160 PRO n 
1 161 GLU n 
1 162 LEU n 
1 163 LYS n 
1 164 LEU n 
1 165 ALA n 
1 166 TYR n 
1 167 ALA n 
1 168 VAL n 
1 169 ARG n 
1 170 GLY n 
1 171 ASN n 
1 172 LYS n 
1 173 LEU n 
1 174 GLU n 
1 175 ARG n 
1 176 GLY n 
1 177 GLN n 
1 178 LYS n 
1 179 ILE n 
1 180 SER n 
1 181 GLU n 
1 182 GLN n 
1 183 ILE n 
1 184 VAL n 
1 185 ILE n 
1 186 GLY n 
1 187 THR n 
1 188 PRO n 
1 189 GLY n 
1 190 THR n 
1 191 VAL n 
1 192 LEU n 
1 193 ASP n 
1 194 TRP n 
1 195 CYS n 
1 196 SER n 
1 197 LYS n 
1 198 LEU n 
1 199 LYS n 
1 200 PHE n 
1 201 ILE n 
1 202 ASP n 
1 203 PRO n 
1 204 LYS n 
1 205 LYS n 
1 206 ILE n 
1 207 LYS n 
1 208 VAL n 
1 209 PHE n 
1 210 VAL n 
1 211 LEU n 
1 212 ASP n 
1 213 GLU n 
1 214 ALA n 
1 215 ASP n 
1 216 VAL n 
1 217 MET n 
1 218 ILE n 
1 219 ALA n 
1 220 THR n 
1 221 GLN n 
1 222 GLY n 
1 223 HIS n 
1 224 GLN n 
1 225 ASP n 
1 226 GLN n 
1 227 SER n 
1 228 ILE n 
1 229 ARG n 
1 230 ILE n 
1 231 GLN n 
1 232 ARG n 
1 233 MET n 
1 234 LEU n 
1 235 PRO n 
1 236 ARG n 
1 237 ASN n 
1 238 CYS n 
1 239 GLN n 
1 240 MET n 
1 241 LEU n 
1 242 LEU n 
1 243 PHE n 
1 244 SER n 
1 245 ALA n 
1 246 THR n 
1 247 PHE n 
1 248 GLU n 
1 249 ASP n 
1 250 SER n 
1 251 VAL n 
1 252 TRP n 
1 253 LYS n 
1 254 PHE n 
1 255 ALA n 
1 256 GLN n 
1 257 LYS n 
1 258 VAL n 
1 259 VAL n 
1 260 PRO n 
1 261 ASP n 
1 262 PRO n 
1 263 ASN n 
1 264 VAL n 
1 265 ILE n 
1 266 LYS n 
1 267 LEU n 
1 268 LYS n 
1 269 ARG n 
1 270 GLU n 
1 271 GLU n 
1 272 GLU n 
1 273 THR n 
1 274 LEU n 
1 275 ASP n 
1 276 THR n 
1 277 ILE n 
1 278 LYS n 
1 279 GLN n 
1 280 TYR n 
1 281 TYR n 
1 282 VAL n 
1 283 LEU n 
1 284 CYS n 
1 285 SER n 
1 286 SER n 
1 287 ARG n 
1 288 ASP n 
1 289 GLU n 
1 290 LYS n 
1 291 PHE n 
1 292 GLN n 
1 293 ALA n 
1 294 LEU n 
1 295 CYS n 
1 296 ASN n 
1 297 LEU n 
1 298 TYR n 
1 299 GLY n 
1 300 ALA n 
1 301 ILE n 
1 302 THR n 
1 303 ILE n 
1 304 ALA n 
1 305 GLN n 
1 306 ALA n 
1 307 MET n 
1 308 ILE n 
1 309 PHE n 
1 310 CYS n 
1 311 HIS n 
1 312 THR n 
1 313 ARG n 
1 314 LYS n 
1 315 THR n 
1 316 ALA n 
1 317 SER n 
1 318 TRP n 
1 319 LEU n 
1 320 ALA n 
1 321 ALA n 
1 322 GLU n 
1 323 LEU n 
1 324 SER n 
1 325 LYS n 
1 326 GLU n 
1 327 GLY n 
1 328 HIS n 
1 329 GLN n 
1 330 VAL n 
1 331 ALA n 
1 332 LEU n 
1 333 LEU n 
1 334 SER n 
1 335 GLY n 
1 336 GLU n 
1 337 MET n 
1 338 MET n 
1 339 VAL n 
1 340 GLU n 
1 341 GLN n 
1 342 ARG n 
1 343 ALA n 
1 344 ALA n 
1 345 VAL n 
1 346 ILE n 
1 347 GLU n 
1 348 ARG n 
1 349 PHE n 
1 350 ARG n 
1 351 GLU n 
1 352 GLY n 
1 353 LYS n 
1 354 GLU n 
1 355 LYS n 
1 356 VAL n 
1 357 LEU n 
1 358 VAL n 
1 359 THR n 
1 360 THR n 
1 361 ASN n 
1 362 VAL n 
1 363 CYS n 
1 364 ALA n 
1 365 ARG n 
1 366 GLY n 
1 367 ILE n 
1 368 ASP n 
1 369 VAL n 
1 370 GLU n 
1 371 GLN n 
1 372 VAL n 
1 373 SER n 
1 374 VAL n 
1 375 VAL n 
1 376 ILE n 
1 377 ASN n 
1 378 PHE n 
1 379 ASP n 
1 380 LEU n 
1 381 PRO n 
1 382 VAL n 
1 383 ASP n 
1 384 LYS n 
1 385 ASP n 
1 386 GLY n 
1 387 ASN n 
1 388 PRO n 
1 389 ASP n 
1 390 ASN n 
1 391 GLU n 
1 392 THR n 
1 393 TYR n 
1 394 LEU n 
1 395 HIS n 
1 396 ARG n 
1 397 ILE n 
1 398 GLY n 
1 399 ARG n 
1 400 THR n 
1 401 GLY n 
1 402 ARG n 
1 403 PHE n 
1 404 GLY n 
1 405 LYS n 
1 406 ARG n 
1 407 GLY n 
1 408 LEU n 
1 409 ALA n 
1 410 VAL n 
1 411 ASN n 
1 412 MET n 
1 413 VAL n 
1 414 ASP n 
1 415 SER n 
1 416 LYS n 
1 417 HIS n 
1 418 SER n 
1 419 MET n 
1 420 ASN n 
1 421 ILE n 
1 422 LEU n 
1 423 ASN n 
1 424 ARG n 
1 425 ILE n 
1 426 GLN n 
1 427 GLU n 
1 428 HIS n 
1 429 PHE n 
1 430 ASN n 
1 431 LYS n 
1 432 LYS n 
1 433 ILE n 
1 434 GLU n 
1 435 ARG n 
1 436 LEU n 
1 437 ASP n 
1 438 THR n 
1 439 ASP n 
1 440 ASP n 
1 441 LEU n 
1 442 ASP n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DBP5, DDX19, DDX19B' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)R3 pRARE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DD19B_HUMAN 
_struct_ref.pdbx_db_accession          Q9UMR2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQN
LIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQI
VIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPN
VIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRA
AVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILN
RIQEHFNKKIERLDTDDLDEIE
;
_struct_ref.pdbx_align_begin           54 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3EWS A 24 ? 445 ? Q9UMR2 54 ? 475 ? 54 475 
2 1 3EWS B 24 ? 445 ? Q9UMR2 54 ? 475 ? 54 475 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3EWS MET A 1  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 31 1  
1 3EWS HIS A 2  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 32 2  
1 3EWS HIS A 3  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 33 3  
1 3EWS HIS A 4  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 34 4  
1 3EWS HIS A 5  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 35 5  
1 3EWS HIS A 6  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 36 6  
1 3EWS HIS A 7  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 37 7  
1 3EWS SER A 8  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 38 8  
1 3EWS SER A 9  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 39 9  
1 3EWS GLY A 10 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 40 10 
1 3EWS VAL A 11 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 41 11 
1 3EWS ASP A 12 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 42 12 
1 3EWS LEU A 13 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 43 13 
1 3EWS GLY A 14 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 44 14 
1 3EWS THR A 15 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 45 15 
1 3EWS GLU A 16 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 46 16 
1 3EWS ASN A 17 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 47 17 
1 3EWS LEU A 18 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 48 18 
1 3EWS TYR A 19 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 49 19 
1 3EWS PHE A 20 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 50 20 
1 3EWS GLN A 21 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 51 21 
1 3EWS SER A 22 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 52 22 
1 3EWS MET A 23 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 53 23 
2 3EWS MET B 1  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 31 24 
2 3EWS HIS B 2  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 32 25 
2 3EWS HIS B 3  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 33 26 
2 3EWS HIS B 4  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 34 27 
2 3EWS HIS B 5  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 35 28 
2 3EWS HIS B 6  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 36 29 
2 3EWS HIS B 7  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 37 30 
2 3EWS SER B 8  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 38 31 
2 3EWS SER B 9  ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 39 32 
2 3EWS GLY B 10 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 40 33 
2 3EWS VAL B 11 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 41 34 
2 3EWS ASP B 12 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 42 35 
2 3EWS LEU B 13 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 43 36 
2 3EWS GLY B 14 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 44 37 
2 3EWS THR B 15 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 45 38 
2 3EWS GLU B 16 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 46 39 
2 3EWS ASN B 17 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 47 40 
2 3EWS LEU B 18 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 48 41 
2 3EWS TYR B 19 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 49 42 
2 3EWS PHE B 20 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 50 43 
2 3EWS GLN B 21 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 51 44 
2 3EWS SER B 22 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 52 45 
2 3EWS MET B 23 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 53 46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3EWS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.1M ammonium acetate, 0.1M Bis-Tris, 17% PEG-10000, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'Rayonics MX-225' 
_diffrn_detector.pdbx_collection_date   2007-12-21 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si-111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918410 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.2' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.918410 
# 
_reflns.entry_id                     3EWS 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   26518 
_reflns.number_all                   26518 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.51 
_reflns.B_iso_Wilson_estimate        52.72 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.396 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.27 
_reflns_shell.pdbx_redundancy        4.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2752 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3EWS 
_refine.ls_number_reflns_obs                     26516 
_refine.ls_number_reflns_all                     26516 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.859 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    99.44 
_refine.ls_R_factor_obs                          0.1918 
_refine.ls_R_factor_all                          0.1918 
_refine.ls_R_factor_R_work                       0.1882 
_refine.ls_R_factor_R_free                       0.2597 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1326 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.321 
_refine.solvent_model_param_bsol                 52.450 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'Isotropic + TLS' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.42 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6428 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             26 
_refine_hist.number_atoms_total               6508 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        19.859 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_angle_deg        0.786  ? ? ? 'X-RAY DIFFRACTION' ? 
f_bond_d           0.004  ? ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.157 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.7000 2.8079  2784 0.2277 100.00 0.3121 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 2.8079 2.9353  2748 0.2201 99.00  0.3284 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 2.9353 3.0895  2761 0.2141 99.00  0.3129 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.0895 3.2822  2791 0.2098 100.00 0.3050 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 3.2822 3.5343  2775 0.1947 100.00 0.2758 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 3.5343 3.8876  2794 0.1901 99.00  0.2478 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 3.8876 4.4447  2809 0.1617 100.00 0.2730 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 4.4447 5.5792  2836 0.1491 100.00 0.2011 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 5.5792 19.8592 2892 0.1674 99.00  0.2014 . . 153 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3EWS 
_struct.title                     'Human DEAD-box RNA-helicase DDX19 in complex with ADP' 
_struct.pdbx_descriptor           'DDX19 (E.C.3.6.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3EWS 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;RNA HELICASE, DEAD, ADP, Structural Genomics, Structural Genomics Consortium, SGC, rRNA, ATP-binding, Hydrolase, Nucleotide-binding, RNA-binding, mRNA, Alternative splicing, Cytoplasm, Helicase, Membrane, mRNA transport, Nuclear pore complex, Nucleus, Protein transport, Translocation, Transport
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 25  ? ARG A 37  ? ASP A 55  ARG A 67  1 ? 13 
HELX_P HELX_P2  2  PHE A 64  ? ARG A 68  ? PHE A 94  ARG A 98  5 ? 5  
HELX_P HELX_P3  3  LYS A 70  ? MET A 80  ? LYS A 100 MET A 110 1 ? 11 
HELX_P HELX_P4  4  ILE A 88  ? LEU A 97  ? ILE A 118 LEU A 127 1 ? 10 
HELX_P HELX_P5  5  GLY A 113 ? VAL A 126 ? GLY A 143 VAL A 156 1 ? 14 
HELX_P HELX_P6  6  THR A 141 ? GLY A 156 ? THR A 171 GLY A 186 1 ? 16 
HELX_P HELX_P7  7  THR A 187 ? SER A 196 ? THR A 217 SER A 226 1 ? 10 
HELX_P HELX_P8  8  ASP A 202 ? ILE A 206 ? ASP A 232 ILE A 236 5 ? 5  
HELX_P HELX_P9  9  GLU A 213 ? ILE A 218 ? GLU A 243 ILE A 248 1 ? 6  
HELX_P HELX_P10 10 THR A 220 ? ARG A 232 ? THR A 250 ARG A 262 1 ? 13 
HELX_P HELX_P11 11 GLU A 248 ? VAL A 259 ? GLU A 278 VAL A 289 1 ? 12 
HELX_P HELX_P12 12 THR A 273 ? ASP A 275 ? THR A 303 ASP A 305 5 ? 3  
HELX_P HELX_P13 13 SER A 286 ? ILE A 301 ? SER A 316 ILE A 331 1 ? 16 
HELX_P HELX_P14 14 THR A 312 ? GLU A 326 ? THR A 342 GLU A 356 1 ? 15 
HELX_P HELX_P15 15 MET A 338 ? GLU A 351 ? MET A 368 GLU A 381 1 ? 14 
HELX_P HELX_P16 16 ASN A 361 ? ARG A 365 ? ASN A 391 ARG A 395 1 ? 5  
HELX_P HELX_P17 17 ASP A 389 ? GLY A 398 ? ASP A 419 GLY A 428 1 ? 10 
HELX_P HELX_P18 18 SER A 415 ? PHE A 429 ? SER A 445 PHE A 459 1 ? 15 
HELX_P HELX_P19 19 ASP B 25  ? ARG B 37  ? ASP B 55  ARG B 67  1 ? 13 
HELX_P HELX_P20 20 PHE B 64  ? ARG B 68  ? PHE B 94  ARG B 98  5 ? 5  
HELX_P HELX_P21 21 LYS B 70  ? MET B 80  ? LYS B 100 MET B 110 1 ? 11 
HELX_P HELX_P22 22 ILE B 88  ? LEU B 97  ? ILE B 118 LEU B 127 1 ? 10 
HELX_P HELX_P23 23 GLY B 113 ? VAL B 126 ? GLY B 143 VAL B 156 1 ? 14 
HELX_P HELX_P24 24 THR B 141 ? GLY B 156 ? THR B 171 GLY B 186 1 ? 16 
HELX_P HELX_P25 25 THR B 187 ? LYS B 197 ? THR B 217 LYS B 227 1 ? 11 
HELX_P HELX_P26 26 ASP B 202 ? ILE B 206 ? ASP B 232 ILE B 236 5 ? 5  
HELX_P HELX_P27 27 GLU B 213 ? ILE B 218 ? GLU B 243 ILE B 248 1 ? 6  
HELX_P HELX_P28 28 THR B 220 ? MET B 233 ? THR B 250 MET B 263 1 ? 14 
HELX_P HELX_P29 29 GLU B 248 ? ALA B 255 ? GLU B 278 ALA B 285 1 ? 8  
HELX_P HELX_P30 30 SER B 286 ? ILE B 301 ? SER B 316 ILE B 331 1 ? 16 
HELX_P HELX_P31 31 THR B 312 ? LYS B 325 ? THR B 342 LYS B 355 1 ? 14 
HELX_P HELX_P32 32 MET B 338 ? GLU B 351 ? MET B 368 GLU B 381 1 ? 14 
HELX_P HELX_P33 33 ASP B 389 ? ARG B 399 ? ASP B 419 ARG B 429 1 ? 11 
HELX_P HELX_P34 34 SER B 415 ? ASN B 430 ? SER B 445 ASN B 460 1 ? 16 
HELX_P HELX_P35 35 ASP B 437 ? LEU B 441 ? ASP B 467 LEU B 471 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           99 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            129 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    100 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     130 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 7 ? 
C ? 7 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 48  ? LEU A 50  ? GLU A 78  LEU A 80  
A 2 PRO A 262 ? LYS A 266 ? PRO A 292 LYS A 296 
A 3 ASN A 103 ? GLN A 107 ? ASN A 133 GLN A 137 
A 4 GLN A 239 ? SER A 244 ? GLN A 269 SER A 274 
A 5 VAL A 208 ? LEU A 211 ? VAL A 238 LEU A 241 
A 6 CYS A 135 ? LEU A 138 ? CYS A 165 LEU A 168 
A 7 ILE A 183 ? GLY A 186 ? ILE A 213 GLY A 216 
A 8 LEU A 164 ? ALA A 167 ? LEU A 194 ALA A 197 
B 1 ALA A 331 ? LEU A 333 ? ALA A 361 LEU A 363 
B 2 VAL A 356 ? THR A 360 ? VAL A 386 THR A 390 
B 3 ALA A 306 ? CYS A 310 ? ALA A 336 CYS A 340 
B 4 VAL A 374 ? ASN A 377 ? VAL A 404 ASN A 407 
B 5 GLY A 407 ? VAL A 413 ? GLY A 437 VAL A 443 
B 6 ILE A 277 ? LEU A 283 ? ILE A 307 LEU A 313 
B 7 GLU A 434 ? ARG A 435 ? GLU A 464 ARG A 465 
C 1 LEU B 164 ? ALA B 167 ? LEU B 194 ALA B 197 
C 2 ILE B 183 ? GLY B 186 ? ILE B 213 GLY B 216 
C 3 CYS B 135 ? LEU B 138 ? CYS B 165 LEU B 168 
C 4 VAL B 208 ? LEU B 211 ? VAL B 238 LEU B 241 
C 5 GLN B 239 ? SER B 244 ? GLN B 269 SER B 274 
C 6 LEU B 104 ? GLN B 107 ? LEU B 134 GLN B 137 
C 7 ILE B 265 ? LYS B 266 ? ILE B 295 LYS B 296 
D 1 ALA B 331 ? LEU B 333 ? ALA B 361 LEU B 363 
D 2 VAL B 356 ? THR B 360 ? VAL B 386 THR B 390 
D 3 ALA B 306 ? CYS B 310 ? ALA B 336 CYS B 340 
D 4 VAL B 374 ? ASN B 377 ? VAL B 404 ASN B 407 
D 5 GLY B 407 ? VAL B 413 ? GLY B 437 VAL B 443 
D 6 ILE B 277 ? LEU B 283 ? ILE B 307 LEU B 313 
D 7 GLU B 434 ? ARG B 435 ? GLU B 464 ARG B 465 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 48  ? N GLU A 78  O LYS A 266 ? O LYS A 296 
A 2 3 O ILE A 265 ? O ILE A 295 N GLN A 107 ? N GLN A 137 
A 3 4 N ALA A 106 ? N ALA A 136 O LEU A 242 ? O LEU A 272 
A 4 5 O LEU A 241 ? O LEU A 271 N LEU A 211 ? N LEU A 241 
A 5 6 O VAL A 208 ? O VAL A 238 N LEU A 136 ? N LEU A 166 
A 6 7 N CYS A 135 ? N CYS A 165 O VAL A 184 ? O VAL A 214 
A 7 8 O ILE A 185 ? O ILE A 215 N ALA A 167 ? N ALA A 197 
B 1 2 N ALA A 331 ? N ALA A 361 O VAL A 358 ? O VAL A 388 
B 2 3 O LEU A 357 ? O LEU A 387 N ILE A 308 ? N ILE A 338 
B 3 4 N MET A 307 ? N MET A 337 O ILE A 376 ? O ILE A 406 
B 4 5 N VAL A 375 ? N VAL A 405 O LEU A 408 ? O LEU A 438 
B 5 6 O ASN A 411 ? O ASN A 441 N VAL A 282 ? N VAL A 312 
B 6 7 N TYR A 281 ? N TYR A 311 O GLU A 434 ? O GLU A 464 
C 1 2 N ALA B 167 ? N ALA B 197 O ILE B 185 ? O ILE B 215 
C 2 3 O VAL B 184 ? O VAL B 214 N CYS B 137 ? N CYS B 167 
C 3 4 N LEU B 138 ? N LEU B 168 O VAL B 210 ? O VAL B 240 
C 4 5 N PHE B 209 ? N PHE B 239 O LEU B 241 ? O LEU B 271 
C 5 6 O MET B 240 ? O MET B 270 N LEU B 104 ? N LEU B 134 
C 6 7 N ILE B 105 ? N ILE B 135 O ILE B 265 ? O ILE B 295 
D 1 2 N ALA B 331 ? N ALA B 361 O VAL B 358 ? O VAL B 388 
D 2 3 O LEU B 357 ? O LEU B 387 N ILE B 308 ? N ILE B 338 
D 3 4 N MET B 307 ? N MET B 337 O ILE B 376 ? O ILE B 406 
D 4 5 N VAL B 375 ? N VAL B 405 O LEU B 408 ? O LEU B 438 
D 5 6 O ALA B 409 ? O ALA B 439 N LYS B 278 ? N LYS B 308 
D 6 7 N GLN B 279 ? N GLN B 309 O GLU B 434 ? O GLU B 464 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP A 602' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP B 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 HOH E .   ? HOH A 6   . ? 1_555 ? 
2  AC1 15 ASN A 39  ? ASN A 69  . ? 1_555 ? 
3  AC1 15 LEU A 40  ? LEU A 70  . ? 1_555 ? 
4  AC1 15 PHE A 64  ? PHE A 94  . ? 1_555 ? 
5  AC1 15 PHE A 82  ? PHE A 112 . ? 1_555 ? 
6  AC1 15 ARG A 84  ? ARG A 114 . ? 1_555 ? 
7  AC1 15 PRO A 85  ? PRO A 115 . ? 1_555 ? 
8  AC1 15 GLN A 89  ? GLN A 119 . ? 1_555 ? 
9  AC1 15 SER A 110 ? SER A 140 . ? 1_555 ? 
10 AC1 15 GLY A 111 ? GLY A 141 . ? 1_555 ? 
11 AC1 15 THR A 112 ? THR A 142 . ? 1_555 ? 
12 AC1 15 GLY A 113 ? GLY A 143 . ? 1_555 ? 
13 AC1 15 LYS A 114 ? LYS A 144 . ? 1_555 ? 
14 AC1 15 THR A 115 ? THR A 145 . ? 1_555 ? 
15 AC1 15 ALA A 116 ? ALA A 146 . ? 1_555 ? 
16 AC2 14 ASN B 39  ? ASN B 69  . ? 1_555 ? 
17 AC2 14 LEU B 40  ? LEU B 70  . ? 1_555 ? 
18 AC2 14 PHE B 64  ? PHE B 94  . ? 1_555 ? 
19 AC2 14 PHE B 82  ? PHE B 112 . ? 1_555 ? 
20 AC2 14 ARG B 84  ? ARG B 114 . ? 1_555 ? 
21 AC2 14 PRO B 85  ? PRO B 115 . ? 1_555 ? 
22 AC2 14 GLN B 89  ? GLN B 119 . ? 1_555 ? 
23 AC2 14 SER B 110 ? SER B 140 . ? 1_555 ? 
24 AC2 14 GLY B 111 ? GLY B 141 . ? 1_555 ? 
25 AC2 14 THR B 112 ? THR B 142 . ? 1_555 ? 
26 AC2 14 GLY B 113 ? GLY B 143 . ? 1_555 ? 
27 AC2 14 LYS B 114 ? LYS B 144 . ? 1_555 ? 
28 AC2 14 THR B 115 ? THR B 145 . ? 1_555 ? 
29 AC2 14 ALA B 116 ? ALA B 146 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3EWS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3EWS 
_atom_sites.fract_transf_matrix[1][1]   0.012258 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001160 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021004 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008056 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 23  ? 37.346  16.055  30.294 1.00 110.24 ? 53  MET A N     1 
ATOM   2    C CA    . MET A 1 23  ? 36.453  15.262  29.449 1.00 115.30 ? 53  MET A CA    1 
ATOM   3    C C     . MET A 1 23  ? 36.308  13.829  29.973 1.00 124.06 ? 53  MET A C     1 
ATOM   4    O O     . MET A 1 23  ? 37.304  13.126  30.176 1.00 124.97 ? 53  MET A O     1 
ATOM   5    C CB    . MET A 1 23  ? 36.963  15.248  28.003 1.00 114.33 ? 53  MET A CB    1 
ATOM   6    N N     . GLU A 1 24  ? 35.066  13.403  30.190 1.00 126.31 ? 54  GLU A N     1 
ATOM   7    C CA    . GLU A 1 24  ? 34.798  12.082  30.750 1.00 117.33 ? 54  GLU A CA    1 
ATOM   8    C C     . GLU A 1 24  ? 33.601  11.368  30.112 1.00 110.70 ? 54  GLU A C     1 
ATOM   9    O O     . GLU A 1 24  ? 32.449  11.613  30.477 1.00 106.79 ? 54  GLU A O     1 
ATOM   10   C CB    . GLU A 1 24  ? 34.607  12.169  32.265 1.00 107.71 ? 54  GLU A CB    1 
ATOM   11   N N     . ASP A 1 25  ? 33.891  10.486  29.159 1.00 102.66 ? 55  ASP A N     1 
ATOM   12   C CA    . ASP A 1 25  ? 32.898  9.583   28.583 1.00 84.77  ? 55  ASP A CA    1 
ATOM   13   C C     . ASP A 1 25  ? 32.833  8.346   29.487 1.00 65.19  ? 55  ASP A C     1 
ATOM   14   O O     . ASP A 1 25  ? 32.200  7.337   29.158 1.00 40.69  ? 55  ASP A O     1 
ATOM   15   C CB    . ASP A 1 25  ? 33.336  9.187   27.172 1.00 93.90  ? 55  ASP A CB    1 
ATOM   16   C CG    . ASP A 1 25  ? 32.191  9.182   26.179 1.00 111.98 ? 55  ASP A CG    1 
ATOM   17   O OD1   . ASP A 1 25  ? 31.191  8.472   26.419 1.00 116.87 ? 55  ASP A OD1   1 
ATOM   18   O OD2   . ASP A 1 25  ? 32.296  9.887   25.151 1.00 120.16 ? 55  ASP A OD2   1 
ATOM   19   N N     . ARG A 1 26  ? 33.492  8.462   30.639 1.00 52.11  ? 56  ARG A N     1 
ATOM   20   C CA    . ARG A 1 26  ? 33.764  7.358   31.553 1.00 40.91  ? 56  ARG A CA    1 
ATOM   21   C C     . ARG A 1 26  ? 32.571  6.465   31.904 1.00 43.64  ? 56  ARG A C     1 
ATOM   22   O O     . ARG A 1 26  ? 32.703  5.238   31.970 1.00 36.67  ? 56  ARG A O     1 
ATOM   23   C CB    . ARG A 1 26  ? 34.354  7.924   32.842 1.00 52.41  ? 56  ARG A CB    1 
ATOM   24   C CG    . ARG A 1 26  ? 35.593  8.785   32.653 1.00 61.75  ? 56  ARG A CG    1 
ATOM   25   C CD    . ARG A 1 26  ? 36.847  7.943   32.733 1.00 83.40  ? 56  ARG A CD    1 
ATOM   26   N NE    . ARG A 1 26  ? 37.937  8.643   33.408 1.00 101.93 ? 56  ARG A NE    1 
ATOM   27   C CZ    . ARG A 1 26  ? 38.929  8.031   34.049 1.00 112.24 ? 56  ARG A CZ    1 
ATOM   28   N NH1   . ARG A 1 26  ? 38.966  6.705   34.107 1.00 108.26 ? 56  ARG A NH1   1 
ATOM   29   N NH2   . ARG A 1 26  ? 39.880  8.743   34.639 1.00 119.83 ? 56  ARG A NH2   1 
ATOM   30   N N     . ALA A 1 27  ? 31.417  7.076   32.155 1.00 41.45  ? 57  ALA A N     1 
ATOM   31   C CA    . ALA A 1 27  ? 30.262  6.328   32.636 1.00 31.59  ? 57  ALA A CA    1 
ATOM   32   C C     . ALA A 1 27  ? 29.826  5.278   31.629 1.00 30.55  ? 57  ALA A C     1 
ATOM   33   O O     . ALA A 1 27  ? 29.746  4.092   31.952 1.00 34.56  ? 57  ALA A O     1 
ATOM   34   C CB    . ALA A 1 27  ? 29.113  7.265   32.968 1.00 27.08  ? 57  ALA A CB    1 
ATOM   35   N N     . ALA A 1 28  ? 29.554  5.721   30.405 1.00 34.44  ? 58  ALA A N     1 
ATOM   36   C CA    . ALA A 1 28  ? 29.134  4.823   29.338 1.00 26.55  ? 58  ALA A CA    1 
ATOM   37   C C     . ALA A 1 28  ? 30.061  3.627   29.198 1.00 28.55  ? 58  ALA A C     1 
ATOM   38   O O     . ALA A 1 28  ? 29.602  2.492   29.090 1.00 44.08  ? 58  ALA A O     1 
ATOM   39   C CB    . ALA A 1 28  ? 29.039  5.571   28.031 1.00 31.30  ? 58  ALA A CB    1 
ATOM   40   N N     . GLN A 1 29  ? 31.366  3.880   29.198 1.00 33.69  ? 59  GLN A N     1 
ATOM   41   C CA    . GLN A 1 29  ? 32.344  2.805   29.036 1.00 29.52  ? 59  GLN A CA    1 
ATOM   42   C C     . GLN A 1 29  ? 32.245  1.823   30.197 1.00 32.46  ? 59  GLN A C     1 
ATOM   43   O O     . GLN A 1 29  ? 32.262  0.609   29.999 1.00 33.33  ? 59  GLN A O     1 
ATOM   44   C CB    . GLN A 1 29  ? 33.769  3.361   28.933 1.00 46.50  ? 59  GLN A CB    1 
ATOM   45   C CG    . GLN A 1 29  ? 33.971  4.449   27.881 1.00 68.93  ? 59  GLN A CG    1 
ATOM   46   C CD    . GLN A 1 29  ? 35.340  5.112   27.979 1.00 85.40  ? 59  GLN A CD    1 
ATOM   47   O OE1   . GLN A 1 29  ? 36.209  4.662   28.729 1.00 89.32  ? 59  GLN A OE1   1 
ATOM   48   N NE2   . GLN A 1 29  ? 35.536  6.187   27.220 1.00 86.58  ? 59  GLN A NE2   1 
ATOM   49   N N     . SER A 1 30  ? 32.138  2.351   31.413 1.00 26.98  ? 60  SER A N     1 
ATOM   50   C CA    . SER A 1 30  ? 32.031  1.497   32.585 1.00 28.48  ? 60  SER A CA    1 
ATOM   51   C C     . SER A 1 30  ? 30.773  0.622   32.530 1.00 29.80  ? 60  SER A C     1 
ATOM   52   O O     . SER A 1 30  ? 30.825  -0.562  32.860 1.00 38.91  ? 60  SER A O     1 
ATOM   53   C CB    . SER A 1 30  ? 32.064  2.337   33.860 1.00 52.51  ? 60  SER A CB    1 
ATOM   54   O OG    . SER A 1 30  ? 32.310  1.527   34.994 1.00 64.07  ? 60  SER A OG    1 
ATOM   55   N N     . LEU A 1 31  ? 29.650  1.199   32.104 1.00 27.90  ? 61  LEU A N     1 
ATOM   56   C CA    . LEU A 1 31  ? 28.416  0.428   31.922 1.00 29.48  ? 61  LEU A CA    1 
ATOM   57   C C     . LEU A 1 31  ? 28.548  -0.672  30.861 1.00 32.32  ? 61  LEU A C     1 
ATOM   58   O O     . LEU A 1 31  ? 28.231  -1.833  31.120 1.00 36.81  ? 61  LEU A O     1 
ATOM   59   C CB    . LEU A 1 31  ? 27.238  1.346   31.584 1.00 37.35  ? 61  LEU A CB    1 
ATOM   60   C CG    . LEU A 1 31  ? 25.860  0.677   31.491 1.00 38.07  ? 61  LEU A CG    1 
ATOM   61   C CD1   . LEU A 1 31  ? 25.530  -0.058  32.777 1.00 35.33  ? 61  LEU A CD1   1 
ATOM   62   C CD2   . LEU A 1 31  ? 24.785  1.700   31.180 1.00 26.44  ? 61  LEU A CD2   1 
ATOM   63   N N     . LEU A 1 32  ? 29.022  -0.313  29.671 1.00 35.16  ? 62  LEU A N     1 
ATOM   64   C CA    . LEU A 1 32  ? 29.178  -1.303  28.610 1.00 29.63  ? 62  LEU A CA    1 
ATOM   65   C C     . LEU A 1 32  ? 30.072  -2.458  29.049 1.00 28.86  ? 62  LEU A C     1 
ATOM   66   O O     . LEU A 1 32  ? 29.763  -3.619  28.791 1.00 38.12  ? 62  LEU A O     1 
ATOM   67   C CB    . LEU A 1 32  ? 29.706  -0.669  27.324 1.00 33.02  ? 62  LEU A CB    1 
ATOM   68   C CG    . LEU A 1 32  ? 29.802  -1.616  26.121 1.00 40.74  ? 62  LEU A CG    1 
ATOM   69   C CD1   . LEU A 1 32  ? 28.530  -2.446  25.977 1.00 32.52  ? 62  LEU A CD1   1 
ATOM   70   C CD2   . LEU A 1 32  ? 30.099  -0.849  24.836 1.00 31.21  ? 62  LEU A CD2   1 
ATOM   71   N N     . ASN A 1 33  ? 31.172  -2.148  29.727 1.00 28.65  ? 63  ASN A N     1 
ATOM   72   C CA    . ASN A 1 33  ? 32.059  -3.205  30.208 1.00 30.52  ? 63  ASN A CA    1 
ATOM   73   C C     . ASN A 1 33  ? 31.372  -4.163  31.166 1.00 28.76  ? 63  ASN A C     1 
ATOM   74   O O     . ASN A 1 33  ? 31.665  -5.354  31.173 1.00 42.92  ? 63  ASN A O     1 
ATOM   75   C CB    . ASN A 1 33  ? 33.333  -2.636  30.826 1.00 29.18  ? 63  ASN A CB    1 
ATOM   76   C CG    . ASN A 1 33  ? 34.458  -2.521  29.821 1.00 44.08  ? 63  ASN A CG    1 
ATOM   77   O OD1   . ASN A 1 33  ? 34.711  -3.446  29.048 1.00 42.06  ? 63  ASN A OD1   1 
ATOM   78   N ND2   . ASN A 1 33  ? 35.137  -1.383  29.820 1.00 58.23  ? 63  ASN A ND2   1 
ATOM   79   N N     . LYS A 1 34  ? 30.450  -3.637  31.963 1.00 29.44  ? 64  LYS A N     1 
ATOM   80   C CA    . LYS A 1 34  ? 29.667  -4.457  32.884 1.00 28.81  ? 64  LYS A CA    1 
ATOM   81   C C     . LYS A 1 34  ? 28.603  -5.289  32.178 1.00 35.17  ? 64  LYS A C     1 
ATOM   82   O O     . LYS A 1 34  ? 28.414  -6.462  32.491 1.00 38.08  ? 64  LYS A O     1 
ATOM   83   C CB    . LYS A 1 34  ? 29.022  -3.581  33.961 1.00 27.79  ? 64  LYS A CB    1 
ATOM   84   C CG    . LYS A 1 34  ? 29.993  -3.200  35.053 1.00 28.57  ? 64  LYS A CG    1 
ATOM   85   C CD    . LYS A 1 34  ? 29.373  -2.297  36.085 1.00 41.83  ? 64  LYS A CD    1 
ATOM   86   C CE    . LYS A 1 34  ? 30.247  -2.263  37.321 1.00 56.46  ? 64  LYS A CE    1 
ATOM   87   N NZ    . LYS A 1 34  ? 30.615  -3.643  37.752 1.00 60.48  ? 64  LYS A NZ    1 
ATOM   88   N N     . LEU A 1 35  ? 27.908  -4.679  31.225 1.00 35.12  ? 65  LEU A N     1 
ATOM   89   C CA    . LEU A 1 35  ? 26.871  -5.390  30.490 1.00 29.98  ? 65  LEU A CA    1 
ATOM   90   C C     . LEU A 1 35  ? 27.417  -6.624  29.757 1.00 34.71  ? 65  LEU A C     1 
ATOM   91   O O     . LEU A 1 35  ? 26.716  -7.622  29.611 1.00 47.58  ? 65  LEU A O     1 
ATOM   92   C CB    . LEU A 1 35  ? 26.151  -4.444  29.526 1.00 27.80  ? 65  LEU A CB    1 
ATOM   93   C CG    . LEU A 1 35  ? 25.399  -3.285  30.185 1.00 34.45  ? 65  LEU A CG    1 
ATOM   94   C CD1   . LEU A 1 35  ? 24.797  -2.345  29.152 1.00 38.43  ? 65  LEU A CD1   1 
ATOM   95   C CD2   . LEU A 1 35  ? 24.325  -3.808  31.112 1.00 24.02  ? 65  LEU A CD2   1 
ATOM   96   N N     . ILE A 1 36  ? 28.672  -6.564  29.321 1.00 32.97  ? 66  ILE A N     1 
ATOM   97   C CA    . ILE A 1 36  ? 29.260  -7.657  28.546 1.00 33.16  ? 66  ILE A CA    1 
ATOM   98   C C     . ILE A 1 36  ? 30.197  -8.556  29.349 1.00 31.54  ? 66  ILE A C     1 
ATOM   99   O O     . ILE A 1 36  ? 30.596  -9.609  28.875 1.00 44.66  ? 66  ILE A O     1 
ATOM   100  C CB    . ILE A 1 36  ? 30.026  -7.138  27.299 1.00 32.44  ? 66  ILE A CB    1 
ATOM   101  C CG1   . ILE A 1 36  ? 31.204  -6.255  27.726 1.00 33.91  ? 66  ILE A CG1   1 
ATOM   102  C CG2   . ILE A 1 36  ? 29.092  -6.383  26.381 1.00 34.42  ? 66  ILE A CG2   1 
ATOM   103  C CD1   . ILE A 1 36  ? 32.109  -5.852  26.602 1.00 29.39  ? 66  ILE A CD1   1 
ATOM   104  N N     . ARG A 1 37  ? 30.555  -8.144  30.559 1.00 48.36  ? 67  ARG A N     1 
ATOM   105  C CA    . ARG A 1 37  ? 31.420  -8.957  31.409 1.00 47.18  ? 67  ARG A CA    1 
ATOM   106  C C     . ARG A 1 37  ? 30.748  -10.265 31.796 1.00 42.73  ? 67  ARG A C     1 
ATOM   107  O O     . ARG A 1 37  ? 29.625  -10.272 32.281 1.00 51.30  ? 67  ARG A O     1 
ATOM   108  C CB    . ARG A 1 37  ? 31.802  -8.200  32.676 1.00 37.75  ? 67  ARG A CB    1 
ATOM   109  C CG    . ARG A 1 37  ? 32.741  -8.985  33.568 1.00 39.48  ? 67  ARG A CG    1 
ATOM   110  C CD    . ARG A 1 37  ? 34.149  -8.911  33.040 1.00 31.53  ? 67  ARG A CD    1 
ATOM   111  N NE    . ARG A 1 37  ? 34.583  -7.522  32.962 1.00 45.15  ? 67  ARG A NE    1 
ATOM   112  C CZ    . ARG A 1 37  ? 35.695  -7.119  32.362 1.00 45.75  ? 67  ARG A CZ    1 
ATOM   113  N NH1   . ARG A 1 37  ? 36.494  -8.007  31.781 1.00 35.38  ? 67  ARG A NH1   1 
ATOM   114  N NH2   . ARG A 1 37  ? 36.000  -5.826  32.342 1.00 37.09  ? 67  ARG A NH2   1 
ATOM   115  N N     . SER A 1 38  ? 31.449  -11.372 31.599 1.00 42.90  ? 68  SER A N     1 
ATOM   116  C CA    . SER A 1 38  ? 30.873  -12.684 31.858 1.00 58.14  ? 68  SER A CA    1 
ATOM   117  C C     . SER A 1 38  ? 31.582  -13.412 32.996 1.00 60.68  ? 68  SER A C     1 
ATOM   118  O O     . SER A 1 38  ? 31.030  -14.334 33.596 1.00 66.69  ? 68  SER A O     1 
ATOM   119  C CB    . SER A 1 38  ? 30.920  -13.534 30.587 1.00 68.82  ? 68  SER A CB    1 
ATOM   120  O OG    . SER A 1 38  ? 32.197  -13.459 29.975 1.00 73.31  ? 68  SER A OG    1 
ATOM   121  N N     . ASN A 1 39  ? 32.809  -12.993 33.287 1.00 51.02  ? 69  ASN A N     1 
ATOM   122  C CA    . ASN A 1 39  ? 33.619  -13.652 34.298 1.00 41.99  ? 69  ASN A CA    1 
ATOM   123  C C     . ASN A 1 39  ? 34.839  -12.821 34.668 1.00 41.23  ? 69  ASN A C     1 
ATOM   124  O O     . ASN A 1 39  ? 35.114  -11.799 34.049 1.00 49.57  ? 69  ASN A O     1 
ATOM   125  C CB    . ASN A 1 39  ? 34.046  -15.035 33.811 1.00 44.84  ? 69  ASN A CB    1 
ATOM   126  C CG    . ASN A 1 39  ? 34.754  -14.982 32.478 1.00 57.58  ? 69  ASN A CG    1 
ATOM   127  O OD1   . ASN A 1 39  ? 35.732  -14.252 32.309 1.00 65.61  ? 69  ASN A OD1   1 
ATOM   128  N ND2   . ASN A 1 39  ? 34.261  -15.752 31.516 1.00 69.39  ? 69  ASN A ND2   1 
ATOM   129  N N     . LEU A 1 40  ? 35.566  -13.267 35.684 1.00 42.02  ? 70  LEU A N     1 
ATOM   130  C CA    . LEU A 1 40  ? 36.725  -12.537 36.182 1.00 34.68  ? 70  LEU A CA    1 
ATOM   131  C C     . LEU A 1 40  ? 37.813  -12.404 35.133 1.00 32.26  ? 70  LEU A C     1 
ATOM   132  O O     . LEU A 1 40  ? 38.208  -13.391 34.516 1.00 29.25  ? 70  LEU A O     1 
ATOM   133  C CB    . LEU A 1 40  ? 37.316  -13.253 37.398 1.00 36.56  ? 70  LEU A CB    1 
ATOM   134  C CG    . LEU A 1 40  ? 36.581  -13.208 38.734 1.00 38.15  ? 70  LEU A CG    1 
ATOM   135  C CD1   . LEU A 1 40  ? 37.056  -14.358 39.610 1.00 28.15  ? 70  LEU A CD1   1 
ATOM   136  C CD2   . LEU A 1 40  ? 36.785  -11.859 39.418 1.00 29.85  ? 70  LEU A CD2   1 
ATOM   137  N N     . VAL A 1 41  ? 38.312  -11.187 34.943 1.00 37.16  ? 71  VAL A N     1 
ATOM   138  C CA    . VAL A 1 41  ? 39.486  -10.989 34.098 1.00 45.12  ? 71  VAL A CA    1 
ATOM   139  C C     . VAL A 1 41  ? 40.675  -11.685 34.758 1.00 53.91  ? 71  VAL A C     1 
ATOM   140  O O     . VAL A 1 41  ? 40.800  -11.697 35.983 1.00 67.78  ? 71  VAL A O     1 
ATOM   141  C CB    . VAL A 1 41  ? 39.804  -9.495  33.887 1.00 42.28  ? 71  VAL A CB    1 
ATOM   142  C CG1   . VAL A 1 41  ? 40.197  -8.845  35.200 1.00 59.81  ? 71  VAL A CG1   1 
ATOM   143  C CG2   . VAL A 1 41  ? 40.911  -9.330  32.887 1.00 54.22  ? 71  VAL A CG2   1 
ATOM   144  N N     . ASP A 1 42  ? 41.534  -12.287 33.949 1.00 53.30  ? 72  ASP A N     1 
ATOM   145  C CA    . ASP A 1 42  ? 42.694  -12.993 34.476 1.00 70.85  ? 72  ASP A CA    1 
ATOM   146  C C     . ASP A 1 42  ? 43.862  -12.044 34.723 1.00 69.64  ? 72  ASP A C     1 
ATOM   147  O O     . ASP A 1 42  ? 44.287  -11.320 33.824 1.00 64.57  ? 72  ASP A O     1 
ATOM   148  C CB    . ASP A 1 42  ? 43.112  -14.130 33.539 1.00 82.90  ? 72  ASP A CB    1 
ATOM   149  C CG    . ASP A 1 42  ? 43.103  -13.720 32.078 1.00 93.82  ? 72  ASP A CG    1 
ATOM   150  O OD1   . ASP A 1 42  ? 44.095  -14.012 31.379 1.00 102.41 ? 72  ASP A OD1   1 
ATOM   151  O OD2   . ASP A 1 42  ? 42.108  -13.111 31.624 1.00 96.44  ? 72  ASP A OD2   1 
ATOM   152  N N     . ASN A 1 43  ? 44.366  -12.049 35.953 1.00 64.10  ? 73  ASN A N     1 
ATOM   153  C CA    . ASN A 1 43  ? 45.486  -11.200 36.332 1.00 59.64  ? 73  ASN A CA    1 
ATOM   154  C C     . ASN A 1 43  ? 46.537  -12.029 37.056 1.00 66.62  ? 73  ASN A C     1 
ATOM   155  O O     . ASN A 1 43  ? 46.203  -12.916 37.840 1.00 75.42  ? 73  ASN A O     1 
ATOM   156  C CB    . ASN A 1 43  ? 45.008  -10.039 37.209 1.00 50.25  ? 73  ASN A CB    1 
ATOM   157  C CG    . ASN A 1 43  ? 46.059  -8.955  37.377 1.00 48.33  ? 73  ASN A CG    1 
ATOM   158  O OD1   . ASN A 1 43  ? 47.232  -9.239  37.614 1.00 53.06  ? 73  ASN A OD1   1 
ATOM   159  N ND2   . ASN A 1 43  ? 45.638  -7.702  37.261 1.00 43.11  ? 73  ASN A ND2   1 
ATOM   160  N N     . THR A 1 44  ? 47.806  -11.741 36.787 1.00 64.47  ? 74  THR A N     1 
ATOM   161  C CA    . THR A 1 44  ? 48.902  -12.549 37.316 1.00 66.50  ? 74  THR A CA    1 
ATOM   162  C C     . THR A 1 44  ? 49.841  -11.750 38.213 1.00 58.08  ? 74  THR A C     1 
ATOM   163  O O     . THR A 1 44  ? 50.663  -12.324 38.924 1.00 72.55  ? 74  THR A O     1 
ATOM   164  C CB    . THR A 1 44  ? 49.712  -13.222 36.185 1.00 68.86  ? 74  THR A CB    1 
ATOM   165  O OG1   . THR A 1 44  ? 50.319  -12.220 35.360 1.00 72.36  ? 74  THR A OG1   1 
ATOM   166  C CG2   . THR A 1 44  ? 48.803  -14.099 35.332 1.00 51.38  ? 74  THR A CG2   1 
ATOM   167  N N     . ASN A 1 45  ? 49.723  -10.428 38.171 1.00 48.74  ? 75  ASN A N     1 
ATOM   168  C CA    . ASN A 1 45  ? 50.426  -9.576  39.120 1.00 59.37  ? 75  ASN A CA    1 
ATOM   169  C C     . ASN A 1 45  ? 49.944  -9.870  40.535 1.00 61.64  ? 75  ASN A C     1 
ATOM   170  O O     . ASN A 1 45  ? 48.888  -10.473 40.723 1.00 54.03  ? 75  ASN A O     1 
ATOM   171  C CB    . ASN A 1 45  ? 50.194  -8.101  38.798 1.00 62.66  ? 75  ASN A CB    1 
ATOM   172  C CG    . ASN A 1 45  ? 50.792  -7.695  37.472 1.00 61.35  ? 75  ASN A CG    1 
ATOM   173  O OD1   . ASN A 1 45  ? 51.931  -8.041  37.158 1.00 68.86  ? 75  ASN A OD1   1 
ATOM   174  N ND2   . ASN A 1 45  ? 50.027  -6.948  36.685 1.00 57.15  ? 75  ASN A ND2   1 
ATOM   175  N N     . GLN A 1 46  ? 50.710  -9.446  41.533 1.00 70.03  ? 76  GLN A N     1 
ATOM   176  C CA    . GLN A 1 46  ? 50.320  -9.682  42.921 1.00 60.89  ? 76  GLN A CA    1 
ATOM   177  C C     . GLN A 1 46  ? 49.669  -8.455  43.545 1.00 52.91  ? 76  GLN A C     1 
ATOM   178  O O     . GLN A 1 46  ? 50.045  -7.317  43.246 1.00 54.41  ? 76  GLN A O     1 
ATOM   179  C CB    . GLN A 1 46  ? 51.517  -10.136 43.762 1.00 64.42  ? 76  GLN A CB    1 
ATOM   180  C CG    . GLN A 1 46  ? 52.163  -11.426 43.271 1.00 78.41  ? 76  GLN A CG    1 
ATOM   181  C CD    . GLN A 1 46  ? 51.154  -12.536 43.012 1.00 85.58  ? 76  GLN A CD    1 
ATOM   182  O OE1   . GLN A 1 46  ? 50.283  -12.812 43.839 1.00 76.53  ? 76  GLN A OE1   1 
ATOM   183  N NE2   . GLN A 1 46  ? 51.277  -13.185 41.857 1.00 96.74  ? 76  GLN A NE2   1 
ATOM   184  N N     . VAL A 1 47  ? 48.682  -8.698  44.404 1.00 43.21  ? 77  VAL A N     1 
ATOM   185  C CA    . VAL A 1 47  ? 48.018  -7.630  45.142 1.00 37.32  ? 77  VAL A CA    1 
ATOM   186  C C     . VAL A 1 47  ? 48.976  -6.936  46.115 1.00 44.54  ? 77  VAL A C     1 
ATOM   187  O O     . VAL A 1 47  ? 49.686  -7.597  46.879 1.00 48.48  ? 77  VAL A O     1 
ATOM   188  C CB    . VAL A 1 47  ? 46.811  -8.169  45.932 1.00 41.40  ? 77  VAL A CB    1 
ATOM   189  C CG1   . VAL A 1 47  ? 46.150  -7.052  46.734 1.00 32.84  ? 77  VAL A CG1   1 
ATOM   190  C CG2   . VAL A 1 47  ? 45.811  -8.829  44.986 1.00 51.60  ? 77  VAL A CG2   1 
ATOM   191  N N     . GLU A 1 48  ? 48.991  -5.604  46.073 1.00 40.18  ? 78  GLU A N     1 
ATOM   192  C CA    . GLU A 1 48  ? 49.769  -4.782  47.001 1.00 41.82  ? 78  GLU A CA    1 
ATOM   193  C C     . GLU A 1 48  ? 48.884  -4.280  48.145 1.00 44.88  ? 78  GLU A C     1 
ATOM   194  O O     . GLU A 1 48  ? 47.948  -3.520  47.921 1.00 52.74  ? 78  GLU A O     1 
ATOM   195  C CB    . GLU A 1 48  ? 50.386  -3.587  46.264 1.00 39.59  ? 78  GLU A CB    1 
ATOM   196  C CG    . GLU A 1 48  ? 51.188  -2.637  47.144 1.00 63.57  ? 78  GLU A CG    1 
ATOM   197  C CD    . GLU A 1 48  ? 51.672  -1.398  46.403 1.00 80.04  ? 78  GLU A CD    1 
ATOM   198  O OE1   . GLU A 1 48  ? 51.426  -1.297  45.183 1.00 90.66  ? 78  GLU A OE1   1 
ATOM   199  O OE2   . GLU A 1 48  ? 52.299  -0.523  47.044 1.00 80.60  ? 78  GLU A OE2   1 
ATOM   200  N N     . VAL A 1 49  ? 49.179  -4.704  49.368 1.00 48.51  ? 79  VAL A N     1 
ATOM   201  C CA    . VAL A 1 49  ? 48.403  -4.270  50.526 1.00 40.85  ? 79  VAL A CA    1 
ATOM   202  C C     . VAL A 1 49  ? 49.193  -3.318  51.412 1.00 41.77  ? 79  VAL A C     1 
ATOM   203  O O     . VAL A 1 49  ? 50.306  -3.624  51.816 1.00 49.25  ? 79  VAL A O     1 
ATOM   204  C CB    . VAL A 1 49  ? 47.972  -5.462  51.384 1.00 37.17  ? 79  VAL A CB    1 
ATOM   205  C CG1   . VAL A 1 49  ? 46.969  -5.019  52.427 1.00 37.93  ? 79  VAL A CG1   1 
ATOM   206  C CG2   . VAL A 1 49  ? 47.400  -6.561  50.506 1.00 37.60  ? 79  VAL A CG2   1 
ATOM   207  N N     . LEU A 1 50  ? 48.614  -2.163  51.714 1.00 49.93  ? 80  LEU A N     1 
ATOM   208  C CA    . LEU A 1 50  ? 49.226  -1.233  52.656 1.00 48.68  ? 80  LEU A CA    1 
ATOM   209  C C     . LEU A 1 50  ? 48.363  -1.111  53.916 1.00 57.77  ? 80  LEU A C     1 
ATOM   210  O O     . LEU A 1 50  ? 47.633  -0.131  54.084 1.00 56.55  ? 80  LEU A O     1 
ATOM   211  C CB    . LEU A 1 50  ? 49.442  0.141   52.009 1.00 46.33  ? 80  LEU A CB    1 
ATOM   212  C CG    . LEU A 1 50  ? 50.183  0.157   50.661 1.00 60.65  ? 80  LEU A CG    1 
ATOM   213  C CD1   . LEU A 1 50  ? 50.284  1.573   50.088 1.00 63.65  ? 80  LEU A CD1   1 
ATOM   214  C CD2   . LEU A 1 50  ? 51.565  -0.479  50.765 1.00 52.72  ? 80  LEU A CD2   1 
ATOM   215  N N     . GLN A 1 51  ? 48.447  -2.121  54.784 1.00 59.08  ? 81  GLN A N     1 
ATOM   216  C CA    . GLN A 1 51  ? 47.727  -2.141  56.060 1.00 52.77  ? 81  GLN A CA    1 
ATOM   217  C C     . GLN A 1 51  ? 47.752  -0.781  56.751 1.00 45.07  ? 81  GLN A C     1 
ATOM   218  O O     . GLN A 1 51  ? 48.794  -0.136  56.831 1.00 38.07  ? 81  GLN A O     1 
ATOM   219  C CB    . GLN A 1 51  ? 48.331  -3.188  57.001 1.00 66.22  ? 81  GLN A CB    1 
ATOM   220  C CG    . GLN A 1 51  ? 48.207  -4.630  56.534 1.00 80.69  ? 81  GLN A CG    1 
ATOM   221  C CD    . GLN A 1 51  ? 46.919  -5.299  56.982 1.00 86.04  ? 81  GLN A CD    1 
ATOM   222  O OE1   . GLN A 1 51  ? 46.209  -4.794  57.853 1.00 95.33  ? 81  GLN A OE1   1 
ATOM   223  N NE2   . GLN A 1 51  ? 46.616  -6.449  56.388 1.00 80.28  ? 81  GLN A NE2   1 
ATOM   224  N N     . ARG A 1 52  ? 46.599  -0.353  57.252 1.00 55.57  ? 82  ARG A N     1 
ATOM   225  C CA    . ARG A 1 52  ? 46.489  0.915   57.971 1.00 70.71  ? 82  ARG A CA    1 
ATOM   226  C C     . ARG A 1 52  ? 47.616  1.067   58.993 1.00 77.15  ? 82  ARG A C     1 
ATOM   227  O O     . ARG A 1 52  ? 48.322  2.077   59.006 1.00 72.90  ? 82  ARG A O     1 
ATOM   228  C CB    . ARG A 1 52  ? 45.125  1.008   58.655 1.00 72.17  ? 82  ARG A CB    1 
ATOM   229  C CG    . ARG A 1 52  ? 44.838  2.322   59.351 1.00 71.05  ? 82  ARG A CG    1 
ATOM   230  C CD    . ARG A 1 52  ? 43.550  2.199   60.142 1.00 78.68  ? 82  ARG A CD    1 
ATOM   231  N NE    . ARG A 1 52  ? 43.437  0.872   60.742 1.00 86.08  ? 82  ARG A NE    1 
ATOM   232  C CZ    . ARG A 1 52  ? 42.386  0.445   61.436 1.00 96.11  ? 82  ARG A CZ    1 
ATOM   233  N NH1   . ARG A 1 52  ? 41.343  1.241   61.627 1.00 101.32 ? 82  ARG A NH1   1 
ATOM   234  N NH2   . ARG A 1 52  ? 42.380  -0.782  61.941 1.00 95.82  ? 82  ARG A NH2   1 
ATOM   235  N N     . ASP A 1 53  ? 47.781  0.055   59.843 1.00 86.25  ? 83  ASP A N     1 
ATOM   236  C CA    . ASP A 1 53  ? 48.902  0.003   60.778 1.00 95.47  ? 83  ASP A CA    1 
ATOM   237  C C     . ASP A 1 53  ? 50.046  -0.815  60.181 1.00 95.68  ? 83  ASP A C     1 
ATOM   238  O O     . ASP A 1 53  ? 49.918  -2.027  60.005 1.00 91.49  ? 83  ASP A O     1 
ATOM   239  C CB    . ASP A 1 53  ? 48.463  -0.608  62.110 1.00 96.72  ? 83  ASP A CB    1 
ATOM   240  N N     . PRO A 1 54  ? 51.173  -0.153  59.873 1.00 96.46  ? 84  PRO A N     1 
ATOM   241  C CA    . PRO A 1 54  ? 52.313  -0.811  59.226 1.00 92.18  ? 84  PRO A CA    1 
ATOM   242  C C     . PRO A 1 54  ? 52.901  -1.897  60.119 1.00 96.85  ? 84  PRO A C     1 
ATOM   243  O O     . PRO A 1 54  ? 53.708  -2.705  59.656 1.00 95.83  ? 84  PRO A O     1 
ATOM   244  C CB    . PRO A 1 54  ? 53.325  0.327   59.048 1.00 95.86  ? 84  PRO A CB    1 
ATOM   245  C CG    . PRO A 1 54  ? 52.540  1.591   59.219 1.00 98.86  ? 84  PRO A CG    1 
ATOM   246  C CD    . PRO A 1 54  ? 51.460  1.255   60.189 1.00 100.81 ? 84  PRO A CD    1 
ATOM   247  N N     . ASN A 1 55  ? 52.499  -1.907  61.387 1.00 96.33  ? 85  ASN A N     1 
ATOM   248  C CA    . ASN A 1 55  ? 52.937  -2.933  62.325 1.00 104.03 ? 85  ASN A CA    1 
ATOM   249  C C     . ASN A 1 55  ? 52.219  -4.257  62.097 1.00 99.80  ? 85  ASN A C     1 
ATOM   250  O O     . ASN A 1 55  ? 52.853  -5.282  61.840 1.00 99.57  ? 85  ASN A O     1 
ATOM   251  C CB    . ASN A 1 55  ? 52.717  -2.471  63.767 1.00 109.04 ? 85  ASN A CB    1 
ATOM   252  C CG    . ASN A 1 55  ? 53.694  -1.394  64.191 1.00 98.86  ? 85  ASN A CG    1 
ATOM   253  O OD1   . ASN A 1 55  ? 54.776  -1.261  63.619 1.00 86.29  ? 85  ASN A OD1   1 
ATOM   254  N ND2   . ASN A 1 55  ? 53.317  -0.618  65.203 1.00 97.08  ? 85  ASN A ND2   1 
ATOM   255  N N     . SER A 1 56  ? 50.894  -4.226  62.203 1.00 93.05  ? 86  SER A N     1 
ATOM   256  C CA    . SER A 1 56  ? 50.074  -5.415  62.000 1.00 91.40  ? 86  SER A CA    1 
ATOM   257  C C     . SER A 1 56  ? 50.446  -6.141  60.708 1.00 91.59  ? 86  SER A C     1 
ATOM   258  O O     . SER A 1 56  ? 50.741  -5.509  59.693 1.00 86.83  ? 86  SER A O     1 
ATOM   259  C CB    . SER A 1 56  ? 48.587  -5.048  62.001 1.00 82.74  ? 86  SER A CB    1 
ATOM   260  O OG    . SER A 1 56  ? 48.343  -3.901  61.203 1.00 77.72  ? 86  SER A OG    1 
ATOM   261  N N     . PRO A 1 57  ? 50.445  -7.480  60.750 1.00 93.48  ? 87  PRO A N     1 
ATOM   262  C CA    . PRO A 1 57  ? 50.822  -8.318  59.608 1.00 92.28  ? 87  PRO A CA    1 
ATOM   263  C C     . PRO A 1 57  ? 49.762  -8.307  58.511 1.00 93.20  ? 87  PRO A C     1 
ATOM   264  O O     . PRO A 1 57  ? 48.690  -7.728  58.694 1.00 97.48  ? 87  PRO A O     1 
ATOM   265  C CB    . PRO A 1 57  ? 50.921  -9.725  60.218 1.00 96.74  ? 87  PRO A CB    1 
ATOM   266  C CG    . PRO A 1 57  ? 50.953  -9.520  61.705 1.00 98.95  ? 87  PRO A CG    1 
ATOM   267  C CD    . PRO A 1 57  ? 50.154  -8.286  61.946 1.00 98.69  ? 87  PRO A CD    1 
ATOM   268  N N     . LEU A 1 58  ? 50.069  -8.946  57.385 1.00 85.52  ? 88  LEU A N     1 
ATOM   269  C CA    . LEU A 1 58  ? 49.135  -9.060  56.270 1.00 77.68  ? 88  LEU A CA    1 
ATOM   270  C C     . LEU A 1 58  ? 48.342  -10.356 56.401 1.00 72.59  ? 88  LEU A C     1 
ATOM   271  O O     . LEU A 1 58  ? 48.897  -11.383 56.802 1.00 77.81  ? 88  LEU A O     1 
ATOM   272  C CB    . LEU A 1 58  ? 49.892  -9.048  54.938 1.00 70.31  ? 88  LEU A CB    1 
ATOM   273  C CG    . LEU A 1 58  ? 50.824  -7.861  54.678 1.00 77.78  ? 88  LEU A CG    1 
ATOM   274  C CD1   . LEU A 1 58  ? 51.860  -8.197  53.608 1.00 82.97  ? 88  LEU A CD1   1 
ATOM   275  C CD2   . LEU A 1 58  ? 50.030  -6.622  54.298 1.00 76.46  ? 88  LEU A CD2   1 
ATOM   276  N N     . TYR A 1 59  ? 47.052  -10.311 56.068 1.00 45.82  ? 89  TYR A N     1 
ATOM   277  C CA    . TYR A 1 59  ? 46.217  -11.507 56.152 1.00 56.35  ? 89  TYR A CA    1 
ATOM   278  C C     . TYR A 1 59  ? 45.380  -11.756 54.882 1.00 66.22  ? 89  TYR A C     1 
ATOM   279  O O     . TYR A 1 59  ? 44.680  -10.861 54.392 1.00 64.80  ? 89  TYR A O     1 
ATOM   280  C CB    . TYR A 1 59  ? 45.335  -11.471 57.409 1.00 57.06  ? 89  TYR A CB    1 
ATOM   281  C CG    . TYR A 1 59  ? 44.547  -12.743 57.633 1.00 63.16  ? 89  TYR A CG    1 
ATOM   282  C CD1   . TYR A 1 59  ? 43.158  -12.728 57.678 1.00 63.52  ? 89  TYR A CD1   1 
ATOM   283  C CD2   . TYR A 1 59  ? 45.193  -13.964 57.783 1.00 57.60  ? 89  TYR A CD2   1 
ATOM   284  C CE1   . TYR A 1 59  ? 42.436  -13.892 57.876 1.00 58.97  ? 89  TYR A CE1   1 
ATOM   285  C CE2   . TYR A 1 59  ? 44.479  -15.131 57.979 1.00 57.15  ? 89  TYR A CE2   1 
ATOM   286  C CZ    . TYR A 1 59  ? 43.102  -15.090 58.024 1.00 62.97  ? 89  TYR A CZ    1 
ATOM   287  O OH    . TYR A 1 59  ? 42.390  -16.252 58.218 1.00 75.21  ? 89  TYR A OH    1 
ATOM   288  N N     . SER A 1 60  ? 45.470  -12.981 54.363 1.00 60.82  ? 90  SER A N     1 
ATOM   289  C CA    . SER A 1 60  ? 44.776  -13.379 53.141 1.00 59.36  ? 90  SER A CA    1 
ATOM   290  C C     . SER A 1 60  ? 44.042  -14.700 53.326 1.00 56.73  ? 90  SER A C     1 
ATOM   291  O O     . SER A 1 60  ? 44.416  -15.512 54.168 1.00 67.32  ? 90  SER A O     1 
ATOM   292  C CB    . SER A 1 60  ? 45.764  -13.527 51.982 1.00 67.08  ? 90  SER A CB    1 
ATOM   293  O OG    . SER A 1 60  ? 46.260  -12.273 51.564 1.00 77.42  ? 90  SER A OG    1 
ATOM   294  N N     . VAL A 1 61  ? 43.004  -14.915 52.523 1.00 50.55  ? 91  VAL A N     1 
ATOM   295  C CA    . VAL A 1 61  ? 42.274  -16.176 52.545 1.00 53.64  ? 91  VAL A CA    1 
ATOM   296  C C     . VAL A 1 61  ? 42.276  -16.817 51.164 1.00 56.11  ? 91  VAL A C     1 
ATOM   297  O O     . VAL A 1 61  ? 42.586  -16.165 50.169 1.00 67.32  ? 91  VAL A O     1 
ATOM   298  C CB    . VAL A 1 61  ? 40.828  -15.982 53.014 1.00 52.03  ? 91  VAL A CB    1 
ATOM   299  C CG1   . VAL A 1 61  ? 40.808  -15.352 54.395 1.00 49.29  ? 91  VAL A CG1   1 
ATOM   300  C CG2   . VAL A 1 61  ? 40.067  -15.123 52.023 1.00 50.54  ? 91  VAL A CG2   1 
ATOM   301  N N     . LYS A 1 62  ? 41.931  -18.097 51.105 1.00 55.16  ? 92  LYS A N     1 
ATOM   302  C CA    . LYS A 1 62  ? 41.925  -18.822 49.841 1.00 57.52  ? 92  LYS A CA    1 
ATOM   303  C C     . LYS A 1 62  ? 40.578  -19.492 49.600 1.00 52.56  ? 92  LYS A C     1 
ATOM   304  O O     . LYS A 1 62  ? 40.383  -20.174 48.595 1.00 54.69  ? 92  LYS A O     1 
ATOM   305  C CB    . LYS A 1 62  ? 43.049  -19.859 49.810 1.00 62.31  ? 92  LYS A CB    1 
ATOM   306  C CG    . LYS A 1 62  ? 44.424  -19.292 50.135 1.00 75.17  ? 92  LYS A CG    1 
ATOM   307  C CD    . LYS A 1 62  ? 44.818  -18.192 49.162 1.00 83.63  ? 92  LYS A CD    1 
ATOM   308  C CE    . LYS A 1 62  ? 46.129  -17.540 49.567 1.00 90.75  ? 92  LYS A CE    1 
ATOM   309  N NZ    . LYS A 1 62  ? 46.514  -16.446 48.633 1.00 97.04  ? 92  LYS A NZ    1 
ATOM   310  N N     . SER A 1 63  ? 39.652  -19.302 50.533 1.00 48.02  ? 93  SER A N     1 
ATOM   311  C CA    . SER A 1 63  ? 38.309  -19.840 50.378 1.00 55.44  ? 93  SER A CA    1 
ATOM   312  C C     . SER A 1 63  ? 37.302  -19.004 51.146 1.00 50.17  ? 93  SER A C     1 
ATOM   313  O O     . SER A 1 63  ? 37.663  -18.250 52.045 1.00 51.34  ? 93  SER A O     1 
ATOM   314  C CB    . SER A 1 63  ? 38.246  -21.296 50.838 1.00 61.66  ? 93  SER A CB    1 
ATOM   315  O OG    . SER A 1 63  ? 38.248  -21.383 52.248 1.00 69.36  ? 93  SER A OG    1 
ATOM   316  N N     . PHE A 1 64  ? 36.034  -19.137 50.779 1.00 46.04  ? 94  PHE A N     1 
ATOM   317  C CA    . PHE A 1 64  ? 34.976  -18.408 51.450 1.00 37.65  ? 94  PHE A CA    1 
ATOM   318  C C     . PHE A 1 64  ? 34.720  -18.994 52.827 1.00 47.53  ? 94  PHE A C     1 
ATOM   319  O O     . PHE A 1 64  ? 34.473  -18.257 53.781 1.00 59.27  ? 94  PHE A O     1 
ATOM   320  C CB    . PHE A 1 64  ? 33.691  -18.431 50.618 1.00 44.35  ? 94  PHE A CB    1 
ATOM   321  C CG    . PHE A 1 64  ? 33.755  -17.583 49.379 1.00 45.05  ? 94  PHE A CG    1 
ATOM   322  C CD1   . PHE A 1 64  ? 33.706  -18.161 48.124 1.00 41.87  ? 94  PHE A CD1   1 
ATOM   323  C CD2   . PHE A 1 64  ? 33.867  -16.207 49.473 1.00 49.19  ? 94  PHE A CD2   1 
ATOM   324  C CE1   . PHE A 1 64  ? 33.765  -17.382 46.986 1.00 49.06  ? 94  PHE A CE1   1 
ATOM   325  C CE2   . PHE A 1 64  ? 33.927  -15.421 48.335 1.00 49.02  ? 94  PHE A CE2   1 
ATOM   326  C CZ    . PHE A 1 64  ? 33.875  -16.009 47.092 1.00 46.17  ? 94  PHE A CZ    1 
ATOM   327  N N     . GLU A 1 65  ? 34.778  -20.320 52.923 1.00 56.06  ? 95  GLU A N     1 
ATOM   328  C CA    . GLU A 1 65  ? 34.544  -21.022 54.185 1.00 75.77  ? 95  GLU A CA    1 
ATOM   329  C C     . GLU A 1 65  ? 35.391  -20.432 55.313 1.00 70.14  ? 95  GLU A C     1 
ATOM   330  O O     . GLU A 1 65  ? 34.926  -20.254 56.439 1.00 56.11  ? 95  GLU A O     1 
ATOM   331  C CB    . GLU A 1 65  ? 34.853  -22.511 54.019 1.00 94.31  ? 95  GLU A CB    1 
ATOM   332  C CG    . GLU A 1 65  ? 33.806  -23.283 53.226 1.00 112.04 ? 95  GLU A CG    1 
ATOM   333  C CD    . GLU A 1 65  ? 32.792  -23.980 54.117 1.00 124.45 ? 95  GLU A CD    1 
ATOM   334  O OE1   . GLU A 1 65  ? 33.189  -24.908 54.852 1.00 126.17 ? 95  GLU A OE1   1 
ATOM   335  O OE2   . GLU A 1 65  ? 31.600  -23.608 54.075 1.00 127.09 ? 95  GLU A OE2   1 
ATOM   336  N N     . GLU A 1 66  ? 36.637  -20.121 54.983 1.00 65.98  ? 96  GLU A N     1 
ATOM   337  C CA    . GLU A 1 66  ? 37.584  -19.521 55.908 1.00 57.22  ? 96  GLU A CA    1 
ATOM   338  C C     . GLU A 1 66  ? 37.093  -18.183 56.476 1.00 50.97  ? 96  GLU A C     1 
ATOM   339  O O     . GLU A 1 66  ? 37.642  -17.677 57.451 1.00 62.05  ? 96  GLU A O     1 
ATOM   340  C CB    . GLU A 1 66  ? 38.917  -19.330 55.184 1.00 60.62  ? 96  GLU A CB    1 
ATOM   341  C CG    . GLU A 1 66  ? 40.107  -19.060 56.074 1.00 77.46  ? 96  GLU A CG    1 
ATOM   342  C CD    . GLU A 1 66  ? 41.422  -19.165 55.316 1.00 91.90  ? 96  GLU A CD    1 
ATOM   343  O OE1   . GLU A 1 66  ? 41.399  -19.576 54.132 1.00 75.63  ? 96  GLU A OE1   1 
ATOM   344  O OE2   . GLU A 1 66  ? 42.476  -18.839 55.906 1.00 105.60 ? 96  GLU A OE2   1 
ATOM   345  N N     . LEU A 1 67  ? 36.057  -17.614 55.870 1.00 35.31  ? 97  LEU A N     1 
ATOM   346  C CA    . LEU A 1 67  ? 35.566  -16.296 56.271 1.00 35.89  ? 97  LEU A CA    1 
ATOM   347  C C     . LEU A 1 67  ? 34.346  -16.366 57.197 1.00 44.01  ? 97  LEU A C     1 
ATOM   348  O O     . LEU A 1 67  ? 33.795  -15.332 57.586 1.00 40.15  ? 97  LEU A O     1 
ATOM   349  C CB    . LEU A 1 67  ? 35.225  -15.450 55.037 1.00 38.76  ? 97  LEU A CB    1 
ATOM   350  C CG    . LEU A 1 67  ? 36.312  -15.093 54.020 1.00 39.11  ? 97  LEU A CG    1 
ATOM   351  C CD1   . LEU A 1 67  ? 35.677  -14.704 52.698 1.00 50.30  ? 97  LEU A CD1   1 
ATOM   352  C CD2   . LEU A 1 67  ? 37.190  -13.970 54.527 1.00 29.00  ? 97  LEU A CD2   1 
ATOM   353  N N     . ARG A 1 68  ? 33.924  -17.578 57.545 1.00 48.16  ? 98  ARG A N     1 
ATOM   354  C CA    . ARG A 1 68  ? 32.773  -17.764 58.425 1.00 57.82  ? 98  ARG A CA    1 
ATOM   355  C C     . ARG A 1 68  ? 31.646  -16.786 58.087 1.00 55.28  ? 98  ARG A C     1 
ATOM   356  O O     . ARG A 1 68  ? 31.302  -15.922 58.898 1.00 57.78  ? 98  ARG A O     1 
ATOM   357  C CB    . ARG A 1 68  ? 33.185  -17.585 59.889 1.00 65.19  ? 98  ARG A CB    1 
ATOM   358  C CG    . ARG A 1 68  ? 32.245  -18.248 60.887 1.00 74.66  ? 98  ARG A CG    1 
ATOM   359  C CD    . ARG A 1 68  ? 32.361  -17.645 62.285 1.00 73.77  ? 98  ARG A CD    1 
ATOM   360  N NE    . ARG A 1 68  ? 31.673  -16.360 62.391 1.00 65.42  ? 98  ARG A NE    1 
ATOM   361  C CZ    . ARG A 1 68  ? 32.284  -15.198 62.606 1.00 64.19  ? 98  ARG A CZ    1 
ATOM   362  N NH1   . ARG A 1 68  ? 33.602  -15.155 62.754 1.00 54.11  ? 98  ARG A NH1   1 
ATOM   363  N NH2   . ARG A 1 68  ? 31.574  -14.079 62.684 1.00 62.05  ? 98  ARG A NH2   1 
ATOM   364  N N     . LEU A 1 69  ? 31.085  -16.916 56.889 1.00 40.54  ? 99  LEU A N     1 
ATOM   365  C CA    . LEU A 1 69  ? 30.012  -16.029 56.458 1.00 28.94  ? 99  LEU A CA    1 
ATOM   366  C C     . LEU A 1 69  ? 28.664  -16.518 56.969 1.00 36.72  ? 99  LEU A C     1 
ATOM   367  O O     . LEU A 1 69  ? 28.461  -17.719 57.163 1.00 33.01  ? 99  LEU A O     1 
ATOM   368  C CB    . LEU A 1 69  ? 29.960  -15.944 54.933 1.00 35.97  ? 99  LEU A CB    1 
ATOM   369  C CG    . LEU A 1 69  ? 31.187  -15.437 54.179 1.00 41.21  ? 99  LEU A CG    1 
ATOM   370  C CD1   . LEU A 1 69  ? 30.916  -15.432 52.680 1.00 24.52  ? 99  LEU A CD1   1 
ATOM   371  C CD2   . LEU A 1 69  ? 31.573  -14.050 54.661 1.00 46.88  ? 99  LEU A CD2   1 
ATOM   372  N N     . LYS A 1 70  ? 27.746  -15.581 57.184 1.00 33.85  ? 100 LYS A N     1 
ATOM   373  C CA    . LYS A 1 70  ? 26.384  -15.930 57.545 1.00 44.09  ? 100 LYS A CA    1 
ATOM   374  C C     . LYS A 1 70  ? 25.872  -16.973 56.564 1.00 50.86  ? 100 LYS A C     1 
ATOM   375  O O     . LYS A 1 70  ? 25.960  -16.792 55.349 1.00 52.89  ? 100 LYS A O     1 
ATOM   376  C CB    . LYS A 1 70  ? 25.495  -14.687 57.527 1.00 59.44  ? 100 LYS A CB    1 
ATOM   377  C CG    . LYS A 1 70  ? 25.731  -13.753 58.704 1.00 66.64  ? 100 LYS A CG    1 
ATOM   378  C CD    . LYS A 1 70  ? 25.502  -12.294 58.335 1.00 57.92  ? 100 LYS A CD    1 
ATOM   379  C CE    . LYS A 1 70  ? 24.037  -11.995 58.105 1.00 62.78  ? 100 LYS A CE    1 
ATOM   380  N NZ    . LYS A 1 70  ? 23.826  -10.553 57.802 1.00 62.23  ? 100 LYS A NZ    1 
ATOM   381  N N     . PRO A 1 71  ? 25.341  -18.077 57.091 1.00 56.73  ? 101 PRO A N     1 
ATOM   382  C CA    . PRO A 1 71  ? 24.899  -19.223 56.291 1.00 57.28  ? 101 PRO A CA    1 
ATOM   383  C C     . PRO A 1 71  ? 24.217  -18.828 54.983 1.00 51.30  ? 101 PRO A C     1 
ATOM   384  O O     . PRO A 1 71  ? 24.712  -19.190 53.922 1.00 51.31  ? 101 PRO A O     1 
ATOM   385  C CB    . PRO A 1 71  ? 23.909  -19.923 57.220 1.00 46.88  ? 101 PRO A CB    1 
ATOM   386  C CG    . PRO A 1 71  ? 24.428  -19.629 58.573 1.00 49.25  ? 101 PRO A CG    1 
ATOM   387  C CD    . PRO A 1 71  ? 25.033  -18.252 58.518 1.00 53.54  ? 101 PRO A CD    1 
ATOM   388  N N     . GLN A 1 72  ? 23.106  -18.102 55.052 1.00 55.00  ? 102 GLN A N     1 
ATOM   389  C CA    . GLN A 1 72  ? 22.352  -17.769 53.844 1.00 56.27  ? 102 GLN A CA    1 
ATOM   390  C C     . GLN A 1 72  ? 23.163  -16.918 52.861 1.00 51.57  ? 102 GLN A C     1 
ATOM   391  O O     . GLN A 1 72  ? 22.938  -16.966 51.650 1.00 51.25  ? 102 GLN A O     1 
ATOM   392  C CB    . GLN A 1 72  ? 21.019  -17.091 54.189 1.00 61.04  ? 102 GLN A CB    1 
ATOM   393  C CG    . GLN A 1 72  ? 21.142  -15.669 54.714 1.00 71.05  ? 102 GLN A CG    1 
ATOM   394  C CD    . GLN A 1 72  ? 21.511  -15.614 56.182 1.00 84.50  ? 102 GLN A CD    1 
ATOM   395  O OE1   . GLN A 1 72  ? 21.622  -16.645 56.847 1.00 83.85  ? 102 GLN A OE1   1 
ATOM   396  N NE2   . GLN A 1 72  ? 21.699  -14.404 56.698 1.00 91.23  ? 102 GLN A NE2   1 
ATOM   397  N N     . LEU A 1 73  ? 24.111  -16.148 53.384 1.00 47.02  ? 103 LEU A N     1 
ATOM   398  C CA    . LEU A 1 73  ? 24.995  -15.350 52.542 1.00 30.55  ? 103 LEU A CA    1 
ATOM   399  C C     . LEU A 1 73  ? 25.941  -16.239 51.745 1.00 32.40  ? 103 LEU A C     1 
ATOM   400  O O     . LEU A 1 73  ? 26.214  -15.985 50.577 1.00 39.52  ? 103 LEU A O     1 
ATOM   401  C CB    . LEU A 1 73  ? 25.814  -14.384 53.391 1.00 26.89  ? 103 LEU A CB    1 
ATOM   402  C CG    . LEU A 1 73  ? 26.723  -13.474 52.574 1.00 33.10  ? 103 LEU A CG    1 
ATOM   403  C CD1   . LEU A 1 73  ? 25.919  -12.853 51.453 1.00 43.42  ? 103 LEU A CD1   1 
ATOM   404  C CD2   . LEU A 1 73  ? 27.362  -12.407 53.442 1.00 46.73  ? 103 LEU A CD2   1 
ATOM   405  N N     . LEU A 1 74  ? 26.457  -17.272 52.397 1.00 33.10  ? 104 LEU A N     1 
ATOM   406  C CA    . LEU A 1 74  ? 27.351  -18.221 51.754 1.00 41.70  ? 104 LEU A CA    1 
ATOM   407  C C     . LEU A 1 74  ? 26.573  -18.987 50.700 1.00 53.68  ? 104 LEU A C     1 
ATOM   408  O O     . LEU A 1 74  ? 27.094  -19.317 49.632 1.00 62.20  ? 104 LEU A O     1 
ATOM   409  C CB    . LEU A 1 74  ? 27.926  -19.188 52.794 1.00 39.54  ? 104 LEU A CB    1 
ATOM   410  C CG    . LEU A 1 74  ? 28.872  -20.258 52.254 1.00 43.96  ? 104 LEU A CG    1 
ATOM   411  C CD1   . LEU A 1 74  ? 30.200  -19.639 51.819 1.00 38.05  ? 104 LEU A CD1   1 
ATOM   412  C CD2   . LEU A 1 74  ? 29.092  -21.347 53.290 1.00 36.84  ? 104 LEU A CD2   1 
ATOM   413  N N     . GLN A 1 75  ? 25.315  -19.264 51.020 1.00 54.05  ? 105 GLN A N     1 
ATOM   414  C CA    . GLN A 1 75  ? 24.409  -19.946 50.112 1.00 54.22  ? 105 GLN A CA    1 
ATOM   415  C C     . GLN A 1 75  ? 24.257  -19.131 48.833 1.00 55.27  ? 105 GLN A C     1 
ATOM   416  O O     . GLN A 1 75  ? 24.352  -19.668 47.732 1.00 57.80  ? 105 GLN A O     1 
ATOM   417  C CB    . GLN A 1 75  ? 23.053  -20.140 50.787 1.00 63.21  ? 105 GLN A CB    1 
ATOM   418  C CG    . GLN A 1 75  ? 22.080  -21.012 50.020 1.00 79.92  ? 105 GLN A CG    1 
ATOM   419  C CD    . GLN A 1 75  ? 20.814  -21.288 50.809 1.00 92.23  ? 105 GLN A CD    1 
ATOM   420  O OE1   . GLN A 1 75  ? 20.789  -21.157 52.036 1.00 95.08  ? 105 GLN A OE1   1 
ATOM   421  N NE2   . GLN A 1 75  ? 19.753  -21.673 50.109 1.00 93.98  ? 105 GLN A NE2   1 
ATOM   422  N N     . GLY A 1 76  ? 24.038  -17.829 48.992 1.00 48.37  ? 106 GLY A N     1 
ATOM   423  C CA    . GLY A 1 76  ? 23.925  -16.921 47.866 1.00 36.07  ? 106 GLY A CA    1 
ATOM   424  C C     . GLY A 1 76  ? 25.195  -16.830 47.035 1.00 46.24  ? 106 GLY A C     1 
ATOM   425  O O     . GLY A 1 76  ? 25.137  -16.715 45.802 1.00 49.25  ? 106 GLY A O     1 
ATOM   426  N N     . VAL A 1 77  ? 26.345  -16.880 47.706 1.00 34.17  ? 107 VAL A N     1 
ATOM   427  C CA    . VAL A 1 77  ? 27.631  -16.777 47.025 1.00 34.22  ? 107 VAL A CA    1 
ATOM   428  C C     . VAL A 1 77  ? 27.863  -17.958 46.092 1.00 43.29  ? 107 VAL A C     1 
ATOM   429  O O     . VAL A 1 77  ? 28.284  -17.779 44.951 1.00 51.54  ? 107 VAL A O     1 
ATOM   430  C CB    . VAL A 1 77  ? 28.803  -16.676 48.021 1.00 34.67  ? 107 VAL A CB    1 
ATOM   431  C CG1   . VAL A 1 77  ? 30.100  -17.116 47.371 1.00 25.98  ? 107 VAL A CG1   1 
ATOM   432  C CG2   . VAL A 1 77  ? 28.929  -15.258 48.548 1.00 37.39  ? 107 VAL A CG2   1 
ATOM   433  N N     . TYR A 1 78  ? 27.585  -19.164 46.573 1.00 44.67  ? 108 TYR A N     1 
ATOM   434  C CA    . TYR A 1 78  ? 27.753  -20.356 45.747 1.00 42.64  ? 108 TYR A CA    1 
ATOM   435  C C     . TYR A 1 78  ? 26.696  -20.413 44.651 1.00 50.98  ? 108 TYR A C     1 
ATOM   436  O O     . TYR A 1 78  ? 26.981  -20.814 43.519 1.00 52.89  ? 108 TYR A O     1 
ATOM   437  C CB    . TYR A 1 78  ? 27.707  -21.632 46.596 1.00 46.00  ? 108 TYR A CB    1 
ATOM   438  C CG    . TYR A 1 78  ? 28.941  -21.845 47.450 1.00 62.69  ? 108 TYR A CG    1 
ATOM   439  C CD1   . TYR A 1 78  ? 30.193  -21.978 46.869 1.00 72.48  ? 108 TYR A CD1   1 
ATOM   440  C CD2   . TYR A 1 78  ? 28.852  -21.918 48.835 1.00 62.03  ? 108 TYR A CD2   1 
ATOM   441  C CE1   . TYR A 1 78  ? 31.325  -22.172 47.638 1.00 76.91  ? 108 TYR A CE1   1 
ATOM   442  C CE2   . TYR A 1 78  ? 29.979  -22.116 49.614 1.00 69.37  ? 108 TYR A CE2   1 
ATOM   443  C CZ    . TYR A 1 78  ? 31.214  -22.240 49.010 1.00 79.33  ? 108 TYR A CZ    1 
ATOM   444  O OH    . TYR A 1 78  ? 32.341  -22.435 49.776 1.00 87.90  ? 108 TYR A OH    1 
ATOM   445  N N     . ALA A 1 79  ? 25.477  -20.004 44.992 1.00 54.79  ? 109 ALA A N     1 
ATOM   446  C CA    . ALA A 1 79  ? 24.356  -20.063 44.057 1.00 60.36  ? 109 ALA A CA    1 
ATOM   447  C C     . ALA A 1 79  ? 24.581  -19.220 42.800 1.00 59.32  ? 109 ALA A C     1 
ATOM   448  O O     . ALA A 1 79  ? 24.009  -19.504 41.745 1.00 60.27  ? 109 ALA A O     1 
ATOM   449  C CB    . ALA A 1 79  ? 23.051  -19.660 44.751 1.00 53.67  ? 109 ALA A CB    1 
ATOM   450  N N     . MET A 1 80  ? 25.404  -18.181 42.910 1.00 47.12  ? 110 MET A N     1 
ATOM   451  C CA    . MET A 1 80  ? 25.686  -17.342 41.752 1.00 45.45  ? 110 MET A CA    1 
ATOM   452  C C     . MET A 1 80  ? 26.973  -17.766 41.036 1.00 54.71  ? 110 MET A C     1 
ATOM   453  O O     . MET A 1 80  ? 27.446  -17.086 40.117 1.00 57.74  ? 110 MET A O     1 
ATOM   454  C CB    . MET A 1 80  ? 25.690  -15.856 42.123 1.00 29.11  ? 110 MET A CB    1 
ATOM   455  C CG    . MET A 1 80  ? 26.792  -15.425 43.046 1.00 28.85  ? 110 MET A CG    1 
ATOM   456  S SD    . MET A 1 80  ? 26.411  -13.817 43.771 1.00 57.91  ? 110 MET A SD    1 
ATOM   457  C CE    . MET A 1 80  ? 25.925  -12.900 42.315 1.00 25.00  ? 110 MET A CE    1 
ATOM   458  N N     . GLY A 1 81  ? 27.521  -18.905 41.455 1.00 41.03  ? 111 GLY A N     1 
ATOM   459  C CA    . GLY A 1 81  ? 28.607  -19.541 40.734 1.00 30.47  ? 111 GLY A CA    1 
ATOM   460  C C     . GLY A 1 81  ? 30.026  -19.311 41.237 1.00 43.14  ? 111 GLY A C     1 
ATOM   461  O O     . GLY A 1 81  ? 30.970  -19.784 40.610 1.00 40.22  ? 111 GLY A O     1 
ATOM   462  N N     . PHE A 1 82  ? 30.195  -18.600 42.351 1.00 36.27  ? 112 PHE A N     1 
ATOM   463  C CA    . PHE A 1 82  ? 31.538  -18.337 42.860 1.00 43.16  ? 112 PHE A CA    1 
ATOM   464  C C     . PHE A 1 82  ? 32.089  -19.528 43.639 1.00 57.46  ? 112 PHE A C     1 
ATOM   465  O O     . PHE A 1 82  ? 31.508  -19.944 44.636 1.00 63.61  ? 112 PHE A O     1 
ATOM   466  C CB    . PHE A 1 82  ? 31.571  -17.083 43.737 1.00 41.40  ? 112 PHE A CB    1 
ATOM   467  C CG    . PHE A 1 82  ? 31.010  -15.861 43.073 1.00 42.67  ? 112 PHE A CG    1 
ATOM   468  C CD1   . PHE A 1 82  ? 30.749  -15.848 41.708 1.00 40.30  ? 112 PHE A CD1   1 
ATOM   469  C CD2   . PHE A 1 82  ? 30.764  -14.712 43.810 1.00 36.20  ? 112 PHE A CD2   1 
ATOM   470  C CE1   . PHE A 1 82  ? 30.232  -14.719 41.095 1.00 37.31  ? 112 PHE A CE1   1 
ATOM   471  C CE2   . PHE A 1 82  ? 30.249  -13.573 43.198 1.00 42.00  ? 112 PHE A CE2   1 
ATOM   472  C CZ    . PHE A 1 82  ? 29.981  -13.580 41.841 1.00 39.55  ? 112 PHE A CZ    1 
ATOM   473  N N     . ASN A 1 83  ? 33.216  -20.069 43.182 1.00 64.53  ? 113 ASN A N     1 
ATOM   474  C CA    . ASN A 1 83  ? 33.866  -21.180 43.871 1.00 68.66  ? 113 ASN A CA    1 
ATOM   475  C C     . ASN A 1 83  ? 34.747  -20.705 45.014 1.00 60.57  ? 113 ASN A C     1 
ATOM   476  O O     . ASN A 1 83  ? 34.678  -21.222 46.125 1.00 53.38  ? 113 ASN A O     1 
ATOM   477  C CB    . ASN A 1 83  ? 34.700  -22.014 42.897 1.00 77.18  ? 113 ASN A CB    1 
ATOM   478  C CG    . ASN A 1 83  ? 34.005  -23.292 42.482 1.00 98.48  ? 113 ASN A CG    1 
ATOM   479  O OD1   . ASN A 1 83  ? 33.031  -23.714 43.106 1.00 109.79 ? 113 ASN A OD1   1 
ATOM   480  N ND2   . ASN A 1 83  ? 34.508  -23.925 41.428 1.00 106.35 ? 113 ASN A ND2   1 
ATOM   481  N N     . ARG A 1 84  ? 35.579  -19.715 44.721 1.00 54.25  ? 114 ARG A N     1 
ATOM   482  C CA    . ARG A 1 84  ? 36.515  -19.177 45.688 1.00 42.48  ? 114 ARG A CA    1 
ATOM   483  C C     . ARG A 1 84  ? 36.690  -17.683 45.443 1.00 40.65  ? 114 ARG A C     1 
ATOM   484  O O     . ARG A 1 84  ? 36.321  -17.177 44.390 1.00 48.16  ? 114 ARG A O     1 
ATOM   485  C CB    . ARG A 1 84  ? 37.854  -19.909 45.581 1.00 51.66  ? 114 ARG A CB    1 
ATOM   486  C CG    . ARG A 1 84  ? 38.476  -19.874 44.195 1.00 66.37  ? 114 ARG A CG    1 
ATOM   487  C CD    . ARG A 1 84  ? 39.461  -21.018 43.977 1.00 83.44  ? 114 ARG A CD    1 
ATOM   488  N NE    . ARG A 1 84  ? 40.415  -21.171 45.075 1.00 96.38  ? 114 ARG A NE    1 
ATOM   489  C CZ    . ARG A 1 84  ? 41.490  -20.408 45.251 1.00 96.11  ? 114 ARG A CZ    1 
ATOM   490  N NH1   . ARG A 1 84  ? 41.749  -19.417 44.405 1.00 101.35 ? 114 ARG A NH1   1 
ATOM   491  N NH2   . ARG A 1 84  ? 42.304  -20.629 46.277 1.00 80.83  ? 114 ARG A NH2   1 
ATOM   492  N N     . PRO A 1 85  ? 37.234  -16.963 46.429 1.00 46.49  ? 115 PRO A N     1 
ATOM   493  C CA    . PRO A 1 85  ? 37.459  -15.528 46.247 1.00 49.52  ? 115 PRO A CA    1 
ATOM   494  C C     . PRO A 1 85  ? 38.471  -15.257 45.145 1.00 55.20  ? 115 PRO A C     1 
ATOM   495  O O     . PRO A 1 85  ? 39.320  -16.100 44.856 1.00 52.64  ? 115 PRO A O     1 
ATOM   496  C CB    . PRO A 1 85  ? 38.026  -15.092 47.597 1.00 43.94  ? 115 PRO A CB    1 
ATOM   497  C CG    . PRO A 1 85  ? 37.539  -16.118 48.555 1.00 44.63  ? 115 PRO A CG    1 
ATOM   498  C CD    . PRO A 1 85  ? 37.547  -17.400 47.797 1.00 38.20  ? 115 PRO A CD    1 
ATOM   499  N N     . SER A 1 86  ? 38.376  -14.081 44.538 1.00 52.64  ? 116 SER A N     1 
ATOM   500  C CA    . SER A 1 86  ? 39.301  -13.696 43.488 1.00 45.47  ? 116 SER A CA    1 
ATOM   501  C C     . SER A 1 86  ? 40.576  -13.119 44.086 1.00 44.02  ? 116 SER A C     1 
ATOM   502  O O     . SER A 1 86  ? 40.651  -12.851 45.280 1.00 54.77  ? 116 SER A O     1 
ATOM   503  C CB    . SER A 1 86  ? 38.653  -12.673 42.555 1.00 41.81  ? 116 SER A CB    1 
ATOM   504  O OG    . SER A 1 86  ? 38.359  -11.473 43.246 1.00 37.84  ? 116 SER A OG    1 
ATOM   505  N N     . LYS A 1 87  ? 41.578  -12.933 43.240 1.00 54.76  ? 117 LYS A N     1 
ATOM   506  C CA    . LYS A 1 87  ? 42.842  -12.337 43.646 1.00 46.91  ? 117 LYS A CA    1 
ATOM   507  C C     . LYS A 1 87  ? 42.620  -11.166 44.600 1.00 37.95  ? 117 LYS A C     1 
ATOM   508  O O     . LYS A 1 87  ? 43.239  -11.092 45.653 1.00 49.98  ? 117 LYS A O     1 
ATOM   509  C CB    . LYS A 1 87  ? 43.601  -11.862 42.405 1.00 42.04  ? 117 LYS A CB    1 
ATOM   510  C CG    . LYS A 1 87  ? 45.085  -11.694 42.585 1.00 41.40  ? 117 LYS A CG    1 
ATOM   511  C CD    . LYS A 1 87  ? 45.779  -13.042 42.556 1.00 68.16  ? 117 LYS A CD    1 
ATOM   512  C CE    . LYS A 1 87  ? 47.204  -12.917 42.053 1.00 74.62  ? 117 LYS A CE    1 
ATOM   513  N NZ    . LYS A 1 87  ? 47.232  -12.482 40.633 1.00 72.05  ? 117 LYS A NZ    1 
ATOM   514  N N     . ILE A 1 88  ? 41.732  -10.252 44.225 1.00 30.73  ? 118 ILE A N     1 
ATOM   515  C CA    . ILE A 1 88  ? 41.508  -9.045  45.013 1.00 27.49  ? 118 ILE A CA    1 
ATOM   516  C C     . ILE A 1 88  ? 40.651  -9.322  46.257 1.00 38.73  ? 118 ILE A C     1 
ATOM   517  O O     . ILE A 1 88  ? 40.859  -8.718  47.308 1.00 36.23  ? 118 ILE A O     1 
ATOM   518  C CB    . ILE A 1 88  ? 40.877  -7.911  44.168 1.00 27.95  ? 118 ILE A CB    1 
ATOM   519  C CG1   . ILE A 1 88  ? 41.299  -6.542  44.697 1.00 41.97  ? 118 ILE A CG1   1 
ATOM   520  C CG2   . ILE A 1 88  ? 39.357  -8.020  44.153 1.00 26.77  ? 118 ILE A CG2   1 
ATOM   521  C CD1   . ILE A 1 88  ? 42.784  -6.336  44.675 1.00 53.53  ? 118 ILE A CD1   1 
ATOM   522  N N     . GLN A 1 89  ? 39.694  -10.238 46.138 1.00 36.96  ? 119 GLN A N     1 
ATOM   523  C CA    . GLN A 1 89  ? 38.824  -10.572 47.259 1.00 40.21  ? 119 GLN A CA    1 
ATOM   524  C C     . GLN A 1 89  ? 39.619  -11.231 48.385 1.00 53.56  ? 119 GLN A C     1 
ATOM   525  O O     . GLN A 1 89  ? 39.338  -11.010 49.566 1.00 52.61  ? 119 GLN A O     1 
ATOM   526  C CB    . GLN A 1 89  ? 37.673  -11.471 46.799 1.00 36.89  ? 119 GLN A CB    1 
ATOM   527  C CG    . GLN A 1 89  ? 36.528  -10.718 46.133 1.00 36.54  ? 119 GLN A CG    1 
ATOM   528  C CD    . GLN A 1 89  ? 35.659  -11.608 45.261 1.00 36.34  ? 119 GLN A CD    1 
ATOM   529  O OE1   . GLN A 1 89  ? 35.780  -12.830 45.285 1.00 39.20  ? 119 GLN A OE1   1 
ATOM   530  N NE2   . GLN A 1 89  ? 34.782  -10.993 44.479 1.00 41.04  ? 119 GLN A NE2   1 
ATOM   531  N N     . GLU A 1 90  ? 40.617  -12.027 48.007 1.00 51.28  ? 120 GLU A N     1 
ATOM   532  C CA    . GLU A 1 90  ? 41.491  -12.694 48.966 1.00 50.23  ? 120 GLU A CA    1 
ATOM   533  C C     . GLU A 1 90  ? 42.025  -11.708 49.991 1.00 48.93  ? 120 GLU A C     1 
ATOM   534  O O     . GLU A 1 90  ? 42.231  -12.052 51.150 1.00 53.91  ? 120 GLU A O     1 
ATOM   535  C CB    . GLU A 1 90  ? 42.664  -13.365 48.247 1.00 46.28  ? 120 GLU A CB    1 
ATOM   536  C CG    . GLU A 1 90  ? 42.269  -14.534 47.360 1.00 56.50  ? 120 GLU A CG    1 
ATOM   537  C CD    . GLU A 1 90  ? 43.462  -15.193 46.687 1.00 72.46  ? 120 GLU A CD    1 
ATOM   538  O OE1   . GLU A 1 90  ? 44.522  -14.542 46.569 1.00 73.26  ? 120 GLU A OE1   1 
ATOM   539  O OE2   . GLU A 1 90  ? 43.336  -16.364 46.272 1.00 80.38  ? 120 GLU A OE2   1 
ATOM   540  N N     . ASN A 1 91  ? 42.245  -10.475 49.553 1.00 44.68  ? 121 ASN A N     1 
ATOM   541  C CA    . ASN A 1 91  ? 42.825  -9.449  50.406 1.00 37.81  ? 121 ASN A CA    1 
ATOM   542  C C     . ASN A 1 91  ? 41.809  -8.447  50.941 1.00 46.75  ? 121 ASN A C     1 
ATOM   543  O O     . ASN A 1 91  ? 42.021  -7.849  51.998 1.00 53.10  ? 121 ASN A O     1 
ATOM   544  C CB    . ASN A 1 91  ? 43.931  -8.710  49.658 1.00 28.15  ? 121 ASN A CB    1 
ATOM   545  C CG    . ASN A 1 91  ? 45.120  -9.591  49.377 1.00 40.60  ? 121 ASN A CG    1 
ATOM   546  O OD1   . ASN A 1 91  ? 45.358  -10.003 48.236 1.00 45.92  ? 121 ASN A OD1   1 
ATOM   547  N ND2   . ASN A 1 91  ? 45.871  -9.905  50.423 1.00 38.54  ? 121 ASN A ND2   1 
ATOM   548  N N     . ALA A 1 92  ? 40.706  -8.268  50.220 1.00 40.35  ? 122 ALA A N     1 
ATOM   549  C CA    . ALA A 1 92  ? 39.711  -7.282  50.610 1.00 33.92  ? 122 ALA A CA    1 
ATOM   550  C C     . ALA A 1 92  ? 38.746  -7.844  51.647 1.00 48.78  ? 122 ALA A C     1 
ATOM   551  O O     . ALA A 1 92  ? 38.511  -7.229  52.692 1.00 48.66  ? 122 ALA A O     1 
ATOM   552  C CB    . ALA A 1 92  ? 38.964  -6.780  49.405 1.00 29.48  ? 122 ALA A CB    1 
ATOM   553  N N     . LEU A 1 93  ? 38.185  -9.012  51.356 1.00 43.92  ? 123 LEU A N     1 
ATOM   554  C CA    . LEU A 1 93  ? 37.183  -9.599  52.237 1.00 39.73  ? 123 LEU A CA    1 
ATOM   555  C C     . LEU A 1 93  ? 37.614  -9.652  53.711 1.00 39.06  ? 123 LEU A C     1 
ATOM   556  O O     . LEU A 1 93  ? 36.870  -9.211  54.584 1.00 41.39  ? 123 LEU A O     1 
ATOM   557  C CB    . LEU A 1 93  ? 36.737  -10.969 51.722 1.00 40.32  ? 123 LEU A CB    1 
ATOM   558  C CG    . LEU A 1 93  ? 35.993  -10.914 50.388 1.00 38.32  ? 123 LEU A CG    1 
ATOM   559  C CD1   . LEU A 1 93  ? 35.490  -12.285 49.972 1.00 46.25  ? 123 LEU A CD1   1 
ATOM   560  C CD2   . LEU A 1 93  ? 34.844  -9.935  50.483 1.00 30.72  ? 123 LEU A CD2   1 
ATOM   561  N N     . PRO A 1 94  ? 38.824  -10.167 53.995 1.00 38.16  ? 124 PRO A N     1 
ATOM   562  C CA    . PRO A 1 94  ? 39.274  -10.211 55.392 1.00 40.34  ? 124 PRO A CA    1 
ATOM   563  C C     . PRO A 1 94  ? 39.399  -8.816  56.002 1.00 36.99  ? 124 PRO A C     1 
ATOM   564  O O     . PRO A 1 94  ? 39.072  -8.633  57.167 1.00 47.02  ? 124 PRO A O     1 
ATOM   565  C CB    . PRO A 1 94  ? 40.658  -10.867 55.299 1.00 36.54  ? 124 PRO A CB    1 
ATOM   566  C CG    . PRO A 1 94  ? 40.690  -11.539 53.974 1.00 41.45  ? 124 PRO A CG    1 
ATOM   567  C CD    . PRO A 1 94  ? 39.843  -10.699 53.077 1.00 40.70  ? 124 PRO A CD    1 
ATOM   568  N N     . LEU A 1 95  ? 39.870  -7.848  55.226 1.00 42.09  ? 125 LEU A N     1 
ATOM   569  C CA    . LEU A 1 95  ? 39.997  -6.482  55.717 1.00 38.16  ? 125 LEU A CA    1 
ATOM   570  C C     . LEU A 1 95  ? 38.635  -5.873  56.011 1.00 35.19  ? 125 LEU A C     1 
ATOM   571  O O     . LEU A 1 95  ? 38.477  -5.127  56.974 1.00 41.10  ? 125 LEU A O     1 
ATOM   572  C CB    . LEU A 1 95  ? 40.756  -5.604  54.713 1.00 32.22  ? 125 LEU A CB    1 
ATOM   573  C CG    . LEU A 1 95  ? 42.235  -5.931  54.502 1.00 45.04  ? 125 LEU A CG    1 
ATOM   574  C CD1   . LEU A 1 95  ? 42.810  -5.119  53.354 1.00 43.98  ? 125 LEU A CD1   1 
ATOM   575  C CD2   . LEU A 1 95  ? 43.032  -5.710  55.782 1.00 51.61  ? 125 LEU A CD2   1 
ATOM   576  N N     . MET A 1 96  ? 37.652  -6.193  55.174 1.00 37.50  ? 126 MET A N     1 
ATOM   577  C CA    . MET A 1 96  ? 36.318  -5.616  55.309 1.00 36.98  ? 126 MET A CA    1 
ATOM   578  C C     . MET A 1 96  ? 35.494  -6.289  56.397 1.00 46.36  ? 126 MET A C     1 
ATOM   579  O O     . MET A 1 96  ? 34.555  -5.698  56.927 1.00 46.87  ? 126 MET A O     1 
ATOM   580  C CB    . MET A 1 96  ? 35.564  -5.701  53.987 1.00 35.08  ? 126 MET A CB    1 
ATOM   581  C CG    . MET A 1 96  ? 36.313  -5.124  52.812 1.00 38.05  ? 126 MET A CG    1 
ATOM   582  S SD    . MET A 1 96  ? 35.375  -5.257  51.289 1.00 55.91  ? 126 MET A SD    1 
ATOM   583  C CE    . MET A 1 96  ? 34.697  -3.615  51.191 1.00 54.56  ? 126 MET A CE    1 
ATOM   584  N N     . LEU A 1 97  ? 35.841  -7.532  56.716 1.00 53.66  ? 127 LEU A N     1 
ATOM   585  C CA    . LEU A 1 97  ? 35.098  -8.306  57.702 1.00 41.53  ? 127 LEU A CA    1 
ATOM   586  C C     . LEU A 1 97  ? 35.791  -8.285  59.052 1.00 46.17  ? 127 LEU A C     1 
ATOM   587  O O     . LEU A 1 97  ? 35.349  -8.933  60.001 1.00 54.94  ? 127 LEU A O     1 
ATOM   588  C CB    . LEU A 1 97  ? 34.904  -9.746  57.227 1.00 34.57  ? 127 LEU A CB    1 
ATOM   589  C CG    . LEU A 1 97  ? 33.985  -9.862  56.011 1.00 45.23  ? 127 LEU A CG    1 
ATOM   590  C CD1   . LEU A 1 97  ? 33.763  -11.313 55.609 1.00 47.80  ? 127 LEU A CD1   1 
ATOM   591  C CD2   . LEU A 1 97  ? 32.664  -9.167  56.296 1.00 39.35  ? 127 LEU A CD2   1 
ATOM   592  N N     . ALA A 1 98  ? 36.877  -7.529  59.137 1.00 48.07  ? 128 ALA A N     1 
ATOM   593  C CA    . ALA A 1 98  ? 37.593  -7.399  60.394 1.00 56.57  ? 128 ALA A CA    1 
ATOM   594  C C     . ALA A 1 98  ? 36.726  -6.671  61.416 1.00 59.26  ? 128 ALA A C     1 
ATOM   595  O O     . ALA A 1 98  ? 35.848  -5.884  61.057 1.00 49.32  ? 128 ALA A O     1 
ATOM   596  C CB    . ALA A 1 98  ? 38.910  -6.671  60.190 1.00 42.17  ? 128 ALA A CB    1 
ATOM   597  N N     . GLU A 1 99  ? 36.977  -6.948  62.690 1.00 63.65  ? 129 GLU A N     1 
ATOM   598  C CA    . GLU A 1 99  ? 36.227  -6.344  63.781 1.00 55.50  ? 129 GLU A CA    1 
ATOM   599  C C     . GLU A 1 99  ? 37.192  -5.662  64.746 1.00 66.36  ? 129 GLU A C     1 
ATOM   600  O O     . GLU A 1 99  ? 38.119  -6.298  65.251 1.00 74.79  ? 129 GLU A O     1 
ATOM   601  C CB    . GLU A 1 99  ? 35.441  -7.422  64.519 1.00 49.76  ? 129 GLU A CB    1 
ATOM   602  C CG    . GLU A 1 99  ? 34.318  -6.884  65.361 1.00 72.20  ? 129 GLU A CG    1 
ATOM   603  C CD    . GLU A 1 99  ? 33.159  -6.421  64.519 1.00 81.24  ? 129 GLU A CD    1 
ATOM   604  O OE1   . GLU A 1 99  ? 32.880  -7.082  63.497 1.00 82.71  ? 129 GLU A OE1   1 
ATOM   605  O OE2   . GLU A 1 99  ? 32.530  -5.403  64.875 1.00 85.66  ? 129 GLU A OE2   1 
ATOM   606  N N     . PRO A 1 100 ? 36.996  -4.358  65.000 1.00 63.18  ? 130 PRO A N     1 
ATOM   607  C CA    . PRO A 1 100 ? 35.955  -3.470  64.467 1.00 62.24  ? 130 PRO A CA    1 
ATOM   608  C C     . PRO A 1 100 ? 36.192  -3.106  63.002 1.00 56.85  ? 130 PRO A C     1 
ATOM   609  O O     . PRO A 1 100 ? 37.338  -3.096  62.550 1.00 58.44  ? 130 PRO A O     1 
ATOM   610  C CB    . PRO A 1 100 ? 36.091  -2.207  65.334 1.00 61.12  ? 130 PRO A CB    1 
ATOM   611  C CG    . PRO A 1 100 ? 37.009  -2.575  66.456 1.00 59.29  ? 130 PRO A CG    1 
ATOM   612  C CD    . PRO A 1 100 ? 37.890  -3.645  65.925 1.00 56.57  ? 130 PRO A CD    1 
ATOM   613  N N     . PRO A 1 101 ? 35.112  -2.777  62.278 1.00 56.22  ? 131 PRO A N     1 
ATOM   614  C CA    . PRO A 1 101 ? 35.107  -2.525  60.832 1.00 60.21  ? 131 PRO A CA    1 
ATOM   615  C C     . PRO A 1 101 ? 36.171  -1.525  60.403 1.00 59.84  ? 131 PRO A C     1 
ATOM   616  O O     . PRO A 1 101 ? 36.161  -0.381  60.854 1.00 63.39  ? 131 PRO A O     1 
ATOM   617  C CB    . PRO A 1 101 ? 33.717  -1.932  60.588 1.00 60.63  ? 131 PRO A CB    1 
ATOM   618  C CG    . PRO A 1 101 ? 32.887  -2.454  61.701 1.00 65.29  ? 131 PRO A CG    1 
ATOM   619  C CD    . PRO A 1 101 ? 33.797  -2.520  62.884 1.00 63.44  ? 131 PRO A CD    1 
ATOM   620  N N     . GLN A 1 102 ? 37.074  -1.953  59.530 1.00 55.38  ? 132 GLN A N     1 
ATOM   621  C CA    . GLN A 1 102 ? 38.126  -1.070  59.045 1.00 46.73  ? 132 GLN A CA    1 
ATOM   622  C C     . GLN A 1 102 ? 37.741  -0.430  57.708 1.00 42.18  ? 132 GLN A C     1 
ATOM   623  O O     . GLN A 1 102 ? 36.966  -0.990  56.933 1.00 29.30  ? 132 GLN A O     1 
ATOM   624  C CB    . GLN A 1 102 ? 39.448  -1.830  58.916 1.00 47.60  ? 132 GLN A CB    1 
ATOM   625  C CG    . GLN A 1 102 ? 39.816  -2.659  60.140 1.00 59.54  ? 132 GLN A CG    1 
ATOM   626  C CD    . GLN A 1 102 ? 41.268  -3.121  60.123 1.00 76.69  ? 132 GLN A CD    1 
ATOM   627  O OE1   . GLN A 1 102 ? 42.081  -2.625  59.341 1.00 86.26  ? 132 GLN A OE1   1 
ATOM   628  N NE2   . GLN A 1 102 ? 41.600  -4.073  60.995 1.00 68.19  ? 132 GLN A NE2   1 
ATOM   629  N N     . ASN A 1 103 ? 38.273  0.758   57.455 1.00 41.06  ? 133 ASN A N     1 
ATOM   630  C CA    . ASN A 1 103 ? 38.059  1.435   56.186 1.00 41.82  ? 133 ASN A CA    1 
ATOM   631  C C     . ASN A 1 103 ? 38.995  0.913   55.103 1.00 43.67  ? 133 ASN A C     1 
ATOM   632  O O     . ASN A 1 103 ? 40.088  0.428   55.397 1.00 41.16  ? 133 ASN A O     1 
ATOM   633  C CB    . ASN A 1 103 ? 38.229  2.939   56.359 1.00 42.13  ? 133 ASN A CB    1 
ATOM   634  C CG    . ASN A 1 103 ? 37.147  3.532   57.208 1.00 36.55  ? 133 ASN A CG    1 
ATOM   635  O OD1   . ASN A 1 103 ? 36.101  2.920   57.390 1.00 36.59  ? 133 ASN A OD1   1 
ATOM   636  N ND2   . ASN A 1 103 ? 37.385  4.723   57.739 1.00 42.22  ? 133 ASN A ND2   1 
ATOM   637  N N     . LEU A 1 104 ? 38.561  1.015   53.851 1.00 27.69  ? 134 LEU A N     1 
ATOM   638  C CA    . LEU A 1 104 ? 39.296  0.408   52.757 1.00 27.15  ? 134 LEU A CA    1 
ATOM   639  C C     . LEU A 1 104 ? 39.252  1.244   51.486 1.00 36.62  ? 134 LEU A C     1 
ATOM   640  O O     . LEU A 1 104 ? 38.196  1.727   51.081 1.00 32.34  ? 134 LEU A O     1 
ATOM   641  C CB    . LEU A 1 104 ? 38.748  -0.994  52.472 1.00 32.79  ? 134 LEU A CB    1 
ATOM   642  C CG    . LEU A 1 104 ? 39.208  -1.679  51.181 1.00 39.75  ? 134 LEU A CG    1 
ATOM   643  C CD1   . LEU A 1 104 ? 40.662  -2.077  51.279 1.00 36.90  ? 134 LEU A CD1   1 
ATOM   644  C CD2   . LEU A 1 104 ? 38.361  -2.897  50.883 1.00 31.58  ? 134 LEU A CD2   1 
ATOM   645  N N     . ILE A 1 105 ? 40.418  1.410   50.871 1.00 35.05  ? 135 ILE A N     1 
ATOM   646  C CA    . ILE A 1 105 ? 40.516  1.924   49.517 1.00 30.55  ? 135 ILE A CA    1 
ATOM   647  C C     . ILE A 1 105 ? 41.090  0.817   48.648 1.00 35.75  ? 135 ILE A C     1 
ATOM   648  O O     . ILE A 1 105 ? 42.216  0.372   48.870 1.00 33.69  ? 135 ILE A O     1 
ATOM   649  C CB    . ILE A 1 105 ? 41.445  3.133   49.431 1.00 30.09  ? 135 ILE A CB    1 
ATOM   650  C CG1   . ILE A 1 105 ? 40.877  4.302   50.233 1.00 35.79  ? 135 ILE A CG1   1 
ATOM   651  C CG2   . ILE A 1 105 ? 41.639  3.543   47.979 1.00 40.94  ? 135 ILE A CG2   1 
ATOM   652  C CD1   . ILE A 1 105 ? 41.823  5.485   50.317 1.00 42.37  ? 135 ILE A CD1   1 
ATOM   653  N N     . ALA A 1 106 ? 40.316  0.365   47.668 1.00 29.37  ? 136 ALA A N     1 
ATOM   654  C CA    . ALA A 1 106 ? 40.770  -0.707  46.786 1.00 27.89  ? 136 ALA A CA    1 
ATOM   655  C C     . ALA A 1 106 ? 40.757  -0.291  45.320 1.00 30.19  ? 136 ALA A C     1 
ATOM   656  O O     . ALA A 1 106 ? 39.719  0.096   44.766 1.00 29.46  ? 136 ALA A O     1 
ATOM   657  C CB    . ALA A 1 106 ? 39.939  -1.965  46.991 1.00 26.57  ? 136 ALA A CB    1 
ATOM   658  N N     . GLN A 1 107 ? 41.922  -0.377  44.696 1.00 34.70  ? 137 GLN A N     1 
ATOM   659  C CA    . GLN A 1 107 ? 42.058  -0.051  43.288 1.00 35.60  ? 137 GLN A CA    1 
ATOM   660  C C     . GLN A 1 107 ? 42.446  -1.297  42.518 1.00 41.81  ? 137 GLN A C     1 
ATOM   661  O O     . GLN A 1 107 ? 43.429  -1.960  42.844 1.00 45.37  ? 137 GLN A O     1 
ATOM   662  C CB    . GLN A 1 107 ? 43.104  1.046   43.096 1.00 47.81  ? 137 GLN A CB    1 
ATOM   663  C CG    . GLN A 1 107 ? 43.641  1.169   41.686 1.00 63.54  ? 137 GLN A CG    1 
ATOM   664  C CD    . GLN A 1 107 ? 44.674  0.114   41.362 1.00 61.76  ? 137 GLN A CD    1 
ATOM   665  O OE1   . GLN A 1 107 ? 45.279  -0.464  42.260 1.00 69.29  ? 137 GLN A OE1   1 
ATOM   666  N NE2   . GLN A 1 107 ? 44.875  -0.148  40.075 1.00 50.70  ? 137 GLN A NE2   1 
ATOM   667  N N     . SER A 1 108 ? 41.663  -1.616  41.497 1.00 42.62  ? 138 SER A N     1 
ATOM   668  C CA    . SER A 1 108 ? 41.974  -2.740  40.633 1.00 40.29  ? 138 SER A CA    1 
ATOM   669  C C     . SER A 1 108 ? 41.122  -2.661  39.381 1.00 35.37  ? 138 SER A C     1 
ATOM   670  O O     . SER A 1 108 ? 39.973  -2.233  39.428 1.00 35.50  ? 138 SER A O     1 
ATOM   671  C CB    . SER A 1 108 ? 41.736  -4.062  41.356 1.00 35.53  ? 138 SER A CB    1 
ATOM   672  O OG    . SER A 1 108 ? 40.359  -4.362  41.406 1.00 44.91  ? 138 SER A OG    1 
ATOM   673  N N     . GLN A 1 109 ? 41.694  -3.075  38.260 1.00 39.61  ? 139 GLN A N     1 
ATOM   674  C CA    . GLN A 1 109 ? 41.003  -3.000  36.981 1.00 35.03  ? 139 GLN A CA    1 
ATOM   675  C C     . GLN A 1 109 ? 39.636  -3.682  37.043 1.00 38.11  ? 139 GLN A C     1 
ATOM   676  O O     . GLN A 1 109 ? 39.420  -4.604  37.831 1.00 38.50  ? 139 GLN A O     1 
ATOM   677  C CB    . GLN A 1 109 ? 41.859  -3.621  35.878 1.00 28.43  ? 139 GLN A CB    1 
ATOM   678  C CG    . GLN A 1 109 ? 41.864  -5.134  35.884 1.00 30.05  ? 139 GLN A CG    1 
ATOM   679  C CD    . GLN A 1 109 ? 42.886  -5.707  34.932 1.00 42.96  ? 139 GLN A CD    1 
ATOM   680  O OE1   . GLN A 1 109 ? 44.079  -5.742  35.235 1.00 47.80  ? 139 GLN A OE1   1 
ATOM   681  N NE2   . GLN A 1 109 ? 42.425  -6.167  33.772 1.00 43.70  ? 139 GLN A NE2   1 
ATOM   682  N N     . SER A 1 110 ? 38.717  -3.227  36.200 1.00 42.33  ? 140 SER A N     1 
ATOM   683  C CA    . SER A 1 110 ? 37.355  -3.736  36.221 1.00 30.82  ? 140 SER A CA    1 
ATOM   684  C C     . SER A 1 110 ? 37.290  -5.210  35.808 1.00 35.49  ? 140 SER A C     1 
ATOM   685  O O     . SER A 1 110 ? 38.030  -5.663  34.928 1.00 28.61  ? 140 SER A O     1 
ATOM   686  C CB    . SER A 1 110 ? 36.455  -2.871  35.342 1.00 21.74  ? 140 SER A CB    1 
ATOM   687  O OG    . SER A 1 110 ? 36.500  -3.275  33.986 1.00 39.31  ? 140 SER A OG    1 
ATOM   688  N N     . GLY A 1 111 ? 36.412  -5.958  36.467 1.00 23.75  ? 141 GLY A N     1 
ATOM   689  C CA    . GLY A 1 111 ? 36.283  -7.381  36.219 1.00 29.97  ? 141 GLY A CA    1 
ATOM   690  C C     . GLY A 1 111 ? 37.144  -8.228  37.138 1.00 35.39  ? 141 GLY A C     1 
ATOM   691  O O     . GLY A 1 111 ? 37.381  -9.406  36.868 1.00 35.41  ? 141 GLY A O     1 
ATOM   692  N N     . THR A 1 112 ? 37.620  -7.631  38.225 1.00 24.02  ? 142 THR A N     1 
ATOM   693  C CA    . THR A 1 112 ? 38.470  -8.354  39.169 1.00 32.95  ? 142 THR A CA    1 
ATOM   694  C C     . THR A 1 112 ? 37.745  -8.703  40.467 1.00 37.32  ? 142 THR A C     1 
ATOM   695  O O     . THR A 1 112 ? 38.359  -9.252  41.385 1.00 33.70  ? 142 THR A O     1 
ATOM   696  C CB    . THR A 1 112 ? 39.747  -7.566  39.516 1.00 31.32  ? 142 THR A CB    1 
ATOM   697  O OG1   . THR A 1 112 ? 39.395  -6.236  39.908 1.00 49.42  ? 142 THR A OG1   1 
ATOM   698  C CG2   . THR A 1 112 ? 40.665  -7.500  38.324 1.00 39.30  ? 142 THR A CG2   1 
ATOM   699  N N     . GLY A 1 113 ? 36.456  -8.362  40.544 1.00 27.89  ? 143 GLY A N     1 
ATOM   700  C CA    . GLY A 1 113 ? 35.608  -8.773  41.651 1.00 29.02  ? 143 GLY A CA    1 
ATOM   701  C C     . GLY A 1 113 ? 35.342  -7.740  42.735 1.00 38.96  ? 143 GLY A C     1 
ATOM   702  O O     . GLY A 1 113 ? 34.942  -8.096  43.838 1.00 45.18  ? 143 GLY A O     1 
ATOM   703  N N     . LYS A 1 114 ? 35.554  -6.464  42.430 1.00 35.81  ? 144 LYS A N     1 
ATOM   704  C CA    . LYS A 1 114 ? 35.333  -5.401  43.406 1.00 23.16  ? 144 LYS A CA    1 
ATOM   705  C C     . LYS A 1 114 ? 33.875  -5.288  43.848 1.00 33.01  ? 144 LYS A C     1 
ATOM   706  O O     . LYS A 1 114 ? 33.592  -5.147  45.051 1.00 33.56  ? 144 LYS A O     1 
ATOM   707  C CB    . LYS A 1 114 ? 35.823  -4.053  42.873 1.00 17.04  ? 144 LYS A CB    1 
ATOM   708  C CG    . LYS A 1 114 ? 37.314  -4.009  42.596 1.00 26.31  ? 144 LYS A CG    1 
ATOM   709  C CD    . LYS A 1 114 ? 37.806  -2.587  42.359 1.00 24.80  ? 144 LYS A CD    1 
ATOM   710  C CE    . LYS A 1 114 ? 37.210  -1.968  41.103 1.00 28.06  ? 144 LYS A CE    1 
ATOM   711  N NZ    . LYS A 1 114 ? 37.237  -2.899  39.940 1.00 21.24  ? 144 LYS A NZ    1 
ATOM   712  N N     . THR A 1 115 ? 32.955  -5.346  42.884 1.00 28.82  ? 145 THR A N     1 
ATOM   713  C CA    . THR A 1 115 ? 31.533  -5.172  43.185 1.00 28.47  ? 145 THR A CA    1 
ATOM   714  C C     . THR A 1 115 ? 30.987  -6.354  43.986 1.00 28.75  ? 145 THR A C     1 
ATOM   715  O O     . THR A 1 115 ? 30.201  -6.180  44.912 1.00 33.49  ? 145 THR A O     1 
ATOM   716  C CB    . THR A 1 115 ? 30.678  -4.954  41.916 1.00 28.60  ? 145 THR A CB    1 
ATOM   717  O OG1   . THR A 1 115 ? 30.832  -3.606  41.452 1.00 35.57  ? 145 THR A OG1   1 
ATOM   718  C CG2   . THR A 1 115 ? 29.211  -5.201  42.217 1.00 25.26  ? 145 THR A CG2   1 
ATOM   719  N N     . ALA A 1 116 ? 31.416  -7.558  43.634 1.00 26.55  ? 146 ALA A N     1 
ATOM   720  C CA    . ALA A 1 116 ? 31.024  -8.736  44.387 1.00 30.63  ? 146 ALA A CA    1 
ATOM   721  C C     . ALA A 1 116 ? 31.557  -8.638  45.816 1.00 42.74  ? 146 ALA A C     1 
ATOM   722  O O     . ALA A 1 116 ? 30.905  -9.079  46.763 1.00 40.84  ? 146 ALA A O     1 
ATOM   723  C CB    . ALA A 1 116 ? 31.531  -10.002 43.702 1.00 29.95  ? 146 ALA A CB    1 
ATOM   724  N N     . ALA A 1 117 ? 32.741  -8.049  45.971 1.00 35.15  ? 147 ALA A N     1 
ATOM   725  C CA    . ALA A 1 117 ? 33.347  -7.925  47.287 1.00 33.00  ? 147 ALA A CA    1 
ATOM   726  C C     . ALA A 1 117 ? 32.515  -7.035  48.208 1.00 38.93  ? 147 ALA A C     1 
ATOM   727  O O     . ALA A 1 117 ? 32.033  -7.485  49.243 1.00 36.39  ? 147 ALA A O     1 
ATOM   728  C CB    . ALA A 1 117 ? 34.766  -7.401  47.180 1.00 35.88  ? 147 ALA A CB    1 
ATOM   729  N N     . PHE A 1 118 ? 32.333  -5.773  47.836 1.00 45.95  ? 148 PHE A N     1 
ATOM   730  C CA    . PHE A 1 118 ? 31.669  -4.850  48.747 1.00 39.15  ? 148 PHE A CA    1 
ATOM   731  C C     . PHE A 1 118 ? 30.195  -5.166  48.937 1.00 36.40  ? 148 PHE A C     1 
ATOM   732  O O     . PHE A 1 118 ? 29.595  -4.762  49.931 1.00 33.90  ? 148 PHE A O     1 
ATOM   733  C CB    . PHE A 1 118 ? 31.914  -3.377  48.383 1.00 30.95  ? 148 PHE A CB    1 
ATOM   734  C CG    . PHE A 1 118 ? 31.202  -2.906  47.148 1.00 37.31  ? 148 PHE A CG    1 
ATOM   735  C CD1   . PHE A 1 118 ? 29.837  -2.669  47.161 1.00 25.25  ? 148 PHE A CD1   1 
ATOM   736  C CD2   . PHE A 1 118 ? 31.914  -2.640  45.985 1.00 45.53  ? 148 PHE A CD2   1 
ATOM   737  C CE1   . PHE A 1 118 ? 29.191  -2.210  46.030 1.00 33.78  ? 148 PHE A CE1   1 
ATOM   738  C CE2   . PHE A 1 118 ? 31.274  -2.177  44.846 1.00 29.60  ? 148 PHE A CE2   1 
ATOM   739  C CZ    . PHE A 1 118 ? 29.911  -1.958  44.870 1.00 34.18  ? 148 PHE A CZ    1 
ATOM   740  N N     . VAL A 1 119 ? 29.620  -5.898  47.989 1.00 30.68  ? 149 VAL A N     1 
ATOM   741  C CA    . VAL A 1 119 ? 28.244  -6.357  48.131 1.00 26.43  ? 149 VAL A CA    1 
ATOM   742  C C     . VAL A 1 119 ? 28.183  -7.427  49.209 1.00 27.15  ? 149 VAL A C     1 
ATOM   743  O O     . VAL A 1 119 ? 27.279  -7.434  50.042 1.00 42.24  ? 149 VAL A O     1 
ATOM   744  C CB    . VAL A 1 119 ? 27.668  -6.876  46.801 1.00 18.58  ? 149 VAL A CB    1 
ATOM   745  C CG1   . VAL A 1 119 ? 26.508  -7.840  47.040 1.00 19.18  ? 149 VAL A CG1   1 
ATOM   746  C CG2   . VAL A 1 119 ? 27.229  -5.712  45.947 1.00 13.91  ? 149 VAL A CG2   1 
ATOM   747  N N     . LEU A 1 120 ? 29.170  -8.314  49.196 1.00 30.05  ? 150 LEU A N     1 
ATOM   748  C CA    . LEU A 1 120 ? 29.349  -9.304  50.251 1.00 30.07  ? 150 LEU A CA    1 
ATOM   749  C C     . LEU A 1 120 ? 29.529  -8.603  51.598 1.00 44.87  ? 150 LEU A C     1 
ATOM   750  O O     . LEU A 1 120 ? 28.947  -9.012  52.607 1.00 50.92  ? 150 LEU A O     1 
ATOM   751  C CB    . LEU A 1 120 ? 30.576  -10.164 49.952 1.00 26.83  ? 150 LEU A CB    1 
ATOM   752  C CG    . LEU A 1 120 ? 30.671  -11.494 50.684 1.00 41.87  ? 150 LEU A CG    1 
ATOM   753  C CD1   . LEU A 1 120 ? 29.366  -12.238 50.528 1.00 53.23  ? 150 LEU A CD1   1 
ATOM   754  C CD2   . LEU A 1 120 ? 31.815  -12.313 50.135 1.00 49.45  ? 150 LEU A CD2   1 
ATOM   755  N N     . ALA A 1 121 ? 30.340  -7.547  51.602 1.00 35.53  ? 151 ALA A N     1 
ATOM   756  C CA    . ALA A 1 121 ? 30.579  -6.750  52.800 1.00 33.52  ? 151 ALA A CA    1 
ATOM   757  C C     . ALA A 1 121 ? 29.273  -6.210  53.371 1.00 43.90  ? 151 ALA A C     1 
ATOM   758  O O     . ALA A 1 121 ? 28.974  -6.408  54.553 1.00 41.05  ? 151 ALA A O     1 
ATOM   759  C CB    . ALA A 1 121 ? 31.515  -5.607  52.487 1.00 30.46  ? 151 ALA A CB    1 
ATOM   760  N N     . MET A 1 122 ? 28.508  -5.524  52.525 1.00 37.52  ? 152 MET A N     1 
ATOM   761  C CA    . MET A 1 122 ? 27.224  -4.961  52.921 1.00 35.70  ? 152 MET A CA    1 
ATOM   762  C C     . MET A 1 122 ? 26.298  -6.027  53.497 1.00 46.03  ? 152 MET A C     1 
ATOM   763  O O     . MET A 1 122 ? 25.712  -5.843  54.566 1.00 47.22  ? 152 MET A O     1 
ATOM   764  C CB    . MET A 1 122 ? 26.543  -4.298  51.729 1.00 32.10  ? 152 MET A CB    1 
ATOM   765  C CG    . MET A 1 122 ? 27.044  -2.910  51.383 1.00 21.47  ? 152 MET A CG    1 
ATOM   766  S SD    . MET A 1 122 ? 26.265  -2.339  49.852 1.00 55.01  ? 152 MET A SD    1 
ATOM   767  C CE    . MET A 1 122 ? 26.374  -0.566  50.069 1.00 50.45  ? 152 MET A CE    1 
ATOM   768  N N     . LEU A 1 123 ? 26.168  -7.141  52.784 1.00 38.63  ? 153 LEU A N     1 
ATOM   769  C CA    . LEU A 1 123 ? 25.245  -8.197  53.184 1.00 38.04  ? 153 LEU A CA    1 
ATOM   770  C C     . LEU A 1 123 ? 25.635  -8.850  54.502 1.00 43.70  ? 153 LEU A C     1 
ATOM   771  O O     . LEU A 1 123 ? 24.813  -9.471  55.168 1.00 48.62  ? 153 LEU A O     1 
ATOM   772  C CB    . LEU A 1 123 ? 25.135  -9.252  52.090 1.00 32.09  ? 153 LEU A CB    1 
ATOM   773  C CG    . LEU A 1 123 ? 24.298  -8.786  50.905 1.00 31.12  ? 153 LEU A CG    1 
ATOM   774  C CD1   . LEU A 1 123 ? 24.355  -9.801  49.777 1.00 50.70  ? 153 LEU A CD1   1 
ATOM   775  C CD2   . LEU A 1 123 ? 22.862  -8.532  51.341 1.00 25.53  ? 153 LEU A CD2   1 
ATOM   776  N N     . SER A 1 124 ? 26.898  -8.705  54.874 1.00 47.33  ? 154 SER A N     1 
ATOM   777  C CA    . SER A 1 124 ? 27.384  -9.252  56.127 1.00 37.92  ? 154 SER A CA    1 
ATOM   778  C C     . SER A 1 124 ? 26.957  -8.390  57.304 1.00 38.24  ? 154 SER A C     1 
ATOM   779  O O     . SER A 1 124 ? 26.654  -8.904  58.371 1.00 47.01  ? 154 SER A O     1 
ATOM   780  C CB    . SER A 1 124 ? 28.905  -9.388  56.094 1.00 30.68  ? 154 SER A CB    1 
ATOM   781  O OG    . SER A 1 124 ? 29.279  -10.625 55.520 1.00 31.39  ? 154 SER A OG    1 
ATOM   782  N N     . GLN A 1 125 ? 26.932  -7.078  57.096 1.00 43.97  ? 155 GLN A N     1 
ATOM   783  C CA    . GLN A 1 125 ? 26.654  -6.133  58.170 1.00 39.46  ? 155 GLN A CA    1 
ATOM   784  C C     . GLN A 1 125 ? 25.170  -5.852  58.314 1.00 46.33  ? 155 GLN A C     1 
ATOM   785  O O     . GLN A 1 125 ? 24.695  -5.513  59.395 1.00 59.85  ? 155 GLN A O     1 
ATOM   786  C CB    . GLN A 1 125 ? 27.390  -4.816  57.925 1.00 46.73  ? 155 GLN A CB    1 
ATOM   787  C CG    . GLN A 1 125 ? 28.889  -4.966  57.742 1.00 59.86  ? 155 GLN A CG    1 
ATOM   788  C CD    . GLN A 1 125 ? 29.566  -5.532  58.970 1.00 63.81  ? 155 GLN A CD    1 
ATOM   789  O OE1   . GLN A 1 125 ? 29.130  -5.302  60.100 1.00 67.67  ? 155 GLN A OE1   1 
ATOM   790  N NE2   . GLN A 1 125 ? 30.642  -6.275  58.757 1.00 65.96  ? 155 GLN A NE2   1 
ATOM   791  N N     . VAL A 1 126 ? 24.440  -5.986  57.216 1.00 57.63  ? 156 VAL A N     1 
ATOM   792  C CA    . VAL A 1 126 ? 23.022  -5.667  57.214 1.00 52.09  ? 156 VAL A CA    1 
ATOM   793  C C     . VAL A 1 126 ? 22.244  -6.642  58.094 1.00 51.28  ? 156 VAL A C     1 
ATOM   794  O O     . VAL A 1 126 ? 22.383  -7.859  57.975 1.00 47.21  ? 156 VAL A O     1 
ATOM   795  C CB    . VAL A 1 126 ? 22.445  -5.665  55.782 1.00 35.56  ? 156 VAL A CB    1 
ATOM   796  C CG1   . VAL A 1 126 ? 22.443  -7.065  55.214 1.00 37.08  ? 156 VAL A CG1   1 
ATOM   797  C CG2   . VAL A 1 126 ? 21.046  -5.096  55.780 1.00 43.20  ? 156 VAL A CG2   1 
ATOM   798  N N     . GLU A 1 127 ? 21.438  -6.095  58.995 1.00 59.78  ? 157 GLU A N     1 
ATOM   799  C CA    . GLU A 1 127 ? 20.528  -6.900  59.799 1.00 72.19  ? 157 GLU A CA    1 
ATOM   800  C C     . GLU A 1 127 ? 19.084  -6.680  59.336 1.00 68.19  ? 157 GLU A C     1 
ATOM   801  O O     . GLU A 1 127 ? 18.466  -5.670  59.672 1.00 60.73  ? 157 GLU A O     1 
ATOM   802  C CB    . GLU A 1 127 ? 20.684  -6.563  61.284 1.00 75.59  ? 157 GLU A CB    1 
ATOM   803  C CG    . GLU A 1 127 ? 19.555  -7.072  62.166 1.00 99.02  ? 157 GLU A CG    1 
ATOM   804  C CD    . GLU A 1 127 ? 19.405  -8.586  62.137 1.00 112.21 ? 157 GLU A CD    1 
ATOM   805  O OE1   . GLU A 1 127 ? 19.294  -9.162  61.033 1.00 106.31 ? 157 GLU A OE1   1 
ATOM   806  O OE2   . GLU A 1 127 ? 19.381  -9.198  63.228 1.00 119.00 ? 157 GLU A OE2   1 
ATOM   807  N N     . PRO A 1 128 ? 18.551  -7.621  58.537 1.00 72.21  ? 158 PRO A N     1 
ATOM   808  C CA    . PRO A 1 128 ? 17.198  -7.514  57.974 1.00 80.51  ? 158 PRO A CA    1 
ATOM   809  C C     . PRO A 1 128 ? 16.119  -7.244  59.026 1.00 80.34  ? 158 PRO A C     1 
ATOM   810  O O     . PRO A 1 128 ? 15.089  -6.663  58.697 1.00 75.30  ? 158 PRO A O     1 
ATOM   811  C CB    . PRO A 1 128 ? 16.981  -8.883  57.325 1.00 71.62  ? 158 PRO A CB    1 
ATOM   812  C CG    . PRO A 1 128 ? 18.353  -9.338  56.970 1.00 62.42  ? 158 PRO A CG    1 
ATOM   813  C CD    . PRO A 1 128 ? 19.251  -8.825  58.058 1.00 65.42  ? 158 PRO A CD    1 
ATOM   814  N N     . ALA A 1 129 ? 16.353  -7.658  60.268 1.00 79.98  ? 159 ALA A N     1 
ATOM   815  C CA    . ALA A 1 129 ? 15.404  -7.396  61.343 1.00 80.58  ? 159 ALA A CA    1 
ATOM   816  C C     . ALA A 1 129 ? 15.074  -5.909  61.419 1.00 68.12  ? 159 ALA A C     1 
ATOM   817  O O     . ALA A 1 129 ? 13.908  -5.526  61.526 1.00 61.45  ? 159 ALA A O     1 
ATOM   818  C CB    . ALA A 1 129 ? 15.960  -7.882  62.669 1.00 86.98  ? 159 ALA A CB    1 
ATOM   819  N N     . ASN A 1 130 ? 16.112  -5.078  61.362 1.00 55.78  ? 160 ASN A N     1 
ATOM   820  C CA    . ASN A 1 130 ? 15.947  -3.630  61.417 1.00 56.23  ? 160 ASN A CA    1 
ATOM   821  C C     . ASN A 1 130 ? 15.461  -3.053  60.095 1.00 60.59  ? 160 ASN A C     1 
ATOM   822  O O     . ASN A 1 130 ? 16.109  -3.210  59.055 1.00 63.19  ? 160 ASN A O     1 
ATOM   823  C CB    . ASN A 1 130 ? 17.256  -2.955  61.820 1.00 58.16  ? 160 ASN A CB    1 
ATOM   824  C CG    . ASN A 1 130 ? 17.730  -3.379  63.188 1.00 60.70  ? 160 ASN A CG    1 
ATOM   825  O OD1   . ASN A 1 130 ? 17.010  -4.054  63.922 1.00 65.66  ? 160 ASN A OD1   1 
ATOM   826  N ND2   . ASN A 1 130 ? 18.949  -2.988  63.540 1.00 59.35  ? 160 ASN A ND2   1 
ATOM   827  N N     . LYS A 1 131 ? 14.325  -2.368  60.146 1.00 59.09  ? 161 LYS A N     1 
ATOM   828  C CA    . LYS A 1 131 ? 13.700  -1.847  58.938 1.00 59.76  ? 161 LYS A CA    1 
ATOM   829  C C     . LYS A 1 131 ? 14.095  -0.401  58.664 1.00 56.59  ? 161 LYS A C     1 
ATOM   830  O O     . LYS A 1 131 ? 13.247  0.494   58.632 1.00 47.84  ? 161 LYS A O     1 
ATOM   831  C CB    . LYS A 1 131 ? 12.184  -1.982  59.027 1.00 53.71  ? 161 LYS A CB    1 
ATOM   832  C CG    . LYS A 1 131 ? 11.731  -3.364  59.462 1.00 61.78  ? 161 LYS A CG    1 
ATOM   833  C CD    . LYS A 1 131 ? 12.193  -4.437  58.486 1.00 64.56  ? 161 LYS A CD    1 
ATOM   834  C CE    . LYS A 1 131 ? 11.725  -5.820  58.930 1.00 71.87  ? 161 LYS A CE    1 
ATOM   835  N NZ    . LYS A 1 131 ? 12.058  -6.881  57.936 1.00 70.73  ? 161 LYS A NZ    1 
ATOM   836  N N     . TYR A 1 132 ? 15.392  -0.184  58.468 1.00 45.36  ? 162 TYR A N     1 
ATOM   837  C CA    . TYR A 1 132 ? 15.889  1.107   58.018 1.00 36.49  ? 162 TYR A CA    1 
ATOM   838  C C     . TYR A 1 132 ? 17.181  0.925   57.230 1.00 28.75  ? 162 TYR A C     1 
ATOM   839  O O     . TYR A 1 132 ? 17.832  -0.114  57.341 1.00 35.02  ? 162 TYR A O     1 
ATOM   840  C CB    . TYR A 1 132 ? 16.093  2.062   59.198 1.00 36.43  ? 162 TYR A CB    1 
ATOM   841  C CG    . TYR A 1 132 ? 16.858  1.472   60.362 1.00 54.35  ? 162 TYR A CG    1 
ATOM   842  C CD1   . TYR A 1 132 ? 16.191  0.988   61.483 1.00 61.85  ? 162 TYR A CD1   1 
ATOM   843  C CD2   . TYR A 1 132 ? 18.247  1.407   60.348 1.00 59.98  ? 162 TYR A CD2   1 
ATOM   844  C CE1   . TYR A 1 132 ? 16.884  0.451   62.557 1.00 65.15  ? 162 TYR A CE1   1 
ATOM   845  C CE2   . TYR A 1 132 ? 18.950  0.869   61.416 1.00 71.96  ? 162 TYR A CE2   1 
ATOM   846  C CZ    . TYR A 1 132 ? 18.262  0.393   62.518 1.00 69.85  ? 162 TYR A CZ    1 
ATOM   847  O OH    . TYR A 1 132 ? 18.955  -0.140  63.580 1.00 63.26  ? 162 TYR A OH    1 
ATOM   848  N N     . PRO A 1 133 ? 17.546  1.927   56.416 1.00 25.49  ? 163 PRO A N     1 
ATOM   849  C CA    . PRO A 1 133 ? 18.808  1.860   55.671 1.00 35.97  ? 163 PRO A CA    1 
ATOM   850  C C     . PRO A 1 133 ? 20.015  1.665   56.590 1.00 40.38  ? 163 PRO A C     1 
ATOM   851  O O     . PRO A 1 133 ? 20.291  2.502   57.452 1.00 45.78  ? 163 PRO A O     1 
ATOM   852  C CB    . PRO A 1 133 ? 18.876  3.222   54.970 1.00 18.89  ? 163 PRO A CB    1 
ATOM   853  C CG    . PRO A 1 133 ? 17.450  3.615   54.793 1.00 24.60  ? 163 PRO A CG    1 
ATOM   854  C CD    . PRO A 1 133 ? 16.726  3.083   56.015 1.00 23.83  ? 163 PRO A CD    1 
ATOM   855  N N     . GLN A 1 134 ? 20.721  0.557   56.393 1.00 37.71  ? 164 GLN A N     1 
ATOM   856  C CA    . GLN A 1 134 ? 21.930  0.248   57.141 1.00 27.50  ? 164 GLN A CA    1 
ATOM   857  C C     . GLN A 1 134 ? 23.152  0.294   56.230 1.00 31.04  ? 164 GLN A C     1 
ATOM   858  O O     . GLN A 1 134 ? 24.282  0.485   56.688 1.00 35.16  ? 164 GLN A O     1 
ATOM   859  C CB    . GLN A 1 134 ? 21.818  -1.135  57.771 1.00 30.15  ? 164 GLN A CB    1 
ATOM   860  C CG    . GLN A 1 134 ? 20.649  -1.289  58.720 1.00 24.95  ? 164 GLN A CG    1 
ATOM   861  C CD    . GLN A 1 134 ? 20.373  -2.740  59.042 1.00 44.50  ? 164 GLN A CD    1 
ATOM   862  O OE1   . GLN A 1 134 ? 21.273  -3.476  59.446 1.00 55.10  ? 164 GLN A OE1   1 
ATOM   863  N NE2   . GLN A 1 134 ? 19.124  -3.164  58.860 1.00 43.43  ? 164 GLN A NE2   1 
ATOM   864  N N     . CYS A 1 135 ? 22.924  0.119   54.935 1.00 31.29  ? 165 CYS A N     1 
ATOM   865  C CA    . CYS A 1 135 ? 24.014  0.145   53.967 1.00 24.58  ? 165 CYS A CA    1 
ATOM   866  C C     . CYS A 1 135 ? 23.716  1.135   52.859 1.00 30.72  ? 165 CYS A C     1 
ATOM   867  O O     . CYS A 1 135 ? 22.591  1.205   52.356 1.00 29.13  ? 165 CYS A O     1 
ATOM   868  C CB    . CYS A 1 135 ? 24.270  -1.249  53.399 1.00 19.40  ? 165 CYS A CB    1 
ATOM   869  S SG    . CYS A 1 135 ? 24.780  -2.462  54.647 1.00 68.05  ? 165 CYS A SG    1 
ATOM   870  N N     . LEU A 1 136 ? 24.732  1.905   52.493 1.00 21.61  ? 166 LEU A N     1 
ATOM   871  C CA    . LEU A 1 136 ? 24.579  2.967   51.509 1.00 34.45  ? 166 LEU A CA    1 
ATOM   872  C C     . LEU A 1 136 ? 25.674  2.886   50.451 1.00 37.71  ? 166 LEU A C     1 
ATOM   873  O O     . LEU A 1 136 ? 26.861  2.838   50.774 1.00 32.77  ? 166 LEU A O     1 
ATOM   874  C CB    . LEU A 1 136 ? 24.615  4.329   52.200 1.00 28.80  ? 166 LEU A CB    1 
ATOM   875  C CG    . LEU A 1 136 ? 24.476  5.539   51.282 1.00 36.18  ? 166 LEU A CG    1 
ATOM   876  C CD1   . LEU A 1 136 ? 23.154  5.473   50.527 1.00 41.88  ? 166 LEU A CD1   1 
ATOM   877  C CD2   . LEU A 1 136 ? 24.585  6.830   52.085 1.00 26.33  ? 166 LEU A CD2   1 
ATOM   878  N N     . CYS A 1 137 ? 25.273  2.864   49.186 1.00 34.66  ? 167 CYS A N     1 
ATOM   879  C CA    . CYS A 1 137 ? 26.229  2.759   48.094 1.00 24.68  ? 167 CYS A CA    1 
ATOM   880  C C     . CYS A 1 137 ? 26.016  3.869   47.080 1.00 26.55  ? 167 CYS A C     1 
ATOM   881  O O     . CYS A 1 137 ? 24.911  4.058   46.580 1.00 35.00  ? 167 CYS A O     1 
ATOM   882  C CB    . CYS A 1 137 ? 26.105  1.398   47.415 1.00 21.17  ? 167 CYS A CB    1 
ATOM   883  S SG    . CYS A 1 137 ? 27.056  1.244   45.889 1.00 47.00  ? 167 CYS A SG    1 
ATOM   884  N N     . LEU A 1 138 ? 27.076  4.607   46.773 1.00 30.68  ? 168 LEU A N     1 
ATOM   885  C CA    . LEU A 1 138 ? 26.980  5.672   45.778 1.00 33.64  ? 168 LEU A CA    1 
ATOM   886  C C     . LEU A 1 138 ? 27.521  5.244   44.413 1.00 47.96  ? 168 LEU A C     1 
ATOM   887  O O     . LEU A 1 138 ? 28.693  4.889   44.277 1.00 46.55  ? 168 LEU A O     1 
ATOM   888  C CB    . LEU A 1 138 ? 27.703  6.933   46.250 1.00 21.55  ? 168 LEU A CB    1 
ATOM   889  C CG    . LEU A 1 138 ? 27.242  7.551   47.569 1.00 38.84  ? 168 LEU A CG    1 
ATOM   890  C CD1   . LEU A 1 138 ? 27.928  8.890   47.768 1.00 45.99  ? 168 LEU A CD1   1 
ATOM   891  C CD2   . LEU A 1 138 ? 25.734  7.712   47.594 1.00 41.38  ? 168 LEU A CD2   1 
ATOM   892  N N     . SER A 1 139 ? 26.650  5.270   43.410 1.00 42.42  ? 169 SER A N     1 
ATOM   893  C CA    . SER A 1 139 ? 27.051  5.054   42.029 1.00 32.63  ? 169 SER A CA    1 
ATOM   894  C C     . SER A 1 139 ? 27.037  6.385   41.298 1.00 37.17  ? 169 SER A C     1 
ATOM   895  O O     . SER A 1 139 ? 26.337  7.313   41.706 1.00 31.00  ? 169 SER A O     1 
ATOM   896  C CB    . SER A 1 139 ? 26.120  4.053   41.337 1.00 29.25  ? 169 SER A CB    1 
ATOM   897  O OG    . SER A 1 139 ? 26.637  2.734   41.420 1.00 46.09  ? 169 SER A OG    1 
ATOM   898  N N     . PRO A 1 140 ? 27.822  6.484   40.216 1.00 34.27  ? 170 PRO A N     1 
ATOM   899  C CA    . PRO A 1 140 ? 27.924  7.712   39.426 1.00 36.62  ? 170 PRO A CA    1 
ATOM   900  C C     . PRO A 1 140 ? 26.703  7.931   38.530 1.00 46.59  ? 170 PRO A C     1 
ATOM   901  O O     . PRO A 1 140 ? 26.449  9.062   38.117 1.00 55.96  ? 170 PRO A O     1 
ATOM   902  C CB    . PRO A 1 140 ? 29.176  7.477   38.565 1.00 39.83  ? 170 PRO A CB    1 
ATOM   903  C CG    . PRO A 1 140 ? 29.853  6.273   39.139 1.00 32.81  ? 170 PRO A CG    1 
ATOM   904  C CD    . PRO A 1 140 ? 28.757  5.454   39.742 1.00 34.82  ? 170 PRO A CD    1 
ATOM   905  N N     . THR A 1 141 ? 25.970  6.862   38.224 1.00 40.50  ? 171 THR A N     1 
ATOM   906  C CA    . THR A 1 141 ? 24.748  6.965   37.429 1.00 39.89  ? 171 THR A CA    1 
ATOM   907  C C     . THR A 1 141 ? 23.741  5.887   37.817 1.00 46.28  ? 171 THR A C     1 
ATOM   908  O O     . THR A 1 141 ? 24.117  4.838   38.340 1.00 48.06  ? 171 THR A O     1 
ATOM   909  C CB    . THR A 1 141 ? 25.026  6.849   35.906 1.00 37.13  ? 171 THR A CB    1 
ATOM   910  O OG1   . THR A 1 141 ? 25.433  5.513   35.577 1.00 46.91  ? 171 THR A OG1   1 
ATOM   911  C CG2   . THR A 1 141 ? 26.105  7.818   35.479 1.00 33.05  ? 171 THR A CG2   1 
ATOM   912  N N     . TYR A 1 142 ? 22.465  6.149   37.548 1.00 44.17  ? 172 TYR A N     1 
ATOM   913  C CA    . TYR A 1 142 ? 21.401  5.191   37.835 1.00 35.88  ? 172 TYR A CA    1 
ATOM   914  C C     . TYR A 1 142 ? 21.624  3.851   37.128 1.00 44.49  ? 172 TYR A C     1 
ATOM   915  O O     . TYR A 1 142 ? 21.388  2.789   37.706 1.00 51.38  ? 172 TYR A O     1 
ATOM   916  C CB    . TYR A 1 142 ? 20.039  5.781   37.454 1.00 36.04  ? 172 TYR A CB    1 
ATOM   917  C CG    . TYR A 1 142 ? 18.858  4.873   37.731 1.00 40.69  ? 172 TYR A CG    1 
ATOM   918  C CD1   . TYR A 1 142 ? 18.824  4.063   38.861 1.00 35.50  ? 172 TYR A CD1   1 
ATOM   919  C CD2   . TYR A 1 142 ? 17.767  4.840   36.873 1.00 43.26  ? 172 TYR A CD2   1 
ATOM   920  C CE1   . TYR A 1 142 ? 17.748  3.235   39.117 1.00 45.53  ? 172 TYR A CE1   1 
ATOM   921  C CE2   . TYR A 1 142 ? 16.685  4.016   37.120 1.00 50.70  ? 172 TYR A CE2   1 
ATOM   922  C CZ    . TYR A 1 142 ? 16.676  3.216   38.247 1.00 56.12  ? 172 TYR A CZ    1 
ATOM   923  O OH    . TYR A 1 142 ? 15.595  2.393   38.504 1.00 54.04  ? 172 TYR A OH    1 
ATOM   924  N N     . GLU A 1 143 ? 22.085  3.904   35.882 1.00 35.90  ? 173 GLU A N     1 
ATOM   925  C CA    . GLU A 1 143 ? 22.305  2.687   35.103 1.00 29.58  ? 173 GLU A CA    1 
ATOM   926  C C     . GLU A 1 143 ? 23.387  1.805   35.715 1.00 27.75  ? 173 GLU A C     1 
ATOM   927  O O     . GLU A 1 143 ? 23.290  0.577   35.670 1.00 40.60  ? 173 GLU A O     1 
ATOM   928  C CB    . GLU A 1 143 ? 22.637  3.021   33.646 1.00 35.05  ? 173 GLU A CB    1 
ATOM   929  C CG    . GLU A 1 143 ? 21.446  3.503   32.831 1.00 44.08  ? 173 GLU A CG    1 
ATOM   930  C CD    . GLU A 1 143 ? 21.097  4.963   33.080 1.00 65.07  ? 173 GLU A CD    1 
ATOM   931  O OE1   . GLU A 1 143 ? 19.934  5.349   32.822 1.00 75.71  ? 173 GLU A OE1   1 
ATOM   932  O OE2   . GLU A 1 143 ? 21.980  5.725   33.529 1.00 64.96  ? 173 GLU A OE2   1 
ATOM   933  N N     . LEU A 1 144 ? 24.421  2.431   36.274 1.00 23.72  ? 174 LEU A N     1 
ATOM   934  C CA    . LEU A 1 144 ? 25.445  1.701   37.015 1.00 25.53  ? 174 LEU A CA    1 
ATOM   935  C C     . LEU A 1 144 ? 24.907  1.240   38.381 1.00 34.27  ? 174 LEU A C     1 
ATOM   936  O O     . LEU A 1 144 ? 25.226  0.147   38.854 1.00 28.20  ? 174 LEU A O     1 
ATOM   937  C CB    . LEU A 1 144 ? 26.707  2.556   37.181 1.00 32.95  ? 174 LEU A CB    1 
ATOM   938  C CG    . LEU A 1 144 ? 27.598  2.744   35.944 1.00 34.98  ? 174 LEU A CG    1 
ATOM   939  C CD1   . LEU A 1 144 ? 28.634  3.844   36.149 1.00 18.86  ? 174 LEU A CD1   1 
ATOM   940  C CD2   . LEU A 1 144 ? 28.271  1.441   35.544 1.00 24.29  ? 174 LEU A CD2   1 
ATOM   941  N N     . ALA A 1 145 ? 24.082  2.074   39.005 1.00 33.61  ? 175 ALA A N     1 
ATOM   942  C CA    . ALA A 1 145 ? 23.416  1.687   40.240 1.00 28.17  ? 175 ALA A CA    1 
ATOM   943  C C     . ALA A 1 145 ? 22.632  0.393   40.033 1.00 35.37  ? 175 ALA A C     1 
ATOM   944  O O     . ALA A 1 145 ? 22.635  -0.491  40.892 1.00 31.09  ? 175 ALA A O     1 
ATOM   945  C CB    . ALA A 1 145 ? 22.501  2.797   40.717 1.00 25.66  ? 175 ALA A CB    1 
ATOM   946  N N     . LEU A 1 146 ? 21.967  0.282   38.884 1.00 21.46  ? 176 LEU A N     1 
ATOM   947  C CA    . LEU A 1 146 ? 21.176  -0.904  38.582 1.00 17.34  ? 176 LEU A CA    1 
ATOM   948  C C     . LEU A 1 146 ? 22.025  -2.153  38.409 1.00 25.69  ? 176 LEU A C     1 
ATOM   949  O O     . LEU A 1 146 ? 21.562  -3.263  38.660 1.00 37.74  ? 176 LEU A O     1 
ATOM   950  C CB    . LEU A 1 146 ? 20.312  -0.678  37.350 1.00 17.53  ? 176 LEU A CB    1 
ATOM   951  C CG    . LEU A 1 146 ? 19.129  0.241   37.609 1.00 31.89  ? 176 LEU A CG    1 
ATOM   952  C CD1   . LEU A 1 146 ? 18.508  0.701   36.303 1.00 23.90  ? 176 LEU A CD1   1 
ATOM   953  C CD2   . LEU A 1 146 ? 18.106  -0.465  38.491 1.00 34.80  ? 176 LEU A CD2   1 
ATOM   954  N N     . GLN A 1 147 ? 23.272  -1.969  37.989 1.00 32.80  ? 177 GLN A N     1 
ATOM   955  C CA    . GLN A 1 147 ? 24.196  -3.088  37.851 1.00 22.44  ? 177 GLN A CA    1 
ATOM   956  C C     . GLN A 1 147 ? 24.628  -3.595  39.219 1.00 29.81  ? 177 GLN A C     1 
ATOM   957  O O     . GLN A 1 147 ? 24.690  -4.801  39.444 1.00 51.54  ? 177 GLN A O     1 
ATOM   958  C CB    . GLN A 1 147 ? 25.405  -2.694  37.001 1.00 20.65  ? 177 GLN A CB    1 
ATOM   959  C CG    . GLN A 1 147 ? 25.042  -2.436  35.551 1.00 26.57  ? 177 GLN A CG    1 
ATOM   960  C CD    . GLN A 1 147 ? 24.341  -3.622  34.926 1.00 28.42  ? 177 GLN A CD    1 
ATOM   961  O OE1   . GLN A 1 147 ? 24.831  -4.749  34.995 1.00 40.03  ? 177 GLN A OE1   1 
ATOM   962  N NE2   . GLN A 1 147 ? 23.182  -3.378  34.321 1.00 26.35  ? 177 GLN A NE2   1 
ATOM   963  N N     . THR A 1 148 ? 24.921  -2.677  40.135 1.00 25.24  ? 178 THR A N     1 
ATOM   964  C CA    . THR A 1 148 ? 25.199  -3.059  41.516 1.00 30.67  ? 178 THR A CA    1 
ATOM   965  C C     . THR A 1 148 ? 23.952  -3.683  42.131 1.00 28.37  ? 178 THR A C     1 
ATOM   966  O O     . THR A 1 148 ? 24.027  -4.732  42.772 1.00 32.32  ? 178 THR A O     1 
ATOM   967  C CB    . THR A 1 148 ? 25.623  -1.853  42.375 1.00 33.83  ? 178 THR A CB    1 
ATOM   968  O OG1   . THR A 1 148 ? 26.857  -1.312  41.886 1.00 30.25  ? 178 THR A OG1   1 
ATOM   969  C CG2   . THR A 1 148 ? 25.802  -2.280  43.817 1.00 31.72  ? 178 THR A CG2   1 
ATOM   970  N N     . GLY A 1 149 ? 22.810  -3.029  41.920 1.00 23.00  ? 179 GLY A N     1 
ATOM   971  C CA    . GLY A 1 149 ? 21.525  -3.535  42.368 1.00 19.18  ? 179 GLY A CA    1 
ATOM   972  C C     . GLY A 1 149 ? 21.267  -4.966  41.939 1.00 29.03  ? 179 GLY A C     1 
ATOM   973  O O     . GLY A 1 149 ? 20.651  -5.744  42.664 1.00 30.38  ? 179 GLY A O     1 
ATOM   974  N N     . LYS A 1 150 ? 21.746  -5.316  40.752 1.00 30.96  ? 180 LYS A N     1 
ATOM   975  C CA    . LYS A 1 150 ? 21.543  -6.650  40.207 1.00 34.50  ? 180 LYS A CA    1 
ATOM   976  C C     . LYS A 1 150 ? 22.277  -7.670  41.068 1.00 34.96  ? 180 LYS A C     1 
ATOM   977  O O     . LYS A 1 150 ? 21.724  -8.704  41.437 1.00 39.68  ? 180 LYS A O     1 
ATOM   978  C CB    . LYS A 1 150 ? 22.060  -6.690  38.771 1.00 41.46  ? 180 LYS A CB    1 
ATOM   979  C CG    . LYS A 1 150 ? 21.413  -7.709  37.857 1.00 50.06  ? 180 LYS A CG    1 
ATOM   980  C CD    . LYS A 1 150 ? 22.084  -7.641  36.480 1.00 68.11  ? 180 LYS A CD    1 
ATOM   981  C CE    . LYS A 1 150 ? 21.168  -8.092  35.345 1.00 79.18  ? 180 LYS A CE    1 
ATOM   982  N NZ    . LYS A 1 150 ? 21.189  -9.565  35.122 1.00 78.31  ? 180 LYS A NZ    1 
ATOM   983  N N     . VAL A 1 151 ? 23.527  -7.361  41.393 1.00 36.41  ? 181 VAL A N     1 
ATOM   984  C CA    . VAL A 1 151 ? 24.373  -8.246  42.194 1.00 36.44  ? 181 VAL A CA    1 
ATOM   985  C C     . VAL A 1 151 ? 23.827  -8.462  43.597 1.00 41.48  ? 181 VAL A C     1 
ATOM   986  O O     . VAL A 1 151 ? 23.875  -9.570  44.128 1.00 41.96  ? 181 VAL A O     1 
ATOM   987  C CB    . VAL A 1 151 ? 25.778  -7.675  42.338 1.00 30.58  ? 181 VAL A CB    1 
ATOM   988  C CG1   . VAL A 1 151 ? 26.643  -8.608  43.183 1.00 29.99  ? 181 VAL A CG1   1 
ATOM   989  C CG2   . VAL A 1 151 ? 26.378  -7.447  40.978 1.00 15.60  ? 181 VAL A CG2   1 
ATOM   990  N N     . ILE A 1 152 ? 23.325  -7.390  44.199 1.00 35.90  ? 182 ILE A N     1 
ATOM   991  C CA    . ILE A 1 152 ? 22.751  -7.470  45.533 1.00 36.00  ? 182 ILE A CA    1 
ATOM   992  C C     . ILE A 1 152 ? 21.542  -8.397  45.561 1.00 42.43  ? 182 ILE A C     1 
ATOM   993  O O     . ILE A 1 152 ? 21.476  -9.310  46.381 1.00 57.02  ? 182 ILE A O     1 
ATOM   994  C CB    . ILE A 1 152 ? 22.340  -6.093  46.050 1.00 32.17  ? 182 ILE A CB    1 
ATOM   995  C CG1   . ILE A 1 152 ? 23.578  -5.211  46.215 1.00 33.18  ? 182 ILE A CG1   1 
ATOM   996  C CG2   . ILE A 1 152 ? 21.619  -6.237  47.367 1.00 33.45  ? 182 ILE A CG2   1 
ATOM   997  C CD1   . ILE A 1 152 ? 23.269  -3.740  46.315 1.00 31.64  ? 182 ILE A CD1   1 
ATOM   998  N N     . GLU A 1 153 ? 20.591  -8.161  44.662 1.00 36.34  ? 183 GLU A N     1 
ATOM   999  C CA    . GLU A 1 153 ? 19.387  -8.978  44.594 1.00 34.20  ? 183 GLU A CA    1 
ATOM   1000 C C     . GLU A 1 153 ? 19.751  -10.447 44.417 1.00 33.13  ? 183 GLU A C     1 
ATOM   1001 O O     . GLU A 1 153 ? 19.004  -11.335 44.808 1.00 54.15  ? 183 GLU A O     1 
ATOM   1002 C CB    . GLU A 1 153 ? 18.485  -8.514  43.444 1.00 48.69  ? 183 GLU A CB    1 
ATOM   1003 C CG    . GLU A 1 153 ? 17.949  -7.086  43.587 1.00 68.77  ? 183 GLU A CG    1 
ATOM   1004 C CD    . GLU A 1 153 ? 17.634  -6.436  42.238 1.00 86.46  ? 183 GLU A CD    1 
ATOM   1005 O OE1   . GLU A 1 153 ? 17.157  -5.277  42.222 1.00 81.29  ? 183 GLU A OE1   1 
ATOM   1006 O OE2   . GLU A 1 153 ? 17.871  -7.082  41.193 1.00 91.08  ? 183 GLU A OE2   1 
ATOM   1007 N N     . GLN A 1 154 ? 20.919  -10.693 43.841 1.00 34.40  ? 184 GLN A N     1 
ATOM   1008 C CA    . GLN A 1 154 ? 21.334  -12.039 43.464 1.00 48.07  ? 184 GLN A CA    1 
ATOM   1009 C C     . GLN A 1 154 ? 22.103  -12.764 44.574 1.00 43.79  ? 184 GLN A C     1 
ATOM   1010 O O     . GLN A 1 154 ? 21.880  -13.950 44.831 1.00 45.89  ? 184 GLN A O     1 
ATOM   1011 C CB    . GLN A 1 154 ? 22.182  -11.966 42.193 1.00 58.68  ? 184 GLN A CB    1 
ATOM   1012 C CG    . GLN A 1 154 ? 22.456  -13.294 41.520 1.00 69.99  ? 184 GLN A CG    1 
ATOM   1013 C CD    . GLN A 1 154 ? 23.149  -13.113 40.182 1.00 85.25  ? 184 GLN A CD    1 
ATOM   1014 O OE1   . GLN A 1 154 ? 23.193  -12.006 39.638 1.00 80.63  ? 184 GLN A OE1   1 
ATOM   1015 N NE2   . GLN A 1 154 ? 23.695  -14.200 39.644 1.00 93.55  ? 184 GLN A NE2   1 
ATOM   1016 N N     . MET A 1 155 ? 23.013  -12.052 45.227 1.00 37.03  ? 185 MET A N     1 
ATOM   1017 C CA    . MET A 1 155 ? 23.797  -12.643 46.302 1.00 34.54  ? 185 MET A CA    1 
ATOM   1018 C C     . MET A 1 155 ? 22.969  -12.732 47.585 1.00 43.00  ? 185 MET A C     1 
ATOM   1019 O O     . MET A 1 155 ? 23.170  -13.623 48.411 1.00 46.71  ? 185 MET A O     1 
ATOM   1020 C CB    . MET A 1 155 ? 25.081  -11.842 46.538 1.00 31.56  ? 185 MET A CB    1 
ATOM   1021 C CG    . MET A 1 155 ? 26.148  -12.607 47.313 1.00 35.62  ? 185 MET A CG    1 
ATOM   1022 S SD    . MET A 1 155 ? 27.599  -11.624 47.726 1.00 38.43  ? 185 MET A SD    1 
ATOM   1023 C CE    . MET A 1 155 ? 28.413  -11.486 46.148 1.00 32.23  ? 185 MET A CE    1 
ATOM   1024 N N     . GLY A 1 156 ? 22.029  -11.808 47.742 1.00 34.64  ? 186 GLY A N     1 
ATOM   1025 C CA    . GLY A 1 156 ? 21.179  -11.797 48.913 1.00 27.15  ? 186 GLY A CA    1 
ATOM   1026 C C     . GLY A 1 156 ? 19.794  -12.342 48.643 1.00 34.75  ? 186 GLY A C     1 
ATOM   1027 O O     . GLY A 1 156 ? 18.823  -11.921 49.270 1.00 40.45  ? 186 GLY A O     1 
ATOM   1028 N N     . LYS A 1 157 ? 19.696  -13.282 47.709 1.00 45.81  ? 187 LYS A N     1 
ATOM   1029 C CA    . LYS A 1 157 ? 18.399  -13.824 47.317 1.00 41.84  ? 187 LYS A CA    1 
ATOM   1030 C C     . LYS A 1 157 ? 17.835  -14.754 48.392 1.00 44.24  ? 187 LYS A C     1 
ATOM   1031 O O     . LYS A 1 157 ? 16.652  -15.075 48.382 1.00 51.83  ? 187 LYS A O     1 
ATOM   1032 C CB    . LYS A 1 157 ? 18.500  -14.566 45.985 1.00 35.26  ? 187 LYS A CB    1 
ATOM   1033 C CG    . LYS A 1 157 ? 19.087  -15.953 46.114 1.00 53.84  ? 187 LYS A CG    1 
ATOM   1034 C CD    . LYS A 1 157 ? 18.627  -16.862 44.994 1.00 56.71  ? 187 LYS A CD    1 
ATOM   1035 C CE    . LYS A 1 157 ? 19.565  -16.805 43.812 1.00 61.04  ? 187 LYS A CE    1 
ATOM   1036 N NZ    . LYS A 1 157 ? 19.512  -18.084 43.051 1.00 62.38  ? 187 LYS A NZ    1 
ATOM   1037 N N     . PHE A 1 158 ? 18.689  -15.190 49.313 1.00 47.89  ? 188 PHE A N     1 
ATOM   1038 C CA    . PHE A 1 158 ? 18.256  -16.062 50.404 1.00 46.30  ? 188 PHE A CA    1 
ATOM   1039 C C     . PHE A 1 158 ? 18.026  -15.278 51.690 1.00 51.43  ? 188 PHE A C     1 
ATOM   1040 O O     . PHE A 1 158 ? 17.843  -15.856 52.759 1.00 56.74  ? 188 PHE A O     1 
ATOM   1041 C CB    . PHE A 1 158 ? 19.251  -17.198 50.633 1.00 38.80  ? 188 PHE A CB    1 
ATOM   1042 C CG    . PHE A 1 158 ? 19.398  -18.115 49.456 1.00 50.23  ? 188 PHE A CG    1 
ATOM   1043 C CD1   . PHE A 1 158 ? 18.364  -18.960 49.091 1.00 55.52  ? 188 PHE A CD1   1 
ATOM   1044 C CD2   . PHE A 1 158 ? 20.568  -18.131 48.710 1.00 44.32  ? 188 PHE A CD2   1 
ATOM   1045 C CE1   . PHE A 1 158 ? 18.492  -19.805 48.003 1.00 51.83  ? 188 PHE A CE1   1 
ATOM   1046 C CE2   . PHE A 1 158 ? 20.703  -18.972 47.630 1.00 40.34  ? 188 PHE A CE2   1 
ATOM   1047 C CZ    . PHE A 1 158 ? 19.667  -19.812 47.274 1.00 46.07  ? 188 PHE A CZ    1 
ATOM   1048 N N     . TYR A 1 159 ? 18.057  -13.956 51.572 1.00 49.21  ? 189 TYR A N     1 
ATOM   1049 C CA    . TYR A 1 159 ? 17.538  -13.070 52.601 1.00 41.62  ? 189 TYR A CA    1 
ATOM   1050 C C     . TYR A 1 159 ? 16.114  -12.732 52.202 1.00 57.85  ? 189 TYR A C     1 
ATOM   1051 O O     . TYR A 1 159 ? 15.898  -11.984 51.249 1.00 63.78  ? 189 TYR A O     1 
ATOM   1052 C CB    . TYR A 1 159 ? 18.328  -11.770 52.646 1.00 39.72  ? 189 TYR A CB    1 
ATOM   1053 C CG    . TYR A 1 159 ? 19.732  -11.881 53.173 1.00 45.37  ? 189 TYR A CG    1 
ATOM   1054 C CD1   . TYR A 1 159 ? 20.698  -12.606 52.490 1.00 44.96  ? 189 TYR A CD1   1 
ATOM   1055 C CD2   . TYR A 1 159 ? 20.103  -11.225 54.338 1.00 52.36  ? 189 TYR A CD2   1 
ATOM   1056 C CE1   . TYR A 1 159 ? 21.991  -12.694 52.969 1.00 55.74  ? 189 TYR A CE1   1 
ATOM   1057 C CE2   . TYR A 1 159 ? 21.390  -11.304 54.823 1.00 58.65  ? 189 TYR A CE2   1 
ATOM   1058 C CZ    . TYR A 1 159 ? 22.330  -12.039 54.138 1.00 63.97  ? 189 TYR A CZ    1 
ATOM   1059 O OH    . TYR A 1 159 ? 23.614  -12.116 54.623 1.00 71.61  ? 189 TYR A OH    1 
ATOM   1060 N N     . PRO A 1 160 ? 15.132  -13.272 52.930 1.00 70.57  ? 190 PRO A N     1 
ATOM   1061 C CA    . PRO A 1 160 ? 13.731  -13.083 52.542 1.00 69.31  ? 190 PRO A CA    1 
ATOM   1062 C C     . PRO A 1 160 ? 13.280  -11.627 52.666 1.00 57.76  ? 190 PRO A C     1 
ATOM   1063 O O     . PRO A 1 160 ? 12.698  -11.079 51.730 1.00 49.02  ? 190 PRO A O     1 
ATOM   1064 C CB    . PRO A 1 160 ? 12.968  -13.959 53.545 1.00 73.68  ? 190 PRO A CB    1 
ATOM   1065 C CG    . PRO A 1 160 ? 14.011  -14.839 54.191 1.00 76.92  ? 190 PRO A CG    1 
ATOM   1066 C CD    . PRO A 1 160 ? 15.265  -14.040 54.177 1.00 74.21  ? 190 PRO A CD    1 
ATOM   1067 N N     . GLU A 1 161 ? 13.565  -11.009 53.806 1.00 55.52  ? 191 GLU A N     1 
ATOM   1068 C CA    . GLU A 1 161 ? 13.033  -9.687  54.117 1.00 55.65  ? 191 GLU A CA    1 
ATOM   1069 C C     . GLU A 1 161 ? 13.887  -8.550  53.572 1.00 34.50  ? 191 GLU A C     1 
ATOM   1070 O O     . GLU A 1 161 ? 13.638  -7.384  53.867 1.00 46.74  ? 191 GLU A O     1 
ATOM   1071 C CB    . GLU A 1 161 ? 12.882  -9.523  55.632 1.00 73.76  ? 191 GLU A CB    1 
ATOM   1072 C CG    . GLU A 1 161 ? 12.159  -10.670 56.320 1.00 85.98  ? 191 GLU A CG    1 
ATOM   1073 C CD    . GLU A 1 161 ? 10.671  -10.681 56.032 1.00 102.82 ? 191 GLU A CD    1 
ATOM   1074 O OE1   . GLU A 1 161 ? 10.225  -9.919  55.147 1.00 106.23 ? 191 GLU A OE1   1 
ATOM   1075 O OE2   . GLU A 1 161 ? 9.946   -11.454 56.694 1.00 110.18 ? 191 GLU A OE2   1 
ATOM   1076 N N     . LEU A 1 162 ? 14.898  -8.882  52.784 1.00 35.63  ? 192 LEU A N     1 
ATOM   1077 C CA    . LEU A 1 162 ? 15.801  -7.862  52.260 1.00 40.15  ? 192 LEU A CA    1 
ATOM   1078 C C     . LEU A 1 162 ? 15.224  -7.146  51.044 1.00 48.54  ? 192 LEU A C     1 
ATOM   1079 O O     . LEU A 1 162 ? 14.908  -7.772  50.032 1.00 64.67  ? 192 LEU A O     1 
ATOM   1080 C CB    . LEU A 1 162 ? 17.153  -8.471  51.900 1.00 51.18  ? 192 LEU A CB    1 
ATOM   1081 C CG    . LEU A 1 162 ? 18.209  -7.460  51.456 1.00 49.86  ? 192 LEU A CG    1 
ATOM   1082 C CD1   . LEU A 1 162 ? 18.626  -6.571  52.626 1.00 39.87  ? 192 LEU A CD1   1 
ATOM   1083 C CD2   . LEU A 1 162 ? 19.407  -8.173  50.849 1.00 51.14  ? 192 LEU A CD2   1 
ATOM   1084 N N     . LYS A 1 163 ? 15.092  -5.829  51.150 1.00 36.72  ? 193 LYS A N     1 
ATOM   1085 C CA    . LYS A 1 163 ? 14.582  -5.018  50.052 1.00 32.18  ? 193 LYS A CA    1 
ATOM   1086 C C     . LYS A 1 163 ? 15.588  -3.929  49.685 1.00 37.99  ? 193 LYS A C     1 
ATOM   1087 O O     . LYS A 1 163 ? 16.480  -3.614  50.464 1.00 41.17  ? 193 LYS A O     1 
ATOM   1088 C CB    . LYS A 1 163 ? 13.225  -4.407  50.411 1.00 29.39  ? 193 LYS A CB    1 
ATOM   1089 C CG    . LYS A 1 163 ? 12.122  -5.429  50.648 1.00 47.66  ? 193 LYS A CG    1 
ATOM   1090 C CD    . LYS A 1 163 ? 11.826  -6.231  49.384 1.00 67.60  ? 193 LYS A CD    1 
ATOM   1091 C CE    . LYS A 1 163 ? 10.570  -7.091  49.529 1.00 72.12  ? 193 LYS A CE    1 
ATOM   1092 N NZ    . LYS A 1 163 ? 10.768  -8.280  50.407 1.00 74.96  ? 193 LYS A NZ    1 
ATOM   1093 N N     . LEU A 1 164 ? 15.433  -3.357  48.496 1.00 43.01  ? 194 LEU A N     1 
ATOM   1094 C CA    . LEU A 1 164 ? 16.418  -2.441  47.940 1.00 28.98  ? 194 LEU A CA    1 
ATOM   1095 C C     . LEU A 1 164 ? 15.767  -1.130  47.503 1.00 24.26  ? 194 LEU A C     1 
ATOM   1096 O O     . LEU A 1 164 ? 14.674  -1.129  46.955 1.00 41.88  ? 194 LEU A O     1 
ATOM   1097 C CB    . LEU A 1 164 ? 17.100  -3.119  46.749 1.00 38.77  ? 194 LEU A CB    1 
ATOM   1098 C CG    . LEU A 1 164 ? 18.244  -2.405  46.038 1.00 51.92  ? 194 LEU A CG    1 
ATOM   1099 C CD1   . LEU A 1 164 ? 19.216  -1.828  47.051 1.00 63.26  ? 194 LEU A CD1   1 
ATOM   1100 C CD2   . LEU A 1 164 ? 18.941  -3.379  45.108 1.00 55.04  ? 194 LEU A CD2   1 
ATOM   1101 N N     . ALA A 1 165 ? 16.437  -0.010  47.747 1.00 24.43  ? 195 ALA A N     1 
ATOM   1102 C CA    . ALA A 1 165 ? 15.907  1.295   47.347 1.00 27.24  ? 195 ALA A CA    1 
ATOM   1103 C C     . ALA A 1 165 ? 16.893  2.044   46.464 1.00 29.45  ? 195 ALA A C     1 
ATOM   1104 O O     . ALA A 1 165 ? 18.087  2.045   46.729 1.00 32.39  ? 195 ALA A O     1 
ATOM   1105 C CB    . ALA A 1 165 ? 15.560  2.138   48.570 1.00 24.20  ? 195 ALA A CB    1 
ATOM   1106 N N     . TYR A 1 166 ? 16.387  2.684   45.415 1.00 27.44  ? 196 TYR A N     1 
ATOM   1107 C CA    . TYR A 1 166 ? 17.234  3.466   44.525 1.00 32.39  ? 196 TYR A CA    1 
ATOM   1108 C C     . TYR A 1 166 ? 17.047  4.957   44.754 1.00 35.79  ? 196 TYR A C     1 
ATOM   1109 O O     . TYR A 1 166 ? 16.054  5.540   44.325 1.00 40.09  ? 196 TYR A O     1 
ATOM   1110 C CB    . TYR A 1 166 ? 16.959  3.128   43.057 1.00 31.11  ? 196 TYR A CB    1 
ATOM   1111 C CG    . TYR A 1 166 ? 17.427  1.752   42.657 1.00 27.17  ? 196 TYR A CG    1 
ATOM   1112 C CD1   . TYR A 1 166 ? 16.538  0.687   42.614 1.00 25.88  ? 196 TYR A CD1   1 
ATOM   1113 C CD2   . TYR A 1 166 ? 18.757  1.515   42.322 1.00 16.17  ? 196 TYR A CD2   1 
ATOM   1114 C CE1   . TYR A 1 166 ? 16.957  -0.577  42.251 1.00 32.28  ? 196 TYR A CE1   1 
ATOM   1115 C CE2   . TYR A 1 166 ? 19.187  0.244   41.954 1.00 19.66  ? 196 TYR A CE2   1 
ATOM   1116 C CZ    . TYR A 1 166 ? 18.280  -0.793  41.923 1.00 27.63  ? 196 TYR A CZ    1 
ATOM   1117 O OH    . TYR A 1 166 ? 18.675  -2.054  41.564 1.00 41.76  ? 196 TYR A OH    1 
ATOM   1118 N N     . ALA A 1 167 ? 18.013  5.572   45.425 1.00 30.30  ? 197 ALA A N     1 
ATOM   1119 C CA    . ALA A 1 167 ? 17.980  7.007   45.648 1.00 31.78  ? 197 ALA A CA    1 
ATOM   1120 C C     . ALA A 1 167 ? 18.518  7.747   44.423 1.00 35.74  ? 197 ALA A C     1 
ATOM   1121 O O     . ALA A 1 167 ? 19.631  8.266   44.436 1.00 35.11  ? 197 ALA A O     1 
ATOM   1122 C CB    . ALA A 1 167 ? 18.766  7.363   46.884 1.00 20.44  ? 197 ALA A CB    1 
ATOM   1123 N N     . VAL A 1 168 ? 17.709  7.791   43.369 1.00 32.95  ? 198 VAL A N     1 
ATOM   1124 C CA    . VAL A 1 168 ? 18.102  8.405   42.102 1.00 32.81  ? 198 VAL A CA    1 
ATOM   1125 C C     . VAL A 1 168 ? 17.136  9.509   41.670 1.00 31.13  ? 198 VAL A C     1 
ATOM   1126 O O     . VAL A 1 168 ? 15.967  9.497   42.036 1.00 41.76  ? 198 VAL A O     1 
ATOM   1127 C CB    . VAL A 1 168 ? 18.195  7.349   40.981 1.00 29.87  ? 198 VAL A CB    1 
ATOM   1128 C CG1   . VAL A 1 168 ? 19.415  6.472   41.179 1.00 19.22  ? 198 VAL A CG1   1 
ATOM   1129 C CG2   . VAL A 1 168 ? 16.939  6.499   40.958 1.00 26.01  ? 198 VAL A CG2   1 
ATOM   1130 N N     . ARG A 1 169 ? 17.630  10.456  40.878 1.00 42.50  ? 199 ARG A N     1 
ATOM   1131 C CA    . ARG A 1 169 ? 16.815  11.574  40.387 1.00 45.60  ? 199 ARG A CA    1 
ATOM   1132 C C     . ARG A 1 169 ? 15.474  11.130  39.799 1.00 45.97  ? 199 ARG A C     1 
ATOM   1133 O O     . ARG A 1 169 ? 14.505  11.884  39.796 1.00 50.41  ? 199 ARG A O     1 
ATOM   1134 C CB    . ARG A 1 169 ? 17.595  12.399  39.353 1.00 60.92  ? 199 ARG A CB    1 
ATOM   1135 C CG    . ARG A 1 169 ? 18.580  13.399  39.953 1.00 80.44  ? 199 ARG A CG    1 
ATOM   1136 C CD    . ARG A 1 169 ? 17.867  14.651  40.452 1.00 97.37  ? 199 ARG A CD    1 
ATOM   1137 N NE    . ARG A 1 169 ? 18.642  15.378  41.457 1.00 104.86 ? 199 ARG A NE    1 
ATOM   1138 C CZ    . ARG A 1 169 ? 18.440  15.289  42.770 1.00 99.85  ? 199 ARG A CZ    1 
ATOM   1139 N NH1   . ARG A 1 169 ? 17.485  14.502  43.248 1.00 83.31  ? 199 ARG A NH1   1 
ATOM   1140 N NH2   . ARG A 1 169 ? 19.195  15.989  43.608 1.00 105.53 ? 199 ARG A NH2   1 
ATOM   1141 N N     . GLY A 1 170 ? 15.423  9.903   39.299 1.00 53.55  ? 200 GLY A N     1 
ATOM   1142 C CA    . GLY A 1 170 ? 14.212  9.383   38.696 1.00 50.33  ? 200 GLY A CA    1 
ATOM   1143 C C     . GLY A 1 170 ? 13.144  8.967   39.690 1.00 49.71  ? 200 GLY A C     1 
ATOM   1144 O O     . GLY A 1 170 ? 11.966  8.918   39.345 1.00 56.32  ? 200 GLY A O     1 
ATOM   1145 N N     . ASN A 1 171 ? 13.547  8.661   40.920 1.00 48.26  ? 201 ASN A N     1 
ATOM   1146 C CA    . ASN A 1 171 ? 12.605  8.176   41.924 1.00 38.89  ? 201 ASN A CA    1 
ATOM   1147 C C     . ASN A 1 171 ? 11.684  9.277   42.438 1.00 39.97  ? 201 ASN A C     1 
ATOM   1148 O O     . ASN A 1 171 ? 12.139  10.293  42.958 1.00 37.65  ? 201 ASN A O     1 
ATOM   1149 C CB    . ASN A 1 171 ? 13.325  7.489   43.084 1.00 40.54  ? 201 ASN A CB    1 
ATOM   1150 C CG    . ASN A 1 171 ? 12.363  6.789   44.022 1.00 52.01  ? 201 ASN A CG    1 
ATOM   1151 O OD1   . ASN A 1 171 ? 11.145  6.935   43.902 1.00 61.02  ? 201 ASN A OD1   1 
ATOM   1152 N ND2   . ASN A 1 171 ? 12.902  6.015   44.955 1.00 45.00  ? 201 ASN A ND2   1 
ATOM   1153 N N     . LYS A 1 172 ? 10.383  9.053   42.293 1.00 52.55  ? 202 LYS A N     1 
ATOM   1154 C CA    . LYS A 1 172 ? 9.390   10.100  42.493 1.00 71.20  ? 202 LYS A CA    1 
ATOM   1155 C C     . LYS A 1 172 ? 8.791   10.061  43.889 1.00 75.52  ? 202 LYS A C     1 
ATOM   1156 O O     . LYS A 1 172 ? 7.600   10.304  44.071 1.00 81.75  ? 202 LYS A O     1 
ATOM   1157 C CB    . LYS A 1 172 ? 8.286   9.965   41.446 1.00 71.64  ? 202 LYS A CB    1 
ATOM   1158 C CG    . LYS A 1 172 ? 7.651   8.589   41.415 1.00 76.33  ? 202 LYS A CG    1 
ATOM   1159 C CD    . LYS A 1 172 ? 7.066   8.293   40.052 1.00 94.27  ? 202 LYS A CD    1 
ATOM   1160 C CE    . LYS A 1 172 ? 8.145   8.308   38.978 1.00 102.73 ? 202 LYS A CE    1 
ATOM   1161 N NZ    . LYS A 1 172 ? 7.618   7.888   37.645 1.00 106.08 ? 202 LYS A NZ    1 
ATOM   1162 N N     . LEU A 1 173 ? 9.631   9.765   44.872 1.00 79.04  ? 203 LEU A N     1 
ATOM   1163 C CA    . LEU A 1 173 ? 9.184   9.642   46.251 1.00 71.84  ? 203 LEU A CA    1 
ATOM   1164 C C     . LEU A 1 173 ? 8.654   10.959  46.801 1.00 74.64  ? 203 LEU A C     1 
ATOM   1165 O O     . LEU A 1 173 ? 9.362   11.965  46.845 1.00 61.99  ? 203 LEU A O     1 
ATOM   1166 C CB    . LEU A 1 173 ? 10.309  9.117   47.140 1.00 62.88  ? 203 LEU A CB    1 
ATOM   1167 C CG    . LEU A 1 173 ? 9.915   8.964   48.608 1.00 63.67  ? 203 LEU A CG    1 
ATOM   1168 C CD1   . LEU A 1 173 ? 8.673   8.097   48.739 1.00 56.37  ? 203 LEU A CD1   1 
ATOM   1169 C CD2   . LEU A 1 173 ? 11.067  8.391   49.414 1.00 66.67  ? 203 LEU A CD2   1 
ATOM   1170 N N     . GLU A 1 174 ? 7.393   10.934  47.216 1.00 89.71  ? 204 GLU A N     1 
ATOM   1171 C CA    . GLU A 1 174 ? 6.735   12.093  47.797 1.00 92.26  ? 204 GLU A CA    1 
ATOM   1172 C C     . GLU A 1 174 ? 7.165   12.261  49.244 1.00 78.82  ? 204 GLU A C     1 
ATOM   1173 O O     . GLU A 1 174 ? 7.333   11.278  49.963 1.00 77.58  ? 204 GLU A O     1 
ATOM   1174 C CB    . GLU A 1 174 ? 5.216   11.917  47.737 1.00 101.67 ? 204 GLU A CB    1 
ATOM   1175 C CG    . GLU A 1 174 ? 4.623   12.006  46.344 1.00 110.13 ? 204 GLU A CG    1 
ATOM   1176 C CD    . GLU A 1 174 ? 4.581   13.429  45.825 1.00 120.75 ? 204 GLU A CD    1 
ATOM   1177 O OE1   . GLU A 1 174 ? 5.632   14.105  45.850 1.00 125.01 ? 204 GLU A OE1   1 
ATOM   1178 O OE2   . GLU A 1 174 ? 3.498   13.871  45.386 1.00 122.44 ? 204 GLU A OE2   1 
ATOM   1179 N N     . ARG A 1 175 ? 7.335   13.506  49.671 1.00 74.39  ? 205 ARG A N     1 
ATOM   1180 C CA    . ARG A 1 175 ? 7.689   13.792  51.053 1.00 89.73  ? 205 ARG A CA    1 
ATOM   1181 C C     . ARG A 1 175 ? 6.835   12.964  52.013 1.00 90.13  ? 205 ARG A C     1 
ATOM   1182 O O     . ARG A 1 175 ? 5.620   12.864  51.845 1.00 93.85  ? 205 ARG A O     1 
ATOM   1183 C CB    . ARG A 1 175 ? 7.513   15.282  51.337 1.00 104.55 ? 205 ARG A CB    1 
ATOM   1184 C CG    . ARG A 1 175 ? 7.992   16.176  50.206 1.00 114.70 ? 205 ARG A CG    1 
ATOM   1185 C CD    . ARG A 1 175 ? 7.889   17.642  50.586 1.00 123.71 ? 205 ARG A CD    1 
ATOM   1186 N NE    . ARG A 1 175 ? 8.732   17.964  51.733 1.00 124.51 ? 205 ARG A NE    1 
ATOM   1187 C CZ    . ARG A 1 175 ? 10.029  18.239  51.649 1.00 119.69 ? 205 ARG A CZ    1 
ATOM   1188 N NH1   . ARG A 1 175 ? 10.631  18.229  50.468 1.00 117.11 ? 205 ARG A NH1   1 
ATOM   1189 N NH2   . ARG A 1 175 ? 10.723  18.523  52.743 1.00 117.24 ? 205 ARG A NH2   1 
ATOM   1190 N N     . GLY A 1 176 ? 7.475   12.362  53.012 1.00 83.49  ? 206 GLY A N     1 
ATOM   1191 C CA    . GLY A 1 176 ? 6.772   11.525  53.968 1.00 64.73  ? 206 GLY A CA    1 
ATOM   1192 C C     . GLY A 1 176 ? 7.701   10.796  54.917 1.00 60.52  ? 206 GLY A C     1 
ATOM   1193 O O     . GLY A 1 176 ? 8.822   11.237  55.158 1.00 64.98  ? 206 GLY A O     1 
ATOM   1194 N N     . GLN A 1 177 ? 7.231   9.672   55.451 1.00 61.39  ? 207 GLN A N     1 
ATOM   1195 C CA    . GLN A 1 177 ? 7.994   8.897   56.429 1.00 65.38  ? 207 GLN A CA    1 
ATOM   1196 C C     . GLN A 1 177 ? 9.294   8.347   55.847 1.00 62.16  ? 207 GLN A C     1 
ATOM   1197 O O     . GLN A 1 177 ? 9.458   8.278   54.626 1.00 56.88  ? 207 GLN A O     1 
ATOM   1198 C CB    . GLN A 1 177 ? 7.145   7.749   56.986 1.00 68.27  ? 207 GLN A CB    1 
ATOM   1199 N N     . LYS A 1 178 ? 10.213  7.961   56.730 1.00 55.02  ? 208 LYS A N     1 
ATOM   1200 C CA    . LYS A 1 178 ? 11.487  7.377   56.320 1.00 39.83  ? 208 LYS A CA    1 
ATOM   1201 C C     . LYS A 1 178 ? 11.274  6.044   55.609 1.00 51.41  ? 208 LYS A C     1 
ATOM   1202 O O     . LYS A 1 178 ? 10.348  5.300   55.941 1.00 56.07  ? 208 LYS A O     1 
ATOM   1203 C CB    . LYS A 1 178 ? 12.396  7.163   57.530 1.00 44.77  ? 208 LYS A CB    1 
ATOM   1204 C CG    . LYS A 1 178 ? 12.675  8.421   58.331 1.00 64.63  ? 208 LYS A CG    1 
ATOM   1205 C CD    . LYS A 1 178 ? 13.887  8.244   59.231 1.00 65.19  ? 208 LYS A CD    1 
ATOM   1206 C CE    . LYS A 1 178 ? 14.040  9.422   60.176 1.00 71.87  ? 208 LYS A CE    1 
ATOM   1207 N NZ    . LYS A 1 178 ? 14.034  10.721  59.450 1.00 74.78  ? 208 LYS A NZ    1 
ATOM   1208 N N     . ILE A 1 179 ? 12.133  5.741   54.638 1.00 36.72  ? 209 ILE A N     1 
ATOM   1209 C CA    . ILE A 1 179 ? 12.022  4.487   53.909 1.00 33.79  ? 209 ILE A CA    1 
ATOM   1210 C C     . ILE A 1 179 ? 12.469  3.316   54.782 1.00 34.64  ? 209 ILE A C     1 
ATOM   1211 O O     . ILE A 1 179 ? 13.211  3.497   55.743 1.00 45.22  ? 209 ILE A O     1 
ATOM   1212 C CB    . ILE A 1 179 ? 12.827  4.517   52.589 1.00 47.50  ? 209 ILE A CB    1 
ATOM   1213 C CG1   . ILE A 1 179 ? 14.327  4.560   52.872 1.00 51.92  ? 209 ILE A CG1   1 
ATOM   1214 C CG2   . ILE A 1 179 ? 12.421  5.708   51.737 1.00 41.22  ? 209 ILE A CG2   1 
ATOM   1215 C CD1   . ILE A 1 179 ? 15.156  4.815   51.655 1.00 48.15  ? 209 ILE A CD1   1 
ATOM   1216 N N     . SER A 1 180 ? 12.018  2.116   54.434 1.00 48.20  ? 210 SER A N     1 
ATOM   1217 C CA    . SER A 1 180 ? 12.250  0.929   55.256 1.00 49.75  ? 210 SER A CA    1 
ATOM   1218 C C     . SER A 1 180 ? 13.214  -0.083  54.629 1.00 51.02  ? 210 SER A C     1 
ATOM   1219 O O     . SER A 1 180 ? 13.485  -1.127  55.220 1.00 65.13  ? 210 SER A O     1 
ATOM   1220 C CB    . SER A 1 180 ? 10.919  0.242   55.573 1.00 62.94  ? 210 SER A CB    1 
ATOM   1221 O OG    . SER A 1 180 ? 10.164  0.024   54.391 1.00 76.68  ? 210 SER A OG    1 
ATOM   1222 N N     . GLU A 1 181 ? 13.726  0.222   53.440 1.00 41.90  ? 211 GLU A N     1 
ATOM   1223 C CA    . GLU A 1 181 ? 14.718  -0.633  52.784 1.00 35.12  ? 211 GLU A CA    1 
ATOM   1224 C C     . GLU A 1 181 ? 16.051  -0.606  53.524 1.00 38.71  ? 211 GLU A C     1 
ATOM   1225 O O     . GLU A 1 181 ? 16.590  0.463   53.827 1.00 39.04  ? 211 GLU A O     1 
ATOM   1226 C CB    . GLU A 1 181 ? 14.936  -0.206  51.330 1.00 32.85  ? 211 GLU A CB    1 
ATOM   1227 C CG    . GLU A 1 181 ? 13.770  -0.523  50.400 1.00 38.08  ? 211 GLU A CG    1 
ATOM   1228 C CD    . GLU A 1 181 ? 12.623  0.465   50.531 1.00 54.38  ? 211 GLU A CD    1 
ATOM   1229 O OE1   . GLU A 1 181 ? 12.765  1.463   51.273 1.00 63.20  ? 211 GLU A OE1   1 
ATOM   1230 O OE2   . GLU A 1 181 ? 11.578  0.243   49.883 1.00 57.44  ? 211 GLU A OE2   1 
ATOM   1231 N N     . GLN A 1 182 ? 16.585  -1.786  53.808 1.00 35.13  ? 212 GLN A N     1 
ATOM   1232 C CA    . GLN A 1 182 ? 17.834  -1.881  54.549 1.00 33.07  ? 212 GLN A CA    1 
ATOM   1233 C C     . GLN A 1 182 ? 19.019  -1.422  53.709 1.00 37.69  ? 212 GLN A C     1 
ATOM   1234 O O     . GLN A 1 182 ? 20.022  -0.972  54.241 1.00 59.46  ? 212 GLN A O     1 
ATOM   1235 C CB    . GLN A 1 182 ? 18.061  -3.305  55.061 1.00 39.16  ? 212 GLN A CB    1 
ATOM   1236 C CG    . GLN A 1 182 ? 16.956  -3.834  55.974 1.00 49.20  ? 212 GLN A CG    1 
ATOM   1237 C CD    . GLN A 1 182 ? 15.914  -4.651  55.223 1.00 61.47  ? 212 GLN A CD    1 
ATOM   1238 O OE1   . GLN A 1 182 ? 15.474  -4.278  54.131 1.00 53.16  ? 212 GLN A OE1   1 
ATOM   1239 N NE2   . GLN A 1 182 ? 15.511  -5.773  55.811 1.00 70.41  ? 212 GLN A NE2   1 
ATOM   1240 N N     . ILE A 1 183 ? 18.906  -1.537  52.392 1.00 35.41  ? 213 ILE A N     1 
ATOM   1241 C CA    . ILE A 1 183 ? 19.984  -1.102  51.511 1.00 32.77  ? 213 ILE A CA    1 
ATOM   1242 C C     . ILE A 1 183 ? 19.549  -0.036  50.513 1.00 20.30  ? 213 ILE A C     1 
ATOM   1243 O O     . ILE A 1 183 ? 18.552  -0.190  49.819 1.00 39.92  ? 213 ILE A O     1 
ATOM   1244 C CB    . ILE A 1 183 ? 20.612  -2.288  50.768 1.00 44.42  ? 213 ILE A CB    1 
ATOM   1245 C CG1   . ILE A 1 183 ? 21.339  -3.190  51.767 1.00 47.91  ? 213 ILE A CG1   1 
ATOM   1246 C CG2   . ILE A 1 183 ? 21.571  -1.793  49.697 1.00 44.87  ? 213 ILE A CG2   1 
ATOM   1247 C CD1   . ILE A 1 183 ? 21.646  -4.563  51.241 1.00 46.93  ? 213 ILE A CD1   1 
ATOM   1248 N N     . VAL A 1 184 ? 20.306  1.053   50.465 1.00 20.00  ? 214 VAL A N     1 
ATOM   1249 C CA    . VAL A 1 184 ? 20.097  2.105   49.481 1.00 23.28  ? 214 VAL A CA    1 
ATOM   1250 C C     . VAL A 1 184 ? 21.294  2.248   48.535 1.00 34.37  ? 214 VAL A C     1 
ATOM   1251 O O     . VAL A 1 184 ? 22.443  2.335   48.974 1.00 38.22  ? 214 VAL A O     1 
ATOM   1252 C CB    . VAL A 1 184 ? 19.884  3.463   50.159 1.00 25.60  ? 214 VAL A CB    1 
ATOM   1253 C CG1   . VAL A 1 184 ? 19.865  4.582   49.115 1.00 16.27  ? 214 VAL A CG1   1 
ATOM   1254 C CG2   . VAL A 1 184 ? 18.614  3.445   50.975 1.00 21.67  ? 214 VAL A CG2   1 
ATOM   1255 N N     . ILE A 1 185 ? 21.006  2.258   47.238 1.00 40.72  ? 215 ILE A N     1 
ATOM   1256 C CA    . ILE A 1 185 ? 21.982  2.602   46.212 1.00 34.70  ? 215 ILE A CA    1 
ATOM   1257 C C     . ILE A 1 185 ? 21.441  3.814   45.496 1.00 29.93  ? 215 ILE A C     1 
ATOM   1258 O O     . ILE A 1 185 ? 20.229  3.968   45.379 1.00 40.97  ? 215 ILE A O     1 
ATOM   1259 C CB    . ILE A 1 185 ? 22.136  1.490   45.169 1.00 29.67  ? 215 ILE A CB    1 
ATOM   1260 C CG1   . ILE A 1 185 ? 21.841  0.125   45.787 1.00 44.15  ? 215 ILE A CG1   1 
ATOM   1261 C CG2   . ILE A 1 185 ? 23.527  1.523   44.577 1.00 26.27  ? 215 ILE A CG2   1 
ATOM   1262 C CD1   . ILE A 1 185 ? 21.617  -0.957  44.767 1.00 48.58  ? 215 ILE A CD1   1 
ATOM   1263 N N     . GLY A 1 186 ? 22.324  4.679   45.014 1.00 22.96  ? 216 GLY A N     1 
ATOM   1264 C CA    . GLY A 1 186 ? 21.877  5.893   44.360 1.00 24.62  ? 216 GLY A CA    1 
ATOM   1265 C C     . GLY A 1 186 ? 22.977  6.869   44.004 1.00 35.68  ? 216 GLY A C     1 
ATOM   1266 O O     . GLY A 1 186 ? 24.152  6.635   44.289 1.00 35.83  ? 216 GLY A O     1 
ATOM   1267 N N     . THR A 1 187 ? 22.586  7.974   43.376 1.00 35.12  ? 217 THR A N     1 
ATOM   1268 C CA    . THR A 1 187 ? 23.536  8.979   42.913 1.00 33.51  ? 217 THR A CA    1 
ATOM   1269 C C     . THR A 1 187 ? 23.698  10.115  43.923 1.00 42.30  ? 217 THR A C     1 
ATOM   1270 O O     . THR A 1 187 ? 22.733  10.525  44.562 1.00 59.43  ? 217 THR A O     1 
ATOM   1271 C CB    . THR A 1 187 ? 23.122  9.534   41.540 1.00 41.64  ? 217 THR A CB    1 
ATOM   1272 O OG1   . THR A 1 187 ? 21.789  10.061  41.610 1.00 44.89  ? 217 THR A OG1   1 
ATOM   1273 C CG2   . THR A 1 187 ? 23.166  8.426   40.512 1.00 18.61  ? 217 THR A CG2   1 
ATOM   1274 N N     . PRO A 1 188 ? 24.927  10.629  44.064 1.00 43.68  ? 218 PRO A N     1 
ATOM   1275 C CA    . PRO A 1 188 ? 25.264  11.596  45.114 1.00 47.61  ? 218 PRO A CA    1 
ATOM   1276 C C     . PRO A 1 188 ? 24.200  12.671  45.344 1.00 46.84  ? 218 PRO A C     1 
ATOM   1277 O O     . PRO A 1 188 ? 23.813  12.895  46.492 1.00 45.39  ? 218 PRO A O     1 
ATOM   1278 C CB    . PRO A 1 188 ? 26.568  12.207  44.604 1.00 43.23  ? 218 PRO A CB    1 
ATOM   1279 C CG    . PRO A 1 188 ? 27.214  11.078  43.876 1.00 38.47  ? 218 PRO A CG    1 
ATOM   1280 C CD    . PRO A 1 188 ? 26.087  10.326  43.208 1.00 43.81  ? 218 PRO A CD    1 
ATOM   1281 N N     . GLY A 1 189 ? 23.731  13.310  44.277 1.00 47.06  ? 219 GLY A N     1 
ATOM   1282 C CA    . GLY A 1 189 ? 22.765  14.388  44.395 1.00 38.57  ? 219 GLY A CA    1 
ATOM   1283 C C     . GLY A 1 189 ? 21.505  13.999  45.143 1.00 43.79  ? 219 GLY A C     1 
ATOM   1284 O O     . GLY A 1 189 ? 21.106  14.667  46.097 1.00 41.66  ? 219 GLY A O     1 
ATOM   1285 N N     . THR A 1 190 ? 20.876  12.912  44.712 1.00 43.34  ? 220 THR A N     1 
ATOM   1286 C CA    . THR A 1 190 ? 19.639  12.457  45.326 1.00 38.37  ? 220 THR A CA    1 
ATOM   1287 C C     . THR A 1 190 ? 19.876  11.914  46.733 1.00 36.92  ? 220 THR A C     1 
ATOM   1288 O O     . THR A 1 190 ? 19.079  12.150  47.638 1.00 55.11  ? 220 THR A O     1 
ATOM   1289 C CB    . THR A 1 190 ? 18.946  11.390  44.459 1.00 37.65  ? 220 THR A CB    1 
ATOM   1290 O OG1   . THR A 1 190 ? 18.662  11.944  43.173 1.00 48.86  ? 220 THR A OG1   1 
ATOM   1291 C CG2   . THR A 1 190 ? 17.640  10.935  45.090 1.00 32.88  ? 220 THR A CG2   1 
ATOM   1292 N N     . VAL A 1 191 ? 20.972  11.188  46.915 1.00 29.91  ? 221 VAL A N     1 
ATOM   1293 C CA    . VAL A 1 191 ? 21.285  10.594  48.209 1.00 41.09  ? 221 VAL A CA    1 
ATOM   1294 C C     . VAL A 1 191 ? 21.486  11.651  49.301 1.00 48.40  ? 221 VAL A C     1 
ATOM   1295 O O     . VAL A 1 191 ? 21.000  11.499  50.419 1.00 40.90  ? 221 VAL A O     1 
ATOM   1296 C CB    . VAL A 1 191 ? 22.528  9.683   48.130 1.00 43.04  ? 221 VAL A CB    1 
ATOM   1297 C CG1   . VAL A 1 191 ? 22.995  9.291   49.530 1.00 39.20  ? 221 VAL A CG1   1 
ATOM   1298 C CG2   . VAL A 1 191 ? 22.223  8.445   47.297 1.00 39.09  ? 221 VAL A CG2   1 
ATOM   1299 N N     . LEU A 1 192 ? 22.203  12.720  48.972 1.00 52.72  ? 222 LEU A N     1 
ATOM   1300 C CA    . LEU A 1 192 ? 22.422  13.804  49.923 1.00 40.77  ? 222 LEU A CA    1 
ATOM   1301 C C     . LEU A 1 192 ? 21.097  14.373  50.412 1.00 50.17  ? 222 LEU A C     1 
ATOM   1302 O O     . LEU A 1 192 ? 20.922  14.600  51.608 1.00 64.64  ? 222 LEU A O     1 
ATOM   1303 C CB    . LEU A 1 192 ? 23.275  14.907  49.299 1.00 39.39  ? 222 LEU A CB    1 
ATOM   1304 C CG    . LEU A 1 192 ? 23.618  16.110  50.177 1.00 37.68  ? 222 LEU A CG    1 
ATOM   1305 C CD1   . LEU A 1 192 ? 24.315  15.670  51.456 1.00 42.45  ? 222 LEU A CD1   1 
ATOM   1306 C CD2   . LEU A 1 192 ? 24.487  17.095  49.407 1.00 31.17  ? 222 LEU A CD2   1 
ATOM   1307 N N     . ASP A 1 193 ? 20.162  14.596  49.491 1.00 49.97  ? 223 ASP A N     1 
ATOM   1308 C CA    . ASP A 1 193 ? 18.850  15.129  49.856 1.00 56.36  ? 223 ASP A CA    1 
ATOM   1309 C C     . ASP A 1 193 ? 18.114  14.193  50.809 1.00 62.92  ? 223 ASP A C     1 
ATOM   1310 O O     . ASP A 1 193 ? 17.577  14.619  51.829 1.00 61.91  ? 223 ASP A O     1 
ATOM   1311 C CB    . ASP A 1 193 ? 17.996  15.378  48.613 1.00 54.87  ? 223 ASP A CB    1 
ATOM   1312 C CG    . ASP A 1 193 ? 18.620  16.391  47.672 1.00 74.37  ? 223 ASP A CG    1 
ATOM   1313 O OD1   . ASP A 1 193 ? 19.822  16.699  47.843 1.00 87.92  ? 223 ASP A OD1   1 
ATOM   1314 O OD2   . ASP A 1 193 ? 17.911  16.873  46.757 1.00 66.76  ? 223 ASP A OD2   1 
ATOM   1315 N N     . TRP A 1 194 ? 18.099  12.912  50.465 1.00 58.63  ? 224 TRP A N     1 
ATOM   1316 C CA    . TRP A 1 194 ? 17.440  11.893  51.276 1.00 52.92  ? 224 TRP A CA    1 
ATOM   1317 C C     . TRP A 1 194 ? 17.993  11.820  52.695 1.00 44.26  ? 224 TRP A C     1 
ATOM   1318 O O     . TRP A 1 194 ? 17.271  11.484  53.631 1.00 47.79  ? 224 TRP A O     1 
ATOM   1319 C CB    . TRP A 1 194 ? 17.583  10.532  50.599 1.00 48.27  ? 224 TRP A CB    1 
ATOM   1320 C CG    . TRP A 1 194 ? 16.657  10.354  49.452 1.00 38.32  ? 224 TRP A CG    1 
ATOM   1321 C CD1   . TRP A 1 194 ? 16.169  11.332  48.633 1.00 48.90  ? 224 TRP A CD1   1 
ATOM   1322 C CD2   . TRP A 1 194 ? 16.110  9.122   48.977 1.00 28.59  ? 224 TRP A CD2   1 
ATOM   1323 N NE1   . TRP A 1 194 ? 15.342  10.785  47.684 1.00 42.24  ? 224 TRP A NE1   1 
ATOM   1324 C CE2   . TRP A 1 194 ? 15.287  9.431   47.873 1.00 30.55  ? 224 TRP A CE2   1 
ATOM   1325 C CE3   . TRP A 1 194 ? 16.232  7.789   49.378 1.00 23.82  ? 224 TRP A CE3   1 
ATOM   1326 C CZ2   . TRP A 1 194 ? 14.593  8.451   47.165 1.00 27.47  ? 224 TRP A CZ2   1 
ATOM   1327 C CZ3   . TRP A 1 194 ? 15.538  6.819   48.679 1.00 36.98  ? 224 TRP A CZ3   1 
ATOM   1328 C CH2   . TRP A 1 194 ? 14.729  7.155   47.583 1.00 36.42  ? 224 TRP A CH2   1 
ATOM   1329 N N     . CYS A 1 195 ? 19.275  12.134  52.840 1.00 36.98  ? 225 CYS A N     1 
ATOM   1330 C CA    . CYS A 1 195 ? 19.960  12.063  54.127 1.00 42.82  ? 225 CYS A CA    1 
ATOM   1331 C C     . CYS A 1 195 ? 19.834  13.360  54.906 1.00 43.59  ? 225 CYS A C     1 
ATOM   1332 O O     . CYS A 1 195 ? 20.070  13.394  56.110 1.00 60.91  ? 225 CYS A O     1 
ATOM   1333 C CB    . CYS A 1 195 ? 21.442  11.752  53.919 1.00 48.15  ? 225 CYS A CB    1 
ATOM   1334 S SG    . CYS A 1 195 ? 21.793  10.031  53.543 1.00 56.02  ? 225 CYS A SG    1 
ATOM   1335 N N     . SER A 1 196 ? 19.475  14.432  54.209 1.00 45.03  ? 226 SER A N     1 
ATOM   1336 C CA    . SER A 1 196 ? 19.325  15.732  54.844 1.00 51.22  ? 226 SER A CA    1 
ATOM   1337 C C     . SER A 1 196 ? 17.919  16.309  54.643 1.00 59.53  ? 226 SER A C     1 
ATOM   1338 O O     . SER A 1 196 ? 16.975  15.901  55.319 1.00 62.77  ? 226 SER A O     1 
ATOM   1339 C CB    . SER A 1 196 ? 20.405  16.705  54.349 1.00 51.55  ? 226 SER A CB    1 
ATOM   1340 O OG    . SER A 1 196 ? 20.360  16.870  52.943 1.00 54.20  ? 226 SER A OG    1 
ATOM   1341 N N     . LYS A 1 197 ? 17.792  17.241  53.703 1.00 60.04  ? 227 LYS A N     1 
ATOM   1342 C CA    . LYS A 1 197 ? 16.553  17.988  53.478 1.00 71.36  ? 227 LYS A CA    1 
ATOM   1343 C C     . LYS A 1 197 ? 15.246  17.185  53.541 1.00 71.80  ? 227 LYS A C     1 
ATOM   1344 O O     . LYS A 1 197 ? 14.335  17.536  54.294 1.00 76.54  ? 227 LYS A O     1 
ATOM   1345 C CB    . LYS A 1 197 ? 16.626  18.734  52.143 1.00 88.49  ? 227 LYS A CB    1 
ATOM   1346 C CG    . LYS A 1 197 ? 15.367  19.514  51.808 1.00 101.62 ? 227 LYS A CG    1 
ATOM   1347 C CD    . LYS A 1 197 ? 15.546  20.330  50.539 1.00 106.18 ? 227 LYS A CD    1 
ATOM   1348 C CE    . LYS A 1 197 ? 14.436  21.359  50.395 1.00 108.31 ? 227 LYS A CE    1 
ATOM   1349 N NZ    . LYS A 1 197 ? 14.344  22.235  51.597 1.00 104.58 ? 227 LYS A NZ    1 
ATOM   1350 N N     . LEU A 1 198 ? 15.147  16.128  52.740 1.00 60.68  ? 228 LEU A N     1 
ATOM   1351 C CA    . LEU A 1 198 ? 13.898  15.382  52.615 1.00 56.41  ? 228 LEU A CA    1 
ATOM   1352 C C     . LEU A 1 198 ? 13.739  14.340  53.714 1.00 63.78  ? 228 LEU A C     1 
ATOM   1353 O O     . LEU A 1 198 ? 12.691  13.703  53.833 1.00 65.35  ? 228 LEU A O     1 
ATOM   1354 C CB    . LEU A 1 198 ? 13.817  14.709  51.249 1.00 60.90  ? 228 LEU A CB    1 
ATOM   1355 C CG    . LEU A 1 198 ? 14.243  15.581  50.069 1.00 65.28  ? 228 LEU A CG    1 
ATOM   1356 C CD1   . LEU A 1 198 ? 14.277  14.769  48.789 1.00 50.94  ? 228 LEU A CD1   1 
ATOM   1357 C CD2   . LEU A 1 198 ? 13.323  16.781  49.929 1.00 68.94  ? 228 LEU A CD2   1 
ATOM   1358 N N     . LYS A 1 199 ? 14.791  14.167  54.506 1.00 60.98  ? 229 LYS A N     1 
ATOM   1359 C CA    . LYS A 1 199 ? 14.764  13.252  55.639 1.00 58.62  ? 229 LYS A CA    1 
ATOM   1360 C C     . LYS A 1 199 ? 14.111  11.911  55.317 1.00 55.95  ? 229 LYS A C     1 
ATOM   1361 O O     . LYS A 1 199 ? 13.154  11.512  55.973 1.00 57.59  ? 229 LYS A O     1 
ATOM   1362 C CB    . LYS A 1 199 ? 14.057  13.899  56.833 1.00 65.27  ? 229 LYS A CB    1 
ATOM   1363 C CG    . LYS A 1 199 ? 14.891  14.947  57.556 1.00 75.57  ? 229 LYS A CG    1 
ATOM   1364 C CD    . LYS A 1 199 ? 14.344  15.242  58.946 1.00 76.98  ? 229 LYS A CD    1 
ATOM   1365 C CE    . LYS A 1 199 ? 15.321  16.080  59.755 1.00 74.52  ? 229 LYS A CE    1 
ATOM   1366 N NZ    . LYS A 1 199 ? 14.832  16.343  61.140 1.00 86.36  ? 229 LYS A NZ    1 
ATOM   1367 N N     . PHE A 1 200 ? 14.627  11.216  54.310 1.00 53.79  ? 230 PHE A N     1 
ATOM   1368 C CA    . PHE A 1 200 ? 14.137  9.878   53.997 1.00 49.98  ? 230 PHE A CA    1 
ATOM   1369 C C     . PHE A 1 200 ? 15.031  8.837   54.656 1.00 48.31  ? 230 PHE A C     1 
ATOM   1370 O O     . PHE A 1 200 ? 14.634  7.685   54.839 1.00 53.23  ? 230 PHE A O     1 
ATOM   1371 C CB    . PHE A 1 200 ? 14.070  9.651   52.483 1.00 36.33  ? 230 PHE A CB    1 
ATOM   1372 C CG    . PHE A 1 200 ? 12.981  10.432  51.797 1.00 43.46  ? 230 PHE A CG    1 
ATOM   1373 C CD1   . PHE A 1 200 ? 11.670  10.343  52.229 1.00 47.05  ? 230 PHE A CD1   1 
ATOM   1374 C CD2   . PHE A 1 200 ? 13.265  11.241  50.710 1.00 55.17  ? 230 PHE A CD2   1 
ATOM   1375 C CE1   . PHE A 1 200 ? 10.663  11.054  51.597 1.00 47.67  ? 230 PHE A CE1   1 
ATOM   1376 C CE2   . PHE A 1 200 ? 12.262  11.953  50.072 1.00 49.29  ? 230 PHE A CE2   1 
ATOM   1377 C CZ    . PHE A 1 200 ? 10.961  11.861  50.519 1.00 43.49  ? 230 PHE A CZ    1 
ATOM   1378 N N     . ILE A 1 201 ? 16.236  9.265   55.019 1.00 46.29  ? 231 ILE A N     1 
ATOM   1379 C CA    . ILE A 1 201 ? 17.240  8.389   55.607 1.00 41.78  ? 231 ILE A CA    1 
ATOM   1380 C C     . ILE A 1 201 ? 17.869  9.039   56.829 1.00 44.37  ? 231 ILE A C     1 
ATOM   1381 O O     . ILE A 1 201 ? 18.180  10.228  56.813 1.00 51.44  ? 231 ILE A O     1 
ATOM   1382 C CB    . ILE A 1 201 ? 18.387  8.112   54.610 1.00 52.70  ? 231 ILE A CB    1 
ATOM   1383 C CG1   . ILE A 1 201 ? 17.844  7.650   53.258 1.00 46.21  ? 231 ILE A CG1   1 
ATOM   1384 C CG2   . ILE A 1 201 ? 19.374  7.090   55.176 1.00 50.81  ? 231 ILE A CG2   1 
ATOM   1385 C CD1   . ILE A 1 201 ? 18.930  7.285   52.278 1.00 47.57  ? 231 ILE A CD1   1 
ATOM   1386 N N     . ASP A 1 202 ? 18.058  8.256   57.887 1.00 48.55  ? 232 ASP A N     1 
ATOM   1387 C CA    . ASP A 1 202 ? 18.858  8.694   59.020 1.00 49.21  ? 232 ASP A CA    1 
ATOM   1388 C C     . ASP A 1 202 ? 20.304  8.253   58.793 1.00 53.22  ? 232 ASP A C     1 
ATOM   1389 O O     . ASP A 1 202 ? 20.625  7.072   58.937 1.00 55.87  ? 232 ASP A O     1 
ATOM   1390 C CB    . ASP A 1 202 ? 18.318  8.102   60.320 1.00 53.38  ? 232 ASP A CB    1 
ATOM   1391 C CG    . ASP A 1 202 ? 19.069  8.599   61.547 1.00 72.35  ? 232 ASP A CG    1 
ATOM   1392 O OD1   . ASP A 1 202 ? 19.848  9.571   61.429 1.00 73.37  ? 232 ASP A OD1   1 
ATOM   1393 O OD2   . ASP A 1 202 ? 18.876  8.016   62.635 1.00 80.39  ? 232 ASP A OD2   1 
ATOM   1394 N N     . PRO A 1 203 ? 21.183  9.205   58.438 1.00 41.29  ? 233 PRO A N     1 
ATOM   1395 C CA    . PRO A 1 203 ? 22.570  8.893   58.074 1.00 43.64  ? 233 PRO A CA    1 
ATOM   1396 C C     . PRO A 1 203 ? 23.337  8.277   59.241 1.00 46.42  ? 233 PRO A C     1 
ATOM   1397 O O     . PRO A 1 203 ? 24.250  7.477   59.030 1.00 45.86  ? 233 PRO A O     1 
ATOM   1398 C CB    . PRO A 1 203 ? 23.170  10.265  57.731 1.00 43.14  ? 233 PRO A CB    1 
ATOM   1399 C CG    . PRO A 1 203 ? 22.014  11.196  57.595 1.00 43.24  ? 233 PRO A CG    1 
ATOM   1400 C CD    . PRO A 1 203 ? 20.932  10.655  58.467 1.00 37.21  ? 233 PRO A CD    1 
ATOM   1401 N N     . LYS A 1 204 ? 22.962  8.648   60.460 1.00 40.06  ? 234 LYS A N     1 
ATOM   1402 C CA    . LYS A 1 204 ? 23.674  8.190   61.642 1.00 47.43  ? 234 LYS A CA    1 
ATOM   1403 C C     . LYS A 1 204 ? 23.420  6.714   61.937 1.00 48.42  ? 234 LYS A C     1 
ATOM   1404 O O     . LYS A 1 204 ? 24.004  6.152   62.862 1.00 58.39  ? 234 LYS A O     1 
ATOM   1405 C CB    . LYS A 1 204 ? 23.309  9.049   62.855 1.00 58.55  ? 234 LYS A CB    1 
ATOM   1406 C CG    . LYS A 1 204 ? 23.806  10.490  62.770 1.00 58.81  ? 234 LYS A CG    1 
ATOM   1407 C CD    . LYS A 1 204 ? 25.321  10.554  62.593 1.00 55.23  ? 234 LYS A CD    1 
ATOM   1408 C CE    . LYS A 1 204 ? 25.851  11.969  62.810 1.00 48.42  ? 234 LYS A CE    1 
ATOM   1409 N NZ    . LYS A 1 204 ? 25.297  12.947  61.834 1.00 49.32  ? 234 LYS A NZ    1 
ATOM   1410 N N     . LYS A 1 205 ? 22.555  6.085   61.150 1.00 40.66  ? 235 LYS A N     1 
ATOM   1411 C CA    . LYS A 1 205 ? 22.265  4.669   61.346 1.00 36.47  ? 235 LYS A CA    1 
ATOM   1412 C C     . LYS A 1 205 ? 22.933  3.797   60.292 1.00 42.19  ? 235 LYS A C     1 
ATOM   1413 O O     . LYS A 1 205 ? 22.788  2.574   60.309 1.00 46.97  ? 235 LYS A O     1 
ATOM   1414 C CB    . LYS A 1 205 ? 20.758  4.419   61.374 1.00 42.35  ? 235 LYS A CB    1 
ATOM   1415 C CG    . LYS A 1 205 ? 20.064  5.048   62.567 1.00 56.24  ? 235 LYS A CG    1 
ATOM   1416 C CD    . LYS A 1 205 ? 18.652  4.523   62.723 1.00 68.20  ? 235 LYS A CD    1 
ATOM   1417 C CE    . LYS A 1 205 ? 18.020  5.035   64.006 1.00 92.32  ? 235 LYS A CE    1 
ATOM   1418 N NZ    . LYS A 1 205 ? 16.614  4.566   64.155 1.00 103.10 ? 235 LYS A NZ    1 
ATOM   1419 N N     . ILE A 1 206 ? 23.670  4.429   59.382 1.00 39.12  ? 236 ILE A N     1 
ATOM   1420 C CA    . ILE A 1 206 ? 24.390  3.697   58.345 1.00 33.87  ? 236 ILE A CA    1 
ATOM   1421 C C     . ILE A 1 206 ? 25.617  2.989   58.907 1.00 36.82  ? 236 ILE A C     1 
ATOM   1422 O O     . ILE A 1 206 ? 26.480  3.618   59.517 1.00 51.46  ? 236 ILE A O     1 
ATOM   1423 C CB    . ILE A 1 206 ? 24.833  4.615   57.196 1.00 28.27  ? 236 ILE A CB    1 
ATOM   1424 C CG1   . ILE A 1 206 ? 23.631  5.343   56.599 1.00 25.20  ? 236 ILE A CG1   1 
ATOM   1425 C CG2   . ILE A 1 206 ? 25.539  3.811   56.124 1.00 23.60  ? 236 ILE A CG2   1 
ATOM   1426 C CD1   . ILE A 1 206 ? 22.544  4.412   56.121 1.00 36.43  ? 236 ILE A CD1   1 
ATOM   1427 N N     . LYS A 1 207 ? 25.680  1.677   58.700 1.00 38.22  ? 237 LYS A N     1 
ATOM   1428 C CA    . LYS A 1 207 ? 26.822  0.874   59.126 1.00 38.38  ? 237 LYS A CA    1 
ATOM   1429 C C     . LYS A 1 207 ? 27.913  0.786   58.051 1.00 43.76  ? 237 LYS A C     1 
ATOM   1430 O O     . LYS A 1 207 ? 29.100  0.749   58.376 1.00 45.13  ? 237 LYS A O     1 
ATOM   1431 C CB    . LYS A 1 207 ? 26.369  -0.533  59.524 1.00 33.47  ? 237 LYS A CB    1 
ATOM   1432 C CG    . LYS A 1 207 ? 25.685  -0.603  60.866 1.00 50.65  ? 237 LYS A CG    1 
ATOM   1433 C CD    . LYS A 1 207 ? 25.489  -2.040  61.327 1.00 64.54  ? 237 LYS A CD    1 
ATOM   1434 C CE    . LYS A 1 207 ? 24.157  -2.602  60.864 1.00 74.53  ? 237 LYS A CE    1 
ATOM   1435 N NZ    . LYS A 1 207 ? 23.793  -3.838  61.617 1.00 78.57  ? 237 LYS A NZ    1 
ATOM   1436 N N     . VAL A 1 208 ? 27.505  0.744   56.780 1.00 36.27  ? 238 VAL A N     1 
ATOM   1437 C CA    . VAL A 1 208 ? 28.443  0.596   55.669 1.00 26.54  ? 238 VAL A CA    1 
ATOM   1438 C C     . VAL A 1 208 ? 28.190  1.582   54.531 1.00 28.61  ? 238 VAL A C     1 
ATOM   1439 O O     . VAL A 1 208 ? 27.090  1.674   54.002 1.00 29.63  ? 238 VAL A O     1 
ATOM   1440 C CB    . VAL A 1 208 ? 28.416  -0.826  55.084 1.00 30.54  ? 238 VAL A CB    1 
ATOM   1441 C CG1   . VAL A 1 208 ? 29.431  -0.951  53.959 1.00 18.87  ? 238 VAL A CG1   1 
ATOM   1442 C CG2   . VAL A 1 208 ? 28.686  -1.849  56.173 1.00 26.88  ? 238 VAL A CG2   1 
ATOM   1443 N N     . PHE A 1 209 ? 29.236  2.304   54.152 1.00 29.11  ? 239 PHE A N     1 
ATOM   1444 C CA    . PHE A 1 209 ? 29.169  3.289   53.083 1.00 25.43  ? 239 PHE A CA    1 
ATOM   1445 C C     . PHE A 1 209 ? 30.150  2.903   51.966 1.00 32.91  ? 239 PHE A C     1 
ATOM   1446 O O     . PHE A 1 209 ? 31.348  2.750   52.203 1.00 25.29  ? 239 PHE A O     1 
ATOM   1447 C CB    . PHE A 1 209 ? 29.489  4.669   53.651 1.00 18.22  ? 239 PHE A CB    1 
ATOM   1448 C CG    . PHE A 1 209 ? 29.728  5.737   52.613 1.00 33.08  ? 239 PHE A CG    1 
ATOM   1449 C CD1   . PHE A 1 209 ? 31.019  6.108   52.267 1.00 37.20  ? 239 PHE A CD1   1 
ATOM   1450 C CD2   . PHE A 1 209 ? 28.665  6.403   52.020 1.00 32.99  ? 239 PHE A CD2   1 
ATOM   1451 C CE1   . PHE A 1 209 ? 31.247  7.107   51.333 1.00 43.09  ? 239 PHE A CE1   1 
ATOM   1452 C CE2   . PHE A 1 209 ? 28.884  7.405   51.083 1.00 31.94  ? 239 PHE A CE2   1 
ATOM   1453 C CZ    . PHE A 1 209 ? 30.177  7.757   50.740 1.00 44.83  ? 239 PHE A CZ    1 
ATOM   1454 N N     . VAL A 1 210 ? 29.632  2.712   50.755 1.00 28.11  ? 240 VAL A N     1 
ATOM   1455 C CA    . VAL A 1 210 ? 30.475  2.374   49.614 1.00 27.19  ? 240 VAL A CA    1 
ATOM   1456 C C     . VAL A 1 210 ? 30.474  3.474   48.574 1.00 21.98  ? 240 VAL A C     1 
ATOM   1457 O O     . VAL A 1 210 ? 29.429  3.985   48.188 1.00 29.91  ? 240 VAL A O     1 
ATOM   1458 C CB    . VAL A 1 210 ? 30.025  1.095   48.910 1.00 21.55  ? 240 VAL A CB    1 
ATOM   1459 C CG1   . VAL A 1 210 ? 30.820  0.919   47.634 1.00 26.24  ? 240 VAL A CG1   1 
ATOM   1460 C CG2   . VAL A 1 210 ? 30.192  -0.106  49.819 1.00 18.94  ? 240 VAL A CG2   1 
ATOM   1461 N N     . LEU A 1 211 ? 31.661  3.844   48.126 1.00 25.86  ? 241 LEU A N     1 
ATOM   1462 C CA    . LEU A 1 211 ? 31.786  4.765   47.016 1.00 28.68  ? 241 LEU A CA    1 
ATOM   1463 C C     . LEU A 1 211 ? 32.316  3.981   45.818 1.00 32.85  ? 241 LEU A C     1 
ATOM   1464 O O     . LEU A 1 211 ? 33.499  3.655   45.754 1.00 36.46  ? 241 LEU A O     1 
ATOM   1465 C CB    . LEU A 1 211 ? 32.702  5.937   47.378 1.00 26.55  ? 241 LEU A CB    1 
ATOM   1466 C CG    . LEU A 1 211 ? 32.575  7.133   46.431 1.00 44.24  ? 241 LEU A CG    1 
ATOM   1467 C CD1   . LEU A 1 211 ? 32.945  8.428   47.131 1.00 55.13  ? 241 LEU A CD1   1 
ATOM   1468 C CD2   . LEU A 1 211 ? 33.418  6.922   45.176 1.00 43.37  ? 241 LEU A CD2   1 
ATOM   1469 N N     . ASP A 1 212 ? 31.423  3.668   44.884 1.00 32.85  ? 242 ASP A N     1 
ATOM   1470 C CA    . ASP A 1 212 ? 31.754  2.822   43.746 1.00 40.76  ? 242 ASP A CA    1 
ATOM   1471 C C     . ASP A 1 212 ? 32.271  3.631   42.552 1.00 36.08  ? 242 ASP A C     1 
ATOM   1472 O O     . ASP A 1 212 ? 31.927  4.799   42.390 1.00 40.16  ? 242 ASP A O     1 
ATOM   1473 C CB    . ASP A 1 212 ? 30.525  2.011   43.342 1.00 50.59  ? 242 ASP A CB    1 
ATOM   1474 C CG    . ASP A 1 212 ? 30.873  0.809   42.488 1.00 69.45  ? 242 ASP A CG    1 
ATOM   1475 O OD1   . ASP A 1 212 ? 31.976  0.248   42.677 1.00 75.09  ? 242 ASP A OD1   1 
ATOM   1476 O OD2   . ASP A 1 212 ? 30.040  0.422   41.636 1.00 67.02  ? 242 ASP A OD2   1 
ATOM   1477 N N     . GLU A 1 213 ? 33.098  3.000   41.720 1.00 35.00  ? 243 GLU A N     1 
ATOM   1478 C CA    . GLU A 1 213 ? 33.595  3.616   40.484 1.00 28.33  ? 243 GLU A CA    1 
ATOM   1479 C C     . GLU A 1 213 ? 34.190  5.002   40.715 1.00 28.03  ? 243 GLU A C     1 
ATOM   1480 O O     . GLU A 1 213 ? 33.879  5.935   39.984 1.00 30.78  ? 243 GLU A O     1 
ATOM   1481 C CB    . GLU A 1 213 ? 32.467  3.750   39.454 1.00 35.08  ? 243 GLU A CB    1 
ATOM   1482 C CG    . GLU A 1 213 ? 31.544  2.553   39.343 1.00 57.38  ? 243 GLU A CG    1 
ATOM   1483 C CD    . GLU A 1 213 ? 32.116  1.452   38.481 1.00 90.48  ? 243 GLU A CD    1 
ATOM   1484 O OE1   . GLU A 1 213 ? 33.305  1.545   38.102 1.00 105.88 ? 243 GLU A OE1   1 
ATOM   1485 O OE2   . GLU A 1 213 ? 31.375  0.493   38.181 1.00 101.39 ? 243 GLU A OE2   1 
ATOM   1486 N N     . ALA A 1 214 ? 35.038  5.147   41.727 1.00 27.99  ? 244 ALA A N     1 
ATOM   1487 C CA    . ALA A 1 214 ? 35.594  6.460   42.047 1.00 30.25  ? 244 ALA A CA    1 
ATOM   1488 C C     . ALA A 1 214 ? 36.167  7.141   40.808 1.00 34.64  ? 244 ALA A C     1 
ATOM   1489 O O     . ALA A 1 214 ? 36.005  8.345   40.621 1.00 35.96  ? 244 ALA A O     1 
ATOM   1490 C CB    . ALA A 1 214 ? 36.654  6.349   43.135 1.00 28.04  ? 244 ALA A CB    1 
ATOM   1491 N N     . ASP A 1 215 ? 36.836  6.360   39.965 1.00 37.10  ? 245 ASP A N     1 
ATOM   1492 C CA    . ASP A 1 215 ? 37.468  6.892   38.761 1.00 44.96  ? 245 ASP A CA    1 
ATOM   1493 C C     . ASP A 1 215 ? 36.439  7.517   37.818 1.00 55.76  ? 245 ASP A C     1 
ATOM   1494 O O     . ASP A 1 215 ? 36.780  8.356   36.985 1.00 63.44  ? 245 ASP A O     1 
ATOM   1495 C CB    . ASP A 1 215 ? 38.282  5.809   38.040 1.00 48.37  ? 245 ASP A CB    1 
ATOM   1496 C CG    . ASP A 1 215 ? 37.444  4.600   37.642 1.00 68.86  ? 245 ASP A CG    1 
ATOM   1497 O OD1   . ASP A 1 215 ? 36.902  3.909   38.536 1.00 58.16  ? 245 ASP A OD1   1 
ATOM   1498 O OD2   . ASP A 1 215 ? 37.350  4.325   36.425 1.00 86.71  ? 245 ASP A OD2   1 
ATOM   1499 N N     . VAL A 1 216 ? 35.182  7.108   37.968 1.00 48.54  ? 246 VAL A N     1 
ATOM   1500 C CA    . VAL A 1 216 ? 34.086  7.632   37.161 1.00 41.51  ? 246 VAL A CA    1 
ATOM   1501 C C     . VAL A 1 216 ? 33.394  8.808   37.843 1.00 41.51  ? 246 VAL A C     1 
ATOM   1502 O O     . VAL A 1 216 ? 32.925  9.732   37.179 1.00 41.05  ? 246 VAL A O     1 
ATOM   1503 C CB    . VAL A 1 216 ? 33.028  6.547   36.878 1.00 41.21  ? 246 VAL A CB    1 
ATOM   1504 C CG1   . VAL A 1 216 ? 31.862  7.123   36.069 1.00 30.20  ? 246 VAL A CG1   1 
ATOM   1505 C CG2   . VAL A 1 216 ? 33.660  5.359   36.165 1.00 34.64  ? 246 VAL A CG2   1 
ATOM   1506 N N     . MET A 1 217 ? 33.327  8.771   39.171 1.00 41.35  ? 247 MET A N     1 
ATOM   1507 C CA    . MET A 1 217 ? 32.602  9.797   39.914 1.00 28.54  ? 247 MET A CA    1 
ATOM   1508 C C     . MET A 1 217 ? 33.328  11.136  39.981 1.00 35.45  ? 247 MET A C     1 
ATOM   1509 O O     . MET A 1 217 ? 32.694  12.175  40.109 1.00 49.14  ? 247 MET A O     1 
ATOM   1510 C CB    . MET A 1 217 ? 32.215  9.318   41.318 1.00 44.24  ? 247 MET A CB    1 
ATOM   1511 C CG    . MET A 1 217 ? 30.975  10.045  41.855 1.00 53.52  ? 247 MET A CG    1 
ATOM   1512 S SD    . MET A 1 217 ? 29.857  9.038   42.846 1.00 56.05  ? 247 MET A SD    1 
ATOM   1513 C CE    . MET A 1 217 ? 30.192  7.408   42.203 1.00 183.35 ? 247 MET A CE    1 
ATOM   1514 N N     . ILE A 1 218 ? 34.652  11.118  39.890 1.00 52.31  ? 248 ILE A N     1 
ATOM   1515 C CA    . ILE A 1 218 ? 35.414  12.359  39.913 1.00 51.67  ? 248 ILE A CA    1 
ATOM   1516 C C     . ILE A 1 218 ? 35.130  13.199  38.666 1.00 59.01  ? 248 ILE A C     1 
ATOM   1517 O O     . ILE A 1 218 ? 35.477  14.379  38.618 1.00 60.63  ? 248 ILE A O     1 
ATOM   1518 C CB    . ILE A 1 218 ? 36.929  12.101  40.018 1.00 64.08  ? 248 ILE A CB    1 
ATOM   1519 C CG1   . ILE A 1 218 ? 37.379  11.118  38.935 1.00 83.10  ? 248 ILE A CG1   1 
ATOM   1520 C CG2   . ILE A 1 218 ? 37.293  11.584  41.401 1.00 60.32  ? 248 ILE A CG2   1 
ATOM   1521 C CD1   . ILE A 1 218 ? 38.885  11.054  38.755 1.00 93.11  ? 248 ILE A CD1   1 
ATOM   1522 N N     . ALA A 1 219 ? 34.492  12.585  37.669 1.00 61.36  ? 249 ALA A N     1 
ATOM   1523 C CA    . ALA A 1 219 ? 34.186  13.252  36.398 1.00 60.82  ? 249 ALA A CA    1 
ATOM   1524 C C     . ALA A 1 219 ? 33.410  14.560  36.566 1.00 63.46  ? 249 ALA A C     1 
ATOM   1525 O O     . ALA A 1 219 ? 33.683  15.546  35.883 1.00 77.74  ? 249 ALA A O     1 
ATOM   1526 C CB    . ALA A 1 219 ? 33.438  12.306  35.469 1.00 54.71  ? 249 ALA A CB    1 
ATOM   1527 N N     . THR A 1 220 ? 32.437  14.559  37.467 1.00 62.26  ? 250 THR A N     1 
ATOM   1528 C CA    . THR A 1 220 ? 31.697  15.768  37.797 1.00 77.35  ? 250 THR A CA    1 
ATOM   1529 C C     . THR A 1 220 ? 32.201  16.348  39.110 1.00 92.96  ? 250 THR A C     1 
ATOM   1530 O O     . THR A 1 220 ? 32.173  15.673  40.140 1.00 96.80  ? 250 THR A O     1 
ATOM   1531 C CB    . THR A 1 220 ? 30.199  15.470  37.967 1.00 82.38  ? 250 THR A CB    1 
ATOM   1532 O OG1   . THR A 1 220 ? 29.687  14.877  36.767 1.00 90.70  ? 250 THR A OG1   1 
ATOM   1533 C CG2   . THR A 1 220 ? 29.429  16.750  38.282 1.00 76.65  ? 250 THR A CG2   1 
ATOM   1534 N N     . GLN A 1 221 ? 32.662  17.594  39.079 1.00 97.01  ? 251 GLN A N     1 
ATOM   1535 C CA    . GLN A 1 221 ? 33.025  18.281  40.312 1.00 92.43  ? 251 GLN A CA    1 
ATOM   1536 C C     . GLN A 1 221 ? 31.886  18.166  41.315 1.00 86.24  ? 251 GLN A C     1 
ATOM   1537 O O     . GLN A 1 221 ? 32.113  18.003  42.517 1.00 84.14  ? 251 GLN A O     1 
ATOM   1538 C CB    . GLN A 1 221 ? 33.342  19.748  40.040 1.00 99.08  ? 251 GLN A CB    1 
ATOM   1539 C CG    . GLN A 1 221 ? 34.825  20.061  40.016 1.00 110.83 ? 251 GLN A CG    1 
ATOM   1540 C CD    . GLN A 1 221 ? 35.413  20.161  41.410 1.00 115.92 ? 251 GLN A CD    1 
ATOM   1541 O OE1   . GLN A 1 221 ? 34.724  20.530  42.363 1.00 113.97 ? 251 GLN A OE1   1 
ATOM   1542 N NE2   . GLN A 1 221 ? 36.694  19.837  41.537 1.00 120.51 ? 251 GLN A NE2   1 
ATOM   1543 N N     . GLY A 1 222 ? 30.659  18.244  40.806 1.00 76.90  ? 252 GLY A N     1 
ATOM   1544 C CA    . GLY A 1 222 ? 29.479  18.113  41.636 1.00 65.28  ? 252 GLY A CA    1 
ATOM   1545 C C     . GLY A 1 222 ? 29.463  16.801  42.395 1.00 60.39  ? 252 GLY A C     1 
ATOM   1546 O O     . GLY A 1 222 ? 29.214  16.773  43.601 1.00 57.80  ? 252 GLY A O     1 
ATOM   1547 N N     . HIS A 1 223 ? 29.733  15.708  41.690 1.00 52.82  ? 253 HIS A N     1 
ATOM   1548 C CA    . HIS A 1 223 ? 29.710  14.399  42.324 1.00 49.96  ? 253 HIS A CA    1 
ATOM   1549 C C     . HIS A 1 223 ? 30.700  14.298  43.490 1.00 53.57  ? 253 HIS A C     1 
ATOM   1550 O O     . HIS A 1 223 ? 30.412  13.651  44.502 1.00 49.38  ? 253 HIS A O     1 
ATOM   1551 C CB    . HIS A 1 223 ? 29.935  13.281  41.301 1.00 25.83  ? 253 HIS A CB    1 
ATOM   1552 C CG    . HIS A 1 223 ? 28.694  12.878  40.573 1.00 35.95  ? 253 HIS A CG    1 
ATOM   1553 N ND1   . HIS A 1 223 ? 28.716  12.309  39.313 1.00 51.78  ? 253 HIS A ND1   1 
ATOM   1554 C CD2   . HIS A 1 223 ? 27.388  12.974  40.914 1.00 37.99  ? 253 HIS A CD2   1 
ATOM   1555 C CE1   . HIS A 1 223 ? 27.481  12.064  38.922 1.00 49.08  ? 253 HIS A CE1   1 
ATOM   1556 N NE2   . HIS A 1 223 ? 26.653  12.461  39.874 1.00 45.59  ? 253 HIS A NE2   1 
ATOM   1557 N N     . GLN A 1 224 ? 31.856  14.941  43.350 1.00 46.00  ? 254 GLN A N     1 
ATOM   1558 C CA    . GLN A 1 224 ? 32.845  14.949  44.421 1.00 43.27  ? 254 GLN A CA    1 
ATOM   1559 C C     . GLN A 1 224 ? 32.290  15.639  45.656 1.00 53.24  ? 254 GLN A C     1 
ATOM   1560 O O     . GLN A 1 224 ? 32.138  15.020  46.711 1.00 62.14  ? 254 GLN A O     1 
ATOM   1561 C CB    . GLN A 1 224 ? 34.119  15.657  43.981 1.00 44.90  ? 254 GLN A CB    1 
ATOM   1562 C CG    . GLN A 1 224 ? 34.861  14.959  42.862 1.00 62.48  ? 254 GLN A CG    1 
ATOM   1563 C CD    . GLN A 1 224 ? 36.230  15.561  42.620 1.00 71.38  ? 254 GLN A CD    1 
ATOM   1564 O OE1   . GLN A 1 224 ? 36.955  15.884  43.564 1.00 72.38  ? 254 GLN A OE1   1 
ATOM   1565 N NE2   . GLN A 1 224 ? 36.593  15.711  41.352 1.00 65.31  ? 254 GLN A NE2   1 
ATOM   1566 N N     . ASP A 1 225 ? 31.986  16.925  45.518 1.00 50.69  ? 255 ASP A N     1 
ATOM   1567 C CA    . ASP A 1 225 ? 31.513  17.718  46.645 1.00 60.08  ? 255 ASP A CA    1 
ATOM   1568 C C     . ASP A 1 225 ? 30.326  17.069  47.354 1.00 62.99  ? 255 ASP A C     1 
ATOM   1569 O O     . ASP A 1 225 ? 30.257  17.057  48.582 1.00 67.94  ? 255 ASP A O     1 
ATOM   1570 C CB    . ASP A 1 225 ? 31.172  19.137  46.191 1.00 74.73  ? 255 ASP A CB    1 
ATOM   1571 C CG    . ASP A 1 225 ? 32.400  19.910  45.729 1.00 93.56  ? 255 ASP A CG    1 
ATOM   1572 O OD1   . ASP A 1 225 ? 32.336  20.548  44.656 1.00 99.93  ? 255 ASP A OD1   1 
ATOM   1573 O OD2   . ASP A 1 225 ? 33.434  19.870  46.435 1.00 92.97  ? 255 ASP A OD2   1 
ATOM   1574 N N     . GLN A 1 226 ? 29.400  16.517  46.579 1.00 53.82  ? 256 GLN A N     1 
ATOM   1575 C CA    . GLN A 1 226 ? 28.229  15.871  47.154 1.00 42.27  ? 256 GLN A CA    1 
ATOM   1576 C C     . GLN A 1 226 ? 28.600  14.609  47.929 1.00 45.99  ? 256 GLN A C     1 
ATOM   1577 O O     . GLN A 1 226 ? 28.040  14.342  48.992 1.00 57.05  ? 256 GLN A O     1 
ATOM   1578 C CB    . GLN A 1 226 ? 27.200  15.559  46.068 1.00 35.34  ? 256 GLN A CB    1 
ATOM   1579 C CG    . GLN A 1 226 ? 26.656  16.799  45.369 1.00 49.54  ? 256 GLN A CG    1 
ATOM   1580 C CD    . GLN A 1 226 ? 25.887  16.470  44.097 1.00 61.97  ? 256 GLN A CD    1 
ATOM   1581 O OE1   . GLN A 1 226 ? 26.181  15.490  43.409 1.00 66.32  ? 256 GLN A OE1   1 
ATOM   1582 N NE2   . GLN A 1 226 ? 24.898  17.294  43.778 1.00 65.57  ? 256 GLN A NE2   1 
ATOM   1583 N N     . SER A 1 227 ? 29.546  13.840  47.401 1.00 32.20  ? 257 SER A N     1 
ATOM   1584 C CA    . SER A 1 227 ? 29.984  12.612  48.065 1.00 33.29  ? 257 SER A CA    1 
ATOM   1585 C C     . SER A 1 227 ? 30.642  12.905  49.413 1.00 37.40  ? 257 SER A C     1 
ATOM   1586 O O     . SER A 1 227 ? 30.310  12.291  50.425 1.00 35.70  ? 257 SER A O     1 
ATOM   1587 C CB    . SER A 1 227 ? 30.939  11.816  47.171 1.00 34.20  ? 257 SER A CB    1 
ATOM   1588 O OG    . SER A 1 227 ? 30.233  11.136  46.147 1.00 39.87  ? 257 SER A OG    1 
ATOM   1589 N N     . ILE A 1 228 ? 31.583  13.842  49.407 1.00 35.26  ? 258 ILE A N     1 
ATOM   1590 C CA    . ILE A 1 228 ? 32.221  14.316  50.622 1.00 38.77  ? 258 ILE A CA    1 
ATOM   1591 C C     . ILE A 1 228 ? 31.182  14.759  51.656 1.00 45.35  ? 258 ILE A C     1 
ATOM   1592 O O     . ILE A 1 228 ? 31.251  14.377  52.826 1.00 34.02  ? 258 ILE A O     1 
ATOM   1593 C CB    . ILE A 1 228 ? 33.133  15.520  50.317 1.00 47.20  ? 258 ILE A CB    1 
ATOM   1594 C CG1   . ILE A 1 228 ? 34.254  15.122  49.355 1.00 41.70  ? 258 ILE A CG1   1 
ATOM   1595 C CG2   . ILE A 1 228 ? 33.691  16.111  51.603 1.00 30.81  ? 258 ILE A CG2   1 
ATOM   1596 C CD1   . ILE A 1 228 ? 35.299  14.252  49.981 1.00 47.73  ? 258 ILE A CD1   1 
ATOM   1597 N N     . ARG A 1 229 ? 30.222  15.568  51.217 1.00 47.57  ? 259 ARG A N     1 
ATOM   1598 C CA    . ARG A 1 229 ? 29.229  16.131  52.124 1.00 47.95  ? 259 ARG A CA    1 
ATOM   1599 C C     . ARG A 1 229 ? 28.287  15.074  52.671 1.00 50.24  ? 259 ARG A C     1 
ATOM   1600 O O     . ARG A 1 229 ? 27.669  15.270  53.712 1.00 59.92  ? 259 ARG A O     1 
ATOM   1601 C CB    . ARG A 1 229 ? 28.443  17.254  51.451 1.00 45.95  ? 259 ARG A CB    1 
ATOM   1602 C CG    . ARG A 1 229 ? 29.265  18.511  51.230 1.00 56.72  ? 259 ARG A CG    1 
ATOM   1603 C CD    . ARG A 1 229 ? 28.534  19.485  50.342 1.00 70.83  ? 259 ARG A CD    1 
ATOM   1604 N NE    . ARG A 1 229 ? 27.260  19.896  50.920 1.00 86.21  ? 259 ARG A NE    1 
ATOM   1605 C CZ    . ARG A 1 229 ? 26.231  20.347  50.208 1.00 97.62  ? 259 ARG A CZ    1 
ATOM   1606 N NH1   . ARG A 1 229 ? 26.325  20.435  48.887 1.00 95.65  ? 259 ARG A NH1   1 
ATOM   1607 N NH2   . ARG A 1 229 ? 25.106  20.701  50.815 1.00 98.44  ? 259 ARG A NH2   1 
ATOM   1608 N N     . ILE A 1 230 ? 28.182  13.951  51.971 1.00 48.23  ? 260 ILE A N     1 
ATOM   1609 C CA    . ILE A 1 230 ? 27.402  12.825  52.470 1.00 45.33  ? 260 ILE A CA    1 
ATOM   1610 C C     . ILE A 1 230 ? 28.232  12.047  53.476 1.00 49.14  ? 260 ILE A C     1 
ATOM   1611 O O     . ILE A 1 230 ? 27.750  11.678  54.543 1.00 48.37  ? 260 ILE A O     1 
ATOM   1612 C CB    . ILE A 1 230 ? 26.971  11.881  51.335 1.00 41.59  ? 260 ILE A CB    1 
ATOM   1613 C CG1   . ILE A 1 230 ? 25.972  12.582  50.413 1.00 38.92  ? 260 ILE A CG1   1 
ATOM   1614 C CG2   . ILE A 1 230 ? 26.363  10.606  51.900 1.00 34.67  ? 260 ILE A CG2   1 
ATOM   1615 C CD1   . ILE A 1 230 ? 25.670  11.806  49.168 1.00 42.47  ? 260 ILE A CD1   1 
ATOM   1616 N N     . GLN A 1 231 ? 29.492  11.817  53.127 1.00 52.58  ? 261 GLN A N     1 
ATOM   1617 C CA    . GLN A 1 231 ? 30.399  11.042  53.959 1.00 40.36  ? 261 GLN A CA    1 
ATOM   1618 C C     . GLN A 1 231 ? 30.548  11.657  55.347 1.00 46.55  ? 261 GLN A C     1 
ATOM   1619 O O     . GLN A 1 231 ? 30.793  10.949  56.322 1.00 62.52  ? 261 GLN A O     1 
ATOM   1620 C CB    . GLN A 1 231 ? 31.761  10.912  53.269 1.00 34.34  ? 261 GLN A CB    1 
ATOM   1621 C CG    . GLN A 1 231 ? 32.748  9.991   53.972 1.00 26.86  ? 261 GLN A CG    1 
ATOM   1622 C CD    . GLN A 1 231 ? 33.469  10.672  55.126 1.00 32.73  ? 261 GLN A CD    1 
ATOM   1623 O OE1   . GLN A 1 231 ? 33.637  11.895  55.146 1.00 38.50  ? 261 GLN A OE1   1 
ATOM   1624 N NE2   . GLN A 1 231 ? 33.909  9.877   56.087 1.00 32.88  ? 261 GLN A NE2   1 
ATOM   1625 N N     . ARG A 1 232 ? 30.385  12.974  55.434 1.00 37.42  ? 262 ARG A N     1 
ATOM   1626 C CA    . ARG A 1 232 ? 30.519  13.688  56.705 1.00 45.16  ? 262 ARG A CA    1 
ATOM   1627 C C     . ARG A 1 232 ? 29.324  13.509  57.645 1.00 57.10  ? 262 ARG A C     1 
ATOM   1628 O O     . ARG A 1 232 ? 29.428  13.760  58.846 1.00 58.67  ? 262 ARG A O     1 
ATOM   1629 C CB    . ARG A 1 232 ? 30.760  15.175  56.456 1.00 29.96  ? 262 ARG A CB    1 
ATOM   1630 C CG    . ARG A 1 232 ? 32.114  15.486  55.850 1.00 46.08  ? 262 ARG A CG    1 
ATOM   1631 C CD    . ARG A 1 232 ? 32.214  16.946  55.471 1.00 51.72  ? 262 ARG A CD    1 
ATOM   1632 N NE    . ARG A 1 232 ? 33.582  17.326  55.141 1.00 64.04  ? 262 ARG A NE    1 
ATOM   1633 C CZ    . ARG A 1 232 ? 33.920  18.500  54.621 1.00 80.48  ? 262 ARG A CZ    1 
ATOM   1634 N NH1   . ARG A 1 232 ? 32.985  19.407  54.365 1.00 79.63  ? 262 ARG A NH1   1 
ATOM   1635 N NH2   . ARG A 1 232 ? 35.191  18.765  54.351 1.00 90.22  ? 262 ARG A NH2   1 
ATOM   1636 N N     . MET A 1 233 ? 28.191  13.077  57.102 1.00 57.02  ? 263 MET A N     1 
ATOM   1637 C CA    . MET A 1 233 ? 26.988  12.894  57.907 1.00 52.71  ? 263 MET A CA    1 
ATOM   1638 C C     . MET A 1 233 ? 26.953  11.524  58.567 1.00 51.01  ? 263 MET A C     1 
ATOM   1639 O O     . MET A 1 233 ? 26.095  11.261  59.410 1.00 55.23  ? 263 MET A O     1 
ATOM   1640 C CB    . MET A 1 233 ? 25.730  13.078  57.056 1.00 45.27  ? 263 MET A CB    1 
ATOM   1641 C CG    . MET A 1 233 ? 25.625  14.426  56.370 1.00 38.66  ? 263 MET A CG    1 
ATOM   1642 S SD    . MET A 1 233 ? 24.038  14.626  55.557 1.00 74.04  ? 263 MET A SD    1 
ATOM   1643 C CE    . MET A 1 233 ? 22.944  14.738  56.978 1.00 77.10  ? 263 MET A CE    1 
ATOM   1644 N N     . LEU A 1 234 ? 27.879  10.653  58.180 1.00 39.31  ? 264 LEU A N     1 
ATOM   1645 C CA    . LEU A 1 234 ? 27.898  9.287   58.694 1.00 34.04  ? 264 LEU A CA    1 
ATOM   1646 C C     . LEU A 1 234 ? 28.518  9.211   60.086 1.00 42.10  ? 264 LEU A C     1 
ATOM   1647 O O     . LEU A 1 234 ? 29.308  10.073  60.468 1.00 44.62  ? 264 LEU A O     1 
ATOM   1648 C CB    . LEU A 1 234 ? 28.651  8.364   57.733 1.00 33.07  ? 264 LEU A CB    1 
ATOM   1649 C CG    . LEU A 1 234 ? 28.036  8.189   56.336 1.00 48.69  ? 264 LEU A CG    1 
ATOM   1650 C CD1   . LEU A 1 234 ? 29.035  7.583   55.359 1.00 42.99  ? 264 LEU A CD1   1 
ATOM   1651 C CD2   . LEU A 1 234 ? 26.760  7.357   56.387 1.00 48.97  ? 264 LEU A CD2   1 
ATOM   1652 N N     . PRO A 1 235 ? 28.159  8.173   60.851 1.00 41.98  ? 265 PRO A N     1 
ATOM   1653 C CA    . PRO A 1 235 ? 28.818  7.961   62.139 1.00 34.45  ? 265 PRO A CA    1 
ATOM   1654 C C     . PRO A 1 235 ? 30.304  7.755   61.893 1.00 41.05  ? 265 PRO A C     1 
ATOM   1655 O O     . PRO A 1 235 ? 30.661  7.205   60.851 1.00 49.01  ? 265 PRO A O     1 
ATOM   1656 C CB    . PRO A 1 235 ? 28.190  6.659   62.647 1.00 44.27  ? 265 PRO A CB    1 
ATOM   1657 C CG    . PRO A 1 235 ? 26.953  6.464   61.830 1.00 47.10  ? 265 PRO A CG    1 
ATOM   1658 C CD    . PRO A 1 235 ? 27.238  7.077   60.509 1.00 38.85  ? 265 PRO A CD    1 
ATOM   1659 N N     . ARG A 1 236 ? 31.148  8.183   62.828 1.00 44.98  ? 266 ARG A N     1 
ATOM   1660 C CA    . ARG A 1 236 ? 32.597  8.114   62.650 1.00 38.24  ? 266 ARG A CA    1 
ATOM   1661 C C     . ARG A 1 236 ? 33.133  6.684   62.603 1.00 35.47  ? 266 ARG A C     1 
ATOM   1662 O O     . ARG A 1 236 ? 34.243  6.448   62.131 1.00 45.73  ? 266 ARG A O     1 
ATOM   1663 C CB    . ARG A 1 236 ? 33.315  8.912   63.742 1.00 42.76  ? 266 ARG A CB    1 
ATOM   1664 C CG    . ARG A 1 236 ? 33.400  10.405  63.459 1.00 45.82  ? 266 ARG A CG    1 
ATOM   1665 C CD    . ARG A 1 236 ? 34.111  11.148  64.582 1.00 45.68  ? 266 ARG A CD    1 
ATOM   1666 N NE    . ARG A 1 236 ? 35.449  10.624  64.838 1.00 53.71  ? 266 ARG A NE    1 
ATOM   1667 C CZ    . ARG A 1 236 ? 36.538  11.011  64.184 1.00 60.44  ? 266 ARG A CZ    1 
ATOM   1668 N NH1   . ARG A 1 236 ? 36.445  11.922  63.226 1.00 65.39  ? 266 ARG A NH1   1 
ATOM   1669 N NH2   . ARG A 1 236 ? 37.716  10.484  64.484 1.00 59.45  ? 266 ARG A NH2   1 
ATOM   1670 N N     . ASN A 1 237 ? 32.345  5.735   63.092 1.00 35.84  ? 267 ASN A N     1 
ATOM   1671 C CA    . ASN A 1 237 ? 32.744  4.332   63.076 1.00 42.45  ? 267 ASN A CA    1 
ATOM   1672 C C     . ASN A 1 237 ? 32.057  3.561   61.950 1.00 44.96  ? 267 ASN A C     1 
ATOM   1673 O O     . ASN A 1 237 ? 32.144  2.336   61.873 1.00 50.97  ? 267 ASN A O     1 
ATOM   1674 C CB    . ASN A 1 237 ? 32.478  3.665   64.430 1.00 41.48  ? 267 ASN A CB    1 
ATOM   1675 C CG    . ASN A 1 237 ? 31.001  3.560   64.748 1.00 54.08  ? 267 ASN A CG    1 
ATOM   1676 O OD1   . ASN A 1 237 ? 30.167  4.236   64.141 1.00 53.83  ? 267 ASN A OD1   1 
ATOM   1677 N ND2   . ASN A 1 237 ? 30.668  2.709   65.707 1.00 68.02  ? 267 ASN A ND2   1 
ATOM   1678 N N     . CYS A 1 238 ? 31.365  4.289   61.081 1.00 42.30  ? 268 CYS A N     1 
ATOM   1679 C CA    . CYS A 1 238 ? 30.826  3.700   59.868 1.00 41.68  ? 268 CYS A CA    1 
ATOM   1680 C C     . CYS A 1 238 ? 31.977  3.201   58.996 1.00 40.07  ? 268 CYS A C     1 
ATOM   1681 O O     . CYS A 1 238 ? 32.997  3.875   58.858 1.00 34.14  ? 268 CYS A O     1 
ATOM   1682 C CB    . CYS A 1 238 ? 30.002  4.729   59.097 1.00 31.99  ? 268 CYS A CB    1 
ATOM   1683 S SG    . CYS A 1 238 ? 29.226  4.063   57.608 1.00 38.79  ? 268 CYS A SG    1 
ATOM   1684 N N     . GLN A 1 239 ? 31.819  2.017   58.417 1.00 28.41  ? 269 GLN A N     1 
ATOM   1685 C CA    . GLN A 1 239 ? 32.848  1.475   57.545 1.00 32.02  ? 269 GLN A CA    1 
ATOM   1686 C C     . GLN A 1 239 ? 32.813  2.157   56.168 1.00 37.81  ? 269 GLN A C     1 
ATOM   1687 O O     . GLN A 1 239 ? 31.812  2.083   55.454 1.00 36.48  ? 269 GLN A O     1 
ATOM   1688 C CB    . GLN A 1 239 ? 32.686  -0.038  57.399 1.00 33.14  ? 269 GLN A CB    1 
ATOM   1689 C CG    . GLN A 1 239 ? 33.667  -0.645  56.413 1.00 43.34  ? 269 GLN A CG    1 
ATOM   1690 C CD    . GLN A 1 239 ? 33.723  -2.152  56.484 1.00 40.33  ? 269 GLN A CD    1 
ATOM   1691 O OE1   . GLN A 1 239 ? 32.724  -2.833  56.266 1.00 49.53  ? 269 GLN A OE1   1 
ATOM   1692 N NE2   . GLN A 1 239 ? 34.901  -2.683  56.780 1.00 31.59  ? 269 GLN A NE2   1 
ATOM   1693 N N     . MET A 1 240 ? 33.905  2.830   55.813 1.00 28.81  ? 270 MET A N     1 
ATOM   1694 C CA    . MET A 1 240 ? 34.011  3.508   54.525 1.00 35.44  ? 270 MET A CA    1 
ATOM   1695 C C     . MET A 1 240 ? 34.804  2.665   53.541 1.00 33.03  ? 270 MET A C     1 
ATOM   1696 O O     . MET A 1 240 ? 35.956  2.317   53.799 1.00 31.00  ? 270 MET A O     1 
ATOM   1697 C CB    . MET A 1 240 ? 34.716  4.854   54.673 1.00 43.77  ? 270 MET A CB    1 
ATOM   1698 C CG    . MET A 1 240 ? 34.501  5.533   56.001 1.00 52.05  ? 270 MET A CG    1 
ATOM   1699 S SD    . MET A 1 240 ? 32.851  6.198   56.175 1.00 63.45  ? 270 MET A SD    1 
ATOM   1700 C CE    . MET A 1 240 ? 32.996  6.962   57.795 1.00 51.66  ? 270 MET A CE    1 
ATOM   1701 N N     . LEU A 1 241 ? 34.187  2.357   52.407 1.00 27.98  ? 271 LEU A N     1 
ATOM   1702 C CA    . LEU A 1 241 ? 34.850  1.604   51.356 1.00 30.80  ? 271 LEU A CA    1 
ATOM   1703 C C     . LEU A 1 241 ? 34.773  2.378   50.047 1.00 28.16  ? 271 LEU A C     1 
ATOM   1704 O O     . LEU A 1 241 ? 33.697  2.810   49.634 1.00 23.84  ? 271 LEU A O     1 
ATOM   1705 C CB    . LEU A 1 241 ? 34.201  0.228   51.207 1.00 24.78  ? 271 LEU A CB    1 
ATOM   1706 C CG    . LEU A 1 241 ? 33.826  -0.408  52.544 1.00 33.07  ? 271 LEU A CG    1 
ATOM   1707 C CD1   . LEU A 1 241 ? 32.810  -1.523  52.355 1.00 46.79  ? 271 LEU A CD1   1 
ATOM   1708 C CD2   . LEU A 1 241 ? 35.057  -0.898  53.299 1.00 21.65  ? 271 LEU A CD2   1 
ATOM   1709 N N     . LEU A 1 242 ? 35.920  2.575   49.409 1.00 23.26  ? 272 LEU A N     1 
ATOM   1710 C CA    . LEU A 1 242 ? 35.957  3.221   48.102 1.00 28.07  ? 272 LEU A CA    1 
ATOM   1711 C C     . LEU A 1 242 ? 36.729  2.359   47.110 1.00 32.54  ? 272 LEU A C     1 
ATOM   1712 O O     . LEU A 1 242 ? 37.844  1.911   47.383 1.00 36.44  ? 272 LEU A O     1 
ATOM   1713 C CB    . LEU A 1 242 ? 36.555  4.632   48.197 1.00 23.58  ? 272 LEU A CB    1 
ATOM   1714 C CG    . LEU A 1 242 ? 36.843  5.376   46.886 1.00 27.30  ? 272 LEU A CG    1 
ATOM   1715 C CD1   . LEU A 1 242 ? 36.833  6.875   47.089 1.00 24.58  ? 272 LEU A CD1   1 
ATOM   1716 C CD2   . LEU A 1 242 ? 38.171  4.938   46.283 1.00 26.85  ? 272 LEU A CD2   1 
ATOM   1717 N N     . PHE A 1 243 ? 36.122  2.129   45.954 1.00 39.92  ? 273 PHE A N     1 
ATOM   1718 C CA    . PHE A 1 243 ? 36.699  1.255   44.949 1.00 34.77  ? 273 PHE A CA    1 
ATOM   1719 C C     . PHE A 1 243 ? 36.933  2.025   43.668 1.00 39.63  ? 273 PHE A C     1 
ATOM   1720 O O     . PHE A 1 243 ? 36.190  2.948   43.336 1.00 38.04  ? 273 PHE A O     1 
ATOM   1721 C CB    . PHE A 1 243 ? 35.776  0.062   44.706 1.00 31.74  ? 273 PHE A CB    1 
ATOM   1722 C CG    . PHE A 1 243 ? 35.639  -0.830  45.897 1.00 39.30  ? 273 PHE A CG    1 
ATOM   1723 C CD1   . PHE A 1 243 ? 34.827  -0.467  46.959 1.00 39.99  ? 273 PHE A CD1   1 
ATOM   1724 C CD2   . PHE A 1 243 ? 36.351  -2.014  45.976 1.00 43.77  ? 273 PHE A CD2   1 
ATOM   1725 C CE1   . PHE A 1 243 ? 34.716  -1.275  48.070 1.00 40.43  ? 273 PHE A CE1   1 
ATOM   1726 C CE2   . PHE A 1 243 ? 36.239  -2.830  47.087 1.00 38.76  ? 273 PHE A CE2   1 
ATOM   1727 C CZ    . PHE A 1 243 ? 35.419  -2.459  48.134 1.00 28.23  ? 273 PHE A CZ    1 
ATOM   1728 N N     . SER A 1 244 ? 37.977  1.647   42.949 1.00 42.05  ? 274 SER A N     1 
ATOM   1729 C CA    . SER A 1 244 ? 38.344  2.369   41.746 1.00 37.42  ? 274 SER A CA    1 
ATOM   1730 C C     . SER A 1 244 ? 39.151  1.473   40.815 1.00 36.65  ? 274 SER A C     1 
ATOM   1731 O O     . SER A 1 244 ? 39.867  0.580   41.261 1.00 41.16  ? 274 SER A O     1 
ATOM   1732 C CB    . SER A 1 244 ? 39.142  3.617   42.122 1.00 44.42  ? 274 SER A CB    1 
ATOM   1733 O OG    . SER A 1 244 ? 39.419  4.417   40.988 1.00 62.44  ? 274 SER A OG    1 
ATOM   1734 N N     . ALA A 1 245 ? 39.024  1.703   39.516 1.00 41.45  ? 275 ALA A N     1 
ATOM   1735 C CA    . ALA A 1 245 ? 39.795  0.941   38.540 1.00 43.80  ? 275 ALA A CA    1 
ATOM   1736 C C     . ALA A 1 245 ? 41.212  1.497   38.414 1.00 48.07  ? 275 ALA A C     1 
ATOM   1737 O O     . ALA A 1 245 ? 42.180  0.745   38.306 1.00 51.35  ? 275 ALA A O     1 
ATOM   1738 C CB    . ALA A 1 245 ? 39.097  0.942   37.195 1.00 24.66  ? 275 ALA A CB    1 
ATOM   1739 N N     . THR A 1 246 ? 41.322  2.821   38.446 1.00 48.56  ? 276 THR A N     1 
ATOM   1740 C CA    . THR A 1 246 ? 42.599  3.498   38.269 1.00 51.17  ? 276 THR A CA    1 
ATOM   1741 C C     . THR A 1 246 ? 42.887  4.462   39.405 1.00 61.04  ? 276 THR A C     1 
ATOM   1742 O O     . THR A 1 246 ? 41.979  4.879   40.130 1.00 50.77  ? 276 THR A O     1 
ATOM   1743 C CB    . THR A 1 246 ? 42.629  4.301   36.960 1.00 48.99  ? 276 THR A CB    1 
ATOM   1744 O OG1   . THR A 1 246 ? 41.794  5.462   37.082 1.00 42.83  ? 276 THR A OG1   1 
ATOM   1745 C CG2   . THR A 1 246 ? 42.141  3.446   35.810 1.00 55.55  ? 276 THR A CG2   1 
ATOM   1746 N N     . PHE A 1 247 ? 44.157  4.822   39.546 1.00 71.71  ? 277 PHE A N     1 
ATOM   1747 C CA    . PHE A 1 247 ? 44.562  5.773   40.569 1.00 81.20  ? 277 PHE A CA    1 
ATOM   1748 C C     . PHE A 1 247 ? 45.242  7.003   40.000 1.00 73.26  ? 277 PHE A C     1 
ATOM   1749 O O     . PHE A 1 247 ? 46.377  7.306   40.359 1.00 63.33  ? 277 PHE A O     1 
ATOM   1750 C CB    . PHE A 1 247 ? 45.488  5.118   41.592 1.00 92.21  ? 277 PHE A CB    1 
ATOM   1751 C CG    . PHE A 1 247 ? 44.791  4.678   42.837 1.00 96.69  ? 277 PHE A CG    1 
ATOM   1752 C CD1   . PHE A 1 247 ? 43.618  5.293   43.238 1.00 105.33 ? 277 PHE A CD1   1 
ATOM   1753 C CD2   . PHE A 1 247 ? 45.317  3.670   43.622 1.00 100.63 ? 277 PHE A CD2   1 
ATOM   1754 C CE1   . PHE A 1 247 ? 42.971  4.896   44.387 1.00 111.41 ? 277 PHE A CE1   1 
ATOM   1755 C CE2   . PHE A 1 247 ? 44.681  3.271   44.774 1.00 109.86 ? 277 PHE A CE2   1 
ATOM   1756 C CZ    . PHE A 1 247 ? 43.503  3.883   45.158 1.00 114.99 ? 277 PHE A CZ    1 
ATOM   1757 N N     . GLU A 1 248 ? 44.555  7.715   39.116 1.00 72.83  ? 278 GLU A N     1 
ATOM   1758 C CA    . GLU A 1 248 ? 45.061  9.007   38.692 1.00 81.21  ? 278 GLU A CA    1 
ATOM   1759 C C     . GLU A 1 248 ? 45.203  9.874   39.934 1.00 78.36  ? 278 GLU A C     1 
ATOM   1760 O O     . GLU A 1 248 ? 44.447  9.720   40.889 1.00 80.99  ? 278 GLU A O     1 
ATOM   1761 C CB    . GLU A 1 248 ? 44.120  9.665   37.689 1.00 92.75  ? 278 GLU A CB    1 
ATOM   1762 C CG    . GLU A 1 248 ? 44.572  11.051  37.263 1.00 106.87 ? 278 GLU A CG    1 
ATOM   1763 C CD    . GLU A 1 248 ? 43.684  11.653  36.198 1.00 115.91 ? 278 GLU A CD    1 
ATOM   1764 O OE1   . GLU A 1 248 ? 42.845  10.915  35.637 1.00 115.14 ? 278 GLU A OE1   1 
ATOM   1765 O OE2   . GLU A 1 248 ? 43.826  12.863  35.921 1.00 119.23 ? 278 GLU A OE2   1 
ATOM   1766 N N     . ASP A 1 249 ? 46.181  10.773  39.929 1.00 79.30  ? 279 ASP A N     1 
ATOM   1767 C CA    . ASP A 1 249 ? 46.396  11.663  41.062 1.00 76.61  ? 279 ASP A CA    1 
ATOM   1768 C C     . ASP A 1 249 ? 45.072  12.213  41.599 1.00 65.83  ? 279 ASP A C     1 
ATOM   1769 O O     . ASP A 1 249 ? 44.891  12.346  42.808 1.00 57.41  ? 279 ASP A O     1 
ATOM   1770 C CB    . ASP A 1 249 ? 47.324  12.813  40.665 1.00 88.43  ? 279 ASP A CB    1 
ATOM   1771 C CG    . ASP A 1 249 ? 47.507  13.824  41.778 1.00 108.47 ? 279 ASP A CG    1 
ATOM   1772 O OD1   . ASP A 1 249 ? 47.287  15.029  41.531 1.00 117.40 ? 279 ASP A OD1   1 
ATOM   1773 O OD2   . ASP A 1 249 ? 47.863  13.414  42.903 1.00 115.36 ? 279 ASP A OD2   1 
ATOM   1774 N N     . SER A 1 250 ? 44.149  12.521  40.694 1.00 67.41  ? 280 SER A N     1 
ATOM   1775 C CA    . SER A 1 250 ? 42.856  13.085  41.073 1.00 68.65  ? 280 SER A CA    1 
ATOM   1776 C C     . SER A 1 250 ? 41.999  12.099  41.868 1.00 61.80  ? 280 SER A C     1 
ATOM   1777 O O     . SER A 1 250 ? 41.319  12.481  42.824 1.00 52.41  ? 280 SER A O     1 
ATOM   1778 C CB    . SER A 1 250 ? 42.102  13.566  39.832 1.00 68.42  ? 280 SER A CB    1 
ATOM   1779 O OG    . SER A 1 250 ? 42.126  12.582  38.815 1.00 73.50  ? 280 SER A OG    1 
ATOM   1780 N N     . VAL A 1 251 ? 42.035  10.833  41.467 1.00 57.20  ? 281 VAL A N     1 
ATOM   1781 C CA    . VAL A 1 251 ? 41.290  9.791   42.158 1.00 59.79  ? 281 VAL A CA    1 
ATOM   1782 C C     . VAL A 1 251 ? 41.835  9.617   43.571 1.00 57.81  ? 281 VAL A C     1 
ATOM   1783 O O     . VAL A 1 251 ? 41.082  9.466   44.533 1.00 44.84  ? 281 VAL A O     1 
ATOM   1784 C CB    . VAL A 1 251 ? 41.402  8.449   41.418 1.00 66.62  ? 281 VAL A CB    1 
ATOM   1785 C CG1   . VAL A 1 251 ? 40.382  7.465   41.954 1.00 68.25  ? 281 VAL A CG1   1 
ATOM   1786 C CG2   . VAL A 1 251 ? 41.213  8.653   39.924 1.00 73.34  ? 281 VAL A CG2   1 
ATOM   1787 N N     . TRP A 1 252 ? 43.158  9.650   43.679 1.00 54.16  ? 282 TRP A N     1 
ATOM   1788 C CA    . TRP A 1 252 ? 43.850  9.437   44.942 1.00 49.75  ? 282 TRP A CA    1 
ATOM   1789 C C     . TRP A 1 252 ? 43.563  10.538  45.968 1.00 56.29  ? 282 TRP A C     1 
ATOM   1790 O O     . TRP A 1 252 ? 43.262  10.261  47.129 1.00 39.37  ? 282 TRP A O     1 
ATOM   1791 C CB    . TRP A 1 252 ? 45.360  9.319   44.691 1.00 47.96  ? 282 TRP A CB    1 
ATOM   1792 C CG    . TRP A 1 252 ? 46.161  9.069   45.924 1.00 49.56  ? 282 TRP A CG    1 
ATOM   1793 C CD1   . TRP A 1 252 ? 47.242  9.777   46.354 1.00 58.09  ? 282 TRP A CD1   1 
ATOM   1794 C CD2   . TRP A 1 252 ? 45.934  8.049   46.901 1.00 59.57  ? 282 TRP A CD2   1 
ATOM   1795 N NE1   . TRP A 1 252 ? 47.710  9.257   47.535 1.00 61.27  ? 282 TRP A NE1   1 
ATOM   1796 C CE2   . TRP A 1 252 ? 46.921  8.191   47.895 1.00 67.54  ? 282 TRP A CE2   1 
ATOM   1797 C CE3   . TRP A 1 252 ? 44.992  7.022   47.035 1.00 57.11  ? 282 TRP A CE3   1 
ATOM   1798 C CZ2   . TRP A 1 252 ? 46.995  7.352   49.006 1.00 72.30  ? 282 TRP A CZ2   1 
ATOM   1799 C CZ3   . TRP A 1 252 ? 45.066  6.187   48.139 1.00 60.22  ? 282 TRP A CZ3   1 
ATOM   1800 C CH2   . TRP A 1 252 ? 46.059  6.358   49.109 1.00 66.49  ? 282 TRP A CH2   1 
ATOM   1801 N N     . LYS A 1 253 ? 43.664  11.790  45.541 1.00 65.99  ? 283 LYS A N     1 
ATOM   1802 C CA    . LYS A 1 253 ? 43.475  12.903  46.461 1.00 69.90  ? 283 LYS A CA    1 
ATOM   1803 C C     . LYS A 1 253 ? 42.022  13.014  46.911 1.00 61.03  ? 283 LYS A C     1 
ATOM   1804 O O     . LYS A 1 253 ? 41.730  13.567  47.967 1.00 58.60  ? 283 LYS A O     1 
ATOM   1805 C CB    . LYS A 1 253 ? 43.964  14.212  45.834 1.00 83.47  ? 283 LYS A CB    1 
ATOM   1806 C CG    . LYS A 1 253 ? 45.461  14.225  45.554 1.00 93.22  ? 283 LYS A CG    1 
ATOM   1807 C CD    . LYS A 1 253 ? 46.245  13.776  46.780 1.00 102.64 ? 283 LYS A CD    1 
ATOM   1808 C CE    . LYS A 1 253 ? 47.719  13.563  46.466 1.00 107.03 ? 283 LYS A CE    1 
ATOM   1809 N NZ    . LYS A 1 253 ? 48.465  13.036  47.645 1.00 102.65 ? 283 LYS A NZ    1 
ATOM   1810 N N     . PHE A 1 254 ? 41.115  12.475  46.104 1.00 58.14  ? 284 PHE A N     1 
ATOM   1811 C CA    . PHE A 1 254 ? 39.701  12.454  46.448 1.00 42.80  ? 284 PHE A CA    1 
ATOM   1812 C C     . PHE A 1 254 ? 39.426  11.355  47.472 1.00 51.15  ? 284 PHE A C     1 
ATOM   1813 O O     . PHE A 1 254 ? 38.736  11.577  48.466 1.00 56.87  ? 284 PHE A O     1 
ATOM   1814 C CB    . PHE A 1 254 ? 38.859  12.260  45.185 1.00 35.91  ? 284 PHE A CB    1 
ATOM   1815 C CG    . PHE A 1 254 ? 37.424  11.901  45.451 1.00 44.97  ? 284 PHE A CG    1 
ATOM   1816 C CD1   . PHE A 1 254 ? 36.933  10.653  45.098 1.00 45.76  ? 284 PHE A CD1   1 
ATOM   1817 C CD2   . PHE A 1 254 ? 36.564  12.810  46.046 1.00 47.93  ? 284 PHE A CD2   1 
ATOM   1818 C CE1   . PHE A 1 254 ? 35.611  10.314  45.338 1.00 42.89  ? 284 PHE A CE1   1 
ATOM   1819 C CE2   . PHE A 1 254 ? 35.240  12.479  46.288 1.00 48.94  ? 284 PHE A CE2   1 
ATOM   1820 C CZ    . PHE A 1 254 ? 34.762  11.228  45.935 1.00 41.61  ? 284 PHE A CZ    1 
ATOM   1821 N N     . ALA A 1 255 ? 39.985  10.175  47.229 1.00 49.09  ? 285 ALA A N     1 
ATOM   1822 C CA    . ALA A 1 255 ? 39.822  9.044   48.134 1.00 39.57  ? 285 ALA A CA    1 
ATOM   1823 C C     . ALA A 1 255 ? 40.269  9.409   49.538 1.00 47.54  ? 285 ALA A C     1 
ATOM   1824 O O     . ALA A 1 255 ? 39.626  9.045   50.519 1.00 63.77  ? 285 ALA A O     1 
ATOM   1825 C CB    . ALA A 1 255 ? 40.601  7.834   47.626 1.00 35.57  ? 285 ALA A CB    1 
ATOM   1826 N N     . GLN A 1 256 ? 41.379  10.130  49.627 1.00 53.50  ? 286 GLN A N     1 
ATOM   1827 C CA    . GLN A 1 256 ? 41.928  10.539  50.914 1.00 46.45  ? 286 GLN A CA    1 
ATOM   1828 C C     . GLN A 1 256 ? 40.973  11.445  51.685 1.00 50.72  ? 286 GLN A C     1 
ATOM   1829 O O     . GLN A 1 256 ? 41.046  11.527  52.909 1.00 59.53  ? 286 GLN A O     1 
ATOM   1830 C CB    . GLN A 1 256 ? 43.263  11.252  50.718 1.00 39.59  ? 286 GLN A CB    1 
ATOM   1831 C CG    . GLN A 1 256 ? 44.394  10.345  50.286 1.00 52.26  ? 286 GLN A CG    1 
ATOM   1832 C CD    . GLN A 1 256 ? 45.719  11.080  50.213 1.00 74.66  ? 286 GLN A CD    1 
ATOM   1833 O OE1   . GLN A 1 256 ? 45.999  11.786  49.241 1.00 79.11  ? 286 GLN A OE1   1 
ATOM   1834 N NE2   . GLN A 1 256 ? 46.544  10.920  51.246 1.00 75.21  ? 286 GLN A NE2   1 
ATOM   1835 N N     . LYS A 1 257 ? 40.082  12.121  50.966 1.00 48.02  ? 287 LYS A N     1 
ATOM   1836 C CA    . LYS A 1 257 ? 39.124  13.031  51.593 1.00 51.52  ? 287 LYS A CA    1 
ATOM   1837 C C     . LYS A 1 257 ? 37.821  12.335  51.989 1.00 48.96  ? 287 LYS A C     1 
ATOM   1838 O O     . LYS A 1 257 ? 37.042  12.868  52.776 1.00 59.72  ? 287 LYS A O     1 
ATOM   1839 C CB    . LYS A 1 257 ? 38.827  14.221  50.675 1.00 48.22  ? 287 LYS A CB    1 
ATOM   1840 C CG    . LYS A 1 257 ? 40.026  15.124  50.418 1.00 57.10  ? 287 LYS A CG    1 
ATOM   1841 C CD    . LYS A 1 257 ? 39.914  15.858  49.082 1.00 70.22  ? 287 LYS A CD    1 
ATOM   1842 C CE    . LYS A 1 257 ? 38.734  16.816  49.047 1.00 74.18  ? 287 LYS A CE    1 
ATOM   1843 N NZ    . LYS A 1 257 ? 38.845  17.890  50.073 1.00 78.77  ? 287 LYS A NZ    1 
ATOM   1844 N N     . VAL A 1 258 ? 37.592  11.143  51.448 1.00 45.24  ? 288 VAL A N     1 
ATOM   1845 C CA    . VAL A 1 258 ? 36.356  10.408  51.697 1.00 48.55  ? 288 VAL A CA    1 
ATOM   1846 C C     . VAL A 1 258 ? 36.548  9.249   52.671 1.00 53.24  ? 288 VAL A C     1 
ATOM   1847 O O     . VAL A 1 258 ? 35.656  8.933   53.456 1.00 54.88  ? 288 VAL A O     1 
ATOM   1848 C CB    . VAL A 1 258 ? 35.772  9.842   50.385 1.00 53.73  ? 288 VAL A CB    1 
ATOM   1849 C CG1   . VAL A 1 258 ? 34.439  9.145   50.645 1.00 50.51  ? 288 VAL A CG1   1 
ATOM   1850 C CG2   . VAL A 1 258 ? 35.608  10.944  49.364 1.00 57.60  ? 288 VAL A CG2   1 
ATOM   1851 N N     . VAL A 1 259 ? 37.714  8.617   52.615 1.00 58.51  ? 289 VAL A N     1 
ATOM   1852 C CA    . VAL A 1 259 ? 37.969  7.413   53.398 1.00 54.61  ? 289 VAL A CA    1 
ATOM   1853 C C     . VAL A 1 259 ? 39.131  7.600   54.378 1.00 57.51  ? 289 VAL A C     1 
ATOM   1854 O O     . VAL A 1 259 ? 40.292  7.391   54.027 1.00 60.83  ? 289 VAL A O     1 
ATOM   1855 C CB    . VAL A 1 259 ? 38.235  6.211   52.473 1.00 40.08  ? 289 VAL A CB    1 
ATOM   1856 C CG1   . VAL A 1 259 ? 38.405  4.938   53.278 1.00 48.57  ? 289 VAL A CG1   1 
ATOM   1857 C CG2   . VAL A 1 259 ? 37.094  6.062   51.485 1.00 35.60  ? 289 VAL A CG2   1 
ATOM   1858 N N     . PRO A 1 260 ? 38.813  7.998   55.616 1.00 51.87  ? 290 PRO A N     1 
ATOM   1859 C CA    . PRO A 1 260 ? 39.809  8.268   56.659 1.00 54.69  ? 290 PRO A CA    1 
ATOM   1860 C C     . PRO A 1 260 ? 40.381  6.980   57.249 1.00 54.97  ? 290 PRO A C     1 
ATOM   1861 O O     . PRO A 1 260 ? 39.647  6.011   57.416 1.00 57.46  ? 290 PRO A O     1 
ATOM   1862 C CB    . PRO A 1 260 ? 39.003  9.020   57.728 1.00 58.31  ? 290 PRO A CB    1 
ATOM   1863 C CG    . PRO A 1 260 ? 37.680  9.362   57.084 1.00 58.05  ? 290 PRO A CG    1 
ATOM   1864 C CD    . PRO A 1 260 ? 37.449  8.298   56.072 1.00 50.76  ? 290 PRO A CD    1 
ATOM   1865 N N     . ASP A 1 261 ? 41.675  6.976   57.559 1.00 59.82  ? 291 ASP A N     1 
ATOM   1866 C CA    . ASP A 1 261 ? 42.335  5.806   58.138 1.00 69.21  ? 291 ASP A CA    1 
ATOM   1867 C C     . ASP A 1 261 ? 42.164  4.569   57.260 1.00 55.20  ? 291 ASP A C     1 
ATOM   1868 O O     . ASP A 1 261 ? 41.616  3.559   57.697 1.00 56.44  ? 291 ASP A O     1 
ATOM   1869 C CB    . ASP A 1 261 ? 41.802  5.529   59.548 1.00 89.65  ? 291 ASP A CB    1 
ATOM   1870 C CG    . ASP A 1 261 ? 42.005  6.703   60.492 1.00 113.74 ? 291 ASP A CG    1 
ATOM   1871 O OD1   . ASP A 1 261 ? 43.077  7.342   60.429 1.00 121.05 ? 291 ASP A OD1   1 
ATOM   1872 O OD2   . ASP A 1 261 ? 41.093  6.984   61.301 1.00 122.91 ? 291 ASP A OD2   1 
ATOM   1873 N N     . PRO A 1 262 ? 42.653  4.637   56.016 1.00 47.83  ? 292 PRO A N     1 
ATOM   1874 C CA    . PRO A 1 262 ? 42.365  3.586   55.044 1.00 43.77  ? 292 PRO A CA    1 
ATOM   1875 C C     . PRO A 1 262 ? 43.449  2.527   54.944 1.00 37.68  ? 292 PRO A C     1 
ATOM   1876 O O     . PRO A 1 262 ? 44.626  2.851   54.861 1.00 39.44  ? 292 PRO A O     1 
ATOM   1877 C CB    . PRO A 1 262 ? 42.325  4.353   53.717 1.00 34.99  ? 292 PRO A CB    1 
ATOM   1878 C CG    . PRO A 1 262 ? 42.853  5.760   54.024 1.00 38.78  ? 292 PRO A CG    1 
ATOM   1879 C CD    . PRO A 1 262 ? 43.417  5.729   55.399 1.00 44.87  ? 292 PRO A CD    1 
ATOM   1880 N N     . ASN A 1 263 ? 43.039  1.267   54.956 1.00 32.43  ? 293 ASN A N     1 
ATOM   1881 C CA    . ASN A 1 263 ? 43.841  0.218   54.363 1.00 38.72  ? 293 ASN A CA    1 
ATOM   1882 C C     . ASN A 1 263 ? 43.762  0.422   52.850 1.00 36.46  ? 293 ASN A C     1 
ATOM   1883 O O     . ASN A 1 263 ? 42.716  0.790   52.325 1.00 42.59  ? 293 ASN A O     1 
ATOM   1884 C CB    . ASN A 1 263 ? 43.291  -1.153  54.743 1.00 34.06  ? 293 ASN A CB    1 
ATOM   1885 C CG    . ASN A 1 263 ? 43.282  -1.379  56.240 1.00 49.51  ? 293 ASN A CG    1 
ATOM   1886 O OD1   . ASN A 1 263 ? 44.330  -1.540  56.863 1.00 55.00  ? 293 ASN A OD1   1 
ATOM   1887 N ND2   . ASN A 1 263 ? 42.094  -1.395  56.825 1.00 45.33  ? 293 ASN A ND2   1 
ATOM   1888 N N     . VAL A 1 264 ? 44.866  0.208   52.152 1.00 34.57  ? 294 VAL A N     1 
ATOM   1889 C CA    . VAL A 1 264 ? 44.897  0.426   50.713 1.00 37.71  ? 294 VAL A CA    1 
ATOM   1890 C C     . VAL A 1 264 ? 45.293  -0.839  49.968 1.00 38.28  ? 294 VAL A C     1 
ATOM   1891 O O     . VAL A 1 264 ? 46.383  -1.362  50.157 1.00 50.44  ? 294 VAL A O     1 
ATOM   1892 C CB    . VAL A 1 264 ? 45.888  1.542   50.344 1.00 40.61  ? 294 VAL A CB    1 
ATOM   1893 C CG1   . VAL A 1 264 ? 45.953  1.705   48.849 1.00 35.78  ? 294 VAL A CG1   1 
ATOM   1894 C CG2   . VAL A 1 264 ? 45.485  2.850   51.013 1.00 40.70  ? 294 VAL A CG2   1 
ATOM   1895 N N     . ILE A 1 265 ? 44.395  -1.330  49.127 1.00 45.72  ? 295 ILE A N     1 
ATOM   1896 C CA    . ILE A 1 265 ? 44.693  -2.448  48.239 1.00 42.34  ? 295 ILE A CA    1 
ATOM   1897 C C     . ILE A 1 265 ? 44.920  -1.928  46.815 1.00 38.33  ? 295 ILE A C     1 
ATOM   1898 O O     . ILE A 1 265 ? 44.113  -1.162  46.291 1.00 39.24  ? 295 ILE A O     1 
ATOM   1899 C CB    . ILE A 1 265 ? 43.535  -3.465  48.213 1.00 39.09  ? 295 ILE A CB    1 
ATOM   1900 C CG1   . ILE A 1 265 ? 43.318  -4.061  49.595 1.00 58.19  ? 295 ILE A CG1   1 
ATOM   1901 C CG2   . ILE A 1 265 ? 43.835  -4.578  47.250 1.00 54.08  ? 295 ILE A CG2   1 
ATOM   1902 C CD1   . ILE A 1 265 ? 44.305  -5.144  49.934 1.00 71.48  ? 295 ILE A CD1   1 
ATOM   1903 N N     . LYS A 1 266 ? 46.022  -2.334  46.196 1.00 34.84  ? 296 LYS A N     1 
ATOM   1904 C CA    . LYS A 1 266 ? 46.301  -1.983  44.799 1.00 42.46  ? 296 LYS A CA    1 
ATOM   1905 C C     . LYS A 1 266 ? 46.627  -3.234  43.987 1.00 39.47  ? 296 LYS A C     1 
ATOM   1906 O O     . LYS A 1 266 ? 47.457  -4.039  44.389 1.00 37.52  ? 296 LYS A O     1 
ATOM   1907 C CB    . LYS A 1 266 ? 47.485  -1.014  44.695 1.00 42.78  ? 296 LYS A CB    1 
ATOM   1908 C CG    . LYS A 1 266 ? 47.251  0.412   45.187 1.00 45.85  ? 296 LYS A CG    1 
ATOM   1909 C CD    . LYS A 1 266 ? 48.605  1.093   45.436 1.00 65.90  ? 296 LYS A CD    1 
ATOM   1910 C CE    . LYS A 1 266 ? 48.481  2.576   45.776 1.00 74.02  ? 296 LYS A CE    1 
ATOM   1911 N NZ    . LYS A 1 266 ? 48.680  3.463   44.593 1.00 74.33  ? 296 LYS A NZ    1 
ATOM   1912 N N     . LEU A 1 267 ? 45.976  -3.399  42.841 1.00 40.29  ? 297 LEU A N     1 
ATOM   1913 C CA    . LEU A 1 267 ? 46.354  -4.459  41.910 1.00 30.86  ? 297 LEU A CA    1 
ATOM   1914 C C     . LEU A 1 267 ? 46.701  -3.851  40.560 1.00 34.47  ? 297 LEU A C     1 
ATOM   1915 O O     . LEU A 1 267 ? 45.880  -3.178  39.937 1.00 49.35  ? 297 LEU A O     1 
ATOM   1916 C CB    . LEU A 1 267 ? 45.248  -5.505  41.767 1.00 35.23  ? 297 LEU A CB    1 
ATOM   1917 C CG    . LEU A 1 267 ? 45.514  -6.642  40.773 1.00 43.88  ? 297 LEU A CG    1 
ATOM   1918 C CD1   . LEU A 1 267 ? 46.773  -7.428  41.128 1.00 37.32  ? 297 LEU A CD1   1 
ATOM   1919 C CD2   . LEU A 1 267 ? 44.312  -7.575  40.667 1.00 41.84  ? 297 LEU A CD2   1 
ATOM   1920 N N     . LYS A 1 268 ? 47.933  -4.077  40.121 1.00 47.51  ? 298 LYS A N     1 
ATOM   1921 C CA    . LYS A 1 268 ? 48.420  -3.505  38.871 1.00 49.30  ? 298 LYS A CA    1 
ATOM   1922 C C     . LYS A 1 268 ? 47.719  -4.124  37.667 1.00 46.04  ? 298 LYS A C     1 
ATOM   1923 O O     . LYS A 1 268 ? 47.590  -5.347  37.564 1.00 42.53  ? 298 LYS A O     1 
ATOM   1924 C CB    . LYS A 1 268 ? 49.933  -3.683  38.755 1.00 50.90  ? 298 LYS A CB    1 
ATOM   1925 C CG    . LYS A 1 268 ? 50.567  -2.924  37.611 1.00 56.46  ? 298 LYS A CG    1 
ATOM   1926 C CD    . LYS A 1 268 ? 52.073  -3.096  37.627 1.00 64.50  ? 298 LYS A CD    1 
ATOM   1927 C CE    . LYS A 1 268 ? 52.698  -2.704  36.300 1.00 62.45  ? 298 LYS A CE    1 
ATOM   1928 N NZ    . LYS A 1 268 ? 54.169  -2.914  36.330 1.00 61.70  ? 298 LYS A NZ    1 
ATOM   1929 N N     . ARG A 1 269 ? 47.256  -3.265  36.767 1.00 44.39  ? 299 ARG A N     1 
ATOM   1930 C CA    . ARG A 1 269 ? 46.571  -3.715  35.564 1.00 50.80  ? 299 ARG A CA    1 
ATOM   1931 C C     . ARG A 1 269 ? 47.463  -4.646  34.750 1.00 49.71  ? 299 ARG A C     1 
ATOM   1932 O O     . ARG A 1 269 ? 48.661  -4.403  34.613 1.00 42.32  ? 299 ARG A O     1 
ATOM   1933 C CB    . ARG A 1 269 ? 46.163  -2.512  34.714 1.00 54.98  ? 299 ARG A CB    1 
ATOM   1934 C CG    . ARG A 1 269 ? 45.404  -2.877  33.463 1.00 58.88  ? 299 ARG A CG    1 
ATOM   1935 C CD    . ARG A 1 269 ? 44.626  -1.692  32.921 1.00 64.50  ? 299 ARG A CD    1 
ATOM   1936 N NE    . ARG A 1 269 ? 43.554  -2.128  32.031 1.00 67.79  ? 299 ARG A NE    1 
ATOM   1937 C CZ    . ARG A 1 269 ? 43.734  -2.478  30.762 1.00 69.75  ? 299 ARG A CZ    1 
ATOM   1938 N NH1   . ARG A 1 269 ? 44.948  -2.442  30.231 1.00 70.03  ? 299 ARG A NH1   1 
ATOM   1939 N NH2   . ARG A 1 269 ? 42.702  -2.865  30.025 1.00 77.28  ? 299 ARG A NH2   1 
ATOM   1940 N N     . GLU A 1 270 ? 46.882  -5.720  34.224 1.00 57.57  ? 300 GLU A N     1 
ATOM   1941 C CA    . GLU A 1 270 ? 47.635  -6.641  33.378 1.00 68.01  ? 300 GLU A CA    1 
ATOM   1942 C C     . GLU A 1 270 ? 48.323  -5.919  32.219 1.00 68.27  ? 300 GLU A C     1 
ATOM   1943 O O     . GLU A 1 270 ? 47.743  -5.027  31.595 1.00 64.69  ? 300 GLU A O     1 
ATOM   1944 C CB    . GLU A 1 270 ? 46.741  -7.767  32.859 1.00 73.61  ? 300 GLU A CB    1 
ATOM   1945 C CG    . GLU A 1 270 ? 46.758  -9.012  33.726 1.00 84.13  ? 300 GLU A CG    1 
ATOM   1946 C CD    . GLU A 1 270 ? 48.097  -9.727  33.687 1.00 102.22 ? 300 GLU A CD    1 
ATOM   1947 O OE1   . GLU A 1 270 ? 48.981  -9.301  32.913 1.00 113.19 ? 300 GLU A OE1   1 
ATOM   1948 O OE2   . GLU A 1 270 ? 48.267  -10.717 34.428 1.00 102.37 ? 300 GLU A OE2   1 
ATOM   1949 N N     . GLU A 1 271 ? 49.566  -6.311  31.952 1.00 69.83  ? 301 GLU A N     1 
ATOM   1950 C CA    . GLU A 1 271 ? 50.382  -5.678  30.927 1.00 69.31  ? 301 GLU A CA    1 
ATOM   1951 C C     . GLU A 1 271 ? 50.182  -6.342  29.565 1.00 74.52  ? 301 GLU A C     1 
ATOM   1952 O O     . GLU A 1 271 ? 50.527  -7.512  29.378 1.00 67.59  ? 301 GLU A O     1 
ATOM   1953 C CB    . GLU A 1 271 ? 51.858  -5.736  31.325 1.00 86.07  ? 301 GLU A CB    1 
ATOM   1954 C CG    . GLU A 1 271 ? 52.816  -5.373  30.196 1.00 104.19 ? 301 GLU A CG    1 
ATOM   1955 C CD    . GLU A 1 271 ? 54.261  -5.716  30.513 1.00 114.06 ? 301 GLU A CD    1 
ATOM   1956 O OE1   . GLU A 1 271 ? 55.145  -5.379  29.696 1.00 109.19 ? 301 GLU A OE1   1 
ATOM   1957 O OE2   . GLU A 1 271 ? 54.513  -6.323  31.576 1.00 121.65 ? 301 GLU A OE2   1 
ATOM   1958 N N     . GLU A 1 272 ? 49.622  -5.590  28.621 1.00 80.18  ? 302 GLU A N     1 
ATOM   1959 C CA    . GLU A 1 272 ? 49.388  -6.093  27.269 1.00 84.39  ? 302 GLU A CA    1 
ATOM   1960 C C     . GLU A 1 272 ? 50.718  -6.348  26.561 1.00 83.08  ? 302 GLU A C     1 
ATOM   1961 O O     . GLU A 1 272 ? 51.708  -5.655  26.811 1.00 69.84  ? 302 GLU A O     1 
ATOM   1962 C CB    . GLU A 1 272 ? 48.546  -5.098  26.467 1.00 91.96  ? 302 GLU A CB    1 
ATOM   1963 C CG    . GLU A 1 272 ? 47.319  -4.563  27.206 1.00 104.24 ? 302 GLU A CG    1 
ATOM   1964 C CD    . GLU A 1 272 ? 46.094  -5.447  27.045 1.00 107.95 ? 302 GLU A CD    1 
ATOM   1965 O OE1   . GLU A 1 272 ? 44.973  -4.972  27.333 1.00 102.66 ? 302 GLU A OE1   1 
ATOM   1966 O OE2   . GLU A 1 272 ? 46.250  -6.613  26.623 1.00 110.61 ? 302 GLU A OE2   1 
ATOM   1967 N N     . THR A 1 273 ? 50.743  -7.336  25.673 1.00 91.61  ? 303 THR A N     1 
ATOM   1968 C CA    . THR A 1 273 ? 51.999  -7.738  25.042 1.00 93.34  ? 303 THR A CA    1 
ATOM   1969 C C     . THR A 1 273 ? 51.914  -7.933  23.522 1.00 88.92  ? 303 THR A C     1 
ATOM   1970 O O     . THR A 1 273 ? 51.111  -8.725  23.022 1.00 80.50  ? 303 THR A O     1 
ATOM   1971 C CB    . THR A 1 273 ? 52.570  -9.008  25.709 1.00 86.49  ? 303 THR A CB    1 
ATOM   1972 O OG1   . THR A 1 273 ? 53.656  -9.514  24.926 1.00 84.75  ? 303 THR A OG1   1 
ATOM   1973 C CG2   . THR A 1 273 ? 51.492  -10.078 25.842 1.00 81.10  ? 303 THR A CG2   1 
ATOM   1974 N N     . LEU A 1 274 ? 52.762  -7.208  22.797 1.00 91.59  ? 304 LEU A N     1 
ATOM   1975 C CA    . LEU A 1 274 ? 52.803  -7.286  21.338 1.00 89.70  ? 304 LEU A CA    1 
ATOM   1976 C C     . LEU A 1 274 ? 53.760  -8.365  20.836 1.00 93.33  ? 304 LEU A C     1 
ATOM   1977 O O     . LEU A 1 274 ? 54.088  -8.408  19.652 1.00 92.02  ? 304 LEU A O     1 
ATOM   1978 C CB    . LEU A 1 274 ? 53.207  -5.936  20.742 1.00 81.21  ? 304 LEU A CB    1 
ATOM   1979 C CG    . LEU A 1 274 ? 52.190  -4.794  20.793 1.00 80.30  ? 304 LEU A CG    1 
ATOM   1980 C CD1   . LEU A 1 274 ? 52.799  -3.509  20.248 1.00 73.52  ? 304 LEU A CD1   1 
ATOM   1981 C CD2   . LEU A 1 274 ? 50.930  -5.160  20.026 1.00 76.72  ? 304 LEU A CD2   1 
ATOM   1982 N N     . ASP A 1 275 ? 54.203  -9.236  21.736 1.00 98.22  ? 305 ASP A N     1 
ATOM   1983 C CA    . ASP A 1 275 ? 55.214  -10.234 21.395 1.00 102.89 ? 305 ASP A CA    1 
ATOM   1984 C C     . ASP A 1 275 ? 54.708  -11.285 20.410 1.00 96.23  ? 305 ASP A C     1 
ATOM   1985 O O     . ASP A 1 275 ? 55.471  -11.813 19.604 1.00 97.78  ? 305 ASP A O     1 
ATOM   1986 C CB    . ASP A 1 275 ? 55.734  -10.917 22.661 1.00 116.42 ? 305 ASP A CB    1 
ATOM   1987 C CG    . ASP A 1 275 ? 56.496  -9.965  23.566 1.00 122.32 ? 305 ASP A CG    1 
ATOM   1988 O OD1   . ASP A 1 275 ? 56.936  -8.902  23.076 1.00 127.66 ? 305 ASP A OD1   1 
ATOM   1989 O OD2   . ASP A 1 275 ? 56.658  -10.283 24.764 1.00 114.67 ? 305 ASP A OD2   1 
ATOM   1990 N N     . THR A 1 276 ? 53.417  -11.578 20.476 1.00 91.36  ? 306 THR A N     1 
ATOM   1991 C CA    . THR A 1 276 ? 52.835  -12.653 19.684 1.00 88.05  ? 306 THR A CA    1 
ATOM   1992 C C     . THR A 1 276 ? 51.969  -12.112 18.535 1.00 82.33  ? 306 THR A C     1 
ATOM   1993 O O     . THR A 1 276 ? 51.109  -12.817 17.998 1.00 78.85  ? 306 THR A O     1 
ATOM   1994 C CB    . THR A 1 276 ? 52.005  -13.580 20.594 1.00 85.54  ? 306 THR A CB    1 
ATOM   1995 O OG1   . THR A 1 276 ? 51.487  -14.680 19.835 1.00 96.30  ? 306 THR A OG1   1 
ATOM   1996 C CG2   . THR A 1 276 ? 50.862  -12.802 21.247 1.00 68.92  ? 306 THR A CG2   1 
ATOM   1997 N N     . ILE A 1 277 ? 52.214  -10.863 18.151 1.00 67.27  ? 307 ILE A N     1 
ATOM   1998 C CA    . ILE A 1 277 ? 51.374  -10.187 17.168 1.00 58.99  ? 307 ILE A CA    1 
ATOM   1999 C C     . ILE A 1 277 ? 52.139  -9.729  15.933 1.00 59.49  ? 307 ILE A C     1 
ATOM   2000 O O     . ILE A 1 277 ? 53.238  -9.181  16.042 1.00 57.68  ? 307 ILE A O     1 
ATOM   2001 C CB    . ILE A 1 277 ? 50.701  -8.951  17.780 1.00 51.63  ? 307 ILE A CB    1 
ATOM   2002 C CG1   . ILE A 1 277 ? 49.846  -9.355  18.979 1.00 49.08  ? 307 ILE A CG1   1 
ATOM   2003 C CG2   . ILE A 1 277 ? 49.874  -8.222  16.724 1.00 41.26  ? 307 ILE A CG2   1 
ATOM   2004 C CD1   . ILE A 1 277 ? 49.345  -8.184  19.778 1.00 52.15  ? 307 ILE A CD1   1 
ATOM   2005 N N     . LYS A 1 278 ? 51.542  -9.942  14.763 1.00 58.52  ? 308 LYS A N     1 
ATOM   2006 C CA    . LYS A 1 278 ? 52.129  -9.486  13.508 1.00 55.67  ? 308 LYS A CA    1 
ATOM   2007 C C     . LYS A 1 278 ? 51.566  -8.128  13.093 1.00 48.01  ? 308 LYS A C     1 
ATOM   2008 O O     . LYS A 1 278 ? 50.355  -7.968  12.919 1.00 38.12  ? 308 LYS A O     1 
ATOM   2009 C CB    . LYS A 1 278 ? 51.925  -10.520 12.402 1.00 59.59  ? 308 LYS A CB    1 
ATOM   2010 C CG    . LYS A 1 278 ? 52.880  -11.697 12.491 1.00 76.74  ? 308 LYS A CG    1 
ATOM   2011 C CD    . LYS A 1 278 ? 53.103  -12.345 11.132 1.00 93.51  ? 308 LYS A CD    1 
ATOM   2012 C CE    . LYS A 1 278 ? 51.979  -13.302 10.770 1.00 100.87 ? 308 LYS A CE    1 
ATOM   2013 N NZ    . LYS A 1 278 ? 52.007  -14.527 11.619 1.00 103.33 ? 308 LYS A NZ    1 
ATOM   2014 N N     . GLN A 1 279 ? 52.459  -7.153  12.946 1.00 38.73  ? 309 GLN A N     1 
ATOM   2015 C CA    . GLN A 1 279 ? 52.070  -5.793  12.608 1.00 38.87  ? 309 GLN A CA    1 
ATOM   2016 C C     . GLN A 1 279 ? 52.450  -5.425  11.181 1.00 44.63  ? 309 GLN A C     1 
ATOM   2017 O O     . GLN A 1 279 ? 53.622  -5.462  10.808 1.00 44.33  ? 309 GLN A O     1 
ATOM   2018 C CB    . GLN A 1 279 ? 52.724  -4.799  13.562 1.00 30.44  ? 309 GLN A CB    1 
ATOM   2019 C CG    . GLN A 1 279 ? 52.299  -4.933  15.003 1.00 38.66  ? 309 GLN A CG    1 
ATOM   2020 C CD    . GLN A 1 279 ? 53.053  -3.970  15.899 1.00 51.04  ? 309 GLN A CD    1 
ATOM   2021 O OE1   . GLN A 1 279 ? 52.932  -2.753  15.766 1.00 50.83  ? 309 GLN A OE1   1 
ATOM   2022 N NE2   . GLN A 1 279 ? 53.848  -4.514  16.811 1.00 65.65  ? 309 GLN A NE2   1 
ATOM   2023 N N     . TYR A 1 280 ? 51.451  -5.050  10.395 1.00 41.68  ? 310 TYR A N     1 
ATOM   2024 C CA    . TYR A 1 280 ? 51.673  -4.614  9.028  1.00 32.10  ? 310 TYR A CA    1 
ATOM   2025 C C     . TYR A 1 280 ? 51.123  -3.219  8.844  1.00 29.52  ? 310 TYR A C     1 
ATOM   2026 O O     . TYR A 1 280 ? 50.335  -2.741  9.648  1.00 42.38  ? 310 TYR A O     1 
ATOM   2027 C CB    . TYR A 1 280 ? 50.951  -5.537  8.054  1.00 27.38  ? 310 TYR A CB    1 
ATOM   2028 C CG    . TYR A 1 280 ? 51.416  -6.967  8.078  1.00 40.91  ? 310 TYR A CG    1 
ATOM   2029 C CD1   . TYR A 1 280 ? 52.527  -7.367  7.346  1.00 44.29  ? 310 TYR A CD1   1 
ATOM   2030 C CD2   . TYR A 1 280 ? 50.735  -7.925  8.815  1.00 36.03  ? 310 TYR A CD2   1 
ATOM   2031 C CE1   . TYR A 1 280 ? 52.951  -8.682  7.353  1.00 42.59  ? 310 TYR A CE1   1 
ATOM   2032 C CE2   . TYR A 1 280 ? 51.151  -9.243  8.832  1.00 43.16  ? 310 TYR A CE2   1 
ATOM   2033 C CZ    . TYR A 1 280 ? 52.260  -9.617  8.096  1.00 50.17  ? 310 TYR A CZ    1 
ATOM   2034 O OH    . TYR A 1 280 ? 52.684  -10.929 8.106  1.00 61.57  ? 310 TYR A OH    1 
ATOM   2035 N N     . TYR A 1 281 ? 51.527  -2.566  7.767  1.00 39.55  ? 311 TYR A N     1 
ATOM   2036 C CA    . TYR A 1 281 ? 50.841  -1.356  7.347  1.00 43.38  ? 311 TYR A CA    1 
ATOM   2037 C C     . TYR A 1 281 ? 50.739  -1.315  5.834  1.00 49.18  ? 311 TYR A C     1 
ATOM   2038 O O     . TYR A 1 281 ? 51.574  -1.881  5.130  1.00 59.29  ? 311 TYR A O     1 
ATOM   2039 C CB    . TYR A 1 281 ? 51.531  -0.110  7.888  1.00 39.44  ? 311 TYR A CB    1 
ATOM   2040 C CG    . TYR A 1 281 ? 52.739  0.324   7.107  1.00 38.91  ? 311 TYR A CG    1 
ATOM   2041 C CD1   . TYR A 1 281 ? 52.637  1.299   6.124  1.00 45.00  ? 311 TYR A CD1   1 
ATOM   2042 C CD2   . TYR A 1 281 ? 53.982  -0.233  7.356  1.00 44.37  ? 311 TYR A CD2   1 
ATOM   2043 C CE1   . TYR A 1 281 ? 53.742  1.707   5.409  1.00 47.55  ? 311 TYR A CE1   1 
ATOM   2044 C CE2   . TYR A 1 281 ? 55.090  0.163   6.647  1.00 58.44  ? 311 TYR A CE2   1 
ATOM   2045 C CZ    . TYR A 1 281 ? 54.966  1.134   5.675  1.00 58.40  ? 311 TYR A CZ    1 
ATOM   2046 O OH    . TYR A 1 281 ? 56.077  1.528   4.971  1.00 68.31  ? 311 TYR A OH    1 
ATOM   2047 N N     . VAL A 1 282 ? 49.697  -0.665  5.337  1.00 36.71  ? 312 VAL A N     1 
ATOM   2048 C CA    . VAL A 1 282 ? 49.516  -0.538  3.905  1.00 34.48  ? 312 VAL A CA    1 
ATOM   2049 C C     . VAL A 1 282 ? 49.530  0.921   3.511  1.00 42.47  ? 312 VAL A C     1 
ATOM   2050 O O     . VAL A 1 282 ? 48.945  1.764   4.191  1.00 46.49  ? 312 VAL A O     1 
ATOM   2051 C CB    . VAL A 1 282 ? 48.212  -1.182  3.435  1.00 32.21  ? 312 VAL A CB    1 
ATOM   2052 C CG1   . VAL A 1 282 ? 48.213  -1.294  1.925  1.00 34.71  ? 312 VAL A CG1   1 
ATOM   2053 C CG2   . VAL A 1 282 ? 48.065  -2.551  4.053  1.00 32.82  ? 312 VAL A CG2   1 
ATOM   2054 N N     . LEU A 1 283 ? 50.220  1.221   2.418  1.00 48.99  ? 313 LEU A N     1 
ATOM   2055 C CA    . LEU A 1 283 ? 50.310  2.590   1.944  1.00 47.01  ? 313 LEU A CA    1 
ATOM   2056 C C     . LEU A 1 283 ? 49.200  2.857   0.934  1.00 53.96  ? 313 LEU A C     1 
ATOM   2057 O O     . LEU A 1 283 ? 49.012  2.100   -0.026 1.00 52.23  ? 313 LEU A O     1 
ATOM   2058 C CB    . LEU A 1 283 ? 51.680  2.865   1.331  1.00 55.38  ? 313 LEU A CB    1 
ATOM   2059 C CG    . LEU A 1 283 ? 52.145  4.319   1.418  1.00 68.96  ? 313 LEU A CG    1 
ATOM   2060 C CD1   . LEU A 1 283 ? 52.292  4.750   2.873  1.00 71.51  ? 313 LEU A CD1   1 
ATOM   2061 C CD2   . LEU A 1 283 ? 53.449  4.508   0.665  1.00 68.74  ? 313 LEU A CD2   1 
ATOM   2062 N N     . CYS A 1 284 ? 48.454  3.928   1.178  1.00 53.66  ? 314 CYS A N     1 
ATOM   2063 C CA    . CYS A 1 284 ? 47.324  4.300   0.342  1.00 49.85  ? 314 CYS A CA    1 
ATOM   2064 C C     . CYS A 1 284 ? 47.371  5.796   0.085  1.00 54.74  ? 314 CYS A C     1 
ATOM   2065 O O     . CYS A 1 284 ? 48.169  6.510   0.689  1.00 71.07  ? 314 CYS A O     1 
ATOM   2066 C CB    . CYS A 1 284 ? 46.008  3.922   1.026  1.00 48.25  ? 314 CYS A CB    1 
ATOM   2067 S SG    . CYS A 1 284 ? 45.802  2.148   1.311  1.00 48.13  ? 314 CYS A SG    1 
ATOM   2068 N N     . SER A 1 285 ? 46.509  6.272   -0.803 1.00 43.53  ? 315 SER A N     1 
ATOM   2069 C CA    . SER A 1 285 ? 46.542  7.669   -1.203 1.00 53.42  ? 315 SER A CA    1 
ATOM   2070 C C     . SER A 1 285 ? 45.210  8.344   -0.922 1.00 55.69  ? 315 SER A C     1 
ATOM   2071 O O     . SER A 1 285 ? 45.119  9.570   -0.889 1.00 71.51  ? 315 SER A O     1 
ATOM   2072 C CB    . SER A 1 285 ? 46.880  7.781   -2.690 1.00 68.42  ? 315 SER A CB    1 
ATOM   2073 O OG    . SER A 1 285 ? 46.027  6.960   -3.472 1.00 73.92  ? 315 SER A OG    1 
ATOM   2074 N N     . SER A 1 286 ? 44.180  7.533   -0.713 1.00 40.26  ? 316 SER A N     1 
ATOM   2075 C CA    . SER A 1 286 ? 42.833  8.040   -0.512 1.00 33.36  ? 316 SER A CA    1 
ATOM   2076 C C     . SER A 1 286 ? 42.049  7.041   0.311  1.00 34.10  ? 316 SER A C     1 
ATOM   2077 O O     . SER A 1 286 ? 42.464  5.890   0.468  1.00 28.87  ? 316 SER A O     1 
ATOM   2078 C CB    . SER A 1 286 ? 42.130  8.233   -1.859 1.00 42.42  ? 316 SER A CB    1 
ATOM   2079 O OG    . SER A 1 286 ? 41.791  6.980   -2.444 1.00 31.23  ? 316 SER A OG    1 
ATOM   2080 N N     . ARG A 1 287 ? 40.905  7.480   0.818  1.00 29.18  ? 317 ARG A N     1 
ATOM   2081 C CA    . ARG A 1 287 ? 39.997  6.590   1.508  1.00 28.34  ? 317 ARG A CA    1 
ATOM   2082 C C     . ARG A 1 287 ? 39.515  5.492   0.557  1.00 39.20  ? 317 ARG A C     1 
ATOM   2083 O O     . ARG A 1 287 ? 39.379  4.330   0.953  1.00 41.03  ? 317 ARG A O     1 
ATOM   2084 C CB    . ARG A 1 287 ? 38.816  7.377   2.065  1.00 44.82  ? 317 ARG A CB    1 
ATOM   2085 C CG    . ARG A 1 287 ? 37.821  6.545   2.858  1.00 28.06  ? 317 ARG A CG    1 
ATOM   2086 C CD    . ARG A 1 287 ? 36.437  7.120   2.686  1.00 45.88  ? 317 ARG A CD    1 
ATOM   2087 N NE    . ARG A 1 287 ? 36.159  7.310   1.266  1.00 66.86  ? 317 ARG A NE    1 
ATOM   2088 C CZ    . ARG A 1 287 ? 35.100  7.947   0.780  1.00 64.53  ? 317 ARG A CZ    1 
ATOM   2089 N NH1   . ARG A 1 287 ? 34.198  8.467   1.605  1.00 61.32  ? 317 ARG A NH1   1 
ATOM   2090 N NH2   . ARG A 1 287 ? 34.948  8.063   -0.535 1.00 50.59  ? 317 ARG A NH2   1 
ATOM   2091 N N     . ASP A 1 288 ? 39.269  5.856   -0.699 1.00 37.35  ? 318 ASP A N     1 
ATOM   2092 C CA    . ASP A 1 288 ? 38.843  4.872   -1.695 1.00 37.48  ? 318 ASP A CA    1 
ATOM   2093 C C     . ASP A 1 288 ? 39.881  3.776   -1.928 1.00 31.34  ? 318 ASP A C     1 
ATOM   2094 O O     . ASP A 1 288 ? 39.532  2.646   -2.244 1.00 42.43  ? 318 ASP A O     1 
ATOM   2095 C CB    . ASP A 1 288 ? 38.455  5.545   -3.013 1.00 56.42  ? 318 ASP A CB    1 
ATOM   2096 C CG    . ASP A 1 288 ? 37.028  6.075   -2.999 1.00 79.49  ? 318 ASP A CG    1 
ATOM   2097 O OD1   . ASP A 1 288 ? 36.403  6.069   -1.915 1.00 79.82  ? 318 ASP A OD1   1 
ATOM   2098 O OD2   . ASP A 1 288 ? 36.532  6.495   -4.069 1.00 84.26  ? 318 ASP A OD2   1 
ATOM   2099 N N     . GLU A 1 289 ? 41.156  4.104   -1.760 1.00 39.19  ? 319 GLU A N     1 
ATOM   2100 C CA    . GLU A 1 289 ? 42.196  3.081   -1.830 1.00 38.57  ? 319 GLU A CA    1 
ATOM   2101 C C     . GLU A 1 289 ? 42.303  2.260   -0.541 1.00 41.39  ? 319 GLU A C     1 
ATOM   2102 O O     . GLU A 1 289 ? 42.555  1.057   -0.587 1.00 35.65  ? 319 GLU A O     1 
ATOM   2103 C CB    . GLU A 1 289 ? 43.551  3.687   -2.194 1.00 48.29  ? 319 GLU A CB    1 
ATOM   2104 C CG    . GLU A 1 289 ? 43.856  3.666   -3.678 1.00 68.71  ? 319 GLU A CG    1 
ATOM   2105 C CD    . GLU A 1 289 ? 45.288  4.062   -3.984 1.00 79.53  ? 319 GLU A CD    1 
ATOM   2106 O OE1   . GLU A 1 289 ? 46.110  4.098   -3.043 1.00 75.90  ? 319 GLU A OE1   1 
ATOM   2107 O OE2   . GLU A 1 289 ? 45.592  4.335   -5.165 1.00 82.04  ? 319 GLU A OE2   1 
ATOM   2108 N N     . LYS A 1 290 ? 42.119  2.900   0.610  1.00 36.54  ? 320 LYS A N     1 
ATOM   2109 C CA    . LYS A 1 290 ? 42.104  2.146   1.857  1.00 28.44  ? 320 LYS A CA    1 
ATOM   2110 C C     . LYS A 1 290 ? 41.003  1.105   1.788  1.00 33.13  ? 320 LYS A C     1 
ATOM   2111 O O     . LYS A 1 290 ? 41.181  -0.028  2.232  1.00 35.09  ? 320 LYS A O     1 
ATOM   2112 C CB    . LYS A 1 290 ? 41.928  3.056   3.076  1.00 34.59  ? 320 LYS A CB    1 
ATOM   2113 C CG    . LYS A 1 290 ? 43.178  3.850   3.421  1.00 35.26  ? 320 LYS A CG    1 
ATOM   2114 C CD    . LYS A 1 290 ? 43.125  4.424   4.812  1.00 38.23  ? 320 LYS A CD    1 
ATOM   2115 C CE    . LYS A 1 290 ? 42.046  5.475   4.955  1.00 43.23  ? 320 LYS A CE    1 
ATOM   2116 N NZ    . LYS A 1 290 ? 42.199  6.230   6.237  1.00 37.63  ? 320 LYS A NZ    1 
ATOM   2117 N N     . PHE A 1 291 ? 39.874  1.482   1.197  1.00 27.26  ? 321 PHE A N     1 
ATOM   2118 C CA    . PHE A 1 291 ? 38.771  0.544   1.040  1.00 27.44  ? 321 PHE A CA    1 
ATOM   2119 C C     . PHE A 1 291 ? 39.126  -0.620  0.115  1.00 30.45  ? 321 PHE A C     1 
ATOM   2120 O O     . PHE A 1 291 ? 38.676  -1.744  0.321  1.00 41.53  ? 321 PHE A O     1 
ATOM   2121 C CB    . PHE A 1 291 ? 37.510  1.251   0.538  1.00 31.93  ? 321 PHE A CB    1 
ATOM   2122 C CG    . PHE A 1 291 ? 36.344  0.326   0.345  1.00 39.45  ? 321 PHE A CG    1 
ATOM   2123 C CD1   . PHE A 1 291 ? 35.923  -0.026  -0.926 1.00 28.47  ? 321 PHE A CD1   1 
ATOM   2124 C CD2   . PHE A 1 291 ? 35.690  -0.220  1.438  1.00 37.99  ? 321 PHE A CD2   1 
ATOM   2125 C CE1   . PHE A 1 291 ? 34.858  -0.893  -1.104 1.00 32.59  ? 321 PHE A CE1   1 
ATOM   2126 C CE2   . PHE A 1 291 ? 34.626  -1.089  1.266  1.00 36.52  ? 321 PHE A CE2   1 
ATOM   2127 C CZ    . PHE A 1 291 ? 34.209  -1.425  -0.006 1.00 37.34  ? 321 PHE A CZ    1 
ATOM   2128 N N     . GLN A 1 292 ? 39.935  -0.359  -0.904 1.00 34.38  ? 322 GLN A N     1 
ATOM   2129 C CA    . GLN A 1 292 ? 40.309  -1.419  -1.834 1.00 42.71  ? 322 GLN A CA    1 
ATOM   2130 C C     . GLN A 1 292 ? 41.379  -2.329  -1.241 1.00 37.12  ? 322 GLN A C     1 
ATOM   2131 O O     . GLN A 1 292 ? 41.343  -3.543  -1.435 1.00 36.89  ? 322 GLN A O     1 
ATOM   2132 C CB    . GLN A 1 292 ? 40.758  -0.845  -3.178 1.00 45.13  ? 322 GLN A CB    1 
ATOM   2133 C CG    . GLN A 1 292 ? 40.410  -1.735  -4.357 1.00 61.86  ? 322 GLN A CG    1 
ATOM   2134 C CD    . GLN A 1 292 ? 40.069  -0.933  -5.602 1.00 88.64  ? 322 GLN A CD    1 
ATOM   2135 O OE1   . GLN A 1 292 ? 40.157  0.301   -5.606 1.00 89.32  ? 322 GLN A OE1   1 
ATOM   2136 N NE2   . GLN A 1 292 ? 39.674  -1.629  -6.666 1.00 90.43  ? 322 GLN A NE2   1 
ATOM   2137 N N     . ALA A 1 293 ? 42.327  -1.740  -0.518 1.00 31.37  ? 323 ALA A N     1 
ATOM   2138 C CA    . ALA A 1 293 ? 43.326  -2.524  0.200  1.00 32.98  ? 323 ALA A CA    1 
ATOM   2139 C C     . ALA A 1 293 ? 42.611  -3.543  1.062  1.00 32.24  ? 323 ALA A C     1 
ATOM   2140 O O     . ALA A 1 293 ? 42.969  -4.719  1.089  1.00 31.03  ? 323 ALA A O     1 
ATOM   2141 C CB    . ALA A 1 293 ? 44.193  -1.624  1.063  1.00 24.51  ? 323 ALA A CB    1 
ATOM   2142 N N     . LEU A 1 294 ? 41.582  -3.070  1.756  1.00 35.01  ? 324 LEU A N     1 
ATOM   2143 C CA    . LEU A 1 294 ? 40.792  -3.899  2.653  1.00 39.08  ? 324 LEU A CA    1 
ATOM   2144 C C     . LEU A 1 294 ? 40.012  -4.991  1.913  1.00 24.97  ? 324 LEU A C     1 
ATOM   2145 O O     . LEU A 1 294 ? 39.996  -6.142  2.337  1.00 43.17  ? 324 LEU A O     1 
ATOM   2146 C CB    . LEU A 1 294 ? 39.843  -3.021  3.470  1.00 37.71  ? 324 LEU A CB    1 
ATOM   2147 C CG    . LEU A 1 294 ? 38.861  -3.767  4.363  1.00 37.43  ? 324 LEU A CG    1 
ATOM   2148 C CD1   . LEU A 1 294 ? 39.611  -4.416  5.514  1.00 39.22  ? 324 LEU A CD1   1 
ATOM   2149 C CD2   . LEU A 1 294 ? 37.788  -2.821  4.858  1.00 29.43  ? 324 LEU A CD2   1 
ATOM   2150 N N     . CYS A 1 295 ? 39.358  -4.632  0.816  1.00 28.30  ? 325 CYS A N     1 
ATOM   2151 C CA    . CYS A 1 295 ? 38.657  -5.627  0.009  1.00 33.59  ? 325 CYS A CA    1 
ATOM   2152 C C     . CYS A 1 295 ? 39.631  -6.690  -0.470 1.00 30.00  ? 325 CYS A C     1 
ATOM   2153 O O     . CYS A 1 295 ? 39.314  -7.877  -0.468 1.00 34.59  ? 325 CYS A O     1 
ATOM   2154 C CB    . CYS A 1 295 ? 37.937  -4.977  -1.175 1.00 30.62  ? 325 CYS A CB    1 
ATOM   2155 S SG    . CYS A 1 295 ? 36.380  -4.148  -0.754 1.00 45.52  ? 325 CYS A SG    1 
ATOM   2156 N N     . ASN A 1 296 ? 40.820  -6.260  -0.882 1.00 30.59  ? 326 ASN A N     1 
ATOM   2157 C CA    . ASN A 1 296 ? 41.879  -7.195  -1.247 1.00 30.30  ? 326 ASN A CA    1 
ATOM   2158 C C     . ASN A 1 296 ? 42.190  -8.140  -0.099 1.00 30.13  ? 326 ASN A C     1 
ATOM   2159 O O     . ASN A 1 296 ? 42.366  -9.339  -0.297 1.00 39.47  ? 326 ASN A O     1 
ATOM   2160 C CB    . ASN A 1 296 ? 43.152  -6.446  -1.649 1.00 35.24  ? 326 ASN A CB    1 
ATOM   2161 C CG    . ASN A 1 296 ? 43.040  -5.793  -3.012 1.00 42.95  ? 326 ASN A CG    1 
ATOM   2162 O OD1   . ASN A 1 296 ? 43.724  -4.810  -3.302 1.00 51.17  ? 326 ASN A OD1   1 
ATOM   2163 N ND2   . ASN A 1 296 ? 42.168  -6.333  -3.855 1.00 34.96  ? 326 ASN A ND2   1 
ATOM   2164 N N     . LEU A 1 297 ? 42.247  -7.584  1.107  1.00 34.22  ? 327 LEU A N     1 
ATOM   2165 C CA    . LEU A 1 297 ? 42.548  -8.358  2.305  1.00 40.02  ? 327 LEU A CA    1 
ATOM   2166 C C     . LEU A 1 297 ? 41.501  -9.445  2.548  1.00 26.46  ? 327 LEU A C     1 
ATOM   2167 O O     . LEU A 1 297 ? 41.834  -10.558 2.939  1.00 44.18  ? 327 LEU A O     1 
ATOM   2168 C CB    . LEU A 1 297 ? 42.655  -7.432  3.513  1.00 39.40  ? 327 LEU A CB    1 
ATOM   2169 C CG    . LEU A 1 297 ? 43.634  -7.872  4.594  1.00 47.72  ? 327 LEU A CG    1 
ATOM   2170 C CD1   . LEU A 1 297 ? 45.012  -8.049  3.991  1.00 44.87  ? 327 LEU A CD1   1 
ATOM   2171 C CD2   . LEU A 1 297 ? 43.664  -6.849  5.714  1.00 60.18  ? 327 LEU A CD2   1 
ATOM   2172 N N     . TYR A 1 298 ? 40.236  -9.112  2.316  1.00 49.57  ? 328 TYR A N     1 
ATOM   2173 C CA    . TYR A 1 298 ? 39.164  -10.101 2.331  1.00 48.84  ? 328 TYR A CA    1 
ATOM   2174 C C     . TYR A 1 298 ? 39.421  -11.140 1.250  1.00 43.66  ? 328 TYR A C     1 
ATOM   2175 O O     . TYR A 1 298 ? 39.124  -12.322 1.425  1.00 44.77  ? 328 TYR A O     1 
ATOM   2176 C CB    . TYR A 1 298 ? 37.810  -9.443  2.054  1.00 38.40  ? 328 TYR A CB    1 
ATOM   2177 C CG    . TYR A 1 298 ? 37.074  -8.911  3.263  1.00 32.12  ? 328 TYR A CG    1 
ATOM   2178 C CD1   . TYR A 1 298 ? 36.233  -9.734  4.006  1.00 32.76  ? 328 TYR A CD1   1 
ATOM   2179 C CD2   . TYR A 1 298 ? 37.194  -7.581  3.645  1.00 30.26  ? 328 TYR A CD2   1 
ATOM   2180 C CE1   . TYR A 1 298 ? 35.539  -9.252  5.104  1.00 39.11  ? 328 TYR A CE1   1 
ATOM   2181 C CE2   . TYR A 1 298 ? 36.501  -7.084  4.744  1.00 35.82  ? 328 TYR A CE2   1 
ATOM   2182 C CZ    . TYR A 1 298 ? 35.675  -7.924  5.467  1.00 43.72  ? 328 TYR A CZ    1 
ATOM   2183 O OH    . TYR A 1 298 ? 34.989  -7.436  6.549  1.00 35.91  ? 328 TYR A OH    1 
ATOM   2184 N N     . GLY A 1 299 ? 39.962  -10.682 0.126  1.00 47.75  ? 329 GLY A N     1 
ATOM   2185 C CA    . GLY A 1 299 ? 40.211  -11.542 -1.013 1.00 28.39  ? 329 GLY A CA    1 
ATOM   2186 C C     . GLY A 1 299 ? 41.226  -12.619 -0.706 1.00 37.95  ? 329 GLY A C     1 
ATOM   2187 O O     . GLY A 1 299 ? 41.163  -13.719 -1.257 1.00 37.82  ? 329 GLY A O     1 
ATOM   2188 N N     . ALA A 1 300 ? 42.159  -12.305 0.187  1.00 34.90  ? 330 ALA A N     1 
ATOM   2189 C CA    . ALA A 1 300 ? 43.247  -13.224 0.494  1.00 47.43  ? 330 ALA A CA    1 
ATOM   2190 C C     . ALA A 1 300 ? 42.935  -14.114 1.691  1.00 49.09  ? 330 ALA A C     1 
ATOM   2191 O O     . ALA A 1 300 ? 42.748  -15.323 1.562  1.00 42.20  ? 330 ALA A O     1 
ATOM   2192 C CB    . ALA A 1 300 ? 44.532  -12.454 0.731  1.00 47.47  ? 330 ALA A CB    1 
ATOM   2193 N N     . ILE A 1 301 ? 42.888  -13.509 2.867  1.00 53.63  ? 331 ILE A N     1 
ATOM   2194 C CA    . ILE A 1 301 ? 42.661  -14.274 4.078  1.00 52.65  ? 331 ILE A CA    1 
ATOM   2195 C C     . ILE A 1 301 ? 41.209  -14.146 4.493  1.00 43.98  ? 331 ILE A C     1 
ATOM   2196 O O     . ILE A 1 301 ? 40.534  -13.178 4.150  1.00 36.99  ? 331 ILE A O     1 
ATOM   2197 C CB    . ILE A 1 301 ? 43.587  -13.813 5.210  1.00 45.18  ? 331 ILE A CB    1 
ATOM   2198 C CG1   . ILE A 1 301 ? 43.255  -12.379 5.616  1.00 46.67  ? 331 ILE A CG1   1 
ATOM   2199 C CG2   . ILE A 1 301 ? 45.040  -13.905 4.766  1.00 41.49  ? 331 ILE A CG2   1 
ATOM   2200 C CD1   . ILE A 1 301 ? 43.992  -11.913 6.841  1.00 46.10  ? 331 ILE A CD1   1 
ATOM   2201 N N     . THR A 1 302 ? 40.717  -15.144 5.208  1.00 48.62  ? 332 THR A N     1 
ATOM   2202 C CA    . THR A 1 302 ? 39.349  -15.094 5.687  1.00 59.93  ? 332 THR A CA    1 
ATOM   2203 C C     . THR A 1 302 ? 39.284  -14.198 6.919  1.00 60.20  ? 332 THR A C     1 
ATOM   2204 O O     . THR A 1 302 ? 39.891  -14.489 7.950  1.00 52.40  ? 332 THR A O     1 
ATOM   2205 C CB    . THR A 1 302 ? 38.800  -16.496 5.994  1.00 57.86  ? 332 THR A CB    1 
ATOM   2206 O OG1   . THR A 1 302 ? 38.030  -16.451 7.201  1.00 59.31  ? 332 THR A OG1   1 
ATOM   2207 C CG2   . THR A 1 302 ? 39.944  -17.495 6.153  1.00 45.82  ? 332 THR A CG2   1 
ATOM   2208 N N     . ILE A 1 303 ? 38.566  -13.090 6.794  1.00 55.86  ? 333 ILE A N     1 
ATOM   2209 C CA    . ILE A 1 303 ? 38.499  -12.117 7.869  1.00 48.00  ? 333 ILE A CA    1 
ATOM   2210 C C     . ILE A 1 303 ? 37.383  -12.468 8.845  1.00 53.88  ? 333 ILE A C     1 
ATOM   2211 O O     . ILE A 1 303 ? 36.212  -12.539 8.480  1.00 57.60  ? 333 ILE A O     1 
ATOM   2212 C CB    . ILE A 1 303 ? 38.336  -10.696 7.325  1.00 51.90  ? 333 ILE A CB    1 
ATOM   2213 C CG1   . ILE A 1 303 ? 39.517  -10.353 6.411  1.00 55.08  ? 333 ILE A CG1   1 
ATOM   2214 C CG2   . ILE A 1 303 ? 38.258  -9.703  8.461  1.00 50.00  ? 333 ILE A CG2   1 
ATOM   2215 C CD1   . ILE A 1 303 ? 39.447  -8.971  5.808  1.00 55.03  ? 333 ILE A CD1   1 
ATOM   2216 N N     . ALA A 1 304 ? 37.769  -12.701 10.093 1.00 54.50  ? 334 ALA A N     1 
ATOM   2217 C CA    . ALA A 1 304 ? 36.856  -13.202 11.107 1.00 46.75  ? 334 ALA A CA    1 
ATOM   2218 C C     . ALA A 1 304 ? 37.405  -12.862 12.477 1.00 43.87  ? 334 ALA A C     1 
ATOM   2219 O O     . ALA A 1 304 ? 38.619  -12.785 12.658 1.00 41.97  ? 334 ALA A O     1 
ATOM   2220 C CB    . ALA A 1 304 ? 36.699  -14.696 10.972 1.00 41.36  ? 334 ALA A CB    1 
ATOM   2221 N N     . GLN A 1 305 ? 36.511  -12.668 13.442 1.00 44.52  ? 335 GLN A N     1 
ATOM   2222 C CA    . GLN A 1 305 ? 36.917  -12.239 14.774 1.00 30.97  ? 335 GLN A CA    1 
ATOM   2223 C C     . GLN A 1 305 ? 37.739  -10.965 14.663 1.00 26.26  ? 335 GLN A C     1 
ATOM   2224 O O     . GLN A 1 305 ? 38.751  -10.818 15.342 1.00 41.15  ? 335 GLN A O     1 
ATOM   2225 C CB    . GLN A 1 305 ? 37.755  -13.319 15.461 1.00 28.40  ? 335 GLN A CB    1 
ATOM   2226 C CG    . GLN A 1 305 ? 37.088  -14.684 15.579 1.00 58.04  ? 335 GLN A CG    1 
ATOM   2227 C CD    . GLN A 1 305 ? 37.916  -15.659 16.396 1.00 71.54  ? 335 GLN A CD    1 
ATOM   2228 O OE1   . GLN A 1 305 ? 39.026  -15.339 16.826 1.00 70.59  ? 335 GLN A OE1   1 
ATOM   2229 N NE2   . GLN A 1 305 ? 37.381  -16.855 16.616 1.00 82.33  ? 335 GLN A NE2   1 
ATOM   2230 N N     . ALA A 1 306 ? 37.313  -10.048 13.803 1.00 25.68  ? 336 ALA A N     1 
ATOM   2231 C CA    . ALA A 1 306 ? 38.108  -8.857  13.530 1.00 28.05  ? 336 ALA A CA    1 
ATOM   2232 C C     . ALA A 1 306 ? 37.374  -7.571  13.863 1.00 29.47  ? 336 ALA A C     1 
ATOM   2233 O O     . ALA A 1 306 ? 36.148  -7.507  13.794 1.00 30.85  ? 336 ALA A O     1 
ATOM   2234 C CB    . ALA A 1 306 ? 38.564  -8.841  12.077 1.00 36.51  ? 336 ALA A CB    1 
ATOM   2235 N N     . MET A 1 307 ? 38.133  -6.545  14.223 1.00 23.52  ? 337 MET A N     1 
ATOM   2236 C CA    . MET A 1 307 ? 37.552  -5.238  14.461 1.00 27.28  ? 337 MET A CA    1 
ATOM   2237 C C     . MET A 1 307 ? 38.214  -4.196  13.578 1.00 29.31  ? 337 MET A C     1 
ATOM   2238 O O     . MET A 1 307 ? 39.442  -4.164  13.455 1.00 31.21  ? 337 MET A O     1 
ATOM   2239 C CB    . MET A 1 307 ? 37.681  -4.850  15.933 1.00 22.61  ? 337 MET A CB    1 
ATOM   2240 C CG    . MET A 1 307 ? 36.795  -5.662  16.858 1.00 40.70  ? 337 MET A CG    1 
ATOM   2241 S SD    . MET A 1 307 ? 36.984  -5.220  18.593 1.00 53.95  ? 337 MET A SD    1 
ATOM   2242 C CE    . MET A 1 307 ? 36.512  -3.499  18.583 1.00 26.94  ? 337 MET A CE    1 
ATOM   2243 N N     . ILE A 1 308 ? 37.398  -3.348  12.962 1.00 25.68  ? 338 ILE A N     1 
ATOM   2244 C CA    . ILE A 1 308 ? 37.915  -2.265  12.137 1.00 26.50  ? 338 ILE A CA    1 
ATOM   2245 C C     . ILE A 1 308 ? 37.608  -0.914  12.770 1.00 29.69  ? 338 ILE A C     1 
ATOM   2246 O O     . ILE A 1 308 ? 36.449  -0.577  13.004 1.00 29.82  ? 338 ILE A O     1 
ATOM   2247 C CB    . ILE A 1 308 ? 37.330  -2.314  10.729 1.00 25.50  ? 338 ILE A CB    1 
ATOM   2248 C CG1   . ILE A 1 308 ? 37.644  -3.668  10.090 1.00 34.60  ? 338 ILE A CG1   1 
ATOM   2249 C CG2   . ILE A 1 308 ? 37.877  -1.170  9.895  1.00 23.57  ? 338 ILE A CG2   1 
ATOM   2250 C CD1   . ILE A 1 308 ? 36.676  -4.074  9.002  1.00 37.78  ? 338 ILE A CD1   1 
ATOM   2251 N N     . PHE A 1 309 ? 38.658  -0.144  13.031 1.00 32.23  ? 339 PHE A N     1 
ATOM   2252 C CA    . PHE A 1 309 ? 38.527  1.131   13.718 1.00 36.03  ? 339 PHE A CA    1 
ATOM   2253 C C     . PHE A 1 309 ? 38.588  2.319   12.770 1.00 39.96  ? 339 PHE A C     1 
ATOM   2254 O O     . PHE A 1 309 ? 39.554  2.482   12.023 1.00 43.54  ? 339 PHE A O     1 
ATOM   2255 C CB    . PHE A 1 309 ? 39.618  1.259   14.772 1.00 23.09  ? 339 PHE A CB    1 
ATOM   2256 C CG    . PHE A 1 309 ? 39.584  0.173   15.795 1.00 30.86  ? 339 PHE A CG    1 
ATOM   2257 C CD1   . PHE A 1 309 ? 40.222  -1.032  15.562 1.00 33.70  ? 339 PHE A CD1   1 
ATOM   2258 C CD2   . PHE A 1 309 ? 38.904  0.349   16.991 1.00 35.36  ? 339 PHE A CD2   1 
ATOM   2259 C CE1   . PHE A 1 309 ? 40.191  -2.045  16.509 1.00 32.83  ? 339 PHE A CE1   1 
ATOM   2260 C CE2   . PHE A 1 309 ? 38.868  -0.658  17.937 1.00 34.50  ? 339 PHE A CE2   1 
ATOM   2261 C CZ    . PHE A 1 309 ? 39.512  -1.855  17.696 1.00 34.42  ? 339 PHE A CZ    1 
ATOM   2262 N N     . CYS A 1 310 ? 37.550  3.149   12.819 1.00 38.12  ? 340 CYS A N     1 
ATOM   2263 C CA    . CYS A 1 310 ? 37.506  4.380   12.051 1.00 36.52  ? 340 CYS A CA    1 
ATOM   2264 C C     . CYS A 1 310 ? 37.506  5.561   12.996 1.00 37.68  ? 340 CYS A C     1 
ATOM   2265 O O     . CYS A 1 310 ? 37.175  5.421   14.169 1.00 56.46  ? 340 CYS A O     1 
ATOM   2266 C CB    . CYS A 1 310 ? 36.251  4.413   11.187 1.00 43.14  ? 340 CYS A CB    1 
ATOM   2267 S SG    . CYS A 1 310 ? 36.033  2.925   10.210 1.00 52.94  ? 340 CYS A SG    1 
ATOM   2268 N N     . HIS A 1 311 ? 37.864  6.730   12.483 1.00 39.42  ? 341 HIS A N     1 
ATOM   2269 C CA    . HIS A 1 311 ? 37.942  7.920   13.319 1.00 49.28  ? 341 HIS A CA    1 
ATOM   2270 C C     . HIS A 1 311 ? 36.565  8.479   13.658 1.00 56.32  ? 341 HIS A C     1 
ATOM   2271 O O     . HIS A 1 311 ? 36.244  8.686   14.826 1.00 70.14  ? 341 HIS A O     1 
ATOM   2272 C CB    . HIS A 1 311 ? 38.798  8.998   12.653 1.00 51.67  ? 341 HIS A CB    1 
ATOM   2273 C CG    . HIS A 1 311 ? 38.821  10.295  13.399 1.00 70.99  ? 341 HIS A CG    1 
ATOM   2274 N ND1   . HIS A 1 311 ? 39.086  10.372  14.751 1.00 73.07  ? 341 HIS A ND1   1 
ATOM   2275 C CD2   . HIS A 1 311 ? 38.623  11.569  12.983 1.00 81.70  ? 341 HIS A CD2   1 
ATOM   2276 C CE1   . HIS A 1 311 ? 39.042  11.635  15.134 1.00 74.87  ? 341 HIS A CE1   1 
ATOM   2277 N NE2   . HIS A 1 311 ? 38.765  12.382  14.081 1.00 78.67  ? 341 HIS A NE2   1 
ATOM   2278 N N     . THR A 1 312 ? 35.752  8.720   12.638 1.00 43.86  ? 342 THR A N     1 
ATOM   2279 C CA    . THR A 1 312 ? 34.457  9.350   12.848 1.00 38.75  ? 342 THR A CA    1 
ATOM   2280 C C     . THR A 1 312 ? 33.293  8.392   12.640 1.00 46.10  ? 342 THR A C     1 
ATOM   2281 O O     . THR A 1 312 ? 33.418  7.368   11.961 1.00 50.10  ? 342 THR A O     1 
ATOM   2282 C CB    . THR A 1 312 ? 34.267  10.541  11.901 1.00 47.95  ? 342 THR A CB    1 
ATOM   2283 O OG1   . THR A 1 312 ? 33.954  10.065  10.583 1.00 38.50  ? 342 THR A OG1   1 
ATOM   2284 C CG2   . THR A 1 312 ? 35.526  11.387  11.860 1.00 37.66  ? 342 THR A CG2   1 
ATOM   2285 N N     . ARG A 1 313 ? 32.152  8.739   13.221 1.00 36.75  ? 343 ARG A N     1 
ATOM   2286 C CA    . ARG A 1 313 ? 30.939  7.978   12.996 1.00 39.41  ? 343 ARG A CA    1 
ATOM   2287 C C     . ARG A 1 313 ? 30.573  8.010   11.521 1.00 45.03  ? 343 ARG A C     1 
ATOM   2288 O O     . ARG A 1 313 ? 30.002  7.053   10.995 1.00 43.96  ? 343 ARG A O     1 
ATOM   2289 C CB    . ARG A 1 313 ? 29.790  8.544   13.823 1.00 52.21  ? 343 ARG A CB    1 
ATOM   2290 C CG    . ARG A 1 313 ? 29.959  8.377   15.317 1.00 60.36  ? 343 ARG A CG    1 
ATOM   2291 C CD    . ARG A 1 313 ? 28.687  8.783   16.023 1.00 67.44  ? 343 ARG A CD    1 
ATOM   2292 N NE    . ARG A 1 313 ? 28.836  8.824   17.473 1.00 63.31  ? 343 ARG A NE    1 
ATOM   2293 C CZ    . ARG A 1 313 ? 27.880  9.232   18.298 1.00 53.54  ? 343 ARG A CZ    1 
ATOM   2294 N NH1   . ARG A 1 313 ? 26.712  9.629   17.810 1.00 48.92  ? 343 ARG A NH1   1 
ATOM   2295 N NH2   . ARG A 1 313 ? 28.089  9.244   19.605 1.00 64.45  ? 343 ARG A NH2   1 
ATOM   2296 N N     . LYS A 1 314 ? 30.898  9.116   10.855 1.00 49.11  ? 344 LYS A N     1 
ATOM   2297 C CA    . LYS A 1 314 ? 30.621  9.239   9.430  1.00 56.05  ? 344 LYS A CA    1 
ATOM   2298 C C     . LYS A 1 314 ? 31.398  8.185   8.636  1.00 56.94  ? 344 LYS A C     1 
ATOM   2299 O O     . LYS A 1 314 ? 30.830  7.501   7.783  1.00 52.72  ? 344 LYS A O     1 
ATOM   2300 C CB    . LYS A 1 314 ? 30.939  10.649  8.927  1.00 50.96  ? 344 LYS A CB    1 
ATOM   2301 N N     . THR A 1 315 ? 32.690  8.046   8.930  1.00 46.99  ? 345 THR A N     1 
ATOM   2302 C CA    . THR A 1 315 ? 33.516  7.046   8.258  1.00 39.82  ? 345 THR A CA    1 
ATOM   2303 C C     . THR A 1 315 ? 33.036  5.619   8.545  1.00 41.23  ? 345 THR A C     1 
ATOM   2304 O O     . THR A 1 315 ? 32.895  4.810   7.627  1.00 37.13  ? 345 THR A O     1 
ATOM   2305 C CB    . THR A 1 315 ? 35.007  7.183   8.634  1.00 43.32  ? 345 THR A CB    1 
ATOM   2306 O OG1   . THR A 1 315 ? 35.538  8.380   8.059  1.00 55.00  ? 345 THR A OG1   1 
ATOM   2307 C CG2   . THR A 1 315 ? 35.806  6.008   8.116  1.00 35.84  ? 345 THR A CG2   1 
ATOM   2308 N N     . ALA A 1 316 ? 32.778  5.314   9.814  1.00 34.28  ? 346 ALA A N     1 
ATOM   2309 C CA    . ALA A 1 316 ? 32.347  3.971   10.199 1.00 31.37  ? 346 ALA A CA    1 
ATOM   2310 C C     . ALA A 1 316 ? 31.089  3.508   9.462  1.00 36.26  ? 346 ALA A C     1 
ATOM   2311 O O     . ALA A 1 316 ? 31.055  2.401   8.913  1.00 32.48  ? 346 ALA A O     1 
ATOM   2312 C CB    . ALA A 1 316 ? 32.149  3.880   11.706 1.00 40.64  ? 346 ALA A CB    1 
ATOM   2313 N N     . SER A 1 317 ? 30.059  4.349   9.441  1.00 39.77  ? 347 SER A N     1 
ATOM   2314 C CA    . SER A 1 317 ? 28.814  3.984   8.768  1.00 47.67  ? 347 SER A CA    1 
ATOM   2315 C C     . SER A 1 317 ? 29.007  3.869   7.252  1.00 49.33  ? 347 SER A C     1 
ATOM   2316 O O     . SER A 1 317 ? 28.361  3.052   6.592  1.00 48.15  ? 347 SER A O     1 
ATOM   2317 C CB    . SER A 1 317 ? 27.695  4.975   9.098  1.00 44.42  ? 347 SER A CB    1 
ATOM   2318 O OG    . SER A 1 317 ? 27.861  6.195   8.398  1.00 60.22  ? 347 SER A OG    1 
ATOM   2319 N N     . TRP A 1 318 ? 29.903  4.686   6.707  1.00 40.35  ? 348 TRP A N     1 
ATOM   2320 C CA    . TRP A 1 318 ? 30.219  4.625   5.284  1.00 37.09  ? 348 TRP A CA    1 
ATOM   2321 C C     . TRP A 1 318 ? 30.939  3.327   4.950  1.00 39.90  ? 348 TRP A C     1 
ATOM   2322 O O     . TRP A 1 318 ? 30.588  2.630   3.995  1.00 40.27  ? 348 TRP A O     1 
ATOM   2323 C CB    . TRP A 1 318 ? 31.095  5.807   4.874  1.00 26.84  ? 348 TRP A CB    1 
ATOM   2324 C CG    . TRP A 1 318 ? 31.601  5.690   3.477  1.00 42.85  ? 348 TRP A CG    1 
ATOM   2325 C CD1   . TRP A 1 318 ? 30.997  6.156   2.347  1.00 43.62  ? 348 TRP A CD1   1 
ATOM   2326 C CD2   . TRP A 1 318 ? 32.816  5.064   3.054  1.00 43.26  ? 348 TRP A CD2   1 
ATOM   2327 N NE1   . TRP A 1 318 ? 31.763  5.866   1.245  1.00 46.38  ? 348 TRP A NE1   1 
ATOM   2328 C CE2   . TRP A 1 318 ? 32.889  5.193   1.652  1.00 46.77  ? 348 TRP A CE2   1 
ATOM   2329 C CE3   . TRP A 1 318 ? 33.860  4.414   3.723  1.00 36.59  ? 348 TRP A CE3   1 
ATOM   2330 C CZ2   . TRP A 1 318 ? 33.955  4.695   0.906  1.00 40.71  ? 348 TRP A CZ2   1 
ATOM   2331 C CZ3   . TRP A 1 318 ? 34.918  3.917   2.981  1.00 38.33  ? 348 TRP A CZ3   1 
ATOM   2332 C CH2   . TRP A 1 318 ? 34.957  4.060   1.588  1.00 37.28  ? 348 TRP A CH2   1 
ATOM   2333 N N     . LEU A 1 319 ? 31.956  3.013   5.744  1.00 31.61  ? 349 LEU A N     1 
ATOM   2334 C CA    . LEU A 1 319 ? 32.712  1.788   5.559  1.00 29.79  ? 349 LEU A CA    1 
ATOM   2335 C C     . LEU A 1 319 ? 31.796  0.573   5.625  1.00 30.51  ? 349 LEU A C     1 
ATOM   2336 O O     . LEU A 1 319 ? 31.875  -0.322  4.786  1.00 41.59  ? 349 LEU A O     1 
ATOM   2337 C CB    . LEU A 1 319 ? 33.802  1.680   6.621  1.00 31.72  ? 349 LEU A CB    1 
ATOM   2338 C CG    . LEU A 1 319 ? 34.735  0.488   6.456  1.00 28.94  ? 349 LEU A CG    1 
ATOM   2339 C CD1   . LEU A 1 319 ? 35.152  0.369   4.996  1.00 29.61  ? 349 LEU A CD1   1 
ATOM   2340 C CD2   . LEU A 1 319 ? 35.938  0.636   7.356  1.00 28.72  ? 349 LEU A CD2   1 
ATOM   2341 N N     . ALA A 1 320 ? 30.925  0.545   6.628  1.00 31.09  ? 350 ALA A N     1 
ATOM   2342 C CA    . ALA A 1 320 ? 30.052  -0.600  6.844  1.00 31.10  ? 350 ALA A CA    1 
ATOM   2343 C C     . ALA A 1 320 ? 29.072  -0.755  5.693  1.00 34.91  ? 350 ALA A C     1 
ATOM   2344 O O     . ALA A 1 320 ? 28.781  -1.869  5.263  1.00 45.97  ? 350 ALA A O     1 
ATOM   2345 C CB    . ALA A 1 320 ? 29.312  -0.458  8.156  1.00 42.51  ? 350 ALA A CB    1 
ATOM   2346 N N     . ALA A 1 321 ? 28.563  0.368   5.201  1.00 35.42  ? 351 ALA A N     1 
ATOM   2347 C CA    . ALA A 1 321 ? 27.673  0.360   4.044  1.00 38.66  ? 351 ALA A CA    1 
ATOM   2348 C C     . ALA A 1 321 ? 28.403  -0.157  2.803  1.00 41.26  ? 351 ALA A C     1 
ATOM   2349 O O     . ALA A 1 321 ? 27.885  -0.990  2.065  1.00 39.04  ? 351 ALA A O     1 
ATOM   2350 C CB    . ALA A 1 321 ? 27.125  1.753   3.791  1.00 29.21  ? 351 ALA A CB    1 
ATOM   2351 N N     . GLU A 1 322 ? 29.613  0.339   2.582  1.00 39.21  ? 352 GLU A N     1 
ATOM   2352 C CA    . GLU A 1 322 ? 30.397  -0.057  1.420  1.00 30.89  ? 352 GLU A CA    1 
ATOM   2353 C C     . GLU A 1 322 ? 30.738  -1.555  1.447  1.00 35.42  ? 352 GLU A C     1 
ATOM   2354 O O     . GLU A 1 322 ? 30.639  -2.247  0.432  1.00 33.42  ? 352 GLU A O     1 
ATOM   2355 C CB    . GLU A 1 322 ? 31.660  0.800   1.331  1.00 45.60  ? 352 GLU A CB    1 
ATOM   2356 C CG    . GLU A 1 322 ? 32.083  1.132   -0.086 1.00 70.47  ? 352 GLU A CG    1 
ATOM   2357 C CD    . GLU A 1 322 ? 30.984  1.811   -0.881 1.00 72.14  ? 352 GLU A CD    1 
ATOM   2358 O OE1   . GLU A 1 322 ? 30.285  2.677   -0.314 1.00 59.27  ? 352 GLU A OE1   1 
ATOM   2359 O OE2   . GLU A 1 322 ? 30.826  1.476   -2.075 1.00 77.15  ? 352 GLU A OE2   1 
ATOM   2360 N N     . LEU A 1 323 ? 31.122  -2.055  2.617  1.00 32.37  ? 353 LEU A N     1 
ATOM   2361 C CA    . LEU A 1 323 ? 31.414  -3.474  2.781  1.00 27.85  ? 353 LEU A CA    1 
ATOM   2362 C C     . LEU A 1 323 ? 30.193  -4.350  2.524  1.00 37.52  ? 353 LEU A C     1 
ATOM   2363 O O     . LEU A 1 323 ? 30.295  -5.384  1.871  1.00 44.90  ? 353 LEU A O     1 
ATOM   2364 C CB    . LEU A 1 323 ? 31.961  -3.746  4.182  1.00 29.42  ? 353 LEU A CB    1 
ATOM   2365 C CG    . LEU A 1 323 ? 33.405  -3.310  4.426  1.00 34.33  ? 353 LEU A CG    1 
ATOM   2366 C CD1   . LEU A 1 323 ? 33.797  -3.508  5.889  1.00 31.33  ? 353 LEU A CD1   1 
ATOM   2367 C CD2   . LEU A 1 323 ? 34.336  -4.077  3.503  1.00 28.81  ? 353 LEU A CD2   1 
ATOM   2368 N N     . SER A 1 324 ? 29.042  -3.942  3.056  1.00 47.47  ? 354 SER A N     1 
ATOM   2369 C CA    . SER A 1 324 ? 27.807  -4.698  2.875  1.00 46.97  ? 354 SER A CA    1 
ATOM   2370 C C     . SER A 1 324 ? 27.486  -4.808  1.393  1.00 43.24  ? 354 SER A C     1 
ATOM   2371 O O     . SER A 1 324 ? 27.100  -5.869  0.899  1.00 42.64  ? 354 SER A O     1 
ATOM   2372 C CB    . SER A 1 324 ? 26.649  -4.026  3.614  1.00 54.50  ? 354 SER A CB    1 
ATOM   2373 O OG    . SER A 1 324 ? 25.453  -4.788  3.505  1.00 59.29  ? 354 SER A OG    1 
ATOM   2374 N N     . LYS A 1 325 ? 27.659  -3.694  0.694  1.00 42.44  ? 355 LYS A N     1 
ATOM   2375 C CA    . LYS A 1 325 ? 27.449  -3.623  -0.746 1.00 45.36  ? 355 LYS A CA    1 
ATOM   2376 C C     . LYS A 1 325 ? 28.362  -4.600  -1.482 1.00 42.38  ? 355 LYS A C     1 
ATOM   2377 O O     . LYS A 1 325 ? 27.962  -5.223  -2.459 1.00 43.66  ? 355 LYS A O     1 
ATOM   2378 C CB    . LYS A 1 325 ? 27.719  -2.201  -1.227 1.00 44.85  ? 355 LYS A CB    1 
ATOM   2379 C CG    . LYS A 1 325 ? 27.018  -1.813  -2.501 1.00 54.58  ? 355 LYS A CG    1 
ATOM   2380 C CD    . LYS A 1 325 ? 27.092  -0.314  -2.696 1.00 58.17  ? 355 LYS A CD    1 
ATOM   2381 C CE    . LYS A 1 325 ? 26.606  0.409   -1.450 1.00 63.63  ? 355 LYS A CE    1 
ATOM   2382 N NZ    . LYS A 1 325 ? 26.806  1.880   -1.548 1.00 70.30  ? 355 LYS A NZ    1 
ATOM   2383 N N     . GLU A 1 326 ? 29.591  -4.736  -1.000 1.00 48.09  ? 356 GLU A N     1 
ATOM   2384 C CA    . GLU A 1 326 ? 30.558  -5.633  -1.621 1.00 43.49  ? 356 GLU A CA    1 
ATOM   2385 C C     . GLU A 1 326 ? 30.272  -7.087  -1.265 1.00 44.14  ? 356 GLU A C     1 
ATOM   2386 O O     . GLU A 1 326 ? 30.937  -7.998  -1.764 1.00 46.57  ? 356 GLU A O     1 
ATOM   2387 C CB    . GLU A 1 326 ? 31.981  -5.259  -1.202 1.00 41.82  ? 356 GLU A CB    1 
ATOM   2388 C CG    . GLU A 1 326 ? 32.995  -5.420  -2.307 1.00 64.11  ? 356 GLU A CG    1 
ATOM   2389 C CD    . GLU A 1 326 ? 32.744  -4.451  -3.440 1.00 78.23  ? 356 GLU A CD    1 
ATOM   2390 O OE1   . GLU A 1 326 ? 32.317  -3.311  -3.156 1.00 79.26  ? 356 GLU A OE1   1 
ATOM   2391 O OE2   . GLU A 1 326 ? 32.970  -4.827  -4.609 1.00 85.99  ? 356 GLU A OE2   1 
ATOM   2392 N N     . GLY A 1 327 ? 29.292  -7.300  -0.390 1.00 43.61  ? 357 GLY A N     1 
ATOM   2393 C CA    . GLY A 1 327 ? 28.892  -8.643  -0.008 1.00 40.79  ? 357 GLY A CA    1 
ATOM   2394 C C     . GLY A 1 327 ? 29.462  -9.108  1.321  1.00 42.42  ? 357 GLY A C     1 
ATOM   2395 O O     . GLY A 1 327 ? 29.388  -10.287 1.662  1.00 32.83  ? 357 GLY A O     1 
ATOM   2396 N N     . HIS A 1 328 ? 30.041  -8.184  2.079  1.00 46.84  ? 358 HIS A N     1 
ATOM   2397 C CA    . HIS A 1 328 ? 30.589  -8.534  3.385  1.00 44.36  ? 358 HIS A CA    1 
ATOM   2398 C C     . HIS A 1 328 ? 29.690  -8.058  4.524  1.00 40.28  ? 358 HIS A C     1 
ATOM   2399 O O     . HIS A 1 328 ? 29.468  -6.862  4.695  1.00 50.13  ? 358 HIS A O     1 
ATOM   2400 C CB    . HIS A 1 328 ? 31.999  -7.971  3.548  1.00 37.91  ? 358 HIS A CB    1 
ATOM   2401 C CG    . HIS A 1 328 ? 32.946  -8.398  2.471  1.00 45.77  ? 358 HIS A CG    1 
ATOM   2402 N ND1   . HIS A 1 328 ? 33.703  -7.503  1.749  1.00 56.41  ? 358 HIS A ND1   1 
ATOM   2403 C CD2   . HIS A 1 328 ? 33.248  -9.626  1.989  1.00 46.39  ? 358 HIS A CD2   1 
ATOM   2404 C CE1   . HIS A 1 328 ? 34.442  -8.162  0.872  1.00 50.19  ? 358 HIS A CE1   1 
ATOM   2405 N NE2   . HIS A 1 328 ? 34.184  -9.449  0.997  1.00 46.12  ? 358 HIS A NE2   1 
ATOM   2406 N N     . GLN A 1 329 ? 29.168  -9.005  5.295  1.00 30.62  ? 359 GLN A N     1 
ATOM   2407 C CA    . GLN A 1 329 ? 28.347  -8.674  6.448  1.00 39.17  ? 359 GLN A CA    1 
ATOM   2408 C C     . GLN A 1 329 ? 29.229  -8.192  7.600  1.00 47.69  ? 359 GLN A C     1 
ATOM   2409 O O     . GLN A 1 329 ? 30.152  -8.892  8.028  1.00 50.70  ? 359 GLN A O     1 
ATOM   2410 C CB    . GLN A 1 329 ? 27.515  -9.882  6.891  1.00 45.32  ? 359 GLN A CB    1 
ATOM   2411 C CG    . GLN A 1 329 ? 26.619  -9.611  8.100  1.00 64.81  ? 359 GLN A CG    1 
ATOM   2412 C CD    . GLN A 1 329 ? 26.041  -10.880 8.718  1.00 77.86  ? 359 GLN A CD    1 
ATOM   2413 O OE1   . GLN A 1 329 ? 24.877  -10.912 9.121  1.00 74.01  ? 359 GLN A OE1   1 
ATOM   2414 N NE2   . GLN A 1 329 ? 26.855  -11.930 8.794  1.00 80.98  ? 359 GLN A NE2   1 
ATOM   2415 N N     . VAL A 1 330 ? 28.951  -6.989  8.090  1.00 32.91  ? 360 VAL A N     1 
ATOM   2416 C CA    . VAL A 1 330 ? 29.652  -6.466  9.251  1.00 36.36  ? 360 VAL A CA    1 
ATOM   2417 C C     . VAL A 1 330 ? 28.676  -5.859  10.250 1.00 41.28  ? 360 VAL A C     1 
ATOM   2418 O O     . VAL A 1 330 ? 27.588  -5.413  9.883  1.00 41.37  ? 360 VAL A O     1 
ATOM   2419 C CB    . VAL A 1 330 ? 30.671  -5.389  8.859  1.00 24.54  ? 360 VAL A CB    1 
ATOM   2420 C CG1   . VAL A 1 330 ? 31.776  -5.991  8.015  1.00 33.56  ? 360 VAL A CG1   1 
ATOM   2421 C CG2   . VAL A 1 330 ? 29.979  -4.265  8.124  1.00 24.99  ? 360 VAL A CG2   1 
ATOM   2422 N N     . ALA A 1 331 ? 29.068  -5.844  11.519 1.00 37.87  ? 361 ALA A N     1 
ATOM   2423 C CA    . ALA A 1 331 ? 28.273  -5.169  12.534 1.00 32.48  ? 361 ALA A CA    1 
ATOM   2424 C C     . ALA A 1 331 ? 28.863  -3.806  12.827 1.00 26.32  ? 361 ALA A C     1 
ATOM   2425 O O     . ALA A 1 331 ? 30.073  -3.662  13.005 1.00 37.58  ? 361 ALA A O     1 
ATOM   2426 C CB    . ALA A 1 331 ? 28.190  -5.995  13.799 1.00 34.02  ? 361 ALA A CB    1 
ATOM   2427 N N     . LEU A 1 332 ? 27.996  -2.805  12.856 1.00 30.22  ? 362 LEU A N     1 
ATOM   2428 C CA    . LEU A 1 332 ? 28.397  -1.440  13.156 1.00 33.80  ? 362 LEU A CA    1 
ATOM   2429 C C     . LEU A 1 332 ? 28.289  -1.188  14.658 1.00 28.62  ? 362 LEU A C     1 
ATOM   2430 O O     . LEU A 1 332 ? 27.408  -1.718  15.324 1.00 33.33  ? 362 LEU A O     1 
ATOM   2431 C CB    . LEU A 1 332 ? 27.521  -0.461  12.378 1.00 31.87  ? 362 LEU A CB    1 
ATOM   2432 C CG    . LEU A 1 332 ? 27.938  1.003   12.403 1.00 41.11  ? 362 LEU A CG    1 
ATOM   2433 C CD1   . LEU A 1 332 ? 29.444  1.122   12.292 1.00 38.79  ? 362 LEU A CD1   1 
ATOM   2434 C CD2   . LEU A 1 332 ? 27.250  1.749   11.271 1.00 49.60  ? 362 LEU A CD2   1 
ATOM   2435 N N     . LEU A 1 333 ? 29.204  -0.388  15.185 1.00 42.54  ? 363 LEU A N     1 
ATOM   2436 C CA    . LEU A 1 333 ? 29.230  -0.073  16.606 1.00 34.81  ? 363 LEU A CA    1 
ATOM   2437 C C     . LEU A 1 333 ? 29.506  1.415   16.753 1.00 41.57  ? 363 LEU A C     1 
ATOM   2438 O O     . LEU A 1 333 ? 30.659  1.817   16.885 1.00 49.24  ? 363 LEU A O     1 
ATOM   2439 C CB    . LEU A 1 333 ? 30.337  -0.878  17.288 1.00 38.11  ? 363 LEU A CB    1 
ATOM   2440 C CG    . LEU A 1 333 ? 30.302  -1.099  18.802 1.00 44.51  ? 363 LEU A CG    1 
ATOM   2441 C CD1   . LEU A 1 333 ? 29.028  -1.815  19.224 1.00 46.61  ? 363 LEU A CD1   1 
ATOM   2442 C CD2   . LEU A 1 333 ? 31.520  -1.897  19.234 1.00 36.37  ? 363 LEU A CD2   1 
ATOM   2443 N N     . SER A 1 334 ? 28.460  2.237   16.699 1.00 32.51  ? 364 SER A N     1 
ATOM   2444 C CA    . SER A 1 334 ? 28.644  3.679   16.841 1.00 38.23  ? 364 SER A CA    1 
ATOM   2445 C C     . SER A 1 334 ? 27.733  4.302   17.902 1.00 44.63  ? 364 SER A C     1 
ATOM   2446 O O     . SER A 1 334 ? 26.784  3.675   18.375 1.00 41.08  ? 364 SER A O     1 
ATOM   2447 C CB    . SER A 1 334 ? 28.501  4.398   15.495 1.00 37.79  ? 364 SER A CB    1 
ATOM   2448 O OG    . SER A 1 334 ? 27.194  4.265   14.988 1.00 52.52  ? 364 SER A OG    1 
ATOM   2449 N N     . GLY A 1 335 ? 28.035  5.547   18.256 1.00 42.24  ? 365 GLY A N     1 
ATOM   2450 C CA    . GLY A 1 335 ? 27.470  6.193   19.426 1.00 49.29  ? 365 GLY A CA    1 
ATOM   2451 C C     . GLY A 1 335 ? 25.983  6.481   19.440 1.00 52.59  ? 365 GLY A C     1 
ATOM   2452 O O     . GLY A 1 335 ? 25.429  6.788   20.491 1.00 63.87  ? 365 GLY A O     1 
ATOM   2453 N N     . GLU A 1 336 ? 25.328  6.396   18.289 1.00 48.52  ? 366 GLU A N     1 
ATOM   2454 C CA    . GLU A 1 336 ? 23.891  6.618   18.247 1.00 38.86  ? 366 GLU A CA    1 
ATOM   2455 C C     . GLU A 1 336 ? 23.149  5.412   18.821 1.00 37.24  ? 366 GLU A C     1 
ATOM   2456 O O     . GLU A 1 336 ? 21.951  5.477   19.089 1.00 43.59  ? 366 GLU A O     1 
ATOM   2457 C CB    . GLU A 1 336 ? 23.413  6.916   16.822 1.00 45.64  ? 366 GLU A CB    1 
ATOM   2458 C CG    . GLU A 1 336 ? 23.436  5.717   15.887 1.00 54.00  ? 366 GLU A CG    1 
ATOM   2459 C CD    . GLU A 1 336 ? 24.731  5.609   15.109 1.00 64.47  ? 366 GLU A CD    1 
ATOM   2460 O OE1   . GLU A 1 336 ? 25.653  6.410   15.377 1.00 64.08  ? 366 GLU A OE1   1 
ATOM   2461 O OE2   . GLU A 1 336 ? 24.821  4.730   14.222 1.00 68.40  ? 366 GLU A OE2   1 
ATOM   2462 N N     . MET A 1 337 ? 23.864  4.308   18.998 1.00 27.19  ? 367 MET A N     1 
ATOM   2463 C CA    . MET A 1 337 ? 23.283  3.125   19.618 1.00 37.04  ? 367 MET A CA    1 
ATOM   2464 C C     . MET A 1 337 ? 23.295  3.280   21.136 1.00 38.62  ? 367 MET A C     1 
ATOM   2465 O O     . MET A 1 337 ? 24.272  3.752   21.702 1.00 34.97  ? 367 MET A O     1 
ATOM   2466 C CB    . MET A 1 337 ? 24.072  1.876   19.219 1.00 33.39  ? 367 MET A CB    1 
ATOM   2467 C CG    . MET A 1 337 ? 23.996  1.531   17.734 1.00 40.84  ? 367 MET A CG    1 
ATOM   2468 S SD    . MET A 1 337 ? 25.296  0.395   17.200 1.00 46.61  ? 367 MET A SD    1 
ATOM   2469 C CE    . MET A 1 337 ? 24.970  -1.034  18.231 1.00 23.97  ? 367 MET A CE    1 
ATOM   2470 N N     . MET A 1 338 ? 22.204  2.900   21.792 1.00 43.10  ? 368 MET A N     1 
ATOM   2471 C CA    . MET A 1 338 ? 22.183  2.850   23.250 1.00 39.67  ? 368 MET A CA    1 
ATOM   2472 C C     . MET A 1 338 ? 23.217  1.818   23.697 1.00 41.28  ? 368 MET A C     1 
ATOM   2473 O O     . MET A 1 338 ? 23.507  0.874   22.959 1.00 40.15  ? 368 MET A O     1 
ATOM   2474 C CB    . MET A 1 338 ? 20.802  2.434   23.765 1.00 33.40  ? 368 MET A CB    1 
ATOM   2475 C CG    . MET A 1 338 ? 19.624  3.261   23.271 1.00 27.32  ? 368 MET A CG    1 
ATOM   2476 S SD    . MET A 1 338 ? 19.398  4.835   24.107 1.00 88.50  ? 368 MET A SD    1 
ATOM   2477 C CE    . MET A 1 338 ? 20.478  5.897   23.160 1.00 33.52  ? 368 MET A CE    1 
ATOM   2478 N N     . VAL A 1 339 ? 23.764  1.985   24.899 1.00 27.94  ? 369 VAL A N     1 
ATOM   2479 C CA    . VAL A 1 339 ? 24.765  1.053   25.413 1.00 24.24  ? 369 VAL A CA    1 
ATOM   2480 C C     . VAL A 1 339 ? 24.303  -0.402  25.339 1.00 33.97  ? 369 VAL A C     1 
ATOM   2481 O O     . VAL A 1 339 ? 25.085  -1.296  25.022 1.00 43.28  ? 369 VAL A O     1 
ATOM   2482 C CB    . VAL A 1 339 ? 25.182  1.390   26.860 1.00 27.29  ? 369 VAL A CB    1 
ATOM   2483 C CG1   . VAL A 1 339 ? 26.318  0.493   27.306 1.00 33.18  ? 369 VAL A CG1   1 
ATOM   2484 C CG2   . VAL A 1 339 ? 25.613  2.836   26.962 1.00 22.09  ? 369 VAL A CG2   1 
ATOM   2485 N N     . GLU A 1 340 ? 23.030  -0.640  25.619 1.00 39.06  ? 370 GLU A N     1 
ATOM   2486 C CA    . GLU A 1 340 ? 22.513  -2.001  25.634 1.00 42.42  ? 370 GLU A CA    1 
ATOM   2487 C C     . GLU A 1 340 ? 22.563  -2.607  24.238 1.00 42.28  ? 370 GLU A C     1 
ATOM   2488 O O     . GLU A 1 340 ? 22.715  -3.816  24.080 1.00 39.99  ? 370 GLU A O     1 
ATOM   2489 C CB    . GLU A 1 340 ? 21.088  -2.032  26.184 1.00 48.58  ? 370 GLU A CB    1 
ATOM   2490 C CG    . GLU A 1 340 ? 20.897  -1.278  27.501 1.00 67.77  ? 370 GLU A CG    1 
ATOM   2491 C CD    . GLU A 1 340 ? 20.831  0.238   27.323 1.00 81.73  ? 370 GLU A CD    1 
ATOM   2492 O OE1   . GLU A 1 340 ? 21.895  0.893   27.299 1.00 86.69  ? 370 GLU A OE1   1 
ATOM   2493 O OE2   . GLU A 1 340 ? 19.709  0.781   27.228 1.00 78.38  ? 370 GLU A OE2   1 
ATOM   2494 N N     . GLN A 1 341 ? 22.437  -1.752  23.229 1.00 43.74  ? 371 GLN A N     1 
ATOM   2495 C CA    . GLN A 1 341 ? 22.506  -2.184  21.843 1.00 32.17  ? 371 GLN A CA    1 
ATOM   2496 C C     . GLN A 1 341 ? 23.927  -2.567  21.473 1.00 28.25  ? 371 GLN A C     1 
ATOM   2497 O O     . GLN A 1 341 ? 24.157  -3.593  20.828 1.00 28.05  ? 371 GLN A O     1 
ATOM   2498 C CB    . GLN A 1 341 ? 21.974  -1.093  20.913 1.00 32.55  ? 371 GLN A CB    1 
ATOM   2499 C CG    . GLN A 1 341 ? 20.463  -0.966  20.948 1.00 28.48  ? 371 GLN A CG    1 
ATOM   2500 C CD    . GLN A 1 341 ? 19.946  0.175   20.104 1.00 29.72  ? 371 GLN A CD    1 
ATOM   2501 O OE1   . GLN A 1 341 ? 20.341  1.330   20.276 1.00 21.24  ? 371 GLN A OE1   1 
ATOM   2502 N NE2   . GLN A 1 341 ? 19.043  -0.142  19.189 1.00 34.26  ? 371 GLN A NE2   1 
ATOM   2503 N N     . ARG A 1 342 ? 24.883  -1.747  21.892 1.00 20.27  ? 372 ARG A N     1 
ATOM   2504 C CA    . ARG A 1 342 ? 26.283  -2.067  21.671 1.00 20.49  ? 372 ARG A CA    1 
ATOM   2505 C C     . ARG A 1 342 ? 26.649  -3.357  22.383 1.00 23.95  ? 372 ARG A C     1 
ATOM   2506 O O     . ARG A 1 342 ? 27.502  -4.108  21.923 1.00 34.12  ? 372 ARG A O     1 
ATOM   2507 C CB    . ARG A 1 342 ? 27.170  -0.949  22.174 1.00 20.40  ? 372 ARG A CB    1 
ATOM   2508 C CG    . ARG A 1 342 ? 26.846  0.413   21.614 1.00 36.97  ? 372 ARG A CG    1 
ATOM   2509 C CD    . ARG A 1 342 ? 27.696  1.450   22.304 1.00 38.00  ? 372 ARG A CD    1 
ATOM   2510 N NE    . ARG A 1 342 ? 27.101  2.778   22.279 1.00 39.12  ? 372 ARG A NE    1 
ATOM   2511 C CZ    . ARG A 1 342 ? 27.609  3.819   22.925 1.00 51.93  ? 372 ARG A CZ    1 
ATOM   2512 N NH1   . ARG A 1 342 ? 28.718  3.672   23.641 1.00 49.25  ? 372 ARG A NH1   1 
ATOM   2513 N NH2   . ARG A 1 342 ? 27.014  5.003   22.857 1.00 58.29  ? 372 ARG A NH2   1 
ATOM   2514 N N     . ALA A 1 343 ? 25.993  -3.619  23.507 1.00 26.66  ? 373 ALA A N     1 
ATOM   2515 C CA    . ALA A 1 343 ? 26.266  -4.828  24.269 1.00 21.32  ? 373 ALA A CA    1 
ATOM   2516 C C     . ALA A 1 343 ? 25.775  -6.044  23.509 1.00 21.41  ? 373 ALA A C     1 
ATOM   2517 O O     . ALA A 1 343 ? 26.457  -7.068  23.457 1.00 27.31  ? 373 ALA A O     1 
ATOM   2518 C CB    . ALA A 1 343 ? 25.615  -4.755  25.641 1.00 48.33  ? 373 ALA A CB    1 
ATOM   2519 N N     . ALA A 1 344 ? 24.585  -5.922  22.924 1.00 21.17  ? 374 ALA A N     1 
ATOM   2520 C CA    . ALA A 1 344 ? 23.984  -7.005  22.149 1.00 34.14  ? 374 ALA A CA    1 
ATOM   2521 C C     . ALA A 1 344 ? 24.811  -7.345  20.907 1.00 37.84  ? 374 ALA A C     1 
ATOM   2522 O O     . ALA A 1 344 ? 25.026  -8.520  20.603 1.00 34.99  ? 374 ALA A O     1 
ATOM   2523 C CB    . ALA A 1 344 ? 22.557  -6.652  21.767 1.00 21.66  ? 374 ALA A CB    1 
ATOM   2524 N N     . VAL A 1 345 ? 25.266  -6.314  20.194 1.00 32.10  ? 375 VAL A N     1 
ATOM   2525 C CA    . VAL A 1 345 ? 26.170  -6.497  19.062 1.00 34.99  ? 375 VAL A CA    1 
ATOM   2526 C C     . VAL A 1 345 ? 27.438  -7.211  19.506 1.00 42.15  ? 375 VAL A C     1 
ATOM   2527 O O     . VAL A 1 345 ? 27.810  -8.249  18.950 1.00 40.62  ? 375 VAL A O     1 
ATOM   2528 C CB    . VAL A 1 345 ? 26.583  -5.149  18.433 1.00 34.09  ? 375 VAL A CB    1 
ATOM   2529 C CG1   . VAL A 1 345 ? 27.753  -5.347  17.492 1.00 30.68  ? 375 VAL A CG1   1 
ATOM   2530 C CG2   . VAL A 1 345 ? 25.422  -4.522  17.705 1.00 31.77  ? 375 VAL A CG2   1 
ATOM   2531 N N     . ILE A 1 346 ? 28.103  -6.647  20.511 1.00 33.34  ? 376 ILE A N     1 
ATOM   2532 C CA    . ILE A 1 346 ? 29.338  -7.232  21.020 1.00 30.56  ? 376 ILE A CA    1 
ATOM   2533 C C     . ILE A 1 346 ? 29.163  -8.698  21.401 1.00 31.02  ? 376 ILE A C     1 
ATOM   2534 O O     . ILE A 1 346 ? 30.035  -9.523  21.129 1.00 41.04  ? 376 ILE A O     1 
ATOM   2535 C CB    . ILE A 1 346 ? 29.882  -6.449  22.217 1.00 32.37  ? 376 ILE A CB    1 
ATOM   2536 C CG1   . ILE A 1 346 ? 30.485  -5.129  21.745 1.00 21.57  ? 376 ILE A CG1   1 
ATOM   2537 C CG2   . ILE A 1 346 ? 30.926  -7.263  22.955 1.00 26.71  ? 376 ILE A CG2   1 
ATOM   2538 C CD1   . ILE A 1 346 ? 30.851  -4.200  22.867 1.00 41.09  ? 376 ILE A CD1   1 
ATOM   2539 N N     . GLU A 1 347 ? 28.037  -9.033  22.019 1.00 36.73  ? 377 GLU A N     1 
ATOM   2540 C CA    . GLU A 1 347 ? 27.803  -10.424 22.396 1.00 40.02  ? 377 GLU A CA    1 
ATOM   2541 C C     . GLU A 1 347 ? 27.575  -11.336 21.192 1.00 41.41  ? 377 GLU A C     1 
ATOM   2542 O O     . GLU A 1 347 ? 28.001  -12.487 21.199 1.00 40.88  ? 377 GLU A O     1 
ATOM   2543 C CB    . GLU A 1 347 ? 26.688  -10.552 23.438 1.00 35.72  ? 377 GLU A CB    1 
ATOM   2544 C CG    . GLU A 1 347 ? 27.232  -10.793 24.846 1.00 67.09  ? 377 GLU A CG    1 
ATOM   2545 C CD    . GLU A 1 347 ? 26.351  -10.216 25.940 1.00 91.66  ? 377 GLU A CD    1 
ATOM   2546 O OE1   . GLU A 1 347 ? 25.976  -9.028  25.841 1.00 97.16  ? 377 GLU A OE1   1 
ATOM   2547 O OE2   . GLU A 1 347 ? 26.048  -10.943 26.910 1.00 95.32  ? 377 GLU A OE2   1 
ATOM   2548 N N     . ARG A 1 348 ? 26.923  -10.823 20.154 1.00 37.74  ? 378 ARG A N     1 
ATOM   2549 C CA    . ARG A 1 348 ? 26.778  -11.592 18.925 1.00 43.87  ? 378 ARG A CA    1 
ATOM   2550 C C     . ARG A 1 348 ? 28.146  -11.815 18.293 1.00 44.84  ? 378 ARG A C     1 
ATOM   2551 O O     . ARG A 1 348 ? 28.426  -12.880 17.745 1.00 51.35  ? 378 ARG A O     1 
ATOM   2552 C CB    . ARG A 1 348 ? 25.837  -10.894 17.942 1.00 51.34  ? 378 ARG A CB    1 
ATOM   2553 C CG    . ARG A 1 348 ? 24.373  -11.062 18.291 1.00 63.28  ? 378 ARG A CG    1 
ATOM   2554 C CD    . ARG A 1 348 ? 23.460  -10.439 17.251 1.00 70.18  ? 378 ARG A CD    1 
ATOM   2555 N NE    . ARG A 1 348 ? 23.443  -11.183 15.994 1.00 83.68  ? 378 ARG A NE    1 
ATOM   2556 C CZ    . ARG A 1 348 ? 23.996  -10.753 14.863 1.00 92.04  ? 378 ARG A CZ    1 
ATOM   2557 N NH1   . ARG A 1 348 ? 24.607  -9.576  14.828 1.00 86.52  ? 378 ARG A NH1   1 
ATOM   2558 N NH2   . ARG A 1 348 ? 23.932  -11.496 13.765 1.00 93.64  ? 378 ARG A NH2   1 
ATOM   2559 N N     . PHE A 1 349 ? 29.000  -10.804 18.383 1.00 40.95  ? 379 PHE A N     1 
ATOM   2560 C CA    . PHE A 1 349 ? 30.353  -10.903 17.857 1.00 44.66  ? 379 PHE A CA    1 
ATOM   2561 C C     . PHE A 1 349 ? 31.159  -11.979 18.587 1.00 52.28  ? 379 PHE A C     1 
ATOM   2562 O O     . PHE A 1 349 ? 31.972  -12.675 17.980 1.00 59.24  ? 379 PHE A O     1 
ATOM   2563 C CB    . PHE A 1 349 ? 31.049  -9.549  17.952 1.00 37.26  ? 379 PHE A CB    1 
ATOM   2564 C CG    . PHE A 1 349 ? 32.501  -9.582  17.577 1.00 41.00  ? 379 PHE A CG    1 
ATOM   2565 C CD1   . PHE A 1 349 ? 32.890  -9.545  16.248 1.00 37.99  ? 379 PHE A CD1   1 
ATOM   2566 C CD2   . PHE A 1 349 ? 33.481  -9.629  18.555 1.00 37.81  ? 379 PHE A CD2   1 
ATOM   2567 C CE1   . PHE A 1 349 ? 34.223  -9.566  15.904 1.00 29.02  ? 379 PHE A CE1   1 
ATOM   2568 C CE2   . PHE A 1 349 ? 34.817  -9.651  18.214 1.00 37.24  ? 379 PHE A CE2   1 
ATOM   2569 C CZ    . PHE A 1 349 ? 35.189  -9.618  16.889 1.00 30.53  ? 379 PHE A CZ    1 
ATOM   2570 N N     . ARG A 1 350 ? 30.931  -12.120 19.888 1.00 43.41  ? 380 ARG A N     1 
ATOM   2571 C CA    . ARG A 1 350 ? 31.638  -13.132 20.665 1.00 45.75  ? 380 ARG A CA    1 
ATOM   2572 C C     . ARG A 1 350 ? 31.200  -14.543 20.303 1.00 48.70  ? 380 ARG A C     1 
ATOM   2573 O O     . ARG A 1 350 ? 32.026  -15.446 20.205 1.00 63.09  ? 380 ARG A O     1 
ATOM   2574 C CB    . ARG A 1 350 ? 31.463  -12.891 22.165 1.00 51.62  ? 380 ARG A CB    1 
ATOM   2575 C CG    . ARG A 1 350 ? 32.305  -11.748 22.688 1.00 55.87  ? 380 ARG A CG    1 
ATOM   2576 C CD    . ARG A 1 350 ? 32.049  -11.499 24.153 1.00 65.46  ? 380 ARG A CD    1 
ATOM   2577 N NE    . ARG A 1 350 ? 32.720  -10.288 24.616 1.00 72.49  ? 380 ARG A NE    1 
ATOM   2578 C CZ    . ARG A 1 350 ? 32.733  -9.886  25.882 1.00 65.83  ? 380 ARG A CZ    1 
ATOM   2579 N NH1   . ARG A 1 350 ? 32.115  -10.606 26.808 1.00 55.50  ? 380 ARG A NH1   1 
ATOM   2580 N NH2   . ARG A 1 350 ? 33.364  -8.770  26.223 1.00 60.05  ? 380 ARG A NH2   1 
ATOM   2581 N N     . GLU A 1 351 ? 29.902  -14.731 20.100 1.00 55.94  ? 381 GLU A N     1 
ATOM   2582 C CA    . GLU A 1 351 ? 29.368  -16.046 19.762 1.00 59.49  ? 381 GLU A CA    1 
ATOM   2583 C C     . GLU A 1 351 ? 29.710  -16.445 18.328 1.00 61.11  ? 381 GLU A C     1 
ATOM   2584 O O     . GLU A 1 351 ? 29.415  -17.558 17.898 1.00 66.65  ? 381 GLU A O     1 
ATOM   2585 C CB    . GLU A 1 351 ? 27.853  -16.075 19.964 1.00 66.90  ? 381 GLU A CB    1 
ATOM   2586 C CG    . GLU A 1 351 ? 27.397  -15.618 21.337 1.00 78.31  ? 381 GLU A CG    1 
ATOM   2587 C CD    . GLU A 1 351 ? 25.946  -15.169 21.349 1.00 97.06  ? 381 GLU A CD    1 
ATOM   2588 O OE1   . GLU A 1 351 ? 25.574  -14.365 22.232 1.00 99.36  ? 381 GLU A OE1   1 
ATOM   2589 O OE2   . GLU A 1 351 ? 25.178  -15.613 20.468 1.00 103.23 ? 381 GLU A OE2   1 
ATOM   2590 N N     . GLY A 1 352 ? 30.328  -15.530 17.590 1.00 63.48  ? 382 GLY A N     1 
ATOM   2591 C CA    . GLY A 1 352 ? 30.698  -15.793 16.212 1.00 51.99  ? 382 GLY A CA    1 
ATOM   2592 C C     . GLY A 1 352 ? 29.546  -15.582 15.245 1.00 49.39  ? 382 GLY A C     1 
ATOM   2593 O O     . GLY A 1 352 ? 29.686  -15.812 14.042 1.00 45.62  ? 382 GLY A O     1 
ATOM   2594 N N     . LYS A 1 353 ? 28.401  -15.151 15.766 1.00 44.75  ? 383 LYS A N     1 
ATOM   2595 C CA    . LYS A 1 353 ? 27.269  -14.828 14.910 1.00 47.85  ? 383 LYS A CA    1 
ATOM   2596 C C     . LYS A 1 353 ? 27.614  -13.646 14.005 1.00 50.73  ? 383 LYS A C     1 
ATOM   2597 O O     . LYS A 1 353 ? 27.046  -13.484 12.926 1.00 52.45  ? 383 LYS A O     1 
ATOM   2598 C CB    . LYS A 1 353 ? 26.024  -14.532 15.748 1.00 61.64  ? 383 LYS A CB    1 
ATOM   2599 C CG    . LYS A 1 353 ? 25.312  -15.780 16.265 1.00 78.51  ? 383 LYS A CG    1 
ATOM   2600 C CD    . LYS A 1 353 ? 23.967  -15.428 16.893 1.00 86.18  ? 383 LYS A CD    1 
ATOM   2601 C CE    . LYS A 1 353 ? 23.096  -16.663 17.082 1.00 89.17  ? 383 LYS A CE    1 
ATOM   2602 N NZ    . LYS A 1 353 ? 21.737  -16.303 17.579 1.00 90.49  ? 383 LYS A NZ    1 
ATOM   2603 N N     . GLU A 1 354 ? 28.547  -12.818 14.461 1.00 48.59  ? 384 GLU A N     1 
ATOM   2604 C CA    . GLU A 1 354 ? 29.094  -11.741 13.647 1.00 43.56  ? 384 GLU A CA    1 
ATOM   2605 C C     . GLU A 1 354 ? 30.605  -11.926 13.486 1.00 54.18  ? 384 GLU A C     1 
ATOM   2606 O O     . GLU A 1 354 ? 31.309  -12.226 14.446 1.00 67.70  ? 384 GLU A O     1 
ATOM   2607 C CB    . GLU A 1 354 ? 28.771  -10.377 14.260 1.00 36.75  ? 384 GLU A CB    1 
ATOM   2608 C CG    . GLU A 1 354 ? 27.432  -9.812  13.827 1.00 54.91  ? 384 GLU A CG    1 
ATOM   2609 C CD    . GLU A 1 354 ? 27.420  -9.370  12.371 1.00 73.97  ? 384 GLU A CD    1 
ATOM   2610 O OE1   . GLU A 1 354 ? 28.476  -9.459  11.706 1.00 84.69  ? 384 GLU A OE1   1 
ATOM   2611 O OE2   . GLU A 1 354 ? 26.354  -8.929  11.889 1.00 76.43  ? 384 GLU A OE2   1 
ATOM   2612 N N     . LYS A 1 355 ? 31.105  -11.752 12.269 1.00 49.28  ? 385 LYS A N     1 
ATOM   2613 C CA    . LYS A 1 355 ? 32.510  -12.026 11.998 1.00 51.94  ? 385 LYS A CA    1 
ATOM   2614 C C     . LYS A 1 355 ? 33.366  -10.771 12.088 1.00 43.12  ? 385 LYS A C     1 
ATOM   2615 O O     . LYS A 1 355 ? 34.544  -10.839 12.441 1.00 34.52  ? 385 LYS A O     1 
ATOM   2616 C CB    . LYS A 1 355 ? 32.679  -12.673 10.619 1.00 57.17  ? 385 LYS A CB    1 
ATOM   2617 C CG    . LYS A 1 355 ? 32.174  -14.103 10.514 1.00 63.71  ? 385 LYS A CG    1 
ATOM   2618 C CD    . LYS A 1 355 ? 32.566  -14.707 9.171  1.00 83.18  ? 385 LYS A CD    1 
ATOM   2619 C CE    . LYS A 1 355 ? 32.074  -16.138 9.017  1.00 91.89  ? 385 LYS A CE    1 
ATOM   2620 N NZ    . LYS A 1 355 ? 32.562  -16.750 7.747  1.00 93.57  ? 385 LYS A NZ    1 
ATOM   2621 N N     . VAL A 1 356 ? 32.776  -9.626  11.761 1.00 37.42  ? 386 VAL A N     1 
ATOM   2622 C CA    . VAL A 1 356 ? 33.536  -8.386  11.700 1.00 25.17  ? 386 VAL A CA    1 
ATOM   2623 C C     . VAL A 1 356 ? 32.779  -7.231  12.331 1.00 36.48  ? 386 VAL A C     1 
ATOM   2624 O O     . VAL A 1 356 ? 31.577  -7.061  12.117 1.00 36.95  ? 386 VAL A O     1 
ATOM   2625 C CB    . VAL A 1 356 ? 33.930  -8.023  10.248 1.00 26.40  ? 386 VAL A CB    1 
ATOM   2626 C CG1   . VAL A 1 356 ? 34.625  -6.669  10.193 1.00 24.55  ? 386 VAL A CG1   1 
ATOM   2627 C CG2   . VAL A 1 356 ? 34.830  -9.089  9.674  1.00 27.29  ? 386 VAL A CG2   1 
ATOM   2628 N N     . LEU A 1 357 ? 33.509  -6.432  13.099 1.00 36.71  ? 387 LEU A N     1 
ATOM   2629 C CA    . LEU A 1 357 ? 32.936  -5.330  13.842 1.00 26.52  ? 387 LEU A CA    1 
ATOM   2630 C C     . LEU A 1 357 ? 33.547  -4.029  13.365 1.00 27.75  ? 387 LEU A C     1 
ATOM   2631 O O     . LEU A 1 357 ? 34.751  -3.825  13.472 1.00 47.38  ? 387 LEU A O     1 
ATOM   2632 C CB    . LEU A 1 357 ? 33.252  -5.515  15.320 1.00 28.89  ? 387 LEU A CB    1 
ATOM   2633 C CG    . LEU A 1 357 ? 32.112  -5.259  16.292 1.00 43.99  ? 387 LEU A CG    1 
ATOM   2634 C CD1   . LEU A 1 357 ? 30.861  -5.944  15.790 1.00 49.30  ? 387 LEU A CD1   1 
ATOM   2635 C CD2   . LEU A 1 357 ? 32.489  -5.768  17.673 1.00 50.02  ? 387 LEU A CD2   1 
ATOM   2636 N N     . VAL A 1 358 ? 32.720  -3.144  12.831 1.00 23.10  ? 388 VAL A N     1 
ATOM   2637 C CA    . VAL A 1 358 ? 33.202  -1.817  12.464 1.00 33.47  ? 388 VAL A CA    1 
ATOM   2638 C C     . VAL A 1 358 ? 32.853  -0.836  13.567 1.00 33.65  ? 388 VAL A C     1 
ATOM   2639 O O     . VAL A 1 358 ? 31.698  -0.739  13.981 1.00 27.46  ? 388 VAL A O     1 
ATOM   2640 C CB    . VAL A 1 358 ? 32.617  -1.318  11.131 1.00 23.39  ? 388 VAL A CB    1 
ATOM   2641 C CG1   . VAL A 1 358 ? 33.181  0.038   10.817 1.00 23.59  ? 388 VAL A CG1   1 
ATOM   2642 C CG2   . VAL A 1 358 ? 32.929  -2.298  10.024 1.00 23.63  ? 388 VAL A CG2   1 
ATOM   2643 N N     . THR A 1 359 ? 33.849  -0.108  14.042 1.00 22.87  ? 389 THR A N     1 
ATOM   2644 C CA    . THR A 1 359 ? 33.639  0.722   15.202 1.00 28.09  ? 389 THR A CA    1 
ATOM   2645 C C     . THR A 1 359 ? 34.381  2.044   15.096 1.00 23.22  ? 389 THR A C     1 
ATOM   2646 O O     . THR A 1 359 ? 35.380  2.150   14.400 1.00 41.23  ? 389 THR A O     1 
ATOM   2647 C CB    . THR A 1 359 ? 34.051  -0.035  16.498 1.00 29.50  ? 389 THR A CB    1 
ATOM   2648 O OG1   . THR A 1 359 ? 33.584  0.683   17.646 1.00 50.37  ? 389 THR A OG1   1 
ATOM   2649 C CG2   . THR A 1 359 ? 35.563  -0.195  16.584 1.00 22.29  ? 389 THR A CG2   1 
ATOM   2650 N N     . THR A 1 360 ? 33.864  3.062   15.773 1.00 45.89  ? 390 THR A N     1 
ATOM   2651 C CA    . THR A 1 360 ? 34.593  4.310   15.948 1.00 36.59  ? 390 THR A CA    1 
ATOM   2652 C C     . THR A 1 360 ? 35.570  4.107   17.093 1.00 33.80  ? 390 THR A C     1 
ATOM   2653 O O     . THR A 1 360 ? 35.473  3.136   17.840 1.00 42.10  ? 390 THR A O     1 
ATOM   2654 C CB    . THR A 1 360 ? 33.658  5.475   16.317 1.00 41.51  ? 390 THR A CB    1 
ATOM   2655 O OG1   . THR A 1 360 ? 33.178  5.289   17.653 1.00 53.51  ? 390 THR A OG1   1 
ATOM   2656 C CG2   . THR A 1 360 ? 32.469  5.537   15.361 1.00 41.12  ? 390 THR A CG2   1 
ATOM   2657 N N     . ASN A 1 361 ? 36.518  5.019   17.229 1.00 39.64  ? 391 ASN A N     1 
ATOM   2658 C CA    . ASN A 1 361 ? 37.485  4.938   18.310 1.00 41.39  ? 391 ASN A CA    1 
ATOM   2659 C C     . ASN A 1 361 ? 36.813  5.074   19.667 1.00 50.08  ? 391 ASN A C     1 
ATOM   2660 O O     . ASN A 1 361 ? 36.982  4.232   20.546 1.00 57.24  ? 391 ASN A O     1 
ATOM   2661 C CB    . ASN A 1 361 ? 38.546  6.019   18.144 1.00 50.77  ? 391 ASN A CB    1 
ATOM   2662 C CG    . ASN A 1 361 ? 39.316  5.874   16.858 1.00 62.17  ? 391 ASN A CG    1 
ATOM   2663 O OD1   . ASN A 1 361 ? 39.429  4.777   16.315 1.00 67.71  ? 391 ASN A OD1   1 
ATOM   2664 N ND2   . ASN A 1 361 ? 39.847  6.980   16.355 1.00 76.02  ? 391 ASN A ND2   1 
ATOM   2665 N N     . VAL A 1 362 ? 36.034  6.136   19.823 1.00 49.66  ? 392 VAL A N     1 
ATOM   2666 C CA    . VAL A 1 362 ? 35.395  6.431   21.095 1.00 48.91  ? 392 VAL A CA    1 
ATOM   2667 C C     . VAL A 1 362 ? 34.467  5.311   21.585 1.00 54.38  ? 392 VAL A C     1 
ATOM   2668 O O     . VAL A 1 362 ? 34.453  4.986   22.773 1.00 66.04  ? 392 VAL A O     1 
ATOM   2669 C CB    . VAL A 1 362 ? 34.643  7.773   21.041 1.00 52.72  ? 392 VAL A CB    1 
ATOM   2670 C CG1   . VAL A 1 362 ? 33.780  7.854   19.791 1.00 62.57  ? 392 VAL A CG1   1 
ATOM   2671 C CG2   . VAL A 1 362 ? 33.810  7.961   22.301 1.00 62.57  ? 392 VAL A CG2   1 
ATOM   2672 N N     . CYS A 1 363 ? 33.699  4.720   20.676 1.00 48.10  ? 393 CYS A N     1 
ATOM   2673 C CA    . CYS A 1 363 ? 32.797  3.636   21.053 1.00 43.94  ? 393 CYS A CA    1 
ATOM   2674 C C     . CYS A 1 363 ? 33.512  2.413   21.617 1.00 46.47  ? 393 CYS A C     1 
ATOM   2675 O O     . CYS A 1 363 ? 32.936  1.666   22.403 1.00 56.24  ? 393 CYS A O     1 
ATOM   2676 C CB    . CYS A 1 363 ? 31.916  3.218   19.875 1.00 28.72  ? 393 CYS A CB    1 
ATOM   2677 S SG    . CYS A 1 363 ? 30.285  3.970   19.883 1.00 88.77  ? 393 CYS A SG    1 
ATOM   2678 N N     . ALA A 1 364 ? 34.763  2.207   21.219 1.00 42.61  ? 394 ALA A N     1 
ATOM   2679 C CA    . ALA A 1 364 ? 35.490  1.006   21.623 1.00 42.30  ? 394 ALA A CA    1 
ATOM   2680 C C     . ALA A 1 364 ? 36.554  1.272   22.695 1.00 36.16  ? 394 ALA A C     1 
ATOM   2681 O O     . ALA A 1 364 ? 37.110  0.337   23.278 1.00 33.52  ? 394 ALA A O     1 
ATOM   2682 C CB    . ALA A 1 364 ? 36.108  0.325   20.401 1.00 31.83  ? 394 ALA A CB    1 
ATOM   2683 N N     . ARG A 1 365 ? 36.828  2.548   22.950 1.00 29.89  ? 395 ARG A N     1 
ATOM   2684 C CA    . ARG A 1 365 ? 37.851  2.944   23.915 1.00 38.25  ? 395 ARG A CA    1 
ATOM   2685 C C     . ARG A 1 365 ? 37.647  2.315   25.294 1.00 48.93  ? 395 ARG A C     1 
ATOM   2686 O O     . ARG A 1 365 ? 36.682  2.615   25.992 1.00 50.47  ? 395 ARG A O     1 
ATOM   2687 C CB    . ARG A 1 365 ? 37.888  4.466   24.049 1.00 47.21  ? 395 ARG A CB    1 
ATOM   2688 C CG    . ARG A 1 365 ? 39.006  4.980   24.936 1.00 61.73  ? 395 ARG A CG    1 
ATOM   2689 C CD    . ARG A 1 365 ? 38.931  6.492   25.102 1.00 76.71  ? 395 ARG A CD    1 
ATOM   2690 N NE    . ARG A 1 365 ? 40.021  6.999   25.931 1.00 86.35  ? 395 ARG A NE    1 
ATOM   2691 C CZ    . ARG A 1 365 ? 41.232  7.297   25.470 1.00 91.66  ? 395 ARG A CZ    1 
ATOM   2692 N NH1   . ARG A 1 365 ? 41.513  7.137   24.184 1.00 93.49  ? 395 ARG A NH1   1 
ATOM   2693 N NH2   . ARG A 1 365 ? 42.163  7.753   26.296 1.00 94.29  ? 395 ARG A NH2   1 
ATOM   2694 N N     . GLY A 1 366 ? 38.564  1.438   25.681 1.00 58.78  ? 396 GLY A N     1 
ATOM   2695 C CA    . GLY A 1 366 ? 38.529  0.839   27.002 1.00 58.44  ? 396 GLY A CA    1 
ATOM   2696 C C     . GLY A 1 366 ? 37.673  -0.406  27.071 1.00 58.26  ? 396 GLY A C     1 
ATOM   2697 O O     . GLY A 1 366 ? 37.811  -1.219  27.986 1.00 49.72  ? 396 GLY A O     1 
ATOM   2698 N N     . ILE A 1 367 ? 36.785  -0.563  26.098 1.00 66.19  ? 397 ILE A N     1 
ATOM   2699 C CA    . ILE A 1 367 ? 35.887  -1.710  26.085 1.00 53.31  ? 397 ILE A CA    1 
ATOM   2700 C C     . ILE A 1 367 ? 36.645  -3.022  25.911 1.00 48.86  ? 397 ILE A C     1 
ATOM   2701 O O     . ILE A 1 367 ? 37.443  -3.178  24.991 1.00 49.59  ? 397 ILE A O     1 
ATOM   2702 C CB    . ILE A 1 367 ? 34.806  -1.584  25.007 1.00 37.09  ? 397 ILE A CB    1 
ATOM   2703 C CG1   . ILE A 1 367 ? 33.704  -0.626  25.470 1.00 45.72  ? 397 ILE A CG1   1 
ATOM   2704 C CG2   . ILE A 1 367 ? 34.201  -2.939  24.737 1.00 24.00  ? 397 ILE A CG2   1 
ATOM   2705 C CD1   . ILE A 1 367 ? 34.125  0.818   25.553 1.00 53.45  ? 397 ILE A CD1   1 
ATOM   2706 N N     . ASP A 1 368 ? 36.391  -3.957  26.820 1.00 63.08  ? 398 ASP A N     1 
ATOM   2707 C CA    . ASP A 1 368 ? 37.020  -5.268  26.782 1.00 68.94  ? 398 ASP A CA    1 
ATOM   2708 C C     . ASP A 1 368 ? 36.243  -6.214  25.873 1.00 64.43  ? 398 ASP A C     1 
ATOM   2709 O O     . ASP A 1 368 ? 35.594  -7.145  26.353 1.00 67.50  ? 398 ASP A O     1 
ATOM   2710 C CB    . ASP A 1 368 ? 37.105  -5.868  28.195 1.00 83.70  ? 398 ASP A CB    1 
ATOM   2711 C CG    . ASP A 1 368 ? 38.190  -5.219  29.055 1.00 99.63  ? 398 ASP A CG    1 
ATOM   2712 O OD1   . ASP A 1 368 ? 38.934  -4.358  28.538 1.00 112.25 ? 398 ASP A OD1   1 
ATOM   2713 O OD2   . ASP A 1 368 ? 38.301  -5.576  30.250 1.00 93.37  ? 398 ASP A OD2   1 
ATOM   2714 N N     . VAL A 1 369 ? 36.295  -5.975  24.564 1.00 57.26  ? 399 VAL A N     1 
ATOM   2715 C CA    . VAL A 1 369 ? 35.725  -6.930  23.614 1.00 56.78  ? 399 VAL A CA    1 
ATOM   2716 C C     . VAL A 1 369 ? 36.630  -8.160  23.534 1.00 65.40  ? 399 VAL A C     1 
ATOM   2717 O O     . VAL A 1 369 ? 37.853  -8.037  23.385 1.00 63.57  ? 399 VAL A O     1 
ATOM   2718 C CB    . VAL A 1 369 ? 35.558  -6.345  22.189 1.00 43.15  ? 399 VAL A CB    1 
ATOM   2719 C CG1   . VAL A 1 369 ? 34.633  -7.229  21.374 1.00 27.94  ? 399 VAL A CG1   1 
ATOM   2720 C CG2   . VAL A 1 369 ? 35.032  -4.921  22.228 1.00 23.30  ? 399 VAL A CG2   1 
ATOM   2721 N N     . GLU A 1 370 ? 36.032  -9.343  23.638 1.00 66.52  ? 400 GLU A N     1 
ATOM   2722 C CA    . GLU A 1 370 ? 36.800  -10.582 23.604 1.00 62.89  ? 400 GLU A CA    1 
ATOM   2723 C C     . GLU A 1 370 ? 36.738  -11.212 22.220 1.00 52.80  ? 400 GLU A C     1 
ATOM   2724 O O     . GLU A 1 370 ? 36.026  -10.727 21.344 1.00 62.89  ? 400 GLU A O     1 
ATOM   2725 C CB    . GLU A 1 370 ? 36.270  -11.565 24.650 1.00 73.92  ? 400 GLU A CB    1 
ATOM   2726 C CG    . GLU A 1 370 ? 36.106  -10.977 26.042 1.00 88.93  ? 400 GLU A CG    1 
ATOM   2727 C CD    . GLU A 1 370 ? 37.427  -10.584 26.682 1.00 106.22 ? 400 GLU A CD    1 
ATOM   2728 O OE1   . GLU A 1 370 ? 38.368  -10.210 25.948 1.00 101.11 ? 400 GLU A OE1   1 
ATOM   2729 O OE2   . GLU A 1 370 ? 37.521  -10.644 27.928 1.00 119.42 ? 400 GLU A OE2   1 
ATOM   2730 N N     . GLN A 1 371 ? 37.479  -12.298 22.027 1.00 48.40  ? 401 GLN A N     1 
ATOM   2731 C CA    . GLN A 1 371 ? 37.449  -13.028 20.765 1.00 50.61  ? 401 GLN A CA    1 
ATOM   2732 C C     . GLN A 1 371 ? 37.801  -12.135 19.572 1.00 47.85  ? 401 GLN A C     1 
ATOM   2733 O O     . GLN A 1 371 ? 37.053  -12.063 18.600 1.00 60.94  ? 401 GLN A O     1 
ATOM   2734 C CB    . GLN A 1 371 ? 36.069  -13.652 20.552 1.00 61.34  ? 401 GLN A CB    1 
ATOM   2735 C CG    . GLN A 1 371 ? 35.571  -14.467 21.724 1.00 65.69  ? 401 GLN A CG    1 
ATOM   2736 C CD    . GLN A 1 371 ? 36.531  -15.576 22.105 1.00 76.73  ? 401 GLN A CD    1 
ATOM   2737 O OE1   . GLN A 1 371 ? 37.216  -16.144 21.252 1.00 65.43  ? 401 GLN A OE1   1 
ATOM   2738 N NE2   . GLN A 1 371 ? 36.586  -15.892 23.395 1.00 91.57  ? 401 GLN A NE2   1 
ATOM   2739 N N     . VAL A 1 372 ? 38.935  -11.450 19.660 1.00 37.35  ? 402 VAL A N     1 
ATOM   2740 C CA    . VAL A 1 372 ? 39.399  -10.583 18.587 1.00 33.83  ? 402 VAL A CA    1 
ATOM   2741 C C     . VAL A 1 372 ? 40.801  -10.980 18.167 1.00 39.78  ? 402 VAL A C     1 
ATOM   2742 O O     . VAL A 1 372 ? 41.766  -10.684 18.862 1.00 50.43  ? 402 VAL A O     1 
ATOM   2743 C CB    . VAL A 1 372 ? 39.472  -9.121  19.038 1.00 32.29  ? 402 VAL A CB    1 
ATOM   2744 C CG1   . VAL A 1 372 ? 40.003  -8.250  17.909 1.00 24.33  ? 402 VAL A CG1   1 
ATOM   2745 C CG2   . VAL A 1 372 ? 38.112  -8.637  19.524 1.00 38.82  ? 402 VAL A CG2   1 
ATOM   2746 N N     . SER A 1 373 ? 40.925  -11.641 17.026 1.00 46.32  ? 403 SER A N     1 
ATOM   2747 C CA    . SER A 1 373 ? 42.240  -12.063 16.562 1.00 44.26  ? 403 SER A CA    1 
ATOM   2748 C C     . SER A 1 373 ? 42.856  -11.073 15.574 1.00 39.99  ? 403 SER A C     1 
ATOM   2749 O O     . SER A 1 373 ? 44.076  -11.009 15.441 1.00 50.99  ? 403 SER A O     1 
ATOM   2750 C CB    . SER A 1 373 ? 42.176  -13.468 15.961 1.00 49.03  ? 403 SER A CB    1 
ATOM   2751 O OG    . SER A 1 373 ? 41.278  -13.509 14.867 1.00 71.27  ? 403 SER A OG    1 
ATOM   2752 N N     . VAL A 1 374 ? 42.012  -10.290 14.904 1.00 39.56  ? 404 VAL A N     1 
ATOM   2753 C CA    . VAL A 1 374 ? 42.467  -9.375  13.856 1.00 30.13  ? 404 VAL A CA    1 
ATOM   2754 C C     . VAL A 1 374 ? 42.013  -7.932  14.065 1.00 35.24  ? 404 VAL A C     1 
ATOM   2755 O O     . VAL A 1 374 ? 40.827  -7.663  14.239 1.00 41.06  ? 404 VAL A O     1 
ATOM   2756 C CB    . VAL A 1 374 ? 41.948  -9.823  12.493 1.00 29.75  ? 404 VAL A CB    1 
ATOM   2757 C CG1   . VAL A 1 374 ? 42.289  -8.786  11.432 1.00 27.69  ? 404 VAL A CG1   1 
ATOM   2758 C CG2   . VAL A 1 374 ? 42.519  -11.180 12.144 1.00 44.11  ? 404 VAL A CG2   1 
ATOM   2759 N N     . VAL A 1 375 ? 42.960  -7.002  14.025 1.00 24.99  ? 405 VAL A N     1 
ATOM   2760 C CA    . VAL A 1 375 ? 42.635  -5.589  14.133 1.00 26.01  ? 405 VAL A CA    1 
ATOM   2761 C C     . VAL A 1 375 ? 43.009  -4.834  12.865 1.00 35.59  ? 405 VAL A C     1 
ATOM   2762 O O     . VAL A 1 375 ? 44.095  -5.009  12.316 1.00 50.10  ? 405 VAL A O     1 
ATOM   2763 C CB    . VAL A 1 375 ? 43.327  -4.929  15.345 1.00 29.90  ? 405 VAL A CB    1 
ATOM   2764 C CG1   . VAL A 1 375 ? 43.297  -3.406  15.217 1.00 27.05  ? 405 VAL A CG1   1 
ATOM   2765 C CG2   . VAL A 1 375 ? 42.667  -5.371  16.633 1.00 25.12  ? 405 VAL A CG2   1 
ATOM   2766 N N     . ILE A 1 376 ? 42.092  -3.996  12.402 1.00 28.40  ? 406 ILE A N     1 
ATOM   2767 C CA    . ILE A 1 376 ? 42.324  -3.170  11.229 1.00 26.09  ? 406 ILE A CA    1 
ATOM   2768 C C     . ILE A 1 376 ? 42.117  -1.713  11.607 1.00 30.93  ? 406 ILE A C     1 
ATOM   2769 O O     . ILE A 1 376 ? 40.992  -1.263  11.803 1.00 33.72  ? 406 ILE A O     1 
ATOM   2770 C CB    . ILE A 1 376 ? 41.345  -3.512  10.088 1.00 35.68  ? 406 ILE A CB    1 
ATOM   2771 C CG1   . ILE A 1 376 ? 41.284  -5.027  9.842  1.00 23.62  ? 406 ILE A CG1   1 
ATOM   2772 C CG2   . ILE A 1 376 ? 41.725  -2.760  8.818  1.00 27.17  ? 406 ILE A CG2   1 
ATOM   2773 C CD1   . ILE A 1 376 ? 42.273  -5.523  8.844  1.00 36.72  ? 406 ILE A CD1   1 
ATOM   2774 N N     . ASN A 1 377 ? 43.208  -0.976  11.722 1.00 22.92  ? 407 ASN A N     1 
ATOM   2775 C CA    . ASN A 1 377 ? 43.115  0.449   11.969 1.00 38.06  ? 407 ASN A CA    1 
ATOM   2776 C C     . ASN A 1 377 ? 42.919  1.193   10.658 1.00 40.75  ? 407 ASN A C     1 
ATOM   2777 O O     . ASN A 1 377 ? 43.883  1.586   9.999  1.00 45.28  ? 407 ASN A O     1 
ATOM   2778 C CB    . ASN A 1 377 ? 44.355  0.954   12.708 1.00 35.41  ? 407 ASN A CB    1 
ATOM   2779 C CG    . ASN A 1 377 ? 44.463  0.388   14.106 1.00 32.23  ? 407 ASN A CG    1 
ATOM   2780 O OD1   . ASN A 1 377 ? 43.454  0.109   14.759 1.00 41.91  ? 407 ASN A OD1   1 
ATOM   2781 N ND2   . ASN A 1 377 ? 45.688  0.214   14.576 1.00 29.13  ? 407 ASN A ND2   1 
ATOM   2782 N N     . PHE A 1 378 ? 41.658  1.362   10.279 1.00 33.44  ? 408 PHE A N     1 
ATOM   2783 C CA    . PHE A 1 378 ? 41.310  2.036   9.040  1.00 41.57  ? 408 PHE A CA    1 
ATOM   2784 C C     . PHE A 1 378 ? 41.806  3.472   9.113  1.00 47.77  ? 408 PHE A C     1 
ATOM   2785 O O     . PHE A 1 378 ? 42.191  4.077   8.112  1.00 49.78  ? 408 PHE A O     1 
ATOM   2786 C CB    . PHE A 1 378 ? 39.799  1.992   8.821  1.00 26.89  ? 408 PHE A CB    1 
ATOM   2787 C CG    . PHE A 1 378 ? 39.389  2.286   7.419  1.00 32.38  ? 408 PHE A CG    1 
ATOM   2788 C CD1   . PHE A 1 378 ? 38.856  3.520   7.086  1.00 37.31  ? 408 PHE A CD1   1 
ATOM   2789 C CD2   . PHE A 1 378 ? 39.549  1.333   6.423  1.00 29.72  ? 408 PHE A CD2   1 
ATOM   2790 C CE1   . PHE A 1 378 ? 38.477  3.801   5.783  1.00 35.10  ? 408 PHE A CE1   1 
ATOM   2791 C CE2   . PHE A 1 378 ? 39.177  1.608   5.119  1.00 33.98  ? 408 PHE A CE2   1 
ATOM   2792 C CZ    . PHE A 1 378 ? 38.641  2.843   4.797  1.00 31.04  ? 408 PHE A CZ    1 
ATOM   2793 N N     . ASP A 1 379 ? 41.784  4.010   10.322 1.00 45.70  ? 409 ASP A N     1 
ATOM   2794 C CA    . ASP A 1 379 ? 42.427  5.275   10.614 1.00 45.46  ? 409 ASP A CA    1 
ATOM   2795 C C     . ASP A 1 379 ? 43.332  5.030   11.816 1.00 50.39  ? 409 ASP A C     1 
ATOM   2796 O O     . ASP A 1 379 ? 43.036  4.180   12.660 1.00 47.79  ? 409 ASP A O     1 
ATOM   2797 C CB    . ASP A 1 379 ? 41.384  6.349   10.923 1.00 47.56  ? 409 ASP A CB    1 
ATOM   2798 C CG    . ASP A 1 379 ? 40.516  6.687   9.722  1.00 54.77  ? 409 ASP A CG    1 
ATOM   2799 O OD1   . ASP A 1 379 ? 41.070  6.876   8.618  1.00 63.42  ? 409 ASP A OD1   1 
ATOM   2800 O OD2   . ASP A 1 379 ? 39.277  6.770   9.878  1.00 57.06  ? 409 ASP A OD2   1 
ATOM   2801 N N     . LEU A 1 380 ? 44.446  5.748   11.883 1.00 48.97  ? 410 LEU A N     1 
ATOM   2802 C CA    . LEU A 1 380 ? 45.388  5.559   12.980 1.00 50.64  ? 410 LEU A CA    1 
ATOM   2803 C C     . LEU A 1 380 ? 44.943  6.311   14.229 1.00 53.74  ? 410 LEU A C     1 
ATOM   2804 O O     . LEU A 1 380 ? 44.475  7.447   14.141 1.00 69.67  ? 410 LEU A O     1 
ATOM   2805 C CB    . LEU A 1 380 ? 46.800  5.967   12.555 1.00 44.72  ? 410 LEU A CB    1 
ATOM   2806 C CG    . LEU A 1 380 ? 47.312  5.194   11.341 1.00 38.64  ? 410 LEU A CG    1 
ATOM   2807 C CD1   . LEU A 1 380 ? 48.781  5.491   11.098 1.00 48.02  ? 410 LEU A CD1   1 
ATOM   2808 C CD2   . LEU A 1 380 ? 47.088  3.706   11.528 1.00 33.83  ? 410 LEU A CD2   1 
ATOM   2809 N N     . PRO A 1 381 ? 45.068  5.665   15.396 1.00 48.99  ? 411 PRO A N     1 
ATOM   2810 C CA    . PRO A 1 381 ? 44.621  6.199   16.692 1.00 54.05  ? 411 PRO A CA    1 
ATOM   2811 C C     . PRO A 1 381 ? 45.446  7.396   17.179 1.00 54.43  ? 411 PRO A C     1 
ATOM   2812 O O     . PRO A 1 381 ? 46.633  7.247   17.465 1.00 56.89  ? 411 PRO A O     1 
ATOM   2813 C CB    . PRO A 1 381 ? 44.818  5.005   17.639 1.00 51.14  ? 411 PRO A CB    1 
ATOM   2814 C CG    . PRO A 1 381 ? 45.874  4.178   16.963 1.00 58.28  ? 411 PRO A CG    1 
ATOM   2815 C CD    . PRO A 1 381 ? 45.512  4.267   15.513 1.00 46.46  ? 411 PRO A CD    1 
ATOM   2816 N N     . VAL A 1 382 ? 44.823  8.567   17.280 1.00 65.53  ? 412 VAL A N     1 
ATOM   2817 C CA    . VAL A 1 382 ? 45.506  9.752   17.800 1.00 73.97  ? 412 VAL A CA    1 
ATOM   2818 C C     . VAL A 1 382 ? 44.723  10.417  18.931 1.00 86.54  ? 412 VAL A C     1 
ATOM   2819 O O     . VAL A 1 382 ? 43.524  10.175  19.098 1.00 84.58  ? 412 VAL A O     1 
ATOM   2820 C CB    . VAL A 1 382 ? 45.771  10.799  16.698 1.00 67.87  ? 412 VAL A CB    1 
ATOM   2821 C CG1   . VAL A 1 382 ? 46.658  10.218  15.608 1.00 53.54  ? 412 VAL A CG1   1 
ATOM   2822 C CG2   . VAL A 1 382 ? 44.460  11.312  16.123 1.00 69.73  ? 412 VAL A CG2   1 
ATOM   2823 N N     . ASP A 1 383 ? 45.410  11.259  19.699 1.00 92.37  ? 413 ASP A N     1 
ATOM   2824 C CA    . ASP A 1 383 ? 44.799  11.952  20.828 1.00 98.11  ? 413 ASP A CA    1 
ATOM   2825 C C     . ASP A 1 383 ? 44.229  13.312  20.430 1.00 100.12 ? 413 ASP A C     1 
ATOM   2826 O O     . ASP A 1 383 ? 44.360  13.740  19.282 1.00 87.71  ? 413 ASP A O     1 
ATOM   2827 C CB    . ASP A 1 383 ? 45.807  12.108  21.971 1.00 109.08 ? 413 ASP A CB    1 
ATOM   2828 C CG    . ASP A 1 383 ? 47.074  12.827  21.540 1.00 120.61 ? 413 ASP A CG    1 
ATOM   2829 O OD1   . ASP A 1 383 ? 47.035  13.559  20.528 1.00 128.75 ? 413 ASP A OD1   1 
ATOM   2830 O OD2   . ASP A 1 383 ? 48.112  12.661  22.215 1.00 120.27 ? 413 ASP A OD2   1 
ATOM   2831 N N     . LYS A 1 384 ? 43.601  13.985  21.392 1.00 112.45 ? 414 LYS A N     1 
ATOM   2832 C CA    . LYS A 1 384 ? 42.957  15.275  21.158 1.00 110.70 ? 414 LYS A CA    1 
ATOM   2833 C C     . LYS A 1 384 ? 43.847  16.234  20.374 1.00 105.78 ? 414 LYS A C     1 
ATOM   2834 O O     . LYS A 1 384 ? 43.372  16.963  19.501 1.00 102.29 ? 414 LYS A O     1 
ATOM   2835 C CB    . LYS A 1 384 ? 42.547  15.914  22.488 1.00 109.15 ? 414 LYS A CB    1 
ATOM   2836 N N     . ASP A 1 385 ? 45.137  16.228  20.691 1.00 105.59 ? 415 ASP A N     1 
ATOM   2837 C CA    . ASP A 1 385 ? 46.096  17.104  20.030 1.00 114.29 ? 415 ASP A CA    1 
ATOM   2838 C C     . ASP A 1 385 ? 46.271  16.706  18.571 1.00 117.06 ? 415 ASP A C     1 
ATOM   2839 O O     . ASP A 1 385 ? 45.867  17.432  17.662 1.00 118.78 ? 415 ASP A O     1 
ATOM   2840 C CB    . ASP A 1 385 ? 47.441  17.040  20.748 1.00 117.38 ? 415 ASP A CB    1 
ATOM   2841 C CG    . ASP A 1 385 ? 47.296  17.076  22.254 1.00 124.23 ? 415 ASP A CG    1 
ATOM   2842 O OD1   . ASP A 1 385 ? 46.364  17.748  22.747 1.00 131.63 ? 415 ASP A OD1   1 
ATOM   2843 O OD2   . ASP A 1 385 ? 48.110  16.431  22.946 1.00 124.13 ? 415 ASP A OD2   1 
ATOM   2844 N N     . GLY A 1 386 ? 46.876  15.543  18.359 1.00 113.06 ? 416 GLY A N     1 
ATOM   2845 C CA    . GLY A 1 386 ? 47.104  15.024  17.025 1.00 102.89 ? 416 GLY A CA    1 
ATOM   2846 C C     . GLY A 1 386 ? 48.253  14.038  17.014 1.00 97.07  ? 416 GLY A C     1 
ATOM   2847 O O     . GLY A 1 386 ? 48.663  13.560  15.958 1.00 99.48  ? 416 GLY A O     1 
ATOM   2848 N N     . ASN A 1 387 ? 48.772  13.734  18.199 1.00 89.70  ? 417 ASN A N     1 
ATOM   2849 C CA    . ASN A 1 387 ? 49.905  12.824  18.335 1.00 88.02  ? 417 ASN A CA    1 
ATOM   2850 C C     . ASN A 1 387 ? 49.472  11.365  18.431 1.00 81.47  ? 417 ASN A C     1 
ATOM   2851 O O     . ASN A 1 387 ? 48.298  11.076  18.655 1.00 81.11  ? 417 ASN A O     1 
ATOM   2852 C CB    . ASN A 1 387 ? 50.747  13.204  19.556 1.00 98.40  ? 417 ASN A CB    1 
ATOM   2853 C CG    . ASN A 1 387 ? 51.537  14.480  19.343 1.00 100.27 ? 417 ASN A CG    1 
ATOM   2854 O OD1   . ASN A 1 387 ? 52.164  14.668  18.301 1.00 102.31 ? 417 ASN A OD1   1 
ATOM   2855 N ND2   . ASN A 1 387 ? 51.512  15.362  20.334 1.00 95.27  ? 417 ASN A ND2   1 
ATOM   2856 N N     . PRO A 1 388 ? 50.425  10.438  18.249 1.00 78.86  ? 418 PRO A N     1 
ATOM   2857 C CA    . PRO A 1 388 ? 50.167  8.997   18.347 1.00 75.92  ? 418 PRO A CA    1 
ATOM   2858 C C     . PRO A 1 388 ? 49.623  8.590   19.715 1.00 79.31  ? 418 PRO A C     1 
ATOM   2859 O O     . PRO A 1 388 ? 50.231  8.895   20.742 1.00 79.38  ? 418 PRO A O     1 
ATOM   2860 C CB    . PRO A 1 388 ? 51.553  8.381   18.138 1.00 77.12  ? 418 PRO A CB    1 
ATOM   2861 C CG    . PRO A 1 388 ? 52.297  9.390   17.349 1.00 83.32  ? 418 PRO A CG    1 
ATOM   2862 C CD    . PRO A 1 388 ? 51.807  10.722  17.829 1.00 83.50  ? 418 PRO A CD    1 
ATOM   2863 N N     . ASP A 1 389 ? 48.486  7.902   19.716 1.00 76.14  ? 419 ASP A N     1 
ATOM   2864 C CA    . ASP A 1 389 ? 47.878  7.396   20.941 1.00 74.12  ? 419 ASP A CA    1 
ATOM   2865 C C     . ASP A 1 389 ? 48.376  5.979   21.227 1.00 66.01  ? 419 ASP A C     1 
ATOM   2866 O O     . ASP A 1 389 ? 47.705  4.998   20.917 1.00 64.67  ? 419 ASP A O     1 
ATOM   2867 C CB    . ASP A 1 389 ? 46.351  7.415   20.815 1.00 79.21  ? 419 ASP A CB    1 
ATOM   2868 C CG    . ASP A 1 389 ? 45.648  7.083   22.120 1.00 89.02  ? 419 ASP A CG    1 
ATOM   2869 O OD1   . ASP A 1 389 ? 46.326  6.652   23.078 1.00 98.85  ? 419 ASP A OD1   1 
ATOM   2870 O OD2   . ASP A 1 389 ? 44.412  7.254   22.185 1.00 86.23  ? 419 ASP A OD2   1 
ATOM   2871 N N     . ASN A 1 390 ? 49.560  5.882   21.823 1.00 67.00  ? 420 ASN A N     1 
ATOM   2872 C CA    . ASN A 1 390 ? 50.201  4.592   22.067 1.00 68.55  ? 420 ASN A CA    1 
ATOM   2873 C C     . ASN A 1 390 ? 49.397  3.659   22.967 1.00 71.33  ? 420 ASN A C     1 
ATOM   2874 O O     . ASN A 1 390 ? 49.339  2.454   22.725 1.00 77.55  ? 420 ASN A O     1 
ATOM   2875 C CB    . ASN A 1 390 ? 51.612  4.795   22.623 1.00 71.34  ? 420 ASN A CB    1 
ATOM   2876 C CG    . ASN A 1 390 ? 52.561  5.369   21.592 1.00 78.80  ? 420 ASN A CG    1 
ATOM   2877 O OD1   . ASN A 1 390 ? 53.006  6.510   21.707 1.00 82.94  ? 420 ASN A OD1   1 
ATOM   2878 N ND2   . ASN A 1 390 ? 52.865  4.582   20.565 1.00 81.80  ? 420 ASN A ND2   1 
ATOM   2879 N N     . GLU A 1 391 ? 48.788  4.217   24.007 1.00 66.84  ? 421 GLU A N     1 
ATOM   2880 C CA    . GLU A 1 391 ? 47.919  3.443   24.881 1.00 75.50  ? 421 GLU A CA    1 
ATOM   2881 C C     . GLU A 1 391 ? 46.911  2.656   24.055 1.00 68.39  ? 421 GLU A C     1 
ATOM   2882 O O     . GLU A 1 391 ? 46.956  1.430   24.004 1.00 72.04  ? 421 GLU A O     1 
ATOM   2883 C CB    . GLU A 1 391 ? 47.179  4.362   25.855 1.00 92.65  ? 421 GLU A CB    1 
ATOM   2884 C CG    . GLU A 1 391 ? 48.061  5.003   26.907 1.00 110.73 ? 421 GLU A CG    1 
ATOM   2885 C CD    . GLU A 1 391 ? 48.607  3.996   27.899 1.00 120.57 ? 421 GLU A CD    1 
ATOM   2886 O OE1   . GLU A 1 391 ? 48.335  4.150   29.109 1.00 121.81 ? 421 GLU A OE1   1 
ATOM   2887 O OE2   . GLU A 1 391 ? 49.299  3.048   27.469 1.00 122.47 ? 421 GLU A OE2   1 
ATOM   2888 N N     . THR A 1 392 ? 46.008  3.378   23.401 1.00 55.49  ? 422 THR A N     1 
ATOM   2889 C CA    . THR A 1 392 ? 44.946  2.762   22.616 1.00 49.98  ? 422 THR A CA    1 
ATOM   2890 C C     . THR A 1 392 ? 45.462  1.708   21.646 1.00 50.58  ? 422 THR A C     1 
ATOM   2891 O O     . THR A 1 392 ? 44.866  0.639   21.507 1.00 53.21  ? 422 THR A O     1 
ATOM   2892 C CB    . THR A 1 392 ? 44.165  3.812   21.819 1.00 59.06  ? 422 THR A CB    1 
ATOM   2893 O OG1   . THR A 1 392 ? 43.521  4.717   22.725 1.00 63.05  ? 422 THR A OG1   1 
ATOM   2894 C CG2   . THR A 1 392 ? 43.115  3.137   20.937 1.00 57.85  ? 422 THR A CG2   1 
ATOM   2895 N N     . TYR A 1 393 ? 46.562  2.013   20.966 1.00 45.28  ? 423 TYR A N     1 
ATOM   2896 C CA    . TYR A 1 393 ? 47.135  1.069   20.019 1.00 47.36  ? 423 TYR A CA    1 
ATOM   2897 C C     . TYR A 1 393 ? 47.445  -0.237  20.724 1.00 48.97  ? 423 TYR A C     1 
ATOM   2898 O O     . TYR A 1 393 ? 46.929  -1.290  20.359 1.00 45.82  ? 423 TYR A O     1 
ATOM   2899 C CB    . TYR A 1 393 ? 48.407  1.632   19.385 1.00 52.36  ? 423 TYR A CB    1 
ATOM   2900 C CG    . TYR A 1 393 ? 48.945  0.784   18.254 1.00 52.44  ? 423 TYR A CG    1 
ATOM   2901 C CD1   . TYR A 1 393 ? 48.469  0.937   16.957 1.00 57.87  ? 423 TYR A CD1   1 
ATOM   2902 C CD2   . TYR A 1 393 ? 49.922  -0.176  18.484 1.00 53.59  ? 423 TYR A CD2   1 
ATOM   2903 C CE1   . TYR A 1 393 ? 48.955  0.156   15.915 1.00 56.77  ? 423 TYR A CE1   1 
ATOM   2904 C CE2   . TYR A 1 393 ? 50.416  -0.959  17.453 1.00 59.18  ? 423 TYR A CE2   1 
ATOM   2905 C CZ    . TYR A 1 393 ? 49.930  -0.789  16.169 1.00 61.80  ? 423 TYR A CZ    1 
ATOM   2906 O OH    . TYR A 1 393 ? 50.422  -1.567  15.144 1.00 54.42  ? 423 TYR A OH    1 
ATOM   2907 N N     . LEU A 1 394 ? 48.284  -0.156  21.749 1.00 64.30  ? 424 LEU A N     1 
ATOM   2908 C CA    . LEU A 1 394 ? 48.698  -1.340  22.488 1.00 64.92  ? 424 LEU A CA    1 
ATOM   2909 C C     . LEU A 1 394 ? 47.510  -2.130  23.021 1.00 61.27  ? 424 LEU A C     1 
ATOM   2910 O O     . LEU A 1 394 ? 47.525  -3.360  23.025 1.00 63.23  ? 424 LEU A O     1 
ATOM   2911 C CB    . LEU A 1 394 ? 49.621  -0.957  23.643 1.00 62.98  ? 424 LEU A CB    1 
ATOM   2912 C CG    . LEU A 1 394 ? 50.039  -2.142  24.515 1.00 69.46  ? 424 LEU A CG    1 
ATOM   2913 C CD1   . LEU A 1 394 ? 50.695  -3.225  23.667 1.00 68.89  ? 424 LEU A CD1   1 
ATOM   2914 C CD2   . LEU A 1 394 ? 50.965  -1.690  25.631 1.00 71.12  ? 424 LEU A CD2   1 
ATOM   2915 N N     . HIS A 1 395 ? 46.479  -1.418  23.465 1.00 59.36  ? 425 HIS A N     1 
ATOM   2916 C CA    . HIS A 1 395 ? 45.324  -2.058  24.081 1.00 51.83  ? 425 HIS A CA    1 
ATOM   2917 C C     . HIS A 1 395 ? 44.401  -2.692  23.054 1.00 56.28  ? 425 HIS A C     1 
ATOM   2918 O O     . HIS A 1 395 ? 43.718  -3.668  23.351 1.00 76.47  ? 425 HIS A O     1 
ATOM   2919 C CB    . HIS A 1 395 ? 44.570  -1.076  24.978 1.00 66.01  ? 425 HIS A CB    1 
ATOM   2920 C CG    . HIS A 1 395 ? 45.303  -0.737  26.240 1.00 86.68  ? 425 HIS A CG    1 
ATOM   2921 N ND1   . HIS A 1 395 ? 46.095  0.385   26.364 1.00 97.00  ? 425 HIS A ND1   1 
ATOM   2922 C CD2   . HIS A 1 395 ? 45.376  -1.380  27.429 1.00 93.82  ? 425 HIS A CD2   1 
ATOM   2923 C CE1   . HIS A 1 395 ? 46.618  0.422   27.575 1.00 99.97  ? 425 HIS A CE1   1 
ATOM   2924 N NE2   . HIS A 1 395 ? 46.198  -0.638  28.243 1.00 101.81 ? 425 HIS A NE2   1 
ATOM   2925 N N     . ARG A 1 396 ? 44.379  -2.137  21.846 1.00 53.12  ? 426 ARG A N     1 
ATOM   2926 C CA    . ARG A 1 396 ? 43.644  -2.755  20.749 1.00 48.71  ? 426 ARG A CA    1 
ATOM   2927 C C     . ARG A 1 396 ? 44.342  -4.028  20.335 1.00 56.15  ? 426 ARG A C     1 
ATOM   2928 O O     . ARG A 1 396 ? 43.758  -5.110  20.363 1.00 58.91  ? 426 ARG A O     1 
ATOM   2929 C CB    . ARG A 1 396 ? 43.599  -1.838  19.531 1.00 44.18  ? 426 ARG A CB    1 
ATOM   2930 C CG    . ARG A 1 396 ? 42.466  -0.859  19.514 1.00 36.75  ? 426 ARG A CG    1 
ATOM   2931 C CD    . ARG A 1 396 ? 42.484  -0.057  18.235 1.00 29.31  ? 426 ARG A CD    1 
ATOM   2932 N NE    . ARG A 1 396 ? 41.839  1.234   18.426 1.00 37.02  ? 426 ARG A NE    1 
ATOM   2933 C CZ    . ARG A 1 396 ? 41.834  2.209   17.526 1.00 45.43  ? 426 ARG A CZ    1 
ATOM   2934 N NH1   . ARG A 1 396 ? 42.443  2.040   16.359 1.00 44.79  ? 426 ARG A NH1   1 
ATOM   2935 N NH2   . ARG A 1 396 ? 41.217  3.352   17.797 1.00 45.45  ? 426 ARG A NH2   1 
ATOM   2936 N N     . ILE A 1 397 ? 45.604  -3.875  19.946 1.00 53.52  ? 427 ILE A N     1 
ATOM   2937 C CA    . ILE A 1 397 ? 46.357  -4.949  19.317 1.00 55.78  ? 427 ILE A CA    1 
ATOM   2938 C C     . ILE A 1 397 ? 46.636  -6.084  20.291 1.00 53.19  ? 427 ILE A C     1 
ATOM   2939 O O     . ILE A 1 397 ? 46.472  -7.259  19.948 1.00 47.39  ? 427 ILE A O     1 
ATOM   2940 C CB    . ILE A 1 397 ? 47.695  -4.435  18.744 1.00 64.27  ? 427 ILE A CB    1 
ATOM   2941 C CG1   . ILE A 1 397 ? 47.530  -3.038  18.142 1.00 58.45  ? 427 ILE A CG1   1 
ATOM   2942 C CG2   . ILE A 1 397 ? 48.245  -5.400  17.714 1.00 64.89  ? 427 ILE A CG2   1 
ATOM   2943 C CD1   . ILE A 1 397 ? 46.516  -2.957  17.042 1.00 44.56  ? 427 ILE A CD1   1 
ATOM   2944 N N     . GLY A 1 398 ? 47.062  -5.727  21.501 1.00 59.10  ? 428 GLY A N     1 
ATOM   2945 C CA    . GLY A 1 398 ? 47.346  -6.707  22.534 1.00 55.20  ? 428 GLY A CA    1 
ATOM   2946 C C     . GLY A 1 398 ? 46.086  -7.457  22.909 1.00 60.14  ? 428 GLY A C     1 
ATOM   2947 O O     . GLY A 1 398 ? 46.153  -8.515  23.532 1.00 53.90  ? 428 GLY A O     1 
ATOM   2948 N N     . ARG A 1 399 ? 44.945  -6.897  22.497 1.00 71.15  ? 429 ARG A N     1 
ATOM   2949 C CA    . ARG A 1 399 ? 43.601  -7.426  22.765 1.00 76.82  ? 429 ARG A CA    1 
ATOM   2950 C C     . ARG A 1 399 ? 42.893  -6.641  23.875 1.00 89.91  ? 429 ARG A C     1 
ATOM   2951 O O     . ARG A 1 399 ? 41.794  -6.112  23.681 1.00 92.05  ? 429 ARG A O     1 
ATOM   2952 C CB    . ARG A 1 399 ? 43.625  -8.921  23.100 1.00 76.38  ? 429 ARG A CB    1 
ATOM   2953 C CG    . ARG A 1 399 ? 43.738  -9.844  21.896 1.00 75.98  ? 429 ARG A CG    1 
ATOM   2954 C CD    . ARG A 1 399 ? 45.030  -9.628  21.130 1.00 67.24  ? 429 ARG A CD    1 
ATOM   2955 N NE    . ARG A 1 399 ? 45.235  -10.649 20.113 1.00 63.82  ? 429 ARG A NE    1 
ATOM   2956 C CZ    . ARG A 1 399 ? 46.084  -11.661 20.236 1.00 71.61  ? 429 ARG A CZ    1 
ATOM   2957 N NH1   . ARG A 1 399 ? 46.824  -11.781 21.333 1.00 71.80  ? 429 ARG A NH1   1 
ATOM   2958 N NH2   . ARG A 1 399 ? 46.198  -12.549 19.258 1.00 71.24  ? 429 ARG A NH2   1 
ATOM   2959 N N     . GLY A 1 404 ? 50.422  -16.051 24.616 1.00 113.94 ? 434 GLY A N     1 
ATOM   2960 C CA    . GLY A 1 404 ? 51.236  -16.222 23.426 1.00 113.32 ? 434 GLY A CA    1 
ATOM   2961 C C     . GLY A 1 404 ? 50.406  -16.575 22.206 1.00 114.03 ? 434 GLY A C     1 
ATOM   2962 O O     . GLY A 1 404 ? 50.850  -17.332 21.339 1.00 108.79 ? 434 GLY A O     1 
ATOM   2963 N N     . LYS A 1 405 ? 49.200  -16.014 22.142 1.00 114.36 ? 435 LYS A N     1 
ATOM   2964 C CA    . LYS A 1 405 ? 48.257  -16.277 21.055 1.00 112.35 ? 435 LYS A CA    1 
ATOM   2965 C C     . LYS A 1 405 ? 48.488  -15.363 19.846 1.00 107.21 ? 435 LYS A C     1 
ATOM   2966 O O     . LYS A 1 405 ? 48.659  -14.155 20.003 1.00 104.78 ? 435 LYS A O     1 
ATOM   2967 C CB    . LYS A 1 405 ? 46.822  -16.118 21.568 1.00 109.84 ? 435 LYS A CB    1 
ATOM   2968 C CG    . LYS A 1 405 ? 46.596  -14.859 22.405 1.00 108.22 ? 435 LYS A CG    1 
ATOM   2969 C CD    . LYS A 1 405 ? 45.236  -14.876 23.091 1.00 109.37 ? 435 LYS A CD    1 
ATOM   2970 C CE    . LYS A 1 405 ? 45.013  -13.622 23.926 1.00 111.55 ? 435 LYS A CE    1 
ATOM   2971 N NZ    . LYS A 1 405 ? 46.030  -13.467 25.003 1.00 114.00 ? 435 LYS A NZ    1 
ATOM   2972 N N     . ARG A 1 406 ? 48.476  -15.941 18.644 1.00 104.31 ? 436 ARG A N     1 
ATOM   2973 C CA    . ARG A 1 406 ? 48.762  -15.190 17.416 1.00 99.49  ? 436 ARG A CA    1 
ATOM   2974 C C     . ARG A 1 406 ? 47.673  -14.183 17.042 1.00 84.74  ? 436 ARG A C     1 
ATOM   2975 O O     . ARG A 1 406 ? 46.483  -14.504 17.028 1.00 85.05  ? 436 ARG A O     1 
ATOM   2976 C CB    . ARG A 1 406 ? 49.004  -16.135 16.236 1.00 102.24 ? 436 ARG A CB    1 
ATOM   2977 C CG    . ARG A 1 406 ? 47.781  -16.941 15.823 1.00 111.85 ? 436 ARG A CG    1 
ATOM   2978 C CD    . ARG A 1 406 ? 47.828  -17.315 14.346 1.00 122.55 ? 436 ARG A CD    1 
ATOM   2979 N NE    . ARG A 1 406 ? 46.861  -18.359 14.010 1.00 132.81 ? 436 ARG A NE    1 
ATOM   2980 C CZ    . ARG A 1 406 ? 46.507  -18.684 12.770 1.00 134.00 ? 436 ARG A CZ    1 
ATOM   2981 N NH1   . ARG A 1 406 ? 47.031  -18.040 11.736 1.00 130.24 ? 436 ARG A NH1   1 
ATOM   2982 N NH2   . ARG A 1 406 ? 45.622  -19.651 12.564 1.00 134.75 ? 436 ARG A NH2   1 
ATOM   2983 N N     . GLY A 1 407 ? 48.098  -12.963 16.729 1.00 63.00  ? 437 GLY A N     1 
ATOM   2984 C CA    . GLY A 1 407 ? 47.183  -11.924 16.303 1.00 53.32  ? 437 GLY A CA    1 
ATOM   2985 C C     . GLY A 1 407 ? 47.680  -11.207 15.062 1.00 47.76  ? 437 GLY A C     1 
ATOM   2986 O O     . GLY A 1 407 ? 48.857  -11.289 14.708 1.00 54.46  ? 437 GLY A O     1 
ATOM   2987 N N     . LEU A 1 408 ? 46.775  -10.496 14.401 1.00 29.98  ? 438 LEU A N     1 
ATOM   2988 C CA    . LEU A 1 408 ? 47.112  -9.754  13.200 1.00 25.64  ? 438 LEU A CA    1 
ATOM   2989 C C     . LEU A 1 408 ? 46.702  -8.306  13.386 1.00 27.15  ? 438 LEU A C     1 
ATOM   2990 O O     . LEU A 1 408 ? 45.625  -8.025  13.894 1.00 32.63  ? 438 LEU A O     1 
ATOM   2991 C CB    . LEU A 1 408 ? 46.392  -10.356 11.990 1.00 28.30  ? 438 LEU A CB    1 
ATOM   2992 C CG    . LEU A 1 408 ? 46.605  -9.672  10.634 1.00 45.68  ? 438 LEU A CG    1 
ATOM   2993 C CD1   . LEU A 1 408 ? 48.050  -9.803  10.190 1.00 44.25  ? 438 LEU A CD1   1 
ATOM   2994 C CD2   . LEU A 1 408 ? 45.675  -10.248 9.578  1.00 42.95  ? 438 LEU A CD2   1 
ATOM   2995 N N     . ALA A 1 409 ? 47.567  -7.381  12.991 1.00 32.66  ? 439 ALA A N     1 
ATOM   2996 C CA    . ALA A 1 409 ? 47.221  -5.967  13.019 1.00 32.45  ? 439 ALA A CA    1 
ATOM   2997 C C     . ALA A 1 409 ? 47.609  -5.323  11.698 1.00 30.49  ? 439 ALA A C     1 
ATOM   2998 O O     . ALA A 1 409 ? 48.752  -5.439  11.269 1.00 32.15  ? 439 ALA A O     1 
ATOM   2999 C CB    . ALA A 1 409 ? 47.910  -5.266  14.172 1.00 24.85  ? 439 ALA A CB    1 
ATOM   3000 N N     . VAL A 1 410 ? 46.653  -4.659  11.055 1.00 22.76  ? 440 VAL A N     1 
ATOM   3001 C CA    . VAL A 1 410 ? 46.905  -3.983  9.790  1.00 30.66  ? 440 VAL A CA    1 
ATOM   3002 C C     . VAL A 1 410 ? 46.597  -2.493  9.911  1.00 33.01  ? 440 VAL A C     1 
ATOM   3003 O O     . VAL A 1 410 ? 45.486  -2.106  10.280 1.00 31.69  ? 440 VAL A O     1 
ATOM   3004 C CB    . VAL A 1 410 ? 46.049  -4.576  8.642  1.00 34.23  ? 440 VAL A CB    1 
ATOM   3005 C CG1   . VAL A 1 410 ? 46.409  -3.917  7.322  1.00 29.89  ? 440 VAL A CG1   1 
ATOM   3006 C CG2   . VAL A 1 410 ? 46.237  -6.085  8.548  1.00 29.97  ? 440 VAL A CG2   1 
ATOM   3007 N N     . ASN A 1 411 ? 47.581  -1.659  9.594  1.00 24.86  ? 441 ASN A N     1 
ATOM   3008 C CA    . ASN A 1 411 ? 47.408  -0.214  9.680  1.00 27.99  ? 441 ASN A CA    1 
ATOM   3009 C C     . ASN A 1 411 ? 47.316  0.437   8.309  1.00 31.84  ? 441 ASN A C     1 
ATOM   3010 O O     . ASN A 1 411 ? 48.198  0.265   7.471  1.00 48.39  ? 441 ASN A O     1 
ATOM   3011 C CB    . ASN A 1 411 ? 48.554  0.412   10.470 1.00 25.78  ? 441 ASN A CB    1 
ATOM   3012 C CG    . ASN A 1 411 ? 48.715  -0.204  11.836 1.00 34.64  ? 441 ASN A CG    1 
ATOM   3013 O OD1   . ASN A 1 411 ? 47.846  -0.073  12.691 1.00 39.95  ? 441 ASN A OD1   1 
ATOM   3014 N ND2   . ASN A 1 411 ? 49.832  -0.880  12.050 1.00 39.38  ? 441 ASN A ND2   1 
ATOM   3015 N N     . MET A 1 412 ? 46.251  1.195   8.088  1.00 27.38  ? 442 MET A N     1 
ATOM   3016 C CA    . MET A 1 412 ? 46.043  1.862   6.813  1.00 28.92  ? 442 MET A CA    1 
ATOM   3017 C C     . MET A 1 412 ? 46.615  3.280   6.835  1.00 36.01  ? 442 MET A C     1 
ATOM   3018 O O     . MET A 1 412 ? 46.111  4.150   7.542  1.00 48.73  ? 442 MET A O     1 
ATOM   3019 C CB    . MET A 1 412 ? 44.554  1.897   6.479  1.00 32.43  ? 442 MET A CB    1 
ATOM   3020 C CG    . MET A 1 412 ? 43.850  0.551   6.577  1.00 32.71  ? 442 MET A CG    1 
ATOM   3021 S SD    . MET A 1 412 ? 44.384  -0.646  5.331  1.00 51.59  ? 442 MET A SD    1 
ATOM   3022 C CE    . MET A 1 412 ? 42.913  -1.647  5.177  1.00 43.07  ? 442 MET A CE    1 
ATOM   3023 N N     . VAL A 1 413 ? 47.676  3.502   6.065  1.00 34.07  ? 443 VAL A N     1 
ATOM   3024 C CA    . VAL A 1 413 ? 48.282  4.828   5.941  1.00 41.92  ? 443 VAL A CA    1 
ATOM   3025 C C     . VAL A 1 413 ? 47.865  5.480   4.626  1.00 49.75  ? 443 VAL A C     1 
ATOM   3026 O O     . VAL A 1 413 ? 48.006  4.880   3.563  1.00 43.13  ? 443 VAL A O     1 
ATOM   3027 C CB    . VAL A 1 413 ? 49.816  4.753   5.945  1.00 39.20  ? 443 VAL A CB    1 
ATOM   3028 C CG1   . VAL A 1 413 ? 50.405  6.148   6.024  1.00 43.45  ? 443 VAL A CG1   1 
ATOM   3029 C CG2   . VAL A 1 413 ? 50.307  3.897   7.086  1.00 32.13  ? 443 VAL A CG2   1 
ATOM   3030 N N     . ASP A 1 414 ? 47.369  6.712   4.690  1.00 60.56  ? 444 ASP A N     1 
ATOM   3031 C CA    . ASP A 1 414 ? 46.850  7.367   3.491  1.00 66.74  ? 444 ASP A CA    1 
ATOM   3032 C C     . ASP A 1 414 ? 47.361  8.794   3.283  1.00 68.51  ? 444 ASP A C     1 
ATOM   3033 O O     . ASP A 1 414 ? 46.761  9.566   2.535  1.00 73.66  ? 444 ASP A O     1 
ATOM   3034 C CB    . ASP A 1 414 ? 45.318  7.353   3.490  1.00 70.69  ? 444 ASP A CB    1 
ATOM   3035 C CG    . ASP A 1 414 ? 44.724  8.284   4.532  1.00 80.73  ? 444 ASP A CG    1 
ATOM   3036 O OD1   . ASP A 1 414 ? 43.565  8.716   4.344  1.00 87.48  ? 444 ASP A OD1   1 
ATOM   3037 O OD2   . ASP A 1 414 ? 45.414  8.587   5.532  1.00 74.53  ? 444 ASP A OD2   1 
ATOM   3038 N N     . SER A 1 415 ? 48.466  9.140   3.935  1.00 59.22  ? 445 SER A N     1 
ATOM   3039 C CA    . SER A 1 415 ? 49.060  10.461  3.768  1.00 63.46  ? 445 SER A CA    1 
ATOM   3040 C C     . SER A 1 415 ? 50.460  10.518  4.364  1.00 69.78  ? 445 SER A C     1 
ATOM   3041 O O     . SER A 1 415 ? 50.816  9.693   5.204  1.00 70.28  ? 445 SER A O     1 
ATOM   3042 C CB    . SER A 1 415 ? 48.181  11.532  4.416  1.00 73.97  ? 445 SER A CB    1 
ATOM   3043 O OG    . SER A 1 415 ? 48.323  11.529  5.826  1.00 69.74  ? 445 SER A OG    1 
ATOM   3044 N N     . LYS A 1 416 ? 51.250  11.495  3.924  1.00 73.38  ? 446 LYS A N     1 
ATOM   3045 C CA    . LYS A 1 416 ? 52.581  11.709  4.481  1.00 67.53  ? 446 LYS A CA    1 
ATOM   3046 C C     . LYS A 1 416 ? 52.446  11.930  5.980  1.00 61.85  ? 446 LYS A C     1 
ATOM   3047 O O     . LYS A 1 416 ? 53.306  11.531  6.763  1.00 60.82  ? 446 LYS A O     1 
ATOM   3048 C CB    . LYS A 1 416 ? 53.267  12.913  3.823  1.00 51.57  ? 446 LYS A CB    1 
ATOM   3049 N N     . HIS A 1 417 ? 51.343  12.556  6.372  1.00 53.94  ? 447 HIS A N     1 
ATOM   3050 C CA    . HIS A 1 417 ? 51.101  12.863  7.770  1.00 65.64  ? 447 HIS A CA    1 
ATOM   3051 C C     . HIS A 1 417 ? 50.817  11.607  8.583  1.00 60.94  ? 447 HIS A C     1 
ATOM   3052 O O     . HIS A 1 417 ? 51.457  11.365  9.605  1.00 74.96  ? 447 HIS A O     1 
ATOM   3053 C CB    . HIS A 1 417 ? 49.948  13.856  7.911  1.00 79.43  ? 447 HIS A CB    1 
ATOM   3054 C CG    . HIS A 1 417 ? 49.628  14.207  9.328  1.00 92.53  ? 447 HIS A CG    1 
ATOM   3055 N ND1   . HIS A 1 417 ? 48.353  14.126  9.847  1.00 100.94 ? 447 HIS A ND1   1 
ATOM   3056 C CD2   . HIS A 1 417 ? 50.421  14.626  10.343 1.00 98.41  ? 447 HIS A CD2   1 
ATOM   3057 C CE1   . HIS A 1 417 ? 48.373  14.489  11.117 1.00 103.91 ? 447 HIS A CE1   1 
ATOM   3058 N NE2   . HIS A 1 417 ? 49.616  14.796  11.443 1.00 102.37 ? 447 HIS A NE2   1 
ATOM   3059 N N     . SER A 1 418 ? 49.857  10.808  8.130  1.00 45.89  ? 448 SER A N     1 
ATOM   3060 C CA    . SER A 1 418 ? 49.495  9.595   8.849  1.00 55.73  ? 448 SER A CA    1 
ATOM   3061 C C     . SER A 1 418 ? 50.629  8.581   8.768  1.00 55.80  ? 448 SER A C     1 
ATOM   3062 O O     . SER A 1 418 ? 50.737  7.688   9.609  1.00 60.27  ? 448 SER A O     1 
ATOM   3063 C CB    . SER A 1 418 ? 48.171  9.010   8.340  1.00 63.45  ? 448 SER A CB    1 
ATOM   3064 O OG    . SER A 1 418 ? 48.180  8.843   6.935  1.00 80.76  ? 448 SER A OG    1 
ATOM   3065 N N     . MET A 1 419 ? 51.483  8.739   7.762  1.00 55.93  ? 449 MET A N     1 
ATOM   3066 C CA    . MET A 1 419 ? 52.697  7.938   7.664  1.00 59.66  ? 449 MET A CA    1 
ATOM   3067 C C     . MET A 1 419 ? 53.654  8.298   8.795  1.00 60.95  ? 449 MET A C     1 
ATOM   3068 O O     . MET A 1 419 ? 54.254  7.423   9.422  1.00 54.33  ? 449 MET A O     1 
ATOM   3069 C CB    . MET A 1 419 ? 53.382  8.149   6.314  1.00 59.20  ? 449 MET A CB    1 
ATOM   3070 C CG    . MET A 1 419 ? 54.574  7.238   6.110  1.00 53.73  ? 449 MET A CG    1 
ATOM   3071 S SD    . MET A 1 419 ? 54.090  5.508   6.209  1.00 83.72  ? 449 MET A SD    1 
ATOM   3072 C CE    . MET A 1 419 ? 55.432  4.834   7.186  1.00 67.44  ? 449 MET A CE    1 
ATOM   3073 N N     . ASN A 1 420 ? 53.793  9.594   9.049  1.00 68.68  ? 450 ASN A N     1 
ATOM   3074 C CA    . ASN A 1 420 ? 54.573  10.059  10.183 1.00 80.14  ? 450 ASN A CA    1 
ATOM   3075 C C     . ASN A 1 420 ? 54.075  9.408   11.467 1.00 71.64  ? 450 ASN A C     1 
ATOM   3076 O O     . ASN A 1 420 ? 54.857  8.849   12.231 1.00 68.79  ? 450 ASN A O     1 
ATOM   3077 C CB    . ASN A 1 420 ? 54.499  11.582  10.302 1.00 98.38  ? 450 ASN A CB    1 
ATOM   3078 C CG    . ASN A 1 420 ? 55.406  12.126  11.389 1.00 114.61 ? 450 ASN A CG    1 
ATOM   3079 O OD1   . ASN A 1 420 ? 56.559  11.710  11.519 1.00 116.83 ? 450 ASN A OD1   1 
ATOM   3080 N ND2   . ASN A 1 420 ? 54.889  13.065  12.175 1.00 120.19 ? 450 ASN A ND2   1 
ATOM   3081 N N     . ILE A 1 421 ? 52.766  9.468   11.690 1.00 71.29  ? 451 ILE A N     1 
ATOM   3082 C CA    . ILE A 1 421 ? 52.170  8.880   12.886 1.00 71.71  ? 451 ILE A CA    1 
ATOM   3083 C C     . ILE A 1 421 ? 52.591  7.427   13.067 1.00 64.20  ? 451 ILE A C     1 
ATOM   3084 O O     . ILE A 1 421 ? 52.970  7.013   14.161 1.00 53.09  ? 451 ILE A O     1 
ATOM   3085 C CB    . ILE A 1 421 ? 50.635  8.944   12.848 1.00 64.40  ? 451 ILE A CB    1 
ATOM   3086 C CG1   . ILE A 1 421 ? 50.161  10.395  12.882 1.00 70.15  ? 451 ILE A CG1   1 
ATOM   3087 C CG2   . ILE A 1 421 ? 50.042  8.166   14.015 1.00 52.92  ? 451 ILE A CG2   1 
ATOM   3088 C CD1   . ILE A 1 421 ? 48.663  10.541  12.728 1.00 76.14  ? 451 ILE A CD1   1 
ATOM   3089 N N     . LEU A 1 422 ? 52.519  6.657   11.988 1.00 62.55  ? 452 LEU A N     1 
ATOM   3090 C CA    . LEU A 1 422 ? 52.888  5.250   12.037 1.00 59.08  ? 452 LEU A CA    1 
ATOM   3091 C C     . LEU A 1 422 ? 54.359  5.077   12.404 1.00 69.46  ? 452 LEU A C     1 
ATOM   3092 O O     . LEU A 1 422 ? 54.709  4.212   13.209 1.00 70.93  ? 452 LEU A O     1 
ATOM   3093 C CB    . LEU A 1 422 ? 52.617  4.582   10.695 1.00 47.53  ? 452 LEU A CB    1 
ATOM   3094 C CG    . LEU A 1 422 ? 52.979  3.102   10.677 1.00 51.77  ? 452 LEU A CG    1 
ATOM   3095 C CD1   . LEU A 1 422 ? 51.762  2.264   11.036 1.00 52.24  ? 452 LEU A CD1   1 
ATOM   3096 C CD2   . LEU A 1 422 ? 53.516  2.721   9.318  1.00 58.24  ? 452 LEU A CD2   1 
ATOM   3097 N N     . ASN A 1 423 ? 55.217  5.897   11.802 1.00 65.37  ? 453 ASN A N     1 
ATOM   3098 C CA    . ASN A 1 423 ? 56.647  5.856   12.099 1.00 66.80  ? 453 ASN A CA    1 
ATOM   3099 C C     . ASN A 1 423 ? 56.941  6.219   13.552 1.00 64.19  ? 453 ASN A C     1 
ATOM   3100 O O     . ASN A 1 423 ? 57.897  5.719   14.143 1.00 68.63  ? 453 ASN A O     1 
ATOM   3101 C CB    . ASN A 1 423 ? 57.428  6.776   11.156 1.00 63.64  ? 453 ASN A CB    1 
ATOM   3102 C CG    . ASN A 1 423 ? 57.606  6.179   9.770  1.00 67.74  ? 453 ASN A CG    1 
ATOM   3103 O OD1   . ASN A 1 423 ? 57.602  4.960   9.601  1.00 72.32  ? 453 ASN A OD1   1 
ATOM   3104 N ND2   . ASN A 1 423 ? 57.772  7.039   8.771  1.00 68.79  ? 453 ASN A ND2   1 
ATOM   3105 N N     . ARG A 1 424 ? 56.111  7.093   14.116 1.00 56.50  ? 454 ARG A N     1 
ATOM   3106 C CA    . ARG A 1 424 ? 56.246  7.514   15.507 1.00 69.48  ? 454 ARG A CA    1 
ATOM   3107 C C     . ARG A 1 424 ? 55.684  6.459   16.456 1.00 75.89  ? 454 ARG A C     1 
ATOM   3108 O O     . ARG A 1 424 ? 56.086  6.377   17.617 1.00 84.50  ? 454 ARG A O     1 
ATOM   3109 C CB    . ARG A 1 424 ? 55.526  8.844   15.735 1.00 76.58  ? 454 ARG A CB    1 
ATOM   3110 C CG    . ARG A 1 424 ? 56.046  10.004  14.897 1.00 73.60  ? 454 ARG A CG    1 
ATOM   3111 C CD    . ARG A 1 424 ? 55.254  11.270  15.189 1.00 71.93  ? 454 ARG A CD    1 
ATOM   3112 N NE    . ARG A 1 424 ? 55.094  11.471  16.627 1.00 84.40  ? 454 ARG A NE    1 
ATOM   3113 C CZ    . ARG A 1 424 ? 54.369  12.442  17.173 1.00 88.69  ? 454 ARG A CZ    1 
ATOM   3114 N NH1   . ARG A 1 424 ? 53.729  13.310  16.400 1.00 91.90  ? 454 ARG A NH1   1 
ATOM   3115 N NH2   . ARG A 1 424 ? 54.281  12.542  18.494 1.00 82.55  ? 454 ARG A NH2   1 
ATOM   3116 N N     . ILE A 1 425 ? 54.739  5.667   15.960 1.00 70.25  ? 455 ILE A N     1 
ATOM   3117 C CA    . ILE A 1 425 ? 54.212  4.542   16.719 1.00 69.02  ? 455 ILE A CA    1 
ATOM   3118 C C     . ILE A 1 425 ? 55.236  3.418   16.702 1.00 69.20  ? 455 ILE A C     1 
ATOM   3119 O O     . ILE A 1 425 ? 55.449  2.738   17.704 1.00 66.74  ? 455 ILE A O     1 
ATOM   3120 C CB    . ILE A 1 425 ? 52.888  4.020   16.126 1.00 58.03  ? 455 ILE A CB    1 
ATOM   3121 C CG1   . ILE A 1 425 ? 51.818  5.110   16.164 1.00 64.62  ? 455 ILE A CG1   1 
ATOM   3122 C CG2   . ILE A 1 425 ? 52.412  2.791   16.886 1.00 41.41  ? 455 ILE A CG2   1 
ATOM   3123 C CD1   . ILE A 1 425 ? 50.499  4.688   15.556 1.00 70.91  ? 455 ILE A CD1   1 
ATOM   3124 N N     . GLN A 1 426 ? 55.867  3.230   15.548 1.00 63.67  ? 456 GLN A N     1 
ATOM   3125 C CA    . GLN A 1 426 ? 56.904  2.224   15.399 1.00 54.80  ? 456 GLN A CA    1 
ATOM   3126 C C     . GLN A 1 426 ? 58.184  2.704   16.075 1.00 64.64  ? 456 GLN A C     1 
ATOM   3127 O O     . GLN A 1 426 ? 59.119  1.932   16.277 1.00 75.96  ? 456 GLN A O     1 
ATOM   3128 C CB    . GLN A 1 426 ? 57.155  1.959   13.922 1.00 47.03  ? 456 GLN A CB    1 
ATOM   3129 C CG    . GLN A 1 426 ? 58.012  0.749   13.639 1.00 56.36  ? 456 GLN A CG    1 
ATOM   3130 C CD    . GLN A 1 426 ? 58.604  0.793   12.248 1.00 71.32  ? 456 GLN A CD    1 
ATOM   3131 O OE1   . GLN A 1 426 ? 58.392  -0.112  11.440 1.00 67.79  ? 456 GLN A OE1   1 
ATOM   3132 N NE2   . GLN A 1 426 ? 59.340  1.859   11.955 1.00 82.84  ? 456 GLN A NE2   1 
ATOM   3133 N N     . GLU A 1 427 ? 58.216  3.988   16.419 1.00 60.32  ? 457 GLU A N     1 
ATOM   3134 C CA    . GLU A 1 427 ? 59.332  4.560   17.164 1.00 72.86  ? 457 GLU A CA    1 
ATOM   3135 C C     . GLU A 1 427 ? 59.141  4.370   18.675 1.00 84.90  ? 457 GLU A C     1 
ATOM   3136 O O     . GLU A 1 427 ? 60.092  4.045   19.390 1.00 89.33  ? 457 GLU A O     1 
ATOM   3137 C CB    . GLU A 1 427 ? 59.523  6.041   16.803 1.00 81.57  ? 457 GLU A CB    1 
ATOM   3138 C CG    . GLU A 1 427 ? 60.298  6.867   17.829 1.00 102.93 ? 457 GLU A CG    1 
ATOM   3139 C CD    . GLU A 1 427 ? 59.386  7.615   18.799 1.00 122.75 ? 457 GLU A CD    1 
ATOM   3140 O OE1   . GLU A 1 427 ? 58.275  8.019   18.390 1.00 127.63 ? 457 GLU A OE1   1 
ATOM   3141 O OE2   . GLU A 1 427 ? 59.783  7.808   19.969 1.00 124.58 ? 457 GLU A OE2   1 
ATOM   3142 N N     . HIS A 1 428 ? 57.909  4.561   19.149 1.00 78.98  ? 458 HIS A N     1 
ATOM   3143 C CA    . HIS A 1 428 ? 57.585  4.384   20.565 1.00 83.47  ? 458 HIS A CA    1 
ATOM   3144 C C     . HIS A 1 428 ? 57.893  2.956   21.004 1.00 84.09  ? 458 HIS A C     1 
ATOM   3145 O O     . HIS A 1 428 ? 58.774  2.725   21.831 1.00 85.83  ? 458 HIS A O     1 
ATOM   3146 C CB    . HIS A 1 428 ? 56.115  4.715   20.826 1.00 88.03  ? 458 HIS A CB    1 
ATOM   3147 C CG    . HIS A 1 428 ? 55.738  4.692   22.276 1.00 97.84  ? 458 HIS A CG    1 
ATOM   3148 N ND1   . HIS A 1 428 ? 55.916  5.775   23.108 1.00 99.94  ? 458 HIS A ND1   1 
ATOM   3149 C CD2   . HIS A 1 428 ? 55.185  3.718   23.037 1.00 103.29 ? 458 HIS A CD2   1 
ATOM   3150 C CE1   . HIS A 1 428 ? 55.492  5.469   24.322 1.00 100.86 ? 458 HIS A CE1   1 
ATOM   3151 N NE2   . HIS A 1 428 ? 55.043  4.227   24.306 1.00 100.01 ? 458 HIS A NE2   1 
ATOM   3152 N N     . PHE A 1 429 ? 57.151  2.001   20.452 1.00 83.76  ? 459 PHE A N     1 
ATOM   3153 C CA    . PHE A 1 429 ? 57.498  0.595   20.587 1.00 70.78  ? 459 PHE A CA    1 
ATOM   3154 C C     . PHE A 1 429 ? 58.730  0.371   19.724 1.00 84.60  ? 459 PHE A C     1 
ATOM   3155 O O     . PHE A 1 429 ? 58.948  1.093   18.753 1.00 90.48  ? 459 PHE A O     1 
ATOM   3156 C CB    . PHE A 1 429 ? 56.352  -0.295  20.104 1.00 48.30  ? 459 PHE A CB    1 
ATOM   3157 C CG    . PHE A 1 429 ? 54.997  0.113   20.625 1.00 64.96  ? 459 PHE A CG    1 
ATOM   3158 C CD1   . PHE A 1 429 ? 54.524  -0.374  21.837 1.00 65.87  ? 459 PHE A CD1   1 
ATOM   3159 C CD2   . PHE A 1 429 ? 54.191  0.978   19.898 1.00 63.44  ? 459 PHE A CD2   1 
ATOM   3160 C CE1   . PHE A 1 429 ? 53.277  -0.003  22.312 1.00 65.38  ? 459 PHE A CE1   1 
ATOM   3161 C CE2   . PHE A 1 429 ? 52.941  1.354   20.371 1.00 60.08  ? 459 PHE A CE2   1 
ATOM   3162 C CZ    . PHE A 1 429 ? 52.485  0.861   21.578 1.00 65.72  ? 459 PHE A CZ    1 
ATOM   3163 N N     . ASN A 1 430 ? 59.543  -0.618  20.070 1.00 94.03  ? 460 ASN A N     1 
ATOM   3164 C CA    . ASN A 1 430 ? 60.766  -0.874  19.316 1.00 93.83  ? 460 ASN A CA    1 
ATOM   3165 C C     . ASN A 1 430 ? 60.629  -2.084  18.400 1.00 86.67  ? 460 ASN A C     1 
ATOM   3166 O O     . ASN A 1 430 ? 61.572  -2.856  18.227 1.00 80.65  ? 460 ASN A O     1 
ATOM   3167 C CB    . ASN A 1 430 ? 61.953  -1.032  20.266 1.00 98.95  ? 460 ASN A CB    1 
ATOM   3168 C CG    . ASN A 1 430 ? 62.119  0.163   21.182 1.00 110.21 ? 460 ASN A CG    1 
ATOM   3169 O OD1   . ASN A 1 430 ? 61.882  0.074   22.387 1.00 116.30 ? 460 ASN A OD1   1 
ATOM   3170 N ND2   . ASN A 1 430 ? 62.504  1.299   20.609 1.00 109.29 ? 460 ASN A ND2   1 
ATOM   3171 N N     . LYS A 1 431 ? 59.442  -2.235  17.818 1.00 84.04  ? 461 LYS A N     1 
ATOM   3172 C CA    . LYS A 1 431 ? 59.147  -3.347  16.922 1.00 83.57  ? 461 LYS A CA    1 
ATOM   3173 C C     . LYS A 1 431 ? 58.683  -2.818  15.565 1.00 79.88  ? 461 LYS A C     1 
ATOM   3174 O O     . LYS A 1 431 ? 57.981  -1.810  15.491 1.00 78.85  ? 461 LYS A O     1 
ATOM   3175 C CB    . LYS A 1 431 ? 58.094  -4.268  17.547 1.00 77.19  ? 461 LYS A CB    1 
ATOM   3176 C CG    . LYS A 1 431 ? 58.348  -4.566  19.025 1.00 85.84  ? 461 LYS A CG    1 
ATOM   3177 C CD    . LYS A 1 431 ? 57.563  -5.774  19.527 1.00 81.05  ? 461 LYS A CD    1 
ATOM   3178 C CE    . LYS A 1 431 ? 57.984  -7.044  18.799 1.00 86.35  ? 461 LYS A CE    1 
ATOM   3179 N NZ    . LYS A 1 431 ? 59.462  -7.252  18.814 1.00 85.40  ? 461 LYS A NZ    1 
ATOM   3180 N N     . LYS A 1 432 ? 59.081  -3.496  14.492 1.00 74.63  ? 462 LYS A N     1 
ATOM   3181 C CA    . LYS A 1 432 ? 58.818  -2.994  13.142 1.00 81.80  ? 462 LYS A CA    1 
ATOM   3182 C C     . LYS A 1 432 ? 57.419  -3.298  12.622 1.00 71.37  ? 462 LYS A C     1 
ATOM   3183 O O     . LYS A 1 432 ? 56.895  -4.397  12.809 1.00 68.88  ? 462 LYS A O     1 
ATOM   3184 C CB    . LYS A 1 432 ? 59.852  -3.508  12.130 1.00 74.59  ? 462 LYS A CB    1 
ATOM   3185 C CG    . LYS A 1 432 ? 59.969  -2.604  10.910 1.00 74.97  ? 462 LYS A CG    1 
ATOM   3186 C CD    . LYS A 1 432 ? 60.698  -3.250  9.746  1.00 85.90  ? 462 LYS A CD    1 
ATOM   3187 C CE    . LYS A 1 432 ? 60.988  -2.218  8.665  1.00 88.30  ? 462 LYS A CE    1 
ATOM   3188 N NZ    . LYS A 1 432 ? 59.822  -1.309  8.436  1.00 88.95  ? 462 LYS A NZ    1 
ATOM   3189 N N     . ILE A 1 433 ? 56.833  -2.306  11.958 1.00 57.85  ? 463 ILE A N     1 
ATOM   3190 C CA    . ILE A 1 433 ? 55.589  -2.495  11.232 1.00 51.48  ? 463 ILE A CA    1 
ATOM   3191 C C     . ILE A 1 433 ? 55.925  -2.755  9.769  1.00 47.24  ? 463 ILE A C     1 
ATOM   3192 O O     . ILE A 1 433 ? 56.205  -1.833  9.002  1.00 51.60  ? 463 ILE A O     1 
ATOM   3193 C CB    . ILE A 1 433 ? 54.656  -1.277  11.374 1.00 54.15  ? 463 ILE A CB    1 
ATOM   3194 C CG1   . ILE A 1 433 ? 54.477  -0.924  12.854 1.00 54.03  ? 463 ILE A CG1   1 
ATOM   3195 C CG2   . ILE A 1 433 ? 53.309  -1.560  10.730 1.00 53.39  ? 463 ILE A CG2   1 
ATOM   3196 C CD1   . ILE A 1 433 ? 53.603  0.281   13.097 1.00 55.66  ? 463 ILE A CD1   1 
ATOM   3197 N N     . GLU A 1 434 ? 55.923  -4.030  9.400  1.00 43.87  ? 464 GLU A N     1 
ATOM   3198 C CA    . GLU A 1 434 ? 56.329  -4.452  8.067  1.00 39.64  ? 464 GLU A CA    1 
ATOM   3199 C C     . GLU A 1 434 ? 55.380  -3.939  6.983  1.00 45.75  ? 464 GLU A C     1 
ATOM   3200 O O     . GLU A 1 434 ? 54.158  -3.998  7.127  1.00 49.69  ? 464 GLU A O     1 
ATOM   3201 C CB    . GLU A 1 434 ? 56.429  -5.978  8.010  1.00 46.79  ? 464 GLU A CB    1 
ATOM   3202 C CG    . GLU A 1 434 ? 56.960  -6.537  6.699  1.00 60.75  ? 464 GLU A CG    1 
ATOM   3203 C CD    . GLU A 1 434 ? 57.005  -8.055  6.696  1.00 72.18  ? 464 GLU A CD    1 
ATOM   3204 O OE1   . GLU A 1 434 ? 56.583  -8.665  7.705  1.00 77.02  ? 464 GLU A OE1   1 
ATOM   3205 O OE2   . GLU A 1 434 ? 57.458  -8.640  5.688  1.00 65.08  ? 464 GLU A OE2   1 
ATOM   3206 N N     . ARG A 1 435 ? 55.958  -3.432  5.899  1.00 49.75  ? 465 ARG A N     1 
ATOM   3207 C CA    . ARG A 1 435 ? 55.186  -2.932  4.771  1.00 57.81  ? 465 ARG A CA    1 
ATOM   3208 C C     . ARG A 1 435 ? 54.422  -4.060  4.087  1.00 51.85  ? 465 ARG A C     1 
ATOM   3209 O O     . ARG A 1 435 ? 54.948  -5.149  3.862  1.00 47.10  ? 465 ARG A O     1 
ATOM   3210 C CB    . ARG A 1 435 ? 56.103  -2.239  3.765  1.00 70.99  ? 465 ARG A CB    1 
ATOM   3211 C CG    . ARG A 1 435 ? 55.429  -1.865  2.458  1.00 74.30  ? 465 ARG A CG    1 
ATOM   3212 C CD    . ARG A 1 435 ? 54.800  -0.486  2.529  1.00 81.74  ? 465 ARG A CD    1 
ATOM   3213 N NE    . ARG A 1 435 ? 54.101  -0.143  1.292  1.00 93.17  ? 465 ARG A NE    1 
ATOM   3214 C CZ    . ARG A 1 435 ? 54.682  0.394   0.222  1.00 91.43  ? 465 ARG A CZ    1 
ATOM   3215 N NH1   . ARG A 1 435 ? 55.982  0.653   0.228  1.00 92.33  ? 465 ARG A NH1   1 
ATOM   3216 N NH2   . ARG A 1 435 ? 53.960  0.671   -0.857 1.00 85.37  ? 465 ARG A NH2   1 
ATOM   3217 N N     . LEU A 1 436 ? 53.170  -3.786  3.758  1.00 52.48  ? 466 LEU A N     1 
ATOM   3218 C CA    . LEU A 1 436 ? 52.325  -4.771  3.112  1.00 52.90  ? 466 LEU A CA    1 
ATOM   3219 C C     . LEU A 1 436 ? 51.812  -4.188  1.801  1.00 52.75  ? 466 LEU A C     1 
ATOM   3220 O O     . LEU A 1 436 ? 51.121  -3.169  1.796  1.00 40.62  ? 466 LEU A O     1 
ATOM   3221 C CB    . LEU A 1 436 ? 51.162  -5.132  4.031  1.00 47.06  ? 466 LEU A CB    1 
ATOM   3222 C CG    . LEU A 1 436 ? 50.370  -6.378  3.660  1.00 41.73  ? 466 LEU A CG    1 
ATOM   3223 C CD1   . LEU A 1 436 ? 51.279  -7.592  3.691  1.00 46.79  ? 466 LEU A CD1   1 
ATOM   3224 C CD2   . LEU A 1 436 ? 49.191  -6.556  4.598  1.00 30.82  ? 466 LEU A CD2   1 
ATOM   3225 N N     . ASP A 1 437 ? 52.174  -4.819  0.688  1.00 61.20  ? 467 ASP A N     1 
ATOM   3226 C CA    . ASP A 1 437 ? 51.746  -4.348  -0.623 1.00 61.00  ? 467 ASP A CA    1 
ATOM   3227 C C     . ASP A 1 437 ? 50.303  -4.770  -0.892 1.00 65.49  ? 467 ASP A C     1 
ATOM   3228 O O     . ASP A 1 437 ? 49.946  -5.937  -0.732 1.00 49.45  ? 467 ASP A O     1 
ATOM   3229 C CB    . ASP A 1 437 ? 52.679  -4.870  -1.714 1.00 65.23  ? 467 ASP A CB    1 
ATOM   3230 C CG    . ASP A 1 437 ? 52.460  -4.179  -3.051 1.00 81.76  ? 467 ASP A CG    1 
ATOM   3231 O OD1   . ASP A 1 437 ? 51.289  -3.947  -3.420 1.00 86.05  ? 467 ASP A OD1   1 
ATOM   3232 O OD2   . ASP A 1 437 ? 53.461  -3.873  -3.735 1.00 88.04  ? 467 ASP A OD2   1 
ATOM   3233 N N     . THR A 1 438 ? 49.481  -3.808  -1.304 1.00 86.10  ? 468 THR A N     1 
ATOM   3234 C CA    . THR A 1 438 ? 48.043  -4.016  -1.469 1.00 94.66  ? 468 THR A CA    1 
ATOM   3235 C C     . THR A 1 438 ? 47.689  -5.305  -2.217 1.00 90.77  ? 468 THR A C     1 
ATOM   3236 O O     . THR A 1 438 ? 46.853  -6.086  -1.760 1.00 81.50  ? 468 THR A O     1 
ATOM   3237 C CB    . THR A 1 438 ? 47.383  -2.819  -2.195 1.00 95.24  ? 468 THR A CB    1 
ATOM   3238 O OG1   . THR A 1 438 ? 47.882  -1.586  -1.657 1.00 98.93  ? 468 THR A OG1   1 
ATOM   3239 C CG2   . THR A 1 438 ? 45.868  -2.868  -2.043 1.00 81.55  ? 468 THR A CG2   1 
ATOM   3240 N N     . ASP A 1 439 ? 48.326  -5.520  -3.364 1.00 92.61  ? 469 ASP A N     1 
ATOM   3241 C CA    . ASP A 1 439 ? 47.992  -6.651  -4.224 1.00 99.24  ? 469 ASP A CA    1 
ATOM   3242 C C     . ASP A 1 439 ? 48.785  -7.902  -3.872 1.00 93.39  ? 469 ASP A C     1 
ATOM   3243 O O     . ASP A 1 439 ? 48.228  -8.996  -3.787 1.00 95.33  ? 469 ASP A O     1 
ATOM   3244 C CB    . ASP A 1 439 ? 48.202  -6.285  -5.692 1.00 108.48 ? 469 ASP A CB    1 
ATOM   3245 C CG    . ASP A 1 439 ? 47.470  -5.016  -6.081 1.00 112.90 ? 469 ASP A CG    1 
ATOM   3246 O OD1   . ASP A 1 439 ? 46.529  -5.099  -6.898 1.00 115.23 ? 469 ASP A OD1   1 
ATOM   3247 O OD2   . ASP A 1 439 ? 47.828  -3.939  -5.558 1.00 111.12 ? 469 ASP A OD2   1 
ATOM   3248 N N     . ASP A 1 440 ? 50.088  -7.735  -3.677 1.00 88.05  ? 470 ASP A N     1 
ATOM   3249 C CA    . ASP A 1 440 ? 50.939  -8.829  -3.228 1.00 94.65  ? 470 ASP A CA    1 
ATOM   3250 C C     . ASP A 1 440 ? 50.737  -9.089  -1.735 1.00 109.32 ? 470 ASP A C     1 
ATOM   3251 O O     . ASP A 1 440 ? 51.257  -8.354  -0.891 1.00 111.34 ? 470 ASP A O     1 
ATOM   3252 C CB    . ASP A 1 440 ? 52.406  -8.512  -3.518 1.00 92.51  ? 470 ASP A CB    1 
ATOM   3253 C CG    . ASP A 1 440 ? 53.358  -9.292  -2.633 1.00 97.19  ? 470 ASP A CG    1 
ATOM   3254 O OD1   . ASP A 1 440 ? 53.090  -10.482 -2.361 1.00 89.03  ? 470 ASP A OD1   1 
ATOM   3255 O OD2   . ASP A 1 440 ? 54.378  -8.709  -2.207 1.00 103.35 ? 470 ASP A OD2   1 
ATOM   3256 N N     . LEU A 1 441 ? 49.983  -10.137 -1.414 1.00 115.70 ? 471 LEU A N     1 
ATOM   3257 C CA    . LEU A 1 441 ? 49.675  -10.461 -0.020 1.00 111.88 ? 471 LEU A CA    1 
ATOM   3258 C C     . LEU A 1 441 ? 50.045  -11.899 0.354  1.00 112.86 ? 471 LEU A C     1 
ATOM   3259 O O     . LEU A 1 441 ? 49.460  -12.478 1.272  1.00 106.25 ? 471 LEU A O     1 
ATOM   3260 C CB    . LEU A 1 441 ? 48.194  -10.206 0.284  1.00 96.89  ? 471 LEU A CB    1 
ATOM   3261 C CG    . LEU A 1 441 ? 47.735  -8.747  0.319  1.00 78.61  ? 471 LEU A CG    1 
ATOM   3262 C CD1   . LEU A 1 441 ? 46.243  -8.644  0.612  1.00 64.32  ? 471 LEU A CD1   1 
ATOM   3263 C CD2   . LEU A 1 441 ? 48.537  -7.981  1.348  1.00 79.71  ? 471 LEU A CD2   1 
ATOM   3264 N N     . ASP A 1 442 ? 51.015  -12.467 -0.356 1.00 113.20 ? 472 ASP A N     1 
ATOM   3265 C CA    . ASP A 1 442 ? 51.488  -13.817 -0.065 1.00 105.35 ? 472 ASP A CA    1 
ATOM   3266 C C     . ASP A 1 442 ? 51.996  -13.915 1.370  1.00 96.29  ? 472 ASP A C     1 
ATOM   3267 O O     . ASP A 1 442 ? 52.569  -14.928 1.771  1.00 91.86  ? 472 ASP A O     1 
ATOM   3268 C CB    . ASP A 1 442 ? 52.596  -14.224 -1.041 1.00 104.82 ? 472 ASP A CB    1 
ATOM   3269 C CG    . ASP A 1 442 ? 52.141  -14.198 -2.492 1.00 103.17 ? 472 ASP A CG    1 
ATOM   3270 O OD1   . ASP A 1 442 ? 50.925  -14.040 -2.744 1.00 100.59 ? 472 ASP A OD1   1 
ATOM   3271 O OD2   . ASP A 1 442 ? 53.002  -14.338 -3.386 1.00 101.12 ? 472 ASP A OD2   1 
ATOM   3272 N N     . GLU B 1 24  ? -1.134  13.565  31.997 1.00 96.08  ? 54  GLU B N     1 
ATOM   3273 C CA    . GLU B 1 24  ? -0.390  13.808  33.226 1.00 96.38  ? 54  GLU B CA    1 
ATOM   3274 C C     . GLU B 1 24  ? -0.326  12.549  34.088 1.00 103.65 ? 54  GLU B C     1 
ATOM   3275 O O     . GLU B 1 24  ? -1.322  12.161  34.701 1.00 106.60 ? 54  GLU B O     1 
ATOM   3276 C CB    . GLU B 1 24  ? -1.020  14.959  34.012 1.00 95.92  ? 54  GLU B CB    1 
ATOM   3277 N N     . ASP B 1 25  ? 0.852   11.924  34.120 1.00 104.26 ? 55  ASP B N     1 
ATOM   3278 C CA    . ASP B 1 25  ? 1.099   10.696  34.886 1.00 91.22  ? 55  ASP B CA    1 
ATOM   3279 C C     . ASP B 1 25  ? 0.556   9.439   34.197 1.00 86.58  ? 55  ASP B C     1 
ATOM   3280 O O     . ASP B 1 25  ? 0.699   8.329   34.713 1.00 74.95  ? 55  ASP B O     1 
ATOM   3281 C CB    . ASP B 1 25  ? 0.552   10.806  36.315 1.00 82.01  ? 55  ASP B CB    1 
ATOM   3282 N N     . ARG B 1 26  ? -0.059  9.620   33.030 1.00 89.29  ? 56  ARG B N     1 
ATOM   3283 C CA    . ARG B 1 26  ? -0.597  8.501   32.263 1.00 78.07  ? 56  ARG B CA    1 
ATOM   3284 C C     . ARG B 1 26  ? 0.531   7.652   31.690 1.00 63.36  ? 56  ARG B C     1 
ATOM   3285 O O     . ARG B 1 26  ? 0.369   6.451   31.476 1.00 59.16  ? 56  ARG B O     1 
ATOM   3286 C CB    . ARG B 1 26  ? -1.484  8.997   31.117 1.00 85.70  ? 56  ARG B CB    1 
ATOM   3287 C CG    . ARG B 1 26  ? -2.464  10.104  31.479 1.00 95.70  ? 56  ARG B CG    1 
ATOM   3288 C CD    . ARG B 1 26  ? -3.471  10.323  30.349 1.00 105.08 ? 56  ARG B CD    1 
ATOM   3289 N NE    . ARG B 1 26  ? -4.040  11.672  30.314 1.00 113.38 ? 56  ARG B NE    1 
ATOM   3290 C CZ    . ARG B 1 26  ? -4.409  12.381  31.379 1.00 121.79 ? 56  ARG B CZ    1 
ATOM   3291 N NH1   . ARG B 1 26  ? -4.302  11.883  32.605 1.00 116.28 ? 56  ARG B NH1   1 
ATOM   3292 N NH2   . ARG B 1 26  ? -4.908  13.598  31.213 1.00 131.01 ? 56  ARG B NH2   1 
ATOM   3293 N N     . ALA B 1 27  ? 1.671   8.289   31.439 1.00 52.59  ? 57  ALA B N     1 
ATOM   3294 C CA    . ALA B 1 27  ? 2.811   7.616   30.823 1.00 51.88  ? 57  ALA B CA    1 
ATOM   3295 C C     . ALA B 1 27  ? 3.429   6.565   31.738 1.00 49.13  ? 57  ALA B C     1 
ATOM   3296 O O     . ALA B 1 27  ? 3.989   5.576   31.268 1.00 59.22  ? 57  ALA B O     1 
ATOM   3297 C CB    . ALA B 1 27  ? 3.861   8.630   30.395 1.00 51.34  ? 57  ALA B CB    1 
ATOM   3298 N N     . ALA B 1 28  ? 3.337   6.784   33.044 1.00 39.29  ? 58  ALA B N     1 
ATOM   3299 C CA    . ALA B 1 28  ? 3.875   5.822   33.996 1.00 42.75  ? 58  ALA B CA    1 
ATOM   3300 C C     . ALA B 1 28  ? 2.955   4.612   34.114 1.00 43.17  ? 58  ALA B C     1 
ATOM   3301 O O     . ALA B 1 28  ? 3.417   3.484   34.282 1.00 35.77  ? 58  ALA B O     1 
ATOM   3302 C CB    . ALA B 1 28  ? 4.087   6.473   35.353 1.00 41.16  ? 58  ALA B CB    1 
ATOM   3303 N N     . GLN B 1 29  ? 1.651   4.851   34.019 1.00 51.85  ? 59  GLN B N     1 
ATOM   3304 C CA    . GLN B 1 29  ? 0.675   3.772   34.096 1.00 50.14  ? 59  GLN B CA    1 
ATOM   3305 C C     . GLN B 1 29  ? 0.794   2.841   32.895 1.00 46.18  ? 59  GLN B C     1 
ATOM   3306 O O     . GLN B 1 29  ? 0.756   1.619   33.039 1.00 45.06  ? 59  GLN B O     1 
ATOM   3307 C CB    . GLN B 1 29  ? -0.741  4.336   34.200 1.00 56.07  ? 59  GLN B CB    1 
ATOM   3308 C CG    . GLN B 1 29  ? -0.972  5.178   35.439 1.00 65.41  ? 59  GLN B CG    1 
ATOM   3309 C CD    . GLN B 1 29  ? -2.388  5.714   35.526 1.00 75.67  ? 59  GLN B CD    1 
ATOM   3310 O OE1   . GLN B 1 29  ? -3.236  5.411   34.685 1.00 81.62  ? 59  GLN B OE1   1 
ATOM   3311 N NE2   . GLN B 1 29  ? -2.650  6.518   36.548 1.00 70.84  ? 59  GLN B NE2   1 
ATOM   3312 N N     . SER B 1 30  ? 0.952   3.421   31.710 1.00 44.57  ? 60  SER B N     1 
ATOM   3313 C CA    . SER B 1 30  ? 1.144   2.628   30.500 1.00 44.81  ? 60  SER B CA    1 
ATOM   3314 C C     . SER B 1 30  ? 2.360   1.730   30.645 1.00 44.33  ? 60  SER B C     1 
ATOM   3315 O O     . SER B 1 30  ? 2.336   0.564   30.245 1.00 52.86  ? 60  SER B O     1 
ATOM   3316 C CB    . SER B 1 30  ? 1.311   3.534   29.281 1.00 53.58  ? 60  SER B CB    1 
ATOM   3317 O OG    . SER B 1 30  ? 0.146   4.313   29.070 1.00 79.75  ? 60  SER B OG    1 
ATOM   3318 N N     . LEU B 1 31  ? 3.421   2.280   31.230 1.00 34.69  ? 61  LEU B N     1 
ATOM   3319 C CA    . LEU B 1 31  ? 4.677   1.557   31.371 1.00 31.73  ? 61  LEU B CA    1 
ATOM   3320 C C     . LEU B 1 31  ? 4.562   0.391   32.343 1.00 35.50  ? 61  LEU B C     1 
ATOM   3321 O O     . LEU B 1 31  ? 4.912   -0.741  32.010 1.00 42.24  ? 61  LEU B O     1 
ATOM   3322 C CB    . LEU B 1 31  ? 5.789   2.498   31.812 1.00 36.12  ? 61  LEU B CB    1 
ATOM   3323 C CG    . LEU B 1 31  ? 7.148   1.823   31.983 1.00 32.78  ? 61  LEU B CG    1 
ATOM   3324 C CD1   . LEU B 1 31  ? 7.576   1.166   30.679 1.00 30.18  ? 61  LEU B CD1   1 
ATOM   3325 C CD2   . LEU B 1 31  ? 8.164   2.839   32.441 1.00 24.69  ? 61  LEU B CD2   1 
ATOM   3326 N N     . LEU B 1 32  ? 4.072   0.661   33.546 1.00 26.40  ? 62  LEU B N     1 
ATOM   3327 C CA    . LEU B 1 32  ? 3.861   -0.416  34.499 1.00 30.31  ? 62  LEU B CA    1 
ATOM   3328 C C     . LEU B 1 32  ? 2.941   -1.466  33.893 1.00 32.93  ? 62  LEU B C     1 
ATOM   3329 O O     . LEU B 1 32  ? 3.198   -2.663  33.992 1.00 38.87  ? 62  LEU B O     1 
ATOM   3330 C CB    . LEU B 1 32  ? 3.286   0.104   35.817 1.00 27.21  ? 62  LEU B CB    1 
ATOM   3331 C CG    . LEU B 1 32  ? 3.225   -0.984  36.891 1.00 33.39  ? 62  LEU B CG    1 
ATOM   3332 C CD1   . LEU B 1 32  ? 4.515   -1.810  36.870 1.00 22.05  ? 62  LEU B CD1   1 
ATOM   3333 C CD2   . LEU B 1 32  ? 2.933   -0.411  38.288 1.00 21.81  ? 62  LEU B CD2   1 
ATOM   3334 N N     . ASN B 1 33  ? 1.870   -1.013  33.252 1.00 32.42  ? 63  ASN B N     1 
ATOM   3335 C CA    . ASN B 1 33  ? 0.944   -1.936  32.610 1.00 39.98  ? 63  ASN B CA    1 
ATOM   3336 C C     . ASN B 1 33  ? 1.621   -2.809  31.555 1.00 45.98  ? 63  ASN B C     1 
ATOM   3337 O O     . ASN B 1 33  ? 1.425   -4.022  31.529 1.00 53.34  ? 63  ASN B O     1 
ATOM   3338 C CB    . ASN B 1 33  ? -0.258  -1.191  32.033 1.00 33.84  ? 63  ASN B CB    1 
ATOM   3339 C CG    . ASN B 1 33  ? -1.309  -0.901  33.083 1.00 39.11  ? 63  ASN B CG    1 
ATOM   3340 O OD1   . ASN B 1 33  ? -1.724  -1.796  33.811 1.00 48.09  ? 63  ASN B OD1   1 
ATOM   3341 N ND2   . ASN B 1 33  ? -1.742  0.351   33.170 1.00 32.46  ? 63  ASN B ND2   1 
ATOM   3342 N N     . LYS B 1 34  ? 2.430   -2.190  30.700 1.00 34.98  ? 64  LYS B N     1 
ATOM   3343 C CA    . LYS B 1 34  ? 3.222   -2.935  29.725 1.00 26.79  ? 64  LYS B CA    1 
ATOM   3344 C C     . LYS B 1 34  ? 4.214   -3.902  30.379 1.00 32.42  ? 64  LYS B C     1 
ATOM   3345 O O     . LYS B 1 34  ? 4.407   -5.021  29.912 1.00 45.64  ? 64  LYS B O     1 
ATOM   3346 C CB    . LYS B 1 34  ? 3.956   -1.978  28.779 1.00 31.99  ? 64  LYS B CB    1 
ATOM   3347 C CG    . LYS B 1 34  ? 3.125   -1.542  27.586 1.00 25.35  ? 64  LYS B CG    1 
ATOM   3348 C CD    . LYS B 1 34  ? 3.831   -0.492  26.755 1.00 62.90  ? 64  LYS B CD    1 
ATOM   3349 C CE    . LYS B 1 34  ? 3.080   -0.224  25.448 1.00 70.44  ? 64  LYS B CE    1 
ATOM   3350 N NZ    . LYS B 1 34  ? 3.130   -1.381  24.503 1.00 69.45  ? 64  LYS B NZ    1 
ATOM   3351 N N     . LEU B 1 35  ? 4.837   -3.481  31.472 1.00 33.26  ? 65  LEU B N     1 
ATOM   3352 C CA    . LEU B 1 35  ? 5.812   -4.339  32.136 1.00 25.30  ? 65  LEU B CA    1 
ATOM   3353 C C     . LEU B 1 35  ? 5.192   -5.584  32.766 1.00 32.79  ? 65  LEU B C     1 
ATOM   3354 O O     . LEU B 1 35  ? 5.864   -6.600  32.913 1.00 38.91  ? 65  LEU B O     1 
ATOM   3355 C CB    . LEU B 1 35  ? 6.612   -3.551  33.168 1.00 19.84  ? 65  LEU B CB    1 
ATOM   3356 C CG    . LEU B 1 35  ? 7.612   -2.563  32.576 1.00 30.36  ? 65  LEU B CG    1 
ATOM   3357 C CD1   . LEU B 1 35  ? 8.269   -1.743  33.671 1.00 31.35  ? 65  LEU B CD1   1 
ATOM   3358 C CD2   . LEU B 1 35  ? 8.644   -3.311  31.756 1.00 18.30  ? 65  LEU B CD2   1 
ATOM   3359 N N     . ILE B 1 36  ? 3.916   -5.511  33.135 1.00 44.00  ? 66  ILE B N     1 
ATOM   3360 C CA    . ILE B 1 36  ? 3.260   -6.643  33.789 1.00 40.39  ? 66  ILE B CA    1 
ATOM   3361 C C     . ILE B 1 36  ? 2.360   -7.458  32.855 1.00 42.43  ? 66  ILE B C     1 
ATOM   3362 O O     . ILE B 1 36  ? 1.867   -8.517  33.239 1.00 54.74  ? 66  ILE B O     1 
ATOM   3363 C CB    . ILE B 1 36  ? 2.467   -6.204  35.040 1.00 37.09  ? 66  ILE B CB    1 
ATOM   3364 C CG1   . ILE B 1 36  ? 1.281   -5.322  34.648 1.00 35.88  ? 66  ILE B CG1   1 
ATOM   3365 C CG2   . ILE B 1 36  ? 3.385   -5.483  36.022 1.00 29.94  ? 66  ILE B CG2   1 
ATOM   3366 C CD1   . ILE B 1 36  ? 0.407   -4.913  35.810 1.00 35.15  ? 66  ILE B CD1   1 
ATOM   3367 N N     . ARG B 1 37  ? 2.162   -6.964  31.633 1.00 47.75  ? 67  ARG B N     1 
ATOM   3368 C CA    . ARG B 1 37  ? 1.376   -7.663  30.614 1.00 53.35  ? 67  ARG B CA    1 
ATOM   3369 C C     . ARG B 1 37  ? 2.013   -8.979  30.205 1.00 51.29  ? 67  ARG B C     1 
ATOM   3370 O O     . ARG B 1 37  ? 3.143   -9.003  29.726 1.00 43.82  ? 67  ARG B O     1 
ATOM   3371 C CB    . ARG B 1 37  ? 1.237   -6.799  29.361 1.00 66.30  ? 67  ARG B CB    1 
ATOM   3372 C CG    . ARG B 1 37  ? 0.052   -5.863  29.362 1.00 58.63  ? 67  ARG B CG    1 
ATOM   3373 C CD    . ARG B 1 37  ? -1.155  -6.471  28.684 1.00 36.63  ? 67  ARG B CD    1 
ATOM   3374 N NE    . ARG B 1 37  ? -2.363  -5.838  29.195 1.00 43.30  ? 67  ARG B NE    1 
ATOM   3375 C CZ    . ARG B 1 37  ? -3.318  -6.480  29.853 1.00 55.67  ? 67  ARG B CZ    1 
ATOM   3376 N NH1   . ARG B 1 37  ? -3.228  -7.790  30.049 1.00 55.95  ? 67  ARG B NH1   1 
ATOM   3377 N NH2   . ARG B 1 37  ? -4.374  -5.814  30.297 1.00 73.93  ? 67  ARG B NH2   1 
ATOM   3378 N N     . SER B 1 38  ? 1.276   -10.070 30.371 1.00 61.62  ? 68  SER B N     1 
ATOM   3379 C CA    . SER B 1 38  ? 1.762   -11.381 29.958 1.00 74.47  ? 68  SER B CA    1 
ATOM   3380 C C     . SER B 1 38  ? 1.107   -11.844 28.651 1.00 81.33  ? 68  SER B C     1 
ATOM   3381 O O     . SER B 1 38  ? 1.744   -12.501 27.823 1.00 79.87  ? 68  SER B O     1 
ATOM   3382 C CB    . SER B 1 38  ? 1.542   -12.408 31.074 1.00 75.97  ? 68  SER B CB    1 
ATOM   3383 O OG    . SER B 1 38  ? 0.278   -12.235 31.693 1.00 75.43  ? 68  SER B OG    1 
ATOM   3384 N N     . ASN B 1 39  ? -0.159  -11.482 28.465 1.00 80.28  ? 69  ASN B N     1 
ATOM   3385 C CA    . ASN B 1 39  ? -0.923  -11.926 27.303 1.00 72.66  ? 69  ASN B CA    1 
ATOM   3386 C C     . ASN B 1 39  ? -2.102  -11.014 26.969 1.00 59.06  ? 69  ASN B C     1 
ATOM   3387 O O     . ASN B 1 39  ? -2.339  -10.015 27.651 1.00 59.54  ? 69  ASN B O     1 
ATOM   3388 C CB    . ASN B 1 39  ? -1.402  -13.366 27.509 1.00 81.65  ? 69  ASN B CB    1 
ATOM   3389 C CG    . ASN B 1 39  ? -1.777  -13.654 28.953 1.00 94.42  ? 69  ASN B CG    1 
ATOM   3390 O OD1   . ASN B 1 39  ? -2.521  -12.897 29.579 1.00 97.57  ? 69  ASN B OD1   1 
ATOM   3391 N ND2   . ASN B 1 39  ? -1.261  -14.756 29.489 1.00 97.44  ? 69  ASN B ND2   1 
ATOM   3392 N N     . LEU B 1 40  ? -2.834  -11.364 25.914 1.00 56.76  ? 70  LEU B N     1 
ATOM   3393 C CA    . LEU B 1 40  ? -3.991  -10.586 25.481 1.00 54.95  ? 70  LEU B CA    1 
ATOM   3394 C C     . LEU B 1 40  ? -4.993  -10.407 26.609 1.00 61.01  ? 70  LEU B C     1 
ATOM   3395 O O     . LEU B 1 40  ? -5.234  -11.328 27.388 1.00 62.29  ? 70  LEU B O     1 
ATOM   3396 C CB    . LEU B 1 40  ? -4.711  -11.278 24.323 1.00 74.14  ? 70  LEU B CB    1 
ATOM   3397 C CG    . LEU B 1 40  ? -3.999  -11.601 23.011 1.00 75.47  ? 70  LEU B CG    1 
ATOM   3398 C CD1   . LEU B 1 40  ? -3.531  -10.329 22.329 1.00 65.21  ? 70  LEU B CD1   1 
ATOM   3399 C CD2   . LEU B 1 40  ? -2.852  -12.566 23.257 1.00 83.96  ? 70  LEU B CD2   1 
ATOM   3400 N N     . VAL B 1 41  ? -5.585  -9.222  26.687 1.00 69.44  ? 71  VAL B N     1 
ATOM   3401 C CA    . VAL B 1 41  ? -6.719  -9.006  27.570 1.00 81.33  ? 71  VAL B CA    1 
ATOM   3402 C C     . VAL B 1 41  ? -7.991  -9.438  26.851 1.00 82.08  ? 71  VAL B C     1 
ATOM   3403 O O     . VAL B 1 41  ? -8.434  -8.781  25.918 1.00 76.84  ? 71  VAL B O     1 
ATOM   3404 C CB    . VAL B 1 41  ? -6.838  -7.533  27.996 1.00 89.67  ? 71  VAL B CB    1 
ATOM   3405 C CG1   . VAL B 1 41  ? -6.618  -6.611  26.806 1.00 90.64  ? 71  VAL B CG1   1 
ATOM   3406 C CG2   . VAL B 1 41  ? -8.196  -7.277  28.637 1.00 91.29  ? 71  VAL B CG2   1 
ATOM   3407 N N     . ASP B 1 42  ? -8.567  -10.554 27.287 1.00 101.45 ? 72  ASP B N     1 
ATOM   3408 C CA    . ASP B 1 42  ? -9.750  -11.126 26.641 1.00 114.62 ? 72  ASP B CA    1 
ATOM   3409 C C     . ASP B 1 42  ? -10.863 -10.099 26.421 1.00 109.61 ? 72  ASP B C     1 
ATOM   3410 O O     . ASP B 1 42  ? -11.119 -9.249  27.275 1.00 102.93 ? 72  ASP B O     1 
ATOM   3411 C CB    . ASP B 1 42  ? -10.285 -12.316 27.446 1.00 123.20 ? 72  ASP B CB    1 
ATOM   3412 C CG    . ASP B 1 42  ? -10.821 -11.909 28.808 1.00 128.27 ? 72  ASP B CG    1 
ATOM   3413 O OD1   . ASP B 1 42  ? -11.829 -12.499 29.248 1.00 136.14 ? 72  ASP B OD1   1 
ATOM   3414 O OD2   . ASP B 1 42  ? -10.237 -10.999 29.437 1.00 127.65 ? 72  ASP B OD2   1 
ATOM   3415 N N     . ASN B 1 43  ? -11.524 -10.189 25.270 1.00 101.79 ? 73  ASN B N     1 
ATOM   3416 C CA    . ASN B 1 43  ? -12.594 -9.260  24.933 1.00 99.54  ? 73  ASN B CA    1 
ATOM   3417 C C     . ASN B 1 43  ? -13.605 -9.900  23.986 1.00 110.60 ? 73  ASN B C     1 
ATOM   3418 O O     . ASN B 1 43  ? -13.258 -10.299 22.875 1.00 111.98 ? 73  ASN B O     1 
ATOM   3419 C CB    . ASN B 1 43  ? -12.008 -7.984  24.320 1.00 92.89  ? 73  ASN B CB    1 
ATOM   3420 C CG    . ASN B 1 43  ? -13.041 -6.888  24.150 1.00 90.14  ? 73  ASN B CG    1 
ATOM   3421 O OD1   . ASN B 1 43  ? -14.230 -7.157  24.012 1.00 90.25  ? 73  ASN B OD1   1 
ATOM   3422 N ND2   . ASN B 1 43  ? -12.587 -5.641  24.157 1.00 89.26  ? 73  ASN B ND2   1 
ATOM   3423 N N     . THR B 1 44  ? -14.855 -9.999  24.430 1.00 117.42 ? 74  THR B N     1 
ATOM   3424 C CA    . THR B 1 44  ? -15.901 -10.665 23.650 1.00 125.07 ? 74  THR B CA    1 
ATOM   3425 C C     . THR B 1 44  ? -16.561 -9.755  22.616 1.00 122.07 ? 74  THR B C     1 
ATOM   3426 O O     . THR B 1 44  ? -17.213 -10.234 21.691 1.00 131.25 ? 74  THR B O     1 
ATOM   3427 C CB    . THR B 1 44  ? -16.995 -11.266 24.555 1.00 131.17 ? 74  THR B CB    1 
ATOM   3428 O OG1   . THR B 1 44  ? -17.548 -10.241 25.392 1.00 123.76 ? 74  THR B OG1   1 
ATOM   3429 C CG2   . THR B 1 44  ? -16.417 -12.368 25.426 1.00 133.42 ? 74  THR B CG2   1 
ATOM   3430 N N     . ASN B 1 45  ? -16.391 -8.447  22.778 1.00 117.25 ? 75  ASN B N     1 
ATOM   3431 C CA    . ASN B 1 45  ? -16.936 -7.470  21.839 1.00 120.06 ? 75  ASN B CA    1 
ATOM   3432 C C     . ASN B 1 45  ? -16.462 -7.687  20.403 1.00 121.27 ? 75  ASN B C     1 
ATOM   3433 O O     . ASN B 1 45  ? -15.347 -8.163  20.172 1.00 119.55 ? 75  ASN B O     1 
ATOM   3434 C CB    . ASN B 1 45  ? -16.575 -6.048  22.277 1.00 114.79 ? 75  ASN B CB    1 
ATOM   3435 C CG    . ASN B 1 45  ? -17.430 -5.552  23.423 1.00 107.73 ? 75  ASN B CG    1 
ATOM   3436 O OD1   . ASN B 1 45  ? -17.220 -4.452  23.934 1.00 105.57 ? 75  ASN B OD1   1 
ATOM   3437 N ND2   . ASN B 1 45  ? -18.404 -6.357  23.830 1.00 104.52 ? 75  ASN B ND2   1 
ATOM   3438 N N     . GLN B 1 46  ? -17.312 -7.330  19.444 1.00 119.89 ? 76  GLN B N     1 
ATOM   3439 C CA    . GLN B 1 46  ? -16.931 -7.366  18.038 1.00 119.73 ? 76  GLN B CA    1 
ATOM   3440 C C     . GLN B 1 46  ? -16.177 -6.087  17.691 1.00 112.52 ? 76  GLN B C     1 
ATOM   3441 O O     . GLN B 1 46  ? -16.333 -5.066  18.369 1.00 108.63 ? 76  GLN B O     1 
ATOM   3442 C CB    . GLN B 1 46  ? -18.163 -7.520  17.137 1.00 135.22 ? 76  GLN B CB    1 
ATOM   3443 C CG    . GLN B 1 46  ? -18.932 -6.228  16.883 1.00 141.93 ? 76  GLN B CG    1 
ATOM   3444 C CD    . GLN B 1 46  ? -19.978 -6.367  15.780 1.00 150.71 ? 76  GLN B CD    1 
ATOM   3445 O OE1   . GLN B 1 46  ? -20.954 -7.105  15.920 1.00 140.03 ? 76  GLN B OE1   1 
ATOM   3446 N NE2   . GLN B 1 46  ? -19.778 -5.645  14.681 1.00 156.37 ? 76  GLN B NE2   1 
ATOM   3447 N N     . VAL B 1 47  ? -15.360 -6.150  16.641 1.00 102.94 ? 77  VAL B N     1 
ATOM   3448 C CA    . VAL B 1 47  ? -14.550 -5.010  16.220 1.00 98.52  ? 77  VAL B CA    1 
ATOM   3449 C C     . VAL B 1 47  ? -15.229 -4.184  15.126 1.00 111.12 ? 77  VAL B C     1 
ATOM   3450 O O     . VAL B 1 47  ? -15.597 -4.713  14.079 1.00 125.08 ? 77  VAL B O     1 
ATOM   3451 C CB    . VAL B 1 47  ? -13.157 -5.465  15.732 1.00 100.08 ? 77  VAL B CB    1 
ATOM   3452 C CG1   . VAL B 1 47  ? -12.496 -4.381  14.887 1.00 90.71  ? 77  VAL B CG1   1 
ATOM   3453 C CG2   . VAL B 1 47  ? -12.274 -5.846  16.917 1.00 104.66 ? 77  VAL B CG2   1 
ATOM   3454 N N     . GLU B 1 48  ? -15.391 -2.887  15.376 1.00 116.11 ? 78  GLU B N     1 
ATOM   3455 C CA    . GLU B 1 48  ? -15.973 -1.977  14.393 1.00 130.50 ? 78  GLU B CA    1 
ATOM   3456 C C     . GLU B 1 48  ? -14.946 -1.639  13.319 1.00 134.36 ? 78  GLU B C     1 
ATOM   3457 O O     . GLU B 1 48  ? -13.743 -1.729  13.551 1.00 136.71 ? 78  GLU B O     1 
ATOM   3458 C CB    . GLU B 1 48  ? -16.477 -0.694  15.065 1.00 145.03 ? 78  GLU B CB    1 
ATOM   3459 C CG    . GLU B 1 48  ? -17.483 -0.924  16.192 1.00 162.63 ? 78  GLU B CG    1 
ATOM   3460 C CD    . GLU B 1 48  ? -17.967 0.372   16.832 1.00 168.07 ? 78  GLU B CD    1 
ATOM   3461 O OE1   . GLU B 1 48  ? -17.792 0.533   18.063 1.00 163.71 ? 78  GLU B OE1   1 
ATOM   3462 O OE2   . GLU B 1 48  ? -18.520 1.226   16.105 1.00 167.71 ? 78  GLU B OE2   1 
ATOM   3463 N N     . VAL B 1 49  ? -15.423 -1.256  12.140 1.00 140.82 ? 79  VAL B N     1 
ATOM   3464 C CA    . VAL B 1 49  ? -14.537 -0.934  11.027 1.00 147.23 ? 79  VAL B CA    1 
ATOM   3465 C C     . VAL B 1 49  ? -15.003 0.342   10.325 1.00 149.37 ? 79  VAL B C     1 
ATOM   3466 O O     . VAL B 1 49  ? -16.034 0.911   10.681 1.00 142.74 ? 79  VAL B O     1 
ATOM   3467 C CB    . VAL B 1 49  ? -14.462 -2.100  10.016 1.00 155.53 ? 79  VAL B CB    1 
ATOM   3468 C CG1   . VAL B 1 49  ? -13.211 -1.985  9.153  1.00 149.75 ? 79  VAL B CG1   1 
ATOM   3469 C CG2   . VAL B 1 49  ? -14.476 -3.437  10.748 1.00 155.05 ? 79  VAL B CG2   1 
ATOM   3470 N N     . LEU B 1 50  ? -14.235 0.791   9.335  1.00 154.84 ? 80  LEU B N     1 
ATOM   3471 C CA    . LEU B 1 50  ? -14.563 2.008   8.601  1.00 160.65 ? 80  LEU B CA    1 
ATOM   3472 C C     . LEU B 1 50  ? -13.594 2.238   7.443  1.00 161.19 ? 80  LEU B C     1 
ATOM   3473 O O     . LEU B 1 50  ? -12.730 3.113   7.510  1.00 162.24 ? 80  LEU B O     1 
ATOM   3474 C CB    . LEU B 1 50  ? -14.560 3.216   9.545  1.00 159.91 ? 80  LEU B CB    1 
ATOM   3475 C CG    . LEU B 1 50  ? -15.376 4.456   9.160  1.00 162.06 ? 80  LEU B CG    1 
ATOM   3476 C CD1   . LEU B 1 50  ? -15.754 5.251   10.406 1.00 163.04 ? 80  LEU B CD1   1 
ATOM   3477 C CD2   . LEU B 1 50  ? -14.638 5.336   8.158  1.00 154.67 ? 80  LEU B CD2   1 
ATOM   3478 N N     . GLN B 1 51  ? -13.734 1.443   6.385  1.00 160.48 ? 81  GLN B N     1 
ATOM   3479 C CA    . GLN B 1 51  ? -12.938 1.640   5.178  1.00 154.84 ? 81  GLN B CA    1 
ATOM   3480 C C     . GLN B 1 51  ? -13.289 2.971   4.527  1.00 154.43 ? 81  GLN B C     1 
ATOM   3481 O O     . GLN B 1 51  ? -14.157 3.699   5.009  1.00 152.69 ? 81  GLN B O     1 
ATOM   3482 C CB    . GLN B 1 51  ? -13.162 0.505   4.174  1.00 154.69 ? 81  GLN B CB    1 
ATOM   3483 C CG    . GLN B 1 51  ? -12.114 -0.601  4.213  1.00 149.14 ? 81  GLN B CG    1 
ATOM   3484 C CD    . GLN B 1 51  ? -12.547 -1.804  5.028  1.00 140.50 ? 81  GLN B CD    1 
ATOM   3485 O OE1   . GLN B 1 51  ? -13.652 -1.837  5.572  1.00 135.23 ? 81  GLN B OE1   1 
ATOM   3486 N NE2   . GLN B 1 51  ? -11.677 -2.806  5.109  1.00 133.57 ? 81  GLN B NE2   1 
ATOM   3487 N N     . ARG B 1 52  ? -12.610 3.284   3.430  1.00 153.49 ? 82  ARG B N     1 
ATOM   3488 C CA    . ARG B 1 52  ? -12.928 4.482   2.666  1.00 152.77 ? 82  ARG B CA    1 
ATOM   3489 C C     . ARG B 1 52  ? -13.846 4.143   1.490  1.00 151.76 ? 82  ARG B C     1 
ATOM   3490 O O     . ARG B 1 52  ? -13.685 3.107   0.840  1.00 146.48 ? 82  ARG B O     1 
ATOM   3491 C CB    . ARG B 1 52  ? -11.648 5.165   2.182  1.00 144.34 ? 82  ARG B CB    1 
ATOM   3492 N N     . ASP B 1 53  ? -14.814 5.017   1.230  1.00 162.90 ? 83  ASP B N     1 
ATOM   3493 C CA    . ASP B 1 53  ? -15.752 4.827   0.126  1.00 177.08 ? 83  ASP B CA    1 
ATOM   3494 C C     . ASP B 1 53  ? -16.529 3.521   0.261  1.00 183.70 ? 83  ASP B C     1 
ATOM   3495 O O     . ASP B 1 53  ? -16.520 2.687   -0.646 1.00 184.39 ? 83  ASP B O     1 
ATOM   3496 C CB    . ASP B 1 53  ? -15.021 4.868   -1.220 1.00 168.86 ? 83  ASP B CB    1 
ATOM   3497 N N     . TYR B 1 59  ? -12.136 -7.221  4.640  1.00 141.46 ? 89  TYR B N     1 
ATOM   3498 C CA    . TYR B 1 59  ? -10.821 -7.840  4.749  1.00 140.20 ? 89  TYR B CA    1 
ATOM   3499 C C     . TYR B 1 59  ? -10.466 -8.136  6.207  1.00 136.41 ? 89  TYR B C     1 
ATOM   3500 O O     . TYR B 1 59  ? -10.193 -7.222  6.983  1.00 126.34 ? 89  TYR B O     1 
ATOM   3501 C CB    . TYR B 1 59  ? -9.754  -6.940  4.118  1.00 134.72 ? 89  TYR B CB    1 
ATOM   3502 N N     . SER B 1 60  ? -10.475 -9.417  6.570  1.00 140.04 ? 90  SER B N     1 
ATOM   3503 C CA    . SER B 1 60  ? -10.138 -9.842  7.927  1.00 135.67 ? 90  SER B CA    1 
ATOM   3504 C C     . SER B 1 60  ? -9.614  -11.281 7.963  1.00 137.50 ? 90  SER B C     1 
ATOM   3505 O O     . SER B 1 60  ? -10.294 -12.208 7.525  1.00 138.55 ? 90  SER B O     1 
ATOM   3506 C CB    . SER B 1 60  ? -11.350 -9.706  8.851  1.00 140.21 ? 90  SER B CB    1 
ATOM   3507 O OG    . SER B 1 60  ? -12.311 -10.713 8.584  1.00 152.68 ? 90  SER B OG    1 
ATOM   3508 N N     . VAL B 1 61  ? -8.408  -11.459 8.500  1.00 138.28 ? 91  VAL B N     1 
ATOM   3509 C CA    . VAL B 1 61  ? -7.753  -12.768 8.530  1.00 143.77 ? 91  VAL B CA    1 
ATOM   3510 C C     . VAL B 1 61  ? -8.083  -13.548 9.800  1.00 141.81 ? 91  VAL B C     1 
ATOM   3511 O O     . VAL B 1 61  ? -8.570  -12.982 10.777 1.00 151.92 ? 91  VAL B O     1 
ATOM   3512 C CB    . VAL B 1 61  ? -6.220  -12.634 8.418  1.00 143.97 ? 91  VAL B CB    1 
ATOM   3513 C CG1   . VAL B 1 61  ? -5.605  -13.949 7.958  1.00 147.63 ? 91  VAL B CG1   1 
ATOM   3514 C CG2   . VAL B 1 61  ? -5.856  -11.515 7.459  1.00 139.50 ? 91  VAL B CG2   1 
ATOM   3515 N N     . LYS B 1 62  ? -7.813  -14.850 9.779  1.00 134.80 ? 92  LYS B N     1 
ATOM   3516 C CA    . LYS B 1 62  ? -8.098  -15.714 10.921 1.00 131.96 ? 92  LYS B CA    1 
ATOM   3517 C C     . LYS B 1 62  ? -6.893  -16.584 11.277 1.00 121.06 ? 92  LYS B C     1 
ATOM   3518 O O     . LYS B 1 62  ? -7.002  -17.525 12.063 1.00 124.33 ? 92  LYS B O     1 
ATOM   3519 C CB    . LYS B 1 62  ? -9.324  -16.592 10.640 1.00 139.22 ? 92  LYS B CB    1 
ATOM   3520 C CG    . LYS B 1 62  ? -10.619 -15.813 10.443 1.00 137.95 ? 92  LYS B CG    1 
ATOM   3521 C CD    . LYS B 1 62  ? -11.022 -15.077 11.713 1.00 132.79 ? 92  LYS B CD    1 
ATOM   3522 C CE    . LYS B 1 62  ? -12.278 -14.248 11.497 1.00 140.20 ? 92  LYS B CE    1 
ATOM   3523 N NZ    . LYS B 1 62  ? -12.733 -13.576 12.746 1.00 135.49 ? 92  LYS B NZ    1 
ATOM   3524 N N     . SER B 1 63  ? -5.744  -16.261 10.693 1.00 110.34 ? 93  SER B N     1 
ATOM   3525 C CA    . SER B 1 63  ? -4.518  -17.001 10.957 1.00 111.37 ? 93  SER B CA    1 
ATOM   3526 C C     . SER B 1 63  ? -3.311  -16.201 10.493 1.00 110.94 ? 93  SER B C     1 
ATOM   3527 O O     . SER B 1 63  ? -3.422  -15.358 9.604  1.00 106.00 ? 93  SER B O     1 
ATOM   3528 C CB    . SER B 1 63  ? -4.544  -18.356 10.247 1.00 116.90 ? 93  SER B CB    1 
ATOM   3529 O OG    . SER B 1 63  ? -4.592  -18.192 8.839  1.00 114.26 ? 93  SER B OG    1 
ATOM   3530 N N     . PHE B 1 64  ? -2.158  -16.465 11.096 1.00 115.46 ? 94  PHE B N     1 
ATOM   3531 C CA    . PHE B 1 64  ? -0.931  -15.780 10.704 1.00 118.41 ? 94  PHE B CA    1 
ATOM   3532 C C     . PHE B 1 64  ? -0.448  -16.256 9.339  1.00 132.32 ? 94  PHE B C     1 
ATOM   3533 O O     . PHE B 1 64  ? -0.026  -15.451 8.509  1.00 132.80 ? 94  PHE B O     1 
ATOM   3534 C CB    . PHE B 1 64  ? 0.169   -15.965 11.753 1.00 109.64 ? 94  PHE B CB    1 
ATOM   3535 C CG    . PHE B 1 64  ? 0.105   -14.973 12.882 1.00 92.09  ? 94  PHE B CG    1 
ATOM   3536 C CD1   . PHE B 1 64  ? 0.248   -15.385 14.195 1.00 88.15  ? 94  PHE B CD1   1 
ATOM   3537 C CD2   . PHE B 1 64  ? -0.106  -13.629 12.627 1.00 81.21  ? 94  PHE B CD2   1 
ATOM   3538 C CE1   . PHE B 1 64  ? 0.190   -14.475 15.231 1.00 81.86  ? 94  PHE B CE1   1 
ATOM   3539 C CE2   . PHE B 1 64  ? -0.168  -12.715 13.657 1.00 73.20  ? 94  PHE B CE2   1 
ATOM   3540 C CZ    . PHE B 1 64  ? -0.018  -13.137 14.960 1.00 75.27  ? 94  PHE B CZ    1 
ATOM   3541 N N     . GLU B 1 65  ? -0.517  -17.564 9.111  1.00 144.86 ? 95  GLU B N     1 
ATOM   3542 C CA    . GLU B 1 65  ? -0.100  -18.141 7.835  1.00 151.62 ? 95  GLU B CA    1 
ATOM   3543 C C     . GLU B 1 65  ? -0.768  -17.483 6.626  1.00 147.54 ? 95  GLU B C     1 
ATOM   3544 O O     . GLU B 1 65  ? -0.116  -17.231 5.613  1.00 147.99 ? 95  GLU B O     1 
ATOM   3545 C CB    . GLU B 1 65  ? -0.351  -19.652 7.814  1.00 160.34 ? 95  GLU B CB    1 
ATOM   3546 C CG    . GLU B 1 65  ? 0.915   -20.499 7.846  1.00 161.55 ? 95  GLU B CG    1 
ATOM   3547 C CD    . GLU B 1 65  ? 1.638   -20.520 6.509  1.00 164.18 ? 95  GLU B CD    1 
ATOM   3548 O OE1   . GLU B 1 65  ? 2.069   -21.613 6.082  1.00 168.67 ? 95  GLU B OE1   1 
ATOM   3549 O OE2   . GLU B 1 65  ? 1.767   -19.450 5.878  1.00 161.22 ? 95  GLU B OE2   1 
ATOM   3550 N N     . GLU B 1 66  ? -2.064  -17.204 6.740  1.00 140.56 ? 96  GLU B N     1 
ATOM   3551 C CA    . GLU B 1 66  ? -2.845  -16.665 5.626  1.00 129.75 ? 96  GLU B CA    1 
ATOM   3552 C C     . GLU B 1 66  ? -2.386  -15.276 5.174  1.00 116.63 ? 96  GLU B C     1 
ATOM   3553 O O     . GLU B 1 66  ? -2.699  -14.840 4.066  1.00 104.47 ? 96  GLU B O     1 
ATOM   3554 C CB    . GLU B 1 66  ? -4.332  -16.630 5.990  1.00 128.94 ? 96  GLU B CB    1 
ATOM   3555 N N     . LEU B 1 67  ? -1.641  -14.589 6.032  1.00 112.58 ? 97  LEU B N     1 
ATOM   3556 C CA    . LEU B 1 67  ? -1.216  -13.220 5.754  1.00 109.40 ? 97  LEU B CA    1 
ATOM   3557 C C     . LEU B 1 67  ? -0.232  -13.117 4.585  1.00 115.63 ? 97  LEU B C     1 
ATOM   3558 O O     . LEU B 1 67  ? -0.172  -12.093 3.901  1.00 116.36 ? 97  LEU B O     1 
ATOM   3559 C CB    . LEU B 1 67  ? -0.615  -12.597 7.013  1.00 99.28  ? 97  LEU B CB    1 
ATOM   3560 C CG    . LEU B 1 67  ? -1.624  -12.286 8.117  1.00 106.78 ? 97  LEU B CG    1 
ATOM   3561 C CD1   . LEU B 1 67  ? -0.935  -12.142 9.467  1.00 110.62 ? 97  LEU B CD1   1 
ATOM   3562 C CD2   . LEU B 1 67  ? -2.414  -11.032 7.769  1.00 103.18 ? 97  LEU B CD2   1 
ATOM   3563 N N     . ARG B 1 68  ? 0.533   -14.181 4.360  1.00 110.92 ? 98  ARG B N     1 
ATOM   3564 C CA    . ARG B 1 68  ? 1.539   -14.191 3.307  1.00 111.44 ? 98  ARG B CA    1 
ATOM   3565 C C     . ARG B 1 68  ? 2.618   -13.163 3.618  1.00 100.54 ? 98  ARG B C     1 
ATOM   3566 O O     . ARG B 1 68  ? 2.776   -12.167 2.908  1.00 97.70  ? 98  ARG B O     1 
ATOM   3567 C CB    . ARG B 1 68  ? 0.902   -13.927 1.938  1.00 130.08 ? 98  ARG B CB    1 
ATOM   3568 C CG    . ARG B 1 68  ? 1.698   -14.482 0.760  1.00 142.29 ? 98  ARG B CG    1 
ATOM   3569 C CD    . ARG B 1 68  ? 2.584   -13.427 0.104  1.00 139.94 ? 98  ARG B CD    1 
ATOM   3570 N NE    . ARG B 1 68  ? 1.827   -12.573 -0.809 1.00 135.91 ? 98  ARG B NE    1 
ATOM   3571 C CZ    . ARG B 1 68  ? 2.375   -11.711 -1.659 1.00 117.35 ? 98  ARG B CZ    1 
ATOM   3572 N NH1   . ARG B 1 68  ? 3.694   -11.585 -1.724 1.00 104.38 ? 98  ARG B NH1   1 
ATOM   3573 N NH2   . ARG B 1 68  ? 1.603   -10.977 -2.449 1.00 116.50 ? 98  ARG B NH2   1 
ATOM   3574 N N     . LEU B 1 69  ? 3.346   -13.418 4.702  1.00 93.83  ? 99  LEU B N     1 
ATOM   3575 C CA    . LEU B 1 69  ? 4.449   -12.570 5.135  1.00 86.29  ? 99  LEU B CA    1 
ATOM   3576 C C     . LEU B 1 69  ? 5.768   -13.246 4.801  1.00 87.70  ? 99  LEU B C     1 
ATOM   3577 O O     . LEU B 1 69  ? 5.844   -14.474 4.759  1.00 91.60  ? 99  LEU B O     1 
ATOM   3578 C CB    . LEU B 1 69  ? 4.388   -12.347 6.646  1.00 84.29  ? 99  LEU B CB    1 
ATOM   3579 C CG    . LEU B 1 69  ? 3.126   -11.757 7.268  1.00 82.39  ? 99  LEU B CG    1 
ATOM   3580 C CD1   . LEU B 1 69  ? 3.279   -11.712 8.778  1.00 70.13  ? 99  LEU B CD1   1 
ATOM   3581 C CD2   . LEU B 1 69  ? 2.855   -10.373 6.706  1.00 88.43  ? 99  LEU B CD2   1 
ATOM   3582 N N     . LYS B 1 70  ? 6.806   -12.445 4.583  1.00 84.53  ? 100 LYS B N     1 
ATOM   3583 C CA    . LYS B 1 70  ? 8.126   -12.972 4.254  1.00 85.38  ? 100 LYS B CA    1 
ATOM   3584 C C     . LYS B 1 70  ? 8.573   -13.978 5.305  1.00 83.67  ? 100 LYS B C     1 
ATOM   3585 O O     . LYS B 1 70  ? 8.374   -13.760 6.496  1.00 81.25  ? 100 LYS B O     1 
ATOM   3586 C CB    . LYS B 1 70  ? 9.142   -11.835 4.103  1.00 85.02  ? 100 LYS B CB    1 
ATOM   3587 C CG    . LYS B 1 70  ? 8.695   -10.524 4.738  1.00 88.77  ? 100 LYS B CG    1 
ATOM   3588 C CD    . LYS B 1 70  ? 7.646   -9.826  3.877  1.00 87.18  ? 100 LYS B CD    1 
ATOM   3589 C CE    . LYS B 1 70  ? 6.592   -9.134  4.735  1.00 71.48  ? 100 LYS B CE    1 
ATOM   3590 N NZ    . LYS B 1 70  ? 5.420   -8.681  3.930  1.00 59.89  ? 100 LYS B NZ    1 
ATOM   3591 N N     . PRO B 1 71  ? 9.175   -15.089 4.860  1.00 90.47  ? 101 PRO B N     1 
ATOM   3592 C CA    . PRO B 1 71  ? 9.552   -16.215 5.722  1.00 96.96  ? 101 PRO B CA    1 
ATOM   3593 C C     . PRO B 1 71  ? 10.168  -15.795 7.060  1.00 95.01  ? 101 PRO B C     1 
ATOM   3594 O O     . PRO B 1 71  ? 9.747   -16.308 8.097  1.00 93.57  ? 101 PRO B O     1 
ATOM   3595 C CB    . PRO B 1 71  ? 10.571  -16.984 4.862  1.00 98.72  ? 101 PRO B CB    1 
ATOM   3596 C CG    . PRO B 1 71  ? 10.896  -16.050 3.703  1.00 95.80  ? 101 PRO B CG    1 
ATOM   3597 C CD    . PRO B 1 71  ? 9.618   -15.323 3.479  1.00 90.22  ? 101 PRO B CD    1 
ATOM   3598 N N     . GLN B 1 72  ? 11.137  -14.883 7.041  1.00 89.89  ? 102 GLN B N     1 
ATOM   3599 C CA    . GLN B 1 72  ? 11.793  -14.452 8.278  1.00 91.44  ? 102 GLN B CA    1 
ATOM   3600 C C     . GLN B 1 72  ? 10.831  -13.801 9.275  1.00 82.65  ? 102 GLN B C     1 
ATOM   3601 O O     . GLN B 1 72  ? 10.881  -14.082 10.472 1.00 77.66  ? 102 GLN B O     1 
ATOM   3602 C CB    . GLN B 1 72  ? 12.977  -13.516 7.992  1.00 88.44  ? 102 GLN B CB    1 
ATOM   3603 C CG    . GLN B 1 72  ? 13.033  -12.969 6.578  1.00 91.51  ? 102 GLN B CG    1 
ATOM   3604 C CD    . GLN B 1 72  ? 14.030  -13.718 5.713  1.00 100.78 ? 102 GLN B CD    1 
ATOM   3605 O OE1   . GLN B 1 72  ? 13.650  -14.444 4.792  1.00 104.51 ? 102 GLN B OE1   1 
ATOM   3606 N NE2   . GLN B 1 72  ? 15.316  -13.555 6.015  1.00 97.75  ? 102 GLN B NE2   1 
ATOM   3607 N N     . LEU B 1 73  ? 9.960   -12.931 8.775  1.00 75.64  ? 103 LEU B N     1 
ATOM   3608 C CA    . LEU B 1 73  ? 9.005   -12.230 9.624  1.00 73.48  ? 103 LEU B CA    1 
ATOM   3609 C C     . LEU B 1 73  ? 8.060   -13.192 10.343 1.00 76.03  ? 103 LEU B C     1 
ATOM   3610 O O     . LEU B 1 73  ? 7.868   -13.102 11.553 1.00 76.56  ? 103 LEU B O     1 
ATOM   3611 C CB    . LEU B 1 73  ? 8.200   -11.224 8.801  1.00 68.65  ? 103 LEU B CB    1 
ATOM   3612 C CG    . LEU B 1 73  ? 7.068   -10.518 9.542  1.00 63.49  ? 103 LEU B CG    1 
ATOM   3613 C CD1   . LEU B 1 73  ? 7.576   -9.957  10.854 1.00 67.92  ? 103 LEU B CD1   1 
ATOM   3614 C CD2   . LEU B 1 73  ? 6.478   -9.418  8.687  1.00 66.94  ? 103 LEU B CD2   1 
ATOM   3615 N N     . LEU B 1 74  ? 7.470   -14.110 9.588  1.00 81.56  ? 104 LEU B N     1 
ATOM   3616 C CA    . LEU B 1 74  ? 6.561   -15.094 10.156 1.00 87.08  ? 104 LEU B CA    1 
ATOM   3617 C C     . LEU B 1 74  ? 7.267   -15.925 11.225 1.00 88.68  ? 104 LEU B C     1 
ATOM   3618 O O     . LEU B 1 74  ? 6.709   -16.191 12.290 1.00 104.71 ? 104 LEU B O     1 
ATOM   3619 C CB    . LEU B 1 74  ? 6.010   -15.999 9.053  1.00 96.62  ? 104 LEU B CB    1 
ATOM   3620 C CG    . LEU B 1 74  ? 4.746   -16.801 9.364  1.00 109.52 ? 104 LEU B CG    1 
ATOM   3621 C CD1   . LEU B 1 74  ? 3.610   -15.878 9.777  1.00 108.12 ? 104 LEU B CD1   1 
ATOM   3622 C CD2   . LEU B 1 74  ? 4.348   -17.639 8.159  1.00 112.88 ? 104 LEU B CD2   1 
ATOM   3623 N N     . GLN B 1 75  ? 8.501   -16.325 10.935 1.00 77.44  ? 105 GLN B N     1 
ATOM   3624 C CA    . GLN B 1 75  ? 9.279   -17.152 11.850 1.00 76.72  ? 105 GLN B CA    1 
ATOM   3625 C C     . GLN B 1 75  ? 9.420   -16.490 13.220 1.00 75.57  ? 105 GLN B C     1 
ATOM   3626 O O     . GLN B 1 75  ? 9.332   -17.156 14.250 1.00 74.19  ? 105 GLN B O     1 
ATOM   3627 C CB    . GLN B 1 75  ? 10.660  -17.446 11.256 1.00 79.12  ? 105 GLN B CB    1 
ATOM   3628 C CG    . GLN B 1 75  ? 11.525  -18.380 12.091 1.00 90.00  ? 105 GLN B CG    1 
ATOM   3629 C CD    . GLN B 1 75  ? 12.916  -18.572 11.505 1.00 101.95 ? 105 GLN B CD    1 
ATOM   3630 O OE1   . GLN B 1 75  ? 13.163  -18.253 10.340 1.00 103.44 ? 105 GLN B OE1   1 
ATOM   3631 N NE2   . GLN B 1 75  ? 13.832  -19.096 12.314 1.00 101.71 ? 105 GLN B NE2   1 
ATOM   3632 N N     . GLY B 1 76  ? 9.633   -15.177 13.220 1.00 69.65  ? 106 GLY B N     1 
ATOM   3633 C CA    . GLY B 1 76  ? 9.820   -14.420 14.447 1.00 57.28  ? 106 GLY B CA    1 
ATOM   3634 C C     . GLY B 1 76  ? 8.532   -14.236 15.220 1.00 70.29  ? 106 GLY B C     1 
ATOM   3635 O O     . GLY B 1 76  ? 8.542   -14.186 16.454 1.00 69.03  ? 106 GLY B O     1 
ATOM   3636 N N     . VAL B 1 77  ? 7.422   -14.127 14.491 1.00 71.21  ? 107 VAL B N     1 
ATOM   3637 C CA    . VAL B 1 77  ? 6.102   -14.067 15.104 1.00 57.62  ? 107 VAL B CA    1 
ATOM   3638 C C     . VAL B 1 77  ? 5.795   -15.385 15.798 1.00 68.78  ? 107 VAL B C     1 
ATOM   3639 O O     . VAL B 1 77  ? 5.235   -15.408 16.888 1.00 82.21  ? 107 VAL B O     1 
ATOM   3640 C CB    . VAL B 1 77  ? 5.010   -13.778 14.067 1.00 57.65  ? 107 VAL B CB    1 
ATOM   3641 C CG1   . VAL B 1 77  ? 3.642   -14.172 14.604 1.00 59.19  ? 107 VAL B CG1   1 
ATOM   3642 C CG2   . VAL B 1 77  ? 5.031   -12.311 13.678 1.00 57.77  ? 107 VAL B CG2   1 
ATOM   3643 N N     . TYR B 1 78  ? 6.172   -16.487 15.164 1.00 72.76  ? 108 TYR B N     1 
ATOM   3644 C CA    . TYR B 1 78  ? 5.991   -17.799 15.774 1.00 82.35  ? 108 TYR B CA    1 
ATOM   3645 C C     . TYR B 1 78  ? 6.935   -17.999 16.953 1.00 73.92  ? 108 TYR B C     1 
ATOM   3646 O O     . TYR B 1 78  ? 6.647   -18.773 17.864 1.00 76.40  ? 108 TYR B O     1 
ATOM   3647 C CB    . TYR B 1 78  ? 6.192   -18.904 14.738 1.00 89.87  ? 108 TYR B CB    1 
ATOM   3648 C CG    . TYR B 1 78  ? 4.933   -19.255 13.985 1.00 104.41 ? 108 TYR B CG    1 
ATOM   3649 C CD1   . TYR B 1 78  ? 3.983   -18.285 13.697 1.00 110.55 ? 108 TYR B CD1   1 
ATOM   3650 C CD2   . TYR B 1 78  ? 4.698   -20.553 13.553 1.00 119.85 ? 108 TYR B CD2   1 
ATOM   3651 C CE1   . TYR B 1 78  ? 2.829   -18.598 13.006 1.00 125.00 ? 108 TYR B CE1   1 
ATOM   3652 C CE2   . TYR B 1 78  ? 3.547   -20.877 12.860 1.00 133.74 ? 108 TYR B CE2   1 
ATOM   3653 C CZ    . TYR B 1 78  ? 2.616   -19.896 12.589 1.00 135.87 ? 108 TYR B CZ    1 
ATOM   3654 O OH    . TYR B 1 78  ? 1.467   -20.211 11.900 1.00 143.75 ? 108 TYR B OH    1 
ATOM   3655 N N     . ALA B 1 79  ? 8.059   -17.290 16.930 1.00 68.07  ? 109 ALA B N     1 
ATOM   3656 C CA    . ALA B 1 79  ? 9.071   -17.412 17.974 1.00 73.43  ? 109 ALA B CA    1 
ATOM   3657 C C     . ALA B 1 79  ? 8.632   -16.760 19.285 1.00 70.51  ? 109 ALA B C     1 
ATOM   3658 O O     . ALA B 1 79  ? 8.954   -17.250 20.366 1.00 77.57  ? 109 ALA B O     1 
ATOM   3659 C CB    . ALA B 1 79  ? 10.395  -16.828 17.502 1.00 80.28  ? 109 ALA B CB    1 
ATOM   3660 N N     . MET B 1 80  ? 7.900   -15.657 19.191 1.00 58.33  ? 110 MET B N     1 
ATOM   3661 C CA    . MET B 1 80  ? 7.426   -14.976 20.389 1.00 65.88  ? 110 MET B CA    1 
ATOM   3662 C C     . MET B 1 80  ? 6.087   -15.519 20.884 1.00 79.69  ? 110 MET B C     1 
ATOM   3663 O O     . MET B 1 80  ? 5.269   -14.781 21.435 1.00 82.72  ? 110 MET B O     1 
ATOM   3664 C CB    . MET B 1 80  ? 7.365   -13.463 20.173 1.00 67.26  ? 110 MET B CB    1 
ATOM   3665 C CG    . MET B 1 80  ? 6.739   -13.036 18.869 1.00 64.84  ? 110 MET B CG    1 
ATOM   3666 S SD    . MET B 1 80  ? 7.445   -11.477 18.306 1.00 82.85  ? 110 MET B SD    1 
ATOM   3667 C CE    . MET B 1 80  ? 7.235   -10.447 19.758 1.00 35.04  ? 110 MET B CE    1 
ATOM   3668 N N     . GLY B 1 81  ? 5.877   -16.816 20.682 1.00 87.86  ? 111 GLY B N     1 
ATOM   3669 C CA    . GLY B 1 81  ? 4.714   -17.506 21.214 1.00 94.33  ? 111 GLY B CA    1 
ATOM   3670 C C     . GLY B 1 81  ? 3.371   -17.050 20.674 1.00 89.25  ? 111 GLY B C     1 
ATOM   3671 O O     . GLY B 1 81  ? 2.353   -17.171 21.356 1.00 104.88 ? 111 GLY B O     1 
ATOM   3672 N N     . PHE B 1 82  ? 3.361   -16.531 19.450 1.00 64.88  ? 112 PHE B N     1 
ATOM   3673 C CA    . PHE B 1 82  ? 2.122   -16.086 18.824 1.00 68.91  ? 112 PHE B CA    1 
ATOM   3674 C C     . PHE B 1 82  ? 1.478   -17.205 17.997 1.00 83.80  ? 112 PHE B C     1 
ATOM   3675 O O     . PHE B 1 82  ? 2.151   -17.909 17.240 1.00 72.60  ? 112 PHE B O     1 
ATOM   3676 C CB    . PHE B 1 82  ? 2.374   -14.858 17.948 1.00 70.24  ? 112 PHE B CB    1 
ATOM   3677 C CG    . PHE B 1 82  ? 2.584   -13.585 18.722 1.00 68.48  ? 112 PHE B CG    1 
ATOM   3678 C CD1   . PHE B 1 82  ? 2.815   -13.611 20.086 1.00 74.50  ? 112 PHE B CD1   1 
ATOM   3679 C CD2   . PHE B 1 82  ? 2.578   -12.359 18.074 1.00 74.59  ? 112 PHE B CD2   1 
ATOM   3680 C CE1   . PHE B 1 82  ? 3.016   -12.434 20.793 1.00 67.28  ? 112 PHE B CE1   1 
ATOM   3681 C CE2   . PHE B 1 82  ? 2.783   -11.181 18.775 1.00 69.84  ? 112 PHE B CE2   1 
ATOM   3682 C CZ    . PHE B 1 82  ? 3.002   -11.220 20.134 1.00 59.01  ? 112 PHE B CZ    1 
ATOM   3683 N N     . ASN B 1 83  ? 0.168   -17.359 18.154 1.00 95.76  ? 113 ASN B N     1 
ATOM   3684 C CA    . ASN B 1 83  ? -0.587  -18.382 17.442 1.00 95.87  ? 113 ASN B CA    1 
ATOM   3685 C C     . ASN B 1 83  ? -1.380  -17.764 16.299 1.00 97.59  ? 113 ASN B C     1 
ATOM   3686 O O     . ASN B 1 83  ? -1.001  -17.877 15.135 1.00 111.06 ? 113 ASN B O     1 
ATOM   3687 C CB    . ASN B 1 83  ? -1.527  -19.102 18.412 1.00 108.02 ? 113 ASN B CB    1 
ATOM   3688 C CG    . ASN B 1 83  ? -2.337  -20.194 17.745 1.00 121.50 ? 113 ASN B CG    1 
ATOM   3689 O OD1   . ASN B 1 83  ? -3.531  -20.351 18.013 1.00 120.05 ? 113 ASN B OD1   1 
ATOM   3690 N ND2   . ASN B 1 83  ? -1.692  -20.958 16.871 1.00 132.91 ? 113 ASN B ND2   1 
ATOM   3691 N N     . ARG B 1 84  ? -2.481  -17.105 16.642 1.00 98.12  ? 114 ARG B N     1 
ATOM   3692 C CA    . ARG B 1 84  ? -3.304  -16.395 15.670 1.00 100.31 ? 114 ARG B CA    1 
ATOM   3693 C C     . ARG B 1 84  ? -3.224  -14.895 15.912 1.00 93.70  ? 114 ARG B C     1 
ATOM   3694 O O     . ARG B 1 84  ? -2.762  -14.459 16.966 1.00 94.52  ? 114 ARG B O     1 
ATOM   3695 C CB    . ARG B 1 84  ? -4.769  -16.822 15.788 1.00 118.05 ? 114 ARG B CB    1 
ATOM   3696 C CG    . ARG B 1 84  ? -5.064  -18.263 15.429 1.00 132.04 ? 114 ARG B CG    1 
ATOM   3697 C CD    . ARG B 1 84  ? -6.543  -18.417 15.120 1.00 141.53 ? 114 ARG B CD    1 
ATOM   3698 N NE    . ARG B 1 84  ? -7.365  -17.626 16.032 1.00 148.96 ? 114 ARG B NE    1 
ATOM   3699 C CZ    . ARG B 1 84  ? -8.617  -17.256 15.782 1.00 161.22 ? 114 ARG B CZ    1 
ATOM   3700 N NH1   . ARG B 1 84  ? -9.198  -17.601 14.641 1.00 165.64 ? 114 ARG B NH1   1 
ATOM   3701 N NH2   . ARG B 1 84  ? -9.288  -16.535 16.671 1.00 164.57 ? 114 ARG B NH2   1 
ATOM   3702 N N     . PRO B 1 85  ? -3.682  -14.097 14.935 1.00 93.04  ? 115 PRO B N     1 
ATOM   3703 C CA    . PRO B 1 85  ? -3.836  -12.655 15.152 1.00 92.75  ? 115 PRO B CA    1 
ATOM   3704 C C     . PRO B 1 85  ? -4.880  -12.386 16.233 1.00 96.00  ? 115 PRO B C     1 
ATOM   3705 O O     . PRO B 1 85  ? -5.604  -13.298 16.631 1.00 96.53  ? 115 PRO B O     1 
ATOM   3706 C CB    . PRO B 1 85  ? -4.341  -12.150 13.796 1.00 91.84  ? 115 PRO B CB    1 
ATOM   3707 C CG    . PRO B 1 85  ? -3.906  -13.181 12.818 1.00 86.99  ? 115 PRO B CG    1 
ATOM   3708 C CD    . PRO B 1 85  ? -3.988  -14.482 13.547 1.00 90.20  ? 115 PRO B CD    1 
ATOM   3709 N N     . SER B 1 86  ? -4.953  -11.147 16.705 1.00 91.51  ? 116 SER B N     1 
ATOM   3710 C CA    . SER B 1 86  ? -5.918  -10.783 17.733 1.00 87.34  ? 116 SER B CA    1 
ATOM   3711 C C     . SER B 1 86  ? -7.117  -10.088 17.103 1.00 93.22  ? 116 SER B C     1 
ATOM   3712 O O     . SER B 1 86  ? -7.019  -9.559  16.001 1.00 95.53  ? 116 SER B O     1 
ATOM   3713 C CB    . SER B 1 86  ? -5.270  -9.875  18.781 1.00 78.00  ? 116 SER B CB    1 
ATOM   3714 O OG    . SER B 1 86  ? -4.807  -8.672  18.193 1.00 70.43  ? 116 SER B OG    1 
ATOM   3715 N N     . LYS B 1 87  ? -8.244  -10.093 17.809 1.00 95.83  ? 117 LYS B N     1 
ATOM   3716 C CA    . LYS B 1 87  ? -9.472  -9.481  17.311 1.00 101.06 ? 117 LYS B CA    1 
ATOM   3717 C C     . LYS B 1 87  ? -9.242  -8.103  16.694 1.00 106.97 ? 117 LYS B C     1 
ATOM   3718 O O     . LYS B 1 87  ? -9.929  -7.721  15.747 1.00 112.47 ? 117 LYS B O     1 
ATOM   3719 C CB    . LYS B 1 87  ? -10.521 -9.388  18.422 1.00 100.76 ? 117 LYS B CB    1 
ATOM   3720 C CG    . LYS B 1 87  ? -11.109 -10.726 18.832 1.00 103.15 ? 117 LYS B CG    1 
ATOM   3721 C CD    . LYS B 1 87  ? -12.358 -10.545 19.677 1.00 105.07 ? 117 LYS B CD    1 
ATOM   3722 C CE    . LYS B 1 87  ? -12.972 -11.888 20.035 1.00 110.65 ? 117 LYS B CE    1 
ATOM   3723 N NZ    . LYS B 1 87  ? -14.180 -11.749 20.893 1.00 107.56 ? 117 LYS B NZ    1 
ATOM   3724 N N     . ILE B 1 88  ? -8.278  -7.359  17.228 1.00 100.15 ? 118 ILE B N     1 
ATOM   3725 C CA    . ILE B 1 88  ? -7.986  -6.028  16.710 1.00 94.44  ? 118 ILE B CA    1 
ATOM   3726 C C     . ILE B 1 88  ? -7.006  -6.091  15.542 1.00 95.18  ? 118 ILE B C     1 
ATOM   3727 O O     . ILE B 1 88  ? -7.018  -5.232  14.660 1.00 94.39  ? 118 ILE B O     1 
ATOM   3728 C CB    . ILE B 1 88  ? -7.424  -5.107  17.801 1.00 86.68  ? 118 ILE B CB    1 
ATOM   3729 C CG1   . ILE B 1 88  ? -7.298  -3.676  17.272 1.00 74.01  ? 118 ILE B CG1   1 
ATOM   3730 C CG2   . ILE B 1 88  ? -6.086  -5.627  18.294 1.00 97.97  ? 118 ILE B CG2   1 
ATOM   3731 C CD1   . ILE B 1 88  ? -8.627  -3.002  17.018 1.00 69.90  ? 118 ILE B CD1   1 
ATOM   3732 N N     . GLN B 1 89  ? -6.162  -7.116  15.542 1.00 88.92  ? 119 GLN B N     1 
ATOM   3733 C CA    . GLN B 1 89  ? -5.210  -7.333  14.463 1.00 81.11  ? 119 GLN B CA    1 
ATOM   3734 C C     . GLN B 1 89  ? -5.899  -7.932  13.241 1.00 90.13  ? 119 GLN B C     1 
ATOM   3735 O O     . GLN B 1 89  ? -5.598  -7.565  12.107 1.00 91.22  ? 119 GLN B O     1 
ATOM   3736 C CB    . GLN B 1 89  ? -4.081  -8.254  14.926 1.00 78.27  ? 119 GLN B CB    1 
ATOM   3737 C CG    . GLN B 1 89  ? -3.106  -7.599  15.887 1.00 79.46  ? 119 GLN B CG    1 
ATOM   3738 C CD    . GLN B 1 89  ? -2.245  -8.605  16.625 1.00 74.33  ? 119 GLN B CD    1 
ATOM   3739 O OE1   . GLN B 1 89  ? -2.287  -9.803  16.342 1.00 66.81  ? 119 GLN B OE1   1 
ATOM   3740 N NE2   . GLN B 1 89  ? -1.463  -8.122  17.584 1.00 72.39  ? 119 GLN B NE2   1 
ATOM   3741 N N     . GLU B 1 90  ? -6.821  -8.858  13.480 1.00 94.14  ? 120 GLU B N     1 
ATOM   3742 C CA    . GLU B 1 90  ? -7.560  -9.498  12.398 1.00 97.69  ? 120 GLU B CA    1 
ATOM   3743 C C     . GLU B 1 90  ? -8.115  -8.462  11.430 1.00 98.11  ? 120 GLU B C     1 
ATOM   3744 O O     . GLU B 1 90  ? -8.329  -8.754  10.258 1.00 111.17 ? 120 GLU B O     1 
ATOM   3745 C CB    . GLU B 1 90  ? -8.687  -10.375 12.950 1.00 106.08 ? 120 GLU B CB    1 
ATOM   3746 C CG    . GLU B 1 90  ? -8.201  -11.660 13.605 1.00 112.52 ? 120 GLU B CG    1 
ATOM   3747 C CD    . GLU B 1 90  ? -9.333  -12.505 14.158 1.00 131.24 ? 120 GLU B CD    1 
ATOM   3748 O OE1   . GLU B 1 90  ? -10.462 -11.984 14.292 1.00 140.20 ? 120 GLU B OE1   1 
ATOM   3749 O OE2   . GLU B 1 90  ? -9.089  -13.692 14.462 1.00 135.97 ? 120 GLU B OE2   1 
ATOM   3750 N N     . ASN B 1 91  ? -8.337  -7.251  11.925 1.00 97.34  ? 121 ASN B N     1 
ATOM   3751 C CA    . ASN B 1 91  ? -8.776  -6.148  11.081 1.00 104.14 ? 121 ASN B CA    1 
ATOM   3752 C C     . ASN B 1 91  ? -7.645  -5.163  10.788 1.00 101.44 ? 121 ASN B C     1 
ATOM   3753 O O     . ASN B 1 91  ? -7.596  -4.562  9.714  1.00 109.73 ? 121 ASN B O     1 
ATOM   3754 C CB    . ASN B 1 91  ? -9.953  -5.415  11.725 1.00 114.68 ? 121 ASN B CB    1 
ATOM   3755 C CG    . ASN B 1 91  ? -11.113 -6.337  12.032 1.00 132.41 ? 121 ASN B CG    1 
ATOM   3756 O OD1   . ASN B 1 91  ? -11.138 -7.001  13.071 1.00 133.90 ? 121 ASN B OD1   1 
ATOM   3757 N ND2   . ASN B 1 91  ? -12.089 -6.377  11.130 1.00 136.34 ? 121 ASN B ND2   1 
ATOM   3758 N N     . ALA B 1 92  ? -6.737  -5.009  11.747 1.00 84.00  ? 122 ALA B N     1 
ATOM   3759 C CA    . ALA B 1 92  ? -5.644  -4.052  11.628 1.00 85.32  ? 122 ALA B CA    1 
ATOM   3760 C C     . ALA B 1 92  ? -4.568  -4.523  10.658 1.00 99.66  ? 122 ALA B C     1 
ATOM   3761 O O     . ALA B 1 92  ? -4.024  -3.729  9.892  1.00 114.21 ? 122 ALA B O     1 
ATOM   3762 C CB    . ALA B 1 92  ? -5.032  -3.768  12.999 1.00 86.48  ? 122 ALA B CB    1 
ATOM   3763 N N     . LEU B 1 93  ? -4.259  -5.815  10.695 1.00 97.80  ? 123 LEU B N     1 
ATOM   3764 C CA    . LEU B 1 93  ? -3.189  -6.360  9.862  1.00 96.39  ? 123 LEU B CA    1 
ATOM   3765 C C     . LEU B 1 93  ? -3.482  -6.301  8.355  1.00 89.45  ? 123 LEU B C     1 
ATOM   3766 O O     . LEU B 1 93  ? -2.632  -5.875  7.575  1.00 84.34  ? 123 LEU B O     1 
ATOM   3767 C CB    . LEU B 1 93  ? -2.810  -7.777  10.312 1.00 93.28  ? 123 LEU B CB    1 
ATOM   3768 C CG    . LEU B 1 93  ? -2.180  -7.846  11.707 1.00 76.93  ? 123 LEU B CG    1 
ATOM   3769 C CD1   . LEU B 1 93  ? -1.640  -9.236  12.012 1.00 65.69  ? 123 LEU B CD1   1 
ATOM   3770 C CD2   . LEU B 1 93  ? -1.079  -6.807  11.831 1.00 67.67  ? 123 LEU B CD2   1 
ATOM   3771 N N     . PRO B 1 94  ? -4.686  -6.723  7.938  1.00 97.63  ? 124 PRO B N     1 
ATOM   3772 C CA    . PRO B 1 94  ? -5.037  -6.628  6.516  1.00 98.00  ? 124 PRO B CA    1 
ATOM   3773 C C     . PRO B 1 94  ? -4.937  -5.198  5.986  1.00 102.25 ? 124 PRO B C     1 
ATOM   3774 O O     . PRO B 1 94  ? -4.286  -4.974  4.970  1.00 109.04 ? 124 PRO B O     1 
ATOM   3775 C CB    . PRO B 1 94  ? -6.487  -7.108  6.485  1.00 102.58 ? 124 PRO B CB    1 
ATOM   3776 C CG    . PRO B 1 94  ? -6.609  -8.000  7.669  1.00 103.62 ? 124 PRO B CG    1 
ATOM   3777 C CD    . PRO B 1 94  ? -5.746  -7.380  8.722  1.00 100.64 ? 124 PRO B CD    1 
ATOM   3778 N N     . LEU B 1 95  ? -5.566  -4.245  6.668  1.00 107.49 ? 125 LEU B N     1 
ATOM   3779 C CA    . LEU B 1 95  ? -5.510  -2.844  6.251  1.00 103.30 ? 125 LEU B CA    1 
ATOM   3780 C C     . LEU B 1 95  ? -4.075  -2.336  6.096  1.00 96.01  ? 125 LEU B C     1 
ATOM   3781 O O     . LEU B 1 95  ? -3.705  -1.790  5.058  1.00 97.78  ? 125 LEU B O     1 
ATOM   3782 C CB    . LEU B 1 95  ? -6.272  -1.949  7.235  1.00 79.71  ? 125 LEU B CB    1 
ATOM   3783 C CG    . LEU B 1 95  ? -7.795  -1.939  7.133  1.00 93.25  ? 125 LEU B CG    1 
ATOM   3784 C CD1   . LEU B 1 95  ? -8.352  -0.730  7.866  1.00 97.03  ? 125 LEU B CD1   1 
ATOM   3785 C CD2   . LEU B 1 95  ? -8.255  -1.943  5.672  1.00 96.15  ? 125 LEU B CD2   1 
ATOM   3786 N N     . MET B 1 96  ? -3.273  -2.516  7.138  1.00 90.40  ? 126 MET B N     1 
ATOM   3787 C CA    . MET B 1 96  ? -1.898  -2.034  7.132  1.00 93.68  ? 126 MET B CA    1 
ATOM   3788 C C     . MET B 1 96  ? -1.063  -2.740  6.069  1.00 94.76  ? 126 MET B C     1 
ATOM   3789 O O     . MET B 1 96  ? -0.010  -2.246  5.670  1.00 100.62 ? 126 MET B O     1 
ATOM   3790 C CB    . MET B 1 96  ? -1.264  -2.209  8.514  1.00 82.75  ? 126 MET B CB    1 
ATOM   3791 C CG    . MET B 1 96  ? -1.985  -1.458  9.616  1.00 73.49  ? 126 MET B CG    1 
ATOM   3792 S SD    . MET B 1 96  ? -1.417  -1.907  11.265 1.00 92.46  ? 126 MET B SD    1 
ATOM   3793 C CE    . MET B 1 96  ? 0.084   -0.948  11.369 1.00 161.24 ? 126 MET B CE    1 
ATOM   3794 N N     . LEU B 1 97  ? -1.536  -3.897  5.616  1.00 92.27  ? 127 LEU B N     1 
ATOM   3795 C CA    . LEU B 1 97  ? -0.842  -4.651  4.577  1.00 96.83  ? 127 LEU B CA    1 
ATOM   3796 C C     . LEU B 1 97  ? -1.560  -4.549  3.229  1.00 104.96 ? 127 LEU B C     1 
ATOM   3797 O O     . LEU B 1 97  ? -1.033  -4.968  2.198  1.00 99.02  ? 127 LEU B O     1 
ATOM   3798 C CB    . LEU B 1 97  ? -0.688  -6.117  4.989  1.00 90.00  ? 127 LEU B CB    1 
ATOM   3799 C CG    . LEU B 1 97  ? 0.306   -6.412  6.113  1.00 76.68  ? 127 LEU B CG    1 
ATOM   3800 C CD1   . LEU B 1 97  ? 0.339   -7.899  6.422  1.00 80.84  ? 127 LEU B CD1   1 
ATOM   3801 C CD2   . LEU B 1 97  ? 1.691   -5.918  5.747  1.00 64.12  ? 127 LEU B CD2   1 
ATOM   3802 N N     . PRO B 1 100 ? -1.167  -2.333  -2.258 1.00 119.53 ? 130 PRO B N     1 
ATOM   3803 C CA    . PRO B 1 100 ? -1.004  -0.909  -1.950 1.00 121.23 ? 130 PRO B CA    1 
ATOM   3804 C C     . PRO B 1 100 ? -1.189  -0.641  -0.464 1.00 129.96 ? 130 PRO B C     1 
ATOM   3805 O O     . PRO B 1 100 ? -2.014  -1.296  0.173  1.00 133.38 ? 130 PRO B O     1 
ATOM   3806 C CB    . PRO B 1 100 ? -2.138  -0.251  -2.742 1.00 121.61 ? 130 PRO B CB    1 
ATOM   3807 C CG    . PRO B 1 100 ? -2.431  -1.203  -3.843 1.00 121.04 ? 130 PRO B CG    1 
ATOM   3808 C CD    . PRO B 1 100 ? -2.225  -2.563  -3.255 1.00 120.82 ? 130 PRO B CD    1 
ATOM   3809 N N     . PRO B 1 101 ? -0.418  0.308   0.087  1.00 132.76 ? 131 PRO B N     1 
ATOM   3810 C CA    . PRO B 1 101 ? -0.537  0.682   1.501  1.00 117.10 ? 131 PRO B CA    1 
ATOM   3811 C C     . PRO B 1 101 ? -1.807  1.489   1.734  1.00 110.17 ? 131 PRO B C     1 
ATOM   3812 O O     . PRO B 1 101 ? -2.340  2.080   0.794  1.00 124.34 ? 131 PRO B O     1 
ATOM   3813 C CB    . PRO B 1 101 ? 0.695   1.569   1.739  1.00 112.84 ? 131 PRO B CB    1 
ATOM   3814 C CG    . PRO B 1 101 ? 1.594   1.343   0.554  1.00 122.58 ? 131 PRO B CG    1 
ATOM   3815 C CD    . PRO B 1 101 ? 0.673   1.032   -0.583 1.00 132.37 ? 131 PRO B CD    1 
ATOM   3816 N N     . GLN B 1 102 ? -2.292  1.506   2.968  1.00 97.05  ? 132 GLN B N     1 
ATOM   3817 C CA    . GLN B 1 102 ? -3.481  2.283   3.293  1.00 110.15 ? 132 GLN B CA    1 
ATOM   3818 C C     . GLN B 1 102 ? -3.462  2.702   4.761  1.00 107.27 ? 132 GLN B C     1 
ATOM   3819 O O     . GLN B 1 102 ? -3.074  1.924   5.631  1.00 107.11 ? 132 GLN B O     1 
ATOM   3820 C CB    . GLN B 1 102 ? -4.749  1.488   2.968  1.00 116.27 ? 132 GLN B CB    1 
ATOM   3821 C CG    . GLN B 1 102 ? -5.972  2.356   2.701  1.00 128.00 ? 132 GLN B CG    1 
ATOM   3822 C CD    . GLN B 1 102 ? -7.103  1.594   2.023  1.00 140.99 ? 132 GLN B CD    1 
ATOM   3823 O OE1   . GLN B 1 102 ? -7.922  0.952   2.682  1.00 140.29 ? 132 GLN B OE1   1 
ATOM   3824 N NE2   . GLN B 1 102 ? -7.159  1.678   0.698  1.00 144.24 ? 132 GLN B NE2   1 
ATOM   3825 N N     . ASN B 1 103 ? -3.876  3.937   5.026  1.00 101.57 ? 133 ASN B N     1 
ATOM   3826 C CA    . ASN B 1 103 ? -3.845  4.487   6.376  1.00 102.88 ? 133 ASN B CA    1 
ATOM   3827 C C     . ASN B 1 103 ? -4.730  3.739   7.365  1.00 102.08 ? 133 ASN B C     1 
ATOM   3828 O O     . ASN B 1 103 ? -5.557  2.913   6.973  1.00 104.78 ? 133 ASN B O     1 
ATOM   3829 C CB    . ASN B 1 103 ? -4.210  5.972   6.364  1.00 109.89 ? 133 ASN B CB    1 
ATOM   3830 C CG    . ASN B 1 103 ? -3.053  6.847   5.939  1.00 113.80 ? 133 ASN B CG    1 
ATOM   3831 O OD1   . ASN B 1 103 ? -2.033  6.355   5.459  1.00 107.17 ? 133 ASN B OD1   1 
ATOM   3832 N ND2   . ASN B 1 103 ? -3.203  8.154   6.116  1.00 123.49 ? 133 ASN B ND2   1 
ATOM   3833 N N     . LEU B 1 104 ? -4.546  4.034   8.649  1.00 94.20  ? 134 LEU B N     1 
ATOM   3834 C CA    . LEU B 1 104 ? -5.321  3.388   9.702  1.00 96.21  ? 134 LEU B CA    1 
ATOM   3835 C C     . LEU B 1 104 ? -5.349  4.214   10.986 1.00 101.69 ? 134 LEU B C     1 
ATOM   3836 O O     . LEU B 1 104 ? -4.416  4.956   11.284 1.00 102.16 ? 134 LEU B O     1 
ATOM   3837 C CB    . LEU B 1 104 ? -4.772  1.986   9.991  1.00 91.47  ? 134 LEU B CB    1 
ATOM   3838 C CG    . LEU B 1 104 ? -5.543  1.140   11.008 1.00 98.68  ? 134 LEU B CG    1 
ATOM   3839 C CD1   . LEU B 1 104 ? -6.966  0.926   10.545 1.00 109.46 ? 134 LEU B CD1   1 
ATOM   3840 C CD2   . LEU B 1 104 ? -4.861  -0.195  11.245 1.00 95.71  ? 134 LEU B CD2   1 
ATOM   3841 N N     . ILE B 1 105 ? -6.442  4.085   11.729 1.00 106.75 ? 135 ILE B N     1 
ATOM   3842 C CA    . ILE B 1 105 ? -6.558  4.655   13.064 1.00 104.25 ? 135 ILE B CA    1 
ATOM   3843 C C     . ILE B 1 105 ? -7.217  3.616   13.961 1.00 103.71 ? 135 ILE B C     1 
ATOM   3844 O O     . ILE B 1 105 ? -8.445  3.543   14.047 1.00 107.00 ? 135 ILE B O     1 
ATOM   3845 C CB    . ILE B 1 105 ? -7.382  5.963   13.075 1.00 102.87 ? 135 ILE B CB    1 
ATOM   3846 C CG1   . ILE B 1 105 ? -6.570  7.111   12.474 1.00 101.90 ? 135 ILE B CG1   1 
ATOM   3847 C CG2   . ILE B 1 105 ? -7.805  6.325   14.493 1.00 91.14  ? 135 ILE B CG2   1 
ATOM   3848 C CD1   . ILE B 1 105 ? -7.113  8.485   12.821 1.00 101.58 ? 135 ILE B CD1   1 
ATOM   3849 N N     . ALA B 1 106 ? -6.394  2.796   14.609 1.00 88.64  ? 136 ALA B N     1 
ATOM   3850 C CA    . ALA B 1 106 ? -6.902  1.722   15.454 1.00 82.34  ? 136 ALA B CA    1 
ATOM   3851 C C     . ALA B 1 106 ? -7.005  2.159   16.906 1.00 78.83  ? 136 ALA B C     1 
ATOM   3852 O O     . ALA B 1 106 ? -6.029  2.606   17.504 1.00 90.69  ? 136 ALA B O     1 
ATOM   3853 C CB    . ALA B 1 106 ? -6.026  0.490   15.335 1.00 78.17  ? 136 ALA B CB    1 
ATOM   3854 N N     . GLN B 1 107 ? -8.197  2.030   17.472 1.00 70.80  ? 137 GLN B N     1 
ATOM   3855 C CA    . GLN B 1 107 ? -8.387  2.312   18.886 1.00 77.38  ? 137 GLN B CA    1 
ATOM   3856 C C     . GLN B 1 107 ? -8.760  1.029   19.614 1.00 66.61  ? 137 GLN B C     1 
ATOM   3857 O O     . GLN B 1 107 ? -9.659  0.305   19.197 1.00 72.86  ? 137 GLN B O     1 
ATOM   3858 C CB    . GLN B 1 107 ? -9.462  3.384   19.092 1.00 87.85  ? 137 GLN B CB    1 
ATOM   3859 C CG    . GLN B 1 107 ? -10.861 2.842   19.345 1.00 96.19  ? 137 GLN B CG    1 
ATOM   3860 C CD    . GLN B 1 107 ? -11.185 2.715   20.823 1.00 106.87 ? 137 GLN B CD    1 
ATOM   3861 O OE1   . GLN B 1 107 ? -10.614 3.416   21.656 1.00 111.49 ? 137 GLN B OE1   1 
ATOM   3862 N NE2   . GLN B 1 107 ? -12.114 1.824   21.154 1.00 115.66 ? 137 GLN B NE2   1 
ATOM   3863 N N     . SER B 1 108 ? -8.052  0.742   20.697 1.00 60.88  ? 138 SER B N     1 
ATOM   3864 C CA    . SER B 1 108 ? -8.379  -0.410  21.525 1.00 76.39  ? 138 SER B CA    1 
ATOM   3865 C C     . SER B 1 108 ? -7.620  -0.363  22.837 1.00 70.99  ? 138 SER B C     1 
ATOM   3866 O O     . SER B 1 108 ? -6.464  0.053   22.878 1.00 80.17  ? 138 SER B O     1 
ATOM   3867 C CB    . SER B 1 108 ? -8.101  -1.717  20.778 1.00 88.22  ? 138 SER B CB    1 
ATOM   3868 O OG    . SER B 1 108 ? -6.953  -1.607  19.962 1.00 99.88  ? 138 SER B OG    1 
ATOM   3869 N N     . GLN B 1 109 ? -8.287  -0.777  23.910 1.00 71.37  ? 139 GLN B N     1 
ATOM   3870 C CA    . GLN B 1 109 ? -7.682  -0.807  25.242 1.00 66.63  ? 139 GLN B CA    1 
ATOM   3871 C C     . GLN B 1 109 ? -6.307  -1.458  25.196 1.00 59.38  ? 139 GLN B C     1 
ATOM   3872 O O     . GLN B 1 109 ? -6.044  -2.309  24.344 1.00 66.97  ? 139 GLN B O     1 
ATOM   3873 C CB    . GLN B 1 109 ? -8.574  -1.586  26.207 1.00 51.76  ? 139 GLN B CB    1 
ATOM   3874 C CG    . GLN B 1 109 ? -8.681  -3.063  25.868 1.00 74.45  ? 139 GLN B CG    1 
ATOM   3875 C CD    . GLN B 1 109 ? -9.715  -3.782  26.712 1.00 77.88  ? 139 GLN B CD    1 
ATOM   3876 O OE1   . GLN B 1 109 ? -10.433 -4.657  26.226 1.00 90.84  ? 139 GLN B OE1   1 
ATOM   3877 N NE2   . GLN B 1 109 ? -9.800  -3.412  27.984 1.00 67.29  ? 139 GLN B NE2   1 
ATOM   3878 N N     . SER B 1 110 ? -5.428  -1.067  26.111 1.00 55.08  ? 140 SER B N     1 
ATOM   3879 C CA    . SER B 1 110 ? -4.111  -1.686  26.154 1.00 49.84  ? 140 SER B CA    1 
ATOM   3880 C C     . SER B 1 110 ? -4.243  -3.184  26.422 1.00 42.51  ? 140 SER B C     1 
ATOM   3881 O O     . SER B 1 110 ? -5.129  -3.615  27.154 1.00 51.68  ? 140 SER B O     1 
ATOM   3882 C CB    . SER B 1 110 ? -3.184  -0.987  27.162 1.00 38.06  ? 140 SER B CB    1 
ATOM   3883 O OG    . SER B 1 110 ? -3.696  -1.008  28.480 1.00 49.41  ? 140 SER B OG    1 
ATOM   3884 N N     . GLY B 1 111 ? -3.381  -3.977  25.796 1.00 44.62  ? 141 GLY B N     1 
ATOM   3885 C CA    . GLY B 1 111 ? -3.441  -5.420  25.927 1.00 49.19  ? 141 GLY B CA    1 
ATOM   3886 C C     . GLY B 1 111 ? -4.131  -6.140  24.778 1.00 56.98  ? 141 GLY B C     1 
ATOM   3887 O O     . GLY B 1 111 ? -4.297  -7.361  24.820 1.00 56.58  ? 141 GLY B O     1 
ATOM   3888 N N     . THR B 1 112 ? -4.535  -5.397  23.751 1.00 55.07  ? 142 THR B N     1 
ATOM   3889 C CA    . THR B 1 112 ? -5.217  -6.004  22.606 1.00 66.23  ? 142 THR B CA    1 
ATOM   3890 C C     . THR B 1 112 ? -4.251  -6.541  21.544 1.00 75.69  ? 142 THR B C     1 
ATOM   3891 O O     . THR B 1 112 ? -4.451  -7.632  21.017 1.00 81.53  ? 142 THR B O     1 
ATOM   3892 C CB    . THR B 1 112 ? -6.241  -5.046  21.952 1.00 62.20  ? 142 THR B CB    1 
ATOM   3893 O OG1   . THR B 1 112 ? -5.739  -3.706  21.976 1.00 68.17  ? 142 THR B OG1   1 
ATOM   3894 C CG2   . THR B 1 112 ? -7.557  -5.089  22.695 1.00 55.00  ? 142 THR B CG2   1 
ATOM   3895 N N     . GLY B 1 113 ? -3.210  -5.773  21.235 1.00 64.31  ? 143 GLY B N     1 
ATOM   3896 C CA    . GLY B 1 113 ? -2.195  -6.203  20.290 1.00 48.51  ? 143 GLY B CA    1 
ATOM   3897 C C     . GLY B 1 113 ? -1.825  -5.130  19.279 1.00 58.42  ? 143 GLY B C     1 
ATOM   3898 O O     . GLY B 1 113 ? -1.308  -5.434  18.199 1.00 61.05  ? 143 GLY B O     1 
ATOM   3899 N N     . LYS B 1 114 ? -2.093  -3.874  19.628 1.00 51.73  ? 144 LYS B N     1 
ATOM   3900 C CA    . LYS B 1 114 ? -1.802  -2.746  18.752 1.00 51.61  ? 144 LYS B CA    1 
ATOM   3901 C C     . LYS B 1 114 ? -0.311  -2.655  18.454 1.00 52.34  ? 144 LYS B C     1 
ATOM   3902 O O     . LYS B 1 114 ? 0.100   -2.538  17.292 1.00 55.49  ? 144 LYS B O     1 
ATOM   3903 C CB    . LYS B 1 114 ? -2.293  -1.436  19.375 1.00 48.75  ? 144 LYS B CB    1 
ATOM   3904 C CG    . LYS B 1 114 ? -3.786  -1.412  19.687 1.00 56.04  ? 144 LYS B CG    1 
ATOM   3905 C CD    . LYS B 1 114 ? -4.231  -0.057  20.226 1.00 66.53  ? 144 LYS B CD    1 
ATOM   3906 C CE    . LYS B 1 114 ? -3.444  0.361   21.469 1.00 74.18  ? 144 LYS B CE    1 
ATOM   3907 N NZ    . LYS B 1 114 ? -3.723  -0.489  22.666 1.00 73.92  ? 144 LYS B NZ    1 
ATOM   3908 N N     . THR B 1 115 ? 0.492   -2.718  19.514 1.00 46.23  ? 145 THR B N     1 
ATOM   3909 C CA    . THR B 1 115 ? 1.941   -2.633  19.397 1.00 34.96  ? 145 THR B CA    1 
ATOM   3910 C C     . THR B 1 115 ? 2.472   -3.702  18.452 1.00 51.48  ? 145 THR B C     1 
ATOM   3911 O O     . THR B 1 115 ? 3.215   -3.402  17.521 1.00 50.34  ? 145 THR B O     1 
ATOM   3912 C CB    . THR B 1 115 ? 2.621   -2.776  20.767 1.00 37.11  ? 145 THR B CB    1 
ATOM   3913 O OG1   . THR B 1 115 ? 2.463   -1.557  21.504 1.00 48.63  ? 145 THR B OG1   1 
ATOM   3914 C CG2   . THR B 1 115 ? 4.101   -3.074  20.601 1.00 35.73  ? 145 THR B CG2   1 
ATOM   3915 N N     . ALA B 1 116 ? 2.080   -4.949  18.690 1.00 52.01  ? 146 ALA B N     1 
ATOM   3916 C CA    . ALA B 1 116 ? 2.522   -6.048  17.846 1.00 54.10  ? 146 ALA B CA    1 
ATOM   3917 C C     . ALA B 1 116 ? 2.075   -5.805  16.409 1.00 63.54  ? 146 ALA B C     1 
ATOM   3918 O O     . ALA B 1 116 ? 2.782   -6.143  15.461 1.00 60.83  ? 146 ALA B O     1 
ATOM   3919 C CB    . ALA B 1 116 ? 1.980   -7.369  18.364 1.00 47.81  ? 146 ALA B CB    1 
ATOM   3920 N N     . ALA B 1 117 ? 0.899   -5.209  16.255 1.00 61.73  ? 147 ALA B N     1 
ATOM   3921 C CA    . ALA B 1 117 ? 0.349   -4.962  14.933 1.00 61.27  ? 147 ALA B CA    1 
ATOM   3922 C C     . ALA B 1 117 ? 1.258   -4.061  14.102 1.00 61.10  ? 147 ALA B C     1 
ATOM   3923 O O     . ALA B 1 117 ? 1.753   -4.471  13.053 1.00 61.70  ? 147 ALA B O     1 
ATOM   3924 C CB    . ALA B 1 117 ? -1.053  -4.370  15.037 1.00 48.41  ? 147 ALA B CB    1 
ATOM   3925 N N     . PHE B 1 118 ? 1.481   -2.836  14.568 1.00 58.74  ? 148 PHE B N     1 
ATOM   3926 C CA    . PHE B 1 118 ? 2.243   -1.878  13.778 1.00 57.56  ? 148 PHE B CA    1 
ATOM   3927 C C     . PHE B 1 118 ? 3.717   -2.265  13.663 1.00 63.25  ? 148 PHE B C     1 
ATOM   3928 O O     . PHE B 1 118 ? 4.384   -1.926  12.685 1.00 53.13  ? 148 PHE B O     1 
ATOM   3929 C CB    . PHE B 1 118 ? 2.057   -0.437  14.284 1.00 54.90  ? 148 PHE B CB    1 
ATOM   3930 C CG    . PHE B 1 118 ? 2.688   -0.156  15.622 1.00 45.92  ? 148 PHE B CG    1 
ATOM   3931 C CD1   . PHE B 1 118 ? 4.064   -0.042  15.751 1.00 54.74  ? 148 PHE B CD1   1 
ATOM   3932 C CD2   . PHE B 1 118 ? 1.900   0.036   16.742 1.00 46.33  ? 148 PHE B CD2   1 
ATOM   3933 C CE1   . PHE B 1 118 ? 4.642   0.232   16.979 1.00 55.42  ? 148 PHE B CE1   1 
ATOM   3934 C CE2   . PHE B 1 118 ? 2.471   0.313   17.977 1.00 44.09  ? 148 PHE B CE2   1 
ATOM   3935 C CZ    . PHE B 1 118 ? 3.845   0.409   18.094 1.00 51.11  ? 148 PHE B CZ    1 
ATOM   3936 N N     . VAL B 1 119 ? 4.216   -2.985  14.663 1.00 61.31  ? 149 VAL B N     1 
ATOM   3937 C CA    . VAL B 1 119 ? 5.563   -3.537  14.596 1.00 61.65  ? 149 VAL B CA    1 
ATOM   3938 C C     . VAL B 1 119 ? 5.638   -4.512  13.428 1.00 59.30  ? 149 VAL B C     1 
ATOM   3939 O O     . VAL B 1 119 ? 6.622   -4.555  12.697 1.00 52.16  ? 149 VAL B O     1 
ATOM   3940 C CB    . VAL B 1 119 ? 5.941   -4.258  15.907 1.00 54.20  ? 149 VAL B CB    1 
ATOM   3941 C CG1   . VAL B 1 119 ? 7.004   -5.312  15.656 1.00 47.93  ? 149 VAL B CG1   1 
ATOM   3942 C CG2   . VAL B 1 119 ? 6.406   -3.249  16.955 1.00 42.88  ? 149 VAL B CG2   1 
ATOM   3943 N N     . LEU B 1 120 ? 4.574   -5.287  13.260 1.00 69.71  ? 150 LEU B N     1 
ATOM   3944 C CA    . LEU B 1 120 ? 4.468   -6.234  12.162 1.00 75.44  ? 150 LEU B CA    1 
ATOM   3945 C C     . LEU B 1 120 ? 4.419   -5.501  10.824 1.00 88.93  ? 150 LEU B C     1 
ATOM   3946 O O     . LEU B 1 120 ? 4.937   -5.988  9.817  1.00 97.45  ? 150 LEU B O     1 
ATOM   3947 C CB    . LEU B 1 120 ? 3.215   -7.092  12.330 1.00 78.15  ? 150 LEU B CB    1 
ATOM   3948 C CG    . LEU B 1 120 ? 3.115   -8.301  11.405 1.00 85.96  ? 150 LEU B CG    1 
ATOM   3949 C CD1   . LEU B 1 120 ? 4.248   -9.267  11.701 1.00 84.96  ? 150 LEU B CD1   1 
ATOM   3950 C CD2   . LEU B 1 120 ? 1.770   -8.982  11.567 1.00 89.68  ? 150 LEU B CD2   1 
ATOM   3951 N N     . ALA B 1 121 ? 3.794   -4.327  10.818 1.00 80.56  ? 151 ALA B N     1 
ATOM   3952 C CA    . ALA B 1 121 ? 3.693   -3.525  9.603  1.00 72.93  ? 151 ALA B CA    1 
ATOM   3953 C C     . ALA B 1 121 ? 5.058   -2.990  9.190  1.00 67.49  ? 151 ALA B C     1 
ATOM   3954 O O     . ALA B 1 121 ? 5.464   -3.121  8.033  1.00 68.14  ? 151 ALA B O     1 
ATOM   3955 C CB    . ALA B 1 121 ? 2.715   -2.382  9.797  1.00 62.50  ? 151 ALA B CB    1 
ATOM   3956 N N     . MET B 1 122 ? 5.757   -2.382  10.143 1.00 56.01  ? 152 MET B N     1 
ATOM   3957 C CA    . MET B 1 122 ? 7.070   -1.814  9.885  1.00 56.57  ? 152 MET B CA    1 
ATOM   3958 C C     . MET B 1 122 ? 8.005   -2.857  9.293  1.00 62.55  ? 152 MET B C     1 
ATOM   3959 O O     . MET B 1 122 ? 8.622   -2.635  8.244  1.00 51.03  ? 152 MET B O     1 
ATOM   3960 C CB    . MET B 1 122 ? 7.661   -1.244  11.171 1.00 57.97  ? 152 MET B CB    1 
ATOM   3961 C CG    . MET B 1 122 ? 6.963   0.010   11.663 1.00 68.33  ? 152 MET B CG    1 
ATOM   3962 S SD    . MET B 1 122 ? 7.477   0.516   13.319 1.00 75.80  ? 152 MET B SD    1 
ATOM   3963 C CE    . MET B 1 122 ? 6.953   2.225   13.304 1.00 209.92 ? 152 MET B CE    1 
ATOM   3964 N N     . LEU B 1 123 ? 8.097   -4.000  9.966  1.00 57.16  ? 153 LEU B N     1 
ATOM   3965 C CA    . LEU B 1 123 ? 8.979   -5.075  9.529  1.00 64.34  ? 153 LEU B CA    1 
ATOM   3966 C C     . LEU B 1 123 ? 8.606   -5.641  8.155  1.00 69.74  ? 153 LEU B C     1 
ATOM   3967 O O     . LEU B 1 123 ? 9.469   -6.141  7.430  1.00 76.57  ? 153 LEU B O     1 
ATOM   3968 C CB    . LEU B 1 123 ? 9.009   -6.192  10.571 1.00 65.59  ? 153 LEU B CB    1 
ATOM   3969 C CG    . LEU B 1 123 ? 9.609   -5.813  11.925 1.00 60.84  ? 153 LEU B CG    1 
ATOM   3970 C CD1   . LEU B 1 123 ? 9.692   -7.033  12.829 1.00 63.79  ? 153 LEU B CD1   1 
ATOM   3971 C CD2   . LEU B 1 123 ? 10.979  -5.171  11.750 1.00 43.42  ? 153 LEU B CD2   1 
ATOM   3972 N N     . SER B 1 124 ? 7.326   -5.555  7.800  1.00 59.25  ? 154 SER B N     1 
ATOM   3973 C CA    . SER B 1 124 ? 6.852   -6.052  6.510  1.00 72.11  ? 154 SER B CA    1 
ATOM   3974 C C     . SER B 1 124 ? 7.338   -5.205  5.332  1.00 75.67  ? 154 SER B C     1 
ATOM   3975 O O     . SER B 1 124 ? 7.582   -5.725  4.243  1.00 77.81  ? 154 SER B O     1 
ATOM   3976 C CB    . SER B 1 124 ? 5.324   -6.143  6.494  1.00 76.69  ? 154 SER B CB    1 
ATOM   3977 O OG    . SER B 1 124 ? 4.874   -7.306  7.165  1.00 77.43  ? 154 SER B OG    1 
ATOM   3978 N N     . GLN B 1 125 ? 7.474   -3.902  5.558  1.00 71.63  ? 155 GLN B N     1 
ATOM   3979 C CA    . GLN B 1 125 ? 7.915   -2.973  4.522  1.00 69.64  ? 155 GLN B CA    1 
ATOM   3980 C C     . GLN B 1 125 ? 9.436   -2.983  4.352  1.00 72.42  ? 155 GLN B C     1 
ATOM   3981 O O     . GLN B 1 125 ? 9.954   -3.300  3.280  1.00 94.43  ? 155 GLN B O     1 
ATOM   3982 C CB    . GLN B 1 125 ? 7.450   -1.555  4.862  1.00 72.98  ? 155 GLN B CB    1 
ATOM   3983 C CG    . GLN B 1 125 ? 5.960   -1.432  5.148  1.00 86.40  ? 155 GLN B CG    1 
ATOM   3984 C CD    . GLN B 1 125 ? 5.127   -1.207  3.893  1.00 95.48  ? 155 GLN B CD    1 
ATOM   3985 O OE1   . GLN B 1 125 ? 5.568   -1.481  2.773  1.00 91.42  ? 155 GLN B OE1   1 
ATOM   3986 N NE2   . GLN B 1 125 ? 3.913   -0.700  4.080  1.00 101.19 ? 155 GLN B NE2   1 
ATOM   3987 N N     . VAL B 1 126 ? 10.132  -2.629  5.426  1.00 51.25  ? 156 VAL B N     1 
ATOM   3988 C CA    . VAL B 1 126 ? 11.585  -2.495  5.451  1.00 60.13  ? 156 VAL B CA    1 
ATOM   3989 C C     . VAL B 1 126 ? 12.370  -3.330  4.442  1.00 73.68  ? 156 VAL B C     1 
ATOM   3990 O O     . VAL B 1 126 ? 12.186  -4.543  4.333  1.00 77.04  ? 156 VAL B O     1 
ATOM   3991 C CB    . VAL B 1 126 ? 12.148  -2.804  6.856  1.00 59.90  ? 156 VAL B CB    1 
ATOM   3992 C CG1   . VAL B 1 126 ? 13.666  -2.857  6.814  1.00 57.01  ? 156 VAL B CG1   1 
ATOM   3993 C CG2   . VAL B 1 126 ? 11.683  -1.766  7.847  1.00 66.56  ? 156 VAL B CG2   1 
ATOM   3994 N N     . GLU B 1 127 ? 13.251  -2.646  3.719  1.00 81.87  ? 157 GLU B N     1 
ATOM   3995 C CA    . GLU B 1 127 ? 14.270  -3.270  2.891  1.00 82.64  ? 157 GLU B CA    1 
ATOM   3996 C C     . GLU B 1 127 ? 15.605  -3.118  3.605  1.00 78.36  ? 157 GLU B C     1 
ATOM   3997 O O     . GLU B 1 127 ? 16.263  -2.088  3.476  1.00 75.22  ? 157 GLU B O     1 
ATOM   3998 C CB    . GLU B 1 127 ? 14.336  -2.571  1.536  1.00 104.23 ? 157 GLU B CB    1 
ATOM   3999 C CG    . GLU B 1 127 ? 13.273  -3.017  0.561  1.00 130.59 ? 157 GLU B CG    1 
ATOM   4000 C CD    . GLU B 1 127 ? 13.637  -4.318  -0.115 1.00 148.80 ? 157 GLU B CD    1 
ATOM   4001 O OE1   . GLU B 1 127 ? 14.812  -4.468  -0.516 1.00 151.55 ? 157 GLU B OE1   1 
ATOM   4002 O OE2   . GLU B 1 127 ? 12.752  -5.189  -0.248 1.00 157.79 ? 157 GLU B OE2   1 
ATOM   4003 N N     . PRO B 1 128 ? 16.005  -4.141  4.375  1.00 85.56  ? 158 PRO B N     1 
ATOM   4004 C CA    . PRO B 1 128 ? 17.191  -4.068  5.239  1.00 79.69  ? 158 PRO B CA    1 
ATOM   4005 C C     . PRO B 1 128 ? 18.482  -3.769  4.477  1.00 83.67  ? 158 PRO B C     1 
ATOM   4006 O O     . PRO B 1 128 ? 19.492  -3.435  5.101  1.00 78.91  ? 158 PRO B O     1 
ATOM   4007 C CB    . PRO B 1 128 ? 17.258  -5.467  5.863  1.00 73.08  ? 158 PRO B CB    1 
ATOM   4008 C CG    . PRO B 1 128 ? 15.871  -5.995  5.767  1.00 82.08  ? 158 PRO B CG    1 
ATOM   4009 C CD    . PRO B 1 128 ? 15.318  -5.438  4.490  1.00 87.91  ? 158 PRO B CD    1 
ATOM   4010 N N     . ALA B 1 129 ? 18.449  -3.886  3.152  1.00 86.77  ? 159 ALA B N     1 
ATOM   4011 C CA    . ALA B 1 129 ? 19.635  -3.645  2.334  1.00 84.78  ? 159 ALA B CA    1 
ATOM   4012 C C     . ALA B 1 129 ? 19.855  -2.156  2.067  1.00 82.55  ? 159 ALA B C     1 
ATOM   4013 O O     . ALA B 1 129 ? 20.849  -1.764  1.453  1.00 87.41  ? 159 ALA B O     1 
ATOM   4014 C CB    . ALA B 1 129 ? 19.545  -4.415  1.025  1.00 86.08  ? 159 ALA B CB    1 
ATOM   4015 N N     . ASN B 1 130 ? 18.922  -1.332  2.531  1.00 72.60  ? 160 ASN B N     1 
ATOM   4016 C CA    . ASN B 1 130 ? 19.049  0.115   2.415  1.00 75.24  ? 160 ASN B CA    1 
ATOM   4017 C C     . ASN B 1 130 ? 19.325  0.745   3.781  1.00 74.75  ? 160 ASN B C     1 
ATOM   4018 O O     . ASN B 1 130 ? 18.433  0.823   4.626  1.00 77.04  ? 160 ASN B O     1 
ATOM   4019 C CB    . ASN B 1 130 ? 17.788  0.708   1.787  1.00 79.39  ? 160 ASN B CB    1 
ATOM   4020 C CG    . ASN B 1 130 ? 17.483  0.119   0.419  1.00 80.38  ? 160 ASN B CG    1 
ATOM   4021 O OD1   . ASN B 1 130 ? 16.322  -0.103  0.071  1.00 80.72  ? 160 ASN B OD1   1 
ATOM   4022 N ND2   . ASN B 1 130 ? 18.528  -0.139  -0.363 1.00 78.96  ? 160 ASN B ND2   1 
ATOM   4023 N N     . LYS B 1 131 ? 20.562  1.196   3.985  1.00 65.72  ? 161 LYS B N     1 
ATOM   4024 C CA    . LYS B 1 131 ? 21.028  1.632   5.304  1.00 58.50  ? 161 LYS B CA    1 
ATOM   4025 C C     . LYS B 1 131 ? 20.571  3.040   5.699  1.00 52.56  ? 161 LYS B C     1 
ATOM   4026 O O     . LYS B 1 131 ? 21.397  3.932   5.902  1.00 54.39  ? 161 LYS B O     1 
ATOM   4027 C CB    . LYS B 1 131 ? 22.560  1.551   5.395  1.00 53.09  ? 161 LYS B CB    1 
ATOM   4028 C CG    . LYS B 1 131 ? 23.173  0.241   4.911  1.00 41.43  ? 161 LYS B CG    1 
ATOM   4029 C CD    . LYS B 1 131 ? 22.540  -0.983  5.552  1.00 48.11  ? 161 LYS B CD    1 
ATOM   4030 C CE    . LYS B 1 131 ? 23.253  -2.262  5.123  1.00 54.82  ? 161 LYS B CE    1 
ATOM   4031 N NZ    . LYS B 1 131 ? 22.612  -3.501  5.653  1.00 54.63  ? 161 LYS B NZ    1 
ATOM   4032 N N     . TYR B 1 132 ? 19.261  3.231   5.826  1.00 45.42  ? 162 TYR B N     1 
ATOM   4033 C CA    . TYR B 1 132 ? 18.709  4.521   6.236  1.00 43.22  ? 162 TYR B CA    1 
ATOM   4034 C C     . TYR B 1 132 ? 17.276  4.360   6.727  1.00 48.82  ? 162 TYR B C     1 
ATOM   4035 O O     . TYR B 1 132 ? 16.604  3.391   6.370  1.00 43.17  ? 162 TYR B O     1 
ATOM   4036 C CB    . TYR B 1 132 ? 18.779  5.539   5.091  1.00 43.26  ? 162 TYR B CB    1 
ATOM   4037 C CG    . TYR B 1 132 ? 18.227  5.037   3.772  1.00 72.43  ? 162 TYR B CG    1 
ATOM   4038 C CD1   . TYR B 1 132 ? 19.066  4.485   2.809  1.00 71.66  ? 162 TYR B CD1   1 
ATOM   4039 C CD2   . TYR B 1 132 ? 16.868  5.118   3.488  1.00 84.01  ? 162 TYR B CD2   1 
ATOM   4040 C CE1   . TYR B 1 132 ? 18.568  4.028   1.603  1.00 75.88  ? 162 TYR B CE1   1 
ATOM   4041 C CE2   . TYR B 1 132 ? 16.360  4.661   2.283  1.00 86.22  ? 162 TYR B CE2   1 
ATOM   4042 C CZ    . TYR B 1 132 ? 17.215  4.119   1.344  1.00 85.25  ? 162 TYR B CZ    1 
ATOM   4043 O OH    . TYR B 1 132 ? 16.715  3.663   0.144  1.00 89.46  ? 162 TYR B OH    1 
ATOM   4044 N N     . PRO B 1 133 ? 16.807  5.303   7.560  1.00 44.27  ? 163 PRO B N     1 
ATOM   4045 C CA    . PRO B 1 133 ? 15.463  5.169   8.132  1.00 51.23  ? 163 PRO B CA    1 
ATOM   4046 C C     . PRO B 1 133 ? 14.404  5.019   7.048  1.00 68.70  ? 163 PRO B C     1 
ATOM   4047 O O     . PRO B 1 133 ? 14.391  5.778   6.075  1.00 73.17  ? 163 PRO B O     1 
ATOM   4048 C CB    . PRO B 1 133 ? 15.273  6.478   8.906  1.00 43.21  ? 163 PRO B CB    1 
ATOM   4049 C CG    . PRO B 1 133 ? 16.656  6.906   9.250  1.00 48.13  ? 163 PRO B CG    1 
ATOM   4050 C CD    . PRO B 1 133 ? 17.517  6.483   8.081  1.00 31.13  ? 163 PRO B CD    1 
ATOM   4051 N N     . GLN B 1 134 ? 13.540  4.025   7.221  1.00 70.08  ? 164 GLN B N     1 
ATOM   4052 C CA    . GLN B 1 134 ? 12.456  3.764   6.289  1.00 66.70  ? 164 GLN B CA    1 
ATOM   4053 C C     . GLN B 1 134 ? 11.153  3.687   7.069  1.00 69.04  ? 164 GLN B C     1 
ATOM   4054 O O     . GLN B 1 134 ? 10.068  3.780   6.500  1.00 68.84  ? 164 GLN B O     1 
ATOM   4055 C CB    . GLN B 1 134 ? 12.689  2.449   5.547  1.00 65.00  ? 164 GLN B CB    1 
ATOM   4056 C CG    . GLN B 1 134 ? 14.014  2.361   4.810  1.00 62.07  ? 164 GLN B CG    1 
ATOM   4057 C CD    . GLN B 1 134 ? 14.270  0.975   4.238  1.00 66.83  ? 164 GLN B CD    1 
ATOM   4058 O OE1   . GLN B 1 134 ? 13.336  0.210   3.996  1.00 76.15  ? 164 GLN B OE1   1 
ATOM   4059 N NE2   . GLN B 1 134 ? 15.539  0.646   4.022  1.00 61.28  ? 164 GLN B NE2   1 
ATOM   4060 N N     . CYS B 1 135 ? 11.274  3.502   8.379  1.00 67.44  ? 165 CYS B N     1 
ATOM   4061 C CA    . CYS B 1 135 ? 10.118  3.489   9.269  1.00 58.38  ? 165 CYS B CA    1 
ATOM   4062 C C     . CYS B 1 135 ? 10.368  4.388   10.472 1.00 51.71  ? 165 CYS B C     1 
ATOM   4063 O O     . CYS B 1 135 ? 11.424  4.334   11.094 1.00 58.58  ? 165 CYS B O     1 
ATOM   4064 C CB    . CYS B 1 135 ? 9.804   2.065   9.730  1.00 55.10  ? 165 CYS B CB    1 
ATOM   4065 S SG    . CYS B 1 135 ? 9.314   0.945   8.397  1.00 94.52  ? 165 CYS B SG    1 
ATOM   4066 N N     . LEU B 1 136 ? 9.391   5.222   10.793 1.00 50.71  ? 166 LEU B N     1 
ATOM   4067 C CA    . LEU B 1 136 ? 9.521   6.136   11.915 1.00 51.53  ? 166 LEU B CA    1 
ATOM   4068 C C     . LEU B 1 136 ? 8.381   5.943   12.906 1.00 56.49  ? 166 LEU B C     1 
ATOM   4069 O O     . LEU B 1 136 ? 7.210   6.046   12.548 1.00 67.50  ? 166 LEU B O     1 
ATOM   4070 C CB    . LEU B 1 136 ? 9.547   7.580   11.419 1.00 59.87  ? 166 LEU B CB    1 
ATOM   4071 C CG    . LEU B 1 136 ? 9.679   8.640   12.508 1.00 67.30  ? 166 LEU B CG    1 
ATOM   4072 C CD1   . LEU B 1 136 ? 10.883  8.345   13.378 1.00 65.56  ? 166 LEU B CD1   1 
ATOM   4073 C CD2   . LEU B 1 136 ? 9.783   10.023  11.892 1.00 73.20  ? 166 LEU B CD2   1 
ATOM   4074 N N     . CYS B 1 137 ? 8.730   5.659   14.156 1.00 51.86  ? 167 CYS B N     1 
ATOM   4075 C CA    . CYS B 1 137 ? 7.733   5.465   15.199 1.00 48.02  ? 167 CYS B CA    1 
ATOM   4076 C C     . CYS B 1 137 ? 7.852   6.547   16.258 1.00 49.00  ? 167 CYS B C     1 
ATOM   4077 O O     . CYS B 1 137 ? 8.950   6.875   16.700 1.00 51.45  ? 167 CYS B O     1 
ATOM   4078 C CB    . CYS B 1 137 ? 7.899   4.093   15.847 1.00 46.51  ? 167 CYS B CB    1 
ATOM   4079 S SG    . CYS B 1 137 ? 6.582   3.654   17.007 1.00 73.71  ? 167 CYS B SG    1 
ATOM   4080 N N     . LEU B 1 138 ? 6.719   7.107   16.663 1.00 48.79  ? 168 LEU B N     1 
ATOM   4081 C CA    . LEU B 1 138 ? 6.718   8.064   17.761 1.00 62.99  ? 168 LEU B CA    1 
ATOM   4082 C C     . LEU B 1 138 ? 6.134   7.467   19.041 1.00 64.26  ? 168 LEU B C     1 
ATOM   4083 O O     . LEU B 1 138 ? 5.009   6.973   19.054 1.00 73.22  ? 168 LEU B O     1 
ATOM   4084 C CB    . LEU B 1 138 ? 5.969   9.337   17.373 1.00 70.55  ? 168 LEU B CB    1 
ATOM   4085 C CG    . LEU B 1 138 ? 6.648   10.213  16.322 1.00 77.78  ? 168 LEU B CG    1 
ATOM   4086 C CD1   . LEU B 1 138 ? 6.027   11.600  16.311 1.00 89.21  ? 168 LEU B CD1   1 
ATOM   4087 C CD2   . LEU B 1 138 ? 8.139   10.299  16.593 1.00 75.69  ? 168 LEU B CD2   1 
ATOM   4088 N N     . SER B 1 139 ? 6.915   7.503   20.113 1.00 58.27  ? 169 SER B N     1 
ATOM   4089 C CA    . SER B 1 139 ? 6.430   7.100   21.425 1.00 57.96  ? 169 SER B CA    1 
ATOM   4090 C C     . SER B 1 139 ? 6.369   8.315   22.333 1.00 57.54  ? 169 SER B C     1 
ATOM   4091 O O     . SER B 1 139 ? 7.133   9.262   22.159 1.00 52.95  ? 169 SER B O     1 
ATOM   4092 C CB    . SER B 1 139 ? 7.318   6.012   22.038 1.00 57.25  ? 169 SER B CB    1 
ATOM   4093 O OG    . SER B 1 139 ? 6.902   4.719   21.626 1.00 60.80  ? 169 SER B OG    1 
ATOM   4094 N N     . PRO B 1 140 ? 5.447   8.293   23.303 1.00 60.53  ? 170 PRO B N     1 
ATOM   4095 C CA    . PRO B 1 140 ? 5.217   9.418   24.217 1.00 59.67  ? 170 PRO B CA    1 
ATOM   4096 C C     . PRO B 1 140 ? 6.419   9.693   25.120 1.00 66.13  ? 170 PRO B C     1 
ATOM   4097 O O     . PRO B 1 140 ? 6.673   10.847  25.464 1.00 68.69  ? 170 PRO B O     1 
ATOM   4098 C CB    . PRO B 1 140 ? 4.024   8.950   25.054 1.00 62.31  ? 170 PRO B CB    1 
ATOM   4099 C CG    . PRO B 1 140 ? 3.387   7.859   24.252 1.00 61.74  ? 170 PRO B CG    1 
ATOM   4100 C CD    . PRO B 1 140 ? 4.509   7.185   23.545 1.00 57.03  ? 170 PRO B CD    1 
ATOM   4101 N N     . THR B 1 141 ? 7.142   8.643   25.501 1.00 66.33  ? 171 THR B N     1 
ATOM   4102 C CA    . THR B 1 141 ? 8.305   8.785   26.374 1.00 65.16  ? 171 THR B CA    1 
ATOM   4103 C C     . THR B 1 141 ? 9.426   7.824   25.997 1.00 68.83  ? 171 THR B C     1 
ATOM   4104 O O     . THR B 1 141 ? 9.257   6.957   25.137 1.00 80.03  ? 171 THR B O     1 
ATOM   4105 C CB    . THR B 1 141 ? 7.950   8.557   27.862 1.00 64.31  ? 171 THR B CB    1 
ATOM   4106 O OG1   . THR B 1 141 ? 7.685   7.166   28.095 1.00 60.71  ? 171 THR B OG1   1 
ATOM   4107 C CG2   . THR B 1 141 ? 6.741   9.388   28.262 1.00 55.73  ? 171 THR B CG2   1 
ATOM   4108 N N     . TYR B 1 142 ? 10.564  7.988   26.664 1.00 63.33  ? 172 TYR B N     1 
ATOM   4109 C CA    . TYR B 1 142 ? 11.769  7.201   26.411 1.00 65.63  ? 172 TYR B CA    1 
ATOM   4110 C C     . TYR B 1 142 ? 11.620  5.754   26.895 1.00 57.18  ? 172 TYR B C     1 
ATOM   4111 O O     . TYR B 1 142 ? 11.999  4.811   26.196 1.00 50.01  ? 172 TYR B O     1 
ATOM   4112 C CB    . TYR B 1 142 ? 12.971  7.913   27.056 1.00 79.34  ? 172 TYR B CB    1 
ATOM   4113 C CG    . TYR B 1 142 ? 14.203  7.074   27.339 1.00 84.39  ? 172 TYR B CG    1 
ATOM   4114 C CD1   . TYR B 1 142 ? 14.980  6.559   26.307 1.00 83.34  ? 172 TYR B CD1   1 
ATOM   4115 C CD2   . TYR B 1 142 ? 14.615  6.841   28.647 1.00 86.72  ? 172 TYR B CD2   1 
ATOM   4116 C CE1   . TYR B 1 142 ? 16.112  5.808   26.575 1.00 84.72  ? 172 TYR B CE1   1 
ATOM   4117 C CE2   . TYR B 1 142 ? 15.742  6.095   28.923 1.00 83.96  ? 172 TYR B CE2   1 
ATOM   4118 C CZ    . TYR B 1 142 ? 16.488  5.581   27.887 1.00 87.36  ? 172 TYR B CZ    1 
ATOM   4119 O OH    . TYR B 1 142 ? 17.613  4.837   28.171 1.00 91.36  ? 172 TYR B OH    1 
ATOM   4120 N N     . GLU B 1 143 ? 11.042  5.585   28.080 1.00 53.27  ? 173 GLU B N     1 
ATOM   4121 C CA    . GLU B 1 143 ? 10.830  4.257   28.648 1.00 42.90  ? 173 GLU B CA    1 
ATOM   4122 C C     . GLU B 1 143 ? 9.804   3.458   27.845 1.00 40.24  ? 173 GLU B C     1 
ATOM   4123 O O     . GLU B 1 143 ? 9.957   2.251   27.664 1.00 41.99  ? 173 GLU B O     1 
ATOM   4124 C CB    . GLU B 1 143 ? 10.409  4.350   30.121 1.00 51.46  ? 173 GLU B CB    1 
ATOM   4125 C CG    . GLU B 1 143 ? 11.436  5.006   31.041 1.00 60.18  ? 173 GLU B CG    1 
ATOM   4126 C CD    . GLU B 1 143 ? 11.240  6.512   31.181 1.00 80.09  ? 173 GLU B CD    1 
ATOM   4127 O OE1   . GLU B 1 143 ? 11.543  7.056   32.266 1.00 90.63  ? 173 GLU B OE1   1 
ATOM   4128 O OE2   . GLU B 1 143 ? 10.780  7.155   30.213 1.00 78.22  ? 173 GLU B OE2   1 
ATOM   4129 N N     . LEU B 1 144 ? 8.759   4.132   27.369 1.00 47.36  ? 174 LEU B N     1 
ATOM   4130 C CA    . LEU B 1 144 ? 7.777   3.491   26.499 1.00 38.21  ? 174 LEU B CA    1 
ATOM   4131 C C     . LEU B 1 144 ? 8.379   3.183   25.130 1.00 46.65  ? 174 LEU B C     1 
ATOM   4132 O O     . LEU B 1 144 ? 8.087   2.147   24.538 1.00 60.20  ? 174 LEU B O     1 
ATOM   4133 C CB    . LEU B 1 144 ? 6.536   4.360   26.339 1.00 30.00  ? 174 LEU B CB    1 
ATOM   4134 C CG    . LEU B 1 144 ? 5.563   4.446   27.513 1.00 41.16  ? 174 LEU B CG    1 
ATOM   4135 C CD1   . LEU B 1 144 ? 4.638   5.637   27.340 1.00 41.36  ? 174 LEU B CD1   1 
ATOM   4136 C CD2   . LEU B 1 144 ? 4.761   3.156   27.667 1.00 38.81  ? 174 LEU B CD2   1 
ATOM   4137 N N     . ALA B 1 145 ? 9.216   4.083   24.626 1.00 40.63  ? 175 ALA B N     1 
ATOM   4138 C CA    . ALA B 1 145 ? 9.914   3.838   23.369 1.00 38.13  ? 175 ALA B CA    1 
ATOM   4139 C C     . ALA B 1 145 ? 10.795  2.601   23.473 1.00 43.06  ? 175 ALA B C     1 
ATOM   4140 O O     . ALA B 1 145 ? 10.916  1.834   22.520 1.00 41.30  ? 175 ALA B O     1 
ATOM   4141 C CB    . ALA B 1 145 ? 10.744  5.039   22.975 1.00 30.82  ? 175 ALA B CB    1 
ATOM   4142 N N     . LEU B 1 146 ? 11.412  2.410   24.635 1.00 43.88  ? 176 LEU B N     1 
ATOM   4143 C CA    . LEU B 1 146 ? 12.248  1.236   24.866 1.00 39.74  ? 176 LEU B CA    1 
ATOM   4144 C C     . LEU B 1 146 ? 11.432  -0.046  24.888 1.00 38.87  ? 176 LEU B C     1 
ATOM   4145 O O     . LEU B 1 146 ? 11.933  -1.118  24.546 1.00 41.88  ? 176 LEU B O     1 
ATOM   4146 C CB    . LEU B 1 146 ? 13.027  1.373   26.169 1.00 35.90  ? 176 LEU B CB    1 
ATOM   4147 C CG    . LEU B 1 146 ? 14.390  2.043   26.051 1.00 45.01  ? 176 LEU B CG    1 
ATOM   4148 C CD1   . LEU B 1 146 ? 14.944  2.334   27.424 1.00 34.78  ? 176 LEU B CD1   1 
ATOM   4149 C CD2   . LEU B 1 146 ? 15.341  1.151   25.261 1.00 55.78  ? 176 LEU B CD2   1 
ATOM   4150 N N     . GLN B 1 147 ? 10.173  0.067   25.295 1.00 37.16  ? 177 GLN B N     1 
ATOM   4151 C CA    . GLN B 1 147 ? 9.300   -1.098  25.368 1.00 32.19  ? 177 GLN B CA    1 
ATOM   4152 C C     . GLN B 1 147 ? 8.928   -1.558  23.982 1.00 31.96  ? 177 GLN B C     1 
ATOM   4153 O O     . GLN B 1 147 ? 9.101   -2.728  23.648 1.00 43.31  ? 177 GLN B O     1 
ATOM   4154 C CB    . GLN B 1 147 ? 8.054   -0.792  26.194 1.00 34.42  ? 177 GLN B CB    1 
ATOM   4155 C CG    . GLN B 1 147 ? 8.339   -0.788  27.677 1.00 30.95  ? 177 GLN B CG    1 
ATOM   4156 C CD    . GLN B 1 147 ? 8.973   -2.084  28.119 1.00 43.28  ? 177 GLN B CD    1 
ATOM   4157 O OE1   . GLN B 1 147 ? 8.404   -3.161  27.929 1.00 45.83  ? 177 GLN B OE1   1 
ATOM   4158 N NE2   . GLN B 1 147 ? 10.166  -1.992  28.698 1.00 44.03  ? 177 GLN B NE2   1 
ATOM   4159 N N     . THR B 1 148 ? 8.422   -0.624  23.181 1.00 36.73  ? 178 THR B N     1 
ATOM   4160 C CA    . THR B 1 148 ? 8.144   -0.866  21.767 1.00 40.33  ? 178 THR B CA    1 
ATOM   4161 C C     . THR B 1 148 ? 9.374   -1.424  21.052 1.00 45.00  ? 178 THR B C     1 
ATOM   4162 O O     . THR B 1 148 ? 9.274   -2.364  20.268 1.00 49.23  ? 178 THR B O     1 
ATOM   4163 C CB    . THR B 1 148 ? 7.701   0.429   21.056 1.00 42.53  ? 178 THR B CB    1 
ATOM   4164 O OG1   . THR B 1 148 ? 6.567   0.996   21.730 1.00 52.27  ? 178 THR B OG1   1 
ATOM   4165 C CG2   . THR B 1 148 ? 7.342   0.143   19.618 1.00 45.65  ? 178 THR B CG2   1 
ATOM   4166 N N     . GLY B 1 149 ? 10.535  -0.842  21.331 1.00 38.08  ? 179 GLY B N     1 
ATOM   4167 C CA    . GLY B 1 149 ? 11.775  -1.303  20.738 1.00 39.59  ? 179 GLY B CA    1 
ATOM   4168 C C     . GLY B 1 149 ? 12.047  -2.777  20.984 1.00 45.10  ? 179 GLY B C     1 
ATOM   4169 O O     . GLY B 1 149 ? 12.617  -3.457  20.130 1.00 44.11  ? 179 GLY B O     1 
ATOM   4170 N N     . LYS B 1 150 ? 11.643  -3.275  22.150 1.00 40.67  ? 180 LYS B N     1 
ATOM   4171 C CA    . LYS B 1 150 ? 11.867  -4.679  22.492 1.00 38.45  ? 180 LYS B CA    1 
ATOM   4172 C C     . LYS B 1 150 ? 11.073  -5.619  21.594 1.00 44.44  ? 180 LYS B C     1 
ATOM   4173 O O     . LYS B 1 150 ? 11.576  -6.656  21.166 1.00 56.82  ? 180 LYS B O     1 
ATOM   4174 C CB    . LYS B 1 150 ? 11.536  -4.956  23.961 1.00 48.51  ? 180 LYS B CB    1 
ATOM   4175 C CG    . LYS B 1 150 ? 12.638  -4.555  24.928 1.00 64.82  ? 180 LYS B CG    1 
ATOM   4176 C CD    . LYS B 1 150 ? 12.770  -5.573  26.052 1.00 74.19  ? 180 LYS B CD    1 
ATOM   4177 C CE    . LYS B 1 150 ? 14.175  -5.553  26.641 1.00 75.24  ? 180 LYS B CE    1 
ATOM   4178 N NZ    . LYS B 1 150 ? 14.579  -6.889  27.168 1.00 75.05  ? 180 LYS B NZ    1 
ATOM   4179 N N     . VAL B 1 151 ? 9.827   -5.254  21.320 1.00 39.04  ? 181 VAL B N     1 
ATOM   4180 C CA    . VAL B 1 151 ? 8.988   -6.014  20.403 1.00 45.54  ? 181 VAL B CA    1 
ATOM   4181 C C     . VAL B 1 151 ? 9.668   -6.109  19.038 1.00 40.60  ? 181 VAL B C     1 
ATOM   4182 O O     . VAL B 1 151 ? 9.811   -7.191  18.475 1.00 44.13  ? 181 VAL B O     1 
ATOM   4183 C CB    . VAL B 1 151 ? 7.618   -5.338  20.239 1.00 47.22  ? 181 VAL B CB    1 
ATOM   4184 C CG1   . VAL B 1 151 ? 6.633   -6.265  19.532 1.00 44.11  ? 181 VAL B CG1   1 
ATOM   4185 C CG2   . VAL B 1 151 ? 7.095   -4.917  21.594 1.00 35.58  ? 181 VAL B CG2   1 
ATOM   4186 N N     . ILE B 1 152 ? 10.088  -4.960  18.523 1.00 36.82  ? 182 ILE B N     1 
ATOM   4187 C CA    . ILE B 1 152 ? 10.815  -4.887  17.262 1.00 39.81  ? 182 ILE B CA    1 
ATOM   4188 C C     . ILE B 1 152 ? 12.039  -5.805  17.218 1.00 35.43  ? 182 ILE B C     1 
ATOM   4189 O O     . ILE B 1 152 ? 12.176  -6.614  16.305 1.00 48.10  ? 182 ILE B O     1 
ATOM   4190 C CB    . ILE B 1 152 ? 11.247  -3.445  16.957 1.00 35.87  ? 182 ILE B CB    1 
ATOM   4191 C CG1   . ILE B 1 152 ? 10.019  -2.545  16.876 1.00 28.20  ? 182 ILE B CG1   1 
ATOM   4192 C CG2   . ILE B 1 152 ? 12.043  -3.383  15.659 1.00 23.26  ? 182 ILE B CG2   1 
ATOM   4193 C CD1   . ILE B 1 152 ? 10.351  -1.144  16.483 1.00 31.68  ? 182 ILE B CD1   1 
ATOM   4194 N N     . GLU B 1 153 ? 12.932  -5.681  18.190 1.00 41.14  ? 183 GLU B N     1 
ATOM   4195 C CA    . GLU B 1 153 ? 14.128  -6.522  18.199 1.00 49.73  ? 183 GLU B CA    1 
ATOM   4196 C C     . GLU B 1 153 ? 13.755  -8.001  18.288 1.00 49.66  ? 183 GLU B C     1 
ATOM   4197 O O     . GLU B 1 153 ? 14.420  -8.851  17.704 1.00 57.95  ? 183 GLU B O     1 
ATOM   4198 C CB    . GLU B 1 153 ? 15.072  -6.140  19.348 1.00 35.30  ? 183 GLU B CB    1 
ATOM   4199 C CG    . GLU B 1 153 ? 15.621  -4.720  19.276 1.00 41.19  ? 183 GLU B CG    1 
ATOM   4200 C CD    . GLU B 1 153 ? 15.929  -4.144  20.657 1.00 46.69  ? 183 GLU B CD    1 
ATOM   4201 O OE1   . GLU B 1 153 ? 15.813  -4.895  21.648 1.00 47.53  ? 183 GLU B OE1   1 
ATOM   4202 O OE2   . GLU B 1 153 ? 16.280  -2.945  20.756 1.00 36.95  ? 183 GLU B OE2   1 
ATOM   4203 N N     . GLN B 1 154 ? 12.684  -8.301  19.013 1.00 47.47  ? 184 GLN B N     1 
ATOM   4204 C CA    . GLN B 1 154 ? 12.291  -9.685  19.264 1.00 54.67  ? 184 GLN B CA    1 
ATOM   4205 C C     . GLN B 1 154 ? 11.589  -10.313 18.065 1.00 62.95  ? 184 GLN B C     1 
ATOM   4206 O O     . GLN B 1 154 ? 11.837  -11.470 17.723 1.00 79.67  ? 184 GLN B O     1 
ATOM   4207 C CB    . GLN B 1 154 ? 11.393  -9.772  20.501 1.00 62.09  ? 184 GLN B CB    1 
ATOM   4208 C CG    . GLN B 1 154 ? 10.926  -11.182 20.842 1.00 81.09  ? 184 GLN B CG    1 
ATOM   4209 C CD    . GLN B 1 154 ? 9.898   -11.207 21.967 1.00 91.72  ? 184 GLN B CD    1 
ATOM   4210 O OE1   . GLN B 1 154 ? 9.492   -10.162 22.483 1.00 92.39  ? 184 GLN B OE1   1 
ATOM   4211 N NE2   . GLN B 1 154 ? 9.472   -12.407 22.350 1.00 90.59  ? 184 GLN B NE2   1 
ATOM   4212 N N     . MET B 1 155 ? 10.707  -9.552  17.429 1.00 58.05  ? 185 MET B N     1 
ATOM   4213 C CA    . MET B 1 155 ? 9.960   -10.064 16.288 1.00 58.56  ? 185 MET B CA    1 
ATOM   4214 C C     . MET B 1 155 ? 10.815  -10.088 15.021 1.00 51.27  ? 185 MET B C     1 
ATOM   4215 O O     . MET B 1 155 ? 10.591  -10.897 14.124 1.00 50.60  ? 185 MET B O     1 
ATOM   4216 C CB    . MET B 1 155 ? 8.691   -9.240  16.058 1.00 59.34  ? 185 MET B CB    1 
ATOM   4217 C CG    . MET B 1 155 ? 7.657   -9.930  15.177 1.00 63.76  ? 185 MET B CG    1 
ATOM   4218 S SD    . MET B 1 155 ? 6.263   -8.871  14.741 1.00 64.62  ? 185 MET B SD    1 
ATOM   4219 C CE    . MET B 1 155 ? 5.583   -8.520  16.365 1.00 74.06  ? 185 MET B CE    1 
ATOM   4220 N N     . GLY B 1 156 ? 11.800  -9.200  14.957 1.00 50.68  ? 186 GLY B N     1 
ATOM   4221 C CA    . GLY B 1 156 ? 12.647  -9.100  13.785 1.00 54.78  ? 186 GLY B CA    1 
ATOM   4222 C C     . GLY B 1 156 ? 14.004  -9.750  13.956 1.00 53.88  ? 186 GLY B C     1 
ATOM   4223 O O     . GLY B 1 156 ? 14.953  -9.391  13.260 1.00 53.36  ? 186 GLY B O     1 
ATOM   4224 N N     . LYS B 1 157 ? 14.095  -10.712 14.872 1.00 51.86  ? 187 LYS B N     1 
ATOM   4225 C CA    . LYS B 1 157 ? 15.369  -11.354 15.189 1.00 52.17  ? 187 LYS B CA    1 
ATOM   4226 C C     . LYS B 1 157 ? 15.932  -12.168 14.025 1.00 65.74  ? 187 LYS B C     1 
ATOM   4227 O O     . LYS B 1 157 ? 17.145  -12.320 13.903 1.00 75.21  ? 187 LYS B O     1 
ATOM   4228 C CB    . LYS B 1 157 ? 15.244  -12.237 16.435 1.00 54.95  ? 187 LYS B CB    1 
ATOM   4229 C CG    . LYS B 1 157 ? 14.411  -13.493 16.240 1.00 61.65  ? 187 LYS B CG    1 
ATOM   4230 C CD    . LYS B 1 157 ? 14.513  -14.415 17.445 1.00 68.70  ? 187 LYS B CD    1 
ATOM   4231 C CE    . LYS B 1 157 ? 14.088  -13.706 18.722 1.00 80.36  ? 187 LYS B CE    1 
ATOM   4232 N NZ    . LYS B 1 157 ? 14.194  -14.588 19.918 1.00 86.67  ? 187 LYS B NZ    1 
ATOM   4233 N N     . PHE B 1 158 ? 15.054  -12.687 13.172 1.00 71.98  ? 188 PHE B N     1 
ATOM   4234 C CA    . PHE B 1 158 ? 15.489  -13.457 12.008 1.00 75.71  ? 188 PHE B CA    1 
ATOM   4235 C C     . PHE B 1 158 ? 15.683  -12.571 10.776 1.00 71.64  ? 188 PHE B C     1 
ATOM   4236 O O     . PHE B 1 158 ? 15.689  -13.053 9.642  1.00 72.77  ? 188 PHE B O     1 
ATOM   4237 C CB    . PHE B 1 158 ? 14.509  -14.591 11.707 1.00 81.82  ? 188 PHE B CB    1 
ATOM   4238 C CG    . PHE B 1 158 ? 14.246  -15.487 12.881 1.00 94.52  ? 188 PHE B CG    1 
ATOM   4239 C CD1   . PHE B 1 158 ? 15.245  -16.302 13.384 1.00 102.80 ? 188 PHE B CD1   1 
ATOM   4240 C CD2   . PHE B 1 158 ? 13.000  -15.514 13.484 1.00 101.08 ? 188 PHE B CD2   1 
ATOM   4241 C CE1   . PHE B 1 158 ? 15.007  -17.128 14.469 1.00 107.97 ? 188 PHE B CE1   1 
ATOM   4242 C CE2   . PHE B 1 158 ? 12.756  -16.339 14.569 1.00 105.54 ? 188 PHE B CE2   1 
ATOM   4243 C CZ    . PHE B 1 158 ? 13.760  -17.146 15.061 1.00 105.69 ? 188 PHE B CZ    1 
ATOM   4244 N N     . TYR B 1 159 ? 15.825  -11.270 11.015 1.00 63.91  ? 189 TYR B N     1 
ATOM   4245 C CA    . TYR B 1 159 ? 16.245  -10.327 9.988  1.00 63.79  ? 189 TYR B CA    1 
ATOM   4246 C C     . TYR B 1 159 ? 17.676  -9.921  10.282 1.00 64.90  ? 189 TYR B C     1 
ATOM   4247 O O     . TYR B 1 159 ? 17.917  -9.070  11.133 1.00 53.30  ? 189 TYR B O     1 
ATOM   4248 C CB    . TYR B 1 159 ? 15.358  -9.083  9.977  1.00 65.03  ? 189 TYR B CB    1 
ATOM   4249 C CG    . TYR B 1 159 ? 14.258  -9.118  8.949  1.00 72.39  ? 189 TYR B CG    1 
ATOM   4250 C CD1   . TYR B 1 159 ? 12.942  -9.349  9.321  1.00 80.96  ? 189 TYR B CD1   1 
ATOM   4251 C CD2   . TYR B 1 159 ? 14.534  -8.915  7.605  1.00 86.06  ? 189 TYR B CD2   1 
ATOM   4252 C CE1   . TYR B 1 159 ? 11.929  -9.378  8.383  1.00 90.96  ? 189 TYR B CE1   1 
ATOM   4253 C CE2   . TYR B 1 159 ? 13.528  -8.944  6.658  1.00 98.46  ? 189 TYR B CE2   1 
ATOM   4254 C CZ    . TYR B 1 159 ? 12.228  -9.176  7.053  1.00 101.91 ? 189 TYR B CZ    1 
ATOM   4255 O OH    . TYR B 1 159 ? 11.221  -9.205  6.117  1.00 111.08 ? 189 TYR B OH    1 
ATOM   4256 N N     . PRO B 1 160 ? 18.631  -10.514 9.555  1.00 84.71  ? 190 PRO B N     1 
ATOM   4257 C CA    . PRO B 1 160 ? 20.068  -10.375 9.809  1.00 90.05  ? 190 PRO B CA    1 
ATOM   4258 C C     . PRO B 1 160 ? 20.511  -8.938  10.090 1.00 85.23  ? 190 PRO B C     1 
ATOM   4259 O O     . PRO B 1 160 ? 20.964  -8.649  11.199 1.00 73.26  ? 190 PRO B O     1 
ATOM   4260 C CB    . PRO B 1 160 ? 20.695  -10.874 8.496  1.00 90.98  ? 190 PRO B CB    1 
ATOM   4261 C CG    . PRO B 1 160 ? 19.566  -10.811 7.489  1.00 87.46  ? 190 PRO B CG    1 
ATOM   4262 C CD    . PRO B 1 160 ? 18.390  -11.230 8.294  1.00 90.63  ? 190 PRO B CD    1 
ATOM   4263 N N     . GLU B 1 161 ? 20.380  -8.054  9.104  1.00 82.87  ? 191 GLU B N     1 
ATOM   4264 C CA    . GLU B 1 161 ? 20.967  -6.722  9.207  1.00 77.75  ? 191 GLU B CA    1 
ATOM   4265 C C     . GLU B 1 161 ? 19.940  -5.603  9.365  1.00 65.07  ? 191 GLU B C     1 
ATOM   4266 O O     . GLU B 1 161 ? 20.116  -4.504  8.836  1.00 59.18  ? 191 GLU B O     1 
ATOM   4267 C CB    . GLU B 1 161 ? 21.888  -6.447  8.012  1.00 90.59  ? 191 GLU B CB    1 
ATOM   4268 C CG    . GLU B 1 161 ? 22.960  -7.512  7.797  1.00 96.57  ? 191 GLU B CG    1 
ATOM   4269 C CD    . GLU B 1 161 ? 24.175  -6.983  7.051  1.00 106.92 ? 191 GLU B CD    1 
ATOM   4270 O OE1   . GLU B 1 161 ? 24.838  -6.057  7.569  1.00 108.02 ? 191 GLU B OE1   1 
ATOM   4271 O OE2   . GLU B 1 161 ? 24.477  -7.504  5.956  1.00 109.05 ? 191 GLU B OE2   1 
ATOM   4272 N N     . LEU B 1 162 ? 18.873  -5.889  10.103 1.00 61.86  ? 192 LEU B N     1 
ATOM   4273 C CA    . LEU B 1 162 ? 17.880  -4.876  10.449 1.00 58.45  ? 192 LEU B CA    1 
ATOM   4274 C C     . LEU B 1 162 ? 18.254  -4.185  11.760 1.00 48.00  ? 192 LEU B C     1 
ATOM   4275 O O     . LEU B 1 162 ? 18.419  -4.844  12.786 1.00 45.95  ? 192 LEU B O     1 
ATOM   4276 C CB    . LEU B 1 162 ? 16.502  -5.512  10.584 1.00 65.71  ? 192 LEU B CB    1 
ATOM   4277 C CG    . LEU B 1 162 ? 15.441  -4.612  11.213 1.00 65.05  ? 192 LEU B CG    1 
ATOM   4278 C CD1   . LEU B 1 162 ? 14.822  -3.699  10.163 1.00 59.80  ? 192 LEU B CD1   1 
ATOM   4279 C CD2   . LEU B 1 162 ? 14.384  -5.459  11.887 1.00 70.84  ? 192 LEU B CD2   1 
ATOM   4280 N N     . LYS B 1 163 ? 18.379  -2.861  11.722 1.00 42.41  ? 193 LYS B N     1 
ATOM   4281 C CA    . LYS B 1 163 ? 18.852  -2.094  12.876 1.00 35.82  ? 193 LYS B CA    1 
ATOM   4282 C C     . LYS B 1 163 ? 17.838  -1.077  13.405 1.00 42.22  ? 193 LYS B C     1 
ATOM   4283 O O     . LYS B 1 163 ? 16.976  -0.597  12.667 1.00 53.83  ? 193 LYS B O     1 
ATOM   4284 C CB    . LYS B 1 163 ? 20.174  -1.392  12.545 1.00 41.93  ? 193 LYS B CB    1 
ATOM   4285 C CG    . LYS B 1 163 ? 21.422  -2.197  12.888 1.00 37.99  ? 193 LYS B CG    1 
ATOM   4286 C CD    . LYS B 1 163 ? 21.240  -3.672  12.570 1.00 52.99  ? 193 LYS B CD    1 
ATOM   4287 C CE    . LYS B 1 163 ? 22.536  -4.445  12.718 1.00 71.54  ? 193 LYS B CE    1 
ATOM   4288 N NZ    . LYS B 1 163 ? 22.318  -5.908  12.536 1.00 76.46  ? 193 LYS B NZ    1 
ATOM   4289 N N     . LEU B 1 164 ? 17.964  -0.744  14.687 1.00 38.71  ? 194 LEU B N     1 
ATOM   4290 C CA    . LEU B 1 164 ? 17.026  0.152   15.357 1.00 23.37  ? 194 LEU B CA    1 
ATOM   4291 C C     . LEU B 1 164 ? 17.760  1.305   16.036 1.00 27.84  ? 194 LEU B C     1 
ATOM   4292 O O     . LEU B 1 164 ? 18.781  1.101   16.689 1.00 41.69  ? 194 LEU B O     1 
ATOM   4293 C CB    . LEU B 1 164 ? 16.222  -0.640  16.381 1.00 27.50  ? 194 LEU B CB    1 
ATOM   4294 C CG    . LEU B 1 164 ? 15.185  0.095   17.220 1.00 48.20  ? 194 LEU B CG    1 
ATOM   4295 C CD1   . LEU B 1 164 ? 14.195  0.829   16.327 1.00 54.24  ? 194 LEU B CD1   1 
ATOM   4296 C CD2   . LEU B 1 164 ? 14.469  -0.884  18.140 1.00 51.04  ? 194 LEU B CD2   1 
ATOM   4297 N N     . ALA B 1 165 ? 17.254  2.522   15.874 1.00 28.92  ? 195 ALA B N     1 
ATOM   4298 C CA    . ALA B 1 165 ? 17.849  3.672   16.555 1.00 29.81  ? 195 ALA B CA    1 
ATOM   4299 C C     . ALA B 1 165 ? 16.824  4.398   17.412 1.00 37.20  ? 195 ALA B C     1 
ATOM   4300 O O     . ALA B 1 165 ? 15.677  4.590   17.004 1.00 42.06  ? 195 ALA B O     1 
ATOM   4301 C CB    . ALA B 1 165 ? 18.471  4.631   15.562 1.00 27.70  ? 195 ALA B CB    1 
ATOM   4302 N N     . TYR B 1 166 ? 17.251  4.800   18.603 1.00 36.53  ? 196 TYR B N     1 
ATOM   4303 C CA    . TYR B 1 166 ? 16.389  5.524   19.526 1.00 38.44  ? 196 TYR B CA    1 
ATOM   4304 C C     . TYR B 1 166 ? 16.659  7.025   19.487 1.00 46.62  ? 196 TYR B C     1 
ATOM   4305 O O     . TYR B 1 166 ? 17.694  7.496   19.965 1.00 45.54  ? 196 TYR B O     1 
ATOM   4306 C CB    . TYR B 1 166 ? 16.557  4.986   20.947 1.00 27.95  ? 196 TYR B CB    1 
ATOM   4307 C CG    . TYR B 1 166 ? 16.071  3.567   21.099 1.00 29.51  ? 196 TYR B CG    1 
ATOM   4308 C CD1   . TYR B 1 166 ? 16.949  2.497   20.982 1.00 27.52  ? 196 TYR B CD1   1 
ATOM   4309 C CD2   . TYR B 1 166 ? 14.728  3.293   21.347 1.00 26.31  ? 196 TYR B CD2   1 
ATOM   4310 C CE1   . TYR B 1 166 ? 16.505  1.193   21.111 1.00 33.90  ? 196 TYR B CE1   1 
ATOM   4311 C CE2   . TYR B 1 166 ? 14.277  1.993   21.486 1.00 23.29  ? 196 TYR B CE2   1 
ATOM   4312 C CZ    . TYR B 1 166 ? 15.169  0.948   21.365 1.00 31.96  ? 196 TYR B CZ    1 
ATOM   4313 O OH    . TYR B 1 166 ? 14.732  -0.347  21.498 1.00 44.87  ? 196 TYR B OH    1 
ATOM   4314 N N     . ALA B 1 167 ? 15.719  7.767   18.909 1.00 45.61  ? 197 ALA B N     1 
ATOM   4315 C CA    . ALA B 1 167 ? 15.827  9.217   18.827 1.00 52.63  ? 197 ALA B CA    1 
ATOM   4316 C C     . ALA B 1 167 ? 15.279  9.846   20.100 1.00 62.01  ? 197 ALA B C     1 
ATOM   4317 O O     . ALA B 1 167 ? 14.188  10.414  20.115 1.00 65.35  ? 197 ALA B O     1 
ATOM   4318 C CB    . ALA B 1 167 ? 15.092  9.742   17.599 1.00 41.40  ? 197 ALA B CB    1 
ATOM   4319 N N     . VAL B 1 168 ? 16.048  9.730   21.174 1.00 57.70  ? 198 VAL B N     1 
ATOM   4320 C CA    . VAL B 1 168 ? 15.630  10.243  22.466 1.00 54.66  ? 198 VAL B CA    1 
ATOM   4321 C C     . VAL B 1 168 ? 16.657  11.230  22.981 1.00 64.68  ? 198 VAL B C     1 
ATOM   4322 O O     . VAL B 1 168 ? 17.819  11.196  22.584 1.00 80.79  ? 198 VAL B O     1 
ATOM   4323 C CB    . VAL B 1 168 ? 15.496  9.110   23.499 1.00 48.80  ? 198 VAL B CB    1 
ATOM   4324 C CG1   . VAL B 1 168 ? 14.411  8.130   23.085 1.00 47.08  ? 198 VAL B CG1   1 
ATOM   4325 C CG2   . VAL B 1 168 ? 16.826  8.394   23.665 1.00 51.61  ? 198 VAL B CG2   1 
ATOM   4326 N N     . ARG B 1 169 ? 16.222  12.114  23.868 1.00 76.57  ? 199 ARG B N     1 
ATOM   4327 C CA    . ARG B 1 169 ? 17.142  13.000  24.560 1.00 83.97  ? 199 ARG B CA    1 
ATOM   4328 C C     . ARG B 1 169 ? 18.191  12.166  25.285 1.00 77.64  ? 199 ARG B C     1 
ATOM   4329 O O     . ARG B 1 169 ? 17.880  11.121  25.859 1.00 73.85  ? 199 ARG B O     1 
ATOM   4330 C CB    . ARG B 1 169 ? 16.377  13.898  25.533 1.00 96.05  ? 199 ARG B CB    1 
ATOM   4331 C CG    . ARG B 1 169 ? 15.975  15.242  24.938 1.00 113.28 ? 199 ARG B CG    1 
ATOM   4332 C CD    . ARG B 1 169 ? 14.531  15.597  25.260 1.00 123.78 ? 199 ARG B CD    1 
ATOM   4333 N NE    . ARG B 1 169 ? 13.619  15.164  24.205 1.00 127.70 ? 199 ARG B NE    1 
ATOM   4334 C CZ    . ARG B 1 169 ? 12.295  15.150  24.317 1.00 133.56 ? 199 ARG B CZ    1 
ATOM   4335 N NH1   . ARG B 1 169 ? 11.718  15.536  25.448 1.00 133.07 ? 199 ARG B NH1   1 
ATOM   4336 N NH2   . ARG B 1 169 ? 11.547  14.742  23.301 1.00 134.28 ? 199 ARG B NH2   1 
ATOM   4337 N N     . GLY B 1 170 ? 19.436  12.623  25.242 1.00 77.49  ? 200 GLY B N     1 
ATOM   4338 C CA    . GLY B 1 170 ? 20.530  11.882  25.839 1.00 85.65  ? 200 GLY B CA    1 
ATOM   4339 C C     . GLY B 1 170 ? 21.260  11.090  24.778 1.00 84.82  ? 200 GLY B C     1 
ATOM   4340 O O     . GLY B 1 170 ? 22.100  10.240  25.079 1.00 86.39  ? 200 GLY B O     1 
ATOM   4341 N N     . ASN B 1 171 ? 20.922  11.372  23.524 1.00 75.46  ? 201 ASN B N     1 
ATOM   4342 C CA    . ASN B 1 171 ? 21.551  10.713  22.390 1.00 58.86  ? 201 ASN B CA    1 
ATOM   4343 C C     . ASN B 1 171 ? 21.940  11.714  21.309 1.00 60.03  ? 201 ASN B C     1 
ATOM   4344 O O     . ASN B 1 171 ? 21.221  11.894  20.326 1.00 57.82  ? 201 ASN B O     1 
ATOM   4345 C CB    . ASN B 1 171 ? 20.630  9.640   21.811 1.00 52.22  ? 201 ASN B CB    1 
ATOM   4346 C CG    . ASN B 1 171 ? 21.349  8.720   20.845 1.00 50.60  ? 201 ASN B CG    1 
ATOM   4347 O OD1   . ASN B 1 171 ? 22.571  8.769   20.723 1.00 55.52  ? 201 ASN B OD1   1 
ATOM   4348 N ND2   . ASN B 1 171 ? 20.594  7.872   20.154 1.00 43.08  ? 201 ASN B ND2   1 
ATOM   4349 N N     . LYS B 1 172 ? 23.078  12.373  21.505 1.00 68.44  ? 202 LYS B N     1 
ATOM   4350 C CA    . LYS B 1 172 ? 23.585  13.327  20.525 1.00 77.94  ? 202 LYS B CA    1 
ATOM   4351 C C     . LYS B 1 172 ? 24.200  12.604  19.329 1.00 67.71  ? 202 LYS B C     1 
ATOM   4352 O O     . LYS B 1 172 ? 24.677  11.471  19.445 1.00 59.33  ? 202 LYS B O     1 
ATOM   4353 C CB    . LYS B 1 172 ? 24.623  14.263  21.155 1.00 92.09  ? 202 LYS B CB    1 
ATOM   4354 C CG    . LYS B 1 172 ? 25.924  13.574  21.556 1.00 103.00 ? 202 LYS B CG    1 
ATOM   4355 C CD    . LYS B 1 172 ? 27.092  14.556  21.669 1.00 108.54 ? 202 LYS B CD    1 
ATOM   4356 C CE    . LYS B 1 172 ? 27.708  14.865  20.308 1.00 104.90 ? 202 LYS B CE    1 
ATOM   4357 N NZ    . LYS B 1 172 ? 28.995  15.606  20.429 1.00 102.38 ? 202 LYS B NZ    1 
ATOM   4358 N N     . LEU B 1 173 ? 24.178  13.271  18.182 1.00 59.56  ? 203 LEU B N     1 
ATOM   4359 C CA    . LEU B 1 173 ? 24.806  12.755  16.976 1.00 70.70  ? 203 LEU B CA    1 
ATOM   4360 C C     . LEU B 1 173 ? 26.002  13.637  16.623 1.00 80.86  ? 203 LEU B C     1 
ATOM   4361 O O     . LEU B 1 173 ? 26.131  14.745  17.145 1.00 83.51  ? 203 LEU B O     1 
ATOM   4362 C CB    . LEU B 1 173 ? 23.795  12.738  15.827 1.00 71.58  ? 203 LEU B CB    1 
ATOM   4363 C CG    . LEU B 1 173 ? 22.440  12.080  16.116 1.00 62.00  ? 203 LEU B CG    1 
ATOM   4364 C CD1   . LEU B 1 173 ? 21.424  12.434  15.041 1.00 68.34  ? 203 LEU B CD1   1 
ATOM   4365 C CD2   . LEU B 1 173 ? 22.571  10.568  16.257 1.00 43.29  ? 203 LEU B CD2   1 
ATOM   4366 N N     . GLU B 1 174 ? 26.882  13.149  15.752 1.00 85.58  ? 204 GLU B N     1 
ATOM   4367 C CA    . GLU B 1 174 ? 28.015  13.953  15.304 1.00 87.67  ? 204 GLU B CA    1 
ATOM   4368 C C     . GLU B 1 174 ? 27.630  14.743  14.057 1.00 93.30  ? 204 GLU B C     1 
ATOM   4369 O O     . GLU B 1 174 ? 26.670  14.399  13.369 1.00 89.95  ? 204 GLU B O     1 
ATOM   4370 C CB    . GLU B 1 174 ? 29.245  13.082  15.027 1.00 86.63  ? 204 GLU B CB    1 
ATOM   4371 C CG    . GLU B 1 174 ? 29.277  12.456  13.635 1.00 93.81  ? 204 GLU B CG    1 
ATOM   4372 C CD    . GLU B 1 174 ? 30.639  11.879  13.278 1.00 93.27  ? 204 GLU B CD    1 
ATOM   4373 O OE1   . GLU B 1 174 ? 30.894  11.662  12.072 1.00 90.57  ? 204 GLU B OE1   1 
ATOM   4374 O OE2   . GLU B 1 174 ? 31.452  11.644  14.200 1.00 88.41  ? 204 GLU B OE2   1 
ATOM   4375 N N     . ARG B 1 175 ? 28.376  15.806  13.773 1.00 106.16 ? 205 ARG B N     1 
ATOM   4376 C CA    . ARG B 1 175 ? 28.108  16.636  12.602 1.00 113.67 ? 205 ARG B CA    1 
ATOM   4377 C C     . ARG B 1 175 ? 27.776  15.799  11.367 1.00 96.69  ? 205 ARG B C     1 
ATOM   4378 O O     . ARG B 1 175 ? 28.551  14.932  10.957 1.00 83.96  ? 205 ARG B O     1 
ATOM   4379 C CB    . ARG B 1 175 ? 29.275  17.595  12.320 1.00 131.70 ? 205 ARG B CB    1 
ATOM   4380 C CG    . ARG B 1 175 ? 30.669  17.015  12.554 1.00 145.21 ? 205 ARG B CG    1 
ATOM   4381 C CD    . ARG B 1 175 ? 31.082  16.041  11.459 1.00 153.79 ? 205 ARG B CD    1 
ATOM   4382 N NE    . ARG B 1 175 ? 32.444  15.545  11.640 1.00 159.52 ? 205 ARG B NE    1 
ATOM   4383 C CZ    . ARG B 1 175 ? 32.981  14.562  10.925 1.00 158.40 ? 205 ARG B CZ    1 
ATOM   4384 N NH1   . ARG B 1 175 ? 32.271  13.961  9.980  1.00 155.51 ? 205 ARG B NH1   1 
ATOM   4385 N NH2   . ARG B 1 175 ? 34.229  14.177  11.157 1.00 158.96 ? 205 ARG B NH2   1 
ATOM   4386 N N     . GLY B 1 176 ? 26.605  16.056  10.796 1.00 92.28  ? 206 GLY B N     1 
ATOM   4387 C CA    . GLY B 1 176 ? 26.182  15.418  9.564  1.00 91.12  ? 206 GLY B CA    1 
ATOM   4388 C C     . GLY B 1 176 ? 26.512  13.943  9.426  1.00 93.66  ? 206 GLY B C     1 
ATOM   4389 O O     . GLY B 1 176 ? 26.951  13.502  8.364  1.00 92.36  ? 206 GLY B O     1 
ATOM   4390 N N     . GLN B 1 177 ? 26.318  13.176  10.493 1.00 93.07  ? 207 GLN B N     1 
ATOM   4391 C CA    . GLN B 1 177 ? 26.347  11.728  10.364 1.00 82.55  ? 207 GLN B CA    1 
ATOM   4392 C C     . GLN B 1 177 ? 25.013  11.333  9.751  1.00 80.06  ? 207 GLN B C     1 
ATOM   4393 O O     . GLN B 1 177 ? 24.008  12.013  9.954  1.00 74.74  ? 207 GLN B O     1 
ATOM   4394 C CB    . GLN B 1 177 ? 26.554  11.039  11.719 1.00 68.65  ? 207 GLN B CB    1 
ATOM   4395 C CG    . GLN B 1 177 ? 25.373  11.146  12.681 1.00 67.69  ? 207 GLN B CG    1 
ATOM   4396 C CD    . GLN B 1 177 ? 25.435  10.134  13.821 1.00 62.58  ? 207 GLN B CD    1 
ATOM   4397 O OE1   . GLN B 1 177 ? 25.712  10.490  14.967 1.00 57.71  ? 207 GLN B OE1   1 
ATOM   4398 N NE2   . GLN B 1 177 ? 25.177  8.868   13.507 1.00 55.71  ? 207 GLN B NE2   1 
ATOM   4399 N N     . LYS B 1 178 ? 25.000  10.257  8.976  1.00 78.77  ? 208 LYS B N     1 
ATOM   4400 C CA    . LYS B 1 178 ? 23.756  9.797   8.377  1.00 77.86  ? 208 LYS B CA    1 
ATOM   4401 C C     . LYS B 1 178 ? 23.265  8.548   9.091  1.00 70.20  ? 208 LYS B C     1 
ATOM   4402 O O     . LYS B 1 178 ? 23.980  7.546   9.168  1.00 67.74  ? 208 LYS B O     1 
ATOM   4403 C CB    . LYS B 1 178 ? 23.940  9.524   6.883  1.00 84.55  ? 208 LYS B CB    1 
ATOM   4404 N N     . ILE B 1 179 ? 22.051  8.617   9.626  1.00 54.91  ? 209 ILE B N     1 
ATOM   4405 C CA    . ILE B 1 179 ? 21.470  7.482   10.325 1.00 40.96  ? 209 ILE B CA    1 
ATOM   4406 C C     . ILE B 1 179 ? 21.419  6.254   9.413  1.00 49.46  ? 209 ILE B C     1 
ATOM   4407 O O     . ILE B 1 179 ? 20.747  6.254   8.383  1.00 57.81  ? 209 ILE B O     1 
ATOM   4408 C CB    . ILE B 1 179 ? 20.060  7.800   10.847 1.00 53.19  ? 209 ILE B CB    1 
ATOM   4409 C CG1   . ILE B 1 179 ? 20.099  8.996   11.797 1.00 60.96  ? 209 ILE B CG1   1 
ATOM   4410 C CG2   . ILE B 1 179 ? 19.469  6.593   11.556 1.00 52.99  ? 209 ILE B CG2   1 
ATOM   4411 C CD1   . ILE B 1 179 ? 20.647  8.668   13.173 1.00 54.96  ? 209 ILE B CD1   1 
ATOM   4412 N N     . SER B 1 180 ? 22.137  5.208   9.807  1.00 51.22  ? 210 SER B N     1 
ATOM   4413 C CA    . SER B 1 180 ? 22.216  3.979   9.030  1.00 47.86  ? 210 SER B CA    1 
ATOM   4414 C C     . SER B 1 180 ? 21.190  2.936   9.472  1.00 52.03  ? 210 SER B C     1 
ATOM   4415 O O     . SER B 1 180 ? 21.108  1.855   8.889  1.00 54.29  ? 210 SER B O     1 
ATOM   4416 C CB    . SER B 1 180 ? 23.623  3.390   9.133  1.00 44.37  ? 210 SER B CB    1 
ATOM   4417 O OG    . SER B 1 180 ? 24.025  3.293   10.488 1.00 49.74  ? 210 SER B OG    1 
ATOM   4418 N N     . GLU B 1 181 ? 20.412  3.260   10.500 1.00 47.96  ? 211 GLU B N     1 
ATOM   4419 C CA    . GLU B 1 181 ? 19.413  2.331   11.022 1.00 46.55  ? 211 GLU B CA    1 
ATOM   4420 C C     . GLU B 1 181 ? 18.106  2.418   10.240 1.00 44.08  ? 211 GLU B C     1 
ATOM   4421 O O     . GLU B 1 181 ? 17.601  3.507   9.969  1.00 45.82  ? 211 GLU B O     1 
ATOM   4422 C CB    . GLU B 1 181 ? 19.152  2.579   12.510 1.00 48.58  ? 211 GLU B CB    1 
ATOM   4423 C CG    . GLU B 1 181 ? 20.303  2.194   13.429 1.00 39.67  ? 211 GLU B CG    1 
ATOM   4424 C CD    . GLU B 1 181 ? 21.388  3.248   13.478 1.00 52.52  ? 211 GLU B CD    1 
ATOM   4425 O OE1   . GLU B 1 181 ? 21.246  4.277   12.783 1.00 63.76  ? 211 GLU B OE1   1 
ATOM   4426 O OE2   . GLU B 1 181 ? 22.383  3.053   14.211 1.00 53.56  ? 211 GLU B OE2   1 
ATOM   4427 N N     . GLN B 1 182 ? 17.558  1.260   9.893  1.00 37.22  ? 212 GLN B N     1 
ATOM   4428 C CA    . GLN B 1 182 ? 16.371  1.192   9.054  1.00 26.79  ? 212 GLN B CA    1 
ATOM   4429 C C     . GLN B 1 182 ? 15.106  1.607   9.789  1.00 37.63  ? 212 GLN B C     1 
ATOM   4430 O O     . GLN B 1 182 ? 14.155  2.074   9.172  1.00 41.69  ? 212 GLN B O     1 
ATOM   4431 C CB    . GLN B 1 182 ? 16.211  -0.213  8.484  1.00 38.78  ? 212 GLN B CB    1 
ATOM   4432 C CG    . GLN B 1 182 ? 17.331  -0.627  7.529  1.00 43.89  ? 212 GLN B CG    1 
ATOM   4433 C CD    . GLN B 1 182 ? 18.495  -1.289  8.237  1.00 53.08  ? 212 GLN B CD    1 
ATOM   4434 O OE1   . GLN B 1 182 ? 18.717  -1.074  9.428  1.00 53.55  ? 212 GLN B OE1   1 
ATOM   4435 N NE2   . GLN B 1 182 ? 19.244  -2.106  7.507  1.00 62.00  ? 212 GLN B NE2   1 
ATOM   4436 N N     . ILE B 1 183 ? 15.098  1.433   11.108 1.00 46.46  ? 213 ILE B N     1 
ATOM   4437 C CA    . ILE B 1 183 ? 13.955  1.833   11.922 1.00 33.78  ? 213 ILE B CA    1 
ATOM   4438 C C     . ILE B 1 183 ? 14.353  2.830   12.993 1.00 36.83  ? 213 ILE B C     1 
ATOM   4439 O O     . ILE B 1 183 ? 15.413  2.716   13.602 1.00 49.92  ? 213 ILE B O     1 
ATOM   4440 C CB    . ILE B 1 183 ? 13.269  0.636   12.591 1.00 32.89  ? 213 ILE B CB    1 
ATOM   4441 C CG1   . ILE B 1 183 ? 12.993  -0.463  11.565 1.00 47.48  ? 213 ILE B CG1   1 
ATOM   4442 C CG2   . ILE B 1 183 ? 11.968  1.078   13.242 1.00 27.47  ? 213 ILE B CG2   1 
ATOM   4443 C CD1   . ILE B 1 183 ? 12.084  -1.557  12.072 1.00 55.11  ? 213 ILE B CD1   1 
ATOM   4444 N N     . VAL B 1 184 ? 13.492  3.814   13.216 1.00 34.85  ? 214 VAL B N     1 
ATOM   4445 C CA    . VAL B 1 184 ? 13.746  4.831   14.221 1.00 35.87  ? 214 VAL B CA    1 
ATOM   4446 C C     . VAL B 1 184 ? 12.556  4.966   15.153 1.00 48.18  ? 214 VAL B C     1 
ATOM   4447 O O     . VAL B 1 184 ? 11.422  5.106   14.705 1.00 52.19  ? 214 VAL B O     1 
ATOM   4448 C CB    . VAL B 1 184 ? 14.014  6.201   13.585 1.00 37.16  ? 214 VAL B CB    1 
ATOM   4449 C CG1   . VAL B 1 184 ? 14.031  7.280   14.662 1.00 33.64  ? 214 VAL B CG1   1 
ATOM   4450 C CG2   . VAL B 1 184 ? 15.324  6.187   12.811 1.00 36.19  ? 214 VAL B CG2   1 
ATOM   4451 N N     . ILE B 1 185 ? 12.821  4.908   16.452 1.00 44.75  ? 215 ILE B N     1 
ATOM   4452 C CA    . ILE B 1 185 ? 11.805  5.191   17.450 1.00 35.21  ? 215 ILE B CA    1 
ATOM   4453 C C     . ILE B 1 185 ? 12.331  6.281   18.361 1.00 34.08  ? 215 ILE B C     1 
ATOM   4454 O O     . ILE B 1 185 ? 13.508  6.298   18.697 1.00 46.45  ? 215 ILE B O     1 
ATOM   4455 C CB    . ILE B 1 185 ? 11.484  3.955   18.285 1.00 46.07  ? 215 ILE B CB    1 
ATOM   4456 C CG1   . ILE B 1 185 ? 11.213  2.761   17.378 1.00 65.38  ? 215 ILE B CG1   1 
ATOM   4457 C CG2   . ILE B 1 185 ? 10.276  4.206   19.179 1.00 41.79  ? 215 ILE B CG2   1 
ATOM   4458 C CD1   . ILE B 1 185 ? 10.576  1.614   18.105 1.00 82.43  ? 215 ILE B CD1   1 
ATOM   4459 N N     . GLY B 1 186 ? 11.466  7.202   18.754 1.00 38.68  ? 216 GLY B N     1 
ATOM   4460 C CA    . GLY B 1 186 ? 11.884  8.276   19.628 1.00 44.39  ? 216 GLY B CA    1 
ATOM   4461 C C     . GLY B 1 186 ? 10.758  9.194   20.054 1.00 53.47  ? 216 GLY B C     1 
ATOM   4462 O O     . GLY B 1 186 ? 9.613   9.055   19.623 1.00 47.71  ? 216 GLY B O     1 
ATOM   4463 N N     . THR B 1 187 ? 11.098  10.143  20.914 1.00 62.90  ? 217 THR B N     1 
ATOM   4464 C CA    . THR B 1 187 ? 10.138  11.114  21.405 1.00 70.99  ? 217 THR B CA    1 
ATOM   4465 C C     . THR B 1 187 ? 10.103  12.318  20.471 1.00 84.39  ? 217 THR B C     1 
ATOM   4466 O O     . THR B 1 187 ? 11.147  12.771  20.004 1.00 88.67  ? 217 THR B O     1 
ATOM   4467 C CB    . THR B 1 187 ? 10.481  11.543  22.841 1.00 67.97  ? 217 THR B CB    1 
ATOM   4468 O OG1   . THR B 1 187 ? 11.842  11.990  22.897 1.00 69.03  ? 217 THR B OG1   1 
ATOM   4469 C CG2   . THR B 1 187 ? 10.312  10.366  23.791 1.00 48.13  ? 217 THR B CG2   1 
ATOM   4470 N N     . PRO B 1 188 ? 8.895   12.835  20.194 1.00 96.88  ? 218 PRO B N     1 
ATOM   4471 C CA    . PRO B 1 188 ? 8.679   13.894  19.201 1.00 97.91  ? 218 PRO B CA    1 
ATOM   4472 C C     . PRO B 1 188 ? 9.731   15.004  19.259 1.00 100.85 ? 218 PRO B C     1 
ATOM   4473 O O     . PRO B 1 188 ? 10.117  15.536  18.219 1.00 103.64 ? 218 PRO B O     1 
ATOM   4474 C CB    . PRO B 1 188 ? 7.301   14.439  19.579 1.00 98.87  ? 218 PRO B CB    1 
ATOM   4475 C CG    . PRO B 1 188 ? 6.601   13.270  20.173 1.00 92.81  ? 218 PRO B CG    1 
ATOM   4476 C CD    . PRO B 1 188 ? 7.653   12.489  20.908 1.00 93.99  ? 218 PRO B CD    1 
ATOM   4477 N N     . GLY B 1 189 ? 10.190  15.340  20.460 1.00 102.30 ? 219 GLY B N     1 
ATOM   4478 C CA    . GLY B 1 189 ? 11.187  16.381  20.624 1.00 96.74  ? 219 GLY B CA    1 
ATOM   4479 C C     . GLY B 1 189 ? 12.457  16.109  19.841 1.00 92.26  ? 219 GLY B C     1 
ATOM   4480 O O     . GLY B 1 189 ? 12.857  16.909  18.998 1.00 94.90  ? 219 GLY B O     1 
ATOM   4481 N N     . THR B 1 190 ? 13.087  14.972  20.120 1.00 84.55  ? 220 THR B N     1 
ATOM   4482 C CA    . THR B 1 190 ? 14.356  14.611  19.500 1.00 81.02  ? 220 THR B CA    1 
ATOM   4483 C C     . THR B 1 190 ? 14.186  14.186  18.044 1.00 80.87  ? 220 THR B C     1 
ATOM   4484 O O     . THR B 1 190 ? 15.027  14.493  17.199 1.00 77.98  ? 220 THR B O     1 
ATOM   4485 C CB    . THR B 1 190 ? 15.049  13.476  20.272 1.00 86.40  ? 220 THR B CB    1 
ATOM   4486 O OG1   . THR B 1 190 ? 15.241  13.873  21.635 1.00 89.09  ? 220 THR B OG1   1 
ATOM   4487 C CG2   . THR B 1 190 ? 16.400  13.147  19.644 1.00 85.38  ? 220 THR B CG2   1 
ATOM   4488 N N     . VAL B 1 191 ? 13.103  13.469  17.760 1.00 75.64  ? 221 VAL B N     1 
ATOM   4489 C CA    . VAL B 1 191 ? 12.797  13.071  16.393 1.00 68.45  ? 221 VAL B CA    1 
ATOM   4490 C C     . VAL B 1 191 ? 12.621  14.316  15.538 1.00 79.65  ? 221 VAL B C     1 
ATOM   4491 O O     . VAL B 1 191 ? 12.904  14.308  14.336 1.00 76.38  ? 221 VAL B O     1 
ATOM   4492 C CB    . VAL B 1 191 ? 11.519  12.218  16.319 1.00 67.47  ? 221 VAL B CB    1 
ATOM   4493 C CG1   . VAL B 1 191 ? 11.020  12.134  14.889 1.00 73.54  ? 221 VAL B CG1   1 
ATOM   4494 C CG2   . VAL B 1 191 ? 11.775  10.829  16.871 1.00 72.97  ? 221 VAL B CG2   1 
ATOM   4495 N N     . LEU B 1 192 ? 12.156  15.390  16.170 1.00 87.31  ? 222 LEU B N     1 
ATOM   4496 C CA    . LEU B 1 192 ? 11.967  16.661  15.483 1.00 98.20  ? 222 LEU B CA    1 
ATOM   4497 C C     . LEU B 1 192 ? 13.270  17.121  14.824 1.00 101.08 ? 222 LEU B C     1 
ATOM   4498 O O     . LEU B 1 192 ? 13.319  17.349  13.615 1.00 90.54  ? 222 LEU B O     1 
ATOM   4499 C CB    . LEU B 1 192 ? 11.453  17.719  16.463 1.00 101.03 ? 222 LEU B CB    1 
ATOM   4500 C CG    . LEU B 1 192 ? 10.857  19.009  15.894 1.00 111.20 ? 222 LEU B CG    1 
ATOM   4501 C CD1   . LEU B 1 192 ? 9.765   18.705  14.877 1.00 119.15 ? 222 LEU B CD1   1 
ATOM   4502 C CD2   . LEU B 1 192 ? 10.319  19.892  17.014 1.00 102.33 ? 222 LEU B CD2   1 
ATOM   4503 N N     . ASP B 1 193 ? 14.325  17.234  15.629 1.00 108.99 ? 223 ASP B N     1 
ATOM   4504 C CA    . ASP B 1 193 ? 15.626  17.711  15.163 1.00 111.04 ? 223 ASP B CA    1 
ATOM   4505 C C     . ASP B 1 193 ? 16.242  16.795  14.115 1.00 110.07 ? 223 ASP B C     1 
ATOM   4506 O O     . ASP B 1 193 ? 16.918  17.254  13.192 1.00 111.75 ? 223 ASP B O     1 
ATOM   4507 C CB    . ASP B 1 193 ? 16.589  17.835  16.344 1.00 110.34 ? 223 ASP B CB    1 
ATOM   4508 C CG    . ASP B 1 193 ? 16.112  18.826  17.381 1.00 113.80 ? 223 ASP B CG    1 
ATOM   4509 O OD1   . ASP B 1 193 ? 16.048  20.034  17.065 1.00 118.53 ? 223 ASP B OD1   1 
ATOM   4510 O OD2   . ASP B 1 193 ? 15.811  18.398  18.515 1.00 108.28 ? 223 ASP B OD2   1 
ATOM   4511 N N     . TRP B 1 194 ? 16.010  15.497  14.273 1.00 101.68 ? 224 TRP B N     1 
ATOM   4512 C CA    . TRP B 1 194 ? 16.611  14.486  13.411 1.00 85.53  ? 224 TRP B CA    1 
ATOM   4513 C C     . TRP B 1 194 ? 16.128  14.562  11.966 1.00 84.30  ? 224 TRP B C     1 
ATOM   4514 O O     . TRP B 1 194 ? 16.762  14.014  11.064 1.00 88.56  ? 224 TRP B O     1 
ATOM   4515 C CB    . TRP B 1 194 ? 16.329  13.097  13.980 1.00 74.97  ? 224 TRP B CB    1 
ATOM   4516 C CG    . TRP B 1 194 ? 17.173  12.761  15.163 1.00 63.37  ? 224 TRP B CG    1 
ATOM   4517 C CD1   . TRP B 1 194 ? 17.625  13.621  16.117 1.00 67.44  ? 224 TRP B CD1   1 
ATOM   4518 C CD2   . TRP B 1 194 ? 17.659  11.460  15.526 1.00 57.82  ? 224 TRP B CD2   1 
ATOM   4519 N NE1   . TRP B 1 194 ? 18.373  12.939  17.048 1.00 74.02  ? 224 TRP B NE1   1 
ATOM   4520 C CE2   . TRP B 1 194 ? 18.407  11.621  16.709 1.00 63.53  ? 224 TRP B CE2   1 
ATOM   4521 C CE3   . TRP B 1 194 ? 17.538  10.191  14.962 1.00 57.78  ? 224 TRP B CE3   1 
ATOM   4522 C CZ2   . TRP B 1 194 ? 19.029  10.540  17.338 1.00 62.64  ? 224 TRP B CZ2   1 
ATOM   4523 C CZ3   . TRP B 1 194 ? 18.158  9.127   15.590 1.00 55.64  ? 224 TRP B CZ3   1 
ATOM   4524 C CH2   . TRP B 1 194 ? 18.892  9.307   16.765 1.00 53.27  ? 224 TRP B CH2   1 
ATOM   4525 N N     . CYS B 1 195 ? 15.007  15.238  11.748 1.00 93.07  ? 225 CYS B N     1 
ATOM   4526 C CA    . CYS B 1 195 ? 14.445  15.351  10.409 1.00 110.16 ? 225 CYS B CA    1 
ATOM   4527 C C     . CYS B 1 195 ? 14.667  16.741  9.824  1.00 127.15 ? 225 CYS B C     1 
ATOM   4528 O O     . CYS B 1 195 ? 14.399  16.979  8.646  1.00 136.87 ? 225 CYS B O     1 
ATOM   4529 C CB    . CYS B 1 195 ? 12.956  15.009  10.424 1.00 113.96 ? 225 CYS B CB    1 
ATOM   4530 S SG    . CYS B 1 195 ? 12.600  13.314  10.937 1.00 98.39  ? 225 CYS B SG    1 
ATOM   4531 N N     . SER B 1 196 ? 15.164  17.652  10.654 1.00 128.95 ? 226 SER B N     1 
ATOM   4532 C CA    . SER B 1 196 ? 15.429  19.016  10.218 1.00 133.95 ? 226 SER B CA    1 
ATOM   4533 C C     . SER B 1 196 ? 16.891  19.201  9.812  1.00 137.28 ? 226 SER B C     1 
ATOM   4534 O O     . SER B 1 196 ? 17.187  19.534  8.662  1.00 141.13 ? 226 SER B O     1 
ATOM   4535 C CB    . SER B 1 196 ? 15.048  20.008  11.318 1.00 131.71 ? 226 SER B CB    1 
ATOM   4536 O OG    . SER B 1 196 ? 13.673  19.897  11.645 1.00 126.73 ? 226 SER B OG    1 
ATOM   4537 N N     . LYS B 1 197 ? 17.800  18.980  10.757 1.00 130.34 ? 227 LYS B N     1 
ATOM   4538 C CA    . LYS B 1 197 ? 19.229  19.122  10.496 1.00 123.72 ? 227 LYS B CA    1 
ATOM   4539 C C     . LYS B 1 197 ? 19.705  18.156  9.412  1.00 117.12 ? 227 LYS B C     1 
ATOM   4540 O O     . LYS B 1 197 ? 19.886  16.964  9.662  1.00 106.35 ? 227 LYS B O     1 
ATOM   4541 C CB    . LYS B 1 197 ? 20.031  18.909  11.781 1.00 121.23 ? 227 LYS B CB    1 
ATOM   4542 N N     . PHE B 1 200 ? 20.292  14.432  8.905  1.00 91.10  ? 230 PHE B N     1 
ATOM   4543 C CA    . PHE B 1 200 ? 20.371  13.136  9.571  1.00 84.85  ? 230 PHE B CA    1 
ATOM   4544 C C     . PHE B 1 200 ? 19.427  12.127  8.937  1.00 90.08  ? 230 PHE B C     1 
ATOM   4545 O O     . PHE B 1 200 ? 19.826  11.015  8.594  1.00 84.86  ? 230 PHE B O     1 
ATOM   4546 C CB    . PHE B 1 200 ? 20.035  13.270  11.053 1.00 77.60  ? 230 PHE B CB    1 
ATOM   4547 C CG    . PHE B 1 200 ? 21.001  14.117  11.818 1.00 82.29  ? 230 PHE B CG    1 
ATOM   4548 C CD1   . PHE B 1 200 ? 22.360  13.869  11.750 1.00 85.72  ? 230 PHE B CD1   1 
ATOM   4549 C CD2   . PHE B 1 200 ? 20.553  15.153  12.617 1.00 87.39  ? 230 PHE B CD2   1 
ATOM   4550 C CE1   . PHE B 1 200 ? 23.255  14.645  12.456 1.00 88.42  ? 230 PHE B CE1   1 
ATOM   4551 C CE2   . PHE B 1 200 ? 21.442  15.932  13.326 1.00 87.85  ? 230 PHE B CE2   1 
ATOM   4552 C CZ    . PHE B 1 200 ? 22.795  15.679  13.246 1.00 89.09  ? 230 PHE B CZ    1 
ATOM   4553 N N     . ILE B 1 201 ? 18.168  12.522  8.797  1.00 100.09 ? 231 ILE B N     1 
ATOM   4554 C CA    . ILE B 1 201 ? 17.155  11.657  8.211  1.00 99.25  ? 231 ILE B CA    1 
ATOM   4555 C C     . ILE B 1 201 ? 16.534  12.318  6.987  1.00 106.58 ? 231 ILE B C     1 
ATOM   4556 O O     . ILE B 1 201 ? 16.313  13.531  6.969  1.00 108.57 ? 231 ILE B O     1 
ATOM   4557 C CB    . ILE B 1 201 ? 16.037  11.335  9.220  1.00 88.06  ? 231 ILE B CB    1 
ATOM   4558 C CG1   . ILE B 1 201 ? 16.631  10.942  10.569 1.00 77.41  ? 231 ILE B CG1   1 
ATOM   4559 C CG2   . ILE B 1 201 ? 15.144  10.223  8.697  1.00 90.86  ? 231 ILE B CG2   1 
ATOM   4560 C CD1   . ILE B 1 201 ? 15.584  10.633  11.614 1.00 79.26  ? 231 ILE B CD1   1 
ATOM   4561 N N     . ASP B 1 202 ? 16.256  11.511  5.968  1.00 104.81 ? 232 ASP B N     1 
ATOM   4562 C CA    . ASP B 1 202 ? 15.595  11.990  4.761  1.00 106.80 ? 232 ASP B CA    1 
ATOM   4563 C C     . ASP B 1 202 ? 14.129  11.572  4.780  1.00 96.72  ? 232 ASP B C     1 
ATOM   4564 O O     . ASP B 1 202 ? 13.794  10.463  4.365  1.00 90.30  ? 232 ASP B O     1 
ATOM   4565 C CB    . ASP B 1 202 ? 16.289  11.427  3.517  1.00 114.52 ? 232 ASP B CB    1 
ATOM   4566 C CG    . ASP B 1 202 ? 15.677  11.934  2.221  1.00 122.15 ? 232 ASP B CG    1 
ATOM   4567 O OD1   . ASP B 1 202 ? 15.946  11.329  1.160  1.00 117.47 ? 232 ASP B OD1   1 
ATOM   4568 O OD2   . ASP B 1 202 ? 14.929  12.935  2.263  1.00 126.07 ? 232 ASP B OD2   1 
ATOM   4569 N N     . PRO B 1 203 ? 13.250  12.460  5.270  1.00 95.61  ? 233 PRO B N     1 
ATOM   4570 C CA    . PRO B 1 203 ? 11.823  12.143  5.379  1.00 99.33  ? 233 PRO B CA    1 
ATOM   4571 C C     . PRO B 1 203 ? 11.262  11.569  4.079  1.00 105.56 ? 233 PRO B C     1 
ATOM   4572 O O     . PRO B 1 203 ? 10.338  10.759  4.116  1.00 111.54 ? 233 PRO B O     1 
ATOM   4573 C CB    . PRO B 1 203 ? 11.193  13.501  5.695  1.00 102.52 ? 233 PRO B CB    1 
ATOM   4574 C CG    . PRO B 1 203 ? 12.267  14.240  6.415  1.00 97.14  ? 233 PRO B CG    1 
ATOM   4575 C CD    . PRO B 1 203 ? 13.552  13.818  5.757  1.00 94.14  ? 233 PRO B CD    1 
ATOM   4576 N N     . LYS B 1 204 ? 11.829  11.983  2.949  1.00 105.64 ? 234 LYS B N     1 
ATOM   4577 C CA    . LYS B 1 204 ? 11.454  11.459  1.637  1.00 106.63 ? 234 LYS B CA    1 
ATOM   4578 C C     . LYS B 1 204 ? 11.423  9.929   1.607  1.00 96.98  ? 234 LYS B C     1 
ATOM   4579 O O     . LYS B 1 204 ? 10.520  9.325   1.025  1.00 82.17  ? 234 LYS B O     1 
ATOM   4580 C CB    . LYS B 1 204 ? 12.435  11.978  0.581  1.00 117.46 ? 234 LYS B CB    1 
ATOM   4581 C CG    . LYS B 1 204 ? 12.377  11.268  -0.768 1.00 126.79 ? 234 LYS B CG    1 
ATOM   4582 C CD    . LYS B 1 204 ? 11.603  12.076  -1.799 1.00 130.67 ? 234 LYS B CD    1 
ATOM   4583 C CE    . LYS B 1 204 ? 11.883  11.581  -3.212 1.00 124.51 ? 234 LYS B CE    1 
ATOM   4584 N NZ    . LYS B 1 204 ? 11.379  12.528  -4.246 1.00 120.88 ? 234 LYS B NZ    1 
ATOM   4585 N N     . LYS B 1 205 ? 12.413  9.308   2.242  1.00 100.00 ? 235 LYS B N     1 
ATOM   4586 C CA    . LYS B 1 205 ? 12.573  7.857   2.194  1.00 93.94  ? 235 LYS B CA    1 
ATOM   4587 C C     . LYS B 1 205 ? 11.799  7.122   3.289  1.00 81.17  ? 235 LYS B C     1 
ATOM   4588 O O     . LYS B 1 205 ? 12.052  5.948   3.550  1.00 78.88  ? 235 LYS B O     1 
ATOM   4589 C CB    . LYS B 1 205 ? 14.057  7.489   2.275  1.00 89.59  ? 235 LYS B CB    1 
ATOM   4590 C CG    . LYS B 1 205 ? 14.927  8.225   1.273  1.00 97.02  ? 235 LYS B CG    1 
ATOM   4591 C CD    . LYS B 1 205 ? 16.391  7.866   1.447  1.00 101.57 ? 235 LYS B CD    1 
ATOM   4592 C CE    . LYS B 1 205 ? 17.239  8.463   0.339  1.00 113.66 ? 235 LYS B CE    1 
ATOM   4593 N NZ    . LYS B 1 205 ? 18.650  7.991   0.410  1.00 120.86 ? 235 LYS B NZ    1 
ATOM   4594 N N     . ILE B 1 206 ? 10.852  7.808   3.920  1.00 74.01  ? 236 ILE B N     1 
ATOM   4595 C CA    . ILE B 1 206 ? 10.081  7.216   5.011  1.00 70.23  ? 236 ILE B CA    1 
ATOM   4596 C C     . ILE B 1 206 ? 8.763   6.607   4.530  1.00 79.59  ? 236 ILE B C     1 
ATOM   4597 O O     . ILE B 1 206 ? 7.820   7.322   4.202  1.00 92.65  ? 236 ILE B O     1 
ATOM   4598 C CB    . ILE B 1 206 ? 9.805   8.243   6.125  1.00 65.72  ? 236 ILE B CB    1 
ATOM   4599 C CG1   . ILE B 1 206 ? 11.120  8.712   6.749  1.00 61.80  ? 236 ILE B CG1   1 
ATOM   4600 C CG2   . ILE B 1 206 ? 8.893   7.649   7.185  1.00 61.11  ? 236 ILE B CG2   1 
ATOM   4601 C CD1   . ILE B 1 206 ? 11.960  7.587   7.313  1.00 57.19  ? 236 ILE B CD1   1 
ATOM   4602 N N     . LYS B 1 207 ? 8.708   5.279   4.505  1.00 74.04  ? 237 LYS B N     1 
ATOM   4603 C CA    . LYS B 1 207 ? 7.544   4.558   4.001  1.00 69.55  ? 237 LYS B CA    1 
ATOM   4604 C C     . LYS B 1 207 ? 6.420   4.440   5.029  1.00 78.31  ? 237 LYS B C     1 
ATOM   4605 O O     . LYS B 1 207 ? 5.240   4.433   4.669  1.00 90.23  ? 237 LYS B O     1 
ATOM   4606 C CB    . LYS B 1 207 ? 7.957   3.166   3.516  1.00 64.39  ? 237 LYS B CB    1 
ATOM   4607 C CG    . LYS B 1 207 ? 9.066   3.186   2.476  1.00 78.74  ? 237 LYS B CG    1 
ATOM   4608 C CD    . LYS B 1 207 ? 9.414   1.790   1.982  1.00 97.14  ? 237 LYS B CD    1 
ATOM   4609 C CE    . LYS B 1 207 ? 10.205  1.011   3.020  1.00 113.07 ? 237 LYS B CE    1 
ATOM   4610 N NZ    . LYS B 1 207 ? 10.771  -0.244  2.449  1.00 124.05 ? 237 LYS B NZ    1 
ATOM   4611 N N     . VAL B 1 208 ? 6.789   4.348   6.305  1.00 72.00  ? 238 VAL B N     1 
ATOM   4612 C CA    . VAL B 1 208 ? 5.816   4.123   7.373  1.00 69.20  ? 238 VAL B CA    1 
ATOM   4613 C C     . VAL B 1 208 ? 5.971   5.105   8.536  1.00 63.65  ? 238 VAL B C     1 
ATOM   4614 O O     . VAL B 1 208 ? 7.084   5.402   8.971  1.00 60.78  ? 238 VAL B O     1 
ATOM   4615 C CB    . VAL B 1 208 ? 5.904   2.679   7.916  1.00 68.29  ? 238 VAL B CB    1 
ATOM   4616 C CG1   . VAL B 1 208 ? 5.139   2.544   9.233  1.00 62.31  ? 238 VAL B CG1   1 
ATOM   4617 C CG2   . VAL B 1 208 ? 5.390   1.686   6.879  1.00 69.21  ? 238 VAL B CG2   1 
ATOM   4618 N N     . PHE B 1 209 ? 4.840   5.602   9.030  1.00 48.39  ? 239 PHE B N     1 
ATOM   4619 C CA    . PHE B 1 209 ? 4.808   6.481   10.193 1.00 57.61  ? 239 PHE B CA    1 
ATOM   4620 C C     . PHE B 1 209 ? 3.835   5.905   11.225 1.00 63.69  ? 239 PHE B C     1 
ATOM   4621 O O     . PHE B 1 209 ? 2.724   5.497   10.879 1.00 67.78  ? 239 PHE B O     1 
ATOM   4622 C CB    . PHE B 1 209 ? 4.386   7.891   9.766  1.00 69.38  ? 239 PHE B CB    1 
ATOM   4623 C CG    . PHE B 1 209 ? 4.288   8.885   10.899 1.00 71.44  ? 239 PHE B CG    1 
ATOM   4624 C CD1   . PHE B 1 209 ? 3.055   9.314   11.357 1.00 68.08  ? 239 PHE B CD1   1 
ATOM   4625 C CD2   . PHE B 1 209 ? 5.428   9.412   11.479 1.00 76.32  ? 239 PHE B CD2   1 
ATOM   4626 C CE1   . PHE B 1 209 ? 2.962   10.236  12.381 1.00 72.90  ? 239 PHE B CE1   1 
ATOM   4627 C CE2   . PHE B 1 209 ? 5.339   10.333  12.505 1.00 73.36  ? 239 PHE B CE2   1 
ATOM   4628 C CZ    . PHE B 1 209 ? 4.105   10.745  12.955 1.00 73.78  ? 239 PHE B CZ    1 
ATOM   4629 N N     . VAL B 1 210 ? 4.260   5.849   12.485 1.00 57.46  ? 240 VAL B N     1 
ATOM   4630 C CA    . VAL B 1 210 ? 3.405   5.336   13.555 1.00 52.41  ? 240 VAL B CA    1 
ATOM   4631 C C     . VAL B 1 210 ? 3.406   6.261   14.756 1.00 57.67  ? 240 VAL B C     1 
ATOM   4632 O O     . VAL B 1 210 ? 4.463   6.636   15.260 1.00 60.89  ? 240 VAL B O     1 
ATOM   4633 C CB    . VAL B 1 210 ? 3.851   3.943   14.043 1.00 49.35  ? 240 VAL B CB    1 
ATOM   4634 C CG1   . VAL B 1 210 ? 3.206   3.619   15.378 1.00 51.82  ? 240 VAL B CG1   1 
ATOM   4635 C CG2   . VAL B 1 210 ? 3.510   2.875   13.027 1.00 57.51  ? 240 VAL B CG2   1 
ATOM   4636 N N     . LEU B 1 211 ? 2.219   6.622   15.223 1.00 69.19  ? 241 LEU B N     1 
ATOM   4637 C CA    . LEU B 1 211 ? 2.110   7.343   16.480 1.00 72.94  ? 241 LEU B CA    1 
ATOM   4638 C C     . LEU B 1 211 ? 1.505   6.436   17.540 1.00 66.16  ? 241 LEU B C     1 
ATOM   4639 O O     . LEU B 1 211 ? 0.285   6.328   17.661 1.00 70.82  ? 241 LEU B O     1 
ATOM   4640 C CB    . LEU B 1 211 ? 1.294   8.624   16.318 1.00 82.07  ? 241 LEU B CB    1 
ATOM   4641 C CG    . LEU B 1 211 ? 1.640   9.692   17.356 1.00 82.90  ? 241 LEU B CG    1 
ATOM   4642 C CD1   . LEU B 1 211 ? 1.595   11.086  16.748 1.00 85.06  ? 241 LEU B CD1   1 
ATOM   4643 C CD2   . LEU B 1 211 ? 0.737   9.589   18.578 1.00 86.23  ? 241 LEU B CD2   1 
ATOM   4644 N N     . ASP B 1 212 ? 2.378   5.773   18.291 1.00 60.51  ? 242 ASP B N     1 
ATOM   4645 C CA    . ASP B 1 212 ? 1.965   4.866   19.352 1.00 71.19  ? 242 ASP B CA    1 
ATOM   4646 C C     . ASP B 1 212 ? 1.343   5.640   20.515 1.00 74.29  ? 242 ASP B C     1 
ATOM   4647 O O     . ASP B 1 212 ? 1.848   6.693   20.910 1.00 61.47  ? 242 ASP B O     1 
ATOM   4648 C CB    . ASP B 1 212 ? 3.169   4.053   19.839 1.00 78.77  ? 242 ASP B CB    1 
ATOM   4649 C CG    . ASP B 1 212 ? 2.767   2.837   20.660 1.00 92.95  ? 242 ASP B CG    1 
ATOM   4650 O OD1   . ASP B 1 212 ? 1.759   2.187   20.309 1.00 98.16  ? 242 ASP B OD1   1 
ATOM   4651 O OD2   . ASP B 1 212 ? 3.467   2.521   21.649 1.00 97.43  ? 242 ASP B OD2   1 
ATOM   4652 N N     . GLU B 1 213 ? 0.239   5.114   21.045 1.00 84.19  ? 243 GLU B N     1 
ATOM   4653 C CA    . GLU B 1 213 ? -0.419  5.665   22.230 1.00 81.70  ? 243 GLU B CA    1 
ATOM   4654 C C     . GLU B 1 213 ? -0.562  7.189   22.192 1.00 85.43  ? 243 GLU B C     1 
ATOM   4655 O O     . GLU B 1 213 ? 0.182   7.908   22.860 1.00 81.71  ? 243 GLU B O     1 
ATOM   4656 C CB    . GLU B 1 213 ? 0.338   5.244   23.488 1.00 85.01  ? 243 GLU B CB    1 
ATOM   4657 C CG    . GLU B 1 213 ? 0.746   3.780   23.504 1.00 97.88  ? 243 GLU B CG    1 
ATOM   4658 C CD    . GLU B 1 213 ? 1.813   3.483   24.545 1.00 99.80  ? 243 GLU B CD    1 
ATOM   4659 O OE1   . GLU B 1 213 ? 1.686   3.980   25.684 1.00 99.48  ? 243 GLU B OE1   1 
ATOM   4660 O OE2   . GLU B 1 213 ? 2.776   2.752   24.224 1.00 98.52  ? 243 GLU B OE2   1 
ATOM   4661 N N     . ALA B 1 214 ? -1.525  7.675   21.415 1.00 90.31  ? 244 ALA B N     1 
ATOM   4662 C CA    . ALA B 1 214 ? -1.753  9.113   21.279 1.00 90.62  ? 244 ALA B CA    1 
ATOM   4663 C C     . ALA B 1 214 ? -2.488  9.681   22.491 1.00 86.41  ? 244 ALA B C     1 
ATOM   4664 O O     . ALA B 1 214 ? -2.341  10.856  22.831 1.00 82.64  ? 244 ALA B O     1 
ATOM   4665 C CB    . ALA B 1 214 ? -2.525  9.406   20.002 1.00 89.25  ? 244 ALA B CB    1 
ATOM   4666 N N     . ASP B 1 215 ? -3.282  8.834   23.134 1.00 81.13  ? 245 ASP B N     1 
ATOM   4667 C CA    . ASP B 1 215 ? -4.026  9.215   24.327 1.00 85.50  ? 245 ASP B CA    1 
ATOM   4668 C C     . ASP B 1 215 ? -3.115  9.650   25.475 1.00 90.00  ? 245 ASP B C     1 
ATOM   4669 O O     . ASP B 1 215 ? -3.569  10.289  26.427 1.00 98.19  ? 245 ASP B O     1 
ATOM   4670 C CB    . ASP B 1 215 ? -4.928  8.063   24.781 1.00 94.27  ? 245 ASP B CB    1 
ATOM   4671 C CG    . ASP B 1 215 ? -4.207  6.720   24.798 1.00 99.42  ? 245 ASP B CG    1 
ATOM   4672 O OD1   . ASP B 1 215 ? -3.093  6.618   24.237 1.00 95.44  ? 245 ASP B OD1   1 
ATOM   4673 O OD2   . ASP B 1 215 ? -4.761  5.759   25.372 1.00 100.27 ? 245 ASP B OD2   1 
ATOM   4674 N N     . VAL B 1 216 ? -1.835  9.299   25.386 1.00 81.92  ? 246 VAL B N     1 
ATOM   4675 C CA    . VAL B 1 216 ? -0.869  9.672   26.416 1.00 76.84  ? 246 VAL B CA    1 
ATOM   4676 C C     . VAL B 1 216 ? 0.142   10.699  25.902 1.00 78.71  ? 246 VAL B C     1 
ATOM   4677 O O     . VAL B 1 216 ? 0.844   11.341  26.680 1.00 85.82  ? 246 VAL B O     1 
ATOM   4678 C CB    . VAL B 1 216 ? -0.134  8.436   26.983 1.00 82.05  ? 246 VAL B CB    1 
ATOM   4679 C CG1   . VAL B 1 216 ? 0.497   7.635   25.867 1.00 96.77  ? 246 VAL B CG1   1 
ATOM   4680 C CG2   . VAL B 1 216 ? 0.913   8.848   28.003 1.00 76.55  ? 246 VAL B CG2   1 
ATOM   4681 N N     . MET B 1 217 ? 0.206   10.865  24.587 1.00 83.19  ? 247 MET B N     1 
ATOM   4682 C CA    . MET B 1 217 ? 1.107   11.854  24.012 1.00 90.46  ? 247 MET B CA    1 
ATOM   4683 C C     . MET B 1 217 ? 0.457   13.235  23.942 1.00 103.53 ? 247 MET B C     1 
ATOM   4684 O O     . MET B 1 217 ? 1.117   14.224  23.625 1.00 110.09 ? 247 MET B O     1 
ATOM   4685 C CB    . MET B 1 217 ? 1.586   11.417  22.628 1.00 83.58  ? 247 MET B CB    1 
ATOM   4686 C CG    . MET B 1 217 ? 2.888   12.071  22.202 1.00 70.04  ? 247 MET B CG    1 
ATOM   4687 S SD    . MET B 1 217 ? 3.596   11.246  20.776 1.00 120.85 ? 247 MET B SD    1 
ATOM   4688 C CE    . MET B 1 217 ? 3.302   9.536   21.213 1.00 64.71  ? 247 MET B CE    1 
ATOM   4689 N N     . ILE B 1 218 ? -0.837  13.298  24.241 1.00 107.24 ? 248 ILE B N     1 
ATOM   4690 C CA    . ILE B 1 218 ? -1.555  14.569  24.251 1.00 109.56 ? 248 ILE B CA    1 
ATOM   4691 C C     . ILE B 1 218 ? -1.533  15.224  25.631 1.00 108.25 ? 248 ILE B C     1 
ATOM   4692 O O     . ILE B 1 218 ? -1.981  16.358  25.797 1.00 108.86 ? 248 ILE B O     1 
ATOM   4693 C CB    . ILE B 1 218 ? -3.016  14.408  23.788 1.00 111.07 ? 248 ILE B CB    1 
ATOM   4694 C CG1   . ILE B 1 218 ? -3.662  13.205  24.475 1.00 119.94 ? 248 ILE B CG1   1 
ATOM   4695 C CG2   . ILE B 1 218 ? -3.086  14.252  22.279 1.00 100.69 ? 248 ILE B CG2   1 
ATOM   4696 C CD1   . ILE B 1 218 ? -5.068  12.921  23.996 1.00 128.61 ? 248 ILE B CD1   1 
ATOM   4697 N N     . ALA B 1 219 ? -1.007  14.506  26.618 1.00 108.49 ? 249 ALA B N     1 
ATOM   4698 C CA    . ALA B 1 219 ? -0.892  15.038  27.972 1.00 115.04 ? 249 ALA B CA    1 
ATOM   4699 C C     . ALA B 1 219 ? 0.032   16.252  28.012 1.00 126.71 ? 249 ALA B C     1 
ATOM   4700 O O     . ALA B 1 219 ? 0.037   17.008  28.982 1.00 127.77 ? 249 ALA B O     1 
ATOM   4701 C CB    . ALA B 1 219 ? -0.398  13.962  28.925 1.00 106.70 ? 249 ALA B CB    1 
ATOM   4702 N N     . THR B 1 220 ? 0.815   16.430  26.952 1.00 134.94 ? 250 THR B N     1 
ATOM   4703 C CA    . THR B 1 220 ? 1.725   17.564  26.851 1.00 135.41 ? 250 THR B CA    1 
ATOM   4704 C C     . THR B 1 220 ? 1.492   18.328  25.557 1.00 137.94 ? 250 THR B C     1 
ATOM   4705 O O     . THR B 1 220 ? 1.674   17.785  24.468 1.00 141.23 ? 250 THR B O     1 
ATOM   4706 C CB    . THR B 1 220 ? 3.195   17.117  26.886 1.00 129.41 ? 250 THR B CB    1 
ATOM   4707 O OG1   . THR B 1 220 ? 3.441   16.357  28.076 1.00 130.00 ? 250 THR B OG1   1 
ATOM   4708 C CG2   . THR B 1 220 ? 4.116   18.327  26.859 1.00 127.94 ? 250 THR B CG2   1 
ATOM   4709 N N     . GLN B 1 221 ? 1.091   19.589  25.682 1.00 137.03 ? 251 GLN B N     1 
ATOM   4710 C CA    . GLN B 1 221 ? 0.849   20.432  24.519 1.00 139.73 ? 251 GLN B CA    1 
ATOM   4711 C C     . GLN B 1 221 ? 1.972   20.302  23.498 1.00 145.12 ? 251 GLN B C     1 
ATOM   4712 O O     . GLN B 1 221 ? 1.726   20.070  22.314 1.00 148.65 ? 251 GLN B O     1 
ATOM   4713 C CB    . GLN B 1 221 ? 0.713   21.891  24.944 1.00 139.34 ? 251 GLN B CB    1 
ATOM   4714 C CG    . GLN B 1 221 ? -0.463  22.159  25.857 1.00 142.64 ? 251 GLN B CG    1 
ATOM   4715 C CD    . GLN B 1 221 ? -0.484  23.587  26.355 1.00 148.51 ? 251 GLN B CD    1 
ATOM   4716 O OE1   . GLN B 1 221 ? 0.563   24.213  26.514 1.00 147.27 ? 251 GLN B OE1   1 
ATOM   4717 N NE2   . GLN B 1 221 ? -1.678  24.111  26.604 1.00 153.39 ? 251 GLN B NE2   1 
ATOM   4718 N N     . GLY B 1 222 ? 3.206   20.452  23.968 1.00 142.91 ? 252 GLY B N     1 
ATOM   4719 C CA    . GLY B 1 222 ? 4.368   20.385  23.104 1.00 138.59 ? 252 GLY B CA    1 
ATOM   4720 C C     . GLY B 1 222 ? 4.339   19.211  22.147 1.00 136.61 ? 252 GLY B C     1 
ATOM   4721 O O     . GLY B 1 222 ? 4.574   19.373  20.949 1.00 146.03 ? 252 GLY B O     1 
ATOM   4722 N N     . HIS B 1 223 ? 4.044   18.026  22.670 1.00 123.05 ? 253 HIS B N     1 
ATOM   4723 C CA    . HIS B 1 223 ? 4.063   16.815  21.857 1.00 112.93 ? 253 HIS B CA    1 
ATOM   4724 C C     . HIS B 1 223 ? 3.107   16.882  20.667 1.00 110.41 ? 253 HIS B C     1 
ATOM   4725 O O     . HIS B 1 223 ? 3.413   16.376  19.587 1.00 101.24 ? 253 HIS B O     1 
ATOM   4726 C CB    . HIS B 1 223 ? 3.765   15.578  22.709 1.00 98.65  ? 253 HIS B CB    1 
ATOM   4727 C CG    . HIS B 1 223 ? 4.902   15.164  23.591 1.00 99.10  ? 253 HIS B CG    1 
ATOM   4728 N ND1   . HIS B 1 223 ? 4.747   14.916  24.938 1.00 111.66 ? 253 HIS B ND1   1 
ATOM   4729 C CD2   . HIS B 1 223 ? 6.212   14.963  23.320 1.00 101.63 ? 253 HIS B CD2   1 
ATOM   4730 C CE1   . HIS B 1 223 ? 5.913   14.573  25.458 1.00 103.03 ? 253 HIS B CE1   1 
ATOM   4731 N NE2   . HIS B 1 223 ? 6.818   14.595  24.497 1.00 102.04 ? 253 HIS B NE2   1 
ATOM   4732 N N     . GLN B 1 224 ? 1.953   17.511  20.865 1.00 111.57 ? 254 GLN B N     1 
ATOM   4733 C CA    . GLN B 1 224 ? 0.932   17.561  19.824 1.00 114.26 ? 254 GLN B CA    1 
ATOM   4734 C C     . GLN B 1 224 ? 1.434   18.196  18.530 1.00 119.16 ? 254 GLN B C     1 
ATOM   4735 O O     . GLN B 1 224 ? 1.439   17.554  17.480 1.00 119.97 ? 254 GLN B O     1 
ATOM   4736 C CB    . GLN B 1 224 ? -0.320  18.285  20.326 1.00 116.26 ? 254 GLN B CB    1 
ATOM   4737 C CG    . GLN B 1 224 ? -0.991  17.594  21.502 1.00 112.42 ? 254 GLN B CG    1 
ATOM   4738 C CD    . GLN B 1 224 ? -2.456  17.955  21.641 1.00 109.87 ? 254 GLN B CD    1 
ATOM   4739 O OE1   . GLN B 1 224 ? -3.123  18.299  20.662 1.00 109.77 ? 254 GLN B OE1   1 
ATOM   4740 N NE2   . GLN B 1 224 ? -2.968  17.868  22.862 1.00 103.96 ? 254 GLN B NE2   1 
ATOM   4741 N N     . ASP B 1 225 ? 1.854   19.453  18.606 1.00 123.82 ? 255 ASP B N     1 
ATOM   4742 C CA    . ASP B 1 225 ? 2.317   20.163  17.419 1.00 133.26 ? 255 ASP B CA    1 
ATOM   4743 C C     . ASP B 1 225 ? 3.556   19.491  16.841 1.00 120.46 ? 255 ASP B C     1 
ATOM   4744 O O     . ASP B 1 225 ? 3.701   19.372  15.624 1.00 111.86 ? 255 ASP B O     1 
ATOM   4745 C CB    . ASP B 1 225 ? 2.613   21.630  17.745 1.00 150.76 ? 255 ASP B CB    1 
ATOM   4746 C CG    . ASP B 1 225 ? 2.772   22.486  16.499 1.00 161.93 ? 255 ASP B CG    1 
ATOM   4747 O OD1   . ASP B 1 225 ? 2.775   23.729  16.627 1.00 168.35 ? 255 ASP B OD1   1 
ATOM   4748 O OD2   . ASP B 1 225 ? 2.889   21.920  15.391 1.00 160.77 ? 255 ASP B OD2   1 
ATOM   4749 N N     . GLN B 1 226 ? 4.443   19.048  17.726 1.00 116.92 ? 256 GLN B N     1 
ATOM   4750 C CA    . GLN B 1 226 ? 5.689   18.421  17.308 1.00 108.44 ? 256 GLN B CA    1 
ATOM   4751 C C     . GLN B 1 226 ? 5.443   17.203  16.423 1.00 100.16 ? 256 GLN B C     1 
ATOM   4752 O O     . GLN B 1 226 ? 6.179   16.967  15.466 1.00 103.24 ? 256 GLN B O     1 
ATOM   4753 C CB    . GLN B 1 226 ? 6.548   18.063  18.523 1.00 99.99  ? 256 GLN B CB    1 
ATOM   4754 C CG    . GLN B 1 226 ? 7.157   19.285  19.197 1.00 103.66 ? 256 GLN B CG    1 
ATOM   4755 C CD    . GLN B 1 226 ? 8.039   18.940  20.381 1.00 102.33 ? 256 GLN B CD    1 
ATOM   4756 O OE1   . GLN B 1 226 ? 7.687   18.106  21.218 1.00 97.54  ? 256 GLN B OE1   1 
ATOM   4757 N NE2   . GLN B 1 226 ? 9.190   19.597  20.465 1.00 101.46 ? 256 GLN B NE2   1 
ATOM   4758 N N     . SER B 1 227 ? 4.402   16.439  16.735 1.00 87.16  ? 257 SER B N     1 
ATOM   4759 C CA    . SER B 1 227 ? 4.033   15.298  15.908 1.00 85.99  ? 257 SER B CA    1 
ATOM   4760 C C     . SER B 1 227 ? 3.609   15.758  14.521 1.00 106.52 ? 257 SER B C     1 
ATOM   4761 O O     . SER B 1 227 ? 3.959   15.138  13.516 1.00 107.45 ? 257 SER B O     1 
ATOM   4762 C CB    . SER B 1 227 ? 2.906   14.497  16.561 1.00 83.36  ? 257 SER B CB    1 
ATOM   4763 O OG    . SER B 1 227 ? 3.353   13.858  17.745 1.00 85.14  ? 257 SER B OG    1 
ATOM   4764 N N     . ILE B 1 228 ? 2.855   16.851  14.473 1.00 120.30 ? 258 ILE B N     1 
ATOM   4765 C CA    . ILE B 1 228 ? 2.376   17.397  13.210 1.00 127.25 ? 258 ILE B CA    1 
ATOM   4766 C C     . ILE B 1 228 ? 3.540   17.837  12.337 1.00 122.81 ? 258 ILE B C     1 
ATOM   4767 O O     . ILE B 1 228 ? 3.696   17.367  11.212 1.00 117.06 ? 258 ILE B O     1 
ATOM   4768 C CB    . ILE B 1 228 ? 1.457   18.606  13.432 1.00 139.99 ? 258 ILE B CB    1 
ATOM   4769 C CG1   . ILE B 1 228 ? 0.387   18.276  14.473 1.00 141.85 ? 258 ILE B CG1   1 
ATOM   4770 C CG2   . ILE B 1 228 ? 0.832   19.046  12.114 1.00 148.75 ? 258 ILE B CG2   1 
ATOM   4771 C CD1   . ILE B 1 228 ? -0.457  17.078  14.117 1.00 140.41 ? 258 ILE B CD1   1 
ATOM   4772 N N     . ARG B 1 229 ? 4.351   18.747  12.867 1.00 126.27 ? 259 ARG B N     1 
ATOM   4773 C CA    . ARG B 1 229 ? 5.521   19.252  12.162 1.00 131.81 ? 259 ARG B CA    1 
ATOM   4774 C C     . ARG B 1 229 ? 6.370   18.099  11.640 1.00 130.19 ? 259 ARG B C     1 
ATOM   4775 O O     . ARG B 1 229 ? 7.009   18.205  10.590 1.00 130.56 ? 259 ARG B O     1 
ATOM   4776 C CB    . ARG B 1 229 ? 6.348   20.136  13.093 1.00 132.44 ? 259 ARG B CB    1 
ATOM   4777 C CG    . ARG B 1 229 ? 5.526   21.174  13.838 1.00 139.82 ? 259 ARG B CG    1 
ATOM   4778 C CD    . ARG B 1 229 ? 6.290   21.733  15.023 1.00 145.32 ? 259 ARG B CD    1 
ATOM   4779 N NE    . ARG B 1 229 ? 7.478   22.471  14.609 1.00 151.99 ? 259 ARG B NE    1 
ATOM   4780 C CZ    . ARG B 1 229 ? 8.445   22.854  15.437 1.00 152.25 ? 259 ARG B CZ    1 
ATOM   4781 N NH1   . ARG B 1 229 ? 8.368   22.562  16.729 1.00 150.09 ? 259 ARG B NH1   1 
ATOM   4782 N NH2   . ARG B 1 229 ? 9.490   23.525  14.973 1.00 151.40 ? 259 ARG B NH2   1 
ATOM   4783 N N     . ILE B 1 230 ? 6.370   16.999  12.386 1.00 119.33 ? 260 ILE B N     1 
ATOM   4784 C CA    . ILE B 1 230 ? 7.083   15.795  11.982 1.00 110.43 ? 260 ILE B CA    1 
ATOM   4785 C C     . ILE B 1 230 ? 6.320   15.067  10.881 1.00 112.71 ? 260 ILE B C     1 
ATOM   4786 O O     . ILE B 1 230 ? 6.896   14.663  9.870  1.00 107.07 ? 260 ILE B O     1 
ATOM   4787 C CB    . ILE B 1 230 ? 7.304   14.852  13.176 1.00 99.93  ? 260 ILE B CB    1 
ATOM   4788 C CG1   . ILE B 1 230 ? 8.396   15.412  14.089 1.00 98.01  ? 260 ILE B CG1   1 
ATOM   4789 C CG2   . ILE B 1 230 ? 7.675   13.462  12.696 1.00 93.50  ? 260 ILE B CG2   1 
ATOM   4790 C CD1   . ILE B 1 230 ? 8.573   14.642  15.377 1.00 94.28  ? 260 ILE B CD1   1 
ATOM   4791 N N     . GLN B 1 231 ? 5.016   14.912  11.079 1.00 117.85 ? 261 GLN B N     1 
ATOM   4792 C CA    . GLN B 1 231 ? 4.162   14.285  10.081 1.00 126.65 ? 261 GLN B CA    1 
ATOM   4793 C C     . GLN B 1 231 ? 4.115   15.130  8.806  1.00 136.61 ? 261 GLN B C     1 
ATOM   4794 O O     . GLN B 1 231 ? 3.779   14.633  7.732  1.00 141.42 ? 261 GLN B O     1 
ATOM   4795 C CB    . GLN B 1 231 ? 2.756   14.070  10.650 1.00 127.25 ? 261 GLN B CB    1 
ATOM   4796 C CG    . GLN B 1 231 ? 1.808   13.320  9.728  1.00 128.32 ? 261 GLN B CG    1 
ATOM   4797 C CD    . GLN B 1 231 ? 1.211   14.212  8.660  1.00 126.89 ? 261 GLN B CD    1 
ATOM   4798 O OE1   . GLN B 1 231 ? 1.098   15.424  8.842  1.00 127.93 ? 261 GLN B OE1   1 
ATOM   4799 N NE2   . GLN B 1 231 ? 0.826   13.618  7.536  1.00 122.18 ? 261 GLN B NE2   1 
ATOM   4800 N N     . ARG B 1 232 ? 4.469   16.406  8.932  1.00 139.35 ? 262 ARG B N     1 
ATOM   4801 C CA    . ARG B 1 232 ? 4.459   17.329  7.799  1.00 142.83 ? 262 ARG B CA    1 
ATOM   4802 C C     . ARG B 1 232 ? 5.612   17.078  6.832  1.00 129.87 ? 262 ARG B C     1 
ATOM   4803 O O     . ARG B 1 232 ? 5.459   17.236  5.623  1.00 132.34 ? 262 ARG B O     1 
ATOM   4804 C CB    . ARG B 1 232 ? 4.513   18.779  8.285  1.00 156.13 ? 262 ARG B CB    1 
ATOM   4805 C CG    . ARG B 1 232 ? 3.215   19.295  8.882  1.00 169.68 ? 262 ARG B CG    1 
ATOM   4806 C CD    . ARG B 1 232 ? 2.109   19.354  7.845  1.00 179.93 ? 262 ARG B CD    1 
ATOM   4807 N NE    . ARG B 1 232 ? 0.956   20.101  8.335  1.00 191.86 ? 262 ARG B NE    1 
ATOM   4808 C CZ    . ARG B 1 232 ? 0.779   21.405  8.147  1.00 205.31 ? 262 ARG B CZ    1 
ATOM   4809 N NH1   . ARG B 1 232 ? 1.681   22.107  7.474  1.00 207.30 ? 262 ARG B NH1   1 
ATOM   4810 N NH2   . ARG B 1 232 ? -0.299  22.007  8.630  1.00 212.95 ? 262 ARG B NH2   1 
ATOM   4811 N N     . MET B 1 233 ? 6.765   16.692  7.369  1.00 112.74 ? 263 MET B N     1 
ATOM   4812 C CA    . MET B 1 233 ? 7.964   16.513  6.556  1.00 97.36  ? 263 MET B CA    1 
ATOM   4813 C C     . MET B 1 233 ? 7.904   15.256  5.697  1.00 89.16  ? 263 MET B C     1 
ATOM   4814 O O     . MET B 1 233 ? 8.803   15.002  4.896  1.00 96.07  ? 263 MET B O     1 
ATOM   4815 C CB    . MET B 1 233 ? 9.207   16.460  7.445  1.00 96.60  ? 263 MET B CB    1 
ATOM   4816 C CG    . MET B 1 233 ? 9.372   17.663  8.355  1.00 102.85 ? 263 MET B CG    1 
ATOM   4817 S SD    . MET B 1 233 ? 10.873  17.570  9.349  1.00 127.44 ? 263 MET B SD    1 
ATOM   4818 C CE    . MET B 1 233 ? 10.792  19.128  10.228 1.00 293.31 ? 263 MET B CE    1 
ATOM   4819 N N     . LEU B 1 234 ? 6.840   14.478  5.857  1.00 79.19  ? 264 LEU B N     1 
ATOM   4820 C CA    . LEU B 1 234 ? 6.750   13.168  5.216  1.00 89.38  ? 264 LEU B CA    1 
ATOM   4821 C C     . LEU B 1 234 ? 6.284   13.216  3.759  1.00 105.22 ? 264 LEU B C     1 
ATOM   4822 O O     . LEU B 1 234 ? 5.730   14.220  3.308  1.00 120.71 ? 264 LEU B O     1 
ATOM   4823 C CB    . LEU B 1 234 ? 5.839   12.246  6.033  1.00 90.91  ? 264 LEU B CB    1 
ATOM   4824 C CG    . LEU B 1 234 ? 6.388   11.826  7.399  1.00 95.93  ? 264 LEU B CG    1 
ATOM   4825 C CD1   . LEU B 1 234 ? 5.346   11.052  8.185  1.00 98.79  ? 264 LEU B CD1   1 
ATOM   4826 C CD2   . LEU B 1 234 ? 7.656   11.003  7.232  1.00 94.35  ? 264 LEU B CD2   1 
ATOM   4827 N N     . PRO B 1 235 ? 6.524   12.124  3.015  1.00 94.60  ? 265 PRO B N     1 
ATOM   4828 C CA    . PRO B 1 235 ? 6.019   11.947  1.651  1.00 91.06  ? 265 PRO B CA    1 
ATOM   4829 C C     . PRO B 1 235 ? 4.509   11.748  1.643  1.00 90.12  ? 265 PRO B C     1 
ATOM   4830 O O     . PRO B 1 235 ? 3.938   11.418  2.674  1.00 94.54  ? 265 PRO B O     1 
ATOM   4831 C CB    . PRO B 1 235 ? 6.712   10.658  1.185  1.00 88.99  ? 265 PRO B CB    1 
ATOM   4832 C CG    . PRO B 1 235 ? 7.878   10.487  2.094  1.00 83.54  ? 265 PRO B CG    1 
ATOM   4833 C CD    . PRO B 1 235 ? 7.429   11.032  3.407  1.00 91.92  ? 265 PRO B CD    1 
ATOM   4834 N N     . ARG B 1 236 ? 3.873   11.939  0.493  1.00 103.41 ? 266 ARG B N     1 
ATOM   4835 C CA    . ARG B 1 236 ? 2.430   11.748  0.387  1.00 116.18 ? 266 ARG B CA    1 
ATOM   4836 C C     . ARG B 1 236 ? 2.063   10.271  0.493  1.00 118.66 ? 266 ARG B C     1 
ATOM   4837 O O     . ARG B 1 236 ? 1.066   9.912   1.123  1.00 125.36 ? 266 ARG B O     1 
ATOM   4838 C CB    . ARG B 1 236 ? 1.901   12.332  -0.926 1.00 120.38 ? 266 ARG B CB    1 
ATOM   4839 N N     . ASN B 1 237 ? 2.879   9.419   -0.121 1.00 108.31 ? 267 ASN B N     1 
ATOM   4840 C CA    . ASN B 1 237 ? 2.633   7.980   -0.127 1.00 109.53 ? 267 ASN B CA    1 
ATOM   4841 C C     . ASN B 1 237 ? 2.982   7.308   1.202  1.00 104.13 ? 267 ASN B C     1 
ATOM   4842 O O     . ASN B 1 237 ? 2.669   6.135   1.418  1.00 92.23  ? 267 ASN B O     1 
ATOM   4843 C CB    . ASN B 1 237 ? 3.406   7.313   -1.267 1.00 110.94 ? 267 ASN B CB    1 
ATOM   4844 C CG    . ASN B 1 237 ? 4.911   7.385   -1.072 1.00 120.80 ? 267 ASN B CG    1 
ATOM   4845 O OD1   . ASN B 1 237 ? 5.402   8.084   -0.184 1.00 125.66 ? 267 ASN B OD1   1 
ATOM   4846 N ND2   . ASN B 1 237 ? 5.651   6.659   -1.903 1.00 121.96 ? 267 ASN B ND2   1 
ATOM   4847 N N     . CYS B 1 238 ? 3.631   8.062   2.085  1.00 105.38 ? 268 CYS B N     1 
ATOM   4848 C CA    . CYS B 1 238 ? 4.061   7.548   3.381  1.00 104.79 ? 268 CYS B CA    1 
ATOM   4849 C C     . CYS B 1 238 ? 2.885   7.079   4.226  1.00 100.03 ? 268 CYS B C     1 
ATOM   4850 O O     . CYS B 1 238 ? 2.078   7.889   4.682  1.00 105.02 ? 268 CYS B O     1 
ATOM   4851 C CB    . CYS B 1 238 ? 4.845   8.618   4.144  1.00 108.92 ? 268 CYS B CB    1 
ATOM   4852 S SG    . CYS B 1 238 ? 5.322   8.144   5.822  1.00 98.08  ? 268 CYS B SG    1 
ATOM   4853 N N     . GLN B 1 239 ? 2.799   5.770   4.442  1.00 93.29  ? 269 GLN B N     1 
ATOM   4854 C CA    . GLN B 1 239 ? 1.716   5.196   5.235  1.00 95.19  ? 269 GLN B CA    1 
ATOM   4855 C C     . GLN B 1 239 ? 1.640   5.820   6.628  1.00 88.49  ? 269 GLN B C     1 
ATOM   4856 O O     . GLN B 1 239 ? 2.634   5.861   7.350  1.00 78.61  ? 269 GLN B O     1 
ATOM   4857 C CB    . GLN B 1 239 ? 1.886   3.681   5.351  1.00 89.63  ? 269 GLN B CB    1 
ATOM   4858 C CG    . GLN B 1 239 ? 0.682   2.982   5.949  1.00 92.02  ? 269 GLN B CG    1 
ATOM   4859 C CD    . GLN B 1 239 ? 0.836   1.479   5.974  1.00 89.21  ? 269 GLN B CD    1 
ATOM   4860 O OE1   . GLN B 1 239 ? 1.942   0.960   6.121  1.00 83.96  ? 269 GLN B OE1   1 
ATOM   4861 N NE2   . GLN B 1 239 ? -0.278  0.769   5.833  1.00 89.26  ? 269 GLN B NE2   1 
ATOM   4862 N N     . MET B 1 240 ? 0.458   6.305   7.001  1.00 95.77  ? 270 MET B N     1 
ATOM   4863 C CA    . MET B 1 240 ? 0.262   6.939   8.305  1.00 96.01  ? 270 MET B CA    1 
ATOM   4864 C C     . MET B 1 240 ? -0.558  6.068   9.254  1.00 78.72  ? 270 MET B C     1 
ATOM   4865 O O     . MET B 1 240 ? -1.727  5.784   9.003  1.00 75.65  ? 270 MET B O     1 
ATOM   4866 C CB    . MET B 1 240 ? -0.416  8.301   8.146  1.00 109.26 ? 270 MET B CB    1 
ATOM   4867 C CG    . MET B 1 240 ? 0.273   9.235   7.165  1.00 116.35 ? 270 MET B CG    1 
ATOM   4868 S SD    . MET B 1 240 ? 1.805   9.938   7.796  1.00 118.53 ? 270 MET B SD    1 
ATOM   4869 C CE    . MET B 1 240 ? 2.288   10.970  6.414  1.00 196.26 ? 270 MET B CE    1 
ATOM   4870 N N     . LEU B 1 241 ? 0.061   5.652   10.351 1.00 74.42  ? 271 LEU B N     1 
ATOM   4871 C CA    . LEU B 1 241 ? -0.621  4.834   11.345 1.00 73.09  ? 271 LEU B CA    1 
ATOM   4872 C C     . LEU B 1 241 ? -0.639  5.532   12.697 1.00 73.13  ? 271 LEU B C     1 
ATOM   4873 O O     . LEU B 1 241 ? 0.383   6.034   13.162 1.00 79.04  ? 271 LEU B O     1 
ATOM   4874 C CB    . LEU B 1 241 ? 0.059   3.472   11.468 1.00 70.19  ? 271 LEU B CB    1 
ATOM   4875 C CG    . LEU B 1 241 ? 0.247   2.710   10.157 1.00 79.77  ? 271 LEU B CG    1 
ATOM   4876 C CD1   . LEU B 1 241 ? 1.453   1.784   10.228 1.00 67.14  ? 271 LEU B CD1   1 
ATOM   4877 C CD2   . LEU B 1 241 ? -1.019  1.946   9.796  1.00 88.90  ? 271 LEU B CD2   1 
ATOM   4878 N N     . LEU B 1 242 ? -1.809  5.570   13.322 1.00 79.07  ? 272 LEU B N     1 
ATOM   4879 C CA    . LEU B 1 242 ? -1.933  6.099   14.674 1.00 74.72  ? 272 LEU B CA    1 
ATOM   4880 C C     . LEU B 1 242 ? -2.757  5.143   15.518 1.00 74.90  ? 272 LEU B C     1 
ATOM   4881 O O     . LEU B 1 242 ? -3.742  4.575   15.049 1.00 65.77  ? 272 LEU B O     1 
ATOM   4882 C CB    . LEU B 1 242 ? -2.555  7.495   14.665 1.00 75.73  ? 272 LEU B CB    1 
ATOM   4883 C CG    . LEU B 1 242 ? -2.784  8.167   16.020 1.00 74.35  ? 272 LEU B CG    1 
ATOM   4884 C CD1   . LEU B 1 242 ? -2.678  9.683   15.905 1.00 81.21  ? 272 LEU B CD1   1 
ATOM   4885 C CD2   . LEU B 1 242 ? -4.129  7.763   16.622 1.00 64.11  ? 272 LEU B CD2   1 
ATOM   4886 N N     . PHE B 1 243 ? -2.341  4.962   16.765 1.00 88.26  ? 273 PHE B N     1 
ATOM   4887 C CA    . PHE B 1 243 ? -2.996  4.016   17.658 1.00 84.09  ? 273 PHE B CA    1 
ATOM   4888 C C     . PHE B 1 243 ? -3.312  4.650   19.006 1.00 79.76  ? 273 PHE B C     1 
ATOM   4889 O O     . PHE B 1 243 ? -2.672  5.621   19.417 1.00 67.75  ? 273 PHE B O     1 
ATOM   4890 C CB    . PHE B 1 243 ? -2.117  2.778   17.849 1.00 77.43  ? 273 PHE B CB    1 
ATOM   4891 C CG    . PHE B 1 243 ? -1.861  2.017   16.582 1.00 77.30  ? 273 PHE B CG    1 
ATOM   4892 C CD1   . PHE B 1 243 ? -0.996  2.514   15.620 1.00 73.01  ? 273 PHE B CD1   1 
ATOM   4893 C CD2   . PHE B 1 243 ? -2.484  0.802   16.352 1.00 74.23  ? 273 PHE B CD2   1 
ATOM   4894 C CE1   . PHE B 1 243 ? -0.761  1.817   14.460 1.00 72.36  ? 273 PHE B CE1   1 
ATOM   4895 C CE2   . PHE B 1 243 ? -2.250  0.098   15.191 1.00 70.72  ? 273 PHE B CE2   1 
ATOM   4896 C CZ    . PHE B 1 243 ? -1.389  0.607   14.243 1.00 73.52  ? 273 PHE B CZ    1 
ATOM   4897 N N     . SER B 1 244 ? -4.304  4.094   19.690 1.00 81.69  ? 274 SER B N     1 
ATOM   4898 C CA    . SER B 1 244 ? -4.703  4.595   20.995 1.00 84.82  ? 274 SER B CA    1 
ATOM   4899 C C     . SER B 1 244 ? -5.693  3.647   21.652 1.00 90.91  ? 274 SER B C     1 
ATOM   4900 O O     . SER B 1 244 ? -6.348  2.855   20.980 1.00 103.73 ? 274 SER B O     1 
ATOM   4901 C CB    . SER B 1 244 ? -5.321  5.986   20.861 1.00 96.11  ? 274 SER B CB    1 
ATOM   4902 O OG    . SER B 1 244 ? -5.722  6.489   22.121 1.00 102.65 ? 274 SER B OG    1 
ATOM   4903 N N     . ALA B 1 245 ? -5.798  3.733   22.972 1.00 81.52  ? 275 ALA B N     1 
ATOM   4904 C CA    . ALA B 1 245 ? -6.751  2.921   23.716 1.00 70.73  ? 275 ALA B CA    1 
ATOM   4905 C C     . ALA B 1 245 ? -8.038  3.699   23.984 1.00 80.38  ? 275 ALA B C     1 
ATOM   4906 O O     . ALA B 1 245 ? -9.113  3.114   24.108 1.00 84.56  ? 275 ALA B O     1 
ATOM   4907 C CB    . ALA B 1 245 ? -6.129  2.442   25.027 1.00 51.56  ? 275 ALA B CB    1 
ATOM   4908 N N     . THR B 1 246 ? -7.919  5.023   24.054 1.00 90.83  ? 276 THR B N     1 
ATOM   4909 C CA    . THR B 1 246 ? -9.031  5.894   24.433 1.00 97.45  ? 276 THR B CA    1 
ATOM   4910 C C     . THR B 1 246 ? -9.553  6.753   23.286 1.00 107.49 ? 276 THR B C     1 
ATOM   4911 O O     . THR B 1 246 ? -8.777  7.379   22.563 1.00 94.74  ? 276 THR B O     1 
ATOM   4912 C CB    . THR B 1 246 ? -8.612  6.846   25.569 1.00 90.15  ? 276 THR B CB    1 
ATOM   4913 O OG1   . THR B 1 246 ? -8.558  6.124   26.805 1.00 93.41  ? 276 THR B OG1   1 
ATOM   4914 C CG2   . THR B 1 246 ? -9.599  7.997   25.696 1.00 91.08  ? 276 THR B CG2   1 
ATOM   4915 N N     . PHE B 1 247 ? -10.873 6.787   23.126 1.00 131.23 ? 277 PHE B N     1 
ATOM   4916 C CA    . PHE B 1 247 ? -11.489 7.726   22.197 1.00 150.57 ? 277 PHE B CA    1 
ATOM   4917 C C     . PHE B 1 247 ? -12.038 8.932   22.938 1.00 160.73 ? 277 PHE B C     1 
ATOM   4918 O O     . PHE B 1 247 ? -13.071 8.852   23.600 1.00 169.37 ? 277 PHE B O     1 
ATOM   4919 C CB    . PHE B 1 247 ? -12.586 7.065   21.366 1.00 160.89 ? 277 PHE B CB    1 
ATOM   4920 C CG    . PHE B 1 247 ? -12.173 6.769   19.955 1.00 174.40 ? 277 PHE B CG    1 
ATOM   4921 C CD1   . PHE B 1 247 ? -11.268 7.590   19.302 1.00 175.20 ? 277 PHE B CD1   1 
ATOM   4922 C CD2   . PHE B 1 247 ? -12.703 5.688   19.272 1.00 183.15 ? 277 PHE B CD2   1 
ATOM   4923 C CE1   . PHE B 1 247 ? -10.885 7.329   18.001 1.00 177.24 ? 277 PHE B CE1   1 
ATOM   4924 C CE2   . PHE B 1 247 ? -12.325 5.423   17.968 1.00 183.73 ? 277 PHE B CE2   1 
ATOM   4925 C CZ    . PHE B 1 247 ? -11.415 6.244   17.333 1.00 180.88 ? 277 PHE B CZ    1 
ATOM   4926 N N     . GLU B 1 248 ? -11.334 10.051  22.823 1.00 164.06 ? 278 GLU B N     1 
ATOM   4927 C CA    . GLU B 1 248 ? -11.699 11.259  23.542 1.00 169.35 ? 278 GLU B CA    1 
ATOM   4928 C C     . GLU B 1 248 ? -11.735 12.434  22.580 1.00 174.88 ? 278 GLU B C     1 
ATOM   4929 O O     . GLU B 1 248 ? -11.041 12.430  21.566 1.00 174.69 ? 278 GLU B O     1 
ATOM   4930 C CB    . GLU B 1 248 ? -10.689 11.520  24.656 1.00 163.89 ? 278 GLU B CB    1 
ATOM   4931 C CG    . GLU B 1 248 ? -11.211 12.370  25.792 1.00 165.05 ? 278 GLU B CG    1 
ATOM   4932 C CD    . GLU B 1 248 ? -10.409 12.171  27.059 1.00 162.77 ? 278 GLU B CD    1 
ATOM   4933 O OE1   . GLU B 1 248 ? -9.442  11.380  27.027 1.00 159.07 ? 278 GLU B OE1   1 
ATOM   4934 O OE2   . GLU B 1 248 ? -10.744 12.797  28.085 1.00 164.63 ? 278 GLU B OE2   1 
ATOM   4935 N N     . ASP B 1 249 ? -12.546 13.438  22.895 1.00 178.47 ? 279 ASP B N     1 
ATOM   4936 C CA    . ASP B 1 249 ? -12.663 14.603  22.032 1.00 184.30 ? 279 ASP B CA    1 
ATOM   4937 C C     . ASP B 1 249 ? -11.282 15.160  21.704 1.00 172.36 ? 279 ASP B C     1 
ATOM   4938 O O     . ASP B 1 249 ? -11.049 15.671  20.609 1.00 174.29 ? 279 ASP B O     1 
ATOM   4939 C CB    . ASP B 1 249 ? -13.529 15.677  22.687 1.00 197.97 ? 279 ASP B CB    1 
ATOM   4940 C CG    . ASP B 1 249 ? -14.028 16.705  21.692 1.00 213.12 ? 279 ASP B CG    1 
ATOM   4941 O OD1   . ASP B 1 249 ? -14.745 17.638  22.109 1.00 220.91 ? 279 ASP B OD1   1 
ATOM   4942 O OD2   . ASP B 1 249 ? -13.707 16.576  20.490 1.00 214.99 ? 279 ASP B OD2   1 
ATOM   4943 N N     . SER B 1 250 ? -10.368 15.054  22.663 1.00 159.72 ? 280 SER B N     1 
ATOM   4944 C CA    . SER B 1 250 ? -8.988  15.468  22.455 1.00 152.15 ? 280 SER B CA    1 
ATOM   4945 C C     . SER B 1 250 ? -8.343  14.583  21.401 1.00 141.96 ? 280 SER B C     1 
ATOM   4946 O O     . SER B 1 250 ? -7.810  15.066  20.404 1.00 139.74 ? 280 SER B O     1 
ATOM   4947 C CB    . SER B 1 250 ? -8.200  15.364  23.760 1.00 150.25 ? 280 SER B CB    1 
ATOM   4948 O OG    . SER B 1 250 ? -8.899  15.969  24.833 1.00 156.83 ? 280 SER B OG    1 
ATOM   4949 N N     . VAL B 1 251 ? -8.402  13.277  21.637 1.00 135.49 ? 281 VAL B N     1 
ATOM   4950 C CA    . VAL B 1 251 ? -7.811  12.297  20.738 1.00 130.46 ? 281 VAL B CA    1 
ATOM   4951 C C     . VAL B 1 251 ? -8.474  12.327  19.371 1.00 128.09 ? 281 VAL B C     1 
ATOM   4952 O O     . VAL B 1 251 ? -7.829  12.593  18.362 1.00 122.22 ? 281 VAL B O     1 
ATOM   4953 C CB    . VAL B 1 251 ? -7.962  10.873  21.294 1.00 130.22 ? 281 VAL B CB    1 
ATOM   4954 C CG1   . VAL B 1 251 ? -7.131  9.898   20.475 1.00 124.30 ? 281 VAL B CG1   1 
ATOM   4955 C CG2   . VAL B 1 251 ? -7.566  10.831  22.760 1.00 130.58 ? 281 VAL B CG2   1 
ATOM   4956 N N     . TRP B 1 252 ? -9.771  12.043  19.357 1.00 134.62 ? 282 TRP B N     1 
ATOM   4957 C CA    . TRP B 1 252 ? -10.544 11.935  18.127 1.00 145.07 ? 282 TRP B CA    1 
ATOM   4958 C C     . TRP B 1 252 ? -10.273 13.090  17.164 1.00 154.09 ? 282 TRP B C     1 
ATOM   4959 O O     . TRP B 1 252 ? -10.263 12.902  15.946 1.00 151.33 ? 282 TRP B O     1 
ATOM   4960 C CB    . TRP B 1 252 ? -12.038 11.835  18.459 1.00 150.22 ? 282 TRP B CB    1 
ATOM   4961 C CG    . TRP B 1 252 ? -12.928 11.467  17.299 1.00 154.70 ? 282 TRP B CG    1 
ATOM   4962 C CD1   . TRP B 1 252 ? -14.238 11.814  17.133 1.00 159.21 ? 282 TRP B CD1   1 
ATOM   4963 C CD2   . TRP B 1 252 ? -12.572 10.686  16.145 1.00 148.65 ? 282 TRP B CD2   1 
ATOM   4964 N NE1   . TRP B 1 252 ? -14.720 11.296  15.956 1.00 157.29 ? 282 TRP B NE1   1 
ATOM   4965 C CE2   . TRP B 1 252 ? -13.721 10.603  15.333 1.00 146.77 ? 282 TRP B CE2   1 
ATOM   4966 C CE3   . TRP B 1 252 ? -11.397 10.053  15.727 1.00 136.41 ? 282 TRP B CE3   1 
ATOM   4967 C CZ2   . TRP B 1 252 ? -13.725 9.909   14.123 1.00 143.34 ? 282 TRP B CZ2   1 
ATOM   4968 C CZ3   . TRP B 1 252 ? -11.406 9.366   14.525 1.00 133.50 ? 282 TRP B CZ3   1 
ATOM   4969 C CH2   . TRP B 1 252 ? -12.563 9.300   13.738 1.00 138.80 ? 282 TRP B CH2   1 
ATOM   4970 N N     . LYS B 1 253 ? -10.042 14.278  17.712 1.00 159.83 ? 283 LYS B N     1 
ATOM   4971 C CA    . LYS B 1 253 ? -9.791  15.460  16.893 1.00 159.52 ? 283 LYS B CA    1 
ATOM   4972 C C     . LYS B 1 253 ? -8.309  15.596  16.557 1.00 142.26 ? 283 LYS B C     1 
ATOM   4973 O O     . LYS B 1 253 ? -7.946  16.020  15.463 1.00 140.05 ? 283 LYS B O     1 
ATOM   4974 C CB    . LYS B 1 253 ? -10.294 16.720  17.603 1.00 165.18 ? 283 LYS B CB    1 
ATOM   4975 C CG    . LYS B 1 253 ? -10.354 17.957  16.718 1.00 168.27 ? 283 LYS B CG    1 
ATOM   4976 C CD    . LYS B 1 253 ? -10.987 19.130  17.453 1.00 171.45 ? 283 LYS B CD    1 
ATOM   4977 C CE    . LYS B 1 253 ? -11.113 20.349  16.553 1.00 178.24 ? 283 LYS B CE    1 
ATOM   4978 N NZ    . LYS B 1 253 ? -11.769 21.490  17.250 1.00 183.19 ? 283 LYS B NZ    1 
ATOM   4979 N N     . PHE B 1 254 ? -7.456  15.228  17.504 1.00 137.66 ? 284 PHE B N     1 
ATOM   4980 C CA    . PHE B 1 254 ? -6.014  15.312  17.305 1.00 134.96 ? 284 PHE B CA    1 
ATOM   4981 C C     . PHE B 1 254 ? -5.505  14.305  16.267 1.00 118.61 ? 284 PHE B C     1 
ATOM   4982 O O     . PHE B 1 254 ? -4.501  14.548  15.599 1.00 96.02  ? 284 PHE B O     1 
ATOM   4983 C CB    . PHE B 1 254 ? -5.286  15.122  18.639 1.00 136.69 ? 284 PHE B CB    1 
ATOM   4984 C CG    . PHE B 1 254 ? -3.804  14.935  18.499 1.00 138.66 ? 284 PHE B CG    1 
ATOM   4985 C CD1   . PHE B 1 254 ? -3.248  13.667  18.528 1.00 139.46 ? 284 PHE B CD1   1 
ATOM   4986 C CD2   . PHE B 1 254 ? -2.968  16.024  18.333 1.00 141.82 ? 284 PHE B CD2   1 
ATOM   4987 C CE1   . PHE B 1 254 ? -1.884  13.489  18.396 1.00 138.13 ? 284 PHE B CE1   1 
ATOM   4988 C CE2   . PHE B 1 254 ? -1.602  15.854  18.200 1.00 140.88 ? 284 PHE B CE2   1 
ATOM   4989 C CZ    . PHE B 1 254 ? -1.059  14.585  18.232 1.00 138.35 ? 284 PHE B CZ    1 
ATOM   4990 N N     . ALA B 1 255 ? -6.206  13.181  16.134 1.00 121.25 ? 285 ALA B N     1 
ATOM   4991 C CA    . ALA B 1 255 ? -5.807  12.120  15.209 1.00 106.62 ? 285 ALA B CA    1 
ATOM   4992 C C     . ALA B 1 255 ? -6.220  12.414  13.773 1.00 114.01 ? 285 ALA B C     1 
ATOM   4993 O O     . ALA B 1 255 ? -5.737  11.777  12.839 1.00 116.36 ? 285 ALA B O     1 
ATOM   4994 C CB    . ALA B 1 255 ? -6.379  10.784  15.653 1.00 101.36 ? 285 ALA B CB    1 
ATOM   4995 N N     . GLN B 1 256 ? -7.126  13.369  13.600 1.00 128.65 ? 286 GLN B N     1 
ATOM   4996 C CA    . GLN B 1 256 ? -7.540  13.785  12.268 1.00 143.05 ? 286 GLN B CA    1 
ATOM   4997 C C     . GLN B 1 256 ? -6.462  14.675  11.672 1.00 147.77 ? 286 GLN B C     1 
ATOM   4998 O O     . GLN B 1 256 ? -6.203  14.645  10.469 1.00 140.98 ? 286 GLN B O     1 
ATOM   4999 C CB    . GLN B 1 256 ? -8.866  14.544  12.334 1.00 149.50 ? 286 GLN B CB    1 
ATOM   5000 C CG    . GLN B 1 256 ? -9.988  13.769  12.998 1.00 150.77 ? 286 GLN B CG    1 
ATOM   5001 C CD    . GLN B 1 256 ? -11.139 14.659  13.424 1.00 154.96 ? 286 GLN B CD    1 
ATOM   5002 O OE1   . GLN B 1 256 ? -11.998 14.250  14.204 1.00 151.50 ? 286 GLN B OE1   1 
ATOM   5003 N NE2   . GLN B 1 256 ? -11.156 15.886  12.918 1.00 161.24 ? 286 GLN B NE2   1 
ATOM   5004 N N     . LYS B 1 257 ? -5.831  15.461  12.538 1.00 161.47 ? 287 LYS B N     1 
ATOM   5005 C CA    . LYS B 1 257 ? -4.797  16.401  12.130 1.00 178.03 ? 287 LYS B CA    1 
ATOM   5006 C C     . LYS B 1 257 ? -3.449  15.696  11.974 1.00 176.55 ? 287 LYS B C     1 
ATOM   5007 O O     . LYS B 1 257 ? -2.429  16.339  11.730 1.00 181.70 ? 287 LYS B O     1 
ATOM   5008 C CB    . LYS B 1 257 ? -4.693  17.535  13.157 1.00 186.24 ? 287 LYS B CB    1 
ATOM   5009 C CG    . LYS B 1 257 ? -4.154  18.850  12.607 1.00 195.59 ? 287 LYS B CG    1 
ATOM   5010 C CD    . LYS B 1 257 ? -4.227  19.956  13.654 1.00 198.25 ? 287 LYS B CD    1 
ATOM   5011 C CE    . LYS B 1 257 ? -3.766  21.294  13.091 1.00 202.55 ? 287 LYS B CE    1 
ATOM   5012 N NZ    . LYS B 1 257 ? -4.674  21.801  12.025 1.00 208.75 ? 287 LYS B NZ    1 
ATOM   5013 N N     . VAL B 1 258 ? -3.453  14.372  12.111 1.00 167.37 ? 288 VAL B N     1 
ATOM   5014 C CA    . VAL B 1 258 ? -2.222  13.587  12.044 1.00 154.18 ? 288 VAL B CA    1 
ATOM   5015 C C     . VAL B 1 258 ? -2.266  12.529  10.948 1.00 140.16 ? 288 VAL B C     1 
ATOM   5016 O O     . VAL B 1 258 ? -1.253  12.240  10.308 1.00 132.57 ? 288 VAL B O     1 
ATOM   5017 C CB    . VAL B 1 258 ? -1.932  12.882  13.381 1.00 155.60 ? 288 VAL B CB    1 
ATOM   5018 C CG1   . VAL B 1 258 ? -0.847  11.830  13.203 1.00 154.40 ? 288 VAL B CG1   1 
ATOM   5019 C CG2   . VAL B 1 258 ? -1.535  13.895  14.442 1.00 156.98 ? 288 VAL B CG2   1 
ATOM   5020 N N     . VAL B 1 259 ? -3.440  11.946  10.743 1.00 132.66 ? 289 VAL B N     1 
ATOM   5021 C CA    . VAL B 1 259 ? -3.605  10.914  9.730  1.00 127.71 ? 289 VAL B CA    1 
ATOM   5022 C C     . VAL B 1 259 ? -4.637  11.341  8.691  1.00 139.74 ? 289 VAL B C     1 
ATOM   5023 O O     . VAL B 1 259 ? -5.827  11.424  8.991  1.00 149.59 ? 289 VAL B O     1 
ATOM   5024 C CB    . VAL B 1 259 ? -4.020  9.573   10.360 1.00 113.57 ? 289 VAL B CB    1 
ATOM   5025 C CG1   . VAL B 1 259 ? -4.028  8.473   9.313  1.00 108.13 ? 289 VAL B CG1   1 
ATOM   5026 C CG2   . VAL B 1 259 ? -3.078  9.217   11.490 1.00 109.98 ? 289 VAL B CG2   1 
ATOM   5027 N N     . PRO B 1 260 ? -4.172  11.633  7.467  1.00 140.30 ? 290 PRO B N     1 
ATOM   5028 C CA    . PRO B 1 260 ? -5.019  12.033  6.338  1.00 147.09 ? 290 PRO B CA    1 
ATOM   5029 C C     . PRO B 1 260 ? -5.779  10.849  5.748  1.00 149.68 ? 290 PRO B C     1 
ATOM   5030 O O     . PRO B 1 260 ? -5.328  9.712   5.877  1.00 141.19 ? 290 PRO B O     1 
ATOM   5031 C CB    . PRO B 1 260 ? -4.009  12.561  5.309  1.00 146.68 ? 290 PRO B CB    1 
ATOM   5032 C CG    . PRO B 1 260 ? -2.735  12.775  6.068  1.00 139.71 ? 290 PRO B CG    1 
ATOM   5033 C CD    . PRO B 1 260 ? -2.742  11.741  7.140  1.00 136.57 ? 290 PRO B CD    1 
ATOM   5034 N N     . ASP B 1 261 ? -6.911  11.125  5.103  1.00 161.64 ? 291 ASP B N     1 
ATOM   5035 C CA    . ASP B 1 261 ? -7.742  10.083  4.500  1.00 169.09 ? 291 ASP B CA    1 
ATOM   5036 C C     . ASP B 1 261 ? -7.669  8.797   5.312  1.00 158.19 ? 291 ASP B C     1 
ATOM   5037 O O     . ASP B 1 261 ? -7.201  7.770   4.820  1.00 156.78 ? 291 ASP B O     1 
ATOM   5038 C CB    . ASP B 1 261 ? -7.315  9.829   3.053  1.00 178.28 ? 291 ASP B CB    1 
ATOM   5039 C CG    . ASP B 1 261 ? -7.532  11.037  2.160  1.00 185.95 ? 291 ASP B CG    1 
ATOM   5040 O OD1   . ASP B 1 261 ? -8.473  11.816  2.430  1.00 194.90 ? 291 ASP B OD1   1 
ATOM   5041 O OD2   . ASP B 1 261 ? -6.765  11.205  1.188  1.00 180.23 ? 291 ASP B OD2   1 
ATOM   5042 N N     . PRO B 1 262 ? -8.138  8.854   6.566  1.00 151.69 ? 292 PRO B N     1 
ATOM   5043 C CA    . PRO B 1 262 ? -7.944  7.768   7.527  1.00 143.32 ? 292 PRO B CA    1 
ATOM   5044 C C     . PRO B 1 262 ? -8.966  6.648   7.406  1.00 141.26 ? 292 PRO B C     1 
ATOM   5045 O O     . PRO B 1 262 ? -10.131 6.892   7.093  1.00 143.50 ? 292 PRO B O     1 
ATOM   5046 C CB    . PRO B 1 262 ? -8.137  8.466   8.887  1.00 143.41 ? 292 PRO B CB    1 
ATOM   5047 C CG    . PRO B 1 262 ? -8.376  9.934   8.585  1.00 146.51 ? 292 PRO B CG    1 
ATOM   5048 C CD    . PRO B 1 262 ? -8.844  9.991   7.173  1.00 153.19 ? 292 PRO B CD    1 
ATOM   5049 N N     . ASN B 1 263 ? -8.518  5.423   7.652  1.00 137.47 ? 293 ASN B N     1 
ATOM   5050 C CA    . ASN B 1 263 ? -9.422  4.343   8.006  1.00 140.77 ? 293 ASN B CA    1 
ATOM   5051 C C     . ASN B 1 263 ? -9.553  4.355   9.521  1.00 135.34 ? 293 ASN B C     1 
ATOM   5052 O O     . ASN B 1 263 ? -8.695  4.902   10.211 1.00 140.36 ? 293 ASN B O     1 
ATOM   5053 C CB    . ASN B 1 263 ? -8.880  2.999   7.530  1.00 140.80 ? 293 ASN B CB    1 
ATOM   5054 C CG    . ASN B 1 263 ? -8.939  2.852   6.030  1.00 149.78 ? 293 ASN B CG    1 
ATOM   5055 O OD1   . ASN B 1 263 ? -9.094  3.834   5.306  1.00 159.89 ? 293 ASN B OD1   1 
ATOM   5056 N ND2   . ASN B 1 263 ? -8.820  1.620   5.551  1.00 150.18 ? 293 ASN B ND2   1 
ATOM   5057 N N     . VAL B 1 264 ? -10.621 3.770   10.049 1.00 123.70 ? 294 VAL B N     1 
ATOM   5058 C CA    . VAL B 1 264 ? -10.826 3.787   11.492 1.00 107.57 ? 294 VAL B CA    1 
ATOM   5059 C C     . VAL B 1 264 ? -11.258 2.430   12.032 1.00 99.47  ? 294 VAL B C     1 
ATOM   5060 O O     . VAL B 1 264 ? -12.208 1.827   11.535 1.00 103.41 ? 294 VAL B O     1 
ATOM   5061 C CB    . VAL B 1 264 ? -11.851 4.857   11.904 1.00 114.45 ? 294 VAL B CB    1 
ATOM   5062 C CG1   . VAL B 1 264 ? -12.082 4.819   13.404 1.00 103.33 ? 294 VAL B CG1   1 
ATOM   5063 C CG2   . VAL B 1 264 ? -11.374 6.235   11.472 1.00 120.82 ? 294 VAL B CG2   1 
ATOM   5064 N N     . ILE B 1 265 ? -10.544 1.951   13.047 1.00 91.43  ? 295 ILE B N     1 
ATOM   5065 C CA    . ILE B 1 265 ? -10.897 0.699   13.708 1.00 98.72  ? 295 ILE B CA    1 
ATOM   5066 C C     . ILE B 1 265 ? -11.253 0.927   15.176 1.00 102.96 ? 295 ILE B C     1 
ATOM   5067 O O     . ILE B 1 265 ? -10.500 1.557   15.920 1.00 96.42  ? 295 ILE B O     1 
ATOM   5068 C CB    . ILE B 1 265 ? -9.770  -0.340  13.615 1.00 99.16  ? 295 ILE B CB    1 
ATOM   5069 C CG1   . ILE B 1 265 ? -9.519  -0.716  12.161 1.00 107.83 ? 295 ILE B CG1   1 
ATOM   5070 C CG2   . ILE B 1 265 ? -10.148 -1.587  14.381 1.00 111.29 ? 295 ILE B CG2   1 
ATOM   5071 C CD1   . ILE B 1 265 ? -10.687 -1.425  11.516 1.00 119.22 ? 295 ILE B CD1   1 
ATOM   5072 N N     . LYS B 1 266 ? -12.408 0.410   15.581 1.00 108.57 ? 296 LYS B N     1 
ATOM   5073 C CA    . LYS B 1 266 ? -12.891 0.567   16.946 1.00 107.68 ? 296 LYS B CA    1 
ATOM   5074 C C     . LYS B 1 266 ? -13.045 -0.784  17.633 1.00 100.79 ? 296 LYS B C     1 
ATOM   5075 O O     . LYS B 1 266 ? -13.548 -1.737  17.039 1.00 104.08 ? 296 LYS B O     1 
ATOM   5076 C CB    . LYS B 1 266 ? -14.245 1.284   16.951 1.00 124.24 ? 296 LYS B CB    1 
ATOM   5077 C CG    . LYS B 1 266 ? -14.183 2.802   17.039 1.00 135.67 ? 296 LYS B CG    1 
ATOM   5078 C CD    . LYS B 1 266 ? -15.569 3.408   16.826 1.00 150.77 ? 296 LYS B CD    1 
ATOM   5079 C CE    . LYS B 1 266 ? -15.678 4.816   17.397 1.00 154.54 ? 296 LYS B CE    1 
ATOM   5080 N NZ    . LYS B 1 266 ? -15.712 4.823   18.888 1.00 146.63 ? 296 LYS B NZ    1 
ATOM   5081 N N     . LEU B 1 267 ? -12.595 -0.861  18.880 1.00 91.21  ? 297 LEU B N     1 
ATOM   5082 C CA    . LEU B 1 267 ? -12.943 -1.973  19.758 1.00 102.11 ? 297 LEU B CA    1 
ATOM   5083 C C     . LEU B 1 267 ? -13.289 -1.415  21.128 1.00 112.36 ? 297 LEU B C     1 
ATOM   5084 O O     . LEU B 1 267 ? -12.445 -0.803  21.785 1.00 117.44 ? 297 LEU B O     1 
ATOM   5085 C CB    . LEU B 1 267 ? -11.803 -2.982  19.881 1.00 95.61  ? 297 LEU B CB    1 
ATOM   5086 C CG    . LEU B 1 267 ? -12.117 -4.110  20.871 1.00 100.25 ? 297 LEU B CG    1 
ATOM   5087 C CD1   . LEU B 1 267 ? -13.360 -4.877  20.437 1.00 101.09 ? 297 LEU B CD1   1 
ATOM   5088 C CD2   . LEU B 1 267 ? -10.938 -5.052  21.041 1.00 106.76 ? 297 LEU B CD2   1 
ATOM   5089 N N     . LYS B 1 268 ? -14.527 -1.623  21.560 1.00 113.09 ? 298 LYS B N     1 
ATOM   5090 C CA    . LYS B 1 268 ? -14.994 -1.022  22.801 1.00 118.50 ? 298 LYS B CA    1 
ATOM   5091 C C     . LYS B 1 268 ? -14.536 -1.791  24.032 1.00 111.11 ? 298 LYS B C     1 
ATOM   5092 O O     . LYS B 1 268 ? -14.495 -3.021  24.032 1.00 112.32 ? 298 LYS B O     1 
ATOM   5093 C CB    . LYS B 1 268 ? -16.516 -0.862  22.797 1.00 129.32 ? 298 LYS B CB    1 
ATOM   5094 C CG    . LYS B 1 268 ? -17.002 0.325   23.614 1.00 133.41 ? 298 LYS B CG    1 
ATOM   5095 C CD    . LYS B 1 268 ? -16.155 1.564   23.332 1.00 139.79 ? 298 LYS B CD    1 
ATOM   5096 C CE    . LYS B 1 268 ? -16.137 1.925   21.848 1.00 142.60 ? 298 LYS B CE    1 
ATOM   5097 N NZ    . LYS B 1 268 ? -14.990 2.817   21.503 1.00 131.36 ? 298 LYS B NZ    1 
ATOM   5098 N N     . ARG B 1 269 ? -14.196 -1.041  25.075 1.00 105.39 ? 299 ARG B N     1 
ATOM   5099 C CA    . ARG B 1 269 ? -13.699 -1.600  26.327 1.00 104.27 ? 299 ARG B CA    1 
ATOM   5100 C C     . ARG B 1 269 ? -14.672 -2.605  26.935 1.00 111.31 ? 299 ARG B C     1 
ATOM   5101 O O     . ARG B 1 269 ? -15.883 -2.366  26.990 1.00 73.44  ? 299 ARG B O     1 
ATOM   5102 C CB    . ARG B 1 269 ? -13.426 -0.473  27.329 1.00 101.85 ? 299 ARG B CB    1 
ATOM   5103 C CG    . ARG B 1 269 ? -12.501 -0.845  28.477 1.00 95.83  ? 299 ARG B CG    1 
ATOM   5104 C CD    . ARG B 1 269 ? -12.151 0.385   29.307 1.00 97.38  ? 299 ARG B CD    1 
ATOM   5105 N NE    . ARG B 1 269 ? -10.987 0.162   30.160 1.00 98.54  ? 299 ARG B NE    1 
ATOM   5106 C CZ    . ARG B 1 269 ? -11.043 -0.382  31.371 1.00 114.69 ? 299 ARG B CZ    1 
ATOM   5107 N NH1   . ARG B 1 269 ? -12.211 -0.763  31.873 1.00 120.02 ? 299 ARG B NH1   1 
ATOM   5108 N NH2   . ARG B 1 269 ? -9.934  -0.548  32.080 1.00 117.98 ? 299 ARG B NH2   1 
ATOM   5109 N N     . GLU B 1 270 ? -14.135 -3.731  27.390 1.00 114.09 ? 300 GLU B N     1 
ATOM   5110 C CA    . GLU B 1 270 ? -14.931 -4.716  28.109 1.00 124.16 ? 300 GLU B CA    1 
ATOM   5111 C C     . GLU B 1 270 ? -15.476 -4.128  29.404 1.00 113.36 ? 300 GLU B C     1 
ATOM   5112 O O     . GLU B 1 270 ? -14.788 -4.103  30.422 1.00 96.21  ? 300 GLU B O     1 
ATOM   5113 C CB    . GLU B 1 270 ? -14.104 -5.967  28.401 1.00 129.93 ? 300 GLU B CB    1 
ATOM   5114 C CG    . GLU B 1 270 ? -14.272 -7.066  27.368 1.00 134.95 ? 300 GLU B CG    1 
ATOM   5115 C CD    . GLU B 1 270 ? -15.651 -7.701  27.422 1.00 135.14 ? 300 GLU B CD    1 
ATOM   5116 O OE1   . GLU B 1 270 ? -16.214 -7.992  26.345 1.00 142.74 ? 300 GLU B OE1   1 
ATOM   5117 O OE2   . GLU B 1 270 ? -16.173 -7.905  28.540 1.00 120.56 ? 300 GLU B OE2   1 
ATOM   5118 N N     . GLU B 1 271 ? -16.715 -3.651  29.349 1.00 100.86 ? 301 GLU B N     1 
ATOM   5119 C CA    . GLU B 1 271 ? -17.381 -3.055  30.504 1.00 110.02 ? 301 GLU B CA    1 
ATOM   5120 C C     . GLU B 1 271 ? -17.405 -3.996  31.705 1.00 97.40  ? 301 GLU B C     1 
ATOM   5121 O O     . GLU B 1 271 ? -17.824 -5.149  31.595 1.00 88.30  ? 301 GLU B O     1 
ATOM   5122 C CB    . GLU B 1 271 ? -18.813 -2.651  30.139 1.00 127.47 ? 301 GLU B CB    1 
ATOM   5123 C CG    . GLU B 1 271 ? -19.683 -2.300  31.337 1.00 144.19 ? 301 GLU B CG    1 
ATOM   5124 C CD    . GLU B 1 271 ? -21.165 -2.303  31.004 1.00 160.33 ? 301 GLU B CD    1 
ATOM   5125 O OE1   . GLU B 1 271 ? -21.987 -2.219  31.942 1.00 161.98 ? 301 GLU B OE1   1 
ATOM   5126 O OE2   . GLU B 1 271 ? -21.506 -2.394  29.805 1.00 167.43 ? 301 GLU B OE2   1 
ATOM   5127 N N     . GLU B 1 272 ? -16.957 -3.496  32.852 1.00 94.34  ? 302 GLU B N     1 
ATOM   5128 C CA    . GLU B 1 272 ? -16.981 -4.272  34.085 1.00 93.31  ? 302 GLU B CA    1 
ATOM   5129 C C     . GLU B 1 272 ? -18.194 -3.892  34.928 1.00 81.43  ? 302 GLU B C     1 
ATOM   5130 O O     . GLU B 1 272 ? -18.645 -2.747  34.901 1.00 77.10  ? 302 GLU B O     1 
ATOM   5131 C CB    . GLU B 1 272 ? -15.691 -4.065  34.882 1.00 106.90 ? 302 GLU B CB    1 
ATOM   5132 C CG    . GLU B 1 272 ? -15.298 -2.607  35.071 1.00 119.53 ? 302 GLU B CG    1 
ATOM   5133 C CD    . GLU B 1 272 ? -14.632 -2.019  33.844 1.00 131.32 ? 302 GLU B CD    1 
ATOM   5134 O OE1   . GLU B 1 272 ? -13.648 -2.617  33.358 1.00 135.08 ? 302 GLU B OE1   1 
ATOM   5135 O OE2   . GLU B 1 272 ? -15.088 -0.958  33.368 1.00 135.32 ? 302 GLU B OE2   1 
ATOM   5136 N N     . THR B 1 273 ? -18.726 -4.858  35.669 1.00 79.79  ? 303 THR B N     1 
ATOM   5137 C CA    . THR B 1 273 ? -19.885 -4.605  36.517 1.00 92.85  ? 303 THR B CA    1 
ATOM   5138 C C     . THR B 1 273 ? -19.732 -5.272  37.881 1.00 88.06  ? 303 THR B C     1 
ATOM   5139 O O     . THR B 1 273 ? -18.827 -6.077  38.090 1.00 80.17  ? 303 THR B O     1 
ATOM   5140 C CB    . THR B 1 273 ? -21.191 -5.081  35.857 1.00 101.15 ? 303 THR B CB    1 
ATOM   5141 O OG1   . THR B 1 273 ? -21.106 -6.485  35.587 1.00 107.61 ? 303 THR B OG1   1 
ATOM   5142 C CG2   . THR B 1 273 ? -21.439 -4.328  34.555 1.00 101.03 ? 303 THR B CG2   1 
ATOM   5143 N N     . LEU B 1 274 ? -20.629 -4.936  38.802 1.00 86.11  ? 304 LEU B N     1 
ATOM   5144 C CA    . LEU B 1 274 ? -20.542 -5.432  40.169 1.00 84.41  ? 304 LEU B CA    1 
ATOM   5145 C C     . LEU B 1 274 ? -21.587 -6.504  40.463 1.00 87.86  ? 304 LEU B C     1 
ATOM   5146 O O     . LEU B 1 274 ? -22.015 -6.664  41.603 1.00 87.71  ? 304 LEU B O     1 
ATOM   5147 C CB    . LEU B 1 274 ? -20.687 -4.270  41.152 1.00 86.63  ? 304 LEU B CB    1 
ATOM   5148 C CG    . LEU B 1 274 ? -19.557 -3.236  41.134 1.00 78.53  ? 304 LEU B CG    1 
ATOM   5149 C CD1   . LEU B 1 274 ? -20.025 -1.886  41.670 1.00 71.76  ? 304 LEU B CD1   1 
ATOM   5150 C CD2   . LEU B 1 274 ? -18.349 -3.751  41.909 1.00 71.17  ? 304 LEU B CD2   1 
ATOM   5151 N N     . ASP B 1 275 ? -21.984 -7.244  39.435 1.00 96.99  ? 305 ASP B N     1 
ATOM   5152 C CA    . ASP B 1 275 ? -23.048 -8.237  39.566 1.00 103.66 ? 305 ASP B CA    1 
ATOM   5153 C C     . ASP B 1 275 ? -22.676 -9.435  40.439 1.00 102.09 ? 305 ASP B C     1 
ATOM   5154 O O     . ASP B 1 275 ? -23.423 -9.811  41.342 1.00 100.90 ? 305 ASP B O     1 
ATOM   5155 C CB    . ASP B 1 275 ? -23.497 -8.720  38.185 1.00 112.12 ? 305 ASP B CB    1 
ATOM   5156 C CG    . ASP B 1 275 ? -24.399 -7.724  37.485 1.00 122.52 ? 305 ASP B CG    1 
ATOM   5157 O OD1   . ASP B 1 275 ? -25.369 -7.254  38.118 1.00 129.96 ? 305 ASP B OD1   1 
ATOM   5158 O OD2   . ASP B 1 275 ? -24.144 -7.416  36.301 1.00 120.61 ? 305 ASP B OD2   1 
ATOM   5159 N N     . THR B 1 276 ? -21.522 -10.032 40.162 1.00 99.74  ? 306 THR B N     1 
ATOM   5160 C CA    . THR B 1 276 ? -21.123 -11.269 40.824 1.00 97.14  ? 306 THR B CA    1 
ATOM   5161 C C     . THR B 1 276 ? -20.271 -11.024 42.071 1.00 93.18  ? 306 THR B C     1 
ATOM   5162 O O     . THR B 1 276 ? -19.550 -11.915 42.527 1.00 98.51  ? 306 THR B O     1 
ATOM   5163 C CB    . THR B 1 276 ? -20.361 -12.194 39.847 1.00 99.31  ? 306 THR B CB    1 
ATOM   5164 O OG1   . THR B 1 276 ? -20.077 -13.447 40.483 1.00 108.59 ? 306 THR B OG1   1 
ATOM   5165 C CG2   . THR B 1 276 ? -19.058 -11.542 39.390 1.00 87.41  ? 306 THR B CG2   1 
ATOM   5166 N N     . ILE B 1 277 ? -20.364 -9.821  42.629 1.00 82.22  ? 307 ILE B N     1 
ATOM   5167 C CA    . ILE B 1 277 ? -19.534 -9.449  43.774 1.00 77.57  ? 307 ILE B CA    1 
ATOM   5168 C C     . ILE B 1 277 ? -20.337 -9.151  45.039 1.00 75.32  ? 307 ILE B C     1 
ATOM   5169 O O     . ILE B 1 277 ? -21.383 -8.503  44.988 1.00 77.83  ? 307 ILE B O     1 
ATOM   5170 C CB    . ILE B 1 277 ? -18.654 -8.228  43.449 1.00 71.84  ? 307 ILE B CB    1 
ATOM   5171 C CG1   . ILE B 1 277 ? -17.685 -8.560  42.317 1.00 78.92  ? 307 ILE B CG1   1 
ATOM   5172 C CG2   . ILE B 1 277 ? -17.888 -7.780  44.679 1.00 71.15  ? 307 ILE B CG2   1 
ATOM   5173 C CD1   . ILE B 1 277 ? -16.903 -7.372  41.832 1.00 80.59  ? 307 ILE B CD1   1 
ATOM   5174 N N     . LYS B 1 278 ? -19.839 -9.627  46.175 1.00 72.55  ? 308 LYS B N     1 
ATOM   5175 C CA    . LYS B 1 278 ? -20.445 -9.304  47.459 1.00 76.34  ? 308 LYS B CA    1 
ATOM   5176 C C     . LYS B 1 278 ? -19.791 -8.058  48.047 1.00 70.38  ? 308 LYS B C     1 
ATOM   5177 O O     . LYS B 1 278 ? -18.583 -8.031  48.276 1.00 72.87  ? 308 LYS B O     1 
ATOM   5178 C CB    . LYS B 1 278 ? -20.312 -10.476 48.435 1.00 87.54  ? 308 LYS B CB    1 
ATOM   5179 C CG    . LYS B 1 278 ? -20.712 -11.827 47.861 1.00 98.65  ? 308 LYS B CG    1 
ATOM   5180 C CD    . LYS B 1 278 ? -20.836 -12.874 48.958 1.00 102.05 ? 308 LYS B CD    1 
ATOM   5181 C CE    . LYS B 1 278 ? -20.594 -14.275 48.419 1.00 106.47 ? 308 LYS B CE    1 
ATOM   5182 N NZ    . LYS B 1 278 ? -19.196 -14.440 47.920 1.00 106.37 ? 308 LYS B NZ    1 
ATOM   5183 N N     . GLN B 1 279 ? -20.594 -7.025  48.281 1.00 64.57  ? 309 GLN B N     1 
ATOM   5184 C CA    . GLN B 1 279 ? -20.095 -5.788  48.868 1.00 57.05  ? 309 GLN B CA    1 
ATOM   5185 C C     . GLN B 1 279 ? -20.469 -5.677  50.337 1.00 62.89  ? 309 GLN B C     1 
ATOM   5186 O O     . GLN B 1 279 ? -21.621 -5.873  50.717 1.00 73.23  ? 309 GLN B O     1 
ATOM   5187 C CB    . GLN B 1 279 ? -20.637 -4.574  48.122 1.00 43.91  ? 309 GLN B CB    1 
ATOM   5188 C CG    . GLN B 1 279 ? -20.331 -4.559  46.642 1.00 43.99  ? 309 GLN B CG    1 
ATOM   5189 C CD    . GLN B 1 279 ? -20.601 -3.207  46.030 1.00 57.93  ? 309 GLN B CD    1 
ATOM   5190 O OE1   . GLN B 1 279 ? -19.971 -2.215  46.397 1.00 63.28  ? 309 GLN B OE1   1 
ATOM   5191 N NE2   . GLN B 1 279 ? -21.547 -3.154  45.097 1.00 66.12  ? 309 GLN B NE2   1 
ATOM   5192 N N     . TYR B 1 280 ? -19.485 -5.349  51.160 1.00 59.52  ? 310 TYR B N     1 
ATOM   5193 C CA    . TYR B 1 280 ? -19.716 -5.173  52.579 1.00 58.27  ? 310 TYR B CA    1 
ATOM   5194 C C     . TYR B 1 280 ? -19.044 -3.909  53.067 1.00 53.74  ? 310 TYR B C     1 
ATOM   5195 O O     . TYR B 1 280 ? -18.297 -3.259  52.335 1.00 53.53  ? 310 TYR B O     1 
ATOM   5196 C CB    . TYR B 1 280 ? -19.170 -6.364  53.361 1.00 56.59  ? 310 TYR B CB    1 
ATOM   5197 C CG    . TYR B 1 280 ? -19.862 -7.663  53.043 1.00 69.24  ? 310 TYR B CG    1 
ATOM   5198 C CD1   . TYR B 1 280 ? -20.923 -8.112  53.814 1.00 73.90  ? 310 TYR B CD1   1 
ATOM   5199 C CD2   . TYR B 1 280 ? -19.456 -8.440  51.970 1.00 78.32  ? 310 TYR B CD2   1 
ATOM   5200 C CE1   . TYR B 1 280 ? -21.559 -9.300  53.525 1.00 84.24  ? 310 TYR B CE1   1 
ATOM   5201 C CE2   . TYR B 1 280 ? -20.085 -9.630  51.673 1.00 85.85  ? 310 TYR B CE2   1 
ATOM   5202 C CZ    . TYR B 1 280 ? -21.136 -10.056 52.453 1.00 89.54  ? 310 TYR B CZ    1 
ATOM   5203 O OH    . TYR B 1 280 ? -21.765 -11.244 52.157 1.00 96.52  ? 310 TYR B OH    1 
ATOM   5204 N N     . TYR B 1 281 ? -19.325 -3.566  54.314 1.00 42.58  ? 311 TYR B N     1 
ATOM   5205 C CA    . TYR B 1 281 ? -18.599 -2.517  54.993 1.00 44.79  ? 311 TYR B CA    1 
ATOM   5206 C C     . TYR B 1 281 ? -18.689 -2.765  56.487 1.00 54.58  ? 311 TYR B C     1 
ATOM   5207 O O     . TYR B 1 281 ? -19.666 -3.330  56.979 1.00 60.15  ? 311 TYR B O     1 
ATOM   5208 C CB    . TYR B 1 281 ? -19.131 -1.134  54.613 1.00 48.77  ? 311 TYR B CB    1 
ATOM   5209 C CG    . TYR B 1 281 ? -20.428 -0.748  55.279 1.00 61.76  ? 311 TYR B CG    1 
ATOM   5210 C CD1   . TYR B 1 281 ? -20.433 0.001   56.449 1.00 58.87  ? 311 TYR B CD1   1 
ATOM   5211 C CD2   . TYR B 1 281 ? -21.649 -1.119  54.733 1.00 60.42  ? 311 TYR B CD2   1 
ATOM   5212 C CE1   . TYR B 1 281 ? -21.611 0.362   57.057 1.00 59.16  ? 311 TYR B CE1   1 
ATOM   5213 C CE2   . TYR B 1 281 ? -22.835 -0.760  55.334 1.00 49.30  ? 311 TYR B CE2   1 
ATOM   5214 C CZ    . TYR B 1 281 ? -22.812 -0.022  56.497 1.00 63.13  ? 311 TYR B CZ    1 
ATOM   5215 O OH    . TYR B 1 281 ? -23.994 0.336   57.104 1.00 75.47  ? 311 TYR B OH    1 
ATOM   5216 N N     . VAL B 1 282 ? -17.649 -2.362  57.200 1.00 57.29  ? 312 VAL B N     1 
ATOM   5217 C CA    . VAL B 1 282 ? -17.579 -2.576  58.633 1.00 62.54  ? 312 VAL B CA    1 
ATOM   5218 C C     . VAL B 1 282 ? -17.259 -1.258  59.320 1.00 67.27  ? 312 VAL B C     1 
ATOM   5219 O O     . VAL B 1 282 ? -16.256 -0.615  59.005 1.00 59.18  ? 312 VAL B O     1 
ATOM   5220 C CB    . VAL B 1 282 ? -16.507 -3.620  58.986 1.00 61.92  ? 312 VAL B CB    1 
ATOM   5221 C CG1   . VAL B 1 282 ? -16.506 -3.898  60.480 1.00 74.44  ? 312 VAL B CG1   1 
ATOM   5222 C CG2   . VAL B 1 282 ? -16.753 -4.901  58.209 1.00 57.86  ? 312 VAL B CG2   1 
ATOM   5223 N N     . LEU B 1 283 ? -18.124 -0.852  60.246 1.00 68.69  ? 313 LEU B N     1 
ATOM   5224 C CA    . LEU B 1 283 ? -17.893 0.364   61.014 1.00 69.85  ? 313 LEU B CA    1 
ATOM   5225 C C     . LEU B 1 283 ? -16.740 0.154   61.997 1.00 77.59  ? 313 LEU B C     1 
ATOM   5226 O O     . LEU B 1 283 ? -16.568 -0.938  62.543 1.00 82.57  ? 313 LEU B O     1 
ATOM   5227 C CB    . LEU B 1 283 ? -19.166 0.778   61.751 1.00 68.61  ? 313 LEU B CB    1 
ATOM   5228 C CG    . LEU B 1 283 ? -20.366 1.191   60.894 1.00 76.24  ? 313 LEU B CG    1 
ATOM   5229 C CD1   . LEU B 1 283 ? -21.661 1.043   61.673 1.00 83.27  ? 313 LEU B CD1   1 
ATOM   5230 C CD2   . LEU B 1 283 ? -20.212 2.614   60.377 1.00 78.58  ? 313 LEU B CD2   1 
ATOM   5231 N N     . CYS B 1 284 ? -15.947 1.199   62.213 1.00 76.37  ? 314 CYS B N     1 
ATOM   5232 C CA    . CYS B 1 284 ? -14.781 1.106   63.085 1.00 82.88  ? 314 CYS B CA    1 
ATOM   5233 C C     . CYS B 1 284 ? -14.486 2.441   63.753 1.00 92.52  ? 314 CYS B C     1 
ATOM   5234 O O     . CYS B 1 284 ? -14.594 3.495   63.127 1.00 93.46  ? 314 CYS B O     1 
ATOM   5235 C CB    . CYS B 1 284 ? -13.561 0.638   62.292 1.00 83.36  ? 314 CYS B CB    1 
ATOM   5236 S SG    . CYS B 1 284 ? -13.721 -1.024  61.615 1.00 105.18 ? 314 CYS B SG    1 
ATOM   5237 N N     . SER B 1 285 ? -14.097 2.383   65.024 1.00 100.88 ? 315 SER B N     1 
ATOM   5238 C CA    . SER B 1 285 ? -13.885 3.584   65.829 1.00 103.56 ? 315 SER B CA    1 
ATOM   5239 C C     . SER B 1 285 ? -12.626 4.350   65.423 1.00 101.11 ? 315 SER B C     1 
ATOM   5240 O O     . SER B 1 285 ? -12.629 5.581   65.356 1.00 92.75  ? 315 SER B O     1 
ATOM   5241 C CB    . SER B 1 285 ? -13.819 3.217   67.313 1.00 97.97  ? 315 SER B CB    1 
ATOM   5242 O OG    . SER B 1 285 ? -14.878 2.344   67.668 1.00 97.11  ? 315 SER B OG    1 
ATOM   5243 N N     . SER B 1 286 ? -11.555 3.610   65.153 1.00 101.70 ? 316 SER B N     1 
ATOM   5244 C CA    . SER B 1 286 ? -10.274 4.204   64.793 1.00 91.59  ? 316 SER B CA    1 
ATOM   5245 C C     . SER B 1 286 ? -9.476  3.275   63.888 1.00 93.72  ? 316 SER B C     1 
ATOM   5246 O O     . SER B 1 286 ? -10.023 2.340   63.302 1.00 95.81  ? 316 SER B O     1 
ATOM   5247 C CB    . SER B 1 286 ? -9.465  4.495   66.049 1.00 81.00  ? 316 SER B CB    1 
ATOM   5248 O OG    . SER B 1 286 ? -9.280  3.302   66.788 1.00 80.80  ? 316 SER B OG    1 
ATOM   5249 N N     . ARG B 1 287 ? -8.175  3.532   63.793 1.00 93.92  ? 317 ARG B N     1 
ATOM   5250 C CA    . ARG B 1 287 ? -7.302  2.779   62.901 1.00 88.91  ? 317 ARG B CA    1 
ATOM   5251 C C     . ARG B 1 287 ? -7.028  1.375   63.433 1.00 85.35  ? 317 ARG B C     1 
ATOM   5252 O O     . ARG B 1 287 ? -7.025  0.401   62.680 1.00 78.26  ? 317 ARG B O     1 
ATOM   5253 C CB    . ARG B 1 287 ? -5.986  3.525   62.716 1.00 90.79  ? 317 ARG B CB    1 
ATOM   5254 C CG    . ARG B 1 287 ? -5.283  3.269   61.395 1.00 93.44  ? 317 ARG B CG    1 
ATOM   5255 C CD    . ARG B 1 287 ? -3.795  3.402   61.599 1.00 98.82  ? 317 ARG B CD    1 
ATOM   5256 N NE    . ARG B 1 287 ? -3.530  3.951   62.924 1.00 111.95 ? 317 ARG B NE    1 
ATOM   5257 C CZ    . ARG B 1 287 ? -2.333  4.004   63.494 1.00 121.51 ? 317 ARG B CZ    1 
ATOM   5258 N NH1   . ARG B 1 287 ? -1.265  3.547   62.853 1.00 116.35 ? 317 ARG B NH1   1 
ATOM   5259 N NH2   . ARG B 1 287 ? -2.208  4.515   64.711 1.00 129.37 ? 317 ARG B NH2   1 
ATOM   5260 N N     . ASP B 1 288 ? -6.787  1.273   64.734 1.00 93.18  ? 318 ASP B N     1 
ATOM   5261 C CA    . ASP B 1 288 ? -6.555  -0.027  65.347 1.00 96.55  ? 318 ASP B CA    1 
ATOM   5262 C C     . ASP B 1 288 ? -7.840  -0.840  65.335 1.00 86.50  ? 318 ASP B C     1 
ATOM   5263 O O     . ASP B 1 288 ? -7.812  -2.069  65.287 1.00 78.35  ? 318 ASP B O     1 
ATOM   5264 C CB    . ASP B 1 288 ? -6.010  0.137   66.767 1.00 104.99 ? 318 ASP B CB    1 
ATOM   5265 C CG    . ASP B 1 288 ? -4.531  0.472   66.783 1.00 114.71 ? 318 ASP B CG    1 
ATOM   5266 O OD1   . ASP B 1 288 ? -3.709  -0.463  66.668 1.00 115.20 ? 318 ASP B OD1   1 
ATOM   5267 O OD2   . ASP B 1 288 ? -4.190  1.667   66.909 1.00 119.41 ? 318 ASP B OD2   1 
ATOM   5268 N N     . GLU B 1 289 ? -8.968  -0.139  65.371 1.00 90.40  ? 319 GLU B N     1 
ATOM   5269 C CA    . GLU B 1 289 ? -10.270 -0.772  65.234 1.00 95.71  ? 319 GLU B CA    1 
ATOM   5270 C C     . GLU B 1 289 ? -10.397 -1.383  63.840 1.00 85.40  ? 319 GLU B C     1 
ATOM   5271 O O     . GLU B 1 289 ? -10.920 -2.487  63.677 1.00 81.57  ? 319 GLU B O     1 
ATOM   5272 C CB    . GLU B 1 289 ? -11.380 0.253   65.468 1.00 110.55 ? 319 GLU B CB    1 
ATOM   5273 C CG    . GLU B 1 289 ? -11.373 0.868   66.857 1.00 119.27 ? 319 GLU B CG    1 
ATOM   5274 C CD    . GLU B 1 289 ? -12.247 0.110   67.837 1.00 128.16 ? 319 GLU B CD    1 
ATOM   5275 O OE1   . GLU B 1 289 ? -13.261 -0.472  67.401 1.00 123.83 ? 319 GLU B OE1   1 
ATOM   5276 O OE2   . GLU B 1 289 ? -11.926 0.104   69.045 1.00 137.15 ? 319 GLU B OE2   1 
ATOM   5277 N N     . LYS B 1 290 ? -9.910  -0.660  62.837 1.00 75.89  ? 320 LYS B N     1 
ATOM   5278 C CA    . LYS B 1 290 ? -9.899  -1.168  61.471 1.00 73.90  ? 320 LYS B CA    1 
ATOM   5279 C C     . LYS B 1 290 ? -9.005  -2.393  61.342 1.00 71.79  ? 320 LYS B C     1 
ATOM   5280 O O     . LYS B 1 290 ? -9.400  -3.398  60.747 1.00 56.14  ? 320 LYS B O     1 
ATOM   5281 C CB    . LYS B 1 290 ? -9.451  -0.084  60.485 1.00 77.31  ? 320 LYS B CB    1 
ATOM   5282 C CG    . LYS B 1 290 ? -10.531 0.924   60.151 1.00 80.88  ? 320 LYS B CG    1 
ATOM   5283 C CD    . LYS B 1 290 ? -10.241 1.654   58.852 1.00 75.58  ? 320 LYS B CD    1 
ATOM   5284 C CE    . LYS B 1 290 ? -9.310  2.827   59.060 1.00 67.79  ? 320 LYS B CE    1 
ATOM   5285 N NZ    . LYS B 1 290 ? -9.379  3.746   57.892 1.00 55.68  ? 320 LYS B NZ    1 
ATOM   5286 N N     . PHE B 1 291 ? -7.800  -2.307  61.901 1.00 74.07  ? 321 PHE B N     1 
ATOM   5287 C CA    . PHE B 1 291 ? -6.845  -3.401  61.783 1.00 66.71  ? 321 PHE B CA    1 
ATOM   5288 C C     . PHE B 1 291 ? -7.396  -4.688  62.384 1.00 61.96  ? 321 PHE B C     1 
ATOM   5289 O O     . PHE B 1 291 ? -7.226  -5.770  61.820 1.00 61.01  ? 321 PHE B O     1 
ATOM   5290 C CB    . PHE B 1 291 ? -5.500  -3.052  62.420 1.00 62.02  ? 321 PHE B CB    1 
ATOM   5291 C CG    . PHE B 1 291 ? -4.563  -4.221  62.504 1.00 62.52  ? 321 PHE B CG    1 
ATOM   5292 C CD1   . PHE B 1 291 ? -4.288  -4.821  63.723 1.00 68.33  ? 321 PHE B CD1   1 
ATOM   5293 C CD2   . PHE B 1 291 ? -3.983  -4.743  61.360 1.00 57.69  ? 321 PHE B CD2   1 
ATOM   5294 C CE1   . PHE B 1 291 ? -3.439  -5.908  63.800 1.00 72.08  ? 321 PHE B CE1   1 
ATOM   5295 C CE2   . PHE B 1 291 ? -3.131  -5.831  61.430 1.00 61.08  ? 321 PHE B CE2   1 
ATOM   5296 C CZ    . PHE B 1 291 ? -2.859  -6.414  62.652 1.00 69.47  ? 321 PHE B CZ    1 
ATOM   5297 N N     . GLN B 1 292 ? -8.060  -4.569  63.527 1.00 57.68  ? 322 GLN B N     1 
ATOM   5298 C CA    . GLN B 1 292 ? -8.664  -5.732  64.165 1.00 71.44  ? 322 GLN B CA    1 
ATOM   5299 C C     . GLN B 1 292 ? -9.800  -6.315  63.335 1.00 71.84  ? 322 GLN B C     1 
ATOM   5300 O O     . GLN B 1 292 ? -9.984  -7.532  63.298 1.00 74.51  ? 322 GLN B O     1 
ATOM   5301 C CB    . GLN B 1 292 ? -9.145  -5.394  65.570 1.00 83.03  ? 322 GLN B CB    1 
ATOM   5302 C CG    . GLN B 1 292 ? -8.021  -5.311  66.574 1.00 104.58 ? 322 GLN B CG    1 
ATOM   5303 C CD    . GLN B 1 292 ? -8.466  -5.711  67.956 1.00 120.25 ? 322 GLN B CD    1 
ATOM   5304 O OE1   . GLN B 1 292 ? -9.660  -5.877  68.208 1.00 123.32 ? 322 GLN B OE1   1 
ATOM   5305 N NE2   . GLN B 1 292 ? -7.509  -5.877  68.864 1.00 124.75 ? 322 GLN B NE2   1 
ATOM   5306 N N     . ALA B 1 293 ? -10.561 -5.450  62.672 1.00 57.90  ? 323 ALA B N     1 
ATOM   5307 C CA    . ALA B 1 293 ? -11.601 -5.917  61.766 1.00 58.59  ? 323 ALA B CA    1 
ATOM   5308 C C     . ALA B 1 293 ? -10.958 -6.741  60.664 1.00 66.73  ? 323 ALA B C     1 
ATOM   5309 O O     . ALA B 1 293 ? -11.466 -7.800  60.289 1.00 67.20  ? 323 ALA B O     1 
ATOM   5310 C CB    . ALA B 1 293 ? -12.368 -4.745  61.176 1.00 56.47  ? 323 ALA B CB    1 
ATOM   5311 N N     . LEU B 1 294 ? -9.834  -6.244  60.152 1.00 62.62  ? 324 LEU B N     1 
ATOM   5312 C CA    . LEU B 1 294 ? -9.099  -6.927  59.097 1.00 55.07  ? 324 LEU B CA    1 
ATOM   5313 C C     . LEU B 1 294 ? -8.659  -8.312  59.562 1.00 53.09  ? 324 LEU B C     1 
ATOM   5314 O O     . LEU B 1 294 ? -8.872  -9.305  58.870 1.00 54.81  ? 324 LEU B O     1 
ATOM   5315 C CB    . LEU B 1 294 ? -7.886  -6.098  58.672 1.00 61.87  ? 324 LEU B CB    1 
ATOM   5316 C CG    . LEU B 1 294 ? -7.218  -6.501  57.357 1.00 53.01  ? 324 LEU B CG    1 
ATOM   5317 C CD1   . LEU B 1 294 ? -8.245  -6.547  56.241 1.00 63.46  ? 324 LEU B CD1   1 
ATOM   5318 C CD2   . LEU B 1 294 ? -6.107  -5.540  57.009 1.00 42.75  ? 324 LEU B CD2   1 
ATOM   5319 N N     . CYS B 1 295 ? -8.050  -8.371  60.742 1.00 59.49  ? 325 CYS B N     1 
ATOM   5320 C CA    . CYS B 1 295 ? -7.666  -9.642  61.350 1.00 73.89  ? 325 CYS B CA    1 
ATOM   5321 C C     . CYS B 1 295 ? -8.856  -10.598 61.491 1.00 90.23  ? 325 CYS B C     1 
ATOM   5322 O O     . CYS B 1 295 ? -8.764  -11.771 61.120 1.00 91.40  ? 325 CYS B O     1 
ATOM   5323 C CB    . CYS B 1 295 ? -7.006  -9.408  62.713 1.00 60.66  ? 325 CYS B CB    1 
ATOM   5324 S SG    . CYS B 1 295 ? -5.321  -8.762  62.632 1.00 104.35 ? 325 CYS B SG    1 
ATOM   5325 N N     . ASN B 1 296 ? -9.964  -10.093 62.033 1.00 93.03  ? 326 ASN B N     1 
ATOM   5326 C CA    . ASN B 1 296 ? -11.192 -10.878 62.170 1.00 91.27  ? 326 ASN B CA    1 
ATOM   5327 C C     . ASN B 1 296 ? -11.649 -11.448 60.837 1.00 85.69  ? 326 ASN B C     1 
ATOM   5328 O O     . ASN B 1 296 ? -12.257 -12.514 60.774 1.00 90.87  ? 326 ASN B O     1 
ATOM   5329 C CB    . ASN B 1 296 ? -12.315 -10.024 62.761 1.00 92.22  ? 326 ASN B CB    1 
ATOM   5330 C CG    . ASN B 1 296 ? -12.185 -9.842  64.259 1.00 99.29  ? 326 ASN B CG    1 
ATOM   5331 O OD1   . ASN B 1 296 ? -12.486 -8.775  64.793 1.00 99.37  ? 326 ASN B OD1   1 
ATOM   5332 N ND2   . ASN B 1 296 ? -11.735 -10.886 64.946 1.00 103.53 ? 326 ASN B ND2   1 
ATOM   5333 N N     . LEU B 1 297 ? -11.350 -10.717 59.773 1.00 80.23  ? 327 LEU B N     1 
ATOM   5334 C CA    . LEU B 1 297 ? -11.713 -11.112 58.425 1.00 76.68  ? 327 LEU B CA    1 
ATOM   5335 C C     . LEU B 1 297 ? -10.703 -12.104 57.854 1.00 85.50  ? 327 LEU B C     1 
ATOM   5336 O O     . LEU B 1 297 ? -11.053 -12.966 57.046 1.00 89.67  ? 327 LEU B O     1 
ATOM   5337 C CB    . LEU B 1 297 ? -11.783 -9.868  57.541 1.00 77.78  ? 327 LEU B CB    1 
ATOM   5338 C CG    . LEU B 1 297 ? -11.872 -10.044 56.027 1.00 74.45  ? 327 LEU B CG    1 
ATOM   5339 C CD1   . LEU B 1 297 ? -13.258 -10.516 55.624 1.00 72.79  ? 327 LEU B CD1   1 
ATOM   5340 C CD2   . LEU B 1 297 ? -11.536 -8.731  55.349 1.00 72.82  ? 327 LEU B CD2   1 
ATOM   5341 N N     . TYR B 1 298 ? -9.451  -11.978 58.287 1.00 85.60  ? 328 TYR B N     1 
ATOM   5342 C CA    . TYR B 1 298 ? -8.358  -12.788 57.757 1.00 91.17  ? 328 TYR B CA    1 
ATOM   5343 C C     . TYR B 1 298 ? -8.606  -14.279 57.963 1.00 94.04  ? 328 TYR B C     1 
ATOM   5344 O O     . TYR B 1 298 ? -8.603  -15.057 57.010 1.00 94.45  ? 328 TYR B O     1 
ATOM   5345 C CB    . TYR B 1 298 ? -7.034  -12.379 58.406 1.00 96.04  ? 328 TYR B CB    1 
ATOM   5346 C CG    . TYR B 1 298 ? -5.833  -12.484 57.490 1.00 100.98 ? 328 TYR B CG    1 
ATOM   5347 C CD1   . TYR B 1 298 ? -5.316  -11.358 56.859 1.00 100.42 ? 328 TYR B CD1   1 
ATOM   5348 C CD2   . TYR B 1 298 ? -5.212  -13.706 57.261 1.00 109.63 ? 328 TYR B CD2   1 
ATOM   5349 C CE1   . TYR B 1 298 ? -4.214  -11.446 56.024 1.00 104.52 ? 328 TYR B CE1   1 
ATOM   5350 C CE2   . TYR B 1 298 ? -4.110  -13.804 56.425 1.00 113.27 ? 328 TYR B CE2   1 
ATOM   5351 C CZ    . TYR B 1 298 ? -3.617  -12.671 55.810 1.00 109.82 ? 328 TYR B CZ    1 
ATOM   5352 O OH    . TYR B 1 298 ? -2.521  -12.764 54.981 1.00 105.91 ? 328 TYR B OH    1 
ATOM   5353 N N     . GLY B 1 299 ? -8.818  -14.675 59.212 1.00 101.59 ? 329 GLY B N     1 
ATOM   5354 C CA    . GLY B 1 299 ? -9.122  -16.059 59.524 1.00 115.37 ? 329 GLY B CA    1 
ATOM   5355 C C     . GLY B 1 299 ? -10.510 -16.468 59.060 1.00 123.70 ? 329 GLY B C     1 
ATOM   5356 O O     . GLY B 1 299 ? -10.663 -17.441 58.323 1.00 125.53 ? 329 GLY B O     1 
ATOM   5357 N N     . ALA B 1 300 ? -11.519 -15.711 59.484 1.00 121.00 ? 330 ALA B N     1 
ATOM   5358 C CA    . ALA B 1 300 ? -12.919 -16.031 59.198 1.00 113.74 ? 330 ALA B CA    1 
ATOM   5359 C C     . ALA B 1 300 ? -13.171 -16.487 57.760 1.00 113.11 ? 330 ALA B C     1 
ATOM   5360 O O     . ALA B 1 300 ? -14.064 -17.297 57.510 1.00 101.08 ? 330 ALA B O     1 
ATOM   5361 C CB    . ALA B 1 300 ? -13.817 -14.847 59.544 1.00 112.36 ? 330 ALA B CB    1 
ATOM   5362 N N     . ILE B 1 301 ? -12.390 -15.964 56.819 1.00 122.66 ? 331 ILE B N     1 
ATOM   5363 C CA    . ILE B 1 301 ? -12.522 -16.357 55.418 1.00 126.16 ? 331 ILE B CA    1 
ATOM   5364 C C     . ILE B 1 301 ? -11.200 -16.858 54.847 1.00 132.39 ? 331 ILE B C     1 
ATOM   5365 O O     . ILE B 1 301 ? -10.132 -16.594 55.401 1.00 133.53 ? 331 ILE B O     1 
ATOM   5366 C CB    . ILE B 1 301 ? -13.029 -15.195 54.544 1.00 118.84 ? 331 ILE B CB    1 
ATOM   5367 C CG1   . ILE B 1 301 ? -11.909 -14.182 54.296 1.00 116.50 ? 331 ILE B CG1   1 
ATOM   5368 C CG2   . ILE B 1 301 ? -14.230 -14.530 55.192 1.00 117.59 ? 331 ILE B CG2   1 
ATOM   5369 C CD1   . ILE B 1 301 ? -12.283 -13.084 53.325 1.00 112.31 ? 331 ILE B CD1   1 
ATOM   5370 N N     . THR B 1 302 ? -11.282 -17.586 53.737 1.00 136.45 ? 332 THR B N     1 
ATOM   5371 C CA    . THR B 1 302 ? -10.091 -18.078 53.055 1.00 141.54 ? 332 THR B CA    1 
ATOM   5372 C C     . THR B 1 302 ? -9.456  -16.951 52.249 1.00 137.84 ? 332 THR B C     1 
ATOM   5373 O O     . THR B 1 302 ? -9.559  -16.909 51.021 1.00 134.76 ? 332 THR B O     1 
ATOM   5374 C CB    . THR B 1 302 ? -10.418 -19.257 52.121 1.00 144.33 ? 332 THR B CB    1 
ATOM   5375 O OG1   . THR B 1 302 ? -11.165 -20.247 52.839 1.00 145.61 ? 332 THR B OG1   1 
ATOM   5376 C CG2   . THR B 1 302 ? -9.138  -19.882 51.578 1.00 142.86 ? 332 THR B CG2   1 
ATOM   5377 N N     . ILE B 1 303 ? -8.803  -16.035 52.954 1.00 134.91 ? 333 ILE B N     1 
ATOM   5378 C CA    . ILE B 1 303 ? -8.217  -14.861 52.326 1.00 128.77 ? 333 ILE B CA    1 
ATOM   5379 C C     . ILE B 1 303 ? -7.041  -15.224 51.423 1.00 126.74 ? 333 ILE B C     1 
ATOM   5380 O O     . ILE B 1 303 ? -5.993  -15.670 51.890 1.00 132.77 ? 333 ILE B O     1 
ATOM   5381 C CB    . ILE B 1 303 ? -7.776  -13.826 53.379 1.00 127.83 ? 333 ILE B CB    1 
ATOM   5382 C CG1   . ILE B 1 303 ? -7.076  -12.646 52.707 1.00 129.39 ? 333 ILE B CG1   1 
ATOM   5383 C CG2   . ILE B 1 303 ? -6.875  -14.472 54.420 1.00 128.02 ? 333 ILE B CG2   1 
ATOM   5384 C CD1   . ILE B 1 303 ? -6.681  -11.553 53.669 1.00 130.41 ? 333 ILE B CD1   1 
ATOM   5385 N N     . ALA B 1 304 ? -7.235  -15.038 50.122 1.00 113.83 ? 334 ALA B N     1 
ATOM   5386 C CA    . ALA B 1 304 ? -6.187  -15.276 49.140 1.00 99.48  ? 334 ALA B CA    1 
ATOM   5387 C C     . ALA B 1 304 ? -6.376  -14.312 47.981 1.00 95.00  ? 334 ALA B C     1 
ATOM   5388 O O     . ALA B 1 304 ? -7.482  -13.825 47.755 1.00 106.41 ? 334 ALA B O     1 
ATOM   5389 C CB    . ALA B 1 304 ? -6.232  -16.712 48.652 1.00 93.46  ? 334 ALA B CB    1 
ATOM   5390 N N     . GLN B 1 305 ? -5.301  -14.030 47.251 1.00 84.29  ? 335 GLN B N     1 
ATOM   5391 C CA    . GLN B 1 305 ? -5.383  -13.117 46.120 1.00 84.15  ? 335 GLN B CA    1 
ATOM   5392 C C     . GLN B 1 305 ? -6.108  -11.841 46.523 1.00 76.45  ? 335 GLN B C     1 
ATOM   5393 O O     . GLN B 1 305 ? -6.987  -11.368 45.805 1.00 81.91  ? 335 GLN B O     1 
ATOM   5394 C CB    . GLN B 1 305 ? -6.140  -13.772 44.965 1.00 95.81  ? 335 GLN B CB    1 
ATOM   5395 C CG    . GLN B 1 305 ? -5.427  -14.944 44.321 1.00 109.36 ? 335 GLN B CG    1 
ATOM   5396 C CD    . GLN B 1 305 ? -6.282  -15.621 43.268 1.00 117.49 ? 335 GLN B CD    1 
ATOM   5397 O OE1   . GLN B 1 305 ? -5.771  -16.164 42.286 1.00 121.23 ? 335 GLN B OE1   1 
ATOM   5398 N NE2   . GLN B 1 305 ? -7.595  -15.584 43.464 1.00 115.09 ? 335 GLN B NE2   1 
ATOM   5399 N N     . ALA B 1 306 ? -5.745  -11.290 47.674 1.00 58.67  ? 336 ALA B N     1 
ATOM   5400 C CA    . ALA B 1 306 ? -6.434  -10.117 48.193 1.00 48.96  ? 336 ALA B CA    1 
ATOM   5401 C C     . ALA B 1 306 ? -5.562  -8.875  48.125 1.00 30.05  ? 336 ALA B C     1 
ATOM   5402 O O     . ALA B 1 306 ? -4.375  -8.927  48.424 1.00 35.82  ? 336 ALA B O     1 
ATOM   5403 C CB    . ALA B 1 306 ? -6.890  -10.364 49.623 1.00 65.20  ? 336 ALA B CB    1 
ATOM   5404 N N     . MET B 1 307 ? -6.165  -7.758  47.736 1.00 34.30  ? 337 MET B N     1 
ATOM   5405 C CA    . MET B 1 307 ? -5.470  -6.479  47.677 1.00 37.27  ? 337 MET B CA    1 
ATOM   5406 C C     . MET B 1 307 ? -6.047  -5.514  48.696 1.00 44.44  ? 337 MET B C     1 
ATOM   5407 O O     . MET B 1 307 ? -7.266  -5.376  48.807 1.00 43.77  ? 337 MET B O     1 
ATOM   5408 C CB    . MET B 1 307 ? -5.601  -5.863  46.284 1.00 35.95  ? 337 MET B CB    1 
ATOM   5409 C CG    . MET B 1 307 ? -4.727  -6.510  45.226 1.00 35.25  ? 337 MET B CG    1 
ATOM   5410 S SD    . MET B 1 307 ? -4.763  -5.631  43.657 1.00 59.98  ? 337 MET B SD    1 
ATOM   5411 C CE    . MET B 1 307 ? -4.022  -4.061  44.076 1.00 26.41  ? 337 MET B CE    1 
ATOM   5412 N N     . ILE B 1 308 ? -5.173  -4.836  49.433 1.00 38.91  ? 338 ILE B N     1 
ATOM   5413 C CA    . ILE B 1 308 ? -5.620  -3.847  50.405 1.00 39.01  ? 338 ILE B CA    1 
ATOM   5414 C C     . ILE B 1 308 ? -5.101  -2.451  50.082 1.00 37.44  ? 338 ILE B C     1 
ATOM   5415 O O     . ILE B 1 308 ? -3.900  -2.230  49.954 1.00 39.16  ? 338 ILE B O     1 
ATOM   5416 C CB    . ILE B 1 308 ? -5.222  -4.238  51.830 1.00 42.73  ? 338 ILE B CB    1 
ATOM   5417 C CG1   . ILE B 1 308 ? -5.769  -5.628  52.162 1.00 40.28  ? 338 ILE B CG1   1 
ATOM   5418 C CG2   . ILE B 1 308 ? -5.743  -3.209  52.815 1.00 50.90  ? 338 ILE B CG2   1 
ATOM   5419 C CD1   . ILE B 1 308 ? -5.034  -6.321  53.288 1.00 44.25  ? 338 ILE B CD1   1 
ATOM   5420 N N     . PHE B 1 309 ? -6.030  -1.513  49.955 1.00 40.93  ? 339 PHE B N     1 
ATOM   5421 C CA    . PHE B 1 309 ? -5.715  -0.157  49.536 1.00 42.53  ? 339 PHE B CA    1 
ATOM   5422 C C     . PHE B 1 309 ? -5.710  0.828   50.701 1.00 45.22  ? 339 PHE B C     1 
ATOM   5423 O O     . PHE B 1 309 ? -6.549  0.754   51.594 1.00 42.84  ? 339 PHE B O     1 
ATOM   5424 C CB    . PHE B 1 309 ? -6.712  0.300   48.472 1.00 39.99  ? 339 PHE B CB    1 
ATOM   5425 C CG    . PHE B 1 309 ? -6.660  -0.511  47.212 1.00 52.14  ? 339 PHE B CG    1 
ATOM   5426 C CD1   . PHE B 1 309 ? -7.459  -1.633  47.062 1.00 52.05  ? 339 PHE B CD1   1 
ATOM   5427 C CD2   . PHE B 1 309 ? -5.808  -0.158  46.178 1.00 53.02  ? 339 PHE B CD2   1 
ATOM   5428 C CE1   . PHE B 1 309 ? -7.412  -2.384  45.903 1.00 39.42  ? 339 PHE B CE1   1 
ATOM   5429 C CE2   . PHE B 1 309 ? -5.755  -0.905  45.020 1.00 43.78  ? 339 PHE B CE2   1 
ATOM   5430 C CZ    . PHE B 1 309 ? -6.559  -2.019  44.883 1.00 46.32  ? 339 PHE B CZ    1 
ATOM   5431 N N     . CYS B 1 310 ? -4.755  1.752   50.673 1.00 48.88  ? 340 CYS B N     1 
ATOM   5432 C CA    . CYS B 1 310 ? -4.613  2.769   51.705 1.00 51.33  ? 340 CYS B CA    1 
ATOM   5433 C C     . CYS B 1 310 ? -4.321  4.114   51.056 1.00 56.71  ? 340 CYS B C     1 
ATOM   5434 O O     . CYS B 1 310 ? -3.816  4.170   49.936 1.00 63.51  ? 340 CYS B O     1 
ATOM   5435 C CB    . CYS B 1 310 ? -3.470  2.406   52.656 1.00 44.53  ? 340 CYS B CB    1 
ATOM   5436 S SG    . CYS B 1 310 ? -3.516  0.708   53.272 1.00 70.03  ? 340 CYS B SG    1 
ATOM   5437 N N     . HIS B 1 311 ? -4.628  5.196   51.763 1.00 53.69  ? 341 HIS B N     1 
ATOM   5438 C CA    . HIS B 1 311 ? -4.409  6.540   51.235 1.00 56.42  ? 341 HIS B CA    1 
ATOM   5439 C C     . HIS B 1 311 ? -2.925  6.900   51.123 1.00 60.69  ? 341 HIS B C     1 
ATOM   5440 O O     . HIS B 1 311 ? -2.457  7.331   50.069 1.00 70.71  ? 341 HIS B O     1 
ATOM   5441 C CB    . HIS B 1 311 ? -5.115  7.575   52.108 1.00 62.32  ? 341 HIS B CB    1 
ATOM   5442 C CG    . HIS B 1 311 ? -5.161  8.943   51.508 1.00 78.62  ? 341 HIS B CG    1 
ATOM   5443 N ND1   . HIS B 1 311 ? -4.075  9.521   50.879 1.00 82.34  ? 341 HIS B ND1   1 
ATOM   5444 C CD2   . HIS B 1 311 ? -6.154  9.862   51.452 1.00 94.06  ? 341 HIS B CD2   1 
ATOM   5445 C CE1   . HIS B 1 311 ? -4.403  10.725  50.455 1.00 91.67  ? 341 HIS B CE1   1 
ATOM   5446 N NE2   . HIS B 1 311 ? -5.661  10.959  50.791 1.00 99.81  ? 341 HIS B NE2   1 
ATOM   5447 N N     . THR B 1 312 ? -2.190  6.731   52.215 1.00 49.80  ? 342 THR B N     1 
ATOM   5448 C CA    . THR B 1 312 ? -0.823  7.224   52.277 1.00 55.84  ? 342 THR B CA    1 
ATOM   5449 C C     . THR B 1 312 ? 0.187   6.100   52.442 1.00 63.06  ? 342 THR B C     1 
ATOM   5450 O O     . THR B 1 312 ? -0.169  4.973   52.794 1.00 64.56  ? 342 THR B O     1 
ATOM   5451 C CB    . THR B 1 312 ? -0.643  8.221   53.438 1.00 58.58  ? 342 THR B CB    1 
ATOM   5452 O OG1   . THR B 1 312 ? -1.026  7.593   54.668 1.00 56.64  ? 342 THR B OG1   1 
ATOM   5453 C CG2   . THR B 1 312 ? -1.498  9.456   53.217 1.00 51.64  ? 342 THR B CG2   1 
ATOM   5454 N N     . ARG B 1 313 ? 1.453   6.417   52.195 1.00 56.77  ? 343 ARG B N     1 
ATOM   5455 C CA    . ARG B 1 313 ? 2.514   5.437   52.337 1.00 60.72  ? 343 ARG B CA    1 
ATOM   5456 C C     . ARG B 1 313 ? 2.588   4.956   53.782 1.00 62.17  ? 343 ARG B C     1 
ATOM   5457 O O     . ARG B 1 313 ? 2.738   3.761   54.039 1.00 61.52  ? 343 ARG B O     1 
ATOM   5458 C CB    . ARG B 1 313 ? 3.859   6.030   51.908 1.00 63.87  ? 343 ARG B CB    1 
ATOM   5459 C CG    . ARG B 1 313 ? 4.792   5.028   51.240 1.00 62.59  ? 343 ARG B CG    1 
ATOM   5460 C CD    . ARG B 1 313 ? 6.246   5.282   51.600 1.00 56.62  ? 343 ARG B CD    1 
ATOM   5461 N NE    . ARG B 1 313 ? 6.574   6.704   51.615 1.00 60.98  ? 343 ARG B NE    1 
ATOM   5462 C CZ    . ARG B 1 313 ? 7.665   7.209   52.183 1.00 68.78  ? 343 ARG B CZ    1 
ATOM   5463 N NH1   . ARG B 1 313 ? 8.533   6.404   52.783 1.00 67.95  ? 343 ARG B NH1   1 
ATOM   5464 N NH2   . ARG B 1 313 ? 7.887   8.517   52.156 1.00 64.37  ? 343 ARG B NH2   1 
ATOM   5465 N N     . LYS B 1 314 ? 2.473   5.891   54.723 1.00 64.69  ? 344 LYS B N     1 
ATOM   5466 C CA    . LYS B 1 314 ? 2.612   5.572   56.145 1.00 67.51  ? 344 LYS B CA    1 
ATOM   5467 C C     . LYS B 1 314 ? 1.551   4.592   56.648 1.00 65.99  ? 344 LYS B C     1 
ATOM   5468 O O     . LYS B 1 314 ? 1.847   3.704   57.447 1.00 62.97  ? 344 LYS B O     1 
ATOM   5469 C CB    . LYS B 1 314 ? 2.634   6.846   56.999 1.00 82.45  ? 344 LYS B CB    1 
ATOM   5470 C CG    . LYS B 1 314 ? 1.741   7.971   56.491 1.00 96.72  ? 344 LYS B CG    1 
ATOM   5471 C CD    . LYS B 1 314 ? 1.827   9.195   57.399 1.00 98.93  ? 344 LYS B CD    1 
ATOM   5472 C CE    . LYS B 1 314 ? 0.971   10.345  56.879 1.00 102.39 ? 344 LYS B CE    1 
ATOM   5473 N NZ    . LYS B 1 314 ? 1.507   10.913  55.609 1.00 108.92 ? 344 LYS B NZ    1 
ATOM   5474 N N     . THR B 1 315 ? 0.318   4.757   56.179 1.00 67.02  ? 345 THR B N     1 
ATOM   5475 C CA    . THR B 1 315 ? -0.747  3.814   56.502 1.00 55.40  ? 345 THR B CA    1 
ATOM   5476 C C     . THR B 1 315 ? -0.418  2.431   55.943 1.00 55.88  ? 345 THR B C     1 
ATOM   5477 O O     . THR B 1 315 ? -0.529  1.426   56.645 1.00 51.65  ? 345 THR B O     1 
ATOM   5478 C CB    . THR B 1 315 ? -2.108  4.285   55.954 1.00 58.36  ? 345 THR B CB    1 
ATOM   5479 O OG1   . THR B 1 315 ? -2.499  5.492   56.616 1.00 62.92  ? 345 THR B OG1   1 
ATOM   5480 C CG2   . THR B 1 315 ? -3.182  3.225   56.176 1.00 50.06  ? 345 THR B CG2   1 
ATOM   5481 N N     . ALA B 1 316 ? 0.008   2.390   54.681 1.00 54.73  ? 346 ALA B N     1 
ATOM   5482 C CA    . ALA B 1 316 ? 0.309   1.126   54.012 1.00 46.82  ? 346 ALA B CA    1 
ATOM   5483 C C     . ALA B 1 316 ? 1.475   0.367   54.654 1.00 50.26  ? 346 ALA B C     1 
ATOM   5484 O O     . ALA B 1 316 ? 1.377   -0.838  54.890 1.00 51.07  ? 346 ALA B O     1 
ATOM   5485 C CB    . ALA B 1 316 ? 0.563   1.352   52.528 1.00 50.27  ? 346 ALA B CB    1 
ATOM   5486 N N     . SER B 1 317 ? 2.573   1.061   54.939 1.00 48.89  ? 347 SER B N     1 
ATOM   5487 C CA    . SER B 1 317 ? 3.716   0.404   55.575 1.00 65.64  ? 347 SER B CA    1 
ATOM   5488 C C     . SER B 1 317 ? 3.396   -0.050  57.002 1.00 71.11  ? 347 SER B C     1 
ATOM   5489 O O     . SER B 1 317 ? 3.804   -1.137  57.415 1.00 70.88  ? 347 SER B O     1 
ATOM   5490 C CB    . SER B 1 317 ? 4.974   1.282   55.537 1.00 70.07  ? 347 SER B CB    1 
ATOM   5491 O OG    . SER B 1 317 ? 4.722   2.582   56.037 1.00 80.60  ? 347 SER B OG    1 
ATOM   5492 N N     . TRP B 1 318 ? 2.662   0.778   57.744 1.00 61.79  ? 348 TRP B N     1 
ATOM   5493 C CA    . TRP B 1 318 ? 2.227   0.412   59.086 1.00 56.63  ? 348 TRP B CA    1 
ATOM   5494 C C     . TRP B 1 318 ? 1.410   -0.858  59.019 1.00 57.14  ? 348 TRP B C     1 
ATOM   5495 O O     . TRP B 1 318 ? 1.633   -1.802  59.773 1.00 64.41  ? 348 TRP B O     1 
ATOM   5496 C CB    . TRP B 1 318 ? 1.361   1.511   59.700 1.00 61.71  ? 348 TRP B CB    1 
ATOM   5497 C CG    . TRP B 1 318 ? 0.747   1.120   61.021 1.00 65.76  ? 348 TRP B CG    1 
ATOM   5498 C CD1   . TRP B 1 318 ? 1.287   1.310   62.257 1.00 71.87  ? 348 TRP B CD1   1 
ATOM   5499 C CD2   . TRP B 1 318 ? -0.513  0.470   61.233 1.00 73.69  ? 348 TRP B CD2   1 
ATOM   5500 N NE1   . TRP B 1 318 ? 0.445   0.824   63.227 1.00 74.72  ? 348 TRP B NE1   1 
ATOM   5501 C CE2   . TRP B 1 318 ? -0.673  0.301   62.624 1.00 77.45  ? 348 TRP B CE2   1 
ATOM   5502 C CE3   . TRP B 1 318 ? -1.531  0.017   60.386 1.00 70.58  ? 348 TRP B CE3   1 
ATOM   5503 C CZ2   . TRP B 1 318 ? -1.796  -0.299  63.187 1.00 74.96  ? 348 TRP B CZ2   1 
ATOM   5504 C CZ3   . TRP B 1 318 ? -2.649  -0.583  60.945 1.00 68.86  ? 348 TRP B CZ3   1 
ATOM   5505 C CH2   . TRP B 1 318 ? -2.772  -0.734  62.331 1.00 76.66  ? 348 TRP B CH2   1 
ATOM   5506 N N     . LEU B 1 319 ? 0.454   -0.865  58.101 1.00 58.45  ? 349 LEU B N     1 
ATOM   5507 C CA    . LEU B 1 319 ? -0.491  -1.961  57.987 1.00 59.15  ? 349 LEU B CA    1 
ATOM   5508 C C     . LEU B 1 319 ? 0.188   -3.228  57.503 1.00 61.98  ? 349 LEU B C     1 
ATOM   5509 O O     . LEU B 1 319 ? -0.224  -4.330  57.859 1.00 68.87  ? 349 LEU B O     1 
ATOM   5510 C CB    . LEU B 1 319 ? -1.625  -1.578  57.043 1.00 56.79  ? 349 LEU B CB    1 
ATOM   5511 C CG    . LEU B 1 319 ? -2.581  -2.710  56.694 1.00 60.83  ? 349 LEU B CG    1 
ATOM   5512 C CD1   . LEU B 1 319 ? -3.245  -3.229  57.955 1.00 61.12  ? 349 LEU B CD1   1 
ATOM   5513 C CD2   . LEU B 1 319 ? -3.611  -2.235  55.677 1.00 57.68  ? 349 LEU B CD2   1 
ATOM   5514 N N     . ALA B 1 320 ? 1.228   -3.066  56.689 1.00 56.16  ? 350 ALA B N     1 
ATOM   5515 C CA    . ALA B 1 320 ? 1.950   -4.206  56.135 1.00 57.30  ? 350 ALA B CA    1 
ATOM   5516 C C     . ALA B 1 320 ? 2.898   -4.808  57.164 1.00 63.21  ? 350 ALA B C     1 
ATOM   5517 O O     . ALA B 1 320 ? 3.113   -6.022  57.197 1.00 57.51  ? 350 ALA B O     1 
ATOM   5518 C CB    . ALA B 1 320 ? 2.708   -3.800  54.880 1.00 52.23  ? 350 ALA B CB    1 
ATOM   5519 N N     . ALA B 1 321 ? 3.471   -3.947  57.998 1.00 73.21  ? 351 ALA B N     1 
ATOM   5520 C CA    . ALA B 1 321 ? 4.332   -4.397  59.081 1.00 72.22  ? 351 ALA B CA    1 
ATOM   5521 C C     . ALA B 1 321 ? 3.479   -5.084  60.132 1.00 75.84  ? 351 ALA B C     1 
ATOM   5522 O O     . ALA B 1 321 ? 3.680   -6.258  60.442 1.00 65.33  ? 351 ALA B O     1 
ATOM   5523 C CB    . ALA B 1 321 ? 5.077   -3.223  59.689 1.00 63.51  ? 351 ALA B CB    1 
ATOM   5524 N N     . GLU B 1 322 ? 2.512   -4.338  60.660 1.00 84.21  ? 352 GLU B N     1 
ATOM   5525 C CA    . GLU B 1 322 ? 1.615   -4.828  61.700 1.00 77.71  ? 352 GLU B CA    1 
ATOM   5526 C C     . GLU B 1 322 ? 0.946   -6.152  61.329 1.00 75.09  ? 352 GLU B C     1 
ATOM   5527 O O     . GLU B 1 322 ? 0.554   -6.918  62.207 1.00 84.28  ? 352 GLU B O     1 
ATOM   5528 C CB    . GLU B 1 322 ? 0.552   -3.776  62.022 1.00 76.50  ? 352 GLU B CB    1 
ATOM   5529 C CG    . GLU B 1 322 ? -0.225  -4.047  63.300 1.00 84.77  ? 352 GLU B CG    1 
ATOM   5530 C CD    . GLU B 1 322 ? 0.641   -3.958  64.537 1.00 99.32  ? 352 GLU B CD    1 
ATOM   5531 O OE1   . GLU B 1 322 ? 1.768   -3.430  64.438 1.00 111.44 ? 352 GLU B OE1   1 
ATOM   5532 O OE2   . GLU B 1 322 ? 0.195   -4.412  65.610 1.00 107.54 ? 352 GLU B OE2   1 
ATOM   5533 N N     . LEU B 1 323 ? 0.818   -6.421  60.032 1.00 70.34  ? 353 LEU B N     1 
ATOM   5534 C CA    . LEU B 1 323 ? 0.243   -7.685  59.573 1.00 71.51  ? 353 LEU B CA    1 
ATOM   5535 C C     . LEU B 1 323 ? 1.200   -8.863  59.744 1.00 87.55  ? 353 LEU B C     1 
ATOM   5536 O O     . LEU B 1 323 ? 0.821   -9.899  60.288 1.00 95.77  ? 353 LEU B O     1 
ATOM   5537 C CB    . LEU B 1 323 ? -0.226  -7.587  58.117 1.00 61.16  ? 353 LEU B CB    1 
ATOM   5538 C CG    . LEU B 1 323 ? -1.671  -7.125  57.882 1.00 64.13  ? 353 LEU B CG    1 
ATOM   5539 C CD1   . LEU B 1 323 ? -1.933  -6.921  56.400 1.00 59.47  ? 353 LEU B CD1   1 
ATOM   5540 C CD2   . LEU B 1 323 ? -2.676  -8.112  58.473 1.00 59.87  ? 353 LEU B CD2   1 
ATOM   5541 N N     . SER B 1 324 ? 2.435   -8.709  59.275 1.00 92.08  ? 354 SER B N     1 
ATOM   5542 C CA    . SER B 1 324 ? 3.438   -9.757  59.437 1.00 99.80  ? 354 SER B CA    1 
ATOM   5543 C C     . SER B 1 324 ? 3.820   -9.869  60.908 1.00 98.83  ? 354 SER B C     1 
ATOM   5544 O O     . SER B 1 324 ? 4.111   -10.956 61.412 1.00 87.96  ? 354 SER B O     1 
ATOM   5545 C CB    . SER B 1 324 ? 4.672   -9.467  58.581 1.00 113.08 ? 354 SER B CB    1 
ATOM   5546 O OG    . SER B 1 324 ? 5.242   -8.212  58.913 1.00 124.27 ? 354 SER B OG    1 
ATOM   5547 N N     . LYS B 1 325 ? 3.803   -8.727  61.587 1.00 109.61 ? 355 LYS B N     1 
ATOM   5548 C CA    . LYS B 1 325 ? 4.053   -8.653  63.021 1.00 113.67 ? 355 LYS B CA    1 
ATOM   5549 C C     . LYS B 1 325 ? 2.929   -9.340  63.792 1.00 114.12 ? 355 LYS B C     1 
ATOM   5550 O O     . LYS B 1 325 ? 3.040   -9.576  64.994 1.00 116.75 ? 355 LYS B O     1 
ATOM   5551 C CB    . LYS B 1 325 ? 4.182   -7.185  63.448 1.00 108.10 ? 355 LYS B CB    1 
ATOM   5552 C CG    . LYS B 1 325 ? 4.275   -6.944  64.946 1.00 101.93 ? 355 LYS B CG    1 
ATOM   5553 C CD    . LYS B 1 325 ? 4.279   -5.452  65.258 1.00 99.40  ? 355 LYS B CD    1 
ATOM   5554 C CE    . LYS B 1 325 ? 4.118   -5.197  66.748 1.00 104.45 ? 355 LYS B CE    1 
ATOM   5555 N NZ    . LYS B 1 325 ? 4.078   -3.743  67.071 1.00 103.13 ? 355 LYS B NZ    1 
ATOM   5556 N N     . GLU B 1 326 ? 1.848   -9.662  63.087 1.00 113.72 ? 356 GLU B N     1 
ATOM   5557 C CA    . GLU B 1 326 ? 0.704   -10.329 63.700 1.00 118.14 ? 356 GLU B CA    1 
ATOM   5558 C C     . GLU B 1 326 ? 0.572   -11.770 63.205 1.00 116.04 ? 356 GLU B C     1 
ATOM   5559 O O     . GLU B 1 326 ? -0.210  -12.547 63.750 1.00 117.92 ? 356 GLU B O     1 
ATOM   5560 C CB    . GLU B 1 326 ? -0.587  -9.550  63.431 1.00 121.50 ? 356 GLU B CB    1 
ATOM   5561 C CG    . GLU B 1 326 ? -1.721  -9.856  64.403 1.00 128.38 ? 356 GLU B CG    1 
ATOM   5562 C CD    . GLU B 1 326 ? -1.558  -9.154  65.741 1.00 133.19 ? 356 GLU B CD    1 
ATOM   5563 O OE1   . GLU B 1 326 ? -1.004  -8.034  65.767 1.00 132.70 ? 356 GLU B OE1   1 
ATOM   5564 O OE2   . GLU B 1 326 ? -1.994  -9.718  66.767 1.00 135.91 ? 356 GLU B OE2   1 
ATOM   5565 N N     . GLY B 1 327 ? 1.332   -12.120 62.171 1.00 109.39 ? 357 GLY B N     1 
ATOM   5566 C CA    . GLY B 1 327 ? 1.389   -13.497 61.710 1.00 107.41 ? 357 GLY B CA    1 
ATOM   5567 C C     . GLY B 1 327 ? 1.011   -13.740 60.261 1.00 108.80 ? 357 GLY B C     1 
ATOM   5568 O O     . GLY B 1 327 ? 1.055   -14.877 59.789 1.00 111.48 ? 357 GLY B O     1 
ATOM   5569 N N     . HIS B 1 328 ? 0.643   -12.679 59.549 1.00 106.74 ? 358 HIS B N     1 
ATOM   5570 C CA    . HIS B 1 328 ? 0.217   -12.803 58.159 1.00 96.99  ? 358 HIS B CA    1 
ATOM   5571 C C     . HIS B 1 328 ? 1.179   -12.089 57.219 1.00 89.80  ? 358 HIS B C     1 
ATOM   5572 O O     . HIS B 1 328 ? 1.401   -10.886 57.349 1.00 89.45  ? 358 HIS B O     1 
ATOM   5573 C CB    . HIS B 1 328 ? -1.190  -12.229 57.975 1.00 98.85  ? 358 HIS B CB    1 
ATOM   5574 C CG    . HIS B 1 328 ? -2.165  -12.658 59.028 1.00 107.34 ? 358 HIS B CG    1 
ATOM   5575 N ND1   . HIS B 1 328 ? -2.690  -13.931 59.082 1.00 114.03 ? 358 HIS B ND1   1 
ATOM   5576 C CD2   . HIS B 1 328 ? -2.719  -11.979 60.060 1.00 111.83 ? 358 HIS B CD2   1 
ATOM   5577 C CE1   . HIS B 1 328 ? -3.520  -14.020 60.107 1.00 115.64 ? 358 HIS B CE1   1 
ATOM   5578 N NE2   . HIS B 1 328 ? -3.556  -12.849 60.716 1.00 113.57 ? 358 HIS B NE2   1 
ATOM   5579 N N     . GLN B 1 329 ? 1.737   -12.828 56.265 1.00 89.60  ? 359 GLN B N     1 
ATOM   5580 C CA    . GLN B 1 329 ? 2.688   -12.255 55.314 1.00 85.19  ? 359 GLN B CA    1 
ATOM   5581 C C     . GLN B 1 329 ? 1.991   -11.474 54.199 1.00 77.82  ? 359 GLN B C     1 
ATOM   5582 O O     . GLN B 1 329 ? 0.935   -11.880 53.697 1.00 64.35  ? 359 GLN B O     1 
ATOM   5583 C CB    . GLN B 1 329 ? 3.554   -13.346 54.689 1.00 98.42  ? 359 GLN B CB    1 
ATOM   5584 C CG    . GLN B 1 329 ? 2.835   -14.134 53.602 1.00 114.50 ? 359 GLN B CG    1 
ATOM   5585 C CD    . GLN B 1 329 ? 3.736   -14.473 52.431 1.00 120.02 ? 359 GLN B CD    1 
ATOM   5586 O OE1   . GLN B 1 329 ? 4.955   -14.299 52.496 1.00 119.93 ? 359 GLN B OE1   1 
ATOM   5587 N NE2   . GLN B 1 329 ? 3.138   -14.958 51.347 1.00 118.53 ? 359 GLN B NE2   1 
ATOM   5588 N N     . VAL B 1 330 ? 2.601   -10.360 53.806 1.00 68.79  ? 360 VAL B N     1 
ATOM   5589 C CA    . VAL B 1 330 ? 2.048   -9.508  52.768 1.00 63.80  ? 360 VAL B CA    1 
ATOM   5590 C C     . VAL B 1 330 ? 3.142   -8.917  51.893 1.00 62.69  ? 360 VAL B C     1 
ATOM   5591 O O     . VAL B 1 330 ? 4.312   -8.892  52.277 1.00 66.63  ? 360 VAL B O     1 
ATOM   5592 C CB    . VAL B 1 330 ? 1.256   -8.338  53.369 1.00 63.91  ? 360 VAL B CB    1 
ATOM   5593 C CG1   . VAL B 1 330 ? 0.069   -8.846  54.169 1.00 61.60  ? 360 VAL B CG1   1 
ATOM   5594 C CG2   . VAL B 1 330 ? 2.169   -7.473  54.224 1.00 60.48  ? 360 VAL B CG2   1 
ATOM   5595 N N     . ALA B 1 331 ? 2.742   -8.436  50.718 1.00 56.72  ? 361 ALA B N     1 
ATOM   5596 C CA    . ALA B 1 331 ? 3.635   -7.745  49.797 1.00 50.38  ? 361 ALA B CA    1 
ATOM   5597 C C     . ALA B 1 331 ? 3.206   -6.289  49.703 1.00 50.33  ? 361 ALA B C     1 
ATOM   5598 O O     . ALA B 1 331 ? 2.022   -5.992  49.588 1.00 57.80  ? 361 ALA B O     1 
ATOM   5599 C CB    . ALA B 1 331 ? 3.591   -8.397  48.426 1.00 53.69  ? 361 ALA B CB    1 
ATOM   5600 N N     . LEU B 1 332 ? 4.173   -5.383  49.746 1.00 43.83  ? 362 LEU B N     1 
ATOM   5601 C CA    . LEU B 1 332 ? 3.884   -3.954  49.791 1.00 38.43  ? 362 LEU B CA    1 
ATOM   5602 C C     . LEU B 1 332 ? 4.213   -3.249  48.476 1.00 48.37  ? 362 LEU B C     1 
ATOM   5603 O O     . LEU B 1 332 ? 5.222   -3.543  47.836 1.00 55.76  ? 362 LEU B O     1 
ATOM   5604 C CB    . LEU B 1 332 ? 4.655   -3.303  50.941 1.00 36.42  ? 362 LEU B CB    1 
ATOM   5605 C CG    . LEU B 1 332 ? 4.632   -1.776  51.031 1.00 49.63  ? 362 LEU B CG    1 
ATOM   5606 C CD1   . LEU B 1 332 ? 3.208   -1.238  51.107 1.00 36.51  ? 362 LEU B CD1   1 
ATOM   5607 C CD2   . LEU B 1 332 ? 5.449   -1.308  52.230 1.00 56.17  ? 362 LEU B CD2   1 
ATOM   5608 N N     . LEU B 1 333 ? 3.352   -2.317  48.082 1.00 44.02  ? 363 LEU B N     1 
ATOM   5609 C CA    . LEU B 1 333 ? 3.585   -1.512  46.891 1.00 43.71  ? 363 LEU B CA    1 
ATOM   5610 C C     . LEU B 1 333 ? 3.565   -0.030  47.261 1.00 48.48  ? 363 LEU B C     1 
ATOM   5611 O O     . LEU B 1 333 ? 2.502   0.566   47.416 1.00 56.14  ? 363 LEU B O     1 
ATOM   5612 C CB    . LEU B 1 333 ? 2.518   -1.818  45.843 1.00 48.48  ? 363 LEU B CB    1 
ATOM   5613 C CG    . LEU B 1 333 ? 2.917   -1.750  44.373 1.00 45.69  ? 363 LEU B CG    1 
ATOM   5614 C CD1   . LEU B 1 333 ? 4.023   -2.750  44.074 1.00 38.31  ? 363 LEU B CD1   1 
ATOM   5615 C CD2   . LEU B 1 333 ? 1.705   -2.024  43.513 1.00 46.16  ? 363 LEU B CD2   1 
ATOM   5616 N N     . SER B 1 334 ? 4.745   0.562   47.412 1.00 52.81  ? 364 SER B N     1 
ATOM   5617 C CA    . SER B 1 334 ? 4.844   1.961   47.821 1.00 52.99  ? 364 SER B CA    1 
ATOM   5618 C C     . SER B 1 334 ? 5.592   2.837   46.813 1.00 54.53  ? 364 SER B C     1 
ATOM   5619 O O     . SER B 1 334 ? 6.222   2.340   45.880 1.00 58.04  ? 364 SER B O     1 
ATOM   5620 C CB    . SER B 1 334 ? 5.481   2.076   49.208 1.00 49.07  ? 364 SER B CB    1 
ATOM   5621 O OG    . SER B 1 334 ? 6.577   1.190   49.345 1.00 54.34  ? 364 SER B OG    1 
ATOM   5622 N N     . GLY B 1 335 ? 5.520   4.147   47.021 1.00 40.13  ? 365 GLY B N     1 
ATOM   5623 C CA    . GLY B 1 335 ? 6.043   5.110   46.072 1.00 31.85  ? 365 GLY B CA    1 
ATOM   5624 C C     . GLY B 1 335 ? 7.548   5.161   45.895 1.00 43.33  ? 365 GLY B C     1 
ATOM   5625 O O     . GLY B 1 335 ? 8.023   5.644   44.870 1.00 49.26  ? 365 GLY B O     1 
ATOM   5626 N N     . GLU B 1 336 ? 8.304   4.684   46.882 1.00 42.23  ? 366 GLU B N     1 
ATOM   5627 C CA    . GLU B 1 336 ? 9.762   4.722   46.780 1.00 43.63  ? 366 GLU B CA    1 
ATOM   5628 C C     . GLU B 1 336 ? 10.292  3.636   45.844 1.00 42.53  ? 366 GLU B C     1 
ATOM   5629 O O     . GLU B 1 336 ? 11.451  3.673   45.435 1.00 43.06  ? 366 GLU B O     1 
ATOM   5630 C CB    . GLU B 1 336 ? 10.435  4.635   48.157 1.00 48.97  ? 366 GLU B CB    1 
ATOM   5631 C CG    . GLU B 1 336 ? 10.663  3.222   48.683 1.00 48.61  ? 366 GLU B CG    1 
ATOM   5632 C CD    . GLU B 1 336 ? 9.389   2.576   49.187 1.00 57.82  ? 366 GLU B CD    1 
ATOM   5633 O OE1   . GLU B 1 336 ? 8.378   3.295   49.335 1.00 68.67  ? 366 GLU B OE1   1 
ATOM   5634 O OE2   . GLU B 1 336 ? 9.398   1.351   49.435 1.00 50.21  ? 366 GLU B OE2   1 
ATOM   5635 N N     . MET B 1 337 ? 9.437   2.681   45.492 1.00 38.16  ? 367 MET B N     1 
ATOM   5636 C CA    . MET B 1 337 ? 9.834   1.608   44.583 1.00 37.81  ? 367 MET B CA    1 
ATOM   5637 C C     . MET B 1 337 ? 9.846   2.068   43.131 1.00 38.94  ? 367 MET B C     1 
ATOM   5638 O O     . MET B 1 337 ? 8.916   2.728   42.673 1.00 41.36  ? 367 MET B O     1 
ATOM   5639 C CB    . MET B 1 337 ? 8.909   0.403   44.735 1.00 29.82  ? 367 MET B CB    1 
ATOM   5640 C CG    . MET B 1 337 ? 8.901   -0.180  46.130 1.00 34.08  ? 367 MET B CG    1 
ATOM   5641 S SD    . MET B 1 337 ? 7.684   -1.476  46.335 1.00 52.06  ? 367 MET B SD    1 
ATOM   5642 C CE    . MET B 1 337 ? 8.096   -2.556  44.971 1.00 44.61  ? 367 MET B CE    1 
ATOM   5643 N N     . MET B 1 338 ? 10.905  1.716   42.409 1.00 31.80  ? 368 MET B N     1 
ATOM   5644 C CA    . MET B 1 338 ? 10.981  2.020   40.985 1.00 35.23  ? 368 MET B CA    1 
ATOM   5645 C C     . MET B 1 338 ? 10.010  1.138   40.203 1.00 44.14  ? 368 MET B C     1 
ATOM   5646 O O     . MET B 1 338 ? 9.537   0.119   40.711 1.00 42.11  ? 368 MET B O     1 
ATOM   5647 C CB    . MET B 1 338 ? 12.413  1.855   40.480 1.00 29.78  ? 368 MET B CB    1 
ATOM   5648 C CG    . MET B 1 338 ? 13.398  2.738   41.215 1.00 37.91  ? 368 MET B CG    1 
ATOM   5649 S SD    . MET B 1 338 ? 12.996  4.487   41.046 1.00 43.38  ? 368 MET B SD    1 
ATOM   5650 C CE    . MET B 1 338 ? 13.958  4.899   39.581 1.00 31.56  ? 368 MET B CE    1 
ATOM   5651 N N     . VAL B 1 339 ? 9.710   1.531   38.970 1.00 41.84  ? 369 VAL B N     1 
ATOM   5652 C CA    . VAL B 1 339 ? 8.680   0.846   38.194 1.00 39.41  ? 369 VAL B CA    1 
ATOM   5653 C C     . VAL B 1 339 ? 8.968   -0.645  37.974 1.00 40.14  ? 369 VAL B C     1 
ATOM   5654 O O     . VAL B 1 339 ? 8.067   -1.478  38.088 1.00 38.53  ? 369 VAL B O     1 
ATOM   5655 C CB    . VAL B 1 339 ? 8.429   1.534   36.844 1.00 44.15  ? 369 VAL B CB    1 
ATOM   5656 C CG1   . VAL B 1 339 ? 9.642   1.391   35.938 1.00 50.38  ? 369 VAL B CG1   1 
ATOM   5657 C CG2   . VAL B 1 339 ? 7.196   0.955   36.183 1.00 35.34  ? 369 VAL B CG2   1 
ATOM   5658 N N     . GLU B 1 340 ? 10.214  -0.992  37.669 1.00 25.92  ? 370 GLU B N     1 
ATOM   5659 C CA    . GLU B 1 340 ? 10.547  -2.403  37.478 1.00 42.95  ? 370 GLU B CA    1 
ATOM   5660 C C     . GLU B 1 340 ? 10.406  -3.148  38.796 1.00 40.11  ? 370 GLU B C     1 
ATOM   5661 O O     . GLU B 1 340 ? 10.021  -4.318  38.824 1.00 37.80  ? 370 GLU B O     1 
ATOM   5662 C CB    . GLU B 1 340 ? 11.952  -2.590  36.876 1.00 26.80  ? 370 GLU B CB    1 
ATOM   5663 C CG    . GLU B 1 340 ? 12.943  -1.502  37.259 1.00 79.12  ? 370 GLU B CG    1 
ATOM   5664 C CD    . GLU B 1 340 ? 12.834  -0.284  36.363 1.00 66.75  ? 370 GLU B CD    1 
ATOM   5665 O OE1   . GLU B 1 340 ? 12.654  -0.470  35.138 1.00 67.29  ? 370 GLU B OE1   1 
ATOM   5666 O OE2   . GLU B 1 340 ? 12.933  0.853   36.878 1.00 46.63  ? 370 GLU B OE2   1 
ATOM   5667 N N     . GLN B 1 341 ? 10.706  -2.453  39.889 1.00 47.51  ? 371 GLN B N     1 
ATOM   5668 C CA    . GLN B 1 341 ? 10.578  -3.025  41.222 1.00 34.77  ? 371 GLN B CA    1 
ATOM   5669 C C     . GLN B 1 341 ? 9.122   -3.282  41.538 1.00 29.79  ? 371 GLN B C     1 
ATOM   5670 O O     . GLN B 1 341 ? 8.772   -4.331  42.080 1.00 40.75  ? 371 GLN B O     1 
ATOM   5671 C CB    . GLN B 1 341 ? 11.192  -2.096  42.262 1.00 40.72  ? 371 GLN B CB    1 
ATOM   5672 C CG    . GLN B 1 341 ? 12.705  -2.078  42.237 1.00 29.36  ? 371 GLN B CG    1 
ATOM   5673 C CD    . GLN B 1 341 ? 13.271  -1.233  43.345 1.00 43.24  ? 371 GLN B CD    1 
ATOM   5674 O OE1   . GLN B 1 341 ? 12.948  -0.051  43.468 1.00 29.95  ? 371 GLN B OE1   1 
ATOM   5675 N NE2   . GLN B 1 341 ? 14.117  -1.834  44.168 1.00 31.74  ? 371 GLN B NE2   1 
ATOM   5676 N N     . ARG B 1 342 ? 8.277   -2.316  41.194 1.00 26.52  ? 372 ARG B N     1 
ATOM   5677 C CA    . ARG B 1 342 ? 6.834   -2.487  41.296 1.00 26.09  ? 372 ARG B CA    1 
ATOM   5678 C C     . ARG B 1 342 ? 6.352   -3.675  40.472 1.00 39.65  ? 372 ARG B C     1 
ATOM   5679 O O     . ARG B 1 342 ? 5.582   -4.497  40.961 1.00 44.83  ? 372 ARG B O     1 
ATOM   5680 C CB    . ARG B 1 342 ? 6.114   -1.218  40.847 1.00 28.00  ? 372 ARG B CB    1 
ATOM   5681 C CG    . ARG B 1 342 ? 6.453   0.005   41.681 1.00 42.38  ? 372 ARG B CG    1 
ATOM   5682 C CD    . ARG B 1 342 ? 5.607   1.193   41.277 1.00 40.46  ? 372 ARG B CD    1 
ATOM   5683 N NE    . ARG B 1 342 ? 6.133   2.449   41.799 1.00 43.27  ? 372 ARG B NE    1 
ATOM   5684 C CZ    . ARG B 1 342 ? 5.458   3.593   41.794 1.00 49.22  ? 372 ARG B CZ    1 
ATOM   5685 N NH1   . ARG B 1 342 ? 4.224   3.631   41.301 1.00 58.36  ? 372 ARG B NH1   1 
ATOM   5686 N NH2   . ARG B 1 342 ? 6.009   4.695   42.288 1.00 37.20  ? 372 ARG B NH2   1 
ATOM   5687 N N     . ALA B 1 343 ? 6.814   -3.767  39.227 1.00 31.94  ? 373 ALA B N     1 
ATOM   5688 C CA    . ALA B 1 343 ? 6.420   -4.868  38.355 1.00 28.42  ? 373 ALA B CA    1 
ATOM   5689 C C     . ALA B 1 343 ? 6.763   -6.227  38.956 1.00 34.87  ? 373 ALA B C     1 
ATOM   5690 O O     . ALA B 1 343 ? 5.950   -7.148  38.921 1.00 31.17  ? 373 ALA B O     1 
ATOM   5691 C CB    . ALA B 1 343 ? 7.048   -4.721  36.983 1.00 26.01  ? 373 ALA B CB    1 
ATOM   5692 N N     . ALA B 1 344 ? 7.964   -6.346  39.514 1.00 27.56  ? 374 ALA B N     1 
ATOM   5693 C CA    . ALA B 1 344 ? 8.419   -7.610  40.094 1.00 31.55  ? 374 ALA B CA    1 
ATOM   5694 C C     . ALA B 1 344 ? 7.550   -8.056  41.272 1.00 38.16  ? 374 ALA B C     1 
ATOM   5695 O O     . ALA B 1 344 ? 7.303   -9.249  41.459 1.00 41.29  ? 374 ALA B O     1 
ATOM   5696 C CB    . ALA B 1 344 ? 9.883   -7.507  40.512 1.00 29.56  ? 374 ALA B CB    1 
ATOM   5697 N N     . VAL B 1 345 ? 7.090   -7.094  42.065 1.00 34.28  ? 375 VAL B N     1 
ATOM   5698 C CA    . VAL B 1 345 ? 6.245   -7.392  43.214 1.00 32.35  ? 375 VAL B CA    1 
ATOM   5699 C C     . VAL B 1 345 ? 4.853   -7.803  42.755 1.00 36.85  ? 375 VAL B C     1 
ATOM   5700 O O     . VAL B 1 345 ? 4.255   -8.735  43.289 1.00 46.89  ? 375 VAL B O     1 
ATOM   5701 C CB    . VAL B 1 345 ? 6.147   -6.185  44.166 1.00 38.52  ? 375 VAL B CB    1 
ATOM   5702 C CG1   . VAL B 1 345 ? 5.000   -6.359  45.136 1.00 29.63  ? 375 VAL B CG1   1 
ATOM   5703 C CG2   . VAL B 1 345 ? 7.466   -5.986  44.908 1.00 29.61  ? 375 VAL B CG2   1 
ATOM   5704 N N     . ILE B 1 346 ? 4.342   -7.102  41.752 1.00 41.42  ? 376 ILE B N     1 
ATOM   5705 C CA    . ILE B 1 346 ? 3.063   -7.451  41.157 1.00 39.59  ? 376 ILE B CA    1 
ATOM   5706 C C     . ILE B 1 346 ? 3.118   -8.838  40.519 1.00 46.72  ? 376 ILE B C     1 
ATOM   5707 O O     . ILE B 1 346 ? 2.140   -9.587  40.560 1.00 47.85  ? 376 ILE B O     1 
ATOM   5708 C CB    . ILE B 1 346 ? 2.631   -6.404  40.124 1.00 34.37  ? 376 ILE B CB    1 
ATOM   5709 C CG1   . ILE B 1 346 ? 2.312   -5.083  40.830 1.00 29.62  ? 376 ILE B CG1   1 
ATOM   5710 C CG2   . ILE B 1 346 ? 1.431   -6.900  39.330 1.00 26.66  ? 376 ILE B CG2   1 
ATOM   5711 C CD1   . ILE B 1 346 ? 2.195   -3.887  39.906 1.00 37.84  ? 376 ILE B CD1   1 
ATOM   5712 N N     . GLU B 1 347 ? 4.266   -9.182  39.945 1.00 51.10  ? 377 GLU B N     1 
ATOM   5713 C CA    . GLU B 1 347 ? 4.450   -10.508 39.364 1.00 62.11  ? 377 GLU B CA    1 
ATOM   5714 C C     . GLU B 1 347 ? 4.387   -11.589 40.438 1.00 54.73  ? 377 GLU B C     1 
ATOM   5715 O O     . GLU B 1 347 ? 3.554   -12.489 40.364 1.00 51.41  ? 377 GLU B O     1 
ATOM   5716 C CB    . GLU B 1 347 ? 5.774   -10.593 38.604 1.00 73.44  ? 377 GLU B CB    1 
ATOM   5717 C CG    . GLU B 1 347 ? 5.844   -9.696  37.379 1.00 98.25  ? 377 GLU B CG    1 
ATOM   5718 C CD    . GLU B 1 347 ? 7.270   -9.473  36.899 1.00 124.00 ? 377 GLU B CD    1 
ATOM   5719 O OE1   . GLU B 1 347 ? 7.542   -8.404  36.310 1.00 128.98 ? 377 GLU B OE1   1 
ATOM   5720 O OE2   . GLU B 1 347 ? 8.121   -10.362 37.118 1.00 133.28 ? 377 GLU B OE2   1 
ATOM   5721 N N     . ARG B 1 348 ? 5.262   -11.495 41.435 1.00 51.90  ? 378 ARG B N     1 
ATOM   5722 C CA    . ARG B 1 348 ? 5.295   -12.480 42.515 1.00 57.77  ? 378 ARG B CA    1 
ATOM   5723 C C     . ARG B 1 348 ? 3.903   -12.710 43.079 1.00 50.24  ? 378 ARG B C     1 
ATOM   5724 O O     . ARG B 1 348 ? 3.515   -13.843 43.358 1.00 65.72  ? 378 ARG B O     1 
ATOM   5725 C CB    . ARG B 1 348 ? 6.247   -12.049 43.636 1.00 61.95  ? 378 ARG B CB    1 
ATOM   5726 C CG    . ARG B 1 348 ? 7.685   -11.876 43.195 1.00 75.47  ? 378 ARG B CG    1 
ATOM   5727 C CD    . ARG B 1 348 ? 8.632   -11.813 44.383 1.00 93.71  ? 378 ARG B CD    1 
ATOM   5728 N NE    . ARG B 1 348 ? 8.855   -13.128 44.980 1.00 101.47 ? 378 ARG B NE    1 
ATOM   5729 C CZ    . ARG B 1 348 ? 8.322   -13.533 46.129 1.00 96.95  ? 378 ARG B CZ    1 
ATOM   5730 N NH1   . ARG B 1 348 ? 7.534   -12.721 46.820 1.00 90.36  ? 378 ARG B NH1   1 
ATOM   5731 N NH2   . ARG B 1 348 ? 8.583   -14.748 46.591 1.00 97.55  ? 378 ARG B NH2   1 
ATOM   5732 N N     . PHE B 1 349 ? 3.152   -11.628 43.244 1.00 36.27  ? 379 PHE B N     1 
ATOM   5733 C CA    . PHE B 1 349 ? 1.785   -11.729 43.737 1.00 47.32  ? 379 PHE B CA    1 
ATOM   5734 C C     . PHE B 1 349 ? 0.914   -12.603 42.832 1.00 59.80  ? 379 PHE B C     1 
ATOM   5735 O O     . PHE B 1 349 ? 0.135   -13.423 43.316 1.00 66.55  ? 379 PHE B O     1 
ATOM   5736 C CB    . PHE B 1 349 ? 1.169   -10.340 43.899 1.00 41.83  ? 379 PHE B CB    1 
ATOM   5737 C CG    . PHE B 1 349 ? -0.296  -10.363 44.238 1.00 47.78  ? 379 PHE B CG    1 
ATOM   5738 C CD1   . PHE B 1 349 ? -0.718  -10.600 45.534 1.00 51.26  ? 379 PHE B CD1   1 
ATOM   5739 C CD2   . PHE B 1 349 ? -1.250  -10.136 43.259 1.00 49.10  ? 379 PHE B CD2   1 
ATOM   5740 C CE1   . PHE B 1 349 ? -2.062  -10.616 45.844 1.00 51.23  ? 379 PHE B CE1   1 
ATOM   5741 C CE2   . PHE B 1 349 ? -2.597  -10.150 43.565 1.00 41.72  ? 379 PHE B CE2   1 
ATOM   5742 C CZ    . PHE B 1 349 ? -3.003  -10.392 44.858 1.00 39.92  ? 379 PHE B CZ    1 
ATOM   5743 N N     . ARG B 1 350 ? 1.048   -12.427 41.521 1.00 58.81  ? 380 ARG B N     1 
ATOM   5744 C CA    . ARG B 1 350 ? 0.291   -13.228 40.562 1.00 56.26  ? 380 ARG B CA    1 
ATOM   5745 C C     . ARG B 1 350 ? 0.737   -14.686 40.569 1.00 60.13  ? 380 ARG B C     1 
ATOM   5746 O O     . ARG B 1 350 ? -0.068  -15.590 40.358 1.00 61.68  ? 380 ARG B O     1 
ATOM   5747 C CB    . ARG B 1 350 ? 0.428   -12.657 39.152 1.00 50.31  ? 380 ARG B CB    1 
ATOM   5748 C CG    . ARG B 1 350 ? -0.290  -11.344 38.938 1.00 46.92  ? 380 ARG B CG    1 
ATOM   5749 C CD    . ARG B 1 350 ? -0.115  -10.880 37.512 1.00 54.38  ? 380 ARG B CD    1 
ATOM   5750 N NE    . ARG B 1 350 ? -0.779  -9.606  37.255 1.00 64.03  ? 380 ARG B NE    1 
ATOM   5751 C CZ    . ARG B 1 350 ? -0.689  -8.948  36.104 1.00 72.42  ? 380 ARG B CZ    1 
ATOM   5752 N NH1   . ARG B 1 350 ? 0.038   -9.450  35.115 1.00 77.03  ? 380 ARG B NH1   1 
ATOM   5753 N NH2   . ARG B 1 350 ? -1.319  -7.793  35.941 1.00 65.38  ? 380 ARG B NH2   1 
ATOM   5754 N N     . GLU B 1 351 ? 2.028   -14.906 40.800 1.00 61.64  ? 381 GLU B N     1 
ATOM   5755 C CA    . GLU B 1 351 ? 2.573   -16.254 40.893 1.00 64.22  ? 381 GLU B CA    1 
ATOM   5756 C C     . GLU B 1 351 ? 1.858   -17.014 42.000 1.00 66.85  ? 381 GLU B C     1 
ATOM   5757 O O     . GLU B 1 351 ? 1.815   -18.243 42.000 1.00 75.32  ? 381 GLU B O     1 
ATOM   5758 C CB    . GLU B 1 351 ? 4.070   -16.203 41.208 1.00 72.30  ? 381 GLU B CB    1 
ATOM   5759 C CG    . GLU B 1 351 ? 4.867   -15.232 40.360 1.00 84.43  ? 381 GLU B CG    1 
ATOM   5760 C CD    . GLU B 1 351 ? 5.329   -15.837 39.052 1.00 95.25  ? 381 GLU B CD    1 
ATOM   5761 O OE1   . GLU B 1 351 ? 5.629   -15.071 38.111 1.00 94.25  ? 381 GLU B OE1   1 
ATOM   5762 O OE2   . GLU B 1 351 ? 5.391   -17.081 38.968 1.00 100.91 ? 381 GLU B OE2   1 
ATOM   5763 N N     . GLY B 1 352 ? 1.301   -16.271 42.948 1.00 64.93  ? 382 GLY B N     1 
ATOM   5764 C CA    . GLY B 1 352 ? 0.707   -16.868 44.125 1.00 72.00  ? 382 GLY B CA    1 
ATOM   5765 C C     . GLY B 1 352 ? 1.716   -16.891 45.253 1.00 81.76  ? 382 GLY B C     1 
ATOM   5766 O O     . GLY B 1 352 ? 1.390   -17.247 46.387 1.00 92.79  ? 382 GLY B O     1 
ATOM   5767 N N     . LYS B 1 353 ? 2.953   -16.513 44.938 1.00 74.07  ? 383 LYS B N     1 
ATOM   5768 C CA    . LYS B 1 353 ? 4.004   -16.423 45.945 1.00 67.06  ? 383 LYS B CA    1 
ATOM   5769 C C     . LYS B 1 353 ? 3.588   -15.444 47.033 1.00 66.79  ? 383 LYS B C     1 
ATOM   5770 O O     . LYS B 1 353 ? 4.076   -15.509 48.157 1.00 65.40  ? 383 LYS B O     1 
ATOM   5771 C CB    . LYS B 1 353 ? 5.326   -15.979 45.315 1.00 66.74  ? 383 LYS B CB    1 
ATOM   5772 C CG    . LYS B 1 353 ? 5.936   -16.986 44.346 1.00 79.33  ? 383 LYS B CG    1 
ATOM   5773 C CD    . LYS B 1 353 ? 6.337   -18.270 45.058 1.00 95.03  ? 383 LYS B CD    1 
ATOM   5774 C CE    . LYS B 1 353 ? 7.173   -19.169 44.156 1.00 100.05 ? 383 LYS B CE    1 
ATOM   5775 N NZ    . LYS B 1 353 ? 7.621   -20.409 44.853 1.00 100.60 ? 383 LYS B NZ    1 
ATOM   5776 N N     . GLU B 1 354 ? 2.681   -14.534 46.687 1.00 78.30  ? 384 GLU B N     1 
ATOM   5777 C CA    . GLU B 1 354 ? 2.107   -13.603 47.654 1.00 79.88  ? 384 GLU B CA    1 
ATOM   5778 C C     . GLU B 1 354 ? 0.603   -13.802 47.740 1.00 78.71  ? 384 GLU B C     1 
ATOM   5779 O O     . GLU B 1 354 ? -0.082  -13.880 46.719 1.00 79.71  ? 384 GLU B O     1 
ATOM   5780 C CB    . GLU B 1 354 ? 2.407   -12.153 47.269 1.00 77.19  ? 384 GLU B CB    1 
ATOM   5781 C CG    . GLU B 1 354 ? 3.878   -11.792 47.302 1.00 81.54  ? 384 GLU B CG    1 
ATOM   5782 C CD    . GLU B 1 354 ? 4.513   -12.082 48.644 1.00 92.12  ? 384 GLU B CD    1 
ATOM   5783 O OE1   . GLU B 1 354 ? 3.795   -12.032 49.665 1.00 102.41 ? 384 GLU B OE1   1 
ATOM   5784 O OE2   . GLU B 1 354 ? 5.730   -12.357 48.678 1.00 93.14  ? 384 GLU B OE2   1 
ATOM   5785 N N     . LYS B 1 355 ? 0.090   -13.884 48.961 1.00 76.31  ? 385 LYS B N     1 
ATOM   5786 C CA    . LYS B 1 355 ? -1.343  -14.042 49.160 1.00 71.11  ? 385 LYS B CA    1 
ATOM   5787 C C     . LYS B 1 355 ? -2.022  -12.682 49.222 1.00 62.22  ? 385 LYS B C     1 
ATOM   5788 O O     . LYS B 1 355 ? -3.089  -12.480 48.648 1.00 58.03  ? 385 LYS B O     1 
ATOM   5789 C CB    . LYS B 1 355 ? -1.623  -14.840 50.433 1.00 80.88  ? 385 LYS B CB    1 
ATOM   5790 C CG    . LYS B 1 355 ? -1.395  -16.335 50.275 1.00 94.13  ? 385 LYS B CG    1 
ATOM   5791 C CD    . LYS B 1 355 ? -1.419  -17.047 51.616 1.00 100.90 ? 385 LYS B CD    1 
ATOM   5792 C CE    . LYS B 1 355 ? -0.268  -16.594 52.496 1.00 107.13 ? 385 LYS B CE    1 
ATOM   5793 N NZ    . LYS B 1 355 ? -0.208  -17.362 53.771 1.00 111.50 ? 385 LYS B NZ    1 
ATOM   5794 N N     . VAL B 1 356 ? -1.389  -11.747 49.916 1.00 64.55  ? 386 VAL B N     1 
ATOM   5795 C CA    . VAL B 1 356 ? -1.956  -10.421 50.091 1.00 56.40  ? 386 VAL B CA    1 
ATOM   5796 C C     . VAL B 1 356 ? -0.987  -9.335  49.668 1.00 53.22  ? 386 VAL B C     1 
ATOM   5797 O O     . VAL B 1 356 ? 0.209   -9.403  49.939 1.00 53.14  ? 386 VAL B O     1 
ATOM   5798 C CB    . VAL B 1 356 ? -2.373  -10.177 51.546 1.00 57.12  ? 386 VAL B CB    1 
ATOM   5799 C CG1   . VAL B 1 356 ? -2.617  -8.696  51.788 1.00 44.43  ? 386 VAL B CG1   1 
ATOM   5800 C CG2   . VAL B 1 356 ? -3.609  -10.994 51.872 1.00 67.54  ? 386 VAL B CG2   1 
ATOM   5801 N N     . LEU B 1 357 ? -1.528  -8.326  49.005 1.00 50.06  ? 387 LEU B N     1 
ATOM   5802 C CA    . LEU B 1 357 ? -0.739  -7.220  48.510 1.00 47.24  ? 387 LEU B CA    1 
ATOM   5803 C C     . LEU B 1 357 ? -1.302  -5.929  49.081 1.00 36.92  ? 387 LEU B C     1 
ATOM   5804 O O     . LEU B 1 357 ? -2.476  -5.628  48.917 1.00 46.23  ? 387 LEU B O     1 
ATOM   5805 C CB    . LEU B 1 357 ? -0.787  -7.199  46.980 1.00 48.87  ? 387 LEU B CB    1 
ATOM   5806 C CG    . LEU B 1 357 ? 0.055   -6.176  46.223 1.00 51.97  ? 387 LEU B CG    1 
ATOM   5807 C CD1   . LEU B 1 357 ? 0.061   -6.509  44.745 1.00 48.10  ? 387 LEU B CD1   1 
ATOM   5808 C CD2   . LEU B 1 357 ? -0.469  -4.770  46.443 1.00 60.03  ? 387 LEU B CD2   1 
ATOM   5809 N N     . VAL B 1 358 ? -0.458  -5.169  49.762 1.00 43.48  ? 388 VAL B N     1 
ATOM   5810 C CA    . VAL B 1 358 ? -0.853  -3.866  50.270 1.00 46.95  ? 388 VAL B CA    1 
ATOM   5811 C C     . VAL B 1 358 ? -0.296  -2.779  49.357 1.00 44.89  ? 388 VAL B C     1 
ATOM   5812 O O     . VAL B 1 358 ? 0.855   -2.839  48.936 1.00 45.73  ? 388 VAL B O     1 
ATOM   5813 C CB    . VAL B 1 358 ? -0.362  -3.658  51.716 1.00 41.44  ? 388 VAL B CB    1 
ATOM   5814 C CG1   . VAL B 1 358 ? -0.826  -2.308  52.248 1.00 40.22  ? 388 VAL B CG1   1 
ATOM   5815 C CG2   . VAL B 1 358 ? -0.862  -4.791  52.602 1.00 34.11  ? 388 VAL B CG2   1 
ATOM   5816 N N     . THR B 1 359 ? -1.116  -1.788  49.042 1.00 27.85  ? 389 THR B N     1 
ATOM   5817 C CA    . THR B 1 359 ? -0.707  -0.759  48.101 1.00 42.14  ? 389 THR B CA    1 
ATOM   5818 C C     . THR B 1 359 ? -1.306  0.587   48.452 1.00 38.08  ? 389 THR B C     1 
ATOM   5819 O O     . THR B 1 359 ? -2.382  0.665   49.037 1.00 29.33  ? 389 THR B O     1 
ATOM   5820 C CB    . THR B 1 359 ? -1.138  -1.107  46.658 1.00 51.08  ? 389 THR B CB    1 
ATOM   5821 O OG1   . THR B 1 359 ? -0.895  0.017   45.806 1.00 58.80  ? 389 THR B OG1   1 
ATOM   5822 C CG2   . THR B 1 359 ? -2.628  -1.457  46.600 1.00 38.18  ? 389 THR B CG2   1 
ATOM   5823 N N     . THR B 1 360 ? -0.602  1.649   48.085 1.00 48.42  ? 390 THR B N     1 
ATOM   5824 C CA    . THR B 1 360 ? -1.139  2.989   48.231 1.00 57.64  ? 390 THR B CA    1 
ATOM   5825 C C     . THR B 1 360 ? -2.171  3.195   47.132 1.00 51.30  ? 390 THR B C     1 
ATOM   5826 O O     . THR B 1 360 ? -2.231  2.418   46.182 1.00 45.63  ? 390 THR B O     1 
ATOM   5827 C CB    . THR B 1 360 ? -0.033  4.048   48.115 1.00 72.79  ? 390 THR B CB    1 
ATOM   5828 O OG1   . THR B 1 360 ? 1.082   3.664   48.932 1.00 81.77  ? 390 THR B OG1   1 
ATOM   5829 C CG2   . THR B 1 360 ? -0.546  5.408   48.569 1.00 75.75  ? 390 THR B CG2   1 
ATOM   5830 N N     . ASN B 1 361 ? -2.990  4.230   47.265 1.00 51.97  ? 391 ASN B N     1 
ATOM   5831 C CA    . ASN B 1 361 ? -3.990  4.528   46.250 1.00 60.53  ? 391 ASN B CA    1 
ATOM   5832 C C     . ASN B 1 361 ? -3.336  5.015   44.977 1.00 59.86  ? 391 ASN B C     1 
ATOM   5833 O O     . ASN B 1 361 ? -3.805  4.727   43.877 1.00 68.08  ? 391 ASN B O     1 
ATOM   5834 C CB    . ASN B 1 361 ? -4.981  5.577   46.751 1.00 66.10  ? 391 ASN B CB    1 
ATOM   5835 C CG    . ASN B 1 361 ? -6.041  4.988   47.639 1.00 63.11  ? 391 ASN B CG    1 
ATOM   5836 O OD1   . ASN B 1 361 ? -6.237  3.776   47.660 1.00 65.96  ? 391 ASN B OD1   1 
ATOM   5837 N ND2   . ASN B 1 361 ? -6.736  5.840   48.381 1.00 77.32  ? 391 ASN B ND2   1 
ATOM   5838 N N     . VAL B 1 362 ? -2.245  5.754   45.144 1.00 53.72  ? 392 VAL B N     1 
ATOM   5839 C CA    . VAL B 1 362 ? -1.530  6.345   44.024 1.00 57.62  ? 392 VAL B CA    1 
ATOM   5840 C C     . VAL B 1 362 ? -0.737  5.312   43.222 1.00 62.70  ? 392 VAL B C     1 
ATOM   5841 O O     . VAL B 1 362 ? -0.661  5.397   41.997 1.00 73.93  ? 392 VAL B O     1 
ATOM   5842 C CB    . VAL B 1 362 ? -0.588  7.463   44.500 1.00 64.58  ? 392 VAL B CB    1 
ATOM   5843 C CG1   . VAL B 1 362 ? 0.403   6.924   45.520 1.00 66.18  ? 392 VAL B CG1   1 
ATOM   5844 C CG2   . VAL B 1 362 ? 0.141   8.080   43.319 1.00 78.07  ? 392 VAL B CG2   1 
ATOM   5845 N N     . CYS B 1 363 ? -0.150  4.338   43.910 1.00 53.81  ? 393 CYS B N     1 
ATOM   5846 C CA    . CYS B 1 363 ? 0.659   3.316   43.246 1.00 52.71  ? 393 CYS B CA    1 
ATOM   5847 C C     . CYS B 1 363 ? -0.186  2.264   42.543 1.00 54.46  ? 393 CYS B C     1 
ATOM   5848 O O     . CYS B 1 363 ? 0.348   1.397   41.852 1.00 54.51  ? 393 CYS B O     1 
ATOM   5849 C CB    . CYS B 1 363 ? 1.588   2.621   44.245 1.00 39.47  ? 393 CYS B CB    1 
ATOM   5850 S SG    . CYS B 1 363 ? 3.016   3.585   44.726 1.00 64.40  ? 393 CYS B SG    1 
ATOM   5851 N N     . ALA B 1 364 ? -1.499  2.333   42.730 1.00 55.06  ? 394 ALA B N     1 
ATOM   5852 C CA    . ALA B 1 364 ? -2.389  1.305   42.207 1.00 44.84  ? 394 ALA B CA    1 
ATOM   5853 C C     . ALA B 1 364 ? -3.319  1.848   41.129 1.00 46.10  ? 394 ALA B C     1 
ATOM   5854 O O     . ALA B 1 364 ? -3.982  1.083   40.423 1.00 49.44  ? 394 ALA B O     1 
ATOM   5855 C CB    . ALA B 1 364 ? -3.187  0.676   43.337 1.00 44.65  ? 394 ALA B CB    1 
ATOM   5856 N N     . ARG B 1 365 ? -3.362  3.170   41.001 1.00 45.74  ? 395 ARG B N     1 
ATOM   5857 C CA    . ARG B 1 365 ? -4.254  3.812   40.041 1.00 44.51  ? 395 ARG B CA    1 
ATOM   5858 C C     . ARG B 1 365 ? -3.898  3.464   38.598 1.00 49.64  ? 395 ARG B C     1 
ATOM   5859 O O     . ARG B 1 365 ? -2.787  3.731   38.133 1.00 50.65  ? 395 ARG B O     1 
ATOM   5860 C CB    . ARG B 1 365 ? -4.253  5.332   40.226 1.00 49.40  ? 395 ARG B CB    1 
ATOM   5861 C CG    . ARG B 1 365 ? -5.468  6.019   39.626 1.00 68.81  ? 395 ARG B CG    1 
ATOM   5862 C CD    . ARG B 1 365 ? -5.639  7.439   40.150 1.00 91.71  ? 395 ARG B CD    1 
ATOM   5863 N NE    . ARG B 1 365 ? -5.029  8.435   39.272 1.00 105.31 ? 395 ARG B NE    1 
ATOM   5864 C CZ    . ARG B 1 365 ? -3.818  8.953   39.449 1.00 111.28 ? 395 ARG B CZ    1 
ATOM   5865 N NH1   . ARG B 1 365 ? -3.071  8.572   40.478 1.00 106.04 ? 395 ARG B NH1   1 
ATOM   5866 N NH2   . ARG B 1 365 ? -3.352  9.855   38.594 1.00 117.50 ? 395 ARG B NH2   1 
ATOM   5867 N N     . GLY B 1 366 ? -4.852  2.864   37.897 1.00 51.63  ? 396 GLY B N     1 
ATOM   5868 C CA    . GLY B 1 366 ? -4.702  2.588   36.483 1.00 36.70  ? 396 GLY B CA    1 
ATOM   5869 C C     . GLY B 1 366 ? -3.992  1.286   36.195 1.00 42.01  ? 396 GLY B C     1 
ATOM   5870 O O     . GLY B 1 366 ? -3.853  0.897   35.035 1.00 56.10  ? 396 GLY B O     1 
ATOM   5871 N N     . ILE B 1 367 ? -3.546  0.600   37.241 1.00 34.37  ? 397 ILE B N     1 
ATOM   5872 C CA    . ILE B 1 367 ? -2.768  -0.617  37.044 1.00 40.08  ? 397 ILE B CA    1 
ATOM   5873 C C     . ILE B 1 367 ? -3.657  -1.853  36.933 1.00 44.98  ? 397 ILE B C     1 
ATOM   5874 O O     . ILE B 1 367 ? -4.380  -2.202  37.861 1.00 48.36  ? 397 ILE B O     1 
ATOM   5875 C CB    . ILE B 1 367 ? -1.679  -0.805  38.128 1.00 36.21  ? 397 ILE B CB    1 
ATOM   5876 C CG1   . ILE B 1 367 ? -0.490  0.126   37.874 1.00 37.92  ? 397 ILE B CG1   1 
ATOM   5877 C CG2   . ILE B 1 367 ? -1.155  -2.218  38.097 1.00 31.25  ? 397 ILE B CG2   1 
ATOM   5878 C CD1   . ILE B 1 367 ? -0.848  1.535   37.462 1.00 41.91  ? 397 ILE B CD1   1 
ATOM   5879 N N     . ASP B 1 368 ? -3.601  -2.499  35.773 1.00 67.51  ? 398 ASP B N     1 
ATOM   5880 C CA    . ASP B 1 368 ? -4.375  -3.704  35.514 1.00 81.26  ? 398 ASP B CA    1 
ATOM   5881 C C     . ASP B 1 368 ? -3.802  -4.887  36.285 1.00 90.16  ? 398 ASP B C     1 
ATOM   5882 O O     . ASP B 1 368 ? -3.283  -5.822  35.675 1.00 101.45 ? 398 ASP B O     1 
ATOM   5883 C CB    . ASP B 1 368 ? -4.376  -4.039  34.012 1.00 84.21  ? 398 ASP B CB    1 
ATOM   5884 C CG    . ASP B 1 368 ? -5.042  -2.964  33.159 1.00 93.72  ? 398 ASP B CG    1 
ATOM   5885 O OD1   . ASP B 1 368 ? -5.989  -2.303  33.645 1.00 102.12 ? 398 ASP B OD1   1 
ATOM   5886 O OD2   . ASP B 1 368 ? -4.624  -2.792  31.990 1.00 87.96  ? 398 ASP B OD2   1 
ATOM   5887 N N     . VAL B 1 369 ? -3.873  -4.851  37.614 1.00 88.72  ? 399 VAL B N     1 
ATOM   5888 C CA    . VAL B 1 369 ? -3.482  -6.024  38.392 1.00 98.66  ? 399 VAL B CA    1 
ATOM   5889 C C     . VAL B 1 369 ? -4.555  -7.098  38.206 1.00 100.44 ? 399 VAL B C     1 
ATOM   5890 O O     . VAL B 1 369 ? -5.740  -6.785  38.039 1.00 83.64  ? 399 VAL B O     1 
ATOM   5891 C CB    . VAL B 1 369 ? -3.262  -5.724  39.899 1.00 62.15  ? 399 VAL B CB    1 
ATOM   5892 C CG1   . VAL B 1 369 ? -2.781  -6.974  40.615 1.00 55.45  ? 399 VAL B CG1   1 
ATOM   5893 C CG2   . VAL B 1 369 ? -2.256  -4.602  40.096 1.00 54.05  ? 399 VAL B CG2   1 
ATOM   5894 N N     . GLU B 1 370 ? -4.137  -8.360  38.226 1.00 109.11 ? 400 GLU B N     1 
ATOM   5895 C CA    . GLU B 1 370 ? -5.015  -9.452  37.836 1.00 111.67 ? 400 GLU B CA    1 
ATOM   5896 C C     . GLU B 1 370 ? -5.008  -10.562 38.880 1.00 111.26 ? 400 GLU B C     1 
ATOM   5897 O O     . GLU B 1 370 ? -4.103  -10.637 39.714 1.00 103.15 ? 400 GLU B O     1 
ATOM   5898 C CB    . GLU B 1 370 ? -4.569  -10.000 36.479 1.00 121.30 ? 400 GLU B CB    1 
ATOM   5899 C CG    . GLU B 1 370 ? -5.694  -10.286 35.496 1.00 128.89 ? 400 GLU B CG    1 
ATOM   5900 C CD    . GLU B 1 370 ? -5.245  -10.135 34.050 1.00 133.58 ? 400 GLU B CD    1 
ATOM   5901 O OE1   . GLU B 1 370 ? -4.200  -9.488  33.817 1.00 129.41 ? 400 GLU B OE1   1 
ATOM   5902 O OE2   . GLU B 1 370 ? -5.934  -10.657 33.147 1.00 137.08 ? 400 GLU B OE2   1 
ATOM   5903 N N     . GLN B 1 371 ? -6.026  -11.416 38.825 1.00 119.08 ? 401 GLN B N     1 
ATOM   5904 C CA    . GLN B 1 371 ? -6.157  -12.544 39.746 1.00 119.00 ? 401 GLN B CA    1 
ATOM   5905 C C     . GLN B 1 371 ? -6.429  -12.083 41.179 1.00 105.87 ? 401 GLN B C     1 
ATOM   5906 O O     . GLN B 1 371 ? -5.779  -12.538 42.121 1.00 107.50 ? 401 GLN B O     1 
ATOM   5907 C CB    . GLN B 1 371 ? -4.912  -13.438 39.695 1.00 124.00 ? 401 GLN B CB    1 
ATOM   5908 C CG    . GLN B 1 371 ? -4.502  -13.865 38.287 1.00 126.30 ? 401 GLN B CG    1 
ATOM   5909 C CD    . GLN B 1 371 ? -5.500  -14.809 37.637 1.00 121.51 ? 401 GLN B CD    1 
ATOM   5910 O OE1   . GLN B 1 371 ? -6.261  -15.499 38.319 1.00 122.03 ? 401 GLN B OE1   1 
ATOM   5911 N NE2   . GLN B 1 371 ? -5.496  -14.849 36.308 1.00 110.85 ? 401 GLN B NE2   1 
ATOM   5912 N N     . VAL B 1 372 ? -7.394  -11.182 41.336 1.00 90.54  ? 402 VAL B N     1 
ATOM   5913 C CA    . VAL B 1 372 ? -7.763  -10.682 42.656 1.00 76.07  ? 402 VAL B CA    1 
ATOM   5914 C C     . VAL B 1 372 ? -9.195  -11.064 43.009 1.00 74.59  ? 402 VAL B C     1 
ATOM   5915 O O     . VAL B 1 372 ? -10.143 -10.578 42.392 1.00 79.55  ? 402 VAL B O     1 
ATOM   5916 C CB    . VAL B 1 372 ? -7.635  -9.152  42.738 1.00 64.21  ? 402 VAL B CB    1 
ATOM   5917 C CG1   . VAL B 1 372 ? -8.132  -8.654  44.085 1.00 54.99  ? 402 VAL B CG1   1 
ATOM   5918 C CG2   . VAL B 1 372 ? -6.198  -8.723  42.499 1.00 67.82  ? 402 VAL B CG2   1 
ATOM   5919 N N     . SER B 1 373 ? -9.348  -11.930 44.006 1.00 66.38  ? 403 SER B N     1 
ATOM   5920 C CA    . SER B 1 373 ? -10.668 -12.387 44.419 1.00 72.32  ? 403 SER B CA    1 
ATOM   5921 C C     . SER B 1 373 ? -11.253 -11.491 45.509 1.00 74.38  ? 403 SER B C     1 
ATOM   5922 O O     . SER B 1 373 ? -12.461 -11.255 45.547 1.00 77.51  ? 403 SER B O     1 
ATOM   5923 C CB    . SER B 1 373 ? -10.608 -13.842 44.900 1.00 80.45  ? 403 SER B CB    1 
ATOM   5924 O OG    . SER B 1 373 ? -10.040 -13.941 46.197 1.00 77.75  ? 403 SER B OG    1 
ATOM   5925 N N     . VAL B 1 374 ? -10.384 -10.994 46.385 1.00 63.72  ? 404 VAL B N     1 
ATOM   5926 C CA    . VAL B 1 374 ? -10.802 -10.213 47.541 1.00 59.18  ? 404 VAL B CA    1 
ATOM   5927 C C     . VAL B 1 374 ? -10.201 -8.812  47.512 1.00 55.79  ? 404 VAL B C     1 
ATOM   5928 O O     . VAL B 1 374 ? -9.016  -8.649  47.249 1.00 58.50  ? 404 VAL B O     1 
ATOM   5929 C CB    . VAL B 1 374 ? -10.374 -10.909 48.850 1.00 66.64  ? 404 VAL B CB    1 
ATOM   5930 C CG1   . VAL B 1 374 ? -10.532 -9.977  50.042 1.00 59.52  ? 404 VAL B CG1   1 
ATOM   5931 C CG2   . VAL B 1 374 ? -11.167 -12.192 49.052 1.00 77.98  ? 404 VAL B CG2   1 
ATOM   5932 N N     . VAL B 1 375 ? -11.022 -7.802  47.780 1.00 53.17  ? 405 VAL B N     1 
ATOM   5933 C CA    . VAL B 1 375 ? -10.538 -6.427  47.883 1.00 44.51  ? 405 VAL B CA    1 
ATOM   5934 C C     . VAL B 1 375 ? -10.917 -5.804  49.218 1.00 41.29  ? 405 VAL B C     1 
ATOM   5935 O O     . VAL B 1 375 ? -12.066 -5.882  49.639 1.00 55.44  ? 405 VAL B O     1 
ATOM   5936 C CB    . VAL B 1 375 ? -11.096 -5.536  46.762 1.00 40.59  ? 405 VAL B CB    1 
ATOM   5937 C CG1   . VAL B 1 375 ? -11.068 -4.072  47.186 1.00 36.72  ? 405 VAL B CG1   1 
ATOM   5938 C CG2   . VAL B 1 375 ? -10.312 -5.747  45.476 1.00 36.91  ? 405 VAL B CG2   1 
ATOM   5939 N N     . ILE B 1 376 ? -9.947  -5.180  49.876 1.00 37.81  ? 406 ILE B N     1 
ATOM   5940 C CA    . ILE B 1 376 ? -10.195 -4.492  51.137 1.00 34.87  ? 406 ILE B CA    1 
ATOM   5941 C C     . ILE B 1 376 ? -9.865  -3.013  51.019 1.00 32.80  ? 406 ILE B C     1 
ATOM   5942 O O     . ILE B 1 376 ? -8.701  -2.630  51.055 1.00 37.00  ? 406 ILE B O     1 
ATOM   5943 C CB    . ILE B 1 376 ? -9.336  -5.068  52.281 1.00 45.22  ? 406 ILE B CB    1 
ATOM   5944 C CG1   . ILE B 1 376 ? -9.305  -6.600  52.230 1.00 52.60  ? 406 ILE B CG1   1 
ATOM   5945 C CG2   . ILE B 1 376 ? -9.818  -4.538  53.635 1.00 38.91  ? 406 ILE B CG2   1 
ATOM   5946 C CD1   . ILE B 1 376 ? -10.664 -7.246  52.251 1.00 58.61  ? 406 ILE B CD1   1 
ATOM   5947 N N     . ASN B 1 377 ? -10.883 -2.176  50.881 1.00 31.99  ? 407 ASN B N     1 
ATOM   5948 C CA    . ASN B 1 377 ? -10.655 -0.738  50.896 1.00 40.85  ? 407 ASN B CA    1 
ATOM   5949 C C     . ASN B 1 377 ? -10.462 -0.241  52.320 1.00 48.06  ? 407 ASN B C     1 
ATOM   5950 O O     . ASN B 1 377 ? -11.393 0.268   52.938 1.00 53.78  ? 407 ASN B O     1 
ATOM   5951 C CB    . ASN B 1 377 ? -11.808 0.006   50.230 1.00 42.80  ? 407 ASN B CB    1 
ATOM   5952 C CG    . ASN B 1 377 ? -11.791 -0.125  48.720 1.00 46.08  ? 407 ASN B CG    1 
ATOM   5953 O OD1   . ASN B 1 377 ? -10.739 -0.040  48.089 1.00 48.42  ? 407 ASN B OD1   1 
ATOM   5954 N ND2   . ASN B 1 377 ? -12.960 -0.332  48.134 1.00 46.98  ? 407 ASN B ND2   1 
ATOM   5955 N N     . PHE B 1 378 ? -9.254  -0.411  52.842 1.00 46.42  ? 408 PHE B N     1 
ATOM   5956 C CA    . PHE B 1 378 ? -8.923  0.063   54.181 1.00 57.30  ? 408 PHE B CA    1 
ATOM   5957 C C     . PHE B 1 378 ? -9.357  1.517   54.310 1.00 60.64  ? 408 PHE B C     1 
ATOM   5958 O O     . PHE B 1 378 ? -9.810  1.953   55.366 1.00 63.58  ? 408 PHE B O     1 
ATOM   5959 C CB    . PHE B 1 378 ? -7.417  -0.057  54.432 1.00 54.84  ? 408 PHE B CB    1 
ATOM   5960 C CG    . PHE B 1 378 ? -7.057  -0.246  55.874 1.00 52.57  ? 408 PHE B CG    1 
ATOM   5961 C CD1   . PHE B 1 378 ? -6.724  0.837   56.666 1.00 56.07  ? 408 PHE B CD1   1 
ATOM   5962 C CD2   . PHE B 1 378 ? -7.055  -1.511  56.438 1.00 56.12  ? 408 PHE B CD2   1 
ATOM   5963 C CE1   . PHE B 1 378 ? -6.395  0.666   57.995 1.00 54.45  ? 408 PHE B CE1   1 
ATOM   5964 C CE2   . PHE B 1 378 ? -6.730  -1.692  57.762 1.00 65.48  ? 408 PHE B CE2   1 
ATOM   5965 C CZ    . PHE B 1 378 ? -6.398  -0.602  58.545 1.00 65.03  ? 408 PHE B CZ    1 
ATOM   5966 N N     . ASP B 1 379 ? -9.212  2.255   53.214 1.00 55.34  ? 409 ASP B N     1 
ATOM   5967 C CA    . ASP B 1 379 ? -9.663  3.636   53.127 1.00 61.19  ? 409 ASP B CA    1 
ATOM   5968 C C     . ASP B 1 379 ? -10.462 3.816   51.835 1.00 65.14  ? 409 ASP B C     1 
ATOM   5969 O O     . ASP B 1 379 ? -10.077 3.309   50.784 1.00 64.14  ? 409 ASP B O     1 
ATOM   5970 C CB    . ASP B 1 379 ? -8.469  4.590   53.161 1.00 71.01  ? 409 ASP B CB    1 
ATOM   5971 C CG    . ASP B 1 379 ? -7.712  4.532   54.480 1.00 90.49  ? 409 ASP B CG    1 
ATOM   5972 O OD1   . ASP B 1 379 ? -8.338  4.198   55.507 1.00 93.73  ? 409 ASP B OD1   1 
ATOM   5973 O OD2   . ASP B 1 379 ? -6.495  4.822   54.493 1.00 101.12 ? 409 ASP B OD2   1 
ATOM   5974 N N     . LEU B 1 380 ? -11.585 4.523   51.915 1.00 68.15  ? 410 LEU B N     1 
ATOM   5975 C CA    . LEU B 1 380 ? -12.453 4.689   50.752 1.00 71.34  ? 410 LEU B CA    1 
ATOM   5976 C C     . LEU B 1 380 ? -11.820 5.565   49.675 1.00 64.32  ? 410 LEU B C     1 
ATOM   5977 O O     . LEU B 1 380 ? -11.246 6.609   49.973 1.00 73.59  ? 410 LEU B O     1 
ATOM   5978 C CB    . LEU B 1 380 ? -13.822 5.246   51.158 1.00 79.76  ? 410 LEU B CB    1 
ATOM   5979 C CG    . LEU B 1 380 ? -14.827 4.262   51.764 1.00 76.15  ? 410 LEU B CG    1 
ATOM   5980 C CD1   . LEU B 1 380 ? -14.878 2.989   50.941 1.00 70.54  ? 410 LEU B CD1   1 
ATOM   5981 C CD2   . LEU B 1 380 ? -14.481 3.948   53.206 1.00 83.63  ? 410 LEU B CD2   1 
ATOM   5982 N N     . PRO B 1 381 ? -11.927 5.133   48.412 1.00 58.27  ? 411 PRO B N     1 
ATOM   5983 C CA    . PRO B 1 381 ? -11.361 5.829   47.251 1.00 62.33  ? 411 PRO B CA    1 
ATOM   5984 C C     . PRO B 1 381 ? -11.979 7.207   47.037 1.00 69.18  ? 411 PRO B C     1 
ATOM   5985 O O     . PRO B 1 381 ? -13.127 7.302   46.614 1.00 72.13  ? 411 PRO B O     1 
ATOM   5986 C CB    . PRO B 1 381 ? -11.734 4.914   46.083 1.00 53.47  ? 411 PRO B CB    1 
ATOM   5987 C CG    . PRO B 1 381 ? -11.982 3.583   46.700 1.00 52.16  ? 411 PRO B CG    1 
ATOM   5988 C CD    . PRO B 1 381 ? -12.566 3.861   48.037 1.00 45.31  ? 411 PRO B CD    1 
ATOM   5989 N N     . VAL B 1 382 ? -11.216 8.259   47.312 1.00 76.30  ? 412 VAL B N     1 
ATOM   5990 C CA    . VAL B 1 382 ? -11.716 9.623   47.167 1.00 87.70  ? 412 VAL B CA    1 
ATOM   5991 C C     . VAL B 1 382 ? -11.066 10.367  45.999 1.00 95.93  ? 412 VAL B C     1 
ATOM   5992 O O     . VAL B 1 382 ? -9.851  10.306  45.810 1.00 101.03 ? 412 VAL B O     1 
ATOM   5993 C CB    . VAL B 1 382 ? -11.527 10.424  48.472 1.00 95.37  ? 412 VAL B CB    1 
ATOM   5994 C CG1   . VAL B 1 382 ? -11.402 11.908  48.183 1.00 102.69 ? 412 VAL B CG1   1 
ATOM   5995 C CG2   . VAL B 1 382 ? -12.677 10.150  49.428 1.00 96.94  ? 412 VAL B CG2   1 
ATOM   5996 N N     . ASP B 1 383 ? -11.889 11.064  45.219 1.00 99.08  ? 413 ASP B N     1 
ATOM   5997 C CA    . ASP B 1 383 ? -11.415 11.835  44.074 1.00 98.39  ? 413 ASP B CA    1 
ATOM   5998 C C     . ASP B 1 383 ? -10.669 13.091  44.515 1.00 99.62  ? 413 ASP B C     1 
ATOM   5999 O O     . ASP B 1 383 ? -10.617 13.409  45.699 1.00 97.98  ? 413 ASP B O     1 
ATOM   6000 C CB    . ASP B 1 383 ? -12.587 12.220  43.167 1.00 99.08  ? 413 ASP B CB    1 
ATOM   6001 N N     . LYS B 1 384 ? -10.095 13.804  43.552 1.00 107.60 ? 414 LYS B N     1 
ATOM   6002 C CA    . LYS B 1 384 ? -9.352  15.027  43.841 1.00 112.44 ? 414 LYS B CA    1 
ATOM   6003 C C     . LYS B 1 384 ? -10.267 16.127  44.375 1.00 115.17 ? 414 LYS B C     1 
ATOM   6004 O O     . LYS B 1 384 ? -9.803  17.094  44.979 1.00 111.99 ? 414 LYS B O     1 
ATOM   6005 C CB    . LYS B 1 384 ? -8.613  15.513  42.591 1.00 113.43 ? 414 LYS B CB    1 
ATOM   6006 N N     . ASP B 1 385 ? -11.567 15.973  44.145 1.00 116.27 ? 415 ASP B N     1 
ATOM   6007 C CA    . ASP B 1 385 ? -12.549 16.934  44.632 1.00 117.63 ? 415 ASP B CA    1 
ATOM   6008 C C     . ASP B 1 385 ? -12.935 16.619  46.074 1.00 119.86 ? 415 ASP B C     1 
ATOM   6009 O O     . ASP B 1 385 ? -13.713 17.343  46.693 1.00 121.13 ? 415 ASP B O     1 
ATOM   6010 C CB    . ASP B 1 385 ? -13.793 16.925  43.740 1.00 111.42 ? 415 ASP B CB    1 
ATOM   6011 N N     . GLY B 1 386 ? -12.378 15.536  46.606 1.00 114.28 ? 416 GLY B N     1 
ATOM   6012 C CA    . GLY B 1 386 ? -12.712 15.082  47.942 1.00 108.14 ? 416 GLY B CA    1 
ATOM   6013 C C     . GLY B 1 386 ? -13.926 14.175  47.914 1.00 108.14 ? 416 GLY B C     1 
ATOM   6014 O O     . GLY B 1 386 ? -14.326 13.621  48.937 1.00 102.71 ? 416 GLY B O     1 
ATOM   6015 N N     . ASN B 1 387 ? -14.504 14.021  46.726 1.00 116.18 ? 417 ASN B N     1 
ATOM   6016 C CA    . ASN B 1 387 ? -15.719 13.234  46.544 1.00 122.98 ? 417 ASN B CA    1 
ATOM   6017 C C     . ASN B 1 387 ? -15.431 11.810  46.074 1.00 114.16 ? 417 ASN B C     1 
ATOM   6018 O O     . ASN B 1 387 ? -14.355 11.535  45.550 1.00 109.10 ? 417 ASN B O     1 
ATOM   6019 C CB    . ASN B 1 387 ? -16.662 13.933  45.560 1.00 136.51 ? 417 ASN B CB    1 
ATOM   6020 C CG    . ASN B 1 387 ? -17.194 15.251  46.095 1.00 147.55 ? 417 ASN B CG    1 
ATOM   6021 O OD1   . ASN B 1 387 ? -18.389 15.534  46.002 1.00 149.23 ? 417 ASN B OD1   1 
ATOM   6022 N ND2   . ASN B 1 387 ? -16.308 16.062  46.662 1.00 151.83 ? 417 ASN B ND2   1 
ATOM   6023 N N     . PRO B 1 388 ? -16.401 10.899  46.262 1.00 108.30 ? 418 PRO B N     1 
ATOM   6024 C CA    . PRO B 1 388 ? -16.256 9.486   45.897 1.00 102.85 ? 418 PRO B CA    1 
ATOM   6025 C C     . PRO B 1 388 ? -15.654 9.295   44.513 1.00 100.15 ? 418 PRO B C     1 
ATOM   6026 O O     . PRO B 1 388 ? -16.115 9.913   43.554 1.00 100.58 ? 418 PRO B O     1 
ATOM   6027 C CB    . PRO B 1 388 ? -17.698 8.981   45.904 1.00 100.81 ? 418 PRO B CB    1 
ATOM   6028 C CG    . PRO B 1 388 ? -18.369 9.821   46.922 1.00 104.85 ? 418 PRO B CG    1 
ATOM   6029 C CD    . PRO B 1 388 ? -17.721 11.179  46.854 1.00 106.37 ? 418 PRO B CD    1 
ATOM   6030 N N     . ASP B 1 389 ? -14.635 8.446   44.423 1.00 97.14  ? 419 ASP B N     1 
ATOM   6031 C CA    . ASP B 1 389 ? -14.004 8.121   43.148 1.00 94.78  ? 419 ASP B CA    1 
ATOM   6032 C C     . ASP B 1 389 ? -14.538 6.794   42.613 1.00 84.65  ? 419 ASP B C     1 
ATOM   6033 O O     . ASP B 1 389 ? -13.891 5.752   42.735 1.00 78.36  ? 419 ASP B O     1 
ATOM   6034 C CB    . ASP B 1 389 ? -12.485 8.060   43.302 1.00 94.06  ? 419 ASP B CB    1 
ATOM   6035 C CG    . ASP B 1 389 ? -11.774 7.889   41.978 1.00 98.22  ? 419 ASP B CG    1 
ATOM   6036 O OD1   . ASP B 1 389 ? -12.357 7.274   41.059 1.00 92.79  ? 419 ASP B OD1   1 
ATOM   6037 O OD2   . ASP B 1 389 ? -10.630 8.369   41.853 1.00 108.99 ? 419 ASP B OD2   1 
ATOM   6038 N N     . ASN B 1 390 ? -15.721 6.848   42.012 1.00 81.34  ? 420 ASN B N     1 
ATOM   6039 C CA    . ASN B 1 390 ? -16.423 5.648   41.575 1.00 76.59  ? 420 ASN B CA    1 
ATOM   6040 C C     . ASN B 1 390 ? -15.692 4.871   40.481 1.00 71.44  ? 420 ASN B C     1 
ATOM   6041 O O     . ASN B 1 390 ? -15.711 3.641   40.466 1.00 58.33  ? 420 ASN B O     1 
ATOM   6042 C CB    . ASN B 1 390 ? -17.845 6.008   41.137 1.00 80.99  ? 420 ASN B CB    1 
ATOM   6043 C CG    . ASN B 1 390 ? -18.649 6.657   42.253 1.00 92.84  ? 420 ASN B CG    1 
ATOM   6044 O OD1   . ASN B 1 390 ? -19.036 5.999   43.220 1.00 93.27  ? 420 ASN B OD1   1 
ATOM   6045 N ND2   . ASN B 1 390 ? -18.905 7.955   42.123 1.00 97.13  ? 420 ASN B ND2   1 
ATOM   6046 N N     . GLU B 1 391 ? -15.052 5.588   39.566 1.00 78.27  ? 421 GLU B N     1 
ATOM   6047 C CA    . GLU B 1 391 ? -14.290 4.937   38.511 1.00 95.04  ? 421 GLU B CA    1 
ATOM   6048 C C     . GLU B 1 391 ? -13.293 3.968   39.137 1.00 87.71  ? 421 GLU B C     1 
ATOM   6049 O O     . GLU B 1 391 ? -13.282 2.777   38.825 1.00 84.53  ? 421 GLU B O     1 
ATOM   6050 C CB    . GLU B 1 391 ? -13.558 5.974   37.658 1.00 112.14 ? 421 GLU B CB    1 
ATOM   6051 C CG    . GLU B 1 391 ? -14.477 6.963   36.963 1.00 129.59 ? 421 GLU B CG    1 
ATOM   6052 C CD    . GLU B 1 391 ? -15.147 6.374   35.738 1.00 144.27 ? 421 GLU B CD    1 
ATOM   6053 O OE1   . GLU B 1 391 ? -14.432 5.826   34.872 1.00 143.03 ? 421 GLU B OE1   1 
ATOM   6054 O OE2   . GLU B 1 391 ? -16.390 6.467   35.637 1.00 154.22 ? 421 GLU B OE2   1 
ATOM   6055 N N     . THR B 1 392 ? -12.465 4.492   40.034 1.00 79.86  ? 422 THR B N     1 
ATOM   6056 C CA    . THR B 1 392 ? -11.461 3.693   40.724 1.00 75.20  ? 422 THR B CA    1 
ATOM   6057 C C     . THR B 1 392 ? -12.098 2.543   41.498 1.00 62.72  ? 422 THR B C     1 
ATOM   6058 O O     . THR B 1 392 ? -11.639 1.400   41.426 1.00 60.21  ? 422 THR B O     1 
ATOM   6059 C CB    . THR B 1 392 ? -10.614 4.564   41.678 1.00 76.22  ? 422 THR B CB    1 
ATOM   6060 O OG1   . THR B 1 392 ? -9.693  5.354   40.913 1.00 83.64  ? 422 THR B OG1   1 
ATOM   6061 C CG2   . THR B 1 392 ? -9.834  3.694   42.654 1.00 73.23  ? 422 THR B CG2   1 
ATOM   6062 N N     . TYR B 1 393 ? -13.159 2.847   42.236 1.00 49.51  ? 423 TYR B N     1 
ATOM   6063 C CA    . TYR B 1 393 ? -13.877 1.820   42.971 1.00 53.34  ? 423 TYR B CA    1 
ATOM   6064 C C     . TYR B 1 393 ? -14.217 0.669   42.039 1.00 55.82  ? 423 TYR B C     1 
ATOM   6065 O O     . TYR B 1 393 ? -13.824 -0.470  42.276 1.00 53.84  ? 423 TYR B O     1 
ATOM   6066 C CB    . TYR B 1 393 ? -15.151 2.393   43.589 1.00 53.17  ? 423 TYR B CB    1 
ATOM   6067 C CG    . TYR B 1 393 ? -15.811 1.461   44.571 1.00 44.03  ? 423 TYR B CG    1 
ATOM   6068 C CD1   . TYR B 1 393 ? -15.499 1.510   45.921 1.00 45.58  ? 423 TYR B CD1   1 
ATOM   6069 C CD2   . TYR B 1 393 ? -16.735 0.523   44.147 1.00 45.05  ? 423 TYR B CD2   1 
ATOM   6070 C CE1   . TYR B 1 393 ? -16.102 0.654   46.825 1.00 44.27  ? 423 TYR B CE1   1 
ATOM   6071 C CE2   . TYR B 1 393 ? -17.343 -0.338  45.042 1.00 50.41  ? 423 TYR B CE2   1 
ATOM   6072 C CZ    . TYR B 1 393 ? -17.025 -0.267  46.378 1.00 50.69  ? 423 TYR B CZ    1 
ATOM   6073 O OH    . TYR B 1 393 ? -17.634 -1.121  47.265 1.00 54.04  ? 423 TYR B OH    1 
ATOM   6074 N N     . LEU B 1 394 ? -14.943 0.982   40.971 1.00 65.78  ? 424 LEU B N     1 
ATOM   6075 C CA    . LEU B 1 394 ? -15.293 -0.005  39.956 1.00 60.22  ? 424 LEU B CA    1 
ATOM   6076 C C     . LEU B 1 394 ? -14.066 -0.737  39.427 1.00 62.01  ? 424 LEU B C     1 
ATOM   6077 O O     . LEU B 1 394 ? -14.069 -1.960  39.319 1.00 67.82  ? 424 LEU B O     1 
ATOM   6078 C CB    . LEU B 1 394 ? -16.033 0.658   38.798 1.00 62.19  ? 424 LEU B CB    1 
ATOM   6079 C CG    . LEU B 1 394 ? -16.465 -0.290  37.678 1.00 66.79  ? 424 LEU B CG    1 
ATOM   6080 C CD1   . LEU B 1 394 ? -17.112 -1.548  38.242 1.00 63.29  ? 424 LEU B CD1   1 
ATOM   6081 C CD2   . LEU B 1 394 ? -17.400 0.421   36.714 1.00 70.51  ? 424 LEU B CD2   1 
ATOM   6082 N N     . HIS B 1 395 ? -13.021 0.018   39.097 1.00 59.52  ? 425 HIS B N     1 
ATOM   6083 C CA    . HIS B 1 395 ? -11.776 -0.562  38.597 1.00 67.12  ? 425 HIS B CA    1 
ATOM   6084 C C     . HIS B 1 395 ? -11.255 -1.674  39.512 1.00 69.92  ? 425 HIS B C     1 
ATOM   6085 O O     . HIS B 1 395 ? -11.019 -2.799  39.060 1.00 70.89  ? 425 HIS B O     1 
ATOM   6086 C CB    . HIS B 1 395 ? -10.713 0.529   38.412 1.00 83.29  ? 425 HIS B CB    1 
ATOM   6087 C CG    . HIS B 1 395 ? -9.460  0.054   37.737 1.00 102.59 ? 425 HIS B CG    1 
ATOM   6088 N ND1   . HIS B 1 395 ? -8.292  -0.195  38.424 1.00 104.25 ? 425 HIS B ND1   1 
ATOM   6089 C CD2   . HIS B 1 395 ? -9.194  -0.206  36.434 1.00 110.52 ? 425 HIS B CD2   1 
ATOM   6090 C CE1   . HIS B 1 395 ? -7.360  -0.594  37.575 1.00 104.25 ? 425 HIS B CE1   1 
ATOM   6091 N NE2   . HIS B 1 395 ? -7.881  -0.610  36.363 1.00 109.15 ? 425 HIS B NE2   1 
ATOM   6092 N N     . ARG B 1 396 ? -11.088 -1.360  40.796 1.00 57.29  ? 426 ARG B N     1 
ATOM   6093 C CA    . ARG B 1 396 ? -10.544 -2.316  41.757 1.00 52.10  ? 426 ARG B CA    1 
ATOM   6094 C C     . ARG B 1 396 ? -11.417 -3.554  41.906 1.00 61.09  ? 426 ARG B C     1 
ATOM   6095 O O     . ARG B 1 396 ? -10.934 -4.684  41.803 1.00 58.26  ? 426 ARG B O     1 
ATOM   6096 C CB    . ARG B 1 396 ? -10.380 -1.667  43.130 1.00 51.13  ? 426 ARG B CB    1 
ATOM   6097 C CG    . ARG B 1 396 ? -9.425  -0.501  43.168 1.00 52.17  ? 426 ARG B CG    1 
ATOM   6098 C CD    . ARG B 1 396 ? -9.455  0.151   44.533 1.00 50.95  ? 426 ARG B CD    1 
ATOM   6099 N NE    . ARG B 1 396 ? -8.582  1.315   44.589 1.00 54.01  ? 426 ARG B NE    1 
ATOM   6100 C CZ    . ARG B 1 396 ? -8.459  2.106   45.648 1.00 50.88  ? 426 ARG B CZ    1 
ATOM   6101 N NH1   . ARG B 1 396 ? -9.157  1.867   46.751 1.00 54.36  ? 426 ARG B NH1   1 
ATOM   6102 N NH2   . ARG B 1 396 ? -7.638  3.143   45.602 1.00 49.03  ? 426 ARG B NH2   1 
ATOM   6103 N N     . ILE B 1 397 ? -12.703 -3.329  42.166 1.00 59.09  ? 427 ILE B N     1 
ATOM   6104 C CA    . ILE B 1 397 ? -13.620 -4.415  42.483 1.00 69.49  ? 427 ILE B CA    1 
ATOM   6105 C C     . ILE B 1 397 ? -14.066 -5.133  41.221 1.00 71.90  ? 427 ILE B C     1 
ATOM   6106 O O     . ILE B 1 397 ? -14.198 -6.356  41.216 1.00 64.67  ? 427 ILE B O     1 
ATOM   6107 C CB    . ILE B 1 397 ? -14.878 -3.907  43.225 1.00 85.56  ? 427 ILE B CB    1 
ATOM   6108 C CG1   . ILE B 1 397 ? -14.567 -2.644  44.034 1.00 97.09  ? 427 ILE B CG1   1 
ATOM   6109 C CG2   . ILE B 1 397 ? -15.458 -5.006  44.107 1.00 76.62  ? 427 ILE B CG2   1 
ATOM   6110 C CD1   . ILE B 1 397 ? -13.532 -2.837  45.117 1.00 98.56  ? 427 ILE B CD1   1 
ATOM   6111 N N     . GLY B 1 398 ? -14.296 -4.360  40.161 1.00 71.57  ? 428 GLY B N     1 
ATOM   6112 C CA    . GLY B 1 398 ? -14.776 -4.882  38.893 1.00 69.02  ? 428 GLY B CA    1 
ATOM   6113 C C     . GLY B 1 398 ? -14.113 -6.174  38.462 1.00 78.95  ? 428 GLY B C     1 
ATOM   6114 O O     . GLY B 1 398 ? -14.800 -7.147  38.135 1.00 69.88  ? 428 GLY B O     1 
ATOM   6115 N N     . ARG B 1 399 ? -12.780 -6.181  38.467 1.00 95.25  ? 429 ARG B N     1 
ATOM   6116 C CA    . ARG B 1 399 ? -11.996 -7.359  38.094 1.00 110.75 ? 429 ARG B CA    1 
ATOM   6117 C C     . ARG B 1 399 ? -12.613 -8.109  36.912 1.00 128.12 ? 429 ARG B C     1 
ATOM   6118 O O     . ARG B 1 399 ? -12.344 -9.292  36.701 1.00 135.31 ? 429 ARG B O     1 
ATOM   6119 C CB    . ARG B 1 399 ? -11.825 -8.295  39.296 1.00 104.14 ? 429 ARG B CB    1 
ATOM   6120 C CG    . ARG B 1 399 ? -13.132 -8.643  39.984 1.00 101.42 ? 429 ARG B CG    1 
ATOM   6121 C CD    . ARG B 1 399 ? -12.940 -8.983  41.453 1.00 101.91 ? 429 ARG B CD    1 
ATOM   6122 N NE    . ARG B 1 399 ? -12.783 -10.414 41.704 1.00 97.75  ? 429 ARG B NE    1 
ATOM   6123 C CZ    . ARG B 1 399 ? -13.333 -11.384 40.979 1.00 88.70  ? 429 ARG B CZ    1 
ATOM   6124 N NH1   . ARG B 1 399 ? -14.108 -11.106 39.939 1.00 87.68  ? 429 ARG B NH1   1 
ATOM   6125 N NH2   . ARG B 1 399 ? -13.114 -12.649 41.306 1.00 84.68  ? 429 ARG B NH2   1 
ATOM   6126 N N     . GLY B 1 404 ? -18.213 -14.496 34.818 1.00 126.17 ? 434 GLY B N     1 
ATOM   6127 C CA    . GLY B 1 404 ? -17.006 -14.112 35.530 1.00 125.24 ? 434 GLY B CA    1 
ATOM   6128 C C     . GLY B 1 404 ? -16.928 -14.723 36.916 1.00 117.12 ? 434 GLY B C     1 
ATOM   6129 O O     . GLY B 1 404 ? -17.953 -15.010 37.534 1.00 115.11 ? 434 GLY B O     1 
ATOM   6130 N N     . LYS B 1 405 ? -15.707 -14.922 37.406 1.00 108.67 ? 435 LYS B N     1 
ATOM   6131 C CA    . LYS B 1 405 ? -15.498 -15.537 38.715 1.00 107.35 ? 435 LYS B CA    1 
ATOM   6132 C C     . LYS B 1 405 ? -16.061 -14.684 39.853 1.00 99.59  ? 435 LYS B C     1 
ATOM   6133 O O     . LYS B 1 405 ? -16.336 -13.497 39.672 1.00 95.00  ? 435 LYS B O     1 
ATOM   6134 C CB    . LYS B 1 405 ? -14.013 -15.851 38.939 1.00 108.95 ? 435 LYS B CB    1 
ATOM   6135 C CG    . LYS B 1 405 ? -13.046 -14.781 38.438 1.00 110.15 ? 435 LYS B CG    1 
ATOM   6136 C CD    . LYS B 1 405 ? -11.643 -15.358 38.260 1.00 111.26 ? 435 LYS B CD    1 
ATOM   6137 C CE    . LYS B 1 405 ? -10.651 -14.323 37.738 1.00 105.07 ? 435 LYS B CE    1 
ATOM   6138 N NZ    . LYS B 1 405 ? -10.156 -13.407 38.805 1.00 101.87 ? 435 LYS B NZ    1 
ATOM   6139 N N     . ARG B 1 406 ? -16.235 -15.298 41.021 1.00 100.51 ? 436 ARG B N     1 
ATOM   6140 C CA    . ARG B 1 406 ? -16.859 -14.629 42.162 1.00 107.61 ? 436 ARG B CA    1 
ATOM   6141 C C     . ARG B 1 406 ? -15.901 -13.680 42.881 1.00 116.69 ? 436 ARG B C     1 
ATOM   6142 O O     . ARG B 1 406 ? -14.749 -14.030 43.141 1.00 121.84 ? 436 ARG B O     1 
ATOM   6143 C CB    . ARG B 1 406 ? -17.414 -15.660 43.148 1.00 105.82 ? 436 ARG B CB    1 
ATOM   6144 C CG    . ARG B 1 406 ? -18.043 -15.057 44.394 1.00 111.97 ? 436 ARG B CG    1 
ATOM   6145 C CD    . ARG B 1 406 ? -18.554 -16.141 45.325 1.00 117.46 ? 436 ARG B CD    1 
ATOM   6146 N NE    . ARG B 1 406 ? -19.573 -16.962 44.680 1.00 126.14 ? 436 ARG B NE    1 
ATOM   6147 C CZ    . ARG B 1 406 ? -20.881 -16.778 44.823 1.00 136.52 ? 436 ARG B CZ    1 
ATOM   6148 N NH1   . ARG B 1 406 ? -21.332 -15.802 45.598 1.00 140.75 ? 436 ARG B NH1   1 
ATOM   6149 N NH2   . ARG B 1 406 ? -21.738 -17.573 44.196 1.00 139.06 ? 436 ARG B NH2   1 
ATOM   6150 N N     . GLY B 1 407 ? -16.388 -12.484 43.205 1.00 113.07 ? 437 GLY B N     1 
ATOM   6151 C CA    . GLY B 1 407 ? -15.575 -11.475 43.861 1.00 102.20 ? 437 GLY B CA    1 
ATOM   6152 C C     . GLY B 1 407 ? -16.171 -10.983 45.166 1.00 96.86  ? 437 GLY B C     1 
ATOM   6153 O O     . GLY B 1 407 ? -17.338 -11.234 45.463 1.00 101.54 ? 437 GLY B O     1 
ATOM   6154 N N     . LEU B 1 408 ? -15.363 -10.270 45.944 1.00 91.04  ? 438 LEU B N     1 
ATOM   6155 C CA    . LEU B 1 408 ? -15.775 -9.794  47.262 1.00 74.14  ? 438 LEU B CA    1 
ATOM   6156 C C     . LEU B 1 408 ? -15.052 -8.508  47.647 1.00 64.08  ? 438 LEU B C     1 
ATOM   6157 O O     . LEU B 1 408 ? -13.827 -8.416  47.522 1.00 49.11  ? 438 LEU B O     1 
ATOM   6158 C CB    . LEU B 1 408 ? -15.493 -10.862 48.318 1.00 67.84  ? 438 LEU B CB    1 
ATOM   6159 C CG    . LEU B 1 408 ? -15.524 -10.366 49.763 1.00 64.48  ? 438 LEU B CG    1 
ATOM   6160 C CD1   . LEU B 1 408 ? -16.952 -10.144 50.206 1.00 54.19  ? 438 LEU B CD1   1 
ATOM   6161 C CD2   . LEU B 1 408 ? -14.822 -11.344 50.688 1.00 74.26  ? 438 LEU B CD2   1 
ATOM   6162 N N     . ALA B 1 409 ? -15.809 -7.521  48.122 1.00 65.38  ? 439 ALA B N     1 
ATOM   6163 C CA    . ALA B 1 409 ? -15.226 -6.266  48.587 1.00 62.99  ? 439 ALA B CA    1 
ATOM   6164 C C     . ALA B 1 409 ? -15.621 -5.950  50.028 1.00 59.11  ? 439 ALA B C     1 
ATOM   6165 O O     . ALA B 1 409 ? -16.726 -6.254  50.465 1.00 66.53  ? 439 ALA B O     1 
ATOM   6166 C CB    . ALA B 1 409 ? -15.610 -5.121  47.666 1.00 31.92  ? 439 ALA B CB    1 
ATOM   6167 N N     . VAL B 1 410 ? -14.702 -5.336  50.762 1.00 53.28  ? 440 VAL B N     1 
ATOM   6168 C CA    . VAL B 1 410 ? -14.952 -4.957  52.143 1.00 47.12  ? 440 VAL B CA    1 
ATOM   6169 C C     . VAL B 1 410 ? -14.406 -3.562  52.405 1.00 47.14  ? 440 VAL B C     1 
ATOM   6170 O O     . VAL B 1 410 ? -13.202 -3.329  52.294 1.00 46.76  ? 440 VAL B O     1 
ATOM   6171 C CB    . VAL B 1 410 ? -14.275 -5.927  53.130 1.00 49.31  ? 440 VAL B CB    1 
ATOM   6172 C CG1   . VAL B 1 410 ? -14.669 -5.580  54.557 1.00 48.31  ? 440 VAL B CG1   1 
ATOM   6173 C CG2   . VAL B 1 410 ? -14.644 -7.369  52.807 1.00 45.50  ? 440 VAL B CG2   1 
ATOM   6174 N N     . ASN B 1 411 ? -15.287 -2.636  52.761 1.00 51.10  ? 441 ASN B N     1 
ATOM   6175 C CA    . ASN B 1 411 ? -14.869 -1.266  53.031 1.00 52.99  ? 441 ASN B CA    1 
ATOM   6176 C C     . ASN B 1 411 ? -14.836 -0.914  54.513 1.00 47.35  ? 441 ASN B C     1 
ATOM   6177 O O     . ASN B 1 411 ? -15.805 -1.139  55.230 1.00 52.09  ? 441 ASN B O     1 
ATOM   6178 C CB    . ASN B 1 411 ? -15.772 -0.288  52.287 1.00 49.60  ? 441 ASN B CB    1 
ATOM   6179 C CG    . ASN B 1 411 ? -15.837 -0.578  50.811 1.00 59.62  ? 441 ASN B CG    1 
ATOM   6180 O OD1   . ASN B 1 411 ? -15.217 0.113   50.006 1.00 62.57  ? 441 ASN B OD1   1 
ATOM   6181 N ND2   . ASN B 1 411 ? -16.574 -1.620  50.444 1.00 63.98  ? 441 ASN B ND2   1 
ATOM   6182 N N     . MET B 1 412 ? -13.719 -0.359  54.970 1.00 43.97  ? 442 MET B N     1 
ATOM   6183 C CA    . MET B 1 412 ? -13.630 0.122   56.343 1.00 53.23  ? 442 MET B CA    1 
ATOM   6184 C C     . MET B 1 412 ? -14.150 1.554   56.447 1.00 65.21  ? 442 MET B C     1 
ATOM   6185 O O     . MET B 1 412 ? -13.643 2.461   55.781 1.00 54.70  ? 442 MET B O     1 
ATOM   6186 C CB    . MET B 1 412 ? -12.198 0.042   56.875 1.00 45.07  ? 442 MET B CB    1 
ATOM   6187 C CG    . MET B 1 412 ? -11.550 -1.326  56.755 1.00 48.88  ? 442 MET B CG    1 
ATOM   6188 S SD    . MET B 1 412 ? -12.676 -2.680  57.102 1.00 86.83  ? 442 MET B SD    1 
ATOM   6189 C CE    . MET B 1 412 ? -11.554 -4.069  57.065 1.00 44.85  ? 442 MET B CE    1 
ATOM   6190 N N     . VAL B 1 413 ? -15.167 1.744   57.284 1.00 68.66  ? 443 VAL B N     1 
ATOM   6191 C CA    . VAL B 1 413 ? -15.734 3.064   57.529 1.00 73.65  ? 443 VAL B CA    1 
ATOM   6192 C C     . VAL B 1 413 ? -15.343 3.534   58.925 1.00 75.16  ? 443 VAL B C     1 
ATOM   6193 O O     . VAL B 1 413 ? -15.499 2.801   59.901 1.00 83.05  ? 443 VAL B O     1 
ATOM   6194 C CB    . VAL B 1 413 ? -17.267 3.051   57.390 1.00 82.23  ? 443 VAL B CB    1 
ATOM   6195 C CG1   . VAL B 1 413 ? -17.823 4.467   57.460 1.00 90.48  ? 443 VAL B CG1   1 
ATOM   6196 C CG2   . VAL B 1 413 ? -17.674 2.377   56.089 1.00 71.27  ? 443 VAL B CG2   1 
ATOM   6197 N N     . ASP B 1 414 ? -14.838 4.760   59.018 1.00 85.26  ? 444 ASP B N     1 
ATOM   6198 C CA    . ASP B 1 414 ? -14.235 5.249   60.256 1.00 95.78  ? 444 ASP B CA    1 
ATOM   6199 C C     . ASP B 1 414 ? -14.808 6.582   60.730 1.00 93.56  ? 444 ASP B C     1 
ATOM   6200 O O     . ASP B 1 414 ? -14.291 7.180   61.672 1.00 97.62  ? 444 ASP B O     1 
ATOM   6201 C CB    . ASP B 1 414 ? -12.720 5.382   60.077 1.00 104.88 ? 444 ASP B CB    1 
ATOM   6202 C CG    . ASP B 1 414 ? -12.345 6.173   58.830 1.00 114.90 ? 444 ASP B CG    1 
ATOM   6203 O OD1   . ASP B 1 414 ? -11.205 6.020   58.343 1.00 118.27 ? 444 ASP B OD1   1 
ATOM   6204 O OD2   . ASP B 1 414 ? -13.192 6.946   58.332 1.00 116.86 ? 444 ASP B OD2   1 
ATOM   6205 N N     . SER B 1 415 ? -15.872 7.047   60.081 1.00 91.86  ? 445 SER B N     1 
ATOM   6206 C CA    . SER B 1 415 ? -16.462 8.337   60.419 1.00 91.34  ? 445 SER B CA    1 
ATOM   6207 C C     . SER B 1 415 ? -17.832 8.527   59.787 1.00 96.38  ? 445 SER B C     1 
ATOM   6208 O O     . SER B 1 415 ? -18.216 7.798   58.873 1.00 95.30  ? 445 SER B O     1 
ATOM   6209 C CB    . SER B 1 415 ? -15.548 9.471   59.958 1.00 91.89  ? 445 SER B CB    1 
ATOM   6210 O OG    . SER B 1 415 ? -15.583 9.603   58.547 1.00 87.05  ? 445 SER B OG    1 
ATOM   6211 N N     . LYS B 1 416 ? -18.563 9.523   60.275 1.00 101.58 ? 446 LYS B N     1 
ATOM   6212 C CA    . LYS B 1 416 ? -19.830 9.905   59.672 1.00 105.86 ? 446 LYS B CA    1 
ATOM   6213 C C     . LYS B 1 416 ? -19.587 10.501  58.287 1.00 97.65  ? 446 LYS B C     1 
ATOM   6214 O O     . LYS B 1 416 ? -20.491 10.567  57.454 1.00 92.89  ? 446 LYS B O     1 
ATOM   6215 C CB    . LYS B 1 416 ? -20.556 10.921  60.556 1.00 109.92 ? 446 LYS B CB    1 
ATOM   6216 C CG    . LYS B 1 416 ? -20.989 10.385  61.912 1.00 110.84 ? 446 LYS B CG    1 
ATOM   6217 C CD    . LYS B 1 416 ? -21.978 9.241   61.767 1.00 108.31 ? 446 LYS B CD    1 
ATOM   6218 C CE    . LYS B 1 416 ? -22.872 9.130   62.990 1.00 106.24 ? 446 LYS B CE    1 
ATOM   6219 N NZ    . LYS B 1 416 ? -23.774 10.310  63.117 1.00 102.09 ? 446 LYS B NZ    1 
ATOM   6220 N N     . HIS B 1 417 ? -18.354 10.935  58.051 1.00 94.39  ? 447 HIS B N     1 
ATOM   6221 C CA    . HIS B 1 417 ? -17.994 11.561  56.787 1.00 102.95 ? 447 HIS B CA    1 
ATOM   6222 C C     . HIS B 1 417 ? -17.762 10.526  55.690 1.00 100.61 ? 447 HIS B C     1 
ATOM   6223 O O     . HIS B 1 417 ? -18.277 10.663  54.578 1.00 94.01  ? 447 HIS B O     1 
ATOM   6224 C CB    . HIS B 1 417 ? -16.753 12.439  56.960 1.00 111.08 ? 447 HIS B CB    1 
ATOM   6225 C CG    . HIS B 1 417 ? -16.161 12.909  55.669 1.00 119.72 ? 447 HIS B CG    1 
ATOM   6226 N ND1   . HIS B 1 417 ? -16.843 13.722  54.789 1.00 125.32 ? 447 HIS B ND1   1 
ATOM   6227 C CD2   . HIS B 1 417 ? -14.949 12.684  55.110 1.00 121.79 ? 447 HIS B CD2   1 
ATOM   6228 C CE1   . HIS B 1 417 ? -16.078 13.975  53.743 1.00 127.73 ? 447 HIS B CE1   1 
ATOM   6229 N NE2   . HIS B 1 417 ? -14.922 13.357  53.913 1.00 126.45 ? 447 HIS B NE2   1 
ATOM   6230 N N     . SER B 1 418 ? -16.988 9.492   56.005 1.00 96.36  ? 448 SER B N     1 
ATOM   6231 C CA    . SER B 1 418 ? -16.684 8.449   55.031 1.00 86.06  ? 448 SER B CA    1 
ATOM   6232 C C     . SER B 1 418 ? -17.906 7.578   54.750 1.00 74.74  ? 448 SER B C     1 
ATOM   6233 O O     . SER B 1 418 ? -18.057 7.045   53.652 1.00 70.35  ? 448 SER B O     1 
ATOM   6234 C CB    . SER B 1 418 ? -15.498 7.595   55.491 1.00 84.11  ? 448 SER B CB    1 
ATOM   6235 O OG    . SER B 1 418 ? -15.803 6.877   56.671 1.00 86.57  ? 448 SER B OG    1 
ATOM   6236 N N     . MET B 1 419 ? -18.778 7.441   55.746 1.00 74.42  ? 449 MET B N     1 
ATOM   6237 C CA    . MET B 1 419 ? -20.035 6.719   55.573 1.00 68.21  ? 449 MET B CA    1 
ATOM   6238 C C     . MET B 1 419 ? -20.922 7.475   54.592 1.00 72.97  ? 449 MET B C     1 
ATOM   6239 O O     . MET B 1 419 ? -21.735 6.881   53.880 1.00 70.88  ? 449 MET B O     1 
ATOM   6240 C CB    . MET B 1 419 ? -20.747 6.546   56.917 1.00 74.05  ? 449 MET B CB    1 
ATOM   6241 C CG    . MET B 1 419 ? -22.044 5.749   56.854 1.00 77.68  ? 449 MET B CG    1 
ATOM   6242 S SD    . MET B 1 419 ? -21.802 3.978   56.595 1.00 86.87  ? 449 MET B SD    1 
ATOM   6243 C CE    . MET B 1 419 ? -23.498 3.430   56.418 1.00 154.65 ? 449 MET B CE    1 
ATOM   6244 N N     . ASN B 1 420 ? -20.759 8.794   54.561 1.00 78.18  ? 450 ASN B N     1 
ATOM   6245 C CA    . ASN B 1 420 ? -21.442 9.617   53.576 1.00 88.78  ? 450 ASN B CA    1 
ATOM   6246 C C     . ASN B 1 420 ? -20.934 9.254   52.190 1.00 87.33  ? 450 ASN B C     1 
ATOM   6247 O O     . ASN B 1 420 ? -21.707 9.138   51.238 1.00 88.38  ? 450 ASN B O     1 
ATOM   6248 C CB    . ASN B 1 420 ? -21.202 11.100  53.861 1.00 103.26 ? 450 ASN B CB    1 
ATOM   6249 C CG    . ASN B 1 420 ? -21.962 12.009  52.915 1.00 117.31 ? 450 ASN B CG    1 
ATOM   6250 O OD1   . ASN B 1 420 ? -22.726 11.549  52.065 1.00 120.40 ? 450 ASN B OD1   1 
ATOM   6251 N ND2   . ASN B 1 420 ? -21.756 13.313  53.060 1.00 123.52 ? 450 ASN B ND2   1 
ATOM   6252 N N     . ILE B 1 421 ? -19.622 9.064   52.094 1.00 84.93  ? 451 ILE B N     1 
ATOM   6253 C CA    . ILE B 1 421 ? -18.987 8.632   50.855 1.00 71.69  ? 451 ILE B CA    1 
ATOM   6254 C C     . ILE B 1 421 ? -19.476 7.249   50.441 1.00 66.60  ? 451 ILE B C     1 
ATOM   6255 O O     . ILE B 1 421 ? -19.825 7.031   49.284 1.00 78.30  ? 451 ILE B O     1 
ATOM   6256 C CB    . ILE B 1 421 ? -17.452 8.605   50.985 1.00 63.85  ? 451 ILE B CB    1 
ATOM   6257 C CG1   . ILE B 1 421 ? -16.929 9.994   51.351 1.00 63.00  ? 451 ILE B CG1   1 
ATOM   6258 C CG2   . ILE B 1 421 ? -16.820 8.118   49.693 1.00 61.37  ? 451 ILE B CG2   1 
ATOM   6259 C CD1   . ILE B 1 421 ? -15.442 10.047  51.584 1.00 67.03  ? 451 ILE B CD1   1 
ATOM   6260 N N     . LEU B 1 422 ? -19.502 6.315   51.388 1.00 58.69  ? 452 LEU B N     1 
ATOM   6261 C CA    . LEU B 1 422 ? -19.953 4.958   51.097 1.00 58.65  ? 452 LEU B CA    1 
ATOM   6262 C C     . LEU B 1 422 ? -21.388 4.940   50.577 1.00 70.84  ? 452 LEU B C     1 
ATOM   6263 O O     . LEU B 1 422 ? -21.705 4.210   49.642 1.00 77.46  ? 452 LEU B O     1 
ATOM   6264 C CB    . LEU B 1 422 ? -19.837 4.056   52.326 1.00 52.32  ? 452 LEU B CB    1 
ATOM   6265 C CG    . LEU B 1 422 ? -19.875 2.562   51.996 1.00 58.53  ? 452 LEU B CG    1 
ATOM   6266 C CD1   . LEU B 1 422 ? -18.469 2.067   51.683 1.00 64.23  ? 452 LEU B CD1   1 
ATOM   6267 C CD2   . LEU B 1 422 ? -20.478 1.756   53.127 1.00 51.74  ? 452 LEU B CD2   1 
ATOM   6268 N N     . ASN B 1 423 ? -22.256 5.737   51.191 1.00 77.23  ? 453 ASN B N     1 
ATOM   6269 C CA    . ASN B 1 423 ? -23.650 5.794   50.768 1.00 80.14  ? 453 ASN B CA    1 
ATOM   6270 C C     . ASN B 1 423 ? -23.785 6.350   49.352 1.00 84.72  ? 453 ASN B C     1 
ATOM   6271 O O     . ASN B 1 423 ? -24.612 5.882   48.567 1.00 88.01  ? 453 ASN B O     1 
ATOM   6272 C CB    . ASN B 1 423 ? -24.490 6.611   51.758 1.00 77.80  ? 453 ASN B CB    1 
ATOM   6273 C CG    . ASN B 1 423 ? -24.822 5.835   53.025 1.00 81.10  ? 453 ASN B CG    1 
ATOM   6274 O OD1   . ASN B 1 423 ? -25.093 4.634   52.980 1.00 80.15  ? 453 ASN B OD1   1 
ATOM   6275 N ND2   . ASN B 1 423 ? -24.810 6.523   54.164 1.00 78.09  ? 453 ASN B ND2   1 
ATOM   6276 N N     . ARG B 1 424 ? -22.957 7.339   49.029 1.00 77.99  ? 454 ARG B N     1 
ATOM   6277 C CA    . ARG B 1 424 ? -22.986 7.960   47.709 1.00 80.54  ? 454 ARG B CA    1 
ATOM   6278 C C     . ARG B 1 424 ? -22.417 7.028   46.642 1.00 77.10  ? 454 ARG B C     1 
ATOM   6279 O O     . ARG B 1 424 ? -22.729 7.154   45.459 1.00 82.90  ? 454 ARG B O     1 
ATOM   6280 C CB    . ARG B 1 424 ? -22.223 9.283   47.729 1.00 82.56  ? 454 ARG B CB    1 
ATOM   6281 C CG    . ARG B 1 424 ? -22.829 10.329  48.652 1.00 92.19  ? 454 ARG B CG    1 
ATOM   6282 C CD    . ARG B 1 424 ? -21.910 11.529  48.803 1.00 99.65  ? 454 ARG B CD    1 
ATOM   6283 N NE    . ARG B 1 424 ? -21.500 12.059  47.506 1.00 103.00 ? 454 ARG B NE    1 
ATOM   6284 C CZ    . ARG B 1 424 ? -20.565 12.989  47.335 1.00 104.03 ? 454 ARG B CZ    1 
ATOM   6285 N NH1   . ARG B 1 424 ? -19.934 13.499  48.384 1.00 102.29 ? 454 ARG B NH1   1 
ATOM   6286 N NH2   . ARG B 1 424 ? -20.260 13.408  46.113 1.00 105.25 ? 454 ARG B NH2   1 
ATOM   6287 N N     . ILE B 1 425 ? -21.576 6.094   47.070 1.00 67.09  ? 455 ILE B N     1 
ATOM   6288 C CA    . ILE B 1 425 ? -21.055 5.063   46.185 1.00 62.89  ? 455 ILE B CA    1 
ATOM   6289 C C     . ILE B 1 425 ? -22.108 3.983   45.989 1.00 64.26  ? 455 ILE B C     1 
ATOM   6290 O O     . ILE B 1 425 ? -22.331 3.511   44.873 1.00 60.76  ? 455 ILE B O     1 
ATOM   6291 C CB    . ILE B 1 425 ? -19.764 4.433   46.746 1.00 59.40  ? 455 ILE B CB    1 
ATOM   6292 C CG1   . ILE B 1 425 ? -18.587 5.397   46.573 1.00 53.92  ? 455 ILE B CG1   1 
ATOM   6293 C CG2   . ILE B 1 425 ? -19.471 3.107   46.059 1.00 54.98  ? 455 ILE B CG2   1 
ATOM   6294 C CD1   . ILE B 1 425 ? -17.300 4.886   47.149 1.00 44.62  ? 455 ILE B CD1   1 
ATOM   6295 N N     . GLN B 1 426 ? -22.759 3.599   47.081 1.00 62.92  ? 456 GLN B N     1 
ATOM   6296 C CA    . GLN B 1 426 ? -23.853 2.647   47.009 1.00 61.88  ? 456 GLN B CA    1 
ATOM   6297 C C     . GLN B 1 426 ? -24.962 3.225   46.143 1.00 73.32  ? 456 GLN B C     1 
ATOM   6298 O O     . GLN B 1 426 ? -25.567 2.524   45.330 1.00 74.79  ? 456 GLN B O     1 
ATOM   6299 C CB    . GLN B 1 426 ? -24.386 2.340   48.402 1.00 60.33  ? 456 GLN B CB    1 
ATOM   6300 C CG    . GLN B 1 426 ? -25.426 1.245   48.423 1.00 67.35  ? 456 GLN B CG    1 
ATOM   6301 C CD    . GLN B 1 426 ? -25.950 0.968   49.811 1.00 81.63  ? 456 GLN B CD    1 
ATOM   6302 O OE1   . GLN B 1 426 ? -26.204 -0.181  50.172 1.00 86.63  ? 456 GLN B OE1   1 
ATOM   6303 N NE2   . GLN B 1 426 ? -26.110 2.020   50.604 1.00 87.79  ? 456 GLN B NE2   1 
ATOM   6304 N N     . GLU B 1 427 ? -25.217 4.515   46.319 1.00 80.99  ? 457 GLU B N     1 
ATOM   6305 C CA    . GLU B 1 427 ? -26.237 5.205   45.545 1.00 90.90  ? 457 GLU B CA    1 
ATOM   6306 C C     . GLU B 1 427 ? -25.853 5.265   44.068 1.00 92.38  ? 457 GLU B C     1 
ATOM   6307 O O     . GLU B 1 427 ? -26.652 4.923   43.197 1.00 93.84  ? 457 GLU B O     1 
ATOM   6308 C CB    . GLU B 1 427 ? -26.450 6.613   46.097 1.00 98.83  ? 457 GLU B CB    1 
ATOM   6309 C CG    . GLU B 1 427 ? -27.490 7.424   45.354 1.00 111.11 ? 457 GLU B CG    1 
ATOM   6310 C CD    . GLU B 1 427 ? -27.569 8.849   45.856 1.00 116.20 ? 457 GLU B CD    1 
ATOM   6311 O OE1   . GLU B 1 427 ? -28.320 9.650   45.258 1.00 119.79 ? 457 GLU B OE1   1 
ATOM   6312 O OE2   . GLU B 1 427 ? -26.877 9.168   46.847 1.00 113.36 ? 457 GLU B OE2   1 
ATOM   6313 N N     . HIS B 1 428 ? -24.624 5.693   43.797 1.00 90.52  ? 458 HIS B N     1 
ATOM   6314 C CA    . HIS B 1 428 ? -24.125 5.813   42.429 1.00 91.39  ? 458 HIS B CA    1 
ATOM   6315 C C     . HIS B 1 428 ? -24.302 4.523   41.628 1.00 86.36  ? 458 HIS B C     1 
ATOM   6316 O O     . HIS B 1 428 ? -24.728 4.554   40.474 1.00 88.47  ? 458 HIS B O     1 
ATOM   6317 C CB    . HIS B 1 428 ? -22.650 6.228   42.436 1.00 95.36  ? 458 HIS B CB    1 
ATOM   6318 C CG    . HIS B 1 428 ? -22.049 6.369   41.069 1.00 95.82  ? 458 HIS B CG    1 
ATOM   6319 N ND1   . HIS B 1 428 ? -21.709 5.285   40.289 1.00 92.04  ? 458 HIS B ND1   1 
ATOM   6320 C CD2   . HIS B 1 428 ? -21.714 7.468   40.352 1.00 93.89  ? 458 HIS B CD2   1 
ATOM   6321 C CE1   . HIS B 1 428 ? -21.198 5.710   39.146 1.00 90.96  ? 458 HIS B CE1   1 
ATOM   6322 N NE2   . HIS B 1 428 ? -21.190 7.030   39.160 1.00 92.71  ? 458 HIS B NE2   1 
ATOM   6323 N N     . PHE B 1 429 ? -23.972 3.393   42.244 1.00 83.14  ? 459 PHE B N     1 
ATOM   6324 C CA    . PHE B 1 429 ? -24.034 2.101   41.564 1.00 76.04  ? 459 PHE B CA    1 
ATOM   6325 C C     . PHE B 1 429 ? -25.370 1.393   41.772 1.00 79.05  ? 459 PHE B C     1 
ATOM   6326 O O     . PHE B 1 429 ? -25.660 0.399   41.106 1.00 83.23  ? 459 PHE B O     1 
ATOM   6327 C CB    . PHE B 1 429 ? -22.894 1.186   42.029 1.00 72.36  ? 459 PHE B CB    1 
ATOM   6328 C CG    . PHE B 1 429 ? -21.525 1.630   41.583 1.00 71.17  ? 459 PHE B CG    1 
ATOM   6329 C CD1   . PHE B 1 429 ? -21.049 1.298   40.327 1.00 66.58  ? 459 PHE B CD1   1 
ATOM   6330 C CD2   . PHE B 1 429 ? -20.709 2.361   42.428 1.00 65.02  ? 459 PHE B CD2   1 
ATOM   6331 C CE1   . PHE B 1 429 ? -19.789 1.696   39.918 1.00 65.53  ? 459 PHE B CE1   1 
ATOM   6332 C CE2   . PHE B 1 429 ? -19.452 2.763   42.026 1.00 59.39  ? 459 PHE B CE2   1 
ATOM   6333 C CZ    . PHE B 1 429 ? -18.990 2.431   40.768 1.00 60.52  ? 459 PHE B CZ    1 
ATOM   6334 N N     . ASN B 1 430 ? -26.175 1.898   42.703 1.00 77.26  ? 460 ASN B N     1 
ATOM   6335 C CA    . ASN B 1 430 ? -27.460 1.278   43.016 1.00 86.07  ? 460 ASN B CA    1 
ATOM   6336 C C     . ASN B 1 430 ? -27.345 -0.194  43.419 1.00 94.94  ? 460 ASN B C     1 
ATOM   6337 O O     . ASN B 1 430 ? -28.256 -0.985  43.174 1.00 106.34 ? 460 ASN B O     1 
ATOM   6338 C CB    . ASN B 1 430 ? -28.436 1.431   41.845 1.00 89.12  ? 460 ASN B CB    1 
ATOM   6339 C CG    . ASN B 1 430 ? -29.152 2.769   41.852 1.00 93.76  ? 460 ASN B CG    1 
ATOM   6340 O OD1   . ASN B 1 430 ? -29.628 3.227   42.894 1.00 92.57  ? 460 ASN B OD1   1 
ATOM   6341 N ND2   . ASN B 1 430 ? -29.240 3.400   40.686 1.00 93.84  ? 460 ASN B ND2   1 
ATOM   6342 N N     . LYS B 1 431 ? -26.221 -0.553  44.035 1.00 82.48  ? 461 LYS B N     1 
ATOM   6343 C CA    . LYS B 1 431 ? -26.006 -1.906  44.541 1.00 83.38  ? 461 LYS B CA    1 
ATOM   6344 C C     . LYS B 1 431 ? -25.801 -1.846  46.046 1.00 79.53  ? 461 LYS B C     1 
ATOM   6345 O O     . LYS B 1 431 ? -25.222 -0.888  46.552 1.00 86.79  ? 461 LYS B O     1 
ATOM   6346 C CB    . LYS B 1 431 ? -24.782 -2.536  43.877 1.00 93.04  ? 461 LYS B CB    1 
ATOM   6347 C CG    . LYS B 1 431 ? -25.089 -3.423  42.681 1.00 96.20  ? 461 LYS B CG    1 
ATOM   6348 C CD    . LYS B 1 431 ? -25.331 -4.863  43.115 1.00 96.27  ? 461 LYS B CD    1 
ATOM   6349 C CE    . LYS B 1 431 ? -25.193 -5.825  41.941 1.00 96.70  ? 461 LYS B CE    1 
ATOM   6350 N NZ    . LYS B 1 431 ? -25.158 -7.251  42.376 1.00 94.74  ? 461 LYS B NZ    1 
ATOM   6351 N N     . LYS B 1 432 ? -26.262 -2.860  46.770 1.00 72.15  ? 462 LYS B N     1 
ATOM   6352 C CA    . LYS B 1 432 ? -26.176 -2.802  48.225 1.00 79.22  ? 462 LYS B CA    1 
ATOM   6353 C C     . LYS B 1 432 ? -24.800 -3.147  48.789 1.00 75.56  ? 462 LYS B C     1 
ATOM   6354 O O     . LYS B 1 432 ? -24.253 -4.219  48.523 1.00 74.41  ? 462 LYS B O     1 
ATOM   6355 C CB    . LYS B 1 432 ? -27.232 -3.677  48.901 1.00 77.78  ? 462 LYS B CB    1 
ATOM   6356 C CG    . LYS B 1 432 ? -27.284 -3.424  50.399 1.00 77.90  ? 462 LYS B CG    1 
ATOM   6357 C CD    . LYS B 1 432 ? -28.035 -4.492  51.164 1.00 74.23  ? 462 LYS B CD    1 
ATOM   6358 C CE    . LYS B 1 432 ? -28.125 -4.118  52.636 1.00 55.79  ? 462 LYS B CE    1 
ATOM   6359 N NZ    . LYS B 1 432 ? -28.948 -5.086  53.402 1.00 63.73  ? 462 LYS B NZ    1 
ATOM   6360 N N     . ILE B 1 433 ? -24.256 -2.221  49.573 1.00 63.38  ? 463 ILE B N     1 
ATOM   6361 C CA    . ILE B 1 433 ? -23.066 -2.479  50.366 1.00 54.59  ? 463 ILE B CA    1 
ATOM   6362 C C     . ILE B 1 433 ? -23.522 -2.840  51.772 1.00 59.88  ? 463 ILE B C     1 
ATOM   6363 O O     . ILE B 1 433 ? -23.651 -1.973  52.631 1.00 68.56  ? 463 ILE B O     1 
ATOM   6364 C CB    . ILE B 1 433 ? -22.139 -1.250  50.410 1.00 50.74  ? 463 ILE B CB    1 
ATOM   6365 C CG1   . ILE B 1 433 ? -21.764 -0.821  48.989 1.00 46.13  ? 463 ILE B CG1   1 
ATOM   6366 C CG2   . ILE B 1 433 ? -20.881 -1.550  51.231 1.00 43.67  ? 463 ILE B CG2   1 
ATOM   6367 C CD1   . ILE B 1 433 ? -20.901 0.414   48.928 1.00 45.89  ? 463 ILE B CD1   1 
ATOM   6368 N N     . GLU B 1 434 ? -23.780 -4.124  51.993 1.00 63.94  ? 464 GLU B N     1 
ATOM   6369 C CA    . GLU B 1 434 ? -24.367 -4.592  53.245 1.00 72.31  ? 464 GLU B CA    1 
ATOM   6370 C C     . GLU B 1 434 ? -23.439 -4.446  54.454 1.00 74.77  ? 464 GLU B C     1 
ATOM   6371 O O     . GLU B 1 434 ? -22.290 -4.888  54.428 1.00 81.87  ? 464 GLU B O     1 
ATOM   6372 C CB    . GLU B 1 434 ? -24.819 -6.046  53.102 1.00 83.03  ? 464 GLU B CB    1 
ATOM   6373 C CG    . GLU B 1 434 ? -25.033 -6.760  54.426 1.00 94.96  ? 464 GLU B CG    1 
ATOM   6374 C CD    . GLU B 1 434 ? -25.406 -8.218  54.245 1.00 103.28 ? 464 GLU B CD    1 
ATOM   6375 O OE1   . GLU B 1 434 ? -25.994 -8.556  53.195 1.00 109.07 ? 464 GLU B OE1   1 
ATOM   6376 O OE2   . GLU B 1 434 ? -25.112 -9.023  55.155 1.00 99.59  ? 464 GLU B OE2   1 
ATOM   6377 N N     . ARG B 1 435 ? -23.951 -3.829  55.515 1.00 71.63  ? 465 ARG B N     1 
ATOM   6378 C CA    . ARG B 1 435 ? -23.180 -3.655  56.737 1.00 69.86  ? 465 ARG B CA    1 
ATOM   6379 C C     . ARG B 1 435 ? -22.843 -4.999  57.350 1.00 78.71  ? 465 ARG B C     1 
ATOM   6380 O O     . ARG B 1 435 ? -23.668 -5.911  57.376 1.00 80.47  ? 465 ARG B O     1 
ATOM   6381 C CB    . ARG B 1 435 ? -23.934 -2.806  57.760 1.00 65.80  ? 465 ARG B CB    1 
ATOM   6382 C CG    . ARG B 1 435 ? -23.206 -2.686  59.087 1.00 72.21  ? 465 ARG B CG    1 
ATOM   6383 C CD    . ARG B 1 435 ? -24.017 -1.926  60.123 1.00 84.17  ? 465 ARG B CD    1 
ATOM   6384 N NE    . ARG B 1 435 ? -24.294 -0.553  59.711 1.00 88.32  ? 465 ARG B NE    1 
ATOM   6385 C CZ    . ARG B 1 435 ? -24.819 0.375   60.506 1.00 84.79  ? 465 ARG B CZ    1 
ATOM   6386 N NH1   . ARG B 1 435 ? -25.121 0.082   61.765 1.00 66.84  ? 465 ARG B NH1   1 
ATOM   6387 N NH2   . ARG B 1 435 ? -25.037 1.598   60.043 1.00 87.31  ? 465 ARG B NH2   1 
ATOM   6388 N N     . LEU B 1 436 ? -21.621 -5.109  57.850 1.00 79.97  ? 466 LEU B N     1 
ATOM   6389 C CA    . LEU B 1 436 ? -21.151 -6.343  58.442 1.00 80.87  ? 466 LEU B CA    1 
ATOM   6390 C C     . LEU B 1 436 ? -20.399 -6.004  59.719 1.00 88.46  ? 466 LEU B C     1 
ATOM   6391 O O     . LEU B 1 436 ? -19.730 -4.973  59.799 1.00 88.04  ? 466 LEU B O     1 
ATOM   6392 C CB    . LEU B 1 436 ? -20.231 -7.063  57.457 1.00 76.79  ? 466 LEU B CB    1 
ATOM   6393 C CG    . LEU B 1 436 ? -20.003 -8.559  57.662 1.00 81.08  ? 466 LEU B CG    1 
ATOM   6394 C CD1   . LEU B 1 436 ? -21.281 -9.341  57.409 1.00 82.73  ? 466 LEU B CD1   1 
ATOM   6395 C CD2   . LEU B 1 436 ? -18.890 -9.044  56.752 1.00 80.60  ? 466 LEU B CD2   1 
ATOM   6396 N N     . ASP B 1 437 ? -20.522 -6.856  60.729 1.00 99.56  ? 467 ASP B N     1 
ATOM   6397 C CA    . ASP B 1 437 ? -19.755 -6.659  61.952 1.00 110.12 ? 467 ASP B CA    1 
ATOM   6398 C C     . ASP B 1 437 ? -18.680 -7.733  62.075 1.00 115.06 ? 467 ASP B C     1 
ATOM   6399 O O     . ASP B 1 437 ? -18.916 -8.902  61.768 1.00 115.05 ? 467 ASP B O     1 
ATOM   6400 C CB    . ASP B 1 437 ? -20.658 -6.642  63.185 1.00 114.20 ? 467 ASP B CB    1 
ATOM   6401 C CG    . ASP B 1 437 ? -20.062 -5.835  64.325 1.00 121.75 ? 467 ASP B CG    1 
ATOM   6402 O OD1   . ASP B 1 437 ? -18.956 -5.281  64.144 1.00 123.79 ? 467 ASP B OD1   1 
ATOM   6403 O OD2   . ASP B 1 437 ? -20.696 -5.749  65.399 1.00 123.01 ? 467 ASP B OD2   1 
ATOM   6404 N N     . THR B 1 438 ? -17.499 -7.319  62.520 1.00 120.26 ? 468 THR B N     1 
ATOM   6405 C CA    . THR B 1 438 ? -16.327 -8.187  62.553 1.00 126.80 ? 468 THR B CA    1 
ATOM   6406 C C     . THR B 1 438 ? -16.623 -9.574  63.126 1.00 125.59 ? 468 THR B C     1 
ATOM   6407 O O     . THR B 1 438 ? -16.250 -10.590 62.540 1.00 121.24 ? 468 THR B O     1 
ATOM   6408 C CB    . THR B 1 438 ? -15.177 -7.537  63.354 1.00 129.25 ? 468 THR B CB    1 
ATOM   6409 O OG1   . THR B 1 438 ? -15.467 -7.600  64.755 1.00 134.72 ? 468 THR B OG1   1 
ATOM   6410 C CG2   . THR B 1 438 ? -15.001 -6.082  62.948 1.00 124.31 ? 468 THR B CG2   1 
ATOM   6411 N N     . ASP B 1 439 ? -17.308 -9.606  64.264 1.00 126.85 ? 469 ASP B N     1 
ATOM   6412 C CA    . ASP B 1 439 ? -17.538 -10.849 64.993 1.00 125.76 ? 469 ASP B CA    1 
ATOM   6413 C C     . ASP B 1 439 ? -18.401 -11.848 64.222 1.00 124.12 ? 469 ASP B C     1 
ATOM   6414 O O     . ASP B 1 439 ? -18.289 -13.058 64.423 1.00 122.87 ? 469 ASP B O     1 
ATOM   6415 C CB    . ASP B 1 439 ? -18.162 -10.557 66.361 1.00 126.19 ? 469 ASP B CB    1 
ATOM   6416 C CG    . ASP B 1 439 ? -17.405 -9.489  67.133 1.00 123.68 ? 469 ASP B CG    1 
ATOM   6417 O OD1   . ASP B 1 439 ? -17.124 -8.420  66.553 1.00 123.32 ? 469 ASP B OD1   1 
ATOM   6418 O OD2   . ASP B 1 439 ? -17.100 -9.713  68.324 1.00 119.65 ? 469 ASP B OD2   1 
ATOM   6419 N N     . ASP B 1 440 ? -19.258 -11.341 63.342 1.00 123.96 ? 470 ASP B N     1 
ATOM   6420 C CA    . ASP B 1 440 ? -20.140 -12.198 62.555 1.00 119.99 ? 470 ASP B CA    1 
ATOM   6421 C C     . ASP B 1 440 ? -19.629 -12.381 61.125 1.00 110.75 ? 470 ASP B C     1 
ATOM   6422 O O     . ASP B 1 440 ? -20.386 -12.766 60.232 1.00 105.64 ? 470 ASP B O     1 
ATOM   6423 C CB    . ASP B 1 440 ? -21.565 -11.637 62.540 1.00 117.94 ? 470 ASP B CB    1 
ATOM   6424 N N     . LEU B 1 441 ? -18.343 -12.109 60.920 1.00 104.82 ? 471 LEU B N     1 
ATOM   6425 C CA    . LEU B 1 441 ? -17.726 -12.238 59.603 1.00 99.05  ? 471 LEU B CA    1 
ATOM   6426 C C     . LEU B 1 441 ? -17.566 -13.702 59.200 1.00 100.40 ? 471 LEU B C     1 
ATOM   6427 O O     . LEU B 1 441 ? -18.535 -14.368 58.831 1.00 100.77 ? 471 LEU B O     1 
ATOM   6428 C CB    . LEU B 1 441 ? -16.368 -11.534 59.578 1.00 93.56  ? 471 LEU B CB    1 
HETATM 6429 P PB    . ADP C 2 .   ? 34.385  -5.272  39.216 1.00 40.34  ? 602 ADP A PB    1 
HETATM 6430 O O1B   . ADP C 2 .   ? 35.786  -5.289  39.769 1.00 29.24  ? 602 ADP A O1B   1 
HETATM 6431 O O2B   . ADP C 2 .   ? 33.339  -4.860  40.224 1.00 37.84  ? 602 ADP A O2B   1 
HETATM 6432 O O3B   . ADP C 2 .   ? 34.262  -4.582  37.873 1.00 45.95  ? 602 ADP A O3B   1 
HETATM 6433 P PA    . ADP C 2 .   ? 32.790  -7.619  39.423 1.00 34.45  ? 602 ADP A PA    1 
HETATM 6434 O O1A   . ADP C 2 .   ? 31.598  -7.122  38.636 1.00 39.38  ? 602 ADP A O1A   1 
HETATM 6435 O O2A   . ADP C 2 .   ? 32.767  -7.580  40.928 1.00 30.39  ? 602 ADP A O2A   1 
HETATM 6436 O O3A   . ADP C 2 .   ? 34.064  -6.806  38.861 1.00 24.90  ? 602 ADP A O3A   1 
HETATM 6437 O "O5'" . ADP C 2 .   ? 33.071  -9.125  38.927 1.00 41.51  ? 602 ADP A "O5'" 1 
HETATM 6438 C "C5'" . ADP C 2 .   ? 33.679  -9.359  37.654 1.00 29.83  ? 602 ADP A "C5'" 1 
HETATM 6439 C "C4'" . ADP C 2 .   ? 33.102  -10.656 37.118 1.00 26.81  ? 602 ADP A "C4'" 1 
HETATM 6440 O "O4'" . ADP C 2 .   ? 33.630  -11.755 37.850 1.00 41.08  ? 602 ADP A "O4'" 1 
HETATM 6441 C "C3'" . ADP C 2 .   ? 31.603  -10.708 37.307 1.00 27.58  ? 602 ADP A "C3'" 1 
HETATM 6442 O "O3'" . ADP C 2 .   ? 31.085  -11.389 36.165 1.00 46.44  ? 602 ADP A "O3'" 1 
HETATM 6443 C "C2'" . ADP C 2 .   ? 31.378  -11.571 38.530 1.00 30.65  ? 602 ADP A "C2'" 1 
HETATM 6444 O "O2'" . ADP C 2 .   ? 30.163  -12.326 38.429 1.00 30.20  ? 602 ADP A "O2'" 1 
HETATM 6445 C "C1'" . ADP C 2 .   ? 32.602  -12.468 38.542 1.00 37.10  ? 602 ADP A "C1'" 1 
HETATM 6446 N N9    . ADP C 2 .   ? 33.103  -12.746 39.909 1.00 45.10  ? 602 ADP A N9    1 
HETATM 6447 C C8    . ADP C 2 .   ? 33.270  -11.846 40.895 1.00 48.27  ? 602 ADP A C8    1 
HETATM 6448 N N7    . ADP C 2 .   ? 33.764  -12.437 42.013 1.00 48.77  ? 602 ADP A N7    1 
HETATM 6449 C C5    . ADP C 2 .   ? 33.926  -13.747 41.743 1.00 46.65  ? 602 ADP A C5    1 
HETATM 6450 C C6    . ADP C 2 .   ? 34.405  -14.945 42.477 1.00 46.04  ? 602 ADP A C6    1 
HETATM 6451 N N6    . ADP C 2 .   ? 34.830  -14.862 43.760 1.00 41.28  ? 602 ADP A N6    1 
HETATM 6452 N N1    . ADP C 2 .   ? 34.411  -16.126 41.821 1.00 50.10  ? 602 ADP A N1    1 
HETATM 6453 C C2    . ADP C 2 .   ? 34.000  -16.222 40.545 1.00 50.63  ? 602 ADP A C2    1 
HETATM 6454 N N3    . ADP C 2 .   ? 33.552  -15.182 39.821 1.00 45.30  ? 602 ADP A N3    1 
HETATM 6455 C C4    . ADP C 2 .   ? 33.490  -13.941 40.353 1.00 45.58  ? 602 ADP A C4    1 
HETATM 6456 P PB    . ADP D 2 .   ? -1.222  -3.054  23.019 1.00 60.33  ? 602 ADP B PB    1 
HETATM 6457 O O1B   . ADP D 2 .   ? -2.391  -3.217  22.084 1.00 66.96  ? 602 ADP B O1B   1 
HETATM 6458 O O2B   . ADP D 2 .   ? 0.001   -2.421  22.400 1.00 44.51  ? 602 ADP B O2B   1 
HETATM 6459 O O3B   . ADP D 2 .   ? -1.607  -2.456  24.353 1.00 65.10  ? 602 ADP B O3B   1 
HETATM 6460 P PA    . ADP D 2 .   ? 0.490   -5.320  22.731 1.00 52.02  ? 602 ADP B PA    1 
HETATM 6461 O O1A   . ADP D 2 .   ? 1.716   -4.911  23.516 1.00 49.19  ? 602 ADP B O1A   1 
HETATM 6462 O O2A   . ADP D 2 .   ? 0.486   -5.118  21.233 1.00 54.01  ? 602 ADP B O2A   1 
HETATM 6463 O O3A   . ADP D 2 .   ? -0.778  -4.565  23.378 1.00 20.62  ? 602 ADP B O3A   1 
HETATM 6464 O "O5'" . ADP D 2 .   ? 0.219   -6.873  23.072 1.00 41.80  ? 602 ADP B "O5'" 1 
HETATM 6465 C "C5'" . ADP D 2 .   ? -0.598  -7.255  24.180 1.00 37.47  ? 602 ADP B "C5'" 1 
HETATM 6466 C "C4'" . ADP D 2 .   ? -0.026  -8.527  24.806 1.00 43.05  ? 602 ADP B "C4'" 1 
HETATM 6467 O "O4'" . ADP D 2 .   ? -0.510  -9.690  24.137 1.00 50.85  ? 602 ADP B "O4'" 1 
HETATM 6468 C "C3'" . ADP D 2 .   ? 1.486   -8.585  24.709 1.00 47.68  ? 602 ADP B "C3'" 1 
HETATM 6469 O "O3'" . ADP D 2 .   ? 1.949   -9.254  25.882 1.00 49.91  ? 602 ADP B "O3'" 1 
HETATM 6470 C "C2'" . ADP D 2 .   ? 1.774   -9.467  23.513 1.00 54.91  ? 602 ADP B "C2'" 1 
HETATM 6471 O "O2'" . ADP D 2 .   ? 2.960   -10.253 23.708 1.00 50.27  ? 602 ADP B "O2'" 1 
HETATM 6472 C "C1'" . ADP D 2 .   ? 0.531   -10.337 23.403 1.00 54.94  ? 602 ADP B "C1'" 1 
HETATM 6473 N N9    . ADP D 2 .   ? 0.049   -10.445 22.008 1.00 56.12  ? 602 ADP B N9    1 
HETATM 6474 C C8    . ADP D 2 .   ? -0.182  -9.415  21.169 1.00 58.79  ? 602 ADP B C8    1 
HETATM 6475 N N7    . ADP D 2 .   ? -0.638  -9.861  19.972 1.00 63.41  ? 602 ADP B N7    1 
HETATM 6476 C C5    . ADP D 2 .   ? -0.706  -11.207 20.042 1.00 65.93  ? 602 ADP B C5    1 
HETATM 6477 C C6    . ADP D 2 .   ? -1.103  -12.310 19.131 1.00 66.32  ? 602 ADP B C6    1 
HETATM 6478 N N6    . ADP D 2 .   ? -1.534  -12.057 17.869 1.00 49.73  ? 602 ADP B N6    1 
HETATM 6479 N N1    . ADP D 2 .   ? -1.022  -13.575 19.608 1.00 70.98  ? 602 ADP B N1    1 
HETATM 6480 C C2    . ADP D 2 .   ? -0.599  -13.842 20.859 1.00 60.83  ? 602 ADP B C2    1 
HETATM 6481 N N3    . ADP D 2 .   ? -0.222  -12.895 21.734 1.00 56.32  ? 602 ADP B N3    1 
HETATM 6482 C C4    . ADP D 2 .   ? -0.252  -11.586 21.389 1.00 57.32  ? 602 ADP B C4    1 
HETATM 6483 O O     . HOH E 3 .   ? 20.211  9.851   39.092 1.00 24.95  ? 1   HOH A O     1 
HETATM 6484 O O     . HOH E 3 .   ? 30.772  7.100   18.616 1.00 31.63  ? 2   HOH A O     1 
HETATM 6485 O O     . HOH E 3 .   ? 21.518  -15.049 50.073 1.00 37.60  ? 3   HOH A O     1 
HETATM 6486 O O     . HOH E 3 .   ? 29.098  21.192  47.793 1.00 48.28  ? 4   HOH A O     1 
HETATM 6487 O O     . HOH E 3 .   ? 21.695  13.552  41.314 1.00 39.48  ? 5   HOH A O     1 
HETATM 6488 O O     . HOH E 3 .   ? 32.831  -6.238  35.757 1.00 49.90  ? 6   HOH A O     1 
HETATM 6489 O O     . HOH E 3 .   ? 34.000  -6.447  29.684 1.00 37.39  ? 7   HOH A O     1 
HETATM 6490 O O     . HOH E 3 .   ? 35.549  7.859   17.199 1.00 40.93  ? 8   HOH A O     1 
HETATM 6491 O O     . HOH E 3 .   ? 45.234  -9.099  18.208 1.00 43.87  ? 9   HOH A O     1 
HETATM 6492 O O     . HOH E 3 .   ? 28.266  -12.919 57.058 1.00 43.97  ? 10  HOH A O     1 
HETATM 6493 O O     . HOH E 3 .   ? 29.463  9.055   29.596 1.00 46.74  ? 11  HOH A O     1 
HETATM 6494 O O     . HOH E 3 .   ? 46.568  11.598  9.948  1.00 57.75  ? 13  HOH A O     1 
HETATM 6495 O O     . HOH E 3 .   ? 22.698  4.263   26.063 1.00 50.21  ? 14  HOH A O     1 
HETATM 6496 O O     . HOH E 3 .   ? 33.071  -9.461  6.471  1.00 45.11  ? 15  HOH A O     1 
HETATM 6497 O O     . HOH E 3 .   ? 51.604  -0.800  0.746  1.00 45.49  ? 17  HOH A O     1 
HETATM 6498 O O     . HOH E 3 .   ? 19.850  3.775   19.387 1.00 47.70  ? 18  HOH A O     1 
HETATM 6499 O O     . HOH E 3 .   ? 37.693  -13.045 3.526  1.00 40.57  ? 19  HOH A O     1 
HETATM 6500 O O     . HOH E 3 .   ? 41.435  4.767   14.636 1.00 45.52  ? 22  HOH A O     1 
HETATM 6501 O O     . HOH E 3 .   ? 35.701  -1.334  37.885 1.00 44.55  ? 23  HOH A O     1 
HETATM 6502 O O     . HOH E 3 .   ? 40.096  2.068   59.340 1.00 42.50  ? 24  HOH A O     1 
HETATM 6503 O O     . HOH E 3 .   ? 35.453  15.067  54.653 1.00 48.59  ? 25  HOH A O     1 
HETATM 6504 O O     . HOH F 3 .   ? 14.855  -4.516  43.722 1.00 28.55  ? 12  HOH B O     1 
HETATM 6505 O O     . HOH F 3 .   ? -0.203  -0.706  28.447 1.00 46.70  ? 16  HOH B O     1 
HETATM 6506 O O     . HOH F 3 .   ? 13.799  2.129   44.673 1.00 31.80  ? 20  HOH B O     1 
HETATM 6507 O O     . HOH F 3 .   ? 18.405  -2.885  19.288 1.00 39.63  ? 21  HOH B O     1 
HETATM 6508 O O     . HOH F 3 .   ? -2.489  -14.049 44.620 1.00 53.38  ? 26  HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 23  ? 1.5292 1.2878 1.3718 -0.0091 0.2226  0.2244  53  MET A N   
2    C CA  . MET A 23  ? 1.6078 1.3663 1.4068 0.0246  0.2148  0.2216  53  MET A CA  
3    C C   . MET A 23  ? 1.7021 1.5006 1.5109 0.0336  0.1985  0.1971  53  MET A C   
4    O O   . MET A 23  ? 1.6920 1.5309 1.5254 0.0250  0.2054  0.1948  53  MET A O   
5    C CB  . MET A 23  ? 1.6049 1.3664 1.3729 0.0391  0.2375  0.2477  53  MET A CB  
6    N N   . GLU A 24  ? 1.7404 1.5276 1.5311 0.0510  0.1771  0.1795  54  GLU A N   
7    C CA  . GLU A 24  ? 1.6132 1.4318 1.4131 0.0582  0.1606  0.1566  54  GLU A CA  
8    C C   . GLU A 24  ? 1.5436 1.3550 1.3076 0.0873  0.1454  0.1472  54  GLU A C   
9    O O   . GLU A 24  ? 1.5031 1.2939 1.2605 0.0934  0.1291  0.1362  54  GLU A O   
10   C CB  . GLU A 24  ? 1.4787 1.3006 1.3130 0.0391  0.1460  0.1374  54  GLU A CB  
11   N N   . ASP A 25  ? 1.4427 1.2730 1.1849 0.1054  0.1505  0.1507  55  ASP A N   
12   C CA  . ASP A 25  ? 1.2261 1.0564 0.9384 0.1316  0.1342  0.1379  55  ASP A CA  
13   C C   . ASP A 25  ? 0.9607 0.8185 0.6977 0.1275  0.1191  0.1150  55  ASP A C   
14   O O   . ASP A 25  ? 0.6534 0.5178 0.3746 0.1451  0.1052  0.1015  55  ASP A O   
15   C CB  . ASP A 25  ? 1.3514 1.1886 1.0278 0.1530  0.1469  0.1508  55  ASP A CB  
16   C CG  . ASP A 25  ? 1.6029 1.4178 1.2342 0.1808  0.1352  0.1498  55  ASP A CG  
17   O OD1 . ASP A 25  ? 1.6650 1.4814 1.2940 0.1910  0.1126  0.1290  55  ASP A OD1 
18   O OD2 . ASP A 25  ? 1.7234 1.5201 1.3218 0.1926  0.1485  0.1703  55  ASP A OD2 
19   N N   . ARG A 26  ? 0.7773 0.6495 0.5531 0.1036  0.1215  0.1111  56  ARG A N   
20   C CA  . ARG A 26  ? 0.6174 0.5179 0.4189 0.0970  0.1119  0.0943  56  ARG A CA  
21   C C   . ARG A 26  ? 0.6547 0.5531 0.4504 0.1081  0.0898  0.0744  56  ARG A C   
22   O O   . ARG A 26  ? 0.5591 0.4767 0.3574 0.1149  0.0831  0.0638  56  ARG A O   
23   C CB  . ARG A 26  ? 0.7478 0.6557 0.5879 0.0701  0.1139  0.0924  56  ARG A CB  
24   C CG  . ARG A 26  ? 0.8591 0.7727 0.7145 0.0539  0.1346  0.1104  56  ARG A CG  
25   C CD  . ARG A 26  ? 1.1130 1.0668 0.9892 0.0500  0.1432  0.1111  56  ARG A CD  
26   N NE  . ARG A 26  ? 1.3304 1.2989 1.2434 0.0242  0.1535  0.1175  56  ARG A NE  
27   C CZ  . ARG A 26  ? 1.4382 1.4440 1.3823 0.0146  0.1543  0.1123  56  ARG A CZ  
28   N NH1 . ARG A 26  ? 1.3814 1.4097 1.3221 0.0295  0.1463  0.1015  56  ARG A NH1 
29   N NH2 . ARG A 26  ? 1.5181 1.5379 1.4972 -0.0097 0.1620  0.1173  56  ARG A NH2 
30   N N   . ALA A 27  ? 0.6364 0.5120 0.4267 0.1095  0.0787  0.0693  57  ALA A N   
31   C CA  . ALA A 27  ? 0.5103 0.3872 0.3028 0.1158  0.0587  0.0508  57  ALA A CA  
32   C C   . ALA A 27  ? 0.5041 0.3851 0.2714 0.1380  0.0503  0.0446  57  ALA A C   
33   O O   . ALA A 27  ? 0.5470 0.4432 0.3229 0.1395  0.0407  0.0316  57  ALA A O   
34   C CB  . ALA A 27  ? 0.4613 0.3153 0.2522 0.1158  0.0502  0.0477  57  ALA A CB  
35   N N   . ALA A 28  ? 0.5697 0.4350 0.3041 0.1555  0.0535  0.0540  58  ALA A N   
36   C CA  . ALA A 28  ? 0.4787 0.3458 0.1842 0.1785  0.0445  0.0472  58  ALA A CA  
37   C C   . ALA A 28  ? 0.4960 0.3848 0.2041 0.1811  0.0488  0.0427  58  ALA A C   
38   O O   . ALA A 28  ? 0.6920 0.5865 0.3963 0.1906  0.0343  0.0269  58  ALA A O   
39   C CB  . ALA A 28  ? 0.5578 0.4069 0.2245 0.1967  0.0519  0.0620  58  ALA A CB  
40   N N   . GLN A 29  ? 0.5544 0.4553 0.2705 0.1727  0.0685  0.0562  59  GLN A N   
41   C CA  . GLN A 29  ? 0.4930 0.4166 0.2121 0.1775  0.0744  0.0531  59  GLN A CA  
42   C C   . GLN A 29  ? 0.5160 0.4524 0.2649 0.1667  0.0612  0.0367  59  GLN A C   
43   O O   . GLN A 29  ? 0.5266 0.4701 0.2698 0.1780  0.0530  0.0249  59  GLN A O   
44   C CB  . GLN A 29  ? 0.6993 0.6386 0.4290 0.1680  0.0987  0.0714  59  GLN A CB  
45   C CG  . GLN A 29  ? 0.9968 0.9223 0.7000 0.1748  0.1157  0.0921  59  GLN A CG  
46   C CD  . GLN A 29  ? 1.1930 1.1351 0.9167 0.1588  0.1402  0.1109  59  GLN A CD  
47   O OE1 . GLN A 29  ? 1.2230 1.1913 0.9793 0.1459  0.1439  0.1072  59  GLN A OE1 
48   N NE2 . GLN A 29  ? 1.2189 1.1462 0.9247 0.1596  0.1568  0.1318  59  GLN A NE2 
49   N N   . SER A 30  ? 0.4364 0.3736 0.2152 0.1456  0.0592  0.0360  60  SER A N   
50   C CA  . SER A 30  ? 0.4430 0.3914 0.2478 0.1352  0.0479  0.0229  60  SER A CA  
51   C C   . SER A 30  ? 0.4660 0.4043 0.2622 0.1450  0.0280  0.0067  60  SER A C   
52   O O   . SER A 30  ? 0.5762 0.5221 0.3799 0.1469  0.0198  -0.0036 60  SER A O   
53   C CB  . SER A 30  ? 0.7374 0.6871 0.5707 0.1126  0.0493  0.0248  60  SER A CB  
54   O OG  . SER A 30  ? 0.8707 0.8359 0.7278 0.1027  0.0426  0.0159  60  SER A OG  
55   N N   . LEU A 31  ? 0.4523 0.3735 0.2341 0.1513  0.0200  0.0048  61  LEU A N   
56   C CA  . LEU A 31  ? 0.4766 0.3910 0.2523 0.1607  0.0005  -0.0107 61  LEU A CA  
57   C C   . LEU A 31  ? 0.5207 0.4347 0.2725 0.1801  -0.0052 -0.0183 61  LEU A C   
58   O O   . LEU A 31  ? 0.5744 0.4904 0.3340 0.1809  -0.0177 -0.0319 61  LEU A O   
59   C CB  . LEU A 31  ? 0.5848 0.4843 0.3500 0.1661  -0.0069 -0.0107 61  LEU A CB  
60   C CG  . LEU A 31  ? 0.5945 0.4914 0.3606 0.1730  -0.0280 -0.0272 61  LEU A CG  
61   C CD1 . LEU A 31  ? 0.5455 0.4528 0.3442 0.1565  -0.0351 -0.0371 61  LEU A CD1 
62   C CD2 . LEU A 31  ? 0.4536 0.3396 0.2114 0.1798  -0.0344 -0.0259 61  LEU A CD2 
63   N N   . LEU A 32  ? 0.5680 0.4782 0.2896 0.1960  0.0042  -0.0094 62  LEU A N   
64   C CA  . LEU A 32  ? 0.5074 0.4167 0.2017 0.2171  -0.0007 -0.0178 62  LEU A CA  
65   C C   . LEU A 32  ? 0.4887 0.4108 0.1971 0.2148  0.0017  -0.0236 62  LEU A C   
66   O O   . LEU A 32  ? 0.6099 0.5273 0.3112 0.2248  -0.0119 -0.0391 62  LEU A O   
67   C CB  . LEU A 32  ? 0.5636 0.4695 0.2215 0.2348  0.0132  -0.0044 62  LEU A CB  
68   C CG  . LEU A 32  ? 0.6739 0.5778 0.2963 0.2604  0.0077  -0.0143 62  LEU A CG  
69   C CD1 . LEU A 32  ? 0.5750 0.4678 0.1929 0.2679  -0.0195 -0.0366 62  LEU A CD1 
70   C CD2 . LEU A 32  ? 0.5687 0.4673 0.1500 0.2793  0.0209  0.0002  62  LEU A CD2 
71   N N   . ASN A 33  ? 0.4740 0.4113 0.2032 0.2017  0.0180  -0.0120 63  ASN A N   
72   C CA  . ASN A 33  ? 0.4881 0.4393 0.2323 0.2008  0.0200  -0.0166 63  ASN A CA  
73   C C   . ASN A 33  ? 0.4608 0.4065 0.2254 0.1919  0.0024  -0.0309 63  ASN A C   
74   O O   . ASN A 33  ? 0.6403 0.5859 0.4045 0.1997  -0.0035 -0.0402 63  ASN A O   
75   C CB  . ASN A 33  ? 0.4564 0.4290 0.2233 0.1875  0.0389  -0.0019 63  ASN A CB  
76   C CG  . ASN A 33  ? 0.6464 0.6325 0.3959 0.2016  0.0575  0.0087  63  ASN A CG  
77   O OD1 . ASN A 33  ? 0.6275 0.6145 0.3561 0.2219  0.0561  0.0013  63  ASN A OD1 
78   N ND2 . ASN A 33  ? 0.8192 0.8158 0.5773 0.1910  0.0755  0.0260  63  ASN A ND2 
79   N N   . LYS A 34  ? 0.4655 0.4057 0.2473 0.1764  -0.0052 -0.0321 64  LYS A N   
80   C CA  . LYS A 34  ? 0.4526 0.3881 0.2540 0.1665  -0.0203 -0.0436 64  LYS A CA  
81   C C   . LYS A 34  ? 0.5431 0.4631 0.3302 0.1782  -0.0385 -0.0592 64  LYS A C   
82   O O   . LYS A 34  ? 0.5791 0.4934 0.3742 0.1776  -0.0491 -0.0696 64  LYS A O   
83   C CB  . LYS A 34  ? 0.4314 0.3690 0.2553 0.1473  -0.0208 -0.0398 64  LYS A CB  
84   C CG  . LYS A 34  ? 0.4291 0.3817 0.2748 0.1320  -0.0091 -0.0303 64  LYS A CG  
85   C CD  . LYS A 34  ? 0.5908 0.5440 0.4545 0.1152  -0.0096 -0.0283 64  LYS A CD  
86   C CE  . LYS A 34  ? 0.7638 0.7320 0.6493 0.1005  -0.0031 -0.0234 64  LYS A CE  
87   N NZ  . LYS A 34  ? 0.8109 0.7841 0.7028 0.1027  -0.0086 -0.0280 64  LYS A NZ  
88   N N   . LEU A 35  ? 0.5520 0.4642 0.3180 0.1889  -0.0430 -0.0608 65  LEU A N   
89   C CA  . LEU A 35  ? 0.4955 0.3954 0.2482 0.2004  -0.0625 -0.0772 65  LEU A CA  
90   C C   . LEU A 35  ? 0.5641 0.4569 0.2977 0.2168  -0.0672 -0.0878 65  LEU A C   
91   O O   . LEU A 35  ? 0.7305 0.6120 0.4653 0.2194  -0.0850 -0.1042 65  LEU A O   
92   C CB  . LEU A 35  ? 0.4773 0.3720 0.2068 0.2124  -0.0662 -0.0758 65  LEU A CB  
93   C CG  . LEU A 35  ? 0.5547 0.4523 0.3019 0.1993  -0.0651 -0.0686 65  LEU A CG  
94   C CD1 . LEU A 35  ? 0.6165 0.5069 0.3369 0.2148  -0.0683 -0.0655 65  LEU A CD1 
95   C CD2 . LEU A 35  ? 0.4113 0.3117 0.1895 0.1848  -0.0796 -0.0801 65  LEU A CD2 
96   N N   . ILE A 36  ? 0.5450 0.4448 0.2629 0.2274  -0.0511 -0.0789 66  ILE A N   
97   C CA  . ILE A 36  ? 0.5568 0.4506 0.2528 0.2468  -0.0537 -0.0891 66  ILE A CA  
98   C C   . ILE A 36  ? 0.5280 0.4271 0.2433 0.2418  -0.0484 -0.0887 66  ILE A C   
99   O O   . ILE A 36  ? 0.7016 0.5924 0.4028 0.2573  -0.0529 -0.0994 66  ILE A O   
100  C CB  . ILE A 36  ? 0.5578 0.4572 0.2174 0.2684  -0.0393 -0.0813 66  ILE A CB  
101  C CG1 . ILE A 36  ? 0.5654 0.4853 0.2377 0.2595  -0.0143 -0.0598 66  ILE A CG1 
102  C CG2 . ILE A 36  ? 0.5945 0.4853 0.2281 0.2782  -0.0469 -0.0825 66  ILE A CG2 
103  C CD1 . ILE A 36  ? 0.5154 0.4443 0.1568 0.2787  0.0036  -0.0495 66  ILE A CD1 
104  N N   . ARG A 37  ? 0.7265 0.6386 0.4722 0.2219  -0.0395 -0.0769 67  ARG A N   
105  C CA  . ARG A 37  ? 0.7032 0.6216 0.4677 0.2176  -0.0357 -0.0753 67  ARG A CA  
106  C C   . ARG A 37  ? 0.6511 0.5491 0.4233 0.2157  -0.0541 -0.0900 67  ARG A C   
107  O O   . ARG A 37  ? 0.7581 0.6468 0.5441 0.2018  -0.0660 -0.0949 67  ARG A O   
108  C CB  . ARG A 37  ? 0.5680 0.5040 0.3623 0.1961  -0.0255 -0.0612 67  ARG A CB  
109  C CG  . ARG A 37  ? 0.5809 0.5262 0.3932 0.1933  -0.0222 -0.0585 67  ARG A CG  
110  C CD  . ARG A 37  ? 0.4758 0.4410 0.2810 0.2071  -0.0064 -0.0512 67  ARG A CD  
111  N NE  . ARG A 37  ? 0.6404 0.6247 0.4504 0.1985  0.0092  -0.0371 67  ARG A NE  
112  C CZ  . ARG A 37  ? 0.6429 0.6476 0.4478 0.2074  0.0262  -0.0279 67  ARG A CZ  
113  N NH1 . ARG A 37  ? 0.5132 0.5243 0.3069 0.2276  0.0300  -0.0320 67  ARG A NH1 
114  N NH2 . ARG A 37  ? 0.5264 0.5447 0.3382 0.1962  0.0398  -0.0144 67  ARG A NH2 
115  N N   . SER A 38  ? 0.6582 0.5491 0.4228 0.2296  -0.0556 -0.0966 68  SER A N   
116  C CA  . SER A 38  ? 0.8579 0.7237 0.6273 0.2292  -0.0730 -0.1107 68  SER A CA  
117  C C   . SER A 38  ? 0.8827 0.7498 0.6730 0.2226  -0.0698 -0.1043 68  SER A C   
118  O O   . SER A 38  ? 0.9617 0.8083 0.7638 0.2145  -0.0821 -0.1102 68  SER A O   
119  C CB  . SER A 38  ? 1.0098 0.8568 0.7480 0.2540  -0.0821 -0.1278 68  SER A CB  
120  O OG  . SER A 38  ? 1.0679 0.9297 0.7878 0.2743  -0.0666 -0.1228 68  SER A OG  
121  N N   . ASN A 39  ? 0.7505 0.6421 0.5458 0.2260  -0.0535 -0.0915 69  ASN A N   
122  C CA  . ASN A 39  ? 0.6288 0.5253 0.4414 0.2238  -0.0507 -0.0851 69  ASN A CA  
123  C C   . ASN A 39  ? 0.6034 0.5356 0.4277 0.2224  -0.0328 -0.0700 69  ASN A C   
124  O O   . ASN A 39  ? 0.7052 0.6555 0.5229 0.2239  -0.0213 -0.0644 69  ASN A O   
125  C CB  . ASN A 39  ? 0.6769 0.5522 0.4746 0.2454  -0.0580 -0.0968 69  ASN A CB  
126  C CG  . ASN A 39  ? 0.8446 0.7277 0.6155 0.2710  -0.0502 -0.1026 69  ASN A CG  
127  O OD1 . ASN A 39  ? 0.9355 0.8497 0.7078 0.2761  -0.0331 -0.0917 69  ASN A OD1 
128  N ND2 . ASN A 39  ? 1.0115 0.8670 0.7579 0.2870  -0.0624 -0.1203 69  ASN A ND2 
129  N N   . LEU A 40  ? 0.6042 0.5461 0.4463 0.2194  -0.0311 -0.0632 70  LEU A N   
130  C CA  . LEU A 40  ? 0.4936 0.4719 0.3523 0.2158  -0.0168 -0.0502 70  LEU A CA  
131  C C   . LEU A 40  ? 0.4597 0.4589 0.3073 0.2362  -0.0035 -0.0493 70  LEU A C   
132  O O   . LEU A 40  ? 0.4297 0.4191 0.2624 0.2585  -0.0058 -0.0576 70  LEU A O   
133  C CB  . LEU A 40  ? 0.5097 0.4933 0.3862 0.2136  -0.0205 -0.0451 70  LEU A CB  
134  C CG  . LEU A 40  ? 0.5275 0.5026 0.4193 0.1919  -0.0285 -0.0403 70  LEU A CG  
135  C CD1 . LEU A 40  ? 0.4015 0.3688 0.2991 0.1985  -0.0352 -0.0377 70  LEU A CD1 
136  C CD2 . LEU A 40  ? 0.4070 0.4111 0.3162 0.1730  -0.0199 -0.0305 70  LEU A CD2 
137  N N   . VAL A 41  ? 0.5097 0.5373 0.3650 0.2286  0.0112  -0.0389 71  VAL A N   
138  C CA  . VAL A 41  ? 0.6029 0.6579 0.4537 0.2453  0.0275  -0.0344 71  VAL A CA  
139  C C   . VAL A 41  ? 0.6999 0.7783 0.5703 0.2539  0.0299  -0.0315 71  VAL A C   
140  O O   . VAL A 41  ? 0.8654 0.9513 0.7586 0.2397  0.0243  -0.0268 71  VAL A O   
141  C CB  . VAL A 41  ? 0.5552 0.6357 0.4154 0.2313  0.0437  -0.0214 71  VAL A CB  
142  C CG1 . VAL A 41  ? 0.7587 0.8611 0.6528 0.2081  0.0450  -0.0121 71  VAL A CG1 
143  C CG2 . VAL A 41  ? 0.6995 0.8073 0.5532 0.2487  0.0622  -0.0158 71  VAL A CG2 
144  N N   . ASP A 42  ? 0.6917 0.7818 0.5515 0.2792  0.0377  -0.0348 72  ASP A N   
145  C CA  . ASP A 42  ? 0.9001 1.0142 0.7779 0.2918  0.0397  -0.0328 72  ASP A CA  
146  C C   . ASP A 42  ? 0.8575 1.0235 0.7649 0.2833  0.0567  -0.0192 72  ASP A C   
147  O O   . ASP A 42  ? 0.7874 0.9747 0.6911 0.2864  0.0737  -0.0135 72  ASP A O   
148  C CB  . ASP A 42  ? 1.0638 1.1678 0.9183 0.3252  0.0400  -0.0439 72  ASP A CB  
149  C CG  . ASP A 42  ? 1.2102 1.3170 1.0377 0.3394  0.0528  -0.0466 72  ASP A CG  
150  O OD1 . ASP A 42  ? 1.3125 1.4436 1.1349 0.3631  0.0660  -0.0470 72  ASP A OD1 
151  O OD2 . ASP A 42  ? 1.2560 1.3420 1.0665 0.3283  0.0501  -0.0480 72  ASP A OD2 
152  N N   . ASN A 43  ? 0.7710 0.9570 0.7077 0.2719  0.0517  -0.0137 73  ASN A N   
153  C CA  . ASN A 43  ? 0.6862 0.9231 0.6566 0.2614  0.0645  -0.0026 73  ASN A CA  
154  C C   . ASN A 43  ? 0.7585 1.0224 0.7503 0.2753  0.0599  -0.0024 73  ASN A C   
155  O O   . ASN A 43  ? 0.8794 1.1196 0.8665 0.2796  0.0437  -0.0070 73  ASN A O   
156  C CB  . ASN A 43  ? 0.5608 0.7997 0.5488 0.2287  0.0616  0.0039  73  ASN A CB  
157  C CG  . ASN A 43  ? 0.5091 0.7966 0.5306 0.2142  0.0758  0.0144  73  ASN A CG  
158  O OD1 . ASN A 43  ? 0.5476 0.8750 0.5934 0.2230  0.0801  0.0171  73  ASN A OD1 
159  N ND2 . ASN A 43  ? 0.4431 0.7273 0.4676 0.1918  0.0826  0.0202  73  ASN A ND2 
160  N N   . THR A 44  ? 0.7067 1.0208 0.7223 0.2826  0.0746  0.0036  74  THR A N   
161  C CA  . THR A 44  ? 0.7149 1.0604 0.7515 0.3007  0.0713  0.0033  74  THR A CA  
162  C C   . THR A 44  ? 0.5759 0.9742 0.6568 0.2823  0.0740  0.0121  74  THR A C   
163  O O   . THR A 44  ? 0.7430 1.1686 0.8448 0.2933  0.0669  0.0121  74  THR A O   
164  C CB  . THR A 44  ? 0.7416 1.1055 0.7693 0.3339  0.0846  -0.0002 74  THR A CB  
165  O OG1 . THR A 44  ? 0.7682 1.1717 0.8093 0.3279  0.1074  0.0082  74  THR A OG1 
166  C CG2 . THR A 44  ? 0.5535 0.8630 0.5358 0.3538  0.0787  -0.0119 74  THR A CG2 
167  N N   . ASN A 45  ? 0.4483 0.8600 0.5435 0.2549  0.0833  0.0189  75  ASN A N   
168  C CA  . ASN A 45  ? 0.5551 1.0091 0.6915 0.2320  0.0823  0.0249  75  ASN A CA  
169  C C   . ASN A 45  ? 0.5900 1.0250 0.7271 0.2220  0.0599  0.0211  75  ASN A C   
170  O O   . ASN A 45  ? 0.5203 0.9061 0.6266 0.2257  0.0482  0.0162  75  ASN A O   
171  C CB  . ASN A 45  ? 0.5920 1.0506 0.7380 0.2033  0.0949  0.0320  75  ASN A CB  
172  C CG  . ASN A 45  ? 0.5664 1.0496 0.7148 0.2110  0.1194  0.0392  75  ASN A CG  
173  O OD1 . ASN A 45  ? 0.6391 1.1679 0.8093 0.2268  0.1300  0.0418  75  ASN A OD1 
174  N ND2 . ASN A 45  ? 0.5305 0.9849 0.6559 0.2009  0.1293  0.0432  75  ASN A ND2 
175  N N   . GLN A 46  ? 0.6713 1.1463 0.8434 0.2091  0.0539  0.0235  76  GLN A N   
176  C CA  . GLN A 46  ? 0.5607 1.0214 0.7314 0.2007  0.0332  0.0207  76  GLN A CA  
177  C C   . GLN A 46  ? 0.4616 0.9117 0.6372 0.1676  0.0299  0.0209  76  GLN A C   
178  O O   . GLN A 46  ? 0.4649 0.9395 0.6631 0.1485  0.0411  0.0241  76  GLN A O   
179  C CB  . GLN A 46  ? 0.5794 1.0878 0.7804 0.2115  0.0240  0.0211  76  GLN A CB  
180  C CG  . GLN A 46  ? 0.7555 1.2725 0.9511 0.2476  0.0252  0.0201  76  GLN A CG  
181  C CD  . GLN A 46  ? 0.8816 1.3368 1.0331 0.2656  0.0183  0.0163  76  GLN A CD  
182  O OE1 . GLN A 46  ? 0.7862 1.2031 0.9184 0.2579  0.0039  0.0156  76  GLN A OE1 
183  N NE2 . GLN A 46  ? 1.0314 1.4772 1.1672 0.2897  0.0288  0.0136  76  GLN A NE2 
184  N N   . VAL A 47  ? 0.3587 0.7708 0.5125 0.1613  0.0152  0.0178  77  VAL A N   
185  C CA  . VAL A 47  ? 0.2873 0.6877 0.4429 0.1332  0.0101  0.0163  77  VAL A CA  
186  C C   . VAL A 47  ? 0.3515 0.7981 0.5428 0.1183  0.0036  0.0155  77  VAL A C   
187  O O   . VAL A 47  ? 0.3892 0.8612 0.5918 0.1302  -0.0079 0.0148  77  VAL A O   
188  C CB  . VAL A 47  ? 0.3641 0.7191 0.4897 0.1325  -0.0036 0.0136  77  VAL A CB  
189  C CG1 . VAL A 47  ? 0.2584 0.6041 0.3854 0.1058  -0.0082 0.0110  77  VAL A CG1 
190  C CG2 . VAL A 47  ? 0.5190 0.8287 0.6128 0.1445  0.0009  0.0128  77  VAL A CG2 
191  N N   . GLU A 48  ? 0.2874 0.7434 0.4959 0.0929  0.0099  0.0151  78  GLU A N   
192  C CA  . GLU A 48  ? 0.2839 0.7786 0.5264 0.0739  0.0021  0.0118  78  GLU A CA  
193  C C   . GLU A 48  ? 0.3370 0.8043 0.5640 0.0571  -0.0120 0.0053  78  GLU A C   
194  O O   . GLU A 48  ? 0.4528 0.8863 0.6647 0.0423  -0.0070 0.0042  78  GLU A O   
195  C CB  . GLU A 48  ? 0.2367 0.7573 0.5101 0.0546  0.0181  0.0152  78  GLU A CB  
196  C CG  . GLU A 48  ? 0.5145 1.0739 0.8270 0.0313  0.0099  0.0101  78  GLU A CG  
197  C CD  . GLU A 48  ? 0.7073 1.2840 1.0497 0.0085  0.0267  0.0148  78  GLU A CD  
198  O OE1 . GLU A 48  ? 0.8510 1.4118 1.1818 0.0129  0.0459  0.0235  78  GLU A OE1 
199  O OE2 . GLU A 48  ? 0.6934 1.2987 1.0703 -0.0141 0.0205  0.0099  78  GLU A OE2 
200  N N   . VAL A 49  ? 0.3771 0.8597 0.6065 0.0612  -0.0296 0.0011  79  VAL A N   
201  C CA  . VAL A 49  ? 0.2929 0.7535 0.5057 0.0477  -0.0428 -0.0053 79  VAL A CA  
202  C C   . VAL A 49  ? 0.2820 0.7799 0.5252 0.0288  -0.0532 -0.0134 79  VAL A C   
203  O O   . VAL A 49  ? 0.3532 0.8959 0.6220 0.0354  -0.0617 -0.0146 79  VAL A O   
204  C CB  . VAL A 49  ? 0.2616 0.7047 0.4461 0.0663  -0.0561 -0.0038 79  VAL A CB  
205  C CG1 . VAL A 49  ? 0.2882 0.7034 0.4496 0.0535  -0.0652 -0.0090 79  VAL A CG1 
206  C CG2 . VAL A 49  ? 0.2860 0.6968 0.4461 0.0865  -0.0479 0.0032  79  VAL A CG2 
207  N N   . LEU A 50  ? 0.3923 0.8716 0.6333 0.0058  -0.0536 -0.0200 80  LEU A N   
208  C CA  . LEU A 50  ? 0.3588 0.8662 0.6245 -0.0134 -0.0663 -0.0307 80  LEU A CA  
209  C C   . LEU A 50  ? 0.4926 0.9743 0.7281 -0.0165 -0.0812 -0.0393 80  LEU A C   
210  O O   . LEU A 50  ? 0.4892 0.9439 0.7155 -0.0337 -0.0797 -0.0460 80  LEU A O   
211  C CB  . LEU A 50  ? 0.3195 0.8291 0.6118 -0.0391 -0.0548 -0.0329 80  LEU A CB  
212  C CG  . LEU A 50  ? 0.4845 1.0162 0.8037 -0.0378 -0.0356 -0.0222 80  LEU A CG  
213  C CD1 . LEU A 50  ? 0.5167 1.0435 0.8584 -0.0650 -0.0235 -0.0221 80  LEU A CD1 
214  C CD2 . LEU A 50  ? 0.3528 0.9436 0.7067 -0.0268 -0.0403 -0.0207 80  LEU A CD2 
215  N N   . GLN A 51  ? 0.5122 1.0018 0.7310 0.0017  -0.0946 -0.0383 81  GLN A N   
216  C CA  . GLN A 51  ? 0.4487 0.9195 0.6368 0.0020  -0.1084 -0.0446 81  GLN A CA  
217  C C   . GLN A 51  ? 0.3462 0.8218 0.5445 -0.0215 -0.1167 -0.0598 81  GLN A C   
218  O O   . GLN A 51  ? 0.2332 0.7459 0.4676 -0.0340 -0.1231 -0.0673 81  GLN A O   
219  C CB  . GLN A 51  ? 0.6131 1.1090 0.7939 0.0222  -0.1246 -0.0421 81  GLN A CB  
220  C CG  . GLN A 51  ? 0.8061 1.2894 0.9702 0.0477  -0.1192 -0.0279 81  GLN A CG  
221  C CD  . GLN A 51  ? 0.9043 1.3411 1.0240 0.0562  -0.1182 -0.0217 81  GLN A CD  
222  O OE1 . GLN A 51  ? 1.0339 1.4549 1.1332 0.0467  -0.1235 -0.0275 81  GLN A OE1 
223  N NE2 . GLN A 51  ? 0.8433 1.2585 0.9486 0.0742  -0.1111 -0.0100 81  GLN A NE2 
224  N N   . ARG A 52  ? 0.5019 0.9400 0.6696 -0.0274 -0.1168 -0.0649 82  ARG A N   
225  C CA  . ARG A 52  ? 0.6935 1.1289 0.8644 -0.0473 -0.1254 -0.0812 82  ARG A CA  
226  C C   . ARG A 52  ? 0.7539 1.2337 0.9438 -0.0499 -0.1464 -0.0928 82  ARG A C   
227  O O   . ARG A 52  ? 0.6825 1.1826 0.9047 -0.0695 -0.1518 -0.1044 82  ARG A O   
228  C CB  . ARG A 52  ? 0.7392 1.1348 0.8680 -0.0448 -0.1254 -0.0848 82  ARG A CB  
229  C CG  . ARG A 52  ? 0.7294 1.1145 0.8555 -0.0626 -0.1328 -0.1028 82  ARG A CG  
230  C CD  . ARG A 52  ? 0.8510 1.2045 0.9338 -0.0548 -0.1328 -0.1052 82  ARG A CD  
231  N NE  . ARG A 52  ? 0.9506 1.3111 1.0088 -0.0339 -0.1373 -0.0943 82  ARG A NE  
232  C CZ  . ARG A 52  ? 1.0977 1.4359 1.1183 -0.0240 -0.1355 -0.0911 82  ARG A CZ  
233  N NH1 . ARG A 52  ? 1.1785 1.4889 1.1823 -0.0317 -0.1296 -0.0995 82  ARG A NH1 
234  N NH2 . ARG A 52  ? 1.0988 1.4426 1.0992 -0.0060 -0.1389 -0.0789 82  ARG A NH2 
235  N N   . ASP A 53  ? 0.8710 1.3651 1.0411 -0.0301 -0.1588 -0.0893 83  ASP A N   
236  C CA  . ASP A 53  ? 0.9668 1.5072 1.1535 -0.0273 -0.1806 -0.0986 83  ASP A CA  
237  C C   . ASP A 53  ? 0.9452 1.5264 1.1638 -0.0147 -0.1803 -0.0884 83  ASP A C   
238  O O   . ASP A 53  ? 0.9002 1.4752 1.1009 0.0081  -0.1763 -0.0740 83  ASP A O   
239  C CB  . ASP A 53  ? 0.9991 1.5330 1.1427 -0.0107 -0.1952 -0.0999 83  ASP A CB  
240  N N   . PRO A 54  ? 0.9249 1.5479 1.1923 -0.0296 -0.1843 -0.0961 84  PRO A N   
241  C CA  . PRO A 54  ? 0.8436 1.5112 1.1477 -0.0186 -0.1818 -0.0873 84  PRO A CA  
242  C C   . PRO A 54  ? 0.8961 1.5940 1.1899 0.0073  -0.2008 -0.0848 84  PRO A C   
243  O O   . PRO A 54  ? 0.8656 1.5951 1.1805 0.0243  -0.1991 -0.0756 84  PRO A O   
244  C CB  . PRO A 54  ? 0.8585 1.5668 1.2169 -0.0447 -0.1859 -0.0995 84  PRO A CB  
245  C CG  . PRO A 54  ? 0.9126 1.5830 1.2605 -0.0702 -0.1837 -0.1114 84  PRO A CG  
246  C CD  . PRO A 54  ? 0.9685 1.6009 1.2608 -0.0577 -0.1923 -0.1143 84  PRO A CD  
247  N N   . ASN A 55  ? 0.9041 1.5919 1.1641 0.0118  -0.2184 -0.0927 85  ASN A N   
248  C CA  . ASN A 55  ? 1.0003 1.7104 1.2418 0.0381  -0.2370 -0.0887 85  ASN A CA  
249  C C   . ASN A 55  ? 0.9723 1.6455 1.1742 0.0640  -0.2260 -0.0688 85  ASN A C   
250  O O   . ASN A 55  ? 0.9602 1.6530 1.1699 0.0865  -0.2273 -0.0577 85  ASN A O   
251  C CB  . ASN A 55  ? 1.0730 1.7831 1.2868 0.0350  -0.2588 -0.1034 85  ASN A CB  
252  C CG  . ASN A 55  ? 0.9148 1.6712 1.1701 0.0146  -0.2774 -0.1250 85  ASN A CG  
253  O OD1 . ASN A 55  ? 0.7232 1.5249 1.0306 0.0086  -0.2785 -0.1266 85  ASN A OD1 
254  N ND2 . ASN A 55  ? 0.9032 1.6491 1.1363 0.0038  -0.2920 -0.1423 85  ASN A ND2 
255  N N   . SER A 56  ? 0.9183 1.5380 1.0790 0.0606  -0.2155 -0.0649 86  SER A N   
256  C CA  . SER A 56  ? 0.9232 1.5027 1.0469 0.0807  -0.2045 -0.0467 86  SER A CA  
257  C C   . SER A 56  ? 0.9177 1.4991 1.0632 0.0915  -0.1900 -0.0348 86  SER A C   
258  O O   . SER A 56  ? 0.8427 1.4347 1.0217 0.0771  -0.1781 -0.0385 86  SER A O   
259  C CB  . SER A 56  ? 0.8426 1.3689 0.9322 0.0691  -0.1913 -0.0459 86  SER A CB  
260  O OG  . SER A 56  ? 0.7738 1.2924 0.8866 0.0448  -0.1795 -0.0553 86  SER A OG  
261  N N   . PRO A 57  ? 0.9525 1.5222 1.0773 0.1180  -0.1907 -0.0201 87  PRO A N   
262  C CA  . PRO A 57  ? 0.9321 1.5018 1.0723 0.1334  -0.1789 -0.0098 87  PRO A CA  
263  C C   . PRO A 57  ? 0.9633 1.4858 1.0920 0.1250  -0.1571 -0.0048 87  PRO A C   
264  O O   . PRO A 57  ? 1.0355 1.5248 1.1436 0.1087  -0.1515 -0.0078 87  PRO A O   
265  C CB  . PRO A 57  ? 1.0015 1.5611 1.1131 0.1637  -0.1885 0.0036  87  PRO A CB  
266  C CG  . PRO A 57  ? 1.0326 1.6041 1.1229 0.1646  -0.2080 -0.0005 87  PRO A CG  
267  C CD  . PRO A 57  ? 1.0364 1.5929 1.1206 0.1363  -0.2038 -0.0125 87  PRO A CD  
268  N N   . LEU A 58  ? 0.8622 1.3834 1.0038 0.1375  -0.1456 0.0020  88  LEU A N   
269  C CA  . LEU A 58  ? 0.7811 1.2594 0.9109 0.1333  -0.1268 0.0063  88  LEU A CA  
270  C C   . LEU A 58  ? 0.7445 1.1771 0.8366 0.1522  -0.1262 0.0181  88  LEU A C   
271  O O   . LEU A 58  ? 0.8105 1.2501 0.8959 0.1754  -0.1356 0.0254  88  LEU A O   
272  C CB  . LEU A 58  ? 0.6697 1.1707 0.8310 0.1377  -0.1142 0.0063  88  LEU A CB  
273  C CG  . LEU A 58  ? 0.7335 1.2834 0.9385 0.1192  -0.1124 -0.0027 88  LEU A CG  
274  C CD1 . LEU A 58  ? 0.7772 1.3617 1.0137 0.1323  -0.1025 0.0004  88  LEU A CD1 
275  C CD2 . LEU A 58  ? 0.7244 1.2518 0.9291 0.0911  -0.1017 -0.0085 88  LEU A CD2 
276  N N   . TYR A 59  ? 0.4287 0.8145 0.4977 0.1422  -0.1158 0.0201  89  TYR A N   
277  C CA  . TYR A 59  ? 0.5881 0.9282 0.6247 0.1561  -0.1143 0.0312  89  TYR A CA  
278  C C   . TYR A 59  ? 0.7275 1.0300 0.7587 0.1539  -0.0995 0.0321  89  TYR A C   
279  O O   . TYR A 59  ? 0.7120 1.0039 0.7461 0.1348  -0.0903 0.0259  89  TYR A O   
280  C CB  . TYR A 59  ? 0.6140 0.9330 0.6209 0.1489  -0.1204 0.0349  89  TYR A CB  
281  C CG  . TYR A 59  ? 0.7166 0.9907 0.6924 0.1620  -0.1191 0.0487  89  TYR A CG  
282  C CD1 . TYR A 59  ? 0.7412 0.9755 0.6966 0.1493  -0.1105 0.0517  89  TYR A CD1 
283  C CD2 . TYR A 59  ? 0.6494 0.9209 0.6184 0.1870  -0.1264 0.0588  89  TYR A CD2 
284  C CE1 . TYR A 59  ? 0.7054 0.8989 0.6362 0.1585  -0.1088 0.0649  89  TYR A CE1 
285  C CE2 . TYR A 59  ? 0.6680 0.8941 0.6093 0.1976  -0.1250 0.0722  89  TYR A CE2 
286  C CZ  . TYR A 59  ? 0.7606 0.9480 0.6840 0.1819  -0.1159 0.0754  89  TYR A CZ  
287  O OH  . TYR A 59  ? 0.9385 1.0810 0.8380 0.1898  -0.1140 0.0894  89  TYR A OH  
288  N N   . SER A 60  ? 0.6691 0.9506 0.6913 0.1747  -0.0984 0.0390  90  SER A N   
289  C CA  . SER A 60  ? 0.6645 0.9108 0.6800 0.1765  -0.0871 0.0384  90  SER A CA  
290  C C   . SER A 60  ? 0.6562 0.8548 0.6444 0.1890  -0.0898 0.0477  90  SER A C   
291  O O   . SER A 60  ? 0.7948 0.9912 0.7719 0.2038  -0.0993 0.0564  90  SER A O   
292  C CB  . SER A 60  ? 0.7476 1.0171 0.7840 0.1907  -0.0813 0.0344  90  SER A CB  
293  O OG  . SER A 60  ? 0.8576 1.1640 0.9201 0.1754  -0.0747 0.0270  90  SER A OG  
294  N N   . VAL A 61  ? 0.5943 0.7543 0.5720 0.1829  -0.0820 0.0459  91  VAL A N   
295  C CA  . VAL A 61  ? 0.6568 0.7686 0.6126 0.1923  -0.0840 0.0535  91  VAL A CA  
296  C C   . VAL A 61  ? 0.6952 0.7853 0.6514 0.2051  -0.0793 0.0477  91  VAL A C   
297  O O   . VAL A 61  ? 0.8262 0.9356 0.7960 0.2034  -0.0722 0.0386  91  VAL A O   
298  C CB  . VAL A 61  ? 0.6515 0.7327 0.5928 0.1719  -0.0809 0.0565  91  VAL A CB  
299  C CG1 . VAL A 61  ? 0.6113 0.7133 0.5481 0.1613  -0.0850 0.0612  91  VAL A CG1 
300  C CG2 . VAL A 61  ? 0.6315 0.7082 0.5807 0.1557  -0.0719 0.0458  91  VAL A CG2 
301  N N   . LYS A 62  ? 0.7026 0.7510 0.6422 0.2183  -0.0832 0.0532  92  LYS A N   
302  C CA  . LYS A 62  ? 0.7420 0.7651 0.6783 0.2329  -0.0809 0.0459  92  LYS A CA  
303  C C   . LYS A 62  ? 0.7026 0.6713 0.6230 0.2239  -0.0814 0.0462  92  LYS A C   
304  O O   . LYS A 62  ? 0.7414 0.6811 0.6556 0.2344  -0.0815 0.0387  92  LYS A O   
305  C CB  . LYS A 62  ? 0.8025 0.8277 0.7372 0.2632  -0.0869 0.0491  92  LYS A CB  
306  C CG  . LYS A 62  ? 0.9393 1.0229 0.8938 0.2729  -0.0880 0.0494  92  LYS A CG  
307  C CD  . LYS A 62  ? 1.0270 1.1487 1.0019 0.2653  -0.0777 0.0385  92  LYS A CD  
308  C CE  . LYS A 62  ? 1.0883 1.2711 1.0885 0.2697  -0.0787 0.0389  92  LYS A CE  
309  N NZ  . LYS A 62  ? 1.1489 1.3676 1.1705 0.2599  -0.0668 0.0306  92  LYS A NZ  
310  N N   . SER A 63  ? 0.6514 0.6074 0.5657 0.2046  -0.0817 0.0541  93  SER A N   
311  C CA  . SER A 63  ? 0.7637 0.6741 0.6687 0.1921  -0.0813 0.0550  93  SER A CA  
312  C C   . SER A 63  ? 0.6940 0.6115 0.6007 0.1663  -0.0768 0.0590  93  SER A C   
313  O O   . SER A 63  ? 0.6974 0.6469 0.6065 0.1608  -0.0759 0.0636  93  SER A O   
314  C CB  . SER A 63  ? 0.8617 0.7291 0.7520 0.2045  -0.0878 0.0662  93  SER A CB  
315  O OG  . SER A 63  ? 0.9605 0.8321 0.8428 0.2003  -0.0894 0.0825  93  SER A OG  
316  N N   . PHE A 64  ? 0.6515 0.5401 0.5575 0.1514  -0.0745 0.0559  94  PHE A N   
317  C CA  . PHE A 64  ? 0.5424 0.4371 0.4511 0.1285  -0.0692 0.0592  94  PHE A CA  
318  C C   . PHE A 64  ? 0.6754 0.5579 0.5727 0.1250  -0.0696 0.0767  94  PHE A C   
319  O O   . PHE A 64  ? 0.8174 0.7216 0.7128 0.1138  -0.0656 0.0819  94  PHE A O   
320  C CB  . PHE A 64  ? 0.6333 0.5040 0.5477 0.1147  -0.0674 0.0505  94  PHE A CB  
321  C CG  . PHE A 64  ? 0.6340 0.5209 0.5566 0.1153  -0.0657 0.0345  94  PHE A CG  
322  C CD1 . PHE A 64  ? 0.6018 0.4664 0.5227 0.1253  -0.0696 0.0237  94  PHE A CD1 
323  C CD2 . PHE A 64  ? 0.6724 0.5945 0.6022 0.1066  -0.0602 0.0304  94  PHE A CD2 
324  C CE1 . PHE A 64  ? 0.6868 0.5661 0.6111 0.1273  -0.0673 0.0107  94  PHE A CE1 
325  C CE2 . PHE A 64  ? 0.6643 0.5985 0.5996 0.1074  -0.0576 0.0182  94  PHE A CE2 
326  C CZ  . PHE A 64  ? 0.6363 0.5501 0.5679 0.1182  -0.0608 0.0091  94  PHE A CZ  
327  N N   . GLU A 65  ? 0.7989 0.6445 0.6864 0.1355  -0.0741 0.0859  95  GLU A N   
328  C CA  . GLU A 65  ? 1.0592 0.8870 0.9327 0.1340  -0.0737 0.1057  95  GLU A CA  
329  C C   . GLU A 65  ? 0.9784 0.8434 0.8433 0.1405  -0.0746 0.1136  95  GLU A C   
330  O O   . GLU A 65  ? 0.8024 0.6721 0.6572 0.1309  -0.0706 0.1256  95  GLU A O   
331  C CB  . GLU A 65  ? 1.3122 1.0956 1.1755 0.1504  -0.0801 0.1139  95  GLU A CB  
332  C CG  . GLU A 65  ? 1.5501 1.2879 1.4192 0.1401  -0.0803 0.1092  95  GLU A CG  
333  C CD  . GLU A 65  ? 1.7198 1.4251 1.5835 0.1243  -0.0757 0.1276  95  GLU A CD  
334  O OE1 . GLU A 65  ? 1.7553 1.4355 1.6031 0.1355  -0.0779 0.1452  95  GLU A OE1 
335  O OE2 . GLU A 65  ? 1.7492 1.4546 1.6250 0.1012  -0.0693 0.1254  95  GLU A OE2 
336  N N   . GLU A 66  ? 0.9146 0.8080 0.7844 0.1571  -0.0801 0.1059  96  GLU A N   
337  C CA  . GLU A 66  ? 0.7914 0.7250 0.6576 0.1642  -0.0839 0.1095  96  GLU A CA  
338  C C   . GLU A 66  ? 0.7006 0.6653 0.5707 0.1444  -0.0786 0.1044  96  GLU A C   
339  O O   . GLU A 66  ? 0.8332 0.8273 0.6970 0.1467  -0.0822 0.1076  96  GLU A O   
340  C CB  . GLU A 66  ? 0.8205 0.7828 0.6998 0.1822  -0.0894 0.0988  96  GLU A CB  
341  C CG  . GLU A 66  ? 1.0213 1.0225 0.8995 0.1951  -0.0970 0.1030  96  GLU A CG  
342  C CD  . GLU A 66  ? 1.1906 1.2169 1.0842 0.2155  -0.1018 0.0948  96  GLU A CD  
343  O OE1 . GLU A 66  ? 0.9884 0.9966 0.8885 0.2222  -0.0987 0.0873  96  GLU A OE1 
344  O OE2 . GLU A 66  ? 1.3488 1.4149 1.2485 0.2255  -0.1089 0.0953  96  GLU A OE2 
345  N N   . LEU A 67  ? 0.5012 0.4592 0.3811 0.1262  -0.0711 0.0955  97  LEU A N   
346  C CA  . LEU A 67  ? 0.4980 0.4829 0.3825 0.1091  -0.0658 0.0885  97  LEU A CA  
347  C C   . LEU A 67  ? 0.6095 0.5803 0.4824 0.0947  -0.0588 0.0988  97  LEU A C   
348  O O   . LEU A 67  ? 0.5537 0.5434 0.4284 0.0815  -0.0536 0.0931  97  LEU A O   
349  C CB  . LEU A 67  ? 0.5261 0.5176 0.4288 0.0997  -0.0616 0.0720  97  LEU A CB  
350  C CG  . LEU A 67  ? 0.5196 0.5308 0.4357 0.1102  -0.0646 0.0609  97  LEU A CG  
351  C CD1 . LEU A 67  ? 0.6612 0.6621 0.5878 0.1032  -0.0596 0.0492  97  LEU A CD1 
352  C CD2 . LEU A 67  ? 0.3751 0.4283 0.2985 0.1083  -0.0665 0.0557  97  LEU A CD2 
353  N N   . ARG A 68  ? 0.6772 0.6143 0.5384 0.0977  -0.0579 0.1142  98  ARG A N   
354  C CA  . ARG A 68  ? 0.8073 0.7311 0.6585 0.0840  -0.0491 0.1269  98  ARG A CA  
355  C C   . ARG A 68  ? 0.7666 0.7015 0.6324 0.0645  -0.0406 0.1154  98  ARG A C   
356  O O   . ARG A 68  ? 0.7924 0.7503 0.6525 0.0569  -0.0353 0.1147  98  ARG A O   
357  C CB  . ARG A 68  ? 0.9018 0.8446 0.7304 0.0897  -0.0496 0.1389  98  ARG A CB  
358  C CG  . ARG A 68  ? 1.0346 0.9562 0.8460 0.0824  -0.0403 0.1593  98  ARG A CG  
359  C CD  . ARG A 68  ? 1.0220 0.9705 0.8104 0.0842  -0.0380 0.1660  98  ARG A CD  
360  N NE  . ARG A 68  ? 0.9048 0.8800 0.7011 0.0697  -0.0310 0.1520  98  ARG A NE  
361  C CZ  . ARG A 68  ? 0.8776 0.8873 0.6738 0.0719  -0.0367 0.1366  98  ARG A CZ  
362  N NH1 . ARG A 68  ? 0.7462 0.7724 0.5372 0.0869  -0.0497 0.1334  98  ARG A NH1 
363  N NH2 . ARG A 68  ? 0.8424 0.8701 0.6449 0.0593  -0.0299 0.1241  98  ARG A NH2 
364  N N   . LEU A 69  ? 0.5794 0.4980 0.4629 0.0583  -0.0401 0.1055  99  LEU A N   
365  C CA  . LEU A 69  ? 0.4241 0.3527 0.3227 0.0422  -0.0336 0.0942  99  LEU A CA  
366  C C   . LEU A 69  ? 0.5272 0.4398 0.4281 0.0274  -0.0246 0.1052  99  LEU A C   
367  O O   . LEU A 69  ? 0.4917 0.3745 0.3883 0.0275  -0.0243 0.1191  99  LEU A O   
368  C CB  . LEU A 69  ? 0.5106 0.4306 0.4256 0.0431  -0.0381 0.0786  99  LEU A CB  
369  C CG  . LEU A 69  ? 0.5707 0.5072 0.4877 0.0562  -0.0444 0.0672  99  LEU A CG  
370  C CD1 . LEU A 69  ? 0.3593 0.2840 0.2885 0.0568  -0.0468 0.0536  99  LEU A CD1 
371  C CD2 . LEU A 69  ? 0.6305 0.6030 0.5478 0.0529  -0.0422 0.0607  99  LEU A CD2 
372  N N   . LYS A 70  ? 0.4817 0.4139 0.3905 0.0147  -0.0167 0.0993  100 LYS A N   
373  C CA  . LYS A 70  ? 0.6113 0.5351 0.5288 -0.0006 -0.0066 0.1078  100 LYS A CA  
374  C C   . LYS A 70  ? 0.7023 0.5937 0.6363 -0.0059 -0.0107 0.1074  100 LYS A C   
375  O O   . LYS A 70  ? 0.7254 0.6126 0.6717 -0.0034 -0.0185 0.0916  100 LYS A O   
376  C CB  . LYS A 70  ? 0.7926 0.7436 0.7221 -0.0107 0.0003  0.0958  100 LYS A CB  
377  C CG  . LYS A 70  ? 0.8804 0.8594 0.7923 -0.0080 0.0061  0.0972  100 LYS A CG  
378  C CD  . LYS A 70  ? 0.7589 0.7623 0.6796 -0.0101 0.0064  0.0783  100 LYS A CD  
379  C CE  . LYS A 70  ? 0.8120 0.8211 0.7524 -0.0225 0.0152  0.0744  100 LYS A CE  
380  N NZ  . LYS A 70  ? 0.7961 0.8261 0.7423 -0.0221 0.0154  0.0568  100 LYS A NZ  
381  N N   . PRO A 71  ? 0.7852 0.6520 0.7184 -0.0132 -0.0057 0.1248  101 PRO A N   
382  C CA  . PRO A 71  ? 0.7995 0.6296 0.7474 -0.0190 -0.0108 0.1256  101 PRO A CA  
383  C C   . PRO A 71  ? 0.7145 0.5475 0.6872 -0.0261 -0.0166 0.1046  101 PRO A C   
384  O O   . PRO A 71  ? 0.7202 0.5349 0.6943 -0.0171 -0.0280 0.0930  101 PRO A O   
385  C CB  . PRO A 71  ? 0.6703 0.4886 0.6222 -0.0349 0.0014  0.1462  101 PRO A CB  
386  C CG  . PRO A 71  ? 0.7036 0.5391 0.6286 -0.0274 0.0095  0.1618  101 PRO A CG  
387  C CD  . PRO A 71  ? 0.7478 0.6206 0.6660 -0.0177 0.0062  0.1452  101 PRO A CD  
388  N N   . GLN A 72  ? 0.7476 0.6040 0.7379 -0.0402 -0.0092 0.0996  102 GLN A N   
389  C CA  . GLN A 72  ? 0.7548 0.6146 0.7688 -0.0466 -0.0156 0.0807  102 GLN A CA  
390  C C   . GLN A 72  ? 0.6940 0.5647 0.7009 -0.0317 -0.0249 0.0623  102 GLN A C   
391  O O   . GLN A 72  ? 0.6894 0.5511 0.7069 -0.0303 -0.0343 0.0473  102 GLN A O   
392  C CB  . GLN A 72  ? 0.7988 0.6864 0.8339 -0.0623 -0.0055 0.0795  102 GLN A CB  
393  C CG  . GLN A 72  ? 0.9165 0.8408 0.9423 -0.0570 0.0016  0.0747  102 GLN A CG  
394  C CD  . GLN A 72  ? 1.0906 1.0249 1.0950 -0.0550 0.0131  0.0919  102 GLN A CD  
395  O OE1 . GLN A 72  ? 1.0918 1.0063 1.0878 -0.0578 0.0170  0.1100  102 GLN A OE1 
396  N NE2 . GLN A 72  ? 1.1698 1.1331 1.1634 -0.0496 0.0179  0.0862  102 GLN A NE2 
397  N N   . LEU A 73  ? 0.6360 0.5260 0.6244 -0.0209 -0.0223 0.0637  103 LEU A N   
398  C CA  . LEU A 73  ? 0.4259 0.3268 0.4081 -0.0079 -0.0290 0.0493  103 LEU A CA  
399  C C   . LEU A 73  ? 0.4604 0.3360 0.4346 0.0056  -0.0390 0.0468  103 LEU A C   
400  O O   . LEU A 73  ? 0.5505 0.4245 0.5267 0.0133  -0.0457 0.0328  103 LEU A O   
401  C CB  . LEU A 73  ? 0.3756 0.3029 0.3430 -0.0017 -0.0244 0.0519  103 LEU A CB  
402  C CG  . LEU A 73  ? 0.4509 0.3916 0.4151 0.0089  -0.0295 0.0386  103 LEU A CG  
403  C CD1 . LEU A 73  ? 0.5761 0.5191 0.5544 0.0047  -0.0313 0.0244  103 LEU A CD1 
404  C CD2 . LEU A 73  ? 0.6177 0.5855 0.5722 0.0109  -0.0255 0.0390  103 LEU A CD2 
405  N N   . LEU A 74  ? 0.4795 0.3354 0.4428 0.0103  -0.0395 0.0609  104 LEU A N   
406  C CA  . LEU A 74  ? 0.6000 0.4296 0.5548 0.0252  -0.0486 0.0594  104 LEU A CA  
407  C C   . LEU A 74  ? 0.7574 0.5574 0.7249 0.0201  -0.0558 0.0497  104 LEU A C   
408  O O   . LEU A 74  ? 0.8713 0.6569 0.8350 0.0328  -0.0645 0.0379  104 LEU A O   
409  C CB  . LEU A 74  ? 0.5834 0.3954 0.5233 0.0313  -0.0475 0.0785  104 LEU A CB  
410  C CG  . LEU A 74  ? 0.6527 0.4350 0.5827 0.0494  -0.0568 0.0783  104 LEU A CG  
411  C CD1 . LEU A 74  ? 0.5721 0.3789 0.4945 0.0682  -0.0605 0.0694  104 LEU A CD1 
412  C CD2 . LEU A 74  ? 0.5754 0.3320 0.4923 0.0525  -0.0556 0.0994  104 LEU A CD2 
413  N N   . GLN A 75  ? 0.7592 0.5521 0.7423 0.0014  -0.0520 0.0543  105 GLN A N   
414  C CA  . GLN A 75  ? 0.7640 0.5322 0.7640 -0.0076 -0.0598 0.0442  105 GLN A CA  
415  C C   . GLN A 75  ? 0.7703 0.5536 0.7759 -0.0024 -0.0668 0.0226  105 GLN A C   
416  O O   . GLN A 75  ? 0.8102 0.5714 0.8147 0.0052  -0.0780 0.0092  105 GLN A O   
417  C CB  . GLN A 75  ? 0.8702 0.6403 0.8913 -0.0308 -0.0522 0.0535  105 GLN A CB  
418  C CG  . GLN A 75  ? 1.0836 0.8265 1.1265 -0.0435 -0.0611 0.0451  105 GLN A CG  
419  C CD  . GLN A 75  ? 1.2300 0.9773 1.2971 -0.0679 -0.0515 0.0576  105 GLN A CD  
420  O OE1 . GLN A 75  ? 1.2637 1.0237 1.3250 -0.0732 -0.0375 0.0768  105 GLN A OE1 
421  N NE2 . GLN A 75  ? 1.2458 0.9845 1.3404 -0.0827 -0.0589 0.0465  105 GLN A NE2 
422  N N   . GLY A 76  ? 0.6699 0.4892 0.6786 -0.0052 -0.0603 0.0193  106 GLY A N   
423  C CA  . GLY A 76  ? 0.5083 0.3429 0.5192 0.0006  -0.0653 0.0017  106 GLY A CA  
424  C C   . GLY A 76  ? 0.6447 0.4754 0.6368 0.0211  -0.0704 -0.0058 106 GLY A C   
425  O O   . GLY A 76  ? 0.6851 0.5108 0.6753 0.0289  -0.0782 -0.0207 106 GLY A O   
426  N N   . VAL A 77  ? 0.4950 0.3301 0.4731 0.0306  -0.0659 0.0045  107 VAL A N   
427  C CA  . VAL A 77  ? 0.4997 0.3372 0.4633 0.0500  -0.0686 -0.0010 107 VAL A CA  
428  C C   . VAL A 77  ? 0.6278 0.4319 0.5851 0.0619  -0.0786 -0.0088 107 VAL A C   
429  O O   . VAL A 77  ? 0.7348 0.5391 0.6844 0.0751  -0.0828 -0.0214 107 VAL A O   
430  C CB  . VAL A 77  ? 0.5039 0.3559 0.4576 0.0576  -0.0632 0.0117  107 VAL A CB  
431  C CG1 . VAL A 77  ? 0.3993 0.2462 0.3415 0.0786  -0.0673 0.0081  107 VAL A CG1 
432  C CG2 . VAL A 77  ? 0.5256 0.4134 0.4815 0.0517  -0.0554 0.0127  107 VAL A CG2 
433  N N   . TYR A 78  ? 0.6548 0.4284 0.6139 0.0576  -0.0821 -0.0013 108 TYR A N   
434  C CA  . TYR A 78  ? 0.6438 0.3796 0.5966 0.0685  -0.0928 -0.0099 108 TYR A CA  
435  C C   . TYR A 78  ? 0.7502 0.4742 0.7125 0.0616  -0.1019 -0.0275 108 TYR A C   
436  O O   . TYR A 78  ? 0.7836 0.4905 0.7357 0.0760  -0.1111 -0.0425 108 TYR A O   
437  C CB  . TYR A 78  ? 0.6980 0.3995 0.6504 0.0646  -0.0942 0.0041  108 TYR A CB  
438  C CG  . TYR A 78  ? 0.9127 0.6188 0.8505 0.0790  -0.0895 0.0190  108 TYR A CG  
439  C CD1 . TYR A 78  ? 1.0407 0.7487 0.9645 0.1033  -0.0927 0.0129  108 TYR A CD1 
440  C CD2 . TYR A 78  ? 0.9028 0.6137 0.8405 0.0695  -0.0820 0.0391  108 TYR A CD2 
441  C CE1 . TYR A 78  ? 1.0976 0.8138 1.0109 0.1175  -0.0899 0.0257  108 TYR A CE1 
442  C CE2 . TYR A 78  ? 0.9986 0.7152 0.9219 0.0842  -0.0798 0.0520  108 TYR A CE2 
443  C CZ  . TYR A 78  ? 1.1271 0.8472 1.0399 0.1080  -0.0845 0.0449  108 TYR A CZ  
444  O OH  . TYR A 78  ? 1.2362 0.9660 1.1376 0.1236  -0.0838 0.0570  108 TYR A OH  
445  N N   . ALA A 79  ? 0.7884 0.5237 0.7698 0.0407  -0.0998 -0.0261 109 ALA A N   
446  C CA  . ALA A 79  ? 0.8570 0.5849 0.8517 0.0323  -0.1100 -0.0425 109 ALA A CA  
447  C C   . ALA A 79  ? 0.8420 0.5863 0.8255 0.0467  -0.1146 -0.0594 109 ALA A C   
448  O O   . ALA A 79  ? 0.8582 0.5889 0.8429 0.0489  -0.1270 -0.0764 109 ALA A O   
449  C CB  . ALA A 79  ? 0.7578 0.5035 0.7780 0.0083  -0.1049 -0.0366 109 ALA A CB  
450  N N   . MET A 80  ? 0.6819 0.4547 0.6539 0.0563  -0.1049 -0.0546 110 MET A N   
451  C CA  . MET A 80  ? 0.6599 0.4476 0.6195 0.0701  -0.1067 -0.0670 110 MET A CA  
452  C C   . MET A 80  ? 0.7883 0.5653 0.7253 0.0935  -0.1079 -0.0715 110 MET A C   
453  O O   . MET A 80  ? 0.8267 0.6174 0.7499 0.1072  -0.1063 -0.0787 110 MET A O   
454  C CB  . MET A 80  ? 0.4398 0.2637 0.4024 0.0653  -0.0957 -0.0608 110 MET A CB  
455  C CG  . MET A 80  ? 0.4325 0.2739 0.3898 0.0682  -0.0840 -0.0468 110 MET A CG  
456  S SD  . MET A 80  ? 0.7857 0.6623 0.7523 0.0558  -0.0732 -0.0405 110 MET A SD  
457  C CE  . MET A 80  ? 0.3685 0.2516 0.3297 0.0629  -0.0774 -0.0548 110 MET A CE  
458  N N   . GLY A 81  ? 0.6245 0.3768 0.5577 0.0989  -0.1102 -0.0666 111 GLY A N   
459  C CA  . GLY A 81  ? 0.5022 0.2396 0.4158 0.1227  -0.1133 -0.0731 111 GLY A CA  
460  C C   . GLY A 81  ? 0.6587 0.4160 0.5644 0.1362  -0.1027 -0.0614 111 GLY A C   
461  O O   . GLY A 81  ? 0.6290 0.3792 0.5199 0.1579  -0.1039 -0.0669 111 GLY A O   
462  N N   . PHE A 82  ? 0.5597 0.3430 0.4755 0.1247  -0.0931 -0.0464 112 PHE A N   
463  C CA  . PHE A 82  ? 0.6407 0.4469 0.5522 0.1363  -0.0850 -0.0364 112 PHE A CA  
464  C C   . PHE A 82  ? 0.8302 0.6145 0.7385 0.1438  -0.0881 -0.0269 112 PHE A C   
465  O O   . PHE A 82  ? 0.9103 0.6811 0.8254 0.1298  -0.0890 -0.0163 112 PHE A O   
466  C CB  . PHE A 82  ? 0.6031 0.4453 0.5247 0.1223  -0.0753 -0.0262 112 PHE A CB  
467  C CG  . PHE A 82  ? 0.6120 0.4728 0.5364 0.1150  -0.0718 -0.0335 112 PHE A CG  
468  C CD1 . PHE A 82  ? 0.5881 0.4395 0.5034 0.1243  -0.0762 -0.0472 112 PHE A CD1 
469  C CD2 . PHE A 82  ? 0.5184 0.4049 0.4523 0.1005  -0.0646 -0.0270 112 PHE A CD2 
470  C CE1 . PHE A 82  ? 0.5451 0.4120 0.4605 0.1194  -0.0734 -0.0523 112 PHE A CE1 
471  C CE2 . PHE A 82  ? 0.5868 0.4869 0.5221 0.0953  -0.0616 -0.0331 112 PHE A CE2 
472  C CZ  . PHE A 82  ? 0.5621 0.4523 0.4882 0.1049  -0.0660 -0.0448 112 PHE A CZ  
473  N N   . ASN A 83  ? 0.9244 0.7056 0.8218 0.1671  -0.0891 -0.0298 113 ASN A N   
474  C CA  . ASN A 83  ? 0.9851 0.7458 0.8777 0.1787  -0.0926 -0.0206 113 ASN A CA  
475  C C   . ASN A 83  ? 0.8700 0.6638 0.7677 0.1793  -0.0858 -0.0050 113 ASN A C   
476  O O   . ASN A 83  ? 0.7827 0.5649 0.6807 0.1743  -0.0873 0.0086  113 ASN A O   
477  C CB  . ASN A 83  ? 1.1035 0.8467 0.9822 0.2065  -0.0973 -0.0316 113 ASN A CB  
478  C CG  . ASN A 83  ? 1.3940 1.0827 1.2651 0.2088  -0.1091 -0.0404 113 ASN A CG  
479  O OD1 . ASN A 83  ? 1.5433 1.2064 1.4219 0.1895  -0.1132 -0.0344 113 ASN A OD1 
480  N ND2 . ASN A 83  ? 1.5045 1.1750 1.3611 0.2324  -0.1142 -0.0551 113 ASN A ND2 
481  N N   . ARG A 84  ? 0.7750 0.6100 0.6763 0.1854  -0.0787 -0.0071 114 ARG A N   
482  C CA  . ARG A 84  ? 0.6115 0.4827 0.5198 0.1865  -0.0739 0.0044  114 ARG A CA  
483  C C   . ARG A 84  ? 0.5712 0.4838 0.4895 0.1764  -0.0654 0.0013  114 ARG A C   
484  O O   . ARG A 84  ? 0.6666 0.5799 0.5834 0.1749  -0.0625 -0.0089 114 ARG A O   
485  C CB  . ARG A 84  ? 0.7273 0.6040 0.6315 0.2133  -0.0759 0.0059  114 ARG A CB  
486  C CG  . ARG A 84  ? 0.9120 0.7972 0.8125 0.2321  -0.0727 -0.0073 114 ARG A CG  
487  C CD  . ARG A 84  ? 1.1348 1.0080 1.0275 0.2613  -0.0769 -0.0084 114 ARG A CD  
488  N NE  . ARG A 84  ? 1.2886 1.1847 1.1887 0.2693  -0.0781 0.0046  114 ARG A NE  
489  C CZ  . ARG A 84  ? 1.2633 1.2107 1.1778 0.2743  -0.0721 0.0076  114 ARG A CZ  
490  N NH1 . ARG A 84  ? 1.3161 1.2956 1.2391 0.2708  -0.0626 0.0003  114 ARG A NH1 
491  N NH2 . ARG A 84  ? 1.0610 1.0281 0.9819 0.2823  -0.0759 0.0184  114 ARG A NH2 
492  N N   . PRO A 85  ? 0.6312 0.5767 0.5587 0.1695  -0.0621 0.0100  115 PRO A N   
493  C CA  . PRO A 85  ? 0.6538 0.6356 0.5922 0.1589  -0.0544 0.0071  115 PRO A CA  
494  C C   . PRO A 85  ? 0.7173 0.7210 0.6590 0.1743  -0.0487 0.0010  115 PRO A C   
495  O O   . PRO A 85  ? 0.6861 0.6893 0.6249 0.1951  -0.0505 0.0006  115 PRO A O   
496  C CB  . PRO A 85  ? 0.5712 0.5806 0.5176 0.1523  -0.0550 0.0166  115 PRO A CB  
497  C CG  . PRO A 85  ? 0.5925 0.5742 0.5289 0.1524  -0.0616 0.0255  115 PRO A CG  
498  C CD  . PRO A 85  ? 0.5256 0.4733 0.4525 0.1694  -0.0661 0.0227  115 PRO A CD  
499  N N   . SER A 86  ? 0.6767 0.6992 0.6241 0.1648  -0.0409 -0.0031 116 SER A N   
500  C CA  . SER A 86  ? 0.5770 0.6229 0.5278 0.1771  -0.0325 -0.0068 116 SER A CA  
501  C C   . SER A 86  ? 0.5374 0.6275 0.5076 0.1770  -0.0281 -0.0006 116 SER A C   
502  O O   . SER A 86  ? 0.6666 0.7687 0.6457 0.1658  -0.0325 0.0048  116 SER A O   
503  C CB  . SER A 86  ? 0.5323 0.5771 0.4792 0.1673  -0.0256 -0.0118 116 SER A CB  
504  O OG  . SER A 86  ? 0.4730 0.5335 0.4314 0.1460  -0.0226 -0.0079 116 SER A OG  
505  N N   . LYS A 87  ? 0.6626 0.7785 0.6397 0.1898  -0.0195 -0.0019 117 LYS A N   
506  C CA  . LYS A 87  ? 0.5394 0.7026 0.5403 0.1889  -0.0146 0.0030  117 LYS A CA  
507  C C   . LYS A 87  ? 0.4160 0.5950 0.4308 0.1634  -0.0154 0.0061  117 LYS A C   
508  O O   . LYS A 87  ? 0.5559 0.7586 0.5847 0.1598  -0.0211 0.0096  117 LYS A O   
509  C CB  . LYS A 87  ? 0.4673 0.6555 0.4746 0.1976  -0.0005 0.0017  117 LYS A CB  
510  C CG  . LYS A 87  ? 0.4336 0.6720 0.4674 0.2049  0.0050  0.0059  117 LYS A CG  
511  C CD  . LYS A 87  ? 0.7734 1.0130 0.8035 0.2333  -0.0001 0.0046  117 LYS A CD  
512  C CE  . LYS A 87  ? 0.8308 1.1207 0.8838 0.2475  0.0110  0.0066  117 LYS A CE  
513  N NZ  . LYS A 87  ? 0.7995 1.0929 0.8450 0.2523  0.0274  0.0048  117 LYS A NZ  
514  N N   . ILE A 88  ? 0.3311 0.4962 0.3404 0.1471  -0.0107 0.0039  118 ILE A N   
515  C CA  . ILE A 88  ? 0.2821 0.4594 0.3031 0.1240  -0.0106 0.0051  118 ILE A CA  
516  C C   . ILE A 88  ? 0.4337 0.5915 0.4462 0.1149  -0.0214 0.0056  118 ILE A C   
517  O O   . ILE A 88  ? 0.3929 0.5681 0.4154 0.1026  -0.0253 0.0066  118 ILE A O   
518  C CB  . ILE A 88  ? 0.2922 0.4603 0.3097 0.1117  -0.0013 0.0033  118 ILE A CB  
519  C CG1 . ILE A 88  ? 0.4548 0.6478 0.4923 0.0918  0.0025  0.0048  118 ILE A CG1 
520  C CG2 . ILE A 88  ? 0.2965 0.4261 0.2946 0.1060  -0.0063 -0.0004 118 ILE A CG2 
521  C CD1 . ILE A 88  ? 0.5786 0.8141 0.6412 0.0943  0.0076  0.0080  118 ILE A CD1 
522  N N   . GLN A 89  ? 0.4293 0.5517 0.4234 0.1209  -0.0262 0.0046  119 GLN A N   
523  C CA  . GLN A 89  ? 0.4795 0.5832 0.4653 0.1124  -0.0340 0.0070  119 GLN A CA  
524  C C   . GLN A 89  ? 0.6428 0.7609 0.6316 0.1198  -0.0415 0.0131  119 GLN A C   
525  O O   . GLN A 89  ? 0.6303 0.7514 0.6172 0.1099  -0.0462 0.0162  119 GLN A O   
526  C CB  . GLN A 89  ? 0.4562 0.5199 0.4257 0.1163  -0.0370 0.0051  119 GLN A CB  
527  C CG  . GLN A 89  ? 0.4581 0.5068 0.4235 0.1046  -0.0332 -0.0006 119 GLN A CG  
528  C CD  . GLN A 89  ? 0.4708 0.4863 0.4238 0.1120  -0.0367 -0.0055 119 GLN A CD  
529  O OE1 . GLN A 89  ? 0.5150 0.5128 0.4616 0.1235  -0.0422 -0.0044 119 GLN A OE1 
530  N NE2 . GLN A 89  ? 0.5348 0.5405 0.4842 0.1059  -0.0344 -0.0114 119 GLN A NE2 
531  N N   . GLU A 90  ? 0.6095 0.7374 0.6015 0.1391  -0.0427 0.0146  120 GLU A N   
532  C CA  . GLU A 90  ? 0.5898 0.7337 0.5849 0.1504  -0.0507 0.0207  120 GLU A CA  
533  C C   . GLU A 90  ? 0.5567 0.7363 0.5661 0.1374  -0.0536 0.0212  120 GLU A C   
534  O O   . GLU A 90  ? 0.6193 0.8047 0.6242 0.1397  -0.0624 0.0263  120 GLU A O   
535  C CB  . GLU A 90  ? 0.5317 0.6922 0.5345 0.1734  -0.0495 0.0203  120 GLU A CB  
536  C CG  . GLU A 90  ? 0.6793 0.8022 0.6651 0.1906  -0.0496 0.0183  120 GLU A CG  
537  C CD  . GLU A 90  ? 0.8734 1.0141 0.8655 0.2162  -0.0479 0.0168  120 GLU A CD  
538  O OE1 . GLU A 90  ? 0.8614 1.0475 0.8747 0.2179  -0.0427 0.0166  120 GLU A OE1 
539  O OE2 . GLU A 90  ? 0.9893 1.0987 0.9663 0.2347  -0.0515 0.0155  120 GLU A OE2 
540  N N   . ASN A 91  ? 0.4904 0.6920 0.5154 0.1240  -0.0466 0.0159  121 ASN A N   
541  C CA  . ASN A 91  ? 0.3865 0.6220 0.4280 0.1103  -0.0499 0.0138  121 ASN A CA  
542  C C   . ASN A 91  ? 0.5066 0.7285 0.5413 0.0890  -0.0492 0.0099  121 ASN A C   
543  O O   . ASN A 91  ? 0.5797 0.8192 0.6188 0.0792  -0.0557 0.0076  121 ASN A O   
544  C CB  . ASN A 91  ? 0.2429 0.5155 0.3112 0.1086  -0.0427 0.0109  121 ASN A CB  
545  C CG  . ASN A 91  ? 0.3882 0.6861 0.4681 0.1303  -0.0441 0.0140  121 ASN A CG  
546  O OD1 . ASN A 91  ? 0.4564 0.7515 0.5366 0.1433  -0.0354 0.0144  121 ASN A OD1 
547  N ND2 . ASN A 91  ? 0.3510 0.6744 0.4391 0.1364  -0.0556 0.0158  121 ASN A ND2 
548  N N   . ALA A 92  ? 0.4394 0.6309 0.4628 0.0833  -0.0423 0.0082  122 ALA A N   
549  C CA  . ALA A 92  ? 0.3639 0.5430 0.3820 0.0653  -0.0406 0.0040  122 ALA A CA  
550  C C   . ALA A 92  ? 0.5653 0.7236 0.5646 0.0641  -0.0462 0.0071  122 ALA A C   
551  O O   . ALA A 92  ? 0.5624 0.7277 0.5587 0.0539  -0.0497 0.0047  122 ALA A O   
552  C CB  . ALA A 92  ? 0.3151 0.4745 0.3305 0.0609  -0.0314 0.0010  122 ALA A CB  
553  N N   . LEU A 93  ? 0.5166 0.6489 0.5032 0.0743  -0.0466 0.0122  123 LEU A N   
554  C CA  . LEU A 93  ? 0.4763 0.5867 0.4467 0.0716  -0.0494 0.0173  123 LEU A CA  
555  C C   . LEU A 93  ? 0.4643 0.5913 0.4285 0.0717  -0.0564 0.0218  123 LEU A C   
556  O O   . LEU A 93  ? 0.4979 0.6217 0.4528 0.0617  -0.0559 0.0215  123 LEU A O   
557  C CB  . LEU A 93  ? 0.4970 0.5773 0.4578 0.0827  -0.0502 0.0228  123 LEU A CB  
558  C CG  . LEU A 93  ? 0.4779 0.5380 0.4400 0.0813  -0.0451 0.0167  123 LEU A CG  
559  C CD1 . LEU A 93  ? 0.5923 0.6199 0.5451 0.0906  -0.0480 0.0200  123 LEU A CD1 
560  C CD2 . LEU A 93  ? 0.3832 0.4385 0.3456 0.0650  -0.0408 0.0119  123 LEU A CD2 
561  N N   . PRO A 94  ? 0.4450 0.5916 0.4134 0.0846  -0.0631 0.0255  124 PRO A N   
562  C CA  . PRO A 94  ? 0.4694 0.6335 0.4297 0.0867  -0.0717 0.0294  124 PRO A CA  
563  C C   . PRO A 94  ? 0.4166 0.6050 0.3838 0.0719  -0.0734 0.0195  124 PRO A C   
564  O O   . PRO A 94  ? 0.5478 0.7385 0.5001 0.0682  -0.0775 0.0203  124 PRO A O   
565  C CB  . PRO A 94  ? 0.4107 0.5969 0.3807 0.1043  -0.0789 0.0327  124 PRO A CB  
566  C CG  . PRO A 94  ? 0.4768 0.6458 0.4522 0.1141  -0.0731 0.0334  124 PRO A CG  
567  C CD  . PRO A 94  ? 0.4699 0.6264 0.4502 0.0993  -0.0634 0.0258  124 PRO A CD  
568  N N   . LEU A 95  ? 0.4689 0.6736 0.4569 0.0638  -0.0699 0.0104  125 LEU A N   
569  C CA  . LEU A 95  ? 0.4102 0.6332 0.4065 0.0484  -0.0718 -0.0002 125 LEU A CA  
570  C C   . LEU A 95  ? 0.3853 0.5847 0.3670 0.0366  -0.0662 -0.0040 125 LEU A C   
571  O O   . LEU A 95  ? 0.4598 0.6670 0.4349 0.0287  -0.0704 -0.0107 125 LEU A O   
572  C CB  . LEU A 95  ? 0.3200 0.5611 0.3431 0.0411  -0.0672 -0.0069 125 LEU A CB  
573  C CG  . LEU A 95  ? 0.4637 0.7393 0.5083 0.0504  -0.0720 -0.0054 125 LEU A CG  
574  C CD1 . LEU A 95  ? 0.4370 0.7267 0.5072 0.0423  -0.0630 -0.0091 125 LEU A CD1 
575  C CD2 . LEU A 95  ? 0.5351 0.8417 0.5840 0.0496  -0.0861 -0.0096 125 LEU A CD2 
576  N N   . MET A 96  ? 0.4254 0.5973 0.4022 0.0366  -0.0575 -0.0007 126 MET A N   
577  C CA  . MET A 96  ? 0.4285 0.5808 0.3957 0.0266  -0.0515 -0.0044 126 MET A CA  
578  C C   . MET A 96  ? 0.5579 0.6993 0.5042 0.0290  -0.0522 0.0024  126 MET A C   
579  O O   . MET A 96  ? 0.5694 0.7045 0.5070 0.0213  -0.0484 -0.0017 126 MET A O   
580  C CB  . MET A 96  ? 0.4104 0.5407 0.3819 0.0261  -0.0433 -0.0041 126 MET A CB  
581  C CG  . MET A 96  ? 0.4397 0.5783 0.4279 0.0254  -0.0401 -0.0081 126 MET A CG  
582  S SD  . MET A 96  ? 0.6750 0.7872 0.6620 0.0277  -0.0321 -0.0080 126 MET A SD  
583  C CE  . MET A 96  ? 0.6584 0.7663 0.6484 0.0137  -0.0273 -0.0167 126 MET A CE  
584  N N   . LEU A 97  ? 0.6543 0.7926 0.5921 0.0405  -0.0561 0.0135  127 LEU A N   
585  C CA  . LEU A 97  ? 0.5118 0.6372 0.4290 0.0432  -0.0552 0.0237  127 LEU A CA  
586  C C   . LEU A 97  ? 0.5685 0.7142 0.4717 0.0483  -0.0636 0.0258  127 LEU A C   
587  O O   . LEU A 97  ? 0.6890 0.8270 0.5714 0.0525  -0.0630 0.0363  127 LEU A O   
588  C CB  . LEU A 97  ? 0.4327 0.5345 0.3465 0.0525  -0.0539 0.0362  127 LEU A CB  
589  C CG  . LEU A 97  ? 0.5719 0.6510 0.4956 0.0473  -0.0469 0.0334  127 LEU A CG  
590  C CD1 . LEU A 97  ? 0.6147 0.6672 0.5344 0.0556  -0.0473 0.0438  127 LEU A CD1 
591  C CD2 . LEU A 97  ? 0.5000 0.5736 0.4213 0.0344  -0.0395 0.0295  127 LEU A CD2 
592  N N   . ALA A 98  ? 0.5798 0.7523 0.4944 0.0478  -0.0716 0.0160  128 ALA A N   
593  C CA  . ALA A 98  ? 0.6838 0.8794 0.5863 0.0527  -0.0824 0.0149  128 ALA A CA  
594  C C   . ALA A 98  ? 0.7249 0.9188 0.6078 0.0449  -0.0799 0.0093  128 ALA A C   
595  O O   . ALA A 98  ? 0.6012 0.7843 0.4884 0.0339  -0.0715 0.0014  128 ALA A O   
596  C CB  . ALA A 98  ? 0.4835 0.7104 0.4083 0.0510  -0.0921 0.0035  128 ALA A CB  
597  N N   . GLU A 99  ? 0.7845 0.9896 0.6443 0.0528  -0.0874 0.0134  129 GLU A N   
598  C CA  . GLU A 99  ? 0.6889 0.8948 0.5250 0.0489  -0.0851 0.0084  129 GLU A CA  
599  C C   . GLU A 99  ? 0.8193 1.0542 0.6480 0.0516  -0.1006 -0.0042 129 GLU A C   
600  O O   . GLU A 99  ? 0.9230 1.1736 0.7450 0.0637  -0.1124 0.0022  129 GLU A O   
601  C CB  . GLU A 99  ? 0.6311 0.8206 0.4390 0.0571  -0.0778 0.0273  129 GLU A CB  
602  C CG  . GLU A 99  ? 0.9238 1.1095 0.7100 0.0521  -0.0685 0.0245  129 GLU A CG  
603  C CD  . GLU A 99  ? 1.0384 1.2076 0.8408 0.0400  -0.0547 0.0197  129 GLU A CD  
604  O OE1 . GLU A 99  ? 1.0570 1.2091 0.8767 0.0378  -0.0490 0.0279  129 GLU A OE1 
605  O OE2 . GLU A 99  ? 1.0947 1.2680 0.8919 0.0339  -0.0503 0.0069  129 GLU A OE2 
606  N N   . PRO A 100 ? 0.7761 1.0177 0.6066 0.0409  -0.1021 -0.0230 130 PRO A N   
607  C CA  . PRO A 100 ? 0.7675 0.9918 0.6054 0.0286  -0.0900 -0.0322 130 PRO A CA  
608  C C   . PRO A 100 ? 0.6901 0.9079 0.5622 0.0193  -0.0861 -0.0360 130 PRO A C   
609  O O   . PRO A 100 ? 0.6978 0.9318 0.5906 0.0192  -0.0947 -0.0384 130 PRO A O   
610  C CB  . PRO A 100 ? 0.7525 0.9893 0.5804 0.0234  -0.0984 -0.0530 130 PRO A CB  
611  C CG  . PRO A 100 ? 0.7278 0.9880 0.5371 0.0341  -0.1141 -0.0528 130 PRO A CG  
612  C CD  . PRO A 100 ? 0.6857 0.9538 0.5100 0.0419  -0.1189 -0.0381 130 PRO A CD  
613  N N   . PRO A 101 ? 0.6872 0.8838 0.5651 0.0125  -0.0732 -0.0367 131 PRO A N   
614  C CA  . PRO A 101 ? 0.7326 0.9184 0.6368 0.0059  -0.0673 -0.0376 131 PRO A CA  
615  C C   . PRO A 101 ? 0.7155 0.9157 0.6422 -0.0025 -0.0747 -0.0504 131 PRO A C   
616  O O   . PRO A 101 ? 0.7599 0.9628 0.6858 -0.0106 -0.0784 -0.0652 131 PRO A O   
617  C CB  . PRO A 101 ? 0.7460 0.9119 0.6460 0.0001  -0.0558 -0.0418 131 PRO A CB  
618  C CG  . PRO A 101 ? 0.8142 0.9784 0.6882 0.0059  -0.0517 -0.0354 131 PRO A CG  
619  C CD  . PRO A 101 ? 0.7895 0.9737 0.6472 0.0116  -0.0636 -0.0379 131 PRO A CD  
620  N N   . GLN A 102 ? 0.6492 0.8582 0.5966 -0.0007 -0.0763 -0.0447 132 GLN A N   
621  C CA  . GLN A 102 ? 0.5257 0.7511 0.4988 -0.0099 -0.0812 -0.0543 132 GLN A CA  
622  C C   . GLN A 102 ? 0.4687 0.6762 0.4579 -0.0182 -0.0700 -0.0552 132 GLN A C   
623  O O   . GLN A 102 ? 0.3135 0.5016 0.2983 -0.0132 -0.0606 -0.0464 132 GLN A O   
624  C CB  . GLN A 102 ? 0.5227 0.7747 0.5110 -0.0022 -0.0890 -0.0479 132 GLN A CB  
625  C CG  . GLN A 102 ? 0.6750 0.9425 0.6446 0.0100  -0.1004 -0.0436 132 GLN A CG  
626  C CD  . GLN A 102 ? 0.8749 1.1752 0.8637 0.0172  -0.1112 -0.0414 132 GLN A CD  
627  O OE1 . GLN A 102 ? 0.9805 1.2973 0.9995 0.0099  -0.1107 -0.0458 132 GLN A OE1 
628  N NE2 . GLN A 102 ? 0.7694 1.0804 0.7411 0.0321  -0.1205 -0.0337 132 GLN A NE2 
629  N N   . ASN A 103 ? 0.4466 0.6597 0.4539 -0.0309 -0.0716 -0.0658 133 ASN A N   
630  C CA  . ASN A 103 ? 0.4568 0.6536 0.4785 -0.0383 -0.0611 -0.0650 133 ASN A CA  
631  C C   . ASN A 103 ? 0.4687 0.6796 0.5112 -0.0351 -0.0571 -0.0554 133 ASN A C   
632  O O   . ASN A 103 ? 0.4233 0.6625 0.4780 -0.0316 -0.0643 -0.0536 133 ASN A O   
633  C CB  . ASN A 103 ? 0.4589 0.6514 0.4906 -0.0538 -0.0635 -0.0789 133 ASN A CB  
634  C CG  . ASN A 103 ? 0.4020 0.5754 0.4115 -0.0546 -0.0647 -0.0892 133 ASN A CG  
635  O OD1 . ASN A 103 ? 0.4132 0.5743 0.4029 -0.0451 -0.0598 -0.0841 133 ASN A OD1 
636  N ND2 . ASN A 103 ? 0.4731 0.6443 0.4868 -0.0660 -0.0710 -0.1044 133 ASN A ND2 
637  N N   . LEU A 104 ? 0.2713 0.4640 0.3169 -0.0346 -0.0456 -0.0494 134 LEU A N   
638  C CA  . LEU A 104 ? 0.2562 0.4598 0.3158 -0.0281 -0.0397 -0.0398 134 LEU A CA  
639  C C   . LEU A 104 ? 0.3770 0.5678 0.4466 -0.0349 -0.0282 -0.0375 134 LEU A C   
640  O O   . LEU A 104 ? 0.3363 0.4991 0.3933 -0.0364 -0.0227 -0.0385 134 LEU A O   
641  C CB  . LEU A 104 ? 0.3366 0.5295 0.3800 -0.0116 -0.0380 -0.0307 134 LEU A CB  
642  C CG  . LEU A 104 ? 0.4215 0.6167 0.4721 -0.0013 -0.0307 -0.0222 134 LEU A CG  
643  C CD1 . LEU A 104 ? 0.3674 0.5973 0.4373 0.0032  -0.0345 -0.0197 134 LEU A CD1 
644  C CD2 . LEU A 104 ? 0.3314 0.5054 0.3632 0.0124  -0.0298 -0.0164 134 LEU A CD2 
645  N N   . ILE A 105 ? 0.3419 0.5552 0.4346 -0.0382 -0.0243 -0.0337 135 ILE A N   
646  C CA  . ILE A 105 ? 0.2854 0.4897 0.3855 -0.0408 -0.0110 -0.0271 135 ILE A CA  
647  C C   . ILE A 105 ? 0.3454 0.5646 0.4482 -0.0252 -0.0053 -0.0175 135 ILE A C   
648  O O   . ILE A 105 ? 0.3021 0.5544 0.4234 -0.0224 -0.0083 -0.0160 135 ILE A O   
649  C CB  . ILE A 105 ? 0.2658 0.4846 0.3927 -0.0592 -0.0079 -0.0292 135 ILE A CB  
650  C CG1 . ILE A 105 ? 0.3460 0.5449 0.4689 -0.0741 -0.0139 -0.0406 135 ILE A CG1 
651  C CG2 . ILE A 105 ? 0.4036 0.6152 0.5366 -0.0600 0.0081  -0.0186 135 ILE A CG2 
652  C CD1 . ILE A 105 ? 0.4157 0.6269 0.5672 -0.0947 -0.0137 -0.0448 135 ILE A CD1 
653  N N   . ALA A 106 ? 0.2785 0.4743 0.3630 -0.0138 0.0019  -0.0122 136 ALA A N   
654  C CA  . ALA A 106 ? 0.2574 0.4624 0.3400 0.0032  0.0069  -0.0051 136 ALA A CA  
655  C C   . ALA A 106 ? 0.2907 0.4862 0.3703 0.0060  0.0211  0.0015  136 ALA A C   
656  O O   . ALA A 106 ? 0.2975 0.4629 0.3590 0.0063  0.0244  0.0016  136 ALA A O   
657  C CB  . ALA A 106 ? 0.2539 0.4410 0.3146 0.0181  0.0001  -0.0057 136 ALA A CB  
658  N N   . GLN A 107 ? 0.3328 0.5559 0.4297 0.0093  0.0297  0.0076  137 GLN A N   
659  C CA  . GLN A 107 ? 0.3472 0.5657 0.4397 0.0140  0.0451  0.0158  137 GLN A CA  
660  C C   . GLN A 107 ? 0.4254 0.6539 0.5093 0.0368  0.0487  0.0189  137 GLN A C   
661  O O   . GLN A 107 ? 0.4546 0.7141 0.5552 0.0436  0.0467  0.0192  137 GLN A O   
662  C CB  . GLN A 107 ? 0.4843 0.7270 0.6054 -0.0026 0.0558  0.0216  137 GLN A CB  
663  C CG  . GLN A 107 ? 0.6807 0.9318 0.8017 0.0046  0.0743  0.0330  137 GLN A CG  
664  C CD  . GLN A 107 ? 0.6424 0.9294 0.7746 0.0214  0.0783  0.0358  137 GLN A CD  
665  O OE1 . GLN A 107 ? 0.7233 1.0362 0.8731 0.0228  0.0680  0.0306  137 GLN A OE1 
666  N NE2 . GLN A 107 ? 0.5060 0.7945 0.6260 0.0363  0.0931  0.0438  137 GLN A NE2 
667  N N   . SER A 108 ? 0.4534 0.6552 0.5106 0.0498  0.0531  0.0203  138 SER A N   
668  C CA  . SER A 108 ? 0.4265 0.6330 0.4715 0.0728  0.0568  0.0215  138 SER A CA  
669  C C   . SER A 108 ? 0.3836 0.5609 0.3995 0.0830  0.0629  0.0228  138 SER A C   
670  O O   . SER A 108 ? 0.4001 0.5478 0.4010 0.0769  0.0575  0.0197  138 SER A O   
671  C CB  . SER A 108 ? 0.3702 0.5712 0.4086 0.0847  0.0424  0.0146  138 SER A CB  
672  O OG  . SER A 108 ? 0.5092 0.6730 0.5243 0.0861  0.0335  0.0091  138 SER A OG  
673  N N   . GLN A 109 ? 0.4368 0.6242 0.4441 0.1000  0.0739  0.0270  139 GLN A N   
674  C CA  . GLN A 109 ? 0.3972 0.5600 0.3739 0.1123  0.0798  0.0283  139 GLN A CA  
675  C C   . GLN A 109 ? 0.4563 0.5831 0.4087 0.1195  0.0641  0.0177  139 GLN A C   
676  O O   . GLN A 109 ? 0.4614 0.5842 0.4174 0.1219  0.0512  0.0103  139 GLN A O   
677  C CB  . GLN A 109 ? 0.3104 0.4913 0.2784 0.1340  0.0922  0.0317  139 GLN A CB  
678  C CG  . GLN A 109 ? 0.3361 0.5128 0.2929 0.1554  0.0819  0.0216  139 GLN A CG  
679  C CD  . GLN A 109 ? 0.4933 0.6935 0.4455 0.1776  0.0950  0.0242  139 GLN A CD  
680  O OE1 . GLN A 109 ? 0.5330 0.7713 0.5120 0.1774  0.1031  0.0293  139 GLN A OE1 
681  N NE2 . GLN A 109 ? 0.5209 0.7005 0.4389 0.1980  0.0968  0.0198  139 GLN A NE2 
682  N N   . SER A 110 ? 0.5260 0.6276 0.4546 0.1229  0.0651  0.0177  140 SER A N   
683  C CA  . SER A 110 ? 0.3968 0.4674 0.3068 0.1273  0.0499  0.0075  140 SER A CA  
684  C C   . SER A 110 ? 0.4636 0.5264 0.3586 0.1476  0.0418  -0.0019 140 SER A C   
685  O O   . SER A 110 ? 0.3766 0.4494 0.2609 0.1651  0.0499  -0.0008 140 SER A O   
686  C CB  . SER A 110 ? 0.2961 0.3451 0.1848 0.1284  0.0523  0.0096  140 SER A CB  
687  O OG  . SER A 110 ? 0.5297 0.5729 0.3910 0.1495  0.0568  0.0092  140 SER A OG  
688  N N   . GLY A 111 ? 0.3211 0.3654 0.2158 0.1453  0.0262  -0.0110 141 GLY A N   
689  C CA  . GLY A 111 ? 0.4082 0.4394 0.2913 0.1617  0.0165  -0.0205 141 GLY A CA  
690  C C   . GLY A 111 ? 0.4663 0.5117 0.3666 0.1631  0.0142  -0.0196 141 GLY A C   
691  O O   . GLY A 111 ? 0.4722 0.5094 0.3636 0.1797  0.0090  -0.0257 141 GLY A O   
692  N N   . THR A 112 ? 0.3077 0.3734 0.2314 0.1469  0.0170  -0.0126 142 THR A N   
693  C CA  . THR A 112 ? 0.4100 0.4922 0.3499 0.1488  0.0137  -0.0109 142 THR A CA  
694  C C   . THR A 112 ? 0.4675 0.5363 0.4141 0.1363  0.0014  -0.0124 142 THR A C   
695  O O   . THR A 112 ? 0.4140 0.4946 0.3720 0.1371  -0.0026 -0.0098 142 THR A O   
696  C CB  . THR A 112 ? 0.3686 0.4895 0.3319 0.1417  0.0247  -0.0024 142 THR A CB  
697  O OG1 . THR A 112 ? 0.5937 0.7176 0.5666 0.1205  0.0281  0.0014  142 THR A OG1 
698  C CG2 . THR A 112 ? 0.4647 0.6043 0.4244 0.1568  0.0386  0.0009  142 THR A CG2 
699  N N   . GLY A 113 ? 0.3579 0.4044 0.2973 0.1257  -0.0039 -0.0159 143 GLY A N   
700  C CA  . GLY A 113 ? 0.3757 0.4080 0.3188 0.1151  -0.0140 -0.0172 143 GLY A CA  
701  C C   . GLY A 113 ? 0.4937 0.5370 0.4495 0.0956  -0.0128 -0.0137 143 GLY A C   
702  O O   . GLY A 113 ? 0.5725 0.6118 0.5325 0.0881  -0.0190 -0.0127 143 GLY A O   
703  N N   . LYS A 114 ? 0.4482 0.5035 0.4088 0.0879  -0.0047 -0.0117 144 LYS A N   
704  C CA  . LYS A 114 ? 0.2817 0.3450 0.2532 0.0703  -0.0040 -0.0104 144 LYS A CA  
705  C C   . LYS A 114 ? 0.4150 0.4582 0.3809 0.0624  -0.0100 -0.0147 144 LYS A C   
706  O O   . LYS A 114 ? 0.4188 0.4658 0.3907 0.0522  -0.0133 -0.0146 144 LYS A O   
707  C CB  . LYS A 114 ? 0.1986 0.2730 0.1759 0.0636  0.0060  -0.0074 144 LYS A CB  
708  C CG  . LYS A 114 ? 0.3029 0.4044 0.2925 0.0676  0.0137  -0.0022 144 LYS A CG  
709  C CD  . LYS A 114 ? 0.2763 0.3891 0.2771 0.0551  0.0237  0.0022  144 LYS A CD  
710  C CE  . LYS A 114 ? 0.3293 0.4229 0.3138 0.0591  0.0312  0.0046  144 LYS A CE  
711  N NZ  . LYS A 114 ? 0.2507 0.3386 0.2179 0.0792  0.0334  0.0046  144 LYS A NZ  
712  N N   . THR A 115 ? 0.3721 0.3965 0.3265 0.0679  -0.0113 -0.0186 145 THR A N   
713  C CA  . THR A 115 ? 0.3730 0.3828 0.3258 0.0609  -0.0165 -0.0231 145 THR A CA  
714  C C   . THR A 115 ? 0.3784 0.3804 0.3336 0.0594  -0.0240 -0.0239 145 THR A C   
715  O O   . THR A 115 ? 0.4368 0.4384 0.3974 0.0493  -0.0257 -0.0242 145 THR A O   
716  C CB  . THR A 115 ? 0.3837 0.3779 0.3249 0.0683  -0.0181 -0.0278 145 THR A CB  
717  O OG1 . THR A 115 ? 0.4718 0.4691 0.4106 0.0659  -0.0106 -0.0252 145 THR A OG1 
718  C CG2 . THR A 115 ? 0.3446 0.3270 0.2882 0.0635  -0.0259 -0.0334 145 THR A CG2 
719  N N   . ALA A 116 ? 0.3543 0.3495 0.3049 0.0700  -0.0278 -0.0238 146 ALA A N   
720  C CA  . ALA A 116 ? 0.4091 0.3932 0.3615 0.0686  -0.0342 -0.0224 146 ALA A CA  
721  C C   . ALA A 116 ? 0.5551 0.5544 0.5143 0.0609  -0.0324 -0.0153 146 ALA A C   
722  O O   . ALA A 116 ? 0.5324 0.5260 0.4935 0.0537  -0.0349 -0.0123 146 ALA A O   
723  C CB  . ALA A 116 ? 0.4075 0.3783 0.3522 0.0834  -0.0388 -0.0241 146 ALA A CB  
724  N N   . ALA A 117 ? 0.4509 0.4709 0.4137 0.0625  -0.0280 -0.0126 147 ALA A N   
725  C CA  . ALA A 117 ? 0.4162 0.4531 0.3844 0.0567  -0.0285 -0.0075 147 ALA A CA  
726  C C   . ALA A 117 ? 0.4897 0.5297 0.4599 0.0426  -0.0272 -0.0089 147 ALA A C   
727  O O   . ALA A 117 ? 0.4592 0.4964 0.4269 0.0383  -0.0295 -0.0055 147 ALA A O   
728  C CB  . ALA A 117 ? 0.4418 0.5036 0.4179 0.0600  -0.0251 -0.0061 147 ALA A CB  
729  N N   . PHE A 118 ? 0.5759 0.6204 0.5494 0.0363  -0.0229 -0.0135 148 PHE A N   
730  C CA  . PHE A 118 ? 0.4883 0.5363 0.4630 0.0250  -0.0216 -0.0163 148 PHE A CA  
731  C C   . PHE A 118 ? 0.4591 0.4930 0.4310 0.0219  -0.0224 -0.0178 148 PHE A C   
732  O O   . PHE A 118 ? 0.4261 0.4643 0.3976 0.0147  -0.0212 -0.0188 148 PHE A O   
733  C CB  . PHE A 118 ? 0.3812 0.4346 0.3603 0.0191  -0.0171 -0.0208 148 PHE A CB  
734  C CG  . PHE A 118 ? 0.4678 0.5063 0.4437 0.0222  -0.0142 -0.0234 148 PHE A CG  
735  C CD1 . PHE A 118 ? 0.3197 0.3465 0.2930 0.0202  -0.0151 -0.0274 148 PHE A CD1 
736  C CD2 . PHE A 118 ? 0.5720 0.6108 0.5474 0.0279  -0.0102 -0.0215 148 PHE A CD2 
737  C CE1 . PHE A 118 ? 0.4331 0.4477 0.4026 0.0248  -0.0142 -0.0301 148 PHE A CE1 
738  C CE2 . PHE A 118 ? 0.3771 0.4019 0.3456 0.0325  -0.0079 -0.0231 148 PHE A CE2 
739  C CZ  . PHE A 118 ? 0.4404 0.4526 0.4056 0.0313  -0.0109 -0.0277 148 PHE A CZ  
740  N N   . VAL A 119 ? 0.3921 0.4109 0.3627 0.0277  -0.0247 -0.0186 149 VAL A N   
741  C CA  . VAL A 119 ? 0.3411 0.3491 0.3140 0.0238  -0.0265 -0.0199 149 VAL A CA  
742  C C   . VAL A 119 ? 0.3510 0.3576 0.3232 0.0210  -0.0276 -0.0124 149 VAL A C   
743  O O   . VAL A 119 ? 0.5404 0.5490 0.5154 0.0133  -0.0252 -0.0105 149 VAL A O   
744  C CB  . VAL A 119 ? 0.2469 0.2393 0.2196 0.0302  -0.0309 -0.0245 149 VAL A CB  
745  C CG1 . VAL A 119 ? 0.2559 0.2376 0.2351 0.0255  -0.0348 -0.0244 149 VAL A CG1 
746  C CG2 . VAL A 119 ? 0.1879 0.1807 0.1598 0.0317  -0.0294 -0.0308 149 VAL A CG2 
747  N N   . LEU A 120 ? 0.3901 0.3938 0.3580 0.0283  -0.0306 -0.0073 150 LEU A N   
748  C CA  . LEU A 120 ? 0.3927 0.3935 0.3564 0.0280  -0.0318 0.0021  150 LEU A CA  
749  C C   . LEU A 120 ? 0.5752 0.5944 0.5353 0.0218  -0.0284 0.0052  150 LEU A C   
750  O O   . LEU A 120 ? 0.6535 0.6715 0.6097 0.0169  -0.0262 0.0119  150 LEU A O   
751  C CB  . LEU A 120 ? 0.3543 0.3517 0.3134 0.0403  -0.0360 0.0060  150 LEU A CB  
752  C CG  . LEU A 120 ? 0.5513 0.5350 0.5044 0.0439  -0.0391 0.0164  150 LEU A CG  
753  C CD1 . LEU A 120 ? 0.7017 0.6624 0.6584 0.0368  -0.0395 0.0176  150 LEU A CD1 
754  C CD2 . LEU A 120 ? 0.6505 0.6287 0.5999 0.0593  -0.0438 0.0178  150 LEU A CD2 
755  N N   . ALA A 121 ? 0.4509 0.4870 0.4120 0.0220  -0.0278 0.0002  151 ALA A N   
756  C CA  . ALA A 121 ? 0.4211 0.4743 0.3780 0.0165  -0.0266 -0.0006 151 ALA A CA  
757  C C   . ALA A 121 ? 0.5535 0.6055 0.5092 0.0083  -0.0216 -0.0034 151 ALA A C   
758  O O   . ALA A 121 ? 0.5184 0.5758 0.4657 0.0058  -0.0197 0.0013  151 ALA A O   
759  C CB  . ALA A 121 ? 0.3757 0.4435 0.3382 0.0154  -0.0272 -0.0078 151 ALA A CB  
760  N N   . MET A 122 ? 0.4721 0.5182 0.4351 0.0057  -0.0192 -0.0108 152 MET A N   
761  C CA  . MET A 122 ? 0.4481 0.4952 0.4130 0.0000  -0.0143 -0.0147 152 MET A CA  
762  C C   . MET A 122 ? 0.5801 0.6231 0.5456 -0.0029 -0.0115 -0.0065 152 MET A C   
763  O O   . MET A 122 ? 0.5937 0.6458 0.5548 -0.0068 -0.0060 -0.0045 152 MET A O   
764  C CB  . MET A 122 ? 0.4023 0.4418 0.3757 0.0007  -0.0140 -0.0225 152 MET A CB  
765  C CG  . MET A 122 ? 0.2670 0.3091 0.2396 0.0008  -0.0134 -0.0301 152 MET A CG  
766  S SD  . MET A 122 ? 0.6941 0.7236 0.6724 0.0051  -0.0138 -0.0359 152 MET A SD  
767  C CE  . MET A 122 ? 0.6369 0.6671 0.6129 0.0025  -0.0106 -0.0436 152 MET A CE  
768  N N   . LEU A 123 ? 0.4895 0.5181 0.4602 -0.0010 -0.0147 -0.0018 153 LEU A N   
769  C CA  . LEU A 123 ? 0.4831 0.5041 0.4583 -0.0062 -0.0121 0.0065  153 LEU A CA  
770  C C   . LEU A 123 ? 0.5580 0.5818 0.5206 -0.0067 -0.0090 0.0190  153 LEU A C   
771  O O   . LEU A 123 ? 0.6205 0.6423 0.5847 -0.0128 -0.0032 0.0279  153 LEU A O   
772  C CB  . LEU A 123 ? 0.4117 0.4128 0.3946 -0.0039 -0.0183 0.0069  153 LEU A CB  
773  C CG  . LEU A 123 ? 0.3963 0.3947 0.3916 -0.0045 -0.0212 -0.0042 153 LEU A CG  
774  C CD1 . LEU A 123 ? 0.6499 0.6278 0.6485 -0.0002 -0.0294 -0.0065 153 LEU A CD1 
775  C CD2 . LEU A 123 ? 0.3177 0.3260 0.3264 -0.0137 -0.0157 -0.0052 153 LEU A CD2 
776  N N   . SER A 124 ? 0.6060 0.6359 0.5565 0.0000  -0.0128 0.0203  154 SER A N   
777  C CA  . SER A 124 ? 0.4906 0.5247 0.4256 0.0023  -0.0119 0.0319  154 SER A CA  
778  C C   . SER A 124 ? 0.4918 0.5440 0.4171 -0.0015 -0.0055 0.0301  154 SER A C   
779  O O   . SER A 124 ? 0.6063 0.6604 0.5195 -0.0024 -0.0003 0.0413  154 SER A O   
780  C CB  . SER A 124 ? 0.3999 0.4383 0.3276 0.0121  -0.0200 0.0324  154 SER A CB  
781  O OG  . SER A 124 ? 0.4147 0.4342 0.3438 0.0186  -0.0244 0.0398  154 SER A OG  
782  N N   . GLN A 125 ? 0.5594 0.6230 0.4884 -0.0030 -0.0055 0.0163  155 GLN A N   
783  C CA  . GLN A 125 ? 0.5006 0.5802 0.4185 -0.0045 -0.0009 0.0110  155 GLN A CA  
784  C C   . GLN A 125 ? 0.5843 0.6668 0.5092 -0.0099 0.0091  0.0093  155 GLN A C   
785  O O   . GLN A 125 ? 0.7555 0.8501 0.6686 -0.0100 0.0161  0.0098  155 GLN A O   
786  C CB  . GLN A 125 ? 0.5897 0.6773 0.5085 -0.0036 -0.0064 -0.0039 155 GLN A CB  
787  C CG  . GLN A 125 ? 0.7553 0.8463 0.6726 0.0007  -0.0159 -0.0036 155 GLN A CG  
788  C CD  . GLN A 125 ? 0.8080 0.9091 0.7075 0.0055  -0.0196 0.0044  155 GLN A CD  
789  O OE1 . GLN A 125 ? 0.8595 0.9686 0.7431 0.0054  -0.0159 0.0048  155 GLN A OE1 
790  N NE2 . GLN A 125 ? 0.8348 0.9363 0.7350 0.0117  -0.0269 0.0108  155 GLN A NE2 
791  N N   . VAL A 126 ? 0.7240 0.7975 0.6681 -0.0131 0.0096  0.0066  156 VAL A N   
792  C CA  . VAL A 126 ? 0.6476 0.7277 0.6038 -0.0175 0.0178  0.0035  156 VAL A CA  
793  C C   . VAL A 126 ? 0.6363 0.7204 0.5918 -0.0226 0.0274  0.0179  156 VAL A C   
794  O O   . VAL A 126 ? 0.5883 0.6593 0.5460 -0.0254 0.0260  0.0302  156 VAL A O   
795  C CB  . VAL A 126 ? 0.4343 0.5051 0.4116 -0.0189 0.0137  -0.0028 156 VAL A CB  
796  C CG1 . VAL A 126 ? 0.4560 0.5113 0.4417 -0.0218 0.0099  0.0067  156 VAL A CG1 
797  C CG2 . VAL A 126 ? 0.5223 0.6052 0.5140 -0.0214 0.0205  -0.0088 156 VAL A CG2 
798  N N   . GLU A 127 ? 0.7395 0.8409 0.6910 -0.0234 0.0379  0.0167  157 GLU A N   
799  C CA  . GLU A 127 ? 0.8933 1.0024 0.8471 -0.0293 0.0504  0.0310  157 GLU A CA  
800  C C   . GLU A 127 ? 0.8296 0.9504 0.8109 -0.0351 0.0576  0.0263  157 GLU A C   
801  O O   . GLU A 127 ? 0.7289 0.8677 0.7110 -0.0313 0.0639  0.0164  157 GLU A O   
802  C CB  . GLU A 127 ? 0.9405 1.0645 0.8670 -0.0244 0.0589  0.0351  157 GLU A CB  
803  C CG  . GLU A 127 ? 1.2318 1.3702 1.1604 -0.0296 0.0761  0.0486  157 GLU A CG  
804  C CD  . GLU A 127 ? 1.4013 1.5249 1.3375 -0.0384 0.0794  0.0696  157 GLU A CD  
805  O OE1 . GLU A 127 ? 1.3240 1.4318 1.2837 -0.0447 0.0718  0.0690  157 GLU A OE1 
806  O OE2 . GLU A 127 ? 1.4925 1.6189 1.4099 -0.0386 0.0896  0.0867  157 GLU A OE2 
807  N N   . PRO A 128 ? 0.8759 0.9869 0.8809 -0.0435 0.0554  0.0321  158 PRO A N   
808  C CA  . PRO A 128 ? 0.9663 1.0904 1.0024 -0.0497 0.0592  0.0268  158 PRO A CA  
809  C C   . PRO A 128 ? 0.9529 1.1051 0.9944 -0.0523 0.0766  0.0315  158 PRO A C   
810  O O   . PRO A 128 ? 0.8754 1.0465 0.9393 -0.0524 0.0800  0.0222  158 PRO A O   
811  C CB  . PRO A 128 ? 0.8532 0.9596 0.9083 -0.0603 0.0545  0.0364  158 PRO A CB  
812  C CG  . PRO A 128 ? 0.7521 0.8322 0.7873 -0.0547 0.0429  0.0385  158 PRO A CG  
813  C CD  . PRO A 128 ? 0.7986 0.8844 0.8027 -0.0465 0.0470  0.0418  158 PRO A CD  
814  N N   . ALA A 129 ? 0.9542 1.1103 0.9744 -0.0530 0.0876  0.0459  159 ALA A N   
815  C CA  . ALA A 129 ? 0.9523 1.1366 0.9727 -0.0537 0.1063  0.0513  159 ALA A CA  
816  C C   . ALA A 129 ? 0.7892 0.9927 0.8064 -0.0421 0.1077  0.0319  159 ALA A C   
817  O O   . ALA A 129 ? 0.6893 0.9183 0.7272 -0.0425 0.1184  0.0281  159 ALA A O   
818  C CB  . ALA A 129 ? 1.0450 1.2279 1.0321 -0.0516 0.1158  0.0680  159 ALA A CB  
819  N N   . ASN A 130 ? 0.6451 0.8365 0.6380 -0.0318 0.0968  0.0196  160 ASN A N   
820  C CA  . ASN A 130 ? 0.6495 0.8511 0.6361 -0.0205 0.0962  0.0004  160 ASN A CA  
821  C C   . ASN A 130 ? 0.6968 0.8953 0.7103 -0.0192 0.0871  -0.0132 160 ASN A C   
822  O O   . ASN A 130 ? 0.7352 0.9126 0.7531 -0.0209 0.0731  -0.0159 160 ASN A O   
823  C CB  . ASN A 130 ? 0.6894 0.8775 0.6429 -0.0122 0.0869  -0.0078 160 ASN A CB  
824  C CG  . ASN A 130 ? 0.7300 0.9237 0.6526 -0.0102 0.0943  0.0033  160 ASN A CG  
825  O OD1 . ASN A 130 ? 0.7879 0.9963 0.7107 -0.0137 0.1091  0.0177  160 ASN A OD1 
826  N ND2 . ASN A 130 ? 0.7253 0.9085 0.6213 -0.0045 0.0838  -0.0028 160 ASN A ND2 
827  N N   . LYS A 131 ? 0.6649 0.8855 0.6947 -0.0143 0.0952  -0.0216 161 LYS A N   
828  C CA  . LYS A 131 ? 0.6646 0.8855 0.7204 -0.0113 0.0869  -0.0333 161 LYS A CA  
829  C C   . LYS A 131 ? 0.6331 0.8430 0.6739 0.0022  0.0795  -0.0511 161 LYS A C   
830  O O   . LYS A 131 ? 0.5145 0.7385 0.5647 0.0119  0.0834  -0.0622 161 LYS A O   
831  C CB  . LYS A 131 ? 0.5666 0.8196 0.6545 -0.0132 0.0985  -0.0321 161 LYS A CB  
832  C CG  . LYS A 131 ? 0.6596 0.9243 0.7637 -0.0287 0.1087  -0.0132 161 LYS A CG  
833  C CD  . LYS A 131 ? 0.6990 0.9393 0.8147 -0.0404 0.0952  -0.0061 161 LYS A CD  
834  C CE  . LYS A 131 ? 0.7837 1.0306 0.9163 -0.0569 0.1053  0.0131  161 LYS A CE  
835  N NZ  . LYS A 131 ? 0.7733 0.9946 0.9194 -0.0677 0.0913  0.0176  161 LYS A NZ  
836  N N   . TYR A 132 ? 0.5067 0.6913 0.5253 0.0028  0.0690  -0.0534 162 TYR A N   
837  C CA  . TYR A 132 ? 0.4037 0.5719 0.4110 0.0122  0.0604  -0.0684 162 TYR A CA  
838  C C   . TYR A 132 ? 0.3171 0.4592 0.3159 0.0079  0.0474  -0.0664 162 TYR A C   
839  O O   . TYR A 132 ? 0.3994 0.5371 0.3941 0.0001  0.0455  -0.0549 162 TYR A O   
840  C CB  . TYR A 132 ? 0.4098 0.5819 0.3922 0.0204  0.0664  -0.0781 162 TYR A CB  
841  C CG  . TYR A 132 ? 0.6438 0.8191 0.6022 0.0161  0.0703  -0.0698 162 TYR A CG  
842  C CD1 . TYR A 132 ? 0.7327 0.9315 0.6858 0.0165  0.0849  -0.0621 162 TYR A CD1 
843  C CD2 . TYR A 132 ? 0.7270 0.8838 0.6680 0.0125  0.0597  -0.0691 162 TYR A CD2 
844  C CE1 . TYR A 132 ? 0.7825 0.9834 0.7096 0.0145  0.0881  -0.0534 162 TYR A CE1 
845  C CE2 . TYR A 132 ? 0.8849 1.0462 0.8032 0.0106  0.0615  -0.0617 162 TYR A CE2 
846  C CZ  . TYR A 132 ? 0.8542 1.0361 0.7636 0.0122  0.0753  -0.0537 162 TYR A CZ  
847  O OH  . TYR A 132 ? 0.7784 0.9638 0.6615 0.0122  0.0766  -0.0452 162 TYR A OH  
848  N N   . PRO A 133 ? 0.2825 0.4072 0.2789 0.0137  0.0390  -0.0767 163 PRO A N   
849  C CA  . PRO A 133 ? 0.4250 0.5279 0.4138 0.0101  0.0287  -0.0747 163 PRO A CA  
850  C C   . PRO A 133 ? 0.4883 0.5888 0.4569 0.0057  0.0278  -0.0717 163 PRO A C   
851  O O   . PRO A 133 ? 0.5617 0.6631 0.5147 0.0089  0.0294  -0.0805 163 PRO A O   
852  C CB  . PRO A 133 ? 0.2149 0.3014 0.2014 0.0178  0.0238  -0.0864 163 PRO A CB  
853  C CG  . PRO A 133 ? 0.2783 0.3769 0.2795 0.0260  0.0281  -0.0919 163 PRO A CG  
854  C CD  . PRO A 133 ? 0.2592 0.3836 0.2626 0.0244  0.0393  -0.0890 163 PRO A CD  
855  N N   . GLN A 134 ? 0.4556 0.5530 0.4244 -0.0005 0.0241  -0.0604 164 GLN A N   
856  C CA  . GLN A 134 ? 0.3321 0.4288 0.2839 -0.0033 0.0212  -0.0564 164 GLN A CA  
857  C C   . GLN A 134 ? 0.3814 0.4638 0.3342 -0.0050 0.0116  -0.0562 164 GLN A C   
858  O O   . GLN A 134 ? 0.4373 0.5196 0.3791 -0.0065 0.0070  -0.0576 164 GLN A O   
859  C CB  . GLN A 134 ? 0.3634 0.4688 0.3132 -0.0072 0.0255  -0.0417 164 GLN A CB  
860  C CG  . GLN A 134 ? 0.2920 0.4146 0.2414 -0.0067 0.0376  -0.0388 164 GLN A CG  
861  C CD  . GLN A 134 ? 0.5370 0.6635 0.4903 -0.0127 0.0428  -0.0214 164 GLN A CD  
862  O OE1 . GLN A 134 ? 0.6775 0.7985 0.6175 -0.0139 0.0395  -0.0119 164 GLN A OE1 
863  N NE2 . GLN A 134 ? 0.5136 0.6496 0.4868 -0.0165 0.0507  -0.0170 164 GLN A NE2 
864  N N   . CYS A 135 ? 0.3834 0.4558 0.3496 -0.0043 0.0086  -0.0547 165 CYS A N   
865  C CA  . CYS A 135 ? 0.3022 0.3627 0.2693 -0.0047 0.0019  -0.0536 165 CYS A CA  
866  C C   . CYS A 135 ? 0.3821 0.4303 0.3549 -0.0009 0.0004  -0.0604 165 CYS A C   
867  O O   . CYS A 135 ? 0.3594 0.4069 0.3405 0.0030  0.0017  -0.0625 165 CYS A O   
868  C CB  . CYS A 135 ? 0.2357 0.2934 0.2080 -0.0054 -0.0010 -0.0430 165 CYS A CB  
869  S SG  . CYS A 135 ? 0.8520 0.9188 0.8149 -0.0081 0.0000  -0.0320 165 CYS A SG  
870  N N   . LEU A 136 ? 0.2710 0.3102 0.2398 -0.0020 -0.0024 -0.0633 166 LEU A N   
871  C CA  . LEU A 136 ? 0.4382 0.4622 0.4087 0.0015  -0.0028 -0.0680 166 LEU A CA  
872  C C   . LEU A 136 ? 0.4820 0.4977 0.4533 0.0006  -0.0052 -0.0623 166 LEU A C   
873  O O   . LEU A 136 ? 0.4179 0.4386 0.3884 -0.0049 -0.0063 -0.0604 166 LEU A O   
874  C CB  . LEU A 136 ? 0.3706 0.3886 0.3351 0.0004  -0.0015 -0.0782 166 LEU A CB  
875  C CG  . LEU A 136 ? 0.4710 0.4684 0.4355 0.0041  -0.0015 -0.0821 166 LEU A CG  
876  C CD1 . LEU A 136 ? 0.5425 0.5372 0.5115 0.0141  -0.0009 -0.0818 166 LEU A CD1 
877  C CD2 . LEU A 136 ? 0.3515 0.3392 0.3096 0.0023  -0.0011 -0.0934 166 LEU A CD2 
878  N N   . CYS A 137 ? 0.4461 0.4515 0.4192 0.0068  -0.0059 -0.0597 167 CYS A N   
879  C CA  . CYS A 137 ? 0.3225 0.3211 0.2941 0.0080  -0.0062 -0.0536 167 CYS A CA  
880  C C   . CYS A 137 ? 0.3536 0.3345 0.3208 0.0130  -0.0045 -0.0541 167 CYS A C   
881  O O   . CYS A 137 ? 0.4633 0.4375 0.4292 0.0209  -0.0061 -0.0566 167 CYS A O   
882  C CB  . CYS A 137 ? 0.2766 0.2785 0.2493 0.0131  -0.0093 -0.0484 167 CYS A CB  
883  S SG  . CYS A 137 ? 0.6082 0.6021 0.5754 0.0193  -0.0087 -0.0420 167 CYS A SG  
884  N N   . LEU A 138 ? 0.4087 0.3825 0.3745 0.0084  -0.0013 -0.0510 168 LEU A N   
885  C CA  . LEU A 138 ? 0.4550 0.4086 0.4147 0.0127  0.0018  -0.0484 168 LEU A CA  
886  C C   . LEU A 138 ? 0.6393 0.5898 0.5932 0.0189  0.0041  -0.0388 168 LEU A C   
887  O O   . LEU A 138 ? 0.6171 0.5770 0.5747 0.0140  0.0074  -0.0333 168 LEU A O   
888  C CB  . LEU A 138 ? 0.3045 0.2477 0.2665 0.0027  0.0052  -0.0505 168 LEU A CB  
889  C CG  . LEU A 138 ? 0.5232 0.4658 0.4868 -0.0019 0.0029  -0.0621 168 LEU A CG  
890  C CD1 . LEU A 138 ? 0.6191 0.5442 0.5841 -0.0112 0.0050  -0.0650 168 LEU A CD1 
891  C CD2 . LEU A 138 ? 0.5589 0.4956 0.5179 0.0094  0.0011  -0.0677 168 LEU A CD2 
892  N N   . SER A 139 ? 0.5760 0.5154 0.5205 0.0310  0.0021  -0.0375 169 SER A N   
893  C CA  . SER A 139 ? 0.4578 0.3910 0.3911 0.0397  0.0046  -0.0292 169 SER A CA  
894  C C   . SER A 139 ? 0.5263 0.4371 0.4490 0.0432  0.0099  -0.0232 169 SER A C   
895  O O   . SER A 139 ? 0.4524 0.3502 0.3752 0.0434  0.0086  -0.0277 169 SER A O   
896  C CB  . SER A 139 ? 0.4159 0.3520 0.3433 0.0522  -0.0033 -0.0323 169 SER A CB  
897  O OG  . SER A 139 ? 0.6232 0.5734 0.5546 0.0511  -0.0055 -0.0323 169 SER A OG  
898  N N   . PRO A 140 ? 0.4949 0.4001 0.4073 0.0470  0.0167  -0.0124 170 PRO A N   
899  C CA  . PRO A 140 ? 0.5366 0.4182 0.4366 0.0502  0.0237  -0.0030 170 PRO A CA  
900  C C   . PRO A 140 ? 0.6742 0.5400 0.5559 0.0685  0.0177  -0.0032 170 PRO A C   
901  O O   . PRO A 140 ? 0.8044 0.6465 0.6754 0.0728  0.0210  0.0028  170 PRO A O   
902  C CB  . PRO A 140 ? 0.5767 0.4645 0.4720 0.0493  0.0342  0.0094  170 PRO A CB  
903  C CG  . PRO A 140 ? 0.4741 0.3892 0.3834 0.0436  0.0322  0.0047  170 PRO A CG  
904  C CD  . PRO A 140 ? 0.4964 0.4179 0.4085 0.0484  0.0197  -0.0076 170 PRO A CD  
905  N N   . THR A 141 ? 0.5941 0.4722 0.4726 0.0791  0.0082  -0.0099 171 THR A N   
906  C CA  . THR A 141 ? 0.5941 0.4629 0.4586 0.0966  -0.0007 -0.0127 171 THR A CA  
907  C C   . THR A 141 ? 0.6650 0.5520 0.5413 0.0996  -0.0133 -0.0258 171 THR A C   
908  O O   . THR A 141 ? 0.6781 0.5818 0.5661 0.0914  -0.0144 -0.0299 171 THR A O   
909  C CB  . THR A 141 ? 0.5707 0.4307 0.4093 0.1118  0.0014  -0.0030 171 THR A CB  
910  O OG1 . THR A 141 ? 0.6891 0.5663 0.5268 0.1140  -0.0015 -0.0063 171 THR A OG1 
911  C CG2 . THR A 141 ? 0.5277 0.3719 0.3562 0.1071  0.0165  0.0128  171 THR A CG2 
912  N N   . TYR A 142 ? 0.6401 0.5239 0.5142 0.1114  -0.0227 -0.0318 172 TYR A N   
913  C CA  . TYR A 142 ? 0.5240 0.4265 0.4129 0.1134  -0.0346 -0.0438 172 TYR A CA  
914  C C   . TYR A 142 ? 0.6318 0.5431 0.5155 0.1171  -0.0409 -0.0462 172 TYR A C   
915  O O   . TYR A 142 ? 0.7084 0.6349 0.6088 0.1093  -0.0459 -0.0535 172 TYR A O   
916  C CB  . TYR A 142 ? 0.5273 0.4272 0.4150 0.1280  -0.0441 -0.0492 172 TYR A CB  
917  C CG  . TYR A 142 ? 0.5719 0.4944 0.4799 0.1288  -0.0563 -0.0617 172 TYR A CG  
918  C CD1 . TYR A 142 ? 0.4924 0.4329 0.4234 0.1133  -0.0546 -0.0670 172 TYR A CD1 
919  C CD2 . TYR A 142 ? 0.6040 0.5306 0.5090 0.1447  -0.0697 -0.0676 172 TYR A CD2 
920  C CE1 . TYR A 142 ? 0.6055 0.5666 0.5576 0.1118  -0.0641 -0.0767 172 TYR A CE1 
921  C CE2 . TYR A 142 ? 0.6827 0.6325 0.6113 0.1433  -0.0810 -0.0792 172 TYR A CE2 
922  C CZ  . TYR A 142 ? 0.7376 0.7042 0.6906 0.1258  -0.0773 -0.0832 172 TYR A CZ  
923  O OH  . TYR A 142 ? 0.6948 0.6846 0.6739 0.1221  -0.0869 -0.0931 172 TYR A OH  
924  N N   . GLU A 143 ? 0.5349 0.4349 0.3941 0.1294  -0.0402 -0.0398 173 GLU A N   
925  C CA  . GLU A 143 ? 0.4562 0.3616 0.3060 0.1360  -0.0467 -0.0437 173 GLU A CA  
926  C C   . GLU A 143 ? 0.4268 0.3410 0.2864 0.1234  -0.0398 -0.0424 173 GLU A C   
927  O O   . GLU A 143 ? 0.5855 0.5069 0.4501 0.1234  -0.0476 -0.0501 173 GLU A O   
928  C CB  . GLU A 143 ? 0.5410 0.4327 0.3579 0.1539  -0.0455 -0.0364 173 GLU A CB  
929  C CG  . GLU A 143 ? 0.6621 0.5473 0.4655 0.1715  -0.0579 -0.0403 173 GLU A CG  
930  C CD  . GLU A 143 ? 0.9327 0.8049 0.7349 0.1731  -0.0524 -0.0325 173 GLU A CD  
931  O OE1 . GLU A 143 ? 1.0677 0.9395 0.8694 0.1850  -0.0640 -0.0382 173 GLU A OE1 
932  O OE2 . GLU A 143 ? 0.9345 0.7966 0.7373 0.1628  -0.0373 -0.0215 173 GLU A OE2 
933  N N   . LEU A 144 ? 0.3751 0.2880 0.2381 0.1129  -0.0261 -0.0330 174 LEU A N   
934  C CA  . LEU A 144 ? 0.3900 0.3145 0.2656 0.1010  -0.0202 -0.0317 174 LEU A CA  
935  C C   . LEU A 144 ? 0.4889 0.4247 0.3884 0.0880  -0.0249 -0.0392 174 LEU A C   
936  O O   . LEU A 144 ? 0.4060 0.3508 0.3144 0.0829  -0.0271 -0.0419 174 LEU A O   
937  C CB  . LEU A 144 ? 0.4847 0.4076 0.3595 0.0932  -0.0055 -0.0201 174 LEU A CB  
938  C CG  . LEU A 144 ? 0.5192 0.4368 0.3730 0.1033  0.0037  -0.0097 174 LEU A CG  
939  C CD1 . LEU A 144 ? 0.3143 0.2295 0.1726 0.0925  0.0186  0.0025  174 LEU A CD1 
940  C CD2 . LEU A 144 ? 0.3814 0.3103 0.2311 0.1096  0.0029  -0.0120 174 LEU A CD2 
941  N N   . ALA A 145 ? 0.4781 0.4126 0.3865 0.0841  -0.0259 -0.0419 175 ALA A N   
942  C CA  . ALA A 145 ? 0.3984 0.3450 0.3270 0.0740  -0.0292 -0.0486 175 ALA A CA  
943  C C   . ALA A 145 ? 0.4846 0.4386 0.4205 0.0766  -0.0400 -0.0560 175 ALA A C   
944  O O   . ALA A 145 ? 0.4228 0.3861 0.3723 0.0671  -0.0407 -0.0577 175 ALA A O   
945  C CB  . ALA A 145 ? 0.3655 0.3098 0.2998 0.0742  -0.0290 -0.0519 175 ALA A CB  
946  N N   . LEU A 146 ? 0.3136 0.2621 0.2398 0.0895  -0.0490 -0.0601 176 LEU A N   
947  C CA  . LEU A 146 ? 0.2569 0.2107 0.1914 0.0914  -0.0614 -0.0691 176 LEU A CA  
948  C C   . LEU A 146 ? 0.3652 0.3158 0.2952 0.0899  -0.0623 -0.0689 176 LEU A C   
949  O O   . LEU A 146 ? 0.5124 0.4661 0.4553 0.0848  -0.0700 -0.0749 176 LEU A O   
950  C CB  . LEU A 146 ? 0.2644 0.2138 0.1878 0.1069  -0.0729 -0.0752 176 LEU A CB  
951  C CG  . LEU A 146 ? 0.4401 0.3966 0.3750 0.1094  -0.0761 -0.0786 176 LEU A CG  
952  C CD1 . LEU A 146 ? 0.3467 0.2969 0.2644 0.1283  -0.0867 -0.0819 176 LEU A CD1 
953  C CD2 . LEU A 146 ? 0.4605 0.4355 0.4260 0.0983  -0.0816 -0.0865 176 LEU A CD2 
954  N N   . GLN A 147 ? 0.4629 0.4073 0.3759 0.0944  -0.0540 -0.0615 177 GLN A N   
955  C CA  . GLN A 147 ? 0.3339 0.2764 0.2422 0.0955  -0.0535 -0.0610 177 GLN A CA  
956  C C   . GLN A 147 ? 0.4186 0.3693 0.3447 0.0811  -0.0487 -0.0576 177 GLN A C   
957  O O   . GLN A 147 ? 0.6926 0.6413 0.6241 0.0791  -0.0537 -0.0605 177 GLN A O   
958  C CB  . GLN A 147 ? 0.3196 0.2580 0.2068 0.1055  -0.0443 -0.0535 177 GLN A CB  
959  C CG  . GLN A 147 ? 0.4059 0.3345 0.2693 0.1227  -0.0495 -0.0563 177 GLN A CG  
960  C CD  . GLN A 147 ? 0.4324 0.3557 0.2918 0.1310  -0.0652 -0.0693 177 GLN A CD  
961  O OE1 . GLN A 147 ? 0.5797 0.5010 0.4404 0.1312  -0.0676 -0.0731 177 GLN A OE1 
962  N NE2 . GLN A 147 ? 0.4084 0.3288 0.2639 0.1382  -0.0771 -0.0770 177 GLN A NE2 
963  N N   . THR A 148 ? 0.3558 0.3139 0.2893 0.0717  -0.0397 -0.0517 178 THR A N   
964  C CA  . THR A 148 ? 0.4167 0.3841 0.3647 0.0591  -0.0363 -0.0489 178 THR A CA  
965  C C   . THR A 148 ? 0.3815 0.3519 0.3446 0.0525  -0.0429 -0.0542 178 THR A C   
966  O O   . THR A 148 ? 0.4286 0.4000 0.3994 0.0466  -0.0446 -0.0529 178 THR A O   
967  C CB  . THR A 148 ? 0.4532 0.4274 0.4049 0.0509  -0.0273 -0.0444 178 THR A CB  
968  O OG1 . THR A 148 ? 0.4110 0.3845 0.3537 0.0537  -0.0201 -0.0384 178 THR A OG1 
969  C CG2 . THR A 148 ? 0.4191 0.4037 0.3823 0.0397  -0.0253 -0.0427 178 THR A CG2 
970  N N   . GLY A 149 ? 0.3112 0.2835 0.2794 0.0540  -0.0463 -0.0592 179 GLY A N   
971  C CA  . GLY A 149 ? 0.2542 0.2339 0.2406 0.0480  -0.0521 -0.0645 179 GLY A CA  
972  C C   . GLY A 149 ? 0.3795 0.3528 0.3708 0.0477  -0.0616 -0.0686 179 GLY A C   
973  O O   . GLY A 149 ? 0.3891 0.3673 0.3977 0.0375  -0.0631 -0.0687 179 GLY A O   
974  N N   . LYS A 150 ? 0.4133 0.3743 0.3886 0.0591  -0.0676 -0.0719 180 LYS A N   
975  C CA  . LYS A 150 ? 0.4612 0.4116 0.4380 0.0608  -0.0784 -0.0784 180 LYS A CA  
976  C C   . LYS A 150 ? 0.4675 0.4127 0.4483 0.0531  -0.0743 -0.0720 180 LYS A C   
977  O O   . LYS A 150 ? 0.5242 0.4644 0.5191 0.0448  -0.0798 -0.0739 180 LYS A O   
978  C CB  . LYS A 150 ? 0.5614 0.4997 0.5143 0.0777  -0.0840 -0.0835 180 LYS A CB  
979  C CG  . LYS A 150 ? 0.6742 0.6015 0.6262 0.0834  -0.1000 -0.0962 180 LYS A CG  
980  C CD  . LYS A 150 ? 0.9165 0.8330 0.8384 0.1028  -0.1031 -0.1003 180 LYS A CD  
981  C CE  . LYS A 150 ? 1.0611 0.9703 0.9771 0.1124  -0.1212 -0.1156 180 LYS A CE  
982  N NZ  . LYS A 150 ? 1.0548 0.9478 0.9727 0.1121  -0.1325 -0.1259 180 LYS A NZ  
983  N N   . VAL A 151 ? 0.4891 0.4358 0.4585 0.0556  -0.0647 -0.0639 181 VAL A N   
984  C CA  . VAL A 151 ? 0.4903 0.4335 0.4608 0.0516  -0.0612 -0.0569 181 VAL A CA  
985  C C   . VAL A 151 ? 0.5461 0.4970 0.5331 0.0368  -0.0573 -0.0510 181 VAL A C   
986  O O   . VAL A 151 ? 0.5534 0.4956 0.5454 0.0321  -0.0591 -0.0471 181 VAL A O   
987  C CB  . VAL A 151 ? 0.4174 0.3679 0.3766 0.0566  -0.0519 -0.0498 181 VAL A CB  
988  C CG1 . VAL A 151 ? 0.4098 0.3590 0.3704 0.0547  -0.0499 -0.0428 181 VAL A CG1 
989  C CG2 . VAL A 151 ? 0.2351 0.1804 0.1773 0.0713  -0.0525 -0.0533 181 VAL A CG2 
990  N N   . ILE A 152 ? 0.4682 0.4341 0.4619 0.0307  -0.0514 -0.0497 182 ILE A N   
991  C CA  . ILE A 152 ? 0.4616 0.4378 0.4684 0.0184  -0.0459 -0.0443 182 ILE A CA  
992  C C   . ILE A 152 ? 0.5383 0.5112 0.5627 0.0105  -0.0516 -0.0468 182 ILE A C   
993  O O   . ILE A 152 ? 0.7221 0.6913 0.7531 0.0020  -0.0493 -0.0395 182 ILE A O   
994  C CB  . ILE A 152 ? 0.4070 0.3989 0.4164 0.0159  -0.0392 -0.0453 182 ILE A CB  
995  C CG1 . ILE A 152 ? 0.4236 0.4180 0.4191 0.0197  -0.0334 -0.0422 182 ILE A CG1 
996  C CG2 . ILE A 152 ? 0.4150 0.4192 0.4367 0.0049  -0.0330 -0.0408 182 ILE A CG2 
997  C CD1 . ILE A 152 ? 0.4020 0.4036 0.3966 0.0202  -0.0290 -0.0458 182 ILE A CD1 
998  N N   . GLU A 153 ? 0.4579 0.4324 0.4906 0.0131  -0.0592 -0.0566 183 GLU A N   
999  C CA  . GLU A 153 ? 0.4234 0.3982 0.4780 0.0042  -0.0660 -0.0608 183 GLU A CA  
1000 C C   . GLU A 153 ? 0.4176 0.3701 0.4713 0.0017  -0.0725 -0.0595 183 GLU A C   
1001 O O   . GLU A 153 ? 0.6785 0.6278 0.7513 -0.0105 -0.0746 -0.0578 183 GLU A O   
1002 C CB  . GLU A 153 ? 0.6033 0.5829 0.6640 0.0109  -0.0768 -0.0736 183 GLU A CB  
1003 C CG  . GLU A 153 ? 0.8502 0.8493 0.9135 0.0147  -0.0716 -0.0753 183 GLU A CG  
1004 C CD  . GLU A 153 ? 1.0777 1.0750 1.1323 0.0288  -0.0820 -0.0856 183 GLU A CD  
1005 O OE1 . GLU A 153 ? 1.0079 1.0173 1.0635 0.0343  -0.0794 -0.0873 183 GLU A OE1 
1006 O OE2 . GLU A 153 ? 1.1446 1.1269 1.1891 0.0360  -0.0929 -0.0920 183 GLU A OE2 
1007 N N   . GLN A 154 ? 0.4460 0.3829 0.4783 0.0134  -0.0748 -0.0599 184 GLN A N   
1008 C CA  . GLN A 154 ? 0.6289 0.5410 0.6566 0.0157  -0.0826 -0.0614 184 GLN A CA  
1009 C C   . GLN A 154 ? 0.5786 0.4825 0.6028 0.0112  -0.0750 -0.0477 184 GLN A C   
1010 O O   . GLN A 154 ? 0.6089 0.4941 0.6405 0.0045  -0.0789 -0.0447 184 GLN A O   
1011 C CB  . GLN A 154 ? 0.7746 0.6755 0.7796 0.0338  -0.0887 -0.0698 184 GLN A CB  
1012 C CG  . GLN A 154 ? 0.9292 0.8027 0.9276 0.0401  -0.0995 -0.0766 184 GLN A CG  
1013 C CD  . GLN A 154 ? 1.1326 0.9992 1.1072 0.0599  -0.1047 -0.0863 184 GLN A CD  
1014 O OE1 . GLN A 154 ? 1.0723 0.9536 1.0376 0.0671  -0.1017 -0.0882 184 GLN A OE1 
1015 N NE2 . GLN A 154 ? 1.2497 1.0924 1.2125 0.0697  -0.1119 -0.0921 184 GLN A NE2 
1016 N N   . MET A 155 ? 0.4925 0.4093 0.5051 0.0150  -0.0652 -0.0393 185 MET A N   
1017 C CA  . MET A 155 ? 0.4644 0.3768 0.4712 0.0132  -0.0592 -0.0263 185 MET A CA  
1018 C C   . MET A 155 ? 0.5639 0.4855 0.5843 -0.0023 -0.0516 -0.0163 185 MET A C   
1019 O O   . MET A 155 ? 0.6150 0.5256 0.6341 -0.0067 -0.0489 -0.0049 185 MET A O   
1020 C CB  . MET A 155 ? 0.4272 0.3533 0.4189 0.0224  -0.0530 -0.0224 185 MET A CB  
1021 C CG  . MET A 155 ? 0.4837 0.4035 0.4662 0.0267  -0.0510 -0.0116 185 MET A CG  
1022 S SD  . MET A 155 ? 0.5152 0.4581 0.4867 0.0346  -0.0449 -0.0078 185 MET A SD  
1023 C CE  . MET A 155 ? 0.4408 0.3797 0.4041 0.0502  -0.0487 -0.0174 185 MET A CE  
1024 N N   . GLY A 156 ? 0.4473 0.3891 0.4795 -0.0091 -0.0477 -0.0201 186 GLY A N   
1025 C CA  . GLY A 156 ? 0.3437 0.2988 0.3889 -0.0224 -0.0387 -0.0114 186 GLY A CA  
1026 C C   . GLY A 156 ? 0.4317 0.3862 0.5023 -0.0343 -0.0422 -0.0151 186 GLY A C   
1027 O O   . GLY A 156 ? 0.4918 0.4669 0.5784 -0.0436 -0.0347 -0.0129 186 GLY A O   
1028 N N   . LYS A 157 ? 0.5776 0.5096 0.6532 -0.0336 -0.0539 -0.0217 187 LYS A N   
1029 C CA  . LYS A 157 ? 0.5184 0.4498 0.6213 -0.0458 -0.0603 -0.0279 187 LYS A CA  
1030 C C   . LYS A 157 ? 0.5448 0.4720 0.6643 -0.0632 -0.0521 -0.0133 187 LYS A C   
1031 O O   . LYS A 157 ? 0.6286 0.5639 0.7769 -0.0775 -0.0531 -0.0152 187 LYS A O   
1032 C CB  . LYS A 157 ? 0.4441 0.3504 0.5452 -0.0395 -0.0771 -0.0415 187 LYS A CB  
1033 C CG  . LYS A 157 ? 0.6931 0.5651 0.7875 -0.0410 -0.0807 -0.0352 187 LYS A CG  
1034 C CD  . LYS A 157 ? 0.7342 0.5821 0.8383 -0.0421 -0.0977 -0.0500 187 LYS A CD  
1035 C CE  . LYS A 157 ? 0.8030 0.6358 0.8806 -0.0209 -0.1080 -0.0629 187 LYS A CE  
1036 N NZ  . LYS A 157 ? 0.8316 0.6286 0.9099 -0.0201 -0.1230 -0.0735 187 LYS A NZ  
1037 N N   . PHE A 158 ? 0.6008 0.5163 0.7025 -0.0618 -0.0440 0.0020  188 PHE A N   
1038 C CA  . PHE A 158 ? 0.5795 0.4885 0.6913 -0.0768 -0.0342 0.0195  188 PHE A CA  
1039 C C   . PHE A 158 ? 0.6355 0.5743 0.7442 -0.0805 -0.0173 0.0313  188 PHE A C   
1040 O O   . PHE A 158 ? 0.7035 0.6399 0.8126 -0.0899 -0.0061 0.0488  188 PHE A O   
1041 C CB  . PHE A 158 ? 0.5027 0.3761 0.5956 -0.0719 -0.0368 0.0304  188 PHE A CB  
1042 C CG  . PHE A 158 ? 0.6575 0.4978 0.7532 -0.0684 -0.0529 0.0186  188 PHE A CG  
1043 C CD1 . PHE A 158 ? 0.7205 0.5460 0.8432 -0.0844 -0.0592 0.0149  188 PHE A CD1 
1044 C CD2 . PHE A 158 ? 0.5956 0.4207 0.6676 -0.0491 -0.0618 0.0103  188 PHE A CD2 
1045 C CE1 . PHE A 158 ? 0.6844 0.4772 0.8078 -0.0806 -0.0757 0.0015  188 PHE A CE1 
1046 C CE2 . PHE A 158 ? 0.5557 0.3501 0.6270 -0.0436 -0.0764 -0.0020 188 PHE A CE2 
1047 C CZ  . PHE A 158 ? 0.6261 0.4026 0.7218 -0.0590 -0.0842 -0.0072 188 PHE A CZ  
1048 N N   . TYR A 159 ? 0.6005 0.5653 0.7040 -0.0720 -0.0155 0.0217  189 TYR A N   
1049 C CA  . TYR A 159 ? 0.4933 0.4893 0.5988 -0.0753 -0.0011 0.0269  189 TYR A CA  
1050 C C   . TYR A 159 ? 0.6805 0.6988 0.8186 -0.0844 -0.0009 0.0179  189 TYR A C   
1051 O O   . TYR A 159 ? 0.7512 0.7776 0.8947 -0.0770 -0.0100 0.0020  189 TYR A O   
1052 C CB  . TYR A 159 ? 0.4722 0.4815 0.5556 -0.0609 -0.0006 0.0194  189 TYR A CB  
1053 C CG  . TYR A 159 ? 0.5575 0.5549 0.6115 -0.0517 -0.0002 0.0272  189 TYR A CG  
1054 C CD1 . TYR A 159 ? 0.5644 0.5361 0.6078 -0.0444 -0.0105 0.0266  189 TYR A CD1 
1055 C CD2 . TYR A 159 ? 0.6463 0.6601 0.6832 -0.0487 0.0096  0.0335  189 TYR A CD2 
1056 C CE1 . TYR A 159 ? 0.7109 0.6764 0.7307 -0.0348 -0.0107 0.0333  189 TYR A CE1 
1057 C CE2 . TYR A 159 ? 0.7366 0.7432 0.7487 -0.0399 0.0080  0.0394  189 TYR A CE2 
1058 C CZ  . TYR A 159 ? 0.8138 0.7977 0.8191 -0.0332 -0.0021 0.0397  189 TYR A CZ  
1059 O OH  . TYR A 159 ? 0.9186 0.8998 0.9025 -0.0235 -0.0042 0.0453  189 TYR A OH  
1060 N N   . PRO A 160 ? 0.8303 0.8601 0.9908 -0.1000 0.0098  0.0288  190 PRO A N   
1061 C CA  . PRO A 160 ? 0.7937 0.8483 0.9917 -0.1099 0.0094  0.0204  190 PRO A CA  
1062 C C   . PRO A 160 ? 0.6355 0.7246 0.8348 -0.1003 0.0148  0.0106  190 PRO A C   
1063 O O   . PRO A 160 ? 0.5152 0.6162 0.7310 -0.0960 0.0047  -0.0050 190 PRO A O   
1064 C CB  . PRO A 160 ? 0.8400 0.9013 1.0584 -0.1289 0.0243  0.0388  190 PRO A CB  
1065 C CG  . PRO A 160 ? 0.9013 0.9301 1.0912 -0.1284 0.0278  0.0560  190 PRO A CG  
1066 C CD  . PRO A 160 ? 0.8814 0.9047 1.0338 -0.1086 0.0237  0.0505  190 PRO A CD  
1067 N N   . GLU A 161 ? 0.6088 0.7119 0.7887 -0.0956 0.0297  0.0191  191 GLU A N   
1068 C CA  . GLU A 161 ? 0.5993 0.7340 0.7811 -0.0872 0.0370  0.0107  191 GLU A CA  
1069 C C   . GLU A 161 ? 0.3425 0.4695 0.4988 -0.0698 0.0282  -0.0024 191 GLU A C   
1070 O O   . GLU A 161 ? 0.4927 0.6388 0.6444 -0.0609 0.0336  -0.0096 191 GLU A O   
1071 C CB  . GLU A 161 ? 0.8259 0.9796 0.9972 -0.0895 0.0574  0.0244  191 GLU A CB  
1072 C CG  . GLU A 161 ? 0.9719 1.1313 1.1639 -0.1074 0.0698  0.0422  191 GLU A CG  
1073 C CD  . GLU A 161 ? 1.1596 1.3500 1.3972 -0.1181 0.0736  0.0376  191 GLU A CD  
1074 O OE1 . GLU A 161 ? 1.1933 1.3969 1.4461 -0.1105 0.0630  0.0197  191 GLU A OE1 
1075 O OE2 . GLU A 161 ? 1.2415 1.4442 1.5005 -0.1340 0.0874  0.0527  191 GLU A OE2 
1076 N N   . LEU A 162 ? 0.3718 0.4703 0.5119 -0.0648 0.0154  -0.0053 192 LEU A N   
1077 C CA  . LEU A 162 ? 0.4395 0.5298 0.5563 -0.0501 0.0086  -0.0152 192 LEU A CA  
1078 C C   . LEU A 162 ? 0.5397 0.6352 0.6692 -0.0427 -0.0019 -0.0306 192 LEU A C   
1079 O O   . LEU A 162 ? 0.7425 0.8288 0.8858 -0.0449 -0.0136 -0.0359 192 LEU A O   
1080 C CB  . LEU A 162 ? 0.5960 0.6578 0.6908 -0.0463 0.0008  -0.0115 192 LEU A CB  
1081 C CG  . LEU A 162 ? 0.5890 0.6443 0.6612 -0.0332 -0.0039 -0.0191 192 LEU A CG  
1082 C CD1 . LEU A 162 ? 0.4638 0.5318 0.5193 -0.0304 0.0063  -0.0165 192 LEU A CD1 
1083 C CD2 . LEU A 162 ? 0.6182 0.6493 0.6757 -0.0288 -0.0124 -0.0168 192 LEU A CD2 
1084 N N   . LYS A 163 ? 0.3879 0.4964 0.5108 -0.0330 0.0014  -0.0381 193 LYS A N   
1085 C CA  . LYS A 163 ? 0.3267 0.4388 0.4573 -0.0231 -0.0081 -0.0511 193 LYS A CA  
1086 C C   . LYS A 163 ? 0.4143 0.5115 0.5176 -0.0106 -0.0107 -0.0559 193 LYS A C   
1087 O O   . LYS A 163 ? 0.4630 0.5548 0.5466 -0.0102 -0.0039 -0.0512 193 LYS A O   
1088 C CB  . LYS A 163 ? 0.2732 0.4159 0.4276 -0.0223 -0.0019 -0.0561 193 LYS A CB  
1089 C CG  . LYS A 163 ? 0.4868 0.6487 0.6752 -0.0363 0.0008  -0.0518 193 LYS A CG  
1090 C CD  . LYS A 163 ? 0.7372 0.8888 0.9423 -0.0399 -0.0159 -0.0580 193 LYS A CD  
1091 C CE  . LYS A 163 ? 0.7733 0.9477 1.0194 -0.0551 -0.0149 -0.0565 193 LYS A CE  
1092 N NZ  . LYS A 163 ? 0.8105 0.9770 1.0606 -0.0722 -0.0051 -0.0411 193 LYS A NZ  
1093 N N   . LEU A 164 ? 0.4803 0.5712 0.5829 -0.0005 -0.0208 -0.0649 194 LEU A N   
1094 C CA  . LEU A 164 ? 0.3167 0.3898 0.3948 0.0099  -0.0235 -0.0675 194 LEU A CA  
1095 C C   . LEU A 164 ? 0.2548 0.3331 0.3338 0.0219  -0.0251 -0.0759 194 LEU A C   
1096 O O   . LEU A 164 ? 0.4679 0.5585 0.5649 0.0258  -0.0312 -0.0819 194 LEU A O   
1097 C CB  . LEU A 164 ? 0.4503 0.5036 0.5193 0.0129  -0.0342 -0.0676 194 LEU A CB  
1098 C CG  . LEU A 164 ? 0.6310 0.6660 0.6756 0.0223  -0.0359 -0.0676 194 LEU A CG  
1099 C CD1 . LEU A 164 ? 0.7794 0.8131 0.8109 0.0189  -0.0261 -0.0625 194 LEU A CD1 
1100 C CD2 . LEU A 164 ? 0.6786 0.6979 0.7148 0.0242  -0.0437 -0.0664 194 LEU A CD2 
1101 N N   . ALA A 165 ? 0.2664 0.3348 0.3269 0.0277  -0.0204 -0.0766 195 ALA A N   
1102 C CA  . ALA A 165 ? 0.3034 0.3703 0.3614 0.0403  -0.0217 -0.0837 195 ALA A CA  
1103 C C   . ALA A 165 ? 0.3474 0.3886 0.3829 0.0477  -0.0252 -0.0826 195 ALA A C   
1104 O O   . ALA A 165 ? 0.3934 0.4227 0.4146 0.0423  -0.0214 -0.0777 195 ALA A O   
1105 C CB  . ALA A 165 ? 0.2610 0.3390 0.3196 0.0411  -0.0113 -0.0869 195 ALA A CB  
1106 N N   . TYR A 166 ? 0.3251 0.3594 0.3581 0.0605  -0.0321 -0.0864 196 TYR A N   
1107 C CA  . TYR A 166 ? 0.4035 0.4128 0.4144 0.0681  -0.0337 -0.0833 196 TYR A CA  
1108 C C   . TYR A 166 ? 0.4527 0.4511 0.4559 0.0766  -0.0296 -0.0862 196 TYR A C   
1109 O O   . TYR A 166 ? 0.5049 0.5058 0.5126 0.0893  -0.0341 -0.0910 196 TYR A O   
1110 C CB  . TYR A 166 ? 0.3909 0.3941 0.3970 0.0784  -0.0448 -0.0836 196 TYR A CB  
1111 C CG  . TYR A 166 ? 0.3403 0.3448 0.3472 0.0717  -0.0495 -0.0814 196 TYR A CG  
1112 C CD1 . TYR A 166 ? 0.3118 0.3328 0.3386 0.0680  -0.0571 -0.0864 196 TYR A CD1 
1113 C CD2 . TYR A 166 ? 0.2119 0.2012 0.2012 0.0692  -0.0463 -0.0747 196 TYR A CD2 
1114 C CE1 . TYR A 166 ? 0.3942 0.4115 0.4209 0.0624  -0.0622 -0.0854 196 TYR A CE1 
1115 C CE2 . TYR A 166 ? 0.2564 0.2453 0.2454 0.0656  -0.0507 -0.0737 196 TYR A CE2 
1116 C CZ  . TYR A 166 ? 0.3477 0.3482 0.3541 0.0624  -0.0591 -0.0794 196 TYR A CZ  
1117 O OH  . TYR A 166 ? 0.5285 0.5241 0.5341 0.0592  -0.0644 -0.0795 196 TYR A OH  
1118 N N   . ALA A 167 ? 0.3911 0.3769 0.3833 0.0700  -0.0219 -0.0841 197 ALA A N   
1119 C CA  . ALA A 167 ? 0.4185 0.3873 0.4016 0.0767  -0.0184 -0.0874 197 ALA A CA  
1120 C C   . ALA A 167 ? 0.4837 0.4249 0.4494 0.0845  -0.0206 -0.0811 197 ALA A C   
1121 O O   . ALA A 167 ? 0.4856 0.4083 0.4400 0.0778  -0.0157 -0.0762 197 ALA A O   
1122 C CB  . ALA A 167 ? 0.2771 0.2434 0.2563 0.0655  -0.0109 -0.0895 197 ALA A CB  
1123 N N   . VAL A 168 ? 0.4493 0.3891 0.4135 0.0988  -0.0281 -0.0809 198 VAL A N   
1124 C CA  . VAL A 168 ? 0.4626 0.3771 0.4070 0.1089  -0.0302 -0.0730 198 VAL A CA  
1125 C C   . VAL A 168 ? 0.4474 0.3490 0.3864 0.1274  -0.0343 -0.0756 198 VAL A C   
1126 O O   . VAL A 168 ? 0.5708 0.4909 0.5249 0.1353  -0.0387 -0.0844 198 VAL A O   
1127 C CB  . VAL A 168 ? 0.4246 0.3458 0.3643 0.1124  -0.0374 -0.0690 198 VAL A CB  
1128 C CG1 . VAL A 168 ? 0.2890 0.2136 0.2276 0.0976  -0.0323 -0.0639 198 VAL A CG1 
1129 C CG2 . VAL A 168 ? 0.3607 0.3082 0.3191 0.1172  -0.0473 -0.0777 198 VAL A CG2 
1130 N N   . ARG A 169 ? 0.6088 0.4793 0.5267 0.1349  -0.0323 -0.0669 199 ARG A N   
1131 C CA  . ARG A 169 ? 0.6575 0.5093 0.5659 0.1545  -0.0362 -0.0670 199 ARG A CA  
1132 C C   . ARG A 169 ? 0.6518 0.5260 0.5688 0.1718  -0.0488 -0.0732 199 ARG A C   
1133 O O   . ARG A 169 ? 0.7080 0.5801 0.6274 0.1883  -0.0533 -0.0781 199 ARG A O   
1134 C CB  . ARG A 169 ? 0.8728 0.6875 0.7542 0.1601  -0.0324 -0.0527 199 ARG A CB  
1135 C CG  . ARG A 169 ? 1.1317 0.9172 1.0074 0.1474  -0.0212 -0.0483 199 ARG A CG  
1136 C CD  . ARG A 169 ? 1.3536 1.1177 1.2283 0.1585  -0.0216 -0.0547 199 ARG A CD  
1137 N NE  . ARG A 169 ? 1.4538 1.1989 1.3313 0.1428  -0.0134 -0.0581 199 ARG A NE  
1138 C CZ  . ARG A 169 ? 1.3798 1.1414 1.2727 0.1349  -0.0124 -0.0724 199 ARG A CZ  
1139 N NH1 . ARG A 169 ? 1.1530 0.9509 1.0615 0.1403  -0.0170 -0.0825 199 ARG A NH1 
1140 N NH2 . ARG A 169 ? 1.4583 1.2004 1.3509 0.1214  -0.0067 -0.0765 199 ARG A NH2 
1141 N N   . GLY A 170 ? 0.7387 0.6345 0.6615 0.1684  -0.0554 -0.0739 200 GLY A N   
1142 C CA  . GLY A 170 ? 0.6864 0.6056 0.6202 0.1822  -0.0694 -0.0810 200 GLY A CA  
1143 C C   . GLY A 170 ? 0.6560 0.6100 0.6229 0.1785  -0.0715 -0.0934 200 GLY A C   
1144 O O   . GLY A 170 ? 0.7283 0.7025 0.7091 0.1922  -0.0823 -0.1005 200 GLY A O   
1145 N N   . ASN A 171 ? 0.6301 0.5935 0.6100 0.1605  -0.0610 -0.0956 201 ASN A N   
1146 C CA  . ASN A 171 ? 0.4898 0.4880 0.5001 0.1552  -0.0599 -0.1052 201 ASN A CA  
1147 C C   . ASN A 171 ? 0.4997 0.5017 0.5173 0.1699  -0.0579 -0.1121 201 ASN A C   
1148 O O   . ASN A 171 ? 0.4829 0.4610 0.4865 0.1717  -0.0497 -0.1114 201 ASN A O   
1149 C CB  . ASN A 171 ? 0.5054 0.5118 0.5229 0.1334  -0.0491 -0.1041 201 ASN A CB  
1150 C CG  . ASN A 171 ? 0.6281 0.6720 0.6761 0.1267  -0.0469 -0.1111 201 ASN A CG  
1151 O OD1 . ASN A 171 ? 0.7285 0.7945 0.7954 0.1379  -0.0522 -0.1178 201 ASN A OD1 
1152 N ND2 . ASN A 171 ? 0.5346 0.5873 0.5880 0.1088  -0.0387 -0.1087 201 ASN A ND2 
1153 N N   . LYS A 172 ? 0.6407 0.6738 0.6822 0.1806  -0.0660 -0.1198 202 LYS A N   
1154 C CA  . LYS A 172 ? 0.8728 0.9114 0.9213 0.2007  -0.0669 -0.1266 202 LYS A CA  
1155 C C   . LYS A 172 ? 0.9094 0.9776 0.9822 0.1951  -0.0560 -0.1348 202 LYS A C   
1156 O O   . LYS A 172 ? 0.9713 1.0681 1.0667 0.2087  -0.0584 -0.1428 202 LYS A O   
1157 C CB  . LYS A 172 ? 0.8673 0.9263 0.9286 0.2189  -0.0832 -0.1307 202 LYS A CB  
1158 C CG  . LYS A 172 ? 0.9018 1.0028 0.9956 0.2068  -0.0902 -0.1358 202 LYS A CG  
1159 C CD  . LYS A 172 ? 1.1259 1.2349 1.2209 0.2207  -0.1099 -0.1383 202 LYS A CD  
1160 C CE  . LYS A 172 ? 1.2593 1.3287 1.3152 0.2226  -0.1146 -0.1288 202 LYS A CE  
1161 N NZ  . LYS A 172 ? 1.2998 1.3778 1.3531 0.2361  -0.1348 -0.1322 202 LYS A NZ  
1162 N N   . LEU A 173 ? 0.9576 1.0204 1.0251 0.1763  -0.0439 -0.1325 203 LEU A N   
1163 C CA  . LEU A 173 ? 0.8514 0.9415 0.9366 0.1700  -0.0321 -0.1388 203 LEU A CA  
1164 C C   . LEU A 173 ? 0.8907 0.9740 0.9712 0.1889  -0.0269 -0.1474 203 LEU A C   
1165 O O   . LEU A 173 ? 0.7525 0.7964 0.8066 0.1938  -0.0247 -0.1472 203 LEU A O   
1166 C CB  . LEU A 173 ? 0.7446 0.8258 0.8185 0.1481  -0.0218 -0.1340 203 LEU A CB  
1167 C CG  . LEU A 173 ? 0.7415 0.8498 0.8280 0.1423  -0.0087 -0.1393 203 LEU A CG  
1168 C CD1 . LEU A 173 ? 0.6212 0.7769 0.7436 0.1411  -0.0083 -0.1411 203 LEU A CD1 
1169 C CD2 . LEU A 173 ? 0.7870 0.8863 0.8597 0.1222  -0.0010 -0.1337 203 LEU A CD2 
1170 N N   . GLU A 174 ? 1.0593 1.1818 1.1673 0.1993  -0.0250 -0.1553 204 GLU A N   
1171 C CA  . GLU A 174 ? 1.0919 1.2144 1.1991 0.2200  -0.0196 -0.1653 204 GLU A CA  
1172 C C   . GLU A 174 ? 0.9250 1.0469 1.0230 0.2108  -0.0040 -0.1699 204 GLU A C   
1173 O O   . GLU A 174 ? 0.8976 1.0440 1.0061 0.1919  0.0040  -0.1667 204 GLU A O   
1174 C CB  . GLU A 174 ? 1.1824 1.3545 1.3262 0.2346  -0.0223 -0.1723 204 GLU A CB  
1175 C CG  . GLU A 174 ? 1.2863 1.4603 1.4378 0.2506  -0.0400 -0.1712 204 GLU A CG  
1176 C CD  . GLU A 174 ? 1.4416 1.5776 1.5686 0.2774  -0.0459 -0.1737 204 GLU A CD  
1177 O OE1 . GLU A 174 ? 1.5238 1.6095 1.6164 0.2747  -0.0426 -0.1695 204 GLU A OE1 
1178 O OE2 . GLU A 174 ? 1.4509 1.6071 1.5943 0.3013  -0.0542 -0.1796 204 GLU A OE2 
1179 N N   . ARG A 175 ? 0.8857 0.9780 0.9627 0.2249  -0.0004 -0.1777 205 ARG A N   
1180 C CA  . ARG A 175 ? 1.0846 1.1750 1.1496 0.2197  0.0126  -0.1852 205 ARG A CA  
1181 C C   . ARG A 175 ? 1.0623 1.2084 1.1538 0.2154  0.0243  -0.1879 205 ARG A C   
1182 O O   . ARG A 175 ? 1.0875 1.2711 1.2072 0.2286  0.0244  -0.1914 205 ARG A O   
1183 C CB  . ARG A 175 ? 1.2887 1.3483 1.3354 0.2423  0.0136  -0.1974 205 ARG A CB  
1184 C CG  . ARG A 175 ? 1.4411 1.4493 1.4678 0.2516  0.0021  -0.1930 205 ARG A CG  
1185 C CD  . ARG A 175 ? 1.5739 1.5453 1.5812 0.2722  0.0034  -0.2052 205 ARG A CD  
1186 N NE  . ARG A 175 ? 1.5972 1.5487 1.5848 0.2602  0.0114  -0.2135 205 ARG A NE  
1187 C CZ  . ARG A 175 ? 1.5579 1.4665 1.5234 0.2432  0.0089  -0.2092 205 ARG A CZ  
1188 N NH1 . ARG A 175 ? 1.5363 1.4176 1.4958 0.2366  0.0009  -0.1953 205 ARG A NH1 
1189 N NH2 . ARG A 175 ? 1.5365 1.4317 1.4864 0.2332  0.0143  -0.2191 205 ARG A NH2 
1190 N N   . GLY A 176 ? 0.9789 1.1315 1.0620 0.1970  0.0342  -0.1855 206 GLY A N   
1191 C CA  . GLY A 176 ? 0.7175 0.9199 0.8221 0.1907  0.0474  -0.1848 206 GLY A CA  
1192 C C   . GLY A 176 ? 0.6700 0.8709 0.7586 0.1693  0.0558  -0.1787 206 GLY A C   
1193 O O   . GLY A 176 ? 0.7488 0.9124 0.8075 0.1639  0.0533  -0.1805 206 GLY A O   
1194 N N   . GLN A 177 ? 0.6604 0.9023 0.7700 0.1570  0.0656  -0.1709 207 GLN A N   
1195 C CA  . GLN A 177 ? 0.7151 0.9595 0.8095 0.1388  0.0745  -0.1633 207 GLN A CA  
1196 C C   . GLN A 177 ? 0.6904 0.9018 0.7697 0.1209  0.0637  -0.1536 207 GLN A C   
1197 O O   . GLN A 177 ? 0.6266 0.8215 0.7130 0.1197  0.0509  -0.1501 207 GLN A O   
1198 C CB  . GLN A 177 ? 0.7259 1.0194 0.8488 0.1288  0.0875  -0.1539 207 GLN A CB  
1199 N N   . LYS A 178 ? 0.6097 0.8135 0.6673 0.1086  0.0689  -0.1495 208 LYS A N   
1200 C CA  . LYS A 178 ? 0.4304 0.6081 0.4748 0.0923  0.0601  -0.1402 208 LYS A CA  
1201 C C   . LYS A 178 ? 0.5641 0.7567 0.6326 0.0789  0.0567  -0.1265 208 LYS A C   
1202 O O   . LYS A 178 ? 0.6039 0.8307 0.6958 0.0752  0.0651  -0.1214 208 LYS A O   
1203 C CB  . LYS A 178 ? 0.5029 0.6767 0.5215 0.0838  0.0662  -0.1387 208 LYS A CB  
1204 C CG  . LYS A 178 ? 0.7684 0.9263 0.7610 0.0958  0.0682  -0.1544 208 LYS A CG  
1205 C CD  . LYS A 178 ? 0.7887 0.9347 0.7537 0.0858  0.0676  -0.1538 208 LYS A CD  
1206 C CE  . LYS A 178 ? 0.8857 1.0200 0.8251 0.0977  0.0696  -0.1718 208 LYS A CE  
1207 N NZ  . LYS A 178 ? 0.9336 1.0361 0.8714 0.1086  0.0611  -0.1846 208 LYS A NZ  
1208 N N   . ILE A 179 ? 0.3882 0.5552 0.4517 0.0713  0.0448  -0.1210 209 ILE A N   
1209 C CA  . ILE A 179 ? 0.3418 0.5172 0.4248 0.0595  0.0396  -0.1102 209 ILE A CA  
1210 C C   . ILE A 179 ? 0.3504 0.5356 0.4303 0.0437  0.0472  -0.0988 209 ILE A C   
1211 O O   . ILE A 179 ? 0.4943 0.6727 0.5511 0.0417  0.0527  -0.0984 209 ILE A O   
1212 C CB  . ILE A 179 ? 0.5282 0.6732 0.6035 0.0586  0.0255  -0.1082 209 ILE A CB  
1213 C CG1 . ILE A 179 ? 0.6016 0.7207 0.6503 0.0508  0.0243  -0.1046 209 ILE A CG1 
1214 C CG2 . ILE A 179 ? 0.4535 0.5852 0.5275 0.0753  0.0185  -0.1172 209 ILE A CG2 
1215 C CD1 . ILE A 179 ? 0.5667 0.6571 0.6058 0.0519  0.0135  -0.1030 209 ILE A CD1 
1216 N N   . SER A 180 ? 0.5097 0.7094 0.6124 0.0330  0.0463  -0.0897 210 SER A N   
1217 C CA  . SER A 180 ? 0.5262 0.7351 0.6289 0.0186  0.0545  -0.0768 210 SER A CA  
1218 C C   . SER A 180 ? 0.5517 0.7378 0.6489 0.0075  0.0449  -0.0677 210 SER A C   
1219 O O   . SER A 180 ? 0.7302 0.9185 0.8260 -0.0038 0.0500  -0.0559 210 SER A O   
1220 C CB  . SER A 180 ? 0.6707 0.9149 0.8059 0.0128  0.0642  -0.0718 210 SER A CB  
1221 O OG  . SER A 180 ? 0.8326 1.0836 0.9972 0.0129  0.0537  -0.0757 210 SER A OG  
1222 N N   . GLU A 181 ? 0.4451 0.6090 0.5380 0.0119  0.0315  -0.0725 211 GLU A N   
1223 C CA  . GLU A 181 ? 0.3692 0.5111 0.4543 0.0047  0.0226  -0.0657 211 GLU A CA  
1224 C C   . GLU A 181 ? 0.4285 0.5559 0.4863 0.0020  0.0251  -0.0610 211 GLU A C   
1225 O O   . GLU A 181 ? 0.4412 0.5608 0.4814 0.0085  0.0258  -0.0677 211 GLU A O   
1226 C CB  . GLU A 181 ? 0.3468 0.4706 0.4308 0.0124  0.0094  -0.0721 211 GLU A CB  
1227 C CG  . GLU A 181 ? 0.4001 0.5364 0.5105 0.0145  0.0020  -0.0764 211 GLU A CG  
1228 C CD  . GLU A 181 ? 0.5951 0.7519 0.7192 0.0251  0.0053  -0.0851 211 GLU A CD  
1229 O OE1 . GLU A 181 ? 0.7116 0.8682 0.8217 0.0321  0.0132  -0.0889 211 GLU A OE1 
1230 O OE2 . GLU A 181 ? 0.6200 0.7933 0.7692 0.0273  -0.0008 -0.0894 211 GLU A OE2 
1231 N N   . GLN A 182 ? 0.3855 0.5085 0.4406 -0.0074 0.0255  -0.0499 212 GLN A N   
1232 C CA  . GLN A 182 ? 0.3707 0.4840 0.4019 -0.0091 0.0267  -0.0448 212 GLN A CA  
1233 C C   . GLN A 182 ? 0.4404 0.5327 0.4590 -0.0051 0.0168  -0.0489 212 GLN A C   
1234 O O   . GLN A 182 ? 0.7238 0.8109 0.7246 -0.0042 0.0167  -0.0499 212 GLN A O   
1235 C CB  . GLN A 182 ? 0.4479 0.5607 0.4792 -0.0183 0.0295  -0.0305 212 GLN A CB  
1236 C CG  . GLN A 182 ? 0.5640 0.6978 0.6075 -0.0245 0.0418  -0.0229 212 GLN A CG  
1237 C CD  . GLN A 182 ? 0.7077 0.8463 0.7817 -0.0319 0.0400  -0.0204 212 GLN A CD  
1238 O OE1 . GLN A 182 ? 0.5979 0.7352 0.6868 -0.0281 0.0315  -0.0303 212 GLN A OE1 
1239 N NE2 . GLN A 182 ? 0.8159 0.9598 0.8994 -0.0426 0.0475  -0.0069 212 GLN A NE2 
1240 N N   . ILE A 183 ? 0.4118 0.4937 0.4398 -0.0026 0.0087  -0.0514 213 ILE A N   
1241 C CA  . ILE A 183 ? 0.3882 0.4520 0.4047 0.0017  0.0015  -0.0538 213 ILE A CA  
1242 C C   . ILE A 183 ? 0.2318 0.2887 0.2507 0.0102  -0.0023 -0.0624 213 ILE A C   
1243 O O   . ILE A 183 ? 0.4744 0.5355 0.5070 0.0136  -0.0059 -0.0652 213 ILE A O   
1244 C CB  . ILE A 183 ? 0.5394 0.5920 0.5564 -0.0006 -0.0049 -0.0471 213 ILE A CB  
1245 C CG1 . ILE A 183 ? 0.5855 0.6401 0.5948 -0.0065 -0.0019 -0.0377 213 ILE A CG1 
1246 C CG2 . ILE A 183 ? 0.5533 0.5910 0.5606 0.0054  -0.0105 -0.0496 213 ILE A CG2 
1247 C CD1 . ILE A 183 ? 0.5756 0.6194 0.5882 -0.0084 -0.0071 -0.0307 213 ILE A CD1 
1248 N N   . VAL A 184 ? 0.2360 0.2821 0.2418 0.0136  -0.0022 -0.0662 214 VAL A N   
1249 C CA  . VAL A 184 ? 0.2826 0.3160 0.2862 0.0222  -0.0055 -0.0717 214 VAL A CA  
1250 C C   . VAL A 184 ? 0.4324 0.4484 0.4253 0.0230  -0.0091 -0.0678 214 VAL A C   
1251 O O   . VAL A 184 ? 0.4846 0.4977 0.4697 0.0174  -0.0072 -0.0652 214 VAL A O   
1252 C CB  . VAL A 184 ? 0.3147 0.3457 0.3124 0.0259  -0.0010 -0.0796 214 VAL A CB  
1253 C CG1 . VAL A 184 ? 0.2049 0.2162 0.1970 0.0349  -0.0043 -0.0828 214 VAL A CG1 
1254 C CG2 . VAL A 184 ? 0.2548 0.3054 0.2632 0.0284  0.0040  -0.0841 214 VAL A CG2 
1255 N N   . ILE A 185 ? 0.5159 0.5227 0.5087 0.0306  -0.0142 -0.0675 215 ILE A N   
1256 C CA  . ILE A 185 ? 0.4490 0.4397 0.4300 0.0339  -0.0155 -0.0634 215 ILE A CA  
1257 C C   . ILE A 185 ? 0.3949 0.3722 0.3703 0.0437  -0.0163 -0.0664 215 ILE A C   
1258 O O   . ILE A 185 ? 0.5305 0.5131 0.5130 0.0508  -0.0195 -0.0715 215 ILE A O   
1259 C CB  . ILE A 185 ? 0.3862 0.3751 0.3660 0.0376  -0.0212 -0.0598 215 ILE A CB  
1260 C CG1 . ILE A 185 ? 0.5618 0.5632 0.5525 0.0311  -0.0232 -0.0591 215 ILE A CG1 
1261 C CG2 . ILE A 185 ? 0.3500 0.3297 0.3183 0.0376  -0.0188 -0.0536 215 ILE A CG2 
1262 C CD1 . ILE A 185 ? 0.6188 0.6163 0.6108 0.0356  -0.0311 -0.0592 215 ILE A CD1 
1263 N N   . GLY A 186 ? 0.3160 0.2764 0.2799 0.0444  -0.0133 -0.0626 216 GLY A N   
1264 C CA  . GLY A 186 ? 0.3456 0.2882 0.3015 0.0541  -0.0133 -0.0633 216 GLY A CA  
1265 C C   . GLY A 186 ? 0.4962 0.4185 0.4411 0.0509  -0.0077 -0.0572 216 GLY A C   
1266 O O   . GLY A 186 ? 0.4965 0.4222 0.4426 0.0403  -0.0038 -0.0532 216 GLY A O   
1267 N N   . THR A 187 ? 0.4991 0.4005 0.4347 0.0601  -0.0074 -0.0559 217 THR A N   
1268 C CA  . THR A 187 ? 0.4899 0.3679 0.4155 0.0567  -0.0011 -0.0480 217 THR A CA  
1269 C C   . THR A 187 ? 0.6046 0.4693 0.5334 0.0489  0.0021  -0.0543 217 THR A C   
1270 O O   . THR A 187 ? 0.8208 0.6850 0.7523 0.0548  -0.0006 -0.0639 217 THR A O   
1271 C CB  . THR A 187 ? 0.6051 0.4626 0.5144 0.0720  -0.0020 -0.0404 217 THR A CB  
1272 O OG1 . THR A 187 ? 0.6480 0.5005 0.5571 0.0852  -0.0078 -0.0476 217 THR A OG1 
1273 C CG2 . THR A 187 ? 0.3116 0.1810 0.2145 0.0793  -0.0056 -0.0354 217 THR A CG2 
1274 N N   . PRO A 188 ? 0.6252 0.4798 0.5547 0.0358  0.0078  -0.0497 218 PRO A N   
1275 C CA  . PRO A 188 ? 0.6773 0.5203 0.6114 0.0253  0.0091  -0.0579 218 PRO A CA  
1276 C C   . PRO A 188 ? 0.6772 0.4977 0.6049 0.0361  0.0070  -0.0661 218 PRO A C   
1277 O O   . PRO A 188 ? 0.6557 0.4814 0.5874 0.0346  0.0048  -0.0791 218 PRO A O   
1278 C CB  . PRO A 188 ? 0.6268 0.4542 0.5615 0.0132  0.0156  -0.0478 218 PRO A CB  
1279 C CG  . PRO A 188 ? 0.5589 0.4076 0.4951 0.0127  0.0179  -0.0375 218 PRO A CG  
1280 C CD  . PRO A 188 ? 0.6272 0.4826 0.5546 0.0302  0.0132  -0.0370 218 PRO A CD  
1281 N N   . GLY A 189 ? 0.6918 0.4884 0.6081 0.0488  0.0078  -0.0585 219 GLY A N   
1282 C CA  . GLY A 189 ? 0.5946 0.3669 0.5040 0.0617  0.0056  -0.0651 219 GLY A CA  
1283 C C   . GLY A 189 ? 0.6511 0.4456 0.5670 0.0728  0.0005  -0.0784 219 GLY A C   
1284 O O   . GLY A 189 ? 0.6260 0.4138 0.5431 0.0745  0.0001  -0.0909 219 GLY A O   
1285 N N   . THR A 190 ? 0.6350 0.4563 0.5555 0.0801  -0.0032 -0.0763 220 THR A N   
1286 C CA  . THR A 190 ? 0.5601 0.4068 0.4910 0.0893  -0.0070 -0.0870 220 THR A CA  
1287 C C   . THR A 190 ? 0.5307 0.4006 0.4717 0.0764  -0.0044 -0.0959 220 THR A C   
1288 O O   . THR A 190 ? 0.7561 0.6361 0.7018 0.0819  -0.0037 -0.1069 220 THR A O   
1289 C CB  . THR A 190 ? 0.5418 0.4108 0.4779 0.0979  -0.0126 -0.0825 220 THR A CB  
1290 O OG1 . THR A 190 ? 0.6951 0.5430 0.6182 0.1127  -0.0162 -0.0750 220 THR A OG1 
1291 C CG2 . THR A 190 ? 0.4664 0.3644 0.4185 0.1053  -0.0157 -0.0928 220 THR A CG2 
1292 N N   . VAL A 191 ? 0.4379 0.3174 0.3810 0.0609  -0.0026 -0.0907 221 VAL A N   
1293 C CA  . VAL A 191 ? 0.5701 0.4715 0.5195 0.0497  -0.0010 -0.0971 221 VAL A CA  
1294 C C   . VAL A 191 ? 0.6688 0.5569 0.6132 0.0463  0.0007  -0.1088 221 VAL A C   
1295 O O   . VAL A 191 ? 0.5677 0.4726 0.5137 0.0473  0.0018  -0.1186 221 VAL A O   
1296 C CB  . VAL A 191 ? 0.5905 0.5026 0.5423 0.0357  -0.0005 -0.0888 221 VAL A CB  
1297 C CG1 . VAL A 191 ? 0.5350 0.4649 0.4895 0.0251  0.0003  -0.0952 221 VAL A CG1 
1298 C CG2 . VAL A 191 ? 0.5336 0.4616 0.4900 0.0398  -0.0029 -0.0807 221 VAL A CG2 
1299 N N   . LEU A 192 ? 0.7361 0.5933 0.6737 0.0423  0.0010  -0.1080 222 LEU A N   
1300 C CA  . LEU A 192 ? 0.5926 0.4313 0.5250 0.0388  0.0008  -0.1210 222 LEU A CA  
1301 C C   . LEU A 192 ? 0.7139 0.5499 0.6423 0.0558  0.0009  -0.1331 222 LEU A C   
1302 O O   . LEU A 192 ? 0.8960 0.7389 0.8213 0.0558  0.0012  -0.1468 222 LEU A O   
1303 C CB  . LEU A 192 ? 0.5892 0.3903 0.5171 0.0317  0.0014  -0.1165 222 LEU A CB  
1304 C CG  . LEU A 192 ? 0.5779 0.3527 0.5012 0.0259  -0.0004 -0.1308 222 LEU A CG  
1305 C CD1 . LEU A 192 ? 0.6294 0.4273 0.5562 0.0124  -0.0033 -0.1415 222 LEU A CD1 
1306 C CD2 . LEU A 192 ? 0.5083 0.2452 0.4309 0.0162  0.0011  -0.1227 222 LEU A CD2 
1307 N N   . ASP A 193 ? 0.7142 0.5423 0.6423 0.0717  0.0004  -0.1284 223 ASP A N   
1308 C CA  . ASP A 193 ? 0.7949 0.6242 0.7224 0.0905  0.0004  -0.1394 223 ASP A CA  
1309 C C   . ASP A 193 ? 0.8607 0.7322 0.7978 0.0924  0.0030  -0.1460 223 ASP A C   
1310 O O   . ASP A 193 ? 0.8470 0.7241 0.7812 0.0993  0.0057  -0.1595 223 ASP A O   
1311 C CB  . ASP A 193 ? 0.7793 0.5987 0.7068 0.1081  -0.0023 -0.1317 223 ASP A CB  
1312 C CG  . ASP A 193 ? 1.0455 0.8199 0.9602 0.1087  -0.0032 -0.1232 223 ASP A CG  
1313 O OD1 . ASP A 193 ? 1.2247 0.9806 1.1354 0.0915  -0.0013 -0.1208 223 ASP A OD1 
1314 O OD2 . ASP A 193 ? 0.9561 0.7149 0.8654 0.1262  -0.0059 -0.1181 223 ASP A OD2 
1315 N N   . TRP A 194 ? 0.7934 0.6932 0.7409 0.0862  0.0029  -0.1361 224 TRP A N   
1316 C CA  . TRP A 194 ? 0.7044 0.6433 0.6628 0.0853  0.0064  -0.1385 224 TRP A CA  
1317 C C   . TRP A 194 ? 0.5943 0.5422 0.5452 0.0757  0.0103  -0.1464 224 TRP A C   
1318 O O   . TRP A 194 ? 0.6295 0.6029 0.5834 0.0799  0.0156  -0.1523 224 TRP A O   
1319 C CB  . TRP A 194 ? 0.6354 0.5943 0.6046 0.0774  0.0044  -0.1258 224 TRP A CB  
1320 C CG  . TRP A 194 ? 0.5046 0.4678 0.4835 0.0894  0.0000  -0.1215 224 TRP A CG  
1321 C CD1 . TRP A 194 ? 0.6472 0.5893 0.6214 0.1045  -0.0038 -0.1229 224 TRP A CD1 
1322 C CD2 . TRP A 194 ? 0.3676 0.3569 0.3619 0.0877  -0.0028 -0.1155 224 TRP A CD2 
1323 N NE1 . TRP A 194 ? 0.5543 0.5109 0.5396 0.1134  -0.0094 -0.1187 224 TRP A NE1 
1324 C CE2 . TRP A 194 ? 0.3921 0.3776 0.3910 0.1025  -0.0092 -0.1151 224 TRP A CE2 
1325 C CE3 . TRP A 194 ? 0.2957 0.3092 0.3001 0.0755  -0.0011 -0.1106 224 TRP A CE3 
1326 C CZ2 . TRP A 194 ? 0.3407 0.3477 0.3551 0.1043  -0.0152 -0.1119 224 TRP A CZ2 
1327 C CZ3 . TRP A 194 ? 0.4511 0.4825 0.4715 0.0765  -0.0059 -0.1067 224 TRP A CZ3 
1328 C CH2 . TRP A 194 ? 0.4429 0.4720 0.4688 0.0903  -0.0135 -0.1083 224 TRP A CH2 
1329 N N   . CYS A 195 ? 0.5117 0.4402 0.4530 0.0631  0.0077  -0.1462 225 CYS A N   
1330 C CA  . CYS A 195 ? 0.5860 0.5225 0.5185 0.0536  0.0085  -0.1540 225 CYS A CA  
1331 C C   . CYS A 195 ? 0.6070 0.5226 0.5266 0.0604  0.0082  -0.1715 225 CYS A C   
1332 O O   . CYS A 195 ? 0.8266 0.7516 0.7361 0.0578  0.0088  -0.1820 225 CYS A O   
1333 C CB  . CYS A 195 ? 0.6559 0.5858 0.5878 0.0365  0.0043  -0.1467 225 CYS A CB  
1334 S SG  . CYS A 195 ? 0.7426 0.7014 0.6847 0.0281  0.0048  -0.1301 225 CYS A SG  
1335 N N   . SER A 196 ? 0.6360 0.5212 0.5539 0.0702  0.0065  -0.1748 226 SER A N   
1336 C CA  . SER A 196 ? 0.7275 0.5859 0.6328 0.0783  0.0054  -0.1922 226 SER A CA  
1337 C C   . SER A 196 ? 0.8333 0.6888 0.7396 0.1014  0.0085  -0.1984 226 SER A C   
1338 O O   . SER A 196 ? 0.8631 0.7496 0.7723 0.1121  0.0141  -0.2039 226 SER A O   
1339 C CB  . SER A 196 ? 0.7474 0.5631 0.6480 0.0674  -0.0002 -0.1924 226 SER A CB  
1340 O OG  . SER A 196 ? 0.7853 0.5821 0.6918 0.0700  -0.0004 -0.1777 226 SER A OG  
1341 N N   . LYS A 197 ? 0.8523 0.6719 0.7569 0.1096  0.0053  -0.1962 227 LYS A N   
1342 C CA  . LYS A 197 ? 0.9990 0.8095 0.9030 0.1339  0.0064  -0.2031 227 LYS A CA  
1343 C C   . LYS A 197 ? 0.9844 0.8404 0.9031 0.1479  0.0113  -0.2015 227 LYS A C   
1344 O O   . LYS A 197 ? 1.0404 0.9095 0.9582 0.1642  0.0157  -0.2148 227 LYS A O   
1345 C CB  . LYS A 197 ? 1.2297 1.0010 1.1315 0.1399  0.0021  -0.1929 227 LYS A CB  
1346 C CG  . LYS A 197 ? 1.4000 1.1603 1.3008 0.1674  0.0016  -0.1986 227 LYS A CG  
1347 C CD  . LYS A 197 ? 1.4752 1.1907 1.3686 0.1737  -0.0030 -0.1872 227 LYS A CD  
1348 C CE  . LYS A 197 ? 1.5108 1.2055 1.3988 0.2027  -0.0047 -0.1958 227 LYS A CE  
1349 N NZ  . LYS A 197 ? 1.4732 1.1495 1.3507 0.2092  -0.0031 -0.2175 227 LYS A NZ  
1350 N N   . LEU A 198 ? 0.8308 0.7109 0.7640 0.1418  0.0105  -0.1860 228 LEU A N   
1351 C CA  . LEU A 198 ? 0.7567 0.6781 0.7086 0.1531  0.0135  -0.1836 228 LEU A CA  
1352 C C   . LEU A 198 ? 0.8333 0.7971 0.7928 0.1438  0.0211  -0.1851 228 LEU A C   
1353 O O   . LEU A 198 ? 0.8346 0.8363 0.8122 0.1506  0.0257  -0.1839 228 LEU A O   
1354 C CB  . LEU A 198 ? 0.8079 0.7344 0.7715 0.1510  0.0076  -0.1681 228 LEU A CB  
1355 C CG  . LEU A 198 ? 0.8821 0.7648 0.8336 0.1565  0.0009  -0.1616 228 LEU A CG  
1356 C CD1 . LEU A 198 ? 0.6952 0.5862 0.6541 0.1537  -0.0046 -0.1467 228 LEU A CD1 
1357 C CD2 . LEU A 198 ? 0.9362 0.7995 0.8835 0.1812  -0.0007 -0.1705 228 LEU A CD2 
1358 N N   . LYS A 199 ? 0.8043 0.7622 0.7505 0.1281  0.0223  -0.1869 229 LYS A N   
1359 C CA  . LYS A 199 ? 0.7625 0.7554 0.7094 0.1201  0.0296  -0.1873 229 LYS A CA  
1360 C C   . LYS A 199 ? 0.7083 0.7400 0.6775 0.1156  0.0332  -0.1742 229 LYS A C   
1361 O O   . LYS A 199 ? 0.7144 0.7799 0.6938 0.1218  0.0419  -0.1763 229 LYS A O   
1362 C CB  . LYS A 199 ? 0.8464 0.8495 0.7839 0.1348  0.0372  -0.2039 229 LYS A CB  
1363 C CG  . LYS A 199 ? 0.9966 0.9659 0.9089 0.1342  0.0336  -0.2191 229 LYS A CG  
1364 C CD  . LYS A 199 ? 1.0131 1.0000 0.9117 0.1462  0.0419  -0.2352 229 LYS A CD  
1365 C CE  . LYS A 199 ? 1.0011 0.9570 0.8733 0.1421  0.0361  -0.2513 229 LYS A CE  
1366 N NZ  . LYS A 199 ? 1.1515 1.1244 1.0053 0.1553  0.0438  -0.2683 229 LYS A NZ  
1367 N N   . PHE A 200 ? 0.6801 0.7065 0.6570 0.1046  0.0269  -0.1610 230 PHE A N   
1368 C CA  . PHE A 200 ? 0.6146 0.6726 0.6118 0.0979  0.0284  -0.1495 230 PHE A CA  
1369 C C   . PHE A 200 ? 0.5923 0.6598 0.5836 0.0802  0.0309  -0.1414 230 PHE A C   
1370 O O   . PHE A 200 ? 0.6410 0.7355 0.6460 0.0733  0.0350  -0.1329 230 PHE A O   
1371 C CB  . PHE A 200 ? 0.4417 0.4894 0.4494 0.0991  0.0191  -0.1412 230 PHE A CB  
1372 C CG  . PHE A 200 ? 0.5293 0.5758 0.5462 0.1184  0.0158  -0.1470 230 PHE A CG  
1373 C CD1 . PHE A 200 ? 0.5572 0.6373 0.5931 0.1292  0.0212  -0.1527 230 PHE A CD1 
1374 C CD2 . PHE A 200 ? 0.6920 0.7053 0.6990 0.1266  0.0077  -0.1457 230 PHE A CD2 
1375 C CE1 . PHE A 200 ? 0.5611 0.6431 0.6071 0.1489  0.0170  -0.1584 230 PHE A CE1 
1376 C CE2 . PHE A 200 ? 0.6160 0.6274 0.6295 0.1466  0.0035  -0.1501 230 PHE A CE2 
1377 C CZ  . PHE A 200 ? 0.5241 0.5706 0.5577 0.1584  0.0074  -0.1572 230 PHE A CZ  
1378 N N   . ILE A 201 ? 0.5807 0.6256 0.5525 0.0730  0.0280  -0.1441 231 ILE A N   
1379 C CA  . ILE A 201 ? 0.5241 0.5753 0.4881 0.0581  0.0282  -0.1369 231 ILE A CA  
1380 C C   . ILE A 201 ? 0.5661 0.6109 0.5089 0.0573  0.0295  -0.1479 231 ILE A C   
1381 O O   . ILE A 201 ? 0.6675 0.6871 0.6000 0.0618  0.0256  -0.1594 231 ILE A O   
1382 C CB  . ILE A 201 ? 0.6691 0.7005 0.6327 0.0479  0.0198  -0.1279 231 ILE A CB  
1383 C CG1 . ILE A 201 ? 0.5815 0.6131 0.5611 0.0511  0.0162  -0.1197 231 ILE A CG1 
1384 C CG2 . ILE A 201 ? 0.6436 0.6851 0.6020 0.0348  0.0195  -0.1198 231 ILE A CG2 
1385 C CD1 . ILE A 201 ? 0.6048 0.6202 0.5822 0.0430  0.0099  -0.1105 231 ILE A CD1 
1386 N N   . ASP A 202 ? 0.6144 0.6804 0.5497 0.0517  0.0344  -0.1446 232 ASP A N   
1387 C CA  . ASP A 202 ? 0.6319 0.6932 0.5445 0.0496  0.0328  -0.1542 232 ASP A CA  
1388 C C   . ASP A 202 ? 0.6872 0.7387 0.5964 0.0355  0.0239  -0.1471 232 ASP A C   
1389 O O   . ASP A 202 ? 0.7147 0.7821 0.6262 0.0284  0.0249  -0.1342 232 ASP A O   
1390 C CB  . ASP A 202 ? 0.6785 0.7689 0.5807 0.0531  0.0429  -0.1535 232 ASP A CB  
1391 C CG  . ASP A 202 ? 0.9292 1.0160 0.8038 0.0538  0.0401  -0.1658 232 ASP A CG  
1392 O OD1 . ASP A 202 ? 0.9533 1.0145 0.8199 0.0520  0.0303  -0.1782 232 ASP A OD1 
1393 O OD2 . ASP A 202 ? 1.0282 1.1376 0.8888 0.0559  0.0475  -0.1629 232 ASP A OD2 
1394 N N   . PRO A 203 ? 0.5462 0.5715 0.4512 0.0316  0.0155  -0.1553 233 PRO A N   
1395 C CA  . PRO A 203 ? 0.5776 0.5959 0.4847 0.0185  0.0075  -0.1487 233 PRO A CA  
1396 C C   . PRO A 203 ? 0.6114 0.6474 0.5051 0.0129  0.0049  -0.1488 233 PRO A C   
1397 O O   . PRO A 203 ? 0.6004 0.6433 0.4987 0.0044  0.0005  -0.1382 233 PRO A O   
1398 C CB  . PRO A 203 ? 0.5820 0.5699 0.4871 0.0159  0.0011  -0.1604 233 PRO A CB  
1399 C CG  . PRO A 203 ? 0.5885 0.5626 0.4919 0.0293  0.0054  -0.1700 233 PRO A CG  
1400 C CD  . PRO A 203 ? 0.5048 0.5059 0.4031 0.0395  0.0137  -0.1717 233 PRO A CD  
1401 N N   . LYS A 204 ? 0.5342 0.5781 0.4100 0.0197  0.0073  -0.1607 234 LYS A N   
1402 C CA  . LYS A 204 ? 0.6282 0.6880 0.4861 0.0169  0.0036  -0.1624 234 LYS A CA  
1403 C C   . LYS A 204 ? 0.6326 0.7170 0.4902 0.0168  0.0103  -0.1441 234 LYS A C   
1404 O O   . LYS A 204 ? 0.7596 0.8578 0.6013 0.0157  0.0075  -0.1413 234 LYS A O   
1405 C CB  . LYS A 204 ? 0.7767 0.8367 0.6113 0.0263  0.0044  -0.1817 234 LYS A CB  
1406 C CG  . LYS A 204 ? 0.7904 0.8222 0.6221 0.0245  -0.0051 -0.2018 234 LYS A CG  
1407 C CD  . LYS A 204 ? 0.7452 0.7702 0.5828 0.0096  -0.0187 -0.2025 234 LYS A CD  
1408 C CE  . LYS A 204 ? 0.6695 0.6680 0.5023 0.0058  -0.0288 -0.2246 234 LYS A CE  
1409 N NZ  . LYS A 204 ? 0.6873 0.6548 0.5320 0.0081  -0.0254 -0.2280 234 LYS A NZ  
1410 N N   . LYS A 205 ? 0.5272 0.6156 0.4020 0.0180  0.0181  -0.1317 235 LYS A N   
1411 C CA  . LYS A 205 ? 0.4670 0.5742 0.3445 0.0161  0.0245  -0.1138 235 LYS A CA  
1412 C C   . LYS A 205 ? 0.5360 0.6372 0.4298 0.0079  0.0189  -0.0999 235 LYS A C   
1413 O O   . LYS A 205 ? 0.5920 0.7029 0.4897 0.0054  0.0226  -0.0848 235 LYS A O   
1414 C CB  . LYS A 205 ? 0.5339 0.6546 0.4206 0.0223  0.0377  -0.1098 235 LYS A CB  
1415 C CG  . LYS A 205 ? 0.7118 0.8448 0.5801 0.0325  0.0462  -0.1211 235 LYS A CG  
1416 C CD  . LYS A 205 ? 0.8522 1.0071 0.7322 0.0370  0.0613  -0.1131 235 LYS A CD  
1417 C CE  . LYS A 205 ? 1.1592 1.3305 1.0181 0.0486  0.0720  -0.1227 235 LYS A CE  
1418 N NZ  . LYS A 205 ? 1.2817 1.4791 1.1564 0.0526  0.0887  -0.1144 235 LYS A NZ  
1419 N N   . ILE A 206 ? 0.5000 0.5839 0.4026 0.0039  0.0108  -0.1049 236 ILE A N   
1420 C CA  . ILE A 206 ? 0.4307 0.5093 0.3467 -0.0020 0.0059  -0.0934 236 ILE A CA  
1421 C C   . ILE A 206 ? 0.4679 0.5554 0.3758 -0.0063 -0.0005 -0.0873 236 ILE A C   
1422 O O   . ILE A 206 ? 0.6560 0.7446 0.5547 -0.0085 -0.0072 -0.0967 236 ILE A O   
1423 C CB  . ILE A 206 ? 0.3629 0.4219 0.2895 -0.0043 0.0011  -0.0988 236 ILE A CB  
1424 C CG1 . ILE A 206 ? 0.3252 0.3740 0.2583 0.0024  0.0059  -0.1043 236 ILE A CG1 
1425 C CG2 . ILE A 206 ? 0.3007 0.3570 0.2390 -0.0083 -0.0022 -0.0868 236 ILE A CG2 
1426 C CD1 . ILE A 206 ? 0.4604 0.5188 0.4049 0.0060  0.0113  -0.0948 236 ILE A CD1 
1427 N N   . LYS A 207 ? 0.4822 0.5757 0.3943 -0.0070 0.0008  -0.0723 237 LYS A N   
1428 C CA  . LYS A 207 ? 0.4837 0.5853 0.3892 -0.0084 -0.0056 -0.0646 237 LYS A CA  
1429 C C   . LYS A 207 ? 0.5493 0.6446 0.4688 -0.0118 -0.0126 -0.0621 237 LYS A C   
1430 O O   . LYS A 207 ? 0.5647 0.6682 0.4820 -0.0134 -0.0202 -0.0628 237 LYS A O   
1431 C CB  . LYS A 207 ? 0.4210 0.5290 0.3219 -0.0063 -0.0004 -0.0487 237 LYS A CB  
1432 C CG  . LYS A 207 ? 0.6407 0.7606 0.5230 -0.0029 0.0067  -0.0478 237 LYS A CG  
1433 C CD  . LYS A 207 ? 0.8174 0.9414 0.6935 -0.0021 0.0115  -0.0292 237 LYS A CD  
1434 C CE  . LYS A 207 ? 0.9397 1.0611 0.8311 -0.0049 0.0222  -0.0211 237 LYS A CE  
1435 N NZ  . LYS A 207 ? 0.9923 1.1178 0.8750 -0.0055 0.0298  -0.0031 237 LYS A NZ  
1436 N N   . VAL A 208 ? 0.4536 0.5370 0.3874 -0.0120 -0.0099 -0.0592 238 VAL A N   
1437 C CA  . VAL A 208 ? 0.3283 0.4066 0.2736 -0.0134 -0.0140 -0.0556 238 VAL A CA  
1438 C C   . VAL A 208 ? 0.3563 0.4199 0.3109 -0.0144 -0.0122 -0.0612 238 VAL A C   
1439 O O   . VAL A 208 ? 0.3712 0.4262 0.3285 -0.0111 -0.0081 -0.0616 238 VAL A O   
1440 C CB  . VAL A 208 ? 0.3780 0.4547 0.3276 -0.0098 -0.0137 -0.0428 238 VAL A CB  
1441 C CG1 . VAL A 208 ? 0.2281 0.3017 0.1873 -0.0089 -0.0170 -0.0401 238 VAL A CG1 
1442 C CG2 . VAL A 208 ? 0.3317 0.4188 0.2707 -0.0079 -0.0153 -0.0346 238 VAL A CG2 
1443 N N   . PHE A 209 ? 0.3613 0.4231 0.3215 -0.0189 -0.0153 -0.0647 239 PHE A N   
1444 C CA  . PHE A 209 ? 0.3178 0.3636 0.2847 -0.0202 -0.0129 -0.0676 239 PHE A CA  
1445 C C   . PHE A 209 ? 0.4092 0.4559 0.3853 -0.0205 -0.0129 -0.0592 239 PHE A C   
1446 O O   . PHE A 209 ? 0.3062 0.3663 0.2882 -0.0247 -0.0160 -0.0577 239 PHE A O   
1447 C CB  . PHE A 209 ? 0.2290 0.2689 0.1946 -0.0268 -0.0149 -0.0794 239 PHE A CB  
1448 C CG  . PHE A 209 ? 0.4210 0.4422 0.3937 -0.0302 -0.0124 -0.0803 239 PHE A CG  
1449 C CD1 . PHE A 209 ? 0.4685 0.4928 0.4521 -0.0390 -0.0138 -0.0784 239 PHE A CD1 
1450 C CD2 . PHE A 209 ? 0.4277 0.4292 0.3967 -0.0245 -0.0084 -0.0824 239 PHE A CD2 
1451 C CE1 . PHE A 209 ? 0.5473 0.5529 0.5369 -0.0432 -0.0097 -0.0769 239 PHE A CE1 
1452 C CE2 . PHE A 209 ? 0.4200 0.4010 0.3924 -0.0266 -0.0058 -0.0813 239 PHE A CE2 
1453 C CZ  . PHE A 209 ? 0.5798 0.5617 0.5619 -0.0367 -0.0057 -0.0778 239 PHE A CZ  
1454 N N   . VAL A 210 ? 0.3520 0.3869 0.3292 -0.0147 -0.0095 -0.0542 240 VAL A N   
1455 C CA  . VAL A 210 ? 0.3384 0.3736 0.3209 -0.0125 -0.0078 -0.0466 240 VAL A CA  
1456 C C   . VAL A 210 ? 0.2776 0.2966 0.2609 -0.0132 -0.0032 -0.0462 240 VAL A C   
1457 O O   . VAL A 210 ? 0.3853 0.3885 0.3627 -0.0088 -0.0019 -0.0487 240 VAL A O   
1458 C CB  . VAL A 210 ? 0.2686 0.3023 0.2481 -0.0032 -0.0084 -0.0404 240 VAL A CB  
1459 C CG1 . VAL A 210 ? 0.3279 0.3601 0.3092 0.0015  -0.0056 -0.0343 240 VAL A CG1 
1460 C CG2 . VAL A 210 ? 0.2316 0.2779 0.2102 -0.0023 -0.0122 -0.0375 240 VAL A CG2 
1461 N N   . LEU A 211 ? 0.3225 0.3463 0.3136 -0.0183 -0.0003 -0.0421 241 LEU A N   
1462 C CA  . LEU A 211 ? 0.3637 0.3715 0.3544 -0.0187 0.0061  -0.0377 241 LEU A CA  
1463 C C   . LEU A 211 ? 0.4150 0.4285 0.4045 -0.0105 0.0104  -0.0279 241 LEU A C   
1464 O O   . LEU A 211 ? 0.4515 0.4829 0.4511 -0.0136 0.0127  -0.0234 241 LEU A O   
1465 C CB  . LEU A 211 ? 0.3331 0.3405 0.3350 -0.0327 0.0081  -0.0400 241 LEU A CB  
1466 C CG  . LEU A 211 ? 0.5665 0.5491 0.5656 -0.0345 0.0152  -0.0355 241 LEU A CG  
1467 C CD1 . LEU A 211 ? 0.7050 0.6770 0.7126 -0.0490 0.0142  -0.0427 241 LEU A CD1 
1468 C CD2 . LEU A 211 ? 0.5527 0.5404 0.5549 -0.0323 0.0239  -0.0224 241 LEU A CD2 
1469 N N   . ASP A 212 ? 0.4237 0.4236 0.4008 0.0012  0.0109  -0.0256 242 ASP A N   
1470 C CA  . ASP A 212 ? 0.5249 0.5279 0.4959 0.0120  0.0136  -0.0189 242 ASP A CA  
1471 C C   . ASP A 212 ? 0.4702 0.4644 0.4364 0.0138  0.0231  -0.0102 242 ASP A C   
1472 O O   . ASP A 212 ? 0.5286 0.5055 0.4916 0.0098  0.0263  -0.0093 242 ASP A O   
1473 C CB  . ASP A 212 ? 0.6563 0.6499 0.6161 0.0236  0.0074  -0.0223 242 ASP A CB  
1474 C CG  . ASP A 212 ? 0.8957 0.8939 0.8491 0.0350  0.0066  -0.0192 242 ASP A CG  
1475 O OD1 . ASP A 212 ? 0.9596 0.9735 0.9199 0.0342  0.0087  -0.0160 242 ASP A OD1 
1476 O OD2 . ASP A 212 ? 0.8727 0.8593 0.8144 0.0458  0.0028  -0.0212 242 ASP A OD2 
1477 N N   . GLU A 213 ? 0.4535 0.4585 0.4179 0.0208  0.0284  -0.0034 243 GLU A N   
1478 C CA  . GLU A 213 ? 0.3736 0.3724 0.3303 0.0248  0.0396  0.0070  243 GLU A CA  
1479 C C   . GLU A 213 ? 0.3673 0.3618 0.3360 0.0092  0.0475  0.0121  243 GLU A C   
1480 O O   . GLU A 213 ? 0.4127 0.3862 0.3705 0.0104  0.0537  0.0186  243 GLU A O   
1481 C CB  . GLU A 213 ? 0.4747 0.4502 0.4079 0.0388  0.0379  0.0077  243 GLU A CB  
1482 C CG  . GLU A 213 ? 0.7608 0.7350 0.6843 0.0513  0.0267  -0.0007 243 GLU A CG  
1483 C CD  . GLU A 213 ? 1.1800 1.1635 1.0944 0.0645  0.0284  0.0014  243 GLU A CD  
1484 O OE1 . GLU A 213 ? 1.3694 1.3661 1.2875 0.0640  0.0390  0.0095  243 GLU A OE1 
1485 O OE2 . GLU A 213 ? 1.3233 1.3014 1.2279 0.0753  0.0190  -0.0057 243 GLU A OE2 
1486 N N   . ALA A 214 ? 0.3533 0.3662 0.3440 -0.0054 0.0465  0.0091  244 ALA A N   
1487 C CA  . ALA A 214 ? 0.3789 0.3864 0.3841 -0.0228 0.0518  0.0114  244 ALA A CA  
1488 C C   . ALA A 214 ? 0.4379 0.4381 0.4403 -0.0232 0.0668  0.0263  244 ALA A C   
1489 O O   . ALA A 214 ? 0.4629 0.4395 0.4639 -0.0315 0.0719  0.0307  244 ALA A O   
1490 C CB  . ALA A 214 ? 0.3329 0.3685 0.3640 -0.0372 0.0481  0.0062  244 ALA A CB  
1491 N N   . ASP A 215 ? 0.4634 0.4827 0.4636 -0.0133 0.0746  0.0345  245 ASP A N   
1492 C CA  . ASP A 215 ? 0.5649 0.5823 0.5612 -0.0122 0.0913  0.0504  245 ASP A CA  
1493 C C   . ASP A 215 ? 0.7236 0.7049 0.6901 -0.0013 0.0943  0.0567  245 ASP A C   
1494 O O   . ASP A 215 ? 0.8267 0.7959 0.7877 -0.0038 0.1081  0.0712  245 ASP A O   
1495 C CB  . ASP A 215 ? 0.5987 0.6450 0.5943 0.0009  0.0987  0.0560  245 ASP A CB  
1496 C CG  . ASP A 215 ? 0.8685 0.9091 0.8388 0.0233  0.0895  0.0488  245 ASP A CG  
1497 O OD1 . ASP A 215 ? 0.7317 0.7735 0.7047 0.0243  0.0750  0.0362  245 ASP A OD1 
1498 O OD2 . ASP A 215 ? 1.1040 1.1390 1.0515 0.0398  0.0969  0.0558  245 ASP A OD2 
1499 N N   . VAL A 216 ? 0.6434 0.6088 0.5920 0.0108  0.0814  0.0465  246 VAL A N   
1500 C CA  . VAL A 216 ? 0.5740 0.5080 0.4953 0.0235  0.0805  0.0500  246 VAL A CA  
1501 C C   . VAL A 216 ? 0.5816 0.4892 0.5063 0.0134  0.0758  0.0457  246 VAL A C   
1502 O O   . VAL A 216 ? 0.5907 0.4699 0.4990 0.0181  0.0803  0.0540  246 VAL A O   
1503 C CB  . VAL A 216 ? 0.5768 0.5099 0.4792 0.0428  0.0681  0.0403  246 VAL A CB  
1504 C CG1 . VAL A 216 ? 0.4558 0.3598 0.3320 0.0567  0.0649  0.0427  246 VAL A CG1 
1505 C CG2 . VAL A 216 ? 0.4888 0.4430 0.3845 0.0551  0.0715  0.0425  246 VAL A CG2 
1506 N N   . MET A 217 ? 0.5705 0.4864 0.5142 0.0013  0.0666  0.0326  247 MET A N   
1507 C CA  . MET A 217 ? 0.4158 0.3075 0.3612 -0.0058 0.0608  0.0252  247 MET A CA  
1508 C C   . MET A 217 ? 0.5053 0.3798 0.4619 -0.0230 0.0699  0.0326  247 MET A C   
1509 O O   . MET A 217 ? 0.6913 0.5347 0.6411 -0.0241 0.0684  0.0310  247 MET A O   
1510 C CB  . MET A 217 ? 0.6059 0.5114 0.5635 -0.0110 0.0483  0.0083  247 MET A CB  
1511 C CG  . MET A 217 ? 0.7341 0.6154 0.6839 -0.0075 0.0409  -0.0015 247 MET A CG  
1512 S SD  . MET A 217 ? 0.7609 0.6580 0.7106 0.0003  0.0279  -0.0170 247 MET A SD  
1513 C CE  . MET A 217 ? 2.3654 2.2882 2.3129 0.0094  0.0273  -0.0122 247 MET A CE  
1514 N N   . ILE A 218 ? 0.7058 0.6004 0.6813 -0.0364 0.0793  0.0405  248 ILE A N   
1515 C CA  . ILE A 218 ? 0.6977 0.5773 0.6884 -0.0557 0.0886  0.0483  248 ILE A CA  
1516 C C   . ILE A 218 ? 0.8090 0.6550 0.7781 -0.0484 0.1007  0.0661  248 ILE A C   
1517 O O   . ILE A 218 ? 0.8355 0.6566 0.8118 -0.0628 0.1081  0.0738  248 ILE A O   
1518 C CB  . ILE A 218 ? 0.8333 0.7481 0.8532 -0.0719 0.0968  0.0538  248 ILE A CB  
1519 C CG1 . ILE A 218 ? 1.0690 1.0083 1.0800 -0.0573 0.1069  0.0661  248 ILE A CG1 
1520 C CG2 . ILE A 218 ? 0.7688 0.7117 0.8114 -0.0820 0.0836  0.0364  248 ILE A CG2 
1521 C CD1 . ILE A 218 ? 1.1752 1.1481 1.2146 -0.0712 0.1196  0.0759  248 ILE A CD1 
1522 N N   . ALA A 219 ? 0.8487 0.6925 0.7903 -0.0257 0.1019  0.0724  249 ALA A N   
1523 C CA  . ALA A 219 ? 0.8606 0.6747 0.7755 -0.0142 0.1127  0.0903  249 ALA A CA  
1524 C C   . ALA A 219 ? 0.9123 0.6810 0.8178 -0.0158 0.1097  0.0907  249 ALA A C   
1525 O O   . ALA A 219 ? 1.1054 0.8458 1.0027 -0.0198 0.1221  0.1080  249 ALA A O   
1526 C CB  . ALA A 219 ? 0.7912 0.6109 0.6764 0.0126  0.1087  0.0912  249 ALA A CB  
1527 N N   . THR A 220 ? 0.8994 0.6607 0.8054 -0.0118 0.0941  0.0723  250 THR A N   
1528 C CA  . THR A 220 ? 1.1064 0.8266 1.0059 -0.0122 0.0899  0.0689  250 THR A CA  
1529 C C   . THR A 220 ? 1.2954 1.0140 1.2226 -0.0356 0.0857  0.0556  250 THR A C   
1530 O O   . THR A 220 ? 1.3302 1.0759 1.2719 -0.0400 0.0755  0.0384  250 THR A O   
1531 C CB  . THR A 220 ? 1.1779 0.8920 1.0602 0.0094  0.0754  0.0557  250 THR A CB  
1532 O OG1 . THR A 220 ? 1.2906 1.0080 1.1474 0.0316  0.0761  0.0652  250 THR A OG1 
1533 C CG2 . THR A 220 ? 1.1220 0.7935 0.9969 0.0122  0.0715  0.0521  250 THR A CG2 
1534 N N   . GLN A 221 ? 1.3556 1.0412 1.2890 -0.0505 0.0932  0.0636  251 GLN A N   
1535 C CA  . GLN A 221 ? 1.2927 0.9699 1.2495 -0.0716 0.0868  0.0483  251 GLN A CA  
1536 C C   . GLN A 221 ? 1.2176 0.8917 1.1675 -0.0600 0.0706  0.0256  251 GLN A C   
1537 O O   . GLN A 221 ? 1.1795 0.8709 1.1467 -0.0715 0.0616  0.0074  251 GLN A O   
1538 C CB  . GLN A 221 ? 1.3922 1.0216 1.3506 -0.0851 0.0951  0.0591  251 GLN A CB  
1539 C CG  . GLN A 221 ? 1.5272 1.1682 1.5156 -0.1138 0.1064  0.0690  251 GLN A CG  
1540 C CD  . GLN A 221 ? 1.5757 1.2335 1.5951 -0.1360 0.0951  0.0470  251 GLN A CD  
1541 O OE1 . GLN A 221 ? 1.5584 1.1983 1.5736 -0.1333 0.0814  0.0267  251 GLN A OE1 
1542 N NE2 . GLN A 221 ? 1.6116 1.3055 1.6618 -0.1568 0.1005  0.0505  251 GLN A NE2 
1543 N N   . GLY A 222 ? 1.1143 0.7687 1.0387 -0.0363 0.0672  0.0270  252 GLY A N   
1544 C CA  . GLY A 222 ? 0.9691 0.6238 0.8873 -0.0228 0.0540  0.0074  252 GLY A CA  
1545 C C   . GLY A 222 ? 0.8878 0.5898 0.8171 -0.0230 0.0465  -0.0057 252 GLY A C   
1546 O O   . GLY A 222 ? 0.8492 0.5600 0.7870 -0.0273 0.0379  -0.0240 252 GLY A O   
1547 N N   . HIS A 223 ? 0.7828 0.5140 0.7101 -0.0174 0.0499  0.0038  253 HIS A N   
1548 C CA  . HIS A 223 ? 0.7299 0.5021 0.6661 -0.0164 0.0431  -0.0065 253 HIS A CA  
1549 C C   . HIS A 223 ? 0.7611 0.5538 0.7203 -0.0372 0.0407  -0.0164 253 HIS A C   
1550 O O   . HIS A 223 ? 0.6991 0.5137 0.6635 -0.0369 0.0322  -0.0303 253 HIS A O   
1551 C CB  . HIS A 223 ? 0.4190 0.2142 0.3484 -0.0068 0.0473  0.0052  253 HIS A CB  
1552 C CG  . HIS A 223 ? 0.5556 0.3457 0.4647 0.0161  0.0423  0.0059  253 HIS A CG  
1553 N ND1 . HIS A 223 ? 0.7597 0.5541 0.6534 0.0289  0.0462  0.0180  253 HIS A ND1 
1554 C CD2 . HIS A 223 ? 0.5861 0.3690 0.4885 0.0289  0.0331  -0.0049 253 HIS A CD2 
1555 C CE1 . HIS A 223 ? 0.7319 0.5218 0.6110 0.0478  0.0379  0.0137  253 HIS A CE1 
1556 N NE2 . HIS A 223 ? 0.6873 0.4715 0.5733 0.0478  0.0304  0.0004  253 HIS A NE2 
1557 N N   . GLN A 224 ? 0.6628 0.4493 0.6359 -0.0553 0.0480  -0.0089 254 GLN A N   
1558 C CA  . GLN A 224 ? 0.6136 0.4201 0.6105 -0.0756 0.0439  -0.0192 254 GLN A CA  
1559 C C   . GLN A 224 ? 0.7455 0.5355 0.7419 -0.0790 0.0334  -0.0391 254 GLN A C   
1560 O O   . GLN A 224 ? 0.8492 0.6631 0.8488 -0.0784 0.0243  -0.0534 254 GLN A O   
1561 C CB  . GLN A 224 ? 0.6298 0.4311 0.6452 -0.0957 0.0538  -0.0074 254 GLN A CB  
1562 C CG  . GLN A 224 ? 0.8438 0.6680 0.8621 -0.0934 0.0659  0.0116  254 GLN A CG  
1563 C CD  . GLN A 224 ? 0.9462 0.7758 0.9901 -0.1162 0.0764  0.0221  254 GLN A CD  
1564 O OE1 . GLN A 224 ? 0.9467 0.7876 1.0157 -0.1359 0.0704  0.0110  254 GLN A OE1 
1565 N NE2 . GLN A 224 ? 0.8733 0.6966 0.9115 -0.1138 0.0921  0.0436  254 GLN A NE2 
1566 N N   . ASP A 225 ? 0.7293 0.4768 0.7198 -0.0813 0.0351  -0.0396 255 ASP A N   
1567 C CA  . ASP A 225 ? 0.8558 0.5826 0.8443 -0.0838 0.0256  -0.0597 255 ASP A CA  
1568 C C   . ASP A 225 ? 0.8923 0.6338 0.8671 -0.0653 0.0176  -0.0734 255 ASP A C   
1569 O O   . ASP A 225 ? 0.9508 0.7026 0.9281 -0.0688 0.0091  -0.0915 255 ASP A O   
1570 C CB  . ASP A 225 ? 1.0623 0.7353 1.0418 -0.0834 0.0293  -0.0561 255 ASP A CB  
1571 C CG  . ASP A 225 ? 1.3006 0.9566 1.2977 -0.1067 0.0373  -0.0443 255 ASP A CG  
1572 O OD1 . ASP A 225 ? 1.3951 1.0187 1.3833 -0.1039 0.0474  -0.0262 255 ASP A OD1 
1573 O OD2 . ASP A 225 ? 1.2785 0.9550 1.2991 -0.1279 0.0335  -0.0524 255 ASP A OD2 
1574 N N   . GLN A 226 ? 0.7800 0.5244 0.7405 -0.0457 0.0203  -0.0647 256 GLN A N   
1575 C CA  . GLN A 226 ? 0.6313 0.3922 0.5827 -0.0292 0.0142  -0.0756 256 GLN A CA  
1576 C C   . GLN A 226 ? 0.6610 0.4653 0.6213 -0.0342 0.0103  -0.0808 256 GLN A C   
1577 O O   . GLN A 226 ? 0.7975 0.6150 0.7552 -0.0301 0.0046  -0.0947 256 GLN A O   
1578 C CB  . GLN A 226 ? 0.5497 0.3056 0.4874 -0.0087 0.0167  -0.0652 256 GLN A CB  
1579 C CG  . GLN A 226 ? 0.7486 0.4604 0.6735 0.0009  0.0193  -0.0603 256 GLN A CG  
1580 C CD  . GLN A 226 ? 0.9116 0.6205 0.8225 0.0204  0.0212  -0.0470 256 GLN A CD  
1581 O OE1 . GLN A 226 ? 0.9588 0.6910 0.8700 0.0216  0.0234  -0.0369 256 GLN A OE1 
1582 N NE2 . GLN A 226 ? 0.9712 0.6511 0.8690 0.0371  0.0193  -0.0480 256 GLN A NE2 
1583 N N   . SER A 227 ? 0.4759 0.3019 0.4457 -0.0417 0.0139  -0.0690 257 SER A N   
1584 C CA  . SER A 227 ? 0.4742 0.3389 0.4519 -0.0451 0.0100  -0.0719 257 SER A CA  
1585 C C   . SER A 227 ? 0.5200 0.3944 0.5066 -0.0590 0.0031  -0.0863 257 SER A C   
1586 O O   . SER A 227 ? 0.4931 0.3874 0.4761 -0.0554 -0.0027 -0.0961 257 SER A O   
1587 C CB  . SER A 227 ? 0.4764 0.3605 0.4624 -0.0487 0.0155  -0.0568 257 SER A CB  
1588 O OG  . SER A 227 ? 0.5521 0.4364 0.5266 -0.0330 0.0186  -0.0472 257 SER A OG  
1589 N N   . ILE A 228 ? 0.4937 0.3542 0.4919 -0.0749 0.0037  -0.0873 258 ILE A N   
1590 C CA  . ILE A 228 ? 0.5336 0.3989 0.5407 -0.0889 -0.0049 -0.1033 258 ILE A CA  
1591 C C   . ILE A 228 ? 0.6269 0.4786 0.6176 -0.0797 -0.0113 -0.1215 258 ILE A C   
1592 O O   . ILE A 228 ? 0.4774 0.3499 0.4653 -0.0804 -0.0191 -0.1344 258 ILE A O   
1593 C CB  . ILE A 228 ? 0.6432 0.4846 0.6655 -0.1077 -0.0029 -0.1023 258 ILE A CB  
1594 C CG1 . ILE A 228 ? 0.5612 0.4211 0.6022 -0.1178 0.0054  -0.0841 258 ILE A CG1 
1595 C CG2 . ILE A 228 ? 0.4325 0.2752 0.4631 -0.1220 -0.0145 -0.1227 258 ILE A CG2 
1596 C CD1 . ILE A 228 ? 0.6169 0.5210 0.6757 -0.1267 -0.0005 -0.0870 258 ILE A CD1 
1597 N N   . ARG A 229 ? 0.6704 0.4880 0.6491 -0.0694 -0.0079 -0.1222 259 ARG A N   
1598 C CA  . ARG A 229 ? 0.6852 0.4878 0.6490 -0.0589 -0.0126 -0.1400 259 ARG A CA  
1599 C C   . ARG A 229 ? 0.7078 0.5395 0.6615 -0.0436 -0.0130 -0.1427 259 ARG A C   
1600 O O   . ARG A 229 ? 0.8334 0.6669 0.7763 -0.0366 -0.0167 -0.1583 259 ARG A O   
1601 C CB  . ARG A 229 ? 0.6775 0.4363 0.6320 -0.0493 -0.0087 -0.1390 259 ARG A CB  
1602 C CG  . ARG A 229 ? 0.8236 0.5455 0.7859 -0.0655 -0.0092 -0.1404 259 ARG A CG  
1603 C CD  . ARG A 229 ? 1.0209 0.6980 0.9725 -0.0544 -0.0039 -0.1335 259 ARG A CD  
1604 N NE  . ARG A 229 ? 1.2260 0.8887 1.1608 -0.0345 -0.0073 -0.1485 259 ARG A NE  
1605 C CZ  . ARG A 229 ? 1.3829 1.0206 1.3056 -0.0154 -0.0037 -0.1428 259 ARG A CZ  
1606 N NH1 . ARG A 229 ? 1.3633 0.9856 1.2854 -0.0134 0.0029  -0.1219 259 ARG A NH1 
1607 N NH2 . ARG A 229 ? 1.4000 1.0299 1.3103 0.0033  -0.0067 -0.1579 259 ARG A NH2 
1608 N N   . ILE A 230 ? 0.6737 0.5279 0.6308 -0.0386 -0.0087 -0.1276 260 ILE A N   
1609 C CA  . ILE A 230 ? 0.6293 0.5122 0.5807 -0.0277 -0.0087 -0.1280 260 ILE A CA  
1610 C C   . ILE A 230 ? 0.6666 0.5794 0.6211 -0.0368 -0.0137 -0.1317 260 ILE A C   
1611 O O   . ILE A 230 ? 0.6548 0.5832 0.6000 -0.0315 -0.0159 -0.1405 260 ILE A O   
1612 C CB  . ILE A 230 ? 0.5778 0.4707 0.5317 -0.0193 -0.0039 -0.1118 260 ILE A CB  
1613 C CG1 . ILE A 230 ? 0.5546 0.4216 0.5025 -0.0065 -0.0007 -0.1089 260 ILE A CG1 
1614 C CG2 . ILE A 230 ? 0.4807 0.4038 0.4329 -0.0128 -0.0043 -0.1111 260 ILE A CG2 
1615 C CD1 . ILE A 230 ? 0.5972 0.4704 0.5462 0.0013  0.0021  -0.0943 260 ILE A CD1 
1616 N N   . GLN A 231 ? 0.7029 0.6247 0.6703 -0.0496 -0.0151 -0.1243 261 GLN A N   
1617 C CA  . GLN A 231 ? 0.5365 0.4883 0.5087 -0.0570 -0.0210 -0.1262 261 GLN A CA  
1618 C C   . GLN A 231 ? 0.6174 0.5697 0.5818 -0.0612 -0.0294 -0.1453 261 GLN A C   
1619 O O   . GLN A 231 ? 0.8131 0.7905 0.7717 -0.0603 -0.0348 -0.1492 261 GLN A O   
1620 C CB  . GLN A 231 ? 0.4510 0.4119 0.4419 -0.0697 -0.0208 -0.1162 261 GLN A CB  
1621 C CG  . GLN A 231 ? 0.3423 0.3378 0.3405 -0.0748 -0.0274 -0.1159 261 GLN A CG  
1622 C CD  . GLN A 231 ? 0.4138 0.4146 0.4152 -0.0860 -0.0381 -0.1324 261 GLN A CD  
1623 O OE1 . GLN A 231 ? 0.4929 0.4708 0.4990 -0.0956 -0.0401 -0.1422 261 GLN A OE1 
1624 N NE2 . GLN A 231 ? 0.4072 0.4368 0.4052 -0.0846 -0.0459 -0.1358 261 GLN A NE2 
1625 N N   . ARG A 232 ? 0.5125 0.4349 0.4744 -0.0646 -0.0311 -0.1573 262 ARG A N   
1626 C CA  . ARG A 232 ? 0.6152 0.5330 0.5678 -0.0679 -0.0402 -0.1786 262 ARG A CA  
1627 C C   . ARG A 232 ? 0.7723 0.6950 0.7022 -0.0515 -0.0390 -0.1888 262 ARG A C   
1628 O O   . ARG A 232 ? 0.7945 0.7231 0.7117 -0.0510 -0.0464 -0.2056 262 ARG A O   
1629 C CB  . ARG A 232 ? 0.4336 0.3131 0.3915 -0.0773 -0.0426 -0.1888 262 ARG A CB  
1630 C CG  . ARG A 232 ? 0.6301 0.5083 0.6123 -0.0976 -0.0447 -0.1821 262 ARG A CG  
1631 C CD  . ARG A 232 ? 0.7145 0.5487 0.7020 -0.1071 -0.0447 -0.1887 262 ARG A CD  
1632 N NE  . ARG A 232 ? 0.8612 0.6972 0.8750 -0.1301 -0.0475 -0.1852 262 ARG A NE  
1633 C CZ  . ARG A 232 ? 1.0779 0.8770 1.1029 -0.1434 -0.0457 -0.1854 262 ARG A CZ  
1634 N NH1 . ARG A 232 ? 1.0870 0.8420 1.0964 -0.1338 -0.0420 -0.1891 262 ARG A NH1 
1635 N NH2 . ARG A 232 ? 1.1896 0.9961 1.2424 -0.1660 -0.0471 -0.1811 262 ARG A NH2 
1636 N N   . MET A 233 ? 0.7729 0.6952 0.6983 -0.0378 -0.0298 -0.1791 263 MET A N   
1637 C CA  . MET A 233 ? 0.7213 0.6519 0.6295 -0.0224 -0.0261 -0.1867 263 MET A CA  
1638 C C   . MET A 233 ? 0.6895 0.6564 0.5923 -0.0195 -0.0248 -0.1789 263 MET A C   
1639 O O   . MET A 233 ? 0.7436 0.7230 0.6318 -0.0086 -0.0208 -0.1839 263 MET A O   
1640 C CB  . MET A 233 ? 0.6313 0.5482 0.5407 -0.0091 -0.0174 -0.1806 263 MET A CB  
1641 C CG  . MET A 233 ? 0.5602 0.4374 0.4715 -0.0086 -0.0178 -0.1862 263 MET A CG  
1642 S SD  . MET A 233 ? 1.0124 0.8785 0.9224 0.0115  -0.0097 -0.1812 263 MET A SD  
1643 C CE  . MET A 233 ? 1.0515 0.9326 0.9454 0.0270  -0.0073 -0.1992 263 MET A CE  
1644 N N   . LEU A 234 ? 0.5320 0.5151 0.4463 -0.0284 -0.0271 -0.1657 264 LEU A N   
1645 C CA  . LEU A 234 ? 0.4570 0.4699 0.3665 -0.0252 -0.0260 -0.1556 264 LEU A CA  
1646 C C   . LEU A 234 ? 0.5585 0.5880 0.4532 -0.0270 -0.0343 -0.1663 264 LEU A C   
1647 O O   . LEU A 234 ? 0.5930 0.6147 0.4878 -0.0349 -0.0436 -0.1803 264 LEU A O   
1648 C CB  . LEU A 234 ? 0.4361 0.4584 0.3619 -0.0312 -0.0259 -0.1382 264 LEU A CB  
1649 C CG  . LEU A 234 ? 0.6344 0.6444 0.5712 -0.0274 -0.0184 -0.1262 264 LEU A CG  
1650 C CD1 . LEU A 234 ? 0.5556 0.5709 0.5069 -0.0338 -0.0193 -0.1130 264 LEU A CD1 
1651 C CD2 . LEU A 234 ? 0.6366 0.6558 0.5684 -0.0167 -0.0115 -0.1198 264 LEU A CD2 
1652 N N   . PRO A 235 ? 0.5539 0.6058 0.4353 -0.0198 -0.0313 -0.1595 265 PRO A N   
1653 C CA  . PRO A 235 ? 0.4583 0.5281 0.3225 -0.0196 -0.0399 -0.1670 265 PRO A CA  
1654 C C   . PRO A 235 ? 0.5340 0.6129 0.4129 -0.0309 -0.0511 -0.1641 265 PRO A C   
1655 O O   . PRO A 235 ? 0.6281 0.7078 0.5262 -0.0352 -0.0483 -0.1496 265 PRO A O   
1656 C CB  . PRO A 235 ? 0.5801 0.6700 0.4318 -0.0107 -0.0319 -0.1521 265 PRO A CB  
1657 C CG  . PRO A 235 ? 0.6155 0.6971 0.4769 -0.0060 -0.0191 -0.1432 265 PRO A CG  
1658 C CD  . PRO A 235 ? 0.5104 0.5722 0.3935 -0.0127 -0.0208 -0.1431 265 PRO A CD  
1659 N N   . ARG A 236 ? 0.5837 0.6712 0.4543 -0.0348 -0.0639 -0.1785 266 ARG A N   
1660 C CA  . ARG A 236 ? 0.4878 0.5882 0.3767 -0.0461 -0.0758 -0.1783 266 ARG A CA  
1661 C C   . ARG A 236 ? 0.4434 0.5689 0.3353 -0.0423 -0.0764 -0.1595 266 ARG A C   
1662 O O   . ARG A 236 ? 0.5622 0.7001 0.4751 -0.0498 -0.0827 -0.1545 266 ARG A O   
1663 C CB  . ARG A 236 ? 0.5465 0.6522 0.4259 -0.0508 -0.0917 -0.2005 266 ARG A CB  
1664 C CG  . ARG A 236 ? 0.5909 0.6691 0.4810 -0.0616 -0.0956 -0.2189 266 ARG A CG  
1665 C CD  . ARG A 236 ? 0.5907 0.6737 0.4713 -0.0668 -0.1134 -0.2434 266 ARG A CD  
1666 N NE  . ARG A 236 ? 0.6774 0.7911 0.5724 -0.0745 -0.1272 -0.2414 266 ARG A NE  
1667 C CZ  . ARG A 236 ? 0.7499 0.8674 0.6791 -0.0918 -0.1339 -0.2419 266 ARG A CZ  
1668 N NH1 . ARG A 236 ? 0.8153 0.9042 0.7651 -0.1036 -0.1271 -0.2427 266 ARG A NH1 
1669 N NH2 . ARG A 236 ? 0.7215 0.8724 0.6647 -0.0967 -0.1467 -0.2405 266 ARG A NH2 
1670 N N   . ASN A 237 ? 0.4523 0.5851 0.3243 -0.0303 -0.0691 -0.1488 267 ASN A N   
1671 C CA  . ASN A 237 ? 0.5301 0.6808 0.4022 -0.0252 -0.0690 -0.1301 267 ASN A CA  
1672 C C   . ASN A 237 ? 0.5612 0.7015 0.4454 -0.0231 -0.0561 -0.1123 267 ASN A C   
1673 O O   . ASN A 237 ? 0.6350 0.7838 0.5178 -0.0177 -0.0539 -0.0961 267 ASN A O   
1674 C CB  . ASN A 237 ? 0.5233 0.6887 0.3641 -0.0140 -0.0707 -0.1277 267 ASN A CB  
1675 C CG  . ASN A 237 ? 0.6920 0.8480 0.5146 -0.0062 -0.0561 -0.1243 267 ASN A CG  
1676 O OD1 . ASN A 237 ? 0.6916 0.8308 0.5229 -0.0084 -0.0476 -0.1295 267 ASN A OD1 
1677 N ND2 . ASN A 237 ? 0.8730 1.0410 0.6706 0.0034  -0.0527 -0.1147 267 ASN A ND2 
1678 N N   . CYS A 238 ? 0.5306 0.6510 0.4257 -0.0266 -0.0484 -0.1159 268 CYS A N   
1679 C CA  . CYS A 238 ? 0.5215 0.6320 0.4303 -0.0253 -0.0390 -0.1019 268 CYS A CA  
1680 C C   . CYS A 238 ? 0.4924 0.6096 0.4204 -0.0295 -0.0432 -0.0929 268 CYS A C   
1681 O O   . CYS A 238 ? 0.4118 0.5334 0.3522 -0.0374 -0.0502 -0.1002 268 CYS A O   
1682 C CB  . CYS A 238 ? 0.4037 0.4922 0.3195 -0.0272 -0.0325 -0.1089 268 CYS A CB  
1683 S SG  . CYS A 238 ? 0.4890 0.5662 0.4188 -0.0239 -0.0230 -0.0941 268 CYS A SG  
1684 N N   . GLN A 239 ? 0.3432 0.4617 0.2746 -0.0243 -0.0387 -0.0776 269 GLN A N   
1685 C CA  . GLN A 239 ? 0.3812 0.5063 0.3292 -0.0252 -0.0413 -0.0693 269 GLN A CA  
1686 C C   . GLN A 239 ? 0.4540 0.5642 0.4183 -0.0299 -0.0359 -0.0698 269 GLN A C   
1687 O O   . GLN A 239 ? 0.4429 0.5372 0.4060 -0.0266 -0.0286 -0.0663 269 GLN A O   
1688 C CB  . GLN A 239 ? 0.3960 0.5234 0.3397 -0.0165 -0.0391 -0.0541 269 GLN A CB  
1689 C CG  . GLN A 239 ? 0.5181 0.6509 0.4775 -0.0143 -0.0407 -0.0462 269 GLN A CG  
1690 C CD  . GLN A 239 ? 0.4816 0.6159 0.4347 -0.0046 -0.0414 -0.0330 269 GLN A CD  
1691 O OE1 . GLN A 239 ? 0.6053 0.7248 0.5520 -0.0012 -0.0357 -0.0264 269 GLN A OE1 
1692 N NE2 . GLN A 239 ? 0.3639 0.5160 0.3204 0.0001  -0.0488 -0.0293 269 GLN A NE2 
1693 N N   . MET A 240 ? 0.3328 0.4495 0.3125 -0.0378 -0.0395 -0.0739 270 MET A N   
1694 C CA  . MET A 240 ? 0.4166 0.5196 0.4102 -0.0425 -0.0333 -0.0721 270 MET A CA  
1695 C C   . MET A 240 ? 0.3786 0.4920 0.3844 -0.0386 -0.0308 -0.0603 270 MET A C   
1696 O O   . MET A 240 ? 0.3418 0.4777 0.3582 -0.0399 -0.0360 -0.0587 270 MET A O   
1697 C CB  . MET A 240 ? 0.5187 0.6203 0.5239 -0.0554 -0.0367 -0.0828 270 MET A CB  
1698 C CG  . MET A 240 ? 0.6274 0.7289 0.6213 -0.0591 -0.0443 -0.0978 270 MET A CG  
1699 S SD  . MET A 240 ? 0.7873 0.8610 0.7624 -0.0535 -0.0382 -0.1051 270 MET A SD  
1700 C CE  . MET A 240 ? 0.6408 0.7196 0.6026 -0.0572 -0.0487 -0.1246 270 MET A CE  
1701 N N   . LEU A 241 ? 0.3203 0.4185 0.3243 -0.0326 -0.0233 -0.0530 271 LEU A N   
1702 C CA  . LEU A 241 ? 0.3511 0.4560 0.3633 -0.0267 -0.0199 -0.0431 271 LEU A CA  
1703 C C   . LEU A 241 ? 0.3211 0.4109 0.3380 -0.0286 -0.0116 -0.0404 271 LEU A C   
1704 O O   . LEU A 241 ? 0.2767 0.3448 0.2841 -0.0266 -0.0082 -0.0419 271 LEU A O   
1705 C CB  . LEU A 241 ? 0.2800 0.3802 0.2812 -0.0147 -0.0200 -0.0364 271 LEU A CB  
1706 C CG  . LEU A 241 ? 0.3867 0.4928 0.3772 -0.0128 -0.0258 -0.0375 271 LEU A CG  
1707 C CD1 . LEU A 241 ? 0.5680 0.6611 0.5485 -0.0047 -0.0241 -0.0313 271 LEU A CD1 
1708 C CD2 . LEU A 241 ? 0.2324 0.3625 0.2277 -0.0116 -0.0330 -0.0357 271 LEU A CD2 
1709 N N   . LEU A 242 ? 0.2497 0.3525 0.2815 -0.0321 -0.0079 -0.0358 272 LEU A N   
1710 C CA  . LEU A 242 ? 0.3142 0.4038 0.3483 -0.0327 0.0018  -0.0300 272 LEU A CA  
1711 C C   . LEU A 242 ? 0.3646 0.4683 0.4034 -0.0232 0.0073  -0.0205 272 LEU A C   
1712 O O   . LEU A 242 ? 0.4003 0.5307 0.4536 -0.0238 0.0057  -0.0186 272 LEU A O   
1713 C CB  . LEU A 242 ? 0.2534 0.3411 0.3017 -0.0486 0.0045  -0.0331 272 LEU A CB  
1714 C CG  . LEU A 242 ? 0.3028 0.3788 0.3554 -0.0513 0.0164  -0.0240 272 LEU A CG  
1715 C CD1 . LEU A 242 ? 0.2724 0.3301 0.3315 -0.0665 0.0179  -0.0283 272 LEU A CD1 
1716 C CD2 . LEU A 242 ? 0.2821 0.3860 0.3522 -0.0515 0.0227  -0.0150 272 LEU A CD2 
1717 N N   . PHE A 243 ? 0.4682 0.5548 0.4938 -0.0130 0.0132  -0.0153 273 PHE A N   
1718 C CA  . PHE A 243 ? 0.4002 0.4965 0.4245 -0.0006 0.0185  -0.0079 273 PHE A CA  
1719 C C   . PHE A 243 ? 0.4650 0.5534 0.4875 -0.0003 0.0304  -0.0004 273 PHE A C   
1720 O O   . PHE A 243 ? 0.4554 0.5208 0.4690 -0.0040 0.0331  -0.0003 273 PHE A O   
1721 C CB  . PHE A 243 ? 0.3720 0.4552 0.3789 0.0139  0.0132  -0.0094 273 PHE A CB  
1722 C CG  . PHE A 243 ? 0.4650 0.5556 0.4728 0.0145  0.0035  -0.0133 273 PHE A CG  
1723 C CD1 . PHE A 243 ? 0.4772 0.5602 0.4821 0.0065  -0.0020 -0.0192 273 PHE A CD1 
1724 C CD2 . PHE A 243 ? 0.5159 0.6208 0.5262 0.0243  0.0007  -0.0105 273 PHE A CD2 
1725 C CE1 . PHE A 243 ? 0.4811 0.5710 0.4841 0.0075  -0.0094 -0.0206 273 PHE A CE1 
1726 C CE2 . PHE A 243 ? 0.4516 0.5607 0.4604 0.0255  -0.0079 -0.0119 273 PHE A CE2 
1727 C CZ  . PHE A 243 ? 0.3221 0.4238 0.3266 0.0167  -0.0124 -0.0163 273 PHE A CZ  
1728 N N   . SER A 244 ? 0.4866 0.5946 0.5167 0.0053  0.0383  0.0068  274 SER A N   
1729 C CA  . SER A 244 ? 0.4299 0.5340 0.4580 0.0055  0.0522  0.0165  274 SER A CA  
1730 C C   . SER A 244 ? 0.4142 0.5375 0.4408 0.0207  0.0601  0.0229  274 SER A C   
1731 O O   . SER A 244 ? 0.4593 0.6070 0.4976 0.0258  0.0562  0.0207  274 SER A O   
1732 C CB  . SER A 244 ? 0.5074 0.6213 0.5591 -0.0150 0.0581  0.0195  274 SER A CB  
1733 O OG  . SER A 244 ? 0.7392 0.8451 0.7883 -0.0168 0.0731  0.0312  274 SER A OG  
1734 N N   . ALA A 245 ? 0.4843 0.5962 0.4942 0.0300  0.0711  0.0307  275 ALA A N   
1735 C CA  . ALA A 245 ? 0.5096 0.6396 0.5148 0.0464  0.0807  0.0366  275 ALA A CA  
1736 C C   . ALA A 245 ? 0.5437 0.7066 0.5763 0.0362  0.0950  0.0464  275 ALA A C   
1737 O O   . ALA A 245 ? 0.5708 0.7644 0.6157 0.0450  0.0990  0.0478  275 ALA A O   
1738 C CB  . ALA A 245 ? 0.2858 0.3920 0.2590 0.0622  0.0865  0.0406  275 ALA A CB  
1739 N N   . THR A 246 ? 0.5484 0.7046 0.5921 0.0175  0.1025  0.0530  276 THR A N   
1740 C CA  . THR A 246 ? 0.5619 0.7474 0.6348 0.0040  0.1174  0.0636  276 THR A CA  
1741 C C   . THR A 246 ? 0.6756 0.8654 0.7781 -0.0225 0.1113  0.0594  276 THR A C   
1742 O O   . THR A 246 ? 0.5574 0.7200 0.6514 -0.0298 0.0991  0.0506  276 THR A O   
1743 C CB  . THR A 246 ? 0.5437 0.7155 0.6021 0.0054  0.1368  0.0794  276 THR A CB  
1744 O OG1 . THR A 246 ? 0.4812 0.6157 0.5304 -0.0077 0.1347  0.0808  276 THR A OG1 
1745 C CG2 . THR A 246 ? 0.6428 0.8035 0.6644 0.0329  0.1404  0.0812  276 THR A CG2 
1746 N N   . PHE A 247 ? 0.7872 1.0126 0.9251 -0.0364 0.1198  0.0650  277 PHE A N   
1747 C CA  . PHE A 247 ? 0.8949 1.1267 1.0637 -0.0629 0.1135  0.0598  277 PHE A CA  
1748 C C   . PHE A 247 ? 0.7863 1.0203 0.9767 -0.0830 0.1309  0.0733  277 PHE A C   
1749 O O   . PHE A 247 ? 0.6352 0.9053 0.8655 -0.0998 0.1342  0.0747  277 PHE A O   
1750 C CB  . PHE A 247 ? 1.0094 1.2850 1.2090 -0.0660 0.1022  0.0505  277 PHE A CB  
1751 C CG  . PHE A 247 ? 1.0735 1.3376 1.2627 -0.0639 0.0805  0.0347  277 PHE A CG  
1752 C CD1 . PHE A 247 ? 1.2039 1.4264 1.3718 -0.0695 0.0727  0.0281  277 PHE A CD1 
1753 C CD2 . PHE A 247 ? 1.1090 1.4048 1.3096 -0.0554 0.0686  0.0273  277 PHE A CD2 
1754 C CE1 . PHE A 247 ? 1.2871 1.5013 1.4449 -0.0672 0.0549  0.0147  277 PHE A CE1 
1755 C CE2 . PHE A 247 ? 1.2337 1.5184 1.4222 -0.0532 0.0502  0.0150  277 PHE A CE2 
1756 C CZ  . PHE A 247 ? 1.3190 1.5638 1.4862 -0.0595 0.0441  0.0088  277 PHE A CZ  
1757 N N   . GLU A 248 ? 0.8021 0.9979 0.9672 -0.0816 0.1418  0.0838  278 GLU A N   
1758 C CA  . GLU A 248 ? 0.9048 1.0927 1.0880 -0.1033 0.1574  0.0974  278 GLU A CA  
1759 C C   . GLU A 248 ? 0.8610 1.0437 1.0726 -0.1300 0.1439  0.0852  278 GLU A C   
1760 O O   . GLU A 248 ? 0.9037 1.0698 1.1040 -0.1279 0.1247  0.0685  278 GLU A O   
1761 C CB  . GLU A 248 ? 1.0795 1.2192 1.2253 -0.0957 0.1675  0.1095  278 GLU A CB  
1762 C CG  . GLU A 248 ? 1.2585 1.3820 1.4200 -0.1184 0.1839  0.1255  278 GLU A CG  
1763 C CD  . GLU A 248 ? 1.4023 1.4785 1.5233 -0.1073 0.1945  0.1400  278 GLU A CD  
1764 O OE1 . GLU A 248 ? 1.4094 1.4734 1.4920 -0.0807 0.1907  0.1382  278 GLU A OE1 
1765 O OE2 . GLU A 248 ? 1.4507 1.5012 1.5784 -0.1251 0.2058  0.1530  278 GLU A OE2 
1766 N N   . ASP A 249 ? 0.8556 1.0533 1.1043 -0.1552 0.1541  0.0929  279 ASP A N   
1767 C CA  . ASP A 249 ? 0.8139 1.0059 1.0911 -0.1821 0.1408  0.0800  279 ASP A CA  
1768 C C   . ASP A 249 ? 0.7060 0.8435 0.9519 -0.1803 0.1266  0.0681  279 ASP A C   
1769 O O   . ASP A 249 ? 0.5975 0.7329 0.8512 -0.1887 0.1075  0.0491  279 ASP A O   
1770 C CB  . ASP A 249 ? 0.9501 1.1465 1.2634 -0.2105 0.1572  0.0938  279 ASP A CB  
1771 C CG  . ASP A 249 ? 1.1986 1.3825 1.5402 -0.2395 0.1424  0.0788  279 ASP A CG  
1772 O OD1 . ASP A 249 ? 1.3257 1.4678 1.6671 -0.2569 0.1493  0.0858  279 ASP A OD1 
1773 O OD2 . ASP A 249 ? 1.2692 1.4829 1.6310 -0.2439 0.1231  0.0598  279 ASP A OD2 
1774 N N   . SER A 250 ? 0.7522 0.8475 0.9617 -0.1676 0.1360  0.0792  280 SER A N   
1775 C CA  . SER A 250 ? 0.7946 0.8390 0.9747 -0.1635 0.1246  0.0696  280 SER A CA  
1776 C C   . SER A 250 ? 0.7134 0.7616 0.8730 -0.1450 0.1057  0.0516  280 SER A C   
1777 O O   . SER A 250 ? 0.6038 0.6303 0.7573 -0.1489 0.0908  0.0358  280 SER A O   
1778 C CB  . SER A 250 ? 0.8168 0.8200 0.9628 -0.1510 0.1389  0.0870  280 SER A CB  
1779 O OG  . SER A 250 ? 0.8812 0.9035 1.0079 -0.1285 0.1492  0.0984  280 SER A OG  
1780 N N   . VAL A 251 ? 0.6500 0.7247 0.7988 -0.1247 0.1070  0.0542  281 VAL A N   
1781 C CA  . VAL A 251 ? 0.6870 0.7663 0.8183 -0.1080 0.0908  0.0398  281 VAL A CA  
1782 C C   . VAL A 251 ? 0.6446 0.7506 0.8012 -0.1205 0.0754  0.0238  281 VAL A C   
1783 O O   . VAL A 251 ? 0.4882 0.5828 0.6328 -0.1172 0.0604  0.0093  281 VAL A O   
1784 C CB  . VAL A 251 ? 0.7702 0.8726 0.8885 -0.0855 0.0956  0.0460  281 VAL A CB  
1785 C CG1 . VAL A 251 ? 0.8010 0.8960 0.8963 -0.0683 0.0805  0.0337  281 VAL A CG1 
1786 C CG2 . VAL A 251 ? 0.8681 0.9533 0.9651 -0.0744 0.1128  0.0632  281 VAL A CG2 
1787 N N   . TRP A 252 ? 0.5740 0.7178 0.7659 -0.1341 0.0794  0.0269  282 TRP A N   
1788 C CA  . TRP A 252 ? 0.4987 0.6748 0.7169 -0.1448 0.0641  0.0125  282 TRP A CA  
1789 C C   . TRP A 252 ? 0.5874 0.7397 0.8116 -0.1640 0.0518  -0.0022 282 TRP A C   
1790 O O   . TRP A 252 ? 0.3737 0.5298 0.5924 -0.1621 0.0346  -0.0185 282 TRP A O   
1791 C CB  . TRP A 252 ? 0.4463 0.6710 0.7051 -0.1555 0.0723  0.0200  282 TRP A CB  
1792 C CG  . TRP A 252 ? 0.4440 0.7072 0.7318 -0.1649 0.0554  0.0056  282 TRP A CG  
1793 C CD1 . TRP A 252 ? 0.5287 0.8193 0.8591 -0.1893 0.0529  0.0017  282 TRP A CD1 
1794 C CD2 . TRP A 252 ? 0.5696 0.8482 0.8455 -0.1502 0.0378  -0.0068 282 TRP A CD2 
1795 N NE1 . TRP A 252 ? 0.5531 0.8770 0.8979 -0.1891 0.0334  -0.0135 282 TRP A NE1 
1796 C CE2 . TRP A 252 ? 0.6467 0.9627 0.9567 -0.1646 0.0245  -0.0180 282 TRP A CE2 
1797 C CE3 . TRP A 252 ? 0.5552 0.8193 0.7954 -0.1267 0.0319  -0.0091 282 TRP A CE3 
1798 C CZ2 . TRP A 252 ? 0.7012 1.0393 1.0067 -0.1542 0.0058  -0.0301 282 TRP A CZ2 
1799 C CZ3 . TRP A 252 ? 0.5887 0.8731 0.8263 -0.1182 0.0150  -0.0200 282 TRP A CZ3 
1800 C CH2 . TRP A 252 ? 0.6459 0.9664 0.9139 -0.1309 0.0022  -0.0298 282 TRP A CH2 
1801 N N   . LYS A 253 ? 0.7158 0.8420 0.9496 -0.1818 0.0608  0.0035  283 LYS A N   
1802 C CA  . LYS A 253 ? 0.7714 0.8721 1.0123 -0.2006 0.0492  -0.0115 283 LYS A CA  
1803 C C   . LYS A 253 ? 0.6856 0.7450 0.8881 -0.1867 0.0400  -0.0223 283 LYS A C   
1804 O O   . LYS A 253 ? 0.6600 0.7051 0.8613 -0.1947 0.0259  -0.0402 283 LYS A O   
1805 C CB  . LYS A 253 ? 0.9438 1.0224 1.2052 -0.2237 0.0621  -0.0011 283 LYS A CB  
1806 C CG  . LYS A 253 ? 1.0369 1.1611 1.3441 -0.2421 0.0708  0.0078  283 LYS A CG  
1807 C CD  . LYS A 253 ? 1.1316 1.3013 1.4672 -0.2501 0.0517  -0.0106 283 LYS A CD  
1808 C CE  . LYS A 253 ? 1.1528 1.3781 1.5357 -0.2635 0.0600  -0.0016 283 LYS A CE  
1809 N NZ  . LYS A 253 ? 1.0728 1.3458 1.4817 -0.2674 0.0394  -0.0196 283 LYS A NZ  
1810 N N   . PHE A 254 ? 0.6649 0.7074 0.8367 -0.1652 0.0477  -0.0124 284 PHE A N   
1811 C CA  . PHE A 254 ? 0.4925 0.5026 0.6309 -0.1501 0.0401  -0.0213 284 PHE A CA  
1812 C C   . PHE A 254 ? 0.5926 0.6278 0.7232 -0.1385 0.0260  -0.0343 284 PHE A C   
1813 O O   . PHE A 254 ? 0.6735 0.6954 0.7921 -0.1374 0.0144  -0.0495 284 PHE A O   
1814 C CB  . PHE A 254 ? 0.4222 0.4087 0.5336 -0.1318 0.0521  -0.0064 284 PHE A CB  
1815 C CG  . PHE A 254 ? 0.5540 0.5199 0.6349 -0.1131 0.0442  -0.0146 284 PHE A CG  
1816 C CD1 . PHE A 254 ? 0.5644 0.5449 0.6295 -0.0935 0.0437  -0.0113 284 PHE A CD1 
1817 C CD2 . PHE A 254 ? 0.6063 0.5387 0.6762 -0.1150 0.0376  -0.0260 284 PHE A CD2 
1818 C CE1 . PHE A 254 ? 0.5410 0.5057 0.5829 -0.0784 0.0368  -0.0184 284 PHE A CE1 
1819 C CE2 . PHE A 254 ? 0.6319 0.5504 0.6774 -0.0977 0.0316  -0.0331 284 PHE A CE2 
1820 C CZ  . PHE A 254 ? 0.5373 0.4734 0.5704 -0.0805 0.0313  -0.0289 284 PHE A CZ  
1821 N N   . ALA A 255 ? 0.5526 0.6236 0.6892 -0.1293 0.0277  -0.0276 285 ALA A N   
1822 C CA  . ALA A 255 ? 0.4268 0.5209 0.5559 -0.1179 0.0156  -0.0364 285 ALA A CA  
1823 C C   . ALA A 255 ? 0.5186 0.6265 0.6612 -0.1310 0.0007  -0.0531 285 ALA A C   
1824 O O   . ALA A 255 ? 0.7305 0.8364 0.8561 -0.1235 -0.0104 -0.0642 285 ALA A O   
1825 C CB  . ALA A 255 ? 0.3612 0.4911 0.4994 -0.1076 0.0199  -0.0263 285 ALA A CB  
1826 N N   . GLN A 256 ? 0.5789 0.7019 0.7521 -0.1507 0.0004  -0.0547 286 GLN A N   
1827 C CA  . GLN A 256 ? 0.4793 0.6176 0.6678 -0.1645 -0.0157 -0.0722 286 GLN A CA  
1828 C C   . GLN A 256 ? 0.5528 0.6532 0.7213 -0.1678 -0.0239 -0.0880 286 GLN A C   
1829 O O   . GLN A 256 ? 0.6620 0.7714 0.8285 -0.1710 -0.0393 -0.1051 286 GLN A O   
1830 C CB  . GLN A 256 ? 0.3717 0.5313 0.6012 -0.1876 -0.0136 -0.0708 286 GLN A CB  
1831 C CG  . GLN A 256 ? 0.5072 0.7161 0.7623 -0.1846 -0.0089 -0.0597 286 GLN A CG  
1832 C CD  . GLN A 256 ? 0.7666 1.0024 1.0677 -0.2095 -0.0077 -0.0597 286 GLN A CD  
1833 O OE1 . GLN A 256 ? 0.8219 1.0458 1.1381 -0.2218 0.0084  -0.0470 286 GLN A OE1 
1834 N NE2 . GLN A 256 ? 0.7533 1.0268 1.0775 -0.2172 -0.0247 -0.0736 286 GLN A NE2 
1835 N N   . LYS A 257 ? 0.5379 0.5966 0.6901 -0.1651 -0.0139 -0.0825 287 LYS A N   
1836 C CA  . LYS A 257 ? 0.6015 0.6218 0.7343 -0.1657 -0.0201 -0.0971 287 LYS A CA  
1837 C C   . LYS A 257 ? 0.5829 0.5947 0.6826 -0.1438 -0.0227 -0.1008 287 LYS A C   
1838 O O   . LYS A 257 ? 0.7318 0.7225 0.8147 -0.1409 -0.0296 -0.1154 287 LYS A O   
1839 C CB  . LYS A 257 ? 0.5740 0.5514 0.7069 -0.1734 -0.0090 -0.0896 287 LYS A CB  
1840 C CG  . LYS A 257 ? 0.6745 0.6535 0.8414 -0.1991 -0.0062 -0.0872 287 LYS A CG  
1841 C CD  . LYS A 257 ? 0.8516 0.7976 1.0189 -0.2030 0.0114  -0.0683 287 LYS A CD  
1842 C CE  . LYS A 257 ? 0.9289 0.8196 1.0700 -0.1966 0.0115  -0.0735 287 LYS A CE  
1843 N NZ  . LYS A 257 ? 0.9921 0.8601 1.1408 -0.2126 -0.0013 -0.0948 287 LYS A NZ  
1844 N N   . VAL A 258 ? 0.5328 0.5618 0.6244 -0.1286 -0.0170 -0.0880 288 VAL A N   
1845 C CA  . VAL A 258 ? 0.5858 0.6084 0.6505 -0.1097 -0.0179 -0.0891 288 VAL A CA  
1846 C C   . VAL A 258 ? 0.6359 0.6907 0.6963 -0.1026 -0.0270 -0.0932 288 VAL A C   
1847 O O   . VAL A 258 ? 0.6646 0.7157 0.7051 -0.0929 -0.0315 -0.1004 288 VAL A O   
1848 C CB  . VAL A 258 ? 0.6577 0.6710 0.7129 -0.0964 -0.0062 -0.0727 288 VAL A CB  
1849 C CG1 . VAL A 258 ? 0.6268 0.6335 0.6588 -0.0794 -0.0078 -0.0749 288 VAL A CG1 
1850 C CG2 . VAL A 258 ? 0.7171 0.6983 0.7731 -0.1012 0.0034  -0.0659 288 VAL A CG2 
1851 N N   . VAL A 259 ? 0.6856 0.7729 0.7647 -0.1065 -0.0291 -0.0876 289 VAL A N   
1852 C CA  . VAL A 259 ? 0.6279 0.7448 0.7022 -0.0973 -0.0372 -0.0881 289 VAL A CA  
1853 C C   . VAL A 259 ? 0.6491 0.7950 0.7408 -0.1083 -0.0501 -0.0985 289 VAL A C   
1854 O O   . VAL A 259 ? 0.6739 0.8467 0.7907 -0.1143 -0.0502 -0.0931 289 VAL A O   
1855 C CB  . VAL A 259 ? 0.4378 0.5698 0.5152 -0.0858 -0.0298 -0.0719 289 VAL A CB  
1856 C CG1 . VAL A 259 ? 0.5399 0.6960 0.6095 -0.0745 -0.0380 -0.0711 289 VAL A CG1 
1857 C CG2 . VAL A 259 ? 0.3959 0.5002 0.4565 -0.0753 -0.0194 -0.0637 289 VAL A CG2 
1858 N N   . PRO A 260 ? 0.5835 0.7257 0.6618 -0.1099 -0.0614 -0.1144 290 PRO A N   
1859 C CA  . PRO A 260 ? 0.6064 0.7741 0.6973 -0.1197 -0.0769 -0.1280 290 PRO A CA  
1860 C C   . PRO A 260 ? 0.5985 0.8028 0.6873 -0.1082 -0.0850 -0.1231 290 PRO A C   
1861 O O   . PRO A 260 ? 0.6389 0.8400 0.7043 -0.0921 -0.0819 -0.1154 290 PRO A O   
1862 C CB  . PRO A 260 ? 0.6674 0.8135 0.7347 -0.1198 -0.0847 -0.1463 290 PRO A CB  
1863 C CG  . PRO A 260 ? 0.6825 0.7908 0.7322 -0.1130 -0.0716 -0.1418 290 PRO A CG  
1864 C CD  . PRO A 260 ? 0.5884 0.7020 0.6383 -0.1020 -0.0600 -0.1216 290 PRO A CD  
1865 N N   . ASP A 261 ? 0.6401 0.8785 0.7543 -0.1164 -0.0955 -0.1273 291 ASP A N   
1866 C CA  . ASP A 261 ? 0.7472 1.0218 0.8609 -0.1042 -0.1049 -0.1228 291 ASP A CA  
1867 C C   . ASP A 261 ? 0.5702 0.8472 0.6799 -0.0884 -0.0930 -0.1029 291 ASP A C   
1868 O O   . ASP A 261 ? 0.5950 0.8698 0.6797 -0.0722 -0.0942 -0.0968 291 ASP A O   
1869 C CB  . ASP A 261 ? 1.0170 1.2912 1.0980 -0.0941 -0.1173 -0.1330 291 ASP A CB  
1870 C CG  . ASP A 261 ? 1.3227 1.5951 1.4040 -0.1074 -0.1314 -0.1557 291 ASP A CG  
1871 O OD1 . ASP A 261 ? 1.3979 1.6898 1.5116 -0.1233 -0.1398 -0.1642 291 ASP A OD1 
1872 O OD2 . ASP A 261 ? 1.4559 1.7081 1.5059 -0.1019 -0.1341 -0.1658 291 ASP A OD2 
1873 N N   . PRO A 262 ? 0.4676 0.7483 0.6014 -0.0931 -0.0814 -0.0926 292 PRO A N   
1874 C CA  . PRO A 262 ? 0.4200 0.6960 0.5470 -0.0779 -0.0692 -0.0759 292 PRO A CA  
1875 C C   . PRO A 262 ? 0.3251 0.6385 0.4681 -0.0672 -0.0728 -0.0679 292 PRO A C   
1876 O O   . PRO A 262 ? 0.3260 0.6716 0.5007 -0.0761 -0.0762 -0.0701 292 PRO A O   
1877 C CB  . PRO A 262 ? 0.3096 0.5687 0.4512 -0.0877 -0.0540 -0.0698 292 PRO A CB  
1878 C CG  . PRO A 262 ? 0.3498 0.6103 0.5131 -0.1101 -0.0585 -0.0818 292 PRO A CG  
1879 C CD  . PRO A 262 ? 0.4173 0.7034 0.5840 -0.1129 -0.0774 -0.0955 292 PRO A CD  
1880 N N   . ASN A 263 ? 0.2670 0.5758 0.3894 -0.0482 -0.0719 -0.0587 293 ASN A N   
1881 C CA  . ASN A 263 ? 0.3348 0.6669 0.4696 -0.0344 -0.0693 -0.0479 293 ASN A CA  
1882 C C   . ASN A 263 ? 0.3071 0.6269 0.4515 -0.0360 -0.0521 -0.0396 293 ASN A C   
1883 O O   . ASN A 263 ? 0.4017 0.6869 0.5294 -0.0385 -0.0434 -0.0384 293 ASN A O   
1884 C CB  . ASN A 263 ? 0.2886 0.6097 0.3958 -0.0142 -0.0725 -0.0403 293 ASN A CB  
1885 C CG  . ASN A 263 ? 0.4865 0.8168 0.5780 -0.0108 -0.0880 -0.0460 293 ASN A CG  
1886 O OD1 . ASN A 263 ? 0.5398 0.9046 0.6452 -0.0081 -0.1001 -0.0491 293 ASN A OD1 
1887 N ND2 . ASN A 263 ? 0.4529 0.7545 0.5149 -0.0101 -0.0876 -0.0473 293 ASN A ND2 
1888 N N   . VAL A 264 ? 0.2643 0.6142 0.4351 -0.0335 -0.0470 -0.0339 294 VAL A N   
1889 C CA  . VAL A 264 ? 0.3042 0.6460 0.4826 -0.0339 -0.0297 -0.0253 294 VAL A CA  
1890 C C   . VAL A 264 ? 0.3081 0.6617 0.4845 -0.0121 -0.0241 -0.0157 294 VAL A C   
1891 O O   . VAL A 264 ? 0.4427 0.8341 0.6396 -0.0046 -0.0285 -0.0144 294 VAL A O   
1892 C CB  . VAL A 264 ? 0.3205 0.6873 0.5353 -0.0532 -0.0239 -0.0264 294 VAL A CB  
1893 C CG1 . VAL A 264 ? 0.2603 0.6200 0.4794 -0.0515 -0.0043 -0.0150 294 VAL A CG1 
1894 C CG2 . VAL A 264 ? 0.3271 0.6761 0.5432 -0.0750 -0.0297 -0.0373 294 VAL A CG2 
1895 N N   . ILE A 265 ? 0.4213 0.7425 0.5732 -0.0010 -0.0154 -0.0102 295 ILE A N   
1896 C CA  . ILE A 265 ? 0.3785 0.7043 0.5257 0.0200  -0.0089 -0.0027 295 ILE A CA  
1897 C C   . ILE A 265 ? 0.3253 0.6511 0.4800 0.0183  0.0086  0.0035  295 ILE A C   
1898 O O   . ILE A 265 ? 0.3504 0.6476 0.4930 0.0092  0.0158  0.0041  295 ILE A O   
1899 C CB  . ILE A 265 ? 0.3611 0.6496 0.4746 0.0347  -0.0123 -0.0016 295 ILE A CB  
1900 C CG1 . ILE A 265 ? 0.6065 0.8943 0.7100 0.0377  -0.0273 -0.0046 295 ILE A CG1 
1901 C CG2 . ILE A 265 ? 0.5529 0.8417 0.6603 0.0563  -0.0065 0.0038  295 ILE A CG2 
1902 C CD1 . ILE A 265 ? 0.7634 1.0778 0.8748 0.0549  -0.0344 -0.0013 295 ILE A CD1 
1903 N N   . LYS A 266 ? 0.2636 0.6226 0.4375 0.0283  0.0161  0.0087  296 LYS A N   
1904 C CA  . LYS A 266 ? 0.3579 0.7197 0.5356 0.0303  0.0348  0.0165  296 LYS A CA  
1905 C C   . LYS A 266 ? 0.3214 0.6898 0.4886 0.0574  0.0401  0.0203  296 LYS A C   
1906 O O   . LYS A 266 ? 0.2822 0.6802 0.4631 0.0702  0.0342  0.0195  296 LYS A O   
1907 C CB  . LYS A 266 ? 0.3352 0.7376 0.5527 0.0132  0.0434  0.0200  296 LYS A CB  
1908 C CG  . LYS A 266 ? 0.3734 0.7655 0.6030 -0.0152 0.0418  0.0166  296 LYS A CG  
1909 C CD  . LYS A 266 ? 0.5957 1.0361 0.8721 -0.0323 0.0443  0.0173  296 LYS A CD  
1910 C CE  . LYS A 266 ? 0.6977 1.1258 0.9889 -0.0619 0.0442  0.0140  296 LYS A CE  
1911 N NZ  . LYS A 266 ? 0.7002 1.1228 1.0010 -0.0731 0.0657  0.0262  296 LYS A NZ  
1912 N N   . LEU A 267 ? 0.3496 0.6900 0.4915 0.0677  0.0503  0.0235  297 LEU A N   
1913 C CA  . LEU A 267 ? 0.2316 0.5782 0.3629 0.0937  0.0573  0.0258  297 LEU A CA  
1914 C C   . LEU A 267 ? 0.2743 0.6293 0.4063 0.0948  0.0780  0.0339  297 LEU A C   
1915 O O   . LEU A 267 ? 0.4792 0.8041 0.5918 0.0878  0.0842  0.0363  297 LEU A O   
1916 C CB  . LEU A 267 ? 0.3133 0.6170 0.4083 0.1103  0.0481  0.0205  297 LEU A CB  
1917 C CG  . LEU A 267 ? 0.4289 0.7304 0.5077 0.1385  0.0532  0.0200  297 LEU A CG  
1918 C CD1 . LEU A 267 ? 0.3256 0.6663 0.4260 0.1539  0.0515  0.0205  297 LEU A CD1 
1919 C CD2 . LEU A 267 ? 0.4299 0.6845 0.4751 0.1501  0.0423  0.0133  297 LEU A CD2 
1920 N N   . LYS A 268 ? 0.4177 0.8154 0.5721 0.1045  0.0891  0.0387  298 LYS A N   
1921 C CA  . LYS A 268 ? 0.4343 0.8472 0.5919 0.1058  0.1117  0.0486  298 LYS A CA  
1922 C C   . LYS A 268 ? 0.4178 0.7982 0.5334 0.1289  0.1181  0.0482  298 LYS A C   
1923 O O   . LYS A 268 ? 0.3827 0.7534 0.4799 0.1527  0.1103  0.0410  298 LYS A O   
1924 C CB  . LYS A 268 ? 0.4222 0.8946 0.6172 0.1119  0.1224  0.0536  298 LYS A CB  
1925 C CG  . LYS A 268 ? 0.4811 0.9769 0.6872 0.1079  0.1483  0.0664  298 LYS A CG  
1926 C CD  . LYS A 268 ? 0.5466 1.1077 0.7965 0.1122  0.1585  0.0709  298 LYS A CD  
1927 C CE  . LYS A 268 ? 0.5113 1.0966 0.7649 0.1176  0.1873  0.0844  298 LYS A CE  
1928 N NZ  . LYS A 268 ? 0.4632 1.1176 0.7636 0.1225  0.1979  0.0885  298 LYS A NZ  
1929 N N   . ARG A 269 ? 0.4087 0.7701 0.5078 0.1220  0.1312  0.0555  299 ARG A N   
1930 C CA  . ARG A 269 ? 0.5139 0.8452 0.5712 0.1433  0.1367  0.0548  299 ARG A CA  
1931 C C   . ARG A 269 ? 0.4920 0.8510 0.5457 0.1713  0.1480  0.0551  299 ARG A C   
1932 O O   . ARG A 269 ? 0.3729 0.7783 0.4567 0.1701  0.1630  0.0633  299 ARG A O   
1933 C CB  . ARG A 269 ? 0.5769 0.8916 0.6206 0.1318  0.1515  0.0657  299 ARG A CB  
1934 C CG  . ARG A 269 ? 0.6520 0.9356 0.6497 0.1538  0.1556  0.0646  299 ARG A CG  
1935 C CD  . ARG A 269 ? 0.7390 0.9936 0.7183 0.1411  0.1622  0.0733  299 ARG A CD  
1936 N NE  . ARG A 269 ? 0.8085 1.0256 0.7415 0.1609  0.1563  0.0672  299 ARG A NE  
1937 C CZ  . ARG A 269 ? 0.8426 1.0611 0.7464 0.1845  0.1686  0.0703  299 ARG A CZ  
1938 N NH1 . ARG A 269 ? 0.8292 1.0860 0.7457 0.1913  0.1897  0.0808  299 ARG A NH1 
1939 N NH2 . ARG A 269 ? 0.9635 1.1473 0.8256 0.2016  0.1596  0.0623  299 ARG A NH2 
1940 N N   . GLU A 270 ? 0.6125 0.9438 0.6310 0.1966  0.1404  0.0454  300 GLU A N   
1941 C CA  . GLU A 270 ? 0.7413 1.0927 0.7500 0.2268  0.1504  0.0435  300 GLU A CA  
1942 C C   . GLU A 270 ? 0.7357 1.1144 0.7438 0.2304  0.1777  0.0569  300 GLU A C   
1943 O O   . GLU A 270 ? 0.7033 1.0617 0.6928 0.2205  0.1862  0.0647  300 GLU A O   
1944 C CB  . GLU A 270 ? 0.8409 1.1494 0.8066 0.2514  0.1376  0.0297  300 GLU A CB  
1945 C CG  . GLU A 270 ? 0.9753 1.2755 0.9459 0.2627  0.1183  0.0180  300 GLU A CG  
1946 C CD  . GLU A 270 ? 1.1835 1.5263 1.1739 0.2839  0.1263  0.0183  300 GLU A CD  
1947 O OE1 . GLU A 270 ? 1.3070 1.6872 1.3066 0.2906  0.1478  0.0267  300 GLU A OE1 
1948 O OE2 . GLU A 270 ? 1.1845 1.5238 1.1812 0.2946  0.1116  0.0108  300 GLU A OE2 
1949 N N   . GLU A 271 ? 0.5901 1.4035 0.6596 0.3048  0.1840  0.0178  301 GLU A N   
1950 C CA  . GLU A 271 ? 0.6006 1.3759 0.6570 0.2815  0.1795  -0.0036 301 GLU A CA  
1951 C C   . GLU A 271 ? 0.7173 1.3688 0.7453 0.2778  0.1799  0.0197  301 GLU A C   
1952 O O   . GLU A 271 ? 0.6414 1.2788 0.6479 0.3036  0.1950  0.0556  301 GLU A O   
1953 C CB  . GLU A 271 ? 0.7812 1.6578 0.8312 0.2964  0.1931  -0.0061 301 GLU A CB  
1954 C CG  . GLU A 271 ? 1.0313 1.8658 1.0617 0.2785  0.1919  -0.0184 301 GLU A CG  
1955 C CD  . GLU A 271 ? 1.1320 2.0547 1.1470 0.2975  0.2029  -0.0101 301 GLU A CD  
1956 O OE1 . GLU A 271 ? 1.0807 1.9864 1.0818 0.2841  0.2041  -0.0223 301 GLU A OE1 
1957 O OE2 . GLU A 271 ? 1.2004 2.2069 1.2148 0.3254  0.2063  0.0106  301 GLU A OE2 
1958 N N   . GLU A 272 ? 0.8176 1.3822 0.8467 0.2465  0.1644  -0.0009 302 GLU A N   
1959 C CA  . GLU A 272 ? 0.9168 1.3680 0.9215 0.2394  0.1628  0.0160  302 GLU A CA  
1960 C C   . GLU A 272 ? 0.9075 1.3607 0.8886 0.2442  0.1719  0.0220  302 GLU A C   
1961 O O   . GLU A 272 ? 0.7153 1.2366 0.7019 0.2381  0.1727  0.0000  302 GLU A O   
1962 C CB  . GLU A 272 ? 1.0360 1.4087 1.0495 0.2057  0.1445  -0.0090 302 GLU A CB  
1963 C CG  . GLU A 272 ? 1.1800 1.5613 1.2192 0.1974  0.1336  -0.0224 302 GLU A CG  
1964 C CD  . GLU A 272 ? 1.2513 1.5668 1.2836 0.2058  0.1327  0.0041  302 GLU A CD  
1965 O OE1 . GLU A 272 ? 1.1841 1.4836 1.2331 0.1946  0.1213  -0.0067 302 GLU A OE1 
1966 O OE2 . GLU A 272 ? 1.3042 1.5838 1.3149 0.2230  0.1444  0.0349  302 GLU A OE2 
1967 N N   . THR A 273 ? 1.0484 1.4285 1.0038 0.2543  0.1791  0.0502  303 THR A N   
1968 C CA  . THR A 273 ? 1.0773 1.4611 1.0081 0.2635  0.1892  0.0604  303 THR A CA  
1969 C C   . THR A 273 ? 1.0641 1.3406 0.9737 0.2490  0.1840  0.0654  303 THR A C   
1970 O O   . THR A 273 ? 0.9856 1.1871 0.8859 0.2530  0.1862  0.0853  303 THR A O   
1971 C CB  . THR A 273 ? 0.9776 1.4135 0.8951 0.3031  0.2115  0.0964  303 THR A CB  
1972 O OG1 . THR A 273 ? 0.9699 1.3906 0.8598 0.3126  0.2213  0.1098  303 THR A OG1 
1973 C CG2 . THR A 273 ? 0.9278 1.3096 0.8440 0.3192  0.2194  0.1267  303 THR A CG2 
1974 N N   . LEU A 274 ? 1.1010 1.3750 1.0039 0.2317  0.1780  0.0464  304 LEU A N   
1975 C CA  . LEU A 274 ? 1.1134 1.2972 0.9974 0.2178  0.1725  0.0491  304 LEU A CA  
1976 C C   . LEU A 274 ? 1.1717 1.3484 1.0261 0.2403  0.1874  0.0756  304 LEU A C   
1977 O O   . LEU A 274 ? 1.1800 1.2991 1.0173 0.2306  0.1839  0.0763  304 LEU A O   
1978 C CB  . LEU A 274 ? 1.0041 1.1842 0.8971 0.1876  0.1591  0.0168  304 LEU A CB  
1979 C CG  . LEU A 274 ? 0.9919 1.1477 0.9112 0.1608  0.1439  -0.0095 304 LEU A CG  
1980 C CD1 . LEU A 274 ? 0.9021 1.0606 0.8306 0.1343  0.1362  -0.0388 304 LEU A CD1 
1981 C CD2 . LEU A 274 ? 0.9793 1.0413 0.8943 0.1543  0.1366  0.0023  304 LEU A CD2 
1982 N N   . ASP A 275 ? 1.2153 1.4525 1.0641 0.2716  0.2048  0.0983  305 ASP A N   
1983 C CA  . ASP A 275 ? 1.2821 1.5242 1.1032 0.2966  0.2218  0.1243  305 ASP A CA  
1984 C C   . ASP A 275 ? 1.2373 1.3794 1.0398 0.3019  0.2280  0.1475  305 ASP A C   
1985 O O   . ASP A 275 ? 1.2736 1.3891 1.0524 0.3098  0.2353  0.1593  305 ASP A O   
1986 C CB  . ASP A 275 ? 1.4223 1.7573 1.2438 0.3318  0.2413  0.1459  305 ASP A CB  
1987 C CG  . ASP A 275 ? 1.4546 1.9019 1.2910 0.3284  0.2379  0.1219  305 ASP A CG  
1988 O OD1 . ASP A 275 ? 1.5198 1.9705 1.3600 0.3011  0.2243  0.0915  305 ASP A OD1 
1989 O OD2 . ASP A 275 ? 1.3257 1.8601 1.1710 0.3529  0.2502  0.1332  305 ASP A OD2 
1990 N N   . THR A 276 ? 1.1895 1.2785 1.0034 0.2969  0.2254  0.1522  306 THR A N   
1991 C CA  . THR A 276 ? 1.1817 1.1821 0.9816 0.3019  0.2342  0.1727  306 THR A CA  
1992 C C   . THR A 276 ? 1.1365 1.0527 0.9390 0.2694  0.2153  0.1532  306 THR A C   
1993 O O   . THR A 276 ? 1.1174 0.9623 0.9162 0.2666  0.2188  0.1627  306 THR A O   
1994 C CB  . THR A 276 ? 1.1461 1.1483 0.9556 0.3229  0.2496  0.1964  306 THR A CB  
1995 O OG1 . THR A 276 ? 1.3153 1.2316 1.1122 0.3271  0.2615  0.2149  306 THR A OG1 
1996 C CG2 . THR A 276 ? 0.9229 0.9365 0.7593 0.3055  0.2338  0.1784  306 THR A CG2 
1997 N N   . ILE A 277 ? 0.9397 0.8671 0.7493 0.2450  0.1968  0.1259  307 ILE A N   
1998 C CA  . ILE A 277 ? 0.8554 0.7154 0.6708 0.2155  0.1789  0.1075  307 ILE A CA  
1999 C C   . ILE A 277 ? 0.8754 0.7083 0.6768 0.2013  0.1710  0.0974  307 ILE A C   
2000 O O   . ILE A 277 ? 0.8365 0.7202 0.6349 0.2017  0.1704  0.0890  307 ILE A O   
2001 C CB  . ILE A 277 ? 0.7440 0.6316 0.5863 0.1962  0.1633  0.0831  307 ILE A CB  
2002 C CG1 . ILE A 277 ? 0.6976 0.6121 0.5552 0.2089  0.1688  0.0922  307 ILE A CG1 
2003 C CG2 . ILE A 277 ? 0.6332 0.4537 0.4807 0.1682  0.1465  0.0668  307 ILE A CG2 
2004 C CD1 . ILE A 277 ? 0.7133 0.6707 0.5976 0.1943  0.1558  0.0684  307 ILE A CD1 
2005 N N   . LYS A 278 ? 0.8910 0.6479 0.6847 0.1884  0.1652  0.0975  308 LYS A N   
2006 C CA  . LYS A 278 ? 0.8682 0.5965 0.6505 0.1742  0.1565  0.0886  308 LYS A CA  
2007 C C   . LYS A 278 ? 0.7698 0.4839 0.5703 0.1463  0.1377  0.0650  308 LYS A C   
2008 O O   . LYS A 278 ? 0.6539 0.3290 0.4654 0.1344  0.1302  0.0604  308 LYS A O   
2009 C CB  . LYS A 278 ? 0.9467 0.6076 0.7097 0.1778  0.1625  0.1021  308 LYS A CB  
2010 C CG  . LYS A 278 ? 1.1675 0.8398 0.9086 0.2045  0.1819  0.1239  308 LYS A CG  
2011 C CD  . LYS A 278 ? 1.4058 1.0201 1.1269 0.2028  0.1844  0.1292  308 LYS A CD  
2012 C CE  . LYS A 278 ? 1.5202 1.0708 1.2414 0.2018  0.1919  0.1362  308 LYS A CE  
2013 N NZ  . LYS A 278 ? 1.5511 1.1075 1.2676 0.2282  0.2156  0.1590  308 LYS A NZ  
2014 N N   . GLN A 279 ? 0.6400 0.3875 0.4440 0.1364  0.1317  0.0506  309 GLN A N   
2015 C CA  . GLN A 279 ? 0.6385 0.3763 0.4618 0.1113  0.1175  0.0290  309 GLN A CA  
2016 C C   . GLN A 279 ? 0.7281 0.4259 0.5417 0.0986  0.1105  0.0265  309 GLN A C   
2017 O O   . GLN A 279 ? 0.7222 0.4398 0.5223 0.1027  0.1138  0.0286  309 GLN A O   
2018 C CB  . GLN A 279 ? 0.5029 0.3099 0.3437 0.1060  0.1173  0.0107  309 GLN A CB  
2019 C CG  . GLN A 279 ? 0.5858 0.4417 0.4413 0.1162  0.1222  0.0091  309 GLN A CG  
2020 C CD  . GLN A 279 ? 0.7117 0.6434 0.5844 0.1101  0.1231  -0.0122 309 GLN A CD  
2021 O OE1 . GLN A 279 ? 0.7030 0.6334 0.5951 0.0881  0.1153  -0.0349 309 GLN A OE1 
2022 N NE2 . GLN A 279 ? 0.8757 0.8761 0.7424 0.1299  0.1344  -0.0053 309 GLN A NE2 
2023 N N   . TYR A 280 ? 0.7055 0.3516 0.5264 0.0838  0.1009  0.0226  310 TYR A N   
2024 C CA  . TYR A 280 ? 0.5978 0.2089 0.4131 0.0718  0.0938  0.0208  310 TYR A CA  
2025 C C   . TYR A 280 ? 0.5600 0.1629 0.3989 0.0514  0.0842  0.0049  310 TYR A C   
2026 O O   . TYR A 280 ? 0.7136 0.3255 0.5713 0.0464  0.0821  -0.0039 310 TYR A O   
2027 C CB  . TYR A 280 ? 0.5613 0.1170 0.3621 0.0745  0.0930  0.0330  310 TYR A CB  
2028 C CG  . TYR A 280 ? 0.7415 0.2933 0.5196 0.0941  0.1050  0.0492  310 TYR A CG  
2029 C CD1 . TYR A 280 ? 0.7904 0.3436 0.5487 0.1013  0.1087  0.0562  310 TYR A CD1 
2030 C CD2 . TYR A 280 ? 0.6823 0.2273 0.4592 0.1060  0.1139  0.0584  310 TYR A CD2 
2031 C CE1 . TYR A 280 ? 0.7780 0.3245 0.5157 0.1206  0.1217  0.0716  310 TYR A CE1 
2032 C CE2 . TYR A 280 ? 0.7816 0.3187 0.5393 0.1249  0.1282  0.0746  310 TYR A CE2 
2033 C CZ  . TYR A 280 ? 0.8770 0.4140 0.6150 0.1325  0.1324  0.0810  310 TYR A CZ  
2034 O OH  . TYR A 280 ? 1.0311 0.5579 0.7501 0.1526  0.1486  0.0977  310 TYR A OH  
2035 N N   . TYR A 281 ? 0.6930 0.2783 0.5316 0.0405  0.0794  0.0024  311 TYR A N   
2036 C CA  . TYR A 281 ? 0.7413 0.3058 0.6012 0.0233  0.0723  -0.0075 311 TYR A CA  
2037 C C   . TYR A 281 ? 0.8269 0.3636 0.6782 0.0182  0.0671  0.0012  311 TYR A C   
2038 O O   . TYR A 281 ? 0.9633 0.4937 0.7956 0.0246  0.0685  0.0094  311 TYR A O   
2039 C CB  . TYR A 281 ? 0.6727 0.2729 0.5530 0.0116  0.0746  -0.0248 311 TYR A CB  
2040 C CG  . TYR A 281 ? 0.6650 0.2736 0.5399 0.0063  0.0760  -0.0256 311 TYR A CG  
2041 C CD1 . TYR A 281 ? 0.7472 0.3284 0.6340 -0.0071 0.0729  -0.0272 311 TYR A CD1 
2042 C CD2 . TYR A 281 ? 0.7272 0.3733 0.5852 0.0157  0.0814  -0.0233 311 TYR A CD2 
2043 C CE1 . TYR A 281 ? 0.7780 0.3677 0.6611 -0.0122 0.0746  -0.0270 311 TYR A CE1 
2044 C CE2 . TYR A 281 ? 0.9040 0.5600 0.7564 0.0104  0.0823  -0.0241 311 TYR A CE2 
2045 C CZ  . TYR A 281 ? 0.9089 0.5359 0.7743 -0.0042 0.0787  -0.0263 311 TYR A CZ  
2046 O OH  . TYR A 281 ? 1.0322 0.6701 0.8930 -0.0095 0.0800  -0.0261 311 TYR A OH  
2047 N N   . VAL A 282 ? 0.6647 0.2004 0.5298 0.0083  0.0615  -0.0002 312 VAL A N   
2048 C CA  . VAL A 282 ? 0.6408 0.1687 0.5007 0.0049  0.0568  0.0069  312 VAL A CA  
2049 C C   . VAL A 282 ? 0.7341 0.2633 0.6161 -0.0064 0.0559  0.0020  312 VAL A C   
2050 O O   . VAL A 282 ? 0.7763 0.3104 0.6797 -0.0128 0.0569  -0.0062 312 VAL A O   
2051 C CB  . VAL A 282 ? 0.6154 0.1386 0.4698 0.0066  0.0526  0.0118  312 VAL A CB  
2052 C CG1 . VAL A 282 ? 0.6527 0.1683 0.4978 0.0058  0.0487  0.0182  312 VAL A CG1 
2053 C CG2 . VAL A 282 ? 0.6295 0.1497 0.4676 0.0163  0.0568  0.0152  312 VAL A CG2 
2054 N N   . LEU A 283 ? 0.8198 0.3438 0.6977 -0.0083 0.0551  0.0073  313 LEU A N   
2055 C CA  . LEU A 283 ? 0.7881 0.3103 0.6877 -0.0179 0.0570  0.0051  313 LEU A CA  
2056 C C   . LEU A 283 ? 0.8760 0.3935 0.7808 -0.0171 0.0527  0.0135  313 LEU A C   
2057 O O   . LEU A 283 ? 0.8607 0.3750 0.7489 -0.0115 0.0479  0.0220  313 LEU A O   
2058 C CB  . LEU A 283 ? 0.8966 0.4159 0.7914 -0.0205 0.0596  0.0072  313 LEU A CB  
2059 C CG  . LEU A 283 ? 1.0604 0.5782 0.9816 -0.0333 0.0668  -0.0007 313 LEU A CG  
2060 C CD1 . LEU A 283 ? 1.0849 0.6105 1.0217 -0.0412 0.0730  -0.0194 313 LEU A CD1 
2061 C CD2 . LEU A 283 ? 1.0609 0.5752 0.9757 -0.0364 0.0688  0.0034  313 LEU A CD2 
2062 N N   . CYS A 284 ? 0.8645 0.3813 0.7931 -0.0227 0.0555  0.0101  314 CYS A N   
2063 C CA  . CYS A 284 ? 0.8153 0.3276 0.7510 -0.0209 0.0530  0.0182  314 CYS A CA  
2064 C C   . CYS A 284 ? 0.8705 0.3762 0.8331 -0.0268 0.0609  0.0190  314 CYS A C   
2065 O O   . CYS A 284 ? 1.0729 0.5776 1.0500 -0.0342 0.0685  0.0100  314 CYS A O   
2066 C CB  . CYS A 284 ? 0.7937 0.3098 0.7297 -0.0188 0.0493  0.0151  314 CYS A CB  
2067 S SG  . CYS A 284 ? 0.8005 0.3200 0.7080 -0.0122 0.0435  0.0152  314 CYS A SG  
2068 N N   . SER A 285 ? 0.7277 0.2278 0.6983 -0.0236 0.0610  0.0293  315 SER A N   
2069 C CA  . SER A 285 ? 0.8477 0.3379 0.8443 -0.0269 0.0713  0.0339  315 SER A CA  
2070 C C   . SER A 285 ? 0.8722 0.3582 0.8857 -0.0253 0.0747  0.0351  315 SER A C   
2071 O O   . SER A 285 ? 1.0677 0.5429 1.1066 -0.0283 0.0863  0.0361  315 SER A O   
2072 C CB  . SER A 285 ? 1.0401 0.5261 1.0335 -0.0222 0.0714  0.0500  315 SER A CB  
2073 O OG  . SER A 285 ? 1.1137 0.6045 1.0904 -0.0143 0.0624  0.0587  315 SER A OG  
2074 N N   . SER A 286 ? 0.6792 0.1720 0.6786 -0.0208 0.0657  0.0348  316 SER A N   
2075 C CA  . SER A 286 ? 0.5888 0.0787 0.5999 -0.0183 0.0671  0.0371  316 SER A CA  
2076 C C   . SER A 286 ? 0.6000 0.0998 0.5960 -0.0174 0.0576  0.0294  316 SER A C   
2077 O O   . SER A 286 ? 0.5382 0.0450 0.5137 -0.0170 0.0507  0.0258  316 SER A O   
2078 C CB  . SER A 286 ? 0.7053 0.1907 0.7157 -0.0108 0.0673  0.0542  316 SER A CB  
2079 O OG  . SER A 286 ? 0.5693 0.0626 0.5546 -0.0070 0.0561  0.0570  316 SER A OG  
2080 N N   . ARG A 287 ? 0.5345 0.0334 0.5410 -0.0164 0.0583  0.0281  317 ARG A N   
2081 C CA  . ARG A 287 ? 0.5252 0.0328 0.5188 -0.0152 0.0496  0.0230  317 ARG A CA  
2082 C C   . ARG A 287 ? 0.6698 0.1792 0.6403 -0.0112 0.0416  0.0304  317 ARG A C   
2083 O O   . ARG A 287 ? 0.6969 0.2120 0.6502 -0.0115 0.0354  0.0254  317 ARG A O   
2084 C CB  . ARG A 287 ? 0.7294 0.2345 0.7389 -0.0144 0.0520  0.0220  317 ARG A CB  
2085 C CG  . ARG A 287 ? 0.5178 0.0321 0.5162 -0.0137 0.0432  0.0169  317 ARG A CG  
2086 C CD  . ARG A 287 ? 0.7426 0.2528 0.7480 -0.0101 0.0434  0.0227  317 ARG A CD  
2087 N NE  . ARG A 287 ? 1.0120 0.5150 1.0132 -0.0052 0.0453  0.0367  317 ARG A NE  
2088 C CZ  . ARG A 287 ? 0.9823 0.4798 0.9899 0.0002  0.0483  0.0466  317 ARG A CZ  
2089 N NH1 . ARG A 287 ? 0.9384 0.4351 0.9562 0.0011  0.0493  0.0432  317 ARG A NH1 
2090 N NH2 . ARG A 287 ? 0.8083 0.3018 0.8122 0.0059  0.0508  0.0609  317 ARG A NH2 
2091 N N   . ASP A 288 ? 0.6478 0.1517 0.6195 -0.0074 0.0434  0.0422  318 ASP A N   
2092 C CA  . ASP A 288 ? 0.6555 0.1610 0.6076 -0.0046 0.0369  0.0477  318 ASP A CA  
2093 C C   . ASP A 288 ? 0.5832 0.0907 0.5167 -0.0061 0.0333  0.0437  318 ASP A C   
2094 O O   . ASP A 288 ? 0.7295 0.2376 0.6450 -0.0060 0.0282  0.0417  318 ASP A O   
2095 C CB  . ASP A 288 ? 0.8945 0.3958 0.8534 0.0012  0.0405  0.0629  318 ASP A CB  
2096 C CG  . ASP A 288 ? 1.1846 0.6847 1.1512 0.0051  0.0418  0.0688  318 ASP A CG  
2097 O OD1 . ASP A 288 ? 1.1874 0.6889 1.1563 0.0024  0.0399  0.0600  318 ASP A OD1 
2098 O OD2 . ASP A 288 ? 1.2442 0.7431 1.2142 0.0120  0.0449  0.0838  318 ASP A OD2 
2099 N N   . GLU A 289 ? 0.6813 0.1883 0.6195 -0.0077 0.0372  0.0422  319 GLU A N   
2100 C CA  . GLU A 289 ? 0.6791 0.1875 0.5990 -0.0080 0.0347  0.0386  319 GLU A CA  
2101 C C   . GLU A 289 ? 0.7162 0.2289 0.6275 -0.0094 0.0335  0.0285  319 GLU A C   
2102 O O   . GLU A 289 ? 0.6501 0.1620 0.5424 -0.0078 0.0314  0.0267  319 GLU A O   
2103 C CB  . GLU A 289 ? 0.8008 0.3073 0.7269 -0.0088 0.0392  0.0417  319 GLU A CB  
2104 C CG  . GLU A 289 ? 1.0618 0.5660 0.9828 -0.0052 0.0381  0.0528  319 GLU A CG  
2105 C CD  . GLU A 289 ? 1.1984 0.7013 1.1220 -0.0063 0.0417  0.0556  319 GLU A CD  
2106 O OE1 . GLU A 289 ? 1.1519 0.6558 1.0762 -0.0101 0.0444  0.0471  319 GLU A OE1 
2107 O OE2 . GLU A 289 ? 1.2300 0.7319 1.1552 -0.0032 0.0421  0.0667  319 GLU A OE2 
2108 N N   . LYS A 290 ? 0.6485 0.1649 0.5748 -0.0119 0.0361  0.0225  320 LYS A N   
2109 C CA  . LYS A 290 ? 0.5461 0.0682 0.4662 -0.0118 0.0352  0.0148  320 LYS A CA  
2110 C C   . LYS A 290 ? 0.6103 0.1316 0.5168 -0.0100 0.0308  0.0156  320 LYS A C   
2111 O O   . LYS A 290 ? 0.6399 0.1610 0.5322 -0.0081 0.0311  0.0135  320 LYS A O   
2112 C CB  . LYS A 290 ? 0.6153 0.1428 0.5561 -0.0149 0.0383  0.0074  320 LYS A CB  
2113 C CG  . LYS A 290 ? 0.6194 0.1474 0.5729 -0.0187 0.0447  0.0021  320 LYS A CG  
2114 C CD  . LYS A 290 ? 0.6487 0.1837 0.6203 -0.0224 0.0482  -0.0095 320 LYS A CD  
2115 C CE  . LYS A 290 ? 0.7061 0.2383 0.6983 -0.0245 0.0497  -0.0107 320 LYS A CE  
2116 N NZ  . LYS A 290 ? 0.6258 0.1641 0.6399 -0.0298 0.0550  -0.0250 320 LYS A NZ  
2117 N N   . PHE A 291 ? 0.5352 0.0543 0.4463 -0.0105 0.0280  0.0192  321 PHE A N   
2118 C CA  . PHE A 291 ? 0.5421 0.0593 0.4411 -0.0105 0.0244  0.0188  321 PHE A CA  
2119 C C   . PHE A 291 ? 0.5891 0.0994 0.4685 -0.0100 0.0243  0.0200  321 PHE A C   
2120 O O   . PHE A 291 ? 0.7348 0.2411 0.6020 -0.0107 0.0247  0.0167  321 PHE A O   
2121 C CB  . PHE A 291 ? 0.5965 0.1129 0.5039 -0.0108 0.0220  0.0228  321 PHE A CB  
2122 C CG  . PHE A 291 ? 0.6965 0.2105 0.5918 -0.0124 0.0185  0.0212  321 PHE A CG  
2123 C CD1 . PHE A 291 ? 0.5623 0.0708 0.4485 -0.0128 0.0172  0.0248  321 PHE A CD1 
2124 C CD2 . PHE A 291 ? 0.6776 0.1946 0.5712 -0.0138 0.0173  0.0157  321 PHE A CD2 
2125 C CE1 . PHE A 291 ? 0.6192 0.1241 0.4950 -0.0163 0.0153  0.0212  321 PHE A CE1 
2126 C CE2 . PHE A 291 ? 0.6637 0.1770 0.5470 -0.0167 0.0155  0.0135  321 PHE A CE2 
2127 C CZ  . PHE A 291 ? 0.6792 0.1858 0.5536 -0.0187 0.0148  0.0153  321 PHE A CZ  
2128 N N   . GLN A 292 ? 0.6405 0.1481 0.5178 -0.0087 0.0249  0.0247  322 GLN A N   
2129 C CA  . GLN A 292 ? 0.7542 0.2547 0.6139 -0.0081 0.0249  0.0251  322 GLN A CA  
2130 C C   . GLN A 292 ? 0.6884 0.1861 0.5358 -0.0059 0.0289  0.0220  322 GLN A C   
2131 O O   . GLN A 292 ? 0.6933 0.1825 0.5258 -0.0054 0.0316  0.0195  322 GLN A O   
2132 C CB  . GLN A 292 ? 0.7844 0.2840 0.6464 -0.0065 0.0237  0.0325  322 GLN A CB  
2133 C CG  . GLN A 292 ? 1.0030 0.4960 0.8515 -0.0070 0.0221  0.0327  322 GLN A CG  
2134 C CD  . GLN A 292 ? 1.3387 0.8339 1.1955 -0.0050 0.0200  0.0422  322 GLN A CD  
2135 O OE1 . GLN A 292 ? 1.3403 0.8404 1.2132 -0.0024 0.0212  0.0501  322 GLN A OE1 
2136 N NE2 . GLN A 292 ? 1.3660 0.8567 1.2132 -0.0058 0.0184  0.0421  322 GLN A NE2 
2137 N N   . ALA A 293 ? 0.6114 0.1148 0.4658 -0.0044 0.0310  0.0220  323 ALA A N   
2138 C CA  . ALA A 293 ? 0.6359 0.1378 0.4794 -0.0007 0.0358  0.0202  323 ALA A CA  
2139 C C   . ALA A 293 ? 0.6296 0.1283 0.4669 0.0005  0.0389  0.0171  323 ALA A C   
2140 O O   . ALA A 293 ? 0.6225 0.1120 0.4446 0.0043  0.0446  0.0175  323 ALA A O   
2141 C CB  . ALA A 293 ? 0.5219 0.0321 0.3774 -0.0007 0.0377  0.0188  323 ALA A CB  
2142 N N   . LEU A 294 ? 0.6585 0.1634 0.5084 -0.0023 0.0364  0.0148  324 LEU A N   
2143 C CA  . LEU A 294 ? 0.7116 0.2146 0.5588 -0.0015 0.0391  0.0125  324 LEU A CA  
2144 C C   . LEU A 294 ? 0.5411 0.0315 0.3760 -0.0038 0.0409  0.0117  324 LEU A C   
2145 O O   . LEU A 294 ? 0.7779 0.2589 0.6035 -0.0015 0.0484  0.0112  324 LEU A O   
2146 C CB  . LEU A 294 ? 0.6851 0.1984 0.5494 -0.0042 0.0346  0.0101  324 LEU A CB  
2147 C CG  . LEU A 294 ? 0.6819 0.1947 0.5456 -0.0040 0.0361  0.0083  324 LEU A CG  
2148 C CD1 . LEU A 294 ? 0.7049 0.2192 0.5661 0.0022  0.0432  0.0091  324 LEU A CD1 
2149 C CD2 . LEU A 294 ? 0.5723 0.0945 0.4516 -0.0071 0.0300  0.0062  324 LEU A CD2 
2150 N N   . CYS A 295 ? 0.5836 0.0723 0.4194 -0.0083 0.0358  0.0114  325 CYS A N   
2151 C CA  . CYS A 295 ? 0.6583 0.1346 0.4834 -0.0122 0.0381  0.0084  325 CYS A CA  
2152 C C   . CYS A 295 ? 0.6222 0.0855 0.4323 -0.0094 0.0455  0.0081  325 CYS A C   
2153 O O   . CYS A 295 ? 0.6880 0.1371 0.4893 -0.0111 0.0533  0.0044  325 CYS A O   
2154 C CB  . CYS A 295 ? 0.6188 0.0970 0.4477 -0.0164 0.0316  0.0088  325 CYS A CB  
2155 S SG  . CYS A 295 ? 0.8004 0.2871 0.6422 -0.0198 0.0258  0.0085  325 CYS A SG  
2156 N N   . ASN A 296 ? 0.6293 0.0959 0.4371 -0.0053 0.0441  0.0119  326 ASN A N   
2157 C CA  . ASN A 296 ? 0.6345 0.0895 0.4274 -0.0008 0.0510  0.0127  326 ASN A CA  
2158 C C   . ASN A 296 ? 0.6369 0.0843 0.4237 0.0047  0.0616  0.0135  326 ASN A C   
2159 O O   . ASN A 296 ? 0.7650 0.1950 0.5398 0.0069  0.0717  0.0125  326 ASN A O   
2160 C CB  . ASN A 296 ? 0.6947 0.1572 0.4871 0.0033  0.0474  0.0175  326 ASN A CB  
2161 C CG  . ASN A 296 ? 0.7903 0.2556 0.5860 0.0000  0.0401  0.0189  326 ASN A CG  
2162 O OD1 . ASN A 296 ? 0.8892 0.3633 0.6916 0.0015  0.0358  0.0236  326 ASN A OD1 
2163 N ND2 . ASN A 296 ? 0.6930 0.1503 0.4852 -0.0045 0.0397  0.0151  326 ASN A ND2 
2164 N N   . LEU A 297 ? 0.6816 0.1409 0.4778 0.0076  0.0607  0.0156  327 LEU A N   
2165 C CA  . LEU A 297 ? 0.7575 0.2126 0.5504 0.0149  0.0710  0.0184  327 LEU A CA  
2166 C C   . LEU A 297 ? 0.5914 0.0319 0.3821 0.0126  0.0792  0.0163  327 LEU A C   
2167 O O   . LEU A 297 ? 0.8236 0.2491 0.6058 0.0192  0.0927  0.0196  327 LEU A O   
2168 C CB  . LEU A 297 ? 0.7390 0.2121 0.5458 0.0170  0.0670  0.0194  327 LEU A CB  
2169 C CG  . LEU A 297 ? 0.8453 0.3197 0.6480 0.0282  0.0764  0.0246  327 LEU A CG  
2170 C CD1 . LEU A 297 ? 0.8153 0.2851 0.6045 0.0343  0.0799  0.0283  327 LEU A CD1 
2171 C CD2 . LEU A 297 ? 0.9915 0.4847 0.8105 0.0284  0.0715  0.0229  327 LEU A CD2 
2172 N N   . TYR A 298 ? 0.8802 0.3240 0.6791 0.0037  0.0724  0.0114  328 TYR A N   
2173 C CA  . TYR A 298 ? 0.8765 0.3054 0.6737 -0.0014 0.0797  0.0074  328 TYR A CA  
2174 C C   . TYR A 298 ? 0.8224 0.2296 0.6070 -0.0038 0.0888  0.0037  328 TYR A C   
2175 O O   . TYR A 298 ? 0.8446 0.2316 0.6249 -0.0045 0.1028  0.0018  328 TYR A O   
2176 C CB  . TYR A 298 ? 0.7382 0.1759 0.5447 -0.0110 0.0694  0.0023  328 TYR A CB  
2177 C CG  . TYR A 298 ? 0.6502 0.1013 0.4689 -0.0103 0.0650  0.0037  328 TYR A CG  
2178 C CD1 . TYR A 298 ? 0.6606 0.1033 0.4810 -0.0119 0.0725  0.0026  328 TYR A CD1 
2179 C CD2 . TYR A 298 ? 0.6164 0.0871 0.4462 -0.0087 0.0543  0.0056  328 TYR A CD2 
2180 C CE1 . TYR A 298 ? 0.7328 0.1886 0.5645 -0.0110 0.0676  0.0040  328 TYR A CE1 
2181 C CE2 . TYR A 298 ? 0.6789 0.1615 0.5207 -0.0083 0.0503  0.0057  328 TYR A CE2 
2182 C CZ  . TYR A 298 ? 0.7809 0.2572 0.6230 -0.0091 0.0560  0.0051  328 TYR A CZ  
2183 O OH  . TYR A 298 ? 0.6738 0.1628 0.5278 -0.0083 0.0512  0.0054  328 TYR A OH  
2184 N N   . GLY A 299 ? 0.8746 0.2851 0.6547 -0.0053 0.0817  0.0025  329 GLY A N   
2185 C CA  . GLY A 299 ? 0.6391 0.0312 0.4085 -0.0082 0.0884  -0.0026 329 GLY A CA  
2186 C C   . GLY A 299 ? 0.7702 0.1437 0.5281 0.0010  0.1038  0.0014  329 GLY A C   
2187 O O   . GLY A 299 ? 0.7785 0.1289 0.5294 -0.0018 0.1161  -0.0041 329 GLY A O   
2188 N N   . ALA A 300 ? 0.7288 0.1117 0.4855 0.0121  0.1046  0.0106  330 ALA A N   
2189 C CA  . ALA A 300 ? 0.8968 0.2641 0.6412 0.0241  0.1195  0.0172  330 ALA A CA  
2190 C C   . ALA A 300 ? 0.9213 0.2760 0.6678 0.0307  0.1358  0.0224  330 ALA A C   
2191 O O   . ALA A 300 ? 0.8447 0.1726 0.5861 0.0315  0.1530  0.0213  330 ALA A O   
2192 C CB  . ALA A 300 ? 0.8929 0.2772 0.6334 0.0336  0.1131  0.0246  330 ALA A CB  
2193 N N   . ILE A 301 ? 0.9698 0.3429 0.7251 0.0358  0.1318  0.0281  331 ILE A N   
2194 C CA  . ILE A 301 ? 0.9591 0.3237 0.7178 0.0447  0.1470  0.0356  331 ILE A CA  
2195 C C   . ILE A 301 ? 0.8437 0.2116 0.6159 0.0341  0.1428  0.0300  331 ILE A C   
2196 O O   . ILE A 301 ? 0.7469 0.1315 0.5268 0.0232  0.1259  0.0227  331 ILE A O   
2197 C CB  . ILE A 301 ? 0.8576 0.2412 0.6177 0.0594  0.1474  0.0463  331 ILE A CB  
2198 C CG1 . ILE A 301 ? 0.8622 0.2750 0.6361 0.0523  0.1280  0.0415  331 ILE A CG1 
2199 C CG2 . ILE A 301 ? 0.8163 0.1983 0.5617 0.0702  0.1510  0.0521  331 ILE A CG2 
2200 C CD1 . ILE A 301 ? 0.8469 0.2789 0.6259 0.0647  0.1288  0.0494  331 ILE A CD1 
2201 N N   . THR A 302 ? 0.9072 0.2579 0.6823 0.0381  0.1596  0.0344  332 THR A N   
2202 C CA  . THR A 302 ? 1.0455 0.3988 0.8329 0.0288  0.1566  0.0298  332 THR A CA  
2203 C C   . THR A 302 ? 1.0358 0.4169 0.8345 0.0350  0.1465  0.0357  332 THR A C   
2204 O O   . THR A 302 ? 0.9356 0.3198 0.7356 0.0499  0.1566  0.0473  332 THR A O   
2205 C CB  . THR A 302 ? 1.0291 0.3518 0.8176 0.0297  0.1797  0.0322  332 THR A CB  
2206 O OG1 . THR A 302 ? 1.0403 0.3718 0.8413 0.0322  0.1808  0.0376  332 THR A OG1 
2207 C CG2 . THR A 302 ? 0.8871 0.1883 0.6657 0.0461  0.2018  0.0439  332 THR A CG2 
2208 N N   . ILE A 303 ? 0.9711 0.3727 0.7784 0.0246  0.1274  0.0281  333 ILE A N   
2209 C CA  . ILE A 303 ? 0.8589 0.2865 0.6783 0.0286  0.1168  0.0309  333 ILE A CA  
2210 C C   . ILE A 303 ? 0.9299 0.3575 0.7599 0.0280  0.1205  0.0327  333 ILE A C   
2211 O O   . ILE A 303 ? 0.9777 0.4002 0.8105 0.0165  0.1164  0.0257  333 ILE A O   
2212 C CB  . ILE A 303 ? 0.8997 0.3476 0.7246 0.0197  0.0967  0.0232  333 ILE A CB  
2213 C CG1 . ILE A 303 ? 0.9432 0.3911 0.7586 0.0213  0.0941  0.0229  333 ILE A CG1 
2214 C CG2 . ILE A 303 ? 0.8631 0.3346 0.7022 0.0229  0.0878  0.0242  333 ILE A CG2 
2215 C CD1 . ILE A 303 ? 0.9347 0.3994 0.7569 0.0139  0.0776  0.0176  333 ILE A CD1 
2216 N N   . ALA A 304 ? 0.9335 0.3680 0.7693 0.0415  0.1287  0.0431  334 ALA A N   
2217 C CA  . ALA A 304 ? 0.8323 0.2655 0.6783 0.0443  0.1354  0.0483  334 ALA A CA  
2218 C C   . ALA A 304 ? 0.7855 0.2404 0.6409 0.0599  0.1364  0.0588  334 ALA A C   
2219 O O   . ALA A 304 ? 0.7609 0.2224 0.6114 0.0722  0.1409  0.0656  334 ALA A O   
2220 C CB  . ALA A 304 ? 0.7765 0.1783 0.6168 0.0475  0.1582  0.0544  334 ALA A CB  
2221 N N   . GLN A 305 ? 0.7851 0.2524 0.6540 0.0602  0.1322  0.0605  335 GLN A N   
2222 C CA  . GLN A 305 ? 0.6014 0.0937 0.4817 0.0751  0.1311  0.0693  335 GLN A CA  
2223 C C   . GLN A 305 ? 0.5342 0.0472 0.4163 0.0737  0.1164  0.0611  335 GLN A C   
2224 O O   . GLN A 305 ? 0.7172 0.2451 0.6012 0.0892  0.1207  0.0687  335 GLN A O   
2225 C CB  . GLN A 305 ? 0.5716 0.0588 0.4486 0.0977  0.1536  0.0893  335 GLN A CB  
2226 C CG  . GLN A 305 ? 0.9557 0.4172 0.8324 0.1009  0.1738  0.0997  335 GLN A CG  
2227 C CD  . GLN A 305 ? 1.1270 0.5881 1.0029 0.1276  0.1978  0.1240  335 GLN A CD  
2228 O OE1 . GLN A 305 ? 1.1085 0.5915 0.9819 0.1448  0.1985  0.1333  335 GLN A OE1 
2229 N NE2 . GLN A 305 ? 1.2708 0.7081 1.1493 0.1326  0.2190  0.1358  335 GLN A NE2 
2230 N N   . ALA A 306 ? 0.5262 0.0410 0.4085 0.0567  0.1005  0.0466  336 ALA A N   
2231 C CA  . ALA A 306 ? 0.5506 0.0798 0.4354 0.0537  0.0893  0.0387  336 ALA A CA  
2232 C C   . ALA A 306 ? 0.5574 0.1045 0.4580 0.0445  0.0730  0.0280  336 ALA A C   
2233 O O   . ALA A 306 ? 0.5739 0.1197 0.4785 0.0362  0.0668  0.0246  336 ALA A O   
2234 C CB  . ALA A 306 ? 0.6671 0.1821 0.5379 0.0452  0.0879  0.0342  336 ALA A CB  
2235 N N   . MET A 307 ? 0.4736 0.0365 0.3835 0.0462  0.0673  0.0221  337 MET A N   
2236 C CA  . MET A 307 ? 0.5110 0.0882 0.4373 0.0373  0.0541  0.0105  337 MET A CA  
2237 C C   . MET A 307 ? 0.5362 0.1138 0.4635 0.0288  0.0486  0.0025  337 MET A C   
2238 O O   . MET A 307 ? 0.5618 0.1392 0.4848 0.0333  0.0537  0.0027  337 MET A O   
2239 C CB  . MET A 307 ? 0.4394 0.0365 0.3832 0.0470  0.0538  0.0073  337 MET A CB  
2240 C CG  . MET A 307 ? 0.6662 0.2666 0.6136 0.0554  0.0571  0.0160  337 MET A CG  
2241 S SD  . MET A 307 ? 0.8152 0.4493 0.7851 0.0720  0.0566  0.0119  337 MET A SD  
2242 C CE  . MET A 307 ? 0.4644 0.1062 0.4529 0.0562  0.0414  -0.0113 337 MET A CE  
2243 N N   . ILE A 308 ? 0.4882 0.0663 0.4214 0.0182  0.0393  -0.0032 338 ILE A N   
2244 C CA  . ILE A 308 ? 0.4972 0.0752 0.4346 0.0113  0.0355  -0.0088 338 ILE A CA  
2245 C C   . ILE A 308 ? 0.5256 0.1167 0.4856 0.0070  0.0300  -0.0192 338 ILE A C   
2246 O O   . ILE A 308 ? 0.5236 0.1183 0.4912 0.0044  0.0241  -0.0207 338 ILE A O   
2247 C CB  . ILE A 308 ? 0.4923 0.0581 0.4186 0.0050  0.0321  -0.0052 338 ILE A CB  
2248 C CG1 . ILE A 308 ? 0.6192 0.1706 0.5249 0.0082  0.0389  0.0019  338 ILE A CG1 
2249 C CG2 . ILE A 308 ? 0.4659 0.0312 0.3984 0.0000  0.0298  -0.0085 338 ILE A CG2 
2250 C CD1 . ILE A 308 ? 0.6666 0.2066 0.5621 0.0025  0.0363  0.0035  338 ILE A CD1 
2251 N N   . PHE A 309 ? 0.5520 0.1495 0.5230 0.0058  0.0329  -0.0278 339 PHE A N   
2252 C CA  . PHE A 309 ? 0.5882 0.1974 0.5836 0.0010  0.0309  -0.0417 339 PHE A CA  
2253 C C   . PHE A 309 ? 0.6373 0.2394 0.6416 -0.0075 0.0307  -0.0446 339 PHE A C   
2254 O O   . PHE A 309 ? 0.6866 0.2819 0.6859 -0.0098 0.0349  -0.0435 339 PHE A O   
2255 C CB  . PHE A 309 ? 0.4161 0.0390 0.4221 0.0045  0.0365  -0.0549 339 PHE A CB  
2256 C CG  . PHE A 309 ? 0.5140 0.1447 0.5139 0.0173  0.0388  -0.0513 339 PHE A CG  
2257 C CD1 . PHE A 309 ? 0.5596 0.1817 0.5391 0.0276  0.0451  -0.0379 339 PHE A CD1 
2258 C CD2 . PHE A 309 ? 0.5604 0.2072 0.5758 0.0214  0.0360  -0.0606 339 PHE A CD2 
2259 C CE1 . PHE A 309 ? 0.5452 0.1814 0.5209 0.0429  0.0503  -0.0301 339 PHE A CE1 
2260 C CE2 . PHE A 309 ? 0.5419 0.2154 0.5535 0.0355  0.0395  -0.0524 339 PHE A CE2 
2261 C CZ  . PHE A 309 ? 0.5487 0.2185 0.5408 0.0465  0.0474  -0.0358 339 PHE A CZ  
2262 N N   . CYS A 310 ? 0.6093 0.2120 0.6269 -0.0109 0.0270  -0.0473 340 CYS A N   
2263 C CA  . CYS A 310 ? 0.5879 0.1820 0.6177 -0.0167 0.0295  -0.0492 340 CYS A CA  
2264 C C   . CYS A 310 ? 0.5903 0.1930 0.6484 -0.0214 0.0332  -0.0661 340 CYS A C   
2265 O O   . CYS A 310 ? 0.8203 0.4375 0.8873 -0.0196 0.0305  -0.0753 340 CYS A O   
2266 C CB  . CYS A 310 ? 0.6777 0.2620 0.6992 -0.0155 0.0244  -0.0381 340 CYS A CB  
2267 S SG  . CYS A 310 ? 0.8147 0.3915 0.8054 -0.0119 0.0205  -0.0242 340 CYS A SG  
2268 N N   . HIS A 311 ? 0.6101 0.2038 0.6838 -0.0274 0.0404  -0.0711 341 HIS A N   
2269 C CA  . HIS A 311 ? 0.7231 0.3228 0.8266 -0.0339 0.0471  -0.0904 341 HIS A CA  
2270 C C   . HIS A 311 ? 0.8091 0.4073 0.9236 -0.0319 0.0437  -0.0904 341 HIS A C   
2271 O O   . HIS A 311 ? 0.9740 0.5872 1.1036 -0.0326 0.0423  -0.1050 341 HIS A O   
2272 C CB  . HIS A 311 ? 0.7527 0.3394 0.8712 -0.0419 0.0590  -0.0962 341 HIS A CB  
2273 C CG  . HIS A 311 ? 0.9855 0.5746 1.1372 -0.0504 0.0691  -0.1179 341 HIS A CG  
2274 N ND1 . HIS A 311 ? 0.9987 0.6111 1.1663 -0.0551 0.0698  -0.1419 341 HIS A ND1 
2275 C CD2 . HIS A 311 ? 1.1201 0.6911 1.2932 -0.0554 0.0805  -0.1209 341 HIS A CD2 
2276 C CE1 . HIS A 311 ? 1.0123 0.6224 1.2102 -0.0640 0.0808  -0.1609 341 HIS A CE1 
2277 N NE2 . HIS A 311 ? 1.0683 0.6506 1.2703 -0.0641 0.0884  -0.1475 341 HIS A NE2 
2278 N N   . THR A 312 ? 0.6594 0.2410 0.7661 -0.0287 0.0426  -0.0748 342 THR A N   
2279 C CA  . THR A 312 ? 0.5928 0.1703 0.7091 -0.0262 0.0408  -0.0738 342 THR A CA  
2280 C C   . THR A 312 ? 0.6927 0.2729 0.7861 -0.0195 0.0287  -0.0597 342 THR A C   
2281 O O   . THR A 312 ? 0.7515 0.3306 0.8216 -0.0172 0.0240  -0.0483 342 THR A O   
2282 C CB  . THR A 312 ? 0.7127 0.2680 0.8410 -0.0272 0.0512  -0.0681 342 THR A CB  
2283 O OG1 . THR A 312 ? 0.6041 0.1486 0.7102 -0.0222 0.0478  -0.0485 342 THR A OG1 
2284 C CG2 . THR A 312 ? 0.5779 0.1264 0.7268 -0.0353 0.0652  -0.0804 342 THR A CG2 
2285 N N   . ARG A 313 ? 0.5708 0.1541 0.6715 -0.0170 0.0246  -0.0619 343 ARG A N   
2286 C CA  . ARG A 313 ? 0.6107 0.1952 0.6915 -0.0119 0.0143  -0.0499 343 ARG A CA  
2287 C C   . ARG A 313 ? 0.6923 0.2606 0.7581 -0.0100 0.0157  -0.0348 343 ARG A C   
2288 O O   . ARG A 313 ? 0.6858 0.2548 0.7297 -0.0081 0.0086  -0.0254 343 ARG A O   
2289 C CB  . ARG A 313 ? 0.7673 0.3563 0.8603 -0.0095 0.0105  -0.0553 343 ARG A CB  
2290 C CG  . ARG A 313 ? 0.8592 0.4682 0.9659 -0.0102 0.0069  -0.0707 343 ARG A CG  
2291 C CD  . ARG A 313 ? 0.9446 0.5586 1.0591 -0.0068 0.0010  -0.0740 343 ARG A CD  
2292 N NE  . ARG A 313 ? 0.8794 0.5143 1.0117 -0.0071 -0.0016 -0.0916 343 ARG A NE  
2293 C CZ  . ARG A 313 ? 0.7494 0.3926 0.8925 -0.0041 -0.0067 -0.0988 343 ARG A CZ  
2294 N NH1 . ARG A 313 ? 0.6973 0.3277 0.8339 -0.0006 -0.0094 -0.0887 343 ARG A NH1 
2295 N NH2 . ARG A 313 ? 0.8744 0.5401 1.0345 -0.0041 -0.0090 -0.1172 343 ARG A NH2 
2296 N N   . LYS A 314 ? 0.7444 0.2977 0.8236 -0.0106 0.0262  -0.0332 344 LYS A N   
2297 C CA  . LYS A 314 ? 0.8411 0.3799 0.9088 -0.0074 0.0291  -0.0182 344 LYS A CA  
2298 C C   . LYS A 314 ? 0.8583 0.3993 0.9058 -0.0089 0.0260  -0.0126 344 LYS A C   
2299 O O   . LYS A 314 ? 0.8119 0.3511 0.8399 -0.0065 0.0209  -0.0029 344 LYS A O   
2300 C CB  . LYS A 314 ? 0.7754 0.2961 0.8645 -0.0068 0.0438  -0.0164 344 LYS A CB  
2301 N N   . THR A 315 ? 0.7294 0.2743 0.7818 -0.0129 0.0296  -0.0199 345 THR A N   
2302 C CA  . THR A 315 ? 0.6444 0.1907 0.6778 -0.0137 0.0274  -0.0152 345 THR A CA  
2303 C C   . THR A 315 ? 0.6662 0.2221 0.6785 -0.0124 0.0179  -0.0136 345 THR A C   
2304 O O   . THR A 315 ? 0.6219 0.1738 0.6151 -0.0116 0.0151  -0.0061 345 THR A O   
2305 C CB  . THR A 315 ? 0.6847 0.2339 0.7272 -0.0179 0.0336  -0.0239 345 THR A CB  
2306 O OG1 . THR A 315 ? 0.8312 0.3675 0.8910 -0.0202 0.0443  -0.0237 345 THR A OG1 
2307 C CG2 . THR A 315 ? 0.5965 0.1480 0.6173 -0.0174 0.0306  -0.0193 345 THR A CG2 
2308 N N   . ALA A 316 ? 0.5726 0.1402 0.5898 -0.0124 0.0141  -0.0211 346 ALA A N   
2309 C CA  . ALA A 316 ? 0.5391 0.1137 0.5393 -0.0110 0.0076  -0.0190 346 ALA A CA  
2310 C C   . ALA A 316 ? 0.6079 0.1770 0.5929 -0.0103 0.0024  -0.0113 346 ALA A C   
2311 O O   . ALA A 316 ? 0.5672 0.1329 0.5338 -0.0111 0.0011  -0.0072 346 ALA A O   
2312 C CB  . ALA A 316 ? 0.6482 0.2365 0.6596 -0.0098 0.0049  -0.0273 346 ALA A CB  
2313 N N   . SER A 317 ? 0.6504 0.2175 0.6433 -0.0091 0.0004  -0.0102 347 SER A N   
2314 C CA  . SER A 317 ? 0.7566 0.3191 0.7354 -0.0086 -0.0043 -0.0037 347 SER A CA  
2315 C C   . SER A 317 ? 0.7853 0.3370 0.7522 -0.0089 -0.0013 0.0038  347 SER A C   
2316 O O   . SER A 317 ? 0.7768 0.3254 0.7272 -0.0105 -0.0044 0.0071  347 SER A O   
2317 C CB  . SER A 317 ? 0.7121 0.2742 0.7016 -0.0057 -0.0062 -0.0032 347 SER A CB  
2318 O OG  . SER A 317 ? 0.9119 0.4634 0.9129 -0.0030 0.0011  0.0012  347 SER A OG  
2319 N N   . TRP A 318 ? 0.6702 0.2160 0.6469 -0.0078 0.0053  0.0060  348 TRP A N   
2320 C CA  . TRP A 318 ? 0.6349 0.1718 0.6026 -0.0071 0.0084  0.0137  348 TRP A CA  
2321 C C   . TRP A 318 ? 0.6758 0.2137 0.6266 -0.0103 0.0069  0.0119  348 TRP A C   
2322 O O   . TRP A 318 ? 0.6870 0.2203 0.6227 -0.0114 0.0053  0.0154  348 TRP A O   
2323 C CB  . TRP A 318 ? 0.5019 0.0317 0.4862 -0.0052 0.0172  0.0169  348 TRP A CB  
2324 C CG  . TRP A 318 ? 0.7097 0.2326 0.6859 -0.0040 0.0202  0.0254  348 TRP A CG  
2325 C CD1 . TRP A 318 ? 0.7222 0.2380 0.6973 0.0009  0.0231  0.0371  348 TRP A CD1 
2326 C CD2 . TRP A 318 ? 0.7175 0.2406 0.6857 -0.0064 0.0210  0.0240  348 TRP A CD2 
2327 N NE1 . TRP A 318 ? 0.7605 0.2732 0.7287 0.0013  0.0251  0.0427  348 TRP A NE1 
2328 C CE2 . TRP A 318 ? 0.7658 0.2822 0.7290 -0.0036 0.0236  0.0342  348 TRP A CE2 
2329 C CE3 . TRP A 318 ? 0.6325 0.1609 0.5970 -0.0097 0.0204  0.0162  348 TRP A CE3 
2330 C CZ2 . TRP A 318 ? 0.6923 0.2073 0.6472 -0.0047 0.0245  0.0356  348 TRP A CZ2 
2331 C CZ3 . TRP A 318 ? 0.6585 0.1843 0.6135 -0.0103 0.0220  0.0182  348 TRP A CZ3 
2332 C CH2 . TRP A 318 ? 0.6490 0.1681 0.5992 -0.0082 0.0235  0.0271  348 TRP A CH2 
2333 N N   . LEU A 319 ? 0.5680 0.1111 0.5220 -0.0115 0.0084  0.0061  349 LEU A N   
2334 C CA  . LEU A 319 ? 0.5503 0.0926 0.4890 -0.0130 0.0090  0.0050  349 LEU A CA  
2335 C C   . LEU A 319 ? 0.5648 0.1061 0.4884 -0.0149 0.0057  0.0044  349 LEU A C   
2336 O O   . LEU A 319 ? 0.7124 0.2464 0.6213 -0.0169 0.0070  0.0056  349 LEU A O   
2337 C CB  . LEU A 319 ? 0.5702 0.1193 0.5157 -0.0124 0.0119  -0.0004 349 LEU A CB  
2338 C CG  . LEU A 319 ? 0.5411 0.0874 0.4712 -0.0119 0.0149  0.0001  349 LEU A CG  
2339 C CD1 . LEU A 319 ? 0.5562 0.0931 0.4757 -0.0127 0.0162  0.0049  349 LEU A CD1 
2340 C CD2 . LEU A 319 ? 0.5335 0.0861 0.4716 -0.0103 0.0189  -0.0040 349 LEU A CD2 
2341 N N   . ALA A 320 ? 0.5684 0.1161 0.4969 -0.0148 0.0022  0.0017  350 ALA A N   
2342 C CA  . ALA A 320 ? 0.5731 0.1190 0.4897 -0.0174 0.0004  0.0006  350 ALA A CA  
2343 C C   . ALA A 320 ? 0.6274 0.1655 0.5333 -0.0209 -0.0015 0.0027  350 ALA A C   
2344 O O   . ALA A 320 ? 0.7744 0.3052 0.6671 -0.0254 0.0005  0.0009  350 ALA A O   
2345 C CB  . ALA A 320 ? 0.7114 0.2668 0.6372 -0.0162 -0.0034 -0.0021 350 ALA A CB  
2346 N N   . ALA A 321 ? 0.6315 0.1700 0.5443 -0.0188 -0.0038 0.0065  351 ALA A N   
2347 C CA  . ALA A 321 ? 0.6777 0.2097 0.5814 -0.0208 -0.0050 0.0100  351 ALA A CA  
2348 C C   . ALA A 321 ? 0.7165 0.2407 0.6104 -0.0228 -0.0013 0.0113  351 ALA A C   
2349 O O   . ALA A 321 ? 0.6947 0.2126 0.5760 -0.0283 -0.0009 0.0089  351 ALA A O   
2350 C CB  . ALA A 321 ? 0.5542 0.0868 0.4690 -0.0152 -0.0056 0.0167  351 ALA A CB  
2351 N N   . GLU A 322 ? 0.6884 0.2126 0.5888 -0.0192 0.0019  0.0139  352 GLU A N   
2352 C CA  . GLU A 322 ? 0.5879 0.1056 0.4800 -0.0201 0.0049  0.0158  352 GLU A CA  
2353 C C   . GLU A 322 ? 0.6518 0.1642 0.5297 -0.0252 0.0072  0.0091  352 GLU A C   
2354 O O   . GLU A 322 ? 0.6327 0.1374 0.4996 -0.0293 0.0089  0.0074  352 GLU A O   
2355 C CB  . GLU A 322 ? 0.7701 0.2894 0.6730 -0.0156 0.0081  0.0198  352 GLU A CB  
2356 C CG  . GLU A 322 ? 1.0873 0.6015 0.9886 -0.0134 0.0103  0.0272  352 GLU A CG  
2357 C CD  . GLU A 322 ? 1.1080 0.6206 1.0122 -0.0102 0.0099  0.0358  352 GLU A CD  
2358 O OE1 . GLU A 322 ? 0.9406 0.4556 0.8557 -0.0069 0.0100  0.0389  352 GLU A OE1 
2359 O OE2 . GLU A 322 ? 1.1755 0.6846 1.0713 -0.0103 0.0101  0.0403  352 GLU A OE2 
2360 N N   . LEU A 323 ? 0.6119 0.1272 0.4910 -0.0247 0.0088  0.0055  353 LEU A N   
2361 C CA  . LEU A 323 ? 0.5611 0.0685 0.4286 -0.0278 0.0141  0.0011  353 LEU A CA  
2362 C C   . LEU A 323 ? 0.6889 0.1890 0.5478 -0.0353 0.0151  -0.0039 353 LEU A C   
2363 O O   . LEU A 323 ? 0.7896 0.2782 0.6382 -0.0406 0.0210  -0.0085 353 LEU A O   
2364 C CB  . LEU A 323 ? 0.5775 0.0900 0.4502 -0.0240 0.0168  0.0006  353 LEU A CB  
2365 C CG  . LEU A 323 ? 0.6368 0.1535 0.5142 -0.0187 0.0190  0.0027  353 LEU A CG  
2366 C CD1 . LEU A 323 ? 0.5942 0.1180 0.4782 -0.0147 0.0215  0.0020  353 LEU A CD1 
2367 C CD2 . LEU A 323 ? 0.5747 0.0807 0.4393 -0.0188 0.0244  0.0033  353 LEU A CD2 
2368 N N   . SER A 324 ? 0.8112 0.3174 0.6751 -0.0367 0.0102  -0.0042 354 SER A N   
2369 C CA  . SER A 324 ? 0.8092 0.3096 0.6658 -0.0453 0.0111  -0.0099 354 SER A CA  
2370 C C   . SER A 324 ? 0.7668 0.2606 0.6155 -0.0518 0.0117  -0.0132 354 SER A C   
2371 O O   . SER A 324 ? 0.7653 0.2495 0.6053 -0.0619 0.0174  -0.0222 354 SER A O   
2372 C CB  . SER A 324 ? 0.8992 0.4090 0.7624 -0.0446 0.0042  -0.0085 354 SER A CB  
2373 O OG  . SER A 324 ? 0.9641 0.4689 0.8199 -0.0544 0.0053  -0.0150 354 SER A OG  
2374 N N   . LYS A 325 ? 0.7535 0.2522 0.6067 -0.0464 0.0073  -0.0063 355 LYS A N   
2375 C CA  . LYS A 325 ? 0.7938 0.2881 0.6416 -0.0503 0.0076  -0.0069 355 LYS A CA  
2376 C C   . LYS A 325 ? 0.7618 0.2469 0.6016 -0.0546 0.0137  -0.0131 355 LYS A C   
2377 O O   . LYS A 325 ? 0.7821 0.2617 0.6149 -0.0643 0.0164  -0.0223 355 LYS A O   
2378 C CB  . LYS A 325 ? 0.7824 0.2823 0.6395 -0.0399 0.0043  0.0060  355 LYS A CB  
2379 C CG  . LYS A 325 ? 0.9069 0.4052 0.7615 -0.0409 0.0038  0.0109  355 LYS A CG  
2380 C CD  . LYS A 325 ? 0.9468 0.4502 0.8133 -0.0274 0.0031  0.0285  355 LYS A CD  
2381 C CE  . LYS A 325 ? 1.0108 0.5199 0.8867 -0.0226 0.0006  0.0305  355 LYS A CE  
2382 N NZ  . LYS A 325 ? 1.0894 0.6017 0.9800 -0.0101 0.0032  0.0454  355 LYS A NZ  
2383 N N   . GLU A 326 ? 0.8339 0.3181 0.6752 -0.0482 0.0163  -0.0099 356 GLU A N   
2384 C CA  . GLU A 326 ? 0.7817 0.2560 0.6149 -0.0503 0.0226  -0.0142 356 GLU A CA  
2385 C C   . GLU A 326 ? 0.7964 0.2585 0.6222 -0.0589 0.0315  -0.0250 356 GLU A C   
2386 O O   . GLU A 326 ? 0.8333 0.2838 0.6522 -0.0617 0.0392  -0.0304 356 GLU A O   
2387 C CB  . GLU A 326 ? 0.7584 0.2358 0.5949 -0.0406 0.0229  -0.0068 356 GLU A CB  
2388 C CG  . GLU A 326 ? 1.0442 0.5164 0.8751 -0.0392 0.0248  -0.0059 356 GLU A CG  
2389 C CD  . GLU A 326 ? 1.2199 0.6973 1.0553 -0.0378 0.0195  -0.0002 356 GLU A CD  
2390 O OE1 . GLU A 326 ? 1.2265 0.7127 1.0723 -0.0331 0.0151  0.0077  356 GLU A OE1 
2391 O OE2 . GLU A 326 ? 1.3220 0.7938 1.1515 -0.0407 0.0208  -0.0030 356 GLU A OE2 
2392 N N   . GLY A 327 ? 0.7883 0.2520 0.6165 -0.0627 0.0317  -0.0276 357 GLY A N   
2393 C CA  . GLY A 327 ? 0.7584 0.2091 0.5822 -0.0714 0.0423  -0.0370 357 GLY A CA  
2394 C C   . GLY A 327 ? 0.7795 0.2262 0.6061 -0.0638 0.0481  -0.0311 357 GLY A C   
2395 O O   . GLY A 327 ? 0.6640 0.0954 0.4878 -0.0684 0.0603  -0.0361 357 GLY A O   
2396 N N   . HIS A 328 ? 0.8289 0.2887 0.6622 -0.0526 0.0411  -0.0211 358 HIS A N   
2397 C CA  . HIS A 328 ? 0.7961 0.2559 0.6333 -0.0452 0.0460  -0.0161 358 HIS A CA  
2398 C C   . HIS A 328 ? 0.7374 0.2093 0.5838 -0.0438 0.0399  -0.0139 358 HIS A C   
2399 O O   . HIS A 328 ? 0.8545 0.3417 0.7084 -0.0404 0.0293  -0.0108 358 HIS A O   
2400 C CB  . HIS A 328 ? 0.7115 0.1783 0.5507 -0.0351 0.0444  -0.0095 358 HIS A CB  
2401 C CG  . HIS A 328 ? 0.8178 0.2737 0.6476 -0.0353 0.0495  -0.0106 358 HIS A CG  
2402 N ND1 . HIS A 328 ? 0.9497 0.4135 0.7802 -0.0318 0.0429  -0.0074 358 HIS A ND1 
2403 C CD2 . HIS A 328 ? 0.8352 0.2719 0.6556 -0.0385 0.0613  -0.0150 358 HIS A CD2 
2404 C CE1 . HIS A 328 ? 0.8781 0.3299 0.6989 -0.0325 0.0488  -0.0093 358 HIS A CE1 
2405 N NE2 . HIS A 328 ? 0.8343 0.2693 0.6489 -0.0365 0.0602  -0.0143 358 HIS A NE2 
2406 N N   . GLN A 329 ? 0.6177 0.0811 0.4645 -0.0464 0.0479  -0.0155 359 GLN A N   
2407 C CA  . GLN A 329 ? 0.7194 0.1940 0.5749 -0.0446 0.0425  -0.0131 359 GLN A CA  
2408 C C   . GLN A 329 ? 0.8201 0.3072 0.6849 -0.0329 0.0407  -0.0060 359 GLN A C   
2409 O O   . GLN A 329 ? 0.8610 0.3407 0.7246 -0.0271 0.0508  -0.0025 359 GLN A O   
2410 C CB  . GLN A 329 ? 0.8024 0.2629 0.6565 -0.0515 0.0529  -0.0166 359 GLN A CB  
2411 C CG  . GLN A 329 ? 1.0424 0.5146 0.9055 -0.0497 0.0472  -0.0137 359 GLN A CG  
2412 C CD  . GLN A 329 ? 1.2126 0.6690 1.0766 -0.0544 0.0604  -0.0146 359 GLN A CD  
2413 O OE1 . GLN A 329 ? 1.1618 0.6216 1.0285 -0.0604 0.0569  -0.0169 359 GLN A OE1 
2414 N NE2 . GLN A 329 ? 1.2590 0.6967 1.1210 -0.0513 0.0769  -0.0122 359 GLN A NE2 
2415 N N   . VAL A 330 ? 0.6235 0.1289 0.4980 -0.0296 0.0290  -0.0046 360 VAL A N   
2416 C CA  . VAL A 330 ? 0.6589 0.1780 0.5448 -0.0207 0.0271  -0.0009 360 VAL A CA  
2417 C C   . VAL A 330 ? 0.7127 0.2458 0.6098 -0.0198 0.0187  -0.0012 360 VAL A C   
2418 O O   . VAL A 330 ? 0.7135 0.2487 0.6098 -0.0249 0.0114  -0.0035 360 VAL A O   
2419 C CB  . VAL A 330 ? 0.5049 0.0324 0.3949 -0.0171 0.0226  -0.0005 360 VAL A CB  
2420 C CG1 . VAL A 330 ? 0.6269 0.1422 0.5060 -0.0164 0.0305  0.0005  360 VAL A CG1 
2421 C CG2 . VAL A 330 ? 0.5079 0.0406 0.4009 -0.0206 0.0132  -0.0022 360 VAL A CG2 
2422 N N   . ALA A 331 ? 0.6629 0.2058 0.5703 -0.0128 0.0200  0.0013  361 ALA A N   
2423 C CA  . ALA A 331 ? 0.5853 0.1435 0.5053 -0.0110 0.0113  0.0002  361 ALA A CA  
2424 C C   . ALA A 331 ? 0.4981 0.0709 0.4310 -0.0073 0.0047  -0.0027 361 ALA A C   
2425 O O   . ALA A 331 ? 0.6387 0.2141 0.5752 -0.0031 0.0090  -0.0028 361 ALA A O   
2426 C CB  . ALA A 331 ? 0.6020 0.1626 0.5278 -0.0055 0.0171  0.0044  361 ALA A CB  
2427 N N   . LEU A 332 ? 0.5425 0.1231 0.4825 -0.0092 -0.0046 -0.0056 362 LEU A N   
2428 C CA  . LEU A 332 ? 0.5792 0.1705 0.5344 -0.0068 -0.0090 -0.0098 362 LEU A CA  
2429 C C   . LEU A 332 ? 0.5031 0.1097 0.4744 -0.0020 -0.0119 -0.0133 362 LEU A C   
2430 O O   . LEU A 332 ? 0.5618 0.1719 0.5328 -0.0011 -0.0148 -0.0117 362 LEU A O   
2431 C CB  . LEU A 332 ? 0.5555 0.1443 0.5110 -0.0098 -0.0150 -0.0103 362 LEU A CB  
2432 C CG  . LEU A 332 ? 0.6657 0.2589 0.6372 -0.0080 -0.0159 -0.0140 362 LEU A CG  
2433 C CD1 . LEU A 332 ? 0.6351 0.2277 0.6109 -0.0073 -0.0093 -0.0159 362 LEU A CD1 
2434 C CD2 . LEU A 332 ? 0.7775 0.3619 0.7450 -0.0096 -0.0175 -0.0106 362 LEU A CD2 
2435 N N   . LEU A 333 ? 0.6716 0.2871 0.6577 0.0008  -0.0107 -0.0192 363 LEU A N   
2436 C CA  . LEU A 333 ? 0.5624 0.1940 0.5661 0.0056  -0.0130 -0.0256 363 LEU A CA  
2437 C C   . LEU A 333 ? 0.6394 0.2779 0.6621 0.0040  -0.0148 -0.0363 363 LEU A C   
2438 O O   . LEU A 333 ? 0.7326 0.3742 0.7642 0.0041  -0.0094 -0.0430 363 LEU A O   
2439 C CB  . LEU A 333 ? 0.6027 0.2384 0.6068 0.0119  -0.0053 -0.0244 363 LEU A CB  
2440 C CG  . LEU A 333 ? 0.6737 0.3258 0.6916 0.0206  -0.0056 -0.0277 363 LEU A CG  
2441 C CD1 . LEU A 333 ? 0.7017 0.3538 0.7153 0.0222  -0.0096 -0.0203 363 LEU A CD1 
2442 C CD2 . LEU A 333 ? 0.5710 0.2245 0.5865 0.0300  0.0047  -0.0238 363 LEU A CD2 
2443 N N   . SER A 334 ? 0.5224 0.1615 0.5513 0.0024  -0.0208 -0.0385 364 SER A N   
2444 C CA  . SER A 334 ? 0.5873 0.2291 0.6362 0.0009  -0.0197 -0.0489 364 SER A CA  
2445 C C   . SER A 334 ? 0.6588 0.3130 0.7240 0.0034  -0.0259 -0.0575 364 SER A C   
2446 O O   . SER A 334 ? 0.6143 0.2739 0.6727 0.0061  -0.0328 -0.0531 364 SER A O   
2447 C CB  . SER A 334 ? 0.5890 0.2142 0.6326 -0.0024 -0.0169 -0.0433 364 SER A CB  
2448 O OG  . SER A 334 ? 0.7818 0.4008 0.8131 -0.0019 -0.0227 -0.0353 364 SER A OG  
2449 N N   . GLY A 335 ? 0.6198 0.2777 0.7073 0.0019  -0.0224 -0.0709 365 GLY A N   
2450 C CA  . GLY A 335 ? 0.6974 0.3704 0.8049 0.0042  -0.0265 -0.0847 365 GLY A CA  
2451 C C   . GLY A 335 ? 0.7414 0.4114 0.8453 0.0069  -0.0343 -0.0795 365 GLY A C   
2452 O O   . GLY A 335 ? 0.8748 0.5596 0.9924 0.0101  -0.0395 -0.0901 365 GLY A O   
2453 N N   . GLU A 336 ? 0.7018 0.3545 0.7873 0.0061  -0.0352 -0.0648 366 GLU A N   
2454 C CA  . GLU A 336 ? 0.5825 0.2322 0.6617 0.0090  -0.0424 -0.0595 366 GLU A CA  
2455 C C   . GLU A 336 ? 0.5629 0.2234 0.6286 0.0109  -0.0519 -0.0541 366 GLU A C   
2456 O O   . GLU A 336 ? 0.6439 0.3068 0.7056 0.0135  -0.0595 -0.0520 366 GLU A O   
2457 C CB  . GLU A 336 ? 0.6803 0.3097 0.7442 0.0083  -0.0394 -0.0470 366 GLU A CB  
2458 C CG  . GLU A 336 ? 0.7965 0.4200 0.8353 0.0053  -0.0406 -0.0352 366 GLU A CG  
2459 C CD  . GLU A 336 ? 0.9322 0.5479 0.9693 0.0022  -0.0320 -0.0338 366 GLU A CD  
2460 O OE1 . GLU A 336 ? 0.9210 0.5371 0.9766 0.0016  -0.0253 -0.0420 366 GLU A OE1 
2461 O OE2 . GLU A 336 ? 0.9907 0.5996 1.0085 -0.0002 -0.0315 -0.0256 366 GLU A OE2 
2462 N N   . MET A 337 ? 0.4364 0.1016 0.4951 0.0100  -0.0502 -0.0513 367 MET A N   
2463 C CA  . MET A 337 ? 0.5617 0.2345 0.6109 0.0120  -0.0558 -0.0459 367 MET A CA  
2464 C C   . MET A 337 ? 0.5683 0.2621 0.6371 0.0181  -0.0598 -0.0572 367 MET A C   
2465 O O   . MET A 337 ? 0.5127 0.2168 0.5990 0.0198  -0.0554 -0.0697 367 MET A O   
2466 C CB  . MET A 337 ? 0.5223 0.1886 0.5576 0.0102  -0.0493 -0.0378 367 MET A CB  
2467 C CG  . MET A 337 ? 0.6297 0.2775 0.6446 0.0045  -0.0457 -0.0288 367 MET A CG  
2468 S SD  . MET A 337 ? 0.7095 0.3486 0.7130 0.0030  -0.0354 -0.0235 367 MET A SD  
2469 C CE  . MET A 337 ? 0.4221 0.0662 0.4224 0.0066  -0.0342 -0.0181 367 MET A CE  
2470 N N   . MET A 338 ? 0.6231 0.3248 0.6897 0.0215  -0.0681 -0.0548 368 MET A N   
2471 C CA  . MET A 338 ? 0.5665 0.2905 0.6505 0.0296  -0.0721 -0.0650 368 MET A CA  
2472 C C   . MET A 338 ? 0.5848 0.3145 0.6691 0.0346  -0.0648 -0.0617 368 MET A C   
2473 O O   . MET A 338 ? 0.5816 0.2953 0.6488 0.0310  -0.0588 -0.0478 368 MET A O   
2474 C CB  . MET A 338 ? 0.4872 0.2166 0.5654 0.0332  -0.0819 -0.0592 368 MET A CB  
2475 C CG  . MET A 338 ? 0.4144 0.1367 0.4870 0.0303  -0.0890 -0.0588 368 MET A CG  
2476 S SD  . MET A 338 ? 1.1756 0.9135 1.2733 0.0361  -0.0934 -0.0794 368 MET A SD  
2477 C CE  . MET A 338 ? 0.4817 0.2045 0.5876 0.0299  -0.0816 -0.0848 368 MET A CE  
2478 N N   . VAL A 339 ? 0.3930 0.1710 0.4976 0.0420  -0.0644 -0.0713 369 VAL A N   
2479 C CA  . VAL A 339 ? 0.3370 0.1406 0.4434 0.0493  -0.0562 -0.0648 369 VAL A CA  
2480 C C   . VAL A 339 ? 0.4696 0.2620 0.5592 0.0530  -0.0534 -0.0427 369 VAL A C   
2481 O O   . VAL A 339 ? 0.5946 0.3751 0.6747 0.0555  -0.0430 -0.0319 369 VAL A O   
2482 C CB  . VAL A 339 ? 0.3448 0.2157 0.4763 0.0587  -0.0573 -0.0774 369 VAL A CB  
2483 C CG1 . VAL A 339 ? 0.4091 0.3100 0.5417 0.0682  -0.0468 -0.0692 369 VAL A CG1 
2484 C CG2 . VAL A 339 ? 0.2691 0.1504 0.4199 0.0527  -0.0580 -0.1028 369 VAL A CG2 
2485 N N   . GLU A 340 ? 0.5342 0.3295 0.6205 0.0531  -0.0614 -0.0364 370 GLU A N   
2486 C CA  . GLU A 340 ? 0.5840 0.3700 0.6577 0.0552  -0.0571 -0.0170 370 GLU A CA  
2487 C C   . GLU A 340 ? 0.6089 0.3377 0.6600 0.0446  -0.0501 -0.0092 370 GLU A C   
2488 O O   . GLU A 340 ? 0.5880 0.3020 0.6295 0.0458  -0.0399 0.0048  370 GLU A O   
2489 C CB  . GLU A 340 ? 0.6562 0.4583 0.7314 0.0555  -0.0677 -0.0138 370 GLU A CB  
2490 C CG  . GLU A 340 ? 0.8724 0.7322 0.9704 0.0650  -0.0768 -0.0243 370 GLU A CG  
2491 C CD  . GLU A 340 ? 1.0465 0.9053 1.1536 0.0601  -0.0849 -0.0451 370 GLU A CD  
2492 O OE1 . GLU A 340 ? 1.1036 0.9686 1.2217 0.0600  -0.0799 -0.0582 370 GLU A OE1 
2493 O OE2 . GLU A 340 ? 1.0070 0.8599 1.1112 0.0567  -0.0949 -0.0482 370 GLU A OE2 
2494 N N   . GLN A 341 ? 0.6386 0.3408 0.6824 0.0345  -0.0545 -0.0181 371 GLN A N   
2495 C CA  . GLN A 341 ? 0.5063 0.1862 0.5300 0.0230  -0.0488 -0.0124 371 GLN A CA  
2496 C C   . GLN A 341 ? 0.4596 0.1326 0.4810 0.0247  -0.0373 -0.0105 371 GLN A C   
2497 O O   . GLN A 341 ? 0.4672 0.1242 0.4744 0.0212  -0.0280 -0.0018 371 GLN A O   
2498 C CB  . GLN A 341 ? 0.5145 0.1891 0.5331 0.0153  -0.0560 -0.0190 371 GLN A CB  
2499 C CG  . GLN A 341 ? 0.4647 0.1400 0.4776 0.0125  -0.0656 -0.0177 371 GLN A CG  
2500 C CD  . GLN A 341 ? 0.4833 0.1537 0.4922 0.0089  -0.0710 -0.0219 371 GLN A CD  
2501 O OE1 . GLN A 341 ? 0.3692 0.0457 0.3920 0.0124  -0.0724 -0.0300 371 GLN A OE1 
2502 N NE2 . GLN A 341 ? 0.5509 0.2091 0.5419 0.0024  -0.0724 -0.0167 371 GLN A NE2 
2503 N N   . ARG A 342 ? 0.3498 0.0346 0.3856 0.0299  -0.0371 -0.0203 372 ARG A N   
2504 C CA  . ARG A 342 ? 0.3545 0.0352 0.3887 0.0331  -0.0265 -0.0190 372 ARG A CA  
2505 C C   . ARG A 342 ? 0.3981 0.0805 0.4313 0.0452  -0.0166 -0.0058 372 ARG A C   
2506 O O   . ARG A 342 ? 0.5342 0.2049 0.5574 0.0467  -0.0054 0.0022  372 ARG A O   
2507 C CB  . ARG A 342 ? 0.3421 0.0382 0.3948 0.0369  -0.0276 -0.0350 372 ARG A CB  
2508 C CG  . ARG A 342 ? 0.5503 0.2453 0.6089 0.0273  -0.0343 -0.0464 372 ARG A CG  
2509 C CD  . ARG A 342 ? 0.5504 0.2622 0.6312 0.0300  -0.0328 -0.0661 372 ARG A CD  
2510 N NE  . ARG A 342 ? 0.5589 0.2746 0.6530 0.0244  -0.0387 -0.0783 372 ARG A NE  
2511 C CZ  . ARG A 342 ? 0.7082 0.4401 0.8248 0.0242  -0.0370 -0.1000 372 ARG A CZ  
2512 N NH1 . ARG A 342 ? 0.6590 0.4254 0.7868 0.0281  -0.0311 -0.1098 372 ARG A NH1 
2513 N NH2 . ARG A 342 ? 0.7846 0.5164 0.9139 0.0196  -0.0400 -0.1092 372 ARG A NH2 
2514 N N   . ALA A 343 ? 0.4193 0.1302 0.4634 0.0540  -0.0198 -0.0016 373 ALA A N   
2515 C CA  . ALA A 343 ? 0.3442 0.0761 0.3899 0.0668  -0.0086 0.0151  373 ALA A CA  
2516 C C   . ALA A 343 ? 0.3668 0.0524 0.3945 0.0612  0.0004  0.0296  373 ALA A C   
2517 O O   . ALA A 343 ? 0.4466 0.1226 0.4686 0.0683  0.0156  0.0429  373 ALA A O   
2518 C CB  . ALA A 343 ? 0.6630 0.4473 0.7261 0.0768  -0.0147 0.0167  373 ALA A CB  
2519 N N   . ALA A 344 ? 0.3728 0.0395 0.3920 0.0472  -0.0077 0.0257  374 ALA A N   
2520 C CA  . ALA A 344 ? 0.5504 0.1928 0.5538 0.0365  0.0008  0.0330  374 ALA A CA  
2521 C C   . ALA A 344 ? 0.6093 0.2308 0.5978 0.0291  0.0103  0.0307  374 ALA A C   
2522 O O   . ALA A 344 ? 0.5820 0.1850 0.5625 0.0290  0.0255  0.0395  374 ALA A O   
2523 C CB  . ALA A 344 ? 0.3953 0.0347 0.3930 0.0239  -0.0112 0.0265  374 ALA A CB  
2524 N N   . VAL A 345 ? 0.5366 0.1606 0.5226 0.0237  0.0025  0.0195  375 VAL A N   
2525 C CA  . VAL A 345 ? 0.5824 0.1910 0.5560 0.0191  0.0100  0.0179  375 VAL A CA  
2526 C C   . VAL A 345 ? 0.6731 0.2799 0.6484 0.0310  0.0242  0.0267  375 VAL A C   
2527 O O   . VAL A 345 ? 0.6639 0.2513 0.6280 0.0305  0.0379  0.0333  375 VAL A O   
2528 C CB  . VAL A 345 ? 0.5682 0.1837 0.5434 0.0147  0.0002  0.0071  375 VAL A CB  
2529 C CG1 . VAL A 345 ? 0.5323 0.1358 0.4975 0.0136  0.0085  0.0074  375 VAL A CG1 
2530 C CG2 . VAL A 345 ? 0.5414 0.1547 0.5110 0.0051  -0.0104 0.0018  375 VAL A CG2 
2531 N N   . ILE A 346 ? 0.5499 0.1772 0.5396 0.0432  0.0219  0.0265  376 ILE A N   
2532 C CA  . ILE A 346 ? 0.5127 0.1437 0.5046 0.0588  0.0352  0.0366  376 ILE A CA  
2533 C C   . ILE A 346 ? 0.5232 0.1441 0.5115 0.0681  0.0515  0.0552  376 ILE A C   
2534 O O   . ILE A 346 ? 0.6569 0.2656 0.6370 0.0751  0.0671  0.0651  376 ILE A O   
2535 C CB  . ILE A 346 ? 0.5175 0.1837 0.5287 0.0740  0.0301  0.0325  376 ILE A CB  
2536 C CG1 . ILE A 346 ? 0.3785 0.0473 0.3936 0.0657  0.0211  0.0137  376 ILE A CG1 
2537 C CG2 . ILE A 346 ? 0.4342 0.1324 0.4481 0.0928  0.0454  0.0466  376 ILE A CG2 
2538 C CD1 . ILE A 346 ? 0.5992 0.3265 0.6356 0.0722  0.0155  0.0011  376 ILE A CD1 
2539 N N   . GLU A 347 ? 0.5921 0.2169 0.5868 0.0685  0.0493  0.0609  377 GLU A N   
2540 C CA  . GLU A 347 ? 0.6378 0.2513 0.6316 0.0766  0.0671  0.0797  377 GLU A CA  
2541 C C   . GLU A 347 ? 0.6729 0.2501 0.6505 0.0617  0.0789  0.0776  377 GLU A C   
2542 O O   . GLU A 347 ? 0.6728 0.2332 0.6472 0.0696  0.0995  0.0912  377 GLU A O   
2543 C CB  . GLU A 347 ? 0.5736 0.2031 0.5803 0.0822  0.0623  0.0879  377 GLU A CB  
2544 C CG  . GLU A 347 ? 0.9479 0.6302 0.9711 0.1067  0.0696  0.1035  377 GLU A CG  
2545 C CD  . GLU A 347 ? 1.2373 0.9682 1.2772 0.1104  0.0555  0.1006  377 GLU A CD  
2546 O OE1 . GLU A 347 ? 1.3021 1.0443 1.3452 0.1004  0.0362  0.0813  377 GLU A OE1 
2547 O OE2 . GLU A 347 ? 1.2708 1.0296 1.3215 0.1244  0.0648  0.1184  377 GLU A OE2 
2548 N N   . ARG A 348 ? 0.6330 0.1998 0.6012 0.0425  0.0670  0.0611  378 ARG A N   
2549 C CA  . ARG A 348 ? 0.7256 0.2623 0.6788 0.0298  0.0769  0.0566  378 ARG A CA  
2550 C C   . ARG A 348 ? 0.7442 0.2708 0.6887 0.0348  0.0871  0.0578  378 ARG A C   
2551 O O   . ARG A 348 ? 0.8380 0.3389 0.7742 0.0340  0.1047  0.0620  378 ARG A O   
2552 C CB  . ARG A 348 ? 0.8236 0.3585 0.7686 0.0120  0.0612  0.0409  378 ARG A CB  
2553 C CG  . ARG A 348 ? 0.9736 0.5089 0.9220 0.0044  0.0559  0.0401  378 ARG A CG  
2554 C CD  . ARG A 348 ? 1.0649 0.5986 1.0030 -0.0111 0.0426  0.0268  378 ARG A CD  
2555 N NE  . ARG A 348 ? 1.2488 0.7574 1.1731 -0.0224 0.0531  0.0211  378 ARG A NE  
2556 C CZ  . ARG A 348 ? 1.3592 0.8643 1.2736 -0.0265 0.0500  0.0140  378 ARG A CZ  
2557 N NH1 . ARG A 348 ? 1.2822 0.8058 1.1994 -0.0207 0.0376  0.0123  378 ARG A NH1 
2558 N NH2 . ARG A 348 ? 1.3906 0.8735 1.2937 -0.0368 0.0601  0.0083  378 ARG A NH2 
2559 N N   . PHE A 349 ? 0.6878 0.2334 0.6348 0.0399  0.0770  0.0535  379 PHE A N   
2560 C CA  . PHE A 349 ? 0.7397 0.2789 0.6784 0.0454  0.0850  0.0549  379 PHE A CA  
2561 C C   . PHE A 349 ? 0.8372 0.3716 0.7777 0.0642  0.1061  0.0735  379 PHE A C   
2562 O O   . PHE A 349 ? 0.9351 0.4510 0.8648 0.0675  0.1203  0.0779  379 PHE A O   
2563 C CB  . PHE A 349 ? 0.6368 0.1983 0.5808 0.0468  0.0705  0.0463  379 PHE A CB  
2564 C CG  . PHE A 349 ? 0.6875 0.2461 0.6243 0.0539  0.0781  0.0486  379 PHE A CG  
2565 C CD1 . PHE A 349 ? 0.6591 0.2020 0.5821 0.0438  0.0778  0.0417  379 PHE A CD1 
2566 C CD2 . PHE A 349 ? 0.6395 0.2140 0.5833 0.0725  0.0850  0.0584  379 PHE A CD2 
2567 C CE1 . PHE A 349 ? 0.5487 0.0893 0.4646 0.0503  0.0841  0.0440  379 PHE A CE1 
2568 C CE2 . PHE A 349 ? 0.6352 0.2083 0.5713 0.0799  0.0918  0.0608  379 PHE A CE2 
2569 C CZ  . PHE A 349 ? 0.5611 0.1159 0.4828 0.0678  0.0911  0.0533  379 PHE A CZ  
2570 N N   . ARG A 350 ? 0.7141 0.2669 0.6683 0.0786  0.1088  0.0862  380 ARG A N   
2571 C CA  . ARG A 350 ? 0.7421 0.2965 0.6995 0.1013  0.1303  0.1090  380 ARG A CA  
2572 C C   . ARG A 350 ? 0.7927 0.3129 0.7447 0.0987  0.1521  0.1184  380 ARG A C   
2573 O O   . ARG A 350 ? 0.9818 0.4871 0.9281 0.1114  0.1734  0.1321  380 ARG A O   
2574 C CB  . ARG A 350 ? 0.7984 0.3891 0.7737 0.1210  0.1270  0.1227  380 ARG A CB  
2575 C CG  . ARG A 350 ? 0.8351 0.4695 0.8183 0.1308  0.1137  0.1152  380 ARG A CG  
2576 C CD  . ARG A 350 ? 0.9282 0.6280 0.9311 0.1456  0.1103  0.1210  380 ARG A CD  
2577 N NE  . ARG A 350 ? 0.9959 0.7496 1.0089 0.1479  0.0970  0.1048  380 ARG A NE  
2578 C CZ  . ARG A 350 ? 0.8823 0.7049 0.9139 0.1607  0.0929  0.1047  380 ARG A CZ  
2579 N NH1 . ARG A 350 ? 0.7402 0.5868 0.7819 0.1743  0.1006  0.1227  380 ARG A NH1 
2580 N NH2 . ARG A 350 ? 0.7902 0.6596 0.8317 0.1597  0.0822  0.0858  380 ARG A NH2 
2581 N N   . GLU A 351 ? 0.8881 0.3951 0.8423 0.0827  0.1480  0.1108  381 GLU A N   
2582 C CA  . GLU A 351 ? 0.9456 0.4176 0.8973 0.0777  0.1695  0.1167  381 GLU A CA  
2583 C C   . GLU A 351 ? 0.9820 0.4221 0.9177 0.0639  0.1764  0.1035  381 GLU A C   
2584 O O   . GLU A 351 ? 1.0643 0.4708 0.9973 0.0587  0.1965  0.1054  381 GLU A O   
2585 C CB  . GLU A 351 ? 1.0380 0.5074 0.9966 0.0637  0.1619  0.1109  381 GLU A CB  
2586 C CG  . GLU A 351 ? 1.1660 0.6688 1.1405 0.0761  0.1524  0.1226  381 GLU A CG  
2587 C CD  . GLU A 351 ? 1.4011 0.9081 1.3788 0.0591  0.1352  0.1106  381 GLU A CD  
2588 O OE1 . GLU A 351 ? 1.4162 0.9546 1.4043 0.0652  0.1188  0.1125  381 GLU A OE1 
2589 O OE2 . GLU A 351 ? 1.4908 0.9710 1.4604 0.0401  0.1384  0.0990  381 GLU A OE2 
2590 N N   . GLY A 352 ? 1.0118 0.4622 0.9380 0.0581  0.1605  0.0903  382 GLY A N   
2591 C CA  . GLY A 352 ? 0.8793 0.3055 0.7906 0.0466  0.1645  0.0787  382 GLY A CA  
2592 C C   . GLY A 352 ? 0.8513 0.2679 0.7574 0.0238  0.1530  0.0605  382 GLY A C   
2593 O O   . GLY A 352 ? 0.8135 0.2118 0.7082 0.0130  0.1557  0.0500  382 GLY A O   
2594 N N   . LYS A 353 ? 0.7851 0.2158 0.6995 0.0173  0.1406  0.0574  383 LYS A N   
2595 C CA  . LYS A 353 ? 0.8273 0.2545 0.7362 -0.0024 0.1283  0.0415  383 LYS A CA  
2596 C C   . LYS A 353 ? 0.8611 0.3044 0.7618 -0.0078 0.1089  0.0303  383 LYS A C   
2597 O O   . LYS A 353 ? 0.8880 0.3249 0.7801 -0.0219 0.1028  0.0185  383 LYS A O   
2598 C CB  . LYS A 353 ? 0.9937 0.4355 0.9127 -0.0058 0.1182  0.0423  383 LYS A CB  
2599 C CG  . LYS A 353 ? 1.2126 0.6321 1.1382 -0.0075 0.1379  0.0499  383 LYS A CG  
2600 C CD  . LYS A 353 ? 1.3026 0.7364 1.2356 -0.0143 0.1253  0.0483  383 LYS A CD  
2601 C CE  . LYS A 353 ? 1.3477 0.7549 1.2854 -0.0226 0.1448  0.0515  383 LYS A CE  
2602 N NZ  . LYS A 353 ? 1.3581 0.7794 1.3008 -0.0314 0.1312  0.0487  383 LYS A NZ  
2603 N N   . GLU A 354 ? 0.8258 0.2903 0.7301 0.0036  0.1005  0.0346  384 GLU A N   
2604 C CA  . GLU A 354 ? 0.7599 0.2368 0.6585 0.0004  0.0861  0.0265  384 GLU A CA  
2605 C C   . GLU A 354 ? 0.8975 0.3703 0.7910 0.0105  0.0952  0.0317  384 GLU A C   
2606 O O   . GLU A 354 ? 1.0651 0.5428 0.9645 0.0246  0.1042  0.0426  384 GLU A O   
2607 C CB  . GLU A 354 ? 0.6607 0.1664 0.5694 0.0019  0.0666  0.0236  384 GLU A CB  
2608 C CG  . GLU A 354 ? 0.8893 0.3998 0.7970 -0.0100 0.0533  0.0154  384 GLU A CG  
2609 C CD  . GLU A 354 ? 1.1363 0.6412 1.0329 -0.0192 0.0476  0.0074  384 GLU A CD  
2610 O OE1 . GLU A 354 ? 1.2765 0.7745 1.1667 -0.0171 0.0527  0.0076  384 GLU A OE1 
2611 O OE2 . GLU A 354 ? 1.1673 0.6752 1.0614 -0.0278 0.0382  0.0019  384 GLU A OE2 
2612 N N   . LYS A 355 ? 0.8416 0.3066 0.7242 0.0045  0.0932  0.0252  385 LYS A N   
2613 C CA  . LYS A 355 ? 0.8799 0.3383 0.7554 0.0132  0.1025  0.0299  385 LYS A CA  
2614 C C   . LYS A 355 ? 0.7594 0.2409 0.6382 0.0175  0.0892  0.0283  385 LYS A C   
2615 O O   . LYS A 355 ? 0.6499 0.1345 0.5273 0.0286  0.0956  0.0346  385 LYS A O   
2616 C CB  . LYS A 355 ? 0.9585 0.3931 0.8204 0.0050  0.1100  0.0241  385 LYS A CB  
2617 C CG  . LYS A 355 ? 1.0522 0.4572 0.9113 0.0016  0.1298  0.0252  385 LYS A CG  
2618 C CD  . LYS A 355 ? 1.3107 0.6925 1.1572 -0.0055 0.1383  0.0183  385 LYS A CD  
2619 C CE  . LYS A 355 ? 1.4326 0.7806 1.2781 -0.0110 0.1608  0.0167  385 LYS A CE  
2620 N NZ  . LYS A 355 ? 1.4653 0.7902 1.2998 -0.0174 0.1706  0.0088  385 LYS A NZ  
2621 N N   . VAL A 356 ? 0.6807 0.1770 0.5640 0.0092  0.0721  0.0202  386 VAL A N   
2622 C CA  . VAL A 356 ? 0.5181 0.0320 0.4062 0.0109  0.0615  0.0172  386 VAL A CA  
2623 C C   . VAL A 356 ? 0.6500 0.1839 0.5523 0.0083  0.0476  0.0127  386 VAL A C   
2624 O O   . VAL A 356 ? 0.6555 0.1894 0.5588 0.0012  0.0408  0.0094  386 VAL A O   
2625 C CB  . VAL A 356 ? 0.5393 0.0463 0.4174 0.0042  0.0576  0.0125  386 VAL A CB  
2626 C CG1 . VAL A 356 ? 0.5079 0.0313 0.3937 0.0049  0.0479  0.0096  386 VAL A CG1 
2627 C CG2 . VAL A 356 ? 0.5613 0.0494 0.4260 0.0078  0.0711  0.0162  386 VAL A CG2 
2628 N N   . LEU A 357 ? 0.6438 0.1939 0.5570 0.0143  0.0442  0.0119  387 LEU A N   
2629 C CA  . LEU A 357 ? 0.5034 0.0716 0.4327 0.0131  0.0332  0.0065  387 LEU A CA  
2630 C C   . LEU A 357 ? 0.5142 0.0900 0.4500 0.0097  0.0266  -0.0001 387 LEU A C   
2631 O O   . LEU A 357 ? 0.7615 0.3400 0.6987 0.0136  0.0307  -0.0009 387 LEU A O   
2632 C CB  . LEU A 357 ? 0.5253 0.1062 0.4662 0.0238  0.0370  0.0096  387 LEU A CB  
2633 C CG  . LEU A 357 ? 0.7082 0.3012 0.6618 0.0242  0.0299  0.0080  387 LEU A CG  
2634 C CD1 . LEU A 357 ? 0.7828 0.3632 0.7272 0.0172  0.0293  0.0108  387 LEU A CD1 
2635 C CD2 . LEU A 357 ? 0.7779 0.3818 0.7408 0.0383  0.0368  0.0145  387 LEU A CD2 
2636 N N   . VAL A 358 ? 0.4533 0.0311 0.3931 0.0030  0.0177  -0.0042 388 VAL A N   
2637 C CA  . VAL A 358 ? 0.5795 0.1627 0.5294 0.0004  0.0138  -0.0095 388 VAL A CA  
2638 C C   . VAL A 358 ? 0.5700 0.1682 0.5403 0.0014  0.0087  -0.0166 388 VAL A C   
2639 O O   . VAL A 358 ? 0.4888 0.0912 0.4632 0.0008  0.0030  -0.0170 388 VAL A O   
2640 C CB  . VAL A 358 ? 0.4568 0.0313 0.4006 -0.0053 0.0097  -0.0083 388 VAL A CB  
2641 C CG1 . VAL A 358 ? 0.4541 0.0315 0.4106 -0.0067 0.0089  -0.0121 388 VAL A CG1 
2642 C CG2 . VAL A 358 ? 0.4709 0.0312 0.3958 -0.0068 0.0144  -0.0038 388 VAL A CG2 
2643 N N   . THR A 359 ? 0.4264 0.0325 0.4100 0.0025  0.0113  -0.0236 389 THR A N   
2644 C CA  . THR A 359 ? 0.4805 0.1015 0.4854 0.0035  0.0083  -0.0338 389 THR A CA  
2645 C C   . THR A 359 ? 0.4121 0.0360 0.4340 -0.0010 0.0108  -0.0449 389 THR A C   
2646 O O   . THR A 359 ? 0.6440 0.2611 0.6613 -0.0031 0.0158  -0.0442 389 THR A O   
2647 C CB  . THR A 359 ? 0.4932 0.1258 0.5018 0.0118  0.0115  -0.0356 389 THR A CB  
2648 O OG1 . THR A 359 ? 0.7451 0.3944 0.7745 0.0133  0.0071  -0.0474 389 THR A OG1 
2649 C CG2 . THR A 359 ? 0.4019 0.0358 0.4093 0.0156  0.0197  -0.0387 389 THR A CG2 
2650 N N   . THR A 360 ? 0.6893 0.3224 0.7318 -0.0030 0.0081  -0.0557 390 THR A N   
2651 C CA  . THR A 360 ? 0.5631 0.2001 0.6270 -0.0082 0.0134  -0.0706 390 THR A CA  
2652 C C   . THR A 360 ? 0.5185 0.1732 0.5925 -0.0060 0.0172  -0.0855 390 THR A C   
2653 O O   . THR A 360 ? 0.6230 0.2867 0.6899 0.0019  0.0153  -0.0828 390 THR A O   
2654 C CB  . THR A 360 ? 0.6178 0.2575 0.7020 -0.0110 0.0112  -0.0794 390 THR A CB  
2655 O OG1 . THR A 360 ? 0.7600 0.4184 0.8546 -0.0072 0.0064  -0.0893 390 THR A OG1 
2656 C CG2 . THR A 360 ? 0.6218 0.2469 0.6937 -0.0101 0.0065  -0.0647 390 THR A CG2 
2657 N N   . ASN A 361 ? 0.5850 0.2453 0.6760 -0.0125 0.0242  -0.1026 391 ASN A N   
2658 C CA  . ASN A 361 ? 0.5963 0.2792 0.6973 -0.0111 0.0287  -0.1234 391 ASN A CA  
2659 C C   . ASN A 361 ? 0.6919 0.4019 0.8089 -0.0070 0.0246  -0.1392 391 ASN A C   
2660 O O   . ASN A 361 ? 0.7696 0.5218 0.8835 0.0034  0.0239  -0.1355 391 ASN A O   
2661 C CB  . ASN A 361 ? 0.7081 0.3950 0.8262 -0.0225 0.0377  -0.1433 391 ASN A CB  
2662 C CG  . ASN A 361 ? 0.8648 0.5300 0.9674 -0.0252 0.0418  -0.1283 391 ASN A CG  
2663 O OD1 . ASN A 361 ? 0.9468 0.6014 1.0246 -0.0175 0.0391  -0.1088 391 ASN A OD1 
2664 N ND2 . ASN A 361 ? 1.0374 0.6958 1.1553 -0.0360 0.0495  -0.1379 391 ASN A ND2 
2665 N N   . VAL A 362 ? 0.6805 0.3893 0.8169 -0.0137 0.0227  -0.1489 392 VAL A N   
2666 C CA  . VAL A 362 ? 0.6542 0.3952 0.8089 -0.0110 0.0187  -0.1659 392 VAL A CA  
2667 C C   . VAL A 362 ? 0.7247 0.4761 0.8653 0.0016  0.0096  -0.1481 392 VAL A C   
2668 O O   . VAL A 362 ? 0.8513 0.6563 1.0017 0.0092  0.0079  -0.1540 392 VAL A O   
2669 C CB  . VAL A 362 ? 0.6989 0.4286 0.8756 -0.0194 0.0195  -0.1769 392 VAL A CB  
2670 C CG1 . VAL A 362 ? 0.8396 0.5357 1.0022 -0.0186 0.0168  -0.1491 392 VAL A CG1 
2671 C CG2 . VAL A 362 ? 0.8087 0.5678 1.0008 -0.0153 0.0132  -0.1927 392 VAL A CG2 
2672 N N   . CYS A 363 ? 0.6653 0.3775 0.7849 0.0036  0.0047  -0.1244 393 CYS A N   
2673 C CA  . CYS A 363 ? 0.6170 0.3294 0.7230 0.0133  -0.0020 -0.1092 393 CYS A CA  
2674 C C   . CYS A 363 ? 0.6422 0.3846 0.7389 0.0246  0.0023  -0.0997 393 CYS A C   
2675 O O   . CYS A 363 ? 0.7581 0.5248 0.8538 0.0342  -0.0006 -0.0910 393 CYS A O   
2676 C CB  . CYS A 363 ? 0.4393 0.1270 0.5249 0.0103  -0.0063 -0.0849 393 CYS A CB  
2677 S SG  . CYS A 363 ? 1.1982 0.8843 1.2905 0.0079  -0.0154 -0.0840 393 CYS A SG  
2678 N N   . ALA A 364 ? 0.5947 0.3393 0.6849 0.0244  0.0104  -0.0993 394 ALA A N   
2679 C CA  . ALA A 364 ? 0.5853 0.3576 0.6643 0.0372  0.0168  -0.0859 394 ALA A CA  
2680 C C   . ALA A 364 ? 0.4789 0.3205 0.5747 0.0425  0.0228  -0.1007 394 ALA A C   
2681 O O   . ALA A 364 ? 0.4350 0.3138 0.5249 0.0566  0.0291  -0.0893 394 ALA A O   
2682 C CB  . ALA A 364 ? 0.4752 0.2038 0.5304 0.0364  0.0222  -0.0710 394 ALA A CB  
2683 N N   . ARG A 365 ? 0.3859 0.2466 0.5034 0.0314  0.0225  -0.1261 395 ARG A N   
2684 C CA  . ARG A 365 ? 0.4621 0.3933 0.5981 0.0328  0.0287  -0.1458 395 ARG A CA  
2685 C C   . ARG A 365 ? 0.5716 0.5712 0.7164 0.0487  0.0283  -0.1427 395 ARG A C   
2686 O O   . ARG A 365 ? 0.5811 0.5966 0.7400 0.0496  0.0212  -0.1490 395 ARG A O   
2687 C CB  . ARG A 365 ? 0.5647 0.5020 0.7270 0.0162  0.0290  -0.1767 395 ARG A CB  
2688 C CG  . ARG A 365 ? 0.7173 0.7278 0.9004 0.0133  0.0369  -0.2026 395 ARG A CG  
2689 C CD  . ARG A 365 ? 0.8967 0.9090 1.1089 -0.0048 0.0393  -0.2355 395 ARG A CD  
2690 N NE  . ARG A 365 ? 0.9870 1.0730 1.2208 -0.0105 0.0481  -0.2644 395 ARG A NE  
2691 C CZ  . ARG A 365 ? 1.0527 1.1438 1.2860 -0.0200 0.0576  -0.2747 395 ARG A CZ  
2692 N NH1 . ARG A 365 ? 1.1046 1.1303 1.3172 -0.0238 0.0589  -0.2571 395 ARG A NH1 
2693 N NH2 . ARG A 365 ? 1.0543 1.2201 1.3082 -0.0260 0.0659  -0.3033 395 ARG A NH2 
2694 N N   . GLY A 366 ? 0.6849 0.7274 0.8212 0.0628  0.0365  -0.1314 396 GLY A N   
2695 C CA  . GLY A 366 ? 0.6527 0.7694 0.7985 0.0806  0.0387  -0.1263 396 GLY A CA  
2696 C C   . GLY A 366 ? 0.6632 0.7572 0.7934 0.0959  0.0377  -0.0950 396 GLY A C   
2697 O O   . GLY A 366 ? 0.5361 0.6845 0.6685 0.1151  0.0436  -0.0809 396 GLY A O   
2698 N N   . ILE A 367 ? 0.7944 0.8104 0.9100 0.0876  0.0318  -0.0840 397 ILE A N   
2699 C CA  . ILE A 367 ? 0.6450 0.6338 0.7468 0.0983  0.0317  -0.0573 397 ILE A CA  
2700 C C   . ILE A 367 ? 0.5954 0.5829 0.6784 0.1141  0.0454  -0.0319 397 ILE A C   
2701 O O   . ILE A 367 ? 0.6206 0.5756 0.6880 0.1103  0.0510  -0.0288 397 ILE A O   
2702 C CB  . ILE A 367 ? 0.4699 0.3798 0.5595 0.0844  0.0233  -0.0533 397 ILE A CB  
2703 C CG1 . ILE A 367 ? 0.5709 0.4879 0.6782 0.0761  0.0110  -0.0694 397 ILE A CG1 
2704 C CG2 . ILE A 367 ? 0.3216 0.1973 0.3929 0.0931  0.0277  -0.0261 397 ILE A CG2 
2705 C CD1 . ILE A 367 ? 0.6564 0.5911 0.7832 0.0637  0.0080  -0.0986 397 ILE A CD1 
2706 N N   . ASP A 368 ? 0.7623 0.7868 0.8478 0.1330  0.0517  -0.0130 398 ASP A N   
2707 C CA  . ASP A 368 ? 0.8417 0.8664 0.9114 0.1515  0.0678  0.0141  398 ASP A CA  
2708 C C   . ASP A 368 ? 0.8175 0.7627 0.8677 0.1482  0.0708  0.0342  398 ASP A C   
2709 O O   . ASP A 368 ? 0.8564 0.8017 0.9064 0.1601  0.0773  0.0544  398 ASP A O   
2710 C CB  . ASP A 368 ? 0.9979 1.1011 1.0812 0.1756  0.0763  0.0281  398 ASP A CB  
2711 C CG  . ASP A 368 ? 1.1643 1.3574 1.2636 0.1829  0.0788  0.0113  398 ASP A CG  
2712 O OD1 . ASP A 368 ? 1.3252 1.5155 1.4242 0.1685  0.0753  -0.0110 398 ASP A OD1 
2713 O OD2 . ASP A 368 ? 1.0549 1.3249 1.1677 0.2031  0.0851  0.0202  398 ASP A OD2 
2714 N N   . VAL A 369 ? 0.7535 0.6337 0.7886 0.1316  0.0670  0.0279  399 VAL A N   
2715 C CA  . VAL A 369 ? 0.7773 0.5870 0.7931 0.1278  0.0721  0.0444  399 VAL A CA  
2716 C C   . VAL A 369 ? 0.8918 0.6994 0.8937 0.1454  0.0917  0.0668  399 VAL A C   
2717 O O   . VAL A 369 ? 0.8635 0.6916 0.8601 0.1510  0.0975  0.0649  399 VAL A O   
2718 C CB  . VAL A 369 ? 0.6295 0.3767 0.6334 0.1065  0.0632  0.0318  399 VAL A CB  
2719 C CG1 . VAL A 369 ? 0.4624 0.1476 0.4515 0.1001  0.0659  0.0439  399 VAL A CG1 
2720 C CG2 . VAL A 369 ? 0.3706 0.1257 0.3891 0.0915  0.0468  0.0087  399 VAL A CG2 
2721 N N   . GLU A 370 ? 0.9161 0.6990 0.9124 0.1541  0.1031  0.0882  400 GLU A N   
2722 C CA  . GLU A 370 ? 0.8762 0.6527 0.8605 0.1727  0.1250  0.1119  400 GLU A CA  
2723 C C   . GLU A 370 ? 0.7814 0.4795 0.7453 0.1611  0.1309  0.1151  400 GLU A C   
2724 O O   . GLU A 370 ? 0.9251 0.5795 0.8848 0.1396  0.1178  0.1003  400 GLU A O   
2725 C CB  . GLU A 370 ? 1.0050 0.8051 0.9985 0.1920  0.1389  0.1355  400 GLU A CB  
2726 C CG  . GLU A 370 ? 1.1609 1.0415 1.1768 0.2030  0.1316  0.1320  400 GLU A CG  
2727 C CD  . GLU A 370 ? 1.3534 1.3078 1.3747 0.2187  0.1359  0.1293  400 GLU A CD  
2728 O OE1 . GLU A 370 ? 1.2964 1.2392 1.3062 0.2122  0.1349  0.1187  400 GLU A OE1 
2729 O OE2 . GLU A 370 ? 1.4903 1.5190 1.5279 0.2377  0.1403  0.1373  400 GLU A OE2 
2730 N N   . GLN A 371 ? 0.7346 0.4181 0.6863 0.1764  0.1516  0.1346  401 GLN A N   
2731 C CA  . GLN A 371 ? 0.7926 0.4044 0.7261 0.1668  0.1600  0.1375  401 GLN A CA  
2732 C C   . GLN A 371 ? 0.7696 0.3553 0.6930 0.1471  0.1446  0.1163  401 GLN A C   
2733 O O   . GLN A 371 ? 0.9465 0.5053 0.8635 0.1229  0.1380  0.1018  401 GLN A O   
2734 C CB  . GLN A 371 ? 0.9408 0.5139 0.8761 0.1534  0.1628  0.1384  401 GLN A CB  
2735 C CG  . GLN A 371 ? 0.9864 0.5752 0.9343 0.1728  0.1769  0.1614  401 GLN A CG  
2736 C CD  . GLN A 371 ? 1.1248 0.7226 1.0680 0.1995  0.2043  0.1877  401 GLN A CD  
2737 O OE1 . GLN A 371 ? 0.9988 0.5607 0.9264 0.1998  0.2170  0.1907  401 GLN A OE1 
2738 N NE2 . GLN A 371 ? 1.2902 0.9419 1.2472 0.2226  0.2147  0.2069  401 GLN A NE2 
2739 N N   . VAL A 372 ? 0.6244 0.2479 0.5469 0.1522  0.1406  0.1098  402 VAL A N   
2740 C CA  . VAL A 372 ? 0.5891 0.1926 0.5037 0.1357  0.1280  0.0919  402 VAL A CA  
2741 C C   . VAL A 372 ? 0.6682 0.2756 0.5678 0.1471  0.1396  0.0996  402 VAL A C   
2742 O O   . VAL A 372 ? 0.7834 0.4460 0.6867 0.1600  0.1426  0.1008  402 VAL A O   
2743 C CB  . VAL A 372 ? 0.5499 0.1968 0.4802 0.1269  0.1106  0.0718  402 VAL A CB  
2744 C CG1 . VAL A 372 ? 0.4590 0.0832 0.3823 0.1109  0.1006  0.0561  402 VAL A CG1 
2745 C CG2 . VAL A 372 ? 0.6270 0.2754 0.5726 0.1172  0.0985  0.0638  402 VAL A CG2 
2746 N N   . SER A 373 ? 0.7728 0.3320 0.6553 0.1406  0.1464  0.1024  403 SER A N   
2747 C CA  . SER A 373 ? 0.7535 0.3083 0.6200 0.1531  0.1573  0.1112  403 SER A CA  
2748 C C   . SER A 373 ? 0.7025 0.2539 0.5629 0.1371  0.1430  0.0935  403 SER A C   
2749 O O   . SER A 373 ? 0.8390 0.4081 0.6903 0.1468  0.1472  0.0966  403 SER A O   
2750 C CB  . SER A 373 ? 0.8298 0.3515 0.6817 0.1557  0.1774  0.1227  403 SER A CB  
2751 O OG  . SER A 373 ? 1.1222 0.6154 0.9704 0.1300  0.1708  0.1062  403 SER A OG  
2752 N N   . VAL A 374 ? 0.6983 0.2411 0.5638 0.1119  0.1272  0.0749  404 VAL A N   
2753 C CA  . VAL A 374 ? 0.5814 0.1208 0.4424 0.0963  0.1150  0.0604  404 VAL A CA  
2754 C C   . VAL A 374 ? 0.6350 0.1905 0.5136 0.0826  0.0977  0.0441  404 VAL A C   
2755 O O   . VAL A 374 ? 0.7049 0.2618 0.5935 0.0725  0.0902  0.0385  404 VAL A O   
2756 C CB  . VAL A 374 ? 0.5892 0.1034 0.4380 0.0808  0.1143  0.0555  404 VAL A CB  
2757 C CG1 . VAL A 374 ? 0.5630 0.0789 0.4101 0.0665  0.1008  0.0433  404 VAL A CG1 
2758 C CG2 . VAL A 374 ? 0.7834 0.2772 0.6153 0.0928  0.1327  0.0681  404 VAL A CG2 
2759 N N   . VAL A 375 ? 0.5000 0.0668 0.3827 0.0824  0.0926  0.0360  405 VAL A N   
2760 C CA  . VAL A 375 ? 0.5030 0.0816 0.4038 0.0684  0.0794  0.0188  405 VAL A CA  
2761 C C   . VAL A 375 ? 0.6287 0.1987 0.5249 0.0530  0.0726  0.0111  405 VAL A C   
2762 O O   . VAL A 375 ? 0.8182 0.3829 0.7025 0.0569  0.0771  0.0142  405 VAL A O   
2763 C CB  . VAL A 375 ? 0.5293 0.1610 0.4459 0.0756  0.0806  0.0096  405 VAL A CB  
2764 C CG1 . VAL A 375 ? 0.4846 0.1241 0.4192 0.0587  0.0703  -0.0111 405 VAL A CG1 
2765 C CG2 . VAL A 375 ? 0.4548 0.1176 0.3820 0.0866  0.0838  0.0147  405 VAL A CG2 
2766 N N   . ILE A 376 ? 0.5341 0.1045 0.4404 0.0379  0.0624  0.0031  406 ILE A N   
2767 C CA  . ILE A 376 ? 0.5067 0.0721 0.4126 0.0262  0.0566  -0.0017 406 ILE A CA  
2768 C C   . ILE A 376 ? 0.5562 0.1337 0.4851 0.0173  0.0504  -0.0146 406 ILE A C   
2769 O O   . ILE A 376 ? 0.5865 0.1679 0.5267 0.0123  0.0446  -0.0175 406 ILE A O   
2770 C CB  . ILE A 376 ? 0.6354 0.1886 0.5318 0.0195  0.0524  0.0028  406 ILE A CB  
2771 C CG1 . ILE A 376 ? 0.4936 0.0328 0.3709 0.0264  0.0604  0.0120  406 ILE A CG1 
2772 C CG2 . ILE A 376 ? 0.5297 0.0782 0.4245 0.0121  0.0482  0.0010  406 ILE A CG2 
2773 C CD1 . ILE A 376 ? 0.6691 0.1966 0.5294 0.0288  0.0653  0.0161  406 ILE A CD1 
2774 N N   . ASN A 377 ? 0.4504 0.0334 0.3870 0.0153  0.0530  -0.0235 407 ASN A N   
2775 C CA  . ASN A 377 ? 0.6314 0.2232 0.5917 0.0048  0.0503  -0.0382 407 ASN A CA  
2776 C C   . ASN A 377 ? 0.6685 0.2498 0.6299 -0.0042 0.0473  -0.0345 407 ASN A C   
2777 O O   . ASN A 377 ? 0.7280 0.3047 0.6877 -0.0077 0.0503  -0.0357 407 ASN A O   
2778 C CB  . ASN A 377 ? 0.5904 0.1941 0.5610 0.0048  0.0565  -0.0549 407 ASN A CB  
2779 C CG  . ASN A 377 ? 0.5360 0.1790 0.5098 0.0161  0.0600  -0.0590 407 ASN A CG  
2780 O OD1 . ASN A 377 ? 0.6562 0.3010 0.6353 0.0204  0.0568  -0.0569 407 ASN A OD1 
2781 N ND2 . ASN A 377 ? 0.4829 0.1700 0.4538 0.0218  0.0670  -0.0628 407 ASN A ND2 
2782 N N   . PHE A 378 ? 0.5763 0.1540 0.5402 -0.0064 0.0418  -0.0297 408 PHE A N   
2783 C CA  . PHE A 378 ? 0.6821 0.2500 0.6472 -0.0114 0.0396  -0.0250 408 PHE A CA  
2784 C C   . PHE A 378 ? 0.7526 0.3218 0.7406 -0.0188 0.0441  -0.0351 408 PHE A C   
2785 O O   . PHE A 378 ? 0.7804 0.3405 0.7703 -0.0222 0.0465  -0.0316 408 PHE A O   
2786 C CB  . PHE A 378 ? 0.4970 0.0628 0.4619 -0.0112 0.0337  -0.0202 408 PHE A CB  
2787 C CG  . PHE A 378 ? 0.5719 0.1270 0.5312 -0.0129 0.0318  -0.0126 408 PHE A CG  
2788 C CD1 . PHE A 378 ? 0.6299 0.1817 0.6059 -0.0160 0.0323  -0.0133 408 PHE A CD1 
2789 C CD2 . PHE A 378 ? 0.5478 0.0952 0.4861 -0.0107 0.0308  -0.0050 408 PHE A CD2 
2790 C CE1 . PHE A 378 ? 0.6067 0.1489 0.5782 -0.0158 0.0316  -0.0049 408 PHE A CE1 
2791 C CE2 . PHE A 378 ? 0.6057 0.1451 0.5401 -0.0118 0.0290  0.0010  408 PHE A CE2 
2792 C CZ  . PHE A 378 ? 0.5637 0.1010 0.5145 -0.0138 0.0293  0.0019  408 PHE A CZ  
2793 N N   . ASP A 379 ? 0.7163 0.2968 0.7233 -0.0215 0.0462  -0.0487 409 ASP A N   
2794 C CA  . ASP A 379 ? 0.7044 0.2874 0.7354 -0.0304 0.0535  -0.0639 409 ASP A CA  
2795 C C   . ASP A 379 ? 0.7596 0.3593 0.7955 -0.0312 0.0571  -0.0807 409 ASP A C   
2796 O O   . ASP A 379 ? 0.7259 0.3355 0.7544 -0.0236 0.0536  -0.0809 409 ASP A O   
2797 C CB  . ASP A 379 ? 0.7236 0.3059 0.7776 -0.0344 0.0542  -0.0700 409 ASP A CB  
2798 C CG  . ASP A 379 ? 0.8216 0.3881 0.8714 -0.0323 0.0523  -0.0548 409 ASP A CG  
2799 O OD1 . ASP A 379 ? 0.9368 0.4919 0.9809 -0.0333 0.0555  -0.0470 409 ASP A OD1 
2800 O OD2 . ASP A 379 ? 0.8499 0.4161 0.9020 -0.0294 0.0476  -0.0511 409 ASP A OD2 
2801 N N   . LEU A 380 ? 0.7364 0.3399 0.7844 -0.0401 0.0648  -0.0961 410 LEU A N   
2802 C CA  . LEU A 380 ? 0.7494 0.3739 0.8008 -0.0415 0.0689  -0.1179 410 LEU A CA  
2803 C C   . LEU A 380 ? 0.7708 0.4219 0.8491 -0.0476 0.0710  -0.1415 410 LEU A C   
2804 O O   . LEU A 380 ? 0.9681 0.6095 1.0696 -0.0576 0.0747  -0.1501 410 LEU A O   
2805 C CB  . LEU A 380 ? 0.6711 0.3051 0.7231 -0.0497 0.0765  -0.1264 410 LEU A CB  
2806 C CG  . LEU A 380 ? 0.6120 0.2196 0.6366 -0.0431 0.0739  -0.1048 410 LEU A CG  
2807 C CD1 . LEU A 380 ? 0.7229 0.3549 0.7468 -0.0495 0.0810  -0.1125 410 LEU A CD1 
2808 C CD2 . LEU A 380 ? 0.5580 0.1708 0.5566 -0.0263 0.0686  -0.0880 410 LEU A CD2 
2809 N N   . PRO A 381 ? 0.6943 0.3958 0.7714 -0.0388 0.0701  -0.1471 411 PRO A N   
2810 C CA  . PRO A 381 ? 0.7368 0.4785 0.8384 -0.0417 0.0709  -0.1681 411 PRO A CA  
2811 C C   . PRO A 381 ? 0.7206 0.4973 0.8503 -0.0579 0.0811  -0.1990 411 PRO A C   
2812 O O   . PRO A 381 ? 0.7374 0.5593 0.8650 -0.0591 0.0871  -0.2082 411 PRO A O   
2813 C CB  . PRO A 381 ? 0.6875 0.4798 0.7759 -0.0251 0.0689  -0.1607 411 PRO A CB  
2814 C CG  . PRO A 381 ? 0.7866 0.5781 0.8497 -0.0179 0.0720  -0.1451 411 PRO A CG  
2815 C CD  . PRO A 381 ? 0.6645 0.3856 0.7152 -0.0228 0.0684  -0.1297 411 PRO A CD  
2816 N N   . VAL A 382 ? 0.8589 0.6162 1.0149 -0.0704 0.0844  -0.2155 412 VAL A N   
2817 C CA  . VAL A 382 ? 0.9453 0.7333 1.1322 -0.0880 0.0965  -0.2485 412 VAL A CA  
2818 C C   . VAL A 382 ? 1.0864 0.9003 1.3014 -0.0924 0.0973  -0.2719 412 VAL A C   
2819 O O   . VAL A 382 ? 1.0696 0.8628 1.2812 -0.0832 0.0885  -0.2603 412 VAL A O   
2820 C CB  . VAL A 382 ? 0.8818 0.6170 1.0800 -0.1030 0.1060  -0.2504 412 VAL A CB  
2821 C CG1 . VAL A 382 ? 0.7148 0.4320 0.8876 -0.0997 0.1054  -0.2302 412 VAL A CG1 
2822 C CG2 . VAL A 382 ? 0.9222 0.6005 1.1267 -0.1009 0.1038  -0.2361 412 VAL A CG2 
2823 N N   . ASP A 383 ? 1.1351 0.9963 1.3782 -0.1071 0.1084  -0.3064 413 ASP A N   
2824 C CA  . ASP A 383 ? 1.1870 1.0808 1.4600 -0.1129 0.1108  -0.3339 413 ASP A CA  
2825 C C   . ASP A 383 ? 1.2214 1.0614 1.5215 -0.1282 0.1208  -0.3476 413 ASP A C   
2826 O O   . ASP A 383 ? 1.0850 0.8657 1.3818 -0.1340 0.1268  -0.3349 413 ASP A O   
2827 C CB  . ASP A 383 ? 1.2899 1.2735 1.5812 -0.1206 0.1185  -0.3673 413 ASP A CB  
2828 C CG  . ASP A 383 ? 1.4297 1.4200 1.7328 -0.1401 0.1334  -0.3876 413 ASP A CG  
2829 O OD1 . ASP A 383 ? 1.5532 1.4768 1.8619 -0.1513 0.1407  -0.3832 413 ASP A OD1 
2830 O OD2 . ASP A 383 ? 1.3990 1.4647 1.7061 -0.1437 0.1386  -0.4073 413 ASP A OD2 
2831 N N   . LYS A 384 ? 1.3606 1.2235 1.6884 -0.1334 0.1236  -0.3726 414 LYS A N   
2832 C CA  . LYS A 384 ? 1.3456 1.1592 1.7012 -0.1456 0.1348  -0.3861 414 LYS A CA  
2833 C C   . LYS A 384 ? 1.2887 1.0699 1.6607 -0.1646 0.1537  -0.3980 414 LYS A C   
2834 O O   . LYS A 384 ? 1.2603 0.9852 1.6410 -0.1652 0.1630  -0.3816 414 LYS A O   
2835 C CB  . LYS A 384 ? 1.2990 1.1610 1.6871 -0.1523 0.1387  -0.4219 414 LYS A CB  
2836 N N   . ASP A 385 ? 1.2668 1.1003 1.6449 -0.1764 0.1614  -0.4199 415 ASP A N   
2837 C CA  . ASP A 385 ? 1.3789 1.1899 1.7737 -0.1964 0.1801  -0.4339 415 ASP A CA  
2838 C C   . ASP A 385 ? 1.4437 1.1937 1.8104 -0.1885 0.1765  -0.3952 415 ASP A C   
2839 O O   . ASP A 385 ? 1.4815 1.1741 1.8576 -0.1892 0.1865  -0.3785 415 ASP A O   
2840 C CB  . ASP A 385 ? 1.3882 1.2799 1.7919 -0.2095 0.1872  -0.4654 415 ASP A CB  
2841 C CG  . ASP A 385 ? 1.4416 1.4131 1.8656 -0.2116 0.1860  -0.4992 415 ASP A CG  
2842 O OD1 . ASP A 385 ? 1.5321 1.4891 1.9800 -0.2147 0.1892  -0.5140 415 ASP A OD1 
2843 O OD2 . ASP A 385 ? 1.4162 1.4682 1.8322 -0.2089 0.1822  -0.5102 415 ASP A OD2 
2844 N N   . GLY A 386 ? 1.3949 1.1720 1.7287 -0.1768 0.1640  -0.3759 416 GLY A N   
2845 C CA  . GLY A 386 ? 1.2919 1.0206 1.5970 -0.1683 0.1589  -0.3406 416 GLY A CA  
2846 C C   . GLY A 386 ? 1.2109 0.9868 1.4904 -0.1632 0.1531  -0.3349 416 GLY A C   
2847 O O   . GLY A 386 ? 1.2593 1.0054 1.5149 -0.1574 0.1494  -0.3093 416 GLY A O   
2848 N N   . ASN A 387 ? 1.0900 0.9436 1.3748 -0.1643 0.1527  -0.3584 417 ASN A N   
2849 C CA  . ASN A 387 ? 1.0579 0.9668 1.3198 -0.1578 0.1493  -0.3545 417 ASN A CA  
2850 C C   . ASN A 387 ? 0.9835 0.9013 1.2105 -0.1317 0.1326  -0.3229 417 ASN A C   
2851 O O   . ASN A 387 ? 0.9873 0.8829 1.2117 -0.1206 0.1234  -0.3107 417 ASN A O   
2852 C CB  . ASN A 387 ? 1.1521 1.1497 1.4370 -0.1706 0.1591  -0.3948 417 ASN A CB  
2853 C CG  . ASN A 387 ? 1.1665 1.1616 1.4818 -0.1986 0.1783  -0.4266 417 ASN A CG  
2854 O OD1 . ASN A 387 ? 1.2075 1.1648 1.5149 -0.2053 0.1836  -0.4152 417 ASN A OD1 
2855 N ND2 . ASN A 387 ? 1.0772 1.1139 1.4290 -0.2156 0.1898  -0.4676 417 ASN A ND2 
2856 N N   . PRO A 388 ? 0.9489 0.8982 1.1494 -0.1217 0.1299  -0.3095 418 PRO A N   
2857 C CA  . PRO A 388 ? 0.9192 0.8783 1.0872 -0.0967 0.1179  -0.2798 418 PRO A CA  
2858 C C   . PRO A 388 ? 0.9403 0.9571 1.1161 -0.0857 0.1140  -0.2883 418 PRO A C   
2859 O O   . PRO A 388 ? 0.9100 1.0028 1.1036 -0.0913 0.1209  -0.3158 418 PRO A O   
2860 C CB  . PRO A 388 ? 0.9279 0.9274 1.0748 -0.0921 0.1215  -0.2747 418 PRO A CB  
2861 C CG  . PRO A 388 ? 1.0101 0.9859 1.1697 -0.1134 0.1310  -0.2887 418 PRO A CG  
2862 C CD  . PRO A 388 ? 1.0008 0.9719 1.2000 -0.1338 0.1396  -0.3200 418 PRO A CD  
2863 N N   . ASP A 389 ? 0.9151 0.8996 1.0783 -0.0703 0.1034  -0.2652 419 ASP A N   
2864 C CA  . ASP A 389 ? 0.8710 0.9057 1.0394 -0.0571 0.0988  -0.2673 419 ASP A CA  
2865 C C   . ASP A 389 ? 0.7644 0.8387 0.9048 -0.0340 0.0968  -0.2436 419 ASP A C   
2866 O O   . ASP A 389 ? 0.7668 0.8052 0.8854 -0.0179 0.0898  -0.2142 419 ASP A O   
2867 C CB  . ASP A 389 ? 0.9532 0.9328 1.1236 -0.0531 0.0894  -0.2547 419 ASP A CB  
2868 C CG  . ASP A 389 ? 1.0567 1.0880 1.2377 -0.0420 0.0848  -0.2601 419 ASP A CG  
2869 O OD1 . ASP A 389 ? 1.1543 1.2642 1.3373 -0.0334 0.0884  -0.2679 419 ASP A OD1 
2870 O OD2 . ASP A 389 ? 1.0309 1.0276 1.2179 -0.0408 0.0777  -0.2555 419 ASP A OD2 
2871 N N   . ASN A 390 ? 0.7513 0.9013 0.8932 -0.0325 0.1049  -0.2570 420 ASN A N   
2872 C CA  . ASN A 390 ? 0.7658 0.9576 0.8812 -0.0091 0.1065  -0.2337 420 ASN A CA  
2873 C C   . ASN A 390 ? 0.7934 1.0121 0.9046 0.0132  0.1024  -0.2163 420 ASN A C   
2874 O O   . ASN A 390 ? 0.8864 1.0887 0.9714 0.0338  0.1017  -0.1845 420 ASN A O   
2875 C CB  . ASN A 390 ? 0.7704 1.0494 0.8909 -0.0121 0.1169  -0.2542 420 ASN A CB  
2876 C CG  . ASN A 390 ? 0.8761 1.1264 0.9916 -0.0294 0.1217  -0.2620 420 ASN A CG  
2877 O OD1 . ASN A 390 ? 0.9135 1.1838 1.0538 -0.0525 0.1281  -0.2949 420 ASN A OD1 
2878 N ND2 . ASN A 390 ? 0.9404 1.1427 1.0248 -0.0189 0.1193  -0.2324 420 ASN A ND2 
2879 N N   . GLU A 391 ? 0.7136 0.9740 0.8520 0.0091  0.1008  -0.2375 421 GLU A N   
2880 C CA  . GLU A 391 ? 0.8152 1.1003 0.9533 0.0290  0.0964  -0.2217 421 GLU A CA  
2881 C C   . GLU A 391 ? 0.7617 0.9593 0.8775 0.0380  0.0886  -0.1886 421 GLU A C   
2882 O O   . GLU A 391 ? 0.8165 1.0113 0.9094 0.0588  0.0906  -0.1589 421 GLU A O   
2883 C CB  . GLU A 391 ? 1.0094 1.3295 1.1812 0.0186  0.0932  -0.2508 421 GLU A CB  
2884 C CG  . GLU A 391 ? 1.1959 1.6189 1.3926 0.0119  0.1017  -0.2857 421 GLU A CG  
2885 C CD  . GLU A 391 ? 1.2920 1.8086 1.4807 0.0378  0.1068  -0.2723 421 GLU A CD  
2886 O OE1 . GLU A 391 ? 1.2746 1.8684 1.4854 0.0434  0.1070  -0.2879 421 GLU A OE1 
2887 O OE2 . GLU A 391 ? 1.3260 1.8406 1.4869 0.0538  0.1115  -0.2453 421 GLU A OE2 
2888 N N   . THR A 392 ? 0.6190 0.7468 0.7426 0.0221  0.0813  -0.1945 422 THR A N   
2889 C CA  . THR A 392 ? 0.5813 0.6308 0.6869 0.0275  0.0735  -0.1677 422 THR A CA  
2890 C C   . THR A 392 ? 0.6125 0.6234 0.6860 0.0380  0.0763  -0.1395 422 THR A C   
2891 O O   . THR A 392 ? 0.6607 0.6443 0.7166 0.0524  0.0746  -0.1138 422 THR A O   
2892 C CB  . THR A 392 ? 0.7151 0.6972 0.8316 0.0080  0.0677  -0.1783 422 THR A CB  
2893 O OG1 . THR A 392 ? 0.7464 0.7573 0.8920 0.0000  0.0654  -0.2025 422 THR A OG1 
2894 C CG2 . THR A 392 ? 0.7313 0.6394 0.8272 0.0135  0.0601  -0.1511 422 THR A CG2 
2895 N N   . TYR A 393 ? 0.5486 0.5567 0.6153 0.0300  0.0814  -0.1453 423 TYR A N   
2896 C CA  . TYR A 393 ? 0.5962 0.5703 0.6329 0.0396  0.0842  -0.1208 423 TYR A CA  
2897 C C   . TYR A 393 ? 0.6073 0.6246 0.6288 0.0648  0.0909  -0.0998 423 TYR A C   
2898 O O   . TYR A 393 ? 0.5871 0.5641 0.5897 0.0776  0.0909  -0.0741 423 TYR A O   
2899 C CB  . TYR A 393 ? 0.6580 0.6396 0.6918 0.0284  0.0893  -0.1323 423 TYR A CB  
2900 C CG  . TYR A 393 ? 0.6832 0.6225 0.6868 0.0362  0.0908  -0.1085 423 TYR A CG  
2901 C CD1 . TYR A 393 ? 0.7804 0.6431 0.7752 0.0268  0.0849  -0.0997 423 TYR A CD1 
2902 C CD2 . TYR A 393 ? 0.6909 0.6702 0.6751 0.0543  0.0989  -0.0944 423 TYR A CD2 
2903 C CE1 . TYR A 393 ? 0.7872 0.6145 0.7553 0.0336  0.0861  -0.0798 423 TYR A CE1 
2904 C CE2 . TYR A 393 ? 0.7840 0.7239 0.7407 0.0619  0.1009  -0.0736 423 TYR A CE2 
2905 C CZ  . TYR A 393 ? 0.8449 0.7091 0.7942 0.0507  0.0941  -0.0675 423 TYR A CZ  
2906 O OH  . TYR A 393 ? 0.7718 0.6008 0.6950 0.0579  0.0959  -0.0488 423 TYR A OH  
2907 N N   . LEU A 394 ? 0.7700 0.8722 0.8010 0.0721  0.0981  -0.1112 424 LEU A N   
2908 C CA  . LEU A 394 ? 0.7647 0.9190 0.7828 0.0989  0.1073  -0.0899 424 LEU A CA  
2909 C C   . LEU A 394 ? 0.7231 0.8631 0.7417 0.1135  0.1054  -0.0704 424 LEU A C   
2910 O O   . LEU A 394 ? 0.7568 0.8888 0.7568 0.1346  0.1131  -0.0417 424 LEU A O   
2911 C CB  . LEU A 394 ? 0.6997 0.9600 0.7334 0.1035  0.1147  -0.1090 424 LEU A CB  
2912 C CG  . LEU A 394 ? 0.7636 1.0892 0.7863 0.1348  0.1261  -0.0850 424 LEU A CG  
2913 C CD1 . LEU A 394 ? 0.7796 1.0682 0.7695 0.1505  0.1342  -0.0550 424 LEU A CD1 
2914 C CD2 . LEU A 394 ? 0.7409 1.1813 0.7801 0.1387  0.1333  -0.1062 424 LEU A CD2 
2915 N N   . HIS A 395 ? 0.6930 0.8288 0.7336 0.1021  0.0963  -0.0861 425 HIS A N   
2916 C CA  . HIS A 395 ? 0.5982 0.7288 0.6424 0.1144  0.0937  -0.0705 425 HIS A CA  
2917 C C   . HIS A 395 ? 0.6914 0.7295 0.7175 0.1124  0.0893  -0.0497 425 HIS A C   
2918 O O   . HIS A 395 ? 0.9531 0.9799 0.9726 0.1270  0.0923  -0.0278 425 HIS A O   
2919 C CB  . HIS A 395 ? 0.7561 0.9219 0.8301 0.1040  0.0855  -0.0953 425 HIS A CB  
2920 C CG  . HIS A 395 ? 0.9763 1.2474 1.0697 0.1109  0.0914  -0.1132 425 HIS A CG  
2921 N ND1 . HIS A 395 ? 1.0880 1.3996 1.1982 0.0938  0.0925  -0.1461 425 HIS A ND1 
2922 C CD2 . HIS A 395 ? 1.0388 1.3875 1.1384 0.1333  0.0978  -0.1030 425 HIS A CD2 
2923 C CE1 . HIS A 395 ? 1.0867 1.4991 1.2125 0.1042  0.0986  -0.1578 425 HIS A CE1 
2924 N NE2 . HIS A 395 ? 1.1033 1.5421 1.2229 0.1293  0.1016  -0.1309 425 HIS A NE2 
2925 N N   . ARG A 396 ? 0.6747 0.6496 0.6939 0.0941  0.0833  -0.0568 426 ARG A N   
2926 C CA  . ARG A 396 ? 0.6523 0.5458 0.6528 0.0916  0.0801  -0.0388 426 ARG A CA  
2927 C C   . ARG A 396 ? 0.7587 0.6404 0.7342 0.1082  0.0915  -0.0144 426 ARG A C   
2928 O O   . ARG A 396 ? 0.8053 0.6626 0.7703 0.1203  0.0966  0.0068  426 ARG A O   
2929 C CB  . ARG A 396 ? 0.6134 0.4524 0.6130 0.0704  0.0725  -0.0512 426 ARG A CB  
2930 C CG  . ARG A 396 ? 0.5213 0.3364 0.5387 0.0551  0.0619  -0.0657 426 ARG A CG  
2931 C CD  . ARG A 396 ? 0.4456 0.2072 0.4607 0.0380  0.0575  -0.0724 426 ARG A CD  
2932 N NE  . ARG A 396 ? 0.5365 0.2951 0.5749 0.0237  0.0514  -0.0924 426 ARG A NE  
2933 C CZ  . ARG A 396 ? 0.6534 0.3752 0.6975 0.0089  0.0496  -0.1010 426 ARG A CZ  
2934 N NH1 . ARG A 396 ? 0.6621 0.3499 0.6900 0.0061  0.0517  -0.0917 426 ARG A NH1 
2935 N NH2 . ARG A 396 ? 0.6468 0.3665 0.7136 -0.0019 0.0467  -0.1180 426 ARG A NH2 
2936 N N   . ILE A 397 ? 0.7227 0.6215 0.6894 0.1082  0.0967  -0.0181 427 ILE A N   
2937 C CA  . ILE A 397 ? 0.7663 0.6456 0.7073 0.1218  0.1070  0.0032  427 ILE A CA  
2938 C C   . ILE A 397 ? 0.7201 0.6450 0.6557 0.1489  0.1212  0.0244  427 ILE A C   
2939 O O   . ILE A 397 ? 0.6645 0.5528 0.5831 0.1622  0.1306  0.0480  427 ILE A O   
2940 C CB  . ILE A 397 ? 0.8709 0.7663 0.8046 0.1158  0.1087  -0.0067 427 ILE A CB  
2941 C CG1 . ILE A 397 ? 0.8001 0.6726 0.7482 0.0898  0.0970  -0.0312 427 ILE A CG1 
2942 C CG2 . ILE A 397 ? 0.9024 0.7547 0.8084 0.1244  0.1156  0.0133  427 ILE A CG2 
2943 C CD1 . ILE A 397 ? 0.6520 0.4458 0.5954 0.0773  0.0882  -0.0271 427 ILE A CD1 
2944 N N   . GLY A 398 ? 0.7623 0.7693 0.7138 0.1573  0.1243  0.0157  428 GLY A N   
2945 C CA  . GLY A 398 ? 0.6948 0.7582 0.6443 0.1855  0.1388  0.0367  428 GLY A CA  
2946 C C   . GLY A 398 ? 0.7659 0.7999 0.7194 0.1939  0.1403  0.0542  428 GLY A C   
2947 O O   . GLY A 398 ? 0.6806 0.7382 0.6293 0.2187  0.1551  0.0792  428 GLY A O   
2948 N N   . ARG A 399 ? 0.9196 0.9019 0.8818 0.1733  0.1261  0.0417  429 ARG A N   
2949 C CA  . ARG A 399 ? 1.0003 0.9508 0.9678 0.1754  0.1244  0.0533  429 ARG A CA  
2950 C C   . ARG A 399 ? 1.1403 1.1418 1.1341 0.1716  0.1146  0.0375  429 ARG A C   
2951 O O   . ARG A 399 ? 1.1764 1.1422 1.1790 0.1555  0.1018  0.0267  429 ARG A O   
2952 C CB  . ARG A 399 ? 0.9993 0.9476 0.9552 0.2011  0.1432  0.0858  429 ARG A CB  
2953 C CG  . ARG A 399 ? 1.0276 0.8998 0.9595 0.2010  0.1519  0.1016  429 ARG A CG  
2954 C CD  . ARG A 399 ? 0.9219 0.7946 0.8382 0.1993  0.1540  0.0965  429 ARG A CD  
2955 N NE  . ARG A 399 ? 0.9071 0.7168 0.8008 0.2038  0.1651  0.1135  429 ARG A NE  
2956 C CZ  . ARG A 399 ? 1.0063 0.8287 0.8857 0.2275  0.1848  0.1360  429 ARG A CZ  
2957 N NH1 . ARG A 399 ? 0.9810 0.8814 0.8655 0.2500  0.1953  0.1456  429 ARG A NH1 
2958 N NH2 . ARG A 399 ? 1.0289 0.7888 0.8891 0.2294  0.1949  0.1485  429 ARG A NH2 
2959 N N   . GLY A 404 ? 1.4479 1.5804 1.3008 0.4121  0.3077  0.2806  434 GLY A N   
2960 C CA  . GLY A 404 ? 1.4646 1.5485 1.2925 0.4064  0.3093  0.2783  434 GLY A CA  
2961 C C   . GLY A 404 ? 1.5147 1.4831 1.3350 0.3838  0.3046  0.2730  434 GLY A C   
2962 O O   . GLY A 404 ? 1.4730 1.3875 1.2731 0.3899  0.3175  0.2851  434 GLY A O   
2963 N N   . LYS A 405 ? 1.5246 1.4592 1.3615 0.3578  0.2862  0.2538  435 LYS A N   
2964 C CA  . LYS A 405 ? 1.5339 1.3683 1.3666 0.3344  0.2802  0.2460  435 LYS A CA  
2965 C C   . LYS A 405 ? 1.4837 1.2826 1.3071 0.3046  0.2578  0.2173  435 LYS A C   
2966 O O   . LYS A 405 ? 1.4362 1.2762 1.2688 0.2891  0.2379  0.1939  435 LYS A O   
2967 C CB  . LYS A 405 ? 1.4999 1.3196 1.3538 0.3220  0.2716  0.2406  435 LYS A CB  
2968 C CG  . LYS A 405 ? 1.4497 1.3383 1.3239 0.3115  0.2504  0.2190  435 LYS A CG  
2969 C CD  . LYS A 405 ? 1.4592 1.3428 1.3536 0.3064  0.2458  0.2197  435 LYS A CD  
2970 C CE  . LYS A 405 ? 1.4570 1.4092 1.3723 0.2964  0.2254  0.1969  435 LYS A CE  
2971 N NZ  . LYS A 405 ? 1.4521 1.5059 1.3735 0.3204  0.2336  0.2033  435 LYS A NZ  
2972 N N   . ARG A 406 ? 1.4776 1.2012 1.2844 0.2967  0.2624  0.2190  436 ARG A N   
2973 C CA  . ARG A 406 ? 1.4308 1.1215 1.2277 0.2719  0.2437  0.1959  436 ARG A CA  
2974 C C   . ARG A 406 ? 1.2481 0.9122 1.0596 0.2402  0.2190  0.1699  436 ARG A C   
2975 O O   . ARG A 406 ? 1.2626 0.8863 1.0826 0.2314  0.2186  0.1702  436 ARG A O   
2976 C CB  . ARG A 406 ? 1.4956 1.1171 1.2719 0.2730  0.2560  0.2045  436 ARG A CB  
2977 C CG  . ARG A 406 ? 1.6401 1.1893 1.4204 0.2638  0.2635  0.2076  436 ARG A CG  
2978 C CD  . ARG A 406 ? 1.8020 1.2875 1.5668 0.2483  0.2637  0.1977  436 ARG A CD  
2979 N NE  . ARG A 406 ? 1.9456 1.3872 1.7133 0.2393  0.2802  0.1969  436 ARG A NE  
2980 C CZ  . ARG A 406 ? 1.9767 1.3777 1.7371 0.2178  0.2798  0.1797  436 ARG A CZ  
2981 N NH1 . ARG A 406 ? 1.9331 1.3326 1.6826 0.2037  0.2632  0.1635  436 ARG A NH1 
2982 N NH2 . ARG A 406 ? 1.9970 1.3611 1.7619 0.2109  0.2961  0.1793  436 ARG A NH2 
2983 N N   . GLY A 407 ? 0.9640 0.6515 0.7783 0.2235  0.1999  0.1481  437 GLY A N   
2984 C CA  . GLY A 407 ? 0.8451 0.5086 0.6724 0.1953  0.1780  0.1248  437 GLY A CA  
2985 C C   . GLY A 407 ? 0.7864 0.4241 0.6043 0.1769  0.1650  0.1091  437 GLY A C   
2986 O O   . GLY A 407 ? 0.8708 0.5242 0.6744 0.1848  0.1700  0.1126  437 GLY A O   
2987 N N   . LEU A 408 ? 0.5707 0.1716 0.3968 0.1535  0.1489  0.0930  438 LEU A N   
2988 C CA  . LEU A 408 ? 0.5259 0.1023 0.3461 0.1360  0.1366  0.0795  438 LEU A CA  
2989 C C   . LEU A 408 ? 0.5322 0.1271 0.3722 0.1176  0.1197  0.0591  438 LEU A C   
2990 O O   . LEU A 408 ? 0.5975 0.1900 0.4525 0.1112  0.1138  0.0540  438 LEU A O   
2991 C CB  . LEU A 408 ? 0.5811 0.1031 0.3909 0.1235  0.1365  0.0791  438 LEU A CB  
2992 C CG  . LEU A 408 ? 0.8066 0.3182 0.6106 0.1041  0.1245  0.0655  438 LEU A CG  
2993 C CD1 . LEU A 408 ? 0.7937 0.3060 0.5817 0.1155  0.1294  0.0721  438 LEU A CD1 
2994 C CD2 . LEU A 408 ? 0.7820 0.2701 0.5799 0.0901  0.1241  0.0608  438 LEU A CD2 
2995 N N   . ALA A 409 ? 0.5955 0.2090 0.4363 0.1092  0.1130  0.0475  439 ALA A N   
2996 C CA  . ALA A 409 ? 0.5832 0.2060 0.4438 0.0905  0.0995  0.0278  439 ALA A CA  
2997 C C   . ALA A 409 ? 0.5701 0.1630 0.4252 0.0763  0.0921  0.0212  439 ALA A C   
2998 O O   . ALA A 409 ? 0.5917 0.1958 0.4341 0.0807  0.0961  0.0242  439 ALA A O   
2999 C CB  . ALA A 409 ? 0.4595 0.1499 0.3349 0.0936  0.1011  0.0167  439 ALA A CB  
3000 N N   . VAL A 410 ? 0.4805 0.0392 0.3449 0.0605  0.0819  0.0139  440 VAL A N   
3001 C CA  . VAL A 410 ? 0.5840 0.1351 0.4460 0.0462  0.0753  0.0095  440 VAL A CA  
3002 C C   . VAL A 410 ? 0.6027 0.1633 0.4881 0.0313  0.0677  -0.0054 440 VAL A C   
3003 O O   . VAL A 410 ? 0.5798 0.1450 0.4791 0.0252  0.0628  -0.0096 440 VAL A O   
3004 C CB  . VAL A 410 ? 0.6379 0.1743 0.4884 0.0399  0.0722  0.0157  440 VAL A CB  
3005 C CG1 . VAL A 410 ? 0.5854 0.1169 0.4335 0.0302  0.0663  0.0133  440 VAL A CG1 
3006 C CG2 . VAL A 410 ? 0.5949 0.1189 0.4250 0.0525  0.0825  0.0274  440 VAL A CG2 
3007 N N   . ASN A 411 ? 0.4972 0.0601 0.3875 0.0255  0.0679  -0.0135 441 ASN A N   
3008 C CA  . ASN A 411 ? 0.5263 0.0964 0.4408 0.0108  0.0644  -0.0284 441 ASN A CA  
3009 C C   . ASN A 411 ? 0.5780 0.1383 0.4933 0.0007  0.0603  -0.0238 441 ASN A C   
3010 O O   . ASN A 411 ? 0.7943 0.3477 0.6966 0.0016  0.0615  -0.0185 441 ASN A O   
3011 C CB  . ASN A 411 ? 0.4814 0.0916 0.4067 0.0084  0.0701  -0.0438 441 ASN A CB  
3012 C CG  . ASN A 411 ? 0.5776 0.2353 0.5031 0.0204  0.0750  -0.0459 441 ASN A CG  
3013 O OD1 . ASN A 411 ? 0.6371 0.3045 0.5765 0.0207  0.0732  -0.0515 441 ASN A OD1 
3014 N ND2 . ASN A 411 ? 0.6319 0.3227 0.5418 0.0319  0.0818  -0.0402 441 ASN A ND2 
3015 N N   . MET A 412 ? 0.5165 0.0768 0.4472 -0.0068 0.0559  -0.0253 442 MET A N   
3016 C CA  . MET A 412 ? 0.5380 0.0894 0.4716 -0.0127 0.0534  -0.0200 442 MET A CA  
3017 C C   . MET A 412 ? 0.6198 0.1724 0.5762 -0.0229 0.0582  -0.0306 442 MET A C   
3018 O O   . MET A 412 ? 0.7716 0.3295 0.7504 -0.0288 0.0603  -0.0411 442 MET A O   
3019 C CB  . MET A 412 ? 0.5823 0.1311 0.5190 -0.0127 0.0479  -0.0147 442 MET A CB  
3020 C CG  . MET A 412 ? 0.5925 0.1397 0.5108 -0.0057 0.0450  -0.0079 442 MET A CG  
3021 S SD  . MET A 412 ? 0.8447 0.3803 0.7353 -0.0005 0.0453  0.0022  442 MET A SD  
3022 C CE  . MET A 412 ? 0.7415 0.2721 0.6226 0.0013  0.0422  0.0060  442 MET A CE  
3023 N N   . VAL A 413 ? 0.5986 0.1456 0.5501 -0.0255 0.0611  -0.0286 443 VAL A N   
3024 C CA  . VAL A 413 ? 0.6914 0.2365 0.6650 -0.0368 0.0679  -0.0383 443 VAL A CA  
3025 C C   . VAL A 413 ? 0.7928 0.3255 0.7718 -0.0379 0.0676  -0.0264 443 VAL A C   
3026 O O   . VAL A 413 ? 0.7171 0.2442 0.6776 -0.0321 0.0631  -0.0134 443 VAL A O   
3027 C CB  . VAL A 413 ? 0.6586 0.2058 0.6252 -0.0404 0.0725  -0.0448 443 VAL A CB  
3028 C CG1 . VAL A 413 ? 0.7036 0.2505 0.6969 -0.0557 0.0818  -0.0599 443 VAL A CG1 
3029 C CG2 . VAL A 413 ? 0.5689 0.1279 0.5242 -0.0348 0.0731  -0.0543 443 VAL A CG2 
3030 N N   . ASP A 414 ? 0.9226 0.4506 0.9277 -0.0446 0.0735  -0.0315 444 ASP A N   
3031 C CA  . ASP A 414 ? 1.0029 0.5180 1.0150 -0.0431 0.0750  -0.0186 444 ASP A CA  
3032 C C   . ASP A 414 ? 1.0197 0.5241 1.0593 -0.0527 0.0880  -0.0238 444 ASP A C   
3033 O O   . ASP A 414 ? 1.0846 0.5767 1.1374 -0.0510 0.0927  -0.0140 444 ASP A O   
3034 C CB  . ASP A 414 ? 1.0525 0.5666 1.0669 -0.0376 0.0704  -0.0126 444 ASP A CB  
3035 C CG  . ASP A 414 ? 1.1709 0.6856 1.2110 -0.0430 0.0766  -0.0250 444 ASP A CG  
3036 O OD1 . ASP A 414 ? 1.2554 0.7646 1.3039 -0.0397 0.0765  -0.0192 444 ASP A OD1 
3037 O OD2 . ASP A 414 ? 1.0860 0.6075 1.1382 -0.0507 0.0821  -0.0417 444 ASP A OD2 
3038 N N   . SER A 415 ? 0.8975 0.4060 0.9464 -0.0632 0.0952  -0.0397 445 SER A N   
3039 C CA  . SER A 415 ? 0.9459 0.4432 1.0222 -0.0752 0.1099  -0.0477 445 SER A CA  
3040 C C   . SER A 415 ? 1.0219 0.5288 1.1007 -0.0882 0.1155  -0.0668 445 SER A C   
3041 O O   . SER A 415 ? 1.0274 0.5513 1.0918 -0.0877 0.1094  -0.0775 445 SER A O   
3042 C CB  . SER A 415 ? 1.0711 0.5620 1.1776 -0.0802 0.1197  -0.0580 445 SER A CB  
3043 O OG  . SER A 415 ? 1.0089 0.5158 1.1250 -0.0886 0.1213  -0.0822 445 SER A OG  
3044 N N   . LYS A 416 ? 1.0647 0.5611 1.1622 -0.1001 0.1283  -0.0716 446 LYS A N   
3045 C CA  . LYS A 416 ? 0.9848 0.4926 1.0883 -0.1168 0.1355  -0.0940 446 LYS A CA  
3046 C C   . LYS A 416 ? 0.9010 0.4282 1.0208 -0.1273 0.1395  -0.1238 446 LYS A C   
3047 O O   . LYS A 416 ? 0.8795 0.4386 0.9927 -0.1342 0.1386  -0.1433 446 LYS A O   
3048 C CB  . LYS A 416 ? 0.7798 0.2717 0.9081 -0.1308 0.1518  -0.0962 446 LYS A CB  
3049 N N   . HIS A 417 ? 0.7962 0.3164 0.9368 -0.1257 0.1441  -0.1264 447 HIS A N   
3050 C CA  . HIS A 417 ? 0.9316 0.4714 1.0912 -0.1353 0.1482  -0.1553 447 HIS A CA  
3051 C C   . HIS A 417 ? 0.8724 0.4353 1.0076 -0.1242 0.1329  -0.1566 447 HIS A C   
3052 O O   . HIS A 417 ? 1.0369 0.6386 1.1728 -0.1306 0.1335  -0.1800 447 HIS A O   
3053 C CB  . HIS A 417 ? 1.1025 0.6256 1.2900 -0.1348 0.1573  -0.1554 447 HIS A CB  
3054 C CG  . HIS A 417 ? 1.2543 0.7984 1.4630 -0.1442 0.1613  -0.1856 447 HIS A CG  
3055 N ND1 . HIS A 417 ? 1.3597 0.9040 1.5715 -0.1340 0.1554  -0.1815 447 HIS A ND1 
3056 C CD2 . HIS A 417 ? 1.3136 0.8841 1.5413 -0.1636 0.1702  -0.2226 447 HIS A CD2 
3057 C CE1 . HIS A 417 ? 1.3825 0.9506 1.6151 -0.1455 0.1604  -0.2133 447 HIS A CE1 
3058 N NE2 . HIS A 417 ? 1.3534 0.9399 1.5962 -0.1638 0.1695  -0.2401 447 HIS A NE2 
3059 N N   . SER A 418 ? 0.6921 0.2452 0.8064 -0.1056 0.1206  -0.1302 448 SER A N   
3060 C CA  . SER A 418 ? 0.8185 0.3882 0.9109 -0.0940 0.1082  -0.1284 448 SER A CA  
3061 C C   . SER A 418 ? 0.8241 0.4066 0.8895 -0.0903 0.1035  -0.1272 448 SER A C   
3062 O O   . SER A 418 ? 0.8734 0.4915 0.9250 -0.0811 0.0987  -0.1300 448 SER A O   
3063 C CB  . SER A 418 ? 0.9249 0.4827 1.0030 -0.0778 0.0979  -0.1026 448 SER A CB  
3064 O OG  . SER A 418 ? 1.1548 0.6952 1.2185 -0.0712 0.0951  -0.0793 448 SER A OG  
3065 N N   . MET A 419 ? 0.8316 0.4034 0.8903 -0.0938 0.1064  -0.1185 449 MET A N   
3066 C CA  . MET A 419 ? 0.8756 0.4804 0.9107 -0.0886 0.1045  -0.1153 449 MET A CA  
3067 C C   . MET A 419 ? 0.8682 0.5314 0.9163 -0.0988 0.1131  -0.1427 449 MET A C   
3068 O O   . MET A 419 ? 0.7754 0.4834 0.8053 -0.0893 0.1107  -0.1442 449 MET A O   
3069 C CB  . MET A 419 ? 0.8799 0.4617 0.9075 -0.0911 0.1058  -0.1007 449 MET A CB  
3070 C CG  . MET A 419 ? 0.8096 0.4225 0.8093 -0.0834 0.1026  -0.0945 449 MET A CG  
3071 S SD  . MET A 419 ? 1.2015 0.8140 1.1656 -0.0599 0.0907  -0.0753 449 MET A SD  
3072 C CE  . MET A 419 ? 0.9779 0.6580 0.9264 -0.0540 0.0948  -0.0858 449 MET A CE  
3073 N N   . ASN A 420 ? 0.9548 0.6192 1.0354 -0.1179 0.1248  -0.1645 450 ASN A N   
3074 C CA  . ASN A 420 ? 1.0744 0.7977 1.1727 -0.1307 0.1345  -0.1959 450 ASN A CA  
3075 C C   . ASN A 420 ? 0.9542 0.7183 1.0494 -0.1204 0.1292  -0.2046 450 ASN A C   
3076 O O   . ASN A 420 ? 0.9011 0.7265 0.9862 -0.1156 0.1298  -0.2137 450 ASN A O   
3077 C CB  . ASN A 420 ? 1.2970 1.0058 1.4354 -0.1536 0.1495  -0.2198 450 ASN A CB  
3078 C CG  . ASN A 420 ? 1.4739 1.2476 1.6330 -0.1705 0.1613  -0.2568 450 ASN A CG  
3079 O OD1 . ASN A 420 ? 1.4905 1.3132 1.6351 -0.1710 0.1622  -0.2622 450 ASN A OD1 
3080 N ND2 . ASN A 420 ? 1.5320 1.3095 1.7253 -0.1845 0.1711  -0.2834 450 ASN A ND2 
3081 N N   . ILE A 421 ? 0.9574 0.6904 1.0610 -0.1156 0.1243  -0.1999 451 ILE A N   
3082 C CA  . ILE A 421 ? 0.9512 0.7198 1.0538 -0.1052 0.1190  -0.2060 451 ILE A CA  
3083 C C   . ILE A 421 ? 0.8570 0.6566 0.9259 -0.0848 0.1115  -0.1881 451 ILE A C   
3084 O O   . ILE A 421 ? 0.6958 0.5574 0.7640 -0.0788 0.1133  -0.1992 451 ILE A O   
3085 C CB  . ILE A 421 ? 0.8720 0.5943 0.9806 -0.0997 0.1123  -0.1957 451 ILE A CB  
3086 C CG1 . ILE A 421 ? 0.9414 0.6383 1.0856 -0.1175 0.1221  -0.2146 451 ILE A CG1 
3087 C CG2 . ILE A 421 ? 0.7160 0.4752 0.8196 -0.0866 0.1057  -0.1974 451 ILE A CG2 
3088 C CD1 . ILE A 421 ? 1.0312 0.6815 1.1804 -0.1114 0.1162  -0.2026 451 ILE A CD1 
3089 N N   . LEU A 422 ? 0.8589 0.6169 0.9009 -0.0735 0.1046  -0.1601 452 LEU A N   
3090 C CA  . LEU A 422 ? 0.8191 0.5965 0.8291 -0.0534 0.0998  -0.1410 452 LEU A CA  
3091 C C   . LEU A 422 ? 0.9329 0.7717 0.9347 -0.0529 0.1066  -0.1503 452 LEU A C   
3092 O O   . LEU A 422 ? 0.9396 0.8273 0.9279 -0.0378 0.1077  -0.1471 452 LEU A O   
3093 C CB  . LEU A 422 ? 0.7000 0.4205 0.6856 -0.0447 0.0928  -0.1134 452 LEU A CB  
3094 C CG  . LEU A 422 ? 0.7603 0.4933 0.7135 -0.0240 0.0902  -0.0937 452 LEU A CG  
3095 C CD1 . LEU A 422 ? 0.7754 0.4877 0.7219 -0.0113 0.0849  -0.0811 452 LEU A CD1 
3096 C CD2 . LEU A 422 ? 0.8603 0.5605 0.7919 -0.0211 0.0876  -0.0762 452 LEU A CD2 
3097 N N   . ASN A 423 ? 0.8787 0.7167 0.8886 -0.0685 0.1122  -0.1605 453 ASN A N   
3098 C CA  . ASN A 423 ? 0.8785 0.7778 0.8817 -0.0708 0.1192  -0.1717 453 ASN A CA  
3099 C C   . ASN A 423 ? 0.8137 0.7882 0.8369 -0.0765 0.1267  -0.2004 453 ASN A C   
3100 O O   . ASN A 423 ? 0.8517 0.8932 0.8626 -0.0684 0.1309  -0.2046 453 ASN A O   
3101 C CB  . ASN A 423 ? 0.8417 0.7227 0.8535 -0.0894 0.1245  -0.1786 453 ASN A CB  
3102 C CG  . ASN A 423 ? 0.9185 0.7519 0.9035 -0.0797 0.1176  -0.1497 453 ASN A CG  
3103 O OD1 . ASN A 423 ? 0.9869 0.8186 0.9424 -0.0592 0.1112  -0.1282 453 ASN A OD1 
3104 N ND2 . ASN A 423 ? 0.9405 0.7361 0.9370 -0.0941 0.1202  -0.1491 453 ASN A ND2 
3105 N N   . ARG A 424 ? 0.7086 0.6752 0.7628 -0.0895 0.1289  -0.2202 454 ARG A N   
3106 C CA  . ARG A 424 ? 0.8415 0.8795 0.9188 -0.0963 0.1357  -0.2505 454 ARG A CA  
3107 C C   . ARG A 424 ? 0.9154 0.9877 0.9805 -0.0731 0.1300  -0.2387 454 ARG A C   
3108 O O   . ARG A 424 ? 0.9952 1.1468 1.0686 -0.0699 0.1351  -0.2560 454 ARG A O   
3109 C CB  . ARG A 424 ? 0.9269 0.9400 1.0429 -0.1183 0.1411  -0.2762 454 ARG A CB  
3110 C CG  . ARG A 424 ? 0.8942 0.8738 1.0285 -0.1422 0.1508  -0.2893 454 ARG A CG  
3111 C CD  . ARG A 424 ? 0.8692 0.8212 1.0427 -0.1614 0.1588  -0.3131 454 ARG A CD  
3112 N NE  . ARG A 424 ? 0.9982 1.0159 1.1928 -0.1651 0.1625  -0.3429 454 ARG A NE  
3113 C CZ  . ARG A 424 ? 1.0443 1.0523 1.2732 -0.1792 0.1692  -0.3672 454 ARG A CZ  
3114 N NH1 . ARG A 424 ? 1.1045 1.0373 1.3501 -0.1897 0.1741  -0.3634 454 ARG A NH1 
3115 N NH2 . ARG A 424 ? 0.9379 1.0140 1.1847 -0.1813 0.1718  -0.3947 454 ARG A NH2 
3116 N N   . ILE A 425 ? 0.8690 0.8841 0.9160 -0.0573 0.1205  -0.2095 455 ILE A N   
3117 C CA  . ILE A 425 ? 0.8503 0.8889 0.8833 -0.0340 0.1163  -0.1930 455 ILE A CA  
3118 C C   . ILE A 425 ? 0.8497 0.9275 0.8522 -0.0141 0.1195  -0.1746 455 ILE A C   
3119 O O   . ILE A 425 ? 0.7993 0.9399 0.7966 0.0029  0.1233  -0.1718 455 ILE A O   
3120 C CB  . ILE A 425 ? 0.7396 0.7027 0.7626 -0.0251 0.1066  -0.1685 455 ILE A CB  
3121 C CG1 . ILE A 425 ? 0.8258 0.7521 0.8775 -0.0418 0.1040  -0.1842 455 ILE A CG1 
3122 C CG2 . ILE A 425 ? 0.5263 0.5124 0.5347 -0.0012 0.1046  -0.1502 455 ILE A CG2 
3123 C CD1 . ILE A 425 ? 0.9314 0.7889 0.9739 -0.0347 0.0947  -0.1620 455 ILE A CD1 
3124 N N   . GLN A 426 ? 0.7984 0.8401 0.7809 -0.0150 0.1187  -0.1609 456 GLN A N   
3125 C CA  . GLN A 426 ? 0.6854 0.7590 0.6377 0.0034  0.1225  -0.1432 456 GLN A CA  
3126 C C   . GLN A 426 ? 0.7787 0.9390 0.7384 -0.0034 0.1318  -0.1665 456 GLN A C   
3127 O O   . GLN A 426 ? 0.9129 1.1230 0.8503 0.0136  0.1371  -0.1555 456 GLN A O   
3128 C CB  . GLN A 426 ? 0.6157 0.6249 0.5463 0.0031  0.1180  -0.1238 456 GLN A CB  
3129 C CG  . GLN A 426 ? 0.7397 0.7658 0.6359 0.0254  0.1212  -0.1004 456 GLN A CG  
3130 C CD  . GLN A 426 ? 0.9492 0.9320 0.8288 0.0199  0.1179  -0.0904 456 GLN A CD  
3131 O OE1 . GLN A 426 ? 0.9277 0.8639 0.7839 0.0334  0.1143  -0.0662 456 GLN A OE1 
3132 N NE2 . GLN A 426 ? 1.0852 1.0838 0.9784 -0.0007 0.1199  -0.1099 456 GLN A NE2 
3133 N N   . GLU A 427 ? 0.7070 0.8863 0.6986 -0.0286 0.1351  -0.1993 457 GLU A N   
3134 C CA  . GLU A 427 ? 0.8322 1.0998 0.8365 -0.0394 0.1450  -0.2282 457 GLU A CA  
3135 C C   . GLU A 427 ? 0.9526 1.3027 0.9705 -0.0295 0.1492  -0.2419 457 GLU A C   
3136 O O   . GLU A 427 ? 0.9814 1.4205 0.9924 -0.0201 0.1568  -0.2483 457 GLU A O   
3137 C CB  . GLU A 427 ? 0.9384 1.1881 0.9728 -0.0730 0.1496  -0.2594 457 GLU A CB  
3138 C CG  . GLU A 427 ? 1.1698 1.5106 1.2304 -0.0907 0.1612  -0.3000 457 GLU A CG  
3139 C CD  . GLU A 427 ? 1.4042 1.7589 1.5009 -0.1027 0.1632  -0.3273 457 GLU A CD  
3140 O OE1 . GLU A 427 ? 1.4875 1.7652 1.5968 -0.1088 0.1578  -0.3222 457 GLU A OE1 
3141 O OE2 . GLU A 427 ? 1.3915 1.8378 1.5042 -0.1055 0.1704  -0.3542 457 GLU A OE2 
3142 N N   . HIS A 428 ? 0.8800 1.2043 0.9166 -0.0305 0.1444  -0.2453 458 HIS A N   
3143 C CA  . HIS A 428 ? 0.9070 1.3062 0.9584 -0.0202 0.1471  -0.2566 458 HIS A CA  
3144 C C   . HIS A 428 ? 0.9098 1.3532 0.9321 0.0140  0.1491  -0.2259 458 HIS A C   
3145 O O   . HIS A 428 ? 0.9003 1.4401 0.9207 0.0239  0.1577  -0.2338 458 HIS A O   
3146 C CB  . HIS A 428 ? 0.9740 1.3247 1.0459 -0.0246 0.1398  -0.2592 458 HIS A CB  
3147 C CG  . HIS A 428 ? 1.0659 1.4942 1.1574 -0.0169 0.1419  -0.2744 458 HIS A CG  
3148 N ND1 . HIS A 428 ? 1.0609 1.5497 1.1868 -0.0373 0.1480  -0.3160 458 HIS A ND1 
3149 C CD2 . HIS A 428 ? 1.1283 1.5849 1.2113 0.0091  0.1397  -0.2536 458 HIS A CD2 
3150 C CE1 . HIS A 428 ? 1.0466 1.6018 1.1839 -0.0237 0.1480  -0.3206 458 HIS A CE1 
3151 N NE2 . HIS A 428 ? 1.0504 1.5874 1.1621 0.0050  0.1430  -0.2818 458 HIS A NE2 
3152 N N   . PHE A 429 ? 0.9358 1.3101 0.9364 0.0322  0.1428  -0.1910 459 PHE A N   
3153 C CA  . PHE A 429 ? 0.7744 1.1702 0.7446 0.0645  0.1474  -0.1574 459 PHE A CA  
3154 C C   . PHE A 429 ? 0.9579 1.3534 0.9030 0.0658  0.1514  -0.1491 459 PHE A C   
3155 O O   . PHE A 429 ? 1.0479 1.3945 0.9953 0.0440  0.1472  -0.1595 459 PHE A O   
3156 C CB  . PHE A 429 ? 0.5222 0.8347 0.4783 0.0788  0.1410  -0.1259 459 PHE A CB  
3157 C CG  . PHE A 429 ? 0.7328 1.0219 0.7133 0.0713  0.1340  -0.1350 459 PHE A CG  
3158 C CD1 . PHE A 429 ? 0.7233 1.0668 0.7125 0.0890  0.1371  -0.1302 459 PHE A CD1 
3159 C CD2 . PHE A 429 ? 0.7336 0.9486 0.7283 0.0481  0.1248  -0.1467 459 PHE A CD2 
3160 C CE1 . PHE A 429 ? 0.7166 1.0401 0.7275 0.0824  0.1300  -0.1383 459 PHE A CE1 
3161 C CE2 . PHE A 429 ? 0.6908 0.8856 0.7065 0.0423  0.1185  -0.1543 459 PHE A CE2 
3162 C CZ  . PHE A 429 ? 0.7416 0.9902 0.7651 0.0589  0.1204  -0.1508 459 PHE A CZ  
3163 N N   . ASN A 430 ? 1.0666 1.5181 0.9880 0.0923  0.1603  -0.1291 460 ASN A N   
3164 C CA  . ASN A 430 ? 1.0699 1.5292 0.9658 0.0958  0.1644  -0.1207 460 ASN A CA  
3165 C C   . ASN A 430 ? 1.0139 1.4024 0.8767 0.1175  0.1638  -0.0819 460 ASN A C   
3166 O O   . ASN A 430 ? 0.9373 1.3542 0.7731 0.1374  0.1716  -0.0633 460 ASN A O   
3167 C CB  . ASN A 430 ? 1.0963 1.6755 0.9877 0.1092  0.1766  -0.1283 460 ASN A CB  
3168 C CG  . ASN A 430 ? 1.2020 1.8575 1.1279 0.0858  0.1785  -0.1710 460 ASN A CG  
3169 O OD1 . ASN A 430 ? 1.2495 1.9786 1.1906 0.0964  0.1834  -0.1783 460 ASN A OD1 
3170 N ND2 . ASN A 430 ? 1.1913 1.8295 1.1318 0.0535  0.1758  -0.2000 460 ASN A ND2 
3171 N N   . LYS A 431 ? 1.0097 1.3081 0.8752 0.1131  0.1552  -0.0712 461 LYS A N   
3172 C CA  . LYS A 431 ? 1.0371 1.2626 0.8754 0.1299  0.1547  -0.0387 461 LYS A CA  
3173 C C   . LYS A 431 ? 1.0204 1.1552 0.8594 0.1078  0.1429  -0.0423 461 LYS A C   
3174 O O   . LYS A 431 ? 1.0078 1.1165 0.8715 0.0847  0.1349  -0.0622 461 LYS A O   
3175 C CB  . LYS A 431 ? 0.9618 1.1706 0.8007 0.1499  0.1580  -0.0184 461 LYS A CB  
3176 C CG  . LYS A 431 ? 1.0367 1.3413 0.8836 0.1697  0.1689  -0.0176 461 LYS A CG  
3177 C CD  . LYS A 431 ? 0.9835 1.2722 0.8236 0.1967  0.1765  0.0119  461 LYS A CD  
3178 C CE  . LYS A 431 ? 1.0752 1.3232 0.8826 0.2199  0.1864  0.0449  461 LYS A CE  
3179 N NZ  . LYS A 431 ? 1.0485 1.3603 0.8361 0.2340  0.1964  0.0499  461 LYS A NZ  
3180 N N   . LYS A 432 ? 0.9778 1.0675 0.7903 0.1160  0.1429  -0.0224 462 LYS A N   
3181 C CA  . LYS A 432 ? 1.0935 1.1093 0.9054 0.0968  0.1325  -0.0250 462 LYS A CA  
3182 C C   . LYS A 432 ? 0.9865 0.9233 0.8020 0.0944  0.1253  -0.0148 462 LYS A C   
3183 O O   . LYS A 432 ? 0.9654 0.8829 0.7687 0.1133  0.1298  0.0049  462 LYS A O   
3184 C CB  . LYS A 432 ? 1.0155 1.0197 0.7988 0.1046  0.1342  -0.0107 462 LYS A CB  
3185 C CG  . LYS A 432 ? 1.0334 0.9929 0.8222 0.0811  0.1246  -0.0206 462 LYS A CG  
3186 C CD  . LYS A 432 ? 1.1905 1.1229 0.9505 0.0901  0.1239  -0.0030 462 LYS A CD  
3187 C CE  . LYS A 432 ? 1.2271 1.1326 0.9955 0.0670  0.1156  -0.0139 462 LYS A CE  
3188 N NZ  . LYS A 432 ? 1.2415 1.1006 1.0376 0.0468  0.1080  -0.0254 462 LYS A NZ  
3189 N N   . ILE A 433 ? 0.8240 0.7171 0.6569 0.0712  0.1155  -0.0283 463 ILE A N   
3190 C CA  . ILE A 433 ? 0.7675 0.5869 0.6018 0.0669  0.1079  -0.0194 463 ILE A CA  
3191 C C   . ILE A 433 ? 0.7360 0.5077 0.5513 0.0653  0.1039  -0.0076 463 ILE A C   
3192 O O   . ILE A 433 ? 0.7931 0.5508 0.6165 0.0485  0.0986  -0.0169 463 ILE A O   
3193 C CB  . ILE A 433 ? 0.7969 0.5989 0.6615 0.0455  0.1008  -0.0384 463 ILE A CB  
3194 C CG1 . ILE A 433 ? 0.7695 0.6287 0.6545 0.0460  0.1048  -0.0538 463 ILE A CG1 
3195 C CG2 . ILE A 433 ? 0.8097 0.5447 0.6742 0.0438  0.0936  -0.0279 463 ILE A CG2 
3196 C CD1 . ILE A 433 ? 0.7845 0.6302 0.7001 0.0260  0.0995  -0.0740 463 ILE A CD1 
3197 N N   . GLU A 434 ? 0.7091 0.4576 0.5001 0.0835  0.1078  0.0129  464 GLU A N   
3198 C CA  . GLU A 434 ? 0.6749 0.3855 0.4457 0.0851  0.1053  0.0242  464 GLU A CA  
3199 C C   . GLU A 434 ? 0.7684 0.4208 0.5490 0.0688  0.0946  0.0216  464 GLU A C   
3200 O O   . GLU A 434 ? 0.8246 0.4475 0.6158 0.0654  0.0915  0.0212  464 GLU A O   
3201 C CB  . GLU A 434 ? 0.7785 0.4755 0.5239 0.1085  0.1145  0.0450  464 GLU A CB  
3202 C CG  . GLU A 434 ? 0.9737 0.6381 0.6966 0.1125  0.1134  0.0557  464 GLU A CG  
3203 C CD  . GLU A 434 ? 1.1317 0.7787 0.8320 0.1354  0.1255  0.0748  464 GLU A CD  
3204 O OE1 . GLU A 434 ? 1.1883 0.8467 0.8912 0.1483  0.1352  0.0814  464 GLU A OE1 
3205 O OE2 . GLU A 434 ? 1.0567 0.6786 0.7376 0.1409  0.1265  0.0833  464 GLU A OE2 
3206 N N   . ARG A 435 ? 0.8244 0.4648 0.6012 0.0598  0.0895  0.0207  465 ARG A N   
3207 C CA  . ARG A 435 ? 0.9394 0.5324 0.7246 0.0468  0.0805  0.0209  465 ARG A CA  
3208 C C   . ARG A 435 ? 0.8836 0.4333 0.6533 0.0559  0.0796  0.0338  465 ARG A C   
3209 O O   . ARG A 435 ? 0.8316 0.3794 0.5786 0.0704  0.0851  0.0447  465 ARG A O   
3210 C CB  . ARG A 435 ? 1.1059 0.7019 0.8895 0.0382  0.0769  0.0199  465 ARG A CB  
3211 C CG  . ARG A 435 ? 1.1604 0.7132 0.9494 0.0292  0.0689  0.0247  465 ARG A CG  
3212 C CD  . ARG A 435 ? 1.2472 0.7926 1.0659 0.0121  0.0662  0.0141  465 ARG A CD  
3213 N NE  . ARG A 435 ? 1.3997 0.9167 1.2237 0.0066  0.0600  0.0210  465 ARG A NE  
3214 C CZ  . ARG A 435 ? 1.3782 0.8926 1.2031 0.0019  0.0577  0.0260  465 ARG A CZ  
3215 N NH1 . ARG A 435 ? 1.3848 0.9186 1.2048 0.0003  0.0608  0.0242  465 ARG A NH1 
3216 N NH2 . ARG A 435 ? 1.3005 0.8119 1.1314 -0.0005 0.0528  0.0316  465 ARG A NH2 
3217 N N   . LEU A 436 ? 0.8985 0.4146 0.6810 0.0468  0.0737  0.0317  466 LEU A N   
3218 C CA  . LEU A 436 ? 0.9110 0.4167 0.6825 0.0494  0.0734  0.0367  466 LEU A CA  
3219 C C   . LEU A 436 ? 0.9081 0.4101 0.6860 0.0371  0.0645  0.0342  466 LEU A C   
3220 O O   . LEU A 436 ? 0.7460 0.2532 0.5440 0.0261  0.0592  0.0284  466 LEU A O   
3221 C CB  . LEU A 436 ? 0.8337 0.3403 0.6140 0.0500  0.0759  0.0343  466 LEU A CB  
3222 C CG  . LEU A 436 ? 0.7747 0.2680 0.5428 0.0542  0.0801  0.0386  466 LEU A CG  
3223 C CD1 . LEU A 436 ? 0.8492 0.3339 0.5948 0.0710  0.0915  0.0488  466 LEU A CD1 
3224 C CD2 . LEU A 436 ? 0.6320 0.1274 0.4118 0.0527  0.0818  0.0361  466 LEU A CD2 
3225 N N   . ASP A 437 ? 1.0235 0.5170 0.7849 0.0409  0.0638  0.0394  467 ASP A N   
3226 C CA  . ASP A 437 ? 1.0200 0.5112 0.7866 0.0326  0.0558  0.0388  467 ASP A CA  
3227 C C   . ASP A 437 ? 1.0774 0.5630 0.8480 0.0286  0.0539  0.0359  467 ASP A C   
3228 O O   . ASP A 437 ? 0.8817 0.3573 0.6401 0.0341  0.0595  0.0362  467 ASP A O   
3229 C CB  . ASP A 437 ? 1.0817 0.5671 0.8298 0.0385  0.0553  0.0446  467 ASP A CB  
3230 C CG  . ASP A 437 ? 1.2878 0.7746 1.0440 0.0312  0.0470  0.0459  467 ASP A CG  
3231 O OD1 . ASP A 437 ? 1.3386 0.8247 1.1061 0.0251  0.0432  0.0433  467 ASP A OD1 
3232 O OD2 . ASP A 437 ? 1.3683 0.8576 1.1193 0.0327  0.0446  0.0509  467 ASP A OD2 
3233 N N   . THR A 438 ? 1.3308 0.8215 1.1191 0.0197  0.0473  0.0337  468 THR A N   
3234 C CA  . THR A 438 ? 1.4383 0.9260 1.2323 0.0156  0.0449  0.0309  468 THR A CA  
3235 C C   . THR A 438 ? 1.3990 0.8735 1.1763 0.0184  0.0471  0.0309  468 THR A C   
3236 O O   . THR A 438 ? 1.2847 0.7524 1.0594 0.0183  0.0512  0.0278  468 THR A O   
3237 C CB  . THR A 438 ? 1.4377 0.9312 1.2497 0.0087  0.0382  0.0320  468 THR A CB  
3238 O OG1 . THR A 438 ? 1.4763 0.9779 1.3049 0.0054  0.0387  0.0317  468 THR A OG1 
3239 C CG2 . THR A 438 ? 1.2619 0.7550 1.0816 0.0051  0.0362  0.0291  468 THR A CG2 
3240 N N   . ASP A 439 ? 1.4271 0.8972 1.1945 0.0205  0.0452  0.0338  469 ASP A N   
3241 C CA  . ASP A 439 ? 1.5202 0.9763 1.2741 0.0217  0.0476  0.0318  469 ASP A CA  
3242 C C   . ASP A 439 ? 1.4569 0.8998 1.1915 0.0305  0.0578  0.0327  469 ASP A C   
3243 O O   . ASP A 439 ? 1.4890 0.9168 1.2164 0.0313  0.0657  0.0292  469 ASP A O   
3244 C CB  . ASP A 439 ? 1.6368 1.0943 1.3906 0.0202  0.0406  0.0346  469 ASP A CB  
3245 C CG  . ASP A 439 ? 1.6823 1.1516 1.4559 0.0142  0.0331  0.0371  469 ASP A CG  
3246 O OD1 . ASP A 439 ? 1.7115 1.1783 1.4884 0.0108  0.0301  0.0359  469 ASP A OD1 
3247 O OD2 . ASP A 439 ? 1.6521 1.1316 1.4383 0.0131  0.0317  0.0403  469 ASP A OD2 
3248 N N   . ASP A 440 ? 1.3904 0.8377 1.1172 0.0377  0.0592  0.0379  470 ASP A N   
3249 C CA  . ASP A 440 ? 1.4840 0.9202 1.1921 0.0494  0.0704  0.0414  470 ASP A CA  
3250 C C   . ASP A 440 ? 1.6683 1.1058 1.3795 0.0541  0.0790  0.0426  470 ASP A C   
3251 O O   . ASP A 440 ? 1.6871 1.1385 1.4048 0.0561  0.0776  0.0449  470 ASP A O   
3252 C CB  . ASP A 440 ? 1.4579 0.9010 1.1559 0.0568  0.0685  0.0478  470 ASP A CB  
3253 C CG  . ASP A 440 ? 1.5240 0.9630 1.2059 0.0716  0.0805  0.0543  470 ASP A CG  
3254 O OD1 . ASP A 440 ? 1.4294 0.8520 1.1013 0.0790  0.0924  0.0553  470 ASP A OD1 
3255 O OD2 . ASP A 440 ? 1.5982 1.0502 1.2783 0.0766  0.0792  0.0595  470 ASP A OD2 
3256 N N   . LEU A 441 ? 1.7554 1.1777 1.4630 0.0558  0.0887  0.0410  471 LEU A N   
3257 C CA  . LEU A 441 ? 1.7053 1.1284 1.4172 0.0613  0.0977  0.0437  471 LEU A CA  
3258 C C   . LEU A 441 ? 1.7295 1.1328 1.4257 0.0753  0.1161  0.0504  471 LEU A C   
3259 O O   . LEU A 441 ? 1.6466 1.0436 1.3467 0.0792  0.1264  0.0528  471 LEU A O   
3260 C CB  . LEU A 441 ? 1.5094 0.9346 1.2375 0.0500  0.0935  0.0372  471 LEU A CB  
3261 C CG  . LEU A 441 ? 1.2650 0.7103 1.0115 0.0396  0.0791  0.0331  471 LEU A CG  
3262 C CD1 . LEU A 441 ? 1.0794 0.5255 0.8390 0.0309  0.0762  0.0280  471 LEU A CD1 
3263 C CD2 . LEU A 441 ? 1.2717 0.7325 1.0243 0.0443  0.0785  0.0360  471 LEU A CD2 
3264 N N   . ASP A 442 ? 1.7430 1.1360 1.4220 0.0840  0.1212  0.0545  472 ASP A N   
3265 C CA  . ASP A 442 ? 1.6557 1.0281 1.3190 0.1000  0.1410  0.0628  472 ASP A CA  
3266 C C   . ASP A 442 ? 1.5376 0.9209 1.2001 0.1164  0.1514  0.0748  472 ASP A C   
3267 O O   . ASP A 442 ? 1.4898 0.8612 1.1392 0.1348  0.1696  0.0865  472 ASP A O   
3268 C CB  . ASP A 442 ? 1.6581 1.0219 1.3026 0.1086  0.1431  0.0662  472 ASP A CB  
3269 C CG  . ASP A 442 ? 1.6401 0.9942 1.2855 0.0946  0.1336  0.0552  472 ASP A CG  
3270 O OD1 . ASP A 442 ? 1.6038 0.9553 1.2628 0.0798  0.1283  0.0456  472 ASP A OD1 
3271 O OD2 . ASP A 442 ? 1.6197 0.9705 1.2521 0.0997  0.1314  0.0567  472 ASP A OD2 
3272 N N   . GLU B 24  ? 1.2729 1.2644 1.1131 0.4819  0.3053  0.2610  54  GLU B N   
3273 C CA  . GLU B 24  ? 1.3051 1.2152 1.1416 0.4454  0.3184  0.2346  54  GLU B CA  
3274 C C   . GLU B 24  ? 1.3763 1.3229 1.2391 0.3924  0.2733  0.2080  54  GLU B C   
3275 O O   . GLU B 24  ? 1.3903 1.3947 1.2651 0.3907  0.2597  0.2117  54  GLU B O   
3276 C CB  . GLU B 24  ? 1.3182 1.1905 1.1357 0.4756  0.3648  0.2483  54  GLU B CB  
3277 N N   . ASP B 25  ? 1.3934 1.3055 1.2627 0.3512  0.2526  0.1823  55  ASP B N   
3278 C CA  . ASP B 25  ? 1.2140 1.1489 1.1029 0.3035  0.2129  0.1586  55  ASP B CA  
3279 C C   . ASP B 25  ? 1.1225 1.1379 1.0293 0.2941  0.1729  0.1617  55  ASP B C   
3280 O O   . ASP B 25  ? 0.9655 0.9976 0.8848 0.2569  0.1427  0.1446  55  ASP B O   
3281 C CB  . ASP B 25  ? 1.0972 1.0309 0.9879 0.2907  0.2186  0.1520  55  ASP B CB  
3282 N N   . ARG B 26  ? 1.1408 1.2059 1.0460 0.3278  0.1758  0.1831  56  ARG B N   
3283 C CA  . ARG B 26  ? 0.9661 1.1140 0.8862 0.3169  0.1426  0.1833  56  ARG B CA  
3284 C C   . ARG B 26  ? 0.7869 0.9085 0.7119 0.2854  0.1201  0.1648  56  ARG B C   
3285 O O   . ARG B 26  ? 0.7152 0.8806 0.6520 0.2567  0.0910  0.1534  56  ARG B O   
3286 C CB  . ARG B 26  ? 1.0414 1.2579 0.9571 0.3634  0.1532  0.2110  56  ARG B CB  
3287 C CG  . ARG B 26  ? 1.1661 1.3988 1.0714 0.4098  0.1849  0.2362  56  ARG B CG  
3288 C CD  . ARG B 26  ? 1.2531 1.5824 1.1570 0.4554  0.1875  0.2643  56  ARG B CD  
3289 N NE  . ARG B 26  ? 1.3681 1.6874 1.2523 0.5166  0.2291  0.2963  56  ARG B NE  
3290 C CZ  . ARG B 26  ? 1.4897 1.7711 1.3665 0.5294  0.2553  0.3014  56  ARG B CZ  
3291 N NH1 . ARG B 26  ? 1.4243 1.6807 1.3131 0.4847  0.2417  0.2763  56  ARG B NH1 
3292 N NH2 . ARG B 26  ? 1.6181 1.8866 1.4732 0.5895  0.2975  0.3330  56  ARG B NH2 
3293 N N   . ALA B 27  ? 0.6786 0.7268 0.5926 0.2901  0.1370  0.1608  57  ALA B N   
3294 C CA  . ALA B 27  ? 0.6772 0.6991 0.5950 0.2656  0.1193  0.1447  57  ALA B CA  
3295 C C   . ALA B 27  ? 0.6456 0.6479 0.5733 0.2215  0.0949  0.1204  57  ALA B C   
3296 O O   . ALA B 27  ? 0.7697 0.7762 0.7041 0.1989  0.0723  0.1088  57  ALA B O   
3297 C CB  . ALA B 27  ? 0.6994 0.6495 0.6019 0.2806  0.1470  0.1447  57  ALA B CB  
3298 N N   . ALA B 28  ? 0.5287 0.5088 0.4551 0.2112  0.1015  0.1139  58  ALA B N   
3299 C CA  . ALA B 28  ? 0.5756 0.5406 0.5080 0.1747  0.0803  0.0947  58  ALA B CA  
3300 C C   . ALA B 28  ? 0.5595 0.5804 0.5003 0.1572  0.0560  0.0948  58  ALA B C   
3301 O O   . ALA B 28  ? 0.4671 0.4814 0.4105 0.1298  0.0356  0.0823  58  ALA B O   
3302 C CB  . ALA B 28  ? 0.5697 0.4977 0.4963 0.1686  0.0963  0.0870  58  ALA B CB  
3303 N N   . GLN B 29  ? 0.6503 0.7263 0.5933 0.1735  0.0612  0.1086  59  GLN B N   
3304 C CA  . GLN B 29  ? 0.6063 0.7425 0.5561 0.1538  0.0425  0.1058  59  GLN B CA  
3305 C C   . GLN B 29  ? 0.5448 0.7115 0.4983 0.1407  0.0260  0.1005  59  GLN B C   
3306 O O   . GLN B 29  ? 0.5279 0.7021 0.4821 0.1081  0.0100  0.0872  59  GLN B O   
3307 C CB  . GLN B 29  ? 0.6593 0.8592 0.6118 0.1765  0.0534  0.1210  59  GLN B CB  
3308 C CG  . GLN B 29  ? 0.7888 0.9596 0.7369 0.1867  0.0715  0.1249  59  GLN B CG  
3309 C CD  . GLN B 29  ? 0.8958 1.1325 0.8467 0.2125  0.0833  0.1411  59  GLN B CD  
3310 O OE1 . GLN B 29  ? 0.9430 1.2580 0.9002 0.2218  0.0759  0.1487  59  GLN B OE1 
3311 N NE2 . GLN B 29  ? 0.8449 1.0559 0.7910 0.2242  0.1027  0.1455  59  GLN B NE2 
3312 N N   . SER B 30  ? 0.5201 0.7002 0.4731 0.1657  0.0331  0.1108  60  SER B N   
3313 C CA  . SER B 30  ? 0.5128 0.7212 0.4687 0.1536  0.0193  0.1048  60  SER B CA  
3314 C C   . SER B 30  ? 0.5276 0.6748 0.4819 0.1235  0.0068  0.0868  60  SER B C   
3315 O O   . SER B 30  ? 0.6300 0.7932 0.5850 0.0960  -0.0067 0.0748  60  SER B O   
3316 C CB  . SER B 30  ? 0.6209 0.8413 0.5736 0.1890  0.0314  0.1203  60  SER B CB  
3317 O OG  . SER B 30  ? 0.9312 1.2159 0.8831 0.2231  0.0441  0.1408  60  SER B OG  
3318 N N   . LEU B 31  ? 0.4296 0.5084 0.3801 0.1288  0.0141  0.0842  61  LEU B N   
3319 C CA  . LEU B 31  ? 0.4102 0.4364 0.3592 0.1077  0.0037  0.0695  61  LEU B CA  
3320 C C   . LEU B 31  ? 0.4614 0.4797 0.4078 0.0786  -0.0088 0.0595  61  LEU B C   
3321 O O   . LEU B 31  ? 0.5507 0.5598 0.4943 0.0579  -0.0196 0.0504  61  LEU B O   
3322 C CB  . LEU B 31  ? 0.4858 0.4550 0.4316 0.1191  0.0161  0.0668  61  LEU B CB  
3323 C CG  . LEU B 31  ? 0.4580 0.3839 0.4034 0.1014  0.0054  0.0520  61  LEU B CG  
3324 C CD1 . LEU B 31  ? 0.4228 0.3534 0.3706 0.0970  -0.0039 0.0488  61  LEU B CD1 
3325 C CD2 . LEU B 31  ? 0.3705 0.2546 0.3132 0.1092  0.0200  0.0457  61  LEU B CD2 
3326 N N   . LEU B 32  ? 0.3470 0.3647 0.2915 0.0778  -0.0045 0.0619  62  LEU B N   
3327 C CA  . LEU B 32  ? 0.4011 0.4112 0.3393 0.0525  -0.0135 0.0549  62  LEU B CA  
3328 C C   . LEU B 32  ? 0.4207 0.4731 0.3575 0.0320  -0.0196 0.0508  62  LEU B C   
3329 O O   . LEU B 32  ? 0.5065 0.5365 0.4341 0.0080  -0.0253 0.0418  62  LEU B O   
3330 C CB  . LEU B 32  ? 0.3616 0.3742 0.2980 0.0550  -0.0068 0.0587  62  LEU B CB  
3331 C CG  . LEU B 32  ? 0.4490 0.4446 0.3751 0.0306  -0.0144 0.0527  62  LEU B CG  
3332 C CD1 . LEU B 32  ? 0.3237 0.2721 0.2420 0.0221  -0.0227 0.0463  62  LEU B CD1 
3333 C CD2 . LEU B 32  ? 0.3050 0.2952 0.2284 0.0331  -0.0081 0.0551  62  LEU B CD2 
3334 N N   . ASN B 33  ? 0.3909 0.5063 0.3347 0.0418  -0.0156 0.0570  63  ASN B N   
3335 C CA  . ASN B 33  ? 0.4682 0.6393 0.4115 0.0187  -0.0196 0.0491  63  ASN B CA  
3336 C C   . ASN B 33  ? 0.5506 0.7061 0.4902 0.0020  -0.0249 0.0383  63  ASN B C   
3337 O O   . ASN B 33  ? 0.6481 0.8002 0.5784 -0.0308 -0.0258 0.0247  63  ASN B O   
3338 C CB  . ASN B 33  ? 0.3589 0.6153 0.3116 0.0379  -0.0147 0.0589  63  ASN B CB  
3339 C CG  . ASN B 33  ? 0.4145 0.7028 0.3687 0.0391  -0.0096 0.0632  63  ASN B CG  
3340 O OD1 . ASN B 33  ? 0.5310 0.8173 0.4788 0.0084  -0.0120 0.0518  63  ASN B OD1 
3341 N ND2 . ASN B 33  ? 0.3199 0.6333 0.2800 0.0754  0.0003  0.0801  63  ASN B ND2 
3342 N N   . LYS B 34  ? 0.4144 0.5554 0.3592 0.0233  -0.0253 0.0437  64  LYS B N   
3343 C CA  . LYS B 34  ? 0.3191 0.4381 0.2609 0.0099  -0.0298 0.0337  64  LYS B CA  
3344 C C   . LYS B 34  ? 0.4185 0.4639 0.3494 -0.0083 -0.0324 0.0248  64  LYS B C   
3345 O O   . LYS B 34  ? 0.5939 0.6244 0.5160 -0.0324 -0.0323 0.0131  64  LYS B O   
3346 C CB  . LYS B 34  ? 0.3848 0.4975 0.3332 0.0384  -0.0282 0.0421  64  LYS B CB  
3347 C CG  . LYS B 34  ? 0.2735 0.4625 0.2273 0.0512  -0.0261 0.0487  64  LYS B CG  
3348 C CD  . LYS B 34  ? 0.7533 0.9275 0.7090 0.0835  -0.0204 0.0602  64  LYS B CD  
3349 C CE  . LYS B 34  ? 0.8216 1.0755 0.7794 0.0972  -0.0191 0.0680  64  LYS B CE  
3350 N NZ  . LYS B 34  ? 0.8004 1.0807 0.7577 0.0654  -0.0281 0.0506  64  LYS B NZ  
3351 N N   . LEU B 35  ? 0.4443 0.4458 0.3737 0.0041  -0.0325 0.0303  65  LEU B N   
3352 C CA  . LEU B 35  ? 0.3676 0.3083 0.2856 -0.0057 -0.0350 0.0255  65  LEU B CA  
3353 C C   . LEU B 35  ? 0.4714 0.4018 0.3729 -0.0331 -0.0313 0.0200  65  LEU B C   
3354 O O   . LEU B 35  ? 0.5698 0.4519 0.4566 -0.0433 -0.0291 0.0161  65  LEU B O   
3355 C CB  . LEU B 35  ? 0.3078 0.2181 0.2279 0.0132  -0.0358 0.0312  65  LEU B CB  
3356 C CG  . LEU B 35  ? 0.4415 0.3403 0.3717 0.0338  -0.0350 0.0315  65  LEU B CG  
3357 C CD1 . LEU B 35  ? 0.4606 0.3388 0.3918 0.0455  -0.0319 0.0322  65  LEU B CD1 
3358 C CD2 . LEU B 35  ? 0.2987 0.1697 0.2268 0.0294  -0.0397 0.0247  65  LEU B CD2 
3359 N N   . ILE B 36  ? 0.5986 0.5727 0.5004 -0.0439 -0.0279 0.0199  66  ILE B N   
3360 C CA  . ILE B 36  ? 0.5628 0.5254 0.4463 -0.0730 -0.0205 0.0129  66  ILE B CA  
3361 C C   . ILE B 36  ? 0.5772 0.5794 0.4556 -0.1047 -0.0130 -0.0021 66  ILE B C   
3362 O O   . ILE B 36  ? 0.7451 0.7305 0.6042 -0.1351 -0.0016 -0.0122 66  ILE B O   
3363 C CB  . ILE B 36  ? 0.5154 0.4953 0.3986 -0.0710 -0.0193 0.0190  66  ILE B CB  
3364 C CG1 . ILE B 36  ? 0.4679 0.5271 0.3681 -0.0649 -0.0195 0.0207  66  ILE B CG1 
3365 C CG2 . ILE B 36  ? 0.4365 0.3790 0.3219 -0.0457 -0.0243 0.0298  66  ILE B CG2 
3366 C CD1 . ILE B 36  ? 0.4515 0.5322 0.3520 -0.0640 -0.0166 0.0256  66  ILE B CD1 
3367 N N   . ARG B 37  ? 0.6218 0.6771 0.5153 -0.0988 -0.0171 -0.0046 67  ARG B N   
3368 C CA  . ARG B 37  ? 0.6765 0.7837 0.5671 -0.1299 -0.0106 -0.0216 67  ARG B CA  
3369 C C   . ARG B 37  ? 0.6770 0.7244 0.5475 -0.1579 0.0001  -0.0362 67  ARG B C   
3370 O O   . ARG B 37  ? 0.5974 0.5990 0.4685 -0.1436 -0.0034 -0.0327 67  ARG B O   
3371 C CB  . ARG B 37  ? 0.8117 0.9862 0.7211 -0.1106 -0.0181 -0.0178 67  ARG B CB  
3372 C CG  . ARG B 37  ? 0.6795 0.9449 0.6034 -0.0950 -0.0208 -0.0096 67  ARG B CG  
3373 C CD  . ARG B 37  ? 0.3711 0.7267 0.2941 -0.1278 -0.0158 -0.0274 67  ARG B CD  
3374 N NE  . ARG B 37  ? 0.4267 0.8592 0.3591 -0.1177 -0.0161 -0.0205 67  ARG B NE  
3375 C CZ  . ARG B 37  ? 0.5761 1.0377 0.5013 -0.1502 -0.0088 -0.0345 67  ARG B CZ  
3376 N NH1 . ARG B 37  ? 0.6017 1.0171 0.5071 -0.1962 0.0024  -0.0562 67  ARG B NH1 
3377 N NH2 . ARG B 37  ? 0.7793 1.3147 0.7152 -0.1363 -0.0096 -0.0267 67  ARG B NH2 
3378 N N   . SER B 38  ? 0.8144 0.8612 0.6655 -0.1988 0.0162  -0.0535 68  SER B N   
3379 C CA  . SER B 38  ? 1.0061 0.9908 0.8328 -0.2288 0.0341  -0.0690 68  SER B CA  
3380 C C   . SER B 38  ? 1.0719 1.1194 0.8990 -0.2649 0.0431  -0.0933 68  SER B C   
3381 O O   . SER B 38  ? 1.0686 1.0802 0.8859 -0.2783 0.0523  -0.1042 68  SER B O   
3382 C CB  . SER B 38  ? 1.0570 0.9765 0.8529 -0.2522 0.0541  -0.0728 68  SER B CB  
3383 O OG  . SER B 38  ? 1.0307 1.0069 0.8283 -0.2695 0.0565  -0.0782 68  SER B OG  
3384 N N   . ASN B 39  ? 1.0214 1.1689 0.8602 -0.2799 0.0407  -0.1024 69  ASN B N   
3385 C CA  . ASN B 39  ? 0.8980 1.1258 0.7370 -0.3184 0.0496  -0.1285 69  ASN B CA  
3386 C C   . ASN B 39  ? 0.6729 1.0353 0.5358 -0.3101 0.0366  -0.1274 69  ASN B C   
3387 O O   . ASN B 39  ? 0.6662 1.0511 0.5447 -0.2731 0.0227  -0.1052 69  ASN B O   
3388 C CB  . ASN B 39  ? 1.0344 1.2265 0.8413 -0.3777 0.0804  -0.1578 69  ASN B CB  
3389 C CG  . ASN B 39  ? 1.2176 1.3617 1.0080 -0.3833 0.0903  -0.1522 69  ASN B CG  
3390 O OD1 . ASN B 39  ? 1.2323 1.4364 1.0386 -0.3683 0.0777  -0.1422 69  ASN B OD1 
3391 N ND2 . ASN B 39  ? 1.3042 1.3377 1.0605 -0.4030 0.1150  -0.1572 69  ASN B ND2 
3392 N N   . LEU B 40  ? 0.6126 1.0671 0.4771 -0.3438 0.0429  -0.1515 70  LEU B N   
3393 C CA  . LEU B 40  ? 0.5345 1.1331 0.4202 -0.3350 0.0319  -0.1509 70  LEU B CA  
3394 C C   . LEU B 40  ? 0.5993 1.2324 0.4865 -0.3386 0.0340  -0.1489 70  LEU B C   
3395 O O   . LEU B 40  ? 0.6398 1.2209 0.5059 -0.3781 0.0521  -0.1660 70  LEU B O   
3396 C CB  . LEU B 40  ? 0.7460 1.4435 0.6277 -0.3845 0.0432  -0.1852 70  LEU B CB  
3397 C CG  . LEU B 40  ? 0.7654 1.4580 0.6444 -0.3946 0.0448  -0.1963 70  LEU B CG  
3398 C CD1 . LEU B 40  ? 0.6150 1.3457 0.5171 -0.3333 0.0207  -0.1652 70  LEU B CD1 
3399 C CD2 . LEU B 40  ? 0.9312 1.4728 0.7861 -0.4132 0.0613  -0.2033 70  LEU B CD2 
3400 N N   . VAL B 41  ? 0.6700 1.3885 0.5799 -0.2964 0.0181  -0.1273 71  VAL B N   
3401 C CA  . VAL B 41  ? 0.7987 1.5783 0.7133 -0.3008 0.0201  -0.1279 71  VAL B CA  
3402 C C   . VAL B 41  ? 0.7591 1.6829 0.6767 -0.3423 0.0275  -0.1574 71  VAL B C   
3403 O O   . VAL B 41  ? 0.6481 1.6882 0.5832 -0.3194 0.0167  -0.1511 71  VAL B O   
3404 C CB  . VAL B 41  ? 0.8878 1.6958 0.8234 -0.2357 0.0042  -0.0917 71  VAL B CB  
3405 C CG1 . VAL B 41  ? 0.8739 1.7449 0.8253 -0.1926 -0.0077 -0.0736 71  VAL B CG1 
3406 C CG2 . VAL B 41  ? 0.8738 1.7777 0.8173 -0.2400 0.0065  -0.0945 71  VAL B CG2 
3407 N N   . ASP B 42  ? 1.0128 1.9305 0.9113 -0.4039 0.0480  -0.1901 72  ASP B N   
3408 C CA  . ASP B 42  ? 1.1345 2.1881 1.0324 -0.4564 0.0597  -0.2269 72  ASP B CA  
3409 C C   . ASP B 42  ? 1.0065 2.2260 0.9320 -0.4229 0.0439  -0.2145 72  ASP B C   
3410 O O   . ASP B 42  ? 0.9179 2.1373 0.8555 -0.3794 0.0338  -0.1871 72  ASP B O   
3411 C CB  . ASP B 42  ? 1.2658 2.2781 1.1372 -0.5235 0.0878  -0.2608 72  ASP B CB  
3412 C CG  . ASP B 42  ? 1.3333 2.3327 1.2078 -0.5062 0.0852  -0.2453 72  ASP B CG  
3413 O OD1 . ASP B 42  ? 1.4190 2.4702 1.2836 -0.5551 0.1029  -0.2737 72  ASP B OD1 
3414 O OD2 . ASP B 42  ? 1.3416 2.2806 1.2278 -0.4466 0.0674  -0.2070 72  ASP B OD2 
3415 N N   . ASN B 43  ? 0.8565 2.2207 0.7905 -0.4424 0.0432  -0.2349 73  ASN B N   
3416 C CA  . ASN B 43  ? 0.7619 2.2997 0.7204 -0.4070 0.0294  -0.2222 73  ASN B CA  
3417 C C   . ASN B 43  ? 0.8455 2.5519 0.8049 -0.4626 0.0384  -0.2644 73  ASN B C   
3418 O O   . ASN B 43  ? 0.8555 2.5890 0.8102 -0.4846 0.0405  -0.2814 73  ASN B O   
3419 C CB  . ASN B 43  ? 0.6691 2.2157 0.6445 -0.3262 0.0084  -0.1771 73  ASN B CB  
3420 C CG  . ASN B 43  ? 0.5745 2.2789 0.5716 -0.2735 -0.0030 -0.1532 73  ASN B CG  
3421 O OD1 . ASN B 43  ? 0.5241 2.3775 0.5276 -0.3023 0.0010  -0.1766 73  ASN B OD1 
3422 N ND2 . ASN B 43  ? 0.5705 2.2436 0.5774 -0.1953 -0.0145 -0.1068 73  ASN B ND2 
3423 N N   . THR B 44  ? 0.8905 2.7150 0.8561 -0.4872 0.0445  -0.2831 74  THR B N   
3424 C CA  . THR B 44  ? 0.9298 2.9266 0.8956 -0.5488 0.0558  -0.3298 74  THR B CA  
3425 C C   . THR B 44  ? 0.8168 3.0135 0.8077 -0.5014 0.0361  -0.3132 74  THR B C   
3426 O O   . THR B 44  ? 0.8820 3.2306 0.8741 -0.5460 0.0418  -0.3494 74  THR B O   
3427 C CB  . THR B 44  ? 0.9924 3.0397 0.9520 -0.6046 0.0742  -0.3636 74  THR B CB  
3428 O OG1 . THR B 44  ? 0.8780 2.9665 0.8576 -0.5442 0.0591  -0.3277 74  THR B OG1 
3429 C CG2 . THR B 44  ? 1.0939 2.9542 1.0211 -0.6620 0.1005  -0.3864 74  THR B CG2 
3430 N N   . ASN B 45  ? 0.7499 2.9468 0.7583 -0.4108 0.0157  -0.2587 75  ASN B N   
3431 C CA  . ASN B 45  ? 0.7210 3.0917 0.7490 -0.3505 -0.0008 -0.2327 75  ASN B CA  
3432 C C   . ASN B 45  ? 0.7213 3.1409 0.7457 -0.3596 -0.0049 -0.2425 75  ASN B C   
3433 O O   . ASN B 45  ? 0.7528 3.0270 0.7626 -0.3799 -0.0006 -0.2482 75  ASN B O   
3434 C CB  . ASN B 45  ? 0.6698 2.9827 0.7089 -0.2502 -0.0147 -0.1697 75  ASN B CB  
3435 C CG  . ASN B 45  ? 0.5663 2.9113 0.6156 -0.2265 -0.0131 -0.1560 75  ASN B CG  
3436 O OD1 . ASN B 45  ? 0.5549 2.8458 0.6105 -0.1524 -0.0187 -0.1095 75  ASN B OD1 
3437 N ND2 . ASN B 45  ? 0.4967 2.9286 0.5460 -0.2914 -0.0026 -0.1982 75  ASN B ND2 
3438 N N   . GLN B 46  ? 0.6295 3.2592 0.6667 -0.3425 -0.0129 -0.2435 76  GLN B N   
3439 C CA  . GLN B 46  ? 0.6059 3.3024 0.6409 -0.3402 -0.0190 -0.2469 76  GLN B CA  
3440 C C   . GLN B 46  ? 0.5323 3.1712 0.5719 -0.2402 -0.0345 -0.1838 76  GLN B C   
3441 O O   . GLN B 46  ? 0.4876 3.1045 0.5354 -0.1693 -0.0400 -0.1395 76  GLN B O   
3442 C CB  . GLN B 46  ? 0.7111 3.6701 0.7564 -0.3632 -0.0207 -0.2747 76  GLN B CB  
3443 C CG  . GLN B 46  ? 0.7350 3.8589 0.7988 -0.2696 -0.0369 -0.2261 76  GLN B CG  
3444 C CD  . GLN B 46  ? 0.7534 4.1468 0.8261 -0.2859 -0.0410 -0.2505 76  GLN B CD  
3445 O OE1 . GLN B 46  ? 0.5721 4.0995 0.6489 -0.3546 -0.0317 -0.3000 76  GLN B OE1 
3446 N NE2 . GLN B 46  ? 0.7963 4.2745 0.8707 -0.2228 -0.0536 -0.2163 76  GLN B NE2 
3447 N N   . VAL B 47  ? 0.4228 3.0334 0.4550 -0.2369 -0.0384 -0.1815 77  VAL B N   
3448 C CA  . VAL B 47  ? 0.3889 2.9335 0.4208 -0.1493 -0.0490 -0.1258 77  VAL B CA  
3449 C C   . VAL B 47  ? 0.4797 3.2235 0.5190 -0.0891 -0.0587 -0.0987 77  VAL B C   
3450 O O   . VAL B 47  ? 0.6090 3.4957 0.6479 -0.1263 -0.0605 -0.1282 77  VAL B O   
3451 C CB  . VAL B 47  ? 0.4665 2.8513 0.4848 -0.1724 -0.0471 -0.1337 77  VAL B CB  
3452 C CG1 . VAL B 47  ? 0.3522 2.7253 0.3690 -0.0924 -0.0564 -0.0855 77  VAL B CG1 
3453 C CG2 . VAL B 47  ? 0.6005 2.7654 0.6107 -0.1944 -0.0395 -0.1369 77  VAL B CG2 
3454 N N   . GLU B 48  ? 0.5387 3.2908 0.5823 0.0047  -0.0625 -0.0422 78  GLU B N   
3455 C CA  . GLU B 48  ? 0.6622 3.5878 0.7082 0.0779  -0.0686 -0.0057 78  GLU B CA  
3456 C C   . GLU B 48  ? 0.7357 3.6007 0.7687 0.1092  -0.0715 0.0161  78  GLU B C   
3457 O O   . GLU B 48  ? 0.8342 3.5018 0.8583 0.0996  -0.0685 0.0186  78  GLU B O   
3458 C CB  . GLU B 48  ? 0.8407 3.7792 0.8906 0.1711  -0.0650 0.0497  78  GLU B CB  
3459 C CG  . GLU B 48  ? 1.0411 4.0337 1.1043 0.1471  -0.0618 0.0323  78  GLU B CG  
3460 C CD  . GLU B 48  ? 1.1060 4.1080 1.1719 0.2420  -0.0555 0.0880  78  GLU B CD  
3461 O OE1 . GLU B 48  ? 1.0954 3.9621 1.1627 0.2418  -0.0485 0.0935  78  GLU B OE1 
3462 O OE2 . GLU B 48  ? 1.0544 4.1987 1.1191 0.3179  -0.0554 0.1270  78  GLU B OE2 
3463 N N   . VAL B 49  ? 0.7592 3.8004 0.7908 0.1469  -0.0771 0.0317  79  VAL B N   
3464 C CA  . VAL B 49  ? 0.8577 3.8608 0.8755 0.1769  -0.0792 0.0522  79  VAL B CA  
3465 C C   . VAL B 49  ? 0.8455 3.9735 0.8563 0.2832  -0.0788 0.1123  79  VAL B C   
3466 O O   . VAL B 49  ? 0.7180 3.9698 0.7356 0.3313  -0.0771 0.1358  79  VAL B O   
3467 C CB  . VAL B 49  ? 0.9347 4.0230 0.9516 0.0928  -0.0844 -0.0027 79  VAL B CB  
3468 C CG1 . VAL B 49  ? 0.9047 3.8780 0.9072 0.1045  -0.0849 0.0095  79  VAL B CG1 
3469 C CG2 . VAL B 49  ? 0.9483 3.9721 0.9706 -0.0142 -0.0790 -0.0660 79  VAL B CG2 
3470 N N   . LEU B 50  ? 0.9318 4.0244 0.9270 0.3221  -0.0783 0.1384  80  LEU B N   
3471 C CA  . LEU B 50  ? 0.9766 4.1693 0.9582 0.4275  -0.0735 0.1995  80  LEU B CA  
3472 C C   . LEU B 50  ? 1.0071 4.1478 0.9697 0.4484  -0.0728 0.2159  80  LEU B C   
3473 O O   . LEU B 50  ? 1.0792 4.0607 1.0245 0.5074  -0.0601 0.2583  80  LEU B O   
3474 C CB  . LEU B 50  ? 1.0063 4.0890 0.9806 0.5128  -0.0574 0.2549  80  LEU B CB  
3475 C CG  . LEU B 50  ? 0.9926 4.2104 0.9545 0.6256  -0.0464 0.3183  80  LEU B CG  
3476 C CD1 . LEU B 50  ? 1.0295 4.1729 0.9926 0.6776  -0.0306 0.3506  80  LEU B CD1 
3477 C CD2 . LEU B 50  ? 0.9255 4.0923 0.8590 0.6993  -0.0347 0.3670  80  LEU B CD2 
3478 N N   . GLN B 51  ? 0.9526 4.2275 0.9173 0.3962  -0.0843 0.1795  81  GLN B N   
3479 C CA  . GLN B 51  ? 0.8934 4.1496 0.8402 0.4161  -0.0845 0.1941  81  GLN B CA  
3480 C C   . GLN B 51  ? 0.8645 4.2117 0.7913 0.5340  -0.0759 0.2645  81  GLN B C   
3481 O O   . GLN B 51  ? 0.8157 4.2425 0.7432 0.5991  -0.0693 0.3007  81  GLN B O   
3482 C CB  . GLN B 51  ? 0.8394 4.2454 0.7925 0.3341  -0.0971 0.1381  81  GLN B CB  
3483 C CG  . GLN B 51  ? 0.8217 4.0679 0.7772 0.2377  -0.0979 0.0841  81  GLN B CG  
3484 C CD  . GLN B 51  ? 0.7056 3.9542 0.6786 0.1386  -0.0987 0.0213  81  GLN B CD  
3485 O OE1 . GLN B 51  ? 0.5925 3.9678 0.5777 0.1362  -0.1002 0.0143  81  GLN B OE1 
3486 N NE2 . GLN B 51  ? 0.6651 3.7725 0.6373 0.0571  -0.0953 -0.0245 81  GLN B NE2 
3487 N N   . ARG B 52  ? 0.8643 4.1966 0.7710 0.5633  -0.0736 0.2851  82  ARG B N   
3488 C CA  . ARG B 52  ? 0.8324 4.2578 0.7144 0.6750  -0.0626 0.3523  82  ARG B CA  
3489 C C   . ARG B 52  ? 0.7259 4.4312 0.6091 0.6735  -0.0768 0.3423  82  ARG B C   
3490 O O   . ARG B 52  ? 0.6343 4.4045 0.5270 0.5892  -0.0913 0.2881  82  ARG B O   
3491 C CB  . ARG B 52  ? 0.7968 4.0362 0.6511 0.7179  -0.0473 0.3872  82  ARG B CB  
3492 N N   . ASP B 53  ? 0.8142 4.6882 0.6869 0.7673  -0.0707 0.3941  83  ASP B N   
3493 C CA  . ASP B 53  ? 0.8979 5.0602 0.7703 0.7794  -0.0837 0.3917  83  ASP B CA  
3494 C C   . ASP B 53  ? 0.9156 5.2438 0.8204 0.6693  -0.1041 0.3147  83  ASP B C   
3495 O O   . ASP B 53  ? 0.8837 5.3297 0.7924 0.6021  -0.1170 0.2692  83  ASP B O   
3496 C CB  . ASP B 53  ? 0.7989 4.9686 0.6484 0.7887  -0.0849 0.4010  83  ASP B CB  
3497 N N   . TYR B 59  ? 0.7328 3.9339 0.7082 -0.2923 -0.0702 -0.2494 89  TYR B N   
3498 C CA  . TYR B 59  ? 0.7955 3.7712 0.7601 -0.3315 -0.0599 -0.2658 89  TYR B CA  
3499 C C   . TYR B 59  ? 0.8116 3.5940 0.7775 -0.3481 -0.0508 -0.2682 89  TYR B C   
3500 O O   . TYR B 59  ? 0.7143 3.4005 0.6853 -0.2766 -0.0586 -0.2187 89  TYR B O   
3501 C CB  . TYR B 59  ? 0.7593 3.6421 0.7173 -0.2564 -0.0698 -0.2152 89  TYR B CB  
3502 N N   . SER B 60  ? 0.8787 3.6050 0.8373 -0.4429 -0.0313 -0.3260 90  SER B N   
3503 C CA  . SER B 60  ? 0.8847 3.4299 0.8405 -0.4651 -0.0199 -0.3319 90  SER B CA  
3504 C C   . SER B 60  ? 0.9525 3.3815 0.8904 -0.5618 0.0066  -0.3893 90  SER B C   
3505 O O   . SER B 60  ? 0.9317 3.4705 0.8620 -0.6420 0.0241  -0.4448 90  SER B O   
3506 C CB  . SER B 60  ? 0.9059 3.5491 0.8723 -0.4658 -0.0201 -0.3343 90  SER B CB  
3507 O OG  . SER B 60  ? 1.0176 3.8033 0.9800 -0.5541 -0.0038 -0.3960 90  SER B OG  
3508 N N   . VAL B 61  ? 1.0388 3.2469 0.9682 -0.5535 0.0122  -0.3761 91  VAL B N   
3509 C CA  . VAL B 61  ? 1.1598 3.2343 1.0686 -0.6323 0.0400  -0.4221 91  VAL B CA  
3510 C C   . VAL B 61  ? 1.1681 3.1533 1.0666 -0.6802 0.0615  -0.4464 91  VAL B C   
3511 O O   . VAL B 61  ? 1.2909 3.2809 1.2003 -0.6433 0.0509  -0.4205 91  VAL B O   
3512 C CB  . VAL B 61  ? 1.2276 3.1121 1.1307 -0.5984 0.0369  -0.3961 91  VAL B CB  
3513 C CG1 . VAL B 61  ? 1.3112 3.1059 1.1920 -0.6768 0.0664  -0.4450 91  VAL B CG1 
3514 C CG2 . VAL B 61  ? 1.1454 3.0947 1.0603 -0.5268 0.0119  -0.3549 91  VAL B CG2 
3515 N N   . LYS B 62  ? 1.1160 3.0152 0.9906 -0.7618 0.0946  -0.4957 92  LYS B N   
3516 C CA  . LYS B 62  ? 1.1172 2.9218 0.9748 -0.8131 0.1220  -0.5218 92  LYS B CA  
3517 C C   . LYS B 62  ? 1.0626 2.6422 0.8951 -0.8367 0.1473  -0.5295 92  LYS B C   
3518 O O   . LYS B 62  ? 1.1439 2.6272 0.9530 -0.8886 0.1791  -0.5567 92  LYS B O   
3519 C CB  . LYS B 62  ? 1.1642 3.1152 1.0105 -0.9037 0.1489  -0.5844 92  LYS B CB  
3520 C CG  . LYS B 62  ? 1.0621 3.2467 0.9328 -0.8824 0.1260  -0.5789 92  LYS B CG  
3521 C CD  . LYS B 62  ? 0.9992 3.1614 0.8847 -0.8269 0.1090  -0.5393 92  LYS B CD  
3522 C CE  . LYS B 62  ? 1.0074 3.4023 0.9172 -0.7963 0.0867  -0.5289 92  LYS B CE  
3523 N NZ  . LYS B 62  ? 0.9499 3.3251 0.8729 -0.7471 0.0740  -0.4940 92  LYS B NZ  
3524 N N   . SER B 63  ? 0.9530 2.4506 0.7887 -0.7960 0.1349  -0.5043 93  SER B N   
3525 C CA  . SER B 63  ? 1.0415 2.3343 0.8555 -0.8077 0.1564  -0.5065 93  SER B CA  
3526 C C   . SER B 63  ? 1.0543 2.2788 0.8823 -0.7375 0.1302  -0.4636 93  SER B C   
3527 O O   . SER B 63  ? 0.9467 2.2875 0.7933 -0.7016 0.1051  -0.4465 93  SER B O   
3528 C CB  . SER B 63  ? 1.1260 2.4051 0.9105 -0.8992 0.1991  -0.5668 93  SER B CB  
3529 O OG  . SER B 63  ? 1.0486 2.4519 0.8410 -0.9112 0.1910  -0.5826 93  SER B OG  
3530 N N   . PHE B 64  ? 1.1769 2.2158 0.9944 -0.7172 0.1375  -0.4459 94  PHE B N   
3531 C CA  . PHE B 64  ? 1.2351 2.1999 1.0642 -0.6564 0.1162  -0.4096 94  PHE B CA  
3532 C C   . PHE B 64  ? 1.4079 2.3910 1.2288 -0.6885 0.1274  -0.4358 94  PHE B C   
3533 O O   . PHE B 64  ? 1.3930 2.4232 1.2295 -0.6463 0.1040  -0.4136 94  PHE B O   
3534 C CB  . PHE B 64  ? 1.1905 1.9644 1.0109 -0.6271 0.1213  -0.3857 94  PHE B CB  
3535 C CG  . PHE B 64  ? 0.9688 1.7238 0.8065 -0.5651 0.0963  -0.3427 94  PHE B CG  
3536 C CD1 . PHE B 64  ? 0.9601 1.6038 0.7856 -0.5659 0.1082  -0.3364 94  PHE B CD1 
3537 C CD2 . PHE B 64  ? 0.7917 1.6389 0.6550 -0.5058 0.0641  -0.3086 94  PHE B CD2 
3538 C CE1 . PHE B 64  ? 0.8800 1.5093 0.7209 -0.5123 0.0864  -0.2995 94  PHE B CE1 
3539 C CE2 . PHE B 64  ? 0.6930 1.5183 0.5699 -0.4518 0.0458  -0.2716 94  PHE B CE2 
3540 C CZ  . PHE B 64  ? 0.7581 1.4768 0.6250 -0.4569 0.0560  -0.2684 94  PHE B CZ  
3541 N N   . GLU B 65  ? 1.5893 2.5317 1.3832 -0.7644 0.1662  -0.4836 95  GLU B N   
3542 C CA  . GLU B 65  ? 1.6742 2.6299 1.4569 -0.8046 0.1828  -0.5149 95  GLU B CA  
3543 C C   . GLU B 65  ? 1.5514 2.7027 1.3518 -0.8030 0.1611  -0.5207 95  GLU B C   
3544 O O   . GLU B 65  ? 1.5517 2.7144 1.3569 -0.7875 0.1518  -0.5155 95  GLU B O   
3545 C CB  . GLU B 65  ? 1.8145 2.7160 1.5616 -0.8954 0.2349  -0.5715 95  GLU B CB  
3546 C CG  . GLU B 65  ? 1.9014 2.6127 1.6241 -0.9034 0.2642  -0.5756 95  GLU B CG  
3547 C CD  . GLU B 65  ? 1.9293 2.6547 1.6542 -0.9075 0.2630  -0.5856 95  GLU B CD  
3548 O OE1 . GLU B 65  ? 2.0237 2.6649 1.7200 -0.9607 0.3042  -0.6213 95  GLU B OE1 
3549 O OE2 . GLU B 65  ? 1.8516 2.6694 1.6044 -0.8577 0.2236  -0.5578 95  GLU B OE2 
3550 N N   . GLU B 66  ? 1.4075 2.7162 1.2171 -0.8169 0.1533  -0.5304 96  GLU B N   
3551 C CA  . GLU B 66  ? 1.1969 2.7126 1.0205 -0.8180 0.1355  -0.5382 96  GLU B CA  
3552 C C   . GLU B 66  ? 1.0097 2.5647 0.8568 -0.7274 0.0954  -0.4826 96  GLU B C   
3553 O O   . GLU B 66  ? 0.8052 2.5045 0.6597 -0.7193 0.0820  -0.4833 96  GLU B O   
3554 C CB  . GLU B 66  ? 1.1311 2.8078 0.9603 -0.8454 0.1356  -0.5569 96  GLU B CB  
3555 N N   . LEU B 67  ? 0.9982 2.4246 0.8545 -0.6604 0.0789  -0.4354 97  LEU B N   
3556 C CA  . LEU B 67  ? 0.9450 2.3918 0.8198 -0.5741 0.0464  -0.3819 97  LEU B CA  
3557 C C   . LEU B 67  ? 1.0339 2.4534 0.9061 -0.5631 0.0433  -0.3789 97  LEU B C   
3558 O O   . LEU B 67  ? 1.0146 2.5094 0.8972 -0.5081 0.0215  -0.3467 97  LEU B O   
3559 C CB  . LEU B 67  ? 0.8607 2.1682 0.7432 -0.5155 0.0351  -0.3394 97  LEU B CB  
3560 C CG  . LEU B 67  ? 0.9373 2.2927 0.8274 -0.5040 0.0301  -0.3287 97  LEU B CG  
3561 C CD1 . LEU B 67  ? 1.0409 2.2307 0.9313 -0.4730 0.0293  -0.3032 97  LEU B CD1 
3562 C CD2 . LEU B 67  ? 0.8346 2.3444 0.7415 -0.4455 0.0057  -0.2950 97  LEU B CD2 
3563 N N   . ARG B 68  ? 1.0165 2.3255 0.8724 -0.6141 0.0676  -0.4116 98  ARG B N   
3564 C CA  . ARG B 68  ? 1.0378 2.3062 0.8903 -0.6085 0.0675  -0.4120 98  ARG B CA  
3565 C C   . ARG B 68  ? 0.9312 2.0929 0.7959 -0.5284 0.0456  -0.3602 98  ARG B C   
3566 O O   . ARG B 68  ? 0.8716 2.0953 0.7454 -0.4784 0.0255  -0.3309 98  ARG B O   
3567 C CB  . ARG B 68  ? 1.2118 2.6641 1.0666 -0.6205 0.0595  -0.4251 98  ARG B CB  
3568 C CG  . ARG B 68  ? 1.3792 2.8044 1.2229 -0.6535 0.0724  -0.4506 98  ARG B CG  
3569 C CD  . ARG B 68  ? 1.3530 2.7580 1.2062 -0.5834 0.0488  -0.4078 98  ARG B CD  
3570 N NE  . ARG B 68  ? 1.2379 2.8282 1.0978 -0.5537 0.0290  -0.3916 98  ARG B NE  
3571 C CZ  . ARG B 68  ? 0.9950 2.6061 0.8575 -0.5020 0.0131  -0.3605 98  ARG B CZ  
3572 N NH1 . ARG B 68  ? 0.8814 2.3419 0.7428 -0.4782 0.0137  -0.3455 98  ARG B NH1 
3573 N NH2 . ARG B 68  ? 0.9253 2.7110 0.7901 -0.4727 -0.0022 -0.3440 98  ARG B NH2 
3574 N N   . LEU B 69  ? 0.9001 1.9028 0.7623 -0.5177 0.0523  -0.3499 99  LEU B N   
3575 C CA  . LEU B 69  ? 0.8387 1.7290 0.7110 -0.4511 0.0360  -0.3077 99  LEU B CA  
3576 C C   . LEU B 69  ? 0.9035 1.6622 0.7665 -0.4664 0.0503  -0.3207 99  LEU B C   
3577 O O   . LEU B 69  ? 0.9750 1.6843 0.8212 -0.5246 0.0772  -0.3577 99  LEU B O   
3578 C CB  . LEU B 69  ? 0.8380 1.6499 0.7148 -0.4253 0.0323  -0.2862 99  LEU B CB  
3579 C CG  . LEU B 69  ? 0.7758 1.6930 0.6615 -0.4095 0.0212  -0.2728 99  LEU B CG  
3580 C CD1 . LEU B 69  ? 0.6548 1.4679 0.5421 -0.3909 0.0214  -0.2560 99  LEU B CD1 
3581 C CD2 . LEU B 69  ? 0.8146 1.8316 0.7136 -0.3480 -0.0019 -0.2362 99  LEU B CD2 
3582 N N   . LYS B 70  ? 0.8802 1.5792 0.7522 -0.4140 0.0355  -0.2906 100 LYS B N   
3583 C CA  . LYS B 70  ? 0.9326 1.5128 0.7986 -0.4207 0.0467  -0.2994 100 LYS B CA  
3584 C C   . LYS B 70  ? 0.9582 1.4078 0.8130 -0.4436 0.0671  -0.3121 100 LYS B C   
3585 O O   . LYS B 70  ? 0.9388 1.3510 0.7972 -0.4226 0.0619  -0.2944 100 LYS B O   
3586 C CB  . LYS B 70  ? 0.9392 1.4734 0.8178 -0.3569 0.0273  -0.2628 100 LYS B CB  
3587 C CG  . LYS B 70  ? 0.9690 1.5436 0.8601 -0.3000 0.0066  -0.2236 100 LYS B CG  
3588 C CD  . LYS B 70  ? 0.8965 1.6266 0.7895 -0.2887 -0.0039 -0.2154 100 LYS B CD  
3589 C CE  . LYS B 70  ? 0.6739 1.4683 0.5735 -0.2607 -0.0139 -0.1929 100 LYS B CE  
3590 N NZ  . LYS B 70  ? 0.4712 1.4336 0.3707 -0.2554 -0.0210 -0.1891 100 LYS B NZ  
3591 N N   . PRO B 71  ? 1.0733 1.4522 0.9120 -0.4853 0.0926  -0.3418 101 PRO B N   
3592 C CA  . PRO B 71  ? 1.2028 1.4579 1.0232 -0.5107 0.1202  -0.3562 101 PRO B CA  
3593 C C   . PRO B 71  ? 1.2075 1.3668 1.0356 -0.4596 0.1083  -0.3219 101 PRO B C   
3594 O O   . PRO B 71  ? 1.2065 1.3251 1.0235 -0.4723 0.1209  -0.3242 101 PRO B O   
3595 C CB  . PRO B 71  ? 1.2537 1.4352 1.0619 -0.5322 0.1413  -0.3768 101 PRO B CB  
3596 C CG  . PRO B 71  ? 1.1861 1.4426 1.0113 -0.5066 0.1175  -0.3658 101 PRO B CG  
3597 C CD  . PRO B 71  ? 1.0626 1.4678 0.8973 -0.5066 0.0992  -0.3614 101 PRO B CD  
3598 N N   . GLN B 72  ? 1.1478 1.2746 0.9929 -0.4055 0.0863  -0.2926 102 GLN B N   
3599 C CA  . GLN B 72  ? 1.1924 1.2369 1.0452 -0.3593 0.0754  -0.2632 102 GLN B CA  
3600 C C   . GLN B 72  ? 1.0621 1.1557 0.9227 -0.3422 0.0610  -0.2451 102 GLN B C   
3601 O O   . GLN B 72  ? 1.0219 1.0518 0.8772 -0.3346 0.0658  -0.2366 102 GLN B O   
3602 C CB  . GLN B 72  ? 1.1590 1.1729 1.0286 -0.3099 0.0564  -0.2399 102 GLN B CB  
3603 C CG  . GLN B 72  ? 1.1716 1.2575 1.0480 -0.3097 0.0479  -0.2440 102 GLN B CG  
3604 C CD  . GLN B 72  ? 1.3106 1.3392 1.1792 -0.3288 0.0636  -0.2636 102 GLN B CD  
3605 O OE1 . GLN B 72  ? 1.3495 1.4148 1.2064 -0.3735 0.0795  -0.2920 102 GLN B OE1 
3606 N NE2 . GLN B 72  ? 1.2990 1.2411 1.1740 -0.2963 0.0605  -0.2504 102 GLN B NE2 
3607 N N   . LEU B 73  ? 0.9312 1.1397 0.8032 -0.3336 0.0445  -0.2379 103 LEU B N   
3608 C CA  . LEU B 73  ? 0.8824 1.1470 0.7627 -0.3140 0.0314  -0.2196 103 LEU B CA  
3609 C C   . LEU B 73  ? 0.9177 1.1873 0.7837 -0.3582 0.0491  -0.2407 103 LEU B C   
3610 O O   . LEU B 73  ? 0.9370 1.1688 0.8031 -0.3441 0.0470  -0.2272 103 LEU B O   
3611 C CB  . LEU B 73  ? 0.7740 1.1692 0.6653 -0.2964 0.0151  -0.2087 103 LEU B CB  
3612 C CG  . LEU B 73  ? 0.6812 1.1512 0.5800 -0.2770 0.0041  -0.1912 103 LEU B CG  
3613 C CD1 . LEU B 73  ? 0.7641 1.1470 0.6695 -0.2371 -0.0033 -0.1647 103 LEU B CD1 
3614 C CD2 . LEU B 73  ? 0.6825 1.2709 0.5900 -0.2453 -0.0104 -0.1728 103 LEU B CD2 
3615 N N   . LEU B 74  ? 0.9766 1.2936 0.8287 -0.4145 0.0685  -0.2757 104 LEU B N   
3616 C CA  . LEU B 74  ? 1.0509 1.3724 0.8852 -0.4654 0.0916  -0.3019 104 LEU B CA  
3617 C C   . LEU B 74  ? 1.1258 1.3013 0.9424 -0.4675 0.1117  -0.3003 104 LEU B C   
3618 O O   . LEU B 74  ? 1.3386 1.4931 1.1469 -0.4751 0.1191  -0.2986 104 LEU B O   
3619 C CB  . LEU B 74  ? 1.1555 1.5411 0.9744 -0.5311 0.1150  -0.3453 104 LEU B CB  
3620 C CG  . LEU B 74  ? 1.3056 1.7474 1.1083 -0.5915 0.1381  -0.3784 104 LEU B CG  
3621 C CD1 . LEU B 74  ? 1.2406 1.8057 1.0617 -0.5701 0.1139  -0.3619 104 LEU B CD1 
3622 C CD2 . LEU B 74  ? 1.3316 1.8384 1.1189 -0.6587 0.1629  -0.4247 104 LEU B CD2 
3623 N N   . GLN B 75  ? 1.0182 1.0959 0.8283 -0.4578 0.1208  -0.2994 105 GLN B N   
3624 C CA  . GLN B 75  ? 1.0610 1.0020 0.8519 -0.4533 0.1418  -0.2952 105 GLN B CA  
3625 C C   . GLN B 75  ? 1.0543 0.9613 0.8556 -0.4057 0.1226  -0.2615 105 GLN B C   
3626 O O   . GLN B 75  ? 1.0664 0.9036 0.8489 -0.4128 0.1403  -0.2603 105 GLN B O   
3627 C CB  . GLN B 75  ? 1.1197 0.9786 0.9079 -0.4377 0.1485  -0.2937 105 GLN B CB  
3628 C CG  . GLN B 75  ? 1.3109 1.0323 1.0762 -0.4290 0.1737  -0.2882 105 GLN B CG  
3629 C CD  . GLN B 75  ? 1.4853 1.1370 1.2514 -0.4068 0.1777  -0.2843 105 GLN B CD  
3630 O OE1 . GLN B 75  ? 1.4847 1.1828 1.2629 -0.4128 0.1693  -0.2942 105 GLN B OE1 
3631 N NE2 . GLN B 75  ? 1.5226 1.0668 1.2752 -0.3794 0.1910  -0.2689 105 GLN B NE2 
3632 N N   . GLY B 76  ? 0.9542 0.9091 0.7829 -0.3583 0.0893  -0.2348 106 GLY B N   
3633 C CA  . GLY B 76  ? 0.8025 0.7314 0.6426 -0.3136 0.0711  -0.2046 106 GLY B CA  
3634 C C   . GLY B 76  ? 0.9478 0.9353 0.7878 -0.3250 0.0685  -0.2033 106 GLY B C   
3635 O O   . GLY B 76  ? 0.9479 0.8899 0.7849 -0.3074 0.0668  -0.1879 106 GLY B O   
3636 N N   . VAL B 77  ? 0.9223 1.0176 0.7656 -0.3539 0.0679  -0.2198 107 VAL B N   
3637 C CA  . VAL B 77  ? 0.7274 0.8920 0.5699 -0.3717 0.0683  -0.2241 107 VAL B CA  
3638 C C   . VAL B 77  ? 0.9005 0.9982 0.7145 -0.4171 0.0997  -0.2461 107 VAL B C   
3639 O O   . VAL B 77  ? 1.0754 1.1636 0.8847 -0.4164 0.1014  -0.2392 107 VAL B O   
3640 C CB  . VAL B 77  ? 0.6776 0.9844 0.5283 -0.3954 0.0633  -0.2403 107 VAL B CB  
3641 C CG1 . VAL B 77  ? 0.6773 1.0513 0.5204 -0.4330 0.0739  -0.2577 107 VAL B CG1 
3642 C CG2 . VAL B 77  ? 0.6469 1.0257 0.5224 -0.3414 0.0339  -0.2103 107 VAL B CG2 
3643 N N   . TYR B 78  ? 0.9755 1.0213 0.7676 -0.4567 0.1277  -0.2726 108 TYR B N   
3644 C CA  . TYR B 78  ? 1.1363 1.0986 0.8942 -0.4990 0.1657  -0.2932 108 TYR B CA  
3645 C C   . TYR B 78  ? 1.0755 0.9107 0.8225 -0.4602 0.1692  -0.2664 108 TYR B C   
3646 O O   . TYR B 78  ? 1.1369 0.9081 0.8577 -0.4782 0.1940  -0.2704 108 TYR B O   
3647 C CB  . TYR B 78  ? 1.2492 1.1821 0.9833 -0.5506 0.2000  -0.3290 108 TYR B CB  
3648 C CG  . TYR B 78  ? 1.3981 1.4427 1.1263 -0.6142 0.2147  -0.3683 108 TYR B CG  
3649 C CD1 . TYR B 78  ? 1.4176 1.6099 1.1730 -0.6071 0.1850  -0.3647 108 TYR B CD1 
3650 C CD2 . TYR B 78  ? 1.6178 1.6240 1.3119 -0.6812 0.2609  -0.4099 108 TYR B CD2 
3651 C CE1 . TYR B 78  ? 1.5623 1.8737 1.3135 -0.6643 0.1973  -0.4015 108 TYR B CE1 
3652 C CE2 . TYR B 78  ? 1.7578 1.8771 1.4464 -0.7448 0.2757  -0.4506 108 TYR B CE2 
3653 C CZ  . TYR B 78  ? 1.7218 2.0002 1.4404 -0.7357 0.2419  -0.4463 108 TYR B CZ  
3654 O OH  . TYR B 78  ? 1.7800 2.1874 1.4945 -0.7979 0.2555  -0.4875 108 TYR B OH  
3655 N N   . ALA B 79  ? 1.0056 0.8094 0.7716 -0.4072 0.1455  -0.2394 109 ALA B N   
3656 C CA  . ALA B 79  ? 1.1108 0.8099 0.8693 -0.3664 0.1458  -0.2138 109 ALA B CA  
3657 C C   . ALA B 79  ? 1.0663 0.7791 0.8336 -0.3394 0.1281  -0.1908 109 ALA B C   
3658 O O   . ALA B 79  ? 1.1884 0.8221 0.9371 -0.3266 0.1401  -0.1783 109 ALA B O   
3659 C CB  . ALA B 79  ? 1.1992 0.8744 0.9767 -0.3229 0.1265  -0.1968 109 ALA B CB  
3660 N N   . MET B 80  ? 0.8698 0.6830 0.6635 -0.3288 0.1013  -0.1841 110 MET B N   
3661 C CA  . MET B 80  ? 0.9564 0.7875 0.7593 -0.3046 0.0857  -0.1638 110 MET B CA  
3662 C C   . MET B 80  ? 1.1252 0.9900 0.9126 -0.3460 0.1024  -0.1805 110 MET B C   
3663 O O   . MET B 80  ? 1.1373 1.0667 0.9389 -0.3363 0.0868  -0.1712 110 MET B O   
3664 C CB  . MET B 80  ? 0.9368 0.8461 0.7728 -0.2659 0.0529  -0.1447 110 MET B CB  
3665 C CG  . MET B 80  ? 0.8680 0.8783 0.7173 -0.2807 0.0459  -0.1574 110 MET B CG  
3666 S SD  . MET B 80  ? 1.0750 1.1201 0.9530 -0.2256 0.0173  -0.1319 110 MET B SD  
3667 C CE  . MET B 80  ? 0.4671 0.5079 0.3565 -0.1857 0.0023  -0.1040 110 MET B CE  
3668 N N   . GLY B 81  ? 1.2546 1.0727 1.0109 -0.3934 0.1373  -0.2063 111 GLY B N   
3669 C CA  . GLY B 81  ? 1.3392 1.1709 1.0739 -0.4390 0.1610  -0.2260 111 GLY B CA  
3670 C C   . GLY B 81  ? 1.2235 1.1929 0.9748 -0.4691 0.1517  -0.2450 111 GLY B C   
3671 O O   . GLY B 81  ? 1.4119 1.4162 1.1567 -0.4915 0.1589  -0.2527 111 GLY B O   
3672 N N   . PHE B 82  ? 0.8804 0.9327 0.6522 -0.4684 0.1364  -0.2521 112 PHE B N   
3673 C CA  . PHE B 82  ? 0.8776 1.0755 0.6651 -0.4920 0.1271  -0.2684 112 PHE B CA  
3674 C C   . PHE B 82  ? 1.0621 1.2949 0.8271 -0.5650 0.1601  -0.3144 112 PHE B C   
3675 O O   . PHE B 82  ? 0.9435 1.1217 0.6933 -0.5866 0.1793  -0.3312 112 PHE B O   
3676 C CB  . PHE B 82  ? 0.8565 1.1364 0.6758 -0.4487 0.0942  -0.2490 112 PHE B CB  
3677 C CG  . PHE B 82  ? 0.8259 1.1080 0.6679 -0.3858 0.0650  -0.2098 112 PHE B CG  
3678 C CD1 . PHE B 82  ? 0.9313 1.1328 0.7668 -0.3674 0.0660  -0.1928 112 PHE B CD1 
3679 C CD2 . PHE B 82  ? 0.8687 1.2298 0.7356 -0.3448 0.0398  -0.1899 112 PHE B CD2 
3680 C CE1 . PHE B 82  ? 0.8324 1.0364 0.6875 -0.3140 0.0422  -0.1604 112 PHE B CE1 
3681 C CE2 . PHE B 82  ? 0.8052 1.1595 0.6891 -0.2898 0.0193  -0.1561 112 PHE B CE2 
3682 C CZ  . PHE B 82  ? 0.6954 0.9725 0.5742 -0.2767 0.0205  -0.1431 112 PHE B CZ  
3683 N N   . ASN B 83  ? 1.1831 1.5096 0.9457 -0.6048 0.1684  -0.3366 113 ASN B N   
3684 C CA  . ASN B 83  ? 1.1753 1.5511 0.9161 -0.6818 0.2022  -0.3858 113 ASN B CA  
3685 C C   . ASN B 83  ? 1.1300 1.6827 0.8954 -0.6923 0.1829  -0.4000 113 ASN B C   
3686 O O   . ASN B 83  ? 1.2905 1.8717 1.0575 -0.7043 0.1841  -0.4137 113 ASN B O   
3687 C CB  . ASN B 83  ? 1.3416 1.7040 1.0585 -0.7275 0.2305  -0.4068 113 ASN B CB  
3688 C CG  . ASN B 83  ? 1.5051 1.9156 1.1958 -0.8150 0.2716  -0.4631 113 ASN B CG  
3689 O OD1 . ASN B 83  ? 1.4578 1.9582 1.1454 -0.8567 0.2818  -0.4879 113 ASN B OD1 
3690 N ND2 . ASN B 83  ? 1.6754 2.0284 1.3462 -0.8457 0.2974  -0.4859 113 ASN B ND2 
3691 N N   . ARG B 84  ? 1.0901 1.7646 0.8736 -0.6852 0.1655  -0.3953 114 ARG B N   
3692 C CA  . ARG B 84  ? 1.0490 1.9058 0.8567 -0.6830 0.1446  -0.4014 114 ARG B CA  
3693 C C   . ARG B 84  ? 0.9388 1.8428 0.7786 -0.6005 0.1035  -0.3513 114 ARG B C   
3694 O O   . ARG B 84  ? 0.9792 1.7895 0.8226 -0.5569 0.0934  -0.3192 114 ARG B O   
3695 C CB  . ARG B 84  ? 1.2333 2.2164 1.0356 -0.7414 0.1606  -0.4384 114 ARG B CB  
3696 C CG  . ARG B 84  ? 1.4286 2.3913 1.1971 -0.8334 0.2069  -0.4959 114 ARG B CG  
3697 C CD  . ARG B 84  ? 1.4869 2.6315 1.2590 -0.8884 0.2150  -0.5353 114 ARG B CD  
3698 N NE  . ARG B 84  ? 1.5502 2.7672 1.3425 -0.8526 0.1925  -0.5109 114 ARG B NE  
3699 C CZ  . ARG B 84  ? 1.6368 3.0428 1.4460 -0.8673 0.1827  -0.5263 114 ARG B CZ  
3700 N NH1 . ARG B 84  ? 1.6450 3.1950 1.4536 -0.9185 0.1923  -0.5671 114 ARG B NH1 
3701 N NH2 . ARG B 84  ? 1.6564 3.1133 1.4831 -0.8301 0.1639  -0.5013 114 ARG B NH2 
3702 N N   . PRO B 85  ? 0.8748 1.9252 0.7352 -0.5786 0.0825  -0.3445 115 PRO B N   
3703 C CA  . PRO B 85  ? 0.8429 1.9520 0.7293 -0.5025 0.0504  -0.2986 115 PRO B CA  
3704 C C   . PRO B 85  ? 0.8650 2.0251 0.7576 -0.4984 0.0481  -0.2928 115 PRO B C   
3705 O O   . PRO B 85  ? 0.8706 2.0484 0.7489 -0.5587 0.0699  -0.3280 115 PRO B O   
3706 C CB  . PRO B 85  ? 0.7724 2.0456 0.6714 -0.4946 0.0378  -0.3016 115 PRO B CB  
3707 C CG  . PRO B 85  ? 0.7228 1.9775 0.6050 -0.5529 0.0575  -0.3405 115 PRO B CG  
3708 C CD  . PRO B 85  ? 0.8027 1.9642 0.6604 -0.6201 0.0898  -0.3773 115 PRO B CD  
3709 N N   . SER B 86  ? 0.7953 1.9746 0.7069 -0.4294 0.0253  -0.2501 116 SER B N   
3710 C CA  . SER B 86  ? 0.7239 1.9518 0.6429 -0.4189 0.0222  -0.2413 116 SER B CA  
3711 C C   . SER B 86  ? 0.7271 2.1519 0.6631 -0.4014 0.0102  -0.2375 116 SER B C   
3712 O O   . SER B 86  ? 0.7271 2.2316 0.6709 -0.3744 -0.0009 -0.2264 116 SER B O   
3713 C CB  . SER B 86  ? 0.6392 1.7583 0.5660 -0.3555 0.0090  -0.1978 116 SER B CB  
3714 O OG  . SER B 86  ? 0.5319 1.6712 0.4729 -0.2893 -0.0093 -0.1613 116 SER B OG  
3715 N N   . LYS B 87  ? 0.7316 2.2372 0.6722 -0.4148 0.0132  -0.2456 117 LYS B N   
3716 C CA  . LYS B 87  ? 0.7261 2.4310 0.6828 -0.3972 0.0032  -0.2424 117 LYS B CA  
3717 C C   . LYS B 87  ? 0.7792 2.5343 0.7508 -0.3118 -0.0178 -0.1939 117 LYS B C   
3718 O O   . LYS B 87  ? 0.7913 2.7108 0.7711 -0.2967 -0.0251 -0.1920 117 LYS B O   
3719 C CB  . LYS B 87  ? 0.7041 2.4580 0.6665 -0.4020 0.0061  -0.2441 117 LYS B CB  
3720 C CG  . LYS B 87  ? 0.7387 2.4956 0.6849 -0.4919 0.0306  -0.2974 117 LYS B CG  
3721 C CD  . LYS B 87  ? 0.7273 2.5824 0.6824 -0.4968 0.0319  -0.3019 117 LYS B CD  
3722 C CE  . LYS B 87  ? 0.8028 2.6631 0.7384 -0.5913 0.0608  -0.3583 117 LYS B CE  
3723 N NZ  . LYS B 87  ? 0.7297 2.6834 0.6735 -0.6000 0.0632  -0.3653 117 LYS B NZ  
3724 N N   . ILE B 88  ? 0.7388 2.3548 0.7115 -0.2564 -0.0249 -0.1553 118 ILE B N   
3725 C CA  . ILE B 88  ? 0.6557 2.2956 0.6371 -0.1757 -0.0382 -0.1089 118 ILE B CA  
3726 C C   . ILE B 88  ? 0.6789 2.2836 0.6540 -0.1727 -0.0407 -0.1087 118 ILE B C   
3727 O O   . ILE B 88  ? 0.6433 2.3212 0.6218 -0.1219 -0.0485 -0.0816 118 ILE B O   
3728 C CB  . ILE B 88  ? 0.5990 2.1115 0.5829 -0.1193 -0.0408 -0.0699 118 ILE B CB  
3729 C CG1 . ILE B 88  ? 0.4259 1.9717 0.4144 -0.0361 -0.0474 -0.0226 118 ILE B CG1 
3730 C CG2 . ILE B 88  ? 0.8075 2.1333 0.7815 -0.1400 -0.0366 -0.0768 118 ILE B CG2 
3731 C CD1 . ILE B 88  ? 0.3122 2.0342 0.3094 0.0008  -0.0500 -0.0056 118 ILE B CD1 
3732 N N   . GLN B 89  ? 0.6414 2.1320 0.6051 -0.2255 -0.0320 -0.1377 119 GLN B N   
3733 C CA  . GLN B 89  ? 0.5577 2.0090 0.5150 -0.2315 -0.0323 -0.1433 119 GLN B CA  
3734 C C   . GLN B 89  ? 0.6218 2.2260 0.5769 -0.2755 -0.0291 -0.1762 119 GLN B C   
3735 O O   . GLN B 89  ? 0.6183 2.2741 0.5736 -0.2538 -0.0356 -0.1667 119 GLN B O   
3736 C CB  . GLN B 89  ? 0.5839 1.8614 0.5286 -0.2703 -0.0214 -0.1623 119 GLN B CB  
3737 C CG  . GLN B 89  ? 0.6482 1.7759 0.5948 -0.2227 -0.0265 -0.1291 119 GLN B CG  
3738 C CD  . GLN B 89  ? 0.6382 1.6141 0.5719 -0.2616 -0.0146 -0.1481 119 GLN B CD  
3739 O OE1 . GLN B 89  ? 0.5506 1.5169 0.4710 -0.3225 0.0006  -0.1849 119 GLN B OE1 
3740 N NE2 . GLN B 89  ? 0.6526 1.5103 0.5877 -0.2259 -0.0188 -0.1231 119 GLN B NE2 
3741 N N   . GLU B 90  ? 0.6490 2.3273 0.6005 -0.3400 -0.0173 -0.2166 120 GLU B N   
3742 C CA  . GLU B 90  ? 0.6425 2.4778 0.5913 -0.3924 -0.0111 -0.2556 120 GLU B CA  
3743 C C   . GLU B 90  ? 0.5876 2.5921 0.5483 -0.3356 -0.0284 -0.2273 120 GLU B C   
3744 O O   . GLU B 90  ? 0.7153 2.8353 0.6733 -0.3606 -0.0279 -0.2485 120 GLU B O   
3745 C CB  . GLU B 90  ? 0.7240 2.6375 0.6691 -0.4605 0.0046  -0.2986 120 GLU B CB  
3746 C CG  . GLU B 90  ? 0.8629 2.6249 0.7876 -0.5314 0.0301  -0.3362 120 GLU B CG  
3747 C CD  . GLU B 90  ? 1.0786 2.9125 0.9957 -0.6007 0.0502  -0.3796 120 GLU B CD  
3748 O OE1 . GLU B 90  ? 1.1355 3.1239 1.0675 -0.5856 0.0403  -0.3750 120 GLU B OE1 
3749 O OE2 . GLU B 90  ? 1.1793 2.9131 1.0736 -0.6696 0.0785  -0.4183 120 GLU B OE2 
3750 N N   . ASN B 91  ? 0.5700 2.5869 0.5414 -0.2577 -0.0412 -0.1786 121 ASN B N   
3751 C CA  . ASN B 91  ? 0.6074 2.7640 0.5854 -0.1889 -0.0541 -0.1416 121 ASN B CA  
3752 C C   . ASN B 91  ? 0.6132 2.6539 0.5871 -0.1182 -0.0601 -0.0951 121 ASN B C   
3753 O O   . ASN B 91  ? 0.6921 2.8139 0.6633 -0.0777 -0.0660 -0.0737 121 ASN B O   
3754 C CB  . ASN B 91  ? 0.6988 2.9704 0.6883 -0.1462 -0.0588 -0.1181 121 ASN B CB  
3755 C CG  . ASN B 91  ? 0.8805 3.2762 0.8745 -0.2166 -0.0519 -0.1653 121 ASN B CG  
3756 O OD1 . ASN B 91  ? 0.9307 3.2343 0.9226 -0.2625 -0.0420 -0.1889 121 ASN B OD1 
3757 N ND2 . ASN B 91  ? 0.8570 3.4675 0.8559 -0.2256 -0.0556 -0.1798 121 ASN B ND2 
3758 N N   . ALA B 92  ? 0.4551 2.3094 0.4271 -0.1051 -0.0571 -0.0809 122 ALA B N   
3759 C CA  . ALA B 92  ? 0.5131 2.2480 0.4806 -0.0425 -0.0595 -0.0401 122 ALA B CA  
3760 C C   . ALA B 92  ? 0.7188 2.3897 0.6779 -0.0669 -0.0587 -0.0555 122 ALA B C   
3761 O O   . ALA B 92  ? 0.9075 2.5705 0.8615 -0.0175 -0.0614 -0.0263 122 ALA B O   
3762 C CB  . ALA B 92  ? 0.5826 2.1518 0.5513 -0.0264 -0.0560 -0.0248 122 ALA B CB  
3763 N N   . LEU B 93  ? 0.7134 2.3341 0.6687 -0.1425 -0.0519 -0.1009 123 LEU B N   
3764 C CA  . LEU B 93  ? 0.7230 2.2695 0.6699 -0.1694 -0.0486 -0.1182 123 LEU B CA  
3765 C C   . LEU B 93  ? 0.5890 2.2768 0.5328 -0.1703 -0.0524 -0.1241 123 LEU B C   
3766 O O   . LEU B 93  ? 0.5401 2.1856 0.4789 -0.1415 -0.0553 -0.1071 123 LEU B O   
3767 C CB  . LEU B 93  ? 0.7179 2.1688 0.6574 -0.2472 -0.0350 -0.1637 123 LEU B CB  
3768 C CG  . LEU B 93  ? 0.5657 1.8526 0.5047 -0.2405 -0.0314 -0.1539 123 LEU B CG  
3769 C CD1 . LEU B 93  ? 0.4631 1.6435 0.3893 -0.3083 -0.0144 -0.1933 123 LEU B CD1 
3770 C CD2 . LEU B 93  ? 0.4836 1.6623 0.4255 -0.1755 -0.0396 -0.1133 123 LEU B CD2 
3771 N N   . PRO B 94  ? 0.6338 2.4957 0.5800 -0.2044 -0.0519 -0.1492 124 PRO B N   
3772 C CA  . PRO B 94  ? 0.5879 2.6046 0.5310 -0.2031 -0.0565 -0.1542 124 PRO B CA  
3773 C C   . PRO B 94  ? 0.6284 2.6861 0.5707 -0.1097 -0.0671 -0.0971 124 PRO B C   
3774 O O   . PRO B 94  ? 0.7187 2.7712 0.6530 -0.0935 -0.0689 -0.0881 124 PRO B O   
3775 C CB  . PRO B 94  ? 0.5811 2.7870 0.5296 -0.2441 -0.0549 -0.1845 124 PRO B CB  
3776 C CG  . PRO B 94  ? 0.6250 2.7382 0.5738 -0.3020 -0.0426 -0.2166 124 PRO B CG  
3777 C CD  . PRO B 94  ? 0.6486 2.5763 0.5991 -0.2518 -0.0456 -0.1787 124 PRO B CD  
3778 N N   . LEU B 95  ? 0.6814 2.7735 0.6292 -0.0488 -0.0709 -0.0587 125 LEU B N   
3779 C CA  . LEU B 95  ? 0.6216 2.7399 0.5633 0.0445  -0.0740 -0.0013 125 LEU B CA  
3780 C C   . LEU B 95  ? 0.5914 2.5333 0.5232 0.0761  -0.0699 0.0220  125 LEU B C   
3781 O O   . LEU B 95  ? 0.6084 2.5776 0.5291 0.1133  -0.0699 0.0438  125 LEU B O   
3782 C CB  . LEU B 95  ? 0.3136 2.4543 0.2607 0.1021  -0.0728 0.0349  125 LEU B CB  
3783 C CG  . LEU B 95  ? 0.4109 2.7665 0.3657 0.1066  -0.0774 0.0320  125 LEU B CG  
3784 C CD1 . LEU B 95  ? 0.4552 2.8211 0.4105 0.1888  -0.0735 0.0829  125 LEU B CD1 
3785 C CD2 . LEU B 95  ? 0.3879 2.9287 0.3368 0.1132  -0.0831 0.0302  125 LEU B CD2 
3786 N N   . MET B 96  ? 0.5780 2.3440 0.5130 0.0611  -0.0657 0.0167  126 MET B N   
3787 C CA  . MET B 96  ? 0.6775 2.2769 0.6050 0.0878  -0.0610 0.0355  126 MET B CA  
3788 C C   . MET B 96  ? 0.7011 2.2765 0.6230 0.0471  -0.0618 0.0087  126 MET B C   
3789 O O   . MET B 96  ? 0.8103 2.2887 0.7241 0.0748  -0.0584 0.0261  126 MET B O   
3790 C CB  . MET B 96  ? 0.5918 2.0270 0.5252 0.0733  -0.0573 0.0300  126 MET B CB  
3791 C CG  . MET B 96  ? 0.4706 1.9131 0.4086 0.1139  -0.0548 0.0567  126 MET B CG  
3792 S SD  . MET B 96  ? 0.7631 2.0416 0.7085 0.0831  -0.0521 0.0416  126 MET B SD  
3793 C CE  . MET B 96  ? 1.6927 2.8042 1.6296 0.1296  -0.0445 0.0702  126 MET B CE  
3794 N N   . LEU B 97  ? 0.6392 2.3023 0.5643 -0.0211 -0.0637 -0.0356 127 LEU B N   
3795 C CA  . LEU B 97  ? 0.7031 2.3539 0.6221 -0.0657 -0.0618 -0.0653 127 LEU B CA  
3796 C C   . LEU B 97  ? 0.7460 2.5824 0.6596 -0.0614 -0.0664 -0.0668 127 LEU B C   
3797 O O   . LEU B 97  ? 0.6702 2.5154 0.5769 -0.0877 -0.0650 -0.0853 127 LEU B O   
3798 C CB  . LEU B 97  ? 0.6348 2.2287 0.5562 -0.1519 -0.0541 -0.1185 127 LEU B CB  
3799 C CG  . LEU B 97  ? 0.5304 1.9297 0.4535 -0.1611 -0.0485 -0.1206 127 LEU B CG  
3800 C CD1 . LEU B 97  ? 0.5990 1.9541 0.5185 -0.2431 -0.0358 -0.1710 127 LEU B CD1 
3801 C CD2 . LEU B 97  ? 0.4142 1.6890 0.3330 -0.1280 -0.0490 -0.1007 127 LEU B CD2 
3802 N N   . PRO B 100 ? 0.8271 3.0286 0.6858 0.0858  -0.0754 0.0172  130 PRO B N   
3803 C CA  . PRO B 100 ? 0.8728 3.0140 0.7194 0.1808  -0.0692 0.0799  130 PRO B CA  
3804 C C   . PRO B 100 ? 1.0108 3.0582 0.8688 0.1950  -0.0661 0.0910  130 PRO B C   
3805 O O   . PRO B 100 ? 1.0264 3.1418 0.8997 0.1540  -0.0717 0.0639  130 PRO B O   
3806 C CB  . PRO B 100 ? 0.8112 3.1630 0.6463 0.2367  -0.0725 0.1125  130 PRO B CB  
3807 C CG  . PRO B 100 ? 0.7548 3.2526 0.5915 0.1747  -0.0809 0.0694  130 PRO B CG  
3808 C CD  . PRO B 100 ? 0.7678 3.1997 0.6233 0.0751  -0.0823 0.0059  130 PRO B CD  
3809 N N   . PRO B 101 ? 1.1009 2.9933 0.9503 0.2493  -0.0552 0.1282  131 PRO B N   
3810 C CA  . PRO B 101 ? 0.9308 2.7296 0.7888 0.2673  -0.0504 0.1414  131 PRO B CA  
3811 C C   . PRO B 101 ? 0.8007 2.7304 0.6547 0.3287  -0.0480 0.1790  131 PRO B C   
3812 O O   . PRO B 101 ? 0.9424 3.0008 0.7812 0.3791  -0.0460 0.2090  131 PRO B O   
3813 C CB  . PRO B 101 ? 0.9427 2.5574 0.7874 0.3098  -0.0356 0.1703  131 PRO B CB  
3814 C CG  . PRO B 101 ? 1.0773 2.6686 0.9115 0.2940  -0.0355 0.1596  131 PRO B CG  
3815 C CD  . PRO B 101 ? 1.1365 2.9265 0.9666 0.2891  -0.0446 0.1546  131 PRO B CD  
3816 N N   . GLN B 102 ? 0.6398 2.5412 0.5066 0.3267  -0.0476 0.1783  132 GLN B N   
3817 C CA  . GLN B 102 ? 0.7680 2.7849 0.6321 0.3868  -0.0437 0.2143  132 GLN B CA  
3818 C C   . GLN B 102 ? 0.7690 2.6664 0.6401 0.4025  -0.0353 0.2262  132 GLN B C   
3819 O O   . GLN B 102 ? 0.7937 2.5952 0.6807 0.3426  -0.0410 0.1905  132 GLN B O   
3820 C CB  . GLN B 102 ? 0.7705 2.9987 0.6484 0.3481  -0.0586 0.1857  132 GLN B CB  
3821 C CG  . GLN B 102 ? 0.8635 3.2666 0.7335 0.4228  -0.0557 0.2287  132 GLN B CG  
3822 C CD  . GLN B 102 ? 0.9459 3.5845 0.8264 0.3845  -0.0706 0.1986  132 GLN B CD  
3823 O OE1 . GLN B 102 ? 0.9053 3.6204 0.8046 0.3395  -0.0778 0.1675  132 GLN B OE1 
3824 N NE2 . GLN B 102 ? 0.9513 3.7106 0.8185 0.4012  -0.0739 0.2066  132 GLN B NE2 
3825 N N   . ASN B 103 ? 0.7002 2.6023 0.5567 0.4849  -0.0193 0.2775  133 ASN B N   
3826 C CA  . ASN B 103 ? 0.7541 2.5412 0.6137 0.5064  -0.0073 0.2925  133 ASN B CA  
3827 C C   . ASN B 103 ? 0.7153 2.5640 0.5992 0.4606  -0.0203 0.2629  133 ASN B C   
3828 O O   . ASN B 103 ? 0.6939 2.6968 0.5906 0.4203  -0.0359 0.2351  133 ASN B O   
3829 C CB  . ASN B 103 ? 0.8503 2.6401 0.6851 0.6064  0.0180  0.3543  133 ASN B CB  
3830 C CG  . ASN B 103 ? 0.9576 2.6010 0.7653 0.6472  0.0409  0.3820  133 ASN B CG  
3831 O OD1 . ASN B 103 ? 0.8988 2.4659 0.7073 0.6047  0.0344  0.3568  133 ASN B OD1 
3832 N ND2 . ASN B 103 ? 1.1033 2.7037 0.8850 0.7291  0.0710  0.4331  133 ASN B ND2 
3833 N N   . LEU B 104 ? 0.6539 2.3824 0.5429 0.4644  -0.0119 0.2672  134 LEU B N   
3834 C CA  . LEU B 104 ? 0.6596 2.4266 0.5694 0.4231  -0.0216 0.2413  134 LEU B CA  
3835 C C   . LEU B 104 ? 0.7641 2.4278 0.6720 0.4615  -0.0062 0.2664  134 LEU B C   
3836 O O   . LEU B 104 ? 0.8244 2.3382 0.7190 0.4908  0.0103  0.2863  134 LEU B O   
3837 C CB  . LEU B 104 ? 0.6144 2.3213 0.5399 0.3291  -0.0364 0.1852  134 LEU B CB  
3838 C CG  . LEU B 104 ? 0.6873 2.4312 0.6308 0.2758  -0.0445 0.1526  134 LEU B CG  
3839 C CD1 . LEU B 104 ? 0.7503 2.7080 0.7007 0.2751  -0.0516 0.1474  134 LEU B CD1 
3840 C CD2 . LEU B 104 ? 0.6750 2.3351 0.6263 0.1899  -0.0521 0.1022  134 LEU B CD2 
3841 N N   . ILE B 105 ? 0.7949 2.5454 0.7156 0.4588  -0.0099 0.2632  135 ILE B N   
3842 C CA  . ILE B 105 ? 0.7925 2.4532 0.7151 0.4805  0.0025  0.2777  135 ILE B CA  
3843 C C   . ILE B 105 ? 0.7638 2.4680 0.7086 0.4152  -0.0128 0.2380  135 ILE B C   
3844 O O   . ILE B 105 ? 0.7534 2.6051 0.7070 0.4225  -0.0170 0.2390  135 ILE B O   
3845 C CB  . ILE B 105 ? 0.7582 2.4838 0.6665 0.5717  0.0230  0.3308  135 ILE B CB  
3846 C CG1 . ILE B 105 ? 0.7876 2.4172 0.6672 0.6378  0.0478  0.3723  135 ILE B CG1 
3847 C CG2 . ILE B 105 ? 0.6255 2.2970 0.5405 0.5815  0.0330  0.3370  135 ILE B CG2 
3848 C CD1 . ILE B 105 ? 0.7921 2.4160 0.6515 0.7270  0.0787  0.4252  135 ILE B CD1 
3849 N N   . ALA B 106 ? 0.6122 2.1910 0.5645 0.3520  -0.0195 0.2031  136 ALA B N   
3850 C CA  . ALA B 106 ? 0.5201 2.1200 0.4884 0.2856  -0.0304 0.1639  136 ALA B CA  
3851 C C   . ALA B 106 ? 0.5037 2.0161 0.4753 0.2991  -0.0219 0.1743  136 ALA B C   
3852 O O   . ALA B 106 ? 0.7071 2.0667 0.6721 0.3114  -0.0131 0.1844  136 ALA B O   
3853 C CB  . ALA B 106 ? 0.4930 2.0133 0.4639 0.2102  -0.0397 0.1207  136 ALA B CB  
3854 N N   . GLN B 107 ? 0.3642 1.9800 0.3459 0.2949  -0.0239 0.1701  137 GLN B N   
3855 C CA  . GLN B 107 ? 0.4704 2.0134 0.4564 0.2995  -0.0168 0.1751  137 GLN B CA  
3856 C C   . GLN B 107 ? 0.3263 1.8805 0.3238 0.2217  -0.0273 0.1305  137 GLN B C   
3857 O O   . GLN B 107 ? 0.3571 2.0491 0.3621 0.1865  -0.0350 0.1063  137 GLN B O   
3858 C CB  . GLN B 107 ? 0.5715 2.2095 0.5570 0.3683  -0.0050 0.2126  137 GLN B CB  
3859 C CG  . GLN B 107 ? 0.6187 2.4170 0.6191 0.3446  -0.0134 0.1948  137 GLN B CG  
3860 C CD  . GLN B 107 ? 0.7708 2.5108 0.7790 0.3236  -0.0100 0.1846  137 GLN B CD  
3861 O OE1 . GLN B 107 ? 0.8759 2.4829 0.8774 0.3515  0.0024  0.2042  137 GLN B OE1 
3862 N NE2 . GLN B 107 ? 0.8439 2.6858 0.8648 0.2720  -0.0190 0.1521  137 GLN B NE2 
3863 N N   . SER B 108 ? 0.3023 1.7121 0.2989 0.1941  -0.0255 0.1188  138 SER B N   
3864 C CA  . SER B 108 ? 0.4997 1.9009 0.5019 0.1261  -0.0306 0.0812  138 SER B CA  
3865 C C   . SER B 108 ? 0.4852 1.7282 0.4841 0.1188  -0.0261 0.0821  138 SER B C   
3866 O O   . SER B 108 ? 0.6440 1.7661 0.6360 0.1376  -0.0231 0.0946  138 SER B O   
3867 C CB  . SER B 108 ? 0.6445 2.0628 0.6444 0.0589  -0.0375 0.0414  138 SER B CB  
3868 O OG  . SER B 108 ? 0.8194 2.1633 0.8121 0.0693  -0.0390 0.0477  138 SER B OG  
3869 N N   . GLN B 109 ? 0.4859 1.7369 0.4890 0.0912  -0.0250 0.0681  139 GLN B N   
3870 C CA  . GLN B 109 ? 0.4723 1.5878 0.4715 0.0812  -0.0213 0.0673  139 GLN B CA  
3871 C C   . GLN B 109 ? 0.4268 1.4123 0.4172 0.0509  -0.0244 0.0527  139 GLN B C   
3872 O O   . GLN B 109 ? 0.5183 1.5206 0.5055 0.0153  -0.0287 0.0312  139 GLN B O   
3873 C CB  . GLN B 109 ? 0.2717 1.4213 0.2736 0.0364  -0.0208 0.0438  139 GLN B CB  
3874 C CG  . GLN B 109 ? 0.5537 1.7247 0.5502 -0.0360 -0.0231 0.0029  139 GLN B CG  
3875 C CD  . GLN B 109 ? 0.5807 1.8011 0.5774 -0.0804 -0.0182 -0.0212 139 GLN B CD  
3876 O OE1 . GLN B 109 ? 0.7142 2.0273 0.7098 -0.1289 -0.0158 -0.0520 139 GLN B OE1 
3877 N NE2 . GLN B 109 ? 0.4666 1.6268 0.4633 -0.0670 -0.0148 -0.0095 139 GLN B NE2 
3878 N N   . SER B 110 ? 0.4155 1.2758 0.4014 0.0646  -0.0209 0.0633  140 SER B N   
3879 C CA  . SER B 110 ? 0.3907 1.1342 0.3687 0.0392  -0.0239 0.0505  140 SER B CA  
3880 C C   . SER B 110 ? 0.3035 1.0368 0.2751 -0.0249 -0.0257 0.0173  140 SER B C   
3881 O O   . SER B 110 ? 0.4075 1.1772 0.3788 -0.0493 -0.0228 0.0060  140 SER B O   
3882 C CB  . SER B 110 ? 0.2817 0.9079 0.2565 0.0638  -0.0193 0.0656  140 SER B CB  
3883 O OG  . SER B 110 ? 0.4304 1.0418 0.4053 0.0558  -0.0162 0.0645  140 SER B OG  
3884 N N   . GLY B 111 ? 0.3495 1.0323 0.3137 -0.0519 -0.0273 0.0014  141 GLY B N   
3885 C CA  . GLY B 111 ? 0.4182 1.0800 0.3706 -0.1116 -0.0225 -0.0297 141 GLY B CA  
3886 C C   . GLY B 111 ? 0.4837 1.2462 0.4352 -0.1482 -0.0199 -0.0540 141 GLY B C   
3887 O O   . GLY B 111 ? 0.4872 1.2371 0.4256 -0.2030 -0.0099 -0.0836 141 GLY B O   
3888 N N   . THR B 112 ? 0.4223 1.2851 0.3849 -0.1187 -0.0259 -0.0423 142 THR B N   
3889 C CA  . THR B 112 ? 0.5255 1.5029 0.4881 -0.1524 -0.0243 -0.0661 142 THR B CA  
3890 C C   . THR B 112 ? 0.6620 1.5965 0.6173 -0.1701 -0.0238 -0.0787 142 THR B C   
3891 O O   . THR B 112 ? 0.7303 1.6912 0.6764 -0.2250 -0.0152 -0.1119 142 THR B O   
3892 C CB  . THR B 112 ? 0.4193 1.5483 0.3955 -0.1129 -0.0304 -0.0482 142 THR B CB  
3893 O OG1 . THR B 112 ? 0.5054 1.5976 0.4870 -0.0434 -0.0348 -0.0082 142 THR B OG1 
3894 C CG2 . THR B 112 ? 0.2963 1.5153 0.2782 -0.1248 -0.0274 -0.0550 142 THR B CG2 
3895 N N   . GLY B 113 ? 0.5394 1.4066 0.4975 -0.1259 -0.0302 -0.0540 143 GLY B N   
3896 C CA  . GLY B 113 ? 0.3579 1.1754 0.3099 -0.1381 -0.0300 -0.0636 143 GLY B CA  
3897 C C   . GLY B 113 ? 0.4696 1.3214 0.4284 -0.0877 -0.0374 -0.0384 143 GLY B C   
3898 O O   . GLY B 113 ? 0.5024 1.3594 0.4579 -0.0989 -0.0379 -0.0480 143 GLY B O   
3899 N N   . LYS B 114 ? 0.3763 1.2473 0.3420 -0.0321 -0.0399 -0.0058 144 LYS B N   
3900 C CA  . LYS B 114 ? 0.3660 1.2619 0.3330 0.0219  -0.0413 0.0226  144 LYS B CA  
3901 C C   . LYS B 114 ? 0.4164 1.1938 0.3783 0.0292  -0.0408 0.0255  144 LYS B C   
3902 O O   . LYS B 114 ? 0.4503 1.2487 0.4095 0.0374  -0.0420 0.0272  144 LYS B O   
3903 C CB  . LYS B 114 ? 0.3237 1.2349 0.2939 0.0799  -0.0369 0.0571  144 LYS B CB  
3904 C CG  . LYS B 114 ? 0.3722 1.4083 0.3489 0.0803  -0.0371 0.0575  144 LYS B CG  
3905 C CD  . LYS B 114 ? 0.5012 1.5477 0.4788 0.1439  -0.0290 0.0946  144 LYS B CD  
3906 C CE  . LYS B 114 ? 0.6458 1.5516 0.6209 0.1538  -0.0226 0.1029  144 LYS B CE  
3907 N NZ  . LYS B 114 ? 0.6514 1.5269 0.6303 0.1087  -0.0260 0.0802  144 LYS B NZ  
3908 N N   . THR B 115 ? 0.3789 1.0382 0.3395 0.0259  -0.0390 0.0252  145 THR B N   
3909 C CA  . THR B 115 ? 0.2741 0.8230 0.2311 0.0322  -0.0384 0.0263  145 THR B CA  
3910 C C   . THR B 115 ? 0.4869 1.0293 0.4400 -0.0069 -0.0406 0.0015  145 THR B C   
3911 O O   . THR B 115 ? 0.4783 1.0046 0.4298 0.0073  -0.0409 0.0060  145 THR B O   
3912 C CB  . THR B 115 ? 0.3373 0.7793 0.2935 0.0262  -0.0372 0.0245  145 THR B CB  
3913 O OG1 . THR B 115 ? 0.4870 0.9154 0.4453 0.0680  -0.0319 0.0488  145 THR B OG1 
3914 C CG2 . THR B 115 ? 0.3537 0.6973 0.3067 0.0198  -0.0378 0.0170  145 THR B CG2 
3915 N N   . ALA B 116 ? 0.4919 1.0432 0.4411 -0.0574 -0.0390 -0.0256 146 ALA B N   
3916 C CA  . ALA B 116 ? 0.5246 1.0642 0.4668 -0.0991 -0.0356 -0.0521 146 ALA B CA  
3917 C C   . ALA B 116 ? 0.6082 1.2538 0.5523 -0.0955 -0.0382 -0.0535 146 ALA B C   
3918 O O   . ALA B 116 ? 0.5812 1.2084 0.5217 -0.1070 -0.0372 -0.0638 146 ALA B O   
3919 C CB  . ALA B 116 ? 0.4492 0.9855 0.3820 -0.1546 -0.0264 -0.0810 146 ALA B CB  
3920 N N   . ALA B 117 ? 0.5448 1.3062 0.4944 -0.0774 -0.0411 -0.0422 147 ALA B N   
3921 C CA  . ALA B 117 ? 0.4986 1.3806 0.4490 -0.0703 -0.0440 -0.0414 147 ALA B CA  
3922 C C   . ALA B 117 ? 0.5079 1.3569 0.4567 -0.0255 -0.0460 -0.0177 147 ALA B C   
3923 O O   . ALA B 117 ? 0.5146 1.3702 0.4594 -0.0431 -0.0461 -0.0311 147 ALA B O   
3924 C CB  . ALA B 117 ? 0.2893 1.3043 0.2457 -0.0482 -0.0464 -0.0278 147 ALA B CB  
3925 N N   . PHE B 118 ? 0.4906 1.3007 0.4405 0.0302  -0.0447 0.0159  148 PHE B N   
3926 C CA  . PHE B 118 ? 0.4871 1.2686 0.4315 0.0744  -0.0417 0.0395  148 PHE B CA  
3927 C C   . PHE B 118 ? 0.6003 1.2603 0.5425 0.0571  -0.0409 0.0265  148 PHE B C   
3928 O O   . PHE B 118 ? 0.4776 1.1265 0.4146 0.0724  -0.0392 0.0325  148 PHE B O   
3929 C CB  . PHE B 118 ? 0.4591 1.2266 0.4003 0.1371  -0.0333 0.0775  148 PHE B CB  
3930 C CG  . PHE B 118 ? 0.3841 1.0333 0.3274 0.1418  -0.0286 0.0809  148 PHE B CG  
3931 C CD1 . PHE B 118 ? 0.5358 1.0677 0.4765 0.1411  -0.0252 0.0774  148 PHE B CD1 
3932 C CD2 . PHE B 118 ? 0.3830 1.0464 0.3308 0.1478  -0.0271 0.0873  148 PHE B CD2 
3933 C CE1 . PHE B 118 ? 0.5754 1.0124 0.5179 0.1445  -0.0210 0.0789  148 PHE B CE1 
3934 C CE2 . PHE B 118 ? 0.3883 0.9498 0.3371 0.1513  -0.0225 0.0897  148 PHE B CE2 
3935 C CZ  . PHE B 118 ? 0.5149 0.9663 0.4609 0.1493  -0.0196 0.0851  148 PHE B CZ  
3936 N N   . VAL B 119 ? 0.6037 1.1768 0.5488 0.0270  -0.0416 0.0094  149 VAL B N   
3937 C CA  . VAL B 119 ? 0.6432 1.1125 0.5867 0.0080  -0.0409 -0.0053 149 VAL B CA  
3938 C C   . VAL B 119 ? 0.6020 1.1093 0.5419 -0.0303 -0.0414 -0.0300 149 VAL B C   
3939 O O   . VAL B 119 ? 0.5271 0.9899 0.4647 -0.0296 -0.0405 -0.0340 149 VAL B O   
3940 C CB  . VAL B 119 ? 0.5768 0.9612 0.5214 -0.0162 -0.0405 -0.0178 149 VAL B CB  
3941 C CG1 . VAL B 119 ? 0.5235 0.8335 0.4641 -0.0483 -0.0385 -0.0401 149 VAL B CG1 
3942 C CG2 . VAL B 119 ? 0.4543 0.7732 0.4017 0.0209  -0.0389 0.0035  149 VAL B CG2 
3943 N N   . LEU B 120 ? 0.7057 1.2986 0.6444 -0.0662 -0.0411 -0.0488 150 LEU B N   
3944 C CA  . LEU B 120 ? 0.7633 1.4063 0.6968 -0.1092 -0.0379 -0.0767 150 LEU B CA  
3945 C C   . LEU B 120 ? 0.9081 1.6298 0.8409 -0.0817 -0.0419 -0.0633 150 LEU B C   
3946 O O   . LEU B 120 ? 1.0174 1.7394 0.9458 -0.1034 -0.0397 -0.0798 150 LEU B O   
3947 C CB  . LEU B 120 ? 0.7690 1.4998 0.7004 -0.1548 -0.0336 -0.1013 150 LEU B CB  
3948 C CG  . LEU B 120 ? 0.8589 1.6257 0.7813 -0.2142 -0.0239 -0.1395 150 LEU B CG  
3949 C CD1 . LEU B 120 ? 0.8948 1.5249 0.8083 -0.2431 -0.0126 -0.1577 150 LEU B CD1 
3950 C CD2 . LEU B 120 ? 0.8730 1.7419 0.7925 -0.2592 -0.0170 -0.1648 150 LEU B CD2 
3951 N N   . ALA B 121 ? 0.7798 1.5663 0.7148 -0.0320 -0.0455 -0.0322 151 ALA B N   
3952 C CA  . ALA B 121 ? 0.6596 1.5216 0.5897 0.0036  -0.0467 -0.0127 151 ALA B CA  
3953 C C   . ALA B 121 ? 0.6264 1.3860 0.5518 0.0288  -0.0434 -0.0006 151 ALA B C   
3954 O O   . ALA B 121 ? 0.6292 1.4107 0.5492 0.0227  -0.0433 -0.0070 151 ALA B O   
3955 C CB  . ALA B 121 ? 0.5003 1.4446 0.4299 0.0574  -0.0466 0.0218  151 ALA B CB  
3956 N N   . MET B 122 ? 0.5163 1.1686 0.4433 0.0546  -0.0396 0.0148  152 MET B N   
3957 C CA  . MET B 122 ? 0.5576 1.1117 0.4803 0.0766  -0.0342 0.0240  152 MET B CA  
3958 C C   . MET B 122 ? 0.6483 1.1559 0.5723 0.0343  -0.0365 -0.0055 152 MET B C   
3959 O O   . MET B 122 ? 0.5054 1.0097 0.4237 0.0422  -0.0342 -0.0041 152 MET B O   
3960 C CB  . MET B 122 ? 0.6086 1.0596 0.5343 0.0961  -0.0293 0.0349  152 MET B CB  
3961 C CG  . MET B 122 ? 0.7335 1.2088 0.6541 0.1453  -0.0209 0.0672  152 MET B CG  
3962 S SD  . MET B 122 ? 0.8627 1.2302 0.7873 0.1562  -0.0143 0.0727  152 MET B SD  
3963 C CE  . MET B 122 ? 2.5609 2.9443 2.4709 0.2216  0.0055  0.1130  152 MET B CE  
3964 N N   . LEU B 123 ? 0.5910 1.0604 0.5202 -0.0092 -0.0384 -0.0314 153 LEU B N   
3965 C CA  . LEU B 123 ? 0.7005 1.1153 0.6287 -0.0485 -0.0363 -0.0591 153 LEU B CA  
3966 C C   . LEU B 123 ? 0.7429 1.2413 0.6657 -0.0765 -0.0354 -0.0770 153 LEU B C   
3967 O O   . LEU B 123 ? 0.8437 1.3020 0.7637 -0.0950 -0.0319 -0.0928 153 LEU B O   
3968 C CB  . LEU B 123 ? 0.7347 1.0933 0.6639 -0.0854 -0.0334 -0.0796 153 LEU B CB  
3969 C CG  . LEU B 123 ? 0.7031 0.9714 0.6370 -0.0630 -0.0345 -0.0663 153 LEU B CG  
3970 C CD1 . LEU B 123 ? 0.7602 0.9729 0.6905 -0.0985 -0.0296 -0.0856 153 LEU B CD1 
3971 C CD2 . LEU B 123 ? 0.5071 0.6991 0.4434 -0.0359 -0.0342 -0.0570 153 LEU B CD2 
3972 N N   . SER B 124 ? 0.5699 1.1900 0.4913 -0.0799 -0.0379 -0.0755 154 SER B N   
3973 C CA  . SER B 124 ? 0.7010 1.4218 0.6170 -0.1083 -0.0371 -0.0941 154 SER B CA  
3974 C C   . SER B 124 ? 0.7400 1.4846 0.6506 -0.0727 -0.0389 -0.0752 154 SER B C   
3975 O O   . SER B 124 ? 0.7583 1.5341 0.6641 -0.0993 -0.0368 -0.0944 154 SER B O   
3976 C CB  . SER B 124 ? 0.7122 1.5727 0.6288 -0.1200 -0.0398 -0.0979 154 SER B CB  
3977 O OG  . SER B 124 ? 0.7246 1.5764 0.6411 -0.1746 -0.0331 -0.1296 154 SER B OG  
3978 N N   . GLN B 125 ? 0.6955 1.4216 0.6046 -0.0138 -0.0397 -0.0383 155 GLN B N   
3979 C CA  . GLN B 125 ? 0.6693 1.4081 0.5685 0.0261  -0.0370 -0.0156 155 GLN B CA  
3980 C C   . GLN B 125 ? 0.7460 1.3609 0.6446 0.0239  -0.0323 -0.0222 155 GLN B C   
3981 O O   . GLN B 125 ? 1.0238 1.6463 0.9177 0.0084  -0.0311 -0.0348 155 GLN B O   
3982 C CB  . GLN B 125 ? 0.7078 1.4650 0.6002 0.0908  -0.0325 0.0269  155 GLN B CB  
3983 C CG  . GLN B 125 ? 0.8364 1.7160 0.7305 0.1015  -0.0366 0.0375  155 GLN B CG  
3984 C CD  . GLN B 125 ? 0.9051 1.9331 0.7896 0.1176  -0.0388 0.0480  155 GLN B CD  
3985 O OE1 . GLN B 125 ? 0.8486 1.8982 0.7267 0.1035  -0.0393 0.0372  155 GLN B OE1 
3986 N NE2 . GLN B 125 ? 0.9416 2.0785 0.8246 0.1489  -0.0399 0.0696  155 GLN B NE2 
3987 N N   . VAL B 126 ? 0.5119 1.0198 0.4156 0.0388  -0.0293 -0.0146 156 VAL B N   
3988 C CA  . VAL B 126 ? 0.6619 1.0562 0.5665 0.0417  -0.0244 -0.0191 156 VAL B CA  
3989 C C   . VAL B 126 ? 0.8388 1.2177 0.7430 0.0082  -0.0244 -0.0446 156 VAL B C   
3990 O O   . VAL B 126 ? 0.8745 1.2702 0.7826 -0.0374 -0.0267 -0.0727 156 VAL B O   
3991 C CB  . VAL B 126 ? 0.6871 0.9866 0.6022 0.0318  -0.0251 -0.0273 156 VAL B CB  
3992 C CG1 . VAL B 126 ? 0.6829 0.8826 0.6008 0.0288  -0.0213 -0.0375 156 VAL B CG1 
3993 C CG2 . VAL B 126 ? 0.7744 1.0660 0.6886 0.0693  -0.0217 -0.0012 156 VAL B CG2 
3994 N N   . GLU B 127 ? 0.9571 1.2991 0.8545 0.0308  -0.0184 -0.0351 157 GLU B N   
3995 C CA  . GLU B 127 ? 0.9796 1.2826 0.8776 0.0052  -0.0167 -0.0573 157 GLU B CA  
3996 C C   . GLU B 127 ? 0.9620 1.1482 0.8672 0.0111  -0.0127 -0.0614 157 GLU B C   
3997 O O   . GLU B 127 ? 0.9379 1.0828 0.8373 0.0423  -0.0048 -0.0458 157 GLU B O   
3998 C CB  . GLU B 127 ? 1.2423 1.5918 1.1262 0.0270  -0.0119 -0.0438 157 GLU B CB  
3999 C CG  . GLU B 127 ? 1.5367 2.0106 1.4144 0.0101  -0.0168 -0.0495 157 GLU B CG  
4000 C CD  . GLU B 127 ? 1.7650 2.2422 1.6466 -0.0441 -0.0177 -0.0869 157 GLU B CD  
4001 O OE1 . GLU B 127 ? 1.8243 2.2273 1.7066 -0.0512 -0.0131 -0.0979 157 GLU B OE1 
4002 O OE2 . GLU B 127 ? 1.8530 2.4065 1.7359 -0.0810 -0.0206 -0.1068 157 GLU B OE2 
4003 N N   . PRO B 128 ? 1.0666 1.2014 0.9826 -0.0184 -0.0157 -0.0826 158 PRO B N   
4004 C CA  . PRO B 128 ? 1.0216 1.0602 0.9460 -0.0115 -0.0137 -0.0863 158 PRO B CA  
4005 C C   . PRO B 128 ? 1.0881 1.0791 1.0117 -0.0058 -0.0078 -0.0924 158 PRO B C   
4006 O O   . PRO B 128 ? 1.0479 0.9723 0.9778 0.0053  -0.0049 -0.0936 158 PRO B O   
4007 C CB  . PRO B 128 ? 0.9452 0.9554 0.8760 -0.0465 -0.0159 -0.1084 158 PRO B CB  
4008 C CG  . PRO B 128 ? 1.0353 1.1222 0.9612 -0.0676 -0.0180 -0.1119 158 PRO B CG  
4009 C CD  . PRO B 128 ? 1.0846 1.2529 1.0026 -0.0599 -0.0183 -0.1044 158 PRO B CD  
4010 N N   . ALA B 129 ? 1.1167 1.1472 1.0328 -0.0146 -0.0057 -0.0977 159 ALA B N   
4011 C CA  . ALA B 129 ? 1.1058 1.0952 1.0202 -0.0117 0.0007  -0.1049 159 ALA B CA  
4012 C C   . ALA B 129 ? 1.0845 1.0644 0.9875 0.0265  0.0102  -0.0817 159 ALA B C   
4013 O O   . ALA B 129 ? 1.1600 1.1018 1.0593 0.0316  0.0184  -0.0861 159 ALA B O   
4014 C CB  . ALA B 129 ? 1.1096 1.1418 1.0191 -0.0392 0.0009  -0.1218 159 ALA B CB  
4015 N N   . ASN B 130 ? 0.9506 0.9622 0.8458 0.0533  0.0123  -0.0573 160 ASN B N   
4016 C CA  . ASN B 130 ? 0.9961 0.9877 0.8752 0.0924  0.0281  -0.0328 160 ASN B CA  
4017 C C   . ASN B 130 ? 1.0080 0.9403 0.8917 0.1069  0.0346  -0.0271 160 ASN B C   
4018 O O   . ASN B 130 ? 1.0283 0.9845 0.9144 0.1151  0.0304  -0.0157 160 ASN B O   
4019 C CB  . ASN B 130 ? 1.0269 1.1010 0.8884 0.1193  0.0313  -0.0055 160 ASN B CB  
4020 C CG  . ASN B 130 ? 1.0172 1.1637 0.8732 0.1037  0.0250  -0.0125 160 ASN B CG  
4021 O OD1 . ASN B 130 ? 0.9916 1.2319 0.8436 0.1047  0.0178  -0.0042 160 ASN B OD1 
4022 N ND2 . ASN B 130 ? 1.0117 1.1209 0.8676 0.0878  0.0282  -0.0294 160 ASN B ND2 
4023 N N   . LYS B 131 ? 0.9174 0.7775 0.8022 0.1078  0.0456  -0.0371 161 LYS B N   
4024 C CA  . LYS B 131 ? 0.8417 0.6476 0.7334 0.1120  0.0512  -0.0403 161 LYS B CA  
4025 C C   . LYS B 131 ? 0.7783 0.5680 0.6507 0.1455  0.0729  -0.0158 161 LYS B C   
4026 O O   . LYS B 131 ? 0.8242 0.5552 0.6874 0.1531  0.0939  -0.0191 161 LYS B O   
4027 C CB  . LYS B 131 ? 0.7900 0.5360 0.6910 0.0968  0.0558  -0.0644 161 LYS B CB  
4028 C CG  . LYS B 131 ? 0.6354 0.3867 0.5521 0.0687  0.0402  -0.0873 161 LYS B CG  
4029 C CD  . LYS B 131 ? 0.7067 0.4841 0.6370 0.0513  0.0217  -0.0927 161 LYS B CD  
4030 C CE  . LYS B 131 ? 0.7914 0.5584 0.7330 0.0253  0.0134  -0.1156 161 LYS B CE  
4031 N NZ  . LYS B 131 ? 0.7813 0.5648 0.7297 0.0065  0.0022  -0.1213 161 LYS B NZ  
4032 N N   . TYR B 132 ? 0.6731 0.5144 0.5382 0.1643  0.0707  0.0070  162 TYR B N   
4033 C CA  . TYR B 132 ? 0.6570 0.4833 0.5019 0.2001  0.0939  0.0332  162 TYR B CA  
4034 C C   . TYR B 132 ? 0.7054 0.5967 0.5527 0.2130  0.0833  0.0518  162 TYR B C   
4035 O O   . TYR B 132 ? 0.6072 0.5674 0.4655 0.1972  0.0616  0.0476  162 TYR B O   
4036 C CB  . TYR B 132 ? 0.6706 0.4877 0.4856 0.2303  0.1195  0.0535  162 TYR B CB  
4037 C CG  . TYR B 132 ? 1.0165 0.9089 0.8265 0.2333  0.1073  0.0622  162 TYR B CG  
4038 C CD1 . TYR B 132 ? 1.0072 0.8942 0.8213 0.2108  0.1010  0.0430  162 TYR B CD1 
4039 C CD2 . TYR B 132 ? 1.1382 1.1141 0.9395 0.2581  0.1027  0.0882  162 TYR B CD2 
4040 C CE1 . TYR B 132 ? 1.0383 0.9980 0.8469 0.2104  0.0910  0.0484  162 TYR B CE1 
4041 C CE2 . TYR B 132 ? 1.1406 1.1982 0.9371 0.2584  0.0917  0.0935  162 TYR B CE2 
4042 C CZ  . TYR B 132 ? 1.1306 1.1783 0.9303 0.2333  0.0862  0.0731  162 TYR B CZ  
4043 O OH  . TYR B 132 ? 1.1574 1.2900 0.9516 0.2305  0.0763  0.0761  162 TYR B OH  
4044 N N   . PRO B 133 ? 0.6586 0.5286 0.4950 0.2391  0.1009  0.0701  163 PRO B N   
4045 C CA  . PRO B 133 ? 0.7248 0.6567 0.5651 0.2515  0.0912  0.0867  163 PRO B CA  
4046 C C   . PRO B 133 ? 0.9174 0.9442 0.7487 0.2696  0.0845  0.1064  163 PRO B C   
4047 O O   . PRO B 133 ? 0.9797 1.0128 0.7876 0.3002  0.1026  0.1268  163 PRO B O   
4048 C CB  . PRO B 133 ? 0.6456 0.5286 0.4675 0.2845  0.1209  0.1067  163 PRO B CB  
4049 C CG  . PRO B 133 ? 0.7395 0.5298 0.5593 0.2692  0.1377  0.0862  163 PRO B CG  
4050 C CD  . PRO B 133 ? 0.5254 0.3118 0.3457 0.2537  0.1322  0.0723  163 PRO B CD  
4051 N N   . GLN B 134 ? 0.9039 1.0065 0.7522 0.2492  0.0600  0.0991  164 GLN B N   
4052 C CA  . GLN B 134 ? 0.8265 1.0385 0.6695 0.2593  0.0511  0.1124  164 GLN B CA  
4053 C C   . GLN B 134 ? 0.8317 1.1104 0.6811 0.2681  0.0438  0.1238  164 GLN B C   
4054 O O   . GLN B 134 ? 0.7979 1.1774 0.6403 0.2883  0.0411  0.1417  164 GLN B O   
4055 C CB  . GLN B 134 ? 0.7869 1.0386 0.6440 0.2142  0.0300  0.0835  164 GLN B CB  
4056 C CG  . GLN B 134 ? 0.7719 0.9599 0.6264 0.2004  0.0347  0.0679  164 GLN B CG  
4057 C CD  . GLN B 134 ? 0.8182 1.0339 0.6872 0.1528  0.0165  0.0367  164 GLN B CD  
4058 O OE1 . GLN B 134 ? 0.9061 1.2069 0.7804 0.1334  0.0039  0.0297  164 GLN B OE1 
4059 N NE2 . GLN B 134 ? 0.7698 0.9143 0.6441 0.1325  0.0177  0.0162  164 GLN B NE2 
4060 N N   . CYS B 135 ? 0.8240 1.0519 0.6867 0.2525  0.0404  0.1129  165 CYS B N   
4061 C CA  . CYS B 135 ? 0.6904 0.9685 0.5592 0.2600  0.0355  0.1227  165 CYS B CA  
4062 C C   . CYS B 135 ? 0.6340 0.8320 0.4986 0.2804  0.0529  0.1330  165 CYS B C   
4063 O O   . CYS B 135 ? 0.7481 0.8589 0.6187 0.2613  0.0554  0.1153  165 CYS B O   
4064 C CB  . CYS B 135 ? 0.6304 0.9425 0.5206 0.2100  0.0115  0.0938  165 CYS B CB  
4065 S SG  . CYS B 135 ? 1.0937 1.5104 0.9873 0.1778  -0.0045 0.0763  165 CYS B SG  
4066 N N   . LEU B 136 ? 0.6136 0.8460 0.4670 0.3197  0.0663  0.1611  166 LEU B N   
4067 C CA  . LEU B 136 ? 0.6507 0.8102 0.4971 0.3396  0.0871  0.1711  166 LEU B CA  
4068 C C   . LEU B 136 ? 0.6928 0.9035 0.5499 0.3409  0.0785  0.1766  166 LEU B C   
4069 O O   . LEU B 136 ? 0.8023 1.1065 0.6557 0.3654  0.0765  0.1966  166 LEU B O   
4070 C CB  . LEU B 136 ? 0.7779 0.9037 0.5931 0.3932  0.1233  0.2033  166 LEU B CB  
4071 C CG  . LEU B 136 ? 0.9037 0.9472 0.7061 0.4139  0.1533  0.2130  166 LEU B CG  
4072 C CD1 . LEU B 136 ? 0.9066 0.8618 0.7227 0.3714  0.1497  0.1796  166 LEU B CD1 
4073 C CD2 . LEU B 136 ? 1.0062 1.0037 0.7714 0.4652  0.1959  0.2437  166 LEU B CD2 
4074 N N   . CYS B 137 ? 0.6483 0.8036 0.5185 0.3149  0.0735  0.1586  167 CYS B N   
4075 C CA  . CYS B 137 ? 0.5836 0.7772 0.4637 0.3127  0.0662  0.1615  167 CYS B CA  
4076 C C   . CYS B 137 ? 0.6231 0.7459 0.4929 0.3360  0.0915  0.1730  167 CYS B C   
4077 O O   . CYS B 137 ? 0.6850 0.7182 0.5519 0.3247  0.1031  0.1599  167 CYS B O   
4078 C CB  . CYS B 137 ? 0.5564 0.7520 0.4586 0.2604  0.0393  0.1307  167 CYS B CB  
4079 S SG  . CYS B 137 ? 0.8777 1.1317 0.7914 0.2509  0.0285  0.1312  167 CYS B SG  
4080 N N   . LEU B 138 ? 0.6075 0.7747 0.4715 0.3674  0.1019  0.1959  168 LEU B N   
4081 C CA  . LEU B 138 ? 0.8122 0.9147 0.6665 0.3859  0.1274  0.2047  168 LEU B CA  
4082 C C   . LEU B 138 ? 0.8154 0.9381 0.6883 0.3611  0.1106  0.1924  168 LEU B C   
4083 O O   . LEU B 138 ? 0.8961 1.1075 0.7785 0.3622  0.0951  0.1985  168 LEU B O   
4084 C CB  . LEU B 138 ? 0.9119 1.0286 0.7402 0.4469  0.1609  0.2430  168 LEU B CB  
4085 C CG  . LEU B 138 ? 1.0292 1.0960 0.8301 0.4777  0.1898  0.2588  168 LEU B CG  
4086 C CD1 . LEU B 138 ? 1.1911 1.2382 0.9601 0.5396  0.2334  0.2969  168 LEU B CD1 
4087 C CD2 . LEU B 138 ? 1.0392 0.9977 0.8389 0.4446  0.1985  0.2312  168 LEU B CD2 
4088 N N   . SER B 139 ? 0.7640 0.8086 0.6412 0.3372  0.1142  0.1736  169 SER B N   
4089 C CA  . SER B 139 ? 0.7533 0.8053 0.6437 0.3176  0.1034  0.1643  169 SER B CA  
4090 C C   . SER B 139 ? 0.7717 0.7669 0.6475 0.3418  0.1358  0.1753  169 SER B C   
4091 O O   . SER B 139 ? 0.7432 0.6675 0.6011 0.3565  0.1650  0.1780  169 SER B O   
4092 C CB  . SER B 139 ? 0.7500 0.7684 0.6569 0.2689  0.0794  0.1331  169 SER B CB  
4093 O OG  . SER B 139 ? 0.7696 0.8503 0.6902 0.2427  0.0508  0.1228  169 SER B OG  
4094 N N   . PRO B 140 ? 0.7978 0.8225 0.6796 0.3438  0.1337  0.1802  170 PRO B N   
4095 C CA  . PRO B 140 ? 0.8074 0.7848 0.6751 0.3667  0.1663  0.1910  170 PRO B CA  
4096 C C   . PRO B 140 ? 0.9204 0.8064 0.7858 0.3387  0.1780  0.1666  170 PRO B C   
4097 O O   . PRO B 140 ? 0.9805 0.8032 0.8261 0.3565  0.2159  0.1716  170 PRO B O   
4098 C CB  . PRO B 140 ? 0.8147 0.8566 0.6961 0.3625  0.1507  0.1945  170 PRO B CB  
4099 C CG  . PRO B 140 ? 0.7711 0.9073 0.6673 0.3514  0.1187  0.1939  170 PRO B CG  
4100 C CD  . PRO B 140 ? 0.7197 0.8269 0.6204 0.3231  0.1030  0.1748  170 PRO B CD  
4101 N N   . THR B 141 ? 0.9185 0.8001 0.8018 0.2958  0.1484  0.1401  171 THR B N   
4102 C CA  . THR B 141 ? 0.9260 0.7401 0.8095 0.2681  0.1549  0.1153  171 THR B CA  
4103 C C   . THR B 141 ? 0.9710 0.7772 0.8671 0.2367  0.1294  0.0931  171 THR B C   
4104 O O   . THR B 141 ? 1.0959 0.9441 1.0009 0.2325  0.1062  0.0955  171 THR B O   
4105 C CB  . THR B 141 ? 0.9116 0.7284 0.8035 0.2498  0.1481  0.1060  171 THR B CB  
4106 O OG1 . THR B 141 ? 0.8438 0.7085 0.7545 0.2244  0.1100  0.0978  171 THR B OG1 
4107 C CG2 . THR B 141 ? 0.8013 0.6333 0.6830 0.2807  0.1711  0.1281  171 THR B CG2 
4108 N N   . TYR B 142 ? 0.9180 0.6741 0.8141 0.2144  0.1357  0.0706  172 TYR B N   
4109 C CA  . TYR B 142 ? 0.9466 0.6953 0.8517 0.1854  0.1159  0.0495  172 TYR B CA  
4110 C C   . TYR B 142 ? 0.8220 0.6044 0.7463 0.1656  0.0794  0.0421  172 TYR B C   
4111 O O   . TYR B 142 ? 0.7238 0.5202 0.6561 0.1548  0.0589  0.0368  172 TYR B O   
4112 C CB  . TYR B 142 ? 1.1376 0.8431 1.0340 0.1642  0.1358  0.0292  172 TYR B CB  
4113 C CG  . TYR B 142 ? 1.1952 0.9059 1.1052 0.1338  0.1134  0.0061  172 TYR B CG  
4114 C CD1 . TYR B 142 ? 1.1786 0.8951 1.0930 0.1267  0.1013  0.0008  172 TYR B CD1 
4115 C CD2 . TYR B 142 ? 1.2219 0.9337 1.1394 0.1156  0.1063  -0.0098 172 TYR B CD2 
4116 C CE1 . TYR B 142 ? 1.1890 0.9139 1.1160 0.1045  0.0827  -0.0177 172 TYR B CE1 
4117 C CE2 . TYR B 142 ? 1.1794 0.9021 1.1085 0.0954  0.0873  -0.0279 172 TYR B CE2 
4118 C CZ  . TYR B 142 ? 1.2186 0.9481 1.1528 0.0911  0.0759  -0.0309 172 TYR B CZ  
4119 O OH  . TYR B 142 ? 1.2609 1.0036 1.2068 0.0764  0.0584  -0.0468 172 TYR B OH  
4120 N N   . GLU B 143 ? 0.7675 0.5617 0.6949 0.1588  0.0745  0.0424  173 GLU B N   
4121 C CA  . GLU B 143 ? 0.6235 0.4447 0.5619 0.1386  0.0457  0.0373  173 GLU B CA  
4122 C C   . GLU B 143 ? 0.5725 0.4416 0.5149 0.1409  0.0305  0.0493  173 GLU B C   
4123 O O   . GLU B 143 ? 0.5890 0.4694 0.5370 0.1222  0.0104  0.0420  173 GLU B O   
4124 C CB  . GLU B 143 ? 0.7317 0.5536 0.6698 0.1316  0.0471  0.0356  173 GLU B CB  
4125 C CG  . GLU B 143 ? 0.8552 0.6413 0.7899 0.1223  0.0605  0.0189  173 GLU B CG  
4126 C CD  . GLU B 143 ? 1.1207 0.8795 1.0429 0.1371  0.0958  0.0218  173 GLU B CD  
4127 O OE1 . GLU B 143 ? 1.2614 1.0027 1.1793 0.1267  0.1095  0.0096  173 GLU B OE1 
4128 O OE2 . GLU B 143 ? 1.1011 0.8555 1.0155 0.1597  0.1125  0.0365  173 GLU B OE2 
4129 N N   . LEU B 144 ? 0.6541 0.5537 0.5918 0.1637  0.0426  0.0671  174 LEU B N   
4130 C CA  . LEU B 144 ? 0.5168 0.4769 0.4579 0.1656  0.0302  0.0764  174 LEU B CA  
4131 C C   . LEU B 144 ? 0.6230 0.5854 0.5642 0.1647  0.0251  0.0731  174 LEU B C   
4132 O O   . LEU B 144 ? 0.7808 0.7795 0.7271 0.1478  0.0085  0.0678  174 LEU B O   
4133 C CB  . LEU B 144 ? 0.4003 0.4035 0.3360 0.1960  0.0453  0.0981  174 LEU B CB  
4134 C CG  . LEU B 144 ? 0.5339 0.5583 0.4716 0.1961  0.0470  0.1030  174 LEU B CG  
4135 C CD1 . LEU B 144 ? 0.5311 0.5806 0.4599 0.2359  0.0705  0.1267  174 LEU B CD1 
4136 C CD2 . LEU B 144 ? 0.4829 0.5623 0.4296 0.1698  0.0240  0.0960  174 LEU B CD2 
4137 N N   . ALA B 145 ? 0.5627 0.4845 0.4965 0.1804  0.0421  0.0744  175 ALA B N   
4138 C CA  . ALA B 145 ? 0.5326 0.4502 0.4659 0.1787  0.0383  0.0700  175 ALA B CA  
4139 C C   . ALA B 145 ? 0.5976 0.4977 0.5407 0.1472  0.0176  0.0492  175 ALA B C   
4140 O O   . ALA B 145 ? 0.5682 0.4871 0.5141 0.1367  0.0064  0.0443  175 ALA B O   
4141 C CB  . ALA B 145 ? 0.4609 0.3280 0.3821 0.1976  0.0637  0.0723  175 ALA B CB  
4142 N N   . LEU B 146 ? 0.6184 0.4841 0.5649 0.1337  0.0145  0.0375  176 LEU B N   
4143 C CA  . LEU B 146 ? 0.5696 0.4180 0.5224 0.1104  -0.0025 0.0216  176 LEU B CA  
4144 C C   . LEU B 146 ? 0.5474 0.4274 0.5021 0.0927  -0.0181 0.0214  176 LEU B C   
4145 O O   . LEU B 146 ? 0.5887 0.4582 0.5443 0.0762  -0.0280 0.0114  176 LEU B O   
4146 C CB  . LEU B 146 ? 0.5313 0.3475 0.4854 0.1043  -0.0015 0.0118  176 LEU B CB  
4147 C CG  . LEU B 146 ? 0.6564 0.4443 0.6093 0.1031  0.0088  -0.0009 176 LEU B CG  
4148 C CD1 . LEU B 146 ? 0.5298 0.3088 0.4827 0.0948  0.0119  -0.0103 176 LEU B CD1 
4149 C CD2 . LEU B 146 ? 0.7918 0.5784 0.7492 0.0915  -0.0036 -0.0107 176 LEU B CD2 
4150 N N   . GLN B 147 ? 0.5138 0.4307 0.4672 0.0954  -0.0171 0.0314  177 GLN B N   
4151 C CA  . GLN B 147 ? 0.4403 0.3897 0.3932 0.0741  -0.0276 0.0282  177 GLN B CA  
4152 C C   . GLN B 147 ? 0.4240 0.4132 0.3769 0.0669  -0.0305 0.0259  177 GLN B C   
4153 O O   . GLN B 147 ? 0.5703 0.5543 0.5210 0.0424  -0.0367 0.0134  177 GLN B O   
4154 C CB  . GLN B 147 ? 0.4569 0.4417 0.4093 0.0779  -0.0248 0.0376  177 GLN B CB  
4155 C CG  . GLN B 147 ? 0.4255 0.3741 0.3762 0.0741  -0.0249 0.0356  177 GLN B CG  
4156 C CD  . GLN B 147 ? 0.5942 0.5098 0.5407 0.0515  -0.0344 0.0241  177 GLN B CD  
4157 O OE1 . GLN B 147 ? 0.6232 0.5534 0.5647 0.0307  -0.0383 0.0191  177 GLN B OE1 
4158 N NE2 . GLN B 147 ? 0.6182 0.4904 0.5645 0.0557  -0.0353 0.0194  177 GLN B NE2 
4159 N N   . THR B 148 ? 0.4713 0.4998 0.4244 0.0894  -0.0234 0.0384  178 THR B N   
4160 C CA  . THR B 148 ? 0.5017 0.5765 0.4541 0.0872  -0.0254 0.0377  178 THR B CA  
4161 C C   . THR B 148 ? 0.5752 0.6068 0.5277 0.0744  -0.0290 0.0241  178 THR B C   
4162 O O   . THR B 148 ? 0.6217 0.6754 0.5734 0.0520  -0.0343 0.0126  178 THR B O   
4163 C CB  . THR B 148 ? 0.5189 0.6295 0.4677 0.1240  -0.0138 0.0581  178 THR B CB  
4164 O OG1 . THR B 148 ? 0.6290 0.7800 0.5772 0.1408  -0.0083 0.0726  178 THR B OG1 
4165 C CG2 . THR B 148 ? 0.5386 0.7102 0.4858 0.1224  -0.0173 0.0582  178 THR B CG2 
4166 N N   . GLY B 149 ? 0.5072 0.4796 0.4602 0.0867  -0.0241 0.0235  179 GLY B N   
4167 C CA  . GLY B 149 ? 0.5391 0.4716 0.4934 0.0772  -0.0269 0.0106  179 GLY B CA  
4168 C C   . GLY B 149 ? 0.6151 0.5293 0.5693 0.0485  -0.0360 -0.0044 179 GLY B C   
4169 O O   . GLY B 149 ? 0.6063 0.5098 0.5598 0.0360  -0.0379 -0.0150 179 GLY B O   
4170 N N   . LYS B 150 ? 0.5623 0.4686 0.5146 0.0389  -0.0388 -0.0047 180 LYS B N   
4171 C CA  . LYS B 150 ? 0.5454 0.4241 0.4915 0.0149  -0.0417 -0.0160 180 LYS B CA  
4172 C C   . LYS B 150 ? 0.6117 0.5247 0.5519 -0.0114 -0.0398 -0.0255 180 LYS B C   
4173 O O   . LYS B 150 ? 0.7804 0.6645 0.7140 -0.0298 -0.0367 -0.0378 180 LYS B O   
4174 C CB  . LYS B 150 ? 0.6796 0.5424 0.6212 0.0120  -0.0426 -0.0122 180 LYS B CB  
4175 C CG  . LYS B 150 ? 0.8992 0.7203 0.8434 0.0281  -0.0444 -0.0099 180 LYS B CG  
4176 C CD  . LYS B 150 ? 1.0317 0.8219 0.9655 0.0192  -0.0453 -0.0105 180 LYS B CD  
4177 C CE  . LYS B 150 ? 1.0561 0.8113 0.9914 0.0337  -0.0481 -0.0118 180 LYS B CE  
4178 N NZ  . LYS B 150 ? 1.0706 0.7895 0.9913 0.0285  -0.0463 -0.0118 180 LYS B NZ  
4179 N N   . VAL B 151 ? 0.5212 0.4992 0.4628 -0.0133 -0.0396 -0.0209 181 VAL B N   
4180 C CA  . VAL B 151 ? 0.5878 0.6179 0.5246 -0.0408 -0.0370 -0.0329 181 VAL B CA  
4181 C C   . VAL B 151 ? 0.5246 0.5555 0.4625 -0.0430 -0.0365 -0.0405 181 VAL B C   
4182 O O   . VAL B 151 ? 0.5753 0.5957 0.5057 -0.0723 -0.0313 -0.0579 181 VAL B O   
4183 C CB  . VAL B 151 ? 0.5785 0.6960 0.5195 -0.0334 -0.0382 -0.0239 181 VAL B CB  
4184 C CG1 . VAL B 151 ? 0.5190 0.7023 0.4545 -0.0698 -0.0348 -0.0413 181 VAL B CG1 
4185 C CG2 . VAL B 151 ? 0.4325 0.5446 0.3749 -0.0221 -0.0387 -0.0129 181 VAL B CG2 
4186 N N   . ILE B 152 ? 0.4718 0.5105 0.4165 -0.0126 -0.0387 -0.0277 182 ILE B N   
4187 C CA  . ILE B 152 ? 0.5104 0.5464 0.4557 -0.0104 -0.0380 -0.0327 182 ILE B CA  
4188 C C   . ILE B 152 ? 0.4790 0.4450 0.4220 -0.0257 -0.0364 -0.0475 182 ILE B C   
4189 O O   . ILE B 152 ? 0.6396 0.6099 0.5781 -0.0484 -0.0331 -0.0622 182 ILE B O   
4190 C CB  . ILE B 152 ? 0.4602 0.4936 0.4092 0.0271  -0.0360 -0.0154 182 ILE B CB  
4191 C CG1 . ILE B 152 ? 0.3400 0.4435 0.2880 0.0484  -0.0337 0.0027  182 ILE B CG1 
4192 C CG2 . ILE B 152 ? 0.3029 0.3298 0.2510 0.0286  -0.0342 -0.0209 182 ILE B CG2 
4193 C CD1 . ILE B 152 ? 0.3878 0.4833 0.3327 0.0868  -0.0247 0.0214  182 ILE B CD1 
4194 N N   . GLU B 153 ? 0.5706 0.4766 0.5160 -0.0127 -0.0376 -0.0440 183 GLU B N   
4195 C CA  . GLU B 153 ? 0.7003 0.5460 0.6433 -0.0202 -0.0356 -0.0550 183 GLU B CA  
4196 C C   . GLU B 153 ? 0.7091 0.5387 0.6391 -0.0514 -0.0281 -0.0678 183 GLU B C   
4197 O O   . GLU B 153 ? 0.8271 0.6235 0.7512 -0.0643 -0.0214 -0.0797 183 GLU B O   
4198 C CB  . GLU B 153 ? 0.5314 0.3313 0.4786 0.0002  -0.0385 -0.0488 183 GLU B CB  
4199 C CG  . GLU B 153 ? 0.6019 0.4049 0.5583 0.0253  -0.0394 -0.0416 183 GLU B CG  
4200 C CD  . GLU B 153 ? 0.6769 0.4610 0.6362 0.0397  -0.0405 -0.0355 183 GLU B CD  
4201 O OE1 . GLU B 153 ? 0.6940 0.4630 0.6489 0.0332  -0.0431 -0.0352 183 GLU B OE1 
4202 O OE2 . GLU B 153 ? 0.5523 0.3355 0.5159 0.0562  -0.0361 -0.0318 183 GLU B OE2 
4203 N N   . GLN B 154 ? 0.6766 0.5269 0.6003 -0.0643 -0.0260 -0.0662 184 GLN B N   
4204 C CA  . GLN B 154 ? 0.7818 0.6070 0.6883 -0.0959 -0.0132 -0.0790 184 GLN B CA  
4205 C C   . GLN B 154 ? 0.8749 0.7423 0.7747 -0.1305 -0.0041 -0.0975 184 GLN B C   
4206 O O   . GLN B 154 ? 1.1048 0.9330 0.9894 -0.1568 0.0116  -0.1135 184 GLN B O   
4207 C CB  . GLN B 154 ? 0.8755 0.7074 0.7761 -0.1001 -0.0123 -0.0725 184 GLN B CB  
4208 C CG  . GLN B 154 ? 1.1347 0.9337 1.0125 -0.1343 0.0061  -0.0857 184 GLN B CG  
4209 C CD  . GLN B 154 ? 1.2661 1.0812 1.1378 -0.1418 0.0077  -0.0808 184 GLN B CD  
4210 O OE1 . GLN B 154 ? 1.2566 1.1114 1.1425 -0.1209 -0.0059 -0.0673 184 GLN B OE1 
4211 N NE2 . GLN B 154 ? 1.2712 1.0512 1.1194 -0.1723 0.0275  -0.0922 184 GLN B NE2 
4212 N N   . MET B 155 ? 0.7824 0.7320 0.6914 -0.1298 -0.0116 -0.0954 185 MET B N   
4213 C CA  . MET B 155 ? 0.7703 0.7809 0.6740 -0.1634 -0.0044 -0.1141 185 MET B CA  
4214 C C   . MET B 155 ? 0.6797 0.6825 0.5857 -0.1631 -0.0038 -0.1217 185 MET B C   
4215 O O   . MET B 155 ? 0.6678 0.6901 0.5647 -0.1979 0.0075  -0.1432 185 MET B O   
4216 C CB  . MET B 155 ? 0.7424 0.8574 0.6547 -0.1579 -0.0129 -0.1068 185 MET B CB  
4217 C CG  . MET B 155 ? 0.7740 0.9697 0.6790 -0.2003 -0.0043 -0.1299 185 MET B CG  
4218 S SD  . MET B 155 ? 0.7338 1.0711 0.6502 -0.1840 -0.0159 -0.1179 185 MET B SD  
4219 C CE  . MET B 155 ? 0.8561 1.1827 0.7753 -0.1692 -0.0190 -0.1025 185 MET B CE  
4220 N N   . GLY B 156 ? 0.6780 0.6523 0.5952 -0.1266 -0.0138 -0.1063 186 GLY B N   
4221 C CA  . GLY B 156 ? 0.7313 0.6984 0.6516 -0.1234 -0.0138 -0.1120 186 GLY B CA  
4222 C C   . GLY B 156 ? 0.7506 0.6291 0.6676 -0.1212 -0.0076 -0.1180 186 GLY B C   
4223 O O   . GLY B 156 ? 0.7475 0.6090 0.6708 -0.1073 -0.0104 -0.1178 186 GLY B O   
4224 N N   . LYS B 157 ? 0.7471 0.5706 0.6527 -0.1332 0.0023  -0.1224 187 LYS B N   
4225 C CA  . LYS B 157 ? 0.7798 0.5219 0.6804 -0.1237 0.0095  -0.1236 187 LYS B CA  
4226 C C   . LYS B 157 ? 0.9619 0.6810 0.8549 -0.1443 0.0229  -0.1420 187 LYS B C   
4227 O O   . LYS B 157 ? 1.0975 0.7674 0.9929 -0.1277 0.0246  -0.1412 187 LYS B O   
4228 C CB  . LYS B 157 ? 0.8379 0.5274 0.7226 -0.1282 0.0207  -0.1207 187 LYS B CB  
4229 C CG  . LYS B 157 ? 0.9339 0.6128 0.7957 -0.1711 0.0438  -0.1392 187 LYS B CG  
4230 C CD  . LYS B 157 ? 1.0539 0.6618 0.8946 -0.1704 0.0600  -0.1338 187 LYS B CD  
4231 C CE  . LYS B 157 ? 1.1930 0.8190 1.0413 -0.1487 0.0448  -0.1150 187 LYS B CE  
4232 N NZ  . LYS B 157 ? 1.3030 0.8618 1.1284 -0.1452 0.0606  -0.1074 187 LYS B NZ  
4233 N N   . PHE B 158 ? 1.0305 0.7903 0.9142 -0.1816 0.0334  -0.1600 188 PHE B N   
4234 C CA  . PHE B 158 ? 1.0862 0.8294 0.9612 -0.2067 0.0486  -0.1807 188 PHE B CA  
4235 C C   . PHE B 158 ? 1.0104 0.8112 0.9003 -0.1986 0.0351  -0.1811 188 PHE B C   
4236 O O   . PHE B 158 ? 1.0214 0.8386 0.9051 -0.2255 0.0452  -0.2002 188 PHE B O   
4237 C CB  . PHE B 158 ? 1.1671 0.9211 1.0206 -0.2581 0.0724  -0.2054 188 PHE B CB  
4238 C CG  . PHE B 158 ? 1.3553 1.0473 1.1887 -0.2681 0.0909  -0.2051 188 PHE B CG  
4239 C CD1 . PHE B 158 ? 1.4983 1.0909 1.3169 -0.2554 0.1082  -0.2013 188 PHE B CD1 
4240 C CD2 . PHE B 158 ? 1.4260 1.1607 1.2538 -0.2879 0.0924  -0.2075 188 PHE B CD2 
4241 C CE1 . PHE B 158 ? 1.5917 1.1234 1.3872 -0.2606 0.1280  -0.1978 188 PHE B CE1 
4242 C CE2 . PHE B 158 ? 1.5101 1.1835 1.3164 -0.2977 0.1117  -0.2070 188 PHE B CE2 
4243 C CZ  . PHE B 158 ? 1.5525 1.1218 1.3413 -0.2832 0.1302  -0.2011 188 PHE B CZ  
4244 N N   . TYR B 159 ? 0.8976 0.7267 0.8041 -0.1623 0.0150  -0.1603 189 TYR B N   
4245 C CA  . TYR B 159 ? 0.8808 0.7446 0.7982 -0.1452 0.0050  -0.1556 189 TYR B CA  
4246 C C   . TYR B 159 ? 0.9124 0.7142 0.8391 -0.1146 0.0006  -0.1473 189 TYR B C   
4247 O O   . TYR B 159 ? 0.7657 0.5582 0.7010 -0.0857 -0.0089 -0.1309 189 TYR B O   
4248 C CB  . TYR B 159 ? 0.8692 0.8074 0.7941 -0.1250 -0.0082 -0.1378 189 TYR B CB  
4249 C CG  . TYR B 159 ? 0.9339 0.9629 0.8538 -0.1471 -0.0072 -0.1460 189 TYR B CG  
4250 C CD1 . TYR B 159 ? 1.0237 1.1130 0.9393 -0.1651 -0.0065 -0.1485 189 TYR B CD1 
4251 C CD2 . TYR B 159 ? 1.0962 1.1583 1.0155 -0.1502 -0.0070 -0.1520 189 TYR B CD2 
4252 C CE1 . TYR B 159 ? 1.1186 1.3070 1.0304 -0.1855 -0.0060 -0.1576 189 TYR B CE1 
4253 C CE2 . TYR B 159 ? 1.2229 1.3811 1.1371 -0.1694 -0.0067 -0.1595 189 TYR B CE2 
4254 C CZ  . TYR B 159 ? 1.2453 1.4704 1.1563 -0.1869 -0.0065 -0.1627 189 TYR B CZ  
4255 O OH  . TYR B 159 ? 1.3260 1.6617 1.2327 -0.2064 -0.0067 -0.1718 189 TYR B OH  
4256 N N   . PRO B 160 ? 1.1768 0.9405 1.1015 -0.1226 0.0089  -0.1607 190 PRO B N   
4257 C CA  . PRO B 160 ? 1.2532 0.9790 1.1893 -0.0933 0.0097  -0.1482 190 PRO B CA  
4258 C C   . PRO B 160 ? 1.1822 0.9234 1.1328 -0.0613 -0.0042 -0.1324 190 PRO B C   
4259 O O   . PRO B 160 ? 1.0319 0.7620 0.9899 -0.0402 -0.0086 -0.1182 190 PRO B O   
4260 C CB  . PRO B 160 ? 1.2662 0.9895 1.2011 -0.1071 0.0200  -0.1612 190 PRO B CB  
4261 C CG  . PRO B 160 ? 1.2099 0.9786 1.1344 -0.1392 0.0183  -0.1805 190 PRO B CG  
4262 C CD  . PRO B 160 ? 1.2477 1.0325 1.1632 -0.1560 0.0203  -0.1811 190 PRO B CD  
4263 N N   . GLU B 161 ? 1.1438 0.9102 1.0947 -0.0596 -0.0089 -0.1368 191 GLU B N   
4264 C CA  . GLU B 161 ? 1.0751 0.8441 1.0349 -0.0310 -0.0138 -0.1237 191 GLU B CA  
4265 C C   . GLU B 161 ? 0.9040 0.7094 0.8591 -0.0174 -0.0178 -0.1105 191 GLU B C   
4266 O O   . GLU B 161 ? 0.8261 0.6425 0.7799 0.0005  -0.0152 -0.1019 191 GLU B O   
4267 C CB  . GLU B 161 ? 1.2358 1.0066 1.1997 -0.0291 -0.0094 -0.1278 191 GLU B CB  
4268 C CG  . GLU B 161 ? 1.3142 1.0689 1.2862 -0.0366 -0.0026 -0.1320 191 GLU B CG  
4269 C CD  . GLU B 161 ? 1.4414 1.1978 1.4231 -0.0272 -0.0002 -0.1314 191 GLU B CD  
4270 O OE1 . GLU B 161 ? 1.4513 1.2111 1.4417 -0.0100 -0.0031 -0.1219 191 GLU B OE1 
4271 O OE2 . GLU B 161 ? 1.4695 1.2248 1.4492 -0.0405 0.0064  -0.1425 191 GLU B OE2 
4272 N N   . LEU B 162 ? 0.8565 0.6853 0.8088 -0.0235 -0.0208 -0.1044 192 LEU B N   
4273 C CA  . LEU B 162 ? 0.8000 0.6707 0.7502 -0.0057 -0.0230 -0.0857 192 LEU B CA  
4274 C C   . LEU B 162 ? 0.6776 0.5128 0.6332 0.0151  -0.0237 -0.0761 192 LEU B C   
4275 O O   . LEU B 162 ? 0.6600 0.4673 0.6187 0.0085  -0.0268 -0.0803 192 LEU B O   
4276 C CB  . LEU B 162 ? 0.8762 0.7988 0.8215 -0.0248 -0.0253 -0.0861 192 LEU B CB  
4277 C CG  . LEU B 162 ? 0.8542 0.8188 0.7988 -0.0049 -0.0277 -0.0664 192 LEU B CG  
4278 C CD1 . LEU B 162 ? 0.7686 0.7965 0.7072 0.0129  -0.0256 -0.0525 192 LEU B CD1 
4279 C CD2 . LEU B 162 ? 0.9189 0.9113 0.8615 -0.0273 -0.0300 -0.0714 192 LEU B CD2 
4280 N N   . LYS B 163 ? 0.6074 0.4428 0.5612 0.0397  -0.0181 -0.0635 193 LYS B N   
4281 C CA  . LYS B 163 ? 0.5342 0.3352 0.4916 0.0557  -0.0146 -0.0587 193 LYS B CA  
4282 C C   . LYS B 163 ? 0.6094 0.4341 0.5606 0.0751  -0.0089 -0.0394 193 LYS B C   
4283 O O   . LYS B 163 ? 0.7455 0.6118 0.6882 0.0864  -0.0046 -0.0258 193 LYS B O   
4284 C CB  . LYS B 163 ? 0.6206 0.3929 0.5796 0.0619  -0.0063 -0.0637 193 LYS B CB  
4285 C CG  . LYS B 163 ? 0.5666 0.3381 0.5387 0.0457  -0.0131 -0.0715 193 LYS B CG  
4286 C CD  . LYS B 163 ? 0.7564 0.5261 0.7309 0.0304  -0.0205 -0.0805 193 LYS B CD  
4287 C CE  . LYS B 163 ? 0.9889 0.7551 0.9744 0.0248  -0.0224 -0.0850 193 LYS B CE  
4288 N NZ  . LYS B 163 ? 1.0561 0.8107 1.0384 0.0112  -0.0229 -0.0916 193 LYS B NZ  
4289 N N   . LEU B 164 ? 0.5717 0.3729 0.5263 0.0809  -0.0077 -0.0378 194 LEU B N   
4290 C CA  . LEU B 164 ? 0.3739 0.1912 0.3228 0.0983  -0.0005 -0.0207 194 LEU B CA  
4291 C C   . LEU B 164 ? 0.4444 0.2241 0.3892 0.1092  0.0148  -0.0206 194 LEU B C   
4292 O O   . LEU B 164 ? 0.6210 0.3919 0.5714 0.0911  0.0111  -0.0316 194 LEU B O   
4293 C CB  . LEU B 164 ? 0.4185 0.2539 0.3723 0.0867  -0.0121 -0.0198 194 LEU B CB  
4294 C CG  . LEU B 164 ? 0.6754 0.5307 0.6253 0.1018  -0.0068 -0.0038 194 LEU B CG  
4295 C CD1 . LEU B 164 ? 0.7394 0.6414 0.6799 0.1220  0.0016  0.0146  194 LEU B CD1 
4296 C CD2 . LEU B 164 ? 0.7042 0.5764 0.6586 0.0849  -0.0189 -0.0063 194 LEU B CD2 
4297 N N   . ALA B 165 ? 0.4631 0.2410 0.3948 0.1325  0.0336  -0.0049 195 ALA B N   
4298 C CA  . ALA B 165 ? 0.4868 0.2386 0.4071 0.1311  0.0540  -0.0046 195 ALA B CA  
4299 C C   . ALA B 165 ? 0.5825 0.3360 0.4949 0.1493  0.0658  0.0107  195 ALA B C   
4300 O O   . ALA B 165 ? 0.6376 0.4142 0.5464 0.1763  0.0685  0.0299  195 ALA B O   
4301 C CB  . ALA B 165 ? 0.4737 0.2015 0.3774 0.1394  0.0766  -0.0017 195 ALA B CB  
4302 N N   . TYR B 166 ? 0.5796 0.3165 0.4919 0.1367  0.0727  0.0032  196 TYR B N   
4303 C CA  . TYR B 166 ? 0.6079 0.3406 0.5123 0.1509  0.0865  0.0151  196 TYR B CA  
4304 C C   . TYR B 166 ? 0.7324 0.4251 0.6137 0.1624  0.1242  0.0213  196 TYR B C   
4305 O O   . TYR B 166 ? 0.7283 0.3945 0.6076 0.1429  0.1374  0.0058  196 TYR B O   
4306 C CB  . TYR B 166 ? 0.4685 0.2073 0.3863 0.1312  0.0721  0.0030  196 TYR B CB  
4307 C CG  . TYR B 166 ? 0.4733 0.2406 0.4073 0.1239  0.0423  0.0010  196 TYR B CG  
4308 C CD1 . TYR B 166 ? 0.4431 0.2143 0.3885 0.1041  0.0236  -0.0135 196 TYR B CD1 
4309 C CD2 . TYR B 166 ? 0.4242 0.2141 0.3614 0.1383  0.0357  0.0150  196 TYR B CD2 
4310 C CE1 . TYR B 166 ? 0.5163 0.3007 0.4709 0.0970  0.0031  -0.0150 196 TYR B CE1 
4311 C CE2 . TYR B 166 ? 0.3741 0.1889 0.3220 0.1253  0.0128  0.0124  196 TYR B CE2 
4312 C CZ  . TYR B 166 ? 0.4860 0.2869 0.4414 0.1065  -0.0013 -0.0032 196 TYR B CZ  
4313 O OH  . TYR B 166 ? 0.6422 0.4614 0.6013 0.0897  -0.0174 -0.0059 196 TYR B OH  
4314 N N   . ALA B 167 ? 0.7265 0.4165 0.5899 0.1961  0.1441  0.0449  197 ALA B N   
4315 C CA  . ALA B 167 ? 0.8413 0.4828 0.6757 0.2130  0.1872  0.0554  197 ALA B CA  
4316 C C   . ALA B 167 ? 0.9673 0.5931 0.7958 0.2172  0.2042  0.0593  197 ALA B C   
4317 O O   . ALA B 167 ? 1.0128 0.6420 0.8280 0.2510  0.2207  0.0835  197 ALA B O   
4318 C CB  . ALA B 167 ? 0.7042 0.3503 0.5186 0.2547  0.2041  0.0833  197 ALA B CB  
4319 N N   . VAL B 168 ? 0.9129 0.5269 0.7525 0.1846  0.2000  0.0360  198 VAL B N   
4320 C CA  . VAL B 168 ? 0.8801 0.4801 0.7167 0.1832  0.2143  0.0350  198 VAL B CA  
4321 C C   . VAL B 168 ? 1.0286 0.5772 0.8518 0.1616  0.2491  0.0163  198 VAL B C   
4322 O O   . VAL B 168 ? 1.2348 0.7737 1.0613 0.1396  0.2504  -0.0016 198 VAL B O   
4323 C CB  . VAL B 168 ? 0.7830 0.4242 0.6472 0.1635  0.1765  0.0226  198 VAL B CB  
4324 C CG1 . VAL B 168 ? 0.7409 0.4299 0.6180 0.1803  0.1468  0.0382  198 VAL B CG1 
4325 C CG2 . VAL B 168 ? 0.8094 0.4601 0.6913 0.1307  0.1560  -0.0028 198 VAL B CG2 
4326 N N   . ARG B 169 ? 1.1947 0.7116 1.0031 0.1668  0.2794  0.0188  199 ARG B N   
4327 C CA  . ARG B 169 ? 1.3074 0.7780 1.1049 0.1397  0.3142  -0.0048 199 ARG B CA  
4328 C C   . ARG B 169 ? 1.2047 0.7129 1.0323 0.1016  0.2828  -0.0358 199 ARG B C   
4329 O O   . ARG B 169 ? 1.1330 0.6890 0.9842 0.0991  0.2431  -0.0365 199 ARG B O   
4330 C CB  . ARG B 169 ? 1.4777 0.9141 1.2576 0.1499  0.3479  0.0013  199 ARG B CB  
4331 C CG  . ARG B 169 ? 1.7328 1.1000 1.4713 0.1787  0.4052  0.0219  199 ARG B CG  
4332 C CD  . ARG B 169 ? 1.8704 1.2363 1.5965 0.2190  0.4175  0.0517  199 ARG B CD  
4333 N NE  . ARG B 169 ? 1.9066 1.3122 1.6334 0.2615  0.3974  0.0845  199 ARG B NE  
4334 C CZ  . ARG B 169 ? 1.9711 1.4062 1.6973 0.2999  0.3938  0.1123  199 ARG B CZ  
4335 N NH1 . ARG B 169 ? 1.9696 1.3928 1.6937 0.3017  0.4087  0.1122  199 ARG B NH1 
4336 N NH2 . ARG B 169 ? 1.9635 1.4461 1.6925 0.3362  0.3753  0.1391  199 ARG B NH2 
4337 N N   . GLY B 170 ? 1.2105 0.6978 1.0360 0.0738  0.3028  -0.0611 200 GLY B N   
4338 C CA  . GLY B 170 ? 1.2904 0.8200 1.1440 0.0428  0.2756  -0.0903 200 GLY B CA  
4339 C C   . GLY B 170 ? 1.2660 0.8224 1.1343 0.0411  0.2494  -0.0911 200 GLY B C   
4340 O O   . GLY B 170 ? 1.2634 0.8621 1.1568 0.0247  0.2204  -0.1090 200 GLY B O   
4341 N N   . ASN B 171 ? 1.1616 0.6931 1.0125 0.0611  0.2611  -0.0710 201 ASN B N   
4342 C CA  . ASN B 171 ? 0.9414 0.4926 0.8026 0.0601  0.2407  -0.0711 201 ASN B CA  
4343 C C   . ASN B 171 ? 0.9822 0.4823 0.8164 0.0634  0.2805  -0.0683 201 ASN B C   
4344 O O   . ASN B 171 ? 0.9662 0.4491 0.7814 0.0915  0.2875  -0.0434 201 ASN B O   
4345 C CB  . ASN B 171 ? 0.8421 0.4291 0.7127 0.0829  0.2032  -0.0486 201 ASN B CB  
4346 C CG  . ASN B 171 ? 0.8073 0.4215 0.6938 0.0765  0.1769  -0.0538 201 ASN B CG  
4347 O OD1 . ASN B 171 ? 0.8666 0.4811 0.7618 0.0564  0.1812  -0.0737 201 ASN B OD1 
4348 N ND2 . ASN B 171 ? 0.7026 0.3410 0.5933 0.0926  0.1516  -0.0378 201 ASN B ND2 
4349 N N   . LYS B 172 ? 1.0975 0.5744 0.9286 0.0349  0.3087  -0.0952 202 LYS B N   
4350 C CA  . LYS B 172 ? 1.2454 0.6673 1.0487 0.0327  0.3510  -0.0965 202 LYS B CA  
4351 C C   . LYS B 172 ? 1.1029 0.5507 0.9191 0.0334  0.3263  -0.0956 202 LYS B C   
4352 O O   . LYS B 172 ? 0.9663 0.4721 0.8161 0.0236  0.2834  -0.1056 202 LYS B O   
4353 C CB  . LYS B 172 ? 1.4381 0.8276 1.2335 -0.0048 0.3933  -0.1314 202 LYS B CB  
4354 C CG  . LYS B 172 ? 1.5447 0.9924 1.3765 -0.0388 0.3673  -0.1664 202 LYS B CG  
4355 C CD  . LYS B 172 ? 1.6291 1.0458 1.4494 -0.0780 0.4146  -0.2037 202 LYS B CD  
4356 C CE  . LYS B 172 ? 1.5986 0.9831 1.4039 -0.0794 0.4348  -0.2025 202 LYS B CE  
4357 N NZ  . LYS B 172 ? 1.5731 0.9427 1.3742 -0.1240 0.4749  -0.2453 202 LYS B NZ  
4358 N N   . LEU B 173 ? 1.0253 0.4259 0.8119 0.0472  0.3564  -0.0827 203 LEU B N   
4359 C CA  . LEU B 173 ? 1.1587 0.5750 0.9527 0.0462  0.3405  -0.0836 203 LEU B CA  
4360 C C   . LEU B 173 ? 1.3070 0.6794 1.0859 0.0193  0.3830  -0.1074 203 LEU B C   
4361 O O   . LEU B 173 ? 1.3668 0.6852 1.1210 0.0066  0.4309  -0.1182 203 LEU B O   
4362 C CB  . LEU B 173 ? 1.1819 0.5848 0.9531 0.0858  0.3393  -0.0497 203 LEU B CB  
4363 C CG  . LEU B 173 ? 1.0453 0.4856 0.8247 0.1140  0.3080  -0.0262 203 LEU B CG  
4364 C CD1 . LEU B 173 ? 1.1414 0.5635 0.8917 0.1572  0.3215  0.0064  203 LEU B CD1 
4365 C CD2 . LEU B 173 ? 0.7716 0.2820 0.5912 0.1017  0.2520  -0.0351 203 LEU B CD2 
4366 N N   . GLU B 174 ? 1.3550 0.7486 1.1479 0.0081  0.3685  -0.1178 204 GLU B N   
4367 C CA  . GLU B 174 ? 1.3996 0.7534 1.1780 -0.0185 0.4095  -0.1414 204 GLU B CA  
4368 C C   . GLU B 174 ? 1.5089 0.7941 1.2420 0.0060  0.4468  -0.1180 204 GLU B C   
4369 O O   . GLU B 174 ? 1.4682 0.7583 1.1914 0.0430  0.4289  -0.0863 204 GLU B O   
4370 C CB  . GLU B 174 ? 1.3544 0.7662 1.1709 -0.0426 0.3787  -0.1664 204 GLU B CB  
4371 C CG  . GLU B 174 ? 1.4413 0.8640 1.2591 -0.0256 0.3573  -0.1502 204 GLU B CG  
4372 C CD  . GLU B 174 ? 1.4104 0.8745 1.2588 -0.0510 0.3420  -0.1773 204 GLU B CD  
4373 O OE1 . GLU B 174 ? 1.3798 0.8383 1.2232 -0.0447 0.3389  -0.1705 204 GLU B OE1 
4374 O OE2 . GLU B 174 ? 1.3258 0.8303 1.2029 -0.0756 0.3338  -0.2059 204 GLU B OE2 
4375 N N   . ARG B 175 ? 1.7026 0.9244 1.4065 -0.0145 0.5013  -0.1349 205 ARG B N   
4376 C CA  . ARG B 175 ? 1.8393 0.9857 1.4940 0.0101  0.5444  -0.1130 205 ARG B CA  
4377 C C   . ARG B 175 ? 1.6102 0.7913 1.2721 0.0396  0.5058  -0.0891 205 ARG B C   
4378 O O   . ARG B 175 ? 1.4201 0.6542 1.1156 0.0209  0.4704  -0.1051 205 ARG B O   
4379 C CB  . ARG B 175 ? 2.0961 1.1815 1.7265 -0.0260 0.6010  -0.1426 205 ARG B CB  
4380 C CG  . ARG B 175 ? 2.2318 1.3788 1.9066 -0.0739 0.5784  -0.1853 205 ARG B CG  
4381 C CD  . ARG B 175 ? 2.3158 1.5127 2.0150 -0.0661 0.5359  -0.1797 205 ARG B CD  
4382 N NE  . ARG B 175 ? 2.3559 1.6098 2.0955 -0.1067 0.5195  -0.2190 205 ARG B NE  
4383 C CZ  . ARG B 175 ? 2.3127 1.6225 2.0835 -0.1058 0.4791  -0.2211 205 ARG B CZ  
4384 N NH1 . ARG B 175 ? 2.2756 1.5914 2.0417 -0.0712 0.4510  -0.1888 205 ARG B NH1 
4385 N NH2 . ARG B 175 ? 2.2905 1.6524 2.0968 -0.1391 0.4686  -0.2571 205 ARG B NH2 
4386 N N   . GLY B 176 ? 1.5739 0.7279 1.2044 0.0873  0.5142  -0.0514 206 GLY B N   
4387 C CA  . GLY B 176 ? 1.5500 0.7317 1.1803 0.1178  0.4859  -0.0290 206 GLY B CA  
4388 C C   . GLY B 176 ? 1.5357 0.8052 1.2177 0.1009  0.4211  -0.0421 206 GLY B C   
4389 O O   . GLY B 176 ? 1.5133 0.7963 1.1996 0.1000  0.4078  -0.0440 206 GLY B O   
4390 N N   . GLN B 177 ? 1.4974 0.8225 1.2164 0.0880  0.3836  -0.0513 207 GLN B N   
4391 C CA  . GLN B 177 ? 1.3250 0.7256 1.0859 0.0820  0.3257  -0.0562 207 GLN B CA  
4392 C C   . GLN B 177 ? 1.2912 0.7089 1.0419 0.1217  0.3074  -0.0263 207 GLN B C   
4393 O O   . GLN B 177 ? 1.2411 0.6330 0.9656 0.1523  0.3289  -0.0034 207 GLN B O   
4394 C CB  . GLN B 177 ? 1.1200 0.5691 0.9191 0.0596  0.2959  -0.0736 207 GLN B CB  
4395 C CG  . GLN B 177 ? 1.1085 0.5604 0.9029 0.0779  0.2923  -0.0576 207 GLN B CG  
4396 C CD  . GLN B 177 ? 1.0118 0.5208 0.8451 0.0619  0.2525  -0.0704 207 GLN B CD  
4397 O OE1 . GLN B 177 ? 0.9489 0.4550 0.7889 0.0458  0.2627  -0.0844 207 GLN B OE1 
4398 N NE2 . GLN B 177 ? 0.9007 0.4585 0.7574 0.0665  0.2099  -0.0663 207 GLN B NE2 
4399 N N   . LYS B 178 ? 1.2531 0.7157 1.0242 0.1226  0.2707  -0.0271 208 LYS B N   
4400 C CA  . LYS B 178 ? 1.2343 0.7235 1.0004 0.1572  0.2525  -0.0039 208 LYS B CA  
4401 C C   . LYS B 178 ? 1.1057 0.6538 0.9076 0.1474  0.2079  -0.0102 208 LYS B C   
4402 O O   . LYS B 178 ? 1.0545 0.6335 0.8860 0.1200  0.1795  -0.0298 208 LYS B O   
4403 C CB  . LYS B 178 ? 1.3205 0.8131 1.0788 0.1679  0.2492  -0.0006 208 LYS B CB  
4404 N N   . ILE B 179 ? 0.9090 0.4707 0.7068 0.1717  0.2048  0.0077  209 ILE B N   
4405 C CA  . ILE B 179 ? 0.7061 0.3170 0.5333 0.1635  0.1674  0.0028  209 ILE B CA  
4406 C C   . ILE B 179 ? 0.7948 0.4437 0.6407 0.1590  0.1369  -0.0044 209 ILE B C   
4407 O O   . ILE B 179 ? 0.8989 0.5623 0.7354 0.1865  0.1387  0.0094  209 ILE B O   
4408 C CB  . ILE B 179 ? 0.8592 0.4835 0.6781 0.1951  0.1715  0.0258  209 ILE B CB  
4409 C CG1 . ILE B 179 ? 0.9789 0.5595 0.7779 0.1981  0.2050  0.0312  209 ILE B CG1 
4410 C CG2 . ILE B 179 ? 0.8311 0.5027 0.6795 0.1839  0.1350  0.0190  209 ILE B CG2 
4411 C CD1 . ILE B 179 ? 0.8940 0.4794 0.7148 0.1641  0.1924  0.0101  209 ILE B CD1 
4412 N N   . SER B 180 ? 0.8018 0.4698 0.6745 0.1273  0.1114  -0.0253 210 SER B N   
4413 C CA  . SER B 180 ? 0.7449 0.4395 0.6342 0.1174  0.0868  -0.0358 210 SER B CA  
4414 C C   . SER B 180 ? 0.7820 0.5085 0.6863 0.1195  0.0633  -0.0356 210 SER B C   
4415 O O   . SER B 180 ? 0.8011 0.5449 0.7166 0.1101  0.0468  -0.0469 210 SER B O   
4416 C CB  . SER B 180 ? 0.6933 0.3903 0.6022 0.0866  0.0771  -0.0556 210 SER B CB  
4417 O OG  . SER B 180 ? 0.7541 0.4579 0.6779 0.0737  0.0715  -0.0615 210 SER B OG  
4418 N N   . GLU B 181 ? 0.7293 0.4605 0.6326 0.1301  0.0649  -0.0248 211 GLU B N   
4419 C CA  . GLU B 181 ? 0.6957 0.4611 0.6121 0.1285  0.0449  -0.0230 211 GLU B CA  
4420 C C   . GLU B 181 ? 0.6479 0.4733 0.5535 0.1441  0.0437  -0.0011 211 GLU B C   
4421 O O   . GLU B 181 ? 0.6747 0.5042 0.5621 0.1732  0.0623  0.0205  211 GLU B O   
4422 C CB  . GLU B 181 ? 0.7231 0.4795 0.6433 0.1277  0.0450  -0.0202 211 GLU B CB  
4423 C CG  . GLU B 181 ? 0.6092 0.3566 0.5414 0.0991  0.0372  -0.0358 211 GLU B CG  
4424 C CD  . GLU B 181 ? 0.7821 0.5066 0.7068 0.0943  0.0573  -0.0393 211 GLU B CD  
4425 O OE1 . GLU B 181 ? 0.9381 0.6420 0.8427 0.1103  0.0799  -0.0295 211 GLU B OE1 
4426 O OE2 . GLU B 181 ? 0.7898 0.5171 0.7281 0.0770  0.0529  -0.0516 211 GLU B OE2 
4427 N N   . GLN B 182 ? 0.5418 0.4158 0.4566 0.1248  0.0243  -0.0073 212 GLN B N   
4428 C CA  . GLN B 182 ? 0.3877 0.3362 0.2942 0.1335  0.0209  0.0079  212 GLN B CA  
4429 C C   . GLN B 182 ? 0.5123 0.5017 0.4157 0.1519  0.0219  0.0277  212 GLN B C   
4430 O O   . GLN B 182 ? 0.5473 0.5974 0.4391 0.1746  0.0264  0.0481  212 GLN B O   
4431 C CB  . GLN B 182 ? 0.5233 0.5109 0.4394 0.0995  0.0039  -0.0110 212 GLN B CB  
4432 C CG  . GLN B 182 ? 0.5973 0.5555 0.5147 0.0838  0.0044  -0.0285 212 GLN B CG  
4433 C CD  . GLN B 182 ? 0.7312 0.6237 0.6620 0.0644  0.0002  -0.0499 212 GLN B CD  
4434 O OE1 . GLN B 182 ? 0.7466 0.6047 0.6832 0.0696  0.0005  -0.0491 212 GLN B OE1 
4435 N NE2 . GLN B 182 ? 0.8472 0.7263 0.7822 0.0434  -0.0029 -0.0686 212 GLN B NE2 
4436 N N   . ILE B 183 ? 0.6305 0.5912 0.5436 0.1438  0.0177  0.0222  213 ILE B N   
4437 C CA  . ILE B 183 ? 0.4596 0.4531 0.3707 0.1600  0.0194  0.0393  213 ILE B CA  
4438 C C   . ILE B 183 ? 0.5201 0.4523 0.4271 0.1774  0.0355  0.0455  213 ILE B C   
4439 O O   . ILE B 183 ? 0.7029 0.5767 0.6170 0.1625  0.0358  0.0284  213 ILE B O   
4440 C CB  . ILE B 183 ? 0.4322 0.4609 0.3566 0.1313  0.0008  0.0273  213 ILE B CB  
4441 C CG1 . ILE B 183 ? 0.5985 0.6798 0.5255 0.1044  -0.0108 0.0135  213 ILE B CG1 
4442 C CG2 . ILE B 183 ? 0.3482 0.4254 0.2701 0.1491  0.0027  0.0457  213 ILE B CG2 
4443 C CD1 . ILE B 183 ? 0.6785 0.8033 0.6123 0.0754  -0.0223 0.0023  213 ILE B CD1 
4444 N N   . VAL B 184 ? 0.4932 0.4433 0.3878 0.2092  0.0507  0.0696  214 VAL B N   
4445 C CA  . VAL B 184 ? 0.5278 0.4201 0.4149 0.2249  0.0713  0.0752  214 VAL B CA  
4446 C C   . VAL B 184 ? 0.6714 0.5990 0.5603 0.2363  0.0699  0.0892  214 VAL B C   
4447 O O   . VAL B 184 ? 0.7021 0.6956 0.5852 0.2577  0.0698  0.1096  214 VAL B O   
4448 C CB  . VAL B 184 ? 0.5651 0.4198 0.4269 0.2588  0.1043  0.0930  214 VAL B CB  
4449 C CG1 . VAL B 184 ? 0.5428 0.3423 0.3930 0.2742  0.1313  0.0992  214 VAL B CG1 
4450 C CG2 . VAL B 184 ? 0.5691 0.3777 0.4282 0.2451  0.1095  0.0761  214 VAL B CG2 
4451 N N   . ILE B 185 ? 0.6376 0.5277 0.5350 0.2221  0.0685  0.0778  215 ILE B N   
4452 C CA  . ILE B 185 ? 0.5096 0.4209 0.4072 0.2335  0.0714  0.0901  215 ILE B CA  
4453 C C   . ILE B 185 ? 0.5218 0.3640 0.4093 0.2435  0.0977  0.0896  215 ILE B C   
4454 O O   . ILE B 185 ? 0.6954 0.4838 0.5859 0.2243  0.1009  0.0690  215 ILE B O   
4455 C CB  . ILE B 185 ? 0.6322 0.5698 0.5485 0.2020  0.0448  0.0751  215 ILE B CB  
4456 C CG1 . ILE B 185 ? 0.8561 0.8473 0.7806 0.1812  0.0234  0.0669  215 ILE B CG1 
4457 C CG2 . ILE B 185 ? 0.5665 0.5384 0.4830 0.2139  0.0469  0.0890  215 ILE B CG2 
4458 C CD1 . ILE B 185 ? 1.0578 1.0804 0.9938 0.1536  0.0046  0.0563  215 ILE B CD1 
4459 N N   . GLY B 186 ? 0.5828 0.4295 0.4572 0.2730  0.1185  0.1109  216 GLY B N   
4460 C CA  . GLY B 186 ? 0.6821 0.4614 0.5432 0.2797  0.1491  0.1087  216 GLY B CA  
4461 C C   . GLY B 186 ? 0.7990 0.5874 0.6453 0.3153  0.1729  0.1348  216 GLY B C   
4462 O O   . GLY B 186 ? 0.7036 0.5594 0.5497 0.3389  0.1652  0.1572  216 GLY B O   
4463 N N   . THR B 187 ? 0.9441 0.6722 0.7734 0.3125  0.2038  0.1304  217 THR B N   
4464 C CA  . THR B 187 ? 1.0548 0.7754 0.8669 0.3474  0.2335  0.1539  217 THR B CA  
4465 C C   . THR B 187 ? 1.2489 0.9321 1.0254 0.3878  0.2767  0.1790  217 THR B C   
4466 O O   . THR B 187 ? 1.3280 0.9541 1.0868 0.3748  0.2973  0.1683  217 THR B O   
4467 C CB  . THR B 187 ? 1.0337 0.7060 0.8430 0.3227  0.2491  0.1362  217 THR B CB  
4468 O OG1 . THR B 187 ? 1.0721 0.6815 0.8692 0.2926  0.2681  0.1134  217 THR B OG1 
4469 C CG2 . THR B 187 ? 0.7578 0.4718 0.5990 0.2927  0.2083  0.1184  217 THR B CG2 
4470 N N   . PRO B 188 ? 1.3995 1.1174 1.1642 0.4391  0.2920  0.2139  218 PRO B N   
4471 C CA  . PRO B 188 ? 1.4326 1.1263 1.1610 0.4897  0.3326  0.2460  218 PRO B CA  
4472 C C   . PRO B 188 ? 1.5195 1.1012 1.2113 0.4801  0.3829  0.2371  218 PRO B C   
4473 O O   . PRO B 188 ? 1.5742 1.1239 1.2396 0.5014  0.4078  0.2502  218 PRO B O   
4474 C CB  . PRO B 188 ? 1.4351 1.1661 1.1554 0.5394  0.3492  0.2794  218 PRO B CB  
4475 C CG  . PRO B 188 ? 1.3156 1.1372 1.0733 0.5129  0.2998  0.2681  218 PRO B CG  
4476 C CD  . PRO B 188 ? 1.3350 1.1198 1.1165 0.4513  0.2745  0.2259  218 PRO B CD  
4477 N N   . GLY B 189 ? 1.5570 1.0828 1.2471 0.4469  0.3987  0.2144  219 GLY B N   
4478 C CA  . GLY B 189 ? 1.5313 0.9557 1.1887 0.4301  0.4484  0.2013  219 GLY B CA  
4479 C C   . GLY B 189 ? 1.4813 0.8844 1.1396 0.3979  0.4408  0.1793  219 GLY B C   
4480 O O   . GLY B 189 ? 1.5447 0.8923 1.1689 0.4163  0.4802  0.1906  219 GLY B O   
4481 N N   . THR B 190 ? 1.3568 0.8028 1.0528 0.3519  0.3922  0.1489  220 THR B N   
4482 C CA  . THR B 190 ? 1.3143 0.7476 1.0166 0.3176  0.3812  0.1249  220 THR B CA  
4483 C C   . THR B 190 ? 1.3006 0.7697 1.0022 0.3434  0.3648  0.1424  220 THR B C   
4484 O O   . THR B 190 ? 1.2815 0.7143 0.9671 0.3376  0.3816  0.1372  220 THR B O   
4485 C CB  . THR B 190 ? 1.3559 0.8287 1.0981 0.2669  0.3350  0.0907  220 THR B CB  
4486 O OG1 . THR B 190 ? 1.3984 0.8447 1.1422 0.2433  0.3495  0.0735  220 THR B OG1 
4487 C CG2 . THR B 190 ? 1.3438 0.8071 1.0931 0.2344  0.3261  0.0671  220 THR B CG2 
4488 N N   . VAL B 191 ? 1.2032 0.7473 0.9233 0.3701  0.3325  0.1615  221 VAL B N   
4489 C CA  . VAL B 191 ? 1.0963 0.6869 0.8175 0.3978  0.3171  0.1796  221 VAL B CA  
4490 C C   . VAL B 191 ? 1.2685 0.8126 0.9453 0.4463  0.3676  0.2110  221 VAL B C   
4491 O O   . VAL B 191 ? 1.2291 0.7775 0.8956 0.4617  0.3695  0.2199  221 VAL B O   
4492 C CB  . VAL B 191 ? 1.0424 0.7308 0.7903 0.4202  0.2795  0.1968  221 VAL B CB  
4493 C CG1 . VAL B 191 ? 1.1031 0.8480 0.8430 0.4570  0.2744  0.2234  221 VAL B CG1 
4494 C CG2 . VAL B 191 ? 1.0848 0.8145 0.8732 0.3734  0.2305  0.1667  221 VAL B CG2 
4495 N N   . LEU B 192 ? 1.3913 0.8867 1.0396 0.4721  0.4111  0.2284  222 LEU B N   
4496 C CA  . LEU B 192 ? 1.5654 1.0016 1.1642 0.5227  0.4686  0.2612  222 LEU B CA  
4497 C C   . LEU B 192 ? 1.6361 0.9940 1.2105 0.4996  0.4971  0.2444  222 LEU B C   
4498 O O   . LEU B 192 ? 1.5105 0.8658 1.0639 0.5315  0.5098  0.2647  222 LEU B O   
4499 C CB  . LEU B 192 ? 1.6299 1.0077 1.2012 0.5433  0.5161  0.2749  222 LEU B CB  
4500 C CG  . LEU B 192 ? 1.7939 1.1194 1.3117 0.6119  0.5786  0.3196  222 LEU B CG  
4501 C CD1 . LEU B 192 ? 1.8612 1.2833 1.3827 0.6745  0.5575  0.3617  222 LEU B CD1 
4502 C CD2 . LEU B 192 ? 1.7069 0.9780 1.2031 0.6265  0.6216  0.3289  222 LEU B CD2 
4503 N N   . ASP B 193 ? 1.7535 1.0556 1.3323 0.4437  0.5060  0.2069  223 ASP B N   
4504 C CA  . ASP B 193 ? 1.8104 1.0404 1.3683 0.4140  0.5356  0.1859  223 ASP B CA  
4505 C C   . ASP B 193 ? 1.7755 1.0513 1.3555 0.3979  0.4955  0.1742  223 ASP B C   
4506 O O   . ASP B 193 ? 1.8208 1.0501 1.3749 0.4011  0.5225  0.1752  223 ASP B O   
4507 C CB  . ASP B 193 ? 1.8109 1.0011 1.3804 0.3532  0.5434  0.1448  223 ASP B CB  
4508 C CG  . ASP B 193 ? 1.8824 1.0147 1.4268 0.3629  0.5902  0.1512  223 ASP B CG  
4509 O OD1 . ASP B 193 ? 1.9875 1.0343 1.4818 0.3912  0.6552  0.1696  223 ASP B OD1 
4510 O OD2 . ASP B 193 ? 1.7913 0.9591 1.3639 0.3426  0.5648  0.1378  223 ASP B OD2 
4511 N N   . TRP B 194 ? 1.6250 0.9873 1.2511 0.3798  0.4341  0.1624  224 TRP B N   
4512 C CA  . TRP B 194 ? 1.3973 0.8039 1.0485 0.3586  0.3938  0.1469  224 TRP B CA  
4513 C C   . TRP B 194 ? 1.3800 0.8090 1.0141 0.4059  0.3979  0.1769  224 TRP B C   
4514 O O   . TRP B 194 ? 1.4257 0.8696 1.0694 0.3918  0.3791  0.1653  224 TRP B O   
4515 C CB  . TRP B 194 ? 1.2210 0.7070 0.9204 0.3329  0.3343  0.1302  224 TRP B CB  
4516 C CG  . TRP B 194 ? 1.0708 0.5449 0.7922 0.2806  0.3215  0.0957  224 TRP B CG  
4517 C CD1 . TRP B 194 ? 1.1455 0.5640 0.8528 0.2628  0.3553  0.0839  224 TRP B CD1 
4518 C CD2 . TRP B 194 ? 0.9708 0.4940 0.7321 0.2424  0.2731  0.0697  224 TRP B CD2 
4519 N NE1 . TRP B 194 ? 1.2113 0.6512 0.9500 0.2172  0.3279  0.0525  224 TRP B NE1 
4520 C CE2 . TRP B 194 ? 1.0473 0.5489 0.8177 0.2066  0.2783  0.0454  224 TRP B CE2 
4521 C CE3 . TRP B 194 ? 0.9421 0.5229 0.7303 0.2365  0.2296  0.0650  224 TRP B CE3 
4522 C CZ2 . TRP B 194 ? 1.0113 0.5520 0.8165 0.1712  0.2398  0.0207  224 TRP B CZ2 
4523 C CZ3 . TRP B 194 ? 0.8957 0.5032 0.7151 0.1985  0.1952  0.0394  224 TRP B CZ3 
4524 C CH2 . TRP B 194 ? 0.8689 0.4586 0.6963 0.1692  0.1998  0.0196  224 TRP B CH2 
4525 N N   . CYS B 195 ? 1.4969 0.9333 1.1061 0.4643  0.4225  0.2167  225 CYS B N   
4526 C CA  . CYS B 195 ? 1.7066 1.1791 1.2997 0.5174  0.4263  0.2512  225 CYS B CA  
4527 C C   . CYS B 195 ? 1.9712 1.3537 1.5064 0.5562  0.4923  0.2765  225 CYS B C   
4528 O O   . CYS B 195 ? 2.0961 1.4942 1.6101 0.6018  0.5033  0.3062  225 CYS B O   
4529 C CB  . CYS B 195 ? 1.7171 1.2888 1.3240 0.5603  0.4022  0.2837  225 CYS B CB  
4530 S SG  . CYS B 195 ? 1.4635 1.1447 1.1303 0.5121  0.3290  0.2561  225 CYS B SG  
4531 N N   . SER B 196 ? 2.0343 1.3223 1.5427 0.5377  0.5384  0.2648  226 SER B N   
4532 C CA  . SER B 196 ? 2.1523 1.3365 1.6005 0.5693  0.6104  0.2855  226 SER B CA  
4533 C C   . SER B 196 ? 2.2222 1.3355 1.6582 0.5216  0.6294  0.2526  226 SER B C   
4534 O O   . SER B 196 ? 2.2900 1.3751 1.6973 0.5459  0.6515  0.2673  226 SER B O   
4535 C CB  . SER B 196 ? 2.1563 1.2717 1.5765 0.5796  0.6597  0.2936  226 SER B CB  
4536 O OG  . SER B 196 ? 2.0676 1.2504 1.4970 0.6280  0.6452  0.3268  226 SER B OG  
4537 N N   . LYS B 197 ? 2.1341 1.2252 1.5929 0.4548  0.6204  0.2087  227 LYS B N   
4538 C CA  . LYS B 197 ? 2.0699 1.1075 1.5236 0.4039  0.6359  0.1738  227 LYS B CA  
4539 C C   . LYS B 197 ? 1.9582 1.0540 1.4377 0.3934  0.5904  0.1650  227 LYS B C   
4540 O O   . LYS B 197 ? 1.7794 0.9521 1.3093 0.3603  0.5306  0.1425  227 LYS B O   
4541 C CB  . LYS B 197 ? 2.0296 1.0633 1.5133 0.3374  0.6249  0.1298  227 LYS B CB  
4542 N N   . PHE B 200 ? 1.5092 0.8299 1.1223 0.3193  0.4175  0.1116  230 PHE B N   
4543 C CA  . PHE B 200 ? 1.3902 0.7799 1.0538 0.2836  0.3613  0.0877  230 PHE B CA  
4544 C C   . PHE B 200 ? 1.4228 0.8910 1.1087 0.3092  0.3197  0.1026  230 PHE B C   
4545 O O   . PHE B 200 ? 1.3323 0.8431 1.0489 0.2837  0.2811  0.0831  230 PHE B O   
4546 C CB  . PHE B 200 ? 1.2949 0.6841 0.9693 0.2702  0.3613  0.0817  230 PHE B CB  
4547 C CG  . PHE B 200 ? 1.3802 0.7054 1.0413 0.2373  0.3982  0.0602  230 PHE B CG  
4548 C CD1 . PHE B 200 ? 1.4201 0.7398 1.0972 0.1925  0.3928  0.0283  230 PHE B CD1 
4549 C CD2 . PHE B 200 ? 1.4704 0.7451 1.1049 0.2506  0.4399  0.0707  230 PHE B CD2 
4550 C CE1 . PHE B 200 ? 1.4734 0.7443 1.1417 0.1602  0.4281  0.0054  230 PHE B CE1 
4551 C CE2 . PHE B 200 ? 1.4995 0.7161 1.1224 0.2163  0.4772  0.0468  230 PHE B CE2 
4552 C CZ  . PHE B 200 ? 1.5089 0.7267 1.1496 0.1701  0.4710  0.0131  230 PHE B CZ  
4553 N N   . ILE B 201 ? 1.5471 1.0376 1.2183 0.3603  0.3300  0.1374  231 ILE B N   
4554 C CA  . ILE B 201 ? 1.4990 1.0803 1.1919 0.3854  0.2934  0.1543  231 ILE B CA  
4555 C C   . ILE B 201 ? 1.5969 1.1989 1.2540 0.4356  0.3162  0.1938  231 ILE B C   
4556 O O   . ILE B 201 ? 1.6539 1.1996 1.2717 0.4750  0.3632  0.2197  231 ILE B O   
4557 C CB  . ILE B 201 ? 1.3335 0.9680 1.0442 0.3923  0.2741  0.1645  231 ILE B CB  
4558 C CG1 . ILE B 201 ? 1.2003 0.8064 0.9347 0.3460  0.2611  0.1315  231 ILE B CG1 
4559 C CG2 . ILE B 201 ? 1.3242 1.0704 1.0576 0.3911  0.2309  0.1722  231 ILE B CG2 
4560 C CD1 . ILE B 201 ? 1.2035 0.8526 0.9556 0.3527  0.2441  0.1393  231 ILE B CD1 
4561 N N   . ASP B 202 ? 1.5437 1.2265 1.2121 0.4347  0.2854  0.1983  232 ASP B N   
4562 C CA  . ASP B 202 ? 1.5647 1.2913 1.2019 0.4829  0.3003  0.2365  232 ASP B CA  
4563 C C   . ASP B 202 ? 1.3947 1.2378 1.0424 0.5084  0.2755  0.2616  232 ASP B C   
4564 O O   . ASP B 202 ? 1.2737 1.2088 0.9483 0.4846  0.2349  0.2494  232 ASP B O   
4565 C CB  . ASP B 202 ? 1.6549 1.4014 1.2948 0.4635  0.2854  0.2232  232 ASP B CB  
4566 C CG  . ASP B 202 ? 1.7469 1.5422 1.3521 0.5138  0.3013  0.2628  232 ASP B CG  
4567 O OD1 . ASP B 202 ? 1.6703 1.5125 1.2807 0.5000  0.2821  0.2551  232 ASP B OD1 
4568 O OD2 . ASP B 202 ? 1.8102 1.5985 1.3815 0.5689  0.3344  0.3024  232 ASP B OD2 
4569 N N   . PRO B 203 ? 1.3891 1.2291 1.0144 0.5555  0.3025  0.2949  233 PRO B N   
4570 C CA  . PRO B 203 ? 1.3942 1.3503 1.0296 0.5818  0.2814  0.3186  233 PRO B CA  
4571 C C   . PRO B 203 ? 1.4331 1.5087 1.0691 0.5941  0.2573  0.3320  233 PRO B C   
4572 O O   . PRO B 203 ? 1.4626 1.6528 1.1228 0.5850  0.2234  0.3300  233 PRO B O   
4573 C CB  . PRO B 203 ? 1.4615 1.3766 1.0573 0.6454  0.3294  0.3607  233 PRO B CB  
4574 C CG  . PRO B 203 ? 1.4467 1.2162 1.0278 0.6277  0.3666  0.3422  233 PRO B CG  
4575 C CD  . PRO B 203 ? 1.4209 1.1473 1.0087 0.5852  0.3579  0.3104  233 PRO B CD  
4576 N N   . LYS B 204 ? 1.4518 1.5020 1.0602 0.6115  0.2763  0.3432  234 LYS B N   
4577 C CA  . LYS B 204 ? 1.4283 1.5882 1.0351 0.6193  0.2553  0.3526  234 LYS B CA  
4578 C C   . LYS B 204 ? 1.2634 1.5055 0.9159 0.5565  0.2037  0.3123  234 LYS B C   
4579 O O   . LYS B 204 ? 1.0292 1.4022 0.6908 0.5592  0.1791  0.3183  234 LYS B O   
4580 C CB  . LYS B 204 ? 1.5984 1.6903 1.1743 0.6288  0.2813  0.3573  234 LYS B CB  
4581 C CG  . LYS B 204 ? 1.6826 1.8730 1.2619 0.6194  0.2560  0.3544  234 LYS B CG  
4582 C CD  . LYS B 204 ? 1.7236 1.9812 1.2602 0.6911  0.2795  0.4064  234 LYS B CD  
4583 C CE  . LYS B 204 ? 1.6251 1.9491 1.1567 0.6805  0.2642  0.4016  234 LYS B CE  
4584 N NZ  . LYS B 204 ? 1.5821 1.9471 1.0638 0.7549  0.2951  0.4548  234 LYS B NZ  
4585 N N   . LYS B 205 ? 1.3182 1.4842 0.9971 0.5004  0.1903  0.2708  235 LYS B N   
4586 C CA  . LYS B 205 ? 1.2115 1.4299 0.9281 0.4404  0.1489  0.2316  235 LYS B CA  
4587 C C   . LYS B 205 ? 1.0240 1.2898 0.7703 0.4164  0.1243  0.2180  235 LYS B C   
4588 O O   . LYS B 205 ? 0.9812 1.2593 0.7566 0.3640  0.0967  0.1831  235 LYS B O   
4589 C CB  . LYS B 205 ? 1.1856 1.3038 0.9144 0.3958  0.1476  0.1955  235 LYS B CB  
4590 C CG  . LYS B 205 ? 1.3091 1.3688 1.0087 0.4140  0.1744  0.2045  235 LYS B CG  
4591 C CD  . LYS B 205 ? 1.3924 1.3601 1.1068 0.3692  0.1730  0.1666  235 LYS B CD  
4592 C CE  . LYS B 205 ? 1.5705 1.4905 1.2574 0.3810  0.1973  0.1715  235 LYS B CE  
4593 N NZ  . LYS B 205 ? 1.6795 1.5283 1.3844 0.3350  0.1922  0.1319  235 LYS B NZ  
4594 N N   . ILE B 206 ? 0.9287 1.2183 0.6652 0.4560  0.1369  0.2464  236 ILE B N   
4595 C CA  . ILE B 206 ? 0.8585 1.1895 0.6205 0.4360  0.1168  0.2354  236 ILE B CA  
4596 C C   . ILE B 206 ? 0.9234 1.4070 0.6937 0.4393  0.0947  0.2428  236 ILE B C   
4597 O O   . ILE B 206 ? 1.0712 1.6268 0.8223 0.4916  0.1072  0.2792  236 ILE B O   
4598 C CB  . ILE B 206 ? 0.8260 1.0950 0.5760 0.4708  0.1428  0.2569  236 ILE B CB  
4599 C CG1 . ILE B 206 ? 0.8253 0.9517 0.5712 0.4545  0.1631  0.2398  236 ILE B CG1 
4600 C CG2 . ILE B 206 ? 0.7412 1.0647 0.5159 0.4534  0.1219  0.2483  236 ILE B CG2 
4601 C CD1 . ILE B 206 ? 0.7673 0.8597 0.5458 0.3917  0.1356  0.1957  236 ILE B CD1 
4602 N N   . LYS B 207 ? 0.8274 1.3611 0.6247 0.3830  0.0644  0.2075  237 LYS B N   
4603 C CA  . LYS B 207 ? 0.7178 1.4005 0.5242 0.3720  0.0441  0.2042  237 LYS B CA  
4604 C C   . LYS B 207 ? 0.8055 1.5453 0.6247 0.3746  0.0368  0.2084  237 LYS B C   
4605 O O   . LYS B 207 ? 0.9132 1.7849 0.7304 0.3935  0.0309  0.2227  237 LYS B O   
4606 C CB  . LYS B 207 ? 0.6387 1.3437 0.4643 0.3060  0.0212  0.1613  237 LYS B CB  
4607 C CG  . LYS B 207 ? 0.8408 1.4951 0.6560 0.2994  0.0268  0.1541  237 LYS B CG  
4608 C CD  . LYS B 207 ? 1.0602 1.7380 0.8927 0.2351  0.0076  0.1118  237 LYS B CD  
4609 C CE  . LYS B 207 ? 1.2896 1.8639 1.1425 0.1903  0.0009  0.0803  237 LYS B CE  
4610 N NZ  . LYS B 207 ? 1.4263 1.9972 1.2898 0.1345  -0.0099 0.0424  237 LYS B NZ  
4611 N N   . VAL B 208 ? 0.7522 1.3992 0.5842 0.3557  0.0373  0.1952  238 VAL B N   
4612 C CA  . VAL B 208 ? 0.6978 1.3877 0.5436 0.3502  0.0295  0.1941  238 VAL B CA  
4613 C C   . VAL B 208 ? 0.6612 1.2567 0.5004 0.3823  0.0496  0.2133  238 VAL B C   
4614 O O   . VAL B 208 ? 0.6664 1.1398 0.5030 0.3750  0.0606  0.2052  238 VAL B O   
4615 C CB  . VAL B 208 ? 0.6781 1.3673 0.5492 0.2807  0.0065  0.1510  238 VAL B CB  
4616 C CG1 . VAL B 208 ? 0.5956 1.2932 0.4789 0.2743  0.0026  0.1493  238 VAL B CG1 
4617 C CG2 . VAL B 208 ? 0.6492 1.4546 0.5257 0.2460  -0.0095 0.1304  238 VAL B CG2 
4618 N N   . PHE B 209 ? 0.4480 1.1066 0.2841 0.4164  0.0554  0.2369  239 PHE B N   
4619 C CA  . PHE B 209 ? 0.5928 1.1734 0.4228 0.4443  0.0756  0.2535  239 PHE B CA  
4620 C C   . PHE B 209 ? 0.6439 1.2818 0.4943 0.4234  0.0598  0.2428  239 PHE B C   
4621 O O   . PHE B 209 ? 0.6503 1.4180 0.5073 0.4246  0.0466  0.2458  239 PHE B O   
4622 C CB  . PHE B 209 ? 0.7496 1.3378 0.5486 0.5193  0.1080  0.3004  239 PHE B CB  
4623 C CG  . PHE B 209 ? 0.8065 1.3137 0.5944 0.5510  0.1355  0.3188  239 PHE B CG  
4624 C CD1 . PHE B 209 ? 0.7406 1.3202 0.5258 0.5894  0.1426  0.3444  239 PHE B CD1 
4625 C CD2 . PHE B 209 ? 0.9190 1.2826 0.6983 0.5420  0.1566  0.3094  239 PHE B CD2 
4626 C CE1 . PHE B 209 ? 0.8315 1.3336 0.6048 0.6180  0.1710  0.3606  239 PHE B CE1 
4627 C CE2 . PHE B 209 ? 0.9100 1.2003 0.6772 0.5670  0.1853  0.3230  239 PHE B CE2 
4628 C CZ  . PHE B 209 ? 0.8947 1.2502 0.6584 0.6053  0.1932  0.3491  239 PHE B CZ  
4629 N N   . VAL B 210 ? 0.5921 1.1389 0.4521 0.4018  0.0613  0.2283  240 VAL B N   
4630 C CA  . VAL B 210 ? 0.5089 1.0964 0.3862 0.3814  0.0487  0.2182  240 VAL B CA  
4631 C C   . VAL B 210 ? 0.6035 1.1135 0.4743 0.4078  0.0697  0.2333  240 VAL B C   
4632 O O   . VAL B 210 ? 0.6846 1.0784 0.5505 0.4013  0.0822  0.2260  240 VAL B O   
4633 C CB  . VAL B 210 ? 0.4711 1.0341 0.3697 0.3131  0.0244  0.1768  240 VAL B CB  
4634 C CG1 . VAL B 210 ? 0.4972 1.0634 0.4082 0.2957  0.0185  0.1686  240 VAL B CG1 
4635 C CG2 . VAL B 210 ? 0.5404 1.1984 0.4463 0.2793  0.0053  0.1575  240 VAL B CG2 
4636 N N   . LEU B 211 ? 0.7262 1.3055 0.5970 0.4356  0.0745  0.2524  241 LEU B N   
4637 C CA  . LEU B 211 ? 0.7973 1.3095 0.6645 0.4527  0.0928  0.2619  241 LEU B CA  
4638 C C   . LEU B 211 ? 0.6925 1.2390 0.5824 0.4115  0.0712  0.2393  241 LEU B C   
4639 O O   . LEU B 211 ? 0.7155 1.3638 0.6114 0.4230  0.0656  0.2485  241 LEU B O   
4640 C CB  . LEU B 211 ? 0.9099 1.4535 0.7550 0.5235  0.1228  0.3048  241 LEU B CB  
4641 C CG  . LEU B 211 ? 0.9634 1.3930 0.7936 0.5468  0.1559  0.3163  241 LEU B CG  
4642 C CD1 . LEU B 211 ? 1.0129 1.4109 0.8080 0.6159  0.1982  0.3568  241 LEU B CD1 
4643 C CD2 . LEU B 211 ? 0.9910 1.4508 0.8347 0.5419  0.1517  0.3145  241 LEU B CD2 
4644 N N   . ASP B 212 ? 0.6446 1.1087 0.5457 0.3642  0.0601  0.2100  242 ASP B N   
4645 C CA  . ASP B 212 ? 0.7698 1.2470 0.6883 0.3229  0.0423  0.1879  242 ASP B CA  
4646 C C   . ASP B 212 ? 0.8148 1.2770 0.7308 0.3480  0.0579  0.2033  242 ASP B C   
4647 O O   . ASP B 212 ? 0.6840 1.0652 0.5865 0.3766  0.0826  0.2173  242 ASP B O   
4648 C CB  . ASP B 212 ? 0.8935 1.2797 0.8199 0.2752  0.0304  0.1578  242 ASP B CB  
4649 C CG  . ASP B 212 ? 1.0615 1.4681 1.0021 0.2282  0.0110  0.1336  242 ASP B CG  
4650 O OD1 . ASP B 212 ? 1.0932 1.5966 1.0397 0.2137  0.0001  0.1283  242 ASP B OD1 
4651 O OD2 . ASP B 212 ? 1.1433 1.4715 1.0873 0.2049  0.0083  0.1191  242 ASP B OD2 
4652 N N   . GLU B 213 ? 0.9102 1.4507 0.8378 0.3348  0.0460  0.1988  243 GLU B N   
4653 C CA  . GLU B 213 ? 0.8811 1.4139 0.8091 0.3513  0.0577  0.2093  243 GLU B CA  
4654 C C   . GLU B 213 ? 0.9440 1.4488 0.8529 0.4145  0.0909  0.2440  243 GLU B C   
4655 O O   . GLU B 213 ? 0.9354 1.3349 0.8342 0.4221  0.1114  0.2456  243 GLU B O   
4656 C CB  . GLU B 213 ? 0.9531 1.3898 0.8872 0.3122  0.0527  0.1862  243 GLU B CB  
4657 C CG  . GLU B 213 ? 1.1127 1.5475 1.0587 0.2544  0.0268  0.1545  243 GLU B CG  
4658 C CD  . GLU B 213 ? 1.1716 1.5014 1.1189 0.2261  0.0245  0.1366  243 GLU B CD  
4659 O OE1 . GLU B 213 ? 1.1799 1.4740 1.1259 0.2331  0.0341  0.1407  243 GLU B OE1 
4660 O OE2 . GLU B 213 ? 1.1688 1.4564 1.1179 0.1980  0.0136  0.1188  243 GLU B OE2 
4661 N N   . ALA B 214 ? 0.9761 1.5773 0.8780 0.4599  0.0989  0.2714  244 ALA B N   
4662 C CA  . ALA B 214 ? 0.9958 1.5732 0.8743 0.5273  0.1355  0.3092  244 ALA B CA  
4663 C C   . ALA B 214 ? 0.9455 1.5141 0.8237 0.5462  0.1522  0.3199  244 ALA B C   
4664 O O   . ALA B 214 ? 0.9293 1.4242 0.7864 0.5876  0.1887  0.3419  244 ALA B O   
4665 C CB  . ALA B 214 ? 0.9435 1.6350 0.8126 0.5750  0.1387  0.3382  244 ALA B CB  
4666 N N   . ASP B 215 ? 0.8474 1.4883 0.7470 0.5135  0.1282  0.3028  245 ASP B N   
4667 C CA  . ASP B 215 ? 0.9017 1.5429 0.8042 0.5241  0.1397  0.3088  245 ASP B CA  
4668 C C   . ASP B 215 ? 1.0074 1.5088 0.9033 0.5071  0.1567  0.2969  245 ASP B C   
4669 O O   . ASP B 215 ? 1.1207 1.5982 1.0120 0.5253  0.1767  0.3064  245 ASP B O   
4670 C CB  . ASP B 215 ? 0.9719 1.7117 0.8985 0.4810  0.1090  0.2862  245 ASP B CB  
4671 C CG  . ASP B 215 ? 1.0410 1.7553 0.9814 0.4110  0.0790  0.2476  245 ASP B CG  
4672 O OD1 . ASP B 215 ? 1.0153 1.6610 0.9498 0.3994  0.0773  0.2400  245 ASP B OD1 
4673 O OD2 . ASP B 215 ? 1.0310 1.7923 0.9863 0.3683  0.0597  0.2252  245 ASP B OD2 
4674 N N   . VAL B 216 ? 0.9339 1.3493 0.8294 0.4715  0.1492  0.2751  246 VAL B N   
4675 C CA  . VAL B 216 ? 0.9119 1.2061 0.8016 0.4515  0.1639  0.2601  246 VAL B CA  
4676 C C   . VAL B 216 ? 0.9749 1.1750 0.8408 0.4770  0.1963  0.2701  246 VAL B C   
4677 O O   . VAL B 216 ? 1.1007 1.2043 0.9557 0.4707  0.2202  0.2617  246 VAL B O   
4678 C CB  . VAL B 216 ? 0.9810 1.2478 0.8887 0.3870  0.1317  0.2238  246 VAL B CB  
4679 C CG1 . VAL B 216 ? 1.1602 1.4434 1.0732 0.3660  0.1101  0.2121  246 VAL B CG1 
4680 C CG2 . VAL B 216 ? 0.9504 1.1064 0.8519 0.3684  0.1463  0.2083  246 VAL B CG2 
4681 N N   . MET B 217 ? 1.0247 1.2551 0.8809 0.5042  0.1994  0.2865  247 MET B N   
4682 C CA  . MET B 217 ? 1.1551 1.2969 0.9850 0.5301  0.2338  0.2974  247 MET B CA  
4683 C C   . MET B 217 ? 1.3360 1.4609 1.1366 0.5962  0.2812  0.3352  247 MET B C   
4684 O O   . MET B 217 ? 1.4583 1.4945 1.2302 0.6211  0.3209  0.3461  247 MET B O   
4685 C CB  . MET B 217 ? 1.0585 1.2293 0.8880 0.5285  0.2181  0.2976  247 MET B CB  
4686 C CG  . MET B 217 ? 0.9297 0.9930 0.7384 0.5294  0.2441  0.2929  247 MET B CG  
4687 S SD  . MET B 217 ? 1.5603 1.6554 1.3762 0.5097  0.2163  0.2823  247 MET B SD  
4688 C CE  . MET B 217 ? 0.8107 0.9831 0.6647 0.4502  0.1618  0.2509  247 MET B CE  
4689 N N   . ILE B 218 ? 1.3534 1.5618 1.1595 0.6249  0.2800  0.3548  248 ILE B N   
4690 C CA  . ILE B 218 ? 1.3957 1.5933 1.1737 0.6928  0.3265  0.3935  248 ILE B CA  
4691 C C   . ILE B 218 ? 1.4099 1.5227 1.1802 0.6870  0.3562  0.3863  248 ILE B C   
4692 O O   . ILE B 218 ? 1.4392 1.5150 1.1820 0.7395  0.4032  0.4150  248 ILE B O   
4693 C CB  . ILE B 218 ? 1.3637 1.7071 1.1494 0.7359  0.3140  0.4224  248 ILE B CB  
4694 C CG1 . ILE B 218 ? 1.4336 1.8673 1.2563 0.6866  0.2682  0.3958  248 ILE B CG1 
4695 C CG2 . ILE B 218 ? 1.2093 1.6280 0.9883 0.7638  0.3039  0.4413  248 ILE B CG2 
4696 C CD1 . ILE B 218 ? 1.4867 2.0794 1.3204 0.7184  0.2523  0.4164  248 ILE B CD1 
4697 N N   . ALA B 219 ? 1.4159 1.4978 1.2085 0.6243  0.3309  0.3484  249 ALA B N   
4698 C CA  . ALA B 219 ? 1.5263 1.5317 1.3132 0.6102  0.3556  0.3360  249 ALA B CA  
4699 C C   . ALA B 219 ? 1.7295 1.6036 1.4815 0.6237  0.4101  0.3372  249 ALA B C   
4700 O O   . ALA B 219 ? 1.7708 1.5756 1.5084 0.6246  0.4459  0.3331  249 ALA B O   
4701 C CB  . ALA B 219 ? 1.4119 1.4147 1.2274 0.5408  0.3158  0.2958  249 ALA B CB  
4702 N N   . THR B 220 ? 1.8501 1.6897 1.5874 0.6312  0.4186  0.3406  250 THR B N   
4703 C CA  . THR B 220 ? 1.9100 1.6245 1.6107 0.6414  0.4737  0.3399  250 THR B CA  
4704 C C   . THR B 220 ? 1.9543 1.6646 1.6223 0.7054  0.5072  0.3797  250 THR B C   
4705 O O   . THR B 220 ? 1.9763 1.7382 1.6518 0.7085  0.4799  0.3853  250 THR B O   
4706 C CB  . THR B 220 ? 1.8508 1.5057 1.5604 0.5811  0.4581  0.2992  250 THR B CB  
4707 O OG1 . THR B 220 ? 1.8453 1.5104 1.5837 0.5253  0.4257  0.2647  250 THR B OG1 
4708 C CG2 . THR B 220 ? 1.8883 1.4168 1.5562 0.5820  0.5188  0.2943  250 THR B CG2 
4709 N N   . GLN B 221 ? 1.9769 1.6234 1.6062 0.7576  0.5690  0.4082  251 GLN B N   
4710 C CA  . GLN B 221 ? 2.0292 1.6606 1.6195 0.8269  0.6100  0.4513  251 GLN B CA  
4711 C C   . GLN B 221 ? 2.1144 1.7054 1.6942 0.8069  0.6064  0.4401  251 GLN B C   
4712 O O   . GLN B 221 ? 2.1375 1.7944 1.7159 0.8415  0.5910  0.4648  251 GLN B O   
4713 C CB  . GLN B 221 ? 2.0790 1.5967 1.6184 0.8687  0.6898  0.4731  251 GLN B CB  
4714 C CG  . GLN B 221 ? 2.1067 1.6613 1.6518 0.9004  0.7015  0.4902  251 GLN B CG  
4715 C CD  . GLN B 221 ? 2.2417 1.6675 1.7335 0.9335  0.7851  0.5068  251 GLN B CD  
4716 O OE1 . GLN B 221 ? 2.2791 1.5774 1.7391 0.9000  0.8276  0.4853  251 GLN B OE1 
4717 N NE2 . GLN B 221 ? 2.2959 1.7559 1.7764 0.9980  0.8118  0.5442  251 GLN B NE2 
4718 N N   . GLY B 222 ? 2.1230 1.6127 1.6943 0.7480  0.6204  0.4019  252 GLY B N   
4719 C CA  . GLY B 222 ? 2.0875 1.5313 1.6471 0.7220  0.6209  0.3869  252 GLY B CA  
4720 C C   . GLY B 222 ? 2.0151 1.5657 1.6098 0.7155  0.5586  0.3858  252 GLY B C   
4721 O O   . GLY B 222 ? 2.1400 1.6924 1.7162 0.7425  0.5669  0.4043  252 GLY B O   
4722 N N   . HIS B 223 ? 1.7981 1.4354 1.4417 0.6796  0.4990  0.3640  253 HIS B N   
4723 C CA  . HIS B 223 ? 1.6269 1.3609 1.3030 0.6613  0.4409  0.3569  253 HIS B CA  
4724 C C   . HIS B 223 ? 1.5676 1.3942 1.2334 0.7213  0.4381  0.3995  253 HIS B C   
4725 O O   . HIS B 223 ? 1.4358 1.3045 1.1064 0.7181  0.4151  0.4001  253 HIS B O   
4726 C CB  . HIS B 223 ? 1.4067 1.2140 1.1275 0.6118  0.3856  0.3295  253 HIS B CB  
4727 C CG  . HIS B 223 ? 1.4291 1.1705 1.1656 0.5478  0.3732  0.2852  253 HIS B CG  
4728 N ND1 . HIS B 223 ? 1.5845 1.3205 1.3376 0.5171  0.3636  0.2654  253 HIS B ND1 
4729 C CD2 . HIS B 223 ? 1.4797 1.1655 1.2162 0.5094  0.3692  0.2578  253 HIS B CD2 
4730 C CE1 . HIS B 223 ? 1.4893 1.1728 1.2525 0.4656  0.3536  0.2287  253 HIS B CE1 
4731 N NE2 . HIS B 223 ? 1.4897 1.1449 1.2424 0.4578  0.3565  0.2233  253 HIS B NE2 
4732 N N   . GLN B 224 ? 1.5750 1.4382 1.2261 0.7770  0.4622  0.4350  254 GLN B N   
4733 C CA  . GLN B 224 ? 1.5752 1.5479 1.2181 0.8380  0.4578  0.4771  254 GLN B CA  
4734 C C   . GLN B 224 ? 1.6624 1.5963 1.2687 0.8781  0.4882  0.5021  254 GLN B C   
4735 O O   . GLN B 224 ? 1.6420 1.6574 1.2590 0.8771  0.4559  0.5051  254 GLN B O   
4736 C CB  . GLN B 224 ? 1.5936 1.6015 1.2221 0.8978  0.4868  0.5133  254 GLN B CB  
4737 C CG  . GLN B 224 ? 1.5127 1.5805 1.1784 0.8623  0.4534  0.4919  254 GLN B CG  
4738 C CD  . GLN B 224 ? 1.4496 1.6132 1.1117 0.9232  0.4637  0.5297  254 GLN B CD  
4739 O OE1 . GLN B 224 ? 1.4288 1.6688 1.0733 0.9866  0.4743  0.5700  254 GLN B OE1 
4740 N NE2 . GLN B 224 ? 1.3682 1.5348 1.0469 0.9053  0.4603  0.5173  254 GLN B NE2 
4741 N N   . ASP B 225 ? 1.7789 1.5860 1.3396 0.9116  0.5533  0.5189  255 ASP B N   
4742 C CA  . ASP B 225 ? 1.9295 1.6858 1.4481 0.9538  0.5909  0.5455  255 ASP B CA  
4743 C C   . ASP B 225 ? 1.7715 1.5001 1.3051 0.8953  0.5623  0.5090  255 ASP B C   
4744 O O   . ASP B 225 ? 1.6537 1.4199 1.1766 0.9161  0.5554  0.5252  255 ASP B O   
4745 C CB  . ASP B 225 ? 2.2200 1.8258 1.6825 0.9905  0.6733  0.5641  255 ASP B CB  
4746 C CG  . ASP B 225 ? 2.3937 1.9557 1.8033 1.0534  0.7212  0.6051  255 ASP B CG  
4747 O OD1 . ASP B 225 ? 2.5307 1.9809 1.8849 1.0964  0.7954  0.6309  255 ASP B OD1 
4748 O OD2 . ASP B 225 ? 2.3506 1.9877 1.7701 1.0584  0.6877  0.6118  255 ASP B OD2 
4749 N N   . GLN B 226 ? 1.7388 1.4067 1.2968 0.8235  0.5459  0.4603  256 GLN B N   
4750 C CA  . GLN B 226 ? 1.6369 1.2746 1.2088 0.7648  0.5210  0.4230  256 GLN B CA  
4751 C C   . GLN B 226 ? 1.4785 1.2419 1.0850 0.7528  0.4598  0.4203  256 GLN B C   
4752 O O   . GLN B 226 ? 1.5218 1.2766 1.1243 0.7412  0.4520  0.4132  256 GLN B O   
4753 C CB  . GLN B 226 ? 1.5428 1.1206 1.1357 0.6896  0.5089  0.3733  256 GLN B CB  
4754 C CG  . GLN B 226 ? 1.6480 1.0913 1.19