data_3EZB
# 
_entry.id   3EZB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3EZB         pdb_00003ezb 10.2210/pdb3ezb/pdb 
RCSB  RCSB008052   ?            ?                   
WWPDB D_1000008052 ?            ?                   
# 
loop_
_pdbx_database_PDB_obs_spr.id 
_pdbx_database_PDB_obs_spr.date 
_pdbx_database_PDB_obs_spr.pdb_id 
_pdbx_database_PDB_obs_spr.replace_pdb_id 
_pdbx_database_PDB_obs_spr.details 
SPRSDE 1999-12-29 3ezb 3ezc ? 
SPRSDE 1999-12-29 3ezb 3ezd ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3EZA 'RESTRAINED REGULARIZED MEAN STRUCTURE'                         'representative structure' 
PDB 3EZE 'RESTRAINED REGULARIZED MEAN STRUCTURE OF THE TRANSITION STATE' 'representative structure' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3EZB 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-03 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'      1 
'Garrett, D.S.'    2 
'Gronenborn, A.M.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solution structure of the 40,000 Mr phosphoryl transfer complex between the N-terminal domain of enzyme I and HPr.' 
Nat.Struct.Biol. 6  166  173 1999 NSBIEW US 1072-8368 2024 ? 10048929 10.1038/5854 
1       
;Tautomeric State and Pka of the Phosphorylated Acti Histidine in the N- Terminal Domain of Enzyme I of T Eschrichia Coli Phosphoenolpyruvate:Sugar Phosphotr System
;
'Protein Sci.'   7  789  ?   1998 PRCIEI US 0961-8368 0795 ? ?        ?            
2       
;Solution Structure of the 30 kDa N-Terminal Domain of Enzyme I of the Escherichia Coli Phosphoenolpyruvate:Sugar Phosphotransferase System by Multidimensional NMR
;
Biochemistry     36 2517 ?   1997 BICHAW US 0006-2960 0033 ? ?        ?            
3       
;Identification by NMR of the Binding Surface for Th Histidine-Containing Phosphocarrier Protein Hpr on N-Terminal Domain of Enzyme I of the Escherichia Co Phosphotransferase System
;
Biochemistry     36 4393 ?   1997 BICHAW US 0006-2960 0033 ? ?        ?            
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Garrett, D.S.'    1  ? 
primary 'Seok, Y.J.'       2  ? 
primary 'Peterkofsky, A.'  3  ? 
primary 'Gronenborn, A.M.' 4  ? 
primary 'Clore, G.M.'      5  ? 
1       'Garrett, D.S.'    6  ? 
1       'Seok, Y.J.'       7  ? 
1       'Peterkofsky, A.'  8  ? 
1       'Clore, G.M.'      9  ? 
1       'Gronenborn, A.M.' 10 ? 
2       'Garrett, D.S.'    11 ? 
2       'Seok, Y.J.'       12 ? 
2       'Liao, D.I.'       13 ? 
2       'Peterkofsky, A.'  14 ? 
2       'Gronenborn, A.M.' 15 ? 
2       'Clore, G.M.'      16 ? 
3       'Garrett, D.S.'    17 ? 
3       'Seok, Y.J.'       18 ? 
3       'Peterkofsky, A.'  19 ? 
3       'Clore, G.M.'      20 ? 
3       'Gronenborn, A.M.' 21 ? 
# 
_cell.entry_id           3EZB 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3EZB 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (PHOSPHOTRANSFER SYSTEM, ENZYME I)' 28381.316 1 2.7.3.9 ? 'AMINO-TERMINAL DOMAIN RESIDUES 1 - 259' ? 
2 polymer man 'PROTEIN (PHOSPHOCARRIER PROTEIN HPR)'       9129.332  1 ?       ? ?                                        ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTKAGETFGEEKEAIFEGHIMLL
EDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDDEYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVA
ADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDR
;
;MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTKAGETFGEEKEAIFEGHIMLL
EDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDDEYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVA
ADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDR
;
A ? 
2 'polypeptide(L)' no no 
;MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKL
MAELE
;
;MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKL
MAELE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   SER n 
1 4   GLY n 
1 5   ILE n 
1 6   LEU n 
1 7   ALA n 
1 8   SER n 
1 9   PRO n 
1 10  GLY n 
1 11  ILE n 
1 12  ALA n 
1 13  PHE n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  LEU n 
1 18  LEU n 
1 19  LEU n 
1 20  LYS n 
1 21  GLU n 
1 22  ASP n 
1 23  GLU n 
1 24  ILE n 
1 25  VAL n 
1 26  ILE n 
1 27  ASP n 
1 28  ARG n 
1 29  LYS n 
1 30  LYS n 
1 31  ILE n 
1 32  SER n 
1 33  ALA n 
1 34  ASP n 
1 35  GLN n 
1 36  VAL n 
1 37  ASP n 
1 38  GLN n 
1 39  GLU n 
1 40  VAL n 
1 41  GLU n 
1 42  ARG n 
1 43  PHE n 
1 44  LEU n 
1 45  SER n 
1 46  GLY n 
1 47  ARG n 
1 48  ALA n 
1 49  LYS n 
1 50  ALA n 
1 51  SER n 
1 52  ALA n 
1 53  GLN n 
1 54  LEU n 
1 55  GLU n 
1 56  THR n 
1 57  ILE n 
1 58  LYS n 
1 59  THR n 
1 60  LYS n 
1 61  ALA n 
1 62  GLY n 
1 63  GLU n 
1 64  THR n 
1 65  PHE n 
1 66  GLY n 
1 67  GLU n 
1 68  GLU n 
1 69  LYS n 
1 70  GLU n 
1 71  ALA n 
1 72  ILE n 
1 73  PHE n 
1 74  GLU n 
1 75  GLY n 
1 76  HIS n 
1 77  ILE n 
1 78  MET n 
1 79  LEU n 
1 80  LEU n 
1 81  GLU n 
1 82  ASP n 
1 83  GLU n 
1 84  GLU n 
1 85  LEU n 
1 86  GLU n 
1 87  GLN n 
1 88  GLU n 
1 89  ILE n 
1 90  ILE n 
1 91  ALA n 
1 92  LEU n 
1 93  ILE n 
1 94  LYS n 
1 95  ASP n 
1 96  LYS n 
1 97  HIS n 
1 98  MET n 
1 99  THR n 
1 100 ALA n 
1 101 ASP n 
1 102 ALA n 
1 103 ALA n 
1 104 ALA n 
1 105 HIS n 
1 106 GLU n 
1 107 VAL n 
1 108 ILE n 
1 109 GLU n 
1 110 GLY n 
1 111 GLN n 
1 112 ALA n 
1 113 SER n 
1 114 ALA n 
1 115 LEU n 
1 116 GLU n 
1 117 GLU n 
1 118 LEU n 
1 119 ASP n 
1 120 ASP n 
1 121 GLU n 
1 122 TYR n 
1 123 LEU n 
1 124 LYS n 
1 125 GLU n 
1 126 ARG n 
1 127 ALA n 
1 128 ALA n 
1 129 ASP n 
1 130 VAL n 
1 131 ARG n 
1 132 ASP n 
1 133 ILE n 
1 134 GLY n 
1 135 LYS n 
1 136 ARG n 
1 137 LEU n 
1 138 LEU n 
1 139 ARG n 
1 140 ASN n 
1 141 ILE n 
1 142 LEU n 
1 143 GLY n 
1 144 LEU n 
1 145 LYS n 
1 146 ILE n 
1 147 ILE n 
1 148 ASP n 
1 149 LEU n 
1 150 SER n 
1 151 ALA n 
1 152 ILE n 
1 153 GLN n 
1 154 ASP n 
1 155 GLU n 
1 156 VAL n 
1 157 ILE n 
1 158 LEU n 
1 159 VAL n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 LEU n 
1 164 THR n 
1 165 PRO n 
1 166 SER n 
1 167 GLU n 
1 168 THR n 
1 169 ALA n 
1 170 GLN n 
1 171 LEU n 
1 172 ASN n 
1 173 LEU n 
1 174 LYS n 
1 175 LYS n 
1 176 VAL n 
1 177 LEU n 
1 178 GLY n 
1 179 PHE n 
1 180 ILE n 
1 181 THR n 
1 182 ASP n 
1 183 ALA n 
1 184 GLY n 
1 185 GLY n 
1 186 ARG n 
1 187 THR n 
1 188 SER n 
1 189 HIS n 
1 190 THR n 
1 191 SER n 
1 192 ILE n 
1 193 MET n 
1 194 ALA n 
1 195 ARG n 
1 196 SER n 
1 197 LEU n 
1 198 GLU n 
1 199 LEU n 
1 200 PRO n 
1 201 ALA n 
1 202 ILE n 
1 203 VAL n 
1 204 GLY n 
1 205 THR n 
1 206 GLY n 
1 207 SER n 
1 208 VAL n 
1 209 THR n 
1 210 SER n 
1 211 GLN n 
1 212 VAL n 
1 213 LYS n 
1 214 ASN n 
1 215 ASP n 
1 216 ASP n 
1 217 TYR n 
1 218 LEU n 
1 219 ILE n 
1 220 LEU n 
1 221 ASP n 
1 222 ALA n 
1 223 VAL n 
1 224 ASN n 
1 225 ASN n 
1 226 GLN n 
1 227 VAL n 
1 228 TYR n 
1 229 VAL n 
1 230 ASN n 
1 231 PRO n 
1 232 THR n 
1 233 ASN n 
1 234 GLU n 
1 235 VAL n 
1 236 ILE n 
1 237 ASP n 
1 238 LYS n 
1 239 MET n 
1 240 ARG n 
1 241 ALA n 
1 242 VAL n 
1 243 GLN n 
1 244 GLU n 
1 245 GLN n 
1 246 VAL n 
1 247 ALA n 
1 248 SER n 
1 249 GLU n 
1 250 LYS n 
1 251 ALA n 
1 252 GLU n 
1 253 LEU n 
1 254 ALA n 
1 255 LYS n 
1 256 LEU n 
1 257 LYS n 
1 258 ASP n 
1 259 ARG n 
2 1   MET n 
2 2   PHE n 
2 3   GLN n 
2 4   GLN n 
2 5   GLU n 
2 6   VAL n 
2 7   THR n 
2 8   ILE n 
2 9   THR n 
2 10  ALA n 
2 11  PRO n 
2 12  ASN n 
2 13  GLY n 
2 14  LEU n 
2 15  HIS n 
2 16  THR n 
2 17  ARG n 
2 18  PRO n 
2 19  ALA n 
2 20  ALA n 
2 21  GLN n 
2 22  PHE n 
2 23  VAL n 
2 24  LYS n 
2 25  GLU n 
2 26  ALA n 
2 27  LYS n 
2 28  GLY n 
2 29  PHE n 
2 30  THR n 
2 31  SER n 
2 32  GLU n 
2 33  ILE n 
2 34  THR n 
2 35  VAL n 
2 36  THR n 
2 37  SER n 
2 38  ASN n 
2 39  GLY n 
2 40  LYS n 
2 41  SER n 
2 42  ALA n 
2 43  SER n 
2 44  ALA n 
2 45  LYS n 
2 46  SER n 
2 47  LEU n 
2 48  PHE n 
2 49  LYS n 
2 50  LEU n 
2 51  GLN n 
2 52  THR n 
2 53  LEU n 
2 54  GLY n 
2 55  LEU n 
2 56  THR n 
2 57  GLN n 
2 58  GLY n 
2 59  THR n 
2 60  VAL n 
2 61  VAL n 
2 62  THR n 
2 63  ILE n 
2 64  SER n 
2 65  ALA n 
2 66  GLU n 
2 67  GLY n 
2 68  GLU n 
2 69  ASP n 
2 70  GLU n 
2 71  GLN n 
2 72  LYS n 
2 73  ALA n 
2 74  VAL n 
2 75  GLU n 
2 76  HIS n 
2 77  LEU n 
2 78  VAL n 
2 79  LYS n 
2 80  LEU n 
2 81  MET n 
2 82  ALA n 
2 83  GLU n 
2 84  LEU n 
2 85  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Escherichia ? ? GI698 ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? 
? ? ? ? ? ? ? ? ? PLASMID ? ? ? PLP2   ? ? 
2 1 sample ? ? ? ? Escherichia ? ? GI698 ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? 
? ? ? ? ? ? ? ? ? PLASMID ? ? ? PSP100 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PT1_ECOLI  1 P08839 ? ? ? 
2 UNP PTHP_ECOLI 2 P0AA04 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3EZB A 1 ? 259 ? P08839 1 ? 259 ? 1   259 
2 2 3EZB B 1 ? 85  ? P0AA04 1 ? 85  ? 301 385 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3EZB 
_struct_ref_seq_dif.mon_id                       ARG 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      259 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08839 
_struct_ref_seq_dif.db_mon_id                    LEU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          259 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            259 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '1) TRIPLE RESONANCE FOR ASSIGNMENT OF PROTEIN. (2) QUANTITATIVE J CORRELATION FOR COUPLING CONSTANTS. (3) 3D' 1 
2 1 '4D HETERONUCLEAR SEPARATED' 1 
3 1 
;FILTERED NOE E (4) IPAP EXPTS FOR DIPOLAR COUPLINGS DIPOLAR COUPLINGS WERE MEASURED IN A NEMATIC PHASE OF A CO SUSPENSION OF PHAGE FD (CLORE ET AL. 1998 J. AM. CHEM. SOC
;
1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.00 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX500 Bruker 500 ? 
2 DMX600 Bruker 600 ? 
3 DMX750 Bruker 750 ? 
# 
_pdbx_nmr_refine.entry_id           3EZB 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE STRUCTURES WERE CALCULATED USING THE SIMULATED ANNEALING PROTOCOL OF NILGES ET AL. (1988) FEBS LETT. 229, 129-136 USING THE PROGRAM CNS MODIFIED TO INCORPORATE COUPLING CONSTANT RESTRAINTS (GARRETT ET AL. (1984) J. MAGN. RESON. SERIES B 104, 99-103), CARBON CHEMICAL SHIFT RESTRAINTS, (KUSZEWSKI ET AL. (1995) J. MAGN. RESON. SERIES B 106, 92-96) RESTRAINTS, AND RESIDUAL DIPOLAR COUPLING RESTRAINTS (CLORE ET AL. J. MAGN. RESON 131, 159-162 (1998); J. MAGN 133, 216-221 (1998)).
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   3EZB 
_pdbx_nmr_details.text       'THE 3D STRUCTURE OF THE EIN-HPR COMPLEX WAS SOLVED BY MULTI HETERONUCLEAR NMR AND IS BASED ON 5475' 
# 
_pdbx_nmr_ensemble.entry_id                                      3EZB 
_pdbx_nmr_ensemble.conformers_calculated_total_number            40 
_pdbx_nmr_ensemble.conformers_submitted_total_number             40 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'REGULARIZED MEAN STRUCTURE' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS ? 
'BRUNGER,ADAMS, CLORE, DELANO, GROS, GROSSE-KUNSTLEVE, JIANG, KUSZEWSKI, NILGES, PANNU, READ, RICE WARREN' 1 
'structure solution' CNS ? ? 2 
# 
_exptl.entry_id          3EZB 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  3EZB 
_struct.title                     
'COMPLEX OF THE AMINO TERMINAL DOMAIN OF ENZYME I AND THE HISTIDINE-CONTAINING PHOSPHOCARRIER PROTEIN HPR FROM ESCHERICHIA COLI' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3EZB 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'PHOSPHOTRANSFERASE, KINASE, SUGAR TRANSPORT, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 33  ? THR A 64  ? ALA A 33  THR A 64  1 ? 32 
HELX_P HELX_P2  2  GLU A 67  ? LEU A 80  ? GLU A 67  LEU A 80  1 ? 14 
HELX_P HELX_P3  3  GLU A 83  ? LYS A 96  ? GLU A 83  LYS A 96  1 ? 14 
HELX_P HELX_P4  4  ALA A 100 ? GLU A 116 ? ALA A 100 GLU A 116 1 ? 17 
HELX_P HELX_P5  5  GLU A 121 ? LEU A 142 ? GLU A 121 LEU A 142 1 ? 22 
HELX_P HELX_P6  6  LEU A 149 ? ALA A 151 ? LEU A 149 ALA A 151 5 ? 3  
HELX_P HELX_P7  7  PRO A 165 ? ALA A 169 ? PRO A 165 ALA A 169 1 ? 5  
HELX_P HELX_P8  8  HIS A 189 ? LEU A 197 ? HIS A 189 LEU A 197 1 ? 9  
HELX_P HELX_P9  9  VAL A 208 ? GLN A 211 ? VAL A 208 GLN A 211 1 ? 4  
HELX_P HELX_P10 10 ASN A 233 ? ALA A 251 ? ASN A 233 ALA A 251 1 ? 19 
HELX_P HELX_P11 11 THR B 16  ? GLY B 28  ? THR B 316 GLY B 328 1 ? 13 
HELX_P HELX_P12 12 LEU B 47  ? THR B 52  ? LEU B 347 THR B 352 1 ? 6  
HELX_P HELX_P13 13 GLU B 70  ? GLU B 83  ? GLU B 370 GLU B 383 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 179 ? THR A 181 ? PHE A 179 THR A 181 
A 2 ILE A 157 ? ALA A 160 ? ILE A 157 ALA A 160 
A 3 ALA A 12  ? LEU A 18  ? ALA A 12  LEU A 18  
A 4 ASP A 216 ? LEU A 220 ? ASP A 216 LEU A 220 
A 5 VAL A 227 ? VAL A 229 ? VAL A 227 VAL A 229 
B 1 PHE B 2   ? THR B 7   ? PHE B 302 THR B 307 
B 2 VAL B 60  ? GLU B 66  ? VAL B 360 GLU B 366 
B 3 GLU B 32  ? SER B 37  ? GLU B 332 SER B 337 
B 4 LYS B 40  ? SER B 43  ? LYS B 340 SER B 343 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 180 ? O ILE A 180 N LEU A 158 ? N LEU A 158 
A 2 3 O ILE A 157 ? O ILE A 157 N LEU A 17  ? N LEU A 17  
A 3 4 O ALA A 12  ? O ALA A 12  N LEU A 220 ? N LEU A 220 
A 4 5 O ILE A 219 ? O ILE A 219 N TYR A 228 ? N TYR A 228 
B 1 2 O PHE B 2   ? O PHE B 302 N ALA B 65  ? N ALA B 365 
B 2 3 O THR B 62  ? O THR B 362 N THR B 36  ? N THR B 336 
B 3 4 O VAL B 35  ? O VAL B 335 N ALA B 42  ? N ALA B 342 
# 
_database_PDB_matrix.entry_id          3EZB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3EZB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      C CA   . MET A 1 1   ? -9.233  -22.715 -20.779 1.00 1.39  ? 1   MET A CA   1  
ATOM 2      C C    . MET A 1 1   ? -8.689  -21.397 -20.221 1.00 1.31  ? 1   MET A C    1  
ATOM 3      O O    . MET A 1 1   ? -7.866  -20.746 -20.834 1.00 1.94  ? 1   MET A O    1  
ATOM 4      C CB   . MET A 1 1   ? -8.265  -23.268 -21.830 1.00 2.04  ? 1   MET A CB   1  
ATOM 5      C CG   . MET A 1 1   ? -8.733  -24.653 -22.290 1.00 2.17  ? 1   MET A CG   1  
ATOM 6      S SD   . MET A 1 1   ? -8.461  -25.867 -20.970 1.00 2.81  ? 1   MET A SD   1  
ATOM 7      C CE   . MET A 1 1   ? -6.692  -26.152 -21.249 1.00 2.91  ? 1   MET A CE   1  
ATOM 8      H HA   . MET A 1 1   ? -9.340  -23.429 -19.975 1.00 1.81  ? 1   MET A HA   1  
ATOM 9      H HB2  . MET A 1 1   ? -8.234  -22.599 -22.677 1.00 2.38  ? 1   MET A HB2  1  
ATOM 10     H HB3  . MET A 1 1   ? -7.278  -23.347 -21.401 1.00 2.62  ? 1   MET A HB3  1  
ATOM 11     H HG2  . MET A 1 1   ? -9.786  -24.616 -22.527 1.00 2.24  ? 1   MET A HG2  1  
ATOM 12     H HG3  . MET A 1 1   ? -8.179  -24.944 -23.168 1.00 2.61  ? 1   MET A HG3  1  
ATOM 13     H HE1  . MET A 1 1   ? -6.504  -26.278 -22.302 1.00 3.16  ? 1   MET A HE1  1  
ATOM 14     H HE2  . MET A 1 1   ? -6.126  -25.307 -20.883 1.00 3.10  ? 1   MET A HE2  1  
ATOM 15     H HE3  . MET A 1 1   ? -6.388  -27.048 -20.725 1.00 3.19  ? 1   MET A HE3  1  
ATOM 16     N N    . ILE A 1 2   ? -9.144  -21.006 -19.055 1.00 1.20  ? 2   ILE A N    1  
ATOM 17     C CA   . ILE A 1 2   ? -8.664  -19.733 -18.429 1.00 1.04  ? 2   ILE A CA   1  
ATOM 18     C C    . ILE A 1 2   ? -7.789  -20.073 -17.224 1.00 1.00  ? 2   ILE A C    1  
ATOM 19     O O    . ILE A 1 2   ? -8.204  -20.779 -16.325 1.00 0.91  ? 2   ILE A O    1  
ATOM 20     C CB   . ILE A 1 2   ? -9.874  -18.917 -17.961 1.00 0.88  ? 2   ILE A CB   1  
ATOM 21     C CG1  . ILE A 1 2   ? -10.738 -18.550 -19.171 1.00 0.97  ? 2   ILE A CG1  1  
ATOM 22     C CG2  . ILE A 1 2   ? -9.399  -17.637 -17.264 1.00 0.89  ? 2   ILE A CG2  1  
ATOM 23     C CD1  . ILE A 1 2   ? -12.070 -17.970 -18.692 1.00 0.97  ? 2   ILE A CD1  1  
ATOM 24     H H    . ILE A 1 2   ? -9.805  -21.556 -18.585 1.00 1.71  ? 2   ILE A H    1  
ATOM 25     H HA   . ILE A 1 2   ? -8.091  -19.154 -19.140 1.00 1.18  ? 2   ILE A HA   1  
ATOM 26     H HB   . ILE A 1 2   ? -10.457 -19.507 -17.268 1.00 0.86  ? 2   ILE A HB   1  
ATOM 27     H HG12 . ILE A 1 2   ? -10.220 -17.815 -19.771 1.00 1.11  ? 2   ILE A HG12 1  
ATOM 28     H HG13 . ILE A 1 2   ? -10.923 -19.433 -19.763 1.00 1.05  ? 2   ILE A HG13 1  
ATOM 29     H HG21 . ILE A 1 2   ? -8.626  -17.169 -17.855 1.00 1.47  ? 2   ILE A HG21 1  
ATOM 30     H HG22 . ILE A 1 2   ? -10.229 -16.956 -17.155 1.00 1.28  ? 2   ILE A HG22 1  
ATOM 31     H HG23 . ILE A 1 2   ? -9.007  -17.884 -16.288 1.00 1.28  ? 2   ILE A HG23 1  
ATOM 32     H HD11 . ILE A 1 2   ? -11.883 -17.145 -18.020 1.00 1.44  ? 2   ILE A HD11 1  
ATOM 33     H HD12 . ILE A 1 2   ? -12.639 -17.621 -19.542 1.00 1.52  ? 2   ILE A HD12 1  
ATOM 34     H HD13 . ILE A 1 2   ? -12.630 -18.735 -18.175 1.00 1.28  ? 2   ILE A HD13 1  
ATOM 35     N N    . SER A 1 3   ? -6.580  -19.573 -17.204 1.00 1.10  ? 3   SER A N    1  
ATOM 36     C CA   . SER A 1 3   ? -5.655  -19.852 -16.062 1.00 1.11  ? 3   SER A CA   1  
ATOM 37     C C    . SER A 1 3   ? -5.070  -18.534 -15.564 1.00 1.07  ? 3   SER A C    1  
ATOM 38     O O    . SER A 1 3   ? -4.571  -17.738 -16.334 1.00 1.17  ? 3   SER A O    1  
ATOM 39     C CB   . SER A 1 3   ? -4.517  -20.758 -16.534 1.00 1.29  ? 3   SER A CB   1  
ATOM 40     O OG   . SER A 1 3   ? -5.058  -21.992 -16.986 1.00 1.40  ? 3   SER A OG   1  
ATOM 41     H H    . SER A 1 3   ? -6.277  -19.009 -17.944 1.00 1.21  ? 3   SER A H    1  
ATOM 42     H HA   . SER A 1 3   ? -6.186  -20.333 -15.254 1.00 1.05  ? 3   SER A HA   1  
ATOM 43     H HB2  . SER A 1 3   ? -3.988  -20.285 -17.343 1.00 1.36  ? 3   SER A HB2  1  
ATOM 44     H HB3  . SER A 1 3   ? -3.834  -20.932 -15.712 1.00 1.30  ? 3   SER A HB3  1  
ATOM 45     H HG   . SER A 1 3   ? -5.961  -22.056 -16.665 1.00 1.66  ? 3   SER A HG   1  
ATOM 46     N N    . GLY A 1 4   ? -5.123  -18.303 -14.279 1.00 0.97  ? 4   GLY A N    1  
ATOM 47     C CA   . GLY A 1 4   ? -4.565  -17.043 -13.700 1.00 0.97  ? 4   GLY A CA   1  
ATOM 48     C C    . GLY A 1 4   ? -3.395  -17.398 -12.790 1.00 1.00  ? 4   GLY A C    1  
ATOM 49     O O    . GLY A 1 4   ? -2.888  -18.503 -12.823 1.00 1.05  ? 4   GLY A O    1  
ATOM 50     H H    . GLY A 1 4   ? -5.526  -18.966 -13.683 1.00 0.93  ? 4   GLY A H    1  
ATOM 51     H HA2  . GLY A 1 4   ? -4.223  -16.383 -14.487 1.00 1.02  ? 4   GLY A HA2  1  
ATOM 52     H HA3  . GLY A 1 4   ? -5.323  -16.546 -13.122 1.00 0.91  ? 4   GLY A HA3  1  
ATOM 53     N N    . ILE A 1 5   ? -2.939  -16.472 -11.991 1.00 1.00  ? 5   ILE A N    1  
ATOM 54     C CA   . ILE A 1 5   ? -1.777  -16.761 -11.102 1.00 1.05  ? 5   ILE A CA   1  
ATOM 55     C C    . ILE A 1 5   ? -2.256  -17.286 -9.743  1.00 1.00  ? 5   ILE A C    1  
ATOM 56     O O    . ILE A 1 5   ? -1.469  -17.758 -8.948  1.00 1.03  ? 5   ILE A O    1  
ATOM 57     C CB   . ILE A 1 5   ? -0.992  -15.465 -10.899 1.00 1.08  ? 5   ILE A CB   1  
ATOM 58     C CG1  . ILE A 1 5   ? -0.479  -14.969 -12.256 1.00 1.14  ? 5   ILE A CG1  1  
ATOM 59     C CG2  . ILE A 1 5   ? 0.195   -15.724 -9.969  1.00 1.12  ? 5   ILE A CG2  1  
ATOM 60     C CD1  . ILE A 1 5   ? -0.052  -13.506 -12.139 1.00 1.15  ? 5   ILE A CD1  1  
ATOM 61     H H    . ILE A 1 5   ? -3.337  -15.576 -11.989 1.00 0.98  ? 5   ILE A H    1  
ATOM 62     H HA   . ILE A 1 5   ? -1.134  -17.495 -11.565 1.00 1.10  ? 5   ILE A HA   1  
ATOM 63     H HB   . ILE A 1 5   ? -1.639  -14.718 -10.460 1.00 1.03  ? 5   ILE A HB   1  
ATOM 64     H HG12 . ILE A 1 5   ? 0.368   -15.567 -12.562 1.00 1.20  ? 5   ILE A HG12 1  
ATOM 65     H HG13 . ILE A 1 5   ? -1.263  -15.055 -12.995 1.00 1.14  ? 5   ILE A HG13 1  
ATOM 66     H HG21 . ILE A 1 5   ? 0.696   -16.633 -10.267 1.00 1.59  ? 5   ILE A HG21 1  
ATOM 67     H HG22 . ILE A 1 5   ? 0.886   -14.895 -10.029 1.00 1.53  ? 5   ILE A HG22 1  
ATOM 68     H HG23 . ILE A 1 5   ? -0.158  -15.823 -8.953  1.00 1.42  ? 5   ILE A HG23 1  
ATOM 69     H HD11 . ILE A 1 5   ? -0.874  -12.922 -11.753 1.00 1.52  ? 5   ILE A HD11 1  
ATOM 70     H HD12 . ILE A 1 5   ? 0.790   -13.428 -11.467 1.00 1.59  ? 5   ILE A HD12 1  
ATOM 71     H HD13 . ILE A 1 5   ? 0.228   -13.133 -13.113 1.00 1.45  ? 5   ILE A HD13 1  
ATOM 72     N N    . LEU A 1 6   ? -3.530  -17.216 -9.459  1.00 0.94  ? 6   LEU A N    1  
ATOM 73     C CA   . LEU A 1 6   ? -4.023  -17.722 -8.144  1.00 0.89  ? 6   LEU A CA   1  
ATOM 74     C C    . LEU A 1 6   ? -3.231  -17.072 -7.009  1.00 0.90  ? 6   LEU A C    1  
ATOM 75     O O    . LEU A 1 6   ? -2.147  -17.498 -6.664  1.00 0.98  ? 6   LEU A O    1  
ATOM 76     C CB   . LEU A 1 6   ? -3.879  -19.249 -8.095  1.00 0.93  ? 6   LEU A CB   1  
ATOM 77     C CG   . LEU A 1 6   ? -4.369  -19.792 -6.743  1.00 0.90  ? 6   LEU A CG   1  
ATOM 78     C CD1  . LEU A 1 6   ? -5.844  -19.415 -6.517  1.00 0.93  ? 6   LEU A CD1  1  
ATOM 79     C CD2  . LEU A 1 6   ? -4.230  -21.317 -6.749  1.00 0.93  ? 6   LEU A CD2  1  
ATOM 80     H H    . LEU A 1 6   ? -4.169  -16.834 -10.096 1.00 0.92  ? 6   LEU A H    1  
ATOM 81     H HA   . LEU A 1 6   ? -5.065  -17.459 -8.035  1.00 0.84  ? 6   LEU A HA   1  
ATOM 82     H HB2  . LEU A 1 6   ? -4.466  -19.685 -8.888  1.00 0.96  ? 6   LEU A HB2  1  
ATOM 83     H HB3  . LEU A 1 6   ? -2.841  -19.515 -8.230  1.00 0.97  ? 6   LEU A HB3  1  
ATOM 84     H HG   . LEU A 1 6   ? -3.766  -19.381 -5.947  1.00 0.90  ? 6   LEU A HG   1  
ATOM 85     H HD11 . LEU A 1 6   ? -6.374  -19.429 -7.458  1.00 1.47  ? 6   LEU A HD11 1  
ATOM 86     H HD12 . LEU A 1 6   ? -6.302  -20.121 -5.837  1.00 1.28  ? 6   LEU A HD12 1  
ATOM 87     H HD13 . LEU A 1 6   ? -5.898  -18.424 -6.090  1.00 1.40  ? 6   LEU A HD13 1  
ATOM 88     H HD21 . LEU A 1 6   ? -3.222  -21.587 -7.023  1.00 1.46  ? 6   LEU A HD21 1  
ATOM 89     H HD22 . LEU A 1 6   ? -4.452  -21.703 -5.765  1.00 1.36  ? 6   LEU A HD22 1  
ATOM 90     H HD23 . LEU A 1 6   ? -4.923  -21.737 -7.463  1.00 1.33  ? 6   LEU A HD23 1  
ATOM 91     N N    . ALA A 1 7   ? -3.781  -16.047 -6.418  1.00 0.83  ? 7   ALA A N    1  
ATOM 92     C CA   . ALA A 1 7   ? -3.085  -15.367 -5.293  1.00 0.85  ? 7   ALA A CA   1  
ATOM 93     C C    . ALA A 1 7   ? -3.259  -16.207 -4.023  1.00 0.83  ? 7   ALA A C    1  
ATOM 94     O O    . ALA A 1 7   ? -2.357  -16.329 -3.218  1.00 0.88  ? 7   ALA A O    1  
ATOM 95     C CB   . ALA A 1 7   ? -3.691  -13.970 -5.090  1.00 0.83  ? 7   ALA A CB   1  
ATOM 96     H H    . ALA A 1 7   ? -4.665  -15.738 -6.704  1.00 0.78  ? 7   ALA A H    1  
ATOM 97     H HA   . ALA A 1 7   ? -2.035  -15.277 -5.521  1.00 0.91  ? 7   ALA A HA   1  
ATOM 98     H HB1  . ALA A 1 7   ? -4.751  -14.006 -5.292  1.00 1.31  ? 7   ALA A HB1  1  
ATOM 99     H HB2  . ALA A 1 7   ? -3.529  -13.644 -4.071  1.00 1.39  ? 7   ALA A HB2  1  
ATOM 100    H HB3  . ALA A 1 7   ? -3.220  -13.273 -5.767  1.00 1.23  ? 7   ALA A HB3  1  
ATOM 101    N N    . SER A 1 8   ? -4.423  -16.780 -3.839  1.00 0.77  ? 8   SER A N    1  
ATOM 102    C CA   . SER A 1 8   ? -4.681  -17.614 -2.618  1.00 0.77  ? 8   SER A CA   1  
ATOM 103    C C    . SER A 1 8   ? -5.534  -18.846 -3.002  1.00 0.73  ? 8   SER A C    1  
ATOM 104    O O    . SER A 1 8   ? -6.448  -18.731 -3.799  1.00 0.70  ? 8   SER A O    1  
ATOM 105    C CB   . SER A 1 8   ? -5.442  -16.761 -1.602  1.00 0.76  ? 8   SER A CB   1  
ATOM 106    O OG   . SER A 1 8   ? -4.526  -15.926 -0.907  1.00 1.69  ? 8   SER A OG   1  
ATOM 107    H H    . SER A 1 8   ? -5.132  -16.658 -4.506  1.00 0.75  ? 8   SER A H    1  
ATOM 108    H HA   . SER A 1 8   ? -3.742  -17.924 -2.190  1.00 0.83  ? 8   SER A HA   1  
ATOM 109    H HB2  . SER A 1 8   ? -6.150  -16.143 -2.124  1.00 1.09  ? 8   SER A HB2  1  
ATOM 110    H HB3  . SER A 1 8   ? -5.967  -17.401 -0.904  1.00 1.25  ? 8   SER A HB3  1  
ATOM 111    H HG   . SER A 1 8   ? -3.806  -15.712 -1.504  1.00 2.09  ? 8   SER A HG   1  
ATOM 112    N N    . PRO A 1 9   ? -5.253  -20.017 -2.444  1.00 0.76  ? 9   PRO A N    1  
ATOM 113    C CA   . PRO A 1 9   ? -6.027  -21.263 -2.752  1.00 0.75  ? 9   PRO A CA   1  
ATOM 114    C C    . PRO A 1 9   ? -7.351  -21.350 -1.975  1.00 0.70  ? 9   PRO A C    1  
ATOM 115    O O    . PRO A 1 9   ? -7.422  -21.006 -0.810  1.00 0.70  ? 9   PRO A O    1  
ATOM 116    C CB   . PRO A 1 9   ? -5.072  -22.372 -2.307  1.00 0.83  ? 9   PRO A CB   1  
ATOM 117    C CG   . PRO A 1 9   ? -4.358  -21.784 -1.137  1.00 0.85  ? 9   PRO A CG   1  
ATOM 118    C CD   . PRO A 1 9   ? -4.178  -20.296 -1.463  1.00 0.82  ? 9   PRO A CD   1  
ATOM 119    H HA   . PRO A 1 9   ? -6.207  -21.344 -3.812  1.00 0.74  ? 9   PRO A HA   1  
ATOM 120    H HB2  . PRO A 1 9   ? -5.622  -23.261 -2.018  1.00 0.85  ? 9   PRO A HB2  1  
ATOM 121    H HB3  . PRO A 1 9   ? -4.369  -22.602 -3.093  1.00 0.88  ? 9   PRO A HB3  1  
ATOM 122    H HG2  . PRO A 1 9   ? -4.953  -21.906 -0.239  1.00 0.84  ? 9   PRO A HG2  1  
ATOM 123    H HG3  . PRO A 1 9   ? -3.393  -22.251 -1.008  1.00 0.91  ? 9   PRO A HG3  1  
ATOM 124    H HD2  . PRO A 1 9   ? -4.303  -19.691 -0.573  1.00 0.81  ? 9   PRO A HD2  1  
ATOM 125    H HD3  . PRO A 1 9   ? -3.212  -20.124 -1.912  1.00 0.86  ? 9   PRO A HD3  1  
ATOM 126    N N    . GLY A 1 10  ? -8.393  -21.816 -2.610  1.00 0.67  ? 10  GLY A N    1  
ATOM 127    C CA   . GLY A 1 10  ? -9.710  -21.934 -1.913  1.00 0.64  ? 10  GLY A CA   1  
ATOM 128    C C    . GLY A 1 10  ? -10.807 -22.164 -2.954  1.00 0.62  ? 10  GLY A C    1  
ATOM 129    O O    . GLY A 1 10  ? -10.531 -22.504 -4.080  1.00 0.92  ? 10  GLY A O    1  
ATOM 130    H H    . GLY A 1 10  ? -8.310  -22.091 -3.549  1.00 0.68  ? 10  GLY A H    1  
ATOM 131    H HA2  . GLY A 1 10  ? -9.681  -22.767 -1.226  1.00 0.70  ? 10  GLY A HA2  1  
ATOM 132    H HA3  . GLY A 1 10  ? -9.917  -21.024 -1.370  1.00 0.60  ? 10  GLY A HA3  1  
ATOM 133    N N    . ILE A 1 11  ? -12.050 -21.970 -2.589  1.00 0.64  ? 11  ILE A N    1  
ATOM 134    C CA   . ILE A 1 11  ? -13.175 -22.156 -3.568  1.00 0.60  ? 11  ILE A CA   1  
ATOM 135    C C    . ILE A 1 11  ? -14.302 -21.177 -3.195  1.00 0.56  ? 11  ILE A C    1  
ATOM 136    O O    . ILE A 1 11  ? -14.479 -20.848 -2.038  1.00 0.61  ? 11  ILE A O    1  
ATOM 137    C CB   . ILE A 1 11  ? -13.716 -23.601 -3.523  1.00 0.67  ? 11  ILE A CB   1  
ATOM 138    C CG1  . ILE A 1 11  ? -12.680 -24.586 -4.093  1.00 0.74  ? 11  ILE A CG1  1  
ATOM 139    C CG2  . ILE A 1 11  ? -14.992 -23.681 -4.366  1.00 0.64  ? 11  ILE A CG2  1  
ATOM 140    C CD1  . ILE A 1 11  ? -13.143 -26.027 -3.849  1.00 0.81  ? 11  ILE A CD1  1  
ATOM 141    H H    . ILE A 1 11  ? -12.244 -21.677 -1.675  1.00 0.92  ? 11  ILE A H    1  
ATOM 142    H HA   . ILE A 1 11  ? -12.824 -21.932 -4.567  1.00 0.56  ? 11  ILE A HA   1  
ATOM 143    H HB   . ILE A 1 11  ? -13.944 -23.867 -2.501  1.00 0.72  ? 11  ILE A HB   1  
ATOM 144    H HG12 . ILE A 1 11  ? -12.569 -24.418 -5.155  1.00 0.77  ? 11  ILE A HG12 1  
ATOM 145    H HG13 . ILE A 1 11  ? -11.732 -24.441 -3.606  1.00 0.78  ? 11  ILE A HG13 1  
ATOM 146    H HG21 . ILE A 1 11  ? -14.831 -23.183 -5.310  1.00 1.20  ? 11  ILE A HG21 1  
ATOM 147    H HG22 . ILE A 1 11  ? -15.250 -24.714 -4.545  1.00 1.26  ? 11  ILE A HG22 1  
ATOM 148    H HG23 . ILE A 1 11  ? -15.798 -23.200 -3.840  1.00 1.09  ? 11  ILE A HG23 1  
ATOM 149    H HD11 . ILE A 1 11  ? -14.165 -26.139 -4.180  1.00 1.35  ? 11  ILE A HD11 1  
ATOM 150    H HD12 . ILE A 1 11  ? -12.511 -26.706 -4.400  1.00 1.21  ? 11  ILE A HD12 1  
ATOM 151    H HD13 . ILE A 1 11  ? -13.080 -26.251 -2.794  1.00 1.35  ? 11  ILE A HD13 1  
ATOM 152    N N    . ALA A 1 12  ? -15.075 -20.707 -4.150  1.00 0.50  ? 12  ALA A N    1  
ATOM 153    C CA   . ALA A 1 12  ? -16.182 -19.757 -3.800  1.00 0.50  ? 12  ALA A CA   1  
ATOM 154    C C    . ALA A 1 12  ? -17.294 -19.805 -4.858  1.00 0.47  ? 12  ALA A C    1  
ATOM 155    O O    . ALA A 1 12  ? -17.069 -20.147 -6.001  1.00 0.51  ? 12  ALA A O    1  
ATOM 156    C CB   . ALA A 1 12  ? -15.628 -18.331 -3.721  1.00 0.49  ? 12  ALA A CB   1  
ATOM 157    H H    . ALA A 1 12  ? -14.933 -20.979 -5.083  1.00 0.48  ? 12  ALA A H    1  
ATOM 158    H HA   . ALA A 1 12  ? -16.597 -20.028 -2.840  1.00 0.55  ? 12  ALA A HA   1  
ATOM 159    H HB1  . ALA A 1 12  ? -14.689 -18.339 -3.186  1.00 1.14  ? 12  ALA A HB1  1  
ATOM 160    H HB2  . ALA A 1 12  ? -15.470 -17.948 -4.719  1.00 1.13  ? 12  ALA A HB2  1  
ATOM 161    H HB3  . ALA A 1 12  ? -16.333 -17.700 -3.200  1.00 1.12  ? 12  ALA A HB3  1  
ATOM 162    N N    . PHE A 1 13  ? -18.497 -19.440 -4.477  1.00 0.48  ? 13  PHE A N    1  
ATOM 163    C CA   . PHE A 1 13  ? -19.643 -19.428 -5.443  1.00 0.48  ? 13  PHE A CA   1  
ATOM 164    C C    . PHE A 1 13  ? -20.459 -18.151 -5.198  1.00 0.49  ? 13  PHE A C    1  
ATOM 165    O O    . PHE A 1 13  ? -20.820 -17.862 -4.075  1.00 0.54  ? 13  PHE A O    1  
ATOM 166    C CB   . PHE A 1 13  ? -20.560 -20.645 -5.200  1.00 0.53  ? 13  PHE A CB   1  
ATOM 167    C CG   . PHE A 1 13  ? -19.747 -21.882 -4.898  1.00 0.52  ? 13  PHE A CG   1  
ATOM 168    C CD1  . PHE A 1 13  ? -19.069 -21.989 -3.678  1.00 0.56  ? 13  PHE A CD1  1  
ATOM 169    C CD2  . PHE A 1 13  ? -19.684 -22.932 -5.827  1.00 0.55  ? 13  PHE A CD2  1  
ATOM 170    C CE1  . PHE A 1 13  ? -18.331 -23.141 -3.387  1.00 0.61  ? 13  PHE A CE1  1  
ATOM 171    C CE2  . PHE A 1 13  ? -18.942 -24.082 -5.535  1.00 0.60  ? 13  PHE A CE2  1  
ATOM 172    C CZ   . PHE A 1 13  ? -18.266 -24.188 -4.315  1.00 0.62  ? 13  PHE A CZ   1  
ATOM 173    H H    . PHE A 1 13  ? -18.643 -19.153 -3.551  1.00 0.55  ? 13  PHE A H    1  
ATOM 174    H HA   . PHE A 1 13  ? -19.278 -19.439 -6.461  1.00 0.45  ? 13  PHE A HA   1  
ATOM 175    H HB2  . PHE A 1 13  ? -21.212 -20.445 -4.360  1.00 0.60  ? 13  PHE A HB2  1  
ATOM 176    H HB3  . PHE A 1 13  ? -21.160 -20.817 -6.080  1.00 0.57  ? 13  PHE A HB3  1  
ATOM 177    H HD1  . PHE A 1 13  ? -19.117 -21.184 -2.961  1.00 0.59  ? 13  PHE A HD1  1  
ATOM 178    H HD2  . PHE A 1 13  ? -20.207 -22.854 -6.769  1.00 0.58  ? 13  PHE A HD2  1  
ATOM 179    H HE1  . PHE A 1 13  ? -17.808 -23.223 -2.445  1.00 0.68  ? 13  PHE A HE1  1  
ATOM 180    H HE2  . PHE A 1 13  ? -18.893 -24.887 -6.251  1.00 0.66  ? 13  PHE A HE2  1  
ATOM 181    H HZ   . PHE A 1 13  ? -17.696 -25.077 -4.088  1.00 0.70  ? 13  PHE A HZ   1  
ATOM 182    N N    . GLY A 1 14  ? -20.765 -17.377 -6.210  1.00 0.49  ? 14  GLY A N    1  
ATOM 183    C CA   . GLY A 1 14  ? -21.560 -16.141 -5.952  1.00 0.53  ? 14  GLY A CA   1  
ATOM 184    C C    . GLY A 1 14  ? -21.698 -15.301 -7.231  1.00 0.55  ? 14  GLY A C    1  
ATOM 185    O O    . GLY A 1 14  ? -21.230 -15.670 -8.290  1.00 0.54  ? 14  GLY A O    1  
ATOM 186    H H    . GLY A 1 14  ? -20.480 -17.584 -7.125  1.00 0.47  ? 14  GLY A H    1  
ATOM 187    H HA2  . GLY A 1 14  ? -22.544 -16.419 -5.601  1.00 0.58  ? 14  GLY A HA2  1  
ATOM 188    H HA3  . GLY A 1 14  ? -21.065 -15.553 -5.194  1.00 0.53  ? 14  GLY A HA3  1  
ATOM 189    N N    . LYS A 1 15  ? -22.346 -14.169 -7.120  1.00 0.61  ? 15  LYS A N    1  
ATOM 190    C CA   . LYS A 1 15  ? -22.537 -13.276 -8.303  1.00 0.65  ? 15  LYS A CA   1  
ATOM 191    C C    . LYS A 1 15  ? -21.263 -12.467 -8.543  1.00 0.63  ? 15  LYS A C    1  
ATOM 192    O O    . LYS A 1 15  ? -20.464 -12.277 -7.647  1.00 0.61  ? 15  LYS A O    1  
ATOM 193    C CB   . LYS A 1 15  ? -23.713 -12.330 -8.050  1.00 0.73  ? 15  LYS A CB   1  
ATOM 194    C CG   . LYS A 1 15  ? -25.004 -13.145 -7.934  1.00 0.82  ? 15  LYS A CG   1  
ATOM 195    C CD   . LYS A 1 15  ? -26.185 -12.206 -7.680  1.00 0.89  ? 15  LYS A CD   1  
ATOM 196    C CE   . LYS A 1 15  ? -27.475 -13.023 -7.566  1.00 1.32  ? 15  LYS A CE   1  
ATOM 197    N NZ   . LYS A 1 15  ? -27.323 -14.061 -6.507  1.00 2.10  ? 15  LYS A NZ   1  
ATOM 198    H H    . LYS A 1 15  ? -22.708 -13.919 -6.246  1.00 0.63  ? 15  LYS A H    1  
ATOM 199    H HA   . LYS A 1 15  ? -22.742 -13.873 -9.176  1.00 0.65  ? 15  LYS A HA   1  
ATOM 200    H HB2  . LYS A 1 15  ? -23.545 -11.788 -7.133  1.00 0.79  ? 15  LYS A HB2  1  
ATOM 201    H HB3  . LYS A 1 15  ? -23.801 -11.634 -8.870  1.00 0.76  ? 15  LYS A HB3  1  
ATOM 202    H HG2  . LYS A 1 15  ? -25.169 -13.697 -8.847  1.00 0.91  ? 15  LYS A HG2  1  
ATOM 203    H HG3  . LYS A 1 15  ? -24.917 -13.834 -7.108  1.00 0.94  ? 15  LYS A HG3  1  
ATOM 204    H HD2  . LYS A 1 15  ? -26.020 -11.660 -6.763  1.00 1.15  ? 15  LYS A HD2  1  
ATOM 205    H HD3  . LYS A 1 15  ? -26.276 -11.510 -8.502  1.00 1.21  ? 15  LYS A HD3  1  
ATOM 206    H HE2  . LYS A 1 15  ? -28.294 -12.368 -7.312  1.00 1.74  ? 15  LYS A HE2  1  
ATOM 207    H HE3  . LYS A 1 15  ? -27.680 -13.503 -8.512  1.00 1.69  ? 15  LYS A HE3  1  
ATOM 208    H HZ1  . LYS A 1 15  ? -26.687 -13.709 -5.765  1.00 2.54  ? 15  LYS A HZ1  1  
ATOM 209    H HZ2  . LYS A 1 15  ? -28.255 -14.272 -6.094  1.00 2.63  ? 15  LYS A HZ2  1  
ATOM 210    H HZ3  . LYS A 1 15  ? -26.924 -14.925 -6.923  1.00 2.45  ? 15  LYS A HZ3  1  
ATOM 211    N N    . ALA A 1 16  ? -21.057 -12.004 -9.754  1.00 0.64  ? 16  ALA A N    1  
ATOM 212    C CA   . ALA A 1 16  ? -19.814 -11.223 -10.066 1.00 0.64  ? 16  ALA A CA   1  
ATOM 213    C C    . ALA A 1 16  ? -20.121 -9.723  -10.172 1.00 0.67  ? 16  ALA A C    1  
ATOM 214    O O    . ALA A 1 16  ? -21.009 -9.303  -10.888 1.00 0.77  ? 16  ALA A O    1  
ATOM 215    C CB   . ALA A 1 16  ? -19.230 -11.728 -11.397 1.00 0.66  ? 16  ALA A CB   1  
ATOM 216    H H    . ALA A 1 16  ? -21.713 -12.184 -10.465 1.00 0.67  ? 16  ALA A H    1  
ATOM 217    H HA   . ALA A 1 16  ? -19.082 -11.374 -9.285  1.00 0.61  ? 16  ALA A HA   1  
ATOM 218    H HB1  . ALA A 1 16  ? -19.473 -12.773 -11.516 1.00 1.18  ? 16  ALA A HB1  1  
ATOM 219    H HB2  . ALA A 1 16  ? -19.647 -11.167 -12.226 1.00 1.27  ? 16  ALA A HB2  1  
ATOM 220    H HB3  . ALA A 1 16  ? -18.158 -11.609 -11.388 1.00 1.19  ? 16  ALA A HB3  1  
ATOM 221    N N    . LEU A 1 17  ? -19.359 -8.913  -9.481  1.00 0.62  ? 17  LEU A N    1  
ATOM 222    C CA   . LEU A 1 17  ? -19.552 -7.432  -9.543  1.00 0.66  ? 17  LEU A CA   1  
ATOM 223    C C    . LEU A 1 17  ? -18.496 -6.875  -10.500 1.00 0.68  ? 17  LEU A C    1  
ATOM 224    O O    . LEU A 1 17  ? -17.350 -7.268  -10.445 1.00 0.68  ? 17  LEU A O    1  
ATOM 225    C CB   . LEU A 1 17  ? -19.360 -6.835  -8.142  1.00 0.64  ? 17  LEU A CB   1  
ATOM 226    C CG   . LEU A 1 17  ? -19.526 -5.308  -8.179  1.00 0.73  ? 17  LEU A CG   1  
ATOM 227    C CD1  . LEU A 1 17  ? -20.949 -4.937  -8.630  1.00 0.91  ? 17  LEU A CD1  1  
ATOM 228    C CD2  . LEU A 1 17  ? -19.263 -4.745  -6.777  1.00 0.69  ? 17  LEU A CD2  1  
ATOM 229    H H    . LEU A 1 17  ? -18.635 -9.283  -8.930  1.00 0.57  ? 17  LEU A H    1  
ATOM 230    H HA   . LEU A 1 17  ? -20.542 -7.202  -9.912  1.00 0.69  ? 17  LEU A HA   1  
ATOM 231    H HB2  . LEU A 1 17  ? -20.095 -7.257  -7.474  1.00 0.64  ? 17  LEU A HB2  1  
ATOM 232    H HB3  . LEU A 1 17  ? -18.372 -7.078  -7.784  1.00 0.65  ? 17  LEU A HB3  1  
ATOM 233    H HG   . LEU A 1 17  ? -18.813 -4.887  -8.872  1.00 0.87  ? 17  LEU A HG   1  
ATOM 234    H HD11 . LEU A 1 17  ? -21.656 -5.656  -8.241  1.00 1.41  ? 17  LEU A HD11 1  
ATOM 235    H HD12 . LEU A 1 17  ? -21.203 -3.951  -8.262  1.00 1.36  ? 17  LEU A HD12 1  
ATOM 236    H HD13 . LEU A 1 17  ? -20.994 -4.935  -9.708  1.00 1.40  ? 17  LEU A HD13 1  
ATOM 237    H HD21 . LEU A 1 17  ? -19.895 -5.250  -6.062  1.00 1.23  ? 17  LEU A HD21 1  
ATOM 238    H HD22 . LEU A 1 17  ? -18.226 -4.902  -6.516  1.00 1.33  ? 17  LEU A HD22 1  
ATOM 239    H HD23 . LEU A 1 17  ? -19.480 -3.687  -6.766  1.00 1.13  ? 17  LEU A HD23 1  
ATOM 240    N N    . LEU A 1 18  ? -18.866 -5.974  -11.381 1.00 0.72  ? 18  LEU A N    1  
ATOM 241    C CA   . LEU A 1 18  ? -17.873 -5.406  -12.355 1.00 0.76  ? 18  LEU A CA   1  
ATOM 242    C C    . LEU A 1 18  ? -17.726 -3.901  -12.132 1.00 0.79  ? 18  LEU A C    1  
ATOM 243    O O    . LEU A 1 18  ? -18.688 -3.161  -12.108 1.00 0.83  ? 18  LEU A O    1  
ATOM 244    C CB   . LEU A 1 18  ? -18.365 -5.667  -13.785 1.00 0.80  ? 18  LEU A CB   1  
ATOM 245    C CG   . LEU A 1 18  ? -17.370 -5.097  -14.817 1.00 0.85  ? 18  LEU A CG   1  
ATOM 246    C CD1  . LEU A 1 18  ? -15.990 -5.761  -14.652 1.00 0.93  ? 18  LEU A CD1  1  
ATOM 247    C CD2  . LEU A 1 18  ? -17.903 -5.369  -16.230 1.00 0.91  ? 18  LEU A CD2  1  
ATOM 248    H H    . LEU A 1 18  ? -19.792 -5.667  -11.404 1.00 0.74  ? 18  LEU A H    1  
ATOM 249    H HA   . LEU A 1 18  ? -16.911 -5.877  -12.220 1.00 0.74  ? 18  LEU A HA   1  
ATOM 250    H HB2  . LEU A 1 18  ? -18.465 -6.731  -13.938 1.00 0.79  ? 18  LEU A HB2  1  
ATOM 251    H HB3  . LEU A 1 18  ? -19.326 -5.195  -13.923 1.00 0.86  ? 18  LEU A HB3  1  
ATOM 252    H HG   . LEU A 1 18  ? -17.271 -4.031  -14.673 1.00 0.91  ? 18  LEU A HG   1  
ATOM 253    H HD11 . LEU A 1 18  ? -16.115 -6.799  -14.378 1.00 1.46  ? 18  LEU A HD11 1  
ATOM 254    H HD12 . LEU A 1 18  ? -15.441 -5.700  -15.581 1.00 1.29  ? 18  LEU A HD12 1  
ATOM 255    H HD13 . LEU A 1 18  ? -15.435 -5.249  -13.880 1.00 1.43  ? 18  LEU A HD13 1  
ATOM 256    H HD21 . LEU A 1 18  ? -18.966 -5.168  -16.262 1.00 1.49  ? 18  LEU A HD21 1  
ATOM 257    H HD22 . LEU A 1 18  ? -17.396 -4.727  -16.935 1.00 1.47  ? 18  LEU A HD22 1  
ATOM 258    H HD23 . LEU A 1 18  ? -17.725 -6.402  -16.492 1.00 1.16  ? 18  LEU A HD23 1  
ATOM 259    N N    . LEU A 1 19  ? -16.514 -3.455  -11.969 1.00 0.80  ? 19  LEU A N    1  
ATOM 260    C CA   . LEU A 1 19  ? -16.276 -2.001  -11.747 1.00 0.85  ? 19  LEU A CA   1  
ATOM 261    C C    . LEU A 1 19  ? -16.119 -1.301  -13.098 1.00 0.89  ? 19  LEU A C    1  
ATOM 262    O O    . LEU A 1 19  ? -15.076 -1.350  -13.719 1.00 0.93  ? 19  LEU A O    1  
ATOM 263    C CB   . LEU A 1 19  ? -15.001 -1.804  -10.933 1.00 0.88  ? 19  LEU A CB   1  
ATOM 264    C CG   . LEU A 1 19  ? -15.078 -2.593  -9.617  1.00 0.87  ? 19  LEU A CG   1  
ATOM 265    C CD1  . LEU A 1 19  ? -13.823 -2.308  -8.776  1.00 0.93  ? 19  LEU A CD1  1  
ATOM 266    C CD2  . LEU A 1 19  ? -16.337 -2.188  -8.829  1.00 0.88  ? 19  LEU A CD2  1  
ATOM 267    H H    . LEU A 1 19  ? -15.776 -4.099  -11.986 1.00 0.79  ? 19  LEU A H    1  
ATOM 268    H HA   . LEU A 1 19  ? -17.114 -1.568  -11.220 1.00 0.87  ? 19  LEU A HA   1  
ATOM 269    H HB2  . LEU A 1 19  ? -14.156 -2.152  -11.509 1.00 0.90  ? 19  LEU A HB2  1  
ATOM 270    H HB3  . LEU A 1 19  ? -14.878 -0.754  -10.715 1.00 0.93  ? 19  LEU A HB3  1  
ATOM 271    H HG   . LEU A 1 19  ? -15.120 -3.649  -9.842  1.00 0.85  ? 19  LEU A HG   1  
ATOM 272    H HD11 . LEU A 1 19  ? -12.960 -2.234  -9.423  1.00 1.30  ? 19  LEU A HD11 1  
ATOM 273    H HD12 . LEU A 1 19  ? -13.948 -1.379  -8.240  1.00 1.33  ? 19  LEU A HD12 1  
ATOM 274    H HD13 . LEU A 1 19  ? -13.672 -3.112  -8.072  1.00 1.52  ? 19  LEU A HD13 1  
ATOM 275    H HD21 . LEU A 1 19  ? -16.502 -1.124  -8.927  1.00 1.38  ? 19  LEU A HD21 1  
ATOM 276    H HD22 . LEU A 1 19  ? -17.191 -2.722  -9.217  1.00 1.27  ? 19  LEU A HD22 1  
ATOM 277    H HD23 . LEU A 1 19  ? -16.207 -2.436  -7.787  1.00 1.31  ? 19  LEU A HD23 1  
ATOM 278    N N    . LYS A 1 20  ? -17.148 -0.641  -13.555 1.00 0.94  ? 20  LYS A N    1  
ATOM 279    C CA   . LYS A 1 20  ? -17.068 0.073   -14.859 1.00 1.01  ? 20  LYS A CA   1  
ATOM 280    C C    . LYS A 1 20  ? -16.611 1.510   -14.604 1.00 1.05  ? 20  LYS A C    1  
ATOM 281    O O    . LYS A 1 20  ? -17.063 2.151   -13.675 1.00 1.29  ? 20  LYS A O    1  
ATOM 282    C CB   . LYS A 1 20  ? -18.459 0.079   -15.483 1.00 1.15  ? 20  LYS A CB   1  
ATOM 283    C CG   . LYS A 1 20  ? -18.870 -1.356  -15.810 1.00 1.32  ? 20  LYS A CG   1  
ATOM 284    C CD   . LYS A 1 20  ? -20.267 -1.346  -16.418 1.00 1.42  ? 20  LYS A CD   1  
ATOM 285    C CE   . LYS A 1 20  ? -20.694 -2.777  -16.750 1.00 2.11  ? 20  LYS A CE   1  
ATOM 286    N NZ   . LYS A 1 20  ? -22.034 -2.761  -17.403 1.00 2.75  ? 20  LYS A NZ   1  
ATOM 287    H H    . LYS A 1 20  ? -17.982 -0.614  -13.039 1.00 0.97  ? 20  LYS A H    1  
ATOM 288    H HA   . LYS A 1 20  ? -16.372 -0.426  -15.517 1.00 1.01  ? 20  LYS A HA   1  
ATOM 289    H HB2  . LYS A 1 20  ? -19.165 0.507   -14.784 1.00 1.24  ? 20  LYS A HB2  1  
ATOM 290    H HB3  . LYS A 1 20  ? -18.446 0.665   -16.389 1.00 1.19  ? 20  LYS A HB3  1  
ATOM 291    H HG2  . LYS A 1 20  ? -18.169 -1.777  -16.518 1.00 1.50  ? 20  LYS A HG2  1  
ATOM 292    H HG3  . LYS A 1 20  ? -18.874 -1.948  -14.908 1.00 1.50  ? 20  LYS A HG3  1  
ATOM 293    H HD2  . LYS A 1 20  ? -20.953 -0.919  -15.702 1.00 1.54  ? 20  LYS A HD2  1  
ATOM 294    H HD3  . LYS A 1 20  ? -20.266 -0.750  -17.319 1.00 1.71  ? 20  LYS A HD3  1  
ATOM 295    H HE2  . LYS A 1 20  ? -19.972 -3.222  -17.420 1.00 2.58  ? 20  LYS A HE2  1  
ATOM 296    H HE3  . LYS A 1 20  ? -20.743 -3.357  -15.841 1.00 2.50  ? 20  LYS A HE3  1  
ATOM 297    H HZ1  . LYS A 1 20  ? -22.068 -1.998  -18.108 1.00 3.07  ? 20  LYS A HZ1  1  
ATOM 298    H HZ2  . LYS A 1 20  ? -22.203 -3.675  -17.872 1.00 3.13  ? 20  LYS A HZ2  1  
ATOM 299    H HZ3  . LYS A 1 20  ? -22.769 -2.600  -16.684 1.00 3.17  ? 20  LYS A HZ3  1  
ATOM 300    N N    . GLU A 1 21  ? -15.721 2.026   -15.416 1.00 0.94  ? 21  GLU A N    1  
ATOM 301    C CA   . GLU A 1 21  ? -15.230 3.427   -15.223 1.00 1.02  ? 21  GLU A CA   1  
ATOM 302    C C    . GLU A 1 21  ? -15.315 4.172   -16.555 1.00 0.91  ? 21  GLU A C    1  
ATOM 303    O O    . GLU A 1 21  ? -14.897 3.674   -17.580 1.00 1.04  ? 21  GLU A O    1  
ATOM 304    C CB   . GLU A 1 21  ? -13.773 3.390   -14.758 1.00 1.24  ? 21  GLU A CB   1  
ATOM 305    C CG   . GLU A 1 21  ? -13.703 2.816   -13.342 1.00 1.72  ? 21  GLU A CG   1  
ATOM 306    C CD   . GLU A 1 21  ? -14.260 3.833   -12.347 1.00 2.36  ? 21  GLU A CD   1  
ATOM 307    O OE1  . GLU A 1 21  ? -14.266 5.009   -12.672 1.00 3.00  ? 21  GLU A OE1  1  
ATOM 308    O OE2  . GLU A 1 21  ? -14.668 3.422   -11.274 1.00 2.83  ? 21  GLU A OE2  1  
ATOM 309    H H    . GLU A 1 21  ? -15.370 1.498   -16.163 1.00 0.92  ? 21  GLU A H    1  
ATOM 310    H HA   . GLU A 1 21  ? -15.832 3.943   -14.487 1.00 1.20  ? 21  GLU A HA   1  
ATOM 311    H HB2  . GLU A 1 21  ? -13.194 2.771   -15.429 1.00 1.75  ? 21  GLU A HB2  1  
ATOM 312    H HB3  . GLU A 1 21  ? -13.369 4.391   -14.757 1.00 1.63  ? 21  GLU A HB3  1  
ATOM 313    H HG2  . GLU A 1 21  ? -14.290 1.908   -13.294 1.00 2.17  ? 21  GLU A HG2  1  
ATOM 314    H HG3  . GLU A 1 21  ? -12.676 2.593   -13.091 1.00 2.19  ? 21  GLU A HG3  1  
ATOM 315    N N    . ASP A 1 22  ? -15.838 5.365   -16.551 1.00 0.93  ? 22  ASP A N    1  
ATOM 316    C CA   . ASP A 1 22  ? -15.929 6.138   -17.819 1.00 0.97  ? 22  ASP A CA   1  
ATOM 317    C C    . ASP A 1 22  ? -14.581 6.795   -18.096 1.00 0.73  ? 22  ASP A C    1  
ATOM 318    O O    . ASP A 1 22  ? -13.848 7.128   -17.187 1.00 0.75  ? 22  ASP A O    1  
ATOM 319    C CB   . ASP A 1 22  ? -17.002 7.219   -17.684 1.00 1.33  ? 22  ASP A CB   1  
ATOM 320    C CG   . ASP A 1 22  ? -18.382 6.563   -17.640 1.00 2.11  ? 22  ASP A CG   1  
ATOM 321    O OD1  . ASP A 1 22  ? -18.492 5.431   -18.083 1.00 2.76  ? 22  ASP A OD1  1  
ATOM 322    O OD2  . ASP A 1 22  ? -19.308 7.205   -17.172 1.00 2.77  ? 22  ASP A OD2  1  
ATOM 323    H H    . ASP A 1 22  ? -16.159 5.763   -15.715 1.00 1.07  ? 22  ASP A H    1  
ATOM 324    H HA   . ASP A 1 22  ? -16.185 5.475   -18.634 1.00 1.16  ? 22  ASP A HA   1  
ATOM 325    H HB2  . ASP A 1 22  ? -16.839 7.776   -16.772 1.00 1.70  ? 22  ASP A HB2  1  
ATOM 326    H HB3  . ASP A 1 22  ? -16.949 7.888   -18.529 1.00 1.69  ? 22  ASP A HB3  1  
ATOM 327    N N    . GLU A 1 23  ? -14.241 6.990   -19.337 1.00 0.86  ? 23  GLU A N    1  
ATOM 328    C CA   . GLU A 1 23  ? -12.937 7.632   -19.646 1.00 0.99  ? 23  GLU A CA   1  
ATOM 329    C C    . GLU A 1 23  ? -12.972 9.082   -19.162 1.00 0.91  ? 23  GLU A C    1  
ATOM 330    O O    . GLU A 1 23  ? -14.001 9.727   -19.182 1.00 0.99  ? 23  GLU A O    1  
ATOM 331    C CB   . GLU A 1 23  ? -12.691 7.598   -21.158 1.00 1.41  ? 23  GLU A CB   1  
ATOM 332    C CG   . GLU A 1 23  ? -11.295 8.153   -21.470 1.00 1.68  ? 23  GLU A CG   1  
ATOM 333    C CD   . GLU A 1 23  ? -10.228 7.244   -20.855 1.00 2.36  ? 23  GLU A CD   1  
ATOM 334    O OE1  . GLU A 1 23  ? -10.504 6.065   -20.693 1.00 2.91  ? 23  GLU A OE1  1  
ATOM 335    O OE2  . GLU A 1 23  ? -9.158  7.741   -20.549 1.00 2.94  ? 23  GLU A OE2  1  
ATOM 336    H H    . GLU A 1 23  ? -14.842 6.718   -20.062 1.00 1.07  ? 23  GLU A H    1  
ATOM 337    H HA   . GLU A 1 23  ? -12.148 7.100   -19.136 1.00 1.03  ? 23  GLU A HA   1  
ATOM 338    H HB2  . GLU A 1 23  ? -12.760 6.580   -21.509 1.00 1.51  ? 23  GLU A HB2  1  
ATOM 339    H HB3  . GLU A 1 23  ? -13.434 8.202   -21.654 1.00 1.54  ? 23  GLU A HB3  1  
ATOM 340    H HG2  . GLU A 1 23  ? -11.159 8.193   -22.541 1.00 1.87  ? 23  GLU A HG2  1  
ATOM 341    H HG3  . GLU A 1 23  ? -11.199 9.146   -21.059 1.00 1.89  ? 23  GLU A HG3  1  
ATOM 342    N N    . ILE A 1 24  ? -11.855 9.600   -18.725 1.00 0.83  ? 24  ILE A N    1  
ATOM 343    C CA   . ILE A 1 24  ? -11.821 11.012  -18.238 1.00 0.81  ? 24  ILE A CA   1  
ATOM 344    C C    . ILE A 1 24  ? -11.387 11.918  -19.394 1.00 0.90  ? 24  ILE A C    1  
ATOM 345    O O    . ILE A 1 24  ? -10.422 11.642  -20.079 1.00 0.95  ? 24  ILE A O    1  
ATOM 346    C CB   . ILE A 1 24  ? -10.823 11.133  -17.087 1.00 0.77  ? 24  ILE A CB   1  
ATOM 347    C CG1  . ILE A 1 24  ? -11.182 10.123  -15.993 1.00 0.73  ? 24  ILE A CG1  1  
ATOM 348    C CG2  . ILE A 1 24  ? -10.900 12.545  -16.508 1.00 0.86  ? 24  ILE A CG2  1  
ATOM 349    C CD1  . ILE A 1 24  ? -10.073 10.099  -14.940 1.00 0.80  ? 24  ILE A CD1  1  
ATOM 350    H H    . ILE A 1 24  ? -11.036 9.063   -18.720 1.00 0.85  ? 24  ILE A H    1  
ATOM 351    H HA   . ILE A 1 24  ? -12.804 11.308  -17.893 1.00 0.84  ? 24  ILE A HA   1  
ATOM 352    H HB   . ILE A 1 24  ? -9.822  10.942  -17.448 1.00 0.81  ? 24  ILE A HB   1  
ATOM 353    H HG12 . ILE A 1 24  ? -12.115 10.409  -15.530 1.00 0.75  ? 24  ILE A HG12 1  
ATOM 354    H HG13 . ILE A 1 24  ? -11.280 9.141   -16.429 1.00 0.71  ? 24  ILE A HG13 1  
ATOM 355    H HG21 . ILE A 1 24  ? -11.925 12.769  -16.246 1.00 1.23  ? 24  ILE A HG21 1  
ATOM 356    H HG22 . ILE A 1 24  ? -10.283 12.605  -15.626 1.00 1.35  ? 24  ILE A HG22 1  
ATOM 357    H HG23 . ILE A 1 24  ? -10.550 13.255  -17.243 1.00 1.46  ? 24  ILE A HG23 1  
ATOM 358    H HD11 . ILE A 1 24  ? -9.904  11.100  -14.574 1.00 1.20  ? 24  ILE A HD11 1  
ATOM 359    H HD12 . ILE A 1 24  ? -10.367 9.459   -14.122 1.00 1.33  ? 24  ILE A HD12 1  
ATOM 360    H HD13 . ILE A 1 24  ? -9.164  9.720   -15.384 1.00 1.33  ? 24  ILE A HD13 1  
ATOM 361    N N    . VAL A 1 25  ? -12.107 12.984  -19.633 1.00 0.95  ? 25  VAL A N    1  
ATOM 362    C CA   . VAL A 1 25  ? -11.759 13.899  -20.767 1.00 1.06  ? 25  VAL A CA   1  
ATOM 363    C C    . VAL A 1 25  ? -11.033 15.148  -20.254 1.00 1.02  ? 25  VAL A C    1  
ATOM 364    O O    . VAL A 1 25  ? -11.485 15.818  -19.348 1.00 1.02  ? 25  VAL A O    1  
ATOM 365    C CB   . VAL A 1 25  ? -13.048 14.333  -21.468 1.00 1.18  ? 25  VAL A CB   1  
ATOM 366    C CG1  . VAL A 1 25  ? -12.711 15.283  -22.617 1.00 1.28  ? 25  VAL A CG1  1  
ATOM 367    C CG2  . VAL A 1 25  ? -13.771 13.101  -22.021 1.00 1.27  ? 25  VAL A CG2  1  
ATOM 368    H H    . VAL A 1 25  ? -12.894 13.175  -19.080 1.00 0.94  ? 25  VAL A H    1  
ATOM 369    H HA   . VAL A 1 25  ? -11.127 13.384  -21.477 1.00 1.10  ? 25  VAL A HA   1  
ATOM 370    H HB   . VAL A 1 25  ? -13.688 14.839  -20.759 1.00 1.19  ? 25  VAL A HB   1  
ATOM 371    H HG11 . VAL A 1 25  ? -11.902 14.870  -23.202 1.00 1.70  ? 25  VAL A HG11 1  
ATOM 372    H HG12 . VAL A 1 25  ? -13.581 15.410  -23.246 1.00 1.57  ? 25  VAL A HG12 1  
ATOM 373    H HG13 . VAL A 1 25  ? -12.415 16.240  -22.217 1.00 1.67  ? 25  VAL A HG13 1  
ATOM 374    H HG21 . VAL A 1 25  ? -13.980 12.413  -21.215 1.00 1.69  ? 25  VAL A HG21 1  
ATOM 375    H HG22 . VAL A 1 25  ? -14.700 13.406  -22.483 1.00 1.58  ? 25  VAL A HG22 1  
ATOM 376    H HG23 . VAL A 1 25  ? -13.146 12.616  -22.756 1.00 1.64  ? 25  VAL A HG23 1  
ATOM 377    N N    . ILE A 1 26  ? -9.911  15.467  -20.851 1.00 1.03  ? 26  ILE A N    1  
ATOM 378    C CA   . ILE A 1 26  ? -9.128  16.678  -20.444 1.00 1.01  ? 26  ILE A CA   1  
ATOM 379    C C    . ILE A 1 26  ? -9.261  17.736  -21.541 1.00 1.09  ? 26  ILE A C    1  
ATOM 380    O O    . ILE A 1 26  ? -9.098  17.445  -22.708 1.00 1.21  ? 26  ILE A O    1  
ATOM 381    C CB   . ILE A 1 26  ? -7.656  16.305  -20.286 1.00 1.01  ? 26  ILE A CB   1  
ATOM 382    C CG1  . ILE A 1 26  ? -7.510  15.225  -19.213 1.00 0.97  ? 26  ILE A CG1  1  
ATOM 383    C CG2  . ILE A 1 26  ? -6.858  17.544  -19.873 1.00 1.01  ? 26  ILE A CG2  1  
ATOM 384    C CD1  . ILE A 1 26  ? -6.082  14.680  -19.235 1.00 1.00  ? 26  ILE A CD1  1  
ATOM 385    H H    . ILE A 1 26  ? -9.584  14.904  -21.584 1.00 1.06  ? 26  ILE A H    1  
ATOM 386    H HA   . ILE A 1 26  ? -9.506  17.073  -19.510 1.00 0.97  ? 26  ILE A HA   1  
ATOM 387    H HB   . ILE A 1 26  ? -7.278  15.933  -21.228 1.00 1.08  ? 26  ILE A HB   1  
ATOM 388    H HG12 . ILE A 1 26  ? -7.718  15.653  -18.243 1.00 0.94  ? 26  ILE A HG12 1  
ATOM 389    H HG13 . ILE A 1 26  ? -8.205  14.422  -19.410 1.00 1.04  ? 26  ILE A HG13 1  
ATOM 390    H HG21 . ILE A 1 26  ? -7.343  18.021  -19.034 1.00 1.49  ? 26  ILE A HG21 1  
ATOM 391    H HG22 . ILE A 1 26  ? -5.858  17.252  -19.593 1.00 1.50  ? 26  ILE A HG22 1  
ATOM 392    H HG23 . ILE A 1 26  ? -6.811  18.234  -20.702 1.00 1.30  ? 26  ILE A HG23 1  
ATOM 393    H HD11 . ILE A 1 26  ? -5.831  14.368  -20.238 1.00 1.37  ? 26  ILE A HD11 1  
ATOM 394    H HD12 . ILE A 1 26  ? -5.399  15.451  -18.915 1.00 1.39  ? 26  ILE A HD12 1  
ATOM 395    H HD13 . ILE A 1 26  ? -6.008  13.834  -18.567 1.00 1.54  ? 26  ILE A HD13 1  
ATOM 396    N N    . ASP A 1 27  ? -9.559  18.963  -21.191 1.00 1.05  ? 27  ASP A N    1  
ATOM 397    C CA   . ASP A 1 27  ? -9.700  20.017  -22.237 1.00 1.14  ? 27  ASP A CA   1  
ATOM 398    C C    . ASP A 1 27  ? -8.333  20.639  -22.522 1.00 1.08  ? 27  ASP A C    1  
ATOM 399    O O    . ASP A 1 27  ? -7.693  21.187  -21.646 1.00 0.99  ? 27  ASP A O    1  
ATOM 400    C CB   . ASP A 1 27  ? -10.650 21.106  -21.735 1.00 1.17  ? 27  ASP A CB   1  
ATOM 401    C CG   . ASP A 1 27  ? -12.074 20.554  -21.667 1.00 1.34  ? 27  ASP A CG   1  
ATOM 402    O OD1  . ASP A 1 27  ? -12.339 19.568  -22.335 1.00 1.81  ? 27  ASP A OD1  1  
ATOM 403    O OD2  . ASP A 1 27  ? -12.874 21.122  -20.944 1.00 1.76  ? 27  ASP A OD2  1  
ATOM 404    H H    . ASP A 1 27  ? -9.686  19.200  -20.248 1.00 0.98  ? 27  ASP A H    1  
ATOM 405    H HA   . ASP A 1 27  ? -10.097 19.583  -23.146 1.00 1.26  ? 27  ASP A HA   1  
ATOM 406    H HB2  . ASP A 1 27  ? -10.339 21.431  -20.752 1.00 1.06  ? 27  ASP A HB2  1  
ATOM 407    H HB3  . ASP A 1 27  ? -10.625 21.945  -22.415 1.00 1.26  ? 27  ASP A HB3  1  
ATOM 408    N N    . ARG A 1 28  ? -7.882  20.557  -23.742 1.00 1.17  ? 28  ARG A N    1  
ATOM 409    C CA   . ARG A 1 28  ? -6.558  21.139  -24.097 1.00 1.16  ? 28  ARG A CA   1  
ATOM 410    C C    . ARG A 1 28  ? -6.753  22.600  -24.505 1.00 1.16  ? 28  ARG A C    1  
ATOM 411    O O    . ARG A 1 28  ? -5.813  23.293  -24.840 1.00 1.22  ? 28  ARG A O    1  
ATOM 412    C CB   . ARG A 1 28  ? -5.957  20.363  -25.274 1.00 1.29  ? 28  ARG A CB   1  
ATOM 413    C CG   . ARG A 1 28  ? -5.872  18.869  -24.935 1.00 1.32  ? 28  ARG A CG   1  
ATOM 414    C CD   . ARG A 1 28  ? -4.818  18.630  -23.850 1.00 1.27  ? 28  ARG A CD   1  
ATOM 415    N NE   . ARG A 1 28  ? -4.503  17.176  -23.769 1.00 1.77  ? 28  ARG A NE   1  
ATOM 416    C CZ   . ARG A 1 28  ? -3.416  16.780  -23.164 1.00 2.03  ? 28  ARG A CZ   1  
ATOM 417    N NH1  . ARG A 1 28  ? -2.612  17.658  -22.629 1.00 2.23  ? 28  ARG A NH1  1  
ATOM 418    N NH2  . ARG A 1 28  ? -3.131  15.507  -23.097 1.00 2.80  ? 28  ARG A NH2  1  
ATOM 419    H H    . ARG A 1 28  ? -8.416  20.107  -24.427 1.00 1.26  ? 28  ARG A H    1  
ATOM 420    H HA   . ARG A 1 28  ? -5.892  21.094  -23.249 1.00 1.08  ? 28  ARG A HA   1  
ATOM 421    H HB2  . ARG A 1 28  ? -6.581  20.498  -26.145 1.00 1.38  ? 28  ARG A HB2  1  
ATOM 422    H HB3  . ARG A 1 28  ? -4.967  20.739  -25.484 1.00 1.31  ? 28  ARG A HB3  1  
ATOM 423    H HG2  . ARG A 1 28  ? -6.834  18.527  -24.582 1.00 1.31  ? 28  ARG A HG2  1  
ATOM 424    H HG3  . ARG A 1 28  ? -5.600  18.316  -25.823 1.00 1.44  ? 28  ARG A HG3  1  
ATOM 425    H HD2  . ARG A 1 28  ? -3.921  19.183  -24.087 1.00 1.39  ? 28  ARG A HD2  1  
ATOM 426    H HD3  . ARG A 1 28  ? -5.202  18.956  -22.897 1.00 1.48  ? 28  ARG A HD3  1  
ATOM 427    H HE   . ARG A 1 28  ? -5.110  16.519  -24.171 1.00 2.44  ? 28  ARG A HE   1  
ATOM 428    H HH11 . ARG A 1 28  ? -2.828  18.633  -22.683 1.00 2.10  ? 28  ARG A HH11 1  
ATOM 429    H HH12 . ARG A 1 28  ? -1.779  17.356  -22.166 1.00 2.94  ? 28  ARG A HH12 1  
ATOM 430    H HH21 . ARG A 1 28  ? -3.744  14.835  -23.511 1.00 3.22  ? 28  ARG A HH21 1  
ATOM 431    H HH22 . ARG A 1 28  ? -2.300  15.204  -22.630 1.00 3.23  ? 28  ARG A HH22 1  
ATOM 432    N N    . LYS A 1 29  ? -7.969  23.074  -24.477 1.00 1.14  ? 29  LYS A N    1  
ATOM 433    C CA   . LYS A 1 29  ? -8.227  24.491  -24.860 1.00 1.17  ? 29  LYS A CA   1  
ATOM 434    C C    . LYS A 1 29  ? -7.629  25.416  -23.801 1.00 1.03  ? 29  LYS A C    1  
ATOM 435    O O    . LYS A 1 29  ? -7.601  25.096  -22.629 1.00 0.96  ? 29  LYS A O    1  
ATOM 436    C CB   . LYS A 1 29  ? -9.735  24.728  -24.944 1.00 1.27  ? 29  LYS A CB   1  
ATOM 437    C CG   . LYS A 1 29  ? -10.305 23.985  -26.145 1.00 1.43  ? 29  LYS A CG   1  
ATOM 438    C CD   . LYS A 1 29  ? -11.812 24.232  -26.216 1.00 1.57  ? 29  LYS A CD   1  
ATOM 439    C CE   . LYS A 1 29  ? -12.383 23.485  -27.415 1.00 2.19  ? 29  LYS A CE   1  
ATOM 440    N NZ   . LYS A 1 29  ? -13.871 23.460  -27.325 1.00 2.87  ? 29  LYS A NZ   1  
ATOM 441    H H    . LYS A 1 29  ? -8.712  22.498  -24.203 1.00 1.12  ? 29  LYS A H    1  
ATOM 442    H HA   . LYS A 1 29  ? -7.774  24.696  -25.819 1.00 1.27  ? 29  LYS A HA   1  
ATOM 443    H HB2  . LYS A 1 29  ? -10.209 24.368  -24.045 1.00 1.23  ? 29  LYS A HB2  1  
ATOM 444    H HB3  . LYS A 1 29  ? -9.929  25.784  -25.055 1.00 1.31  ? 29  LYS A HB3  1  
ATOM 445    H HG2  . LYS A 1 29  ? -9.835  24.348  -27.049 1.00 1.49  ? 29  LYS A HG2  1  
ATOM 446    H HG3  . LYS A 1 29  ? -10.120 22.928  -26.039 1.00 1.46  ? 29  LYS A HG3  1  
ATOM 447    H HD2  . LYS A 1 29  ? -12.278 23.876  -25.309 1.00 1.95  ? 29  LYS A HD2  1  
ATOM 448    H HD3  . LYS A 1 29  ? -12.002 25.289  -26.329 1.00 1.63  ? 29  LYS A HD3  1  
ATOM 449    H HE2  . LYS A 1 29  ? -12.083 23.984  -28.322 1.00 2.56  ? 29  LYS A HE2  1  
ATOM 450    H HE3  . LYS A 1 29  ? -12.005 22.473  -27.418 1.00 2.66  ? 29  LYS A HE3  1  
ATOM 451    H HZ1  . LYS A 1 29  ? -14.184 24.094  -26.564 1.00 3.27  ? 29  LYS A HZ1  1  
ATOM 452    H HZ2  . LYS A 1 29  ? -14.276 23.775  -28.230 1.00 3.20  ? 29  LYS A HZ2  1  
ATOM 453    H HZ3  . LYS A 1 29  ? -14.189 22.492  -27.120 1.00 3.29  ? 29  LYS A HZ3  1  
ATOM 454    N N    . LYS A 1 30  ? -7.150  26.563  -24.201 1.00 1.01  ? 30  LYS A N    1  
ATOM 455    C CA   . LYS A 1 30  ? -6.553  27.510  -23.216 1.00 0.90  ? 30  LYS A CA   1  
ATOM 456    C C    . LYS A 1 30  ? -7.647  28.428  -22.669 1.00 0.88  ? 30  LYS A C    1  
ATOM 457    O O    . LYS A 1 30  ? -8.613  28.730  -23.341 1.00 0.95  ? 30  LYS A O    1  
ATOM 458    C CB   . LYS A 1 30  ? -5.479  28.346  -23.911 1.00 0.92  ? 30  LYS A CB   1  
ATOM 459    C CG   . LYS A 1 30  ? -4.303  27.441  -24.277 1.00 1.02  ? 30  LYS A CG   1  
ATOM 460    C CD   . LYS A 1 30  ? -3.218  28.263  -24.971 1.00 1.43  ? 30  LYS A CD   1  
ATOM 461    C CE   . LYS A 1 30  ? -2.044  27.353  -25.334 1.00 1.84  ? 30  LYS A CE   1  
ATOM 462    N NZ   . LYS A 1 30  ? -1.380  26.890  -24.082 1.00 2.35  ? 30  LYS A NZ   1  
ATOM 463    H H    . LYS A 1 30  ? -7.184  26.808  -25.148 1.00 1.08  ? 30  LYS A H    1  
ATOM 464    H HA   . LYS A 1 30  ? -6.106  26.958  -22.402 1.00 0.85  ? 30  LYS A HA   1  
ATOM 465    H HB2  . LYS A 1 30  ? -5.888  28.793  -24.805 1.00 0.99  ? 30  LYS A HB2  1  
ATOM 466    H HB3  . LYS A 1 30  ? -5.139  29.121  -23.240 1.00 0.86  ? 30  LYS A HB3  1  
ATOM 467    H HG2  . LYS A 1 30  ? -3.900  26.990  -23.380 1.00 1.22  ? 30  LYS A HG2  1  
ATOM 468    H HG3  . LYS A 1 30  ? -4.645  26.667  -24.946 1.00 1.37  ? 30  LYS A HG3  1  
ATOM 469    H HD2  . LYS A 1 30  ? -3.626  28.702  -25.871 1.00 1.90  ? 30  LYS A HD2  1  
ATOM 470    H HD3  . LYS A 1 30  ? -2.876  29.046  -24.311 1.00 2.00  ? 30  LYS A HD3  1  
ATOM 471    H HE2  . LYS A 1 30  ? -2.406  26.499  -25.889 1.00 2.34  ? 30  LYS A HE2  1  
ATOM 472    H HE3  . LYS A 1 30  ? -1.335  27.901  -25.938 1.00 2.30  ? 30  LYS A HE3  1  
ATOM 473    H HZ1  . LYS A 1 30  ? -1.867  27.300  -23.261 1.00 2.80  ? 30  LYS A HZ1  1  
ATOM 474    H HZ2  . LYS A 1 30  ? -1.423  25.853  -24.029 1.00 2.66  ? 30  LYS A HZ2  1  
ATOM 475    H HZ3  . LYS A 1 30  ? -0.387  27.199  -24.082 1.00 2.72  ? 30  LYS A HZ3  1  
ATOM 476    N N    . ILE A 1 31  ? -7.501  28.875  -21.451 1.00 0.84  ? 31  ILE A N    1  
ATOM 477    C CA   . ILE A 1 31  ? -8.527  29.774  -20.848 1.00 0.88  ? 31  ILE A CA   1  
ATOM 478    C C    . ILE A 1 31  ? -8.125  31.234  -21.060 1.00 0.85  ? 31  ILE A C    1  
ATOM 479    O O    . ILE A 1 31  ? -6.994  31.533  -21.387 1.00 0.78  ? 31  ILE A O    1  
ATOM 480    C CB   . ILE A 1 31  ? -8.635  29.498  -19.344 1.00 0.87  ? 31  ILE A CB   1  
ATOM 481    C CG1  . ILE A 1 31  ? -7.219  29.514  -18.706 1.00 0.75  ? 31  ILE A CG1  1  
ATOM 482    C CG2  . ILE A 1 31  ? -9.334  28.130  -19.110 1.00 0.97  ? 31  ILE A CG2  1  
ATOM 483    C CD1  . ILE A 1 31  ? -7.290  30.046  -17.266 1.00 0.79  ? 31  ILE A CD1  1  
ATOM 484    H H    . ILE A 1 31  ? -6.709  28.624  -20.928 1.00 0.82  ? 31  ILE A H    1  
ATOM 485    H HA   . ILE A 1 31  ? -9.488  29.597  -21.312 1.00 0.98  ? 31  ILE A HA   1  
ATOM 486    H HB   . ILE A 1 31  ? -9.230  30.272  -18.907 1.00 0.92  ? 31  ILE A HB   1  
ATOM 487    H HG12 . ILE A 1 31  ? -6.821  28.509  -18.690 1.00 0.74  ? 31  ILE A HG12 1  
ATOM 488    H HG13 . ILE A 1 31  ? -6.561  30.146  -19.283 1.00 0.70  ? 31  ILE A HG13 1  
ATOM 489    H HG21 . ILE A 1 31  ? -9.332  27.549  -20.024 1.00 1.43  ? 31  ILE A HG21 1  
ATOM 490    H HG22 . ILE A 1 31  ? -8.815  27.578  -18.339 1.00 1.43  ? 31  ILE A HG22 1  
ATOM 491    H HG23 . ILE A 1 31  ? -10.358 28.294  -18.800 1.00 1.39  ? 31  ILE A HG23 1  
ATOM 492    H HD11 . ILE A 1 31  ? -7.801  31.001  -17.256 1.00 1.33  ? 31  ILE A HD11 1  
ATOM 493    H HD12 . ILE A 1 31  ? -7.824  29.346  -16.646 1.00 1.34  ? 31  ILE A HD12 1  
ATOM 494    H HD13 . ILE A 1 31  ? -6.288  30.173  -16.881 1.00 1.20  ? 31  ILE A HD13 1  
ATOM 495    N N    . SER A 1 32  ? -9.034  32.153  -20.844 1.00 0.93  ? 32  SER A N    1  
ATOM 496    C CA   . SER A 1 32  ? -8.700  33.598  -20.999 1.00 0.94  ? 32  SER A CA   1  
ATOM 497    C C    . SER A 1 32  ? -8.384  34.167  -19.615 1.00 0.95  ? 32  SER A C    1  
ATOM 498    O O    . SER A 1 32  ? -8.587  33.516  -18.610 1.00 0.99  ? 32  SER A O    1  
ATOM 499    C CB   . SER A 1 32  ? -9.899  34.344  -21.592 1.00 1.06  ? 32  SER A CB   1  
ATOM 500    O OG   . SER A 1 32  ? -11.011 34.220  -20.713 1.00 1.17  ? 32  SER A OG   1  
ATOM 501    H H    . SER A 1 32  ? -9.932  31.908  -20.538 1.00 1.00  ? 32  SER A H    1  
ATOM 502    H HA   . SER A 1 32  ? -7.841  33.716  -21.648 1.00 0.89  ? 32  SER A HA   1  
ATOM 503    H HB2  . SER A 1 32  ? -9.656  35.387  -21.709 1.00 1.11  ? 32  SER A HB2  1  
ATOM 504    H HB3  . SER A 1 32  ? -10.142 33.923  -22.558 1.00 1.08  ? 32  SER A HB3  1  
ATOM 505    H HG   . SER A 1 32  ? -10.696 34.355  -19.816 1.00 1.54  ? 32  SER A HG   1  
ATOM 506    N N    . ALA A 1 33  ? -7.896  35.372  -19.545 1.00 0.96  ? 33  ALA A N    1  
ATOM 507    C CA   . ALA A 1 33  ? -7.582  35.951  -18.209 1.00 1.01  ? 33  ALA A CA   1  
ATOM 508    C C    . ALA A 1 33  ? -8.857  35.970  -17.364 1.00 1.11  ? 33  ALA A C    1  
ATOM 509    O O    . ALA A 1 33  ? -8.871  35.532  -16.236 1.00 1.18  ? 33  ALA A O    1  
ATOM 510    C CB   . ALA A 1 33  ? -7.056  37.377  -18.370 1.00 1.06  ? 33  ALA A CB   1  
ATOM 511    H H    . ALA A 1 33  ? -7.741  35.884  -20.366 1.00 0.96  ? 33  ALA A H    1  
ATOM 512    H HA   . ALA A 1 33  ? -6.835  35.345  -17.720 1.00 0.96  ? 33  ALA A HA   1  
ATOM 513    H HB1  . ALA A 1 33  ? -6.186  37.369  -19.007 1.00 1.60  ? 33  ALA A HB1  1  
ATOM 514    H HB2  . ALA A 1 33  ? -7.822  37.997  -18.810 1.00 1.35  ? 33  ALA A HB2  1  
ATOM 515    H HB3  . ALA A 1 33  ? -6.790  37.768  -17.398 1.00 1.46  ? 33  ALA A HB3  1  
ATOM 516    N N    . ASP A 1 34  ? -9.931  36.470  -17.897 1.00 1.18  ? 34  ASP A N    1  
ATOM 517    C CA   . ASP A 1 34  ? -11.195 36.505  -17.111 1.00 1.31  ? 34  ASP A CA   1  
ATOM 518    C C    . ASP A 1 34  ? -11.516 35.101  -16.597 1.00 1.26  ? 34  ASP A C    1  
ATOM 519    O O    . ASP A 1 34  ? -12.131 34.932  -15.562 1.00 1.36  ? 34  ASP A O    1  
ATOM 520    C CB   . ASP A 1 34  ? -12.340 36.978  -18.008 1.00 1.44  ? 34  ASP A CB   1  
ATOM 521    C CG   . ASP A 1 34  ? -12.158 38.460  -18.337 1.00 1.90  ? 34  ASP A CG   1  
ATOM 522    O OD1  . ASP A 1 34  ? -11.424 39.120  -17.619 1.00 2.56  ? 34  ASP A OD1  1  
ATOM 523    O OD2  . ASP A 1 34  ? -12.751 38.908  -19.303 1.00 2.39  ? 34  ASP A OD2  1  
ATOM 524    H H    . ASP A 1 34  ? -9.908  36.827  -18.809 1.00 1.17  ? 34  ASP A H    1  
ATOM 525    H HA   . ASP A 1 34  ? -11.086 37.182  -16.278 1.00 1.38  ? 34  ASP A HA   1  
ATOM 526    H HB2  . ASP A 1 34  ? -12.338 36.403  -18.924 1.00 1.64  ? 34  ASP A HB2  1  
ATOM 527    H HB3  . ASP A 1 34  ? -13.279 36.838  -17.496 1.00 1.89  ? 34  ASP A HB3  1  
ATOM 528    N N    . GLN A 1 35  ? -11.114 34.094  -17.320 1.00 1.14  ? 35  GLN A N    1  
ATOM 529    C CA   . GLN A 1 35  ? -11.397 32.698  -16.897 1.00 1.12  ? 35  GLN A CA   1  
ATOM 530    C C    . GLN A 1 35  ? -10.357 32.228  -15.877 1.00 1.03  ? 35  GLN A C    1  
ATOM 531    O O    . GLN A 1 35  ? -10.508 31.187  -15.270 1.00 1.01  ? 35  GLN A O    1  
ATOM 532    C CB   . GLN A 1 35  ? -11.351 31.793  -18.130 1.00 1.14  ? 35  GLN A CB   1  
ATOM 533    C CG   . GLN A 1 35  ? -12.663 31.892  -18.905 1.00 1.22  ? 35  GLN A CG   1  
ATOM 534    C CD   . GLN A 1 35  ? -12.492 31.243  -20.280 1.00 1.29  ? 35  GLN A CD   1  
ATOM 535    O OE1  . GLN A 1 35  ? -11.726 30.312  -20.433 1.00 1.70  ? 35  GLN A OE1  1  
ATOM 536    N NE2  . GLN A 1 35  ? -13.173 31.701  -21.294 1.00 1.79  ? 35  GLN A NE2  1  
ATOM 537    H H    . GLN A 1 35  ? -10.624 34.255  -18.148 1.00 1.09  ? 35  GLN A H    1  
ATOM 538    H HA   . GLN A 1 35  ? -12.379 32.650  -16.453 1.00 1.19  ? 35  GLN A HA   1  
ATOM 539    H HB2  . GLN A 1 35  ? -10.542 32.113  -18.769 1.00 1.27  ? 35  GLN A HB2  1  
ATOM 540    H HB3  . GLN A 1 35  ? -11.194 30.768  -17.827 1.00 1.27  ? 35  GLN A HB3  1  
ATOM 541    H HG2  . GLN A 1 35  ? -13.437 31.373  -18.358 1.00 1.39  ? 35  GLN A HG2  1  
ATOM 542    H HG3  . GLN A 1 35  ? -12.936 32.928  -19.027 1.00 1.49  ? 35  GLN A HG3  1  
ATOM 543    H HE21 . GLN A 1 35  ? -13.788 32.455  -21.172 1.00 2.36  ? 35  GLN A HE21 1  
ATOM 544    H HE22 . GLN A 1 35  ? -13.071 31.291  -22.179 1.00 1.94  ? 35  GLN A HE22 1  
ATOM 545    N N    . VAL A 1 36  ? -9.306  32.973  -15.675 1.00 1.00  ? 36  VAL A N    1  
ATOM 546    C CA   . VAL A 1 36  ? -8.286  32.532  -14.687 1.00 0.93  ? 36  VAL A CA   1  
ATOM 547    C C    . VAL A 1 36  ? -8.936  32.472  -13.306 1.00 0.97  ? 36  VAL A C    1  
ATOM 548    O O    . VAL A 1 36  ? -8.890  31.465  -12.628 1.00 0.92  ? 36  VAL A O    1  
ATOM 549    C CB   . VAL A 1 36  ? -7.114  33.532  -14.679 1.00 0.95  ? 36  VAL A CB   1  
ATOM 550    C CG1  . VAL A 1 36  ? -6.246  33.330  -13.434 1.00 0.96  ? 36  VAL A CG1  1  
ATOM 551    C CG2  . VAL A 1 36  ? -6.249  33.308  -15.923 1.00 0.92  ? 36  VAL A CG2  1  
ATOM 552    H H    . VAL A 1 36  ? -9.188  33.816  -16.161 1.00 1.05  ? 36  VAL A H    1  
ATOM 553    H HA   . VAL A 1 36  ? -7.924  31.553  -14.956 1.00 0.88  ? 36  VAL A HA   1  
ATOM 554    H HB   . VAL A 1 36  ? -7.495  34.543  -14.686 1.00 1.00  ? 36  VAL A HB   1  
ATOM 555    H HG11 . VAL A 1 36  ? -6.011  32.281  -13.325 1.00 1.33  ? 36  VAL A HG11 1  
ATOM 556    H HG12 . VAL A 1 36  ? -5.335  33.898  -13.546 1.00 1.22  ? 36  VAL A HG12 1  
ATOM 557    H HG13 . VAL A 1 36  ? -6.779  33.674  -12.559 1.00 1.43  ? 36  VAL A HG13 1  
ATOM 558    H HG21 . VAL A 1 36  ? -6.885  33.198  -16.789 1.00 1.36  ? 36  VAL A HG21 1  
ATOM 559    H HG22 . VAL A 1 36  ? -5.593  34.155  -16.062 1.00 1.38  ? 36  VAL A HG22 1  
ATOM 560    H HG23 . VAL A 1 36  ? -5.658  32.413  -15.797 1.00 1.31  ? 36  VAL A HG23 1  
ATOM 561    N N    . ASP A 1 37  ? -9.541  33.542  -12.890 1.00 1.08  ? 37  ASP A N    1  
ATOM 562    C CA   . ASP A 1 37  ? -10.194 33.555  -11.557 1.00 1.15  ? 37  ASP A CA   1  
ATOM 563    C C    . ASP A 1 37  ? -11.281 32.482  -11.506 1.00 1.12  ? 37  ASP A C    1  
ATOM 564    O O    . ASP A 1 37  ? -11.466 31.818  -10.507 1.00 1.11  ? 37  ASP A O    1  
ATOM 565    C CB   . ASP A 1 37  ? -10.822 34.929  -11.306 1.00 1.31  ? 37  ASP A CB   1  
ATOM 566    C CG   . ASP A 1 37  ? -9.721  35.973  -11.100 1.00 1.36  ? 37  ASP A CG   1  
ATOM 567    O OD1  . ASP A 1 37  ? -8.611  35.580  -10.780 1.00 1.73  ? 37  ASP A OD1  1  
ATOM 568    O OD2  . ASP A 1 37  ? -10.008 37.147  -11.266 1.00 1.77  ? 37  ASP A OD2  1  
ATOM 569    H H    . ASP A 1 37  ? -9.563  34.342  -13.455 1.00 1.14  ? 37  ASP A H    1  
ATOM 570    H HA   . ASP A 1 37  ? -9.458  33.353  -10.796 1.00 1.13  ? 37  ASP A HA   1  
ATOM 571    H HB2  . ASP A 1 37  ? -11.428 35.207  -12.157 1.00 1.36  ? 37  ASP A HB2  1  
ATOM 572    H HB3  . ASP A 1 37  ? -11.441 34.885  -10.423 1.00 1.39  ? 37  ASP A HB3  1  
ATOM 573    N N    . GLN A 1 38  ? -12.018 32.324  -12.569 1.00 1.13  ? 38  GLN A N    1  
ATOM 574    C CA   . GLN A 1 38  ? -13.113 31.311  -12.565 1.00 1.15  ? 38  GLN A CA   1  
ATOM 575    C C    . GLN A 1 38  ? -12.546 29.895  -12.441 1.00 1.04  ? 38  GLN A C    1  
ATOM 576    O O    . GLN A 1 38  ? -13.079 29.071  -11.726 1.00 1.06  ? 38  GLN A O    1  
ATOM 577    C CB   . GLN A 1 38  ? -13.895 31.416  -13.872 1.00 1.22  ? 38  GLN A CB   1  
ATOM 578    C CG   . GLN A 1 38  ? -14.654 32.743  -13.911 1.00 1.33  ? 38  GLN A CG   1  
ATOM 579    C CD   . GLN A 1 38  ? -15.230 32.956  -15.311 1.00 1.99  ? 38  GLN A CD   1  
ATOM 580    O OE1  . GLN A 1 38  ? -14.780 32.351  -16.264 1.00 2.56  ? 38  GLN A OE1  1  
ATOM 581    N NE2  . GLN A 1 38  ? -16.209 33.803  -15.478 1.00 2.70  ? 38  GLN A NE2  1  
ATOM 582    H H    . GLN A 1 38  ? -11.865 32.882  -13.363 1.00 1.14  ? 38  GLN A H    1  
ATOM 583    H HA   . GLN A 1 38  ? -13.772 31.503  -11.735 1.00 1.22  ? 38  GLN A HA   1  
ATOM 584    H HB2  . GLN A 1 38  ? -13.210 31.367  -14.704 1.00 1.18  ? 38  GLN A HB2  1  
ATOM 585    H HB3  . GLN A 1 38  ? -14.599 30.601  -13.936 1.00 1.26  ? 38  GLN A HB3  1  
ATOM 586    H HG2  . GLN A 1 38  ? -15.455 32.722  -13.187 1.00 1.73  ? 38  GLN A HG2  1  
ATOM 587    H HG3  . GLN A 1 38  ? -13.978 33.552  -13.675 1.00 1.31  ? 38  GLN A HG3  1  
ATOM 588    H HE21 . GLN A 1 38  ? -16.567 34.294  -14.710 1.00 2.93  ? 38  GLN A HE21 1  
ATOM 589    H HE22 . GLN A 1 38  ? -16.586 33.947  -16.371 1.00 3.32  ? 38  GLN A HE22 1  
ATOM 590    N N    . GLU A 1 39  ? -11.483 29.597  -13.133 1.00 0.96  ? 39  GLU A N    1  
ATOM 591    C CA   . GLU A 1 39  ? -10.914 28.222  -13.047 1.00 0.90  ? 39  GLU A CA   1  
ATOM 592    C C    . GLU A 1 39  ? -10.382 27.954  -11.646 1.00 0.84  ? 39  GLU A C    1  
ATOM 593    O O    . GLU A 1 39  ? -10.553 26.876  -11.113 1.00 0.81  ? 39  GLU A O    1  
ATOM 594    C CB   . GLU A 1 39  ? -9.798  28.051  -14.078 1.00 0.88  ? 39  GLU A CB   1  
ATOM 595    C CG   . GLU A 1 39  ? -10.413 27.950  -15.477 1.00 0.96  ? 39  GLU A CG   1  
ATOM 596    C CD   . GLU A 1 39  ? -11.152 26.616  -15.615 1.00 0.99  ? 39  GLU A CD   1  
ATOM 597    O OE1  . GLU A 1 39  ? -10.925 25.748  -14.789 1.00 1.51  ? 39  GLU A OE1  1  
ATOM 598    O OE2  . GLU A 1 39  ? -11.929 26.485  -16.546 1.00 1.44  ? 39  GLU A OE2  1  
ATOM 599    H H    . GLU A 1 39  ? -11.069 30.269  -13.713 1.00 0.97  ? 39  GLU A H    1  
ATOM 600    H HA   . GLU A 1 39  ? -11.695 27.509  -13.254 1.00 0.95  ? 39  GLU A HA   1  
ATOM 601    H HB2  . GLU A 1 39  ? -9.133  28.902  -14.036 1.00 0.91  ? 39  GLU A HB2  1  
ATOM 602    H HB3  . GLU A 1 39  ? -9.244  27.150  -13.865 1.00 0.84  ? 39  GLU A HB3  1  
ATOM 603    H HG2  . GLU A 1 39  ? -11.106 28.764  -15.627 1.00 1.07  ? 39  GLU A HG2  1  
ATOM 604    H HG3  . GLU A 1 39  ? -9.633  28.000  -16.214 1.00 0.98  ? 39  GLU A HG3  1  
ATOM 605    N N    . VAL A 1 40  ? -9.749  28.910  -11.026 1.00 0.86  ? 40  VAL A N    1  
ATOM 606    C CA   . VAL A 1 40  ? -9.240  28.661  -9.655  1.00 0.84  ? 40  VAL A CA   1  
ATOM 607    C C    . VAL A 1 40  ? -10.428 28.314  -8.751  1.00 0.87  ? 40  VAL A C    1  
ATOM 608    O O    . VAL A 1 40  ? -10.376 27.374  -7.982  1.00 0.84  ? 40  VAL A O    1  
ATOM 609    C CB   . VAL A 1 40  ? -8.521  29.915  -9.144  1.00 0.90  ? 40  VAL A CB   1  
ATOM 610    C CG1  . VAL A 1 40  ? -8.209  29.763  -7.653  1.00 0.93  ? 40  VAL A CG1  1  
ATOM 611    C CG2  . VAL A 1 40  ? -7.211  30.102  -9.925  1.00 0.87  ? 40  VAL A CG2  1  
ATOM 612    H H    . VAL A 1 40  ? -9.608  29.786  -11.444 1.00 0.89  ? 40  VAL A H    1  
ATOM 613    H HA   . VAL A 1 40  ? -8.550  27.830  -9.672  1.00 0.80  ? 40  VAL A HA   1  
ATOM 614    H HB   . VAL A 1 40  ? -9.157  30.778  -9.291  1.00 0.96  ? 40  VAL A HB   1  
ATOM 615    H HG11 . VAL A 1 40  ? -7.820  28.774  -7.468  1.00 1.41  ? 40  VAL A HG11 1  
ATOM 616    H HG12 . VAL A 1 40  ? -7.475  30.499  -7.360  1.00 1.40  ? 40  VAL A HG12 1  
ATOM 617    H HG13 . VAL A 1 40  ? -9.113  29.907  -7.079  1.00 1.29  ? 40  VAL A HG13 1  
ATOM 618    H HG21 . VAL A 1 40  ? -7.387  29.927  -10.977 1.00 1.41  ? 40  VAL A HG21 1  
ATOM 619    H HG22 . VAL A 1 40  ? -6.849  31.109  -9.785  1.00 1.22  ? 40  VAL A HG22 1  
ATOM 620    H HG23 . VAL A 1 40  ? -6.472  29.402  -9.565  1.00 1.37  ? 40  VAL A HG23 1  
ATOM 621    N N    . GLU A 1 41  ? -11.497 29.063  -8.828  1.00 0.95  ? 41  GLU A N    1  
ATOM 622    C CA   . GLU A 1 41  ? -12.670 28.763  -7.959  1.00 1.01  ? 41  GLU A CA   1  
ATOM 623    C C    . GLU A 1 41  ? -13.173 27.350  -8.263  1.00 0.96  ? 41  GLU A C    1  
ATOM 624    O O    . GLU A 1 41  ? -13.511 26.601  -7.369  1.00 0.95  ? 41  GLU A O    1  
ATOM 625    C CB   . GLU A 1 41  ? -13.783 29.782  -8.237  1.00 1.14  ? 41  GLU A CB   1  
ATOM 626    C CG   . GLU A 1 41  ? -14.985 29.519  -7.323  1.00 1.22  ? 41  GLU A CG   1  
ATOM 627    C CD   . GLU A 1 41  ? -14.581 29.744  -5.864  1.00 1.26  ? 41  GLU A CD   1  
ATOM 628    O OE1  . GLU A 1 41  ? -13.573 30.394  -5.642  1.00 1.53  ? 41  GLU A OE1  1  
ATOM 629    O OE2  . GLU A 1 41  ? -15.288 29.263  -4.994  1.00 1.81  ? 41  GLU A OE2  1  
ATOM 630    H H    . GLU A 1 41  ? -11.515 29.837  -9.436  1.00 0.99  ? 41  GLU A H    1  
ATOM 631    H HA   . GLU A 1 41  ? -12.378 28.819  -6.922  1.00 1.02  ? 41  GLU A HA   1  
ATOM 632    H HB2  . GLU A 1 41  ? -13.406 30.778  -8.055  1.00 1.17  ? 41  GLU A HB2  1  
ATOM 633    H HB3  . GLU A 1 41  ? -14.094 29.701  -9.268  1.00 1.15  ? 41  GLU A HB3  1  
ATOM 634    H HG2  . GLU A 1 41  ? -15.786 30.196  -7.583  1.00 1.31  ? 41  GLU A HG2  1  
ATOM 635    H HG3  . GLU A 1 41  ? -15.324 28.502  -7.447  1.00 1.19  ? 41  GLU A HG3  1  
ATOM 636    N N    . ARG A 1 42  ? -13.206 26.965  -9.506  1.00 0.96  ? 42  ARG A N    1  
ATOM 637    C CA   . ARG A 1 42  ? -13.666 25.587  -9.820  1.00 0.94  ? 42  ARG A CA   1  
ATOM 638    C C    . ARG A 1 42  ? -12.739 24.598  -9.121  1.00 0.84  ? 42  ARG A C    1  
ATOM 639    O O    . ARG A 1 42  ? -13.172 23.630  -8.530  1.00 0.83  ? 42  ARG A O    1  
ATOM 640    C CB   . ARG A 1 42  ? -13.627 25.356  -11.328 1.00 0.98  ? 42  ARG A CB   1  
ATOM 641    C CG   . ARG A 1 42  ? -14.721 26.191  -11.990 1.00 1.13  ? 42  ARG A CG   1  
ATOM 642    C CD   . ARG A 1 42  ? -14.690 25.966  -13.500 1.00 1.26  ? 42  ARG A CD   1  
ATOM 643    N NE   . ARG A 1 42  ? -15.102 24.566  -13.802 1.00 1.54  ? 42  ARG A NE   1  
ATOM 644    C CZ   . ARG A 1 42  ? -15.443 24.241  -15.017 1.00 1.98  ? 42  ARG A CZ   1  
ATOM 645    N NH1  . ARG A 1 42  ? -15.435 25.145  -15.954 1.00 2.34  ? 42  ARG A NH1  1  
ATOM 646    N NH2  . ARG A 1 42  ? -15.797 23.015  -15.295 1.00 2.78  ? 42  ARG A NH2  1  
ATOM 647    H H    . ARG A 1 42  ? -12.915 27.571  -10.218 1.00 0.98  ? 42  ARG A H    1  
ATOM 648    H HA   . ARG A 1 42  ? -14.674 25.453  -9.459  1.00 1.00  ? 42  ARG A HA   1  
ATOM 649    H HB2  . ARG A 1 42  ? -12.662 25.652  -11.714 1.00 0.95  ? 42  ARG A HB2  1  
ATOM 650    H HB3  . ARG A 1 42  ? -13.797 24.311  -11.538 1.00 0.99  ? 42  ARG A HB3  1  
ATOM 651    H HG2  . ARG A 1 42  ? -15.685 25.897  -11.599 1.00 1.18  ? 42  ARG A HG2  1  
ATOM 652    H HG3  . ARG A 1 42  ? -14.553 27.236  -11.781 1.00 1.18  ? 42  ARG A HG3  1  
ATOM 653    H HD2  . ARG A 1 42  ? -15.370 26.654  -13.980 1.00 1.67  ? 42  ARG A HD2  1  
ATOM 654    H HD3  . ARG A 1 42  ? -13.689 26.132  -13.867 1.00 1.70  ? 42  ARG A HD3  1  
ATOM 655    H HE   . ARG A 1 42  ? -15.114 23.892  -13.090 1.00 2.11  ? 42  ARG A HE   1  
ATOM 656    H HH11 . ARG A 1 42  ? -15.169 26.085  -15.738 1.00 2.38  ? 42  ARG A HH11 1  
ATOM 657    H HH12 . ARG A 1 42  ? -15.694 24.901  -16.888 1.00 3.00  ? 42  ARG A HH12 1  
ATOM 658    H HH21 . ARG A 1 42  ? -15.807 22.321  -14.576 1.00 3.20  ? 42  ARG A HH21 1  
ATOM 659    H HH22 . ARG A 1 42  ? -16.055 22.770  -16.229 1.00 3.26  ? 42  ARG A HH22 1  
ATOM 660    N N    . PHE A 1 43  ? -11.461 24.850  -9.170  1.00 0.78  ? 43  PHE A N    1  
ATOM 661    C CA   . PHE A 1 43  ? -10.499 23.941  -8.496  1.00 0.70  ? 43  PHE A CA   1  
ATOM 662    C C    . PHE A 1 43  ? -10.717 24.023  -6.989  1.00 0.69  ? 43  PHE A C    1  
ATOM 663    O O    . PHE A 1 43  ? -10.721 23.026  -6.294  1.00 0.68  ? 43  PHE A O    1  
ATOM 664    C CB   . PHE A 1 43  ? -9.069  24.364  -8.826  1.00 0.67  ? 43  PHE A CB   1  
ATOM 665    C CG   . PHE A 1 43  ? -8.107  23.412  -8.162  1.00 0.60  ? 43  PHE A CG   1  
ATOM 666    C CD1  . PHE A 1 43  ? -7.787  22.202  -8.787  1.00 0.59  ? 43  PHE A CD1  1  
ATOM 667    C CD2  . PHE A 1 43  ? -7.539  23.734  -6.923  1.00 0.67  ? 43  PHE A CD2  1  
ATOM 668    C CE1  . PHE A 1 43  ? -6.900  21.312  -8.174  1.00 0.59  ? 43  PHE A CE1  1  
ATOM 669    C CE2  . PHE A 1 43  ? -6.649  22.844  -6.311  1.00 0.69  ? 43  PHE A CE2  1  
ATOM 670    C CZ   . PHE A 1 43  ? -6.330  21.632  -6.936  1.00 0.63  ? 43  PHE A CZ   1  
ATOM 671    H H    . PHE A 1 43  ? -11.137 25.644  -9.642  1.00 0.80  ? 43  PHE A H    1  
ATOM 672    H HA   . PHE A 1 43  ? -10.664 22.927  -8.830  1.00 0.70  ? 43  PHE A HA   1  
ATOM 673    H HB2  . PHE A 1 43  ? -8.923  24.342  -9.894  1.00 0.70  ? 43  PHE A HB2  1  
ATOM 674    H HB3  . PHE A 1 43  ? -8.896  25.364  -8.459  1.00 0.72  ? 43  PHE A HB3  1  
ATOM 675    H HD1  . PHE A 1 43  ? -8.226  21.954  -9.743  1.00 0.66  ? 43  PHE A HD1  1  
ATOM 676    H HD2  . PHE A 1 43  ? -7.785  24.669  -6.442  1.00 0.77  ? 43  PHE A HD2  1  
ATOM 677    H HE1  . PHE A 1 43  ? -6.653  20.379  -8.657  1.00 0.65  ? 43  PHE A HE1  1  
ATOM 678    H HE2  . PHE A 1 43  ? -6.207  23.091  -5.358  1.00 0.81  ? 43  PHE A HE2  1  
ATOM 679    H HZ   . PHE A 1 43  ? -5.650  20.942  -6.460  1.00 0.69  ? 43  PHE A HZ   1  
ATOM 680    N N    . LEU A 1 44  ? -10.899 25.209  -6.476  1.00 0.75  ? 44  LEU A N    1  
ATOM 681    C CA   . LEU A 1 44  ? -11.122 25.353  -5.014  1.00 0.78  ? 44  LEU A CA   1  
ATOM 682    C C    . LEU A 1 44  ? -12.376 24.566  -4.641  1.00 0.81  ? 44  LEU A C    1  
ATOM 683    O O    . LEU A 1 44  ? -12.369 23.761  -3.731  1.00 0.79  ? 44  LEU A O    1  
ATOM 684    C CB   . LEU A 1 44  ? -11.313 26.837  -4.686  1.00 0.87  ? 44  LEU A CB   1  
ATOM 685    C CG   . LEU A 1 44  ? -11.549 27.039  -3.183  1.00 0.96  ? 44  LEU A CG   1  
ATOM 686    C CD1  . LEU A 1 44  ? -10.313 26.592  -2.384  1.00 1.07  ? 44  LEU A CD1  1  
ATOM 687    C CD2  . LEU A 1 44  ? -11.826 28.525  -2.922  1.00 1.07  ? 44  LEU A CD2  1  
ATOM 688    H H    . LEU A 1 44  ? -10.895 26.001  -7.054  1.00 0.79  ? 44  LEU A H    1  
ATOM 689    H HA   . LEU A 1 44  ? -10.271 24.963  -4.476  1.00 0.76  ? 44  LEU A HA   1  
ATOM 690    H HB2  . LEU A 1 44  ? -10.429 27.383  -4.984  1.00 0.86  ? 44  LEU A HB2  1  
ATOM 691    H HB3  . LEU A 1 44  ? -12.164 27.214  -5.233  1.00 0.93  ? 44  LEU A HB3  1  
ATOM 692    H HG   . LEU A 1 44  ? -12.403 26.456  -2.870  1.00 1.03  ? 44  LEU A HG   1  
ATOM 693    H HD11 . LEU A 1 44  ? -9.414  26.838  -2.934  1.00 1.44  ? 44  LEU A HD11 1  
ATOM 694    H HD12 . LEU A 1 44  ? -10.296 27.096  -1.428  1.00 1.49  ? 44  LEU A HD12 1  
ATOM 695    H HD13 . LEU A 1 44  ? -10.355 25.526  -2.223  1.00 1.59  ? 44  LEU A HD13 1  
ATOM 696    H HD21 . LEU A 1 44  ? -11.108 29.127  -3.459  1.00 1.49  ? 44  LEU A HD21 1  
ATOM 697    H HD22 . LEU A 1 44  ? -12.823 28.769  -3.257  1.00 1.59  ? 44  LEU A HD22 1  
ATOM 698    H HD23 . LEU A 1 44  ? -11.744 28.725  -1.864  1.00 1.42  ? 44  LEU A HD23 1  
ATOM 699    N N    . SER A 1 45  ? -13.454 24.785  -5.346  1.00 0.87  ? 45  SER A N    1  
ATOM 700    C CA   . SER A 1 45  ? -14.699 24.033  -5.029  1.00 0.92  ? 45  SER A CA   1  
ATOM 701    C C    . SER A 1 45  ? -14.456 22.544  -5.283  1.00 0.86  ? 45  SER A C    1  
ATOM 702    O O    . SER A 1 45  ? -14.835 21.701  -4.494  1.00 0.86  ? 45  SER A O    1  
ATOM 703    C CB   . SER A 1 45  ? -15.850 24.531  -5.903  1.00 1.03  ? 45  SER A CB   1  
ATOM 704    O OG   . SER A 1 45  ? -17.015 23.769  -5.620  1.00 1.12  ? 45  SER A OG   1  
ATOM 705    H H    . SER A 1 45  ? -13.436 25.447  -6.073  1.00 0.90  ? 45  SER A H    1  
ATOM 706    H HA   . SER A 1 45  ? -14.949 24.180  -3.988  1.00 0.95  ? 45  SER A HA   1  
ATOM 707    H HB2  . SER A 1 45  ? -16.044 25.566  -5.682  1.00 1.09  ? 45  SER A HB2  1  
ATOM 708    H HB3  . SER A 1 45  ? -15.582 24.429  -6.945  1.00 1.03  ? 45  SER A HB3  1  
ATOM 709    H HG   . SER A 1 45  ? -16.961 23.471  -4.708  1.00 1.38  ? 45  SER A HG   1  
ATOM 710    N N    . GLY A 1 46  ? -13.804 22.210  -6.366  1.00 0.84  ? 46  GLY A N    1  
ATOM 711    C CA   . GLY A 1 46  ? -13.521 20.773  -6.644  1.00 0.82  ? 46  GLY A CA   1  
ATOM 712    C C    . GLY A 1 46  ? -12.674 20.213  -5.500  1.00 0.74  ? 46  GLY A C    1  
ATOM 713    O O    . GLY A 1 46  ? -12.906 19.124  -5.014  1.00 0.74  ? 46  GLY A O    1  
ATOM 714    H H    . GLY A 1 46  ? -13.491 22.903  -6.983  1.00 0.86  ? 46  GLY A H    1  
ATOM 715    H HA2  . GLY A 1 46  ? -14.451 20.226  -6.712  1.00 0.87  ? 46  GLY A HA2  1  
ATOM 716    H HA3  . GLY A 1 46  ? -12.976 20.682  -7.570  1.00 0.83  ? 46  GLY A HA3  1  
ATOM 717    N N    . ARG A 1 47  ? -11.703 20.966  -5.057  1.00 0.70  ? 47  ARG A N    1  
ATOM 718    C CA   . ARG A 1 47  ? -10.844 20.503  -3.932  1.00 0.67  ? 47  ARG A CA   1  
ATOM 719    C C    . ARG A 1 47  ? -11.714 20.390  -2.684  1.00 0.68  ? 47  ARG A C    1  
ATOM 720    O O    . ARG A 1 47  ? -11.530 19.522  -1.853  1.00 0.67  ? 47  ARG A O    1  
ATOM 721    C CB   . ARG A 1 47  ? -9.729  21.521  -3.682  1.00 0.71  ? 47  ARG A CB   1  
ATOM 722    C CG   . ARG A 1 47  ? -8.681  20.914  -2.745  1.00 0.83  ? 47  ARG A CG   1  
ATOM 723    C CD   . ARG A 1 47  ? -7.568  21.937  -2.496  1.00 0.91  ? 47  ARG A CD   1  
ATOM 724    N NE   . ARG A 1 47  ? -6.344  21.241  -1.979  1.00 1.62  ? 47  ARG A NE   1  
ATOM 725    C CZ   . ARG A 1 47  ? -6.384  20.487  -0.913  1.00 2.11  ? 47  ARG A CZ   1  
ATOM 726    N NH1  . ARG A 1 47  ? -7.445  20.461  -0.155  1.00 2.26  ? 47  ARG A NH1  1  
ATOM 727    N NH2  . ARG A 1 47  ? -5.330  19.796  -0.574  1.00 3.09  ? 47  ARG A NH2  1  
ATOM 728    H H    . ARG A 1 47  ? -11.545 21.847  -5.457  1.00 0.73  ? 47  ARG A H    1  
ATOM 729    H HA   . ARG A 1 47  ? -10.415 19.540  -4.168  1.00 0.66  ? 47  ARG A HA   1  
ATOM 730    H HB2  . ARG A 1 47  ? -9.266  21.784  -4.622  1.00 0.77  ? 47  ARG A HB2  1  
ATOM 731    H HB3  . ARG A 1 47  ? -10.147 22.407  -3.225  1.00 0.73  ? 47  ARG A HB3  1  
ATOM 732    H HG2  . ARG A 1 47  ? -9.151  20.647  -1.812  1.00 0.92  ? 47  ARG A HG2  1  
ATOM 733    H HG3  . ARG A 1 47  ? -8.260  20.031  -3.202  1.00 0.99  ? 47  ARG A HG3  1  
ATOM 734    H HD2  . ARG A 1 47  ? -7.305  22.410  -3.421  1.00 1.27  ? 47  ARG A HD2  1  
ATOM 735    H HD3  . ARG A 1 47  ? -7.926  22.693  -1.801  1.00 1.32  ? 47  ARG A HD3  1  
ATOM 736    H HE   . ARG A 1 47  ? -5.506  21.313  -2.482  1.00 2.29  ? 47  ARG A HE   1  
ATOM 737    H HH11 . ARG A 1 47  ? -8.236  21.027  -0.381  1.00 2.05  ? 47  ARG A HH11 1  
ATOM 738    H HH12 . ARG A 1 47  ? -7.465  19.873  0.654   1.00 3.03  ? 47  ARG A HH12 1  
ATOM 739    H HH21 . ARG A 1 47  ? -4.499  19.847  -1.128  1.00 3.52  ? 47  ARG A HH21 1  
ATOM 740    H HH22 . ARG A 1 47  ? -5.352  19.218  0.241   1.00 3.62  ? 47  ARG A HH22 1  
ATOM 741    N N    . ALA A 1 48  ? -12.662 21.272  -2.555  1.00 0.73  ? 48  ALA A N    1  
ATOM 742    C CA   . ALA A 1 48  ? -13.557 21.240  -1.372  1.00 0.78  ? 48  ALA A CA   1  
ATOM 743    C C    . ALA A 1 48  ? -14.165 19.846  -1.254  1.00 0.76  ? 48  ALA A C    1  
ATOM 744    O O    . ALA A 1 48  ? -14.289 19.298  -0.174  1.00 0.77  ? 48  ALA A O    1  
ATOM 745    C CB   . ALA A 1 48  ? -14.668 22.284  -1.543  1.00 0.88  ? 48  ALA A CB   1  
ATOM 746    H H    . ALA A 1 48  ? -12.785 21.959  -3.241  1.00 0.75  ? 48  ALA A H    1  
ATOM 747    H HA   . ALA A 1 48  ? -12.988 21.460  -0.482  1.00 0.79  ? 48  ALA A HA   1  
ATOM 748    H HB1  . ALA A 1 48  ? -14.245 23.196  -1.942  1.00 1.30  ? 48  ALA A HB1  1  
ATOM 749    H HB2  . ALA A 1 48  ? -15.416 21.908  -2.226  1.00 1.34  ? 48  ALA A HB2  1  
ATOM 750    H HB3  . ALA A 1 48  ? -15.122 22.486  -0.586  1.00 1.43  ? 48  ALA A HB3  1  
ATOM 751    N N    . LYS A 1 49  ? -14.530 19.254  -2.358  1.00 0.78  ? 49  LYS A N    1  
ATOM 752    C CA   . LYS A 1 49  ? -15.113 17.892  -2.287  1.00 0.81  ? 49  LYS A CA   1  
ATOM 753    C C    . LYS A 1 49  ? -13.985 16.915  -1.953  1.00 0.71  ? 49  LYS A C    1  
ATOM 754    O O    . LYS A 1 49  ? -13.922 16.391  -0.859  1.00 0.68  ? 49  LYS A O    1  
ATOM 755    C CB   . LYS A 1 49  ? -15.726 17.537  -3.646  1.00 0.94  ? 49  LYS A CB   1  
ATOM 756    C CG   . LYS A 1 49  ? -16.187 16.075  -3.642  1.00 1.38  ? 49  LYS A CG   1  
ATOM 757    C CD   . LYS A 1 49  ? -17.175 15.838  -4.791  1.00 1.43  ? 49  LYS A CD   1  
ATOM 758    C CE   . LYS A 1 49  ? -16.456 15.996  -6.135  1.00 1.88  ? 49  LYS A CE   1  
ATOM 759    N NZ   . LYS A 1 49  ? -16.285 17.443  -6.443  1.00 2.59  ? 49  LYS A NZ   1  
ATOM 760    H H    . LYS A 1 49  ? -14.412 19.700  -3.220  1.00 0.81  ? 49  LYS A H    1  
ATOM 761    H HA   . LYS A 1 49  ? -15.868 17.855  -1.520  1.00 0.85  ? 49  LYS A HA   1  
ATOM 762    H HB2  . LYS A 1 49  ? -16.570 18.183  -3.835  1.00 1.52  ? 49  LYS A HB2  1  
ATOM 763    H HB3  . LYS A 1 49  ? -14.987 17.676  -4.420  1.00 1.54  ? 49  LYS A HB3  1  
ATOM 764    H HG2  . LYS A 1 49  ? -15.330 15.430  -3.762  1.00 1.99  ? 49  LYS A HG2  1  
ATOM 765    H HG3  . LYS A 1 49  ? -16.673 15.854  -2.702  1.00 1.99  ? 49  LYS A HG3  1  
ATOM 766    H HD2  . LYS A 1 49  ? -17.580 14.839  -4.713  1.00 1.83  ? 49  LYS A HD2  1  
ATOM 767    H HD3  . LYS A 1 49  ? -17.981 16.555  -4.730  1.00 1.76  ? 49  LYS A HD3  1  
ATOM 768    H HE2  . LYS A 1 49  ? -15.486 15.522  -6.086  1.00 2.30  ? 49  LYS A HE2  1  
ATOM 769    H HE3  . LYS A 1 49  ? -17.042 15.529  -6.913  1.00 2.32  ? 49  LYS A HE3  1  
ATOM 770    H HZ1  . LYS A 1 49  ? -16.851 18.009  -5.782  1.00 2.94  ? 49  LYS A HZ1  1  
ATOM 771    H HZ2  . LYS A 1 49  ? -15.280 17.701  -6.351  1.00 2.93  ? 49  LYS A HZ2  1  
ATOM 772    H HZ3  . LYS A 1 49  ? -16.603 17.630  -7.416  1.00 3.08  ? 49  LYS A HZ3  1  
ATOM 773    N N    . ALA A 1 50  ? -13.122 16.628  -2.897  1.00 0.70  ? 50  ALA A N    1  
ATOM 774    C CA   . ALA A 1 50  ? -12.020 15.644  -2.661  1.00 0.66  ? 50  ALA A CA   1  
ATOM 775    C C    . ALA A 1 50  ? -11.458 15.739  -1.240  1.00 0.55  ? 50  ALA A C    1  
ATOM 776    O O    . ALA A 1 50  ? -11.181 14.735  -0.616  1.00 0.55  ? 50  ALA A O    1  
ATOM 777    C CB   . ALA A 1 50  ? -10.891 15.916  -3.663  1.00 0.69  ? 50  ALA A CB   1  
ATOM 778    H H    . ALA A 1 50  ? -13.236 16.970  -3.807  1.00 0.75  ? 50  ALA A H    1  
ATOM 779    H HA   . ALA A 1 50  ? -12.395 14.650  -2.830  1.00 0.71  ? 50  ALA A HA   1  
ATOM 780    H HB1  . ALA A 1 50  ? -11.315 16.166  -4.622  1.00 1.15  ? 50  ALA A HB1  1  
ATOM 781    H HB2  . ALA A 1 50  ? -10.285 16.742  -3.314  1.00 1.20  ? 50  ALA A HB2  1  
ATOM 782    H HB3  . ALA A 1 50  ? -10.275 15.035  -3.760  1.00 1.33  ? 50  ALA A HB3  1  
ATOM 783    N N    . SER A 1 51  ? -11.281 16.917  -0.713  1.00 0.52  ? 51  SER A N    1  
ATOM 784    C CA   . SER A 1 51  ? -10.729 17.006  0.667   1.00 0.48  ? 51  SER A CA   1  
ATOM 785    C C    . SER A 1 51  ? -11.647 16.235  1.616   1.00 0.48  ? 51  SER A C    1  
ATOM 786    O O    . SER A 1 51  ? -11.218 15.352  2.332   1.00 0.47  ? 51  SER A O    1  
ATOM 787    C CB   . SER A 1 51  ? -10.658 18.471  1.100   1.00 0.55  ? 51  SER A CB   1  
ATOM 788    O OG   . SER A 1 51  ? -11.975 18.967  1.301   1.00 1.40  ? 51  SER A OG   1  
ATOM 789    H H    . SER A 1 51  ? -11.500 17.727  -1.217  1.00 0.56  ? 51  SER A H    1  
ATOM 790    H HA   . SER A 1 51  ? -9.741  16.573  0.689   1.00 0.48  ? 51  SER A HA   1  
ATOM 791    H HB2  . SER A 1 51  ? -10.105 18.549  2.022   1.00 1.03  ? 51  SER A HB2  1  
ATOM 792    H HB3  . SER A 1 51  ? -10.158 19.048  0.334   1.00 1.18  ? 51  SER A HB3  1  
ATOM 793    H HG   . SER A 1 51  ? -12.282 19.342  0.472   1.00 1.85  ? 51  SER A HG   1  
ATOM 794    N N    . ALA A 1 52  ? -12.906 16.568  1.628   1.00 0.53  ? 52  ALA A N    1  
ATOM 795    C CA   . ALA A 1 52  ? -13.862 15.864  2.534   1.00 0.57  ? 52  ALA A CA   1  
ATOM 796    C C    . ALA A 1 52  ? -13.979 14.379  2.158   1.00 0.58  ? 52  ALA A C    1  
ATOM 797    O O    . ALA A 1 52  ? -14.059 13.521  3.014   1.00 0.61  ? 52  ALA A O    1  
ATOM 798    C CB   . ALA A 1 52  ? -15.240 16.520  2.420   1.00 0.67  ? 52  ALA A CB   1  
ATOM 799    H H    . ALA A 1 52  ? -13.219 17.300  1.053   1.00 0.57  ? 52  ALA A H    1  
ATOM 800    H HA   . ALA A 1 52  ? -13.513 15.945  3.553   1.00 0.57  ? 52  ALA A HA   1  
ATOM 801    H HB1  . ALA A 1 52  ? -15.157 17.574  2.638   1.00 1.14  ? 52  ALA A HB1  1  
ATOM 802    H HB2  . ALA A 1 52  ? -15.618 16.388  1.417   1.00 1.35  ? 52  ALA A HB2  1  
ATOM 803    H HB3  . ALA A 1 52  ? -15.918 16.059  3.124   1.00 1.21  ? 52  ALA A HB3  1  
ATOM 804    N N    . GLN A 1 53  ? -14.004 14.068  0.889   1.00 0.62  ? 53  GLN A N    1  
ATOM 805    C CA   . GLN A 1 53  ? -14.132 12.634  0.481   1.00 0.68  ? 53  GLN A CA   1  
ATOM 806    C C    . GLN A 1 53  ? -12.935 11.821  0.980   1.00 0.62  ? 53  GLN A C    1  
ATOM 807    O O    . GLN A 1 53  ? -13.088 10.743  1.514   1.00 0.63  ? 53  GLN A O    1  
ATOM 808    C CB   . GLN A 1 53  ? -14.207 12.525  -1.043  1.00 0.78  ? 53  GLN A CB   1  
ATOM 809    C CG   . GLN A 1 53  ? -15.544 13.083  -1.535  1.00 0.87  ? 53  GLN A CG   1  
ATOM 810    C CD   . GLN A 1 53  ? -15.641 12.932  -3.057  1.00 1.01  ? 53  GLN A CD   1  
ATOM 811    O OE1  . GLN A 1 53  ? -16.725 12.858  -3.601  1.00 1.41  ? 53  GLN A OE1  1  
ATOM 812    N NE2  . GLN A 1 53  ? -14.550 12.898  -3.774  1.00 1.66  ? 53  GLN A NE2  1  
ATOM 813    H H    . GLN A 1 53  ? -13.941 14.778  0.216   1.00 0.65  ? 53  GLN A H    1  
ATOM 814    H HA   . GLN A 1 53  ? -15.037 12.227  0.908   1.00 0.74  ? 53  GLN A HA   1  
ATOM 815    H HB2  . GLN A 1 53  ? -13.400 13.090  -1.476  1.00 0.74  ? 53  GLN A HB2  1  
ATOM 816    H HB3  . GLN A 1 53  ? -14.119 11.490  -1.335  1.00 0.84  ? 53  GLN A HB3  1  
ATOM 817    H HG2  . GLN A 1 53  ? -16.354 12.541  -1.066  1.00 0.94  ? 53  GLN A HG2  1  
ATOM 818    H HG3  . GLN A 1 53  ? -15.614 14.129  -1.275  1.00 0.84  ? 53  GLN A HG3  1  
ATOM 819    H HE21 . GLN A 1 53  ? -13.674 12.971  -3.340  1.00 2.34  ? 53  GLN A HE21 1  
ATOM 820    H HE22 . GLN A 1 53  ? -14.608 12.797  -4.748  1.00 1.73  ? 53  GLN A HE22 1  
ATOM 821    N N    . LEU A 1 54  ? -11.745 12.323  0.804   1.00 0.58  ? 54  LEU A N    1  
ATOM 822    C CA   . LEU A 1 54  ? -10.543 11.566  1.260   1.00 0.55  ? 54  LEU A CA   1  
ATOM 823    C C    . LEU A 1 54  ? -10.608 11.374  2.773   1.00 0.50  ? 54  LEU A C    1  
ATOM 824    O O    . LEU A 1 54  ? -10.280 10.326  3.292   1.00 0.59  ? 54  LEU A O    1  
ATOM 825    C CB   . LEU A 1 54  ? -9.282  12.360  0.909   1.00 0.54  ? 54  LEU A CB   1  
ATOM 826    C CG   . LEU A 1 54  ? -9.096  12.422  -0.616  1.00 0.76  ? 54  LEU A CG   1  
ATOM 827    C CD1  . LEU A 1 54  ? -8.000  13.440  -0.940  1.00 1.58  ? 54  LEU A CD1  1  
ATOM 828    C CD2  . LEU A 1 54  ? -8.686  11.043  -1.169  1.00 1.13  ? 54  LEU A CD2  1  
ATOM 829    H H    . LEU A 1 54  ? -11.640 13.191  0.364   1.00 0.60  ? 54  LEU A H    1  
ATOM 830    H HA   . LEU A 1 54  ? -10.515 10.603  0.781   1.00 0.61  ? 54  LEU A HA   1  
ATOM 831    H HB2  . LEU A 1 54  ? -9.377  13.363  1.297   1.00 0.53  ? 54  LEU A HB2  1  
ATOM 832    H HB3  . LEU A 1 54  ? -8.423  11.885  1.358   1.00 0.57  ? 54  LEU A HB3  1  
ATOM 833    H HG   . LEU A 1 54  ? -10.024 12.735  -1.076  1.00 1.56  ? 54  LEU A HG   1  
ATOM 834    H HD11 . LEU A 1 54  ? -8.241  14.386  -0.480  1.00 2.13  ? 54  LEU A HD11 1  
ATOM 835    H HD12 . LEU A 1 54  ? -7.055  13.084  -0.557  1.00 2.20  ? 54  LEU A HD12 1  
ATOM 836    H HD13 . LEU A 1 54  ? -7.931  13.567  -2.010  1.00 1.98  ? 54  LEU A HD13 1  
ATOM 837    H HD21 . LEU A 1 54  ? -7.997  10.566  -0.488  1.00 1.63  ? 54  LEU A HD21 1  
ATOM 838    H HD22 . LEU A 1 54  ? -9.561  10.425  -1.288  1.00 1.83  ? 54  LEU A HD22 1  
ATOM 839    H HD23 . LEU A 1 54  ? -8.210  11.167  -2.131  1.00 1.65  ? 54  LEU A HD23 1  
ATOM 840    N N    . GLU A 1 55  ? -11.033 12.376  3.484   1.00 0.45  ? 55  GLU A N    1  
ATOM 841    C CA   . GLU A 1 55  ? -11.123 12.252  4.962   1.00 0.45  ? 55  GLU A CA   1  
ATOM 842    C C    . GLU A 1 55  ? -12.131 11.160  5.325   1.00 0.49  ? 55  GLU A C    1  
ATOM 843    O O    . GLU A 1 55  ? -11.932 10.400  6.250   1.00 0.50  ? 55  GLU A O    1  
ATOM 844    C CB   . GLU A 1 55  ? -11.574 13.585  5.554   1.00 0.46  ? 55  GLU A CB   1  
ATOM 845    C CG   . GLU A 1 55  ? -10.453 14.618  5.416   1.00 0.48  ? 55  GLU A CG   1  
ATOM 846    C CD   . GLU A 1 55  ? -9.317  14.270  6.383   1.00 0.56  ? 55  GLU A CD   1  
ATOM 847    O OE1  . GLU A 1 55  ? -9.540  13.444  7.253   1.00 1.09  ? 55  GLU A OE1  1  
ATOM 848    O OE2  . GLU A 1 55  ? -8.246  14.835  6.237   1.00 1.35  ? 55  GLU A OE2  1  
ATOM 849    H H    . GLU A 1 55  ? -11.297 13.214  3.045   1.00 0.49  ? 55  GLU A H    1  
ATOM 850    H HA   . GLU A 1 55  ? -10.156 11.990  5.358   1.00 0.46  ? 55  GLU A HA   1  
ATOM 851    H HB2  . GLU A 1 55  ? -12.448 13.934  5.028   1.00 0.47  ? 55  GLU A HB2  1  
ATOM 852    H HB3  . GLU A 1 55  ? -11.808 13.452  6.598   1.00 0.50  ? 55  GLU A HB3  1  
ATOM 853    H HG2  . GLU A 1 55  ? -10.078 14.608  4.403   1.00 0.47  ? 55  GLU A HG2  1  
ATOM 854    H HG3  . GLU A 1 55  ? -10.835 15.600  5.651   1.00 0.51  ? 55  GLU A HG3  1  
ATOM 855    N N    . THR A 1 56  ? -13.224 11.087  4.619   1.00 0.53  ? 56  THR A N    1  
ATOM 856    C CA   . THR A 1 56  ? -14.246 10.053  4.943   1.00 0.59  ? 56  THR A CA   1  
ATOM 857    C C    . THR A 1 56  ? -13.679 8.653   4.674   1.00 0.57  ? 56  THR A C    1  
ATOM 858    O O    . THR A 1 56  ? -13.879 7.736   5.447   1.00 0.61  ? 56  THR A O    1  
ATOM 859    C CB   . THR A 1 56  ? -15.490 10.282  4.084   1.00 0.67  ? 56  THR A CB   1  
ATOM 860    O OG1  . THR A 1 56  ? -16.001 11.582  4.337   1.00 0.70  ? 56  THR A OG1  1  
ATOM 861    C CG2  . THR A 1 56  ? -16.550 9.246   4.448   1.00 0.77  ? 56  THR A CG2  1  
ATOM 862    H H    . THR A 1 56  ? -13.376 11.718  3.885   1.00 0.54  ? 56  THR A H    1  
ATOM 863    H HA   . THR A 1 56  ? -14.514 10.134  5.985   1.00 0.62  ? 56  THR A HA   1  
ATOM 864    H HB   . THR A 1 56  ? -15.237 10.186  3.040   1.00 0.66  ? 56  THR A HB   1  
ATOM 865    H HG1  . THR A 1 56  ? -16.341 11.933  3.511   1.00 1.14  ? 56  THR A HG1  1  
ATOM 866    H HG21 . THR A 1 56  ? -16.662 9.212   5.522   1.00 1.19  ? 56  THR A HG21 1  
ATOM 867    H HG22 . THR A 1 56  ? -17.493 9.521   3.998   1.00 1.33  ? 56  THR A HG22 1  
ATOM 868    H HG23 . THR A 1 56  ? -16.246 8.277   4.086   1.00 1.34  ? 56  THR A HG23 1  
ATOM 869    N N    . ILE A 1 57  ? -12.966 8.481   3.592   1.00 0.55  ? 57  ILE A N    1  
ATOM 870    C CA   . ILE A 1 57  ? -12.381 7.141   3.286   1.00 0.56  ? 57  ILE A CA   1  
ATOM 871    C C    . ILE A 1 57  ? -11.412 6.759   4.406   1.00 0.53  ? 57  ILE A C    1  
ATOM 872    O O    . ILE A 1 57  ? -11.346 5.621   4.826   1.00 0.57  ? 57  ILE A O    1  
ATOM 873    C CB   . ILE A 1 57  ? -11.626 7.179   1.950   1.00 0.56  ? 57  ILE A CB   1  
ATOM 874    C CG1  . ILE A 1 57  ? -12.591 7.556   0.820   1.00 0.59  ? 57  ILE A CG1  1  
ATOM 875    C CG2  . ILE A 1 57  ? -11.038 5.796   1.661   1.00 0.62  ? 57  ILE A CG2  1  
ATOM 876    C CD1  . ILE A 1 57  ? -11.811 7.839   -0.472  1.00 0.63  ? 57  ILE A CD1  1  
ATOM 877    H H    . ILE A 1 57  ? -12.812 9.233   2.985   1.00 0.55  ? 57  ILE A H    1  
ATOM 878    H HA   . ILE A 1 57  ? -13.173 6.407   3.234   1.00 0.60  ? 57  ILE A HA   1  
ATOM 879    H HB   . ILE A 1 57  ? -10.829 7.906   2.006   1.00 0.55  ? 57  ILE A HB   1  
ATOM 880    H HG12 . ILE A 1 57  ? -13.277 6.739   0.649   1.00 0.64  ? 57  ILE A HG12 1  
ATOM 881    H HG13 . ILE A 1 57  ? -13.145 8.436   1.101   1.00 0.60  ? 57  ILE A HG13 1  
ATOM 882    H HG21 . ILE A 1 57  ? -11.828 5.059   1.678   1.00 1.19  ? 57  ILE A HG21 1  
ATOM 883    H HG22 . ILE A 1 57  ? -10.571 5.800   0.686   1.00 1.15  ? 57  ILE A HG22 1  
ATOM 884    H HG23 . ILE A 1 57  ? -10.305 5.552   2.410   1.00 1.26  ? 57  ILE A HG23 1  
ATOM 885    H HD11 . ILE A 1 57  ? -10.968 7.169   -0.546  1.00 1.16  ? 57  ILE A HD11 1  
ATOM 886    H HD12 . ILE A 1 57  ? -12.461 7.689   -1.321  1.00 1.19  ? 57  ILE A HD12 1  
ATOM 887    H HD13 . ILE A 1 57  ? -11.461 8.861   -0.465  1.00 1.22  ? 57  ILE A HD13 1  
ATOM 888    N N    . LYS A 1 58  ? -10.654 7.706   4.884   1.00 0.50  ? 58  LYS A N    1  
ATOM 889    C CA   . LYS A 1 58  ? -9.676  7.420   5.970   1.00 0.51  ? 58  LYS A CA   1  
ATOM 890    C C    . LYS A 1 58  ? -10.397 6.791   7.163   1.00 0.54  ? 58  LYS A C    1  
ATOM 891    O O    . LYS A 1 58  ? -9.976  5.787   7.702   1.00 0.55  ? 58  LYS A O    1  
ATOM 892    C CB   . LYS A 1 58  ? -9.075  8.762   6.407   1.00 0.52  ? 58  LYS A CB   1  
ATOM 893    C CG   . LYS A 1 58  ? -8.091  8.578   7.570   1.00 0.55  ? 58  LYS A CG   1  
ATOM 894    C CD   . LYS A 1 58  ? -7.615  9.953   8.064   1.00 0.62  ? 58  LYS A CD   1  
ATOM 895    C CE   . LYS A 1 58  ? -8.761  10.690  8.784   1.00 0.70  ? 58  LYS A CE   1  
ATOM 896    N NZ   . LYS A 1 58  ? -8.184  11.692  9.725   1.00 1.14  ? 58  LYS A NZ   1  
ATOM 897    H H    . LYS A 1 58  ? -10.718 8.618   4.530   1.00 0.51  ? 58  LYS A H    1  
ATOM 898    H HA   . LYS A 1 58  ? -8.897  6.765   5.613   1.00 0.51  ? 58  LYS A HA   1  
ATOM 899    H HB2  . LYS A 1 58  ? -8.557  9.208   5.570   1.00 0.52  ? 58  LYS A HB2  1  
ATOM 900    H HB3  . LYS A 1 58  ? -9.872  9.414   6.716   1.00 0.54  ? 58  LYS A HB3  1  
ATOM 901    H HG2  . LYS A 1 58  ? -8.576  8.060   8.378   1.00 0.57  ? 58  LYS A HG2  1  
ATOM 902    H HG3  . LYS A 1 58  ? -7.241  8.008   7.236   1.00 0.55  ? 58  LYS A HG3  1  
ATOM 903    H HD2  . LYS A 1 58  ? -6.790  9.819   8.751   1.00 0.62  ? 58  LYS A HD2  1  
ATOM 904    H HD3  . LYS A 1 58  ? -7.284  10.542  7.222   1.00 0.66  ? 58  LYS A HD3  1  
ATOM 905    H HE2  . LYS A 1 58  ? -9.374  11.203  8.058   1.00 1.02  ? 58  LYS A HE2  1  
ATOM 906    H HE3  . LYS A 1 58  ? -9.370  9.987   9.339   1.00 1.09  ? 58  LYS A HE3  1  
ATOM 907    H HZ1  . LYS A 1 58  ? -7.174  11.489  9.869   1.00 1.59  ? 58  LYS A HZ1  1  
ATOM 908    H HZ2  . LYS A 1 58  ? -8.294  12.645  9.326   1.00 1.70  ? 58  LYS A HZ2  1  
ATOM 909    H HZ3  . LYS A 1 58  ? -8.684  11.639  10.635  1.00 1.60  ? 58  LYS A HZ3  1  
ATOM 910    N N    . THR A 1 59  ? -11.453 7.405   7.608   1.00 0.58  ? 59  THR A N    1  
ATOM 911    C CA   . THR A 1 59  ? -12.178 6.883   8.799   1.00 0.64  ? 59  THR A CA   1  
ATOM 912    C C    . THR A 1 59  ? -12.658 5.446   8.542   1.00 0.63  ? 59  THR A C    1  
ATOM 913    O O    . THR A 1 59  ? -12.627 4.609   9.422   1.00 0.65  ? 59  THR A O    1  
ATOM 914    C CB   . THR A 1 59  ? -13.375 7.800   9.089   1.00 0.71  ? 59  THR A CB   1  
ATOM 915    O OG1  . THR A 1 59  ? -12.995 9.148   8.850   1.00 0.73  ? 59  THR A OG1  1  
ATOM 916    C CG2  . THR A 1 59  ? -13.791 7.665   10.555  1.00 0.79  ? 59  THR A CG2  1  
ATOM 917    H H    . THR A 1 59  ? -11.741 8.244   7.191   1.00 0.59  ? 59  THR A H    1  
ATOM 918    H HA   . THR A 1 59  ? -11.509 6.888   9.646   1.00 0.66  ? 59  THR A HA   1  
ATOM 919    H HB   . THR A 1 59  ? -14.206 7.535   8.453   1.00 0.72  ? 59  THR A HB   1  
ATOM 920    H HG1  . THR A 1 59  ? -13.395 9.426   8.022   1.00 1.15  ? 59  THR A HG1  1  
ATOM 921    H HG21 . THR A 1 59  ? -13.732 6.629   10.856  1.00 1.35  ? 59  THR A HG21 1  
ATOM 922    H HG22 . THR A 1 59  ? -13.125 8.258   11.168  1.00 1.10  ? 59  THR A HG22 1  
ATOM 923    H HG23 . THR A 1 59  ? -14.803 8.020   10.676  1.00 1.35  ? 59  THR A HG23 1  
ATOM 924    N N    . LYS A 1 60  ? -13.083 5.149   7.345   1.00 0.60  ? 60  LYS A N    1  
ATOM 925    C CA   . LYS A 1 60  ? -13.546 3.763   7.034   1.00 0.61  ? 60  LYS A CA   1  
ATOM 926    C C    . LYS A 1 60  ? -12.394 2.790   7.230   1.00 0.58  ? 60  LYS A C    1  
ATOM 927    O O    . LYS A 1 60  ? -12.565 1.685   7.707   1.00 0.62  ? 60  LYS A O    1  
ATOM 928    C CB   . LYS A 1 60  ? -14.018 3.673   5.579   1.00 0.61  ? 60  LYS A CB   1  
ATOM 929    C CG   . LYS A 1 60  ? -15.325 4.450   5.405   1.00 0.65  ? 60  LYS A CG   1  
ATOM 930    C CD   . LYS A 1 60  ? -15.782 4.349   3.945   1.00 0.68  ? 60  LYS A CD   1  
ATOM 931    C CE   . LYS A 1 60  ? -17.097 5.120   3.747   1.00 1.06  ? 60  LYS A CE   1  
ATOM 932    N NZ   . LYS A 1 60  ? -18.247 4.242   4.104   1.00 1.53  ? 60  LYS A NZ   1  
ATOM 933    H H    . LYS A 1 60  ? -13.079 5.831   6.648   1.00 0.59  ? 60  LYS A H    1  
ATOM 934    H HA   . LYS A 1 60  ? -14.358 3.500   7.693   1.00 0.65  ? 60  LYS A HA   1  
ATOM 935    H HB2  . LYS A 1 60  ? -13.259 4.088   4.929   1.00 0.59  ? 60  LYS A HB2  1  
ATOM 936    H HB3  . LYS A 1 60  ? -14.179 2.637   5.321   1.00 0.64  ? 60  LYS A HB3  1  
ATOM 937    H HG2  . LYS A 1 60  ? -16.082 4.029   6.050   1.00 0.69  ? 60  LYS A HG2  1  
ATOM 938    H HG3  . LYS A 1 60  ? -15.167 5.486   5.661   1.00 0.64  ? 60  LYS A HG3  1  
ATOM 939    H HD2  . LYS A 1 60  ? -15.020 4.767   3.304   1.00 0.79  ? 60  LYS A HD2  1  
ATOM 940    H HD3  . LYS A 1 60  ? -15.936 3.311   3.687   1.00 0.87  ? 60  LYS A HD3  1  
ATOM 941    H HE2  . LYS A 1 60  ? -17.105 5.999   4.378   1.00 1.69  ? 60  LYS A HE2  1  
ATOM 942    H HE3  . LYS A 1 60  ? -17.184 5.422   2.713   1.00 1.56  ? 60  LYS A HE3  1  
ATOM 943    H HZ1  . LYS A 1 60  ? -17.929 3.251   4.142   1.00 2.08  ? 60  LYS A HZ1  1  
ATOM 944    H HZ2  . LYS A 1 60  ? -18.622 4.522   5.032   1.00 2.00  ? 60  LYS A HZ2  1  
ATOM 945    H HZ3  . LYS A 1 60  ? -18.994 4.341   3.388   1.00 1.94  ? 60  LYS A HZ3  1  
ATOM 946    N N    . ALA A 1 61  ? -11.222 3.196   6.852   1.00 0.53  ? 61  ALA A N    1  
ATOM 947    C CA   . ALA A 1 61  ? -10.035 2.318   6.990   1.00 0.53  ? 61  ALA A CA   1  
ATOM 948    C C    . ALA A 1 61  ? -9.716  2.092   8.467   1.00 0.55  ? 61  ALA A C    1  
ATOM 949    O O    . ALA A 1 61  ? -9.469  0.983   8.897   1.00 0.57  ? 61  ALA A O    1  
ATOM 950    C CB   . ALA A 1 61  ? -8.858  3.011   6.311   1.00 0.54  ? 61  ALA A CB   1  
ATOM 951    H H    . ALA A 1 61  ? -11.114 4.094   6.476   1.00 0.53  ? 61  ALA A H    1  
ATOM 952    H HA   . ALA A 1 61  ? -10.226 1.369   6.511   1.00 0.53  ? 61  ALA A HA   1  
ATOM 953    H HB1  . ALA A 1 61  ? -9.191  3.435   5.374   1.00 1.08  ? 61  ALA A HB1  1  
ATOM 954    H HB2  . ALA A 1 61  ? -8.491  3.803   6.947   1.00 1.16  ? 61  ALA A HB2  1  
ATOM 955    H HB3  . ALA A 1 61  ? -8.070  2.296   6.130   1.00 1.21  ? 61  ALA A HB3  1  
ATOM 956    N N    . GLY A 1 62  ? -9.701  3.135   9.245   1.00 0.58  ? 62  GLY A N    1  
ATOM 957    C CA   . GLY A 1 62  ? -9.377  2.975   10.688  1.00 0.65  ? 62  GLY A CA   1  
ATOM 958    C C    . GLY A 1 62  ? -10.295 1.925   11.312  1.00 0.69  ? 62  GLY A C    1  
ATOM 959    O O    . GLY A 1 62  ? -9.841  0.984   11.934  1.00 0.75  ? 62  GLY A O    1  
ATOM 960    H H    . GLY A 1 62  ? -9.883  4.025   8.882   1.00 0.58  ? 62  GLY A H    1  
ATOM 961    H HA2  . GLY A 1 62  ? -8.347  2.663   10.792  1.00 0.65  ? 62  GLY A HA2  1  
ATOM 962    H HA3  . GLY A 1 62  ? -9.519  3.918   11.195  1.00 0.69  ? 62  GLY A HA3  1  
ATOM 963    N N    . GLU A 1 63  ? -11.581 2.074   11.162  1.00 0.69  ? 63  GLU A N    1  
ATOM 964    C CA   . GLU A 1 63  ? -12.509 1.076   11.763  1.00 0.77  ? 63  GLU A CA   1  
ATOM 965    C C    . GLU A 1 63  ? -12.421 -0.255  11.014  1.00 0.74  ? 63  GLU A C    1  
ATOM 966    O O    . GLU A 1 63  ? -12.411 -1.314  11.610  1.00 0.82  ? 63  GLU A O    1  
ATOM 967    C CB   . GLU A 1 63  ? -13.943 1.601   11.683  1.00 0.81  ? 63  GLU A CB   1  
ATOM 968    C CG   . GLU A 1 63  ? -14.104 2.785   12.636  1.00 0.87  ? 63  GLU A CG   1  
ATOM 969    C CD   . GLU A 1 63  ? -15.514 3.360   12.504  1.00 0.93  ? 63  GLU A CD   1  
ATOM 970    O OE1  . GLU A 1 63  ? -16.283 2.820   11.725  1.00 1.59  ? 63  GLU A OE1  1  
ATOM 971    O OE2  . GLU A 1 63  ? -15.801 4.334   13.180  1.00 1.23  ? 63  GLU A OE2  1  
ATOM 972    H H    . GLU A 1 63  ? -11.936 2.842   10.659  1.00 0.65  ? 63  GLU A H    1  
ATOM 973    H HA   . GLU A 1 63  ? -12.245 0.921   12.796  1.00 0.83  ? 63  GLU A HA   1  
ATOM 974    H HB2  . GLU A 1 63  ? -14.156 1.918   10.671  1.00 0.78  ? 63  GLU A HB2  1  
ATOM 975    H HB3  . GLU A 1 63  ? -14.630 0.818   11.967  1.00 0.85  ? 63  GLU A HB3  1  
ATOM 976    H HG2  . GLU A 1 63  ? -13.943 2.452   13.652  1.00 0.95  ? 63  GLU A HG2  1  
ATOM 977    H HG3  . GLU A 1 63  ? -13.380 3.547   12.389  1.00 0.84  ? 63  GLU A HG3  1  
ATOM 978    N N    . THR A 1 64  ? -12.414 -0.215  9.711   1.00 0.66  ? 64  THR A N    1  
ATOM 979    C CA   . THR A 1 64  ? -12.396 -1.478  8.917   1.00 0.66  ? 64  THR A CA   1  
ATOM 980    C C    . THR A 1 64  ? -11.089 -2.267  9.086   1.00 0.61  ? 64  THR A C    1  
ATOM 981    O O    . THR A 1 64  ? -11.105 -3.383  9.566   1.00 0.64  ? 64  THR A O    1  
ATOM 982    C CB   . THR A 1 64  ? -12.577 -1.119  7.440   1.00 0.64  ? 64  THR A CB   1  
ATOM 983    O OG1  . THR A 1 64  ? -13.756 -0.338  7.290   1.00 0.71  ? 64  THR A OG1  1  
ATOM 984    C CG2  . THR A 1 64  ? -12.702 -2.394  6.606   1.00 0.73  ? 64  THR A CG2  1  
ATOM 985    H H    . THR A 1 64  ? -12.484 0.637   9.236   1.00 0.61  ? 64  THR A H    1  
ATOM 986    H HA   . THR A 1 64  ? -13.221 -2.098  9.225   1.00 0.74  ? 64  THR A HA   1  
ATOM 987    H HB   . THR A 1 64  ? -11.725 -0.554  7.099   1.00 0.59  ? 64  THR A HB   1  
ATOM 988    H HG1  . THR A 1 64  ? -13.593 0.525   7.682   1.00 1.11  ? 64  THR A HG1  1  
ATOM 989    H HG21 . THR A 1 64  ? -13.539 -2.978  6.963   1.00 1.41  ? 64  THR A HG21 1  
ATOM 990    H HG22 . THR A 1 64  ? -12.862 -2.131  5.572   1.00 1.16  ? 64  THR A HG22 1  
ATOM 991    H HG23 . THR A 1 64  ? -11.796 -2.973  6.694   1.00 1.19  ? 64  THR A HG23 1  
ATOM 992    N N    . PHE A 1 65  ? -9.966  -1.732  8.670   1.00 0.57  ? 65  PHE A N    1  
ATOM 993    C CA   . PHE A 1 65  ? -8.684  -2.506  8.786   1.00 0.57  ? 65  PHE A CA   1  
ATOM 994    C C    . PHE A 1 65  ? -7.930  -2.128  10.058  1.00 0.63  ? 65  PHE A C    1  
ATOM 995    O O    . PHE A 1 65  ? -7.462  -2.993  10.771  1.00 0.75  ? 65  PHE A O    1  
ATOM 996    C CB   . PHE A 1 65  ? -7.813  -2.240  7.551   1.00 0.55  ? 65  PHE A CB   1  
ATOM 997    C CG   . PHE A 1 65  ? -8.402  -2.978  6.367   1.00 0.55  ? 65  PHE A CG   1  
ATOM 998    C CD1  . PHE A 1 65  ? -9.452  -2.402  5.644   1.00 0.57  ? 65  PHE A CD1  1  
ATOM 999    C CD2  . PHE A 1 65  ? -7.909  -4.241  5.998   1.00 0.61  ? 65  PHE A CD2  1  
ATOM 1000   C CE1  . PHE A 1 65  ? -10.012 -3.084  4.556   1.00 0.62  ? 65  PHE A CE1  1  
ATOM 1001   C CE2  . PHE A 1 65  ? -8.468  -4.919  4.910   1.00 0.68  ? 65  PHE A CE2  1  
ATOM 1002   C CZ   . PHE A 1 65  ? -9.519  -4.341  4.190   1.00 0.67  ? 65  PHE A CZ   1  
ATOM 1003   H H    . PHE A 1 65  ? -9.964  -0.841  8.262   1.00 0.56  ? 65  PHE A H    1  
ATOM 1004   H HA   . PHE A 1 65  ? -8.907  -3.562  8.829   1.00 0.58  ? 65  PHE A HA   1  
ATOM 1005   H HB2  . PHE A 1 65  ? -7.792  -1.180  7.345   1.00 0.55  ? 65  PHE A HB2  1  
ATOM 1006   H HB3  . PHE A 1 65  ? -6.809  -2.594  7.733   1.00 0.59  ? 65  PHE A HB3  1  
ATOM 1007   H HD1  . PHE A 1 65  ? -9.832  -1.431  5.926   1.00 0.62  ? 65  PHE A HD1  1  
ATOM 1008   H HD2  . PHE A 1 65  ? -7.094  -4.692  6.548   1.00 0.66  ? 65  PHE A HD2  1  
ATOM 1009   H HE1  . PHE A 1 65  ? -10.822 -2.640  4.000   1.00 0.68  ? 65  PHE A HE1  1  
ATOM 1010   H HE2  . PHE A 1 65  ? -8.089  -5.889  4.625   1.00 0.79  ? 65  PHE A HE2  1  
ATOM 1011   H HZ   . PHE A 1 65  ? -9.953  -4.867  3.352   1.00 0.75  ? 65  PHE A HZ   1  
ATOM 1012   N N    . GLY A 1 66  ? -7.810  -0.863  10.372  1.00 0.59  ? 66  GLY A N    1  
ATOM 1013   C CA   . GLY A 1 66  ? -7.088  -0.473  11.625  1.00 0.67  ? 66  GLY A CA   1  
ATOM 1014   C C    . GLY A 1 66  ? -6.229  0.774   11.392  1.00 0.84  ? 66  GLY A C    1  
ATOM 1015   O O    . GLY A 1 66  ? -6.340  1.455   10.392  1.00 1.22  ? 66  GLY A O    1  
ATOM 1016   H H    . GLY A 1 66  ? -8.197  -0.165  9.803   1.00 0.55  ? 66  GLY A H    1  
ATOM 1017   H HA2  . GLY A 1 66  ? -7.812  -0.263  12.398  1.00 0.77  ? 66  GLY A HA2  1  
ATOM 1018   H HA3  . GLY A 1 66  ? -6.445  -1.281  11.951  1.00 1.02  ? 66  GLY A HA3  1  
ATOM 1019   N N    . GLU A 1 67  ? -5.366  1.056   12.329  1.00 1.60  ? 67  GLU A N    1  
ATOM 1020   C CA   . GLU A 1 67  ? -4.463  2.239   12.219  1.00 2.17  ? 67  GLU A CA   1  
ATOM 1021   C C    . GLU A 1 67  ? -3.417  1.995   11.123  1.00 1.40  ? 67  GLU A C    1  
ATOM 1022   O O    . GLU A 1 67  ? -2.860  2.918   10.559  1.00 1.44  ? 67  GLU A O    1  
ATOM 1023   C CB   . GLU A 1 67  ? -3.759  2.464   13.561  1.00 3.28  ? 67  GLU A CB   1  
ATOM 1024   C CG   . GLU A 1 67  ? -2.920  3.743   13.496  1.00 4.04  ? 67  GLU A CG   1  
ATOM 1025   C CD   . GLU A 1 67  ? -2.224  3.969   14.841  1.00 5.21  ? 67  GLU A CD   1  
ATOM 1026   O OE1  . GLU A 1 67  ? -2.485  3.206   15.757  1.00 5.73  ? 67  GLU A OE1  1  
ATOM 1027   O OE2  . GLU A 1 67  ? -1.441  4.899   14.932  1.00 5.81  ? 67  GLU A OE2  1  
ATOM 1028   H H    . GLU A 1 67  ? -5.308  0.462   13.105  1.00 2.07  ? 67  GLU A H    1  
ATOM 1029   H HA   . GLU A 1 67  ? -5.046  3.112   11.971  1.00 2.67  ? 67  GLU A HA   1  
ATOM 1030   H HB2  . GLU A 1 67  ? -4.500  2.557   14.343  1.00 3.61  ? 67  GLU A HB2  1  
ATOM 1031   H HB3  . GLU A 1 67  ? -3.115  1.624   13.775  1.00 3.66  ? 67  GLU A HB3  1  
ATOM 1032   H HG2  . GLU A 1 67  ? -2.178  3.646   12.718  1.00 4.17  ? 67  GLU A HG2  1  
ATOM 1033   H HG3  . GLU A 1 67  ? -3.561  4.584   13.280  1.00 4.03  ? 67  GLU A HG3  1  
ATOM 1034   N N    . GLU A 1 68  ? -3.141  0.754   10.831  1.00 1.13  ? 68  GLU A N    1  
ATOM 1035   C CA   . GLU A 1 68  ? -2.127  0.405   9.788   1.00 0.88  ? 68  GLU A CA   1  
ATOM 1036   C C    . GLU A 1 68  ? -2.540  0.961   8.420   1.00 0.77  ? 68  GLU A C    1  
ATOM 1037   O O    . GLU A 1 68  ? -1.711  1.372   7.634   1.00 0.83  ? 68  GLU A O    1  
ATOM 1038   C CB   . GLU A 1 68  ? -2.013  -1.124  9.704   1.00 1.52  ? 68  GLU A CB   1  
ATOM 1039   C CG   . GLU A 1 68  ? -0.905  -1.524  8.723   1.00 2.17  ? 68  GLU A CG   1  
ATOM 1040   C CD   . GLU A 1 68  ? 0.450   -1.054  9.254   1.00 2.89  ? 68  GLU A CD   1  
ATOM 1041   O OE1  . GLU A 1 68  ? 0.533   -0.771  10.438  1.00 3.35  ? 68  GLU A OE1  1  
ATOM 1042   O OE2  . GLU A 1 68  ? 1.382   -0.986  8.470   1.00 3.37  ? 68  GLU A OE2  1  
ATOM 1043   H H    . GLU A 1 68  ? -3.608  0.032   11.296  1.00 1.52  ? 68  GLU A H    1  
ATOM 1044   H HA   . GLU A 1 68  ? -1.170  0.819   10.069  1.00 0.94  ? 68  GLU A HA   1  
ATOM 1045   H HB2  . GLU A 1 68  ? -1.783  -1.520  10.682  1.00 1.89  ? 68  GLU A HB2  1  
ATOM 1046   H HB3  . GLU A 1 68  ? -2.953  -1.533  9.365   1.00 2.03  ? 68  GLU A HB3  1  
ATOM 1047   H HG2  . GLU A 1 68  ? -0.893  -2.599  8.617   1.00 2.52  ? 68  GLU A HG2  1  
ATOM 1048   H HG3  . GLU A 1 68  ? -1.089  -1.073  7.759   1.00 2.43  ? 68  GLU A HG3  1  
ATOM 1049   N N    . LYS A 1 69  ? -3.813  0.971   8.126   1.00 0.69  ? 69  LYS A N    1  
ATOM 1050   C CA   . LYS A 1 69  ? -4.279  1.493   6.802   1.00 0.65  ? 69  LYS A CA   1  
ATOM 1051   C C    . LYS A 1 69  ? -4.739  2.944   6.951   1.00 0.60  ? 69  LYS A C    1  
ATOM 1052   O O    . LYS A 1 69  ? -4.825  3.672   5.985   1.00 0.62  ? 69  LYS A O    1  
ATOM 1053   C CB   . LYS A 1 69  ? -5.456  0.646   6.294   1.00 0.68  ? 69  LYS A CB   1  
ATOM 1054   C CG   . LYS A 1 69  ? -4.994  -0.783  5.954   1.00 0.75  ? 69  LYS A CG   1  
ATOM 1055   C CD   . LYS A 1 69  ? -4.299  -0.819  4.585   1.00 1.01  ? 69  LYS A CD   1  
ATOM 1056   C CE   . LYS A 1 69  ? -4.096  -2.275  4.161   1.00 1.34  ? 69  LYS A CE   1  
ATOM 1057   N NZ   . LYS A 1 69  ? -5.422  -2.892  3.876   1.00 1.77  ? 69  LYS A NZ   1  
ATOM 1058   H H    . LYS A 1 69  ? -4.460  0.651   8.787   1.00 0.70  ? 69  LYS A H    1  
ATOM 1059   H HA   . LYS A 1 69  ? -3.473  1.452   6.086   1.00 0.70  ? 69  LYS A HA   1  
ATOM 1060   H HB2  . LYS A 1 69  ? -6.215  0.600   7.060   1.00 0.71  ? 69  LYS A HB2  1  
ATOM 1061   H HB3  . LYS A 1 69  ? -5.870  1.108   5.412   1.00 0.74  ? 69  LYS A HB3  1  
ATOM 1062   H HG2  . LYS A 1 69  ? -4.305  -1.127  6.711   1.00 0.89  ? 69  LYS A HG2  1  
ATOM 1063   H HG3  . LYS A 1 69  ? -5.853  -1.436  5.933   1.00 0.76  ? 69  LYS A HG3  1  
ATOM 1064   H HD2  . LYS A 1 69  ? -4.910  -0.313  3.851   1.00 1.28  ? 69  LYS A HD2  1  
ATOM 1065   H HD3  . LYS A 1 69  ? -3.340  -0.336  4.652   1.00 1.30  ? 69  LYS A HD3  1  
ATOM 1066   H HE2  . LYS A 1 69  ? -3.483  -2.309  3.273   1.00 1.72  ? 69  LYS A HE2  1  
ATOM 1067   H HE3  . LYS A 1 69  ? -3.610  -2.818  4.957   1.00 2.03  ? 69  LYS A HE3  1  
ATOM 1068   H HZ1  . LYS A 1 69  ? -6.062  -2.173  3.486   1.00 2.10  ? 69  LYS A HZ1  1  
ATOM 1069   H HZ2  . LYS A 1 69  ? -5.304  -3.664  3.187   1.00 2.37  ? 69  LYS A HZ2  1  
ATOM 1070   H HZ3  . LYS A 1 69  ? -5.824  -3.271  4.757   1.00 2.17  ? 69  LYS A HZ3  1  
ATOM 1071   N N    . GLU A 1 70  ? -5.037  3.370   8.149   1.00 0.60  ? 70  GLU A N    1  
ATOM 1072   C CA   . GLU A 1 70  ? -5.501  4.774   8.363   1.00 0.62  ? 70  GLU A CA   1  
ATOM 1073   C C    . GLU A 1 70  ? -4.359  5.757   8.109   1.00 0.61  ? 70  GLU A C    1  
ATOM 1074   O O    . GLU A 1 70  ? -4.547  6.819   7.548   1.00 0.62  ? 70  GLU A O    1  
ATOM 1075   C CB   . GLU A 1 70  ? -5.952  4.926   9.813   1.00 0.70  ? 70  GLU A CB   1  
ATOM 1076   C CG   . GLU A 1 70  ? -6.653  6.268   10.004  1.00 0.99  ? 70  GLU A CG   1  
ATOM 1077   C CD   . GLU A 1 70  ? -7.009  6.449   11.481  1.00 1.02  ? 70  GLU A CD   1  
ATOM 1078   O OE1  . GLU A 1 70  ? -6.724  5.548   12.253  1.00 1.65  ? 70  GLU A OE1  1  
ATOM 1079   O OE2  . GLU A 1 70  ? -7.557  7.487   11.817  1.00 1.33  ? 70  GLU A OE2  1  
ATOM 1080   H H    . GLU A 1 70  ? -4.956  2.768   8.918   1.00 0.63  ? 70  GLU A H    1  
ATOM 1081   H HA   . GLU A 1 70  ? -6.325  4.993   7.702   1.00 0.64  ? 70  GLU A HA   1  
ATOM 1082   H HB2  . GLU A 1 70  ? -6.632  4.125   10.061  1.00 1.17  ? 70  GLU A HB2  1  
ATOM 1083   H HB3  . GLU A 1 70  ? -5.089  4.879   10.458  1.00 1.07  ? 70  GLU A HB3  1  
ATOM 1084   H HG2  . GLU A 1 70  ? -5.998  7.068   9.687   1.00 1.40  ? 70  GLU A HG2  1  
ATOM 1085   H HG3  . GLU A 1 70  ? -7.555  6.285   9.417   1.00 1.46  ? 70  GLU A HG3  1  
ATOM 1086   N N    . ALA A 1 71  ? -3.179  5.418   8.541   1.00 0.64  ? 71  ALA A N    1  
ATOM 1087   C CA   . ALA A 1 71  ? -2.022  6.336   8.354   1.00 0.69  ? 71  ALA A CA   1  
ATOM 1088   C C    . ALA A 1 71  ? -1.692  6.473   6.862   1.00 0.66  ? 71  ALA A C    1  
ATOM 1089   O O    . ALA A 1 71  ? -1.251  7.512   6.415   1.00 0.68  ? 71  ALA A O    1  
ATOM 1090   C CB   . ALA A 1 71  ? -0.816  5.781   9.125   1.00 0.77  ? 71  ALA A CB   1  
ATOM 1091   H H    . ALA A 1 71  ? -3.056  4.562   9.006   1.00 0.65  ? 71  ALA A H    1  
ATOM 1092   H HA   . ALA A 1 71  ? -2.278  7.310   8.746   1.00 0.73  ? 71  ALA A HA   1  
ATOM 1093   H HB1  . ALA A 1 71  ? -0.870  4.704   9.140   1.00 1.42  ? 71  ALA A HB1  1  
ATOM 1094   H HB2  . ALA A 1 71  ? 0.103   6.091   8.648   1.00 1.24  ? 71  ALA A HB2  1  
ATOM 1095   H HB3  . ALA A 1 71  ? -0.834  6.151   10.141  1.00 1.17  ? 71  ALA A HB3  1  
ATOM 1096   N N    . ILE A 1 72  ? -1.895  5.444   6.088   1.00 0.65  ? 72  ILE A N    1  
ATOM 1097   C CA   . ILE A 1 72  ? -1.573  5.561   4.637   1.00 0.65  ? 72  ILE A CA   1  
ATOM 1098   C C    . ILE A 1 72  ? -2.421  6.684   4.036   1.00 0.60  ? 72  ILE A C    1  
ATOM 1099   O O    . ILE A 1 72  ? -1.951  7.462   3.230   1.00 0.60  ? 72  ILE A O    1  
ATOM 1100   C CB   . ILE A 1 72  ? -1.875  4.245   3.909   1.00 0.69  ? 72  ILE A CB   1  
ATOM 1101   C CG1  . ILE A 1 72  ? -0.866  3.177   4.345   1.00 0.77  ? 72  ILE A CG1  1  
ATOM 1102   C CG2  . ILE A 1 72  ? -1.758  4.457   2.394   1.00 0.73  ? 72  ILE A CG2  1  
ATOM 1103   C CD1  . ILE A 1 72  ? -1.305  1.808   3.822   1.00 0.80  ? 72  ILE A CD1  1  
ATOM 1104   H H    . ILE A 1 72  ? -2.244  4.608   6.465   1.00 0.65  ? 72  ILE A H    1  
ATOM 1105   H HA   . ILE A 1 72  ? -0.529  5.804   4.521   1.00 0.70  ? 72  ILE A HA   1  
ATOM 1106   H HB   . ILE A 1 72  ? -2.878  3.923   4.153   1.00 0.69  ? 72  ILE A HB   1  
ATOM 1107   H HG12 . ILE A 1 72  ? 0.109   3.419   3.941   1.00 0.85  ? 72  ILE A HG12 1  
ATOM 1108   H HG13 . ILE A 1 72  ? -0.811  3.149   5.422   1.00 0.82  ? 72  ILE A HG13 1  
ATOM 1109   H HG21 . ILE A 1 72  ? -0.854  5.009   2.177   1.00 1.38  ? 72  ILE A HG21 1  
ATOM 1110   H HG22 . ILE A 1 72  ? -1.722  3.500   1.896   1.00 1.20  ? 72  ILE A HG22 1  
ATOM 1111   H HG23 . ILE A 1 72  ? -2.612  5.014   2.041   1.00 1.12  ? 72  ILE A HG23 1  
ATOM 1112   H HD11 . ILE A 1 72  ? -2.358  1.670   4.012   1.00 1.14  ? 72  ILE A HD11 1  
ATOM 1113   H HD12 . ILE A 1 72  ? -1.122  1.754   2.759   1.00 1.43  ? 72  ILE A HD12 1  
ATOM 1114   H HD13 . ILE A 1 72  ? -0.744  1.034   4.325   1.00 1.30  ? 72  ILE A HD13 1  
ATOM 1115   N N    . PHE A 1 73  ? -3.662  6.783   4.423   1.00 0.56  ? 73  PHE A N    1  
ATOM 1116   C CA   . PHE A 1 73  ? -4.516  7.871   3.866   1.00 0.53  ? 73  PHE A CA   1  
ATOM 1117   C C    . PHE A 1 73  ? -3.959  9.219   4.307   1.00 0.52  ? 73  PHE A C    1  
ATOM 1118   O O    . PHE A 1 73  ? -3.925  10.166  3.547   1.00 0.51  ? 73  PHE A O    1  
ATOM 1119   C CB   . PHE A 1 73  ? -5.952  7.724   4.375   1.00 0.54  ? 73  PHE A CB   1  
ATOM 1120   C CG   . PHE A 1 73  ? -6.651  6.640   3.596   1.00 0.58  ? 73  PHE A CG   1  
ATOM 1121   C CD1  . PHE A 1 73  ? -7.182  6.917   2.332   1.00 0.77  ? 73  PHE A CD1  1  
ATOM 1122   C CD2  . PHE A 1 73  ? -6.753  5.355   4.133   1.00 0.58  ? 73  PHE A CD2  1  
ATOM 1123   C CE1  . PHE A 1 73  ? -7.818  5.905   1.606   1.00 0.88  ? 73  PHE A CE1  1  
ATOM 1124   C CE2  . PHE A 1 73  ? -7.385  4.343   3.407   1.00 0.66  ? 73  PHE A CE2  1  
ATOM 1125   C CZ   . PHE A 1 73  ? -7.917  4.617   2.143   1.00 0.78  ? 73  PHE A CZ   1  
ATOM 1126   H H    . PHE A 1 73  ? -4.028  6.151   5.081   1.00 0.57  ? 73  PHE A H    1  
ATOM 1127   H HA   . PHE A 1 73  ? -4.506  7.819   2.789   1.00 0.54  ? 73  PHE A HA   1  
ATOM 1128   H HB2  . PHE A 1 73  ? -5.932  7.463   5.421   1.00 0.55  ? 73  PHE A HB2  1  
ATOM 1129   H HB3  . PHE A 1 73  ? -6.482  8.657   4.246   1.00 0.58  ? 73  PHE A HB3  1  
ATOM 1130   H HD1  . PHE A 1 73  ? -7.105  7.912   1.919   1.00 0.91  ? 73  PHE A HD1  1  
ATOM 1131   H HD2  . PHE A 1 73  ? -6.348  5.150   5.109   1.00 0.64  ? 73  PHE A HD2  1  
ATOM 1132   H HE1  . PHE A 1 73  ? -8.228  6.118   0.630   1.00 1.08  ? 73  PHE A HE1  1  
ATOM 1133   H HE2  . PHE A 1 73  ? -7.460  3.350   3.821   1.00 0.73  ? 73  PHE A HE2  1  
ATOM 1134   H HZ   . PHE A 1 73  ? -8.408  3.836   1.585   1.00 0.88  ? 73  PHE A HZ   1  
ATOM 1135   N N    . GLU A 1 74  ? -3.519  9.316   5.529   1.00 0.55  ? 74  GLU A N    1  
ATOM 1136   C CA   . GLU A 1 74  ? -2.964  10.602  6.018   1.00 0.58  ? 74  GLU A CA   1  
ATOM 1137   C C    . GLU A 1 74  ? -1.762  10.995  5.162   1.00 0.57  ? 74  GLU A C    1  
ATOM 1138   O O    . GLU A 1 74  ? -1.598  12.140  4.792   1.00 0.58  ? 74  GLU A O    1  
ATOM 1139   C CB   . GLU A 1 74  ? -2.536  10.432  7.477   1.00 0.64  ? 74  GLU A CB   1  
ATOM 1140   C CG   . GLU A 1 74  ? -2.047  11.772  8.035   1.00 0.73  ? 74  GLU A CG   1  
ATOM 1141   C CD   . GLU A 1 74  ? -2.087  11.731  9.566   1.00 0.79  ? 74  GLU A CD   1  
ATOM 1142   O OE1  . GLU A 1 74  ? -2.152  10.640  10.107  1.00 1.34  ? 74  GLU A OE1  1  
ATOM 1143   O OE2  . GLU A 1 74  ? -2.052  12.791  10.169  1.00 1.37  ? 74  GLU A OE2  1  
ATOM 1144   H H    . GLU A 1 74  ? -3.546  8.550   6.138   1.00 0.57  ? 74  GLU A H    1  
ATOM 1145   H HA   . GLU A 1 74  ? -3.720  11.368  5.951   1.00 0.58  ? 74  GLU A HA   1  
ATOM 1146   H HB2  . GLU A 1 74  ? -3.378  10.080  8.057   1.00 0.64  ? 74  GLU A HB2  1  
ATOM 1147   H HB3  . GLU A 1 74  ? -1.735  9.709   7.533   1.00 0.66  ? 74  GLU A HB3  1  
ATOM 1148   H HG2  . GLU A 1 74  ? -1.030  11.946  7.707   1.00 0.81  ? 74  GLU A HG2  1  
ATOM 1149   H HG3  . GLU A 1 74  ? -2.682  12.569  7.681   1.00 0.78  ? 74  GLU A HG3  1  
ATOM 1150   N N    . GLY A 1 75  ? -0.924  10.051  4.835   1.00 0.59  ? 75  GLY A N    1  
ATOM 1151   C CA   . GLY A 1 75  ? 0.265   10.371  3.998   1.00 0.62  ? 75  GLY A CA   1  
ATOM 1152   C C    . GLY A 1 75  ? -0.202  10.937  2.659   1.00 0.59  ? 75  GLY A C    1  
ATOM 1153   O O    . GLY A 1 75  ? 0.332   11.911  2.166   1.00 0.60  ? 75  GLY A O    1  
ATOM 1154   H H    . GLY A 1 75  ? -1.078  9.133   5.138   1.00 0.62  ? 75  GLY A H    1  
ATOM 1155   H HA2  . GLY A 1 75  ? 0.883   11.097  4.507   1.00 0.65  ? 75  GLY A HA2  1  
ATOM 1156   H HA3  . GLY A 1 75  ? 0.834   9.472   3.824   1.00 0.67  ? 75  GLY A HA3  1  
ATOM 1157   N N    . HIS A 1 76  ? -1.200  10.338  2.067   1.00 0.56  ? 76  HIS A N    1  
ATOM 1158   C CA   . HIS A 1 76  ? -1.704  10.854  0.766   1.00 0.56  ? 76  HIS A CA   1  
ATOM 1159   C C    . HIS A 1 76  ? -2.407  12.190  0.995   1.00 0.53  ? 76  HIS A C    1  
ATOM 1160   O O    . HIS A 1 76  ? -2.271  13.116  0.220   1.00 0.57  ? 76  HIS A O    1  
ATOM 1161   C CB   . HIS A 1 76  ? -2.694  9.852   0.166   1.00 0.58  ? 76  HIS A CB   1  
ATOM 1162   C CG   . HIS A 1 76  ? -1.972  8.606   -0.286  1.00 0.64  ? 76  HIS A CG   1  
ATOM 1163   N ND1  . HIS A 1 76  ? -2.594  7.365   -0.294  1.00 1.50  ? 76  HIS A ND1  1  
ATOM 1164   C CD2  . HIS A 1 76  ? -0.696  8.387   -0.758  1.00 1.07  ? 76  HIS A CD2  1  
ATOM 1165   C CE1  . HIS A 1 76  ? -1.707  6.465   -0.756  1.00 1.28  ? 76  HIS A CE1  1  
ATOM 1166   N NE2  . HIS A 1 76  ? -0.538  7.037   -1.052  1.00 0.79  ? 76  HIS A NE2  1  
ATOM 1167   H H    . HIS A 1 76  ? -1.623  9.558   2.482   1.00 0.57  ? 76  HIS A H    1  
ATOM 1168   H HA   . HIS A 1 76  ? -0.879  11.001  0.089   1.00 0.60  ? 76  HIS A HA   1  
ATOM 1169   H HB2  . HIS A 1 76  ? -3.426  9.587   0.913   1.00 0.58  ? 76  HIS A HB2  1  
ATOM 1170   H HB3  . HIS A 1 76  ? -3.194  10.303  -0.677  1.00 0.61  ? 76  HIS A HB3  1  
ATOM 1171   H HD2  . HIS A 1 76  ? 0.064   9.141   -0.885  1.00 1.99  ? 76  HIS A HD2  1  
ATOM 1172   H HE1  . HIS A 1 76  ? -1.917  5.413   -0.878  1.00 1.94  ? 76  HIS A HE1  1  
ATOM 1173   H HE2  . HIS A 1 76  ? 0.264   6.596   -1.404  1.00 1.09  ? 76  HIS A HE2  1  
ATOM 1174   N N    . ILE A 1 77  ? -3.153  12.306  2.060   1.00 0.51  ? 77  ILE A N    1  
ATOM 1175   C CA   . ILE A 1 77  ? -3.845  13.594  2.326   1.00 0.51  ? 77  ILE A CA   1  
ATOM 1176   C C    . ILE A 1 77  ? -2.803  14.659  2.660   1.00 0.52  ? 77  ILE A C    1  
ATOM 1177   O O    . ILE A 1 77  ? -2.847  15.759  2.146   1.00 0.52  ? 77  ILE A O    1  
ATOM 1178   C CB   . ILE A 1 77  ? -4.833  13.444  3.492   1.00 0.54  ? 77  ILE A CB   1  
ATOM 1179   C CG1  . ILE A 1 77  ? -6.009  12.572  3.042   1.00 0.58  ? 77  ILE A CG1  1  
ATOM 1180   C CG2  . ILE A 1 77  ? -5.351  14.826  3.914   1.00 0.58  ? 77  ILE A CG2  1  
ATOM 1181   C CD1  . ILE A 1 77  ? -6.907  12.242  4.239   1.00 0.63  ? 77  ILE A CD1  1  
ATOM 1182   H H    . ILE A 1 77  ? -3.246  11.556  2.680   1.00 0.53  ? 77  ILE A H    1  
ATOM 1183   H HA   . ILE A 1 77  ? -4.385  13.895  1.439   1.00 0.53  ? 77  ILE A HA   1  
ATOM 1184   H HB   . ILE A 1 77  ? -4.332  12.977  4.328   1.00 0.55  ? 77  ILE A HB   1  
ATOM 1185   H HG12 . ILE A 1 77  ? -6.583  13.103  2.297   1.00 0.63  ? 77  ILE A HG12 1  
ATOM 1186   H HG13 . ILE A 1 77  ? -5.631  11.654  2.617   1.00 0.58  ? 77  ILE A HG13 1  
ATOM 1187   H HG21 . ILE A 1 77  ? -5.634  15.387  3.036   1.00 1.21  ? 77  ILE A HG21 1  
ATOM 1188   H HG22 . ILE A 1 77  ? -6.208  14.712  4.560   1.00 1.22  ? 77  ILE A HG22 1  
ATOM 1189   H HG23 . ILE A 1 77  ? -4.573  15.357  4.443   1.00 1.06  ? 77  ILE A HG23 1  
ATOM 1190   H HD11 . ILE A 1 77  ? -6.299  11.918  5.069   1.00 1.22  ? 77  ILE A HD11 1  
ATOM 1191   H HD12 . ILE A 1 77  ? -7.468  13.124  4.523   1.00 1.16  ? 77  ILE A HD12 1  
ATOM 1192   H HD13 . ILE A 1 77  ? -7.595  11.456  3.967   1.00 1.19  ? 77  ILE A HD13 1  
ATOM 1193   N N    . MET A 1 78  ? -1.870  14.357  3.527   1.00 0.54  ? 78  MET A N    1  
ATOM 1194   C CA   . MET A 1 78  ? -0.848  15.369  3.895   1.00 0.59  ? 78  MET A CA   1  
ATOM 1195   C C    . MET A 1 78  ? -0.067  15.792  2.653   1.00 0.58  ? 78  MET A C    1  
ATOM 1196   O O    . MET A 1 78  ? 0.229   16.954  2.462   1.00 0.62  ? 78  MET A O    1  
ATOM 1197   C CB   . MET A 1 78  ? 0.099   14.761  4.932   1.00 0.64  ? 78  MET A CB   1  
ATOM 1198   C CG   . MET A 1 78  ? 1.146   15.792  5.351   1.00 0.70  ? 78  MET A CG   1  
ATOM 1199   S SD   . MET A 1 78  ? 1.916   15.264  6.904   1.00 0.84  ? 78  MET A SD   1  
ATOM 1200   C CE   . MET A 1 78  ? 2.392   13.596  6.385   1.00 1.51  ? 78  MET A CE   1  
ATOM 1201   H H    . MET A 1 78  ? -1.835  13.479  3.961   1.00 0.55  ? 78  MET A H    1  
ATOM 1202   H HA   . MET A 1 78  ? -1.334  16.229  4.317   1.00 0.61  ? 78  MET A HA   1  
ATOM 1203   H HB2  . MET A 1 78  ? -0.469  14.454  5.798   1.00 0.69  ? 78  MET A HB2  1  
ATOM 1204   H HB3  . MET A 1 78  ? 0.594   13.901  4.505   1.00 0.64  ? 78  MET A HB3  1  
ATOM 1205   H HG2  . MET A 1 78  ? 1.900   15.873  4.581   1.00 0.70  ? 78  MET A HG2  1  
ATOM 1206   H HG3  . MET A 1 78  ? 0.670   16.752  5.493   1.00 0.79  ? 78  MET A HG3  1  
ATOM 1207   H HE1  . MET A 1 78  ? 2.752   13.625  5.365   1.00 2.02  ? 78  MET A HE1  1  
ATOM 1208   H HE2  . MET A 1 78  ? 3.172   13.225  7.030   1.00 2.11  ? 78  MET A HE2  1  
ATOM 1209   H HE3  . MET A 1 78  ? 1.533   12.942  6.451   1.00 2.01  ? 78  MET A HE3  1  
ATOM 1210   N N    . LEU A 1 79  ? 0.255   14.861  1.803   1.00 0.58  ? 79  LEU A N    1  
ATOM 1211   C CA   . LEU A 1 79  ? 1.005   15.216  0.568   1.00 0.60  ? 79  LEU A CA   1  
ATOM 1212   C C    . LEU A 1 79  ? 0.103   16.034  -0.352  1.00 0.55  ? 79  LEU A C    1  
ATOM 1213   O O    . LEU A 1 79  ? 0.526   16.992  -0.968  1.00 0.58  ? 79  LEU A O    1  
ATOM 1214   C CB   . LEU A 1 79  ? 1.468   13.931  -0.130  1.00 0.62  ? 79  LEU A CB   1  
ATOM 1215   C CG   . LEU A 1 79  ? 2.028   14.234  -1.538  1.00 0.67  ? 79  LEU A CG   1  
ATOM 1216   C CD1  . LEU A 1 79  ? 3.199   15.240  -1.457  1.00 0.77  ? 79  LEU A CD1  1  
ATOM 1217   C CD2  . LEU A 1 79  ? 2.495   12.922  -2.211  1.00 0.71  ? 79  LEU A CD2  1  
ATOM 1218   H H    . LEU A 1 79  ? -0.002  13.932  1.973   1.00 0.60  ? 79  LEU A H    1  
ATOM 1219   H HA   . LEU A 1 79  ? 1.864   15.799  0.842   1.00 0.65  ? 79  LEU A HA   1  
ATOM 1220   H HB2  . LEU A 1 79  ? 2.241   13.483  0.468   1.00 0.67  ? 79  LEU A HB2  1  
ATOM 1221   H HB3  . LEU A 1 79  ? 0.637   13.248  -0.214  1.00 0.59  ? 79  LEU A HB3  1  
ATOM 1222   H HG   . LEU A 1 79  ? 1.246   14.662  -2.141  1.00 0.65  ? 79  LEU A HG   1  
ATOM 1223   H HD11 . LEU A 1 79  ? 3.614   15.259  -0.461  1.00 1.33  ? 79  LEU A HD11 1  
ATOM 1224   H HD12 . LEU A 1 79  ? 3.973   14.960  -2.156  1.00 1.25  ? 79  LEU A HD12 1  
ATOM 1225   H HD13 . LEU A 1 79  ? 2.834   16.226  -1.705  1.00 1.31  ? 79  LEU A HD13 1  
ATOM 1226   H HD21 . LEU A 1 79  ? 1.893   12.095  -1.864  1.00 1.26  ? 79  LEU A HD21 1  
ATOM 1227   H HD22 . LEU A 1 79  ? 2.381   13.014  -3.280  1.00 1.14  ? 79  LEU A HD22 1  
ATOM 1228   H HD23 . LEU A 1 79  ? 3.536   12.739  -1.977  1.00 1.24  ? 79  LEU A HD23 1  
ATOM 1229   N N    . LEU A 1 80  ? -1.141  15.668  -0.439  1.00 0.51  ? 80  LEU A N    1  
ATOM 1230   C CA   . LEU A 1 80  ? -2.084  16.421  -1.308  1.00 0.50  ? 80  LEU A CA   1  
ATOM 1231   C C    . LEU A 1 80  ? -2.207  17.864  -0.800  1.00 0.53  ? 80  LEU A C    1  
ATOM 1232   O O    . LEU A 1 80  ? -2.271  18.801  -1.569  1.00 0.57  ? 80  LEU A O    1  
ATOM 1233   C CB   . LEU A 1 80  ? -3.453  15.730  -1.280  1.00 0.51  ? 80  LEU A CB   1  
ATOM 1234   C CG   . LEU A 1 80  ? -4.470  16.507  -2.129  1.00 0.53  ? 80  LEU A CG   1  
ATOM 1235   C CD1  . LEU A 1 80  ? -3.969  16.637  -3.576  1.00 0.58  ? 80  LEU A CD1  1  
ATOM 1236   C CD2  . LEU A 1 80  ? -5.802  15.747  -2.119  1.00 0.62  ? 80  LEU A CD2  1  
ATOM 1237   H H    . LEU A 1 80  ? -1.457  14.901  0.084   1.00 0.52  ? 80  LEU A H    1  
ATOM 1238   H HA   . LEU A 1 80  ? -1.699  16.427  -2.318  1.00 0.51  ? 80  LEU A HA   1  
ATOM 1239   H HB2  . LEU A 1 80  ? -3.353  14.729  -1.673  1.00 0.55  ? 80  LEU A HB2  1  
ATOM 1240   H HB3  . LEU A 1 80  ? -3.805  15.678  -0.261  1.00 0.53  ? 80  LEU A HB3  1  
ATOM 1241   H HG   . LEU A 1 80  ? -4.616  17.490  -1.707  1.00 0.55  ? 80  LEU A HG   1  
ATOM 1242   H HD11 . LEU A 1 80  ? -3.447  15.737  -3.863  1.00 1.19  ? 80  LEU A HD11 1  
ATOM 1243   H HD12 . LEU A 1 80  ? -4.808  16.792  -4.241  1.00 1.10  ? 80  LEU A HD12 1  
ATOM 1244   H HD13 . LEU A 1 80  ? -3.299  17.480  -3.648  1.00 1.18  ? 80  LEU A HD13 1  
ATOM 1245   H HD21 . LEU A 1 80  ? -5.626  14.712  -2.377  1.00 1.13  ? 80  LEU A HD21 1  
ATOM 1246   H HD22 . LEU A 1 80  ? -6.244  15.804  -1.135  1.00 1.18  ? 80  LEU A HD22 1  
ATOM 1247   H HD23 . LEU A 1 80  ? -6.473  16.188  -2.841  1.00 1.29  ? 80  LEU A HD23 1  
ATOM 1248   N N    . GLU A 1 81  ? -2.249  18.043  0.494   1.00 0.57  ? 81  GLU A N    1  
ATOM 1249   C CA   . GLU A 1 81  ? -2.379  19.417  1.065   1.00 0.65  ? 81  GLU A CA   1  
ATOM 1250   C C    . GLU A 1 81  ? -1.019  20.126  1.052   1.00 0.68  ? 81  GLU A C    1  
ATOM 1251   O O    . GLU A 1 81  ? -0.890  21.241  1.517   1.00 0.76  ? 81  GLU A O    1  
ATOM 1252   C CB   . GLU A 1 81  ? -2.867  19.313  2.514   1.00 0.73  ? 81  GLU A CB   1  
ATOM 1253   C CG   . GLU A 1 81  ? -4.285  18.735  2.547   1.00 0.76  ? 81  GLU A CG   1  
ATOM 1254   C CD   . GLU A 1 81  ? -4.758  18.638  4.001   1.00 0.87  ? 81  GLU A CD   1  
ATOM 1255   O OE1  . GLU A 1 81  ? -3.937  18.826  4.884   1.00 1.32  ? 81  GLU A OE1  1  
ATOM 1256   O OE2  . GLU A 1 81  ? -5.934  18.386  4.206   1.00 1.47  ? 81  GLU A OE2  1  
ATOM 1257   H H    . GLU A 1 81  ? -2.203  17.271  1.094   1.00 0.58  ? 81  GLU A H    1  
ATOM 1258   H HA   . GLU A 1 81  ? -3.091  19.986  0.486   1.00 0.67  ? 81  GLU A HA   1  
ATOM 1259   H HB2  . GLU A 1 81  ? -2.203  18.669  3.071   1.00 0.71  ? 81  GLU A HB2  1  
ATOM 1260   H HB3  . GLU A 1 81  ? -2.872  20.295  2.962   1.00 0.84  ? 81  GLU A HB3  1  
ATOM 1261   H HG2  . GLU A 1 81  ? -4.951  19.381  1.994   1.00 0.84  ? 81  GLU A HG2  1  
ATOM 1262   H HG3  . GLU A 1 81  ? -4.285  17.751  2.104   1.00 0.70  ? 81  GLU A HG3  1  
ATOM 1263   N N    . ASP A 1 82  ? 0.002   19.491  0.543   1.00 0.64  ? 82  ASP A N    1  
ATOM 1264   C CA   . ASP A 1 82  ? 1.346   20.141  0.533   1.00 0.71  ? 82  ASP A CA   1  
ATOM 1265   C C    . ASP A 1 82  ? 1.236   21.562  -0.034  1.00 0.73  ? 82  ASP A C    1  
ATOM 1266   O O    . ASP A 1 82  ? 0.683   21.789  -1.095  1.00 0.68  ? 82  ASP A O    1  
ATOM 1267   C CB   . ASP A 1 82  ? 2.308   19.314  -0.321  1.00 0.70  ? 82  ASP A CB   1  
ATOM 1268   C CG   . ASP A 1 82  ? 3.702   19.941  -0.269  1.00 0.81  ? 82  ASP A CG   1  
ATOM 1269   O OD1  . ASP A 1 82  ? 3.808   21.065  0.195   1.00 1.28  ? 82  ASP A OD1  1  
ATOM 1270   O OD2  . ASP A 1 82  ? 4.641   19.287  -0.691  1.00 1.47  ? 82  ASP A OD2  1  
ATOM 1271   H H    . ASP A 1 82  ? -0.109  18.586  0.182   1.00 0.60  ? 82  ASP A H    1  
ATOM 1272   H HA   . ASP A 1 82  ? 1.723   20.190  1.545   1.00 0.77  ? 82  ASP A HA   1  
ATOM 1273   H HB2  . ASP A 1 82  ? 2.352   18.305  0.064   1.00 0.69  ? 82  ASP A HB2  1  
ATOM 1274   H HB3  . ASP A 1 82  ? 1.960   19.296  -1.343  1.00 0.66  ? 82  ASP A HB3  1  
ATOM 1275   N N    . GLU A 1 83  ? 1.753   22.521  0.686   1.00 0.83  ? 83  GLU A N    1  
ATOM 1276   C CA   . GLU A 1 83  ? 1.681   23.941  0.237   1.00 0.88  ? 83  GLU A CA   1  
ATOM 1277   C C    . GLU A 1 83  ? 2.436   24.127  -1.085  1.00 0.88  ? 83  GLU A C    1  
ATOM 1278   O O    . GLU A 1 83  ? 2.235   25.098  -1.786  1.00 0.90  ? 83  GLU A O    1  
ATOM 1279   C CB   . GLU A 1 83  ? 2.302   24.838  1.309   1.00 1.02  ? 83  GLU A CB   1  
ATOM 1280   C CG   . GLU A 1 83  ? 1.399   24.848  2.548   1.00 1.08  ? 83  GLU A CG   1  
ATOM 1281   C CD   . GLU A 1 83  ? 2.019   25.737  3.629   1.00 1.23  ? 83  GLU A CD   1  
ATOM 1282   O OE1  . GLU A 1 83  ? 3.134   26.191  3.428   1.00 1.57  ? 83  GLU A OE1  1  
ATOM 1283   O OE2  . GLU A 1 83  ? 1.372   25.941  4.644   1.00 1.78  ? 83  GLU A OE2  1  
ATOM 1284   H H    . GLU A 1 83  ? 2.171   22.306  1.546   1.00 0.89  ? 83  GLU A H    1  
ATOM 1285   H HA   . GLU A 1 83  ? 0.647   24.218  0.099   1.00 0.85  ? 83  GLU A HA   1  
ATOM 1286   H HB2  . GLU A 1 83  ? 3.278   24.462  1.575   1.00 1.06  ? 83  GLU A HB2  1  
ATOM 1287   H HB3  . GLU A 1 83  ? 2.394   25.844  0.928   1.00 1.08  ? 83  GLU A HB3  1  
ATOM 1288   H HG2  . GLU A 1 83  ? 0.426   25.233  2.279   1.00 1.12  ? 83  GLU A HG2  1  
ATOM 1289   H HG3  . GLU A 1 83  ? 1.296   23.843  2.926   1.00 1.07  ? 83  GLU A HG3  1  
ATOM 1290   N N    . GLU A 1 84  ? 3.281   23.199  -1.453  1.00 0.87  ? 84  GLU A N    1  
ATOM 1291   C CA   . GLU A 1 84  ? 4.003   23.339  -2.752  1.00 0.89  ? 84  GLU A CA   1  
ATOM 1292   C C    . GLU A 1 84  ? 3.017   23.083  -3.895  1.00 0.79  ? 84  GLU A C    1  
ATOM 1293   O O    . GLU A 1 84  ? 3.118   23.653  -4.964  1.00 0.79  ? 84  GLU A O    1  
ATOM 1294   C CB   . GLU A 1 84  ? 5.158   22.329  -2.844  1.00 0.96  ? 84  GLU A CB   1  
ATOM 1295   C CG   . GLU A 1 84  ? 6.275   22.714  -1.869  1.00 1.07  ? 84  GLU A CG   1  
ATOM 1296   C CD   . GLU A 1 84  ? 7.432   21.714  -1.997  1.00 1.87  ? 84  GLU A CD   1  
ATOM 1297   O OE1  . GLU A 1 84  ? 7.251   20.709  -2.666  1.00 2.53  ? 84  GLU A OE1  1  
ATOM 1298   O OE2  . GLU A 1 84  ? 8.484   21.972  -1.430  1.00 2.52  ? 84  GLU A OE2  1  
ATOM 1299   H H    . GLU A 1 84  ? 3.403   22.395  -0.909  1.00 0.86  ? 84  GLU A H    1  
ATOM 1300   H HA   . GLU A 1 84  ? 4.394   24.342  -2.835  1.00 0.95  ? 84  GLU A HA   1  
ATOM 1301   H HB2  . GLU A 1 84  ? 4.791   21.343  -2.596  1.00 0.92  ? 84  GLU A HB2  1  
ATOM 1302   H HB3  . GLU A 1 84  ? 5.548   22.323  -3.850  1.00 1.01  ? 84  GLU A HB3  1  
ATOM 1303   H HG2  . GLU A 1 84  ? 6.630   23.708  -2.100  1.00 1.48  ? 84  GLU A HG2  1  
ATOM 1304   H HG3  . GLU A 1 84  ? 5.895   22.692  -0.859  1.00 1.32  ? 84  GLU A HG3  1  
ATOM 1305   N N    . LEU A 1 85  ? 2.066   22.218  -3.666  1.00 0.73  ? 85  LEU A N    1  
ATOM 1306   C CA   . LEU A 1 85  ? 1.060   21.901  -4.722  1.00 0.66  ? 85  LEU A CA   1  
ATOM 1307   C C    . LEU A 1 85  ? 0.117   23.087  -4.935  1.00 0.61  ? 85  LEU A C    1  
ATOM 1308   O O    . LEU A 1 85  ? -0.217  23.434  -6.048  1.00 0.62  ? 85  LEU A O    1  
ATOM 1309   C CB   . LEU A 1 85  ? 0.235   20.687  -4.292  1.00 0.63  ? 85  LEU A CB   1  
ATOM 1310   C CG   . LEU A 1 85  ? 1.114   19.429  -4.247  1.00 0.70  ? 85  LEU A CG   1  
ATOM 1311   C CD1  . LEU A 1 85  ? 0.329   18.294  -3.580  1.00 0.71  ? 85  LEU A CD1  1  
ATOM 1312   C CD2  . LEU A 1 85  ? 1.521   19.005  -5.673  1.00 0.80  ? 85  LEU A CD2  1  
ATOM 1313   H H    . LEU A 1 85  ? 2.018   21.792  -2.786  1.00 0.74  ? 85  LEU A H    1  
ATOM 1314   H HA   . LEU A 1 85  ? 1.566   21.683  -5.646  1.00 0.70  ? 85  LEU A HA   1  
ATOM 1315   H HB2  . LEU A 1 85  ? -0.177  20.872  -3.311  1.00 0.61  ? 85  LEU A HB2  1  
ATOM 1316   H HB3  . LEU A 1 85  ? -0.574  20.537  -4.992  1.00 0.62  ? 85  LEU A HB3  1  
ATOM 1317   H HG   . LEU A 1 85  ? 2.002   19.637  -3.666  1.00 0.73  ? 85  LEU A HG   1  
ATOM 1318   H HD11 . LEU A 1 85  ? -0.105  18.647  -2.656  1.00 1.29  ? 85  LEU A HD11 1  
ATOM 1319   H HD12 . LEU A 1 85  ? -0.455  17.963  -4.243  1.00 1.19  ? 85  LEU A HD12 1  
ATOM 1320   H HD13 . LEU A 1 85  ? 0.995   17.472  -3.370  1.00 1.19  ? 85  LEU A HD13 1  
ATOM 1321   H HD21 . LEU A 1 85  ? 0.711   19.199  -6.360  1.00 1.34  ? 85  LEU A HD21 1  
ATOM 1322   H HD22 . LEU A 1 85  ? 2.394   19.562  -5.980  1.00 1.19  ? 85  LEU A HD22 1  
ATOM 1323   H HD23 . LEU A 1 85  ? 1.757   17.951  -5.686  1.00 1.36  ? 85  LEU A HD23 1  
ATOM 1324   N N    . GLU A 1 86  ? -0.337  23.696  -3.877  1.00 0.62  ? 86  GLU A N    1  
ATOM 1325   C CA   . GLU A 1 86  ? -1.283  24.839  -4.031  1.00 0.62  ? 86  GLU A CA   1  
ATOM 1326   C C    . GLU A 1 86  ? -0.636  25.963  -4.839  1.00 0.66  ? 86  GLU A C    1  
ATOM 1327   O O    . GLU A 1 86  ? -1.257  26.562  -5.695  1.00 0.63  ? 86  GLU A O    1  
ATOM 1328   C CB   . GLU A 1 86  ? -1.676  25.370  -2.650  1.00 0.68  ? 86  GLU A CB   1  
ATOM 1329   C CG   . GLU A 1 86  ? -2.794  26.405  -2.800  1.00 0.81  ? 86  GLU A CG   1  
ATOM 1330   C CD   . GLU A 1 86  ? -3.290  26.832  -1.416  1.00 0.84  ? 86  GLU A CD   1  
ATOM 1331   O OE1  . GLU A 1 86  ? -2.789  26.302  -0.439  1.00 1.35  ? 86  GLU A OE1  1  
ATOM 1332   O OE2  . GLU A 1 86  ? -4.166  27.680  -1.359  1.00 1.42  ? 86  GLU A OE2  1  
ATOM 1333   H H    . GLU A 1 86  ? -0.072  23.388  -2.983  1.00 0.66  ? 86  GLU A H    1  
ATOM 1334   H HA   . GLU A 1 86  ? -2.169  24.500  -4.545  1.00 0.57  ? 86  GLU A HA   1  
ATOM 1335   H HB2  . GLU A 1 86  ? -2.019  24.552  -2.034  1.00 0.69  ? 86  GLU A HB2  1  
ATOM 1336   H HB3  . GLU A 1 86  ? -0.818  25.835  -2.185  1.00 0.74  ? 86  GLU A HB3  1  
ATOM 1337   H HG2  . GLU A 1 86  ? -2.418  27.267  -3.331  1.00 0.94  ? 86  GLU A HG2  1  
ATOM 1338   H HG3  . GLU A 1 86  ? -3.614  25.971  -3.354  1.00 0.93  ? 86  GLU A HG3  1  
ATOM 1339   N N    . GLN A 1 87  ? 0.597   26.272  -4.565  1.00 0.76  ? 87  GLN A N    1  
ATOM 1340   C CA   . GLN A 1 87  ? 1.267   27.375  -5.309  1.00 0.83  ? 87  GLN A CA   1  
ATOM 1341   C C    . GLN A 1 87  ? 1.529   26.969  -6.769  1.00 0.79  ? 87  GLN A C    1  
ATOM 1342   O O    . GLN A 1 87  ? 1.337   27.750  -7.680  1.00 0.81  ? 87  GLN A O    1  
ATOM 1343   C CB   . GLN A 1 87  ? 2.594   27.703  -4.617  1.00 0.95  ? 87  GLN A CB   1  
ATOM 1344   C CG   . GLN A 1 87  ? 2.319   28.138  -3.173  1.00 1.02  ? 87  GLN A CG   1  
ATOM 1345   C CD   . GLN A 1 87  ? 3.639   28.466  -2.472  1.00 1.22  ? 87  GLN A CD   1  
ATOM 1346   O OE1  . GLN A 1 87  ? 4.585   28.897  -3.100  1.00 1.71  ? 87  GLN A OE1  1  
ATOM 1347   N NE2  . GLN A 1 87  ? 3.746   28.269  -1.184  1.00 1.69  ? 87  GLN A NE2  1  
ATOM 1348   H H    . GLN A 1 87  ? 1.080   25.787  -3.861  1.00 0.81  ? 87  GLN A H    1  
ATOM 1349   H HA   . GLN A 1 87  ? 0.634   28.249  -5.291  1.00 0.84  ? 87  GLN A HA   1  
ATOM 1350   H HB2  . GLN A 1 87  ? 3.228   26.828  -4.617  1.00 0.97  ? 87  GLN A HB2  1  
ATOM 1351   H HB3  . GLN A 1 87  ? 3.085   28.505  -5.146  1.00 1.01  ? 87  GLN A HB3  1  
ATOM 1352   H HG2  . GLN A 1 87  ? 1.686   29.014  -3.178  1.00 1.06  ? 87  GLN A HG2  1  
ATOM 1353   H HG3  . GLN A 1 87  ? 1.823   27.339  -2.644  1.00 0.95  ? 87  GLN A HG3  1  
ATOM 1354   H HE21 . GLN A 1 87  ? 2.985   27.915  -0.677  1.00 2.27  ? 87  GLN A HE21 1  
ATOM 1355   H HE22 . GLN A 1 87  ? 4.587   28.474  -0.725  1.00 1.81  ? 87  GLN A HE22 1  
ATOM 1356   N N    . GLU A 1 88  ? 1.983   25.764  -7.000  1.00 0.77  ? 88  GLU A N    1  
ATOM 1357   C CA   . GLU A 1 88  ? 2.276   25.327  -8.402  1.00 0.77  ? 88  GLU A CA   1  
ATOM 1358   C C    . GLU A 1 88  ? 0.987   25.148  -9.211  1.00 0.69  ? 88  GLU A C    1  
ATOM 1359   O O    . GLU A 1 88  ? 0.918   25.494  -10.374 1.00 0.70  ? 88  GLU A O    1  
ATOM 1360   C CB   . GLU A 1 88  ? 3.033   23.998  -8.361  1.00 0.81  ? 88  GLU A CB   1  
ATOM 1361   C CG   . GLU A 1 88  ? 4.441   24.237  -7.817  1.00 0.91  ? 88  GLU A CG   1  
ATOM 1362   C CD   . GLU A 1 88  ? 5.198   22.911  -7.750  1.00 1.00  ? 88  GLU A CD   1  
ATOM 1363   O OE1  . GLU A 1 88  ? 5.735   22.507  -8.768  1.00 1.57  ? 88  GLU A OE1  1  
ATOM 1364   O OE2  . GLU A 1 88  ? 5.229   22.322  -6.682  1.00 1.39  ? 88  GLU A OE2  1  
ATOM 1365   H H    . GLU A 1 88  ? 2.146   25.152  -6.254  1.00 0.76  ? 88  GLU A H    1  
ATOM 1366   H HA   . GLU A 1 88  ? 2.893   26.070  -8.882  1.00 0.83  ? 88  GLU A HA   1  
ATOM 1367   H HB2  . GLU A 1 88  ? 2.509   23.305  -7.719  1.00 0.78  ? 88  GLU A HB2  1  
ATOM 1368   H HB3  . GLU A 1 88  ? 3.099   23.588  -9.358  1.00 0.83  ? 88  GLU A HB3  1  
ATOM 1369   H HG2  . GLU A 1 88  ? 4.967   24.922  -8.466  1.00 0.95  ? 88  GLU A HG2  1  
ATOM 1370   H HG3  . GLU A 1 88  ? 4.374   24.662  -6.826  1.00 0.96  ? 88  GLU A HG3  1  
ATOM 1371   N N    . ILE A 1 89  ? -0.029  24.605  -8.605  1.00 0.62  ? 89  ILE A N    1  
ATOM 1372   C CA   . ILE A 1 89  ? -1.311  24.390  -9.336  1.00 0.58  ? 89  ILE A CA   1  
ATOM 1373   C C    . ILE A 1 89  ? -1.914  25.738  -9.743  1.00 0.59  ? 89  ILE A C    1  
ATOM 1374   O O    . ILE A 1 89  ? -2.289  25.950  -10.879 1.00 0.65  ? 89  ILE A O    1  
ATOM 1375   C CB   . ILE A 1 89  ? -2.282  23.636  -8.425  1.00 0.54  ? 89  ILE A CB   1  
ATOM 1376   C CG1  . ILE A 1 89  ? -1.772  22.207  -8.221  1.00 0.53  ? 89  ILE A CG1  1  
ATOM 1377   C CG2  . ILE A 1 89  ? -3.676  23.595  -9.064  1.00 0.56  ? 89  ILE A CG2  1  
ATOM 1378   C CD1  . ILE A 1 89  ? -2.539  21.561  -7.069  1.00 0.54  ? 89  ILE A CD1  1  
ATOM 1379   H H    . ILE A 1 89  ? 0.051   24.341  -7.666  1.00 0.62  ? 89  ILE A H    1  
ATOM 1380   H HA   . ILE A 1 89  ? -1.124  23.802  -10.222 1.00 0.61  ? 89  ILE A HA   1  
ATOM 1381   H HB   . ILE A 1 89  ? -2.341  24.138  -7.469  1.00 0.54  ? 89  ILE A HB   1  
ATOM 1382   H HG12 . ILE A 1 89  ? -1.928  21.637  -9.125  1.00 0.56  ? 89  ILE A HG12 1  
ATOM 1383   H HG13 . ILE A 1 89  ? -0.721  22.228  -7.983  1.00 0.55  ? 89  ILE A HG13 1  
ATOM 1384   H HG21 . ILE A 1 89  ? -3.583  23.389  -10.120 1.00 1.19  ? 89  ILE A HG21 1  
ATOM 1385   H HG22 . ILE A 1 89  ? -4.267  22.820  -8.597  1.00 1.08  ? 89  ILE A HG22 1  
ATOM 1386   H HG23 . ILE A 1 89  ? -4.162  24.550  -8.925  1.00 1.19  ? 89  ILE A HG23 1  
ATOM 1387   H HD11 . ILE A 1 89  ? -3.597  21.677  -7.237  1.00 1.17  ? 89  ILE A HD11 1  
ATOM 1388   H HD12 . ILE A 1 89  ? -2.295  20.510  -7.018  1.00 1.06  ? 89  ILE A HD12 1  
ATOM 1389   H HD13 . ILE A 1 89  ? -2.266  22.040  -6.141  1.00 1.12  ? 89  ILE A HD13 1  
ATOM 1390   N N    . ILE A 1 90  ? -2.016  26.645  -8.813  1.00 0.60  ? 90  ILE A N    1  
ATOM 1391   C CA   . ILE A 1 90  ? -2.599  27.981  -9.118  1.00 0.65  ? 90  ILE A CA   1  
ATOM 1392   C C    . ILE A 1 90  ? -1.653  28.776  -10.025 1.00 0.69  ? 90  ILE A C    1  
ATOM 1393   O O    . ILE A 1 90  ? -2.087  29.530  -10.873 1.00 0.74  ? 90  ILE A O    1  
ATOM 1394   C CB   . ILE A 1 90  ? -2.842  28.740  -7.808  1.00 0.71  ? 90  ILE A CB   1  
ATOM 1395   C CG1  . ILE A 1 90  ? -3.868  27.969  -6.965  1.00 0.71  ? 90  ILE A CG1  1  
ATOM 1396   C CG2  . ILE A 1 90  ? -3.384  30.138  -8.113  1.00 0.82  ? 90  ILE A CG2  1  
ATOM 1397   C CD1  . ILE A 1 90  ? -4.035  28.630  -5.589  1.00 0.79  ? 90  ILE A CD1  1  
ATOM 1398   H H    . ILE A 1 90  ? -1.713  26.443  -7.905  1.00 0.61  ? 90  ILE A H    1  
ATOM 1399   H HA   . ILE A 1 90  ? -3.539  27.849  -9.624  1.00 0.65  ? 90  ILE A HA   1  
ATOM 1400   H HB   . ILE A 1 90  ? -1.913  28.823  -7.263  1.00 0.72  ? 90  ILE A HB   1  
ATOM 1401   H HG12 . ILE A 1 90  ? -4.820  27.966  -7.477  1.00 0.75  ? 90  ILE A HG12 1  
ATOM 1402   H HG13 . ILE A 1 90  ? -3.531  26.952  -6.832  1.00 0.64  ? 90  ILE A HG13 1  
ATOM 1403   H HG21 . ILE A 1 90  ? -4.256  30.057  -8.745  1.00 1.38  ? 90  ILE A HG21 1  
ATOM 1404   H HG22 . ILE A 1 90  ? -3.652  30.631  -7.191  1.00 1.31  ? 90  ILE A HG22 1  
ATOM 1405   H HG23 . ILE A 1 90  ? -2.626  30.715  -8.617  1.00 1.25  ? 90  ILE A HG23 1  
ATOM 1406   H HD11 . ILE A 1 90  ? -3.089  29.032  -5.256  1.00 1.14  ? 90  ILE A HD11 1  
ATOM 1407   H HD12 . ILE A 1 90  ? -4.759  29.428  -5.662  1.00 1.34  ? 90  ILE A HD12 1  
ATOM 1408   H HD13 . ILE A 1 90  ? -4.383  27.895  -4.878  1.00 1.39  ? 90  ILE A HD13 1  
ATOM 1409   N N    . ALA A 1 91  ? -0.371  28.628  -9.848  1.00 0.68  ? 91  ALA A N    1  
ATOM 1410   C CA   . ALA A 1 91  ? 0.593   29.389  -10.695 1.00 0.73  ? 91  ALA A CA   1  
ATOM 1411   C C    . ALA A 1 91  ? 0.433   29.016  -12.173 1.00 0.69  ? 91  ALA A C    1  
ATOM 1412   O O    . ALA A 1 91  ? 0.407   29.874  -13.032 1.00 0.71  ? 91  ALA A O    1  
ATOM 1413   C CB   . ALA A 1 91  ? 2.023   29.081  -10.250 1.00 0.79  ? 91  ALA A CB   1  
ATOM 1414   H H    . ALA A 1 91  ? -0.041  28.013  -9.159  1.00 0.67  ? 91  ALA A H    1  
ATOM 1415   H HA   . ALA A 1 91  ? 0.406   30.443  -10.577 1.00 0.78  ? 91  ALA A HA   1  
ATOM 1416   H HB1  . ALA A 1 91  ? 2.139   28.016  -10.122 1.00 1.22  ? 91  ALA A HB1  1  
ATOM 1417   H HB2  . ALA A 1 91  ? 2.716   29.432  -11.002 1.00 1.28  ? 91  ALA A HB2  1  
ATOM 1418   H HB3  . ALA A 1 91  ? 2.225   29.581  -9.313  1.00 1.39  ? 91  ALA A HB3  1  
ATOM 1419   N N    . LEU A 1 92  ? 0.339   27.751  -12.485 1.00 0.64  ? 92  LEU A N    1  
ATOM 1420   C CA   . LEU A 1 92  ? 0.196   27.344  -13.916 1.00 0.63  ? 92  LEU A CA   1  
ATOM 1421   C C    . LEU A 1 92  ? -1.078  27.946  -14.505 1.00 0.62  ? 92  LEU A C    1  
ATOM 1422   O O    . LEU A 1 92  ? -1.072  28.514  -15.579 1.00 0.71  ? 92  LEU A O    1  
ATOM 1423   C CB   . LEU A 1 92  ? 0.111   25.817  -13.996 1.00 0.62  ? 92  LEU A CB   1  
ATOM 1424   C CG   . LEU A 1 92  ? 1.438   25.185  -13.549 1.00 0.72  ? 92  LEU A CG   1  
ATOM 1425   C CD1  . LEU A 1 92  ? 1.239   23.677  -13.375 1.00 0.69  ? 92  LEU A CD1  1  
ATOM 1426   C CD2  . LEU A 1 92  ? 2.537   25.437  -14.598 1.00 0.95  ? 92  LEU A CD2  1  
ATOM 1427   H H    . LEU A 1 92  ? 0.360   27.060  -11.793 1.00 0.63  ? 92  LEU A H    1  
ATOM 1428   H HA   . LEU A 1 92  ? 1.047   27.691  -14.479 1.00 0.67  ? 92  LEU A HA   1  
ATOM 1429   H HB2  . LEU A 1 92  ? -0.683  25.472  -13.350 1.00 0.63  ? 92  LEU A HB2  1  
ATOM 1430   H HB3  . LEU A 1 92  ? -0.104  25.522  -15.012 1.00 0.66  ? 92  LEU A HB3  1  
ATOM 1431   H HG   . LEU A 1 92  ? 1.735   25.616  -12.603 1.00 0.83  ? 92  LEU A HG   1  
ATOM 1432   H HD11 . LEU A 1 92  ? 0.909   23.248  -14.310 1.00 1.32  ? 92  LEU A HD11 1  
ATOM 1433   H HD12 . LEU A 1 92  ? 2.172   23.222  -13.080 1.00 1.20  ? 92  LEU A HD12 1  
ATOM 1434   H HD13 . LEU A 1 92  ? 0.494   23.497  -12.614 1.00 1.15  ? 92  LEU A HD13 1  
ATOM 1435   H HD21 . LEU A 1 92  ? 2.123   25.344  -15.590 1.00 1.36  ? 92  LEU A HD21 1  
ATOM 1436   H HD22 . LEU A 1 92  ? 2.942   26.429  -14.468 1.00 1.50  ? 92  LEU A HD22 1  
ATOM 1437   H HD23 . LEU A 1 92  ? 3.330   24.713  -14.473 1.00 1.44  ? 92  LEU A HD23 1  
ATOM 1438   N N    . ILE A 1 93  ? -2.169  27.826  -13.806 1.00 0.56  ? 93  ILE A N    1  
ATOM 1439   C CA   . ILE A 1 93  ? -3.451  28.392  -14.309 1.00 0.58  ? 93  ILE A CA   1  
ATOM 1440   C C    . ILE A 1 93  ? -3.291  29.901  -14.486 1.00 0.64  ? 93  ILE A C    1  
ATOM 1441   O O    . ILE A 1 93  ? -3.618  30.467  -15.504 1.00 0.66  ? 93  ILE A O    1  
ATOM 1442   C CB   . ILE A 1 93  ? -4.549  28.122  -13.280 1.00 0.60  ? 93  ILE A CB   1  
ATOM 1443   C CG1  . ILE A 1 93  ? -4.720  26.606  -13.091 1.00 0.58  ? 93  ILE A CG1  1  
ATOM 1444   C CG2  . ILE A 1 93  ? -5.862  28.732  -13.778 1.00 0.65  ? 93  ILE A CG2  1  
ATOM 1445   C CD1  . ILE A 1 93  ? -5.442  26.327  -11.769 1.00 0.60  ? 93  ILE A CD1  1  
ATOM 1446   H H    . ILE A 1 93  ? -2.143  27.370  -12.938 1.00 0.57  ? 93  ILE A H    1  
ATOM 1447   H HA   . ILE A 1 93  ? -3.711  27.936  -15.252 1.00 0.57  ? 93  ILE A HA   1  
ATOM 1448   H HB   . ILE A 1 93  ? -4.276  28.578  -12.338 1.00 0.63  ? 93  ILE A HB   1  
ATOM 1449   H HG12 . ILE A 1 93  ? -5.298  26.200  -13.910 1.00 0.60  ? 93  ILE A HG12 1  
ATOM 1450   H HG13 . ILE A 1 93  ? -3.748  26.132  -13.071 1.00 0.58  ? 93  ILE A HG13 1  
ATOM 1451   H HG21 . ILE A 1 93  ? -6.040  28.419  -14.795 1.00 1.29  ? 93  ILE A HG21 1  
ATOM 1452   H HG22 . ILE A 1 93  ? -6.675  28.399  -13.151 1.00 1.17  ? 93  ILE A HG22 1  
ATOM 1453   H HG23 . ILE A 1 93  ? -5.794  29.809  -13.738 1.00 1.13  ? 93  ILE A HG23 1  
ATOM 1454   H HD11 . ILE A 1 93  ? -6.234  27.049  -11.628 1.00 1.13  ? 93  ILE A HD11 1  
ATOM 1455   H HD12 . ILE A 1 93  ? -5.862  25.333  -11.788 1.00 1.15  ? 93  ILE A HD12 1  
ATOM 1456   H HD13 . ILE A 1 93  ? -4.739  26.400  -10.954 1.00 1.21  ? 93  ILE A HD13 1  
ATOM 1457   N N    . LYS A 1 94  ? -2.790  30.540  -13.476 1.00 0.69  ? 94  LYS A N    1  
ATOM 1458   C CA   . LYS A 1 94  ? -2.600  32.019  -13.544 1.00 0.78  ? 94  LYS A CA   1  
ATOM 1459   C C    . LYS A 1 94  ? -1.481  32.389  -14.524 1.00 0.80  ? 94  LYS A C    1  
ATOM 1460   O O    . LYS A 1 94  ? -1.577  33.369  -15.236 1.00 0.84  ? 94  LYS A O    1  
ATOM 1461   C CB   . LYS A 1 94  ? -2.243  32.584  -12.164 1.00 0.86  ? 94  LYS A CB   1  
ATOM 1462   C CG   . LYS A 1 94  ? -3.451  32.507  -11.231 1.00 0.94  ? 94  LYS A CG   1  
ATOM 1463   C CD   . LYS A 1 94  ? -3.156  33.313  -9.965  1.00 1.00  ? 94  LYS A CD   1  
ATOM 1464   C CE   . LYS A 1 94  ? -4.399  33.341  -9.076  1.00 1.48  ? 94  LYS A CE   1  
ATOM 1465   N NZ   . LYS A 1 94  ? -5.445  34.188  -9.715  1.00 2.20  ? 94  LYS A NZ   1  
ATOM 1466   H H    . LYS A 1 94  ? -2.551  30.023  -12.680 1.00 0.69  ? 94  LYS A H    1  
ATOM 1467   H HA   . LYS A 1 94  ? -3.519  32.471  -13.880 1.00 0.79  ? 94  LYS A HA   1  
ATOM 1468   H HB2  . LYS A 1 94  ? -1.428  32.012  -11.741 1.00 0.83  ? 94  LYS A HB2  1  
ATOM 1469   H HB3  . LYS A 1 94  ? -1.940  33.614  -12.268 1.00 0.97  ? 94  LYS A HB3  1  
ATOM 1470   H HG2  . LYS A 1 94  ? -4.318  32.914  -11.724 1.00 1.11  ? 94  LYS A HG2  1  
ATOM 1471   H HG3  . LYS A 1 94  ? -3.637  31.478  -10.965 1.00 1.00  ? 94  LYS A HG3  1  
ATOM 1472   H HD2  . LYS A 1 94  ? -2.337  32.858  -9.430  1.00 1.53  ? 94  LYS A HD2  1  
ATOM 1473   H HD3  . LYS A 1 94  ? -2.889  34.322  -10.237 1.00 1.50  ? 94  LYS A HD3  1  
ATOM 1474   H HE2  . LYS A 1 94  ? -4.775  32.337  -8.953  1.00 2.08  ? 94  LYS A HE2  1  
ATOM 1475   H HE3  . LYS A 1 94  ? -4.142  33.751  -8.111  1.00 1.98  ? 94  LYS A HE3  1  
ATOM 1476   H HZ1  . LYS A 1 94  ? -5.328  34.166  -10.748 1.00 2.64  ? 94  LYS A HZ1  1  
ATOM 1477   H HZ2  . LYS A 1 94  ? -6.386  33.824  -9.467  1.00 2.63  ? 94  LYS A HZ2  1  
ATOM 1478   H HZ3  . LYS A 1 94  ? -5.352  35.168  -9.376  1.00 2.62  ? 94  LYS A HZ3  1  
ATOM 1479   N N    . ASP A 1 95  ? -0.405  31.647  -14.549 1.00 0.79  ? 95  ASP A N    1  
ATOM 1480   C CA   . ASP A 1 95  ? 0.724   32.007  -15.463 1.00 0.84  ? 95  ASP A CA   1  
ATOM 1481   C C    . ASP A 1 95  ? 0.526   31.453  -16.882 1.00 0.80  ? 95  ASP A C    1  
ATOM 1482   O O    . ASP A 1 95  ? 0.547   32.189  -17.850 1.00 0.86  ? 95  ASP A O    1  
ATOM 1483   C CB   . ASP A 1 95  ? 2.031   31.451  -14.892 1.00 0.89  ? 95  ASP A CB   1  
ATOM 1484   C CG   . ASP A 1 95  ? 3.209   32.008  -15.694 1.00 1.02  ? 95  ASP A CG   1  
ATOM 1485   O OD1  . ASP A 1 95  ? 2.965   32.602  -16.731 1.00 1.65  ? 95  ASP A OD1  1  
ATOM 1486   O OD2  . ASP A 1 95  ? 4.334   31.831  -15.257 1.00 1.36  ? 95  ASP A OD2  1  
ATOM 1487   H H    . ASP A 1 95  ? -0.327  30.874  -13.948 1.00 0.76  ? 95  ASP A H    1  
ATOM 1488   H HA   . ASP A 1 95  ? 0.803   33.082  -15.518 1.00 0.90  ? 95  ASP A HA   1  
ATOM 1489   H HB2  . ASP A 1 95  ? 2.125   31.747  -13.858 1.00 0.93  ? 95  ASP A HB2  1  
ATOM 1490   H HB3  . ASP A 1 95  ? 2.026   30.374  -14.961 1.00 0.84  ? 95  ASP A HB3  1  
ATOM 1491   N N    . LYS A 1 96  ? 0.384   30.164  -17.022 1.00 0.74  ? 96  LYS A N    1  
ATOM 1492   C CA   . LYS A 1 96  ? 0.247   29.571  -18.391 1.00 0.74  ? 96  LYS A CA   1  
ATOM 1493   C C    . LYS A 1 96  ? -1.201  29.641  -18.889 1.00 0.70  ? 96  LYS A C    1  
ATOM 1494   O O    . LYS A 1 96  ? -1.495  29.216  -19.987 1.00 0.71  ? 96  LYS A O    1  
ATOM 1495   C CB   . LYS A 1 96  ? 0.697   28.107  -18.358 1.00 0.75  ? 96  LYS A CB   1  
ATOM 1496   C CG   . LYS A 1 96  ? 2.189   28.013  -18.003 1.00 0.86  ? 96  LYS A CG   1  
ATOM 1497   C CD   . LYS A 1 96  ? 3.053   28.300  -19.243 1.00 1.02  ? 96  LYS A CD   1  
ATOM 1498   C CE   . LYS A 1 96  ? 4.517   27.969  -18.943 1.00 1.40  ? 96  LYS A CE   1  
ATOM 1499   N NZ   . LYS A 1 96  ? 5.096   29.037  -18.086 1.00 2.03  ? 96  LYS A NZ   1  
ATOM 1500   H H    . LYS A 1 96  ? 0.411   29.587  -16.230 1.00 0.72  ? 96  LYS A H    1  
ATOM 1501   H HA   . LYS A 1 96  ? 0.873   30.117  -19.078 1.00 0.80  ? 96  LYS A HA   1  
ATOM 1502   H HB2  . LYS A 1 96  ? 0.118   27.570  -17.620 1.00 0.71  ? 96  LYS A HB2  1  
ATOM 1503   H HB3  . LYS A 1 96  ? 0.533   27.665  -19.328 1.00 0.79  ? 96  LYS A HB3  1  
ATOM 1504   H HG2  . LYS A 1 96  ? 2.420   28.732  -17.230 1.00 0.92  ? 96  LYS A HG2  1  
ATOM 1505   H HG3  . LYS A 1 96  ? 2.404   27.019  -17.640 1.00 0.86  ? 96  LYS A HG3  1  
ATOM 1506   H HD2  . LYS A 1 96  ? 2.714   27.694  -20.069 1.00 1.13  ? 96  LYS A HD2  1  
ATOM 1507   H HD3  . LYS A 1 96  ? 2.976   29.343  -19.508 1.00 1.41  ? 96  LYS A HD3  1  
ATOM 1508   H HE2  . LYS A 1 96  ? 4.580   27.020  -18.433 1.00 1.82  ? 96  LYS A HE2  1  
ATOM 1509   H HE3  . LYS A 1 96  ? 5.066   27.915  -19.871 1.00 1.96  ? 96  LYS A HE3  1  
ATOM 1510   H HZ1  . LYS A 1 96  ? 4.362   29.736  -17.861 1.00 2.50  ? 96  LYS A HZ1  1  
ATOM 1511   H HZ2  . LYS A 1 96  ? 5.458   28.617  -17.205 1.00 2.39  ? 96  LYS A HZ2  1  
ATOM 1512   H HZ3  . LYS A 1 96  ? 5.873   29.506  -18.593 1.00 2.50  ? 96  LYS A HZ3  1  
ATOM 1513   N N    . HIS A 1 97  ? -2.104  30.161  -18.103 1.00 0.69  ? 97  HIS A N    1  
ATOM 1514   C CA   . HIS A 1 97  ? -3.529  30.248  -18.551 1.00 0.71  ? 97  HIS A CA   1  
ATOM 1515   C C    . HIS A 1 97  ? -4.048  28.853  -18.907 1.00 0.68  ? 97  HIS A C    1  
ATOM 1516   O O    . HIS A 1 97  ? -4.805  28.678  -19.841 1.00 0.74  ? 97  HIS A O    1  
ATOM 1517   C CB   . HIS A 1 97  ? -3.637  31.172  -19.770 1.00 0.79  ? 97  HIS A CB   1  
ATOM 1518   C CG   . HIS A 1 97  ? -3.086  32.523  -19.413 1.00 0.93  ? 97  HIS A CG   1  
ATOM 1519   N ND1  . HIS A 1 97  ? -3.554  33.250  -18.327 1.00 1.42  ? 97  HIS A ND1  1  
ATOM 1520   C CD2  . HIS A 1 97  ? -2.100  33.291  -19.981 1.00 1.28  ? 97  HIS A CD2  1  
ATOM 1521   C CE1  . HIS A 1 97  ? -2.855  34.399  -18.276 1.00 1.41  ? 97  HIS A CE1  1  
ATOM 1522   N NE2  . HIS A 1 97  ? -1.959  34.471  -19.261 1.00 1.26  ? 97  HIS A NE2  1  
ATOM 1523   H H    . HIS A 1 97  ? -1.852  30.486  -17.214 1.00 0.71  ? 97  HIS A H    1  
ATOM 1524   H HA   . HIS A 1 97  ? -4.129  30.653  -17.750 1.00 0.72  ? 97  HIS A HA   1  
ATOM 1525   H HB2  . HIS A 1 97  ? -3.081  30.760  -20.595 1.00 0.82  ? 97  HIS A HB2  1  
ATOM 1526   H HB3  . HIS A 1 97  ? -4.674  31.275  -20.052 1.00 0.80  ? 97  HIS A HB3  1  
ATOM 1527   H HD2  . HIS A 1 97  ? -1.523  33.019  -20.852 1.00 1.88  ? 97  HIS A HD2  1  
ATOM 1528   H HE1  . HIS A 1 97  ? -2.999  35.164  -17.528 1.00 1.88  ? 97  HIS A HE1  1  
ATOM 1529   H HE2  . HIS A 1 97  ? -1.331  35.201  -19.438 1.00 1.51  ? 97  HIS A HE2  1  
ATOM 1530   N N    . MET A 1 98  ? -3.629  27.858  -18.170 1.00 0.62  ? 98  MET A N    1  
ATOM 1531   C CA   . MET A 1 98  ? -4.082  26.461  -18.457 1.00 0.62  ? 98  MET A CA   1  
ATOM 1532   C C    . MET A 1 98  ? -5.356  26.153  -17.670 1.00 0.61  ? 98  MET A C    1  
ATOM 1533   O O    . MET A 1 98  ? -5.747  26.885  -16.782 1.00 0.62  ? 98  MET A O    1  
ATOM 1534   C CB   . MET A 1 98  ? -2.986  25.465  -18.069 1.00 0.61  ? 98  MET A CB   1  
ATOM 1535   C CG   . MET A 1 98  ? -1.865  25.517  -19.109 1.00 0.68  ? 98  MET A CG   1  
ATOM 1536   S SD   . MET A 1 98  ? -0.562  24.342  -18.660 1.00 0.78  ? 98  MET A SD   1  
ATOM 1537   C CE   . MET A 1 98  ? 0.439   24.516  -20.161 1.00 1.18  ? 98  MET A CE   1  
ATOM 1538   H H    . MET A 1 98  ? -2.999  28.044  -17.441 1.00 0.59  ? 98  MET A H    1  
ATOM 1539   H HA   . MET A 1 98  ? -4.291  26.361  -19.514 1.00 0.68  ? 98  MET A HA   1  
ATOM 1540   H HB2  . MET A 1 98  ? -2.590  25.726  -17.098 1.00 0.57  ? 98  MET A HB2  1  
ATOM 1541   H HB3  . MET A 1 98  ? -3.398  24.468  -18.035 1.00 0.62  ? 98  MET A HB3  1  
ATOM 1542   H HG2  . MET A 1 98  ? -2.263  25.262  -20.080 1.00 0.74  ? 98  MET A HG2  1  
ATOM 1543   H HG3  . MET A 1 98  ? -1.456  26.514  -19.140 1.00 0.74  ? 98  MET A HG3  1  
ATOM 1544   H HE1  . MET A 1 98  ? 0.349   25.520  -20.542 1.00 1.61  ? 98  MET A HE1  1  
ATOM 1545   H HE2  . MET A 1 98  ? 1.475   24.314  -19.926 1.00 1.69  ? 98  MET A HE2  1  
ATOM 1546   H HE3  . MET A 1 98  ? 0.092   23.816  -20.909 1.00 1.71  ? 98  MET A HE3  1  
ATOM 1547   N N    . THR A 1 99  ? -6.006  25.068  -17.995 1.00 0.65  ? 99  THR A N    1  
ATOM 1548   C CA   . THR A 1 99  ? -7.256  24.696  -17.277 1.00 0.68  ? 99  THR A CA   1  
ATOM 1549   C C    . THR A 1 99  ? -6.897  24.014  -15.954 1.00 0.62  ? 99  THR A C    1  
ATOM 1550   O O    . THR A 1 99  ? -5.794  23.539  -15.772 1.00 0.62  ? 99  THR A O    1  
ATOM 1551   C CB   . THR A 1 99  ? -8.064  23.733  -18.153 1.00 0.77  ? 99  THR A CB   1  
ATOM 1552   O OG1  . THR A 1 99  ? -7.274  22.591  -18.445 1.00 0.81  ? 99  THR A OG1  1  
ATOM 1553   C CG2  . THR A 1 99  ? -8.455  24.428  -19.458 1.00 0.98  ? 99  THR A CG2  1  
ATOM 1554   H H    . THR A 1 99  ? -5.670  24.492  -18.712 1.00 0.67  ? 99  THR A H    1  
ATOM 1555   H HA   . THR A 1 99  ? -7.840  25.584  -17.082 1.00 0.72  ? 99  THR A HA   1  
ATOM 1556   H HB   . THR A 1 99  ? -8.958  23.431  -17.629 1.00 0.83  ? 99  THR A HB   1  
ATOM 1557   H HG1  . THR A 1 99  ? -6.810  22.756  -19.269 1.00 1.20  ? 99  THR A HG1  1  
ATOM 1558   H HG21 . THR A 1 99  ? -7.580  24.879  -19.902 1.00 1.61  ? 99  THR A HG21 1  
ATOM 1559   H HG22 . THR A 1 99  ? -8.871  23.702  -20.141 1.00 1.55  ? 99  THR A HG22 1  
ATOM 1560   H HG23 . THR A 1 99  ? -9.190  25.193  -19.254 1.00 1.13  ? 99  THR A HG23 1  
ATOM 1561   N N    . ALA A 1 100 ? -7.814  23.966  -15.025 1.00 0.62  ? 100 ALA A N    1  
ATOM 1562   C CA   . ALA A 1 100 ? -7.513  23.319  -13.714 1.00 0.57  ? 100 ALA A CA   1  
ATOM 1563   C C    . ALA A 1 100 ? -7.347  21.813  -13.899 1.00 0.55  ? 100 ALA A C    1  
ATOM 1564   O O    . ALA A 1 100 ? -6.474  21.198  -13.319 1.00 0.49  ? 100 ALA A O    1  
ATOM 1565   C CB   . ALA A 1 100 ? -8.662  23.576  -12.742 1.00 0.64  ? 100 ALA A CB   1  
ATOM 1566   H H    . ALA A 1 100 ? -8.698  24.358  -15.187 1.00 0.68  ? 100 ALA A H    1  
ATOM 1567   H HA   . ALA A 1 100 ? -6.603  23.732  -13.310 1.00 0.54  ? 100 ALA A HA   1  
ATOM 1568   H HB1  . ALA A 1 100 ? -9.576  23.171  -13.151 1.00 1.33  ? 100 ALA A HB1  1  
ATOM 1569   H HB2  . ALA A 1 100 ? -8.446  23.094  -11.800 1.00 1.21  ? 100 ALA A HB2  1  
ATOM 1570   H HB3  . ALA A 1 100 ? -8.774  24.639  -12.589 1.00 1.02  ? 100 ALA A HB3  1  
ATOM 1571   N N    . ASP A 1 101 ? -8.174  21.213  -14.705 1.00 0.62  ? 101 ASP A N    1  
ATOM 1572   C CA   . ASP A 1 101 ? -8.054  19.749  -14.928 1.00 0.64  ? 101 ASP A CA   1  
ATOM 1573   C C    . ASP A 1 101 ? -6.716  19.451  -15.606 1.00 0.62  ? 101 ASP A C    1  
ATOM 1574   O O    . ASP A 1 101 ? -6.070  18.466  -15.320 1.00 0.62  ? 101 ASP A O    1  
ATOM 1575   C CB   . ASP A 1 101 ? -9.210  19.276  -15.815 1.00 0.76  ? 101 ASP A CB   1  
ATOM 1576   C CG   . ASP A 1 101 ? -9.165  20.018  -17.150 1.00 1.32  ? 101 ASP A CG   1  
ATOM 1577   O OD1  . ASP A 1 101 ? -8.566  21.077  -17.195 1.00 2.00  ? 101 ASP A OD1  1  
ATOM 1578   O OD2  . ASP A 1 101 ? -9.739  19.517  -18.104 1.00 2.07  ? 101 ASP A OD2  1  
ATOM 1579   H H    . ASP A 1 101 ? -8.869  21.724  -15.168 1.00 0.69  ? 101 ASP A H    1  
ATOM 1580   H HA   . ASP A 1 101 ? -8.097  19.239  -13.978 1.00 0.61  ? 101 ASP A HA   1  
ATOM 1581   H HB2  . ASP A 1 101 ? -9.119  18.213  -15.988 1.00 1.38  ? 101 ASP A HB2  1  
ATOM 1582   H HB3  . ASP A 1 101 ? -10.148 19.482  -15.324 1.00 1.22  ? 101 ASP A HB3  1  
ATOM 1583   N N    . ALA A 1 102 ? -6.283  20.305  -16.489 1.00 0.65  ? 102 ALA A N    1  
ATOM 1584   C CA   . ALA A 1 102 ? -4.980  20.074  -17.171 1.00 0.67  ? 102 ALA A CA   1  
ATOM 1585   C C    . ALA A 1 102 ? -3.832  20.526  -16.265 1.00 0.59  ? 102 ALA A C    1  
ATOM 1586   O O    . ALA A 1 102 ? -2.860  19.823  -16.075 1.00 0.62  ? 102 ALA A O    1  
ATOM 1587   C CB   . ALA A 1 102 ? -4.943  20.882  -18.467 1.00 0.73  ? 102 ALA A CB   1  
ATOM 1588   H H    . ALA A 1 102 ? -6.801  21.113  -16.688 1.00 0.68  ? 102 ALA A H    1  
ATOM 1589   H HA   . ALA A 1 102 ? -4.870  19.025  -17.397 1.00 0.73  ? 102 ALA A HA   1  
ATOM 1590   H HB1  . ALA A 1 102 ? -5.860  20.726  -19.016 1.00 1.37  ? 102 ALA A HB1  1  
ATOM 1591   H HB2  . ALA A 1 102 ? -4.840  21.932  -18.233 1.00 1.20  ? 102 ALA A HB2  1  
ATOM 1592   H HB3  . ALA A 1 102 ? -4.105  20.563  -19.068 1.00 1.15  ? 102 ALA A HB3  1  
ATOM 1593   N N    . ALA A 1 103 ? -3.935  21.707  -15.724 1.00 0.54  ? 103 ALA A N    1  
ATOM 1594   C CA   . ALA A 1 103 ? -2.847  22.232  -14.845 1.00 0.50  ? 103 ALA A CA   1  
ATOM 1595   C C    . ALA A 1 103 ? -2.645  21.330  -13.627 1.00 0.50  ? 103 ALA A C    1  
ATOM 1596   O O    . ALA A 1 103 ? -1.535  20.967  -13.295 1.00 0.52  ? 103 ALA A O    1  
ATOM 1597   C CB   . ALA A 1 103 ? -3.208  23.644  -14.374 1.00 0.49  ? 103 ALA A CB   1  
ATOM 1598   H H    . ALA A 1 103 ? -4.724  22.258  -15.909 1.00 0.55  ? 103 ALA A H    1  
ATOM 1599   H HA   . ALA A 1 103 ? -1.929  22.270  -15.406 1.00 0.54  ? 103 ALA A HA   1  
ATOM 1600   H HB1  . ALA A 1 103 ? -4.187  23.632  -13.916 1.00 1.08  ? 103 ALA A HB1  1  
ATOM 1601   H HB2  . ALA A 1 103 ? -2.478  23.979  -13.652 1.00 1.13  ? 103 ALA A HB2  1  
ATOM 1602   H HB3  . ALA A 1 103 ? -3.214  24.319  -15.219 1.00 1.14  ? 103 ALA A HB3  1  
ATOM 1603   N N    . ALA A 1 104 ? -3.696  20.982  -12.945 1.00 0.49  ? 104 ALA A N    1  
ATOM 1604   C CA   . ALA A 1 104 ? -3.537  20.122  -11.736 1.00 0.50  ? 104 ALA A CA   1  
ATOM 1605   C C    . ALA A 1 104 ? -2.893  18.788  -12.115 1.00 0.54  ? 104 ALA A C    1  
ATOM 1606   O O    . ALA A 1 104 ? -2.009  18.300  -11.438 1.00 0.56  ? 104 ALA A O    1  
ATOM 1607   C CB   . ALA A 1 104 ? -4.910  19.865  -11.116 1.00 0.51  ? 104 ALA A CB   1  
ATOM 1608   H H    . ALA A 1 104 ? -4.586  21.296  -13.215 1.00 0.50  ? 104 ALA A H    1  
ATOM 1609   H HA   . ALA A 1 104 ? -2.909  20.628  -11.019 1.00 0.51  ? 104 ALA A HA   1  
ATOM 1610   H HB1  . ALA A 1 104 ? -5.593  19.527  -11.882 1.00 1.09  ? 104 ALA A HB1  1  
ATOM 1611   H HB2  . ALA A 1 104 ? -4.822  19.106  -10.352 1.00 1.26  ? 104 ALA A HB2  1  
ATOM 1612   H HB3  . ALA A 1 104 ? -5.282  20.778  -10.678 1.00 1.05  ? 104 ALA A HB3  1  
ATOM 1613   N N    . HIS A 1 105 ? -3.343  18.178  -13.172 1.00 0.57  ? 105 HIS A N    1  
ATOM 1614   C CA   . HIS A 1 105 ? -2.773  16.860  -13.566 1.00 0.65  ? 105 HIS A CA   1  
ATOM 1615   C C    . HIS A 1 105 ? -1.272  16.983  -13.817 1.00 0.65  ? 105 HIS A C    1  
ATOM 1616   O O    . HIS A 1 105 ? -0.508  16.096  -13.488 1.00 0.71  ? 105 HIS A O    1  
ATOM 1617   C CB   . HIS A 1 105 ? -3.448  16.367  -14.844 1.00 0.72  ? 105 HIS A CB   1  
ATOM 1618   C CG   . HIS A 1 105 ? -2.871  15.035  -15.239 1.00 0.84  ? 105 HIS A CG   1  
ATOM 1619   N ND1  . HIS A 1 105 ? -2.980  13.913  -14.428 1.00 1.54  ? 105 HIS A ND1  1  
ATOM 1620   C CD2  . HIS A 1 105 ? -2.182  14.623  -16.355 1.00 1.17  ? 105 HIS A CD2  1  
ATOM 1621   C CE1  . HIS A 1 105 ? -2.375  12.892  -15.061 1.00 1.43  ? 105 HIS A CE1  1  
ATOM 1622   N NE2  . HIS A 1 105 ? -1.872  13.273  -16.238 1.00 1.05  ? 105 HIS A NE2  1  
ATOM 1623   H H    . HIS A 1 105 ? -4.085  18.569  -13.683 1.00 0.58  ? 105 HIS A H    1  
ATOM 1624   H HA   . HIS A 1 105 ? -2.944  16.149  -12.774 1.00 0.68  ? 105 HIS A HA   1  
ATOM 1625   H HB2  . HIS A 1 105 ? -4.505  16.261  -14.670 1.00 0.73  ? 105 HIS A HB2  1  
ATOM 1626   H HB3  . HIS A 1 105 ? -3.283  17.080  -15.638 1.00 0.73  ? 105 HIS A HB3  1  
ATOM 1627   H HD2  . HIS A 1 105 ? -1.923  15.250  -17.196 1.00 1.94  ? 105 HIS A HD2  1  
ATOM 1628   H HE1  . HIS A 1 105 ? -2.303  11.890  -14.666 1.00 2.02  ? 105 HIS A HE1  1  
ATOM 1629   H HE2  . HIS A 1 105 ? -1.389  12.715  -16.883 1.00 1.27  ? 105 HIS A HE2  1  
ATOM 1630   N N    . GLU A 1 106 ? -0.833  18.060  -14.402 1.00 0.61  ? 106 GLU A N    1  
ATOM 1631   C CA   . GLU A 1 106 ? 0.624   18.205  -14.675 1.00 0.64  ? 106 GLU A CA   1  
ATOM 1632   C C    . GLU A 1 106 ? 1.431   18.198  -13.369 1.00 0.64  ? 106 GLU A C    1  
ATOM 1633   O O    . GLU A 1 106 ? 2.499   17.626  -13.300 1.00 0.70  ? 106 GLU A O    1  
ATOM 1634   C CB   . GLU A 1 106 ? 0.876   19.520  -15.415 1.00 0.64  ? 106 GLU A CB   1  
ATOM 1635   C CG   . GLU A 1 106 ? 2.370   19.646  -15.729 1.00 0.72  ? 106 GLU A CG   1  
ATOM 1636   C CD   . GLU A 1 106 ? 2.608   20.860  -16.625 1.00 0.74  ? 106 GLU A CD   1  
ATOM 1637   O OE1  . GLU A 1 106 ? 1.638   21.510  -16.979 1.00 1.28  ? 106 GLU A OE1  1  
ATOM 1638   O OE2  . GLU A 1 106 ? 3.757   21.120  -16.942 1.00 1.33  ? 106 GLU A OE2  1  
ATOM 1639   H H    . GLU A 1 106 ? -1.452  18.779  -14.657 1.00 0.60  ? 106 GLU A H    1  
ATOM 1640   H HA   . GLU A 1 106 ? 0.950   17.385  -15.294 1.00 0.68  ? 106 GLU A HA   1  
ATOM 1641   H HB2  . GLU A 1 106 ? 0.310   19.531  -16.335 1.00 0.66  ? 106 GLU A HB2  1  
ATOM 1642   H HB3  . GLU A 1 106 ? 0.570   20.348  -14.793 1.00 0.63  ? 106 GLU A HB3  1  
ATOM 1643   H HG2  . GLU A 1 106 ? 2.923   19.766  -14.809 1.00 0.79  ? 106 GLU A HG2  1  
ATOM 1644   H HG3  . GLU A 1 106 ? 2.706   18.755  -16.237 1.00 0.80  ? 106 GLU A HG3  1  
ATOM 1645   N N    . VAL A 1 107 ? 0.953   18.857  -12.347 1.00 0.61  ? 107 VAL A N    1  
ATOM 1646   C CA   . VAL A 1 107 ? 1.728   18.911  -11.068 1.00 0.63  ? 107 VAL A CA   1  
ATOM 1647   C C    . VAL A 1 107 ? 1.861   17.512  -10.455 1.00 0.66  ? 107 VAL A C    1  
ATOM 1648   O O    . VAL A 1 107 ? 2.948   17.065  -10.143 1.00 0.70  ? 107 VAL A O    1  
ATOM 1649   C CB   . VAL A 1 107 ? 1.008   19.835  -10.084 1.00 0.64  ? 107 VAL A CB   1  
ATOM 1650   C CG1  . VAL A 1 107 ? 1.831   19.968  -8.800  1.00 0.72  ? 107 VAL A CG1  1  
ATOM 1651   C CG2  . VAL A 1 107 ? 0.834   21.213  -10.724 1.00 0.65  ? 107 VAL A CG2  1  
ATOM 1652   H H    . VAL A 1 107 ? 0.105   19.343  -12.430 1.00 0.60  ? 107 VAL A H    1  
ATOM 1653   H HA   . VAL A 1 107 ? 2.711   19.305  -11.266 1.00 0.66  ? 107 VAL A HA   1  
ATOM 1654   H HB   . VAL A 1 107 ? 0.038   19.420  -9.849  1.00 0.62  ? 107 VAL A HB   1  
ATOM 1655   H HG11 . VAL A 1 107 ? 2.805   20.370  -9.038  1.00 1.26  ? 107 VAL A HG11 1  
ATOM 1656   H HG12 . VAL A 1 107 ? 1.324   20.634  -8.118  1.00 1.21  ? 107 VAL A HG12 1  
ATOM 1657   H HG13 . VAL A 1 107 ? 1.945   18.998  -8.338  1.00 1.30  ? 107 VAL A HG13 1  
ATOM 1658   H HG21 . VAL A 1 107 ? 0.336   21.108  -11.678 1.00 1.21  ? 107 VAL A HG21 1  
ATOM 1659   H HG22 . VAL A 1 107 ? 0.239   21.838  -10.076 1.00 1.20  ? 107 VAL A HG22 1  
ATOM 1660   H HG23 . VAL A 1 107 ? 1.801   21.667  -10.871 1.00 1.15  ? 107 VAL A HG23 1  
ATOM 1661   N N    . ILE A 1 108 ? 0.775   16.815  -10.287 1.00 0.65  ? 108 ILE A N    1  
ATOM 1662   C CA   . ILE A 1 108 ? 0.850   15.442  -9.701  1.00 0.70  ? 108 ILE A CA   1  
ATOM 1663   C C    . ILE A 1 108 ? 1.578   14.535  -10.690 1.00 0.76  ? 108 ILE A C    1  
ATOM 1664   O O    . ILE A 1 108 ? 2.398   13.719  -10.319 1.00 0.85  ? 108 ILE A O    1  
ATOM 1665   C CB   . ILE A 1 108 ? -0.569  14.907  -9.454  1.00 0.70  ? 108 ILE A CB   1  
ATOM 1666   C CG1  . ILE A 1 108 ? -1.325  15.826  -8.475  1.00 0.66  ? 108 ILE A CG1  1  
ATOM 1667   C CG2  . ILE A 1 108 ? -0.497  13.491  -8.876  1.00 0.78  ? 108 ILE A CG2  1  
ATOM 1668   C CD1  . ILE A 1 108 ? -0.534  16.008  -7.171  1.00 0.70  ? 108 ILE A CD1  1  
ATOM 1669   H H    . ILE A 1 108 ? -0.090  17.191  -10.548 1.00 0.62  ? 108 ILE A H    1  
ATOM 1670   H HA   . ILE A 1 108 ? 1.404   15.467  -8.775  1.00 0.73  ? 108 ILE A HA   1  
ATOM 1671   H HB   . ILE A 1 108 ? -1.103  14.873  -10.393 1.00 0.71  ? 108 ILE A HB   1  
ATOM 1672   H HG12 . ILE A 1 108 ? -1.475  16.790  -8.937  1.00 0.64  ? 108 ILE A HG12 1  
ATOM 1673   H HG13 . ILE A 1 108 ? -2.286  15.387  -8.249  1.00 0.68  ? 108 ILE A HG13 1  
ATOM 1674   H HG21 . ILE A 1 108 ? 0.245   13.462  -8.091  1.00 1.28  ? 108 ILE A HG21 1  
ATOM 1675   H HG22 . ILE A 1 108 ? -1.461  13.218  -8.470  1.00 1.32  ? 108 ILE A HG22 1  
ATOM 1676   H HG23 . ILE A 1 108 ? -0.226  12.796  -9.655  1.00 1.22  ? 108 ILE A HG23 1  
ATOM 1677   H HD11 . ILE A 1 108 ? -0.029  15.088  -6.915  1.00 1.16  ? 108 ILE A HD11 1  
ATOM 1678   H HD12 . ILE A 1 108 ? 0.194   16.794  -7.299  1.00 1.28  ? 108 ILE A HD12 1  
ATOM 1679   H HD13 . ILE A 1 108 ? -1.213  16.275  -6.375  1.00 1.27  ? 108 ILE A HD13 1  
ATOM 1680   N N    . GLU A 1 109 ? 1.300   14.701  -11.951 1.00 0.75  ? 109 GLU A N    1  
ATOM 1681   C CA   . GLU A 1 109 ? 1.987   13.881  -12.986 1.00 0.84  ? 109 GLU A CA   1  
ATOM 1682   C C    . GLU A 1 109 ? 3.470   14.250  -13.000 1.00 0.87  ? 109 GLU A C    1  
ATOM 1683   O O    . GLU A 1 109 ? 4.332   13.411  -13.181 1.00 0.93  ? 109 GLU A O    1  
ATOM 1684   C CB   . GLU A 1 109 ? 1.370   14.162  -14.359 1.00 0.88  ? 109 GLU A CB   1  
ATOM 1685   C CG   . GLU A 1 109 ? 2.039   13.281  -15.421 1.00 1.01  ? 109 GLU A CG   1  
ATOM 1686   C CD   . GLU A 1 109 ? 1.417   13.567  -16.788 1.00 1.76  ? 109 GLU A CD   1  
ATOM 1687   O OE1  . GLU A 1 109 ? 0.484   14.351  -16.841 1.00 2.44  ? 109 GLU A OE1  1  
ATOM 1688   O OE2  . GLU A 1 109 ? 1.886   12.999  -17.761 1.00 2.44  ? 109 GLU A OE2  1  
ATOM 1689   H H    . GLU A 1 109 ? 0.662   15.396  -12.213 1.00 0.72  ? 109 GLU A H    1  
ATOM 1690   H HA   . GLU A 1 109 ? 1.878   12.833  -12.747 1.00 0.90  ? 109 GLU A HA   1  
ATOM 1691   H HB2  . GLU A 1 109 ? 0.311   13.946  -14.329 1.00 0.90  ? 109 GLU A HB2  1  
ATOM 1692   H HB3  . GLU A 1 109 ? 1.517   15.201  -14.613 1.00 0.89  ? 109 GLU A HB3  1  
ATOM 1693   H HG2  . GLU A 1 109 ? 3.098   13.497  -15.456 1.00 1.53  ? 109 GLU A HG2  1  
ATOM 1694   H HG3  . GLU A 1 109 ? 1.892   12.242  -15.170 1.00 1.29  ? 109 GLU A HG3  1  
ATOM 1695   N N    . GLY A 1 110 ? 3.771   15.508  -12.828 1.00 0.85  ? 110 GLY A N    1  
ATOM 1696   C CA   . GLY A 1 110 ? 5.193   15.949  -12.847 1.00 0.92  ? 110 GLY A CA   1  
ATOM 1697   C C    . GLY A 1 110 ? 5.988   15.224  -11.761 1.00 0.90  ? 110 GLY A C    1  
ATOM 1698   O O    . GLY A 1 110 ? 7.063   14.720  -12.012 1.00 0.98  ? 110 GLY A O    1  
ATOM 1699   H H    . GLY A 1 110 ? 3.060   16.169  -12.697 1.00 0.82  ? 110 GLY A H    1  
ATOM 1700   H HA2  . GLY A 1 110 ? 5.622   15.725  -13.814 1.00 0.99  ? 110 GLY A HA2  1  
ATOM 1701   H HA3  . GLY A 1 110 ? 5.241   17.013  -12.673 1.00 0.94  ? 110 GLY A HA3  1  
ATOM 1702   N N    . GLN A 1 111 ? 5.487   15.162  -10.554 1.00 0.82  ? 111 GLN A N    1  
ATOM 1703   C CA   . GLN A 1 111 ? 6.264   14.458  -9.495  1.00 0.84  ? 111 GLN A CA   1  
ATOM 1704   C C    . GLN A 1 111 ? 6.288   12.964  -9.817  1.00 0.91  ? 111 GLN A C    1  
ATOM 1705   O O    . GLN A 1 111 ? 7.336   12.361  -9.910  1.00 1.00  ? 111 GLN A O    1  
ATOM 1706   C CB   . GLN A 1 111 ? 5.625   14.689  -8.122  1.00 0.77  ? 111 GLN A CB   1  
ATOM 1707   C CG   . GLN A 1 111 ? 5.555   16.195  -7.834  1.00 0.73  ? 111 GLN A CG   1  
ATOM 1708   C CD   . GLN A 1 111 ? 6.964   16.796  -7.841  1.00 0.87  ? 111 GLN A CD   1  
ATOM 1709   O OE1  . GLN A 1 111 ? 7.754   16.538  -6.956  1.00 1.41  ? 111 GLN A OE1  1  
ATOM 1710   N NE2  . GLN A 1 111 ? 7.313   17.593  -8.815  1.00 1.35  ? 111 GLN A NE2  1  
ATOM 1711   H H    . GLN A 1 111 ? 4.617   15.570  -10.349 1.00 0.77  ? 111 GLN A H    1  
ATOM 1712   H HA   . GLN A 1 111 ? 7.275   14.831  -9.489  1.00 0.89  ? 111 GLN A HA   1  
ATOM 1713   H HB2  . GLN A 1 111 ? 4.629   14.272  -8.109  1.00 0.75  ? 111 GLN A HB2  1  
ATOM 1714   H HB3  . GLN A 1 111 ? 6.227   14.210  -7.363  1.00 0.82  ? 111 GLN A HB3  1  
ATOM 1715   H HG2  . GLN A 1 111 ? 4.955   16.676  -8.593  1.00 0.74  ? 111 GLN A HG2  1  
ATOM 1716   H HG3  . GLN A 1 111 ? 5.103   16.355  -6.866  1.00 0.71  ? 111 GLN A HG3  1  
ATOM 1717   H HE21 . GLN A 1 111 ? 6.676   17.800  -9.531  1.00 1.97  ? 111 GLN A HE21 1  
ATOM 1718   H HE22 . GLN A 1 111 ? 8.212   17.983  -8.831  1.00 1.45  ? 111 GLN A HE22 1  
ATOM 1719   N N    . ALA A 1 112 ? 5.145   12.365  -10.018 1.00 0.89  ? 112 ALA A N    1  
ATOM 1720   C CA   . ALA A 1 112 ? 5.116   10.916  -10.356 1.00 0.98  ? 112 ALA A CA   1  
ATOM 1721   C C    . ALA A 1 112 ? 6.056   10.658  -11.533 1.00 1.09  ? 112 ALA A C    1  
ATOM 1722   O O    . ALA A 1 112 ? 6.763   9.670   -11.570 1.00 1.20  ? 112 ALA A O    1  
ATOM 1723   C CB   . ALA A 1 112 ? 3.695   10.511  -10.747 1.00 0.96  ? 112 ALA A CB   1  
ATOM 1724   H H    . ALA A 1 112 ? 4.309   12.869  -9.952  1.00 0.84  ? 112 ALA A H    1  
ATOM 1725   H HA   . ALA A 1 112 ? 5.436   10.336  -9.502  1.00 1.01  ? 112 ALA A HA   1  
ATOM 1726   H HB1  . ALA A 1 112 ? 3.375   11.103  -11.592 1.00 1.43  ? 112 ALA A HB1  1  
ATOM 1727   H HB2  . ALA A 1 112 ? 3.679   9.464   -11.013 1.00 1.33  ? 112 ALA A HB2  1  
ATOM 1728   H HB3  . ALA A 1 112 ? 3.029   10.683  -9.914  1.00 1.42  ? 112 ALA A HB3  1  
ATOM 1729   N N    . SER A 1 113 ? 6.077   11.540  -12.498 1.00 1.10  ? 113 SER A N    1  
ATOM 1730   C CA   . SER A 1 113 ? 6.983   11.333  -13.661 1.00 1.23  ? 113 SER A CA   1  
ATOM 1731   C C    . SER A 1 113 ? 8.422   11.278  -13.152 1.00 1.28  ? 113 SER A C    1  
ATOM 1732   O O    . SER A 1 113 ? 9.209   10.451  -13.569 1.00 1.41  ? 113 SER A O    1  
ATOM 1733   C CB   . SER A 1 113 ? 6.830   12.491  -14.649 1.00 1.22  ? 113 SER A CB   1  
ATOM 1734   O OG   . SER A 1 113 ? 7.690   12.276  -15.761 1.00 1.70  ? 113 SER A OG   1  
ATOM 1735   H H    . SER A 1 113 ? 5.502   12.332  -12.454 1.00 1.03  ? 113 SER A H    1  
ATOM 1736   H HA   . SER A 1 113 ? 6.736   10.403  -14.149 1.00 1.30  ? 113 SER A HA   1  
ATOM 1737   H HB2  . SER A 1 113 ? 5.812   12.541  -14.994 1.00 1.49  ? 113 SER A HB2  1  
ATOM 1738   H HB3  . SER A 1 113 ? 7.087   13.420  -14.156 1.00 1.47  ? 113 SER A HB3  1  
ATOM 1739   H HG   . SER A 1 113 ? 7.334   12.760  -16.509 1.00 2.12  ? 113 SER A HG   1  
ATOM 1740   N N    . ALA A 1 114 ? 8.769   12.150  -12.247 1.00 1.22  ? 114 ALA A N    1  
ATOM 1741   C CA   . ALA A 1 114 ? 10.153  12.148  -11.702 1.00 1.30  ? 114 ALA A CA   1  
ATOM 1742   C C    . ALA A 1 114 ? 10.431  10.801  -11.046 1.00 1.36  ? 114 ALA A C    1  
ATOM 1743   O O    . ALA A 1 114 ? 11.508  10.256  -11.158 1.00 1.47  ? 114 ALA A O    1  
ATOM 1744   C CB   . ALA A 1 114 ? 10.301  13.258  -10.657 1.00 1.25  ? 114 ALA A CB   1  
ATOM 1745   H H    . ALA A 1 114 ? 8.120   12.810  -11.929 1.00 1.13  ? 114 ALA A H    1  
ATOM 1746   H HA   . ALA A 1 114 ? 10.858  12.309  -12.504 1.00 1.38  ? 114 ALA A HA   1  
ATOM 1747   H HB1  . ALA A 1 114 ? 9.550   13.134  -9.892  1.00 1.64  ? 114 ALA A HB1  1  
ATOM 1748   H HB2  . ALA A 1 114 ? 11.283  13.203  -10.208 1.00 1.60  ? 114 ALA A HB2  1  
ATOM 1749   H HB3  . ALA A 1 114 ? 10.175  14.219  -11.133 1.00 1.56  ? 114 ALA A HB3  1  
ATOM 1750   N N    . LEU A 1 115 ? 9.474   10.255  -10.352 1.00 1.30  ? 115 LEU A N    1  
ATOM 1751   C CA   . LEU A 1 115 ? 9.714   8.944   -9.696  1.00 1.37  ? 115 LEU A CA   1  
ATOM 1752   C C    . LEU A 1 115 ? 9.875   7.871   -10.773 1.00 1.46  ? 115 LEU A C    1  
ATOM 1753   O O    . LEU A 1 115 ? 10.721  7.006   -10.670 1.00 1.56  ? 115 LEU A O    1  
ATOM 1754   C CB   . LEU A 1 115 ? 8.538   8.586   -8.791  1.00 1.32  ? 115 LEU A CB   1  
ATOM 1755   C CG   . LEU A 1 115 ? 8.161   9.783   -7.903  1.00 1.25  ? 115 LEU A CG   1  
ATOM 1756   C CD1  . LEU A 1 115 ? 7.173   9.329   -6.822  1.00 1.20  ? 115 LEU A CD1  1  
ATOM 1757   C CD2  . LEU A 1 115 ? 9.412   10.373  -7.240  1.00 1.49  ? 115 LEU A CD2  1  
ATOM 1758   H H    . LEU A 1 115 ? 8.609   10.704  -10.260 1.00 1.21  ? 115 LEU A H    1  
ATOM 1759   H HA   . LEU A 1 115 ? 10.619  8.996   -9.110  1.00 1.43  ? 115 LEU A HA   1  
ATOM 1760   H HB2  . LEU A 1 115 ? 7.689   8.309   -9.400  1.00 1.28  ? 115 LEU A HB2  1  
ATOM 1761   H HB3  . LEU A 1 115 ? 8.820   7.753   -8.167  1.00 1.41  ? 115 LEU A HB3  1  
ATOM 1762   H HG   . LEU A 1 115 ? 7.690   10.538  -8.514  1.00 1.21  ? 115 LEU A HG   1  
ATOM 1763   H HD11 . LEU A 1 115 ? 7.516   8.405   -6.379  1.00 1.56  ? 115 LEU A HD11 1  
ATOM 1764   H HD12 . LEU A 1 115 ? 7.103   10.089  -6.058  1.00 1.67  ? 115 LEU A HD12 1  
ATOM 1765   H HD13 . LEU A 1 115 ? 6.201   9.177   -7.264  1.00 1.48  ? 115 LEU A HD13 1  
ATOM 1766   H HD21 . LEU A 1 115 ? 10.004  9.578   -6.811  1.00 1.82  ? 115 LEU A HD21 1  
ATOM 1767   H HD22 . LEU A 1 115 ? 9.997   10.904  -7.977  1.00 1.83  ? 115 LEU A HD22 1  
ATOM 1768   H HD23 . LEU A 1 115 ? 9.114   11.060  -6.463  1.00 1.93  ? 115 LEU A HD23 1  
ATOM 1769   N N    . GLU A 1 116 ? 9.068   7.907   -11.802 1.00 1.45  ? 116 GLU A N    1  
ATOM 1770   C CA   . GLU A 1 116 ? 9.187   6.874   -12.868 1.00 1.56  ? 116 GLU A CA   1  
ATOM 1771   C C    . GLU A 1 116 ? 10.627  6.836   -13.370 1.00 1.68  ? 116 GLU A C    1  
ATOM 1772   O O    . GLU A 1 116 ? 11.128  5.803   -13.766 1.00 1.80  ? 116 GLU A O    1  
ATOM 1773   C CB   . GLU A 1 116 ? 8.258   7.224   -14.034 1.00 1.55  ? 116 GLU A CB   1  
ATOM 1774   C CG   . GLU A 1 116 ? 6.799   7.012   -13.623 1.00 1.68  ? 116 GLU A CG   1  
ATOM 1775   C CD   . GLU A 1 116 ? 5.889   7.339   -14.809 1.00 1.73  ? 116 GLU A CD   1  
ATOM 1776   O OE1  . GLU A 1 116 ? 5.510   8.491   -14.940 1.00 2.20  ? 116 GLU A OE1  1  
ATOM 1777   O OE2  . GLU A 1 116 ? 5.590   6.432   -15.569 1.00 1.89  ? 116 GLU A OE2  1  
ATOM 1778   H H    . GLU A 1 116 ? 8.367   8.587   -11.869 1.00 1.38  ? 116 GLU A H    1  
ATOM 1779   H HA   . GLU A 1 116 ? 8.919   5.909   -12.467 1.00 1.59  ? 116 GLU A HA   1  
ATOM 1780   H HB2  . GLU A 1 116 ? 8.403   8.257   -14.309 1.00 1.76  ? 116 GLU A HB2  1  
ATOM 1781   H HB3  . GLU A 1 116 ? 8.487   6.592   -14.878 1.00 1.66  ? 116 GLU A HB3  1  
ATOM 1782   H HG2  . GLU A 1 116 ? 6.652   5.982   -13.327 1.00 1.86  ? 116 GLU A HG2  1  
ATOM 1783   H HG3  . GLU A 1 116 ? 6.558   7.663   -12.798 1.00 1.94  ? 116 GLU A HG3  1  
ATOM 1784   N N    . GLU A 1 117 ? 11.301  7.950   -13.350 1.00 1.67  ? 117 GLU A N    1  
ATOM 1785   C CA   . GLU A 1 117 ? 12.712  7.962   -13.820 1.00 1.80  ? 117 GLU A CA   1  
ATOM 1786   C C    . GLU A 1 117 ? 13.529  7.012   -12.944 1.00 1.86  ? 117 GLU A C    1  
ATOM 1787   O O    . GLU A 1 117 ? 14.553  6.504   -13.352 1.00 1.98  ? 117 GLU A O    1  
ATOM 1788   C CB   . GLU A 1 117 ? 13.275  9.377   -13.713 1.00 1.80  ? 117 GLU A CB   1  
ATOM 1789   C CG   . GLU A 1 117 ? 12.523  10.289  -14.681 1.00 1.70  ? 117 GLU A CG   1  
ATOM 1790   C CD   . GLU A 1 117 ? 13.046  11.718  -14.545 1.00 1.76  ? 117 GLU A CD   1  
ATOM 1791   O OE1  . GLU A 1 117 ? 13.860  11.947  -13.667 1.00 2.12  ? 117 GLU A OE1  1  
ATOM 1792   O OE2  . GLU A 1 117 ? 12.620  12.560  -15.319 1.00 2.04  ? 117 GLU A OE2  1  
ATOM 1793   H H    . GLU A 1 117 ? 10.883  8.775   -13.022 1.00 1.59  ? 117 GLU A H    1  
ATOM 1794   H HA   . GLU A 1 117 ? 12.753  7.631   -14.848 1.00 1.88  ? 117 GLU A HA   1  
ATOM 1795   H HB2  . GLU A 1 117 ? 13.160  9.739   -12.704 1.00 1.75  ? 117 GLU A HB2  1  
ATOM 1796   H HB3  . GLU A 1 117 ? 14.323  9.367   -13.974 1.00 1.94  ? 117 GLU A HB3  1  
ATOM 1797   H HG2  . GLU A 1 117 ? 12.677  9.942   -15.693 1.00 1.80  ? 117 GLU A HG2  1  
ATOM 1798   H HG3  . GLU A 1 117 ? 11.469  10.268  -14.450 1.00 1.55  ? 117 GLU A HG3  1  
ATOM 1799   N N    . LEU A 1 118 ? 13.087  6.774   -11.738 1.00 1.78  ? 118 LEU A N    1  
ATOM 1800   C CA   . LEU A 1 118 ? 13.840  5.866   -10.829 1.00 1.85  ? 118 LEU A CA   1  
ATOM 1801   C C    . LEU A 1 118 ? 13.877  4.462   -11.435 1.00 1.93  ? 118 LEU A C    1  
ATOM 1802   O O    . LEU A 1 118 ? 12.925  4.014   -12.042 1.00 1.92  ? 118 LEU A O    1  
ATOM 1803   C CB   . LEU A 1 118 ? 13.112  5.784   -9.486  1.00 1.77  ? 118 LEU A CB   1  
ATOM 1804   C CG   . LEU A 1 118 ? 13.013  7.174   -8.842  1.00 1.78  ? 118 LEU A CG   1  
ATOM 1805   C CD1  . LEU A 1 118 ? 12.044  7.107   -7.657  1.00 1.69  ? 118 LEU A CD1  1  
ATOM 1806   C CD2  . LEU A 1 118 ? 14.392  7.628   -8.337  1.00 2.00  ? 118 LEU A CD2  1  
ATOM 1807   H H    . LEU A 1 118 ? 12.266  7.202   -11.413 1.00 1.69  ? 118 LEU A H    1  
ATOM 1808   H HA   . LEU A 1 118 ? 14.841  6.234   -10.685 1.00 1.94  ? 118 LEU A HA   1  
ATOM 1809   H HB2  . LEU A 1 118 ? 12.119  5.392   -9.650  1.00 1.65  ? 118 LEU A HB2  1  
ATOM 1810   H HB3  . LEU A 1 118 ? 13.651  5.120   -8.827  1.00 1.85  ? 118 LEU A HB3  1  
ATOM 1811   H HG   . LEU A 1 118 ? 12.641  7.881   -9.569  1.00 1.76  ? 118 LEU A HG   1  
ATOM 1812   H HD11 . LEU A 1 118 ? 11.130  6.619   -7.960  1.00 2.03  ? 118 LEU A HD11 1  
ATOM 1813   H HD12 . LEU A 1 118 ? 12.499  6.548   -6.855  1.00 1.86  ? 118 LEU A HD12 1  
ATOM 1814   H HD13 . LEU A 1 118 ? 11.820  8.105   -7.317  1.00 2.00  ? 118 LEU A HD13 1  
ATOM 1815   H HD21 . LEU A 1 118 ? 14.884  6.810   -7.834  1.00 2.24  ? 118 LEU A HD21 1  
ATOM 1816   H HD22 . LEU A 1 118 ? 14.995  7.953   -9.171  1.00 2.34  ? 118 LEU A HD22 1  
ATOM 1817   H HD23 . LEU A 1 118 ? 14.269  8.450   -7.646  1.00 2.27  ? 118 LEU A HD23 1  
ATOM 1818   N N    . ASP A 1 119 ? 14.968  3.762   -11.270 1.00 2.04  ? 119 ASP A N    1  
ATOM 1819   C CA   . ASP A 1 119 ? 15.073  2.379   -11.827 1.00 2.14  ? 119 ASP A CA   1  
ATOM 1820   C C    . ASP A 1 119 ? 14.802  1.364   -10.713 1.00 2.12  ? 119 ASP A C    1  
ATOM 1821   O O    . ASP A 1 119 ? 15.553  0.429   -10.523 1.00 2.19  ? 119 ASP A O    1  
ATOM 1822   C CB   . ASP A 1 119 ? 16.485  2.157   -12.374 1.00 2.30  ? 119 ASP A CB   1  
ATOM 1823   C CG   . ASP A 1 119 ? 16.522  0.845   -13.158 1.00 2.69  ? 119 ASP A CG   1  
ATOM 1824   O OD1  . ASP A 1 119 ? 15.590  0.071   -13.021 1.00 3.23  ? 119 ASP A OD1  1  
ATOM 1825   O OD2  . ASP A 1 119 ? 17.482  0.637   -13.881 1.00 3.10  ? 119 ASP A OD2  1  
ATOM 1826   H H    . ASP A 1 119 ? 15.721  4.143   -10.771 1.00 2.08  ? 119 ASP A H    1  
ATOM 1827   H HA   . ASP A 1 119 ? 14.354  2.242   -12.623 1.00 2.15  ? 119 ASP A HA   1  
ATOM 1828   H HB2  . ASP A 1 119 ? 16.752  2.977   -13.026 1.00 2.47  ? 119 ASP A HB2  1  
ATOM 1829   H HB3  . ASP A 1 119 ? 17.185  2.105   -11.554 1.00 2.58  ? 119 ASP A HB3  1  
ATOM 1830   N N    . ASP A 1 120 ? 13.735  1.544   -9.969  1.00 2.03  ? 120 ASP A N    1  
ATOM 1831   C CA   . ASP A 1 120 ? 13.411  0.594   -8.857  1.00 2.03  ? 120 ASP A CA   1  
ATOM 1832   C C    . ASP A 1 120 ? 11.922  0.233   -8.900  1.00 1.96  ? 120 ASP A C    1  
ATOM 1833   O O    . ASP A 1 120 ? 11.066  1.087   -9.018  1.00 1.85  ? 120 ASP A O    1  
ATOM 1834   C CB   . ASP A 1 120 ? 13.740  1.255   -7.516  1.00 2.01  ? 120 ASP A CB   1  
ATOM 1835   C CG   . ASP A 1 120 ? 13.505  0.258   -6.381  1.00 2.09  ? 120 ASP A CG   1  
ATOM 1836   O OD1  . ASP A 1 120 ? 12.790  -0.706  -6.604  1.00 2.27  ? 120 ASP A OD1  1  
ATOM 1837   O OD2  . ASP A 1 120 ? 14.043  0.474   -5.308  1.00 2.49  ? 120 ASP A OD2  1  
ATOM 1838   H H    . ASP A 1 120 ? 13.147  2.310   -10.140 1.00 1.97  ? 120 ASP A H    1  
ATOM 1839   H HA   . ASP A 1 120 ? 13.996  -0.311  -8.960  1.00 2.12  ? 120 ASP A HA   1  
ATOM 1840   H HB2  . ASP A 1 120 ? 14.775  1.565   -7.514  1.00 2.06  ? 120 ASP A HB2  1  
ATOM 1841   H HB3  . ASP A 1 120 ? 13.106  2.116   -7.373  1.00 1.91  ? 120 ASP A HB3  1  
ATOM 1842   N N    . GLU A 1 121 ? 11.616  -1.031  -8.796  1.00 2.04  ? 121 GLU A N    1  
ATOM 1843   C CA   . GLU A 1 121 ? 10.188  -1.469  -8.818  1.00 2.01  ? 121 GLU A CA   1  
ATOM 1844   C C    . GLU A 1 121 ? 9.490   -1.034  -7.528  1.00 1.91  ? 121 GLU A C    1  
ATOM 1845   O O    . GLU A 1 121 ? 8.299   -0.792  -7.503  1.00 1.85  ? 121 GLU A O    1  
ATOM 1846   C CB   . GLU A 1 121 ? 10.121  -2.993  -8.953  1.00 2.17  ? 121 GLU A CB   1  
ATOM 1847   C CG   . GLU A 1 121 ? 10.874  -3.648  -7.793  1.00 2.84  ? 121 GLU A CG   1  
ATOM 1848   C CD   . GLU A 1 121 ? 10.806  -5.169  -7.936  1.00 3.37  ? 121 GLU A CD   1  
ATOM 1849   O OE1  . GLU A 1 121 ? 9.936   -5.639  -8.650  1.00 3.68  ? 121 GLU A OE1  1  
ATOM 1850   O OE2  . GLU A 1 121 ? 11.625  -5.837  -7.327  1.00 3.95  ? 121 GLU A OE2  1  
ATOM 1851   H H    . GLU A 1 121 ? 12.334  -1.689  -8.690  1.00 2.13  ? 121 GLU A H    1  
ATOM 1852   H HA   . GLU A 1 121 ? 9.690   -1.016  -9.661  1.00 1.97  ? 121 GLU A HA   1  
ATOM 1853   H HB2  . GLU A 1 121 ? 9.087   -3.307  -8.934  1.00 2.33  ? 121 GLU A HB2  1  
ATOM 1854   H HB3  . GLU A 1 121 ? 10.572  -3.291  -9.887  1.00 2.29  ? 121 GLU A HB3  1  
ATOM 1855   H HG2  . GLU A 1 121 ? 11.906  -3.328  -7.806  1.00 3.17  ? 121 GLU A HG2  1  
ATOM 1856   H HG3  . GLU A 1 121 ? 10.418  -3.358  -6.858  1.00 3.30  ? 121 GLU A HG3  1  
ATOM 1857   N N    . TYR A 1 122 ? 10.226  -0.930  -6.458  1.00 1.92  ? 122 TYR A N    1  
ATOM 1858   C CA   . TYR A 1 122 ? 9.623   -0.507  -5.162  1.00 1.87  ? 122 TYR A CA   1  
ATOM 1859   C C    . TYR A 1 122 ? 9.248   0.983   -5.207  1.00 1.71  ? 122 TYR A C    1  
ATOM 1860   O O    . TYR A 1 122 ? 8.220   1.381   -4.700  1.00 1.60  ? 122 TYR A O    1  
ATOM 1861   C CB   . TYR A 1 122 ? 10.639  -0.780  -4.030  1.00 1.99  ? 122 TYR A CB   1  
ATOM 1862   C CG   . TYR A 1 122 ? 10.397  0.147   -2.850  1.00 1.96  ? 122 TYR A CG   1  
ATOM 1863   C CD1  . TYR A 1 122 ? 9.158   0.143   -2.194  1.00 1.93  ? 122 TYR A CD1  1  
ATOM 1864   C CD2  . TYR A 1 122 ? 11.414  1.012   -2.417  1.00 1.99  ? 122 TYR A CD2  1  
ATOM 1865   C CE1  . TYR A 1 122 ? 8.938   1.003   -1.112  1.00 1.94  ? 122 TYR A CE1  1  
ATOM 1866   C CE2  . TYR A 1 122 ? 11.192  1.867   -1.333  1.00 1.98  ? 122 TYR A CE2  1  
ATOM 1867   C CZ   . TYR A 1 122 ? 9.956   1.862   -0.682  1.00 1.96  ? 122 TYR A CZ   1  
ATOM 1868   O OH   . TYR A 1 122 ? 9.737   2.712   0.377   1.00 2.00  ? 122 TYR A OH   1  
ATOM 1869   H H    . TYR A 1 122 ? 11.188  -1.107  -6.504  1.00 1.98  ? 122 TYR A H    1  
ATOM 1870   H HA   . TYR A 1 122 ? 8.731   -1.090  -4.984  1.00 1.89  ? 122 TYR A HA   1  
ATOM 1871   H HB2  . TYR A 1 122 ? 10.539  -1.805  -3.702  1.00 2.10  ? 122 TYR A HB2  1  
ATOM 1872   H HB3  . TYR A 1 122 ? 11.639  -0.627  -4.410  1.00 2.03  ? 122 TYR A HB3  1  
ATOM 1873   H HD1  . TYR A 1 122 ? 8.371   -0.518  -2.525  1.00 1.94  ? 122 TYR A HD1  1  
ATOM 1874   H HD2  . TYR A 1 122 ? 12.370  1.020   -2.921  1.00 2.03  ? 122 TYR A HD2  1  
ATOM 1875   H HE1  . TYR A 1 122 ? 7.983   1.004   -0.607  1.00 1.96  ? 122 TYR A HE1  1  
ATOM 1876   H HE2  . TYR A 1 122 ? 11.975  2.530   -0.998  1.00 2.02  ? 122 TYR A HE2  1  
ATOM 1877   H HH   . TYR A 1 122 ? 10.466  2.612   0.994   1.00 2.25  ? 122 TYR A HH   1  
ATOM 1878   N N    . LEU A 1 123 ? 10.070  1.805   -5.799  1.00 1.70  ? 123 LEU A N    1  
ATOM 1879   C CA   . LEU A 1 123 ? 9.749   3.262   -5.859  1.00 1.57  ? 123 LEU A CA   1  
ATOM 1880   C C    . LEU A 1 123 ? 8.737   3.523   -6.974  1.00 1.48  ? 123 LEU A C    1  
ATOM 1881   O O    . LEU A 1 123 ? 7.830   4.319   -6.827  1.00 1.36  ? 123 LEU A O    1  
ATOM 1882   C CB   . LEU A 1 123 ? 11.033  4.059   -6.116  1.00 1.63  ? 123 LEU A CB   1  
ATOM 1883   C CG   . LEU A 1 123 ? 12.040  3.807   -4.979  1.00 1.73  ? 123 LEU A CG   1  
ATOM 1884   C CD1  . LEU A 1 123 ? 13.371  4.519   -5.285  1.00 1.86  ? 123 LEU A CD1  1  
ATOM 1885   C CD2  . LEU A 1 123 ? 11.467  4.328   -3.646  1.00 1.72  ? 123 LEU A CD2  1  
ATOM 1886   H H    . LEU A 1 123 ? 10.887  1.464   -6.219  1.00 1.81  ? 123 LEU A H    1  
ATOM 1887   H HA   . LEU A 1 123 ? 9.318   3.572   -4.922  1.00 1.52  ? 123 LEU A HA   1  
ATOM 1888   H HB2  . LEU A 1 123 ? 11.462  3.751   -7.058  1.00 1.70  ? 123 LEU A HB2  1  
ATOM 1889   H HB3  . LEU A 1 123 ? 10.797  5.112   -6.157  1.00 1.57  ? 123 LEU A HB3  1  
ATOM 1890   H HG   . LEU A 1 123 ? 12.220  2.744   -4.898  1.00 1.80  ? 123 LEU A HG   1  
ATOM 1891   H HD11 . LEU A 1 123 ? 13.561  4.506   -6.349  1.00 2.27  ? 123 LEU A HD11 1  
ATOM 1892   H HD12 . LEU A 1 123 ? 13.326  5.544   -4.942  1.00 2.14  ? 123 LEU A HD12 1  
ATOM 1893   H HD13 . LEU A 1 123 ? 14.175  4.009   -4.774  1.00 2.03  ? 123 LEU A HD13 1  
ATOM 1894   H HD21 . LEU A 1 123 ? 10.892  5.226   -3.820  1.00 1.92  ? 123 LEU A HD21 1  
ATOM 1895   H HD22 . LEU A 1 123 ? 10.832  3.576   -3.211  1.00 2.11  ? 123 LEU A HD22 1  
ATOM 1896   H HD23 . LEU A 1 123 ? 12.276  4.548   -2.962  1.00 1.98  ? 123 LEU A HD23 1  
ATOM 1897   N N    . LYS A 1 124 ? 8.881   2.869   -8.092  1.00 1.56  ? 124 LYS A N    1  
ATOM 1898   C CA   . LYS A 1 124 ? 7.920   3.092   -9.206  1.00 1.52  ? 124 LYS A CA   1  
ATOM 1899   C C    . LYS A 1 124 ? 6.506   2.729   -8.748  1.00 1.43  ? 124 LYS A C    1  
ATOM 1900   O O    . LYS A 1 124 ? 5.573   3.487   -8.919  1.00 1.33  ? 124 LYS A O    1  
ATOM 1901   C CB   . LYS A 1 124 ? 8.309   2.228   -10.406 1.00 1.68  ? 124 LYS A CB   1  
ATOM 1902   C CG   . LYS A 1 124 ? 7.426   2.591   -11.603 1.00 1.69  ? 124 LYS A CG   1  
ATOM 1903   C CD   . LYS A 1 124 ? 7.814   1.726   -12.808 1.00 1.92  ? 124 LYS A CD   1  
ATOM 1904   C CE   . LYS A 1 124 ? 6.999   2.144   -14.041 1.00 2.25  ? 124 LYS A CE   1  
ATOM 1905   N NZ   . LYS A 1 124 ? 7.729   1.735   -15.275 1.00 2.84  ? 124 LYS A NZ   1  
ATOM 1906   H H    . LYS A 1 124 ? 9.620   2.232   -8.198  1.00 1.67  ? 124 LYS A H    1  
ATOM 1907   H HA   . LYS A 1 124 ? 7.944   4.132   -9.492  1.00 1.47  ? 124 LYS A HA   1  
ATOM 1908   H HB2  . LYS A 1 124 ? 9.346   2.404   -10.655 1.00 1.76  ? 124 LYS A HB2  1  
ATOM 1909   H HB3  . LYS A 1 124 ? 8.169   1.185   -10.161 1.00 1.72  ? 124 LYS A HB3  1  
ATOM 1910   H HG2  . LYS A 1 124 ? 6.390   2.420   -11.351 1.00 1.63  ? 124 LYS A HG2  1  
ATOM 1911   H HG3  . LYS A 1 124 ? 7.569   3.632   -11.850 1.00 1.68  ? 124 LYS A HG3  1  
ATOM 1912   H HD2  . LYS A 1 124 ? 8.867   1.850   -13.014 1.00 2.27  ? 124 LYS A HD2  1  
ATOM 1913   H HD3  . LYS A 1 124 ? 7.613   0.689   -12.583 1.00 2.19  ? 124 LYS A HD3  1  
ATOM 1914   H HE2  . LYS A 1 124 ? 6.035   1.659   -14.017 1.00 2.63  ? 124 LYS A HE2  1  
ATOM 1915   H HE3  . LYS A 1 124 ? 6.863   3.216   -14.043 1.00 2.58  ? 124 LYS A HE3  1  
ATOM 1916   H HZ1  . LYS A 1 124 ? 8.747   1.904   -15.146 1.00 3.31  ? 124 LYS A HZ1  1  
ATOM 1917   H HZ2  . LYS A 1 124 ? 7.567   0.725   -15.456 1.00 3.06  ? 124 LYS A HZ2  1  
ATOM 1918   H HZ3  . LYS A 1 124 ? 7.383   2.293   -16.083 1.00 3.24  ? 124 LYS A HZ3  1  
ATOM 1919   N N    . GLU A 1 125 ? 6.342   1.569   -8.169  1.00 1.46  ? 125 GLU A N    1  
ATOM 1920   C CA   . GLU A 1 125 ? 4.988   1.152   -7.705  1.00 1.39  ? 125 GLU A CA   1  
ATOM 1921   C C    . GLU A 1 125 ? 4.504   2.139   -6.642  1.00 1.25  ? 125 GLU A C    1  
ATOM 1922   O O    . GLU A 1 125 ? 3.352   2.530   -6.612  1.00 1.18  ? 125 GLU A O    1  
ATOM 1923   C CB   . GLU A 1 125 ? 5.065   -0.256  -7.108  1.00 1.48  ? 125 GLU A CB   1  
ATOM 1924   C CG   . GLU A 1 125 ? 5.324   -1.273  -8.224  1.00 1.60  ? 125 GLU A CG   1  
ATOM 1925   C CD   . GLU A 1 125 ? 5.573   -2.654  -7.614  1.00 2.07  ? 125 GLU A CD   1  
ATOM 1926   O OE1  . GLU A 1 125 ? 5.529   -2.760  -6.399  1.00 2.73  ? 125 GLU A OE1  1  
ATOM 1927   O OE2  . GLU A 1 125 ? 5.809   -3.581  -8.372  1.00 2.49  ? 125 GLU A OE2  1  
ATOM 1928   H H    . GLU A 1 125 ? 7.109   0.973   -8.045  1.00 1.55  ? 125 GLU A H    1  
ATOM 1929   H HA   . GLU A 1 125 ? 4.303   1.155   -8.540  1.00 1.40  ? 125 GLU A HA   1  
ATOM 1930   H HB2  . GLU A 1 125 ? 5.866   -0.300  -6.384  1.00 1.51  ? 125 GLU A HB2  1  
ATOM 1931   H HB3  . GLU A 1 125 ? 4.129   -0.491  -6.623  1.00 1.43  ? 125 GLU A HB3  1  
ATOM 1932   H HG2  . GLU A 1 125 ? 4.465   -1.317  -8.878  1.00 1.86  ? 125 GLU A HG2  1  
ATOM 1933   H HG3  . GLU A 1 125 ? 6.192   -0.970  -8.790  1.00 1.77  ? 125 GLU A HG3  1  
ATOM 1934   N N    . ARG A 1 126 ? 5.389   2.555   -5.779  1.00 1.23  ? 126 ARG A N    1  
ATOM 1935   C CA   . ARG A 1 126 ? 5.011   3.533   -4.722  1.00 1.11  ? 126 ARG A CA   1  
ATOM 1936   C C    . ARG A 1 126 ? 4.515   4.805   -5.415  1.00 1.04  ? 126 ARG A C    1  
ATOM 1937   O O    . ARG A 1 126 ? 3.542   5.416   -5.013  1.00 0.94  ? 126 ARG A O    1  
ATOM 1938   C CB   . ARG A 1 126 ? 6.251   3.836   -3.875  1.00 1.16  ? 126 ARG A CB   1  
ATOM 1939   C CG   . ARG A 1 126 ? 5.856   4.461   -2.532  1.00 1.12  ? 126 ARG A CG   1  
ATOM 1940   C CD   . ARG A 1 126 ? 7.097   4.540   -1.623  1.00 1.19  ? 126 ARG A CD   1  
ATOM 1941   N NE   . ARG A 1 126 ? 6.909   5.638   -0.636  1.00 1.63  ? 126 ARG A NE   1  
ATOM 1942   C CZ   . ARG A 1 126 ? 7.749   5.782   0.349   1.00 2.01  ? 126 ARG A CZ   1  
ATOM 1943   N NH1  . ARG A 1 126 ? 8.754   4.961   0.473   1.00 2.27  ? 126 ARG A NH1  1  
ATOM 1944   N NH2  . ARG A 1 126 ? 7.593   6.756   1.203   1.00 2.77  ? 126 ARG A NH2  1  
ATOM 1945   H H    . ARG A 1 126 ? 6.312   2.233   -5.837  1.00 1.31  ? 126 ARG A H    1  
ATOM 1946   H HA   . ARG A 1 126 ? 4.228   3.121   -4.102  1.00 1.08  ? 126 ARG A HA   1  
ATOM 1947   H HB2  . ARG A 1 126 ? 6.790   2.920   -3.692  1.00 1.24  ? 126 ARG A HB2  1  
ATOM 1948   H HB3  . ARG A 1 126 ? 6.892   4.525   -4.412  1.00 1.17  ? 126 ARG A HB3  1  
ATOM 1949   H HG2  . ARG A 1 126 ? 5.462   5.453   -2.697  1.00 1.07  ? 126 ARG A HG2  1  
ATOM 1950   H HG3  . ARG A 1 126 ? 5.105   3.850   -2.058  1.00 1.16  ? 126 ARG A HG3  1  
ATOM 1951   H HD2  . ARG A 1 126 ? 7.222   3.612   -1.096  1.00 1.51  ? 126 ARG A HD2  1  
ATOM 1952   H HD3  . ARG A 1 126 ? 7.983   4.726   -2.222  1.00 1.51  ? 126 ARG A HD3  1  
ATOM 1953   H HE   . ARG A 1 126 ? 6.156   6.258   -0.730  1.00 2.21  ? 126 ARG A HE   1  
ATOM 1954   H HH11 . ARG A 1 126 ? 8.880   4.223   -0.188  1.00 2.25  ? 126 ARG A HH11 1  
ATOM 1955   H HH12 . ARG A 1 126 ? 9.398   5.069   1.231   1.00 2.91  ? 126 ARG A HH12 1  
ATOM 1956   H HH21 . ARG A 1 126 ? 6.828   7.392   1.102   1.00 3.19  ? 126 ARG A HH21 1  
ATOM 1957   H HH22 . ARG A 1 126 ? 8.239   6.867   1.958   1.00 3.20  ? 126 ARG A HH22 1  
ATOM 1958   N N    . ALA A 1 127 ? 5.170   5.187   -6.478  1.00 1.10  ? 127 ALA A N    1  
ATOM 1959   C CA   . ALA A 1 127 ? 4.738   6.395   -7.227  1.00 1.06  ? 127 ALA A CA   1  
ATOM 1960   C C    . ALA A 1 127 ? 3.365   6.116   -7.834  1.00 1.02  ? 127 ALA A C    1  
ATOM 1961   O O    . ALA A 1 127 ? 2.593   7.015   -8.101  1.00 0.95  ? 127 ALA A O    1  
ATOM 1962   C CB   . ALA A 1 127 ? 5.747   6.693   -8.338  1.00 1.19  ? 127 ALA A CB   1  
ATOM 1963   H H    . ALA A 1 127 ? 5.939   4.666   -6.792  1.00 1.19  ? 127 ALA A H    1  
ATOM 1964   H HA   . ALA A 1 127 ? 4.676   7.238   -6.554  1.00 1.01  ? 127 ALA A HA   1  
ATOM 1965   H HB1  . ALA A 1 127 ? 6.731   6.783   -7.907  1.00 1.66  ? 127 ALA A HB1  1  
ATOM 1966   H HB2  . ALA A 1 127 ? 5.739   5.889   -9.057  1.00 1.66  ? 127 ALA A HB2  1  
ATOM 1967   H HB3  . ALA A 1 127 ? 5.481   7.619   -8.829  1.00 1.43  ? 127 ALA A HB3  1  
ATOM 1968   N N    . ALA A 1 128 ? 3.051   4.864   -8.024  1.00 1.08  ? 128 ALA A N    1  
ATOM 1969   C CA   . ALA A 1 128 ? 1.717   4.517   -8.582  1.00 1.09  ? 128 ALA A CA   1  
ATOM 1970   C C    . ALA A 1 128 ? 0.660   5.026   -7.602  1.00 0.98  ? 128 ALA A C    1  
ATOM 1971   O O    . ALA A 1 128 ? -0.361  5.559   -7.988  1.00 0.96  ? 128 ALA A O    1  
ATOM 1972   C CB   . ALA A 1 128 ? 1.592   2.998   -8.761  1.00 1.20  ? 128 ALA A CB   1  
ATOM 1973   H H    . ALA A 1 128 ? 3.694   4.173   -7.763  1.00 1.15  ? 128 ALA A H    1  
ATOM 1974   H HA   . ALA A 1 128 ? 1.589   5.008   -9.536  1.00 1.10  ? 128 ALA A HA   1  
ATOM 1975   H HB1  . ALA A 1 128 ? 2.535   2.596   -9.096  1.00 1.54  ? 128 ALA A HB1  1  
ATOM 1976   H HB2  . ALA A 1 128 ? 1.319   2.539   -7.820  1.00 1.67  ? 128 ALA A HB2  1  
ATOM 1977   H HB3  . ALA A 1 128 ? 0.830   2.786   -9.498  1.00 1.53  ? 128 ALA A HB3  1  
ATOM 1978   N N    . ASP A 1 129 ? 0.915   4.879   -6.327  1.00 0.94  ? 129 ASP A N    1  
ATOM 1979   C CA   . ASP A 1 129 ? -0.056  5.372   -5.309  1.00 0.87  ? 129 ASP A CA   1  
ATOM 1980   C C    . ASP A 1 129 ? -0.211  6.887   -5.458  1.00 0.78  ? 129 ASP A C    1  
ATOM 1981   O O    . ASP A 1 129 ? -1.302  7.422   -5.390  1.00 0.74  ? 129 ASP A O    1  
ATOM 1982   C CB   . ASP A 1 129 ? 0.467   5.048   -3.907  1.00 0.88  ? 129 ASP A CB   1  
ATOM 1983   C CG   . ASP A 1 129 ? 0.398   3.538   -3.674  1.00 1.00  ? 129 ASP A CG   1  
ATOM 1984   O OD1  . ASP A 1 129 ? -0.368  2.888   -4.366  1.00 1.55  ? 129 ASP A OD1  1  
ATOM 1985   O OD2  . ASP A 1 129 ? 1.110   3.058   -2.809  1.00 1.46  ? 129 ASP A OD2  1  
ATOM 1986   H H    . ASP A 1 129 ? 1.755   4.457   -6.041  1.00 0.98  ? 129 ASP A H    1  
ATOM 1987   H HA   . ASP A 1 129 ? -1.011  4.894   -5.459  1.00 0.89  ? 129 ASP A HA   1  
ATOM 1988   H HB2  . ASP A 1 129 ? 1.493   5.379   -3.822  1.00 0.89  ? 129 ASP A HB2  1  
ATOM 1989   H HB3  . ASP A 1 129 ? -0.136  5.554   -3.169  1.00 0.87  ? 129 ASP A HB3  1  
ATOM 1990   N N    . VAL A 1 130 ? 0.871   7.580   -5.677  1.00 0.78  ? 130 VAL A N    1  
ATOM 1991   C CA   . VAL A 1 130 ? 0.787   9.058   -5.847  1.00 0.73  ? 130 VAL A CA   1  
ATOM 1992   C C    . VAL A 1 130 ? -0.040  9.351   -7.104  1.00 0.72  ? 130 VAL A C    1  
ATOM 1993   O O    . VAL A 1 130 ? -0.855  10.254  -7.139  1.00 0.67  ? 130 VAL A O    1  
ATOM 1994   C CB   . VAL A 1 130 ? 2.205   9.635   -5.987  1.00 0.77  ? 130 VAL A CB   1  
ATOM 1995   C CG1  . VAL A 1 130 ? 2.140   11.117  -6.360  1.00 0.76  ? 130 VAL A CG1  1  
ATOM 1996   C CG2  . VAL A 1 130 ? 2.949   9.474   -4.656  1.00 0.80  ? 130 VAL A CG2  1  
ATOM 1997   H H    . VAL A 1 130 ? 1.739   7.125   -5.738  1.00 0.84  ? 130 VAL A H    1  
ATOM 1998   H HA   . VAL A 1 130 ? 0.300   9.494   -4.987  1.00 0.70  ? 130 VAL A HA   1  
ATOM 1999   H HB   . VAL A 1 130 ? 2.740   9.104   -6.758  1.00 0.82  ? 130 VAL A HB   1  
ATOM 2000   H HG11 . VAL A 1 130 ? 1.514   11.641  -5.653  1.00 1.17  ? 130 VAL A HG11 1  
ATOM 2001   H HG12 . VAL A 1 130 ? 3.135   11.533  -6.337  1.00 1.29  ? 130 VAL A HG12 1  
ATOM 2002   H HG13 . VAL A 1 130 ? 1.731   11.226  -7.354  1.00 1.32  ? 130 VAL A HG13 1  
ATOM 2003   H HG21 . VAL A 1 130 ? 2.784   8.478   -4.267  1.00 1.30  ? 130 VAL A HG21 1  
ATOM 2004   H HG22 . VAL A 1 130 ? 4.007   9.627   -4.816  1.00 1.31  ? 130 VAL A HG22 1  
ATOM 2005   H HG23 . VAL A 1 130 ? 2.584   10.202  -3.947  1.00 1.28  ? 130 VAL A HG23 1  
ATOM 2006   N N    . ARG A 1 131 ? 0.165   8.574   -8.133  1.00 0.80  ? 131 ARG A N    1  
ATOM 2007   C CA   . ARG A 1 131 ? -0.596  8.763   -9.401  1.00 0.82  ? 131 ARG A CA   1  
ATOM 2008   C C    . ARG A 1 131 ? -2.087  8.536   -9.140  1.00 0.80  ? 131 ARG A C    1  
ATOM 2009   O O    . ARG A 1 131 ? -2.937  9.156   -9.749  1.00 0.79  ? 131 ARG A O    1  
ATOM 2010   C CB   . ARG A 1 131 ? -0.090  7.756   -10.437 1.00 0.93  ? 131 ARG A CB   1  
ATOM 2011   C CG   . ARG A 1 131 ? -0.758  8.012   -11.788 1.00 1.01  ? 131 ARG A CG   1  
ATOM 2012   C CD   . ARG A 1 131 ? -0.235  6.992   -12.801 1.00 1.15  ? 131 ARG A CD   1  
ATOM 2013   N NE   . ARG A 1 131 ? 1.190   7.289   -13.117 1.00 1.66  ? 131 ARG A NE   1  
ATOM 2014   C CZ   . ARG A 1 131 ? 1.936   6.376   -13.676 1.00 2.13  ? 131 ARG A CZ   1  
ATOM 2015   N NH1  . ARG A 1 131 ? 1.447   5.189   -13.913 1.00 2.30  ? 131 ARG A NH1  1  
ATOM 2016   N NH2  . ARG A 1 131 ? 3.176   6.644   -13.985 1.00 3.09  ? 131 ARG A NH2  1  
ATOM 2017   H H    . ARG A 1 131 ? 0.821   7.850   -8.067  1.00 0.86  ? 131 ARG A H    1  
ATOM 2018   H HA   . ARG A 1 131 ? -0.443  9.768   -9.769  1.00 0.80  ? 131 ARG A HA   1  
ATOM 2019   H HB2  . ARG A 1 131 ? 0.979   7.858   -10.541 1.00 0.97  ? 131 ARG A HB2  1  
ATOM 2020   H HB3  . ARG A 1 131 ? -0.324  6.754   -10.108 1.00 0.97  ? 131 ARG A HB3  1  
ATOM 2021   H HG2  . ARG A 1 131 ? -1.829  7.910   -11.689 1.00 1.05  ? 131 ARG A HG2  1  
ATOM 2022   H HG3  . ARG A 1 131 ? -0.519  9.010   -12.127 1.00 1.07  ? 131 ARG A HG3  1  
ATOM 2023   H HD2  . ARG A 1 131 ? -0.314  5.999   -12.379 1.00 1.55  ? 131 ARG A HD2  1  
ATOM 2024   H HD3  . ARG A 1 131 ? -0.819  7.048   -13.706 1.00 1.67  ? 131 ARG A HD3  1  
ATOM 2025   H HE   . ARG A 1 131 ? 1.563   8.173   -12.918 1.00 2.27  ? 131 ARG A HE   1  
ATOM 2026   H HH11 . ARG A 1 131 ? 0.501   4.980   -13.665 1.00 2.21  ? 131 ARG A HH11 1  
ATOM 2027   H HH12 . ARG A 1 131 ? 2.018   4.489   -14.341 1.00 2.97  ? 131 ARG A HH12 1  
ATOM 2028   H HH21 . ARG A 1 131 ? 3.553   7.551   -13.793 1.00 3.56  ? 131 ARG A HH21 1  
ATOM 2029   H HH22 . ARG A 1 131 ? 3.747   5.946   -14.416 1.00 3.58  ? 131 ARG A HH22 1  
ATOM 2030   N N    . ASP A 1 132 ? -2.411  7.645   -8.243  1.00 0.82  ? 132 ASP A N    1  
ATOM 2031   C CA   . ASP A 1 132 ? -3.848  7.372   -7.949  1.00 0.83  ? 132 ASP A CA   1  
ATOM 2032   C C    . ASP A 1 132 ? -4.520  8.653   -7.458  1.00 0.75  ? 132 ASP A C    1  
ATOM 2033   O O    . ASP A 1 132 ? -5.634  8.962   -7.834  1.00 0.76  ? 132 ASP A O    1  
ATOM 2034   C CB   . ASP A 1 132 ? -3.945  6.301   -6.855  1.00 0.88  ? 132 ASP A CB   1  
ATOM 2035   C CG   . ASP A 1 132 ? -5.416  6.015   -6.541  1.00 0.93  ? 132 ASP A CG   1  
ATOM 2036   O OD1  . ASP A 1 132 ? -6.264  6.672   -7.122  1.00 1.36  ? 132 ASP A OD1  1  
ATOM 2037   O OD2  . ASP A 1 132 ? -5.669  5.155   -5.709  1.00 1.46  ? 132 ASP A OD2  1  
ATOM 2038   H H    . ASP A 1 132 ? -1.711  7.152   -7.767  1.00 0.84  ? 132 ASP A H    1  
ATOM 2039   H HA   . ASP A 1 132 ? -4.340  7.021   -8.842  1.00 0.88  ? 132 ASP A HA   1  
ATOM 2040   H HB2  . ASP A 1 132 ? -3.468  5.395   -7.199  1.00 0.94  ? 132 ASP A HB2  1  
ATOM 2041   H HB3  . ASP A 1 132 ? -3.450  6.653   -5.963  1.00 0.86  ? 132 ASP A HB3  1  
ATOM 2042   N N    . ILE A 1 133 ? -3.858  9.403   -6.625  1.00 0.69  ? 133 ILE A N    1  
ATOM 2043   C CA   . ILE A 1 133 ? -4.468  10.663  -6.115  1.00 0.64  ? 133 ILE A CA   1  
ATOM 2044   C C    . ILE A 1 133 ? -4.776  11.603  -7.285  1.00 0.60  ? 133 ILE A C    1  
ATOM 2045   O O    . ILE A 1 133 ? -5.836  12.191  -7.363  1.00 0.66  ? 133 ILE A O    1  
ATOM 2046   C CB   . ILE A 1 133 ? -3.492  11.355  -5.164  1.00 0.63  ? 133 ILE A CB   1  
ATOM 2047   C CG1  . ILE A 1 133 ? -3.186  10.431  -3.982  1.00 0.69  ? 133 ILE A CG1  1  
ATOM 2048   C CG2  . ILE A 1 133 ? -4.118  12.650  -4.646  1.00 0.61  ? 133 ILE A CG2  1  
ATOM 2049   C CD1  . ILE A 1 133 ? -2.032  11.013  -3.164  1.00 0.71  ? 133 ILE A CD1  1  
ATOM 2050   H H    . ILE A 1 133 ? -2.959  9.138   -6.331  1.00 0.70  ? 133 ILE A H    1  
ATOM 2051   H HA   . ILE A 1 133 ? -5.381  10.432  -5.587  1.00 0.68  ? 133 ILE A HA   1  
ATOM 2052   H HB   . ILE A 1 133 ? -2.578  11.583  -5.693  1.00 0.63  ? 133 ILE A HB   1  
ATOM 2053   H HG12 . ILE A 1 133 ? -4.065  10.343  -3.358  1.00 0.71  ? 133 ILE A HG12 1  
ATOM 2054   H HG13 . ILE A 1 133 ? -2.908  9.456   -4.352  1.00 0.74  ? 133 ILE A HG13 1  
ATOM 2055   H HG21 . ILE A 1 133 ? -5.119  12.449  -4.296  1.00 1.07  ? 133 ILE A HG21 1  
ATOM 2056   H HG22 . ILE A 1 133 ? -3.523  13.039  -3.833  1.00 1.20  ? 133 ILE A HG22 1  
ATOM 2057   H HG23 . ILE A 1 133 ? -4.155  13.376  -5.445  1.00 1.20  ? 133 ILE A HG23 1  
ATOM 2058   H HD11 . ILE A 1 133 ? -1.217  11.276  -3.822  1.00 1.05  ? 133 ILE A HD11 1  
ATOM 2059   H HD12 . ILE A 1 133 ? -2.372  11.894  -2.641  1.00 1.15  ? 133 ILE A HD12 1  
ATOM 2060   H HD13 . ILE A 1 133 ? -1.692  10.279  -2.450  1.00 1.22  ? 133 ILE A HD13 1  
ATOM 2061   N N    . GLY A 1 134 ? -3.847  11.753  -8.186  1.00 0.57  ? 134 GLY A N    1  
ATOM 2062   C CA   . GLY A 1 134 ? -4.063  12.664  -9.350  1.00 0.56  ? 134 GLY A CA   1  
ATOM 2063   C C    . GLY A 1 134 ? -5.232  12.180  -10.218 1.00 0.56  ? 134 GLY A C    1  
ATOM 2064   O O    . GLY A 1 134 ? -6.041  12.965  -10.674 1.00 0.55  ? 134 GLY A O    1  
ATOM 2065   H H    . GLY A 1 134 ? -3.001  11.266  -8.089  1.00 0.61  ? 134 GLY A H    1  
ATOM 2066   H HA2  . GLY A 1 134 ? -4.276  13.660  -8.988  1.00 0.55  ? 134 GLY A HA2  1  
ATOM 2067   H HA3  . GLY A 1 134 ? -3.167  12.690  -9.952  1.00 0.59  ? 134 GLY A HA3  1  
ATOM 2068   N N    . LYS A 1 135 ? -5.313  10.905  -10.478 1.00 0.62  ? 135 LYS A N    1  
ATOM 2069   C CA   . LYS A 1 135 ? -6.420  10.393  -11.350 1.00 0.67  ? 135 LYS A CA   1  
ATOM 2070   C C    . LYS A 1 135 ? -7.791  10.715  -10.740 1.00 0.65  ? 135 LYS A C    1  
ATOM 2071   O O    . LYS A 1 135 ? -8.677  11.207  -11.416 1.00 0.65  ? 135 LYS A O    1  
ATOM 2072   C CB   . LYS A 1 135 ? -6.278  8.876   -11.524 1.00 0.75  ? 135 LYS A CB   1  
ATOM 2073   C CG   . LYS A 1 135 ? -5.052  8.583   -12.395 1.00 1.24  ? 135 LYS A CG   1  
ATOM 2074   C CD   . LYS A 1 135 ? -4.854  7.067   -12.558 1.00 1.30  ? 135 LYS A CD   1  
ATOM 2075   C CE   . LYS A 1 135 ? -5.863  6.501   -13.565 1.00 1.98  ? 135 LYS A CE   1  
ATOM 2076   N NZ   . LYS A 1 135 ? -5.473  5.107   -13.925 1.00 2.59  ? 135 LYS A NZ   1  
ATOM 2077   H H    . LYS A 1 135 ? -4.637  10.289  -10.122 1.00 0.65  ? 135 LYS A H    1  
ATOM 2078   H HA   . LYS A 1 135 ? -6.347  10.864  -12.319 1.00 0.68  ? 135 LYS A HA   1  
ATOM 2079   H HB2  . LYS A 1 135 ? -6.157  8.412   -10.556 1.00 1.14  ? 135 LYS A HB2  1  
ATOM 2080   H HB3  . LYS A 1 135 ? -7.163  8.488   -12.004 1.00 1.18  ? 135 LYS A HB3  1  
ATOM 2081   H HG2  . LYS A 1 135 ? -5.189  9.035   -13.366 1.00 1.88  ? 135 LYS A HG2  1  
ATOM 2082   H HG3  . LYS A 1 135 ? -4.176  9.007   -11.928 1.00 1.90  ? 135 LYS A HG3  1  
ATOM 2083   H HD2  . LYS A 1 135 ? -3.852  6.875   -12.913 1.00 1.58  ? 135 LYS A HD2  1  
ATOM 2084   H HD3  . LYS A 1 135 ? -4.993  6.582   -11.603 1.00 1.71  ? 135 LYS A HD3  1  
ATOM 2085   H HE2  . LYS A 1 135 ? -6.848  6.492   -13.126 1.00 2.50  ? 135 LYS A HE2  1  
ATOM 2086   H HE3  . LYS A 1 135 ? -5.871  7.111   -14.456 1.00 2.39  ? 135 LYS A HE3  1  
ATOM 2087   H HZ1  . LYS A 1 135 ? -5.236  4.579   -13.061 1.00 2.78  ? 135 LYS A HZ1  1  
ATOM 2088   H HZ2  . LYS A 1 135 ? -6.265  4.640   -14.408 1.00 3.03  ? 135 LYS A HZ2  1  
ATOM 2089   H HZ3  . LYS A 1 135 ? -4.646  5.130   -14.557 1.00 3.10  ? 135 LYS A HZ3  1  
ATOM 2090   N N    . ARG A 1 136 ? -7.984  10.446  -9.476  1.00 0.65  ? 136 ARG A N    1  
ATOM 2091   C CA   . ARG A 1 136 ? -9.306  10.738  -8.843  1.00 0.67  ? 136 ARG A CA   1  
ATOM 2092   C C    . ARG A 1 136 ? -9.510  12.248  -8.738  1.00 0.63  ? 136 ARG A C    1  
ATOM 2093   O O    . ARG A 1 136 ? -10.623 12.735  -8.763  1.00 0.65  ? 136 ARG A O    1  
ATOM 2094   C CB   . ARG A 1 136 ? -9.348  10.115  -7.448  1.00 0.72  ? 136 ARG A CB   1  
ATOM 2095   C CG   . ARG A 1 136 ? -9.409  8.595   -7.579  1.00 0.86  ? 136 ARG A CG   1  
ATOM 2096   C CD   . ARG A 1 136 ? -9.453  7.968   -6.189  1.00 1.01  ? 136 ARG A CD   1  
ATOM 2097   N NE   . ARG A 1 136 ? -9.468  6.485   -6.317  1.00 1.21  ? 136 ARG A NE   1  
ATOM 2098   C CZ   . ARG A 1 136 ? -9.216  5.743   -5.276  1.00 2.12  ? 136 ARG A CZ   1  
ATOM 2099   N NH1  . ARG A 1 136 ? -8.962  6.306   -4.126  1.00 2.83  ? 136 ARG A NH1  1  
ATOM 2100   N NH2  . ARG A 1 136 ? -9.228  4.444   -5.384  1.00 2.77  ? 136 ARG A NH2  1  
ATOM 2101   H H    . ARG A 1 136 ? -7.272  10.047  -8.935  1.00 0.67  ? 136 ARG A H    1  
ATOM 2102   H HA   . ARG A 1 136 ? -10.093 10.313  -9.448  1.00 0.71  ? 136 ARG A HA   1  
ATOM 2103   H HB2  . ARG A 1 136 ? -8.459  10.395  -6.901  1.00 0.73  ? 136 ARG A HB2  1  
ATOM 2104   H HB3  . ARG A 1 136 ? -10.223 10.466  -6.922  1.00 0.73  ? 136 ARG A HB3  1  
ATOM 2105   H HG2  . ARG A 1 136 ? -10.298 8.318   -8.129  1.00 0.94  ? 136 ARG A HG2  1  
ATOM 2106   H HG3  . ARG A 1 136 ? -8.534  8.243   -8.105  1.00 0.89  ? 136 ARG A HG3  1  
ATOM 2107   H HD2  . ARG A 1 136 ? -8.583  8.271   -5.627  1.00 1.48  ? 136 ARG A HD2  1  
ATOM 2108   H HD3  . ARG A 1 136 ? -10.344 8.295   -5.675  1.00 1.45  ? 136 ARG A HD3  1  
ATOM 2109   H HE   . ARG A 1 136 ? -9.666  6.067   -7.182  1.00 1.45  ? 136 ARG A HE   1  
ATOM 2110   H HH11 . ARG A 1 136 ? -8.963  7.303   -4.048  1.00 2.73  ? 136 ARG A HH11 1  
ATOM 2111   H HH12 . ARG A 1 136 ? -8.766  5.741   -3.326  1.00 3.71  ? 136 ARG A HH12 1  
ATOM 2112   H HH21 . ARG A 1 136 ? -9.432  4.017   -6.265  1.00 2.75  ? 136 ARG A HH21 1  
ATOM 2113   H HH22 . ARG A 1 136 ? -9.033  3.875   -4.587  1.00 3.55  ? 136 ARG A HH22 1  
ATOM 2114   N N    . LEU A 1 137 ? -8.448  12.991  -8.621  1.00 0.59  ? 137 LEU A N    1  
ATOM 2115   C CA   . LEU A 1 137 ? -8.588  14.467  -8.517  1.00 0.57  ? 137 LEU A CA   1  
ATOM 2116   C C    . LEU A 1 137 ? -9.293  14.978  -9.772  1.00 0.56  ? 137 LEU A C    1  
ATOM 2117   O O    . LEU A 1 137 ? -10.168 15.819  -9.705  1.00 0.61  ? 137 LEU A O    1  
ATOM 2118   C CB   . LEU A 1 137 ? -7.191  15.088  -8.391  1.00 0.57  ? 137 LEU A CB   1  
ATOM 2119   C CG   . LEU A 1 137 ? -7.279  16.617  -8.348  1.00 0.63  ? 137 LEU A CG   1  
ATOM 2120   C CD1  . LEU A 1 137 ? -8.160  17.067  -7.172  1.00 1.19  ? 137 LEU A CD1  1  
ATOM 2121   C CD2  . LEU A 1 137 ? -5.864  17.182  -8.177  1.00 1.25  ? 137 LEU A CD2  1  
ATOM 2122   H H    . LEU A 1 137 ? -7.560  12.580  -8.603  1.00 0.60  ? 137 LEU A H    1  
ATOM 2123   H HA   . LEU A 1 137 ? -9.176  14.711  -7.645  1.00 0.59  ? 137 LEU A HA   1  
ATOM 2124   H HB2  . LEU A 1 137 ? -6.726  14.734  -7.482  1.00 0.64  ? 137 LEU A HB2  1  
ATOM 2125   H HB3  . LEU A 1 137 ? -6.592  14.789  -9.237  1.00 0.59  ? 137 LEU A HB3  1  
ATOM 2126   H HG   . LEU A 1 137 ? -7.701  16.979  -9.274  1.00 1.22  ? 137 LEU A HG   1  
ATOM 2127   H HD11 . LEU A 1 137 ? -8.009  16.409  -6.329  1.00 1.82  ? 137 LEU A HD11 1  
ATOM 2128   H HD12 . LEU A 1 137 ? -7.901  18.077  -6.888  1.00 1.68  ? 137 LEU A HD12 1  
ATOM 2129   H HD13 . LEU A 1 137 ? -9.198  17.037  -7.470  1.00 1.68  ? 137 LEU A HD13 1  
ATOM 2130   H HD21 . LEU A 1 137 ? -5.402  16.736  -7.309  1.00 1.65  ? 137 LEU A HD21 1  
ATOM 2131   H HD22 . LEU A 1 137 ? -5.276  16.953  -9.054  1.00 1.87  ? 137 LEU A HD22 1  
ATOM 2132   H HD23 . LEU A 1 137 ? -5.917  18.251  -8.046  1.00 1.86  ? 137 LEU A HD23 1  
ATOM 2133   N N    . LEU A 1 138 ? -8.941  14.460  -10.917 1.00 0.56  ? 138 LEU A N    1  
ATOM 2134   C CA   . LEU A 1 138 ? -9.617  14.899  -12.171 1.00 0.59  ? 138 LEU A CA   1  
ATOM 2135   C C    . LEU A 1 138 ? -11.101 14.558  -12.090 1.00 0.62  ? 138 LEU A C    1  
ATOM 2136   O O    . LEU A 1 138 ? -11.950 15.329  -12.491 1.00 0.67  ? 138 LEU A O    1  
ATOM 2137   C CB   . LEU A 1 138 ? -9.006  14.175  -13.369 1.00 0.62  ? 138 LEU A CB   1  
ATOM 2138   C CG   . LEU A 1 138 ? -7.585  14.689  -13.612 1.00 0.64  ? 138 LEU A CG   1  
ATOM 2139   C CD1  . LEU A 1 138 ? -6.903  13.809  -14.666 1.00 0.67  ? 138 LEU A CD1  1  
ATOM 2140   C CD2  . LEU A 1 138 ? -7.626  16.158  -14.092 1.00 0.70  ? 138 LEU A CD2  1  
ATOM 2141   H H    . LEU A 1 138 ? -8.244  13.772  -10.949 1.00 0.58  ? 138 LEU A H    1  
ATOM 2142   H HA   . LEU A 1 138 ? -9.499  15.965  -12.292 1.00 0.59  ? 138 LEU A HA   1  
ATOM 2143   H HB2  . LEU A 1 138 ? -8.976  13.114  -13.167 1.00 0.62  ? 138 LEU A HB2  1  
ATOM 2144   H HB3  . LEU A 1 138 ? -9.611  14.354  -14.245 1.00 0.66  ? 138 LEU A HB3  1  
ATOM 2145   H HG   . LEU A 1 138 ? -7.027  14.630  -12.689 1.00 0.65  ? 138 LEU A HG   1  
ATOM 2146   H HD11 . LEU A 1 138 ? -7.016  12.768  -14.397 1.00 1.17  ? 138 LEU A HD11 1  
ATOM 2147   H HD12 . LEU A 1 138 ? -7.357  13.983  -15.630 1.00 1.29  ? 138 LEU A HD12 1  
ATOM 2148   H HD13 . LEU A 1 138 ? -5.853  14.054  -14.714 1.00 1.22  ? 138 LEU A HD13 1  
ATOM 2149   H HD21 . LEU A 1 138 ? -8.554  16.359  -14.611 1.00 1.24  ? 138 LEU A HD21 1  
ATOM 2150   H HD22 . LEU A 1 138 ? -7.546  16.815  -13.239 1.00 1.16  ? 138 LEU A HD22 1  
ATOM 2151   H HD23 . LEU A 1 138 ? -6.802  16.345  -14.759 1.00 1.25  ? 138 LEU A HD23 1  
ATOM 2152   N N    . ARG A 1 139 ? -11.419 13.412  -11.559 1.00 0.65  ? 139 ARG A N    1  
ATOM 2153   C CA   . ARG A 1 139 ? -12.851 13.026  -11.430 1.00 0.70  ? 139 ARG A CA   1  
ATOM 2154   C C    . ARG A 1 139 ? -13.522 13.941  -10.407 1.00 0.68  ? 139 ARG A C    1  
ATOM 2155   O O    . ARG A 1 139 ? -14.655 14.351  -10.564 1.00 0.72  ? 139 ARG A O    1  
ATOM 2156   C CB   . ARG A 1 139 ? -12.956 11.575  -10.955 1.00 0.75  ? 139 ARG A CB   1  
ATOM 2157   C CG   . ARG A 1 139 ? -12.501 10.627  -12.066 1.00 0.80  ? 139 ARG A CG   1  
ATOM 2158   C CD   . ARG A 1 139 ? -12.619 9.178   -11.583 1.00 0.85  ? 139 ARG A CD   1  
ATOM 2159   N NE   . ARG A 1 139 ? -12.107 8.262   -12.641 1.00 1.34  ? 139 ARG A NE   1  
ATOM 2160   C CZ   . ARG A 1 139 ? -11.885 7.004   -12.372 1.00 1.71  ? 139 ARG A CZ   1  
ATOM 2161   N NH1  . ARG A 1 139 ? -12.159 6.527   -11.188 1.00 1.82  ? 139 ARG A NH1  1  
ATOM 2162   N NH2  . ARG A 1 139 ? -11.394 6.220   -13.293 1.00 2.57  ? 139 ARG A NH2  1  
ATOM 2163   H H    . ARG A 1 139 ? -10.713 12.817  -11.221 1.00 0.67  ? 139 ARG A H    1  
ATOM 2164   H HA   . ARG A 1 139 ? -13.342 13.131  -12.387 1.00 0.74  ? 139 ARG A HA   1  
ATOM 2165   H HB2  . ARG A 1 139 ? -12.323 11.438  -10.089 1.00 0.74  ? 139 ARG A HB2  1  
ATOM 2166   H HB3  . ARG A 1 139 ? -13.979 11.354  -10.691 1.00 0.85  ? 139 ARG A HB3  1  
ATOM 2167   H HG2  . ARG A 1 139 ? -13.125 10.769  -12.937 1.00 0.95  ? 139 ARG A HG2  1  
ATOM 2168   H HG3  . ARG A 1 139 ? -11.475 10.837  -12.321 1.00 0.82  ? 139 ARG A HG3  1  
ATOM 2169   H HD2  . ARG A 1 139 ? -12.037 9.046   -10.685 1.00 1.33  ? 139 ARG A HD2  1  
ATOM 2170   H HD3  . ARG A 1 139 ? -13.656 8.953   -11.371 1.00 1.24  ? 139 ARG A HD3  1  
ATOM 2171   H HE   . ARG A 1 139 ? -11.920 8.610   -13.538 1.00 1.93  ? 139 ARG A HE   1  
ATOM 2172   H HH11 . ARG A 1 139 ? -12.541 7.124   -10.483 1.00 1.81  ? 139 ARG A HH11 1  
ATOM 2173   H HH12 . ARG A 1 139 ? -11.988 5.562   -10.985 1.00 2.36  ? 139 ARG A HH12 1  
ATOM 2174   H HH21 . ARG A 1 139 ? -11.186 6.584   -14.200 1.00 3.05  ? 139 ARG A HH21 1  
ATOM 2175   H HH22 . ARG A 1 139 ? -11.229 5.254   -13.092 1.00 2.94  ? 139 ARG A HH22 1  
ATOM 2176   N N    . ASN A 1 140 ? -12.829 14.241  -9.346  1.00 0.65  ? 140 ASN A N    1  
ATOM 2177   C CA   . ASN A 1 140 ? -13.404 15.105  -8.281  1.00 0.68  ? 140 ASN A CA   1  
ATOM 2178   C C    . ASN A 1 140 ? -13.779 16.484  -8.827  1.00 0.68  ? 140 ASN A C    1  
ATOM 2179   O O    . ASN A 1 140 ? -14.791 17.045  -8.458  1.00 0.78  ? 140 ASN A O    1  
ATOM 2180   C CB   . ASN A 1 140 ? -12.383 15.278  -7.157  1.00 0.69  ? 140 ASN A CB   1  
ATOM 2181   C CG   . ASN A 1 140 ? -12.130 13.927  -6.490  1.00 0.73  ? 140 ASN A CG   1  
ATOM 2182   O OD1  . ASN A 1 140 ? -11.475 13.853  -5.470  1.00 1.23  ? 140 ASN A OD1  1  
ATOM 2183   N ND2  . ASN A 1 140 ? -12.618 12.848  -7.034  1.00 0.84  ? 140 ASN A ND2  1  
ATOM 2184   H H    . ASN A 1 140 ? -11.923 13.880  -9.243  1.00 0.64  ? 140 ASN A H    1  
ATOM 2185   H HA   . ASN A 1 140 ? -14.287 14.632  -7.882  1.00 0.72  ? 140 ASN A HA   1  
ATOM 2186   H HB2  . ASN A 1 140 ? -11.459 15.662  -7.565  1.00 0.67  ? 140 ASN A HB2  1  
ATOM 2187   H HB3  . ASN A 1 140 ? -12.773 15.971  -6.427  1.00 0.75  ? 140 ASN A HB3  1  
ATOM 2188   H HD21 . ASN A 1 140 ? -13.141 12.910  -7.862  1.00 1.26  ? 140 ASN A HD21 1  
ATOM 2189   H HD22 . ASN A 1 140 ? -12.460 11.976  -6.618  1.00 0.84  ? 140 ASN A HD22 1  
ATOM 2190   N N    . ILE A 1 141 ? -12.984 17.045  -9.697  1.00 0.66  ? 141 ILE A N    1  
ATOM 2191   C CA   . ILE A 1 141 ? -13.324 18.388  -10.240 1.00 0.70  ? 141 ILE A CA   1  
ATOM 2192   C C    . ILE A 1 141 ? -14.482 18.266  -11.222 1.00 0.73  ? 141 ILE A C    1  
ATOM 2193   O O    . ILE A 1 141 ? -15.378 19.087  -11.251 1.00 0.81  ? 141 ILE A O    1  
ATOM 2194   C CB   . ILE A 1 141 ? -12.112 18.961  -10.966 1.00 0.69  ? 141 ILE A CB   1  
ATOM 2195   C CG1  . ILE A 1 141 ? -10.957 19.128  -9.978  1.00 0.68  ? 141 ILE A CG1  1  
ATOM 2196   C CG2  . ILE A 1 141 ? -12.480 20.321  -11.562 1.00 0.78  ? 141 ILE A CG2  1  
ATOM 2197   C CD1  . ILE A 1 141 ? -9.677  19.450  -10.747 1.00 0.70  ? 141 ILE A CD1  1  
ATOM 2198   H H    . ILE A 1 141 ? -12.181 16.590  -10.021 1.00 0.66  ? 141 ILE A H    1  
ATOM 2199   H HA   . ILE A 1 141 ? -13.604 19.044  -9.430  1.00 0.74  ? 141 ILE A HA   1  
ATOM 2200   H HB   . ILE A 1 141 ? -11.816 18.289  -11.759 1.00 0.69  ? 141 ILE A HB   1  
ATOM 2201   H HG12 . ILE A 1 141 ? -11.182 19.935  -9.295  1.00 0.74  ? 141 ILE A HG12 1  
ATOM 2202   H HG13 . ILE A 1 141 ? -10.821 18.212  -9.423  1.00 0.66  ? 141 ILE A HG13 1  
ATOM 2203   H HG21 . ILE A 1 141 ? -12.972 20.920  -10.812 1.00 1.30  ? 141 ILE A HG21 1  
ATOM 2204   H HG22 . ILE A 1 141 ? -11.584 20.824  -11.897 1.00 1.26  ? 141 ILE A HG22 1  
ATOM 2205   H HG23 . ILE A 1 141 ? -13.145 20.177  -12.401 1.00 1.34  ? 141 ILE A HG23 1  
ATOM 2206   H HD11 . ILE A 1 141 ? -9.827  20.341  -11.338 1.00 1.30  ? 141 ILE A HD11 1  
ATOM 2207   H HD12 . ILE A 1 141 ? -8.869  19.613  -10.050 1.00 1.23  ? 141 ILE A HD12 1  
ATOM 2208   H HD13 . ILE A 1 141 ? -9.431  18.623  -11.396 1.00 1.17  ? 141 ILE A HD13 1  
ATOM 2209   N N    . LEU A 1 142 ? -14.461 17.251  -12.038 1.00 0.70  ? 142 LEU A N    1  
ATOM 2210   C CA   . LEU A 1 142 ? -15.549 17.074  -13.029 1.00 0.76  ? 142 LEU A CA   1  
ATOM 2211   C C    . LEU A 1 142 ? -16.834 16.677  -12.307 1.00 0.79  ? 142 LEU A C    1  
ATOM 2212   O O    . LEU A 1 142 ? -17.925 17.000  -12.734 1.00 0.86  ? 142 LEU A O    1  
ATOM 2213   C CB   . LEU A 1 142 ? -15.155 15.986  -14.030 1.00 0.75  ? 142 LEU A CB   1  
ATOM 2214   C CG   . LEU A 1 142 ? -13.946 16.454  -14.857 1.00 0.82  ? 142 LEU A CG   1  
ATOM 2215   C CD1  . LEU A 1 142 ? -13.397 15.270  -15.656 1.00 0.84  ? 142 LEU A CD1  1  
ATOM 2216   C CD2  . LEU A 1 142 ? -14.355 17.585  -15.826 1.00 1.00  ? 142 LEU A CD2  1  
ATOM 2217   H H    . LEU A 1 142 ? -13.723 16.607  -12.000 1.00 0.66  ? 142 LEU A H    1  
ATOM 2218   H HA   . LEU A 1 142 ? -15.706 18.000  -13.547 1.00 0.82  ? 142 LEU A HA   1  
ATOM 2219   H HB2  . LEU A 1 142 ? -14.896 15.085  -13.495 1.00 0.74  ? 142 LEU A HB2  1  
ATOM 2220   H HB3  . LEU A 1 142 ? -15.985 15.784  -14.689 1.00 0.82  ? 142 LEU A HB3  1  
ATOM 2221   H HG   . LEU A 1 142 ? -13.179 16.816  -14.187 1.00 0.87  ? 142 LEU A HG   1  
ATOM 2222   H HD11 . LEU A 1 142 ? -13.156 14.461  -14.981 1.00 1.34  ? 142 LEU A HD11 1  
ATOM 2223   H HD12 . LEU A 1 142 ? -14.140 14.937  -16.364 1.00 1.30  ? 142 LEU A HD12 1  
ATOM 2224   H HD13 . LEU A 1 142 ? -12.505 15.576  -16.186 1.00 1.30  ? 142 LEU A HD13 1  
ATOM 2225   H HD21 . LEU A 1 142 ? -15.357 17.416  -16.189 1.00 1.41  ? 142 LEU A HD21 1  
ATOM 2226   H HD22 . LEU A 1 142 ? -14.317 18.534  -15.309 1.00 1.60  ? 142 LEU A HD22 1  
ATOM 2227   H HD23 . LEU A 1 142 ? -13.671 17.612  -16.663 1.00 1.37  ? 142 LEU A HD23 1  
ATOM 2228   N N    . GLY A 1 143 ? -16.714 15.966  -11.219 1.00 0.79  ? 143 GLY A N    1  
ATOM 2229   C CA   . GLY A 1 143 ? -17.927 15.533  -10.469 1.00 0.88  ? 143 GLY A CA   1  
ATOM 2230   C C    . GLY A 1 143 ? -18.403 14.186  -11.016 1.00 0.84  ? 143 GLY A C    1  
ATOM 2231   O O    . GLY A 1 143 ? -19.585 13.934  -11.130 1.00 0.89  ? 143 GLY A O    1  
ATOM 2232   H H    . GLY A 1 143 ? -15.826 15.705  -10.897 1.00 0.76  ? 143 GLY A H    1  
ATOM 2233   H HA2  . GLY A 1 143 ? -17.681 15.431  -9.422  1.00 0.95  ? 143 GLY A HA2  1  
ATOM 2234   H HA3  . GLY A 1 143 ? -18.712 16.264  -10.586 1.00 0.96  ? 143 GLY A HA3  1  
ATOM 2235   N N    . LEU A 1 144 ? -17.488 13.318  -11.360 1.00 0.79  ? 144 LEU A N    1  
ATOM 2236   C CA   . LEU A 1 144 ? -17.886 11.994  -11.900 1.00 0.83  ? 144 LEU A CA   1  
ATOM 2237   C C    . LEU A 1 144 ? -18.423 11.136  -10.748 1.00 0.96  ? 144 LEU A C    1  
ATOM 2238   O O    . LEU A 1 144 ? -17.943 11.206  -9.634  1.00 1.01  ? 144 LEU A O    1  
ATOM 2239   C CB   . LEU A 1 144 ? -16.657 11.327  -12.531 1.00 0.88  ? 144 LEU A CB   1  
ATOM 2240   C CG   . LEU A 1 144 ? -17.077 10.185  -13.471 1.00 0.98  ? 144 LEU A CG   1  
ATOM 2241   C CD1  . LEU A 1 144 ? -17.880 10.739  -14.669 1.00 1.07  ? 144 LEU A CD1  1  
ATOM 2242   C CD2  . LEU A 1 144 ? -15.813 9.475   -13.977 1.00 1.14  ? 144 LEU A CD2  1  
ATOM 2243   H H    . LEU A 1 144 ? -16.538 13.540  -11.267 1.00 0.75  ? 144 LEU A H    1  
ATOM 2244   H HA   . LEU A 1 144 ? -18.656 12.128  -12.641 1.00 0.84  ? 144 LEU A HA   1  
ATOM 2245   H HB2  . LEU A 1 144 ? -16.101 12.064  -13.091 1.00 0.89  ? 144 LEU A HB2  1  
ATOM 2246   H HB3  . LEU A 1 144 ? -16.029 10.927  -11.748 1.00 0.94  ? 144 LEU A HB3  1  
ATOM 2247   H HG   . LEU A 1 144 ? -17.689 9.482   -12.925 1.00 1.01  ? 144 LEU A HG   1  
ATOM 2248   H HD11 . LEU A 1 144 ? -17.577 11.756  -14.877 1.00 1.44  ? 144 LEU A HD11 1  
ATOM 2249   H HD12 . LEU A 1 144 ? -17.707 10.128  -15.544 1.00 1.59  ? 144 LEU A HD12 1  
ATOM 2250   H HD13 . LEU A 1 144 ? -18.933 10.722  -14.433 1.00 1.48  ? 144 LEU A HD13 1  
ATOM 2251   H HD21 . LEU A 1 144 ? -15.099 10.211  -14.326 1.00 1.50  ? 144 LEU A HD21 1  
ATOM 2252   H HD22 . LEU A 1 144 ? -15.375 8.902   -13.173 1.00 1.51  ? 144 LEU A HD22 1  
ATOM 2253   H HD23 . LEU A 1 144 ? -16.073 8.813   -14.790 1.00 1.67  ? 144 LEU A HD23 1  
ATOM 2254   N N    . LYS A 1 145 ? -19.433 10.352  -11.000 1.00 1.27  ? 145 LYS A N    1  
ATOM 2255   C CA   . LYS A 1 145 ? -20.026 9.515   -9.913  1.00 1.49  ? 145 LYS A CA   1  
ATOM 2256   C C    . LYS A 1 145 ? -19.054 8.407   -9.492  1.00 1.12  ? 145 LYS A C    1  
ATOM 2257   O O    . LYS A 1 145 ? -18.355 7.831   -10.304 1.00 1.12  ? 145 LYS A O    1  
ATOM 2258   C CB   . LYS A 1 145 ? -21.332 8.887   -10.413 1.00 2.04  ? 145 LYS A CB   1  
ATOM 2259   C CG   . LYS A 1 145 ? -22.043 8.133   -9.274  1.00 2.33  ? 145 LYS A CG   1  
ATOM 2260   C CD   . LYS A 1 145 ? -22.488 9.120   -8.179  1.00 3.18  ? 145 LYS A CD   1  
ATOM 2261   C CE   . LYS A 1 145 ? -23.664 8.540   -7.389  1.00 3.88  ? 145 LYS A CE   1  
ATOM 2262   N NZ   . LYS A 1 145 ? -24.089 9.523   -6.354  1.00 4.60  ? 145 LYS A NZ   1  
ATOM 2263   H H    . LYS A 1 145 ? -19.817 10.328  -11.900 1.00 1.46  ? 145 LYS A H    1  
ATOM 2264   H HA   . LYS A 1 145 ? -20.236 10.146  -9.065  1.00 1.68  ? 145 LYS A HA   1  
ATOM 2265   H HB2  . LYS A 1 145 ? -21.981 9.663   -10.788 1.00 2.33  ? 145 LYS A HB2  1  
ATOM 2266   H HB3  . LYS A 1 145 ? -21.109 8.195   -11.210 1.00 2.06  ? 145 LYS A HB3  1  
ATOM 2267   H HG2  . LYS A 1 145 ? -22.908 7.624   -9.677  1.00 2.20  ? 145 LYS A HG2  1  
ATOM 2268   H HG3  . LYS A 1 145 ? -21.368 7.406   -8.848  1.00 2.54  ? 145 LYS A HG3  1  
ATOM 2269   H HD2  . LYS A 1 145 ? -21.667 9.298   -7.500  1.00 3.61  ? 145 LYS A HD2  1  
ATOM 2270   H HD3  . LYS A 1 145 ? -22.791 10.055  -8.629  1.00 3.35  ? 145 LYS A HD3  1  
ATOM 2271   H HE2  . LYS A 1 145 ? -24.488 8.342   -8.058  1.00 4.02  ? 145 LYS A HE2  1  
ATOM 2272   H HE3  . LYS A 1 145 ? -23.359 7.621   -6.909  1.00 4.22  ? 145 LYS A HE3  1  
ATOM 2273   H HZ1  . LYS A 1 145 ? -24.240 10.451  -6.799  1.00 4.85  ? 145 LYS A HZ1  1  
ATOM 2274   H HZ2  . LYS A 1 145 ? -24.974 9.205   -5.911  1.00 4.96  ? 145 LYS A HZ2  1  
ATOM 2275   H HZ3  . LYS A 1 145 ? -23.347 9.605   -5.628  1.00 4.90  ? 145 LYS A HZ3  1  
ATOM 2276   N N    . ILE A 1 146 ? -19.015 8.108   -8.215  1.00 0.99  ? 146 ILE A N    1  
ATOM 2277   C CA   . ILE A 1 146 ? -18.103 7.037   -7.693  1.00 0.75  ? 146 ILE A CA   1  
ATOM 2278   C C    . ILE A 1 146 ? -18.936 5.837   -7.245  1.00 0.75  ? 146 ILE A C    1  
ATOM 2279   O O    . ILE A 1 146 ? -19.909 5.959   -6.528  1.00 0.78  ? 146 ILE A O    1  
ATOM 2280   C CB   . ILE A 1 146 ? -17.303 7.577   -6.503  1.00 0.86  ? 146 ILE A CB   1  
ATOM 2281   C CG1  . ILE A 1 146 ? -16.470 8.780   -6.954  1.00 0.95  ? 146 ILE A CG1  1  
ATOM 2282   C CG2  . ILE A 1 146 ? -16.368 6.488   -5.971  1.00 0.98  ? 146 ILE A CG2  1  
ATOM 2283   C CD1  . ILE A 1 146 ? -15.867 9.472   -5.730  1.00 1.24  ? 146 ILE A CD1  1  
ATOM 2284   H H    . ILE A 1 146 ? -19.596 8.600   -7.597  1.00 1.19  ? 146 ILE A H    1  
ATOM 2285   H HA   . ILE A 1 146 ? -17.419 6.711   -8.472  1.00 0.75  ? 146 ILE A HA   1  
ATOM 2286   H HB   . ILE A 1 146 ? -17.983 7.881   -5.720  1.00 1.05  ? 146 ILE A HB   1  
ATOM 2287   H HG12 . ILE A 1 146 ? -15.677 8.443   -7.607  1.00 0.94  ? 146 ILE A HG12 1  
ATOM 2288   H HG13 . ILE A 1 146 ? -17.102 9.476   -7.484  1.00 1.03  ? 146 ILE A HG13 1  
ATOM 2289   H HG21 . ILE A 1 146 ? -15.752 6.116   -6.778  1.00 1.42  ? 146 ILE A HG21 1  
ATOM 2290   H HG22 . ILE A 1 146 ? -15.736 6.903   -5.199  1.00 1.51  ? 146 ILE A HG22 1  
ATOM 2291   H HG23 . ILE A 1 146 ? -16.952 5.677   -5.561  1.00 1.39  ? 146 ILE A HG23 1  
ATOM 2292   H HD11 . ILE A 1 146 ? -16.646 9.673   -5.009  1.00 1.68  ? 146 ILE A HD11 1  
ATOM 2293   H HD12 . ILE A 1 146 ? -15.121 8.830   -5.285  1.00 1.58  ? 146 ILE A HD12 1  
ATOM 2294   H HD13 . ILE A 1 146 ? -15.407 10.401  -6.033  1.00 1.66  ? 146 ILE A HD13 1  
ATOM 2295   N N    . ILE A 1 147 ? -18.557 4.683   -7.701  1.00 0.77  ? 147 ILE A N    1  
ATOM 2296   C CA   . ILE A 1 147 ? -19.292 3.432   -7.369  1.00 0.84  ? 147 ILE A CA   1  
ATOM 2297   C C    . ILE A 1 147 ? -19.272 3.177   -5.858  1.00 0.78  ? 147 ILE A C    1  
ATOM 2298   O O    . ILE A 1 147 ? -20.270 2.810   -5.273  1.00 0.77  ? 147 ILE A O    1  
ATOM 2299   C CB   . ILE A 1 147 ? -18.591 2.286   -8.099  1.00 0.96  ? 147 ILE A CB   1  
ATOM 2300   C CG1  . ILE A 1 147 ? -18.567 2.584   -9.627  1.00 1.10  ? 147 ILE A CG1  1  
ATOM 2301   C CG2  . ILE A 1 147 ? -19.335 0.971   -7.825  1.00 1.06  ? 147 ILE A CG2  1  
ATOM 2302   C CD1  . ILE A 1 147 ? -17.239 2.121   -10.228 1.00 1.54  ? 147 ILE A CD1  1  
ATOM 2303   H H    . ILE A 1 147 ? -17.779 4.633   -8.294  1.00 0.79  ? 147 ILE A H    1  
ATOM 2304   H HA   . ILE A 1 147 ? -20.311 3.506   -7.715  1.00 0.89  ? 147 ILE A HA   1  
ATOM 2305   H HB   . ILE A 1 147 ? -17.580 2.203   -7.724  1.00 0.95  ? 147 ILE A HB   1  
ATOM 2306   H HG12 . ILE A 1 147 ? -19.378 2.065   -10.118 1.00 1.57  ? 147 ILE A HG12 1  
ATOM 2307   H HG13 . ILE A 1 147 ? -18.671 3.649   -9.803  1.00 1.56  ? 147 ILE A HG13 1  
ATOM 2308   H HG21 . ILE A 1 147 ? -20.401 1.138   -7.882  1.00 1.64  ? 147 ILE A HG21 1  
ATOM 2309   H HG22 . ILE A 1 147 ? -19.047 0.233   -8.559  1.00 1.41  ? 147 ILE A HG22 1  
ATOM 2310   H HG23 . ILE A 1 147 ? -19.081 0.613   -6.838  1.00 1.41  ? 147 ILE A HG23 1  
ATOM 2311   H HD11 . ILE A 1 147 ? -17.031 1.110   -9.913  1.00 1.98  ? 147 ILE A HD11 1  
ATOM 2312   H HD12 . ILE A 1 147 ? -17.298 2.159   -11.306 1.00 2.14  ? 147 ILE A HD12 1  
ATOM 2313   H HD13 . ILE A 1 147 ? -16.451 2.778   -9.885  1.00 1.98  ? 147 ILE A HD13 1  
ATOM 2314   N N    . ASP A 1 148 ? -18.139 3.353   -5.228  1.00 0.79  ? 148 ASP A N    1  
ATOM 2315   C CA   . ASP A 1 148 ? -18.047 3.108   -3.755  1.00 0.77  ? 148 ASP A CA   1  
ATOM 2316   C C    . ASP A 1 148 ? -18.318 1.623   -3.475  1.00 0.72  ? 148 ASP A C    1  
ATOM 2317   O O    . ASP A 1 148 ? -19.444 1.167   -3.519  1.00 0.76  ? 148 ASP A O    1  
ATOM 2318   C CB   . ASP A 1 148 ? -19.066 3.982   -3.010  1.00 0.87  ? 148 ASP A CB   1  
ATOM 2319   C CG   . ASP A 1 148 ? -18.672 4.088   -1.535  1.00 0.97  ? 148 ASP A CG   1  
ATOM 2320   O OD1  . ASP A 1 148 ? -18.005 3.187   -1.053  1.00 1.50  ? 148 ASP A OD1  1  
ATOM 2321   O OD2  . ASP A 1 148 ? -19.045 5.069   -0.912  1.00 1.44  ? 148 ASP A OD2  1  
ATOM 2322   H H    . ASP A 1 148 ? -17.345 3.635   -5.729  1.00 0.84  ? 148 ASP A H    1  
ATOM 2323   H HA   . ASP A 1 148 ? -17.048 3.354   -3.421  1.00 0.77  ? 148 ASP A HA   1  
ATOM 2324   H HB2  . ASP A 1 148 ? -19.083 4.968   -3.451  1.00 0.94  ? 148 ASP A HB2  1  
ATOM 2325   H HB3  . ASP A 1 148 ? -20.047 3.539   -3.083  1.00 0.89  ? 148 ASP A HB3  1  
ATOM 2326   N N    . LEU A 1 149 ? -17.285 0.868   -3.209  1.00 0.67  ? 149 LEU A N    1  
ATOM 2327   C CA   . LEU A 1 149 ? -17.457 -0.595  -2.946  1.00 0.68  ? 149 LEU A CA   1  
ATOM 2328   C C    . LEU A 1 149 ? -18.145 -0.812  -1.593  1.00 0.68  ? 149 LEU A C    1  
ATOM 2329   O O    . LEU A 1 149 ? -18.491 -1.918  -1.233  1.00 0.72  ? 149 LEU A O    1  
ATOM 2330   C CB   . LEU A 1 149 ? -16.083 -1.267  -2.911  1.00 0.70  ? 149 LEU A CB   1  
ATOM 2331   C CG   . LEU A 1 149 ? -15.236 -0.795  -4.095  1.00 0.72  ? 149 LEU A CG   1  
ATOM 2332   C CD1  . LEU A 1 149 ? -13.875 -1.491  -4.055  1.00 0.79  ? 149 LEU A CD1  1  
ATOM 2333   C CD2  . LEU A 1 149 ? -15.937 -1.135  -5.410  1.00 0.79  ? 149 LEU A CD2  1  
ATOM 2334   H H    . LEU A 1 149 ? -16.388 1.261   -3.196  1.00 0.67  ? 149 LEU A H    1  
ATOM 2335   H HA   . LEU A 1 149 ? -18.056 -1.037  -3.727  1.00 0.72  ? 149 LEU A HA   1  
ATOM 2336   H HB2  . LEU A 1 149 ? -15.582 -1.008  -1.990  1.00 0.70  ? 149 LEU A HB2  1  
ATOM 2337   H HB3  . LEU A 1 149 ? -16.206 -2.338  -2.964  1.00 0.74  ? 149 LEU A HB3  1  
ATOM 2338   H HG   . LEU A 1 149 ? -15.092 0.274   -4.028  1.00 0.72  ? 149 LEU A HG   1  
ATOM 2339   H HD11 . LEU A 1 149 ? -14.018 -2.563  -4.052  1.00 1.29  ? 149 LEU A HD11 1  
ATOM 2340   H HD12 . LEU A 1 149 ? -13.301 -1.209  -4.925  1.00 1.34  ? 149 LEU A HD12 1  
ATOM 2341   H HD13 . LEU A 1 149 ? -13.344 -1.197  -3.162  1.00 1.13  ? 149 LEU A HD13 1  
ATOM 2342   H HD21 . LEU A 1 149 ? -16.305 -2.149  -5.371  1.00 1.14  ? 149 LEU A HD21 1  
ATOM 2343   H HD22 . LEU A 1 149 ? -16.760 -0.455  -5.566  1.00 1.35  ? 149 LEU A HD22 1  
ATOM 2344   H HD23 . LEU A 1 149 ? -15.234 -1.036  -6.225  1.00 1.39  ? 149 LEU A HD23 1  
ATOM 2345   N N    . SER A 1 150 ? -18.356 0.234   -0.849  1.00 0.68  ? 150 SER A N    1  
ATOM 2346   C CA   . SER A 1 150 ? -19.037 0.081   0.471   1.00 0.72  ? 150 SER A CA   1  
ATOM 2347   C C    . SER A 1 150 ? -20.552 0.104   0.247   1.00 0.78  ? 150 SER A C    1  
ATOM 2348   O O    . SER A 1 150 ? -21.330 -0.224  1.121   1.00 0.91  ? 150 SER A O    1  
ATOM 2349   C CB   . SER A 1 150 ? -18.636 1.230   1.396   1.00 0.73  ? 150 SER A CB   1  
ATOM 2350   O OG   . SER A 1 150 ? -19.161 2.447   0.885   1.00 1.40  ? 150 SER A OG   1  
ATOM 2351   H H    . SER A 1 150 ? -18.091 1.119   -1.175  1.00 0.67  ? 150 SER A H    1  
ATOM 2352   H HA   . SER A 1 150 ? -18.750 -0.864  0.920   1.00 0.74  ? 150 SER A HA   1  
ATOM 2353   H HB2  . SER A 1 150 ? -19.035 1.058   2.381   1.00 1.21  ? 150 SER A HB2  1  
ATOM 2354   H HB3  . SER A 1 150 ? -17.556 1.286   1.452   1.00 1.19  ? 150 SER A HB3  1  
ATOM 2355   H HG   . SER A 1 150 ? -18.874 3.159   1.462   1.00 1.83  ? 150 SER A HG   1  
ATOM 2356   N N    . ALA A 1 151 ? -20.966 0.521   -0.918  1.00 0.76  ? 151 ALA A N    1  
ATOM 2357   C CA   . ALA A 1 151 ? -22.423 0.608   -1.221  1.00 0.83  ? 151 ALA A CA   1  
ATOM 2358   C C    . ALA A 1 151 ? -22.990 -0.760  -1.607  1.00 0.81  ? 151 ALA A C    1  
ATOM 2359   O O    . ALA A 1 151 ? -24.084 -0.850  -2.127  1.00 0.87  ? 151 ALA A O    1  
ATOM 2360   C CB   . ALA A 1 151 ? -22.632 1.569   -2.392  1.00 0.92  ? 151 ALA A CB   1  
ATOM 2361   H H    . ALA A 1 151 ? -20.310 0.806   -1.587  1.00 0.77  ? 151 ALA A H    1  
ATOM 2362   H HA   . ALA A 1 151 ? -22.948 0.985   -0.357  1.00 0.86  ? 151 ALA A HA   1  
ATOM 2363   H HB1  . ALA A 1 151 ? -22.031 2.453   -2.245  1.00 1.46  ? 151 ALA A HB1  1  
ATOM 2364   H HB2  . ALA A 1 151 ? -22.337 1.082   -3.311  1.00 1.32  ? 151 ALA A HB2  1  
ATOM 2365   H HB3  . ALA A 1 151 ? -23.674 1.844   -2.449  1.00 1.33  ? 151 ALA A HB3  1  
ATOM 2366   N N    . ILE A 1 152 ? -22.283 -1.830  -1.355  1.00 0.75  ? 152 ILE A N    1  
ATOM 2367   C CA   . ILE A 1 152 ? -22.830 -3.175  -1.713  1.00 0.75  ? 152 ILE A CA   1  
ATOM 2368   C C    . ILE A 1 152 ? -23.635 -3.697  -0.519  1.00 0.81  ? 152 ILE A C    1  
ATOM 2369   O O    . ILE A 1 152 ? -23.209 -3.607  0.614   1.00 0.88  ? 152 ILE A O    1  
ATOM 2370   C CB   . ILE A 1 152 ? -21.676 -4.146  -2.053  1.00 0.70  ? 152 ILE A CB   1  
ATOM 2371   C CG1  . ILE A 1 152 ? -21.117 -3.849  -3.471  1.00 0.71  ? 152 ILE A CG1  1  
ATOM 2372   C CG2  . ILE A 1 152 ? -22.188 -5.595  -2.005  1.00 0.75  ? 152 ILE A CG2  1  
ATOM 2373   C CD1  . ILE A 1 152 ? -20.040 -2.762  -3.406  1.00 0.83  ? 152 ILE A CD1  1  
ATOM 2374   H H    . ILE A 1 152 ? -21.410 -1.766  -0.916  1.00 0.72  ? 152 ILE A H    1  
ATOM 2375   H HA   . ILE A 1 152 ? -23.492 -3.082  -2.563  1.00 0.80  ? 152 ILE A HA   1  
ATOM 2376   H HB   . ILE A 1 152 ? -20.887 -4.027  -1.321  1.00 0.70  ? 152 ILE A HB   1  
ATOM 2377   H HG12 . ILE A 1 152 ? -20.676 -4.748  -3.880  1.00 0.97  ? 152 ILE A HG12 1  
ATOM 2378   H HG13 . ILE A 1 152 ? -21.914 -3.520  -4.121  1.00 0.92  ? 152 ILE A HG13 1  
ATOM 2379   H HG21 . ILE A 1 152 ? -23.140 -5.657  -2.510  1.00 1.20  ? 152 ILE A HG21 1  
ATOM 2380   H HG22 . ILE A 1 152 ? -21.477 -6.244  -2.495  1.00 1.34  ? 152 ILE A HG22 1  
ATOM 2381   H HG23 . ILE A 1 152 ? -22.305 -5.903  -0.977  1.00 1.23  ? 152 ILE A HG23 1  
ATOM 2382   H HD11 . ILE A 1 152 ? -20.325 -2.007  -2.691  1.00 1.42  ? 152 ILE A HD11 1  
ATOM 2383   H HD12 . ILE A 1 152 ? -19.102 -3.204  -3.107  1.00 1.21  ? 152 ILE A HD12 1  
ATOM 2384   H HD13 . ILE A 1 152 ? -19.928 -2.310  -4.380  1.00 1.37  ? 152 ILE A HD13 1  
ATOM 2385   N N    . GLN A 1 153 ? -24.807 -4.219  -0.774  1.00 0.85  ? 153 GLN A N    1  
ATOM 2386   C CA   . GLN A 1 153 ? -25.681 -4.737  0.325   1.00 0.94  ? 153 GLN A CA   1  
ATOM 2387   C C    . GLN A 1 153 ? -25.907 -6.244  0.141   1.00 0.90  ? 153 GLN A C    1  
ATOM 2388   O O    . GLN A 1 153 ? -26.453 -6.906  1.001   1.00 0.96  ? 153 GLN A O    1  
ATOM 2389   C CB   . GLN A 1 153 ? -27.018 -3.990  0.262   1.00 1.08  ? 153 GLN A CB   1  
ATOM 2390   C CG   . GLN A 1 153 ? -27.942 -4.454  1.390   1.00 1.89  ? 153 GLN A CG   1  
ATOM 2391   C CD   . GLN A 1 153 ? -29.181 -3.557  1.426   1.00 1.99  ? 153 GLN A CD   1  
ATOM 2392   O OE1  . GLN A 1 153 ? -29.840 -3.372  0.423   1.00 2.19  ? 153 GLN A OE1  1  
ATOM 2393   N NE2  . GLN A 1 153 ? -29.521 -2.981  2.546   1.00 2.45  ? 153 GLN A NE2  1  
ATOM 2394   H H    . GLN A 1 153 ? -25.125 -4.256  -1.700  1.00 0.84  ? 153 GLN A H    1  
ATOM 2395   H HA   . GLN A 1 153 ? -25.219 -4.561  1.287   1.00 0.97  ? 153 GLN A HA   1  
ATOM 2396   H HB2  . GLN A 1 153 ? -26.838 -2.930  0.364   1.00 1.53  ? 153 GLN A HB2  1  
ATOM 2397   H HB3  . GLN A 1 153 ? -27.492 -4.183  -0.689  1.00 1.38  ? 153 GLN A HB3  1  
ATOM 2398   H HG2  . GLN A 1 153 ? -28.247 -5.473  1.211   1.00 2.40  ? 153 GLN A HG2  1  
ATOM 2399   H HG3  . GLN A 1 153 ? -27.424 -4.390  2.334   1.00 2.50  ? 153 GLN A HG3  1  
ATOM 2400   H HE21 . GLN A 1 153 ? -28.986 -3.124  3.354   1.00 2.94  ? 153 GLN A HE21 1  
ATOM 2401   H HE22 . GLN A 1 153 ? -30.313 -2.403  2.579   1.00 2.55  ? 153 GLN A HE22 1  
ATOM 2402   N N    . ASP A 1 154 ? -25.493 -6.791  -0.978  1.00 0.83  ? 154 ASP A N    1  
ATOM 2403   C CA   . ASP A 1 154 ? -25.693 -8.261  -1.232  1.00 0.81  ? 154 ASP A CA   1  
ATOM 2404   C C    . ASP A 1 154 ? -24.343 -8.962  -1.413  1.00 0.71  ? 154 ASP A C    1  
ATOM 2405   O O    . ASP A 1 154 ? -23.382 -8.380  -1.877  1.00 0.68  ? 154 ASP A O    1  
ATOM 2406   C CB   . ASP A 1 154 ? -26.533 -8.437  -2.499  1.00 0.88  ? 154 ASP A CB   1  
ATOM 2407   C CG   . ASP A 1 154 ? -27.971 -7.997  -2.217  1.00 1.03  ? 154 ASP A CG   1  
ATOM 2408   O OD1  . ASP A 1 154 ? -28.406 -8.153  -1.087  1.00 1.47  ? 154 ASP A OD1  1  
ATOM 2409   O OD2  . ASP A 1 154 ? -28.615 -7.518  -3.136  1.00 1.52  ? 154 ASP A OD2  1  
ATOM 2410   H H    . ASP A 1 154 ? -25.051 -6.229  -1.652  1.00 0.83  ? 154 ASP A H    1  
ATOM 2411   H HA   . ASP A 1 154 ? -26.213 -8.716  -0.402  1.00 0.85  ? 154 ASP A HA   1  
ATOM 2412   H HB2  . ASP A 1 154 ? -26.119 -7.831  -3.293  1.00 0.86  ? 154 ASP A HB2  1  
ATOM 2413   H HB3  . ASP A 1 154 ? -26.526 -9.475  -2.797  1.00 0.91  ? 154 ASP A HB3  1  
ATOM 2414   N N    . GLU A 1 155 ? -24.269 -10.217 -1.047  1.00 0.69  ? 155 GLU A N    1  
ATOM 2415   C CA   . GLU A 1 155 ? -22.991 -10.965 -1.196  1.00 0.62  ? 155 GLU A CA   1  
ATOM 2416   C C    . GLU A 1 155 ? -22.647 -11.055 -2.681  1.00 0.59  ? 155 GLU A C    1  
ATOM 2417   O O    . GLU A 1 155 ? -23.472 -11.415 -3.496  1.00 0.62  ? 155 GLU A O    1  
ATOM 2418   C CB   . GLU A 1 155 ? -23.160 -12.379 -0.631  1.00 0.67  ? 155 GLU A CB   1  
ATOM 2419   C CG   . GLU A 1 155 ? -23.314 -12.312 0.889   1.00 0.75  ? 155 GLU A CG   1  
ATOM 2420   C CD   . GLU A 1 155 ? -23.481 -13.728 1.444   1.00 0.87  ? 155 GLU A CD   1  
ATOM 2421   O OE1  . GLU A 1 155 ? -23.660 -14.638 0.651   1.00 1.23  ? 155 GLU A OE1  1  
ATOM 2422   O OE2  . GLU A 1 155 ? -23.430 -13.879 2.654   1.00 1.58  ? 155 GLU A OE2  1  
ATOM 2423   H H    . GLU A 1 155 ? -25.054 -10.666 -0.675  1.00 0.74  ? 155 GLU A H    1  
ATOM 2424   H HA   . GLU A 1 155 ? -22.203 -10.452 -0.666  1.00 0.61  ? 155 GLU A HA   1  
ATOM 2425   H HB2  . GLU A 1 155 ? -24.039 -12.835 -1.062  1.00 0.69  ? 155 GLU A HB2  1  
ATOM 2426   H HB3  . GLU A 1 155 ? -22.291 -12.971 -0.877  1.00 0.68  ? 155 GLU A HB3  1  
ATOM 2427   H HG2  . GLU A 1 155 ? -22.437 -11.852 1.321   1.00 0.83  ? 155 GLU A HG2  1  
ATOM 2428   H HG3  . GLU A 1 155 ? -24.187 -11.727 1.137   1.00 0.79  ? 155 GLU A HG3  1  
ATOM 2429   N N    . VAL A 1 156 ? -21.437 -10.729 -3.041  1.00 0.55  ? 156 VAL A N    1  
ATOM 2430   C CA   . VAL A 1 156 ? -21.046 -10.796 -4.476  1.00 0.56  ? 156 VAL A CA   1  
ATOM 2431   C C    . VAL A 1 156 ? -19.549 -11.058 -4.584  1.00 0.51  ? 156 VAL A C    1  
ATOM 2432   O O    . VAL A 1 156 ? -18.804 -10.833 -3.650  1.00 0.48  ? 156 VAL A O    1  
ATOM 2433   C CB   . VAL A 1 156 ? -21.369 -9.463  -5.156  1.00 0.62  ? 156 VAL A CB   1  
ATOM 2434   C CG1  . VAL A 1 156 ? -22.882 -9.243  -5.166  1.00 0.69  ? 156 VAL A CG1  1  
ATOM 2435   C CG2  . VAL A 1 156 ? -20.695 -8.324  -4.388  1.00 0.62  ? 156 VAL A CG2  1  
ATOM 2436   H H    . VAL A 1 156 ? -20.783 -10.450 -2.361  1.00 0.54  ? 156 VAL A H    1  
ATOM 2437   H HA   . VAL A 1 156 ? -21.587 -11.592 -4.968  1.00 0.57  ? 156 VAL A HA   1  
ATOM 2438   H HB   . VAL A 1 156 ? -21.001 -9.481  -6.171  1.00 0.65  ? 156 VAL A HB   1  
ATOM 2439   H HG11 . VAL A 1 156 ? -23.376 -10.151 -5.479  1.00 1.32  ? 156 VAL A HG11 1  
ATOM 2440   H HG12 . VAL A 1 156 ? -23.214 -8.977  -4.173  1.00 1.23  ? 156 VAL A HG12 1  
ATOM 2441   H HG13 . VAL A 1 156 ? -23.124 -8.446  -5.853  1.00 1.14  ? 156 VAL A HG13 1  
ATOM 2442   H HG21 . VAL A 1 156 ? -20.985 -8.371  -3.348  1.00 1.23  ? 156 VAL A HG21 1  
ATOM 2443   H HG22 . VAL A 1 156 ? -19.623 -8.420  -4.467  1.00 1.16  ? 156 VAL A HG22 1  
ATOM 2444   H HG23 . VAL A 1 156 ? -21.004 -7.377  -4.805  1.00 1.20  ? 156 VAL A HG23 1  
ATOM 2445   N N    . ILE A 1 157 ? -19.090 -11.469 -5.734  1.00 0.52  ? 157 ILE A N    1  
ATOM 2446   C CA   . ILE A 1 157 ? -17.626 -11.672 -5.921  1.00 0.50  ? 157 ILE A CA   1  
ATOM 2447   C C    . ILE A 1 157 ? -17.095 -10.377 -6.521  1.00 0.52  ? 157 ILE A C    1  
ATOM 2448   O O    . ILE A 1 157 ? -17.801 -9.691  -7.235  1.00 0.55  ? 157 ILE A O    1  
ATOM 2449   C CB   . ILE A 1 157 ? -17.343 -12.849 -6.858  1.00 0.52  ? 157 ILE A CB   1  
ATOM 2450   C CG1  . ILE A 1 157 ? -17.882 -14.143 -6.237  1.00 0.58  ? 157 ILE A CG1  1  
ATOM 2451   C CG2  . ILE A 1 157 ? -15.830 -12.976 -7.056  1.00 0.52  ? 157 ILE A CG2  1  
ATOM 2452   C CD1  . ILE A 1 157 ? -17.827 -15.273 -7.269  1.00 0.61  ? 157 ILE A CD1  1  
ATOM 2453   H H    . ILE A 1 157 ? -19.698 -11.591 -6.492  1.00 0.55  ? 157 ILE A H    1  
ATOM 2454   H HA   . ILE A 1 157 ? -17.148 -11.845 -4.963  1.00 0.47  ? 157 ILE A HA   1  
ATOM 2455   H HB   . ILE A 1 157 ? -17.819 -12.675 -7.811  1.00 0.55  ? 157 ILE A HB   1  
ATOM 2456   H HG12 . ILE A 1 157 ? -17.280 -14.408 -5.380  1.00 0.61  ? 157 ILE A HG12 1  
ATOM 2457   H HG13 . ILE A 1 157 ? -18.906 -13.993 -5.924  1.00 0.63  ? 157 ILE A HG13 1  
ATOM 2458   H HG21 . ILE A 1 157 ? -15.340 -13.021 -6.091  1.00 1.16  ? 157 ILE A HG21 1  
ATOM 2459   H HG22 . ILE A 1 157 ? -15.613 -13.876 -7.611  1.00 1.15  ? 157 ILE A HG22 1  
ATOM 2460   H HG23 . ILE A 1 157 ? -15.466 -12.118 -7.603  1.00 1.13  ? 157 ILE A HG23 1  
ATOM 2461   H HD11 . ILE A 1 157 ? -18.422 -15.006 -8.130  1.00 1.27  ? 157 ILE A HD11 1  
ATOM 2462   H HD12 . ILE A 1 157 ? -16.803 -15.432 -7.574  1.00 1.12  ? 157 ILE A HD12 1  
ATOM 2463   H HD13 . ILE A 1 157 ? -18.216 -16.180 -6.829  1.00 1.18  ? 157 ILE A HD13 1  
ATOM 2464   N N    . LEU A 1 158 ? -15.884 -10.009 -6.221  1.00 0.51  ? 158 LEU A N    1  
ATOM 2465   C CA   . LEU A 1 158 ? -15.344 -8.721  -6.756  1.00 0.54  ? 158 LEU A CA   1  
ATOM 2466   C C    . LEU A 1 158 ? -14.498 -8.962  -8.011  1.00 0.56  ? 158 LEU A C    1  
ATOM 2467   O O    . LEU A 1 158 ? -13.470 -9.608  -7.971  1.00 0.57  ? 158 LEU A O    1  
ATOM 2468   C CB   . LEU A 1 158 ? -14.494 -8.067  -5.658  1.00 0.55  ? 158 LEU A CB   1  
ATOM 2469   C CG   . LEU A 1 158 ? -13.907 -6.734  -6.149  1.00 0.66  ? 158 LEU A CG   1  
ATOM 2470   C CD1  . LEU A 1 158 ? -15.041 -5.754  -6.492  1.00 0.87  ? 158 LEU A CD1  1  
ATOM 2471   C CD2  . LEU A 1 158 ? -13.029 -6.137  -5.045  1.00 0.61  ? 158 LEU A CD2  1  
ATOM 2472   H H    . LEU A 1 158 ? -15.335 -10.568 -5.634  1.00 0.50  ? 158 LEU A H    1  
ATOM 2473   H HA   . LEU A 1 158 ? -16.160 -8.059  -7.003  1.00 0.56  ? 158 LEU A HA   1  
ATOM 2474   H HB2  . LEU A 1 158 ? -15.121 -7.886  -4.794  1.00 0.58  ? 158 LEU A HB2  1  
ATOM 2475   H HB3  . LEU A 1 158 ? -13.695 -8.732  -5.378  1.00 0.54  ? 158 LEU A HB3  1  
ATOM 2476   H HG   . LEU A 1 158 ? -13.305 -6.906  -7.029  1.00 0.81  ? 158 LEU A HG   1  
ATOM 2477   H HD11 . LEU A 1 158 ? -15.863 -5.889  -5.804  1.00 1.28  ? 158 LEU A HD11 1  
ATOM 2478   H HD12 . LEU A 1 158 ? -14.680 -4.738  -6.423  1.00 1.18  ? 158 LEU A HD12 1  
ATOM 2479   H HD13 . LEU A 1 158 ? -15.384 -5.940  -7.500  1.00 1.41  ? 158 LEU A HD13 1  
ATOM 2480   H HD21 . LEU A 1 158 ? -12.324 -6.880  -4.702  1.00 1.13  ? 158 LEU A HD21 1  
ATOM 2481   H HD22 . LEU A 1 158 ? -12.494 -5.284  -5.434  1.00 1.33  ? 158 LEU A HD22 1  
ATOM 2482   H HD23 . LEU A 1 158 ? -13.651 -5.825  -4.222  1.00 1.06  ? 158 LEU A HD23 1  
ATOM 2483   N N    . VAL A 1 159 ? -14.931 -8.412  -9.126  1.00 0.59  ? 159 VAL A N    1  
ATOM 2484   C CA   . VAL A 1 159 ? -14.168 -8.560  -10.408 1.00 0.63  ? 159 VAL A CA   1  
ATOM 2485   C C    . VAL A 1 159 ? -13.776 -7.162  -10.896 1.00 0.68  ? 159 VAL A C    1  
ATOM 2486   O O    . VAL A 1 159 ? -14.610 -6.288  -11.033 1.00 0.71  ? 159 VAL A O    1  
ATOM 2487   C CB   . VAL A 1 159 ? -15.048 -9.236  -11.465 1.00 0.64  ? 159 VAL A CB   1  
ATOM 2488   C CG1  . VAL A 1 159 ? -14.245 -9.417  -12.754 1.00 0.67  ? 159 VAL A CG1  1  
ATOM 2489   C CG2  . VAL A 1 159 ? -15.508 -10.604 -10.953 1.00 0.65  ? 159 VAL A CG2  1  
ATOM 2490   H H    . VAL A 1 159 ? -15.762 -7.886  -9.111  1.00 0.61  ? 159 VAL A H    1  
ATOM 2491   H HA   . VAL A 1 159 ? -13.275 -9.151  -10.250 1.00 0.62  ? 159 VAL A HA   1  
ATOM 2492   H HB   . VAL A 1 159 ? -15.908 -8.618  -11.667 1.00 0.65  ? 159 VAL A HB   1  
ATOM 2493   H HG11 . VAL A 1 159 ? -13.334 -9.956  -12.538 1.00 1.23  ? 159 VAL A HG11 1  
ATOM 2494   H HG12 . VAL A 1 159 ? -14.832 -9.975  -13.469 1.00 1.17  ? 159 VAL A HG12 1  
ATOM 2495   H HG13 . VAL A 1 159 ? -14.001 -8.449  -13.166 1.00 1.18  ? 159 VAL A HG13 1  
ATOM 2496   H HG21 . VAL A 1 159 ? -14.672 -11.124 -10.514 1.00 1.23  ? 159 VAL A HG21 1  
ATOM 2497   H HG22 . VAL A 1 159 ? -16.279 -10.469 -10.208 1.00 1.15  ? 159 VAL A HG22 1  
ATOM 2498   H HG23 . VAL A 1 159 ? -15.899 -11.184 -11.776 1.00 1.21  ? 159 VAL A HG23 1  
ATOM 2499   N N    . ALA A 1 160 ? -12.518 -6.939  -11.156 1.00 0.71  ? 160 ALA A N    1  
ATOM 2500   C CA   . ALA A 1 160 ? -12.075 -5.592  -11.630 1.00 0.77  ? 160 ALA A CA   1  
ATOM 2501   C C    . ALA A 1 160 ? -10.768 -5.738  -12.409 1.00 0.81  ? 160 ALA A C    1  
ATOM 2502   O O    . ALA A 1 160 ? -10.066 -6.714  -12.278 1.00 0.81  ? 160 ALA A O    1  
ATOM 2503   C CB   . ALA A 1 160 ? -11.844 -4.675  -10.427 1.00 0.76  ? 160 ALA A CB   1  
ATOM 2504   H H    . ALA A 1 160 ? -11.861 -7.657  -11.037 1.00 0.70  ? 160 ALA A H    1  
ATOM 2505   H HA   . ALA A 1 160 ? -12.834 -5.163  -12.269 1.00 0.80  ? 160 ALA A HA   1  
ATOM 2506   H HB1  . ALA A 1 160 ? -12.702 -4.714  -9.772  1.00 1.23  ? 160 ALA A HB1  1  
ATOM 2507   H HB2  . ALA A 1 160 ? -10.965 -5.000  -9.890  1.00 1.20  ? 160 ALA A HB2  1  
ATOM 2508   H HB3  . ALA A 1 160 ? -11.700 -3.662  -10.772 1.00 1.32  ? 160 ALA A HB3  1  
ATOM 2509   N N    . ALA A 1 161 ? -10.408 -4.778  -13.207 1.00 0.86  ? 161 ALA A N    1  
ATOM 2510   C CA   . ALA A 1 161 ? -9.126  -4.916  -13.945 1.00 0.91  ? 161 ALA A CA   1  
ATOM 2511   C C    . ALA A 1 161 ? -7.987  -4.809  -12.930 1.00 0.88  ? 161 ALA A C    1  
ATOM 2512   O O    . ALA A 1 161 ? -6.940  -5.407  -13.077 1.00 0.91  ? 161 ALA A O    1  
ATOM 2513   C CB   . ALA A 1 161 ? -8.992  -3.808  -14.990 1.00 0.98  ? 161 ALA A CB   1  
ATOM 2514   H H    . ALA A 1 161 ? -10.955 -3.972  -13.306 1.00 0.88  ? 161 ALA A H    1  
ATOM 2515   H HA   . ALA A 1 161 ? -9.094  -5.882  -14.430 1.00 0.92  ? 161 ALA A HA   1  
ATOM 2516   H HB1  . ALA A 1 161 ? -9.302  -2.867  -14.560 1.00 1.42  ? 161 ALA A HB1  1  
ATOM 2517   H HB2  . ALA A 1 161 ? -7.961  -3.737  -15.306 1.00 1.36  ? 161 ALA A HB2  1  
ATOM 2518   H HB3  . ALA A 1 161 ? -9.613  -4.040  -15.842 1.00 1.49  ? 161 ALA A HB3  1  
ATOM 2519   N N    . ASP A 1 162 ? -8.201  -4.045  -11.894 1.00 0.84  ? 162 ASP A N    1  
ATOM 2520   C CA   . ASP A 1 162 ? -7.161  -3.877  -10.844 1.00 0.82  ? 162 ASP A CA   1  
ATOM 2521   C C    . ASP A 1 162 ? -7.799  -3.195  -9.631  1.00 0.78  ? 162 ASP A C    1  
ATOM 2522   O O    . ASP A 1 162 ? -8.941  -2.783  -9.677  1.00 0.79  ? 162 ASP A O    1  
ATOM 2523   C CB   . ASP A 1 162 ? -6.017  -3.022  -11.392 1.00 0.87  ? 162 ASP A CB   1  
ATOM 2524   C CG   . ASP A 1 162 ? -6.560  -1.663  -11.835 1.00 1.54  ? 162 ASP A CG   1  
ATOM 2525   O OD1  . ASP A 1 162 ? -7.767  -1.543  -11.961 1.00 2.22  ? 162 ASP A OD1  1  
ATOM 2526   O OD2  . ASP A 1 162 ? -5.759  -0.769  -12.050 1.00 2.25  ? 162 ASP A OD2  1  
ATOM 2527   H H    . ASP A 1 162 ? -9.057  -3.579  -11.801 1.00 0.83  ? 162 ASP A H    1  
ATOM 2528   H HA   . ASP A 1 162 ? -6.783  -4.847  -10.554 1.00 0.83  ? 162 ASP A HA   1  
ATOM 2529   H HB2  . ASP A 1 162 ? -5.273  -2.879  -10.621 1.00 1.24  ? 162 ASP A HB2  1  
ATOM 2530   H HB3  . ASP A 1 162 ? -5.568  -3.522  -12.237 1.00 1.35  ? 162 ASP A HB3  1  
ATOM 2531   N N    . LEU A 1 163 ? -7.077  -3.065  -8.547  1.00 0.76  ? 163 LEU A N    1  
ATOM 2532   C CA   . LEU A 1 163 ? -7.646  -2.399  -7.331  1.00 0.73  ? 163 LEU A CA   1  
ATOM 2533   C C    . LEU A 1 163 ? -6.557  -1.543  -6.682  1.00 0.74  ? 163 LEU A C    1  
ATOM 2534   O O    . LEU A 1 163 ? -5.456  -2.002  -6.445  1.00 0.76  ? 163 LEU A O    1  
ATOM 2535   C CB   . LEU A 1 163 ? -8.116  -3.461  -6.325  1.00 0.68  ? 163 LEU A CB   1  
ATOM 2536   C CG   . LEU A 1 163 ? -9.277  -4.287  -6.901  1.00 0.72  ? 163 LEU A CG   1  
ATOM 2537   C CD1  . LEU A 1 163 ? -9.562  -5.468  -5.968  1.00 0.72  ? 163 LEU A CD1  1  
ATOM 2538   C CD2  . LEU A 1 163 ? -10.543 -3.424  -7.021  1.00 0.78  ? 163 LEU A CD2  1  
ATOM 2539   H H    . LEU A 1 163 ? -6.152  -3.385  -8.532  1.00 0.78  ? 163 LEU A H    1  
ATOM 2540   H HA   . LEU A 1 163 ? -8.473  -1.764  -7.607  1.00 0.75  ? 163 LEU A HA   1  
ATOM 2541   H HB2  . LEU A 1 163 ? -7.292  -4.119  -6.099  1.00 0.68  ? 163 LEU A HB2  1  
ATOM 2542   H HB3  . LEU A 1 163 ? -8.438  -2.974  -5.416  1.00 0.67  ? 163 LEU A HB3  1  
ATOM 2543   H HG   . LEU A 1 163 ? -9.001  -4.662  -7.873  1.00 0.80  ? 163 LEU A HG   1  
ATOM 2544   H HD11 . LEU A 1 163 ? -8.680  -6.085  -5.887  1.00 1.33  ? 163 LEU A HD11 1  
ATOM 2545   H HD12 . LEU A 1 163 ? -9.833  -5.097  -4.990  1.00 1.16  ? 163 LEU A HD12 1  
ATOM 2546   H HD13 . LEU A 1 163 ? -10.376 -6.055  -6.368  1.00 1.26  ? 163 LEU A HD13 1  
ATOM 2547   H HD21 . LEU A 1 163 ? -10.640 -2.801  -6.146  1.00 1.29  ? 163 LEU A HD21 1  
ATOM 2548   H HD22 . LEU A 1 163 ? -10.479 -2.804  -7.901  1.00 1.35  ? 163 LEU A HD22 1  
ATOM 2549   H HD23 . LEU A 1 163 ? -11.410 -4.063  -7.103  1.00 1.23  ? 163 LEU A HD23 1  
ATOM 2550   N N    . THR A 1 164 ? -6.848  -0.303  -6.387  1.00 0.75  ? 164 THR A N    1  
ATOM 2551   C CA   . THR A 1 164 ? -5.821  0.572   -5.749  1.00 0.78  ? 164 THR A CA   1  
ATOM 2552   C C    . THR A 1 164 ? -5.895  0.409   -4.221  1.00 0.70  ? 164 THR A C    1  
ATOM 2553   O O    . THR A 1 164 ? -6.961  0.190   -3.680  1.00 0.65  ? 164 THR A O    1  
ATOM 2554   C CB   . THR A 1 164 ? -6.098  2.035   -6.108  1.00 0.85  ? 164 THR A CB   1  
ATOM 2555   O OG1  . THR A 1 164 ? -7.241  2.488   -5.396  1.00 0.89  ? 164 THR A OG1  1  
ATOM 2556   C CG2  . THR A 1 164 ? -6.345  2.157   -7.613  1.00 0.98  ? 164 THR A CG2  1  
ATOM 2557   H H    . THR A 1 164 ? -7.741  0.051   -6.582  1.00 0.76  ? 164 THR A H    1  
ATOM 2558   H HA   . THR A 1 164 ? -4.846  0.295   -6.111  1.00 0.81  ? 164 THR A HA   1  
ATOM 2559   H HB   . THR A 1 164 ? -5.245  2.638   -5.838  1.00 0.88  ? 164 THR A HB   1  
ATOM 2560   H HG1  . THR A 1 164 ? -8.009  2.371   -5.959  1.00 1.28  ? 164 THR A HG1  1  
ATOM 2561   H HG21 . THR A 1 164 ? -5.571  1.627   -8.149  1.00 1.33  ? 164 THR A HG21 1  
ATOM 2562   H HG22 . THR A 1 164 ? -7.307  1.731   -7.857  1.00 1.42  ? 164 THR A HG22 1  
ATOM 2563   H HG23 . THR A 1 164 ? -6.331  3.200   -7.897  1.00 1.56  ? 164 THR A HG23 1  
ATOM 2564   N N    . PRO A 1 165 ? -4.790  0.528   -3.519  1.00 0.71  ? 165 PRO A N    1  
ATOM 2565   C CA   . PRO A 1 165 ? -4.785  0.401   -2.032  1.00 0.68  ? 165 PRO A CA   1  
ATOM 2566   C C    . PRO A 1 165 ? -5.961  1.149   -1.383  1.00 0.64  ? 165 PRO A C    1  
ATOM 2567   O O    . PRO A 1 165 ? -6.521  0.714   -0.393  1.00 0.63  ? 165 PRO A O    1  
ATOM 2568   C CB   . PRO A 1 165 ? -3.449  1.040   -1.624  1.00 0.74  ? 165 PRO A CB   1  
ATOM 2569   C CG   . PRO A 1 165 ? -2.538  0.830   -2.794  1.00 0.81  ? 165 PRO A CG   1  
ATOM 2570   C CD   . PRO A 1 165 ? -3.431  0.787   -4.046  1.00 0.80  ? 165 PRO A CD   1  
ATOM 2571   H HA   . PRO A 1 165 ? -4.794  -0.635  -1.744  1.00 0.67  ? 165 PRO A HA   1  
ATOM 2572   H HB2  . PRO A 1 165 ? -3.581  2.099   -1.433  1.00 0.74  ? 165 PRO A HB2  1  
ATOM 2573   H HB3  . PRO A 1 165 ? -3.049  0.550   -0.748  1.00 0.75  ? 165 PRO A HB3  1  
ATOM 2574   H HG2  . PRO A 1 165 ? -1.829  1.647   -2.865  1.00 0.87  ? 165 PRO A HG2  1  
ATOM 2575   H HG3  . PRO A 1 165 ? -2.008  -0.107  -2.692  1.00 0.84  ? 165 PRO A HG3  1  
ATOM 2576   H HD2  . PRO A 1 165 ? -3.400  1.734   -4.569  1.00 0.85  ? 165 PRO A HD2  1  
ATOM 2577   H HD3  . PRO A 1 165 ? -3.121  -0.017  -4.697  1.00 0.83  ? 165 PRO A HD3  1  
ATOM 2578   N N    . SER A 1 166 ? -6.324  2.278   -1.928  1.00 0.67  ? 166 SER A N    1  
ATOM 2579   C CA   . SER A 1 166 ? -7.441  3.075   -1.343  1.00 0.69  ? 166 SER A CA   1  
ATOM 2580   C C    . SER A 1 166 ? -8.726  2.249   -1.347  1.00 0.67  ? 166 SER A C    1  
ATOM 2581   O O    . SER A 1 166 ? -9.506  2.294   -0.417  1.00 0.72  ? 166 SER A O    1  
ATOM 2582   C CB   . SER A 1 166 ? -7.670  4.328   -2.188  1.00 0.76  ? 166 SER A CB   1  
ATOM 2583   O OG   . SER A 1 166 ? -6.479  5.100   -2.226  1.00 0.90  ? 166 SER A OG   1  
ATOM 2584   H H    . SER A 1 166 ? -5.846  2.615   -2.715  1.00 0.72  ? 166 SER A H    1  
ATOM 2585   H HA   . SER A 1 166 ? -7.195  3.361   -0.332  1.00 0.68  ? 166 SER A HA   1  
ATOM 2586   H HB2  . SER A 1 166 ? -7.939  4.041   -3.189  1.00 0.77  ? 166 SER A HB2  1  
ATOM 2587   H HB3  . SER A 1 166 ? -8.476  4.909   -1.753  1.00 0.81  ? 166 SER A HB3  1  
ATOM 2588   H HG   . SER A 1 166 ? -6.128  5.058   -3.122  1.00 1.36  ? 166 SER A HG   1  
ATOM 2589   N N    . GLU A 1 167 ? -8.965  1.507   -2.393  1.00 0.68  ? 167 GLU A N    1  
ATOM 2590   C CA   . GLU A 1 167 ? -10.212 0.699   -2.452  1.00 0.67  ? 167 GLU A CA   1  
ATOM 2591   C C    . GLU A 1 167 ? -10.143 -0.434  -1.426  1.00 0.62  ? 167 GLU A C    1  
ATOM 2592   O O    . GLU A 1 167 ? -11.120 -0.757  -0.779  1.00 0.63  ? 167 GLU A O    1  
ATOM 2593   C CB   . GLU A 1 167 ? -10.376 0.112   -3.857  1.00 0.72  ? 167 GLU A CB   1  
ATOM 2594   C CG   . GLU A 1 167 ? -10.706 1.232   -4.850  1.00 0.83  ? 167 GLU A CG   1  
ATOM 2595   C CD   . GLU A 1 167 ? -10.870 0.643   -6.252  1.00 0.93  ? 167 GLU A CD   1  
ATOM 2596   O OE1  . GLU A 1 167 ? -10.483 -0.496  -6.442  1.00 1.61  ? 167 GLU A OE1  1  
ATOM 2597   O OE2  . GLU A 1 167 ? -11.371 1.345   -7.115  1.00 1.26  ? 167 GLU A OE2  1  
ATOM 2598   H H    . GLU A 1 167 ? -8.331  1.491   -3.140  1.00 0.71  ? 167 GLU A H    1  
ATOM 2599   H HA   . GLU A 1 167 ? -11.056 1.331   -2.229  1.00 0.70  ? 167 GLU A HA   1  
ATOM 2600   H HB2  . GLU A 1 167 ? -9.457  -0.373  -4.153  1.00 0.71  ? 167 GLU A HB2  1  
ATOM 2601   H HB3  . GLU A 1 167 ? -11.179 -0.610  -3.852  1.00 0.73  ? 167 GLU A HB3  1  
ATOM 2602   H HG2  . GLU A 1 167 ? -11.624 1.719   -4.553  1.00 0.87  ? 167 GLU A HG2  1  
ATOM 2603   H HG3  . GLU A 1 167 ? -9.903  1.954   -4.858  1.00 0.87  ? 167 GLU A HG3  1  
ATOM 2604   N N    . THR A 1 168 ? -9.009  -1.063  -1.288  1.00 0.58  ? 168 THR A N    1  
ATOM 2605   C CA   . THR A 1 168 ? -8.911  -2.194  -0.324  1.00 0.55  ? 168 THR A CA   1  
ATOM 2606   C C    . THR A 1 168 ? -9.339  -1.746  1.079   1.00 0.54  ? 168 THR A C    1  
ATOM 2607   O O    . THR A 1 168 ? -9.845  -2.530  1.856   1.00 0.55  ? 168 THR A O    1  
ATOM 2608   C CB   . THR A 1 168 ? -7.476  -2.741  -0.277  1.00 0.57  ? 168 THR A CB   1  
ATOM 2609   O OG1  . THR A 1 168 ? -6.561  -1.728  0.143   1.00 0.61  ? 168 THR A OG1  1  
ATOM 2610   C CG2  . THR A 1 168 ? -7.066  -3.258  -1.659  1.00 0.60  ? 168 THR A CG2  1  
ATOM 2611   H H    . THR A 1 168 ? -8.242  -0.823  -1.847  1.00 0.60  ? 168 THR A H    1  
ATOM 2612   H HA   . THR A 1 168 ? -9.572  -2.983  -0.650  1.00 0.55  ? 168 THR A HA   1  
ATOM 2613   H HB   . THR A 1 168 ? -7.451  -3.556  0.421   1.00 0.57  ? 168 THR A HB   1  
ATOM 2614   H HG1  . THR A 1 168 ? -5.670  -2.105  0.141   1.00 0.61  ? 168 THR A HG1  1  
ATOM 2615   H HG21 . THR A 1 168 ? -7.905  -3.751  -2.129  1.00 1.14  ? 168 THR A HG21 1  
ATOM 2616   H HG22 . THR A 1 168 ? -6.746  -2.429  -2.273  1.00 1.13  ? 168 THR A HG22 1  
ATOM 2617   H HG23 . THR A 1 168 ? -6.251  -3.962  -1.552  1.00 1.21  ? 168 THR A HG23 1  
ATOM 2618   N N    . ALA A 1 169 ? -9.148  -0.502  1.414   1.00 0.55  ? 169 ALA A N    1  
ATOM 2619   C CA   . ALA A 1 169 ? -9.555  -0.026  2.768   1.00 0.56  ? 169 ALA A CA   1  
ATOM 2620   C C    . ALA A 1 169 ? -11.081 0.045   2.849   1.00 0.58  ? 169 ALA A C    1  
ATOM 2621   O O    . ALA A 1 169 ? -11.697 -0.477  3.757   1.00 0.60  ? 169 ALA A O    1  
ATOM 2622   C CB   . ALA A 1 169 ? -8.970  1.367   3.027   1.00 0.59  ? 169 ALA A CB   1  
ATOM 2623   H H    . ALA A 1 169 ? -8.746  0.120   0.777   1.00 0.56  ? 169 ALA A H    1  
ATOM 2624   H HA   . ALA A 1 169 ? -9.188  -0.715  3.515   1.00 0.56  ? 169 ALA A HA   1  
ATOM 2625   H HB1  . ALA A 1 169 ? -7.995  1.439   2.568   1.00 1.21  ? 169 ALA A HB1  1  
ATOM 2626   H HB2  . ALA A 1 169 ? -9.621  2.124   2.608   1.00 1.10  ? 169 ALA A HB2  1  
ATOM 2627   H HB3  . ALA A 1 169 ? -8.881  1.522   4.089   1.00 1.16  ? 169 ALA A HB3  1  
ATOM 2628   N N    . GLN A 1 170 ? -11.687 0.695   1.897   1.00 0.59  ? 170 GLN A N    1  
ATOM 2629   C CA   . GLN A 1 170 ? -13.167 0.820   1.887   1.00 0.63  ? 170 GLN A CA   1  
ATOM 2630   C C    . GLN A 1 170 ? -13.750 -0.420  1.223   1.00 0.60  ? 170 GLN A C    1  
ATOM 2631   O O    . GLN A 1 170 ? -14.722 -0.354  0.496   1.00 0.65  ? 170 GLN A O    1  
ATOM 2632   C CB   . GLN A 1 170 ? -13.576 2.070   1.102   1.00 0.69  ? 170 GLN A CB   1  
ATOM 2633   C CG   . GLN A 1 170 ? -12.913 2.054   -0.275  1.00 0.70  ? 170 GLN A CG   1  
ATOM 2634   C CD   . GLN A 1 170 ? -13.372 3.273   -1.076  1.00 0.78  ? 170 GLN A CD   1  
ATOM 2635   O OE1  . GLN A 1 170 ? -13.741 4.283   -0.510  1.00 1.33  ? 170 GLN A OE1  1  
ATOM 2636   N NE2  . GLN A 1 170 ? -13.364 3.222   -2.380  1.00 1.40  ? 170 GLN A NE2  1  
ATOM 2637   H H    . GLN A 1 170 ? -11.162 1.098   1.182   1.00 0.59  ? 170 GLN A H    1  
ATOM 2638   H HA   . GLN A 1 170 ? -13.534 0.893   2.900   1.00 0.65  ? 170 GLN A HA   1  
ATOM 2639   H HB2  . GLN A 1 170 ? -14.650 2.085   0.985   1.00 0.72  ? 170 GLN A HB2  1  
ATOM 2640   H HB3  . GLN A 1 170 ? -13.260 2.952   1.640   1.00 0.72  ? 170 GLN A HB3  1  
ATOM 2641   H HG2  . GLN A 1 170 ? -11.839 2.085   -0.157  1.00 0.72  ? 170 GLN A HG2  1  
ATOM 2642   H HG3  . GLN A 1 170 ? -13.193 1.153   -0.801  1.00 0.77  ? 170 GLN A HG3  1  
ATOM 2643   H HE21 . GLN A 1 170 ? -13.064 2.409   -2.837  1.00 2.11  ? 170 GLN A HE21 1  
ATOM 2644   H HE22 . GLN A 1 170 ? -13.660 3.997   -2.902  1.00 1.45  ? 170 GLN A HE22 1  
ATOM 2645   N N    . LEU A 1 171 ? -13.166 -1.558  1.486   1.00 0.54  ? 171 LEU A N    1  
ATOM 2646   C CA   . LEU A 1 171 ? -13.668 -2.832  0.906   1.00 0.53  ? 171 LEU A CA   1  
ATOM 2647   C C    . LEU A 1 171 ? -14.448 -3.603  1.976   1.00 0.57  ? 171 LEU A C    1  
ATOM 2648   O O    . LEU A 1 171 ? -13.980 -3.798  3.080   1.00 0.63  ? 171 LEU A O    1  
ATOM 2649   C CB   . LEU A 1 171 ? -12.464 -3.658  0.455   1.00 0.49  ? 171 LEU A CB   1  
ATOM 2650   C CG   . LEU A 1 171 ? -12.910 -5.014  -0.100  1.00 0.48  ? 171 LEU A CG   1  
ATOM 2651   C CD1  . LEU A 1 171 ? -13.849 -4.812  -1.297  1.00 0.70  ? 171 LEU A CD1  1  
ATOM 2652   C CD2  . LEU A 1 171 ? -11.665 -5.787  -0.545  1.00 0.48  ? 171 LEU A CD2  1  
ATOM 2653   H H    . LEU A 1 171 ? -12.402 -1.595  2.097   1.00 0.53  ? 171 LEU A H    1  
ATOM 2654   H HA   . LEU A 1 171 ? -14.309 -2.629  0.060   1.00 0.55  ? 171 LEU A HA   1  
ATOM 2655   H HB2  . LEU A 1 171 ? -11.932 -3.120  -0.311  1.00 0.53  ? 171 LEU A HB2  1  
ATOM 2656   H HB3  . LEU A 1 171 ? -11.808 -3.820  1.298   1.00 0.52  ? 171 LEU A HB3  1  
ATOM 2657   H HG   . LEU A 1 171 ? -13.423 -5.573  0.669   1.00 0.59  ? 171 LEU A HG   1  
ATOM 2658   H HD11 . LEU A 1 171 ? -13.523 -3.960  -1.877  1.00 1.29  ? 171 LEU A HD11 1  
ATOM 2659   H HD12 . LEU A 1 171 ? -13.839 -5.695  -1.916  1.00 1.26  ? 171 LEU A HD12 1  
ATOM 2660   H HD13 . LEU A 1 171 ? -14.853 -4.640  -0.940  1.00 1.25  ? 171 LEU A HD13 1  
ATOM 2661   H HD21 . LEU A 1 171 ? -11.009 -5.130  -1.097  1.00 1.06  ? 171 LEU A HD21 1  
ATOM 2662   H HD22 . LEU A 1 171 ? -11.148 -6.162  0.327   1.00 1.19  ? 171 LEU A HD22 1  
ATOM 2663   H HD23 . LEU A 1 171 ? -11.959 -6.613  -1.173  1.00 1.03  ? 171 LEU A HD23 1  
ATOM 2664   N N    . ASN A 1 172 ? -15.626 -4.049  1.648   1.00 0.58  ? 172 ASN A N    1  
ATOM 2665   C CA   . ASN A 1 172 ? -16.441 -4.820  2.633   1.00 0.65  ? 172 ASN A CA   1  
ATOM 2666   C C    . ASN A 1 172 ? -16.003 -6.283  2.599   1.00 0.58  ? 172 ASN A C    1  
ATOM 2667   O O    . ASN A 1 172 ? -16.319 -7.018  1.685   1.00 0.58  ? 172 ASN A O    1  
ATOM 2668   C CB   . ASN A 1 172 ? -17.918 -4.720  2.250   1.00 0.77  ? 172 ASN A CB   1  
ATOM 2669   C CG   . ASN A 1 172 ? -18.443 -3.314  2.558   1.00 1.52  ? 172 ASN A CG   1  
ATOM 2670   O OD1  . ASN A 1 172 ? -19.527 -2.958  2.142   1.00 2.35  ? 172 ASN A OD1  1  
ATOM 2671   N ND2  . ASN A 1 172 ? -17.721 -2.495  3.273   1.00 2.12  ? 172 ASN A ND2  1  
ATOM 2672   H H    . ASN A 1 172 ? -15.973 -3.885  0.752   1.00 0.57  ? 172 ASN A H    1  
ATOM 2673   H HA   . ASN A 1 172 ? -16.293 -4.423  3.626   1.00 0.72  ? 172 ASN A HA   1  
ATOM 2674   H HB2  . ASN A 1 172 ? -18.027 -4.920  1.193   1.00 1.13  ? 172 ASN A HB2  1  
ATOM 2675   H HB3  . ASN A 1 172 ? -18.485 -5.446  2.814   1.00 1.26  ? 172 ASN A HB3  1  
ATOM 2676   H HD21 . ASN A 1 172 ? -16.847 -2.776  3.611   1.00 2.32  ? 172 ASN A HD21 1  
ATOM 2677   H HD22 . ASN A 1 172 ? -18.053 -1.594  3.469   1.00 2.81  ? 172 ASN A HD22 1  
ATOM 2678   N N    . LEU A 1 173 ? -15.251 -6.701  3.578   1.00 0.63  ? 173 LEU A N    1  
ATOM 2679   C CA   . LEU A 1 173 ? -14.756 -8.106  3.599   1.00 0.60  ? 173 LEU A CA   1  
ATOM 2680   C C    . LEU A 1 173 ? -15.910 -9.101  3.739   1.00 0.62  ? 173 LEU A C    1  
ATOM 2681   O O    . LEU A 1 173 ? -15.929 -10.127 3.091   1.00 0.65  ? 173 LEU A O    1  
ATOM 2682   C CB   . LEU A 1 173 ? -13.812 -8.278  4.788   1.00 0.68  ? 173 LEU A CB   1  
ATOM 2683   C CG   . LEU A 1 173 ? -12.607 -7.346  4.632   1.00 0.76  ? 173 LEU A CG   1  
ATOM 2684   C CD1  . LEU A 1 173 ? -11.805 -7.348  5.935   1.00 1.51  ? 173 LEU A CD1  1  
ATOM 2685   C CD2  . LEU A 1 173 ? -11.712 -7.815  3.470   1.00 1.29  ? 173 LEU A CD2  1  
ATOM 2686   H H    . LEU A 1 173 ? -14.988 -6.077  4.287   1.00 0.73  ? 173 LEU A H    1  
ATOM 2687   H HA   . LEU A 1 173 ? -14.222 -8.312  2.687   1.00 0.55  ? 173 LEU A HA   1  
ATOM 2688   H HB2  . LEU A 1 173 ? -14.339 -8.032  5.697   1.00 0.81  ? 173 LEU A HB2  1  
ATOM 2689   H HB3  . LEU A 1 173 ? -13.476 -9.302  4.836   1.00 0.76  ? 173 LEU A HB3  1  
ATOM 2690   H HG   . LEU A 1 173 ? -12.958 -6.343  4.434   1.00 1.47  ? 173 LEU A HG   1  
ATOM 2691   H HD11 . LEU A 1 173 ? -11.556 -8.364  6.203   1.00 2.03  ? 173 LEU A HD11 1  
ATOM 2692   H HD12 . LEU A 1 173 ? -10.898 -6.778  5.799   1.00 2.01  ? 173 LEU A HD12 1  
ATOM 2693   H HD13 . LEU A 1 173 ? -12.396 -6.902  6.720   1.00 2.09  ? 173 LEU A HD13 1  
ATOM 2694   H HD21 . LEU A 1 173 ? -11.688 -8.894  3.433   1.00 1.96  ? 173 LEU A HD21 1  
ATOM 2695   H HD22 . LEU A 1 173 ? -12.101 -7.432  2.539   1.00 1.75  ? 173 LEU A HD22 1  
ATOM 2696   H HD23 . LEU A 1 173 ? -10.707 -7.441  3.612   1.00 1.81  ? 173 LEU A HD23 1  
ATOM 2697   N N    . LYS A 1 174 ? -16.850 -8.837  4.601   1.00 0.67  ? 174 LYS A N    1  
ATOM 2698   C CA   . LYS A 1 174 ? -17.969 -9.806  4.801   1.00 0.73  ? 174 LYS A CA   1  
ATOM 2699   C C    . LYS A 1 174 ? -18.909 -9.869  3.595   1.00 0.72  ? 174 LYS A C    1  
ATOM 2700   O O    . LYS A 1 174 ? -19.580 -10.861 3.394   1.00 0.83  ? 174 LYS A O    1  
ATOM 2701   C CB   . LYS A 1 174 ? -18.774 -9.404  6.038   1.00 0.83  ? 174 LYS A CB   1  
ATOM 2702   C CG   . LYS A 1 174 ? -17.948 -9.652  7.303   1.00 0.97  ? 174 LYS A CG   1  
ATOM 2703   C CD   . LYS A 1 174 ? -18.838 -9.476  8.542   1.00 1.10  ? 174 LYS A CD   1  
ATOM 2704   C CE   . LYS A 1 174 ? -19.254 -8.009  8.699   1.00 1.59  ? 174 LYS A CE   1  
ATOM 2705   N NZ   . LYS A 1 174 ? -18.067 -7.125  8.520   1.00 2.33  ? 174 LYS A NZ   1  
ATOM 2706   H H    . LYS A 1 174 ? -16.818 -8.029  5.155   1.00 0.69  ? 174 LYS A H    1  
ATOM 2707   H HA   . LYS A 1 174 ? -17.553 -10.787 4.963   1.00 0.76  ? 174 LYS A HA   1  
ATOM 2708   H HB2  . LYS A 1 174 ? -19.017 -8.354  5.969   1.00 0.85  ? 174 LYS A HB2  1  
ATOM 2709   H HB3  . LYS A 1 174 ? -19.685 -9.982  6.082   1.00 0.89  ? 174 LYS A HB3  1  
ATOM 2710   H HG2  . LYS A 1 174 ? -17.563 -10.662 7.284   1.00 1.05  ? 174 LYS A HG2  1  
ATOM 2711   H HG3  . LYS A 1 174 ? -17.126 -8.957  7.344   1.00 1.02  ? 174 LYS A HG3  1  
ATOM 2712   H HD2  . LYS A 1 174 ? -19.722 -10.088 8.433   1.00 1.54  ? 174 LYS A HD2  1  
ATOM 2713   H HD3  . LYS A 1 174 ? -18.293 -9.789  9.419   1.00 1.28  ? 174 LYS A HD3  1  
ATOM 2714   H HE2  . LYS A 1 174 ? -20.003 -7.764  7.963   1.00 2.03  ? 174 LYS A HE2  1  
ATOM 2715   H HE3  . LYS A 1 174 ? -19.665 -7.860  9.687   1.00 2.07  ? 174 LYS A HE3  1  
ATOM 2716   H HZ1  . LYS A 1 174 ? -17.219 -7.609  8.873   1.00 2.86  ? 174 LYS A HZ1  1  
ATOM 2717   H HZ2  . LYS A 1 174 ? -17.949 -6.906  7.510   1.00 2.70  ? 174 LYS A HZ2  1  
ATOM 2718   H HZ3  . LYS A 1 174 ? -18.207 -6.244  9.053   1.00 2.67  ? 174 LYS A HZ3  1  
ATOM 2719   N N    . LYS A 1 175 ? -18.997 -8.833  2.801   1.00 0.66  ? 175 LYS A N    1  
ATOM 2720   C CA   . LYS A 1 175 ? -19.939 -8.882  1.636   1.00 0.72  ? 175 LYS A CA   1  
ATOM 2721   C C    . LYS A 1 175 ? -19.215 -9.364  0.383   1.00 0.62  ? 175 LYS A C    1  
ATOM 2722   O O    . LYS A 1 175 ? -19.838 -9.666  -0.615  1.00 0.63  ? 175 LYS A O    1  
ATOM 2723   C CB   . LYS A 1 175 ? -20.507 -7.488  1.385   1.00 0.85  ? 175 LYS A CB   1  
ATOM 2724   C CG   . LYS A 1 175 ? -21.454 -7.117  2.526   1.00 1.02  ? 175 LYS A CG   1  
ATOM 2725   C CD   . LYS A 1 175 ? -22.024 -5.724  2.278   1.00 1.42  ? 175 LYS A CD   1  
ATOM 2726   C CE   . LYS A 1 175 ? -22.971 -5.347  3.418   1.00 1.50  ? 175 LYS A CE   1  
ATOM 2727   N NZ   . LYS A 1 175 ? -23.411 -3.934  3.244   1.00 1.92  ? 175 LYS A NZ   1  
ATOM 2728   H H    . LYS A 1 175 ? -18.467 -8.029  2.977   1.00 0.64  ? 175 LYS A H    1  
ATOM 2729   H HA   . LYS A 1 175 ? -20.759 -9.558  1.852   1.00 0.79  ? 175 LYS A HA   1  
ATOM 2730   H HB2  . LYS A 1 175 ? -19.699 -6.773  1.337   1.00 0.83  ? 175 LYS A HB2  1  
ATOM 2731   H HB3  . LYS A 1 175 ? -21.051 -7.481  0.451   1.00 0.93  ? 175 LYS A HB3  1  
ATOM 2732   H HG2  . LYS A 1 175 ? -22.260 -7.834  2.570   1.00 1.54  ? 175 LYS A HG2  1  
ATOM 2733   H HG3  . LYS A 1 175 ? -20.914 -7.123  3.461   1.00 1.47  ? 175 LYS A HG3  1  
ATOM 2734   H HD2  . LYS A 1 175 ? -21.219 -5.006  2.223   1.00 1.92  ? 175 LYS A HD2  1  
ATOM 2735   H HD3  . LYS A 1 175 ? -22.571 -5.726  1.349   1.00 1.97  ? 175 LYS A HD3  1  
ATOM 2736   H HE2  . LYS A 1 175 ? -23.833 -5.999  3.404   1.00 1.87  ? 175 LYS A HE2  1  
ATOM 2737   H HE3  . LYS A 1 175 ? -22.457 -5.450  4.362   1.00 1.94  ? 175 LYS A HE3  1  
ATOM 2738   H HZ1  . LYS A 1 175 ? -23.793 -3.806  2.286   1.00 2.27  ? 175 LYS A HZ1  1  
ATOM 2739   H HZ2  . LYS A 1 175 ? -24.148 -3.712  3.944   1.00 2.38  ? 175 LYS A HZ2  1  
ATOM 2740   H HZ3  . LYS A 1 175 ? -22.600 -3.298  3.379   1.00 2.39  ? 175 LYS A HZ3  1  
ATOM 2741   N N    . VAL A 1 176 ? -17.911 -9.461  0.426   1.00 0.60  ? 176 VAL A N    1  
ATOM 2742   C CA   . VAL A 1 176 ? -17.149 -9.947  -0.766  1.00 0.54  ? 176 VAL A CA   1  
ATOM 2743   C C    . VAL A 1 176 ? -16.610 -11.338 -0.450  1.00 0.53  ? 176 VAL A C    1  
ATOM 2744   O O    . VAL A 1 176 ? -15.886 -11.533 0.505   1.00 0.67  ? 176 VAL A O    1  
ATOM 2745   C CB   . VAL A 1 176 ? -15.984 -8.995  -1.041  1.00 0.56  ? 176 VAL A CB   1  
ATOM 2746   C CG1  . VAL A 1 176 ? -15.194 -9.481  -2.262  1.00 0.55  ? 176 VAL A CG1  1  
ATOM 2747   C CG2  . VAL A 1 176 ? -16.533 -7.587  -1.301  1.00 0.66  ? 176 VAL A CG2  1  
ATOM 2748   H H    . VAL A 1 176 ? -17.428 -9.219  1.243   1.00 0.66  ? 176 VAL A H    1  
ATOM 2749   H HA   . VAL A 1 176 ? -17.790 -9.994  -1.637  1.00 0.56  ? 176 VAL A HA   1  
ATOM 2750   H HB   . VAL A 1 176 ? -15.333 -8.974  -0.179  1.00 0.59  ? 176 VAL A HB   1  
ATOM 2751   H HG11 . VAL A 1 176 ? -15.877 -9.837  -3.020  1.00 1.10  ? 176 VAL A HG11 1  
ATOM 2752   H HG12 . VAL A 1 176 ? -14.608 -8.667  -2.660  1.00 1.16  ? 176 VAL A HG12 1  
ATOM 2753   H HG13 . VAL A 1 176 ? -14.536 -10.285 -1.966  1.00 1.08  ? 176 VAL A HG13 1  
ATOM 2754   H HG21 . VAL A 1 176 ? -17.305 -7.360  -0.579  1.00 1.20  ? 176 VAL A HG21 1  
ATOM 2755   H HG22 . VAL A 1 176 ? -15.733 -6.868  -1.207  1.00 1.22  ? 176 VAL A HG22 1  
ATOM 2756   H HG23 . VAL A 1 176 ? -16.946 -7.538  -2.296  1.00 1.27  ? 176 VAL A HG23 1  
ATOM 2757   N N    . LEU A 1 177 ? -16.993 -12.319 -1.218  1.00 0.48  ? 177 LEU A N    1  
ATOM 2758   C CA   . LEU A 1 177 ? -16.539 -13.717 -0.935  1.00 0.55  ? 177 LEU A CA   1  
ATOM 2759   C C    . LEU A 1 177 ? -15.243 -14.035 -1.678  1.00 0.52  ? 177 LEU A C    1  
ATOM 2760   O O    . LEU A 1 177 ? -14.792 -15.164 -1.686  1.00 0.62  ? 177 LEU A O    1  
ATOM 2761   C CB   . LEU A 1 177 ? -17.627 -14.697 -1.378  1.00 0.66  ? 177 LEU A CB   1  
ATOM 2762   C CG   . LEU A 1 177 ? -18.929 -14.419 -0.613  1.00 0.88  ? 177 LEU A CG   1  
ATOM 2763   C CD1  . LEU A 1 177 ? -20.024 -15.351 -1.139  1.00 1.44  ? 177 LEU A CD1  1  
ATOM 2764   C CD2  . LEU A 1 177 ? -18.723 -14.662 0.895   1.00 1.53  ? 177 LEU A CD2  1  
ATOM 2765   H H    . LEU A 1 177 ? -17.618 -12.146 -1.960  1.00 0.49  ? 177 LEU A H    1  
ATOM 2766   H HA   . LEU A 1 177 ? -16.372 -13.835 0.126   1.00 0.62  ? 177 LEU A HA   1  
ATOM 2767   H HB2  . LEU A 1 177 ? -17.803 -14.578 -2.438  1.00 0.66  ? 177 LEU A HB2  1  
ATOM 2768   H HB3  . LEU A 1 177 ? -17.305 -15.707 -1.179  1.00 0.75  ? 177 LEU A HB3  1  
ATOM 2769   H HG   . LEU A 1 177 ? -19.225 -13.392 -0.777  1.00 1.41  ? 177 LEU A HG   1  
ATOM 2770   H HD11 . LEU A 1 177 ? -19.716 -16.376 -1.006  1.00 1.90  ? 177 LEU A HD11 1  
ATOM 2771   H HD12 . LEU A 1 177 ? -20.939 -15.174 -0.591  1.00 2.04  ? 177 LEU A HD12 1  
ATOM 2772   H HD13 . LEU A 1 177 ? -20.190 -15.156 -2.188  1.00 1.90  ? 177 LEU A HD13 1  
ATOM 2773   H HD21 . LEU A 1 177 ? -18.019 -15.469 1.045   1.00 1.98  ? 177 LEU A HD21 1  
ATOM 2774   H HD22 . LEU A 1 177 ? -18.339 -13.763 1.354   1.00 2.17  ? 177 LEU A HD22 1  
ATOM 2775   H HD23 . LEU A 1 177 ? -19.666 -14.922 1.356   1.00 1.96  ? 177 LEU A HD23 1  
ATOM 2776   N N    . GLY A 1 178 ? -14.627 -13.069 -2.297  1.00 0.48  ? 178 GLY A N    1  
ATOM 2777   C CA   . GLY A 1 178 ? -13.356 -13.363 -3.019  1.00 0.47  ? 178 GLY A CA   1  
ATOM 2778   C C    . GLY A 1 178 ? -12.937 -12.151 -3.846  1.00 0.46  ? 178 GLY A C    1  
ATOM 2779   O O    . GLY A 1 178 ? -13.667 -11.187 -3.964  1.00 0.47  ? 178 GLY A O    1  
ATOM 2780   H H    . GLY A 1 178 ? -14.984 -12.157 -2.281  1.00 0.52  ? 178 GLY A H    1  
ATOM 2781   H HA2  . GLY A 1 178 ? -12.582 -13.598 -2.303  1.00 0.48  ? 178 GLY A HA2  1  
ATOM 2782   H HA3  . GLY A 1 178 ? -13.506 -14.208 -3.675  1.00 0.48  ? 178 GLY A HA3  1  
ATOM 2783   N N    . PHE A 1 179 ? -11.763 -12.198 -4.422  1.00 0.47  ? 179 PHE A N    1  
ATOM 2784   C CA   . PHE A 1 179 ? -11.274 -11.056 -5.257  1.00 0.49  ? 179 PHE A CA   1  
ATOM 2785   C C    . PHE A 1 179 ? -10.698 -11.615 -6.558  1.00 0.53  ? 179 PHE A C    1  
ATOM 2786   O O    . PHE A 1 179 ? -9.858  -12.491 -6.543  1.00 0.55  ? 179 PHE A O    1  
ATOM 2787   C CB   . PHE A 1 179 ? -10.162 -10.299 -4.511  1.00 0.48  ? 179 PHE A CB   1  
ATOM 2788   C CG   . PHE A 1 179 ? -10.528 -10.131 -3.052  1.00 0.46  ? 179 PHE A CG   1  
ATOM 2789   C CD1  . PHE A 1 179 ? -11.687 -9.434  -2.692  1.00 0.45  ? 179 PHE A CD1  1  
ATOM 2790   C CD2  . PHE A 1 179 ? -9.700  -10.670 -2.056  1.00 0.48  ? 179 PHE A CD2  1  
ATOM 2791   C CE1  . PHE A 1 179 ? -12.019 -9.277  -1.340  1.00 0.46  ? 179 PHE A CE1  1  
ATOM 2792   C CE2  . PHE A 1 179 ? -10.032 -10.511 -0.706  1.00 0.47  ? 179 PHE A CE2  1  
ATOM 2793   C CZ   . PHE A 1 179 ? -11.192 -9.816  -0.348  1.00 0.46  ? 179 PHE A CZ   1  
ATOM 2794   H H    . PHE A 1 179 ? -11.193 -12.984 -4.307  1.00 0.48  ? 179 PHE A H    1  
ATOM 2795   H HA   . PHE A 1 179 ? -12.084 -10.383 -5.485  1.00 0.50  ? 179 PHE A HA   1  
ATOM 2796   H HB2  . PHE A 1 179 ? -9.235  -10.849 -4.590  1.00 0.51  ? 179 PHE A HB2  1  
ATOM 2797   H HB3  . PHE A 1 179 ? -10.036 -9.323  -4.959  1.00 0.49  ? 179 PHE A HB3  1  
ATOM 2798   H HD1  . PHE A 1 179 ? -12.325 -9.017  -3.457  1.00 0.48  ? 179 PHE A HD1  1  
ATOM 2799   H HD2  . PHE A 1 179 ? -8.805  -11.208 -2.329  1.00 0.52  ? 179 PHE A HD2  1  
ATOM 2800   H HE1  . PHE A 1 179 ? -12.915 -8.742  -1.062  1.00 0.49  ? 179 PHE A HE1  1  
ATOM 2801   H HE2  . PHE A 1 179 ? -9.393  -10.926 0.059   1.00 0.52  ? 179 PHE A HE2  1  
ATOM 2802   H HZ   . PHE A 1 179 ? -11.448 -9.694  0.694   1.00 0.47  ? 179 PHE A HZ   1  
ATOM 2803   N N    . ILE A 1 180 ? -11.129 -11.102 -7.681  1.00 0.55  ? 180 ILE A N    1  
ATOM 2804   C CA   . ILE A 1 180 ? -10.596 -11.583 -8.992  1.00 0.59  ? 180 ILE A CA   1  
ATOM 2805   C C    . ILE A 1 180 ? -10.233 -10.379 -9.859  1.00 0.64  ? 180 ILE A C    1  
ATOM 2806   O O    . ILE A 1 180 ? -11.033 -9.497  -10.072 1.00 0.65  ? 180 ILE A O    1  
ATOM 2807   C CB   . ILE A 1 180 ? -11.654 -12.429 -9.699  1.00 0.58  ? 180 ILE A CB   1  
ATOM 2808   C CG1  . ILE A 1 180 ? -11.917 -13.690 -8.871  1.00 0.58  ? 180 ILE A CG1  1  
ATOM 2809   C CG2  . ILE A 1 180 ? -11.146 -12.820 -11.091 1.00 0.64  ? 180 ILE A CG2  1  
ATOM 2810   C CD1  . ILE A 1 180 ? -13.113 -14.447 -9.447  1.00 0.55  ? 180 ILE A CD1  1  
ATOM 2811   H H    . ILE A 1 180 ? -11.796 -10.385 -7.664  1.00 0.54  ? 180 ILE A H    1  
ATOM 2812   H HA   . ILE A 1 180 ? -9.713  -12.184 -8.835  1.00 0.61  ? 180 ILE A HA   1  
ATOM 2813   H HB   . ILE A 1 180 ? -12.565 -11.856 -9.795  1.00 0.59  ? 180 ILE A HB   1  
ATOM 2814   H HG12 . ILE A 1 180 ? -11.045 -14.325 -8.897  1.00 0.66  ? 180 ILE A HG12 1  
ATOM 2815   H HG13 . ILE A 1 180 ? -12.130 -13.412 -7.849  1.00 0.62  ? 180 ILE A HG13 1  
ATOM 2816   H HG21 . ILE A 1 180 ? -10.121 -13.149 -11.019 1.00 1.27  ? 180 ILE A HG21 1  
ATOM 2817   H HG22 . ILE A 1 180 ? -11.753 -13.620 -11.488 1.00 1.18  ? 180 ILE A HG22 1  
ATOM 2818   H HG23 . ILE A 1 180 ? -11.204 -11.966 -11.748 1.00 1.14  ? 180 ILE A HG23 1  
ATOM 2819   H HD11 . ILE A 1 180 ? -13.907 -13.752 -9.673  1.00 1.13  ? 180 ILE A HD11 1  
ATOM 2820   H HD12 . ILE A 1 180 ? -12.808 -14.954 -10.351 1.00 1.07  ? 180 ILE A HD12 1  
ATOM 2821   H HD13 . ILE A 1 180 ? -13.460 -15.172 -8.726  1.00 1.23  ? 180 ILE A HD13 1  
ATOM 2822   N N    . THR A 1 181 ? -9.032  -10.332 -10.368 1.00 0.68  ? 181 THR A N    1  
ATOM 2823   C CA   . THR A 1 181 ? -8.632  -9.176  -11.228 1.00 0.74  ? 181 THR A CA   1  
ATOM 2824   C C    . THR A 1 181 ? -7.597  -9.611  -12.261 1.00 0.79  ? 181 THR A C    1  
ATOM 2825   O O    . THR A 1 181 ? -6.959  -10.635 -12.128 1.00 0.80  ? 181 THR A O    1  
ATOM 2826   C CB   . THR A 1 181 ? -8.022  -8.059  -10.375 1.00 0.79  ? 181 THR A CB   1  
ATOM 2827   O OG1  . THR A 1 181 ? -6.801  -8.511  -9.809  1.00 0.82  ? 181 THR A OG1  1  
ATOM 2828   C CG2  . THR A 1 181 ? -8.983  -7.661  -9.260  1.00 0.77  ? 181 THR A CG2  1  
ATOM 2829   H H    . THR A 1 181 ? -8.403  -11.054 -10.191 1.00 0.69  ? 181 THR A H    1  
ATOM 2830   H HA   . THR A 1 181 ? -9.499  -8.803  -11.742 1.00 0.73  ? 181 THR A HA   1  
ATOM 2831   H HB   . THR A 1 181 ? -7.830  -7.198  -10.999 1.00 0.84  ? 181 THR A HB   1  
ATOM 2832   H HG1  . THR A 1 181 ? -6.460  -7.817  -9.240  1.00 1.30  ? 181 THR A HG1  1  
ATOM 2833   H HG21 . THR A 1 181 ? -9.958  -7.466  -9.677  1.00 1.31  ? 181 THR A HG21 1  
ATOM 2834   H HG22 . THR A 1 181 ? -9.050  -8.463  -8.540  1.00 1.08  ? 181 THR A HG22 1  
ATOM 2835   H HG23 . THR A 1 181 ? -8.615  -6.772  -8.775  1.00 1.39  ? 181 THR A HG23 1  
ATOM 2836   N N    . ASP A 1 182 ? -7.427  -8.823  -13.293 1.00 0.84  ? 182 ASP A N    1  
ATOM 2837   C CA   . ASP A 1 182 ? -6.424  -9.162  -14.352 1.00 0.90  ? 182 ASP A CA   1  
ATOM 2838   C C    . ASP A 1 182 ? -5.185  -8.272  -14.177 1.00 0.96  ? 182 ASP A C    1  
ATOM 2839   O O    . ASP A 1 182 ? -4.452  -8.024  -15.116 1.00 1.04  ? 182 ASP A O    1  
ATOM 2840   C CB   . ASP A 1 182 ? -7.044  -8.927  -15.739 1.00 0.95  ? 182 ASP A CB   1  
ATOM 2841   C CG   . ASP A 1 182 ? -7.217  -7.428  -16.004 1.00 1.71  ? 182 ASP A CG   1  
ATOM 2842   O OD1  . ASP A 1 182 ? -6.995  -6.651  -15.093 1.00 2.37  ? 182 ASP A OD1  1  
ATOM 2843   O OD2  . ASP A 1 182 ? -7.571  -7.085  -17.121 1.00 2.46  ? 182 ASP A OD2  1  
ATOM 2844   H H    . ASP A 1 182 ? -7.963  -7.997  -13.368 1.00 0.85  ? 182 ASP A H    1  
ATOM 2845   H HA   . ASP A 1 182 ? -6.129  -10.199 -14.266 1.00 0.90  ? 182 ASP A HA   1  
ATOM 2846   H HB2  . ASP A 1 182 ? -6.400  -9.351  -16.492 1.00 1.38  ? 182 ASP A HB2  1  
ATOM 2847   H HB3  . ASP A 1 182 ? -8.010  -9.409  -15.784 1.00 1.36  ? 182 ASP A HB3  1  
ATOM 2848   N N    . ALA A 1 183 ? -4.961  -7.761  -12.991 1.00 0.95  ? 183 ALA A N    1  
ATOM 2849   C CA   . ALA A 1 183 ? -3.793  -6.857  -12.762 1.00 1.03  ? 183 ALA A CA   1  
ATOM 2850   C C    . ALA A 1 183 ? -2.470  -7.538  -13.131 1.00 1.08  ? 183 ALA A C    1  
ATOM 2851   O O    . ALA A 1 183 ? -2.433  -8.487  -13.889 1.00 1.28  ? 183 ALA A O    1  
ATOM 2852   C CB   . ALA A 1 183 ? -3.763  -6.450  -11.286 1.00 1.03  ? 183 ALA A CB   1  
ATOM 2853   H H    . ALA A 1 183 ? -5.564  -7.944  -12.238 1.00 0.91  ? 183 ALA A H    1  
ATOM 2854   H HA   . ALA A 1 183 ? -3.911  -5.969  -13.365 1.00 1.09  ? 183 ALA A HA   1  
ATOM 2855   H HB1  . ALA A 1 183 ? -4.754  -6.153  -10.976 1.00 1.49  ? 183 ALA A HB1  1  
ATOM 2856   H HB2  . ALA A 1 183 ? -3.435  -7.286  -10.687 1.00 1.35  ? 183 ALA A HB2  1  
ATOM 2857   H HB3  . ALA A 1 183 ? -3.082  -5.622  -11.154 1.00 1.51  ? 183 ALA A HB3  1  
ATOM 2858   N N    . GLY A 1 184 ? -1.379  -7.034  -12.608 1.00 1.51  ? 184 GLY A N    1  
ATOM 2859   C CA   . GLY A 1 184 ? -0.040  -7.615  -12.929 1.00 1.61  ? 184 GLY A CA   1  
ATOM 2860   C C    . GLY A 1 184 ? 0.168   -8.943  -12.199 1.00 1.55  ? 184 GLY A C    1  
ATOM 2861   O O    . GLY A 1 184 ? 0.473   -9.947  -12.811 1.00 2.19  ? 184 GLY A O    1  
ATOM 2862   H H    . GLY A 1 184 ? -1.443  -6.260  -12.011 1.00 1.99  ? 184 GLY A H    1  
ATOM 2863   H HA2  . GLY A 1 184 ? 0.029   -7.782  -13.994 1.00 1.61  ? 184 GLY A HA2  1  
ATOM 2864   H HA3  . GLY A 1 184 ? 0.731   -6.920  -12.628 1.00 2.23  ? 184 GLY A HA3  1  
ATOM 2865   N N    . GLY A 1 185 ? 0.015   -8.974  -10.901 1.00 1.40  ? 185 GLY A N    1  
ATOM 2866   C CA   . GLY A 1 185 ? 0.218   -10.260 -10.177 1.00 1.79  ? 185 GLY A CA   1  
ATOM 2867   C C    . GLY A 1 185 ? 0.466   -10.010 -8.688  1.00 1.91  ? 185 GLY A C    1  
ATOM 2868   O O    . GLY A 1 185 ? -0.265  -9.295  -8.032  1.00 2.13  ? 185 GLY A O    1  
ATOM 2869   H H    . GLY A 1 185 ? -0.232  -8.163  -10.407 1.00 1.53  ? 185 GLY A H    1  
ATOM 2870   H HA2  . GLY A 1 185 ? -0.663  -10.876 -10.293 1.00 2.23  ? 185 GLY A HA2  1  
ATOM 2871   H HA3  . GLY A 1 185 ? 1.070   -10.777 -10.595 1.00 2.23  ? 185 GLY A HA3  1  
ATOM 2872   N N    . ARG A 1 186 ? 1.485   -10.624 -8.152  1.00 2.13  ? 186 ARG A N    1  
ATOM 2873   C CA   . ARG A 1 186 ? 1.792   -10.470 -6.700  1.00 2.75  ? 186 ARG A CA   1  
ATOM 2874   C C    . ARG A 1 186 ? 2.302   -9.056  -6.391  1.00 2.72  ? 186 ARG A C    1  
ATOM 2875   O O    . ARG A 1 186 ? 2.267   -8.618  -5.259  1.00 3.16  ? 186 ARG A O    1  
ATOM 2876   C CB   . ARG A 1 186 ? 2.868   -11.483 -6.308  1.00 3.24  ? 186 ARG A CB   1  
ATOM 2877   C CG   . ARG A 1 186 ? 2.279   -12.897 -6.342  1.00 3.69  ? 186 ARG A CG   1  
ATOM 2878   C CD   . ARG A 1 186 ? 3.343   -13.922 -5.910  1.00 4.28  ? 186 ARG A CD   1  
ATOM 2879   N NE   . ARG A 1 186 ? 3.111   -15.225 -6.614  1.00 4.62  ? 186 ARG A NE   1  
ATOM 2880   C CZ   . ARG A 1 186 ? 1.925   -15.777 -6.663  1.00 5.22  ? 186 ARG A CZ   1  
ATOM 2881   N NH1  . ARG A 1 186 ? 0.948   -15.321 -5.929  1.00 5.53  ? 186 ARG A NH1  1  
ATOM 2882   N NH2  . ARG A 1 186 ? 1.737   -16.834 -7.405  1.00 5.86  ? 186 ARG A NH2  1  
ATOM 2883   H H    . ARG A 1 186 ? 2.043   -11.210 -8.705  1.00 2.07  ? 186 ARG A H    1  
ATOM 2884   H HA   . ARG A 1 186 ? 0.899   -10.662 -6.125  1.00 3.09  ? 186 ARG A HA   1  
ATOM 2885   H HB2  . ARG A 1 186 ? 3.691   -11.419 -7.007  1.00 3.28  ? 186 ARG A HB2  1  
ATOM 2886   H HB3  . ARG A 1 186 ? 3.223   -11.265 -5.313  1.00 3.66  ? 186 ARG A HB3  1  
ATOM 2887   H HG2  . ARG A 1 186 ? 1.438   -12.938 -5.668  1.00 4.01  ? 186 ARG A HG2  1  
ATOM 2888   H HG3  . ARG A 1 186 ? 1.948   -13.125 -7.343  1.00 3.67  ? 186 ARG A HG3  1  
ATOM 2889   H HD2  . ARG A 1 186 ? 4.323   -13.568 -6.182  1.00 4.60  ? 186 ARG A HD2  1  
ATOM 2890   H HD3  . ARG A 1 186 ? 3.300   -14.053 -4.833  1.00 4.53  ? 186 ARG A HD3  1  
ATOM 2891   H HE   . ARG A 1 186 ? 3.853   -15.647 -7.094  1.00 4.71  ? 186 ARG A HE   1  
ATOM 2892   H HH11 . ARG A 1 186 ? 1.100   -14.550 -5.317  1.00 5.36  ? 186 ARG A HH11 1  
ATOM 2893   H HH12 . ARG A 1 186 ? 0.044   -15.746 -5.983  1.00 6.16  ? 186 ARG A HH12 1  
ATOM 2894   H HH21 . ARG A 1 186 ? 2.496   -17.215 -7.933  1.00 5.95  ? 186 ARG A HH21 1  
ATOM 2895   H HH22 . ARG A 1 186 ? 0.834   -17.262 -7.448  1.00 6.44  ? 186 ARG A HH22 1  
ATOM 2896   N N    . THR A 1 187 ? 2.791   -8.346  -7.370  1.00 2.51  ? 187 THR A N    1  
ATOM 2897   C CA   . THR A 1 187 ? 3.316   -6.975  -7.097  1.00 2.54  ? 187 THR A CA   1  
ATOM 2898   C C    . THR A 1 187 ? 2.160   -6.005  -6.836  1.00 2.01  ? 187 THR A C    1  
ATOM 2899   O O    . THR A 1 187 ? 2.370   -4.834  -6.590  1.00 2.27  ? 187 THR A O    1  
ATOM 2900   C CB   . THR A 1 187 ? 4.120   -6.487  -8.305  1.00 3.16  ? 187 THR A CB   1  
ATOM 2901   O OG1  . THR A 1 187 ? 3.350   -6.666  -9.487  1.00 3.23  ? 187 THR A OG1  1  
ATOM 2902   C CG2  . THR A 1 187 ? 5.422   -7.281  -8.414  1.00 3.72  ? 187 THR A CG2  1  
ATOM 2903   H H    . THR A 1 187 ? 2.827   -8.715  -8.276  1.00 2.59  ? 187 THR A H    1  
ATOM 2904   H HA   . THR A 1 187 ? 3.959   -7.004  -6.230  1.00 2.63  ? 187 THR A HA   1  
ATOM 2905   H HB   . THR A 1 187 ? 4.351   -5.439  -8.184  1.00 3.28  ? 187 THR A HB   1  
ATOM 2906   H HG1  . THR A 1 187 ? 2.926   -5.829  -9.693  1.00 3.45  ? 187 THR A HG1  1  
ATOM 2907   H HG21 . THR A 1 187 ? 5.934   -7.267  -7.463  1.00 3.91  ? 187 THR A HG21 1  
ATOM 2908   H HG22 . THR A 1 187 ? 5.200   -8.301  -8.688  1.00 3.97  ? 187 THR A HG22 1  
ATOM 2909   H HG23 . THR A 1 187 ? 6.054   -6.835  -9.168  1.00 4.09  ? 187 THR A HG23 1  
ATOM 2910   N N    . SER A 1 188 ? 0.943   -6.475  -6.887  1.00 1.47  ? 188 SER A N    1  
ATOM 2911   C CA   . SER A 1 188 ? -0.220  -5.569  -6.640  1.00 1.20  ? 188 SER A CA   1  
ATOM 2912   C C    . SER A 1 188 ? -0.587  -5.578  -5.151  1.00 1.05  ? 188 SER A C    1  
ATOM 2913   O O    . SER A 1 188 ? -0.696  -6.620  -4.533  1.00 1.13  ? 188 SER A O    1  
ATOM 2914   C CB   . SER A 1 188 ? -1.420  -6.047  -7.460  1.00 1.08  ? 188 SER A CB   1  
ATOM 2915   O OG   . SER A 1 188 ? -1.207  -5.734  -8.831  1.00 1.74  ? 188 SER A OG   1  
ATOM 2916   H H    . SER A 1 188 ? 0.792   -7.423  -7.088  1.00 1.47  ? 188 SER A H    1  
ATOM 2917   H HA   . SER A 1 188 ? 0.033   -4.560  -6.937  1.00 1.57  ? 188 SER A HA   1  
ATOM 2918   H HB2  . SER A 1 188 ? -1.532  -7.112  -7.352  1.00 1.46  ? 188 SER A HB2  1  
ATOM 2919   H HB3  . SER A 1 188 ? -2.316  -5.556  -7.104  1.00 1.56  ? 188 SER A HB3  1  
ATOM 2920   H HG   . SER A 1 188 ? -0.596  -6.381  -9.190  1.00 2.20  ? 188 SER A HG   1  
ATOM 2921   N N    . HIS A 1 189 ? -0.772  -4.421  -4.571  1.00 0.95  ? 189 HIS A N    1  
ATOM 2922   C CA   . HIS A 1 189 ? -1.127  -4.331  -3.123  1.00 0.83  ? 189 HIS A CA   1  
ATOM 2923   C C    . HIS A 1 189 ? -2.302  -5.270  -2.824  1.00 0.76  ? 189 HIS A C    1  
ATOM 2924   O O    . HIS A 1 189 ? -2.281  -6.024  -1.873  1.00 0.71  ? 189 HIS A O    1  
ATOM 2925   C CB   . HIS A 1 189 ? -1.524  -2.875  -2.834  1.00 0.85  ? 189 HIS A CB   1  
ATOM 2926   C CG   . HIS A 1 189 ? -1.992  -2.698  -1.412  1.00 0.77  ? 189 HIS A CG   1  
ATOM 2927   N ND1  . HIS A 1 189 ? -1.118  -2.399  -0.375  1.00 0.87  ? 189 HIS A ND1  1  
ATOM 2928   C CD2  . HIS A 1 189 ? -3.249  -2.710  -0.854  1.00 0.88  ? 189 HIS A CD2  1  
ATOM 2929   C CE1  . HIS A 1 189 ? -1.853  -2.239  0.743   1.00 0.86  ? 189 HIS A CE1  1  
ATOM 2930   N NE2  . HIS A 1 189 ? -3.166  -2.419  0.506   1.00 0.84  ? 189 HIS A NE2  1  
ATOM 2931   H H    . HIS A 1 189 ? -0.661  -3.591  -5.080  1.00 1.04  ? 189 HIS A H    1  
ATOM 2932   H HA   . HIS A 1 189 ? -0.278  -4.604  -2.519  1.00 0.84  ? 189 HIS A HA   1  
ATOM 2933   H HB2  . HIS A 1 189 ? -0.671  -2.236  -3.006  1.00 0.93  ? 189 HIS A HB2  1  
ATOM 2934   H HB3  . HIS A 1 189 ? -2.319  -2.588  -3.507  1.00 0.92  ? 189 HIS A HB3  1  
ATOM 2935   H HD1  . HIS A 1 189 ? -0.144  -2.316  -0.445  1.00 1.09  ? 189 HIS A HD1  1  
ATOM 2936   H HD2  . HIS A 1 189 ? -4.163  -2.914  -1.390  1.00 1.15  ? 189 HIS A HD2  1  
ATOM 2937   H HE1  . HIS A 1 189 ? -1.439  -1.999  1.711   1.00 1.04  ? 189 HIS A HE1  1  
ATOM 2938   N N    . THR A 1 190 ? -3.327  -5.216  -3.621  1.00 0.83  ? 190 THR A N    1  
ATOM 2939   C CA   . THR A 1 190 ? -4.510  -6.093  -3.375  1.00 0.82  ? 190 THR A CA   1  
ATOM 2940   C C    . THR A 1 190 ? -4.078  -7.563  -3.344  1.00 0.80  ? 190 THR A C    1  
ATOM 2941   O O    . THR A 1 190 ? -4.558  -8.340  -2.544  1.00 0.80  ? 190 THR A O    1  
ATOM 2942   C CB   . THR A 1 190 ? -5.538  -5.901  -4.492  1.00 0.92  ? 190 THR A CB   1  
ATOM 2943   O OG1  . THR A 1 190 ? -6.398  -7.032  -4.538  1.00 1.55  ? 190 THR A OG1  1  
ATOM 2944   C CG2  . THR A 1 190 ? -4.817  -5.754  -5.833  1.00 1.46  ? 190 THR A CG2  1  
ATOM 2945   H H    . THR A 1 190 ? -3.323  -4.576  -4.362  1.00 0.92  ? 190 THR A H    1  
ATOM 2946   H HA   . THR A 1 190 ? -4.959  -5.832  -2.428  1.00 0.80  ? 190 THR A HA   1  
ATOM 2947   H HB   . THR A 1 190 ? -6.117  -5.013  -4.299  1.00 1.45  ? 190 THR A HB   1  
ATOM 2948   H HG1  . THR A 1 190 ? -6.579  -7.305  -3.636  1.00 1.99  ? 190 THR A HG1  1  
ATOM 2949   H HG21 . THR A 1 190 ? -4.086  -6.543  -5.937  1.00 1.88  ? 190 THR A HG21 1  
ATOM 2950   H HG22 . THR A 1 190 ? -5.534  -5.820  -6.637  1.00 2.00  ? 190 THR A HG22 1  
ATOM 2951   H HG23 . THR A 1 190 ? -4.319  -4.797  -5.873  1.00 2.01  ? 190 THR A HG23 1  
ATOM 2952   N N    . SER A 1 191 ? -3.183  -7.957  -4.207  1.00 0.85  ? 191 SER A N    1  
ATOM 2953   C CA   . SER A 1 191 ? -2.745  -9.384  -4.218  1.00 0.89  ? 191 SER A CA   1  
ATOM 2954   C C    . SER A 1 191 ? -2.134  -9.752  -2.864  1.00 0.82  ? 191 SER A C    1  
ATOM 2955   O O    . SER A 1 191 ? -2.392  -10.810 -2.325  1.00 0.85  ? 191 SER A O    1  
ATOM 2956   C CB   . SER A 1 191 ? -1.695  -9.586  -5.308  1.00 1.00  ? 191 SER A CB   1  
ATOM 2957   O OG   . SER A 1 191 ? -1.432  -10.976 -5.450  1.00 1.51  ? 191 SER A OG   1  
ATOM 2958   H H    . SER A 1 191 ? -2.808  -7.322  -4.852  1.00 0.90  ? 191 SER A H    1  
ATOM 2959   H HA   . SER A 1 191 ? -3.595  -10.021 -4.414  1.00 0.91  ? 191 SER A HA   1  
ATOM 2960   H HB2  . SER A 1 191 ? -2.062  -9.196  -6.242  1.00 1.43  ? 191 SER A HB2  1  
ATOM 2961   H HB3  . SER A 1 191 ? -0.787  -9.064  -5.033  1.00 1.59  ? 191 SER A HB3  1  
ATOM 2962   H HG   . SER A 1 191 ? -0.985  -11.276 -4.654  1.00 1.93  ? 191 SER A HG   1  
ATOM 2963   N N    . ILE A 1 192 ? -1.325  -8.895  -2.313  1.00 0.80  ? 192 ILE A N    1  
ATOM 2964   C CA   . ILE A 1 192 ? -0.696  -9.202  -1.000  1.00 0.78  ? 192 ILE A CA   1  
ATOM 2965   C C    . ILE A 1 192 ? -1.779  -9.353  0.071   1.00 0.71  ? 192 ILE A C    1  
ATOM 2966   O O    . ILE A 1 192 ? -1.714  -10.231 0.909   1.00 0.72  ? 192 ILE A O    1  
ATOM 2967   C CB   . ILE A 1 192 ? 0.250   -8.064  -0.612  1.00 0.82  ? 192 ILE A CB   1  
ATOM 2968   C CG1  . ILE A 1 192 ? 1.427   -8.031  -1.590  1.00 0.97  ? 192 ILE A CG1  1  
ATOM 2969   C CG2  . ILE A 1 192 ? 0.773   -8.298  0.810   1.00 0.85  ? 192 ILE A CG2  1  
ATOM 2970   C CD1  . ILE A 1 192 ? 2.241   -6.753  -1.374  1.00 1.67  ? 192 ILE A CD1  1  
ATOM 2971   H H    . ILE A 1 192 ? -1.127  -8.051  -2.766  1.00 0.85  ? 192 ILE A H    1  
ATOM 2972   H HA   . ILE A 1 192 ? -0.136  -10.122 -1.077  1.00 0.83  ? 192 ILE A HA   1  
ATOM 2973   H HB   . ILE A 1 192 ? -0.283  -7.125  -0.650  1.00 0.80  ? 192 ILE A HB   1  
ATOM 2974   H HG12 . ILE A 1 192 ? 2.059   -8.892  -1.423  1.00 1.38  ? 192 ILE A HG12 1  
ATOM 2975   H HG13 . ILE A 1 192 ? 1.054   -8.050  -2.604  1.00 1.44  ? 192 ILE A HG13 1  
ATOM 2976   H HG21 . ILE A 1 192 ? 1.064   -9.331  0.922   1.00 1.41  ? 192 ILE A HG21 1  
ATOM 2977   H HG22 . ILE A 1 192 ? 1.627   -7.662  0.990   1.00 1.39  ? 192 ILE A HG22 1  
ATOM 2978   H HG23 . ILE A 1 192 ? -0.005  -8.064  1.522   1.00 1.19  ? 192 ILE A HG23 1  
ATOM 2979   H HD11 . ILE A 1 192 ? 2.419   -6.614  -0.318  1.00 2.12  ? 192 ILE A HD11 1  
ATOM 2980   H HD12 . ILE A 1 192 ? 3.184   -6.835  -1.892  1.00 2.20  ? 192 ILE A HD12 1  
ATOM 2981   H HD13 . ILE A 1 192 ? 1.691   -5.907  -1.760  1.00 2.20  ? 192 ILE A HD13 1  
ATOM 2982   N N    . MET A 1 193 ? -2.773  -8.508  0.054   1.00 0.67  ? 193 MET A N    1  
ATOM 2983   C CA   . MET A 1 193 ? -3.848  -8.616  1.079   1.00 0.64  ? 193 MET A CA   1  
ATOM 2984   C C    . MET A 1 193 ? -4.583  -9.946  0.933   1.00 0.61  ? 193 MET A C    1  
ATOM 2985   O O    . MET A 1 193 ? -4.910  -10.584 1.911   1.00 0.62  ? 193 MET A O    1  
ATOM 2986   C CB   . MET A 1 193 ? -4.832  -7.455  0.927   1.00 0.67  ? 193 MET A CB   1  
ATOM 2987   C CG   . MET A 1 193 ? -4.167  -6.164  1.421   1.00 0.69  ? 193 MET A CG   1  
ATOM 2988   S SD   . MET A 1 193 ? -5.274  -4.758  1.169   1.00 1.02  ? 193 MET A SD   1  
ATOM 2989   C CE   . MET A 1 193 ? -6.661  -5.330  2.187   1.00 0.71  ? 193 MET A CE   1  
ATOM 2990   H H    . MET A 1 193 ? -2.812  -7.806  -0.629  1.00 0.70  ? 193 MET A H    1  
ATOM 2991   H HA   . MET A 1 193 ? -3.401  -8.573  2.059   1.00 0.67  ? 193 MET A HA   1  
ATOM 2992   H HB2  . MET A 1 193 ? -5.107  -7.348  -0.112  1.00 0.70  ? 193 MET A HB2  1  
ATOM 2993   H HB3  . MET A 1 193 ? -5.713  -7.654  1.515   1.00 0.74  ? 193 MET A HB3  1  
ATOM 2994   H HG2  . MET A 1 193 ? -3.943  -6.255  2.475   1.00 0.86  ? 193 MET A HG2  1  
ATOM 2995   H HG3  . MET A 1 193 ? -3.253  -6.000  0.871   1.00 0.74  ? 193 MET A HG3  1  
ATOM 2996   H HE1  . MET A 1 193 ? -6.285  -5.917  3.013   1.00 1.32  ? 193 MET A HE1  1  
ATOM 2997   H HE2  . MET A 1 193 ? -7.210  -4.475  2.564   1.00 1.28  ? 193 MET A HE2  1  
ATOM 2998   H HE3  . MET A 1 193 ? -7.322  -5.936  1.588   1.00 1.19  ? 193 MET A HE3  1  
ATOM 2999   N N    . ALA A 1 194 ? -4.840  -10.390 -0.263  1.00 0.61  ? 194 ALA A N    1  
ATOM 3000   C CA   . ALA A 1 194 ? -5.552  -11.688 -0.415  1.00 0.62  ? 194 ALA A CA   1  
ATOM 3001   C C    . ALA A 1 194 ? -4.773  -12.767 0.331   1.00 0.64  ? 194 ALA A C    1  
ATOM 3002   O O    . ALA A 1 194 ? -5.339  -13.605 1.004   1.00 0.68  ? 194 ALA A O    1  
ATOM 3003   C CB   . ALA A 1 194 ? -5.642  -12.059 -1.902  1.00 0.67  ? 194 ALA A CB   1  
ATOM 3004   H H    . ALA A 1 194 ? -4.573  -9.887  -1.060  1.00 0.63  ? 194 ALA A H    1  
ATOM 3005   H HA   . ALA A 1 194 ? -6.544  -11.606 -0.001  1.00 0.62  ? 194 ALA A HA   1  
ATOM 3006   H HB1  . ALA A 1 194 ? -4.710  -11.815 -2.389  1.00 1.30  ? 194 ALA A HB1  1  
ATOM 3007   H HB2  . ALA A 1 194 ? -5.835  -13.119 -2.003  1.00 1.16  ? 194 ALA A HB2  1  
ATOM 3008   H HB3  . ALA A 1 194 ? -6.444  -11.502 -2.364  1.00 1.21  ? 194 ALA A HB3  1  
ATOM 3009   N N    . ARG A 1 195 ? -3.480  -12.761 0.202   1.00 0.66  ? 195 ARG A N    1  
ATOM 3010   C CA   . ARG A 1 195 ? -2.664  -13.797 0.887   1.00 0.72  ? 195 ARG A CA   1  
ATOM 3011   C C    . ARG A 1 195 ? -2.880  -13.719 2.400   1.00 0.72  ? 195 ARG A C    1  
ATOM 3012   O O    . ARG A 1 195 ? -3.136  -14.713 3.051   1.00 0.74  ? 195 ARG A O    1  
ATOM 3013   C CB   . ARG A 1 195 ? -1.192  -13.549 0.569   1.00 0.80  ? 195 ARG A CB   1  
ATOM 3014   C CG   . ARG A 1 195 ? -0.959  -13.747 -0.928  1.00 0.87  ? 195 ARG A CG   1  
ATOM 3015   C CD   . ARG A 1 195 ? 0.514   -13.499 -1.254  1.00 0.97  ? 195 ARG A CD   1  
ATOM 3016   N NE   . ARG A 1 195 ? 1.347   -14.558 -0.617  1.00 1.61  ? 195 ARG A NE   1  
ATOM 3017   C CZ   . ARG A 1 195 ? 2.587   -14.725 -0.988  1.00 2.06  ? 195 ARG A CZ   1  
ATOM 3018   N NH1  . ARG A 1 195 ? 3.094   -13.977 -1.929  1.00 2.26  ? 195 ARG A NH1  1  
ATOM 3019   N NH2  . ARG A 1 195 ? 3.320   -15.643 -0.418  1.00 2.93  ? 195 ARG A NH2  1  
ATOM 3020   H H    . ARG A 1 195 ? -3.048  -12.086 -0.365  1.00 0.68  ? 195 ARG A H    1  
ATOM 3021   H HA   . ARG A 1 195 ? -2.947  -14.774 0.531   1.00 0.72  ? 195 ARG A HA   1  
ATOM 3022   H HB2  . ARG A 1 195 ? -0.930  -12.537 0.847   1.00 0.81  ? 195 ARG A HB2  1  
ATOM 3023   H HB3  . ARG A 1 195 ? -0.581  -14.245 1.123   1.00 0.86  ? 195 ARG A HB3  1  
ATOM 3024   H HG2  . ARG A 1 195 ? -1.226  -14.757 -1.204  1.00 0.90  ? 195 ARG A HG2  1  
ATOM 3025   H HG3  . ARG A 1 195 ? -1.570  -13.048 -1.483  1.00 0.88  ? 195 ARG A HG3  1  
ATOM 3026   H HD2  . ARG A 1 195 ? 0.656   -13.522 -2.324  1.00 1.25  ? 195 ARG A HD2  1  
ATOM 3027   H HD3  . ARG A 1 195 ? 0.807   -12.532 -0.872  1.00 1.40  ? 195 ARG A HD3  1  
ATOM 3028   H HE   . ARG A 1 195 ? 0.964   -15.126 0.085   1.00 2.23  ? 195 ARG A HE   1  
ATOM 3029   H HH11 . ARG A 1 195 ? 2.533   -13.275 -2.367  1.00 2.16  ? 195 ARG A HH11 1  
ATOM 3030   H HH12 . ARG A 1 195 ? 4.045   -14.106 -2.212  1.00 2.92  ? 195 ARG A HH12 1  
ATOM 3031   H HH21 . ARG A 1 195 ? 2.931   -16.218 0.302   1.00 3.38  ? 195 ARG A HH21 1  
ATOM 3032   H HH22 . ARG A 1 195 ? 4.270   -15.771 -0.703  1.00 3.38  ? 195 ARG A HH22 1  
ATOM 3033   N N    . SER A 1 196 ? -2.765  -12.554 2.969   1.00 0.72  ? 196 SER A N    1  
ATOM 3034   C CA   . SER A 1 196 ? -2.948  -12.411 4.442   1.00 0.75  ? 196 SER A CA   1  
ATOM 3035   C C    . SER A 1 196 ? -4.415  -12.612 4.827   1.00 0.71  ? 196 SER A C    1  
ATOM 3036   O O    . SER A 1 196 ? -4.721  -13.128 5.883   1.00 0.76  ? 196 SER A O    1  
ATOM 3037   C CB   . SER A 1 196 ? -2.505  -11.014 4.869   1.00 0.79  ? 196 SER A CB   1  
ATOM 3038   O OG   . SER A 1 196 ? -1.105  -10.883 4.664   1.00 0.86  ? 196 SER A OG   1  
ATOM 3039   H H    . SER A 1 196 ? -2.541  -11.763 2.439   1.00 0.71  ? 196 SER A H    1  
ATOM 3040   H HA   . SER A 1 196 ? -2.342  -13.146 4.949   1.00 0.81  ? 196 SER A HA   1  
ATOM 3041   H HB2  . SER A 1 196 ? -3.021  -10.274 4.279   1.00 0.78  ? 196 SER A HB2  1  
ATOM 3042   H HB3  . SER A 1 196 ? -2.743  -10.866 5.915   1.00 0.84  ? 196 SER A HB3  1  
ATOM 3043   H HG   . SER A 1 196 ? -0.725  -10.491 5.454   1.00 1.15  ? 196 SER A HG   1  
ATOM 3044   N N    . LEU A 1 197 ? -5.325  -12.207 3.987   1.00 0.64  ? 197 LEU A N    1  
ATOM 3045   C CA   . LEU A 1 197 ? -6.768  -12.373 4.315   1.00 0.61  ? 197 LEU A CA   1  
ATOM 3046   C C    . LEU A 1 197 ? -7.128  -13.851 4.263   1.00 0.61  ? 197 LEU A C    1  
ATOM 3047   O O    . LEU A 1 197 ? -8.113  -14.278 4.829   1.00 0.61  ? 197 LEU A O    1  
ATOM 3048   C CB   . LEU A 1 197 ? -7.606  -11.601 3.301   1.00 0.57  ? 197 LEU A CB   1  
ATOM 3049   C CG   . LEU A 1 197 ? -7.408  -10.093 3.503   1.00 0.60  ? 197 LEU A CG   1  
ATOM 3050   C CD1  . LEU A 1 197 ? -8.001  -9.359  2.302   1.00 0.59  ? 197 LEU A CD1  1  
ATOM 3051   C CD2  . LEU A 1 197 ? -8.101  -9.621  4.798   1.00 0.67  ? 197 LEU A CD2  1  
ATOM 3052   H H    . LEU A 1 197 ? -5.064  -11.801 3.134   1.00 0.62  ? 197 LEU A H    1  
ATOM 3053   H HA   . LEU A 1 197 ? -6.958  -11.999 5.306   1.00 0.66  ? 197 LEU A HA   1  
ATOM 3054   H HB2  . LEU A 1 197 ? -7.295  -11.873 2.302   1.00 0.54  ? 197 LEU A HB2  1  
ATOM 3055   H HB3  . LEU A 1 197 ? -8.649  -11.850 3.430   1.00 0.57  ? 197 LEU A HB3  1  
ATOM 3056   H HG   . LEU A 1 197 ? -6.352  -9.877  3.567   1.00 0.63  ? 197 LEU A HG   1  
ATOM 3057   H HD11 . LEU A 1 197 ? -9.015  -9.693  2.145   1.00 1.14  ? 197 LEU A HD11 1  
ATOM 3058   H HD12 . LEU A 1 197 ? -7.994  -8.296  2.489   1.00 1.26  ? 197 LEU A HD12 1  
ATOM 3059   H HD13 . LEU A 1 197 ? -7.410  -9.577  1.424   1.00 1.10  ? 197 LEU A HD13 1  
ATOM 3060   H HD21 . LEU A 1 197 ? -9.019  -10.168 4.944   1.00 1.14  ? 197 LEU A HD21 1  
ATOM 3061   H HD22 . LEU A 1 197 ? -7.445  -9.790  5.639   1.00 1.15  ? 197 LEU A HD22 1  
ATOM 3062   H HD23 . LEU A 1 197 ? -8.319  -8.565  4.729   1.00 1.28  ? 197 LEU A HD23 1  
ATOM 3063   N N    . GLU A 1 198 ? -6.344  -14.623 3.568   1.00 0.63  ? 198 GLU A N    1  
ATOM 3064   C CA   . GLU A 1 198 ? -6.610  -16.086 3.440   1.00 0.65  ? 198 GLU A CA   1  
ATOM 3065   C C    . GLU A 1 198 ? -7.964  -16.334 2.778   1.00 0.59  ? 198 GLU A C    1  
ATOM 3066   O O    . GLU A 1 198 ? -8.752  -17.136 3.237   1.00 0.61  ? 198 GLU A O    1  
ATOM 3067   C CB   . GLU A 1 198 ? -6.568  -16.768 4.815   1.00 0.73  ? 198 GLU A CB   1  
ATOM 3068   C CG   . GLU A 1 198 ? -5.128  -16.781 5.327   1.00 0.88  ? 198 GLU A CG   1  
ATOM 3069   C CD   . GLU A 1 198 ? -5.078  -17.460 6.695   1.00 0.95  ? 198 GLU A CD   1  
ATOM 3070   O OE1  . GLU A 1 198 ? -6.135  -17.720 7.246   1.00 1.50  ? 198 GLU A OE1  1  
ATOM 3071   O OE2  . GLU A 1 198 ? -3.982  -17.721 7.164   1.00 1.40  ? 198 GLU A OE2  1  
ATOM 3072   H H    . GLU A 1 198 ? -5.575  -14.241 3.096   1.00 0.64  ? 198 GLU A H    1  
ATOM 3073   H HA   . GLU A 1 198 ? -5.840  -16.517 2.818   1.00 0.68  ? 198 GLU A HA   1  
ATOM 3074   H HB2  . GLU A 1 198 ? -7.191  -16.231 5.511   1.00 0.73  ? 198 GLU A HB2  1  
ATOM 3075   H HB3  . GLU A 1 198 ? -6.924  -17.783 4.723   1.00 0.76  ? 198 GLU A HB3  1  
ATOM 3076   H HG2  . GLU A 1 198 ? -4.501  -17.320 4.631   1.00 0.94  ? 198 GLU A HG2  1  
ATOM 3077   H HG3  . GLU A 1 198 ? -4.775  -15.766 5.419   1.00 0.98  ? 198 GLU A HG3  1  
ATOM 3078   N N    . LEU A 1 199 ? -8.215  -15.674 1.675   1.00 0.54  ? 199 LEU A N    1  
ATOM 3079   C CA   . LEU A 1 199 ? -9.496  -15.879 0.924   1.00 0.50  ? 199 LEU A CA   1  
ATOM 3080   C C    . LEU A 1 199 ? -9.124  -16.216 -0.524  1.00 0.51  ? 199 LEU A C    1  
ATOM 3081   O O    . LEU A 1 199 ? -8.114  -15.761 -1.013  1.00 0.59  ? 199 LEU A O    1  
ATOM 3082   C CB   . LEU A 1 199 ? -10.319 -14.586 0.936   1.00 0.48  ? 199 LEU A CB   1  
ATOM 3083   C CG   . LEU A 1 199 ? -10.577 -14.135 2.376   1.00 0.54  ? 199 LEU A CG   1  
ATOM 3084   C CD1  . LEU A 1 199 ? -11.148 -12.715 2.356   1.00 0.52  ? 199 LEU A CD1  1  
ATOM 3085   C CD2  . LEU A 1 199 ? -11.577 -15.081 3.057   1.00 0.72  ? 199 LEU A CD2  1  
ATOM 3086   H H    . LEU A 1 199 ? -7.540  -15.055 1.320   1.00 0.54  ? 199 LEU A H    1  
ATOM 3087   H HA   . LEU A 1 199 ? -10.064 -16.688 1.362   1.00 0.53  ? 199 LEU A HA   1  
ATOM 3088   H HB2  . LEU A 1 199 ? -9.772  -13.813 0.416   1.00 0.49  ? 199 LEU A HB2  1  
ATOM 3089   H HB3  . LEU A 1 199 ? -11.261 -14.748 0.437   1.00 0.54  ? 199 LEU A HB3  1  
ATOM 3090   H HG   . LEU A 1 199 ? -9.645  -14.138 2.923   1.00 0.62  ? 199 LEU A HG   1  
ATOM 3091   H HD11 . LEU A 1 199 ? -10.461 -12.060 1.840   1.00 1.22  ? 199 LEU A HD11 1  
ATOM 3092   H HD12 . LEU A 1 199 ? -12.097 -12.717 1.841   1.00 1.14  ? 199 LEU A HD12 1  
ATOM 3093   H HD13 . LEU A 1 199 ? -11.287 -12.368 3.368   1.00 1.01  ? 199 LEU A HD13 1  
ATOM 3094   H HD21 . LEU A 1 199 ? -12.376 -15.324 2.374   1.00 1.24  ? 199 LEU A HD21 1  
ATOM 3095   H HD22 . LEU A 1 199 ? -11.070 -15.987 3.354   1.00 1.19  ? 199 LEU A HD22 1  
ATOM 3096   H HD23 . LEU A 1 199 ? -11.988 -14.599 3.933   1.00 1.37  ? 199 LEU A HD23 1  
ATOM 3097   N N    . PRO A 1 200 ? -9.916  -16.994 -1.219  1.00 0.52  ? 200 PRO A N    1  
ATOM 3098   C CA   . PRO A 1 200 ? -9.615  -17.362 -2.637  1.00 0.55  ? 200 PRO A CA   1  
ATOM 3099   C C    . PRO A 1 200 ? -9.593  -16.128 -3.548  1.00 0.52  ? 200 PRO A C    1  
ATOM 3100   O O    . PRO A 1 200 ? -10.430 -15.253 -3.436  1.00 0.48  ? 200 PRO A O    1  
ATOM 3101   C CB   . PRO A 1 200 ? -10.754 -18.326 -3.021  1.00 0.59  ? 200 PRO A CB   1  
ATOM 3102   C CG   . PRO A 1 200 ? -11.854 -18.044 -2.044  1.00 0.61  ? 200 PRO A CG   1  
ATOM 3103   C CD   . PRO A 1 200 ? -11.170 -17.606 -0.750  1.00 0.61  ? 200 PRO A CD   1  
ATOM 3104   H HA   . PRO A 1 200 ? -8.668  -17.875 -2.692  1.00 0.60  ? 200 PRO A HA   1  
ATOM 3105   H HB2  . PRO A 1 200 ? -11.088 -18.141 -4.035  1.00 0.65  ? 200 PRO A HB2  1  
ATOM 3106   H HB3  . PRO A 1 200 ? -10.426 -19.351 -2.921  1.00 0.63  ? 200 PRO A HB3  1  
ATOM 3107   H HG2  . PRO A 1 200 ? -12.489 -17.250 -2.419  1.00 0.71  ? 200 PRO A HG2  1  
ATOM 3108   H HG3  . PRO A 1 200 ? -12.439 -18.934 -1.864  1.00 0.67  ? 200 PRO A HG3  1  
ATOM 3109   H HD2  . PRO A 1 200 ? -11.781 -16.887 -0.223  1.00 0.76  ? 200 PRO A HD2  1  
ATOM 3110   H HD3  . PRO A 1 200 ? -10.955 -18.457 -0.122  1.00 0.73  ? 200 PRO A HD3  1  
ATOM 3111   N N    . ALA A 1 201 ? -8.645  -16.040 -4.447  1.00 0.56  ? 201 ALA A N    1  
ATOM 3112   C CA   . ALA A 1 201 ? -8.605  -14.844 -5.339  1.00 0.56  ? 201 ALA A CA   1  
ATOM 3113   C C    . ALA A 1 201 ? -7.589  -15.024 -6.475  1.00 0.61  ? 201 ALA A C    1  
ATOM 3114   O O    . ALA A 1 201 ? -6.589  -15.702 -6.339  1.00 0.66  ? 201 ALA A O    1  
ATOM 3115   C CB   . ALA A 1 201 ? -8.222  -13.615 -4.508  1.00 0.55  ? 201 ALA A CB   1  
ATOM 3116   H H    . ALA A 1 201 ? -7.972  -16.753 -4.530  1.00 0.60  ? 201 ALA A H    1  
ATOM 3117   H HA   . ALA A 1 201 ? -9.585  -14.689 -5.763  1.00 0.55  ? 201 ALA A HA   1  
ATOM 3118   H HB1  . ALA A 1 201 ? -7.427  -13.877 -3.824  1.00 1.11  ? 201 ALA A HB1  1  
ATOM 3119   H HB2  . ALA A 1 201 ? -7.885  -12.822 -5.161  1.00 1.15  ? 201 ALA A HB2  1  
ATOM 3120   H HB3  . ALA A 1 201 ? -9.081  -13.277 -3.948  1.00 1.19  ? 201 ALA A HB3  1  
ATOM 3121   N N    . ILE A 1 202 ? -7.851  -14.388 -7.593  1.00 0.63  ? 202 ILE A N    1  
ATOM 3122   C CA   . ILE A 1 202 ? -6.936  -14.456 -8.774  1.00 0.69  ? 202 ILE A CA   1  
ATOM 3123   C C    . ILE A 1 202 ? -6.606  -13.018 -9.201  1.00 0.72  ? 202 ILE A C    1  
ATOM 3124   O O    . ILE A 1 202 ? -7.435  -12.140 -9.105  1.00 0.70  ? 202 ILE A O    1  
ATOM 3125   C CB   . ILE A 1 202 ? -7.634  -15.191 -9.920  1.00 0.70  ? 202 ILE A CB   1  
ATOM 3126   C CG1  . ILE A 1 202 ? -7.973  -16.618 -9.478  1.00 0.69  ? 202 ILE A CG1  1  
ATOM 3127   C CG2  . ILE A 1 202 ? -6.704  -15.248 -11.130 1.00 0.79  ? 202 ILE A CG2  1  
ATOM 3128   C CD1  . ILE A 1 202 ? -8.887  -17.284 -10.516 1.00 0.71  ? 202 ILE A CD1  1  
ATOM 3129   H H    . ILE A 1 202 ? -8.663  -13.846 -7.654  1.00 0.60  ? 202 ILE A H    1  
ATOM 3130   H HA   . ILE A 1 202 ? -6.023  -14.973 -8.509  1.00 0.73  ? 202 ILE A HA   1  
ATOM 3131   H HB   . ILE A 1 202 ? -8.545  -14.669 -10.186 1.00 0.68  ? 202 ILE A HB   1  
ATOM 3132   H HG12 . ILE A 1 202 ? -7.062  -17.189 -9.382  1.00 0.76  ? 202 ILE A HG12 1  
ATOM 3133   H HG13 . ILE A 1 202 ? -8.480  -16.586 -8.526  1.00 0.67  ? 202 ILE A HG13 1  
ATOM 3134   H HG21 . ILE A 1 202 ? -5.752  -15.663 -10.832 1.00 1.24  ? 202 ILE A HG21 1  
ATOM 3135   H HG22 . ILE A 1 202 ? -7.149  -15.871 -11.889 1.00 1.28  ? 202 ILE A HG22 1  
ATOM 3136   H HG23 . ILE A 1 202 ? -6.556  -14.254 -11.519 1.00 1.31  ? 202 ILE A HG23 1  
ATOM 3137   H HD11 . ILE A 1 202 ? -8.574  -17.008 -11.512 1.00 1.29  ? 202 ILE A HD11 1  
ATOM 3138   H HD12 . ILE A 1 202 ? -8.828  -18.357 -10.408 1.00 1.28  ? 202 ILE A HD12 1  
ATOM 3139   H HD13 . ILE A 1 202 ? -9.907  -16.964 -10.357 1.00 1.14  ? 202 ILE A HD13 1  
ATOM 3140   N N    . VAL A 1 203 ? -5.398  -12.755 -9.644  1.00 0.79  ? 203 VAL A N    1  
ATOM 3141   C CA   . VAL A 1 203 ? -5.026  -11.353 -10.045 1.00 0.83  ? 203 VAL A CA   1  
ATOM 3142   C C    . VAL A 1 203 ? -4.409  -11.332 -11.448 1.00 0.89  ? 203 VAL A C    1  
ATOM 3143   O O    . VAL A 1 203 ? -4.188  -10.276 -12.017 1.00 0.91  ? 203 VAL A O    1  
ATOM 3144   C CB   . VAL A 1 203 ? -4.003  -10.809 -9.042  1.00 0.87  ? 203 VAL A CB   1  
ATOM 3145   C CG1  . VAL A 1 203 ? -4.704  -10.490 -7.718  1.00 0.83  ? 203 VAL A CG1  1  
ATOM 3146   C CG2  . VAL A 1 203 ? -2.919  -11.864 -8.802  1.00 0.91  ? 203 VAL A CG2  1  
ATOM 3147   H H    . VAL A 1 203 ? -4.735  -13.474 -9.698  1.00 0.83  ? 203 VAL A H    1  
ATOM 3148   H HA   . VAL A 1 203 ? -5.899  -10.714 -10.037 1.00 0.81  ? 203 VAL A HA   1  
ATOM 3149   H HB   . VAL A 1 203 ? -3.552  -9.910  -9.437  1.00 0.93  ? 203 VAL A HB   1  
ATOM 3150   H HG11 . VAL A 1 203 ? -5.370  -11.300 -7.459  1.00 1.29  ? 203 VAL A HG11 1  
ATOM 3151   H HG12 . VAL A 1 203 ? -3.966  -10.368 -6.939  1.00 1.36  ? 203 VAL A HG12 1  
ATOM 3152   H HG13 . VAL A 1 203 ? -5.272  -9.578  -7.822  1.00 1.27  ? 203 VAL A HG13 1  
ATOM 3153   H HG21 . VAL A 1 203 ? -2.583  -12.257 -9.750  1.00 1.31  ? 203 VAL A HG21 1  
ATOM 3154   H HG22 . VAL A 1 203 ? -2.086  -11.412 -8.284  1.00 1.38  ? 203 VAL A HG22 1  
ATOM 3155   H HG23 . VAL A 1 203 ? -3.324  -12.667 -8.201  1.00 1.30  ? 203 VAL A HG23 1  
ATOM 3156   N N    . GLY A 1 204 ? -4.129  -12.485 -12.010 1.00 0.92  ? 204 GLY A N    1  
ATOM 3157   C CA   . GLY A 1 204 ? -3.513  -12.549 -13.376 1.00 0.99  ? 204 GLY A CA   1  
ATOM 3158   C C    . GLY A 1 204 ? -4.525  -13.081 -14.393 1.00 0.96  ? 204 GLY A C    1  
ATOM 3159   O O    . GLY A 1 204 ? -4.155  -13.583 -15.437 1.00 1.01  ? 204 GLY A O    1  
ATOM 3160   H H    . GLY A 1 204 ? -4.325  -13.317 -11.538 1.00 0.92  ? 204 GLY A H    1  
ATOM 3161   H HA2  . GLY A 1 204 ? -3.183  -11.565 -13.681 1.00 1.01  ? 204 GLY A HA2  1  
ATOM 3162   H HA3  . GLY A 1 204 ? -2.663  -13.213 -13.348 1.00 1.03  ? 204 GLY A HA3  1  
ATOM 3163   N N    . THR A 1 205 ? -5.795  -12.989 -14.101 1.00 0.90  ? 205 THR A N    1  
ATOM 3164   C CA   . THR A 1 205 ? -6.826  -13.502 -15.051 1.00 0.90  ? 205 THR A CA   1  
ATOM 3165   C C    . THR A 1 205 ? -6.484  -13.070 -16.481 1.00 0.97  ? 205 THR A C    1  
ATOM 3166   O O    . THR A 1 205 ? -6.558  -13.848 -17.412 1.00 0.99  ? 205 THR A O    1  
ATOM 3167   C CB   . THR A 1 205 ? -8.185  -12.910 -14.675 1.00 0.83  ? 205 THR A CB   1  
ATOM 3168   O OG1  . THR A 1 205 ? -8.055  -11.508 -14.519 1.00 0.85  ? 205 THR A OG1  1  
ATOM 3169   C CG2  . THR A 1 205 ? -8.706  -13.519 -13.370 1.00 0.78  ? 205 THR A CG2  1  
ATOM 3170   H H    . THR A 1 205 ? -6.075  -12.592 -13.251 1.00 0.88  ? 205 THR A H    1  
ATOM 3171   H HA   . THR A 1 205 ? -6.869  -14.579 -14.998 1.00 0.90  ? 205 THR A HA   1  
ATOM 3172   H HB   . THR A 1 205 ? -8.878  -13.110 -15.463 1.00 0.83  ? 205 THR A HB   1  
ATOM 3173   H HG1  . THR A 1 205 ? -7.770  -11.143 -15.358 1.00 1.23  ? 205 THR A HG1  1  
ATOM 3174   H HG21 . THR A 1 205 ? -8.469  -14.572 -13.334 1.00 1.25  ? 205 THR A HG21 1  
ATOM 3175   H HG22 . THR A 1 205 ? -8.247  -13.017 -12.532 1.00 1.38  ? 205 THR A HG22 1  
ATOM 3176   H HG23 . THR A 1 205 ? -9.777  -13.393 -13.318 1.00 1.19  ? 205 THR A HG23 1  
ATOM 3177   N N    . GLY A 1 206 ? -6.102  -11.837 -16.657 1.00 1.02  ? 206 GLY A N    1  
ATOM 3178   C CA   . GLY A 1 206 ? -5.738  -11.346 -18.024 1.00 1.10  ? 206 GLY A CA   1  
ATOM 3179   C C    . GLY A 1 206 ? -6.943  -10.687 -18.712 1.00 1.08  ? 206 GLY A C    1  
ATOM 3180   O O    . GLY A 1 206 ? -6.845  -9.580  -19.205 1.00 1.12  ? 206 GLY A O    1  
ATOM 3181   H H    . GLY A 1 206 ? -6.040  -11.233 -15.886 1.00 1.03  ? 206 GLY A H    1  
ATOM 3182   H HA2  . GLY A 1 206 ? -4.943  -10.620 -17.936 1.00 1.17  ? 206 GLY A HA2  1  
ATOM 3183   H HA3  . GLY A 1 206 ? -5.396  -12.174 -18.629 1.00 1.12  ? 206 GLY A HA3  1  
ATOM 3184   N N    . SER A 1 207 ? -8.074  -11.345 -18.774 1.00 1.05  ? 207 SER A N    1  
ATOM 3185   C CA   . SER A 1 207 ? -9.247  -10.713 -19.461 1.00 1.05  ? 207 SER A CA   1  
ATOM 3186   C C    . SER A 1 207 ? -10.571 -11.316 -18.978 1.00 0.97  ? 207 SER A C    1  
ATOM 3187   O O    . SER A 1 207 ? -11.518 -11.430 -19.731 1.00 0.99  ? 207 SER A O    1  
ATOM 3188   C CB   . SER A 1 207 ? -9.118  -10.930 -20.966 1.00 1.13  ? 207 SER A CB   1  
ATOM 3189   O OG   . SER A 1 207 ? -9.568  -12.238 -21.291 1.00 1.72  ? 207 SER A OG   1  
ATOM 3190   H H    . SER A 1 207 ? -8.147  -12.240 -18.381 1.00 1.03  ? 207 SER A H    1  
ATOM 3191   H HA   . SER A 1 207 ? -9.250  -9.651  -19.258 1.00 1.07  ? 207 SER A HA   1  
ATOM 3192   H HB2  . SER A 1 207 ? -9.721  -10.207 -21.488 1.00 1.61  ? 207 SER A HB2  1  
ATOM 3193   H HB3  . SER A 1 207 ? -8.082  -10.811 -21.257 1.00 1.43  ? 207 SER A HB3  1  
ATOM 3194   H HG   . SER A 1 207 ? -9.910  -12.220 -22.187 1.00 2.07  ? 207 SER A HG   1  
ATOM 3195   N N    . VAL A 1 208 ? -10.661 -11.673 -17.731 1.00 0.89  ? 208 VAL A N    1  
ATOM 3196   C CA   . VAL A 1 208 ? -11.946 -12.232 -17.216 1.00 0.82  ? 208 VAL A CA   1  
ATOM 3197   C C    . VAL A 1 208 ? -12.966 -11.094 -17.085 1.00 0.83  ? 208 VAL A C    1  
ATOM 3198   O O    . VAL A 1 208 ? -14.137 -11.257 -17.365 1.00 0.83  ? 208 VAL A O    1  
ATOM 3199   C CB   . VAL A 1 208 ? -11.708 -12.901 -15.849 1.00 0.76  ? 208 VAL A CB   1  
ATOM 3200   C CG1  . VAL A 1 208 ? -13.033 -13.061 -15.090 1.00 0.72  ? 208 VAL A CG1  1  
ATOM 3201   C CG2  . VAL A 1 208 ? -11.086 -14.290 -16.065 1.00 0.77  ? 208 VAL A CG2  1  
ATOM 3202   H H    . VAL A 1 208 ? -9.894  -11.542 -17.135 1.00 0.88  ? 208 VAL A H    1  
ATOM 3203   H HA   . VAL A 1 208 ? -12.322 -12.964 -17.917 1.00 0.83  ? 208 VAL A HA   1  
ATOM 3204   H HB   . VAL A 1 208 ? -11.036 -12.290 -15.266 1.00 0.77  ? 208 VAL A HB   1  
ATOM 3205   H HG11 . VAL A 1 208 ? -13.784 -13.458 -15.756 1.00 1.14  ? 208 VAL A HG11 1  
ATOM 3206   H HG12 . VAL A 1 208 ? -12.892 -13.740 -14.262 1.00 1.29  ? 208 VAL A HG12 1  
ATOM 3207   H HG13 . VAL A 1 208 ? -13.353 -12.100 -14.716 1.00 1.27  ? 208 VAL A HG13 1  
ATOM 3208   H HG21 . VAL A 1 208 ? -10.350 -14.240 -16.856 1.00 1.23  ? 208 VAL A HG21 1  
ATOM 3209   H HG22 . VAL A 1 208 ? -10.613 -14.618 -15.152 1.00 1.22  ? 208 VAL A HG22 1  
ATOM 3210   H HG23 . VAL A 1 208 ? -11.858 -14.993 -16.342 1.00 1.35  ? 208 VAL A HG23 1  
ATOM 3211   N N    . THR A 1 209 ? -12.526 -9.952  -16.635 1.00 0.86  ? 209 THR A N    1  
ATOM 3212   C CA   . THR A 1 209 ? -13.460 -8.805  -16.446 1.00 0.89  ? 209 THR A CA   1  
ATOM 3213   C C    . THR A 1 209 ? -14.192 -8.482  -17.754 1.00 0.95  ? 209 THR A C    1  
ATOM 3214   O O    . THR A 1 209 ? -15.335 -8.069  -17.745 1.00 0.99  ? 209 THR A O    1  
ATOM 3215   C CB   . THR A 1 209 ? -12.664 -7.572  -16.010 1.00 0.94  ? 209 THR A CB   1  
ATOM 3216   O OG1  . THR A 1 209 ? -12.117 -6.937  -17.158 1.00 1.03  ? 209 THR A OG1  1  
ATOM 3217   C CG2  . THR A 1 209 ? -11.526 -7.991  -15.077 1.00 0.95  ? 209 THR A CG2  1  
ATOM 3218   H H    . THR A 1 209 ? -11.580 -9.860  -16.395 1.00 0.87  ? 209 THR A H    1  
ATOM 3219   H HA   . THR A 1 209 ? -14.181 -9.052  -15.682 1.00 0.84  ? 209 THR A HA   1  
ATOM 3220   H HB   . THR A 1 209 ? -13.314 -6.885  -15.493 1.00 1.01  ? 209 THR A HB   1  
ATOM 3221   H HG1  . THR A 1 209 ? -12.132 -7.568  -17.882 1.00 1.44  ? 209 THR A HG1  1  
ATOM 3222   H HG21 . THR A 1 209 ? -11.890 -8.717  -14.364 1.00 1.30  ? 209 THR A HG21 1  
ATOM 3223   H HG22 . THR A 1 209 ? -10.724 -8.423  -15.656 1.00 1.38  ? 209 THR A HG22 1  
ATOM 3224   H HG23 . THR A 1 209 ? -11.161 -7.124  -14.552 1.00 1.49  ? 209 THR A HG23 1  
ATOM 3225   N N    . SER A 1 210 ? -13.546 -8.653  -18.873 1.00 0.98  ? 210 SER A N    1  
ATOM 3226   C CA   . SER A 1 210 ? -14.205 -8.341  -20.171 1.00 1.06  ? 210 SER A CA   1  
ATOM 3227   C C    . SER A 1 210 ? -15.280 -9.382  -20.468 1.00 1.04  ? 210 SER A C    1  
ATOM 3228   O O    . SER A 1 210 ? -16.270 -9.097  -21.113 1.00 1.11  ? 210 SER A O    1  
ATOM 3229   C CB   . SER A 1 210 ? -13.164 -8.357  -21.292 1.00 1.14  ? 210 SER A CB   1  
ATOM 3230   O OG   . SER A 1 210 ? -13.766 -7.899  -22.496 1.00 1.83  ? 210 SER A OG   1  
ATOM 3231   H H    . SER A 1 210 ? -12.628 -8.984  -18.862 1.00 0.97  ? 210 SER A H    1  
ATOM 3232   H HA   . SER A 1 210 ? -14.657 -7.362  -20.117 1.00 1.09  ? 210 SER A HA   1  
ATOM 3233   H HB2  . SER A 1 210 ? -12.345 -7.708  -21.034 1.00 1.49  ? 210 SER A HB2  1  
ATOM 3234   H HB3  . SER A 1 210 ? -12.794 -9.366  -21.423 1.00 1.53  ? 210 SER A HB3  1  
ATOM 3235   H HG   . SER A 1 210 ? -14.157 -8.656  -22.939 1.00 2.16  ? 210 SER A HG   1  
ATOM 3236   N N    . GLN A 1 211 ? -15.080 -10.596 -20.031 1.00 0.96  ? 211 GLN A N    1  
ATOM 3237   C CA   . GLN A 1 211 ? -16.080 -11.664 -20.320 1.00 0.96  ? 211 GLN A CA   1  
ATOM 3238   C C    . GLN A 1 211 ? -17.142 -11.728 -19.213 1.00 0.90  ? 211 GLN A C    1  
ATOM 3239   O O    . GLN A 1 211 ? -18.117 -12.445 -19.329 1.00 0.90  ? 211 GLN A O    1  
ATOM 3240   C CB   . GLN A 1 211 ? -15.361 -13.014 -20.408 1.00 0.95  ? 211 GLN A CB   1  
ATOM 3241   C CG   . GLN A 1 211 ? -14.467 -13.049 -21.652 1.00 1.05  ? 211 GLN A CG   1  
ATOM 3242   C CD   . GLN A 1 211 ? -13.582 -14.297 -21.605 1.00 1.53  ? 211 GLN A CD   1  
ATOM 3243   O OE1  . GLN A 1 211 ? -13.409 -14.894 -20.561 1.00 2.13  ? 211 GLN A OE1  1  
ATOM 3244   N NE2  . GLN A 1 211 ? -13.005 -14.719 -22.699 1.00 2.27  ? 211 GLN A NE2  1  
ATOM 3245   H H    . GLN A 1 211 ? -14.265 -10.809 -19.532 1.00 0.92  ? 211 GLN A H    1  
ATOM 3246   H HA   . GLN A 1 211 ? -16.558 -11.458 -21.263 1.00 1.03  ? 211 GLN A HA   1  
ATOM 3247   H HB2  . GLN A 1 211 ? -14.755 -13.157 -19.525 1.00 0.94  ? 211 GLN A HB2  1  
ATOM 3248   H HB3  . GLN A 1 211 ? -16.093 -13.805 -20.474 1.00 0.98  ? 211 GLN A HB3  1  
ATOM 3249   H HG2  . GLN A 1 211 ? -15.083 -13.075 -22.540 1.00 1.40  ? 211 GLN A HG2  1  
ATOM 3250   H HG3  . GLN A 1 211 ? -13.841 -12.168 -21.674 1.00 1.44  ? 211 GLN A HG3  1  
ATOM 3251   H HE21 . GLN A 1 211 ? -13.138 -14.236 -23.540 1.00 2.59  ? 211 GLN A HE21 1  
ATOM 3252   H HE22 . GLN A 1 211 ? -12.440 -15.520 -22.677 1.00 2.89  ? 211 GLN A HE22 1  
ATOM 3253   N N    . VAL A 1 212 ? -16.959 -11.006 -18.134 1.00 0.87  ? 212 VAL A N    1  
ATOM 3254   C CA   . VAL A 1 212 ? -17.958 -11.052 -17.012 1.00 0.82  ? 212 VAL A CA   1  
ATOM 3255   C C    . VAL A 1 212 ? -18.845 -9.808  -17.033 1.00 0.87  ? 212 VAL A C    1  
ATOM 3256   O O    . VAL A 1 212 ? -18.373 -8.690  -17.103 1.00 0.92  ? 212 VAL A O    1  
ATOM 3257   C CB   . VAL A 1 212 ? -17.216 -11.112 -15.670 1.00 0.76  ? 212 VAL A CB   1  
ATOM 3258   C CG1  . VAL A 1 212 ? -18.205 -10.983 -14.510 1.00 0.76  ? 212 VAL A CG1  1  
ATOM 3259   C CG2  . VAL A 1 212 ? -16.481 -12.451 -15.567 1.00 0.75  ? 212 VAL A CG2  1  
ATOM 3260   H H    . VAL A 1 212 ? -16.153 -10.455 -18.050 1.00 0.89  ? 212 VAL A H    1  
ATOM 3261   H HA   . VAL A 1 212 ? -18.581 -11.933 -17.106 1.00 0.83  ? 212 VAL A HA   1  
ATOM 3262   H HB   . VAL A 1 212 ? -16.505 -10.306 -15.611 1.00 0.78  ? 212 VAL A HB   1  
ATOM 3263   H HG11 . VAL A 1 212 ? -19.019 -11.679 -14.646 1.00 1.19  ? 212 VAL A HG11 1  
ATOM 3264   H HG12 . VAL A 1 212 ? -17.693 -11.197 -13.589 1.00 1.27  ? 212 VAL A HG12 1  
ATOM 3265   H HG13 . VAL A 1 212 ? -18.594 -9.976  -14.474 1.00 1.33  ? 212 VAL A HG13 1  
ATOM 3266   H HG21 . VAL A 1 212 ? -15.854 -12.584 -16.436 1.00 1.32  ? 212 VAL A HG21 1  
ATOM 3267   H HG22 . VAL A 1 212 ? -15.869 -12.458 -14.677 1.00 1.21  ? 212 VAL A HG22 1  
ATOM 3268   H HG23 . VAL A 1 212 ? -17.200 -13.254 -15.518 1.00 1.25  ? 212 VAL A HG23 1  
ATOM 3269   N N    . LYS A 1 213 ? -20.134 -10.009 -16.932 1.00 0.87  ? 213 LYS A N    1  
ATOM 3270   C CA   . LYS A 1 213 ? -21.093 -8.869  -16.903 1.00 0.93  ? 213 LYS A CA   1  
ATOM 3271   C C    . LYS A 1 213 ? -21.687 -8.819  -15.498 1.00 0.90  ? 213 LYS A C    1  
ATOM 3272   O O    . LYS A 1 213 ? -21.865 -9.835  -14.858 1.00 0.91  ? 213 LYS A O    1  
ATOM 3273   C CB   . LYS A 1 213 ? -22.203 -9.097  -17.934 1.00 1.00  ? 213 LYS A CB   1  
ATOM 3274   C CG   . LYS A 1 213 ? -21.580 -9.361  -19.311 1.00 1.20  ? 213 LYS A CG   1  
ATOM 3275   C CD   . LYS A 1 213 ? -20.709 -8.167  -19.733 1.00 1.17  ? 213 LYS A CD   1  
ATOM 3276   C CE   . LYS A 1 213 ? -20.495 -8.185  -21.251 1.00 1.60  ? 213 LYS A CE   1  
ATOM 3277   N NZ   . LYS A 1 213 ? -20.248 -9.583  -21.709 1.00 2.20  ? 213 LYS A NZ   1  
ATOM 3278   H H    . LYS A 1 213 ? -20.472 -10.923 -16.845 1.00 0.84  ? 213 LYS A H    1  
ATOM 3279   H HA   . LYS A 1 213 ? -20.584 -7.936  -17.110 1.00 0.96  ? 213 LYS A HA   1  
ATOM 3280   H HB2  . LYS A 1 213 ? -22.799 -9.947  -17.639 1.00 1.00  ? 213 LYS A HB2  1  
ATOM 3281   H HB3  . LYS A 1 213 ? -22.830 -8.219  -17.988 1.00 1.10  ? 213 LYS A HB3  1  
ATOM 3282   H HG2  . LYS A 1 213 ? -20.969 -10.251 -19.263 1.00 1.75  ? 213 LYS A HG2  1  
ATOM 3283   H HG3  . LYS A 1 213 ? -22.367 -9.505  -20.036 1.00 1.74  ? 213 LYS A HG3  1  
ATOM 3284   H HD2  . LYS A 1 213 ? -21.196 -7.245  -19.451 1.00 1.43  ? 213 LYS A HD2  1  
ATOM 3285   H HD3  . LYS A 1 213 ? -19.749 -8.233  -19.242 1.00 1.53  ? 213 LYS A HD3  1  
ATOM 3286   H HE2  . LYS A 1 213 ? -21.374 -7.798  -21.742 1.00 2.07  ? 213 LYS A HE2  1  
ATOM 3287   H HE3  . LYS A 1 213 ? -19.643 -7.569  -21.499 1.00 2.04  ? 213 LYS A HE3  1  
ATOM 3288   H HZ1  . LYS A 1 213 ? -19.727 -10.104 -20.972 1.00 2.56  ? 213 LYS A HZ1  1  
ATOM 3289   H HZ2  . LYS A 1 213 ? -21.155 -10.055 -21.892 1.00 2.73  ? 213 LYS A HZ2  1  
ATOM 3290   H HZ3  . LYS A 1 213 ? -19.686 -9.567  -22.584 1.00 2.55  ? 213 LYS A HZ3  1  
ATOM 3291   N N    . ASN A 1 214 ? -21.960 -7.653  -14.998 1.00 0.95  ? 214 ASN A N    1  
ATOM 3292   C CA   . ASN A 1 214 ? -22.501 -7.552  -13.617 1.00 0.93  ? 214 ASN A CA   1  
ATOM 3293   C C    . ASN A 1 214 ? -23.755 -8.422  -13.451 1.00 0.92  ? 214 ASN A C    1  
ATOM 3294   O O    . ASN A 1 214 ? -24.616 -8.452  -14.302 1.00 0.97  ? 214 ASN A O    1  
ATOM 3295   C CB   . ASN A 1 214 ? -22.839 -6.089  -13.315 1.00 1.00  ? 214 ASN A CB   1  
ATOM 3296   C CG   . ASN A 1 214 ? -23.856 -5.568  -14.335 1.00 1.51  ? 214 ASN A CG   1  
ATOM 3297   O OD1  . ASN A 1 214 ? -24.177 -6.247  -15.291 1.00 2.36  ? 214 ASN A OD1  1  
ATOM 3298   N ND2  . ASN A 1 214 ? -24.377 -4.381  -14.173 1.00 1.98  ? 214 ASN A ND2  1  
ATOM 3299   H H    . ASN A 1 214 ? -21.784 -6.842  -15.519 1.00 1.04  ? 214 ASN A H    1  
ATOM 3300   H HA   . ASN A 1 214 ? -21.746 -7.888  -12.920 1.00 0.88  ? 214 ASN A HA   1  
ATOM 3301   H HB2  . ASN A 1 214 ? -23.255 -6.014  -12.321 1.00 1.51  ? 214 ASN A HB2  1  
ATOM 3302   H HB3  . ASN A 1 214 ? -21.939 -5.494  -13.373 1.00 1.48  ? 214 ASN A HB3  1  
ATOM 3303   H HD21 . ASN A 1 214 ? -24.116 -3.831  -13.404 1.00 2.03  ? 214 ASN A HD21 1  
ATOM 3304   H HD22 . ASN A 1 214 ? -25.028 -4.038  -14.822 1.00 2.70  ? 214 ASN A HD22 1  
ATOM 3305   N N    . ASP A 1 215 ? -23.838 -9.107  -12.329 1.00 0.88  ? 215 ASP A N    1  
ATOM 3306   C CA   . ASP A 1 215 ? -25.012 -9.992  -11.993 1.00 0.89  ? 215 ASP A CA   1  
ATOM 3307   C C    . ASP A 1 215 ? -24.787 -11.414 -12.515 1.00 0.84  ? 215 ASP A C    1  
ATOM 3308   O O    . ASP A 1 215 ? -25.588 -12.300 -12.298 1.00 0.84  ? 215 ASP A O    1  
ATOM 3309   C CB   . ASP A 1 215 ? -26.324 -9.394  -12.560 1.00 0.98  ? 215 ASP A CB   1  
ATOM 3310   C CG   . ASP A 1 215 ? -26.691 -9.978  -13.942 1.00 1.68  ? 215 ASP A CG   1  
ATOM 3311   O OD1  . ASP A 1 215 ? -25.797 -10.407 -14.654 1.00 2.32  ? 215 ASP A OD1  1  
ATOM 3312   O OD2  . ASP A 1 215 ? -27.869 -9.981  -14.260 1.00 2.38  ? 215 ASP A OD2  1  
ATOM 3313   H H    . ASP A 1 215 ? -23.104 -9.025  -11.684 1.00 0.85  ? 215 ASP A H    1  
ATOM 3314   H HA   . ASP A 1 215 ? -25.092 -10.041 -10.914 1.00 0.88  ? 215 ASP A HA   1  
ATOM 3315   H HB2  . ASP A 1 215 ? -27.130 -9.606  -11.875 1.00 1.17  ? 215 ASP A HB2  1  
ATOM 3316   H HB3  . ASP A 1 215 ? -26.214 -8.327  -12.644 1.00 1.54  ? 215 ASP A HB3  1  
ATOM 3317   N N    . ASP A 1 216 ? -23.701 -11.637 -13.184 1.00 0.81  ? 216 ASP A N    1  
ATOM 3318   C CA   . ASP A 1 216 ? -23.419 -13.004 -13.703 1.00 0.77  ? 216 ASP A CA   1  
ATOM 3319   C C    . ASP A 1 216 ? -23.065 -13.931 -12.536 1.00 0.71  ? 216 ASP A C    1  
ATOM 3320   O O    . ASP A 1 216 ? -22.519 -13.507 -11.537 1.00 0.67  ? 216 ASP A O    1  
ATOM 3321   C CB   . ASP A 1 216 ? -22.252 -12.958 -14.690 1.00 0.77  ? 216 ASP A CB   1  
ATOM 3322   C CG   . ASP A 1 216 ? -22.702 -12.273 -15.982 1.00 1.31  ? 216 ASP A CG   1  
ATOM 3323   O OD1  . ASP A 1 216 ? -23.899 -12.142 -16.173 1.00 2.09  ? 216 ASP A OD1  1  
ATOM 3324   O OD2  . ASP A 1 216 ? -21.840 -11.891 -16.756 1.00 1.80  ? 216 ASP A OD2  1  
ATOM 3325   H H    . ASP A 1 216 ? -23.069 -10.907 -13.339 1.00 0.83  ? 216 ASP A H    1  
ATOM 3326   H HA   . ASP A 1 216 ? -24.298 -13.384 -14.205 1.00 0.81  ? 216 ASP A HA   1  
ATOM 3327   H HB2  . ASP A 1 216 ? -21.434 -12.405 -14.253 1.00 1.09  ? 216 ASP A HB2  1  
ATOM 3328   H HB3  . ASP A 1 216 ? -21.929 -13.964 -14.913 1.00 1.04  ? 216 ASP A HB3  1  
ATOM 3329   N N    . TYR A 1 217 ? -23.358 -15.198 -12.666 1.00 0.69  ? 217 TYR A N    1  
ATOM 3330   C CA   . TYR A 1 217 ? -23.027 -16.170 -11.578 1.00 0.64  ? 217 TYR A CA   1  
ATOM 3331   C C    . TYR A 1 217 ? -21.731 -16.885 -11.954 1.00 0.60  ? 217 TYR A C    1  
ATOM 3332   O O    . TYR A 1 217 ? -21.649 -17.527 -12.980 1.00 0.65  ? 217 TYR A O    1  
ATOM 3333   C CB   . TYR A 1 217 ? -24.157 -17.193 -11.453 1.00 0.66  ? 217 TYR A CB   1  
ATOM 3334   C CG   . TYR A 1 217 ? -23.926 -18.081 -10.251 1.00 0.70  ? 217 TYR A CG   1  
ATOM 3335   C CD1  . TYR A 1 217 ? -24.447 -17.717 -9.002  1.00 0.87  ? 217 TYR A CD1  1  
ATOM 3336   C CD2  . TYR A 1 217 ? -23.202 -19.272 -10.385 1.00 0.77  ? 217 TYR A CD2  1  
ATOM 3337   C CE1  . TYR A 1 217 ? -24.246 -18.545 -7.890  1.00 1.03  ? 217 TYR A CE1  1  
ATOM 3338   C CE2  . TYR A 1 217 ? -22.999 -20.097 -9.272  1.00 0.95  ? 217 TYR A CE2  1  
ATOM 3339   C CZ   . TYR A 1 217 ? -23.522 -19.734 -8.026  1.00 1.04  ? 217 TYR A CZ   1  
ATOM 3340   O OH   . TYR A 1 217 ? -23.327 -20.553 -6.931  1.00 1.27  ? 217 TYR A OH   1  
ATOM 3341   H H    . TYR A 1 217 ? -23.780 -15.509 -13.494 1.00 0.73  ? 217 TYR A H    1  
ATOM 3342   H HA   . TYR A 1 217 ? -22.897 -15.650 -10.639 1.00 0.63  ? 217 TYR A HA   1  
ATOM 3343   H HB2  . TYR A 1 217 ? -25.097 -16.674 -11.339 1.00 0.76  ? 217 TYR A HB2  1  
ATOM 3344   H HB3  . TYR A 1 217 ? -24.189 -17.801 -12.345 1.00 0.68  ? 217 TYR A HB3  1  
ATOM 3345   H HD1  . TYR A 1 217 ? -25.006 -16.799 -8.896  1.00 0.98  ? 217 TYR A HD1  1  
ATOM 3346   H HD2  . TYR A 1 217 ? -22.795 -19.553 -11.345 1.00 0.82  ? 217 TYR A HD2  1  
ATOM 3347   H HE1  . TYR A 1 217 ? -24.648 -18.265 -6.927  1.00 1.22  ? 217 TYR A HE1  1  
ATOM 3348   H HE2  . TYR A 1 217 ? -22.440 -21.014 -9.377  1.00 1.10  ? 217 TYR A HE2  1  
ATOM 3349   H HH   . TYR A 1 217 ? -24.085 -20.457 -6.349  1.00 1.45  ? 217 TYR A HH   1  
ATOM 3350   N N    . LEU A 1 218 ? -20.714 -16.765 -11.137 1.00 0.54  ? 218 LEU A N    1  
ATOM 3351   C CA   . LEU A 1 218 ? -19.402 -17.420 -11.452 1.00 0.52  ? 218 LEU A CA   1  
ATOM 3352   C C    . LEU A 1 218 ? -18.958 -18.280 -10.277 1.00 0.46  ? 218 LEU A C    1  
ATOM 3353   O O    . LEU A 1 218 ? -19.229 -17.965 -9.134  1.00 0.47  ? 218 LEU A O    1  
ATOM 3354   C CB   . LEU A 1 218 ? -18.342 -16.337 -11.649 1.00 0.58  ? 218 LEU A CB   1  
ATOM 3355   C CG   . LEU A 1 218 ? -18.783 -15.347 -12.725 1.00 0.62  ? 218 LEU A CG   1  
ATOM 3356   C CD1  . LEU A 1 218 ? -17.736 -14.241 -12.839 1.00 0.67  ? 218 LEU A CD1  1  
ATOM 3357   C CD2  . LEU A 1 218 ? -18.922 -16.062 -14.075 1.00 0.75  ? 218 LEU A CD2  1  
ATOM 3358   H H    . LEU A 1 218 ? -20.808 -16.232 -10.319 1.00 0.53  ? 218 LEU A H    1  
ATOM 3359   H HA   . LEU A 1 218 ? -19.475 -18.025 -12.344 1.00 0.55  ? 218 LEU A HA   1  
ATOM 3360   H HB2  . LEU A 1 218 ? -18.195 -15.810 -10.717 1.00 0.61  ? 218 LEU A HB2  1  
ATOM 3361   H HB3  . LEU A 1 218 ? -17.411 -16.797 -11.948 1.00 0.67  ? 218 LEU A HB3  1  
ATOM 3362   H HG   . LEU A 1 218 ? -19.733 -14.913 -12.444 1.00 0.62  ? 218 LEU A HG   1  
ATOM 3363   H HD11 . LEU A 1 218 ? -17.454 -13.901 -11.853 1.00 1.22  ? 218 LEU A HD11 1  
ATOM 3364   H HD12 . LEU A 1 218 ? -16.865 -14.620 -13.354 1.00 1.23  ? 218 LEU A HD12 1  
ATOM 3365   H HD13 . LEU A 1 218 ? -18.152 -13.423 -13.393 1.00 1.17  ? 218 LEU A HD13 1  
ATOM 3366   H HD21 . LEU A 1 218 ? -18.140 -16.800 -14.177 1.00 1.22  ? 218 LEU A HD21 1  
ATOM 3367   H HD22 . LEU A 1 218 ? -19.882 -16.546 -14.125 1.00 1.31  ? 218 LEU A HD22 1  
ATOM 3368   H HD23 . LEU A 1 218 ? -18.845 -15.343 -14.879 1.00 1.31  ? 218 LEU A HD23 1  
ATOM 3369   N N    . ILE A 1 219 ? -18.236 -19.342 -10.545 1.00 0.46  ? 219 ILE A N    1  
ATOM 3370   C CA   . ILE A 1 219 ? -17.719 -20.206 -9.437  1.00 0.44  ? 219 ILE A CA   1  
ATOM 3371   C C    . ILE A 1 219 ? -16.195 -20.191 -9.523  1.00 0.44  ? 219 ILE A C    1  
ATOM 3372   O O    . ILE A 1 219 ? -15.628 -20.389 -10.580 1.00 0.48  ? 219 ILE A O    1  
ATOM 3373   C CB   . ILE A 1 219 ? -18.244 -21.635 -9.589  1.00 0.47  ? 219 ILE A CB   1  
ATOM 3374   C CG1  . ILE A 1 219 ? -19.779 -21.612 -9.542  1.00 0.53  ? 219 ILE A CG1  1  
ATOM 3375   C CG2  . ILE A 1 219 ? -17.710 -22.497 -8.444  1.00 0.52  ? 219 ILE A CG2  1  
ATOM 3376   C CD1  . ILE A 1 219 ? -20.345 -22.993 -9.906  1.00 0.63  ? 219 ILE A CD1  1  
ATOM 3377   H H    . ILE A 1 219 ? -18.004 -19.560 -11.482 1.00 0.50  ? 219 ILE A H    1  
ATOM 3378   H HA   . ILE A 1 219 ? -18.022 -19.811 -8.475  1.00 0.44  ? 219 ILE A HA   1  
ATOM 3379   H HB   . ILE A 1 219 ? -17.912 -22.039 -10.529 1.00 0.50  ? 219 ILE A HB   1  
ATOM 3380   H HG12 . ILE A 1 219 ? -20.100 -21.346 -8.546  1.00 0.60  ? 219 ILE A HG12 1  
ATOM 3381   H HG13 . ILE A 1 219 ? -20.148 -20.880 -10.243 1.00 0.55  ? 219 ILE A HG13 1  
ATOM 3382   H HG21 . ILE A 1 219 ? -17.812 -21.960 -7.512  1.00 1.19  ? 219 ILE A HG21 1  
ATOM 3383   H HG22 . ILE A 1 219 ? -18.271 -23.417 -8.392  1.00 1.11  ? 219 ILE A HG22 1  
ATOM 3384   H HG23 . ILE A 1 219 ? -16.668 -22.720 -8.617  1.00 1.12  ? 219 ILE A HG23 1  
ATOM 3385   H HD11 . ILE A 1 219 ? -19.741 -23.448 -10.673 1.00 1.24  ? 219 ILE A HD11 1  
ATOM 3386   H HD12 . ILE A 1 219 ? -20.343 -23.623 -9.030  1.00 1.04  ? 219 ILE A HD12 1  
ATOM 3387   H HD13 . ILE A 1 219 ? -21.357 -22.881 -10.264 1.00 1.29  ? 219 ILE A HD13 1  
ATOM 3388   N N    . LEU A 1 220 ? -15.523 -19.932 -8.431  1.00 0.43  ? 220 LEU A N    1  
ATOM 3389   C CA   . LEU A 1 220 ? -14.031 -19.872 -8.453  1.00 0.46  ? 220 LEU A CA   1  
ATOM 3390   C C    . LEU A 1 220 ? -13.462 -21.164 -7.872  1.00 0.50  ? 220 LEU A C    1  
ATOM 3391   O O    . LEU A 1 220 ? -13.704 -21.501 -6.730  1.00 0.52  ? 220 LEU A O    1  
ATOM 3392   C CB   . LEU A 1 220 ? -13.583 -18.673 -7.604  1.00 0.47  ? 220 LEU A CB   1  
ATOM 3393   C CG   . LEU A 1 220 ? -12.063 -18.691 -7.387  1.00 0.55  ? 220 LEU A CG   1  
ATOM 3394   C CD1  . LEU A 1 220 ? -11.335 -18.776 -8.732  1.00 0.70  ? 220 LEU A CD1  1  
ATOM 3395   C CD2  . LEU A 1 220 ? -11.644 -17.403 -6.670  1.00 0.56  ? 220 LEU A CD2  1  
ATOM 3396   H H    . LEU A 1 220 ? -15.992 -19.765 -7.586  1.00 0.43  ? 220 LEU A H    1  
ATOM 3397   H HA   . LEU A 1 220 ? -13.679 -19.745 -9.468  1.00 0.50  ? 220 LEU A HA   1  
ATOM 3398   H HB2  . LEU A 1 220 ? -13.860 -17.757 -8.107  1.00 0.52  ? 220 LEU A HB2  1  
ATOM 3399   H HB3  . LEU A 1 220 ? -14.078 -18.714 -6.646  1.00 0.48  ? 220 LEU A HB3  1  
ATOM 3400   H HG   . LEU A 1 220 ? -11.796 -19.540 -6.778  1.00 0.61  ? 220 LEU A HG   1  
ATOM 3401   H HD11 . LEU A 1 220 ? -11.793 -18.096 -9.435  1.00 1.28  ? 220 LEU A HD11 1  
ATOM 3402   H HD12 . LEU A 1 220 ? -10.298 -18.508 -8.596  1.00 1.14  ? 220 LEU A HD12 1  
ATOM 3403   H HD13 . LEU A 1 220 ? -11.395 -19.784 -9.112  1.00 1.31  ? 220 LEU A HD13 1  
ATOM 3404   H HD21 . LEU A 1 220 ? -12.313 -17.216 -5.843  1.00 1.11  ? 220 LEU A HD21 1  
ATOM 3405   H HD22 . LEU A 1 220 ? -10.635 -17.509 -6.301  1.00 1.12  ? 220 LEU A HD22 1  
ATOM 3406   H HD23 . LEU A 1 220 ? -11.689 -16.575 -7.362  1.00 1.13  ? 220 LEU A HD23 1  
ATOM 3407   N N    . ASP A 1 221 ? -12.699 -21.886 -8.644  1.00 0.55  ? 221 ASP A N    1  
ATOM 3408   C CA   . ASP A 1 221 ? -12.106 -23.145 -8.126  1.00 0.62  ? 221 ASP A CA   1  
ATOM 3409   C C    . ASP A 1 221 ? -10.878 -22.800 -7.283  1.00 0.63  ? 221 ASP A C    1  
ATOM 3410   O O    . ASP A 1 221 ? -10.652 -23.367 -6.239  1.00 0.69  ? 221 ASP A O    1  
ATOM 3411   C CB   . ASP A 1 221 ? -11.696 -24.035 -9.300  1.00 0.74  ? 221 ASP A CB   1  
ATOM 3412   C CG   . ASP A 1 221 ? -11.422 -25.450 -8.791  1.00 1.52  ? 221 ASP A CG   1  
ATOM 3413   O OD1  . ASP A 1 221 ? -12.311 -26.018 -8.177  1.00 2.20  ? 221 ASP A OD1  1  
ATOM 3414   O OD2  . ASP A 1 221 ? -10.332 -25.942 -9.024  1.00 2.31  ? 221 ASP A OD2  1  
ATOM 3415   H H    . ASP A 1 221 ? -12.503 -21.590 -9.558  1.00 0.58  ? 221 ASP A H    1  
ATOM 3416   H HA   . ASP A 1 221 ? -12.829 -23.661 -7.515  1.00 0.64  ? 221 ASP A HA   1  
ATOM 3417   H HB2  . ASP A 1 221 ? -12.497 -24.061 -10.026 1.00 1.28  ? 221 ASP A HB2  1  
ATOM 3418   H HB3  . ASP A 1 221 ? -10.805 -23.639 -9.759  1.00 1.31  ? 221 ASP A HB3  1  
ATOM 3419   N N    . ALA A 1 222 ? -10.082 -21.871 -7.747  1.00 0.62  ? 222 ALA A N    1  
ATOM 3420   C CA   . ALA A 1 222 ? -8.850  -21.463 -6.999  1.00 0.66  ? 222 ALA A CA   1  
ATOM 3421   C C    . ALA A 1 222 ? -8.076  -22.710 -6.543  1.00 0.73  ? 222 ALA A C    1  
ATOM 3422   O O    . ALA A 1 222 ? -7.145  -22.622 -5.766  1.00 0.78  ? 222 ALA A O    1  
ATOM 3423   C CB   . ALA A 1 222 ? -9.243  -20.590 -5.791  1.00 0.62  ? 222 ALA A CB   1  
ATOM 3424   H H    . ALA A 1 222 ? -10.294 -21.443 -8.602  1.00 0.64  ? 222 ALA A H    1  
ATOM 3425   H HA   . ALA A 1 222 ? -8.217  -20.889 -7.664  1.00 0.70  ? 222 ALA A HA   1  
ATOM 3426   H HB1  . ALA A 1 222 ? -10.273 -20.770 -5.541  1.00 1.19  ? 222 ALA A HB1  1  
ATOM 3427   H HB2  . ALA A 1 222 ? -8.619  -20.827 -4.940  1.00 1.17  ? 222 ALA A HB2  1  
ATOM 3428   H HB3  . ALA A 1 222 ? -9.119  -19.545 -6.043  1.00 1.19  ? 222 ALA A HB3  1  
ATOM 3429   N N    . VAL A 1 223 ? -8.440  -23.859 -7.048  1.00 0.77  ? 223 VAL A N    1  
ATOM 3430   C CA   . VAL A 1 223 ? -7.722  -25.124 -6.699  1.00 0.86  ? 223 VAL A CA   1  
ATOM 3431   C C    . VAL A 1 223 ? -7.151  -25.676 -7.999  1.00 0.93  ? 223 VAL A C    1  
ATOM 3432   O O    . VAL A 1 223 ? -6.067  -26.222 -8.045  1.00 1.04  ? 223 VAL A O    1  
ATOM 3433   C CB   . VAL A 1 223 ? -8.706  -26.127 -6.087  1.00 0.86  ? 223 VAL A CB   1  
ATOM 3434   C CG1  . VAL A 1 223 ? -8.054  -27.509 -6.004  1.00 0.96  ? 223 VAL A CG1  1  
ATOM 3435   C CG2  . VAL A 1 223 ? -9.083  -25.666 -4.678  1.00 0.86  ? 223 VAL A CG2  1  
ATOM 3436   H H    . VAL A 1 223 ? -9.178  -23.889 -7.690  1.00 0.75  ? 223 VAL A H    1  
ATOM 3437   H HA   . VAL A 1 223 ? -6.916  -24.927 -6.002  1.00 0.89  ? 223 VAL A HA   1  
ATOM 3438   H HB   . VAL A 1 223 ? -9.594  -26.182 -6.701  1.00 0.83  ? 223 VAL A HB   1  
ATOM 3439   H HG11 . VAL A 1 223 ? -7.060  -27.413 -5.589  1.00 1.40  ? 223 VAL A HG11 1  
ATOM 3440   H HG12 . VAL A 1 223 ? -8.648  -28.149 -5.370  1.00 1.45  ? 223 VAL A HG12 1  
ATOM 3441   H HG13 . VAL A 1 223 ? -7.991  -27.938 -6.992  1.00 1.40  ? 223 VAL A HG13 1  
ATOM 3442   H HG21 . VAL A 1 223 ? -9.441  -24.649 -4.715  1.00 1.37  ? 223 VAL A HG21 1  
ATOM 3443   H HG22 . VAL A 1 223 ? -9.858  -26.306 -4.284  1.00 1.33  ? 223 VAL A HG22 1  
ATOM 3444   H HG23 . VAL A 1 223 ? -8.214  -25.718 -4.039  1.00 1.29  ? 223 VAL A HG23 1  
ATOM 3445   N N    . ASN A 1 224 ? -7.883  -25.490 -9.067  1.00 0.92  ? 224 ASN A N    1  
ATOM 3446   C CA   . ASN A 1 224 ? -7.428  -25.940 -10.411 1.00 1.01  ? 224 ASN A CA   1  
ATOM 3447   C C    . ASN A 1 224 ? -7.175  -24.688 -11.250 1.00 0.99  ? 224 ASN A C    1  
ATOM 3448   O O    . ASN A 1 224 ? -6.876  -24.757 -12.425 1.00 1.04  ? 224 ASN A O    1  
ATOM 3449   C CB   . ASN A 1 224 ? -8.521  -26.786 -11.069 1.00 1.03  ? 224 ASN A CB   1  
ATOM 3450   C CG   . ASN A 1 224 ? -8.816  -28.010 -10.199 1.00 1.73  ? 224 ASN A CG   1  
ATOM 3451   O OD1  . ASN A 1 224 ? -9.957  -28.395 -10.041 1.00 2.43  ? 224 ASN A OD1  1  
ATOM 3452   N ND2  . ASN A 1 224 ? -7.829  -28.639 -9.620  1.00 2.44  ? 224 ASN A ND2  1  
ATOM 3453   H H    . ASN A 1 224 ? -8.738  -25.016 -8.984  1.00 0.90  ? 224 ASN A H    1  
ATOM 3454   H HA   . ASN A 1 224 ? -6.515  -26.515 -10.330 1.00 1.08  ? 224 ASN A HA   1  
ATOM 3455   H HB2  . ASN A 1 224 ? -9.418  -26.194 -11.176 1.00 1.16  ? 224 ASN A HB2  1  
ATOM 3456   H HB3  . ASN A 1 224 ? -8.186  -27.111 -12.042 1.00 1.52  ? 224 ASN A HB3  1  
ATOM 3457   H HD21 . ASN A 1 224 ? -6.909  -28.327 -9.742  1.00 2.63  ? 224 ASN A HD21 1  
ATOM 3458   H HD22 . ASN A 1 224 ? -8.009  -29.426 -9.062  1.00 3.13  ? 224 ASN A HD22 1  
ATOM 3459   N N    . ASN A 1 225 ? -7.303  -23.539 -10.636 1.00 0.95  ? 225 ASN A N    1  
ATOM 3460   C CA   . ASN A 1 225 ? -7.082  -22.257 -11.363 1.00 0.96  ? 225 ASN A CA   1  
ATOM 3461   C C    . ASN A 1 225 ? -8.020  -22.163 -12.566 1.00 0.93  ? 225 ASN A C    1  
ATOM 3462   O O    . ASN A 1 225 ? -7.590  -21.886 -13.668 1.00 1.00  ? 225 ASN A O    1  
ATOM 3463   C CB   . ASN A 1 225 ? -5.633  -22.174 -11.845 1.00 1.05  ? 225 ASN A CB   1  
ATOM 3464   C CG   . ASN A 1 225 ? -5.354  -20.765 -12.376 1.00 1.09  ? 225 ASN A CG   1  
ATOM 3465   O OD1  . ASN A 1 225 ? -4.320  -20.521 -12.968 1.00 1.54  ? 225 ASN A OD1  1  
ATOM 3466   N ND2  . ASN A 1 225 ? -6.241  -19.822 -12.200 1.00 1.55  ? 225 ASN A ND2  1  
ATOM 3467   H H    . ASN A 1 225 ? -7.550  -23.521 -9.687  1.00 0.93  ? 225 ASN A H    1  
ATOM 3468   H HA   . ASN A 1 225 ? -7.280  -21.435 -10.692 1.00 0.92  ? 225 ASN A HA   1  
ATOM 3469   H HB2  . ASN A 1 225 ? -4.967  -22.388 -11.023 1.00 1.07  ? 225 ASN A HB2  1  
ATOM 3470   H HB3  . ASN A 1 225 ? -5.474  -22.891 -12.635 1.00 1.12  ? 225 ASN A HB3  1  
ATOM 3471   H HD21 . ASN A 1 225 ? -7.078  -20.015 -11.731 1.00 2.20  ? 225 ASN A HD21 1  
ATOM 3472   H HD22 . ASN A 1 225 ? -6.070  -18.918 -12.541 1.00 1.59  ? 225 ASN A HD22 1  
ATOM 3473   N N    . GLN A 1 226 ? -9.298  -22.385 -12.371 1.00 0.85  ? 226 GLN A N    1  
ATOM 3474   C CA   . GLN A 1 226 ? -10.260 -22.299 -13.518 1.00 0.84  ? 226 GLN A CA   1  
ATOM 3475   C C    . GLN A 1 226 ? -11.518 -21.556 -13.075 1.00 0.75  ? 226 GLN A C    1  
ATOM 3476   O O    . GLN A 1 226 ? -11.937 -21.646 -11.938 1.00 0.72  ? 226 GLN A O    1  
ATOM 3477   C CB   . GLN A 1 226 ? -10.654 -23.708 -13.966 1.00 0.88  ? 226 GLN A CB   1  
ATOM 3478   C CG   . GLN A 1 226 ? -9.458  -24.389 -14.636 1.00 1.57  ? 226 GLN A CG   1  
ATOM 3479   C CD   . GLN A 1 226 ? -9.788  -25.861 -14.894 1.00 1.54  ? 226 GLN A CD   1  
ATOM 3480   O OE1  . GLN A 1 226 ? -10.560 -26.457 -14.170 1.00 1.99  ? 226 GLN A OE1  1  
ATOM 3481   N NE2  . GLN A 1 226 ? -9.236  -26.476 -15.905 1.00 1.77  ? 226 GLN A NE2  1  
ATOM 3482   H H    . GLN A 1 226 ? -9.629  -22.604 -11.470 1.00 0.81  ? 226 GLN A H    1  
ATOM 3483   H HA   . GLN A 1 226 ? -9.810  -21.772 -14.347 1.00 0.88  ? 226 GLN A HA   1  
ATOM 3484   H HB2  . GLN A 1 226 ? -10.965 -24.286 -13.108 1.00 1.26  ? 226 GLN A HB2  1  
ATOM 3485   H HB3  . GLN A 1 226 ? -11.471 -23.644 -14.671 1.00 1.27  ? 226 GLN A HB3  1  
ATOM 3486   H HG2  . GLN A 1 226 ? -9.239  -23.895 -15.572 1.00 2.14  ? 226 GLN A HG2  1  
ATOM 3487   H HG3  . GLN A 1 226 ? -8.598  -24.325 -13.986 1.00 2.13  ? 226 GLN A HG3  1  
ATOM 3488   H HE21 . GLN A 1 226 ? -8.615  -25.996 -16.492 1.00 2.32  ? 226 GLN A HE21 1  
ATOM 3489   H HE22 . GLN A 1 226 ? -9.442  -27.419 -16.075 1.00 1.77  ? 226 GLN A HE22 1  
ATOM 3490   N N    . VAL A 1 227 ? -12.131 -20.834 -13.978 1.00 0.73  ? 227 VAL A N    1  
ATOM 3491   C CA   . VAL A 1 227 ? -13.381 -20.080 -13.649 1.00 0.68  ? 227 VAL A CA   1  
ATOM 3492   C C    . VAL A 1 227 ? -14.530 -20.668 -14.461 1.00 0.66  ? 227 VAL A C    1  
ATOM 3493   O O    . VAL A 1 227 ? -14.433 -20.823 -15.663 1.00 0.69  ? 227 VAL A O    1  
ATOM 3494   C CB   . VAL A 1 227 ? -13.202 -18.607 -14.024 1.00 0.71  ? 227 VAL A CB   1  
ATOM 3495   C CG1  . VAL A 1 227 ? -14.488 -17.837 -13.705 1.00 0.73  ? 227 VAL A CG1  1  
ATOM 3496   C CG2  . VAL A 1 227 ? -12.040 -18.016 -13.218 1.00 0.77  ? 227 VAL A CG2  1  
ATOM 3497   H H    . VAL A 1 227 ? -11.770 -20.794 -14.888 1.00 0.78  ? 227 VAL A H    1  
ATOM 3498   H HA   . VAL A 1 227 ? -13.607 -20.161 -12.595 1.00 0.67  ? 227 VAL A HA   1  
ATOM 3499   H HB   . VAL A 1 227 ? -12.988 -18.527 -15.080 1.00 0.73  ? 227 VAL A HB   1  
ATOM 3500   H HG11 . VAL A 1 227 ? -14.853 -18.130 -12.733 1.00 1.21  ? 227 VAL A HG11 1  
ATOM 3501   H HG12 . VAL A 1 227 ? -14.285 -16.776 -13.709 1.00 1.32  ? 227 VAL A HG12 1  
ATOM 3502   H HG13 . VAL A 1 227 ? -15.238 -18.061 -14.453 1.00 1.13  ? 227 VAL A HG13 1  
ATOM 3503   H HG21 . VAL A 1 227 ? -11.180 -18.665 -13.302 1.00 1.15  ? 227 VAL A HG21 1  
ATOM 3504   H HG22 . VAL A 1 227 ? -11.794 -17.039 -13.605 1.00 1.40  ? 227 VAL A HG22 1  
ATOM 3505   H HG23 . VAL A 1 227 ? -12.327 -17.932 -12.181 1.00 1.24  ? 227 VAL A HG23 1  
ATOM 3506   N N    . TYR A 1 228 ? -15.622 -20.994 -13.817 1.00 0.63  ? 228 TYR A N    1  
ATOM 3507   C CA   . TYR A 1 228 ? -16.790 -21.571 -14.549 1.00 0.63  ? 228 TYR A CA   1  
ATOM 3508   C C    . TYR A 1 228 ? -17.864 -20.495 -14.686 1.00 0.63  ? 228 TYR A C    1  
ATOM 3509   O O    . TYR A 1 228 ? -18.343 -19.948 -13.712 1.00 0.59  ? 228 TYR A O    1  
ATOM 3510   C CB   . TYR A 1 228 ? -17.337 -22.766 -13.771 1.00 0.64  ? 228 TYR A CB   1  
ATOM 3511   C CG   . TYR A 1 228 ? -16.367 -23.917 -13.887 1.00 0.69  ? 228 TYR A CG   1  
ATOM 3512   C CD1  . TYR A 1 228 ? -15.332 -24.058 -12.955 1.00 0.75  ? 228 TYR A CD1  1  
ATOM 3513   C CD2  . TYR A 1 228 ? -16.506 -24.844 -14.927 1.00 0.82  ? 228 TYR A CD2  1  
ATOM 3514   C CE1  . TYR A 1 228 ? -14.434 -25.126 -13.063 1.00 0.83  ? 228 TYR A CE1  1  
ATOM 3515   C CE2  . TYR A 1 228 ? -15.608 -25.913 -15.035 1.00 0.91  ? 228 TYR A CE2  1  
ATOM 3516   C CZ   . TYR A 1 228 ? -14.572 -26.054 -14.103 1.00 0.87  ? 228 TYR A CZ   1  
ATOM 3517   O OH   . TYR A 1 228 ? -13.688 -27.108 -14.210 1.00 0.98  ? 228 TYR A OH   1  
ATOM 3518   H H    . TYR A 1 228 ? -15.677 -20.849 -12.848 1.00 0.62  ? 228 TYR A H    1  
ATOM 3519   H HA   . TYR A 1 228 ? -16.484 -21.899 -15.535 1.00 0.67  ? 228 TYR A HA   1  
ATOM 3520   H HB2  . TYR A 1 228 ? -17.454 -22.497 -12.734 1.00 0.64  ? 228 TYR A HB2  1  
ATOM 3521   H HB3  . TYR A 1 228 ? -18.292 -23.057 -14.179 1.00 0.65  ? 228 TYR A HB3  1  
ATOM 3522   H HD1  . TYR A 1 228 ? -15.224 -23.339 -12.156 1.00 0.83  ? 228 TYR A HD1  1  
ATOM 3523   H HD2  . TYR A 1 228 ? -17.304 -24.734 -15.644 1.00 0.94  ? 228 TYR A HD2  1  
ATOM 3524   H HE1  . TYR A 1 228 ? -13.634 -25.235 -12.345 1.00 0.95  ? 228 TYR A HE1  1  
ATOM 3525   H HE2  . TYR A 1 228 ? -15.715 -26.627 -15.837 1.00 1.08  ? 228 TYR A HE2  1  
ATOM 3526   H HH   . TYR A 1 228 ? -12.796 -26.752 -14.203 1.00 1.29  ? 228 TYR A HH   1  
ATOM 3527   N N    . VAL A 1 229 ? -18.231 -20.179 -15.896 1.00 0.70  ? 229 VAL A N    1  
ATOM 3528   C CA   . VAL A 1 229 ? -19.260 -19.124 -16.130 1.00 0.73  ? 229 VAL A CA   1  
ATOM 3529   C C    . VAL A 1 229 ? -20.620 -19.777 -16.408 1.00 0.77  ? 229 VAL A C    1  
ATOM 3530   O O    . VAL A 1 229 ? -20.828 -20.388 -17.436 1.00 0.80  ? 229 VAL A O    1  
ATOM 3531   C CB   . VAL A 1 229 ? -18.849 -18.282 -17.345 1.00 0.82  ? 229 VAL A CB   1  
ATOM 3532   C CG1  . VAL A 1 229 ? -19.841 -17.132 -17.535 1.00 0.85  ? 229 VAL A CG1  1  
ATOM 3533   C CG2  . VAL A 1 229 ? -17.444 -17.706 -17.128 1.00 0.83  ? 229 VAL A CG2  1  
ATOM 3534   H H    . VAL A 1 229 ? -17.817 -20.628 -16.652 1.00 0.75  ? 229 VAL A H    1  
ATOM 3535   H HA   . VAL A 1 229 ? -19.336 -18.486 -15.264 1.00 0.70  ? 229 VAL A HA   1  
ATOM 3536   H HB   . VAL A 1 229 ? -18.850 -18.904 -18.229 1.00 0.89  ? 229 VAL A HB   1  
ATOM 3537   H HG11 . VAL A 1 229 ? -19.888 -16.543 -16.630 1.00 1.17  ? 229 VAL A HG11 1  
ATOM 3538   H HG12 . VAL A 1 229 ? -19.516 -16.507 -18.354 1.00 1.38  ? 229 VAL A HG12 1  
ATOM 3539   H HG13 . VAL A 1 229 ? -20.819 -17.533 -17.755 1.00 1.36  ? 229 VAL A HG13 1  
ATOM 3540   H HG21 . VAL A 1 229 ? -16.785 -18.480 -16.765 1.00 1.32  ? 229 VAL A HG21 1  
ATOM 3541   H HG22 . VAL A 1 229 ? -17.064 -17.324 -18.065 1.00 1.21  ? 229 VAL A HG22 1  
ATOM 3542   H HG23 . VAL A 1 229 ? -17.490 -16.904 -16.408 1.00 1.34  ? 229 VAL A HG23 1  
ATOM 3543   N N    . ASN A 1 230 ? -21.548 -19.640 -15.497 1.00 0.79  ? 230 ASN A N    1  
ATOM 3544   C CA   . ASN A 1 230 ? -22.904 -20.237 -15.698 1.00 0.85  ? 230 ASN A CA   1  
ATOM 3545   C C    . ASN A 1 230 ? -22.799 -21.724 -16.067 1.00 0.83  ? 230 ASN A C    1  
ATOM 3546   O O    . ASN A 1 230 ? -23.091 -22.114 -17.181 1.00 0.88  ? 230 ASN A O    1  
ATOM 3547   C CB   . ASN A 1 230 ? -23.617 -19.488 -16.822 1.00 0.94  ? 230 ASN A CB   1  
ATOM 3548   C CG   . ASN A 1 230 ? -25.059 -19.985 -16.926 1.00 1.05  ? 230 ASN A CG   1  
ATOM 3549   O OD1  . ASN A 1 230 ? -25.834 -19.477 -17.711 1.00 1.44  ? 230 ASN A OD1  1  
ATOM 3550   N ND2  . ASN A 1 230 ? -25.453 -20.967 -16.161 1.00 1.66  ? 230 ASN A ND2  1  
ATOM 3551   H H    . ASN A 1 230 ? -21.359 -19.140 -14.676 1.00 0.79  ? 230 ASN A H    1  
ATOM 3552   H HA   . ASN A 1 230 ? -23.475 -20.136 -14.788 1.00 0.88  ? 230 ASN A HA   1  
ATOM 3553   H HB2  . ASN A 1 230 ? -23.614 -18.428 -16.607 1.00 1.00  ? 230 ASN A HB2  1  
ATOM 3554   H HB3  . ASN A 1 230 ? -23.107 -19.668 -17.757 1.00 0.93  ? 230 ASN A HB3  1  
ATOM 3555   H HD21 . ASN A 1 230 ? -24.827 -21.378 -15.528 1.00 2.33  ? 230 ASN A HD21 1  
ATOM 3556   H HD22 . ASN A 1 230 ? -26.375 -21.292 -16.218 1.00 1.75  ? 230 ASN A HD22 1  
ATOM 3557   N N    . PRO A 1 231 ? -22.400 -22.546 -15.130 1.00 0.81  ? 231 PRO A N    1  
ATOM 3558   C CA   . PRO A 1 231 ? -22.266 -24.015 -15.333 1.00 0.84  ? 231 PRO A CA   1  
ATOM 3559   C C    . PRO A 1 231 ? -23.560 -24.773 -14.980 1.00 0.93  ? 231 PRO A C    1  
ATOM 3560   O O    . PRO A 1 231 ? -24.303 -24.376 -14.104 1.00 0.95  ? 231 PRO A O    1  
ATOM 3561   C CB   . PRO A 1 231 ? -21.136 -24.377 -14.367 1.00 0.81  ? 231 PRO A CB   1  
ATOM 3562   C CG   . PRO A 1 231 ? -21.267 -23.401 -13.226 1.00 0.80  ? 231 PRO A CG   1  
ATOM 3563   C CD   . PRO A 1 231 ? -22.025 -22.168 -13.761 1.00 0.79  ? 231 PRO A CD   1  
ATOM 3564   H HA   . PRO A 1 231 ? -21.964 -24.232 -16.345 1.00 0.86  ? 231 PRO A HA   1  
ATOM 3565   H HB2  . PRO A 1 231 ? -21.246 -25.397 -14.018 1.00 0.86  ? 231 PRO A HB2  1  
ATOM 3566   H HB3  . PRO A 1 231 ? -20.179 -24.252 -14.853 1.00 0.79  ? 231 PRO A HB3  1  
ATOM 3567   H HG2  . PRO A 1 231 ? -21.821 -23.857 -12.411 1.00 0.85  ? 231 PRO A HG2  1  
ATOM 3568   H HG3  . PRO A 1 231 ? -20.289 -23.103 -12.879 1.00 0.79  ? 231 PRO A HG3  1  
ATOM 3569   H HD2  . PRO A 1 231 ? -22.907 -21.973 -13.165 1.00 0.83  ? 231 PRO A HD2  1  
ATOM 3570   H HD3  . PRO A 1 231 ? -21.382 -21.300 -13.779 1.00 0.78  ? 231 PRO A HD3  1  
ATOM 3571   N N    . THR A 1 232 ? -23.837 -25.856 -15.661 1.00 1.01  ? 232 THR A N    1  
ATOM 3572   C CA   . THR A 1 232 ? -25.084 -26.631 -15.372 1.00 1.12  ? 232 THR A CA   1  
ATOM 3573   C C    . THR A 1 232 ? -24.955 -27.345 -14.017 1.00 1.12  ? 232 THR A C    1  
ATOM 3574   O O    . THR A 1 232 ? -23.880 -27.454 -13.460 1.00 1.09  ? 232 THR A O    1  
ATOM 3575   C CB   . THR A 1 232 ? -25.310 -27.668 -16.480 1.00 1.24  ? 232 THR A CB   1  
ATOM 3576   O OG1  . THR A 1 232 ? -25.146 -27.050 -17.750 1.00 1.61  ? 232 THR A OG1  1  
ATOM 3577   C CG2  . THR A 1 232 ? -26.726 -28.245 -16.375 1.00 1.84  ? 232 THR A CG2  1  
ATOM 3578   H H    . THR A 1 232 ? -23.232 -26.154 -16.373 1.00 1.03  ? 232 THR A H    1  
ATOM 3579   H HA   . THR A 1 232 ? -25.923 -25.952 -15.339 1.00 1.15  ? 232 THR A HA   1  
ATOM 3580   H HB   . THR A 1 232 ? -24.594 -28.468 -16.375 1.00 1.48  ? 232 THR A HB   1  
ATOM 3581   H HG1  . THR A 1 232 ? -25.140 -26.099 -17.620 1.00 1.90  ? 232 THR A HG1  1  
ATOM 3582   H HG21 . THR A 1 232 ? -27.442 -27.440 -16.296 1.00 2.28  ? 232 THR A HG21 1  
ATOM 3583   H HG22 . THR A 1 232 ? -26.941 -28.832 -17.255 1.00 2.28  ? 232 THR A HG22 1  
ATOM 3584   H HG23 . THR A 1 232 ? -26.794 -28.874 -15.500 1.00 2.31  ? 232 THR A HG23 1  
ATOM 3585   N N    . ASN A 1 233 ? -26.052 -27.821 -13.480 1.00 1.21  ? 233 ASN A N    1  
ATOM 3586   C CA   . ASN A 1 233 ? -26.010 -28.518 -12.158 1.00 1.26  ? 233 ASN A CA   1  
ATOM 3587   C C    . ASN A 1 233 ? -25.095 -29.743 -12.244 1.00 1.29  ? 233 ASN A C    1  
ATOM 3588   O O    . ASN A 1 233 ? -24.353 -30.040 -11.328 1.00 1.31  ? 233 ASN A O    1  
ATOM 3589   C CB   . ASN A 1 233 ? -27.426 -28.971 -11.779 1.00 1.41  ? 233 ASN A CB   1  
ATOM 3590   C CG   . ASN A 1 233 ? -27.393 -29.675 -10.420 1.00 2.02  ? 233 ASN A CG   1  
ATOM 3591   O OD1  . ASN A 1 233 ? -26.482 -29.474 -9.642  1.00 2.65  ? 233 ASN A OD1  1  
ATOM 3592   N ND2  . ASN A 1 233 ? -28.357 -30.496 -10.099 1.00 2.74  ? 233 ASN A ND2  1  
ATOM 3593   H H    . ASN A 1 233 ? -26.907 -27.714 -13.946 1.00 1.29  ? 233 ASN A H    1  
ATOM 3594   H HA   . ASN A 1 233 ? -25.637 -27.842 -11.406 1.00 1.19  ? 233 ASN A HA   1  
ATOM 3595   H HB2  . ASN A 1 233 ? -28.079 -28.112 -11.725 1.00 1.71  ? 233 ASN A HB2  1  
ATOM 3596   H HB3  . ASN A 1 233 ? -27.795 -29.658 -12.526 1.00 1.78  ? 233 ASN A HB3  1  
ATOM 3597   H HD21 . ASN A 1 233 ? -29.094 -30.656 -10.724 1.00 2.93  ? 233 ASN A HD21 1  
ATOM 3598   H HD22 . ASN A 1 233 ? -28.343 -30.949 -9.230  1.00 3.45  ? 233 ASN A HD22 1  
ATOM 3599   N N    . GLU A 1 234 ? -25.146 -30.462 -13.330 1.00 1.35  ? 234 GLU A N    1  
ATOM 3600   C CA   . GLU A 1 234 ? -24.282 -31.668 -13.470 1.00 1.43  ? 234 GLU A CA   1  
ATOM 3601   C C    . GLU A 1 234 ? -22.808 -31.260 -13.371 1.00 1.33  ? 234 GLU A C    1  
ATOM 3602   O O    . GLU A 1 234 ? -22.005 -31.939 -12.764 1.00 1.37  ? 234 GLU A O    1  
ATOM 3603   C CB   . GLU A 1 234 ? -24.544 -32.335 -14.824 1.00 1.54  ? 234 GLU A CB   1  
ATOM 3604   C CG   . GLU A 1 234 ? -23.801 -33.673 -14.903 1.00 1.95  ? 234 GLU A CG   1  
ATOM 3605   C CD   . GLU A 1 234 ? -24.390 -34.655 -13.886 1.00 2.35  ? 234 GLU A CD   1  
ATOM 3606   O OE1  . GLU A 1 234 ? -25.509 -34.430 -13.453 1.00 2.89  ? 234 GLU A OE1  1  
ATOM 3607   O OE2  . GLU A 1 234 ? -23.711 -35.613 -13.555 1.00 2.77  ? 234 GLU A OE2  1  
ATOM 3608   H H    . GLU A 1 234 ? -25.754 -30.209 -14.055 1.00 1.37  ? 234 GLU A H    1  
ATOM 3609   H HA   . GLU A 1 234 ? -24.513 -32.363 -12.676 1.00 1.50  ? 234 GLU A HA   1  
ATOM 3610   H HB2  . GLU A 1 234 ? -25.605 -32.506 -14.943 1.00 1.86  ? 234 GLU A HB2  1  
ATOM 3611   H HB3  . GLU A 1 234 ? -24.196 -31.687 -15.615 1.00 1.89  ? 234 GLU A HB3  1  
ATOM 3612   H HG2  . GLU A 1 234 ? -23.902 -34.083 -15.898 1.00 2.39  ? 234 GLU A HG2  1  
ATOM 3613   H HG3  . GLU A 1 234 ? -22.756 -33.517 -14.684 1.00 2.49  ? 234 GLU A HG3  1  
ATOM 3614   N N    . VAL A 1 235 ? -22.447 -30.148 -13.959 1.00 1.24  ? 235 VAL A N    1  
ATOM 3615   C CA   . VAL A 1 235 ? -21.027 -29.694 -13.893 1.00 1.19  ? 235 VAL A CA   1  
ATOM 3616   C C    . VAL A 1 235 ? -20.668 -29.384 -12.435 1.00 1.10  ? 235 VAL A C    1  
ATOM 3617   O O    . VAL A 1 235 ? -19.614 -29.750 -11.952 1.00 1.11  ? 235 VAL A O    1  
ATOM 3618   C CB   . VAL A 1 235 ? -20.858 -28.427 -14.745 1.00 1.16  ? 235 VAL A CB   1  
ATOM 3619   C CG1  . VAL A 1 235 ? -19.470 -27.823 -14.510 1.00 1.13  ? 235 VAL A CG1  1  
ATOM 3620   C CG2  . VAL A 1 235 ? -21.013 -28.782 -16.226 1.00 1.30  ? 235 VAL A CG2  1  
ATOM 3621   H H    . VAL A 1 235 ? -23.114 -29.603 -14.426 1.00 1.23  ? 235 VAL A H    1  
ATOM 3622   H HA   . VAL A 1 235 ? -20.379 -30.472 -14.269 1.00 1.26  ? 235 VAL A HA   1  
ATOM 3623   H HB   . VAL A 1 235 ? -21.613 -27.706 -14.466 1.00 1.10  ? 235 VAL A HB   1  
ATOM 3624   H HG11 . VAL A 1 235 ? -18.726 -28.602 -14.558 1.00 1.31  ? 235 VAL A HG11 1  
ATOM 3625   H HG12 . VAL A 1 235 ? -19.267 -27.083 -15.270 1.00 1.51  ? 235 VAL A HG12 1  
ATOM 3626   H HG13 . VAL A 1 235 ? -19.441 -27.355 -13.537 1.00 1.68  ? 235 VAL A HG13 1  
ATOM 3627   H HG21 . VAL A 1 235 ? -20.298 -29.546 -16.490 1.00 1.57  ? 235 VAL A HG21 1  
ATOM 3628   H HG22 . VAL A 1 235 ? -22.013 -29.148 -16.406 1.00 1.72  ? 235 VAL A HG22 1  
ATOM 3629   H HG23 . VAL A 1 235 ? -20.838 -27.902 -16.828 1.00 1.73  ? 235 VAL A HG23 1  
ATOM 3630   N N    . ILE A 1 236 ? -21.539 -28.706 -11.734 1.00 1.06  ? 236 ILE A N    1  
ATOM 3631   C CA   . ILE A 1 236 ? -21.260 -28.362 -10.310 1.00 1.00  ? 236 ILE A CA   1  
ATOM 3632   C C    . ILE A 1 236 ? -21.144 -29.643 -9.485  1.00 1.09  ? 236 ILE A C    1  
ATOM 3633   O O    . ILE A 1 236 ? -20.287 -29.762 -8.633  1.00 1.08  ? 236 ILE A O    1  
ATOM 3634   C CB   . ILE A 1 236 ? -22.394 -27.486 -9.769  1.00 1.00  ? 236 ILE A CB   1  
ATOM 3635   C CG1  . ILE A 1 236 ? -22.419 -26.163 -10.542 1.00 0.99  ? 236 ILE A CG1  1  
ATOM 3636   C CG2  . ILE A 1 236 ? -22.156 -27.197 -8.287  1.00 1.00  ? 236 ILE A CG2  1  
ATOM 3637   C CD1  . ILE A 1 236 ? -23.686 -25.372 -10.197 1.00 1.03  ? 236 ILE A CD1  1  
ATOM 3638   H H    . ILE A 1 236 ? -22.380 -28.419 -12.148 1.00 1.08  ? 236 ILE A H    1  
ATOM 3639   H HA   . ILE A 1 236 ? -20.329 -27.821 -10.247 1.00 0.94  ? 236 ILE A HA   1  
ATOM 3640   H HB   . ILE A 1 236 ? -23.337 -27.997 -9.892  1.00 1.07  ? 236 ILE A HB   1  
ATOM 3641   H HG12 . ILE A 1 236 ? -21.550 -25.578 -10.276 1.00 0.98  ? 236 ILE A HG12 1  
ATOM 3642   H HG13 . ILE A 1 236 ? -22.402 -26.368 -11.600 1.00 1.00  ? 236 ILE A HG13 1  
ATOM 3643   H HG21 . ILE A 1 236 ? -21.150 -26.829 -8.149  1.00 1.57  ? 236 ILE A HG21 1  
ATOM 3644   H HG22 . ILE A 1 236 ? -22.861 -26.450 -7.950  1.00 1.32  ? 236 ILE A HG22 1  
ATOM 3645   H HG23 . ILE A 1 236 ? -22.293 -28.103 -7.720  1.00 1.40  ? 236 ILE A HG23 1  
ATOM 3646   H HD11 . ILE A 1 236 ? -23.900 -25.465 -9.143  1.00 1.38  ? 236 ILE A HD11 1  
ATOM 3647   H HD12 . ILE A 1 236 ? -23.534 -24.332 -10.442 1.00 1.49  ? 236 ILE A HD12 1  
ATOM 3648   H HD13 . ILE A 1 236 ? -24.518 -25.758 -10.768 1.00 1.45  ? 236 ILE A HD13 1  
ATOM 3649   N N    . ASP A 1 237 ? -21.975 -30.615 -9.739  1.00 1.21  ? 237 ASP A N    1  
ATOM 3650   C CA   . ASP A 1 237 ? -21.872 -31.880 -8.963  1.00 1.34  ? 237 ASP A CA   1  
ATOM 3651   C C    . ASP A 1 237 ? -20.480 -32.468 -9.176  1.00 1.37  ? 237 ASP A C    1  
ATOM 3652   O O    . ASP A 1 237 ? -19.856 -32.958 -8.257  1.00 1.42  ? 237 ASP A O    1  
ATOM 3653   C CB   . ASP A 1 237 ? -22.923 -32.876 -9.458  1.00 1.48  ? 237 ASP A CB   1  
ATOM 3654   C CG   . ASP A 1 237 ? -22.806 -34.179 -8.663  1.00 1.86  ? 237 ASP A CG   1  
ATOM 3655   O OD1  . ASP A 1 237 ? -21.818 -34.872 -8.846  1.00 2.33  ? 237 ASP A OD1  1  
ATOM 3656   O OD2  . ASP A 1 237 ? -23.702 -34.460 -7.886  1.00 2.43  ? 237 ASP A OD2  1  
ATOM 3657   H H    . ASP A 1 237 ? -22.654 -30.517 -10.439 1.00 1.24  ? 237 ASP A H    1  
ATOM 3658   H HA   . ASP A 1 237 ? -22.027 -31.678 -7.913  1.00 1.34  ? 237 ASP A HA   1  
ATOM 3659   H HB2  . ASP A 1 237 ? -23.911 -32.456 -9.321  1.00 1.62  ? 237 ASP A HB2  1  
ATOM 3660   H HB3  . ASP A 1 237 ? -22.760 -33.079 -10.505 1.00 1.79  ? 237 ASP A HB3  1  
ATOM 3661   N N    . LYS A 1 238 ? -19.978 -32.402 -10.376 1.00 1.38  ? 238 LYS A N    1  
ATOM 3662   C CA   . LYS A 1 238 ? -18.614 -32.939 -10.634 1.00 1.47  ? 238 LYS A CA   1  
ATOM 3663   C C    . LYS A 1 238 ? -17.603 -32.095 -9.855  1.00 1.39  ? 238 LYS A C    1  
ATOM 3664   O O    . LYS A 1 238 ? -16.685 -32.607 -9.245  1.00 1.48  ? 238 LYS A O    1  
ATOM 3665   C CB   . LYS A 1 238 ? -18.311 -32.869 -12.132 1.00 1.52  ? 238 LYS A CB   1  
ATOM 3666   C CG   . LYS A 1 238 ? -17.011 -33.619 -12.423 1.00 1.65  ? 238 LYS A CG   1  
ATOM 3667   C CD   . LYS A 1 238 ? -16.715 -33.565 -13.925 1.00 1.77  ? 238 LYS A CD   1  
ATOM 3668   C CE   . LYS A 1 238 ? -15.422 -34.329 -14.222 1.00 2.22  ? 238 LYS A CE   1  
ATOM 3669   N NZ   . LYS A 1 238 ? -14.287 -33.697 -13.490 1.00 2.78  ? 238 LYS A NZ   1  
ATOM 3670   H H    . LYS A 1 238 ? -20.490 -31.988 -11.102 1.00 1.36  ? 238 LYS A H    1  
ATOM 3671   H HA   . LYS A 1 238 ? -18.560 -33.963 -10.300 1.00 1.58  ? 238 LYS A HA   1  
ATOM 3672   H HB2  . LYS A 1 238 ? -19.121 -33.323 -12.684 1.00 1.58  ? 238 LYS A HB2  1  
ATOM 3673   H HB3  . LYS A 1 238 ? -18.205 -31.837 -12.431 1.00 1.45  ? 238 LYS A HB3  1  
ATOM 3674   H HG2  . LYS A 1 238 ? -16.199 -33.156 -11.879 1.00 1.64  ? 238 LYS A HG2  1  
ATOM 3675   H HG3  . LYS A 1 238 ? -17.112 -34.647 -12.114 1.00 1.73  ? 238 LYS A HG3  1  
ATOM 3676   H HD2  . LYS A 1 238 ? -17.533 -34.019 -14.467 1.00 1.95  ? 238 LYS A HD2  1  
ATOM 3677   H HD3  . LYS A 1 238 ? -16.604 -32.537 -14.234 1.00 2.03  ? 238 LYS A HD3  1  
ATOM 3678   H HE2  . LYS A 1 238 ? -15.528 -35.355 -13.902 1.00 2.64  ? 238 LYS A HE2  1  
ATOM 3679   H HE3  . LYS A 1 238 ? -15.225 -34.301 -15.283 1.00 2.62  ? 238 LYS A HE3  1  
ATOM 3680   H HZ1  . LYS A 1 238 ? -14.639 -32.894 -12.931 1.00 3.08  ? 238 LYS A HZ1  1  
ATOM 3681   H HZ2  . LYS A 1 238 ? -13.851 -34.397 -12.858 1.00 3.18  ? 238 LYS A HZ2  1  
ATOM 3682   H HZ3  . LYS A 1 238 ? -13.578 -33.362 -14.174 1.00 3.18  ? 238 LYS A HZ3  1  
ATOM 3683   N N    . MET A 1 239 ? -17.775 -30.801 -9.860  1.00 1.25  ? 239 MET A N    1  
ATOM 3684   C CA   . MET A 1 239 ? -16.836 -29.922 -9.106  1.00 1.20  ? 239 MET A CA   1  
ATOM 3685   C C    . MET A 1 239 ? -17.038 -30.113 -7.606  1.00 1.18  ? 239 MET A C    1  
ATOM 3686   O O    . MET A 1 239 ? -16.104 -30.046 -6.831  1.00 1.23  ? 239 MET A O    1  
ATOM 3687   C CB   . MET A 1 239 ? -17.079 -28.456 -9.461  1.00 1.09  ? 239 MET A CB   1  
ATOM 3688   C CG   . MET A 1 239 ? -16.594 -28.180 -10.883 1.00 1.15  ? 239 MET A CG   1  
ATOM 3689   S SD   . MET A 1 239 ? -16.765 -26.411 -11.242 1.00 1.13  ? 239 MET A SD   1  
ATOM 3690   C CE   . MET A 1 239 ? -15.534 -25.796 -10.058 1.00 1.08  ? 239 MET A CE   1  
ATOM 3691   H H    . MET A 1 239 ? -18.527 -30.409 -10.352 1.00 1.21  ? 239 MET A H    1  
ATOM 3692   H HA   . MET A 1 239 ? -15.821 -30.186 -9.363  1.00 1.29  ? 239 MET A HA   1  
ATOM 3693   H HB2  . MET A 1 239 ? -18.136 -28.244 -9.394  1.00 1.07  ? 239 MET A HB2  1  
ATOM 3694   H HB3  . MET A 1 239 ? -16.541 -27.826 -8.770  1.00 1.07  ? 239 MET A HB3  1  
ATOM 3695   H HG2  . MET A 1 239 ? -15.558 -28.473 -10.977 1.00 1.24  ? 239 MET A HG2  1  
ATOM 3696   H HG3  . MET A 1 239 ? -17.192 -28.748 -11.582 1.00 1.23  ? 239 MET A HG3  1  
ATOM 3697   H HE1  . MET A 1 239 ? -14.801 -26.566 -9.866  1.00 1.38  ? 239 MET A HE1  1  
ATOM 3698   H HE2  . MET A 1 239 ? -15.047 -24.923 -10.468 1.00 1.56  ? 239 MET A HE2  1  
ATOM 3699   H HE3  . MET A 1 239 ? -16.022 -25.529 -9.135  1.00 1.59  ? 239 MET A HE3  1  
ATOM 3700   N N    . ARG A 1 240 ? -18.244 -30.366 -7.186  1.00 1.15  ? 240 ARG A N    1  
ATOM 3701   C CA   . ARG A 1 240 ? -18.499 -30.575 -5.738  1.00 1.19  ? 240 ARG A CA   1  
ATOM 3702   C C    . ARG A 1 240 ? -17.787 -31.848 -5.282  1.00 1.32  ? 240 ARG A C    1  
ATOM 3703   O O    . ARG A 1 240 ? -17.240 -31.912 -4.200  1.00 1.33  ? 240 ARG A O    1  
ATOM 3704   C CB   . ARG A 1 240 ? -20.009 -30.713 -5.510  1.00 1.24  ? 240 ARG A CB   1  
ATOM 3705   C CG   . ARG A 1 240 ? -20.712 -29.359 -5.710  1.00 1.14  ? 240 ARG A CG   1  
ATOM 3706   C CD   . ARG A 1 240 ? -20.668 -28.530 -4.419  1.00 1.16  ? 240 ARG A CD   1  
ATOM 3707   N NE   . ARG A 1 240 ? -21.652 -29.092 -3.451  1.00 1.59  ? 240 ARG A NE   1  
ATOM 3708   C CZ   . ARG A 1 240 ? -21.658 -28.688 -2.210  1.00 1.84  ? 240 ARG A CZ   1  
ATOM 3709   N NH1  . ARG A 1 240 ? -20.814 -27.771 -1.820  1.00 2.05  ? 240 ARG A NH1  1  
ATOM 3710   N NH2  . ARG A 1 240 ? -22.510 -29.195 -1.362  1.00 2.63  ? 240 ARG A NH2  1  
ATOM 3711   H H    . ARG A 1 240 ? -18.990 -30.444 -7.819  1.00 1.14  ? 240 ARG A H    1  
ATOM 3712   H HA   . ARG A 1 240 ? -18.120 -29.733 -5.183  1.00 1.13  ? 240 ARG A HA   1  
ATOM 3713   H HB2  . ARG A 1 240 ? -20.406 -31.424 -6.221  1.00 1.29  ? 240 ARG A HB2  1  
ATOM 3714   H HB3  . ARG A 1 240 ? -20.190 -31.071 -4.509  1.00 1.33  ? 240 ARG A HB3  1  
ATOM 3715   H HG2  . ARG A 1 240 ? -20.224 -28.810 -6.502  1.00 1.07  ? 240 ARG A HG2  1  
ATOM 3716   H HG3  . ARG A 1 240 ? -21.743 -29.533 -5.981  1.00 1.20  ? 240 ARG A HG3  1  
ATOM 3717   H HD2  . ARG A 1 240 ? -19.685 -28.567 -3.986  1.00 1.50  ? 240 ARG A HD2  1  
ATOM 3718   H HD3  . ARG A 1 240 ? -20.919 -27.501 -4.644  1.00 1.40  ? 240 ARG A HD3  1  
ATOM 3719   H HE   . ARG A 1 240 ? -22.293 -29.774 -3.745  1.00 2.25  ? 240 ARG A HE   1  
ATOM 3720   H HH11 . ARG A 1 240 ? -20.164 -27.379 -2.472  1.00 2.04  ? 240 ARG A HH11 1  
ATOM 3721   H HH12 . ARG A 1 240 ? -20.819 -27.460 -0.870  1.00 2.69  ? 240 ARG A HH12 1  
ATOM 3722   H HH21 . ARG A 1 240 ? -23.158 -29.895 -1.663  1.00 3.11  ? 240 ARG A HH21 1  
ATOM 3723   H HH22 . ARG A 1 240 ? -22.516 -28.883 -0.412  1.00 3.01  ? 240 ARG A HH22 1  
ATOM 3724   N N    . ALA A 1 241 ? -17.799 -32.865 -6.101  1.00 1.45  ? 241 ALA A N    1  
ATOM 3725   C CA   . ALA A 1 241 ? -17.134 -34.141 -5.719  1.00 1.61  ? 241 ALA A CA   1  
ATOM 3726   C C    . ALA A 1 241 ? -15.645 -33.897 -5.461  1.00 1.62  ? 241 ALA A C    1  
ATOM 3727   O O    . ALA A 1 241 ? -15.087 -34.402 -4.508  1.00 1.63  ? 241 ALA A O    1  
ATOM 3728   C CB   . ALA A 1 241 ? -17.294 -35.153 -6.856  1.00 1.80  ? 241 ALA A CB   1  
ATOM 3729   H H    . ALA A 1 241 ? -18.252 -32.790 -6.965  1.00 1.47  ? 241 ALA A H    1  
ATOM 3730   H HA   . ALA A 1 241 ? -17.595 -34.531 -4.824  1.00 1.63  ? 241 ALA A HA   1  
ATOM 3731   H HB1  . ALA A 1 241 ? -18.340 -35.253 -7.105  1.00 2.17  ? 241 ALA A HB1  1  
ATOM 3732   H HB2  . ALA A 1 241 ? -16.750 -34.808 -7.723  1.00 2.07  ? 241 ALA A HB2  1  
ATOM 3733   H HB3  . ALA A 1 241 ? -16.903 -36.110 -6.544  1.00 2.02  ? 241 ALA A HB3  1  
ATOM 3734   N N    . VAL A 1 242 ? -14.993 -33.127 -6.288  1.00 1.66  ? 242 VAL A N    1  
ATOM 3735   C CA   . VAL A 1 242 ? -13.545 -32.869 -6.051  1.00 1.74  ? 242 VAL A CA   1  
ATOM 3736   C C    . VAL A 1 242 ? -13.386 -32.204 -4.686  1.00 1.58  ? 242 VAL A C    1  
ATOM 3737   O O    . VAL A 1 242 ? -12.485 -32.513 -3.932  1.00 1.58  ? 242 VAL A O    1  
ATOM 3738   C CB   . VAL A 1 242 ? -12.992 -31.954 -7.147  1.00 1.93  ? 242 VAL A CB   1  
ATOM 3739   C CG1  . VAL A 1 242 ? -11.573 -31.497 -6.781  1.00 2.11  ? 242 VAL A CG1  1  
ATOM 3740   C CG2  . VAL A 1 242 ? -12.955 -32.728 -8.465  1.00 2.13  ? 242 VAL A CG2  1  
ATOM 3741   H H    . VAL A 1 242 ? -15.451 -32.718 -7.053  1.00 1.67  ? 242 VAL A H    1  
ATOM 3742   H HA   . VAL A 1 242 ? -13.008 -33.807 -6.057  1.00 1.84  ? 242 VAL A HA   1  
ATOM 3743   H HB   . VAL A 1 242 ? -13.632 -31.090 -7.252  1.00 1.87  ? 242 VAL A HB   1  
ATOM 3744   H HG11 . VAL A 1 242 ? -11.017 -32.331 -6.377  1.00 2.40  ? 242 VAL A HG11 1  
ATOM 3745   H HG12 . VAL A 1 242 ? -11.071 -31.127 -7.664  1.00 2.26  ? 242 VAL A HG12 1  
ATOM 3746   H HG13 . VAL A 1 242 ? -11.627 -30.710 -6.043  1.00 2.51  ? 242 VAL A HG13 1  
ATOM 3747   H HG21 . VAL A 1 242 ? -13.917 -33.188 -8.637  1.00 2.46  ? 242 VAL A HG21 1  
ATOM 3748   H HG22 . VAL A 1 242 ? -12.726 -32.052 -9.275  1.00 2.32  ? 242 VAL A HG22 1  
ATOM 3749   H HG23 . VAL A 1 242 ? -12.196 -33.495 -8.409  1.00 2.41  ? 242 VAL A HG23 1  
ATOM 3750   N N    . GLN A 1 243 ? -14.259 -31.294 -4.360  1.00 1.51  ? 243 GLN A N    1  
ATOM 3751   C CA   . GLN A 1 243 ? -14.162 -30.614 -3.042  1.00 1.47  ? 243 GLN A CA   1  
ATOM 3752   C C    . GLN A 1 243 ? -14.272 -31.656 -1.926  1.00 1.40  ? 243 GLN A C    1  
ATOM 3753   O O    . GLN A 1 243 ? -13.573 -31.593 -0.935  1.00 1.47  ? 243 GLN A O    1  
ATOM 3754   C CB   . GLN A 1 243 ? -15.297 -29.601 -2.914  1.00 1.44  ? 243 GLN A CB   1  
ATOM 3755   C CG   . GLN A 1 243 ? -15.121 -28.802 -1.624  1.00 1.70  ? 243 GLN A CG   1  
ATOM 3756   C CD   . GLN A 1 243 ? -16.216 -27.739 -1.532  1.00 2.52  ? 243 GLN A CD   1  
ATOM 3757   O OE1  . GLN A 1 243 ? -15.930 -26.573 -1.349  1.00 3.17  ? 243 GLN A OE1  1  
ATOM 3758   N NE2  . GLN A 1 243 ? -17.465 -28.096 -1.659  1.00 3.13  ? 243 GLN A NE2  1  
ATOM 3759   H H    . GLN A 1 243 ? -14.982 -31.061 -4.981  1.00 1.53  ? 243 GLN A H    1  
ATOM 3760   H HA   . GLN A 1 243 ? -13.212 -30.104 -2.967  1.00 1.60  ? 243 GLN A HA   1  
ATOM 3761   H HB2  . GLN A 1 243 ? -15.277 -28.930 -3.761  1.00 1.68  ? 243 GLN A HB2  1  
ATOM 3762   H HB3  . GLN A 1 243 ? -16.242 -30.121 -2.888  1.00 1.19  ? 243 GLN A HB3  1  
ATOM 3763   H HG2  . GLN A 1 243 ? -15.192 -29.469 -0.776  1.00 1.93  ? 243 GLN A HG2  1  
ATOM 3764   H HG3  . GLN A 1 243 ? -14.153 -28.322 -1.625  1.00 1.88  ? 243 GLN A HG3  1  
ATOM 3765   H HE21 . GLN A 1 243 ? -17.694 -29.037 -1.811  1.00 3.20  ? 243 GLN A HE21 1  
ATOM 3766   H HE22 . GLN A 1 243 ? -18.175 -27.422 -1.600  1.00 3.82  ? 243 GLN A HE22 1  
ATOM 3767   N N    . GLU A 1 244 ? -15.141 -32.620 -2.081  1.00 1.34  ? 244 GLU A N    1  
ATOM 3768   C CA   . GLU A 1 244 ? -15.287 -33.667 -1.030  1.00 1.41  ? 244 GLU A CA   1  
ATOM 3769   C C    . GLU A 1 244 ? -13.964 -34.417 -0.882  1.00 1.52  ? 244 GLU A C    1  
ATOM 3770   O O    . GLU A 1 244 ? -13.535 -34.730 0.211   1.00 1.68  ? 244 GLU A O    1  
ATOM 3771   C CB   . GLU A 1 244 ? -16.393 -34.643 -1.436  1.00 1.41  ? 244 GLU A CB   1  
ATOM 3772   C CG   . GLU A 1 244 ? -17.748 -33.938 -1.346  1.00 1.31  ? 244 GLU A CG   1  
ATOM 3773   C CD   . GLU A 1 244 ? -18.855 -34.904 -1.771  1.00 1.37  ? 244 GLU A CD   1  
ATOM 3774   O OE1  . GLU A 1 244 ? -19.342 -35.627 -0.919  1.00 1.78  ? 244 GLU A OE1  1  
ATOM 3775   O OE2  . GLU A 1 244 ? -19.196 -34.904 -2.943  1.00 1.77  ? 244 GLU A OE2  1  
ATOM 3776   H H    . GLU A 1 244 ? -15.694 -32.658 -2.890  1.00 1.32  ? 244 GLU A H    1  
ATOM 3777   H HA   . GLU A 1 244 ? -15.542 -33.200 -0.090  1.00 1.45  ? 244 GLU A HA   1  
ATOM 3778   H HB2  . GLU A 1 244 ? -16.226 -34.974 -2.451  1.00 1.42  ? 244 GLU A HB2  1  
ATOM 3779   H HB3  . GLU A 1 244 ? -16.388 -35.495 -0.773  1.00 1.54  ? 244 GLU A HB3  1  
ATOM 3780   H HG2  . GLU A 1 244 ? -17.919 -33.620 -0.328  1.00 1.35  ? 244 GLU A HG2  1  
ATOM 3781   H HG3  . GLU A 1 244 ? -17.751 -33.079 -1.999  1.00 1.23  ? 244 GLU A HG3  1  
ATOM 3782   N N    . GLN A 1 245 ? -13.306 -34.696 -1.973  1.00 1.52  ? 245 GLN A N    1  
ATOM 3783   C CA   . GLN A 1 245 ? -12.002 -35.411 -1.892  1.00 1.69  ? 245 GLN A CA   1  
ATOM 3784   C C    . GLN A 1 245 ? -11.024 -34.562 -1.083  1.00 1.73  ? 245 GLN A C    1  
ATOM 3785   O O    . GLN A 1 245 ? -10.263 -35.064 -0.281  1.00 1.89  ? 245 GLN A O    1  
ATOM 3786   C CB   . GLN A 1 245 ? -11.453 -35.624 -3.305  1.00 1.74  ? 245 GLN A CB   1  
ATOM 3787   C CG   . GLN A 1 245 ? -10.109 -36.359 -3.240  1.00 2.02  ? 245 GLN A CG   1  
ATOM 3788   C CD   . GLN A 1 245 ? -9.575  -36.571 -4.657  1.00 2.17  ? 245 GLN A CD   1  
ATOM 3789   O OE1  . GLN A 1 245 ? -10.275 -36.344 -5.623  1.00 2.47  ? 245 GLN A OE1  1  
ATOM 3790   N NE2  . GLN A 1 245 ? -8.351  -36.995 -4.821  1.00 2.44  ? 245 GLN A NE2  1  
ATOM 3791   H H    . GLN A 1 245 ? -13.662 -34.424 -2.844  1.00 1.46  ? 245 GLN A H    1  
ATOM 3792   H HA   . GLN A 1 245 ? -12.140 -36.365 -1.408  1.00 1.81  ? 245 GLN A HA   1  
ATOM 3793   H HB2  . GLN A 1 245 ? -12.156 -36.212 -3.877  1.00 1.90  ? 245 GLN A HB2  1  
ATOM 3794   H HB3  . GLN A 1 245 ? -11.314 -34.666 -3.783  1.00 1.90  ? 245 GLN A HB3  1  
ATOM 3795   H HG2  . GLN A 1 245 ? -9.400  -35.771 -2.676  1.00 2.27  ? 245 GLN A HG2  1  
ATOM 3796   H HG3  . GLN A 1 245 ? -10.246 -37.316 -2.762  1.00 2.24  ? 245 GLN A HG3  1  
ATOM 3797   H HE21 . GLN A 1 245 ? -7.786  -37.174 -4.040  1.00 2.77  ? 245 GLN A HE21 1  
ATOM 3798   H HE22 . GLN A 1 245 ? -7.997  -37.132 -5.723  1.00 2.59  ? 245 GLN A HE22 1  
ATOM 3799   N N    . VAL A 1 246 ? -11.044 -33.277 -1.294  1.00 1.64  ? 246 VAL A N    1  
ATOM 3800   C CA   . VAL A 1 246 ? -10.122 -32.380 -0.548  1.00 1.76  ? 246 VAL A CA   1  
ATOM 3801   C C    . VAL A 1 246 ? -10.452 -32.448 0.948   1.00 1.89  ? 246 VAL A C    1  
ATOM 3802   O O    . VAL A 1 246 ? -9.575  -32.467 1.789   1.00 2.09  ? 246 VAL A O    1  
ATOM 3803   C CB   . VAL A 1 246 ? -10.300 -30.946 -1.057  1.00 1.73  ? 246 VAL A CB   1  
ATOM 3804   C CG1  . VAL A 1 246 ? -9.462  -29.988 -0.209  1.00 1.89  ? 246 VAL A CG1  1  
ATOM 3805   C CG2  . VAL A 1 246 ? -9.847  -30.864 -2.518  1.00 1.74  ? 246 VAL A CG2  1  
ATOM 3806   H H    . VAL A 1 246 ? -11.669 -32.900 -1.948  1.00 1.55  ? 246 VAL A H    1  
ATOM 3807   H HA   . VAL A 1 246 ? -9.103  -32.696 -0.707  1.00 1.85  ? 246 VAL A HA   1  
ATOM 3808   H HB   . VAL A 1 246 ? -11.343 -30.667 -0.988  1.00 1.68  ? 246 VAL A HB   1  
ATOM 3809   H HG11 . VAL A 1 246 ? -8.455  -30.367 -0.128  1.00 2.16  ? 246 VAL A HG11 1  
ATOM 3810   H HG12 . VAL A 1 246 ? -9.443  -29.014 -0.677  1.00 2.12  ? 246 VAL A HG12 1  
ATOM 3811   H HG13 . VAL A 1 246 ? -9.896  -29.904 0.776   1.00 2.25  ? 246 VAL A HG13 1  
ATOM 3812   H HG21 . VAL A 1 246 ? -10.348 -31.630 -3.094  1.00 2.06  ? 246 VAL A HG21 1  
ATOM 3813   H HG22 . VAL A 1 246 ? -10.097 -29.892 -2.920  1.00 2.04  ? 246 VAL A HG22 1  
ATOM 3814   H HG23 . VAL A 1 246 ? -8.779  -31.013 -2.574  1.00 1.95  ? 246 VAL A HG23 1  
ATOM 3815   N N    . ALA A 1 247 ? -11.713 -32.487 1.283   1.00 1.85  ? 247 ALA A N    1  
ATOM 3816   C CA   . ALA A 1 247 ? -12.106 -32.554 2.721   1.00 2.06  ? 247 ALA A CA   1  
ATOM 3817   C C    . ALA A 1 247 ? -11.521 -33.817 3.353   1.00 2.28  ? 247 ALA A C    1  
ATOM 3818   O O    . ALA A 1 247 ? -11.020 -33.794 4.460   1.00 2.54  ? 247 ALA A O    1  
ATOM 3819   C CB   . ALA A 1 247 ? -13.632 -32.589 2.830   1.00 2.02  ? 247 ALA A CB   1  
ATOM 3820   H H    . ALA A 1 247 ? -12.404 -32.473 0.588   1.00 1.71  ? 247 ALA A H    1  
ATOM 3821   H HA   . ALA A 1 247 ? -11.728 -31.684 3.238   1.00 2.17  ? 247 ALA A HA   1  
ATOM 3822   H HB1  . ALA A 1 247 ? -14.053 -31.800 2.225   1.00 2.28  ? 247 ALA A HB1  1  
ATOM 3823   H HB2  . ALA A 1 247 ? -13.995 -33.544 2.480   1.00 2.13  ? 247 ALA A HB2  1  
ATOM 3824   H HB3  . ALA A 1 247 ? -13.923 -32.449 3.860   1.00 2.34  ? 247 ALA A HB3  1  
ATOM 3825   N N    . SER A 1 248 ? -11.577 -34.918 2.656   1.00 2.23  ? 248 SER A N    1  
ATOM 3826   C CA   . SER A 1 248 ? -11.017 -36.182 3.211   1.00 2.52  ? 248 SER A CA   1  
ATOM 3827   C C    . SER A 1 248 ? -9.507  -36.025 3.368   1.00 2.66  ? 248 SER A C    1  
ATOM 3828   O O    . SER A 1 248 ? -8.919  -36.465 4.336   1.00 2.99  ? 248 SER A O    1  
ATOM 3829   C CB   . SER A 1 248 ? -11.315 -37.338 2.257   1.00 2.50  ? 248 SER A CB   1  
ATOM 3830   O OG   . SER A 1 248 ? -10.937 -38.563 2.871   1.00 2.82  ? 248 SER A OG   1  
ATOM 3831   H H    . SER A 1 248 ? -11.981 -34.912 1.762   1.00 2.05  ? 248 SER A H    1  
ATOM 3832   H HA   . SER A 1 248 ? -11.461 -36.382 4.174   1.00 2.70  ? 248 SER A HA   1  
ATOM 3833   H HB2  . SER A 1 248 ? -12.368 -37.363 2.034   1.00 2.55  ? 248 SER A HB2  1  
ATOM 3834   H HB3  . SER A 1 248 ? -10.758 -37.196 1.340   1.00 2.55  ? 248 SER A HB3  1  
ATOM 3835   H HG   . SER A 1 248 ? -10.067 -38.803 2.542   1.00 3.03  ? 248 SER A HG   1  
ATOM 3836   N N    . GLU A 1 249 ? -8.878  -35.396 2.415   1.00 2.48  ? 249 GLU A N    1  
ATOM 3837   C CA   . GLU A 1 249 ? -7.406  -35.196 2.490   1.00 2.68  ? 249 GLU A CA   1  
ATOM 3838   C C    . GLU A 1 249 ? -7.070  -34.326 3.700   1.00 2.88  ? 249 GLU A C    1  
ATOM 3839   O O    . GLU A 1 249 ? -6.043  -34.492 4.326   1.00 3.19  ? 249 GLU A O    1  
ATOM 3840   C CB   . GLU A 1 249 ? -6.910  -34.515 1.213   1.00 2.51  ? 249 GLU A CB   1  
ATOM 3841   C CG   . GLU A 1 249 ? -7.012  -35.495 0.043   1.00 2.79  ? 249 GLU A CG   1  
ATOM 3842   C CD   . GLU A 1 249 ? -6.546  -34.806 -1.242  1.00 2.93  ? 249 GLU A CD   1  
ATOM 3843   O OE1  . GLU A 1 249 ? -6.131  -33.662 -1.160  1.00 3.34  ? 249 GLU A OE1  1  
ATOM 3844   O OE2  . GLU A 1 249 ? -6.610  -35.435 -2.286  1.00 3.27  ? 249 GLU A OE2  1  
ATOM 3845   H H    . GLU A 1 249 ? -9.380  -35.050 1.647   1.00 2.25  ? 249 GLU A H    1  
ATOM 3846   H HA   . GLU A 1 249 ? -6.921  -36.157 2.595   1.00 2.89  ? 249 GLU A HA   1  
ATOM 3847   H HB2  . GLU A 1 249 ? -7.516  -33.643 1.010   1.00 2.41  ? 249 GLU A HB2  1  
ATOM 3848   H HB3  . GLU A 1 249 ? -5.880  -34.216 1.341   1.00 2.38  ? 249 GLU A HB3  1  
ATOM 3849   H HG2  . GLU A 1 249 ? -6.386  -36.354 0.239   1.00 3.00  ? 249 GLU A HG2  1  
ATOM 3850   H HG3  . GLU A 1 249 ? -8.036  -35.815 -0.073  1.00 3.17  ? 249 GLU A HG3  1  
ATOM 3851   N N    . LYS A 1 250 ? -7.922  -33.397 4.038   1.00 2.69  ? 250 LYS A N    1  
ATOM 3852   C CA   . LYS A 1 250 ? -7.628  -32.524 5.206   1.00 2.94  ? 250 LYS A CA   1  
ATOM 3853   C C    . LYS A 1 250 ? -7.490  -33.391 6.459   1.00 3.28  ? 250 LYS A C    1  
ATOM 3854   O O    . LYS A 1 250 ? -6.622  -33.174 7.279   1.00 3.61  ? 250 LYS A O    1  
ATOM 3855   C CB   . LYS A 1 250 ? -8.770  -31.511 5.384   1.00 2.81  ? 250 LYS A CB   1  
ATOM 3856   C CG   . LYS A 1 250 ? -8.532  -30.609 6.609   1.00 3.05  ? 250 LYS A CG   1  
ATOM 3857   C CD   . LYS A 1 250 ? -7.282  -29.741 6.415   1.00 3.04  ? 250 LYS A CD   1  
ATOM 3858   C CE   . LYS A 1 250 ? -7.272  -28.625 7.464   1.00 3.46  ? 250 LYS A CE   1  
ATOM 3859   N NZ   . LYS A 1 250 ? -8.517  -27.815 7.342   1.00 3.88  ? 250 LYS A NZ   1  
ATOM 3860   H H    . LYS A 1 250 ? -8.747  -33.271 3.524   1.00 2.47  ? 250 LYS A H    1  
ATOM 3861   H HA   . LYS A 1 250 ? -6.704  -32.003 5.026   1.00 3.07  ? 250 LYS A HA   1  
ATOM 3862   H HB2  . LYS A 1 250 ? -8.839  -30.895 4.499   1.00 2.84  ? 250 LYS A HB2  1  
ATOM 3863   H HB3  . LYS A 1 250 ? -9.700  -32.045 5.512   1.00 3.04  ? 250 LYS A HB3  1  
ATOM 3864   H HG2  . LYS A 1 250 ? -9.391  -29.968 6.744   1.00 3.44  ? 250 LYS A HG2  1  
ATOM 3865   H HG3  . LYS A 1 250 ? -8.409  -31.220 7.490   1.00 3.29  ? 250 LYS A HG3  1  
ATOM 3866   H HD2  . LYS A 1 250 ? -6.396  -30.346 6.540   1.00 3.17  ? 250 LYS A HD2  1  
ATOM 3867   H HD3  . LYS A 1 250 ? -7.290  -29.305 5.428   1.00 3.16  ? 250 LYS A HD3  1  
ATOM 3868   H HE2  . LYS A 1 250 ? -7.221  -29.061 8.451   1.00 3.77  ? 250 LYS A HE2  1  
ATOM 3869   H HE3  . LYS A 1 250 ? -6.412  -27.991 7.307   1.00 3.80  ? 250 LYS A HE3  1  
ATOM 3870   H HZ1  . LYS A 1 250 ? -9.044  -28.112 6.498   1.00 4.18  ? 250 LYS A HZ1  1  
ATOM 3871   H HZ2  . LYS A 1 250 ? -9.108  -27.958 8.185   1.00 4.15  ? 250 LYS A HZ2  1  
ATOM 3872   H HZ3  . LYS A 1 250 ? -8.266  -26.807 7.260   1.00 4.14  ? 250 LYS A HZ3  1  
ATOM 3873   N N    . ALA A 1 251 ? -8.326  -34.380 6.612   1.00 3.26  ? 251 ALA A N    1  
ATOM 3874   C CA   . ALA A 1 251 ? -8.218  -35.258 7.813   1.00 3.68  ? 251 ALA A CA   1  
ATOM 3875   C C    . ALA A 1 251 ? -6.839  -35.928 7.827   1.00 4.00  ? 251 ALA A C    1  
ATOM 3876   O O    . ALA A 1 251 ? -6.211  -36.060 8.859   1.00 4.43  ? 251 ALA A O    1  
ATOM 3877   C CB   . ALA A 1 251 ? -9.316  -36.324 7.767   1.00 3.68  ? 251 ALA A CB   1  
ATOM 3878   H H    . ALA A 1 251 ? -9.017  -34.552 5.938   1.00 3.03  ? 251 ALA A H    1  
ATOM 3879   H HA   . ALA A 1 251 ? -8.333  -34.661 8.704   1.00 3.85  ? 251 ALA A HA   1  
ATOM 3880   H HB1  . ALA A 1 251 ? -10.222 -35.890 7.370   1.00 3.78  ? 251 ALA A HB1  1  
ATOM 3881   H HB2  . ALA A 1 251 ? -9.005  -37.143 7.135   1.00 3.91  ? 251 ALA A HB2  1  
ATOM 3882   H HB3  . ALA A 1 251 ? -9.502  -36.692 8.765   1.00 3.80  ? 251 ALA A HB3  1  
ATOM 3883   N N    . GLU A 1 252 ? -6.364  -36.341 6.683   1.00 3.92  ? 252 GLU A N    1  
ATOM 3884   C CA   . GLU A 1 252 ? -5.024  -36.994 6.609   1.00 4.33  ? 252 GLU A CA   1  
ATOM 3885   C C    . GLU A 1 252 ? -5.017  -38.264 7.471   1.00 4.64  ? 252 GLU A C    1  
ATOM 3886   O O    . GLU A 1 252 ? -3.981  -38.774 7.849   1.00 5.15  ? 252 GLU A O    1  
ATOM 3887   C CB   . GLU A 1 252 ? -3.961  -36.007 7.108   1.00 4.36  ? 252 GLU A CB   1  
ATOM 3888   C CG   . GLU A 1 252 ? -2.583  -36.418 6.583   1.00 4.72  ? 252 GLU A CG   1  
ATOM 3889   C CD   . GLU A 1 252 ? -1.536  -35.416 7.068   1.00 5.00  ? 252 GLU A CD   1  
ATOM 3890   O OE1  . GLU A 1 252 ? -1.927  -34.384 7.587   1.00 5.42  ? 252 GLU A OE1  1  
ATOM 3891   O OE2  . GLU A 1 252 ? -0.360  -35.697 6.907   1.00 5.06  ? 252 GLU A OE2  1  
ATOM 3892   H H    . GLU A 1 252 ? -6.889  -36.215 5.867   1.00 3.67  ? 252 GLU A H    1  
ATOM 3893   H HA   . GLU A 1 252 ? -4.817  -37.260 5.583   1.00 4.57  ? 252 GLU A HA   1  
ATOM 3894   H HB2  . GLU A 1 252 ? -4.202  -35.017 6.752   1.00 4.28  ? 252 GLU A HB2  1  
ATOM 3895   H HB3  . GLU A 1 252 ? -3.946  -36.006 8.188   1.00 4.57  ? 252 GLU A HB3  1  
ATOM 3896   H HG2  . GLU A 1 252 ? -2.336  -37.401 6.950   1.00 5.03  ? 252 GLU A HG2  1  
ATOM 3897   H HG3  . GLU A 1 252 ? -2.597  -36.427 5.503   1.00 4.78  ? 252 GLU A HG3  1  
ATOM 3898   N N    . LEU A 1 253 ? -6.172  -38.784 7.770   1.00 4.50  ? 253 LEU A N    1  
ATOM 3899   C CA   . LEU A 1 253 ? -6.248  -40.023 8.593   1.00 5.00  ? 253 LEU A CA   1  
ATOM 3900   C C    . LEU A 1 253 ? -5.721  -41.208 7.778   1.00 5.53  ? 253 LEU A C    1  
ATOM 3901   O O    . LEU A 1 253 ? -5.275  -42.198 8.324   1.00 6.10  ? 253 LEU A O    1  
ATOM 3902   C CB   . LEU A 1 253 ? -7.705  -40.281 8.986   1.00 4.97  ? 253 LEU A CB   1  
ATOM 3903   C CG   . LEU A 1 253 ? -8.175  -39.219 9.991   1.00 5.34  ? 253 LEU A CG   1  
ATOM 3904   C CD1  . LEU A 1 253 ? -9.687  -39.357 10.191  1.00 5.76  ? 253 LEU A CD1  1  
ATOM 3905   C CD2  . LEU A 1 253 ? -7.454  -39.394 11.344  1.00 5.62  ? 253 LEU A CD2  1  
ATOM 3906   H H    . LEU A 1 253 ? -6.994  -38.362 7.447   1.00 4.17  ? 253 LEU A H    1  
ATOM 3907   H HA   . LEU A 1 253 ? -5.644  -39.907 9.479   1.00 5.22  ? 253 LEU A HA   1  
ATOM 3908   H HB2  . LEU A 1 253 ? -8.326  -40.233 8.102   1.00 5.01  ? 253 LEU A HB2  1  
ATOM 3909   H HB3  . LEU A 1 253 ? -7.792  -41.261 9.430   1.00 5.02  ? 253 LEU A HB3  1  
ATOM 3910   H HG   . LEU A 1 253 ? -7.958  -38.238 9.594   1.00 5.57  ? 253 LEU A HG   1  
ATOM 3911   H HD11 . LEU A 1 253 ? -9.924  -40.375 10.463  1.00 5.87  ? 253 LEU A HD11 1  
ATOM 3912   H HD12 . LEU A 1 253 ? -10.008 -38.691 10.977  1.00 5.96  ? 253 LEU A HD12 1  
ATOM 3913   H HD13 . LEU A 1 253 ? -10.195 -39.102 9.273   1.00 6.11  ? 253 LEU A HD13 1  
ATOM 3914   H HD21 . LEU A 1 253 ? -7.294  -40.445 11.543  1.00 5.87  ? 253 LEU A HD21 1  
ATOM 3915   H HD22 . LEU A 1 253 ? -6.503  -38.885 11.315  1.00 5.81  ? 253 LEU A HD22 1  
ATOM 3916   H HD23 . LEU A 1 253 ? -8.056  -38.968 12.134  1.00 5.78  ? 253 LEU A HD23 1  
ATOM 3917   N N    . ALA A 1 254 ? -5.783  -41.116 6.475   1.00 5.50  ? 254 ALA A N    1  
ATOM 3918   C CA   . ALA A 1 254 ? -5.304  -42.236 5.607   1.00 6.24  ? 254 ALA A CA   1  
ATOM 3919   C C    . ALA A 1 254 ? -3.986  -42.807 6.142   1.00 6.70  ? 254 ALA A C    1  
ATOM 3920   O O    . ALA A 1 254 ? -3.627  -43.931 5.854   1.00 7.37  ? 254 ALA A O    1  
ATOM 3921   C CB   . ALA A 1 254 ? -5.082  -41.715 4.185   1.00 6.30  ? 254 ALA A CB   1  
ATOM 3922   H H    . ALA A 1 254 ? -6.161  -40.313 6.061   1.00 5.10  ? 254 ALA A H    1  
ATOM 3923   H HA   . ALA A 1 254 ? -6.049  -43.018 5.587   1.00 6.59  ? 254 ALA A HA   1  
ATOM 3924   H HB1  . ALA A 1 254 ? -5.927  -41.114 3.884   1.00 6.48  ? 254 ALA A HB1  1  
ATOM 3925   H HB2  . ALA A 1 254 ? -4.186  -41.113 4.160   1.00 6.32  ? 254 ALA A HB2  1  
ATOM 3926   H HB3  . ALA A 1 254 ? -4.974  -42.549 3.508   1.00 6.42  ? 254 ALA A HB3  1  
ATOM 3927   N N    . LYS A 1 255 ? -3.264  -42.050 6.922   1.00 6.47  ? 255 LYS A N    1  
ATOM 3928   C CA   . LYS A 1 255 ? -1.978  -42.565 7.471   1.00 7.08  ? 255 LYS A CA   1  
ATOM 3929   C C    . LYS A 1 255 ? -2.265  -43.610 8.546   1.00 7.46  ? 255 LYS A C    1  
ATOM 3930   O O    . LYS A 1 255 ? -3.358  -43.694 9.070   1.00 8.01  ? 255 LYS A O    1  
ATOM 3931   C CB   . LYS A 1 255 ? -1.175  -41.412 8.078   1.00 6.96  ? 255 LYS A CB   1  
ATOM 3932   C CG   . LYS A 1 255 ? -0.639  -40.519 6.959   1.00 7.15  ? 255 LYS A CG   1  
ATOM 3933   C CD   . LYS A 1 255 ? 0.164   -39.368 7.565   1.00 7.28  ? 255 LYS A CD   1  
ATOM 3934   C CE   . LYS A 1 255 ? 0.858   -38.589 6.447   1.00 7.65  ? 255 LYS A CE   1  
ATOM 3935   N NZ   . LYS A 1 255 ? -0.155  -38.143 5.448   1.00 8.01  ? 255 LYS A NZ   1  
ATOM 3936   H H    . LYS A 1 255 ? -3.568  -41.149 7.151   1.00 6.00  ? 255 LYS A H    1  
ATOM 3937   H HA   . LYS A 1 255 ? -1.407  -43.019 6.674   1.00 7.51  ? 255 LYS A HA   1  
ATOM 3938   H HB2  . LYS A 1 255 ? -1.812  -40.832 8.729   1.00 6.73  ? 255 LYS A HB2  1  
ATOM 3939   H HB3  . LYS A 1 255 ? -0.346  -41.810 8.644   1.00 7.26  ? 255 LYS A HB3  1  
ATOM 3940   H HG2  . LYS A 1 255 ? -0.002  -41.101 6.309   1.00 7.56  ? 255 LYS A HG2  1  
ATOM 3941   H HG3  . LYS A 1 255 ? -1.465  -40.119 6.390   1.00 7.05  ? 255 LYS A HG3  1  
ATOM 3942   H HD2  . LYS A 1 255 ? -0.503  -38.710 8.105   1.00 7.13  ? 255 LYS A HD2  1  
ATOM 3943   H HD3  . LYS A 1 255 ? 0.906   -39.763 8.242   1.00 7.55  ? 255 LYS A HD3  1  
ATOM 3944   H HE2  . LYS A 1 255 ? 1.355   -37.727 6.864   1.00 7.78  ? 255 LYS A HE2  1  
ATOM 3945   H HE3  . LYS A 1 255 ? 1.584   -39.225 5.963   1.00 7.84  ? 255 LYS A HE3  1  
ATOM 3946   H HZ1  . LYS A 1 255 ? -1.094  -38.116 5.895   1.00 8.09  ? 255 LYS A HZ1  1  
ATOM 3947   H HZ2  . LYS A 1 255 ? 0.094   -37.195 5.103   1.00 8.18  ? 255 LYS A HZ2  1  
ATOM 3948   H HZ3  . LYS A 1 255 ? -0.171  -38.807 4.650   1.00 8.30  ? 255 LYS A HZ3  1  
ATOM 3949   N N    . LEU A 1 256 ? -1.291  -44.412 8.880   1.00 7.33  ? 256 LEU A N    1  
ATOM 3950   C CA   . LEU A 1 256 ? -1.514  -45.451 9.921   1.00 7.85  ? 256 LEU A CA   1  
ATOM 3951   C C    . LEU A 1 256 ? -1.938  -44.761 11.215  1.00 8.47  ? 256 LEU A C    1  
ATOM 3952   O O    . LEU A 1 256 ? -2.762  -45.261 11.954  1.00 9.05  ? 256 LEU A O    1  
ATOM 3953   C CB   . LEU A 1 256 ? -0.213  -46.239 10.151  1.00 7.76  ? 256 LEU A CB   1  
ATOM 3954   C CG   . LEU A 1 256 ? -0.039  -47.291 9.048   1.00 7.82  ? 256 LEU A CG   1  
ATOM 3955   C CD1  . LEU A 1 256 ? 0.247   -46.597 7.714   1.00 8.10  ? 256 LEU A CD1  1  
ATOM 3956   C CD2  . LEU A 1 256 ? 1.132   -48.216 9.399   1.00 8.05  ? 256 LEU A CD2  1  
ATOM 3957   H H    . LEU A 1 256 ? -0.416  -44.330 8.445   1.00 7.00  ? 256 LEU A H    1  
ATOM 3958   H HA   . LEU A 1 256 ? -2.297  -46.121 9.599   1.00 8.05  ? 256 LEU A HA   1  
ATOM 3959   H HB2  . LEU A 1 256 ? 0.626   -45.558 10.140  1.00 7.62  ? 256 LEU A HB2  1  
ATOM 3960   H HB3  . LEU A 1 256 ? -0.258  -46.734 11.111  1.00 8.08  ? 256 LEU A HB3  1  
ATOM 3961   H HG   . LEU A 1 256 ? -0.942  -47.876 8.961   1.00 7.87  ? 256 LEU A HG   1  
ATOM 3962   H HD11 . LEU A 1 256 ? 0.991   -45.826 7.857   1.00 8.36  ? 256 LEU A HD11 1  
ATOM 3963   H HD12 . LEU A 1 256 ? 0.613   -47.321 7.003   1.00 8.13  ? 256 LEU A HD12 1  
ATOM 3964   H HD13 . LEU A 1 256 ? -0.663  -46.154 7.339   1.00 8.28  ? 256 LEU A HD13 1  
ATOM 3965   H HD21 . LEU A 1 256 ? 2.005   -47.623 9.630   1.00 8.18  ? 256 LEU A HD21 1  
ATOM 3966   H HD22 . LEU A 1 256 ? 0.870   -48.820 10.255  1.00 8.28  ? 256 LEU A HD22 1  
ATOM 3967   H HD23 . LEU A 1 256 ? 1.347   -48.859 8.558   1.00 8.17  ? 256 LEU A HD23 1  
ATOM 3968   N N    . LYS A 1 257 ? -1.393  -43.606 11.489  1.00 8.53  ? 257 LYS A N    1  
ATOM 3969   C CA   . LYS A 1 257 ? -1.777  -42.874 12.732  1.00 9.34  ? 257 LYS A CA   1  
ATOM 3970   C C    . LYS A 1 257 ? -1.649  -41.369 12.497  1.00 9.86  ? 257 LYS A C    1  
ATOM 3971   O O    . LYS A 1 257 ? -0.823  -40.917 11.729  1.00 10.56 ? 257 LYS A O    1  
ATOM 3972   C CB   . LYS A 1 257 ? -0.861  -43.305 13.881  1.00 9.48  ? 257 LYS A CB   1  
ATOM 3973   C CG   . LYS A 1 257 ? 0.601   -43.045 13.511  1.00 9.24  ? 257 LYS A CG   1  
ATOM 3974   C CD   . LYS A 1 257 ? 1.499   -43.508 14.662  1.00 9.67  ? 257 LYS A CD   1  
ATOM 3975   C CE   . LYS A 1 257 ? 2.966   -43.255 14.310  1.00 9.79  ? 257 LYS A CE   1  
ATOM 3976   N NZ   . LYS A 1 257 ? 3.271   -41.804 14.457  1.00 10.04 ? 257 LYS A NZ   1  
ATOM 3977   H H    . LYS A 1 257 ? -0.740  -43.214 10.870  1.00 8.16  ? 257 LYS A H    1  
ATOM 3978   H HA   . LYS A 1 257 ? -2.803  -43.105 12.986  1.00 9.65  ? 257 LYS A HA   1  
ATOM 3979   H HB2  . LYS A 1 257 ? -1.112  -42.745 14.769  1.00 9.27  ? 257 LYS A HB2  1  
ATOM 3980   H HB3  . LYS A 1 257 ? -0.998  -44.360 14.072  1.00 10.15 ? 257 LYS A HB3  1  
ATOM 3981   H HG2  . LYS A 1 257 ? 0.848   -43.595 12.614  1.00 9.55  ? 257 LYS A HG2  1  
ATOM 3982   H HG3  . LYS A 1 257 ? 0.748   -41.990 13.342  1.00 8.62  ? 257 LYS A HG3  1  
ATOM 3983   H HD2  . LYS A 1 257 ? 1.244   -42.959 15.558  1.00 9.81  ? 257 LYS A HD2  1  
ATOM 3984   H HD3  . LYS A 1 257 ? 1.349   -44.563 14.831  1.00 9.97  ? 257 LYS A HD3  1  
ATOM 3985   H HE2  . LYS A 1 257 ? 3.597   -43.825 14.976  1.00 9.79  ? 257 LYS A HE2  1  
ATOM 3986   H HE3  . LYS A 1 257 ? 3.151   -43.561 13.291  1.00 9.95  ? 257 LYS A HE3  1  
ATOM 3987   H HZ1  . LYS A 1 257 ? 2.453   -41.244 14.147  1.00 10.27 ? 257 LYS A HZ1  1  
ATOM 3988   H HZ2  . LYS A 1 257 ? 3.476   -41.592 15.455  1.00 10.18 ? 257 LYS A HZ2  1  
ATOM 3989   H HZ3  . LYS A 1 257 ? 4.099   -41.564 13.874  1.00 10.08 ? 257 LYS A HZ3  1  
ATOM 3990   N N    . ASP A 1 258 ? -2.474  -40.589 13.152  1.00 9.69  ? 258 ASP A N    1  
ATOM 3991   C CA   . ASP A 1 258 ? -2.429  -39.101 12.980  1.00 10.39 ? 258 ASP A CA   1  
ATOM 3992   C C    . ASP A 1 258 ? -2.397  -38.434 14.356  1.00 10.68 ? 258 ASP A C    1  
ATOM 3993   O O    . ASP A 1 258 ? -3.075  -37.454 14.596  1.00 11.32 ? 258 ASP A O    1  
ATOM 3994   C CB   . ASP A 1 258 ? -3.674  -38.639 12.220  1.00 10.40 ? 258 ASP A CB   1  
ATOM 3995   C CG   . ASP A 1 258 ? -3.489  -37.186 11.778  1.00 10.43 ? 258 ASP A CG   1  
ATOM 3996   O OD1  . ASP A 1 258 ? -2.570  -36.551 12.268  1.00 10.57 ? 258 ASP A OD1  1  
ATOM 3997   O OD2  . ASP A 1 258 ? -4.268  -36.734 10.955  1.00 10.51 ? 258 ASP A OD2  1  
ATOM 3998   H H    . ASP A 1 258 ? -3.135  -40.988 13.756  1.00 9.22  ? 258 ASP A H    1  
ATOM 3999   H HA   . ASP A 1 258 ? -1.545  -38.815 12.427  1.00 10.89 ? 258 ASP A HA   1  
ATOM 4000   H HB2  . ASP A 1 258 ? -3.817  -39.265 11.351  1.00 9.98  ? 258 ASP A HB2  1  
ATOM 4001   H HB3  . ASP A 1 258 ? -4.537  -38.712 12.863  1.00 11.00 ? 258 ASP A HB3  1  
ATOM 4002   N N    . ARG A 1 259 ? -1.615  -38.956 15.258  1.00 10.38 ? 259 ARG A N    1  
ATOM 4003   C CA   . ARG A 1 259 ? -1.534  -38.354 16.618  1.00 10.85 ? 259 ARG A CA   1  
ATOM 4004   C C    . ARG A 1 259 ? -2.946  -38.180 17.183  1.00 11.04 ? 259 ARG A C    1  
ATOM 4005   O O    . ARG A 1 259 ? -3.502  -37.107 17.016  1.00 11.20 ? 259 ARG A O    1  
ATOM 4006   C CB   . ARG A 1 259 ? -0.845  -36.989 16.531  1.00 10.75 ? 259 ARG A CB   1  
ATOM 4007   C CG   . ARG A 1 259 ? -0.643  -36.421 17.937  1.00 11.03 ? 259 ARG A CG   1  
ATOM 4008   C CD   . ARG A 1 259 ? 0.045   -35.057 17.840  1.00 11.23 ? 259 ARG A CD   1  
ATOM 4009   N NE   . ARG A 1 259 ? -0.899  -34.070 17.242  1.00 11.63 ? 259 ARG A NE   1  
ATOM 4010   C CZ   . ARG A 1 259 ? -0.644  -32.791 17.306  1.00 11.88 ? 259 ARG A CZ   1  
ATOM 4011   N NH1  . ARG A 1 259 ? 0.445   -32.366 17.886  1.00 11.80 ? 259 ARG A NH1  1  
ATOM 4012   N NH2  . ARG A 1 259 ? -1.479  -31.937 16.782  1.00 12.42 ? 259 ARG A NH2  1  
ATOM 4013   O OXT  . ARG A 1 259 ? -3.448  -39.123 17.772  1.00 11.20 ? 259 ARG A OXT  1  
ATOM 4014   H H    . ARG A 1 259 ? -1.075  -39.745 15.040  1.00 9.95  ? 259 ARG A H    1  
ATOM 4015   H HA   . ARG A 1 259 ? -0.965  -39.003 17.267  1.00 11.34 ? 259 ARG A HA   1  
ATOM 4016   H HB2  . ARG A 1 259 ? 0.114   -37.100 16.045  1.00 10.61 ? 259 ARG A HB2  1  
ATOM 4017   H HB3  . ARG A 1 259 ? -1.462  -36.312 15.958  1.00 10.87 ? 259 ARG A HB3  1  
ATOM 4018   H HG2  . ARG A 1 259 ? -1.603  -36.310 18.424  1.00 11.30 ? 259 ARG A HG2  1  
ATOM 4019   H HG3  . ARG A 1 259 ? -0.024  -37.094 18.512  1.00 11.06 ? 259 ARG A HG3  1  
ATOM 4020   H HD2  . ARG A 1 259 ? 0.335   -34.727 18.825  1.00 11.30 ? 259 ARG A HD2  1  
ATOM 4021   H HD3  . ARG A 1 259 ? 0.925   -35.141 17.215  1.00 11.24 ? 259 ARG A HD3  1  
ATOM 4022   H HE   . ARG A 1 259 ? -1.716  -34.383 16.801  1.00 11.85 ? 259 ARG A HE   1  
ATOM 4023   H HH11 . ARG A 1 259 ? 1.088   -33.020 18.283  1.00 11.53 ? 259 ARG A HH11 1  
ATOM 4024   H HH12 . ARG A 1 259 ? 0.635   -31.384 17.935  1.00 12.13 ? 259 ARG A HH12 1  
ATOM 4025   H HH21 . ARG A 1 259 ? -2.312  -32.262 16.333  1.00 12.63 ? 259 ARG A HH21 1  
ATOM 4026   H HH22 . ARG A 1 259 ? -1.287  -30.956 16.830  1.00 12.74 ? 259 ARG A HH22 1  
ATOM 4027   N N    . MET B 2 1   ? 23.774  23.261  14.021  1.00 0.00  ? 301 MET B N    1  
ATOM 4028   C CA   . MET B 2 1   ? 23.331  22.100  13.199  1.00 0.00  ? 301 MET B CA   1  
ATOM 4029   C C    . MET B 2 1   ? 23.570  20.806  13.983  1.00 0.00  ? 301 MET B C    1  
ATOM 4030   O O    . MET B 2 1   ? 24.411  20.744  14.856  1.00 0.00  ? 301 MET B O    1  
ATOM 4031   C CB   . MET B 2 1   ? 24.136  22.075  11.896  1.00 0.00  ? 301 MET B CB   1  
ATOM 4032   C CG   . MET B 2 1   ? 23.480  21.128  10.884  1.00 0.00  ? 301 MET B CG   1  
ATOM 4033   S SD   . MET B 2 1   ? 24.264  21.369  9.269   1.00 0.00  ? 301 MET B SD   1  
ATOM 4034   C CE   . MET B 2 1   ? 23.197  20.271  8.304   1.00 0.00  ? 301 MET B CE   1  
ATOM 4035   H H1   . MET B 2 1   ? 24.718  23.066  14.414  1.00 0.00  ? 301 MET B H1   1  
ATOM 4036   H H2   . MET B 2 1   ? 23.816  24.111  13.426  1.00 0.00  ? 301 MET B H2   1  
ATOM 4037   H H3   . MET B 2 1   ? 23.099  23.415  14.797  1.00 0.00  ? 301 MET B H3   1  
ATOM 4038   H HA   . MET B 2 1   ? 22.279  22.198  12.974  1.00 0.00  ? 301 MET B HA   1  
ATOM 4039   H HB2  . MET B 2 1   ? 24.173  23.071  11.481  1.00 0.00  ? 301 MET B HB2  1  
ATOM 4040   H HB3  . MET B 2 1   ? 25.139  21.735  12.104  1.00 0.00  ? 301 MET B HB3  1  
ATOM 4041   H HG2  . MET B 2 1   ? 23.612  20.102  11.201  1.00 0.00  ? 301 MET B HG2  1  
ATOM 4042   H HG3  . MET B 2 1   ? 22.425  21.348  10.809  1.00 0.00  ? 301 MET B HG3  1  
ATOM 4043   H HE1  . MET B 2 1   ? 22.257  20.135  8.813   1.00 0.00  ? 301 MET B HE1  1  
ATOM 4044   H HE2  . MET B 2 1   ? 23.016  20.711  7.332   1.00 0.00  ? 301 MET B HE2  1  
ATOM 4045   H HE3  . MET B 2 1   ? 23.684  19.313  8.185   1.00 0.00  ? 301 MET B HE3  1  
ATOM 4046   N N    . PHE B 2 2   ? 22.844  19.770  13.665  1.00 0.00  ? 302 PHE B N    1  
ATOM 4047   C CA   . PHE B 2 2   ? 23.037  18.473  14.381  1.00 0.00  ? 302 PHE B CA   1  
ATOM 4048   C C    . PHE B 2 2   ? 22.603  17.329  13.463  1.00 0.00  ? 302 PHE B C    1  
ATOM 4049   O O    . PHE B 2 2   ? 21.747  17.497  12.618  1.00 0.00  ? 302 PHE B O    1  
ATOM 4050   C CB   . PHE B 2 2   ? 22.206  18.462  15.667  1.00 0.00  ? 302 PHE B CB   1  
ATOM 4051   C CG   . PHE B 2 2   ? 22.521  17.212  16.455  1.00 0.00  ? 302 PHE B CG   1  
ATOM 4052   C CD1  . PHE B 2 2   ? 23.597  17.198  17.351  1.00 0.00  ? 302 PHE B CD1  1  
ATOM 4053   C CD2  . PHE B 2 2   ? 21.738  16.068  16.286  1.00 0.00  ? 302 PHE B CD2  1  
ATOM 4054   C CE1  . PHE B 2 2   ? 23.888  16.036  18.078  1.00 0.00  ? 302 PHE B CE1  1  
ATOM 4055   C CE2  . PHE B 2 2   ? 22.026  14.906  17.013  1.00 0.00  ? 302 PHE B CE2  1  
ATOM 4056   C CZ   . PHE B 2 2   ? 23.102  14.889  17.908  1.00 0.00  ? 302 PHE B CZ   1  
ATOM 4057   H H    . PHE B 2 2   ? 22.186  19.849  12.940  1.00 0.00  ? 302 PHE B H    1  
ATOM 4058   H HA   . PHE B 2 2   ? 24.082  18.351  14.630  1.00 0.00  ? 302 PHE B HA   1  
ATOM 4059   H HB2  . PHE B 2 2   ? 22.444  19.333  16.259  1.00 0.00  ? 302 PHE B HB2  1  
ATOM 4060   H HB3  . PHE B 2 2   ? 21.156  18.472  15.417  1.00 0.00  ? 302 PHE B HB3  1  
ATOM 4061   H HD1  . PHE B 2 2   ? 24.203  18.082  17.482  1.00 0.00  ? 302 PHE B HD1  1  
ATOM 4062   H HD2  . PHE B 2 2   ? 20.908  16.084  15.600  1.00 0.00  ? 302 PHE B HD2  1  
ATOM 4063   H HE1  . PHE B 2 2   ? 24.717  16.026  18.769  1.00 0.00  ? 302 PHE B HE1  1  
ATOM 4064   H HE2  . PHE B 2 2   ? 21.420  14.021  16.881  1.00 0.00  ? 302 PHE B HE2  1  
ATOM 4065   H HZ   . PHE B 2 2   ? 23.328  13.994  18.468  1.00 0.00  ? 302 PHE B HZ   1  
ATOM 4066   N N    . GLN B 2 3   ? 23.187  16.168  13.608  1.00 0.00  ? 303 GLN B N    1  
ATOM 4067   C CA   . GLN B 2 3   ? 22.802  15.029  12.721  1.00 0.00  ? 303 GLN B CA   1  
ATOM 4068   C C    . GLN B 2 3   ? 22.951  13.705  13.469  1.00 0.00  ? 303 GLN B C    1  
ATOM 4069   O O    . GLN B 2 3   ? 23.649  13.607  14.459  1.00 0.00  ? 303 GLN B O    1  
ATOM 4070   C CB   . GLN B 2 3   ? 23.703  15.021  11.480  1.00 0.00  ? 303 GLN B CB   1  
ATOM 4071   C CG   . GLN B 2 3   ? 25.163  14.889  11.914  1.00 0.00  ? 303 GLN B CG   1  
ATOM 4072   C CD   . GLN B 2 3   ? 26.079  14.967  10.692  1.00 0.00  ? 303 GLN B CD   1  
ATOM 4073   O OE1  . GLN B 2 3   ? 25.684  15.445  9.646   1.00 0.00  ? 303 GLN B OE1  1  
ATOM 4074   N NE2  . GLN B 2 3   ? 27.299  14.513  10.784  1.00 0.00  ? 303 GLN B NE2  1  
ATOM 4075   H H    . GLN B 2 3   ? 23.886  16.053  14.285  1.00 0.00  ? 303 GLN B H    1  
ATOM 4076   H HA   . GLN B 2 3   ? 21.774  15.145  12.413  1.00 0.00  ? 303 GLN B HA   1  
ATOM 4077   H HB2  . GLN B 2 3   ? 23.436  14.186  10.848  1.00 0.00  ? 303 GLN B HB2  1  
ATOM 4078   H HB3  . GLN B 2 3   ? 23.573  15.943  10.932  1.00 0.00  ? 303 GLN B HB3  1  
ATOM 4079   H HG2  . GLN B 2 3   ? 25.407  15.688  12.597  1.00 0.00  ? 303 GLN B HG2  1  
ATOM 4080   H HG3  . GLN B 2 3   ? 25.307  13.939  12.406  1.00 0.00  ? 303 GLN B HG3  1  
ATOM 4081   H HE21 . GLN B 2 3   ? 27.615  14.130  11.630  1.00 0.00  ? 303 GLN B HE21 1  
ATOM 4082   H HE22 . GLN B 2 3   ? 27.899  14.558  10.012  1.00 0.00  ? 303 GLN B HE22 1  
ATOM 4083   N N    . GLN B 2 4   ? 22.291  12.684  12.991  1.00 0.00  ? 304 GLN B N    1  
ATOM 4084   C CA   . GLN B 2 4   ? 22.373  11.351  13.654  1.00 0.00  ? 304 GLN B CA   1  
ATOM 4085   C C    . GLN B 2 4   ? 22.139  10.253  12.611  1.00 0.00  ? 304 GLN B C    1  
ATOM 4086   O O    . GLN B 2 4   ? 21.413  10.448  11.658  1.00 0.00  ? 304 GLN B O    1  
ATOM 4087   C CB   . GLN B 2 4   ? 21.293  11.267  14.737  1.00 0.00  ? 304 GLN B CB   1  
ATOM 4088   C CG   . GLN B 2 4   ? 21.402  9.937   15.492  1.00 0.00  ? 304 GLN B CG   1  
ATOM 4089   C CD   . GLN B 2 4   ? 22.754  9.862   16.205  1.00 0.00  ? 304 GLN B CD   1  
ATOM 4090   O OE1  . GLN B 2 4   ? 23.189  10.823  16.807  1.00 0.00  ? 304 GLN B OE1  1  
ATOM 4091   N NE2  . GLN B 2 4   ? 23.438  8.752   16.165  1.00 0.00  ? 304 GLN B NE2  1  
ATOM 4092   H H    . GLN B 2 4   ? 21.744  12.799  12.187  1.00 0.00  ? 304 GLN B H    1  
ATOM 4093   H HA   . GLN B 2 4   ? 23.345  11.231  14.101  1.00 0.00  ? 304 GLN B HA   1  
ATOM 4094   H HB2  . GLN B 2 4   ? 21.419  12.084  15.433  1.00 0.00  ? 304 GLN B HB2  1  
ATOM 4095   H HB3  . GLN B 2 4   ? 20.319  11.337  14.277  1.00 0.00  ? 304 GLN B HB3  1  
ATOM 4096   H HG2  . GLN B 2 4   ? 20.606  9.874   16.221  1.00 0.00  ? 304 GLN B HG2  1  
ATOM 4097   H HG3  . GLN B 2 4   ? 21.317  9.116   14.796  1.00 0.00  ? 304 GLN B HG3  1  
ATOM 4098   H HE21 . GLN B 2 4   ? 23.086  7.975   15.684  1.00 0.00  ? 304 GLN B HE21 1  
ATOM 4099   H HE22 . GLN B 2 4   ? 24.307  8.697   16.615  1.00 0.00  ? 304 GLN B HE22 1  
ATOM 4100   N N    . GLU B 2 5   ? 22.740  9.097   12.789  1.00 0.00  ? 305 GLU B N    1  
ATOM 4101   C CA   . GLU B 2 5   ? 22.549  7.973   11.814  1.00 0.00  ? 305 GLU B CA   1  
ATOM 4102   C C    . GLU B 2 5   ? 21.721  6.867   12.461  1.00 0.00  ? 305 GLU B C    1  
ATOM 4103   O O    . GLU B 2 5   ? 21.985  6.459   13.575  1.00 0.00  ? 305 GLU B O    1  
ATOM 4104   C CB   . GLU B 2 5   ? 23.896  7.379   11.421  1.00 0.00  ? 305 GLU B CB   1  
ATOM 4105   C CG   . GLU B 2 5   ? 24.685  8.377   10.576  1.00 0.00  ? 305 GLU B CG   1  
ATOM 4106   C CD   . GLU B 2 5   ? 26.071  7.801   10.284  1.00 0.00  ? 305 GLU B CD   1  
ATOM 4107   O OE1  . GLU B 2 5   ? 26.309  6.666   10.664  1.00 0.00  ? 305 GLU B OE1  1  
ATOM 4108   O OE2  . GLU B 2 5   ? 26.869  8.501   9.685   1.00 0.00  ? 305 GLU B OE2  1  
ATOM 4109   H H    . GLU B 2 5   ? 23.309  8.964   13.563  1.00 0.00  ? 305 GLU B H    1  
ATOM 4110   H HA   . GLU B 2 5   ? 22.046  8.331   10.939  1.00 0.00  ? 305 GLU B HA   1  
ATOM 4111   H HB2  . GLU B 2 5   ? 24.456  7.135   12.312  1.00 0.00  ? 305 GLU B HB2  1  
ATOM 4112   H HB3  . GLU B 2 5   ? 23.726  6.481   10.846  1.00 0.00  ? 305 GLU B HB3  1  
ATOM 4113   H HG2  . GLU B 2 5   ? 24.162  8.554   9.648   1.00 0.00  ? 305 GLU B HG2  1  
ATOM 4114   H HG3  . GLU B 2 5   ? 24.789  9.306   11.117  1.00 0.00  ? 305 GLU B HG3  1  
ATOM 4115   N N    . VAL B 2 6   ? 20.693  6.410   11.787  1.00 0.00  ? 306 VAL B N    1  
ATOM 4116   C CA   . VAL B 2 6   ? 19.809  5.352   12.391  1.00 0.00  ? 306 VAL B CA   1  
ATOM 4117   C C    . VAL B 2 6   ? 19.544  4.196   11.414  1.00 0.00  ? 306 VAL B C    1  
ATOM 4118   O O    . VAL B 2 6   ? 19.060  4.377   10.312  1.00 0.00  ? 306 VAL B O    1  
ATOM 4119   C CB   . VAL B 2 6   ? 18.488  6.017   12.816  1.00 0.00  ? 306 VAL B CB   1  
ATOM 4120   C CG1  . VAL B 2 6   ? 18.025  6.980   11.723  1.00 0.00  ? 306 VAL B CG1  1  
ATOM 4121   C CG2  . VAL B 2 6   ? 17.402  4.961   13.058  1.00 0.00  ? 306 VAL B CG2  1  
ATOM 4122   H H    . VAL B 2 6   ? 20.482  6.813   10.912  1.00 0.00  ? 306 VAL B H    1  
ATOM 4123   H HA   . VAL B 2 6   ? 20.284  4.942   13.272  1.00 0.00  ? 306 VAL B HA   1  
ATOM 4124   H HB   . VAL B 2 6   ? 18.653  6.574   13.729  1.00 0.00  ? 306 VAL B HB   1  
ATOM 4125   H HG11 . VAL B 2 6   ? 17.939  6.448   10.788  1.00 0.00  ? 306 VAL B HG11 1  
ATOM 4126   H HG12 . VAL B 2 6   ? 17.065  7.394   11.993  1.00 0.00  ? 306 VAL B HG12 1  
ATOM 4127   H HG13 . VAL B 2 6   ? 18.744  7.779   11.617  1.00 0.00  ? 306 VAL B HG13 1  
ATOM 4128   H HG21 . VAL B 2 6   ? 17.805  4.161   13.662  1.00 0.00  ? 306 VAL B HG21 1  
ATOM 4129   H HG22 . VAL B 2 6   ? 16.568  5.415   13.570  1.00 0.00  ? 306 VAL B HG22 1  
ATOM 4130   H HG23 . VAL B 2 6   ? 17.067  4.563   12.111  1.00 0.00  ? 306 VAL B HG23 1  
ATOM 4131   N N    . THR B 2 7   ? 19.912  3.006   11.828  1.00 0.00  ? 307 THR B N    1  
ATOM 4132   C CA   . THR B 2 7   ? 19.746  1.798   10.965  1.00 0.00  ? 307 THR B CA   1  
ATOM 4133   C C    . THR B 2 7   ? 18.278  1.358   10.933  1.00 0.00  ? 307 THR B C    1  
ATOM 4134   O O    . THR B 2 7   ? 17.745  0.835   11.891  1.00 0.00  ? 307 THR B O    1  
ATOM 4135   C CB   . THR B 2 7   ? 20.597  0.657   11.544  1.00 0.00  ? 307 THR B CB   1  
ATOM 4136   O OG1  . THR B 2 7   ? 21.945  1.087   11.673  1.00 0.00  ? 307 THR B OG1  1  
ATOM 4137   C CG2  . THR B 2 7   ? 20.537  -0.571  10.626  1.00 0.00  ? 307 THR B CG2  1  
ATOM 4138   H H    . THR B 2 7   ? 20.371  2.939   12.688  1.00 0.00  ? 307 THR B H    1  
ATOM 4139   H HA   . THR B 2 7   ? 20.076  2.017   9.968   1.00 0.00  ? 307 THR B HA   1  
ATOM 4140   H HB   . THR B 2 7   ? 20.216  0.388   12.519  1.00 0.00  ? 307 THR B HB   1  
ATOM 4141   H HG1  . THR B 2 7   ? 21.992  1.699   12.410  1.00 0.00  ? 307 THR B HG1  1  
ATOM 4142   H HG21 . THR B 2 7   ? 20.488  -0.256  9.593   1.00 0.00  ? 307 THR B HG21 1  
ATOM 4143   H HG22 . THR B 2 7   ? 21.422  -1.173  10.774  1.00 0.00  ? 307 THR B HG22 1  
ATOM 4144   H HG23 . THR B 2 7   ? 19.662  -1.156  10.867  1.00 0.00  ? 307 THR B HG23 1  
ATOM 4145   N N    . ILE B 2 8   ? 17.622  1.608   9.831   1.00 0.00  ? 308 ILE B N    1  
ATOM 4146   C CA   . ILE B 2 8   ? 16.176  1.253   9.714   1.00 0.00  ? 308 ILE B CA   1  
ATOM 4147   C C    . ILE B 2 8   ? 15.957  -0.214  10.093  1.00 0.00  ? 308 ILE B C    1  
ATOM 4148   O O    . ILE B 2 8   ? 16.548  -1.123  9.548   1.00 0.00  ? 308 ILE B O    1  
ATOM 4149   C CB   . ILE B 2 8   ? 15.687  1.522   8.283   1.00 0.00  ? 308 ILE B CB   1  
ATOM 4150   C CG1  . ILE B 2 8   ? 15.632  3.039   8.061   1.00 0.00  ? 308 ILE B CG1  1  
ATOM 4151   C CG2  . ILE B 2 8   ? 14.291  0.919   8.080   1.00 0.00  ? 308 ILE B CG2  1  
ATOM 4152   C CD1  . ILE B 2 8   ? 15.364  3.348   6.587   1.00 0.00  ? 308 ILE B CD1  1  
ATOM 4153   H H    . ILE B 2 8   ? 18.085  2.091   9.114   1.00 0.00  ? 308 ILE B H    1  
ATOM 4154   H HA   . ILE B 2 8   ? 15.608  1.867   10.395  1.00 0.00  ? 308 ILE B HA   1  
ATOM 4155   H HB   . ILE B 2 8   ? 16.376  1.079   7.578   1.00 0.00  ? 308 ILE B HB   1  
ATOM 4156   H HG12 . ILE B 2 8   ? 14.840  3.458   8.664   1.00 0.00  ? 308 ILE B HG12 1  
ATOM 4157   H HG13 . ILE B 2 8   ? 16.574  3.477   8.352   1.00 0.00  ? 308 ILE B HG13 1  
ATOM 4158   H HG21 . ILE B 2 8   ? 13.671  1.150   8.933   1.00 0.00  ? 308 ILE B HG21 1  
ATOM 4159   H HG22 . ILE B 2 8   ? 13.844  1.331   7.187   1.00 0.00  ? 308 ILE B HG22 1  
ATOM 4160   H HG23 . ILE B 2 8   ? 14.374  -0.153  7.975   1.00 0.00  ? 308 ILE B HG23 1  
ATOM 4161   H HD11 . ILE B 2 8   ? 16.093  2.845   5.974   1.00 0.00  ? 308 ILE B HD11 1  
ATOM 4162   H HD12 . ILE B 2 8   ? 14.374  3.008   6.321   1.00 0.00  ? 308 ILE B HD12 1  
ATOM 4163   H HD13 . ILE B 2 8   ? 15.433  4.413   6.427   1.00 0.00  ? 308 ILE B HD13 1  
ATOM 4164   N N    . THR B 2 9   ? 15.102  -0.415  11.061  1.00 0.00  ? 309 THR B N    1  
ATOM 4165   C CA   . THR B 2 9   ? 14.796  -1.787  11.564  1.00 0.00  ? 309 THR B CA   1  
ATOM 4166   C C    . THR B 2 9   ? 13.434  -2.241  11.034  1.00 0.00  ? 309 THR B C    1  
ATOM 4167   O O    . THR B 2 9   ? 12.794  -3.102  11.604  1.00 0.00  ? 309 THR B O    1  
ATOM 4168   C CB   . THR B 2 9   ? 14.762  -1.769  13.097  1.00 0.00  ? 309 THR B CB   1  
ATOM 4169   O OG1  . THR B 2 9   ? 13.782  -0.840  13.539  1.00 0.00  ? 309 THR B OG1  1  
ATOM 4170   C CG2  . THR B 2 9   ? 16.135  -1.363  13.640  1.00 0.00  ? 309 THR B CG2  1  
ATOM 4171   H H    . THR B 2 9   ? 14.686  0.375   11.468  1.00 0.00  ? 309 THR B H    1  
ATOM 4172   H HA   . THR B 2 9   ? 15.558  -2.478  11.232  1.00 0.00  ? 309 THR B HA   1  
ATOM 4173   H HB   . THR B 2 9   ? 14.514  -2.754  13.462  1.00 0.00  ? 309 THR B HB   1  
ATOM 4174   H HG1  . THR B 2 9   ? 14.139  -0.372  14.299  1.00 0.00  ? 309 THR B HG1  1  
ATOM 4175   H HG21 . THR B 2 9   ? 16.893  -2.006  13.218  1.00 0.00  ? 309 THR B HG21 1  
ATOM 4176   H HG22 . THR B 2 9   ? 16.339  -0.339  13.367  1.00 0.00  ? 309 THR B HG22 1  
ATOM 4177   H HG23 . THR B 2 9   ? 16.139  -1.457  14.715  1.00 0.00  ? 309 THR B HG23 1  
ATOM 4178   N N    . ALA B 2 10  ? 12.986  -1.676  9.943   1.00 0.00  ? 310 ALA B N    1  
ATOM 4179   C CA   . ALA B 2 10  ? 11.667  -2.095  9.378   1.00 0.00  ? 310 ALA B CA   1  
ATOM 4180   C C    . ALA B 2 10  ? 11.859  -3.374  8.527   1.00 0.00  ? 310 ALA B C    1  
ATOM 4181   O O    . ALA B 2 10  ? 12.590  -3.342  7.558   1.00 0.00  ? 310 ALA B O    1  
ATOM 4182   C CB   . ALA B 2 10  ? 11.133  -0.988  8.467   1.00 0.00  ? 310 ALA B CB   1  
ATOM 4183   H H    . ALA B 2 10  ? 13.519  -0.989  9.485   1.00 0.00  ? 310 ALA B H    1  
ATOM 4184   H HA   . ALA B 2 10  ? 10.974  -2.258  10.182  1.00 0.00  ? 310 ALA B HA   1  
ATOM 4185   H HB1  . ALA B 2 10  ? 11.183  -0.040  8.979   1.00 0.00  ? 310 ALA B HB1  1  
ATOM 4186   H HB2  . ALA B 2 10  ? 11.729  -0.945  7.568   1.00 0.00  ? 310 ALA B HB2  1  
ATOM 4187   H HB3  . ALA B 2 10  ? 10.106  -1.203  8.205   1.00 0.00  ? 310 ALA B HB3  1  
ATOM 4188   N N    . PRO B 2 11  ? 11.225  -4.493  8.847   1.00 0.00  ? 311 PRO B N    1  
ATOM 4189   C CA   . PRO B 2 11  ? 11.407  -5.719  8.014   1.00 0.00  ? 311 PRO B CA   1  
ATOM 4190   C C    . PRO B 2 11  ? 10.824  -5.544  6.601   1.00 0.00  ? 311 PRO B C    1  
ATOM 4191   O O    . PRO B 2 11  ? 11.005  -6.379  5.738   1.00 0.00  ? 311 PRO B O    1  
ATOM 4192   C CB   . PRO B 2 11  ? 10.640  -6.794  8.811   1.00 0.00  ? 311 PRO B CB   1  
ATOM 4193   C CG   . PRO B 2 11  ? 9.855   -6.097  9.939   1.00 0.00  ? 311 PRO B CG   1  
ATOM 4194   C CD   . PRO B 2 11  ? 10.312  -4.629  10.022  1.00 0.00  ? 311 PRO B CD   1  
ATOM 4195   H HA   . PRO B 2 11  ? 12.453  -5.980  7.956   1.00 0.00  ? 311 PRO B HA   1  
ATOM 4196   H HB2  . PRO B 2 11  ? 9.953   -7.325  8.159   1.00 0.00  ? 311 PRO B HB2  1  
ATOM 4197   H HB3  . PRO B 2 11  ? 11.339  -7.500  9.241   1.00 0.00  ? 311 PRO B HB3  1  
ATOM 4198   H HG2  . PRO B 2 11  ? 8.792   -6.138  9.725   1.00 0.00  ? 311 PRO B HG2  1  
ATOM 4199   H HG3  . PRO B 2 11  ? 10.048  -6.591  10.883  1.00 0.00  ? 311 PRO B HG3  1  
ATOM 4200   H HD2  . PRO B 2 11  ? 9.465   -3.960  9.933   1.00 0.00  ? 311 PRO B HD2  1  
ATOM 4201   H HD3  . PRO B 2 11  ? 10.854  -4.444  10.938  1.00 0.00  ? 311 PRO B HD3  1  
ATOM 4202   N N    . ASN B 2 12  ? 10.129  -4.459  6.370   1.00 0.00  ? 312 ASN B N    1  
ATOM 4203   C CA   . ASN B 2 12  ? 9.522   -4.197  5.027   1.00 0.00  ? 312 ASN B CA   1  
ATOM 4204   C C    . ASN B 2 12  ? 10.143  -2.930  4.446   1.00 0.00  ? 312 ASN B C    1  
ATOM 4205   O O    . ASN B 2 12  ? 9.720   -2.431  3.423   1.00 0.00  ? 312 ASN B O    1  
ATOM 4206   C CB   . ASN B 2 12  ? 8.015   -3.983  5.196   1.00 0.00  ? 312 ASN B CB   1  
ATOM 4207   C CG   . ASN B 2 12  ? 7.357   -5.298  5.615   1.00 0.00  ? 312 ASN B CG   1  
ATOM 4208   O OD1  . ASN B 2 12  ? 7.794   -6.363  5.227   1.00 0.00  ? 312 ASN B OD1  1  
ATOM 4209   N ND2  . ASN B 2 12  ? 6.321   -5.268  6.409   1.00 0.00  ? 312 ASN B ND2  1  
ATOM 4210   H H    . ASN B 2 12  ? 10.011  -3.802  7.085   1.00 0.00  ? 312 ASN B H    1  
ATOM 4211   H HA   . ASN B 2 12  ? 9.699   -5.029  4.359   1.00 0.00  ? 312 ASN B HA   1  
ATOM 4212   H HB2  . ASN B 2 12  ? 7.840   -3.233  5.954   1.00 0.00  ? 312 ASN B HB2  1  
ATOM 4213   H HB3  . ASN B 2 12  ? 7.590   -3.653  4.259   1.00 0.00  ? 312 ASN B HB3  1  
ATOM 4214   H HD21 . ASN B 2 12  ? 5.973   -4.409  6.728   1.00 0.00  ? 312 ASN B HD21 1  
ATOM 4215   H HD22 . ASN B 2 12  ? 5.895   -6.104  6.691   1.00 0.00  ? 312 ASN B HD22 1  
ATOM 4216   N N    . GLY B 2 13  ? 11.132  -2.394  5.106   1.00 0.00  ? 313 GLY B N    1  
ATOM 4217   C CA   . GLY B 2 13  ? 11.764  -1.146  4.605   1.00 0.00  ? 313 GLY B CA   1  
ATOM 4218   C C    . GLY B 2 13  ? 10.806  0.014   4.869   1.00 0.00  ? 313 GLY B C    1  
ATOM 4219   O O    . GLY B 2 13  ? 9.716   -0.178  5.371   1.00 0.00  ? 313 GLY B O    1  
ATOM 4220   H H    . GLY B 2 13  ? 11.450  -2.806  5.937   1.00 0.00  ? 313 GLY B H    1  
ATOM 4221   H HA2  . GLY B 2 13  ? 12.696  -0.976  5.128   1.00 0.00  ? 313 GLY B HA2  1  
ATOM 4222   H HA3  . GLY B 2 13  ? 11.949  -1.227  3.546   1.00 0.00  ? 313 GLY B HA3  1  
ATOM 4223   N N    . LEU B 2 14  ? 11.197  1.215   4.558   1.00 0.00  ? 314 LEU B N    1  
ATOM 4224   C CA   . LEU B 2 14  ? 10.305  2.380   4.816   1.00 0.00  ? 314 LEU B CA   1  
ATOM 4225   C C    . LEU B 2 14  ? 9.370   2.562   3.610   1.00 0.00  ? 314 LEU B C    1  
ATOM 4226   O O    . LEU B 2 14  ? 9.735   3.186   2.638   1.00 0.00  ? 314 LEU B O    1  
ATOM 4227   C CB   . LEU B 2 14  ? 11.196  3.625   4.987   1.00 0.00  ? 314 LEU B CB   1  
ATOM 4228   C CG   . LEU B 2 14  ? 10.449  4.729   5.764   1.00 0.00  ? 314 LEU B CG   1  
ATOM 4229   C CD1  . LEU B 2 14  ? 10.656  4.530   7.273   1.00 0.00  ? 314 LEU B CD1  1  
ATOM 4230   C CD2  . LEU B 2 14  ? 11.001  6.106   5.374   1.00 0.00  ? 314 LEU B CD2  1  
ATOM 4231   H H    . LEU B 2 14  ? 12.088  1.364   4.177   1.00 0.00  ? 314 LEU B H    1  
ATOM 4232   H HA   . LEU B 2 14  ? 9.726   2.216   5.712   1.00 0.00  ? 314 LEU B HA   1  
ATOM 4233   H HB2  . LEU B 2 14  ? 12.093  3.345   5.523   1.00 0.00  ? 314 LEU B HB2  1  
ATOM 4234   H HB3  . LEU B 2 14  ? 11.476  3.997   4.010   1.00 0.00  ? 314 LEU B HB3  1  
ATOM 4235   H HG   . LEU B 2 14  ? 9.393   4.686   5.536   1.00 0.00  ? 314 LEU B HG   1  
ATOM 4236   H HD11 . LEU B 2 14  ? 10.342  3.535   7.552   1.00 0.00  ? 314 LEU B HD11 1  
ATOM 4237   H HD12 . LEU B 2 14  ? 11.702  4.657   7.511   1.00 0.00  ? 314 LEU B HD12 1  
ATOM 4238   H HD13 . LEU B 2 14  ? 10.076  5.260   7.817   1.00 0.00  ? 314 LEU B HD13 1  
ATOM 4239   H HD21 . LEU B 2 14  ? 12.080  6.093   5.440   1.00 0.00  ? 314 LEU B HD21 1  
ATOM 4240   H HD22 . LEU B 2 14  ? 10.706  6.339   4.362   1.00 0.00  ? 314 LEU B HD22 1  
ATOM 4241   H HD23 . LEU B 2 14  ? 10.610  6.854   6.046   1.00 0.00  ? 314 LEU B HD23 1  
ATOM 4242   N N    . HIS B 2 15  ? 8.158   2.030   3.671   1.00 0.00  ? 315 HIS B N    1  
ATOM 4243   C CA   . HIS B 2 15  ? 7.201   2.185   2.518   1.00 0.00  ? 315 HIS B CA   1  
ATOM 4244   C C    . HIS B 2 15  ? 6.226   3.341   2.774   1.00 0.00  ? 315 HIS B C    1  
ATOM 4245   O O    . HIS B 2 15  ? 6.512   4.248   3.530   1.00 0.00  ? 315 HIS B O    1  
ATOM 4246   C CB   . HIS B 2 15  ? 6.466   0.858   2.209   1.00 0.00  ? 315 HIS B CB   1  
ATOM 4247   C CG   . HIS B 2 15  ? 5.419   0.503   3.236   1.00 0.00  ? 315 HIS B CG   1  
ATOM 4248   N ND1  . HIS B 2 15  ? 4.062   0.452   2.918   1.00 0.00  ? 315 HIS B ND1  1  
ATOM 4249   C CD2  . HIS B 2 15  ? 5.512   0.098   4.544   1.00 0.00  ? 315 HIS B CD2  1  
ATOM 4250   C CE1  . HIS B 2 15  ? 3.408   0.026   4.011   1.00 0.00  ? 315 HIS B CE1  1  
ATOM 4251   N NE2  . HIS B 2 15  ? 4.243   -0.204  5.031   1.00 0.00  ? 315 HIS B NE2  1  
ATOM 4252   H H    . HIS B 2 15  ? 7.885   1.551   4.481   1.00 0.00  ? 315 HIS B H    1  
ATOM 4253   H HA   . HIS B 2 15  ? 7.775   2.449   1.638   1.00 0.00  ? 315 HIS B HA   1  
ATOM 4254   H HB2  . HIS B 2 15  ? 5.987   0.942   1.247   1.00 0.00  ? 315 HIS B HB2  1  
ATOM 4255   H HB3  . HIS B 2 15  ? 7.196   0.061   2.164   1.00 0.00  ? 315 HIS B HB3  1  
ATOM 4256   H HD1  . HIS B 2 15  ? 3.659   0.685   2.056   1.00 0.00  ? 315 HIS B HD1  1  
ATOM 4257   H HD2  . HIS B 2 15  ? 6.431   0.020   5.107   1.00 0.00  ? 315 HIS B HD2  1  
ATOM 4258   H HE1  . HIS B 2 15  ? 2.338   -0.113  4.062   1.00 0.00  ? 315 HIS B HE1  1  
ATOM 4259   N N    . THR B 2 16  ? 5.113   3.358   2.094   1.00 0.00  ? 316 THR B N    1  
ATOM 4260   C CA   . THR B 2 16  ? 4.160   4.505   2.230   1.00 0.00  ? 316 THR B CA   1  
ATOM 4261   C C    . THR B 2 16  ? 3.658   4.679   3.674   1.00 0.00  ? 316 THR B C    1  
ATOM 4262   O O    . THR B 2 16  ? 3.551   5.789   4.157   1.00 0.00  ? 316 THR B O    1  
ATOM 4263   C CB   . THR B 2 16  ? 2.964   4.266   1.302   1.00 0.00  ? 316 THR B CB   1  
ATOM 4264   O OG1  . THR B 2 16  ? 3.439   3.967   -0.002  1.00 0.00  ? 316 THR B OG1  1  
ATOM 4265   C CG2  . THR B 2 16  ? 2.098   5.527   1.241   1.00 0.00  ? 316 THR B CG2  1  
ATOM 4266   H H    . THR B 2 16  ? 4.927   2.647   1.446   1.00 0.00  ? 316 THR B H    1  
ATOM 4267   H HA   . THR B 2 16  ? 4.660   5.410   1.922   1.00 0.00  ? 316 THR B HA   1  
ATOM 4268   H HB   . THR B 2 16  ? 2.374   3.442   1.673   1.00 0.00  ? 316 THR B HB   1  
ATOM 4269   H HG1  . THR B 2 16  ? 4.399   3.958   0.026   1.00 0.00  ? 316 THR B HG1  1  
ATOM 4270   H HG21 . THR B 2 16  ? 1.807   5.816   2.240   1.00 0.00  ? 316 THR B HG21 1  
ATOM 4271   H HG22 . THR B 2 16  ? 2.661   6.328   0.784   1.00 0.00  ? 316 THR B HG22 1  
ATOM 4272   H HG23 . THR B 2 16  ? 1.215   5.329   0.652   1.00 0.00  ? 316 THR B HG23 1  
ATOM 4273   N N    . ARG B 2 17  ? 3.316   3.625   4.362   1.00 0.00  ? 317 ARG B N    1  
ATOM 4274   C CA   . ARG B 2 17  ? 2.791   3.799   5.753   1.00 0.00  ? 317 ARG B CA   1  
ATOM 4275   C C    . ARG B 2 17  ? 3.827   4.501   6.665   1.00 0.00  ? 317 ARG B C    1  
ATOM 4276   O O    . ARG B 2 17  ? 3.573   5.597   7.126   1.00 0.00  ? 317 ARG B O    1  
ATOM 4277   C CB   . ARG B 2 17  ? 2.330   2.420   6.302   1.00 0.00  ? 317 ARG B CB   1  
ATOM 4278   C CG   . ARG B 2 17  ? 2.267   2.379   7.847   1.00 0.00  ? 317 ARG B CG   1  
ATOM 4279   C CD   . ARG B 2 17  ? 1.092   3.229   8.342   1.00 0.00  ? 317 ARG B CD   1  
ATOM 4280   N NE   . ARG B 2 17  ? 1.300   3.622   9.776   1.00 0.00  ? 317 ARG B NE   1  
ATOM 4281   C CZ   . ARG B 2 17  ? 1.558   2.738   10.705  1.00 0.00  ? 317 ARG B CZ   1  
ATOM 4282   N NH1  . ARG B 2 17  ? 1.468   1.462   10.455  1.00 0.00  ? 317 ARG B NH1  1  
ATOM 4283   N NH2  . ARG B 2 17  ? 1.851   3.139   11.912  1.00 0.00  ? 317 ARG B NH2  1  
ATOM 4284   H H    . ARG B 2 17  ? 3.374   2.730   3.965   1.00 0.00  ? 317 ARG B H    1  
ATOM 4285   H HA   . ARG B 2 17  ? 1.930   4.450   5.688   1.00 0.00  ? 317 ARG B HA   1  
ATOM 4286   H HB2  . ARG B 2 17  ? 1.341   2.211   5.917   1.00 0.00  ? 317 ARG B HB2  1  
ATOM 4287   H HB3  . ARG B 2 17  ? 2.994   1.657   5.951   1.00 0.00  ? 317 ARG B HB3  1  
ATOM 4288   H HG2  . ARG B 2 17  ? 2.121   1.355   8.152   1.00 0.00  ? 317 ARG B HG2  1  
ATOM 4289   H HG3  . ARG B 2 17  ? 3.185   2.741   8.276   1.00 0.00  ? 317 ARG B HG3  1  
ATOM 4290   H HD2  . ARG B 2 17  ? 1.032   4.131   7.768   1.00 0.00  ? 317 ARG B HD2  1  
ATOM 4291   H HD3  . ARG B 2 17  ? 0.168   2.670   8.217   1.00 0.00  ? 317 ARG B HD3  1  
ATOM 4292   H HE   . ARG B 2 17  ? 1.284   4.573   10.015  1.00 0.00  ? 317 ARG B HE   1  
ATOM 4293   H HH11 . ARG B 2 17  ? 1.194   1.147   9.551   1.00 0.00  ? 317 ARG B HH11 1  
ATOM 4294   H HH12 . ARG B 2 17  ? 1.675   0.797   11.173  1.00 0.00  ? 317 ARG B HH12 1  
ATOM 4295   H HH21 . ARG B 2 17  ? 1.878   4.116   12.121  1.00 0.00  ? 317 ARG B HH21 1  
ATOM 4296   H HH22 . ARG B 2 17  ? 2.046   2.469   12.628  1.00 0.00  ? 317 ARG B HH22 1  
ATOM 4297   N N    . PRO B 2 18  ? 4.975   3.916   6.939   1.00 0.00  ? 318 PRO B N    1  
ATOM 4298   C CA   . PRO B 2 18  ? 5.983   4.587   7.813   1.00 0.00  ? 318 PRO B CA   1  
ATOM 4299   C C    . PRO B 2 18  ? 6.353   5.981   7.289   1.00 0.00  ? 318 PRO B C    1  
ATOM 4300   O O    . PRO B 2 18  ? 6.619   6.892   8.048   1.00 0.00  ? 318 PRO B O    1  
ATOM 4301   C CB   . PRO B 2 18  ? 7.179   3.618   7.734   1.00 0.00  ? 318 PRO B CB   1  
ATOM 4302   C CG   . PRO B 2 18  ? 6.882   2.601   6.626   1.00 0.00  ? 318 PRO B CG   1  
ATOM 4303   C CD   . PRO B 2 18  ? 5.366   2.582   6.422   1.00 0.00  ? 318 PRO B CD   1  
ATOM 4304   H HA   . PRO B 2 18  ? 5.623   4.648   8.828   1.00 0.00  ? 318 PRO B HA   1  
ATOM 4305   H HB2  . PRO B 2 18  ? 8.086   4.157   7.505   1.00 0.00  ? 318 PRO B HB2  1  
ATOM 4306   H HB3  . PRO B 2 18  ? 7.298   3.099   8.676   1.00 0.00  ? 318 PRO B HB3  1  
ATOM 4307   H HG2  . PRO B 2 18  ? 7.372   2.907   5.713   1.00 0.00  ? 318 PRO B HG2  1  
ATOM 4308   H HG3  . PRO B 2 18  ? 7.226   1.618   6.915   1.00 0.00  ? 318 PRO B HG3  1  
ATOM 4309   H HD2  . PRO B 2 18  ? 5.115   2.477   5.378   1.00 0.00  ? 318 PRO B HD2  1  
ATOM 4310   H HD3  . PRO B 2 18  ? 4.920   1.805   7.019   1.00 0.00  ? 318 PRO B HD3  1  
ATOM 4311   N N    . ALA B 2 19  ? 6.365   6.149   5.995   1.00 0.00  ? 319 ALA B N    1  
ATOM 4312   C CA   . ALA B 2 19  ? 6.709   7.480   5.428   1.00 0.00  ? 319 ALA B CA   1  
ATOM 4313   C C    . ALA B 2 19  ? 5.702   8.506   5.940   1.00 0.00  ? 319 ALA B C    1  
ATOM 4314   O O    . ALA B 2 19  ? 6.062   9.555   6.435   1.00 0.00  ? 319 ALA B O    1  
ATOM 4315   C CB   . ALA B 2 19  ? 6.644   7.419   3.903   1.00 0.00  ? 319 ALA B CB   1  
ATOM 4316   H H    . ALA B 2 19  ? 6.137   5.398   5.406   1.00 0.00  ? 319 ALA B H    1  
ATOM 4317   H HA   . ALA B 2 19  ? 7.703   7.762   5.739   1.00 0.00  ? 319 ALA B HA   1  
ATOM 4318   H HB1  . ALA B 2 19  ? 7.252   6.599   3.555   1.00 0.00  ? 319 ALA B HB1  1  
ATOM 4319   H HB2  . ALA B 2 19  ? 5.621   7.269   3.591   1.00 0.00  ? 319 ALA B HB2  1  
ATOM 4320   H HB3  . ALA B 2 19  ? 7.015   8.344   3.489   1.00 0.00  ? 319 ALA B HB3  1  
ATOM 4321   N N    . ALA B 2 20  ? 4.438   8.216   5.807   1.00 0.00  ? 320 ALA B N    1  
ATOM 4322   C CA   . ALA B 2 20  ? 3.411   9.186   6.269   1.00 0.00  ? 320 ALA B CA   1  
ATOM 4323   C C    . ALA B 2 20  ? 3.702   9.576   7.719   1.00 0.00  ? 320 ALA B C    1  
ATOM 4324   O O    . ALA B 2 20  ? 3.617   10.731  8.082   1.00 0.00  ? 320 ALA B O    1  
ATOM 4325   C CB   . ALA B 2 20  ? 2.021   8.549   6.162   1.00 0.00  ? 320 ALA B CB   1  
ATOM 4326   H H    . ALA B 2 20  ? 4.174   7.373   5.371   1.00 0.00  ? 320 ALA B H    1  
ATOM 4327   H HA   . ALA B 2 20  ? 3.454   10.073  5.652   1.00 0.00  ? 320 ALA B HA   1  
ATOM 4328   H HB1  . ALA B 2 20  ? 1.949   7.999   5.235   1.00 0.00  ? 320 ALA B HB1  1  
ATOM 4329   H HB2  . ALA B 2 20  ? 1.866   7.874   6.991   1.00 0.00  ? 320 ALA B HB2  1  
ATOM 4330   H HB3  . ALA B 2 20  ? 1.267   9.322   6.182   1.00 0.00  ? 320 ALA B HB3  1  
ATOM 4331   N N    . GLN B 2 21  ? 4.083   8.639   8.542   1.00 0.00  ? 321 GLN B N    1  
ATOM 4332   C CA   . GLN B 2 21  ? 4.413   8.993   9.951   1.00 0.00  ? 321 GLN B CA   1  
ATOM 4333   C C    . GLN B 2 21  ? 5.720   9.789   9.963   1.00 0.00  ? 321 GLN B C    1  
ATOM 4334   O O    . GLN B 2 21  ? 5.881   10.733  10.712  1.00 0.00  ? 321 GLN B O    1  
ATOM 4335   C CB   . GLN B 2 21  ? 4.579   7.722   10.788  1.00 0.00  ? 321 GLN B CB   1  
ATOM 4336   C CG   . GLN B 2 21  ? 3.218   7.049   10.973  1.00 0.00  ? 321 GLN B CG   1  
ATOM 4337   C CD   . GLN B 2 21  ? 3.394   5.741   11.747  1.00 0.00  ? 321 GLN B CD   1  
ATOM 4338   O OE1  . GLN B 2 21  ? 3.739   4.725   11.178  1.00 0.00  ? 321 GLN B OE1  1  
ATOM 4339   N NE2  . GLN B 2 21  ? 3.173   5.725   13.032  1.00 0.00  ? 321 GLN B NE2  1  
ATOM 4340   H H    . GLN B 2 21  ? 4.192   7.718   8.223   1.00 0.00  ? 321 GLN B H    1  
ATOM 4341   H HA   . GLN B 2 21  ? 3.623   9.602   10.363  1.00 0.00  ? 321 GLN B HA   1  
ATOM 4342   H HB2  . GLN B 2 21  ? 5.254   7.044   10.287  1.00 0.00  ? 321 GLN B HB2  1  
ATOM 4343   H HB3  . GLN B 2 21  ? 4.983   7.981   11.757  1.00 0.00  ? 321 GLN B HB3  1  
ATOM 4344   H HG2  . GLN B 2 21  ? 2.563   7.708   11.523  1.00 0.00  ? 321 GLN B HG2  1  
ATOM 4345   H HG3  . GLN B 2 21  ? 2.788   6.837   10.006  1.00 0.00  ? 321 GLN B HG3  1  
ATOM 4346   H HE21 . GLN B 2 21  ? 2.898   6.546   13.492  1.00 0.00  ? 321 GLN B HE21 1  
ATOM 4347   H HE22 . GLN B 2 21  ? 3.282   4.894   13.539  1.00 0.00  ? 321 GLN B HE22 1  
ATOM 4348   N N    . PHE B 2 22  ? 6.664   9.395   9.151   1.00 0.00  ? 322 PHE B N    1  
ATOM 4349   C CA   . PHE B 2 22  ? 7.970   10.108  9.121   1.00 0.00  ? 322 PHE B CA   1  
ATOM 4350   C C    . PHE B 2 22  ? 7.772   11.571  8.704   1.00 0.00  ? 322 PHE B C    1  
ATOM 4351   O O    . PHE B 2 22  ? 8.223   12.477  9.377   1.00 0.00  ? 322 PHE B O    1  
ATOM 4352   C CB   . PHE B 2 22  ? 8.906   9.411   8.132   1.00 0.00  ? 322 PHE B CB   1  
ATOM 4353   C CG   . PHE B 2 22  ? 10.267  10.055  8.194   1.00 0.00  ? 322 PHE B CG   1  
ATOM 4354   C CD1  . PHE B 2 22  ? 11.221  9.581   9.101   1.00 0.00  ? 322 PHE B CD1  1  
ATOM 4355   C CD2  . PHE B 2 22  ? 10.578  11.124  7.348   1.00 0.00  ? 322 PHE B CD2  1  
ATOM 4356   C CE1  . PHE B 2 22  ? 12.487  10.176  9.163   1.00 0.00  ? 322 PHE B CE1  1  
ATOM 4357   C CE2  . PHE B 2 22  ? 11.843  11.720  7.408   1.00 0.00  ? 322 PHE B CE2  1  
ATOM 4358   C CZ   . PHE B 2 22  ? 12.797  11.246  8.315   1.00 0.00  ? 322 PHE B CZ   1  
ATOM 4359   H H    . PHE B 2 22  ? 6.513   8.618   8.572   1.00 0.00  ? 322 PHE B H    1  
ATOM 4360   H HA   . PHE B 2 22  ? 8.412   10.078  10.107  1.00 0.00  ? 322 PHE B HA   1  
ATOM 4361   H HB2  . PHE B 2 22  ? 8.989   8.365   8.388   1.00 0.00  ? 322 PHE B HB2  1  
ATOM 4362   H HB3  . PHE B 2 22  ? 8.509   9.507   7.133   1.00 0.00  ? 322 PHE B HB3  1  
ATOM 4363   H HD1  . PHE B 2 22  ? 10.981  8.755   9.756   1.00 0.00  ? 322 PHE B HD1  1  
ATOM 4364   H HD2  . PHE B 2 22  ? 9.841   11.489  6.646   1.00 0.00  ? 322 PHE B HD2  1  
ATOM 4365   H HE1  . PHE B 2 22  ? 13.222  9.810   9.862   1.00 0.00  ? 322 PHE B HE1  1  
ATOM 4366   H HE2  . PHE B 2 22  ? 12.082  12.546  6.754   1.00 0.00  ? 322 PHE B HE2  1  
ATOM 4367   H HZ   . PHE B 2 22  ? 13.774  11.707  8.363   1.00 0.00  ? 322 PHE B HZ   1  
ATOM 4368   N N    . VAL B 2 23  ? 7.119   11.820  7.597   1.00 0.00  ? 323 VAL B N    1  
ATOM 4369   C CA   . VAL B 2 23  ? 6.924   13.233  7.152   1.00 0.00  ? 323 VAL B CA   1  
ATOM 4370   C C    . VAL B 2 23  ? 5.965   13.948  8.106   1.00 0.00  ? 323 VAL B C    1  
ATOM 4371   O O    . VAL B 2 23  ? 6.101   15.124  8.375   1.00 0.00  ? 323 VAL B O    1  
ATOM 4372   C CB   . VAL B 2 23  ? 6.346   13.247  5.730   1.00 0.00  ? 323 VAL B CB   1  
ATOM 4373   C CG1  . VAL B 2 23  ? 5.972   14.680  5.332   1.00 0.00  ? 323 VAL B CG1  1  
ATOM 4374   C CG2  . VAL B 2 23  ? 7.393   12.703  4.754   1.00 0.00  ? 323 VAL B CG2  1  
ATOM 4375   H H    . VAL B 2 23  ? 6.774   11.088  7.037   1.00 0.00  ? 323 VAL B H    1  
ATOM 4376   H HA   . VAL B 2 23  ? 7.877   13.742  7.156   1.00 0.00  ? 323 VAL B HA   1  
ATOM 4377   H HB   . VAL B 2 23  ? 5.463   12.624  5.696   1.00 0.00  ? 323 VAL B HB   1  
ATOM 4378   H HG11 . VAL B 2 23  ? 6.745   15.359  5.661   1.00 0.00  ? 323 VAL B HG11 1  
ATOM 4379   H HG12 . VAL B 2 23  ? 5.871   14.746  4.256   1.00 0.00  ? 323 VAL B HG12 1  
ATOM 4380   H HG13 . VAL B 2 23  ? 5.036   14.951  5.796   1.00 0.00  ? 323 VAL B HG13 1  
ATOM 4381   H HG21 . VAL B 2 23  ? 7.687   11.708  5.058   1.00 0.00  ? 323 VAL B HG21 1  
ATOM 4382   H HG22 . VAL B 2 23  ? 6.974   12.668  3.760   1.00 0.00  ? 323 VAL B HG22 1  
ATOM 4383   H HG23 . VAL B 2 23  ? 8.258   13.350  4.757   1.00 0.00  ? 323 VAL B HG23 1  
ATOM 4384   N N    . LYS B 2 24  ? 4.995   13.244  8.612   1.00 0.00  ? 324 LYS B N    1  
ATOM 4385   C CA   . LYS B 2 24  ? 4.025   13.892  9.536   1.00 0.00  ? 324 LYS B CA   1  
ATOM 4386   C C    . LYS B 2 24  ? 4.760   14.443  10.758  1.00 0.00  ? 324 LYS B C    1  
ATOM 4387   O O    . LYS B 2 24  ? 4.548   15.570  11.163  1.00 0.00  ? 324 LYS B O    1  
ATOM 4388   C CB   . LYS B 2 24  ? 2.982   12.875  9.988   1.00 0.00  ? 324 LYS B CB   1  
ATOM 4389   C CG   . LYS B 2 24  ? 2.010   13.548  10.959  1.00 0.00  ? 324 LYS B CG   1  
ATOM 4390   C CD   . LYS B 2 24  ? 0.766   12.678  11.105  1.00 0.00  ? 324 LYS B CD   1  
ATOM 4391   C CE   . LYS B 2 24  ? 1.171   11.273  11.554  1.00 0.00  ? 324 LYS B CE   1  
ATOM 4392   N NZ   . LYS B 2 24  ? -0.015  10.573  12.125  1.00 0.00  ? 324 LYS B NZ   1  
ATOM 4393   H H    . LYS B 2 24  ? 4.917   12.296  8.370   1.00 0.00  ? 324 LYS B H    1  
ATOM 4394   H HA   . LYS B 2 24  ? 3.532   14.703  9.021   1.00 0.00  ? 324 LYS B HA   1  
ATOM 4395   H HB2  . LYS B 2 24  ? 2.439   12.507  9.128   1.00 0.00  ? 324 LYS B HB2  1  
ATOM 4396   H HB3  . LYS B 2 24  ? 3.471   12.051  10.485  1.00 0.00  ? 324 LYS B HB3  1  
ATOM 4397   H HG2  . LYS B 2 24  ? 2.487   13.666  11.923  1.00 0.00  ? 324 LYS B HG2  1  
ATOM 4398   H HG3  . LYS B 2 24  ? 1.726   14.518  10.576  1.00 0.00  ? 324 LYS B HG3  1  
ATOM 4399   H HD2  . LYS B 2 24  ? 0.101   13.115  11.835  1.00 0.00  ? 324 LYS B HD2  1  
ATOM 4400   H HD3  . LYS B 2 24  ? 0.268   12.617  10.153  1.00 0.00  ? 324 LYS B HD3  1  
ATOM 4401   H HE2  . LYS B 2 24  ? 1.540   10.721  10.701  1.00 0.00  ? 324 LYS B HE2  1  
ATOM 4402   H HE3  . LYS B 2 24  ? 1.946   11.338  12.304  1.00 0.00  ? 324 LYS B HE3  1  
ATOM 4403   H HZ1  . LYS B 2 24  ? -0.867  11.146  11.960  1.00 0.00  ? 324 LYS B HZ1  1  
ATOM 4404   H HZ2  . LYS B 2 24  ? -0.125  9.646   11.669  1.00 0.00  ? 324 LYS B HZ2  1  
ATOM 4405   H HZ3  . LYS B 2 24  ? 0.120   10.438  13.148  1.00 0.00  ? 324 LYS B HZ3  1  
ATOM 4406   N N    . GLU B 2 25  ? 5.620   13.667  11.350  1.00 0.00  ? 325 GLU B N    1  
ATOM 4407   C CA   . GLU B 2 25  ? 6.359   14.160  12.546  1.00 0.00  ? 325 GLU B CA   1  
ATOM 4408   C C    . GLU B 2 25  ? 7.299   15.303  12.147  1.00 0.00  ? 325 GLU B C    1  
ATOM 4409   O O    . GLU B 2 25  ? 7.454   16.268  12.868  1.00 0.00  ? 325 GLU B O    1  
ATOM 4410   C CB   . GLU B 2 25  ? 7.171   13.014  13.155  1.00 0.00  ? 325 GLU B CB   1  
ATOM 4411   C CG   . GLU B 2 25  ? 7.753   13.458  14.500  1.00 0.00  ? 325 GLU B CG   1  
ATOM 4412   C CD   . GLU B 2 25  ? 6.625   13.642  15.519  1.00 0.00  ? 325 GLU B CD   1  
ATOM 4413   O OE1  . GLU B 2 25  ? 5.568   13.066  15.314  1.00 0.00  ? 325 GLU B OE1  1  
ATOM 4414   O OE2  . GLU B 2 25  ? 6.835   14.360  16.483  1.00 0.00  ? 325 GLU B OE2  1  
ATOM 4415   H H    . GLU B 2 25  ? 5.779   12.762  11.013  1.00 0.00  ? 325 GLU B H    1  
ATOM 4416   H HA   . GLU B 2 25  ? 5.650   14.521  13.276  1.00 0.00  ? 325 GLU B HA   1  
ATOM 4417   H HB2  . GLU B 2 25  ? 6.529   12.158  13.303  1.00 0.00  ? 325 GLU B HB2  1  
ATOM 4418   H HB3  . GLU B 2 25  ? 7.976   12.748  12.485  1.00 0.00  ? 325 GLU B HB3  1  
ATOM 4419   H HG2  . GLU B 2 25  ? 8.441   12.705  14.857  1.00 0.00  ? 325 GLU B HG2  1  
ATOM 4420   H HG3  . GLU B 2 25  ? 8.279   14.393  14.376  1.00 0.00  ? 325 GLU B HG3  1  
ATOM 4421   N N    . ALA B 2 26  ? 7.946   15.196  11.017  1.00 0.00  ? 326 ALA B N    1  
ATOM 4422   C CA   . ALA B 2 26  ? 8.889   16.276  10.592  1.00 0.00  ? 326 ALA B CA   1  
ATOM 4423   C C    . ALA B 2 26  ? 8.137   17.585  10.338  1.00 0.00  ? 326 ALA B C    1  
ATOM 4424   O O    . ALA B 2 26  ? 8.483   18.621  10.869  1.00 0.00  ? 326 ALA B O    1  
ATOM 4425   C CB   . ALA B 2 26  ? 9.614   15.842  9.315   1.00 0.00  ? 326 ALA B CB   1  
ATOM 4426   H H    . ALA B 2 26  ? 7.824   14.405  10.451  1.00 0.00  ? 326 ALA B H    1  
ATOM 4427   H HA   . ALA B 2 26  ? 9.612   16.437  11.373  1.00 0.00  ? 326 ALA B HA   1  
ATOM 4428   H HB1  . ALA B 2 26  ? 8.890   15.626  8.543   1.00 0.00  ? 326 ALA B HB1  1  
ATOM 4429   H HB2  . ALA B 2 26  ? 10.266  16.637  8.985   1.00 0.00  ? 326 ALA B HB2  1  
ATOM 4430   H HB3  . ALA B 2 26  ? 10.198  14.957  9.518   1.00 0.00  ? 326 ALA B HB3  1  
ATOM 4431   N N    . LYS B 2 27  ? 7.112   17.552  9.535   1.00 0.00  ? 327 LYS B N    1  
ATOM 4432   C CA   . LYS B 2 27  ? 6.349   18.803  9.257   1.00 0.00  ? 327 LYS B CA   1  
ATOM 4433   C C    . LYS B 2 27  ? 5.896   19.430  10.576  1.00 0.00  ? 327 LYS B C    1  
ATOM 4434   O O    . LYS B 2 27  ? 5.432   20.552  10.614  1.00 0.00  ? 327 LYS B O    1  
ATOM 4435   C CB   . LYS B 2 27  ? 5.130   18.487  8.387   1.00 0.00  ? 327 LYS B CB   1  
ATOM 4436   C CG   . LYS B 2 27  ? 5.586   18.205  6.953   1.00 0.00  ? 327 LYS B CG   1  
ATOM 4437   C CD   . LYS B 2 27  ? 4.364   17.891  6.088   1.00 0.00  ? 327 LYS B CD   1  
ATOM 4438   C CE   . LYS B 2 27  ? 4.788   17.694  4.628   1.00 0.00  ? 327 LYS B CE   1  
ATOM 4439   N NZ   . LYS B 2 27  ? 4.914   19.025  3.967   1.00 0.00  ? 327 LYS B NZ   1  
ATOM 4440   H H    . LYS B 2 27  ? 6.846   16.710  9.115   1.00 0.00  ? 327 LYS B H    1  
ATOM 4441   H HA   . LYS B 2 27  ? 6.989   19.500  8.736   1.00 0.00  ? 327 LYS B HA   1  
ATOM 4442   H HB2  . LYS B 2 27  ? 4.624   17.617  8.780   1.00 0.00  ? 327 LYS B HB2  1  
ATOM 4443   H HB3  . LYS B 2 27  ? 4.453   19.329  8.389   1.00 0.00  ? 327 LYS B HB3  1  
ATOM 4444   H HG2  . LYS B 2 27  ? 6.098   19.073  6.560   1.00 0.00  ? 327 LYS B HG2  1  
ATOM 4445   H HG3  . LYS B 2 27  ? 6.255   17.359  6.949   1.00 0.00  ? 327 LYS B HG3  1  
ATOM 4446   H HD2  . LYS B 2 27  ? 3.898   16.989  6.450   1.00 0.00  ? 327 LYS B HD2  1  
ATOM 4447   H HD3  . LYS B 2 27  ? 3.661   18.708  6.149   1.00 0.00  ? 327 LYS B HD3  1  
ATOM 4448   H HE2  . LYS B 2 27  ? 5.738   17.181  4.587   1.00 0.00  ? 327 LYS B HE2  1  
ATOM 4449   H HE3  . LYS B 2 27  ? 4.041   17.108  4.112   1.00 0.00  ? 327 LYS B HE3  1  
ATOM 4450   H HZ1  . LYS B 2 27  ? 5.469   19.662  4.572   1.00 0.00  ? 327 LYS B HZ1  1  
ATOM 4451   H HZ2  . LYS B 2 27  ? 5.392   18.912  3.050   1.00 0.00  ? 327 LYS B HZ2  1  
ATOM 4452   H HZ3  . LYS B 2 27  ? 3.967   19.429  3.820   1.00 0.00  ? 327 LYS B HZ3  1  
ATOM 4453   N N    . GLY B 2 28  ? 6.042   18.721  11.661  1.00 0.00  ? 328 GLY B N    1  
ATOM 4454   C CA   . GLY B 2 28  ? 5.635   19.287  12.976  1.00 0.00  ? 328 GLY B CA   1  
ATOM 4455   C C    . GLY B 2 28  ? 6.633   20.374  13.384  1.00 0.00  ? 328 GLY B C    1  
ATOM 4456   O O    . GLY B 2 28  ? 6.309   21.282  14.124  1.00 0.00  ? 328 GLY B O    1  
ATOM 4457   H H    . GLY B 2 28  ? 6.437   17.826  11.611  1.00 0.00  ? 328 GLY B H    1  
ATOM 4458   H HA2  . GLY B 2 28  ? 4.646   19.714  12.894  1.00 0.00  ? 328 GLY B HA2  1  
ATOM 4459   H HA3  . GLY B 2 28  ? 5.634   18.506  13.721  1.00 0.00  ? 328 GLY B HA3  1  
ATOM 4460   N N    . PHE B 2 29  ? 7.851   20.285  12.904  1.00 0.00  ? 329 PHE B N    1  
ATOM 4461   C CA   . PHE B 2 29  ? 8.890   21.308  13.257  1.00 0.00  ? 329 PHE B CA   1  
ATOM 4462   C C    . PHE B 2 29  ? 9.057   22.284  12.087  1.00 0.00  ? 329 PHE B C    1  
ATOM 4463   O O    . PHE B 2 29  ? 8.966   21.904  10.937  1.00 0.00  ? 329 PHE B O    1  
ATOM 4464   C CB   . PHE B 2 29  ? 10.225  20.605  13.522  1.00 0.00  ? 329 PHE B CB   1  
ATOM 4465   C CG   . PHE B 2 29  ? 10.047  19.601  14.637  1.00 0.00  ? 329 PHE B CG   1  
ATOM 4466   C CD1  . PHE B 2 29  ? 9.904   20.042  15.957  1.00 0.00  ? 329 PHE B CD1  1  
ATOM 4467   C CD2  . PHE B 2 29  ? 10.013  18.230  14.348  1.00 0.00  ? 329 PHE B CD2  1  
ATOM 4468   C CE1  . PHE B 2 29  ? 9.730   19.113  16.989  1.00 0.00  ? 329 PHE B CE1  1  
ATOM 4469   C CE2  . PHE B 2 29  ? 9.837   17.303  15.381  1.00 0.00  ? 329 PHE B CE2  1  
ATOM 4470   C CZ   . PHE B 2 29  ? 9.697   17.743  16.701  1.00 0.00  ? 329 PHE B CZ   1  
ATOM 4471   H H    . PHE B 2 29  ? 8.085   19.539  12.311  1.00 0.00  ? 329 PHE B H    1  
ATOM 4472   H HA   . PHE B 2 29  ? 8.589   21.854  14.141  1.00 0.00  ? 329 PHE B HA   1  
ATOM 4473   H HB2  . PHE B 2 29  ? 10.552  20.099  12.624  1.00 0.00  ? 329 PHE B HB2  1  
ATOM 4474   H HB3  . PHE B 2 29  ? 10.965  21.335  13.812  1.00 0.00  ? 329 PHE B HB3  1  
ATOM 4475   H HD1  . PHE B 2 29  ? 9.929   21.097  16.179  1.00 0.00  ? 329 PHE B HD1  1  
ATOM 4476   H HD2  . PHE B 2 29  ? 10.125  17.891  13.329  1.00 0.00  ? 329 PHE B HD2  1  
ATOM 4477   H HE1  . PHE B 2 29  ? 9.620   19.453  18.009  1.00 0.00  ? 329 PHE B HE1  1  
ATOM 4478   H HE2  . PHE B 2 29  ? 9.812   16.246  15.158  1.00 0.00  ? 329 PHE B HE2  1  
ATOM 4479   H HZ   . PHE B 2 29  ? 9.561   17.027  17.498  1.00 0.00  ? 329 PHE B HZ   1  
ATOM 4480   N N    . THR B 2 30  ? 9.312   23.540  12.363  1.00 0.00  ? 330 THR B N    1  
ATOM 4481   C CA   . THR B 2 30  ? 9.498   24.530  11.262  1.00 0.00  ? 330 THR B CA   1  
ATOM 4482   C C    . THR B 2 30  ? 10.983  24.592  10.893  1.00 0.00  ? 330 THR B C    1  
ATOM 4483   O O    . THR B 2 30  ? 11.360  25.129  9.870   1.00 0.00  ? 330 THR B O    1  
ATOM 4484   C CB   . THR B 2 30  ? 9.035   25.909  11.745  1.00 0.00  ? 330 THR B CB   1  
ATOM 4485   O OG1  . THR B 2 30  ? 7.780   25.783  12.399  1.00 0.00  ? 330 THR B OG1  1  
ATOM 4486   C CG2  . THR B 2 30  ? 8.896   26.858  10.553  1.00 0.00  ? 330 THR B CG2  1  
ATOM 4487   H H    . THR B 2 30  ? 9.405   23.846  13.290  1.00 0.00  ? 330 THR B H    1  
ATOM 4488   H HA   . THR B 2 30  ? 8.919   24.236  10.397  1.00 0.00  ? 330 THR B HA   1  
ATOM 4489   H HB   . THR B 2 30  ? 9.761   26.310  12.435  1.00 0.00  ? 330 THR B HB   1  
ATOM 4490   H HG1  . THR B 2 30  ? 7.249   26.549  12.172  1.00 0.00  ? 330 THR B HG1  1  
ATOM 4491   H HG21 . THR B 2 30  ? 9.832   26.906  10.018  1.00 0.00  ? 330 THR B HG21 1  
ATOM 4492   H HG22 . THR B 2 30  ? 8.121   26.496  9.894   1.00 0.00  ? 330 THR B HG22 1  
ATOM 4493   H HG23 . THR B 2 30  ? 8.635   27.844  10.909  1.00 0.00  ? 330 THR B HG23 1  
ATOM 4494   N N    . SER B 2 31  ? 11.828  24.040  11.722  1.00 0.00  ? 331 SER B N    1  
ATOM 4495   C CA   . SER B 2 31  ? 13.287  24.057  11.425  1.00 0.00  ? 331 SER B CA   1  
ATOM 4496   C C    . SER B 2 31  ? 13.542  23.279  10.137  1.00 0.00  ? 331 SER B C    1  
ATOM 4497   O O    . SER B 2 31  ? 12.823  22.356  9.808   1.00 0.00  ? 331 SER B O    1  
ATOM 4498   C CB   . SER B 2 31  ? 14.053  23.407  12.578  1.00 0.00  ? 331 SER B CB   1  
ATOM 4499   O OG   . SER B 2 31  ? 15.397  23.178  12.179  1.00 0.00  ? 331 SER B OG   1  
ATOM 4500   H H    . SER B 2 31  ? 11.499  23.605  12.535  1.00 0.00  ? 331 SER B H    1  
ATOM 4501   H HA   . SER B 2 31  ? 13.619  25.077  11.300  1.00 0.00  ? 331 SER B HA   1  
ATOM 4502   H HB2  . SER B 2 31  ? 14.046  24.063  13.432  1.00 0.00  ? 331 SER B HB2  1  
ATOM 4503   H HB3  . SER B 2 31  ? 13.580  22.471  12.841  1.00 0.00  ? 331 SER B HB3  1  
ATOM 4504   H HG   . SER B 2 31  ? 15.522  23.582  11.317  1.00 0.00  ? 331 SER B HG   1  
ATOM 4505   N N    . GLU B 2 32  ? 14.552  23.645  9.400   1.00 0.00  ? 332 GLU B N    1  
ATOM 4506   C CA   . GLU B 2 32  ? 14.835  22.920  8.134   1.00 0.00  ? 332 GLU B CA   1  
ATOM 4507   C C    . GLU B 2 32  ? 15.289  21.502  8.460   1.00 0.00  ? 332 GLU B C    1  
ATOM 4508   O O    . GLU B 2 32  ? 16.104  21.283  9.335   1.00 0.00  ? 332 GLU B O    1  
ATOM 4509   C CB   . GLU B 2 32  ? 15.933  23.642  7.359   1.00 0.00  ? 332 GLU B CB   1  
ATOM 4510   C CG   . GLU B 2 32  ? 16.132  22.966  6.002   1.00 0.00  ? 332 GLU B CG   1  
ATOM 4511   C CD   . GLU B 2 32  ? 17.233  23.694  5.231   1.00 0.00  ? 332 GLU B CD   1  
ATOM 4512   O OE1  . GLU B 2 32  ? 17.615  24.770  5.660   1.00 0.00  ? 332 GLU B OE1  1  
ATOM 4513   O OE2  . GLU B 2 32  ? 17.669  23.168  4.221   1.00 0.00  ? 332 GLU B OE2  1  
ATOM 4514   H H    . GLU B 2 32  ? 15.120  24.393  9.678   1.00 0.00  ? 332 GLU B H    1  
ATOM 4515   H HA   . GLU B 2 32  ? 13.937  22.882  7.534   1.00 0.00  ? 332 GLU B HA   1  
ATOM 4516   H HB2  . GLU B 2 32  ? 15.649  24.673  7.211   1.00 0.00  ? 332 GLU B HB2  1  
ATOM 4517   H HB3  . GLU B 2 32  ? 16.854  23.597  7.917   1.00 0.00  ? 332 GLU B HB3  1  
ATOM 4518   H HG2  . GLU B 2 32  ? 16.413  21.935  6.150   1.00 0.00  ? 332 GLU B HG2  1  
ATOM 4519   H HG3  . GLU B 2 32  ? 15.211  23.011  5.438   1.00 0.00  ? 332 GLU B HG3  1  
ATOM 4520   N N    . ILE B 2 33  ? 14.758  20.537  7.760   1.00 0.00  ? 333 ILE B N    1  
ATOM 4521   C CA   . ILE B 2 33  ? 15.131  19.110  8.004   1.00 0.00  ? 333 ILE B CA   1  
ATOM 4522   C C    . ILE B 2 33  ? 15.468  18.433  6.677   1.00 0.00  ? 333 ILE B C    1  
ATOM 4523   O O    . ILE B 2 33  ? 14.716  18.507  5.725   1.00 0.00  ? 333 ILE B O    1  
ATOM 4524   C CB   . ILE B 2 33  ? 13.954  18.383  8.655   1.00 0.00  ? 333 ILE B CB   1  
ATOM 4525   C CG1  . ILE B 2 33  ? 13.636  19.049  9.996   1.00 0.00  ? 333 ILE B CG1  1  
ATOM 4526   C CG2  . ILE B 2 33  ? 14.325  16.919  8.886   1.00 0.00  ? 333 ILE B CG2  1  
ATOM 4527   C CD1  . ILE B 2 33  ? 12.318  18.507  10.552  1.00 0.00  ? 333 ILE B CD1  1  
ATOM 4528   H H    . ILE B 2 33  ? 14.104  20.756  7.068   1.00 0.00  ? 333 ILE B H    1  
ATOM 4529   H HA   . ILE B 2 33  ? 15.990  19.054  8.660   1.00 0.00  ? 333 ILE B HA   1  
ATOM 4530   H HB   . ILE B 2 33  ? 13.092  18.441  8.006   1.00 0.00  ? 333 ILE B HB   1  
ATOM 4531   H HG12 . ILE B 2 33  ? 14.429  18.842  10.695  1.00 0.00  ? 333 ILE B HG12 1  
ATOM 4532   H HG13 . ILE B 2 33  ? 13.551  20.117  9.854   1.00 0.00  ? 333 ILE B HG13 1  
ATOM 4533   H HG21 . ILE B 2 33  ? 15.279  16.864  9.389   1.00 0.00  ? 333 ILE B HG21 1  
ATOM 4534   H HG22 . ILE B 2 33  ? 13.568  16.449  9.495   1.00 0.00  ? 333 ILE B HG22 1  
ATOM 4535   H HG23 . ILE B 2 33  ? 14.390  16.409  7.936   1.00 0.00  ? 333 ILE B HG23 1  
ATOM 4536   H HD11 . ILE B 2 33  ? 12.274  17.439  10.405  1.00 0.00  ? 333 ILE B HD11 1  
ATOM 4537   H HD12 . ILE B 2 33  ? 12.259  18.727  11.608  1.00 0.00  ? 333 ILE B HD12 1  
ATOM 4538   H HD13 . ILE B 2 33  ? 11.491  18.977  10.041  1.00 0.00  ? 333 ILE B HD13 1  
ATOM 4539   N N    . THR B 2 34  ? 16.589  17.759  6.615   1.00 0.00  ? 334 THR B N    1  
ATOM 4540   C CA   . THR B 2 34  ? 16.991  17.050  5.361   1.00 0.00  ? 334 THR B CA   1  
ATOM 4541   C C    . THR B 2 34  ? 17.365  15.611  5.697   1.00 0.00  ? 334 THR B C    1  
ATOM 4542   O O    . THR B 2 34  ? 17.820  15.311  6.783   1.00 0.00  ? 334 THR B O    1  
ATOM 4543   C CB   . THR B 2 34  ? 18.198  17.740  4.720   1.00 0.00  ? 334 THR B CB   1  
ATOM 4544   O OG1  . THR B 2 34  ? 17.853  19.076  4.384   1.00 0.00  ? 334 THR B OG1  1  
ATOM 4545   C CG2  . THR B 2 34  ? 18.604  16.976  3.451   1.00 0.00  ? 334 THR B CG2  1  
ATOM 4546   H H    . THR B 2 34  ? 17.164  17.707  7.408   1.00 0.00  ? 334 THR B H    1  
ATOM 4547   H HA   . THR B 2 34  ? 16.170  17.043  4.657   1.00 0.00  ? 334 THR B HA   1  
ATOM 4548   H HB   . THR B 2 34  ? 19.024  17.743  5.414   1.00 0.00  ? 334 THR B HB   1  
ATOM 4549   H HG1  . THR B 2 34  ? 17.197  19.046  3.682   1.00 0.00  ? 334 THR B HG1  1  
ATOM 4550   H HG21 . THR B 2 34  ? 17.737  16.841  2.820   1.00 0.00  ? 334 THR B HG21 1  
ATOM 4551   H HG22 . THR B 2 34  ? 19.353  17.538  2.917   1.00 0.00  ? 334 THR B HG22 1  
ATOM 4552   H HG23 . THR B 2 34  ? 19.005  16.008  3.719   1.00 0.00  ? 334 THR B HG23 1  
ATOM 4553   N N    . VAL B 2 35  ? 17.201  14.730  4.752   1.00 0.00  ? 335 VAL B N    1  
ATOM 4554   C CA   . VAL B 2 35  ? 17.560  13.297  4.950   1.00 0.00  ? 335 VAL B CA   1  
ATOM 4555   C C    . VAL B 2 35  ? 18.674  12.975  3.959   1.00 0.00  ? 335 VAL B C    1  
ATOM 4556   O O    . VAL B 2 35  ? 18.645  13.436  2.838   1.00 0.00  ? 335 VAL B O    1  
ATOM 4557   C CB   . VAL B 2 35  ? 16.340  12.420  4.660   1.00 0.00  ? 335 VAL B CB   1  
ATOM 4558   C CG1  . VAL B 2 35  ? 16.701  10.954  4.897   1.00 0.00  ? 335 VAL B CG1  1  
ATOM 4559   C CG2  . VAL B 2 35  ? 15.191  12.818  5.590   1.00 0.00  ? 335 VAL B CG2  1  
ATOM 4560   H H    . VAL B 2 35  ? 16.866  15.015  3.876   1.00 0.00  ? 335 VAL B H    1  
ATOM 4561   H HA   . VAL B 2 35  ? 17.908  13.125  5.960   1.00 0.00  ? 335 VAL B HA   1  
ATOM 4562   H HB   . VAL B 2 35  ? 16.038  12.554  3.632   1.00 0.00  ? 335 VAL B HB   1  
ATOM 4563   H HG11 . VAL B 2 35  ? 17.076  10.834  5.903   1.00 0.00  ? 335 VAL B HG11 1  
ATOM 4564   H HG12 . VAL B 2 35  ? 15.823  10.339  4.765   1.00 0.00  ? 335 VAL B HG12 1  
ATOM 4565   H HG13 . VAL B 2 35  ? 17.460  10.652  4.191   1.00 0.00  ? 335 VAL B HG13 1  
ATOM 4566   H HG21 . VAL B 2 35  ? 15.555  12.888  6.605   1.00 0.00  ? 335 VAL B HG21 1  
ATOM 4567   H HG22 . VAL B 2 35  ? 14.794  13.775  5.284   1.00 0.00  ? 335 VAL B HG22 1  
ATOM 4568   H HG23 . VAL B 2 35  ? 14.412  12.072  5.539   1.00 0.00  ? 335 VAL B HG23 1  
ATOM 4569   N N    . THR B 2 36  ? 19.657  12.202  4.350   1.00 0.00  ? 336 THR B N    1  
ATOM 4570   C CA   . THR B 2 36  ? 20.776  11.863  3.406   1.00 0.00  ? 336 THR B CA   1  
ATOM 4571   C C    . THR B 2 36  ? 21.004  10.352  3.407   1.00 0.00  ? 336 THR B C    1  
ATOM 4572   O O    . THR B 2 36  ? 21.198  9.751   4.445   1.00 0.00  ? 336 THR B O    1  
ATOM 4573   C CB   . THR B 2 36  ? 22.058  12.563  3.861   1.00 0.00  ? 336 THR B CB   1  
ATOM 4574   O OG1  . THR B 2 36  ? 21.879  13.971  3.794   1.00 0.00  ? 336 THR B OG1  1  
ATOM 4575   C CG2  . THR B 2 36  ? 23.218  12.147  2.953   1.00 0.00  ? 336 THR B CG2  1  
ATOM 4576   H H    . THR B 2 36  ? 19.658  11.829  5.256   1.00 0.00  ? 336 THR B H    1  
ATOM 4577   H HA   . THR B 2 36  ? 20.529  12.184  2.406   1.00 0.00  ? 336 THR B HA   1  
ATOM 4578   H HB   . THR B 2 36  ? 22.283  12.280  4.875   1.00 0.00  ? 336 THR B HB   1  
ATOM 4579   H HG1  . THR B 2 36  ? 21.303  14.233  4.517   1.00 0.00  ? 336 THR B HG1  1  
ATOM 4580   H HG21 . THR B 2 36  ? 22.898  12.174  1.922   1.00 0.00  ? 336 THR B HG21 1  
ATOM 4581   H HG22 . THR B 2 36  ? 24.045  12.827  3.091   1.00 0.00  ? 336 THR B HG22 1  
ATOM 4582   H HG23 . THR B 2 36  ? 23.531  11.145  3.206   1.00 0.00  ? 336 THR B HG23 1  
ATOM 4583   N N    . SER B 2 37  ? 20.982  9.728   2.254   1.00 0.00  ? 337 SER B N    1  
ATOM 4584   C CA   . SER B 2 37  ? 21.199  8.250   2.192   1.00 0.00  ? 337 SER B CA   1  
ATOM 4585   C C    . SER B 2 37  ? 22.100  7.877   1.003   1.00 0.00  ? 337 SER B C    1  
ATOM 4586   O O    . SER B 2 37  ? 21.710  7.952   -0.145  1.00 0.00  ? 337 SER B O    1  
ATOM 4587   C CB   . SER B 2 37  ? 19.850  7.549   2.044   1.00 0.00  ? 337 SER B CB   1  
ATOM 4588   O OG   . SER B 2 37  ? 20.061  6.204   1.632   1.00 0.00  ? 337 SER B OG   1  
ATOM 4589   H H    . SER B 2 37  ? 20.818  10.226  1.431   1.00 0.00  ? 337 SER B H    1  
ATOM 4590   H HA   . SER B 2 37  ? 21.672  7.909   3.102   1.00 0.00  ? 337 SER B HA   1  
ATOM 4591   H HB2  . SER B 2 37  ? 19.340  7.553   2.992   1.00 0.00  ? 337 SER B HB2  1  
ATOM 4592   H HB3  . SER B 2 37  ? 19.250  8.073   1.313   1.00 0.00  ? 337 SER B HB3  1  
ATOM 4593   H HG   . SER B 2 37  ? 19.278  5.698   1.860   1.00 0.00  ? 337 SER B HG   1  
ATOM 4594   N N    . ASN B 2 38  ? 23.285  7.421   1.299   1.00 0.00  ? 338 ASN B N    1  
ATOM 4595   C CA   . ASN B 2 38  ? 24.235  6.964   0.238   1.00 0.00  ? 338 ASN B CA   1  
ATOM 4596   C C    . ASN B 2 38  ? 24.337  7.948   -0.940  1.00 0.00  ? 338 ASN B C    1  
ATOM 4597   O O    . ASN B 2 38  ? 24.162  7.561   -2.079  1.00 0.00  ? 338 ASN B O    1  
ATOM 4598   C CB   . ASN B 2 38  ? 23.767  5.608   -0.294  1.00 0.00  ? 338 ASN B CB   1  
ATOM 4599   C CG   . ASN B 2 38  ? 23.876  4.560   0.816   1.00 0.00  ? 338 ASN B CG   1  
ATOM 4600   O OD1  . ASN B 2 38  ? 24.608  4.742   1.768   1.00 0.00  ? 338 ASN B OD1  1  
ATOM 4601   N ND2  . ASN B 2 38  ? 23.170  3.466   0.735   1.00 0.00  ? 338 ASN B ND2  1  
ATOM 4602   H H    . ASN B 2 38  ? 23.533  7.330   2.244   1.00 0.00  ? 338 ASN B H    1  
ATOM 4603   H HA   . ASN B 2 38  ? 25.213  6.843   0.675   1.00 0.00  ? 338 ASN B HA   1  
ATOM 4604   H HB2  . ASN B 2 38  ? 22.741  5.683   -0.623  1.00 0.00  ? 338 ASN B HB2  1  
ATOM 4605   H HB3  . ASN B 2 38  ? 24.392  5.313   -1.125  1.00 0.00  ? 338 ASN B HB3  1  
ATOM 4606   H HD21 . ASN B 2 38  ? 22.579  3.320   -0.033  1.00 0.00  ? 338 ASN B HD21 1  
ATOM 4607   H HD22 . ASN B 2 38  ? 23.229  2.791   1.443   1.00 0.00  ? 338 ASN B HD22 1  
ATOM 4608   N N    . GLY B 2 39  ? 24.671  9.193   -0.711  1.00 0.00  ? 339 GLY B N    1  
ATOM 4609   C CA   . GLY B 2 39  ? 24.837  10.139  -1.862  1.00 0.00  ? 339 GLY B CA   1  
ATOM 4610   C C    . GLY B 2 39  ? 23.505  10.757  -2.304  1.00 0.00  ? 339 GLY B C    1  
ATOM 4611   O O    . GLY B 2 39  ? 23.493  11.745  -3.011  1.00 0.00  ? 339 GLY B O    1  
ATOM 4612   H H    . GLY B 2 39  ? 24.868  9.510   0.196   1.00 0.00  ? 339 GLY B H    1  
ATOM 4613   H HA2  . GLY B 2 39  ? 25.508  10.932  -1.568  1.00 0.00  ? 339 GLY B HA2  1  
ATOM 4614   H HA3  . GLY B 2 39  ? 25.271  9.608   -2.697  1.00 0.00  ? 339 GLY B HA3  1  
ATOM 4615   N N    . LYS B 2 40  ? 22.386  10.199  -1.906  1.00 0.00  ? 340 LYS B N    1  
ATOM 4616   C CA   . LYS B 2 40  ? 21.063  10.775  -2.323  1.00 0.00  ? 340 LYS B CA   1  
ATOM 4617   C C    . LYS B 2 40  ? 20.372  11.392  -1.111  1.00 0.00  ? 340 LYS B C    1  
ATOM 4618   O O    . LYS B 2 40  ? 20.135  10.732  -0.118  1.00 0.00  ? 340 LYS B O    1  
ATOM 4619   C CB   . LYS B 2 40  ? 20.184  9.662   -2.904  1.00 0.00  ? 340 LYS B CB   1  
ATOM 4620   C CG   . LYS B 2 40  ? 20.748  9.234   -4.265  1.00 0.00  ? 340 LYS B CG   1  
ATOM 4621   C CD   . LYS B 2 40  ? 19.901  8.087   -4.868  1.00 0.00  ? 340 LYS B CD   1  
ATOM 4622   C CE   . LYS B 2 40  ? 18.806  8.640   -5.796  1.00 0.00  ? 340 LYS B CE   1  
ATOM 4623   N NZ   . LYS B 2 40  ? 18.219  9.883   -5.220  1.00 0.00  ? 340 LYS B NZ   1  
ATOM 4624   H H    . LYS B 2 40  ? 22.411  9.404   -1.336  1.00 0.00  ? 340 LYS B H    1  
ATOM 4625   H HA   . LYS B 2 40  ? 21.206  11.538  -3.076  1.00 0.00  ? 340 LYS B HA   1  
ATOM 4626   H HB2  . LYS B 2 40  ? 20.185  8.815   -2.231  1.00 0.00  ? 340 LYS B HB2  1  
ATOM 4627   H HB3  . LYS B 2 40  ? 19.176  10.024  -3.028  1.00 0.00  ? 340 LYS B HB3  1  
ATOM 4628   H HG2  . LYS B 2 40  ? 20.742  10.085  -4.933  1.00 0.00  ? 340 LYS B HG2  1  
ATOM 4629   H HG3  . LYS B 2 40  ? 21.766  8.896   -4.133  1.00 0.00  ? 340 LYS B HG3  1  
ATOM 4630   H HD2  . LYS B 2 40  ? 20.543  7.433   -5.441  1.00 0.00  ? 340 LYS B HD2  1  
ATOM 4631   H HD3  . LYS B 2 40  ? 19.438  7.517   -4.074  1.00 0.00  ? 340 LYS B HD3  1  
ATOM 4632   H HE2  . LYS B 2 40  ? 19.234  8.863   -6.762  1.00 0.00  ? 340 LYS B HE2  1  
ATOM 4633   H HE3  . LYS B 2 40  ? 18.030  7.898   -5.912  1.00 0.00  ? 340 LYS B HE3  1  
ATOM 4634   H HZ1  . LYS B 2 40  ? 18.981  10.530  -4.939  1.00 0.00  ? 340 LYS B HZ1  1  
ATOM 4635   H HZ2  . LYS B 2 40  ? 17.618  10.343  -5.936  1.00 0.00  ? 340 LYS B HZ2  1  
ATOM 4636   H HZ3  . LYS B 2 40  ? 17.645  9.643   -4.388  1.00 0.00  ? 340 LYS B HZ3  1  
ATOM 4637   N N    . SER B 2 41  ? 20.065  12.667  -1.176  1.00 0.00  ? 341 SER B N    1  
ATOM 4638   C CA   . SER B 2 41  ? 19.407  13.355  -0.024  1.00 0.00  ? 341 SER B CA   1  
ATOM 4639   C C    . SER B 2 41  ? 18.162  14.087  -0.502  1.00 0.00  ? 341 SER B C    1  
ATOM 4640   O O    . SER B 2 41  ? 18.081  14.548  -1.623  1.00 0.00  ? 341 SER B O    1  
ATOM 4641   C CB   . SER B 2 41  ? 20.388  14.356  0.590   1.00 0.00  ? 341 SER B CB   1  
ATOM 4642   O OG   . SER B 2 41  ? 20.726  15.340  -0.382  1.00 0.00  ? 341 SER B OG   1  
ATOM 4643   H H    . SER B 2 41  ? 20.293  13.186  -1.975  1.00 0.00  ? 341 SER B H    1  
ATOM 4644   H HA   . SER B 2 41  ? 19.113  12.639  0.721   1.00 0.00  ? 341 SER B HA   1  
ATOM 4645   H HB2  . SER B 2 41  ? 19.933  14.838  1.438   1.00 0.00  ? 341 SER B HB2  1  
ATOM 4646   H HB3  . SER B 2 41  ? 21.279  13.832  0.911   1.00 0.00  ? 341 SER B HB3  1  
ATOM 4647   H HG   . SER B 2 41  ? 21.318  15.973  0.031   1.00 0.00  ? 341 SER B HG   1  
ATOM 4648   N N    . ALA B 2 42  ? 17.178  14.176  0.350   1.00 0.00  ? 342 ALA B N    1  
ATOM 4649   C CA   . ALA B 2 42  ? 15.903  14.855  -0.035  1.00 0.00  ? 342 ALA B CA   1  
ATOM 4650   C C    . ALA B 2 42  ? 15.316  15.595  1.170   1.00 0.00  ? 342 ALA B C    1  
ATOM 4651   O O    . ALA B 2 42  ? 15.770  15.454  2.288   1.00 0.00  ? 342 ALA B O    1  
ATOM 4652   C CB   . ALA B 2 42  ? 14.898  13.808  -0.527  1.00 0.00  ? 342 ALA B CB   1  
ATOM 4653   H H    . ALA B 2 42  ? 17.277  13.771  1.242   1.00 0.00  ? 342 ALA B H    1  
ATOM 4654   H HA   . ALA B 2 42  ? 16.092  15.568  -0.827  1.00 0.00  ? 342 ALA B HA   1  
ATOM 4655   H HB1  . ALA B 2 42  ? 15.397  13.112  -1.184  1.00 0.00  ? 342 ALA B HB1  1  
ATOM 4656   H HB2  . ALA B 2 42  ? 14.488  13.276  0.314   1.00 0.00  ? 342 ALA B HB2  1  
ATOM 4657   H HB3  . ALA B 2 42  ? 14.102  14.297  -1.062  1.00 0.00  ? 342 ALA B HB3  1  
ATOM 4658   N N    . SER B 2 43  ? 14.307  16.392  0.936   1.00 0.00  ? 343 SER B N    1  
ATOM 4659   C CA   . SER B 2 43  ? 13.668  17.164  2.041   1.00 0.00  ? 343 SER B CA   1  
ATOM 4660   C C    . SER B 2 43  ? 12.555  16.323  2.679   1.00 0.00  ? 343 SER B C    1  
ATOM 4661   O O    . SER B 2 43  ? 11.836  15.623  1.995   1.00 0.00  ? 343 SER B O    1  
ATOM 4662   C CB   . SER B 2 43  ? 13.062  18.436  1.452   1.00 0.00  ? 343 SER B CB   1  
ATOM 4663   O OG   . SER B 2 43  ? 14.098  19.240  0.900   1.00 0.00  ? 343 SER B OG   1  
ATOM 4664   H H    . SER B 2 43  ? 13.965  16.483  0.023   1.00 0.00  ? 343 SER B H    1  
ATOM 4665   H HA   . SER B 2 43  ? 14.406  17.422  2.786   1.00 0.00  ? 343 SER B HA   1  
ATOM 4666   H HB2  . SER B 2 43  ? 12.359  18.175  0.672   1.00 0.00  ? 343 SER B HB2  1  
ATOM 4667   H HB3  . SER B 2 43  ? 12.548  18.979  2.228   1.00 0.00  ? 343 SER B HB3  1  
ATOM 4668   H HG   . SER B 2 43  ? 14.921  18.749  0.960   1.00 0.00  ? 343 SER B HG   1  
ATOM 4669   N N    . ALA B 2 44  ? 12.415  16.366  3.982   1.00 0.00  ? 344 ALA B N    1  
ATOM 4670   C CA   . ALA B 2 44  ? 11.361  15.550  4.650   1.00 0.00  ? 344 ALA B CA   1  
ATOM 4671   C C    . ALA B 2 44  ? 10.017  16.278  4.600   1.00 0.00  ? 344 ALA B C    1  
ATOM 4672   O O    . ALA B 2 44  ? 8.980   15.698  4.854   1.00 0.00  ? 344 ALA B O    1  
ATOM 4673   C CB   . ALA B 2 44  ? 11.756  15.327  6.112   1.00 0.00  ? 344 ALA B CB   1  
ATOM 4674   H H    . ALA B 2 44  ? 13.005  16.907  4.537   1.00 0.00  ? 344 ALA B H    1  
ATOM 4675   H HA   . ALA B 2 44  ? 11.275  14.596  4.154   1.00 0.00  ? 344 ALA B HA   1  
ATOM 4676   H HB1  . ALA B 2 44  ? 11.909  16.282  6.593   1.00 0.00  ? 344 ALA B HB1  1  
ATOM 4677   H HB2  . ALA B 2 44  ? 10.969  14.790  6.621   1.00 0.00  ? 344 ALA B HB2  1  
ATOM 4678   H HB3  . ALA B 2 44  ? 12.671  14.753  6.155   1.00 0.00  ? 344 ALA B HB3  1  
ATOM 4679   N N    . LYS B 2 45  ? 10.013  17.536  4.245   1.00 0.00  ? 345 LYS B N    1  
ATOM 4680   C CA   . LYS B 2 45  ? 8.719   18.279  4.151   1.00 0.00  ? 345 LYS B CA   1  
ATOM 4681   C C    . LYS B 2 45  ? 8.185   18.091  2.738   1.00 0.00  ? 345 LYS B C    1  
ATOM 4682   O O    . LYS B 2 45  ? 7.370   18.845  2.246   1.00 0.00  ? 345 LYS B O    1  
ATOM 4683   C CB   . LYS B 2 45  ? 8.928   19.766  4.455   1.00 0.00  ? 345 LYS B CB   1  
ATOM 4684   C CG   . LYS B 2 45  ? 9.961   20.359  3.499   1.00 0.00  ? 345 LYS B CG   1  
ATOM 4685   C CD   . LYS B 2 45  ? 10.242  21.808  3.903   1.00 0.00  ? 345 LYS B CD   1  
ATOM 4686   C CE   . LYS B 2 45  ? 11.123  22.484  2.849   1.00 0.00  ? 345 LYS B CE   1  
ATOM 4687   N NZ   . LYS B 2 45  ? 10.451  22.431  1.520   1.00 0.00  ? 345 LYS B NZ   1  
ATOM 4688   H H    . LYS B 2 45  ? 10.856  17.981  4.015   1.00 0.00  ? 345 LYS B H    1  
ATOM 4689   H HA   . LYS B 2 45  ? 8.011   17.863  4.857   1.00 0.00  ? 345 LYS B HA   1  
ATOM 4690   H HB2  . LYS B 2 45  ? 7.989   20.288  4.335   1.00 0.00  ? 345 LYS B HB2  1  
ATOM 4691   H HB3  . LYS B 2 45  ? 9.274   19.878  5.471   1.00 0.00  ? 345 LYS B HB3  1  
ATOM 4692   H HG2  . LYS B 2 45  ? 10.871  19.785  3.558   1.00 0.00  ? 345 LYS B HG2  1  
ATOM 4693   H HG3  . LYS B 2 45  ? 9.580   20.335  2.490   1.00 0.00  ? 345 LYS B HG3  1  
ATOM 4694   H HD2  . LYS B 2 45  ? 9.308   22.344  3.989   1.00 0.00  ? 345 LYS B HD2  1  
ATOM 4695   H HD3  . LYS B 2 45  ? 10.751  21.822  4.855   1.00 0.00  ? 345 LYS B HD3  1  
ATOM 4696   H HE2  . LYS B 2 45  ? 11.287  23.514  3.127   1.00 0.00  ? 345 LYS B HE2  1  
ATOM 4697   H HE3  . LYS B 2 45  ? 12.073  21.972  2.792   1.00 0.00  ? 345 LYS B HE3  1  
ATOM 4698   H HZ1  . LYS B 2 45  ? 9.424   22.532  1.647   1.00 0.00  ? 345 LYS B HZ1  1  
ATOM 4699   H HZ2  . LYS B 2 45  ? 10.802  23.205  0.922   1.00 0.00  ? 345 LYS B HZ2  1  
ATOM 4700   H HZ3  . LYS B 2 45  ? 10.656  21.518  1.064   1.00 0.00  ? 345 LYS B HZ3  1  
ATOM 4701   N N    . SER B 2 46  ? 8.665   17.064  2.090   1.00 0.00  ? 346 SER B N    1  
ATOM 4702   C CA   . SER B 2 46  ? 8.211   16.786  0.695   1.00 0.00  ? 346 SER B CA   1  
ATOM 4703   C C    . SER B 2 46  ? 8.198   15.293  0.393   1.00 0.00  ? 346 SER B C    1  
ATOM 4704   O O    . SER B 2 46  ? 9.205   14.702  0.055   1.00 0.00  ? 346 SER B O    1  
ATOM 4705   C CB   . SER B 2 46  ? 9.142   17.497  -0.287  1.00 0.00  ? 346 SER B CB   1  
ATOM 4706   O OG   . SER B 2 46  ? 9.096   18.898  -0.045  1.00 0.00  ? 346 SER B OG   1  
ATOM 4707   H H    . SER B 2 46  ? 9.322   16.507  2.570   1.00 0.00  ? 346 SER B H    1  
ATOM 4708   H HA   . SER B 2 46  ? 7.209   17.168  0.568   1.00 0.00  ? 346 SER B HA   1  
ATOM 4709   H HB2  . SER B 2 46  ? 10.150  17.146  -0.151  1.00 0.00  ? 346 SER B HB2  1  
ATOM 4710   H HB3  . SER B 2 46  ? 8.822   17.286  -1.300  1.00 0.00  ? 346 SER B HB3  1  
ATOM 4711   H HG   . SER B 2 46  ? 9.387   19.346  -0.843  1.00 0.00  ? 346 SER B HG   1  
ATOM 4712   N N    . LEU B 2 47  ? 7.048   14.681  0.493   1.00 0.00  ? 347 LEU B N    1  
ATOM 4713   C CA   . LEU B 2 47  ? 6.947   13.232  0.189   1.00 0.00  ? 347 LEU B CA   1  
ATOM 4714   C C    . LEU B 2 47  ? 7.373   13.002  -1.258  1.00 0.00  ? 347 LEU B C    1  
ATOM 4715   O O    . LEU B 2 47  ? 7.971   12.003  -1.574  1.00 0.00  ? 347 LEU B O    1  
ATOM 4716   C CB   . LEU B 2 47  ? 5.505   12.756  0.410   1.00 0.00  ? 347 LEU B CB   1  
ATOM 4717   C CG   . LEU B 2 47  ? 5.326   11.306  -0.064  1.00 0.00  ? 347 LEU B CG   1  
ATOM 4718   C CD1  . LEU B 2 47  ? 6.362   10.390  0.597   1.00 0.00  ? 347 LEU B CD1  1  
ATOM 4719   C CD2  . LEU B 2 47  ? 3.918   10.834  0.320   1.00 0.00  ? 347 LEU B CD2  1  
ATOM 4720   H H    . LEU B 2 47  ? 6.249   15.179  0.769   1.00 0.00  ? 347 LEU B H    1  
ATOM 4721   H HA   . LEU B 2 47  ? 7.604   12.690  0.841   1.00 0.00  ? 347 LEU B HA   1  
ATOM 4722   H HB2  . LEU B 2 47  ? 5.266   12.817  1.460   1.00 0.00  ? 347 LEU B HB2  1  
ATOM 4723   H HB3  . LEU B 2 47  ? 4.838   13.388  -0.144  1.00 0.00  ? 347 LEU B HB3  1  
ATOM 4724   H HG   . LEU B 2 47  ? 5.439   11.261  -1.137  1.00 0.00  ? 347 LEU B HG   1  
ATOM 4725   H HD11 . LEU B 2 47  ? 6.469   10.659  1.638   1.00 0.00  ? 347 LEU B HD11 1  
ATOM 4726   H HD12 . LEU B 2 47  ? 6.037   9.361   0.520   1.00 0.00  ? 347 LEU B HD12 1  
ATOM 4727   H HD13 . LEU B 2 47  ? 7.312   10.499  0.096   1.00 0.00  ? 347 LEU B HD13 1  
ATOM 4728   H HD21 . LEU B 2 47  ? 3.187   11.535  -0.049  1.00 0.00  ? 347 LEU B HD21 1  
ATOM 4729   H HD22 . LEU B 2 47  ? 3.732   9.862   -0.112  1.00 0.00  ? 347 LEU B HD22 1  
ATOM 4730   H HD23 . LEU B 2 47  ? 3.839   10.772  1.397   1.00 0.00  ? 347 LEU B HD23 1  
ATOM 4731   N N    . PHE B 2 48  ? 7.087   13.918  -2.146  1.00 0.00  ? 348 PHE B N    1  
ATOM 4732   C CA   . PHE B 2 48  ? 7.498   13.706  -3.565  1.00 0.00  ? 348 PHE B CA   1  
ATOM 4733   C C    . PHE B 2 48  ? 9.014   13.503  -3.645  1.00 0.00  ? 348 PHE B C    1  
ATOM 4734   O O    . PHE B 2 48  ? 9.489   12.557  -4.240  1.00 0.00  ? 348 PHE B O    1  
ATOM 4735   C CB   . PHE B 2 48  ? 7.166   14.938  -4.414  1.00 0.00  ? 348 PHE B CB   1  
ATOM 4736   C CG   . PHE B 2 48  ? 5.670   15.174  -4.493  1.00 0.00  ? 348 PHE B CG   1  
ATOM 4737   C CD1  . PHE B 2 48  ? 4.831   14.210  -5.068  1.00 0.00  ? 348 PHE B CD1  1  
ATOM 4738   C CD2  . PHE B 2 48  ? 5.126   16.376  -4.014  1.00 0.00  ? 348 PHE B CD2  1  
ATOM 4739   C CE1  . PHE B 2 48  ? 3.454   14.447  -5.159  1.00 0.00  ? 348 PHE B CE1  1  
ATOM 4740   C CE2  . PHE B 2 48  ? 3.748   16.609  -4.105  1.00 0.00  ? 348 PHE B CE2  1  
ATOM 4741   C CZ   . PHE B 2 48  ? 2.914   15.643  -4.679  1.00 0.00  ? 348 PHE B CZ   1  
ATOM 4742   H H    . PHE B 2 48  ? 6.617   14.737  -1.883  1.00 0.00  ? 348 PHE B H    1  
ATOM 4743   H HA   . PHE B 2 48  ? 6.993   12.842  -3.965  1.00 0.00  ? 348 PHE B HA   1  
ATOM 4744   H HB2  . PHE B 2 48  ? 7.646   15.803  -3.981  1.00 0.00  ? 348 PHE B HB2  1  
ATOM 4745   H HB3  . PHE B 2 48  ? 7.552   14.784  -5.410  1.00 0.00  ? 348 PHE B HB3  1  
ATOM 4746   H HD1  . PHE B 2 48  ? 5.244   13.285  -5.440  1.00 0.00  ? 348 PHE B HD1  1  
ATOM 4747   H HD2  . PHE B 2 48  ? 5.768   17.121  -3.571  1.00 0.00  ? 348 PHE B HD2  1  
ATOM 4748   H HE1  . PHE B 2 48  ? 2.807   13.707  -5.602  1.00 0.00  ? 348 PHE B HE1  1  
ATOM 4749   H HE2  . PHE B 2 48  ? 3.331   17.532  -3.732  1.00 0.00  ? 348 PHE B HE2  1  
ATOM 4750   H HZ   . PHE B 2 48  ? 1.852   15.818  -4.750  1.00 0.00  ? 348 PHE B HZ   1  
ATOM 4751   N N    . LYS B 2 49  ? 9.781   14.411  -3.097  1.00 0.00  ? 349 LYS B N    1  
ATOM 4752   C CA   . LYS B 2 49  ? 11.262  14.303  -3.190  1.00 0.00  ? 349 LYS B CA   1  
ATOM 4753   C C    . LYS B 2 49  ? 11.787  13.143  -2.337  1.00 0.00  ? 349 LYS B C    1  
ATOM 4754   O O    . LYS B 2 49  ? 12.859  12.626  -2.585  1.00 0.00  ? 349 LYS B O    1  
ATOM 4755   C CB   . LYS B 2 49  ? 11.862  15.630  -2.720  1.00 0.00  ? 349 LYS B CB   1  
ATOM 4756   C CG   . LYS B 2 49  ? 11.541  16.732  -3.753  1.00 0.00  ? 349 LYS B CG   1  
ATOM 4757   C CD   . LYS B 2 49  ? 11.511  18.104  -3.072  1.00 0.00  ? 349 LYS B CD   1  
ATOM 4758   C CE   . LYS B 2 49  ? 12.905  18.459  -2.556  1.00 0.00  ? 349 LYS B CE   1  
ATOM 4759   N NZ   . LYS B 2 49  ? 12.885  19.847  -2.011  1.00 0.00  ? 349 LYS B NZ   1  
ATOM 4760   H H    . LYS B 2 49  ? 9.394   15.205  -2.667  1.00 0.00  ? 349 LYS B H    1  
ATOM 4761   H HA   . LYS B 2 49  ? 11.540  14.137  -4.219  1.00 0.00  ? 349 LYS B HA   1  
ATOM 4762   H HB2  . LYS B 2 49  ? 11.443  15.889  -1.758  1.00 0.00  ? 349 LYS B HB2  1  
ATOM 4763   H HB3  . LYS B 2 49  ? 12.931  15.527  -2.630  1.00 0.00  ? 349 LYS B HB3  1  
ATOM 4764   H HG2  . LYS B 2 49  ? 12.300  16.733  -4.523  1.00 0.00  ? 349 LYS B HG2  1  
ATOM 4765   H HG3  . LYS B 2 49  ? 10.577  16.542  -4.206  1.00 0.00  ? 349 LYS B HG3  1  
ATOM 4766   H HD2  . LYS B 2 49  ? 11.193  18.851  -3.784  1.00 0.00  ? 349 LYS B HD2  1  
ATOM 4767   H HD3  . LYS B 2 49  ? 10.819  18.081  -2.244  1.00 0.00  ? 349 LYS B HD3  1  
ATOM 4768   H HE2  . LYS B 2 49  ? 13.189  17.768  -1.777  1.00 0.00  ? 349 LYS B HE2  1  
ATOM 4769   H HE3  . LYS B 2 49  ? 13.615  18.401  -3.368  1.00 0.00  ? 349 LYS B HE3  1  
ATOM 4770   H HZ1  . LYS B 2 49  ? 12.063  20.357  -2.390  1.00 0.00  ? 349 LYS B HZ1  1  
ATOM 4771   H HZ2  . LYS B 2 49  ? 12.823  19.809  -0.973  1.00 0.00  ? 349 LYS B HZ2  1  
ATOM 4772   H HZ3  . LYS B 2 49  ? 13.756  20.341  -2.290  1.00 0.00  ? 349 LYS B HZ3  1  
ATOM 4773   N N    . LEU B 2 50  ? 11.042  12.700  -1.362  1.00 0.00  ? 350 LEU B N    1  
ATOM 4774   C CA   . LEU B 2 50  ? 11.525  11.545  -0.552  1.00 0.00  ? 350 LEU B CA   1  
ATOM 4775   C C    . LEU B 2 50  ? 11.491  10.297  -1.434  1.00 0.00  ? 350 LEU B C    1  
ATOM 4776   O O    . LEU B 2 50  ? 12.452  9.563   -1.536  1.00 0.00  ? 350 LEU B O    1  
ATOM 4777   C CB   . LEU B 2 50  ? 10.604  11.332  0.654   1.00 0.00  ? 350 LEU B CB   1  
ATOM 4778   C CG   . LEU B 2 50  ? 10.976  12.283  1.804   1.00 0.00  ? 350 LEU B CG   1  
ATOM 4779   C CD1  . LEU B 2 50  ? 9.865   12.246  2.870   1.00 0.00  ? 350 LEU B CD1  1  
ATOM 4780   C CD2  . LEU B 2 50  ? 12.325  11.861  2.435   1.00 0.00  ? 350 LEU B CD2  1  
ATOM 4781   H H    . LEU B 2 50  ? 10.159  13.096  -1.191  1.00 0.00  ? 350 LEU B H    1  
ATOM 4782   H HA   . LEU B 2 50  ? 12.533  11.727  -0.222  1.00 0.00  ? 350 LEU B HA   1  
ATOM 4783   H HB2  . LEU B 2 50  ? 9.587   11.527  0.354   1.00 0.00  ? 350 LEU B HB2  1  
ATOM 4784   H HB3  . LEU B 2 50  ? 10.682  10.311  0.996   1.00 0.00  ? 350 LEU B HB3  1  
ATOM 4785   H HG   . LEU B 2 50  ? 11.059  13.288  1.416   1.00 0.00  ? 350 LEU B HG   1  
ATOM 4786   H HD11 . LEU B 2 50  ? 9.434   11.254  2.920   1.00 0.00  ? 350 LEU B HD11 1  
ATOM 4787   H HD12 . LEU B 2 50  ? 10.275  12.506  3.835   1.00 0.00  ? 350 LEU B HD12 1  
ATOM 4788   H HD13 . LEU B 2 50  ? 9.096   12.956  2.608   1.00 0.00  ? 350 LEU B HD13 1  
ATOM 4789   H HD21 . LEU B 2 50  ? 12.454  10.791  2.364   1.00 0.00  ? 350 LEU B HD21 1  
ATOM 4790   H HD22 . LEU B 2 50  ? 13.128  12.353  1.918   1.00 0.00  ? 350 LEU B HD22 1  
ATOM 4791   H HD23 . LEU B 2 50  ? 12.346  12.153  3.476   1.00 0.00  ? 350 LEU B HD23 1  
ATOM 4792   N N    . GLN B 2 51  ? 10.360  10.044  -2.030  1.00 0.00  ? 351 GLN B N    1  
ATOM 4793   C CA   . GLN B 2 51  ? 10.175  8.836   -2.884  1.00 0.00  ? 351 GLN B CA   1  
ATOM 4794   C C    . GLN B 2 51  ? 11.430  8.538   -3.703  1.00 0.00  ? 351 GLN B C    1  
ATOM 4795   O O    . GLN B 2 51  ? 11.633  7.428   -4.147  1.00 0.00  ? 351 GLN B O    1  
ATOM 4796   C CB   . GLN B 2 51  ? 9.027   9.101   -3.858  1.00 0.00  ? 351 GLN B CB   1  
ATOM 4797   C CG   . GLN B 2 51  ? 7.704   9.242   -3.099  1.00 0.00  ? 351 GLN B CG   1  
ATOM 4798   C CD   . GLN B 2 51  ? 7.190   7.877   -2.662  1.00 0.00  ? 351 GLN B CD   1  
ATOM 4799   O OE1  . GLN B 2 51  ? 6.538   7.765   -1.645  1.00 0.00  ? 351 GLN B OE1  1  
ATOM 4800   N NE2  . GLN B 2 51  ? 7.435   6.831   -3.394  1.00 0.00  ? 351 GLN B NE2  1  
ATOM 4801   H H    . GLN B 2 51  ? 9.592   10.626  -1.867  1.00 0.00  ? 351 GLN B H    1  
ATOM 4802   H HA   . GLN B 2 51  ? 9.931   7.987   -2.265  1.00 0.00  ? 351 GLN B HA   1  
ATOM 4803   H HB2  . GLN B 2 51  ? 9.227   10.017  -4.392  1.00 0.00  ? 351 GLN B HB2  1  
ATOM 4804   H HB3  . GLN B 2 51  ? 8.960   8.288   -4.559  1.00 0.00  ? 351 GLN B HB3  1  
ATOM 4805   H HG2  . GLN B 2 51  ? 7.860   9.848   -2.227  1.00 0.00  ? 351 GLN B HG2  1  
ATOM 4806   H HG3  . GLN B 2 51  ? 6.970   9.711   -3.740  1.00 0.00  ? 351 GLN B HG3  1  
ATOM 4807   H HE21 . GLN B 2 51  ? 7.945   6.920   -4.221  1.00 0.00  ? 351 GLN B HE21 1  
ATOM 4808   H HE22 . GLN B 2 51  ? 7.110   5.959   -3.116  1.00 0.00  ? 351 GLN B HE22 1  
ATOM 4809   N N    . THR B 2 52  ? 12.263  9.514   -3.931  1.00 0.00  ? 352 THR B N    1  
ATOM 4810   C CA   . THR B 2 52  ? 13.478  9.264   -4.750  1.00 0.00  ? 352 THR B CA   1  
ATOM 4811   C C    . THR B 2 52  ? 14.579  8.644   -3.887  1.00 0.00  ? 352 THR B C    1  
ATOM 4812   O O    . THR B 2 52  ? 15.577  8.172   -4.393  1.00 0.00  ? 352 THR B O    1  
ATOM 4813   C CB   . THR B 2 52  ? 13.943  10.589  -5.357  1.00 0.00  ? 352 THR B CB   1  
ATOM 4814   O OG1  . THR B 2 52  ? 14.301  11.489  -4.318  1.00 0.00  ? 352 THR B OG1  1  
ATOM 4815   C CG2  . THR B 2 52  ? 12.798  11.181  -6.184  1.00 0.00  ? 352 THR B CG2  1  
ATOM 4816   H H    . THR B 2 52  ? 12.086  10.412  -3.579  1.00 0.00  ? 352 THR B H    1  
ATOM 4817   H HA   . THR B 2 52  ? 13.237  8.580   -5.546  1.00 0.00  ? 352 THR B HA   1  
ATOM 4818   H HB   . THR B 2 52  ? 14.791  10.418  -6.000  1.00 0.00  ? 352 THR B HB   1  
ATOM 4819   H HG1  . THR B 2 52  ? 13.510  11.965  -4.052  1.00 0.00  ? 352 THR B HG1  1  
ATOM 4820   H HG21 . THR B 2 52  ? 11.890  11.189  -5.593  1.00 0.00  ? 352 THR B HG21 1  
ATOM 4821   H HG22 . THR B 2 52  ? 13.048  12.190  -6.476  1.00 0.00  ? 352 THR B HG22 1  
ATOM 4822   H HG23 . THR B 2 52  ? 12.646  10.577  -7.069  1.00 0.00  ? 352 THR B HG23 1  
ATOM 4823   N N    . LEU B 2 53  ? 14.401  8.616   -2.589  1.00 0.00  ? 353 LEU B N    1  
ATOM 4824   C CA   . LEU B 2 53  ? 15.438  7.993   -1.709  1.00 0.00  ? 353 LEU B CA   1  
ATOM 4825   C C    . LEU B 2 53  ? 15.046  6.549   -1.423  1.00 0.00  ? 353 LEU B C    1  
ATOM 4826   O O    . LEU B 2 53  ? 14.038  6.279   -0.798  1.00 0.00  ? 353 LEU B O    1  
ATOM 4827   C CB   . LEU B 2 53  ? 15.527  8.742   -0.382  1.00 0.00  ? 353 LEU B CB   1  
ATOM 4828   C CG   . LEU B 2 53  ? 15.799  10.222  -0.637  1.00 0.00  ? 353 LEU B CG   1  
ATOM 4829   C CD1  . LEU B 2 53  ? 15.901  10.951  0.706   1.00 0.00  ? 353 LEU B CD1  1  
ATOM 4830   C CD2  . LEU B 2 53  ? 17.107  10.394  -1.427  1.00 0.00  ? 353 LEU B CD2  1  
ATOM 4831   H H    . LEU B 2 53  ? 13.581  8.985   -2.198  1.00 0.00  ? 353 LEU B H    1  
ATOM 4832   H HA   . LEU B 2 53  ? 16.402  8.012   -2.198  1.00 0.00  ? 353 LEU B HA   1  
ATOM 4833   H HB2  . LEU B 2 53  ? 14.595  8.636   0.154   1.00 0.00  ? 353 LEU B HB2  1  
ATOM 4834   H HB3  . LEU B 2 53  ? 16.330  8.329   0.210   1.00 0.00  ? 353 LEU B HB3  1  
ATOM 4835   H HG   . LEU B 2 53  ? 14.980  10.633  -1.207  1.00 0.00  ? 353 LEU B HG   1  
ATOM 4836   H HD11 . LEU B 2 53  ? 16.496  10.362  1.393   1.00 0.00  ? 353 LEU B HD11 1  
ATOM 4837   H HD12 . LEU B 2 53  ? 16.369  11.913  0.563   1.00 0.00  ? 353 LEU B HD12 1  
ATOM 4838   H HD13 . LEU B 2 53  ? 14.913  11.088  1.114   1.00 0.00  ? 353 LEU B HD13 1  
ATOM 4839   H HD21 . LEU B 2 53  ? 17.833  9.663   -1.099  1.00 0.00  ? 353 LEU B HD21 1  
ATOM 4840   H HD22 . LEU B 2 53  ? 16.907  10.258  -2.480  1.00 0.00  ? 353 LEU B HD22 1  
ATOM 4841   H HD23 . LEU B 2 53  ? 17.501  11.388  -1.267  1.00 0.00  ? 353 LEU B HD23 1  
ATOM 4842   N N    . GLY B 2 54  ? 15.838  5.619   -1.864  1.00 0.00  ? 354 GLY B N    1  
ATOM 4843   C CA   . GLY B 2 54  ? 15.518  4.187   -1.607  1.00 0.00  ? 354 GLY B CA   1  
ATOM 4844   C C    . GLY B 2 54  ? 15.948  3.828   -0.186  1.00 0.00  ? 354 GLY B C    1  
ATOM 4845   O O    . GLY B 2 54  ? 17.085  3.472   0.054   1.00 0.00  ? 354 GLY B O    1  
ATOM 4846   H H    . GLY B 2 54  ? 16.644  5.859   -2.365  1.00 0.00  ? 354 GLY B H    1  
ATOM 4847   H HA2  . GLY B 2 54  ? 14.453  4.028   -1.718  1.00 0.00  ? 354 GLY B HA2  1  
ATOM 4848   H HA3  . GLY B 2 54  ? 16.052  3.567   -2.309  1.00 0.00  ? 354 GLY B HA3  1  
ATOM 4849   N N    . LEU B 2 55  ? 15.046  3.905   0.761   1.00 0.00  ? 355 LEU B N    1  
ATOM 4850   C CA   . LEU B 2 55  ? 15.393  3.553   2.174   1.00 0.00  ? 355 LEU B CA   1  
ATOM 4851   C C    . LEU B 2 55  ? 14.900  2.133   2.457   1.00 0.00  ? 355 LEU B C    1  
ATOM 4852   O O    . LEU B 2 55  ? 13.760  1.925   2.823   1.00 0.00  ? 355 LEU B O    1  
ATOM 4853   C CB   . LEU B 2 55  ? 14.704  4.538   3.123   1.00 0.00  ? 355 LEU B CB   1  
ATOM 4854   C CG   . LEU B 2 55  ? 14.980  5.977   2.666   1.00 0.00  ? 355 LEU B CG   1  
ATOM 4855   C CD1  . LEU B 2 55  ? 14.418  6.956   3.698   1.00 0.00  ? 355 LEU B CD1  1  
ATOM 4856   C CD2  . LEU B 2 55  ? 16.492  6.200   2.515   1.00 0.00  ? 355 LEU B CD2  1  
ATOM 4857   H H    . LEU B 2 55  ? 14.131  4.176   0.541   1.00 0.00  ? 355 LEU B H    1  
ATOM 4858   H HA   . LEU B 2 55  ? 16.463  3.598   2.319   1.00 0.00  ? 355 LEU B HA   1  
ATOM 4859   H HB2  . LEU B 2 55  ? 13.639  4.358   3.117   1.00 0.00  ? 355 LEU B HB2  1  
ATOM 4860   H HB3  . LEU B 2 55  ? 15.086  4.400   4.121   1.00 0.00  ? 355 LEU B HB3  1  
ATOM 4861   H HG   . LEU B 2 55  ? 14.496  6.146   1.716   1.00 0.00  ? 355 LEU B HG   1  
ATOM 4862   H HD11 . LEU B 2 55  ? 14.719  6.649   4.688   1.00 0.00  ? 355 LEU B HD11 1  
ATOM 4863   H HD12 . LEU B 2 55  ? 14.799  7.947   3.497   1.00 0.00  ? 355 LEU B HD12 1  
ATOM 4864   H HD13 . LEU B 2 55  ? 13.340  6.965   3.636   1.00 0.00  ? 355 LEU B HD13 1  
ATOM 4865   H HD21 . LEU B 2 55  ? 17.011  5.727   3.333   1.00 0.00  ? 355 LEU B HD21 1  
ATOM 4866   H HD22 . LEU B 2 55  ? 16.827  5.774   1.581   1.00 0.00  ? 355 LEU B HD22 1  
ATOM 4867   H HD23 . LEU B 2 55  ? 16.704  7.260   2.519   1.00 0.00  ? 355 LEU B HD23 1  
ATOM 4868   N N    . THR B 2 56  ? 15.737  1.148   2.265   1.00 0.00  ? 356 THR B N    1  
ATOM 4869   C CA   . THR B 2 56  ? 15.309  -0.267  2.494   1.00 0.00  ? 356 THR B CA   1  
ATOM 4870   C C    . THR B 2 56  ? 15.681  -0.721  3.908   1.00 0.00  ? 356 THR B C    1  
ATOM 4871   O O    . THR B 2 56  ? 16.236  0.017   4.690   1.00 0.00  ? 356 THR B O    1  
ATOM 4872   C CB   . THR B 2 56  ? 16.001  -1.167  1.470   1.00 0.00  ? 356 THR B CB   1  
ATOM 4873   O OG1  . THR B 2 56  ? 17.408  -1.094  1.657   1.00 0.00  ? 356 THR B OG1  1  
ATOM 4874   C CG2  . THR B 2 56  ? 15.647  -0.700  0.054   1.00 0.00  ? 356 THR B CG2  1  
ATOM 4875   H H    . THR B 2 56  ? 16.647  1.329   1.950   1.00 0.00  ? 356 THR B H    1  
ATOM 4876   H HA   . THR B 2 56  ? 14.237  -0.346  2.365   1.00 0.00  ? 356 THR B HA   1  
ATOM 4877   H HB   . THR B 2 56  ? 15.673  -2.186  1.601   1.00 0.00  ? 356 THR B HB   1  
ATOM 4878   H HG1  . THR B 2 56  ? 17.618  -1.521  2.491   1.00 0.00  ? 356 THR B HG1  1  
ATOM 4879   H HG21 . THR B 2 56  ? 14.575  -0.729  -0.077  1.00 0.00  ? 356 THR B HG21 1  
ATOM 4880   H HG22 . THR B 2 56  ? 16.000  0.310   -0.091  1.00 0.00  ? 356 THR B HG22 1  
ATOM 4881   H HG23 . THR B 2 56  ? 16.116  -1.352  -0.667  1.00 0.00  ? 356 THR B HG23 1  
ATOM 4882   N N    . GLN B 2 57  ? 15.359  -1.940  4.239   1.00 0.00  ? 357 GLN B N    1  
ATOM 4883   C CA   . GLN B 2 57  ? 15.673  -2.469  5.595   1.00 0.00  ? 357 GLN B CA   1  
ATOM 4884   C C    . GLN B 2 57  ? 17.138  -2.184  5.980   1.00 0.00  ? 357 GLN B C    1  
ATOM 4885   O O    . GLN B 2 57  ? 18.008  -2.022  5.146   1.00 0.00  ? 357 GLN B O    1  
ATOM 4886   C CB   . GLN B 2 57  ? 15.414  -3.983  5.611   1.00 0.00  ? 357 GLN B CB   1  
ATOM 4887   C CG   . GLN B 2 57  ? 15.728  -4.551  6.999   1.00 0.00  ? 357 GLN B CG   1  
ATOM 4888   C CD   . GLN B 2 57  ? 15.321  -6.026  7.064   1.00 0.00  ? 357 GLN B CD   1  
ATOM 4889   O OE1  . GLN B 2 57  ? 14.667  -6.530  6.174   1.00 0.00  ? 357 GLN B OE1  1  
ATOM 4890   N NE2  . GLN B 2 57  ? 15.678  -6.741  8.098   1.00 0.00  ? 357 GLN B NE2  1  
ATOM 4891   H H    . GLN B 2 57  ? 14.898  -2.512  3.592   1.00 0.00  ? 357 GLN B H    1  
ATOM 4892   H HA   . GLN B 2 57  ? 15.023  -1.995  6.317   1.00 0.00  ? 357 GLN B HA   1  
ATOM 4893   H HB2  . GLN B 2 57  ? 14.376  -4.170  5.372   1.00 0.00  ? 357 GLN B HB2  1  
ATOM 4894   H HB3  . GLN B 2 57  ? 16.043  -4.462  4.876   1.00 0.00  ? 357 GLN B HB3  1  
ATOM 4895   H HG2  . GLN B 2 57  ? 16.788  -4.470  7.189   1.00 0.00  ? 357 GLN B HG2  1  
ATOM 4896   H HG3  . GLN B 2 57  ? 15.183  -3.997  7.748   1.00 0.00  ? 357 GLN B HG3  1  
ATOM 4897   H HE21 . GLN B 2 57  ? 16.199  -6.332  8.821   1.00 0.00  ? 357 GLN B HE21 1  
ATOM 4898   H HE22 . GLN B 2 57  ? 15.427  -7.687  8.149   1.00 0.00  ? 357 GLN B HE22 1  
ATOM 4899   N N    . GLY B 2 58  ? 17.390  -2.179  7.258   1.00 0.00  ? 358 GLY B N    1  
ATOM 4900   C CA   . GLY B 2 58  ? 18.773  -1.974  7.792   1.00 0.00  ? 358 GLY B CA   1  
ATOM 4901   C C    . GLY B 2 58  ? 19.539  -0.931  6.978   1.00 0.00  ? 358 GLY B C    1  
ATOM 4902   O O    . GLY B 2 58  ? 20.754  -0.930  6.956   1.00 0.00  ? 358 GLY B O    1  
ATOM 4903   H H    . GLY B 2 58  ? 16.649  -2.380  7.859   1.00 0.00  ? 358 GLY B H    1  
ATOM 4904   H HA2  . GLY B 2 58  ? 18.710  -1.645  8.816   1.00 0.00  ? 358 GLY B HA2  1  
ATOM 4905   H HA3  . GLY B 2 58  ? 19.308  -2.911  7.755   1.00 0.00  ? 358 GLY B HA3  1  
ATOM 4906   N N    . THR B 2 59  ? 18.861  -0.045  6.308   1.00 0.00  ? 359 THR B N    1  
ATOM 4907   C CA   . THR B 2 59  ? 19.591  0.980   5.508   1.00 0.00  ? 359 THR B CA   1  
ATOM 4908   C C    . THR B 2 59  ? 19.982  2.150   6.414   1.00 0.00  ? 359 THR B C    1  
ATOM 4909   O O    . THR B 2 59  ? 19.142  2.856   6.933   1.00 0.00  ? 359 THR B O    1  
ATOM 4910   C CB   . THR B 2 59  ? 18.691  1.479   4.375   1.00 0.00  ? 359 THR B CB   1  
ATOM 4911   O OG1  . THR B 2 59  ? 18.538  0.447   3.412   1.00 0.00  ? 359 THR B OG1  1  
ATOM 4912   C CG2  . THR B 2 59  ? 19.316  2.710   3.710   1.00 0.00  ? 359 THR B CG2  1  
ATOM 4913   H H    . THR B 2 59  ? 17.882  -0.050  6.329   1.00 0.00  ? 359 THR B H    1  
ATOM 4914   H HA   . THR B 2 59  ? 20.485  0.541   5.085   1.00 0.00  ? 359 THR B HA   1  
ATOM 4915   H HB   . THR B 2 59  ? 17.728  1.740   4.774   1.00 0.00  ? 359 THR B HB   1  
ATOM 4916   H HG1  . THR B 2 59  ? 17.776  0.660   2.868   1.00 0.00  ? 359 THR B HG1  1  
ATOM 4917   H HG21 . THR B 2 59  ? 20.369  2.535   3.547   1.00 0.00  ? 359 THR B HG21 1  
ATOM 4918   H HG22 . THR B 2 59  ? 18.830  2.894   2.764   1.00 0.00  ? 359 THR B HG22 1  
ATOM 4919   H HG23 . THR B 2 59  ? 19.192  3.572   4.352   1.00 0.00  ? 359 THR B HG23 1  
ATOM 4920   N N    . VAL B 2 60  ? 21.251  2.313   6.662   1.00 0.00  ? 360 VAL B N    1  
ATOM 4921   C CA   . VAL B 2 60  ? 21.677  3.391   7.600   1.00 0.00  ? 360 VAL B CA   1  
ATOM 4922   C C    . VAL B 2 60  ? 21.592  4.738   6.902   1.00 0.00  ? 360 VAL B C    1  
ATOM 4923   O O    . VAL B 2 60  ? 22.269  5.010   5.930   1.00 0.00  ? 360 VAL B O    1  
ATOM 4924   C CB   . VAL B 2 60  ? 23.118  3.149   8.056   1.00 0.00  ? 360 VAL B CB   1  
ATOM 4925   C CG1  . VAL B 2 60  ? 23.476  4.159   9.152   1.00 0.00  ? 360 VAL B CG1  1  
ATOM 4926   C CG2  . VAL B 2 60  ? 23.254  1.729   8.612   1.00 0.00  ? 360 VAL B CG2  1  
ATOM 4927   H H    . VAL B 2 60  ? 21.888  1.654   6.316   1.00 0.00  ? 360 VAL B H    1  
ATOM 4928   H HA   . VAL B 2 60  ? 21.027  3.401   8.454   1.00 0.00  ? 360 VAL B HA   1  
ATOM 4929   H HB   . VAL B 2 60  ? 23.788  3.277   7.217   1.00 0.00  ? 360 VAL B HB   1  
ATOM 4930   H HG11 . VAL B 2 60  ? 22.701  4.162   9.905   1.00 0.00  ? 360 VAL B HG11 1  
ATOM 4931   H HG12 . VAL B 2 60  ? 24.416  3.882   9.604   1.00 0.00  ? 360 VAL B HG12 1  
ATOM 4932   H HG13 . VAL B 2 60  ? 23.562  5.146   8.719   1.00 0.00  ? 360 VAL B HG13 1  
ATOM 4933   H HG21 . VAL B 2 60  ? 22.812  1.025   7.924   1.00 0.00  ? 360 VAL B HG21 1  
ATOM 4934   H HG22 . VAL B 2 60  ? 24.299  1.494   8.744   1.00 0.00  ? 360 VAL B HG22 1  
ATOM 4935   H HG23 . VAL B 2 60  ? 22.750  1.667   9.562   1.00 0.00  ? 360 VAL B HG23 1  
ATOM 4936   N N    . VAL B 2 61  ? 20.718  5.576   7.404   1.00 0.00  ? 361 VAL B N    1  
ATOM 4937   C CA   . VAL B 2 61  ? 20.501  6.919   6.810   1.00 0.00  ? 361 VAL B CA   1  
ATOM 4938   C C    . VAL B 2 61  ? 20.988  7.957   7.804   1.00 0.00  ? 361 VAL B C    1  
ATOM 4939   O O    . VAL B 2 61  ? 21.358  7.623   8.905   1.00 0.00  ? 361 VAL B O    1  
ATOM 4940   C CB   . VAL B 2 61  ? 19.003  7.115   6.561   1.00 0.00  ? 361 VAL B CB   1  
ATOM 4941   C CG1  . VAL B 2 61  ? 18.475  5.981   5.683   1.00 0.00  ? 361 VAL B CG1  1  
ATOM 4942   C CG2  . VAL B 2 61  ? 18.249  7.111   7.895   1.00 0.00  ? 361 VAL B CG2  1  
ATOM 4943   H H    . VAL B 2 61  ? 20.172  5.299   8.179   1.00 0.00  ? 361 VAL B H    1  
ATOM 4944   H HA   . VAL B 2 61  ? 21.041  7.013   5.877   1.00 0.00  ? 361 VAL B HA   1  
ATOM 4945   H HB   . VAL B 2 61  ? 18.848  8.056   6.064   1.00 0.00  ? 361 VAL B HB   1  
ATOM 4946   H HG11 . VAL B 2 61  ? 18.728  5.031   6.131   1.00 0.00  ? 361 VAL B HG11 1  
ATOM 4947   H HG12 . VAL B 2 61  ? 17.402  6.063   5.598   1.00 0.00  ? 361 VAL B HG12 1  
ATOM 4948   H HG13 . VAL B 2 61  ? 18.921  6.044   4.703   1.00 0.00  ? 361 VAL B HG13 1  
ATOM 4949   H HG21 . VAL B 2 61  ? 18.599  6.292   8.505   1.00 0.00  ? 361 VAL B HG21 1  
ATOM 4950   H HG22 . VAL B 2 61  ? 18.423  8.044   8.413   1.00 0.00  ? 361 VAL B HG22 1  
ATOM 4951   H HG23 . VAL B 2 61  ? 17.191  6.996   7.710   1.00 0.00  ? 361 VAL B HG23 1  
ATOM 4952   N N    . THR B 2 62  ? 20.949  9.211   7.446   1.00 0.00  ? 362 THR B N    1  
ATOM 4953   C CA   . THR B 2 62  ? 21.366  10.285  8.401   1.00 0.00  ? 362 THR B CA   1  
ATOM 4954   C C    . THR B 2 62  ? 20.291  11.352  8.423   1.00 0.00  ? 362 THR B C    1  
ATOM 4955   O O    . THR B 2 62  ? 19.894  11.854  7.391   1.00 0.00  ? 362 THR B O    1  
ATOM 4956   C CB   . THR B 2 62  ? 22.677  10.929  7.961   1.00 0.00  ? 362 THR B CB   1  
ATOM 4957   O OG1  . THR B 2 62  ? 23.668  9.926   7.795   1.00 0.00  ? 362 THR B OG1  1  
ATOM 4958   C CG2  . THR B 2 62  ? 23.123  11.930  9.033   1.00 0.00  ? 362 THR B CG2  1  
ATOM 4959   H H    . THR B 2 62  ? 20.586  9.457   6.566   1.00 0.00  ? 362 THR B H    1  
ATOM 4960   H HA   . THR B 2 62  ? 21.480  9.882   9.392   1.00 0.00  ? 362 THR B HA   1  
ATOM 4961   H HB   . THR B 2 62  ? 22.529  11.448  7.030   1.00 0.00  ? 362 THR B HB   1  
ATOM 4962   H HG1  . THR B 2 62  ? 24.185  10.149  7.017   1.00 0.00  ? 362 THR B HG1  1  
ATOM 4963   H HG21 . THR B 2 62  ? 23.153  11.437  9.997   1.00 0.00  ? 362 THR B HG21 1  
ATOM 4964   H HG22 . THR B 2 62  ? 24.106  12.306  8.791   1.00 0.00  ? 362 THR B HG22 1  
ATOM 4965   H HG23 . THR B 2 62  ? 22.422  12.757  9.074   1.00 0.00  ? 362 THR B HG23 1  
ATOM 4966   N N    . ILE B 2 63  ? 19.831  11.740  9.580   1.00 0.00  ? 363 ILE B N    1  
ATOM 4967   C CA   . ILE B 2 63  ? 18.802  12.815  9.651   1.00 0.00  ? 363 ILE B CA   1  
ATOM 4968   C C    . ILE B 2 63  ? 19.532  14.086  10.080  1.00 0.00  ? 363 ILE B C    1  
ATOM 4969   O O    . ILE B 2 63  ? 20.111  14.133  11.144  1.00 0.00  ? 363 ILE B O    1  
ATOM 4970   C CB   . ILE B 2 63  ? 17.757  12.439  10.707  1.00 0.00  ? 363 ILE B CB   1  
ATOM 4971   C CG1  . ILE B 2 63  ? 17.095  11.112  10.317  1.00 0.00  ? 363 ILE B CG1  1  
ATOM 4972   C CG2  . ILE B 2 63  ? 16.687  13.533  10.778  1.00 0.00  ? 363 ILE B CG2  1  
ATOM 4973   C CD1  . ILE B 2 63  ? 16.250  10.591  11.485  1.00 0.00  ? 363 ILE B CD1  1  
ATOM 4974   H H    . ILE B 2 63  ? 20.172  11.365  10.422  1.00 0.00  ? 363 ILE B H    1  
ATOM 4975   H HA   . ILE B 2 63  ? 18.326  12.964  8.690   1.00 0.00  ? 363 ILE B HA   1  
ATOM 4976   H HB   . ILE B 2 63  ? 18.235  12.339  11.670  1.00 0.00  ? 363 ILE B HB   1  
ATOM 4977   H HG12 . ILE B 2 63  ? 16.461  11.264  9.457   1.00 0.00  ? 363 ILE B HG12 1  
ATOM 4978   H HG13 . ILE B 2 63  ? 17.858  10.387  10.078  1.00 0.00  ? 363 ILE B HG13 1  
ATOM 4979   H HG21 . ILE B 2 63  ? 16.267  13.693  9.794   1.00 0.00  ? 363 ILE B HG21 1  
ATOM 4980   H HG22 . ILE B 2 63  ? 15.904  13.227  11.457  1.00 0.00  ? 363 ILE B HG22 1  
ATOM 4981   H HG23 . ILE B 2 63  ? 17.131  14.452  11.132  1.00 0.00  ? 363 ILE B HG23 1  
ATOM 4982   H HD11 . ILE B 2 63  ? 15.711  11.409  11.937  1.00 0.00  ? 363 ILE B HD11 1  
ATOM 4983   H HD12 . ILE B 2 63  ? 15.548  9.855   11.120  1.00 0.00  ? 363 ILE B HD12 1  
ATOM 4984   H HD13 . ILE B 2 63  ? 16.896  10.135  12.222  1.00 0.00  ? 363 ILE B HD13 1  
ATOM 4985   N N    . SER B 2 64  ? 19.530  15.109  9.259   1.00 0.00  ? 364 SER B N    1  
ATOM 4986   C CA   . SER B 2 64  ? 20.249  16.375  9.622   1.00 0.00  ? 364 SER B CA   1  
ATOM 4987   C C    . SER B 2 64  ? 19.268  17.542  9.572   1.00 0.00  ? 364 SER B C    1  
ATOM 4988   O O    . SER B 2 64  ? 18.496  17.677  8.643   1.00 0.00  ? 364 SER B O    1  
ATOM 4989   C CB   . SER B 2 64  ? 21.378  16.631  8.621   1.00 0.00  ? 364 SER B CB   1  
ATOM 4990   O OG   . SER B 2 64  ? 22.224  15.490  8.567   1.00 0.00  ? 364 SER B OG   1  
ATOM 4991   H H    . SER B 2 64  ? 19.061  15.038  8.401   1.00 0.00  ? 364 SER B H    1  
ATOM 4992   H HA   . SER B 2 64  ? 20.669  16.298  10.615  1.00 0.00  ? 364 SER B HA   1  
ATOM 4993   H HB2  . SER B 2 64  ? 20.963  16.811  7.643   1.00 0.00  ? 364 SER B HB2  1  
ATOM 4994   H HB3  . SER B 2 64  ? 21.947  17.500  8.936   1.00 0.00  ? 364 SER B HB3  1  
ATOM 4995   H HG   . SER B 2 64  ? 21.781  14.817  8.046   1.00 0.00  ? 364 SER B HG   1  
ATOM 4996   N N    . ALA B 2 65  ? 19.280  18.386  10.570  1.00 0.00  ? 365 ALA B N    1  
ATOM 4997   C CA   . ALA B 2 65  ? 18.337  19.542  10.583  1.00 0.00  ? 365 ALA B CA   1  
ATOM 4998   C C    . ALA B 2 65  ? 19.020  20.759  11.210  1.00 0.00  ? 365 ALA B C    1  
ATOM 4999   O O    . ALA B 2 65  ? 19.888  20.638  12.056  1.00 0.00  ? 365 ALA B O    1  
ATOM 5000   C CB   . ALA B 2 65  ? 17.100  19.172  11.405  1.00 0.00  ? 365 ALA B CB   1  
ATOM 5001   H H    . ALA B 2 65  ? 19.896  18.249  11.319  1.00 0.00  ? 365 ALA B H    1  
ATOM 5002   H HA   . ALA B 2 65  ? 18.035  19.784  9.574   1.00 0.00  ? 365 ALA B HA   1  
ATOM 5003   H HB1  . ALA B 2 65  ? 16.687  18.244  11.035  1.00 0.00  ? 365 ALA B HB1  1  
ATOM 5004   H HB2  . ALA B 2 65  ? 17.377  19.056  12.442  1.00 0.00  ? 365 ALA B HB2  1  
ATOM 5005   H HB3  . ALA B 2 65  ? 16.364  19.957  11.315  1.00 0.00  ? 365 ALA B HB3  1  
ATOM 5006   N N    . GLU B 2 66  ? 18.626  21.936  10.793  1.00 0.00  ? 366 GLU B N    1  
ATOM 5007   C CA   . GLU B 2 66  ? 19.230  23.190  11.342  1.00 0.00  ? 366 GLU B CA   1  
ATOM 5008   C C    . GLU B 2 66  ? 18.121  24.229  11.532  1.00 0.00  ? 366 GLU B C    1  
ATOM 5009   O O    . GLU B 2 66  ? 17.466  24.614  10.583  1.00 0.00  ? 366 GLU B O    1  
ATOM 5010   C CB   . GLU B 2 66  ? 20.247  23.735  10.333  1.00 0.00  ? 366 GLU B CB   1  
ATOM 5011   C CG   . GLU B 2 66  ? 21.034  24.892  10.954  1.00 0.00  ? 366 GLU B CG   1  
ATOM 5012   C CD   . GLU B 2 66  ? 22.068  25.400  9.947   1.00 0.00  ? 366 GLU B CD   1  
ATOM 5013   O OE1  . GLU B 2 66  ? 22.226  24.763  8.918   1.00 0.00  ? 366 GLU B OE1  1  
ATOM 5014   O OE2  . GLU B 2 66  ? 22.684  26.417  10.222  1.00 0.00  ? 366 GLU B OE2  1  
ATOM 5015   H H    . GLU B 2 66  ? 17.922  21.993  10.112  1.00 0.00  ? 366 GLU B H    1  
ATOM 5016   H HA   . GLU B 2 66  ? 19.722  22.991  12.281  1.00 0.00  ? 366 GLU B HA   1  
ATOM 5017   H HB2  . GLU B 2 66  ? 20.927  22.949  10.048  1.00 0.00  ? 366 GLU B HB2  1  
ATOM 5018   H HB3  . GLU B 2 66  ? 19.725  24.092  9.457   1.00 0.00  ? 366 GLU B HB3  1  
ATOM 5019   H HG2  . GLU B 2 66  ? 20.354  25.693  11.209  1.00 0.00  ? 366 GLU B HG2  1  
ATOM 5020   H HG3  . GLU B 2 66  ? 21.539  24.549  11.844  1.00 0.00  ? 366 GLU B HG3  1  
ATOM 5021   N N    . GLY B 2 67  ? 17.893  24.700  12.732  1.00 0.00  ? 367 GLY B N    1  
ATOM 5022   C CA   . GLY B 2 67  ? 16.816  25.715  12.914  1.00 0.00  ? 367 GLY B CA   1  
ATOM 5023   C C    . GLY B 2 67  ? 16.363  25.805  14.377  1.00 0.00  ? 367 GLY B C    1  
ATOM 5024   O O    . GLY B 2 67  ? 17.062  25.432  15.298  1.00 0.00  ? 367 GLY B O    1  
ATOM 5025   H H    . GLY B 2 67  ? 18.412  24.393  13.502  1.00 0.00  ? 367 GLY B H    1  
ATOM 5026   H HA2  . GLY B 2 67  ? 17.188  26.680  12.601  1.00 0.00  ? 367 GLY B HA2  1  
ATOM 5027   H HA3  . GLY B 2 67  ? 15.967  25.449  12.300  1.00 0.00  ? 367 GLY B HA3  1  
ATOM 5028   N N    . GLU B 2 68  ? 15.196  26.358  14.565  1.00 0.00  ? 368 GLU B N    1  
ATOM 5029   C CA   . GLU B 2 68  ? 14.650  26.559  15.942  1.00 0.00  ? 368 GLU B CA   1  
ATOM 5030   C C    . GLU B 2 68  ? 14.491  25.239  16.703  1.00 0.00  ? 368 GLU B C    1  
ATOM 5031   O O    . GLU B 2 68  ? 14.927  25.129  17.833  1.00 0.00  ? 368 GLU B O    1  
ATOM 5032   C CB   . GLU B 2 68  ? 13.284  27.242  15.857  1.00 0.00  ? 368 GLU B CB   1  
ATOM 5033   C CG   . GLU B 2 68  ? 12.727  27.448  17.271  1.00 0.00  ? 368 GLU B CG   1  
ATOM 5034   C CD   . GLU B 2 68  ? 11.451  28.288  17.198  1.00 0.00  ? 368 GLU B CD   1  
ATOM 5035   O OE1  . GLU B 2 68  ? 11.126  28.741  16.112  1.00 0.00  ? 368 GLU B OE1  1  
ATOM 5036   O OE2  . GLU B 2 68  ? 10.822  28.468  18.228  1.00 0.00  ? 368 GLU B OE2  1  
ATOM 5037   H H    . GLU B 2 68  ? 14.720  26.671  13.768  1.00 0.00  ? 368 GLU B H    1  
ATOM 5038   H HA   . GLU B 2 68  ? 15.322  27.200  16.491  1.00 0.00  ? 368 GLU B HA   1  
ATOM 5039   H HB2  . GLU B 2 68  ? 13.389  28.201  15.367  1.00 0.00  ? 368 GLU B HB2  1  
ATOM 5040   H HB3  . GLU B 2 68  ? 12.605  26.622  15.292  1.00 0.00  ? 368 GLU B HB3  1  
ATOM 5041   H HG2  . GLU B 2 68  ? 12.499  26.485  17.715  1.00 0.00  ? 368 GLU B HG2  1  
ATOM 5042   H HG3  . GLU B 2 68  ? 13.459  27.959  17.876  1.00 0.00  ? 368 GLU B HG3  1  
ATOM 5043   N N    . ASP B 2 69  ? 13.838  24.252  16.134  1.00 0.00  ? 369 ASP B N    1  
ATOM 5044   C CA   . ASP B 2 69  ? 13.620  22.968  16.882  1.00 0.00  ? 369 ASP B CA   1  
ATOM 5045   C C    . ASP B 2 69  ? 14.537  21.863  16.351  1.00 0.00  ? 369 ASP B C    1  
ATOM 5046   O O    . ASP B 2 69  ? 14.380  20.707  16.690  1.00 0.00  ? 369 ASP B O    1  
ATOM 5047   C CB   . ASP B 2 69  ? 12.166  22.526  16.699  1.00 0.00  ? 369 ASP B CB   1  
ATOM 5048   C CG   . ASP B 2 69  ? 11.240  23.478  17.458  1.00 0.00  ? 369 ASP B CG   1  
ATOM 5049   O OD1  . ASP B 2 69  ? 11.717  24.136  18.367  1.00 0.00  ? 369 ASP B OD1  1  
ATOM 5050   O OD2  . ASP B 2 69  ? 10.071  23.536  17.112  1.00 0.00  ? 369 ASP B OD2  1  
ATOM 5051   H H    . ASP B 2 69  ? 13.452  24.366  15.239  1.00 0.00  ? 369 ASP B H    1  
ATOM 5052   H HA   . ASP B 2 69  ? 13.807  23.119  17.936  1.00 0.00  ? 369 ASP B HA   1  
ATOM 5053   H HB2  . ASP B 2 69  ? 11.916  22.536  15.649  1.00 0.00  ? 369 ASP B HB2  1  
ATOM 5054   H HB3  . ASP B 2 69  ? 12.045  21.526  17.088  1.00 0.00  ? 369 ASP B HB3  1  
ATOM 5055   N N    . GLU B 2 70  ? 15.472  22.197  15.506  1.00 0.00  ? 370 GLU B N    1  
ATOM 5056   C CA   . GLU B 2 70  ? 16.379  21.155  14.935  1.00 0.00  ? 370 GLU B CA   1  
ATOM 5057   C C    . GLU B 2 70  ? 16.831  20.164  16.016  1.00 0.00  ? 370 GLU B C    1  
ATOM 5058   O O    . GLU B 2 70  ? 17.022  18.992  15.751  1.00 0.00  ? 370 GLU B O    1  
ATOM 5059   C CB   . GLU B 2 70  ? 17.616  21.831  14.337  1.00 0.00  ? 370 GLU B CB   1  
ATOM 5060   C CG   . GLU B 2 70  ? 18.394  22.554  15.445  1.00 0.00  ? 370 GLU B CG   1  
ATOM 5061   C CD   . GLU B 2 70  ? 19.562  23.330  14.839  1.00 0.00  ? 370 GLU B CD   1  
ATOM 5062   O OE1  . GLU B 2 70  ? 20.541  22.698  14.479  1.00 0.00  ? 370 GLU B OE1  1  
ATOM 5063   O OE2  . GLU B 2 70  ? 19.460  24.542  14.747  1.00 0.00  ? 370 GLU B OE2  1  
ATOM 5064   H H    . GLU B 2 70  ? 15.559  23.131  15.221  1.00 0.00  ? 370 GLU B H    1  
ATOM 5065   H HA   . GLU B 2 70  ? 15.859  20.619  14.156  1.00 0.00  ? 370 GLU B HA   1  
ATOM 5066   H HB2  . GLU B 2 70  ? 18.249  21.082  13.882  1.00 0.00  ? 370 GLU B HB2  1  
ATOM 5067   H HB3  . GLU B 2 70  ? 17.309  22.544  13.590  1.00 0.00  ? 370 GLU B HB3  1  
ATOM 5068   H HG2  . GLU B 2 70  ? 17.735  23.237  15.959  1.00 0.00  ? 370 GLU B HG2  1  
ATOM 5069   H HG3  . GLU B 2 70  ? 18.780  21.831  16.145  1.00 0.00  ? 370 GLU B HG3  1  
ATOM 5070   N N    . GLN B 2 71  ? 17.009  20.621  17.227  1.00 0.00  ? 371 GLN B N    1  
ATOM 5071   C CA   . GLN B 2 71  ? 17.461  19.696  18.306  1.00 0.00  ? 371 GLN B CA   1  
ATOM 5072   C C    . GLN B 2 71  ? 16.342  18.717  18.663  1.00 0.00  ? 371 GLN B C    1  
ATOM 5073   O O    . GLN B 2 71  ? 16.576  17.545  18.876  1.00 0.00  ? 371 GLN B O    1  
ATOM 5074   C CB   . GLN B 2 71  ? 17.830  20.508  19.552  1.00 0.00  ? 371 GLN B CB   1  
ATOM 5075   C CG   . GLN B 2 71  ? 19.112  21.304  19.298  1.00 0.00  ? 371 GLN B CG   1  
ATOM 5076   C CD   . GLN B 2 71  ? 19.456  22.125  20.544  1.00 0.00  ? 371 GLN B CD   1  
ATOM 5077   O OE1  . GLN B 2 71  ? 18.576  22.561  21.259  1.00 0.00  ? 371 GLN B OE1  1  
ATOM 5078   N NE2  . GLN B 2 71  ? 20.709  22.354  20.834  1.00 0.00  ? 371 GLN B NE2  1  
ATOM 5079   H H    . GLN B 2 71  ? 16.844  21.566  17.427  1.00 0.00  ? 371 GLN B H    1  
ATOM 5080   H HA   . GLN B 2 71  ? 18.325  19.146  17.968  1.00 0.00  ? 371 GLN B HA   1  
ATOM 5081   H HB2  . GLN B 2 71  ? 17.025  21.189  19.785  1.00 0.00  ? 371 GLN B HB2  1  
ATOM 5082   H HB3  . GLN B 2 71  ? 17.984  19.837  20.384  1.00 0.00  ? 371 GLN B HB3  1  
ATOM 5083   H HG2  . GLN B 2 71  ? 19.922  20.624  19.077  1.00 0.00  ? 371 GLN B HG2  1  
ATOM 5084   H HG3  . GLN B 2 71  ? 18.962  21.970  18.463  1.00 0.00  ? 371 GLN B HG3  1  
ATOM 5085   H HE21 . GLN B 2 71  ? 21.418  22.003  20.257  1.00 0.00  ? 371 GLN B HE21 1  
ATOM 5086   H HE22 . GLN B 2 71  ? 20.939  22.878  21.630  1.00 0.00  ? 371 GLN B HE22 1  
ATOM 5087   N N    . LYS B 2 72  ? 15.131  19.185  18.736  1.00 0.00  ? 372 LYS B N    1  
ATOM 5088   C CA   . LYS B 2 72  ? 14.012  18.268  19.093  1.00 0.00  ? 372 LYS B CA   1  
ATOM 5089   C C    . LYS B 2 72  ? 13.796  17.271  17.954  1.00 0.00  ? 372 LYS B C    1  
ATOM 5090   O O    . LYS B 2 72  ? 13.706  16.078  18.166  1.00 0.00  ? 372 LYS B O    1  
ATOM 5091   C CB   . LYS B 2 72  ? 12.728  19.078  19.313  1.00 0.00  ? 372 LYS B CB   1  
ATOM 5092   C CG   . LYS B 2 72  ? 12.985  20.204  20.322  1.00 0.00  ? 372 LYS B CG   1  
ATOM 5093   C CD   . LYS B 2 72  ? 13.380  19.617  21.684  1.00 0.00  ? 372 LYS B CD   1  
ATOM 5094   C CE   . LYS B 2 72  ? 13.188  20.674  22.777  1.00 0.00  ? 372 LYS B CE   1  
ATOM 5095   N NZ   . LYS B 2 72  ? 13.708  20.148  24.072  1.00 0.00  ? 372 LYS B NZ   1  
ATOM 5096   H H    . LYS B 2 72  ? 14.965  20.135  18.572  1.00 0.00  ? 372 LYS B H    1  
ATOM 5097   H HA   . LYS B 2 72  ? 14.259  17.729  19.992  1.00 0.00  ? 372 LYS B HA   1  
ATOM 5098   H HB2  . LYS B 2 72  ? 12.407  19.503  18.374  1.00 0.00  ? 372 LYS B HB2  1  
ATOM 5099   H HB3  . LYS B 2 72  ? 11.955  18.427  19.695  1.00 0.00  ? 372 LYS B HB3  1  
ATOM 5100   H HG2  . LYS B 2 72  ? 13.783  20.834  19.959  1.00 0.00  ? 372 LYS B HG2  1  
ATOM 5101   H HG3  . LYS B 2 72  ? 12.086  20.794  20.434  1.00 0.00  ? 372 LYS B HG3  1  
ATOM 5102   H HD2  . LYS B 2 72  ? 12.762  18.757  21.900  1.00 0.00  ? 372 LYS B HD2  1  
ATOM 5103   H HD3  . LYS B 2 72  ? 14.417  19.319  21.660  1.00 0.00  ? 372 LYS B HD3  1  
ATOM 5104   H HE2  . LYS B 2 72  ? 13.728  21.569  22.510  1.00 0.00  ? 372 LYS B HE2  1  
ATOM 5105   H HE3  . LYS B 2 72  ? 12.137  20.903  22.877  1.00 0.00  ? 372 LYS B HE3  1  
ATOM 5106   H HZ1  . LYS B 2 72  ? 14.144  19.218  23.917  1.00 0.00  ? 372 LYS B HZ1  1  
ATOM 5107   H HZ2  . LYS B 2 72  ? 14.420  20.803  24.452  1.00 0.00  ? 372 LYS B HZ2  1  
ATOM 5108   H HZ3  . LYS B 2 72  ? 12.922  20.056  24.748  1.00 0.00  ? 372 LYS B HZ3  1  
ATOM 5109   N N    . ALA B 2 73  ? 13.692  17.755  16.751  1.00 0.00  ? 373 ALA B N    1  
ATOM 5110   C CA   . ALA B 2 73  ? 13.455  16.849  15.593  1.00 0.00  ? 373 ALA B CA   1  
ATOM 5111   C C    . ALA B 2 73  ? 14.407  15.644  15.633  1.00 0.00  ? 373 ALA B C    1  
ATOM 5112   O O    . ALA B 2 73  ? 14.000  14.539  15.928  1.00 0.00  ? 373 ALA B O    1  
ATOM 5113   C CB   . ALA B 2 73  ? 13.663  17.638  14.293  1.00 0.00  ? 373 ALA B CB   1  
ATOM 5114   H H    . ALA B 2 73  ? 13.734  18.722  16.602  1.00 0.00  ? 373 ALA B H    1  
ATOM 5115   H HA   . ALA B 2 73  ? 12.437  16.493  15.628  1.00 0.00  ? 373 ALA B HA   1  
ATOM 5116   H HB1  . ALA B 2 73  ? 13.301  18.647  14.425  1.00 0.00  ? 373 ALA B HB1  1  
ATOM 5117   H HB2  . ALA B 2 73  ? 14.715  17.666  14.046  1.00 0.00  ? 373 ALA B HB2  1  
ATOM 5118   H HB3  . ALA B 2 73  ? 13.116  17.165  13.492  1.00 0.00  ? 373 ALA B HB3  1  
ATOM 5119   N N    . VAL B 2 74  ? 15.653  15.831  15.282  1.00 0.00  ? 374 VAL B N    1  
ATOM 5120   C CA   . VAL B 2 74  ? 16.592  14.667  15.244  1.00 0.00  ? 374 VAL B CA   1  
ATOM 5121   C C    . VAL B 2 74  ? 16.442  13.799  16.496  1.00 0.00  ? 374 VAL B C    1  
ATOM 5122   O O    . VAL B 2 74  ? 16.545  12.592  16.430  1.00 0.00  ? 374 VAL B O    1  
ATOM 5123   C CB   . VAL B 2 74  ? 18.042  15.158  15.133  1.00 0.00  ? 374 VAL B CB   1  
ATOM 5124   C CG1  . VAL B 2 74  ? 18.994  13.946  15.119  1.00 0.00  ? 374 VAL B CG1  1  
ATOM 5125   C CG2  . VAL B 2 74  ? 18.208  15.961  13.836  1.00 0.00  ? 374 VAL B CG2  1  
ATOM 5126   H H    . VAL B 2 74  ? 15.948  16.720  14.982  1.00 0.00  ? 374 VAL B H    1  
ATOM 5127   H HA   . VAL B 2 74  ? 16.362  14.067  14.379  1.00 0.00  ? 374 VAL B HA   1  
ATOM 5128   H HB   . VAL B 2 74  ? 18.274  15.788  15.981  1.00 0.00  ? 374 VAL B HB   1  
ATOM 5129   H HG11 . VAL B 2 74  ? 18.551  13.140  14.552  1.00 0.00  ? 374 VAL B HG11 1  
ATOM 5130   H HG12 . VAL B 2 74  ? 19.935  14.221  14.665  1.00 0.00  ? 374 VAL B HG12 1  
ATOM 5131   H HG13 . VAL B 2 74  ? 19.171  13.615  16.132  1.00 0.00  ? 374 VAL B HG13 1  
ATOM 5132   H HG21 . VAL B 2 74  ? 17.358  16.612  13.700  1.00 0.00  ? 374 VAL B HG21 1  
ATOM 5133   H HG22 . VAL B 2 74  ? 19.109  16.554  13.893  1.00 0.00  ? 374 VAL B HG22 1  
ATOM 5134   H HG23 . VAL B 2 74  ? 18.278  15.282  12.999  1.00 0.00  ? 374 VAL B HG23 1  
ATOM 5135   N N    . GLU B 2 75  ? 16.203  14.377  17.633  1.00 0.00  ? 375 GLU B N    1  
ATOM 5136   C CA   . GLU B 2 75  ? 16.056  13.534  18.852  1.00 0.00  ? 375 GLU B CA   1  
ATOM 5137   C C    . GLU B 2 75  ? 14.824  12.625  18.736  1.00 0.00  ? 375 GLU B C    1  
ATOM 5138   O O    . GLU B 2 75  ? 14.914  11.421  18.898  1.00 0.00  ? 375 GLU B O    1  
ATOM 5139   C CB   . GLU B 2 75  ? 15.925  14.437  20.080  1.00 0.00  ? 375 GLU B CB   1  
ATOM 5140   C CG   . GLU B 2 75  ? 17.270  15.116  20.354  1.00 0.00  ? 375 GLU B CG   1  
ATOM 5141   C CD   . GLU B 2 75  ? 18.267  14.080  20.878  1.00 0.00  ? 375 GLU B CD   1  
ATOM 5142   O OE1  . GLU B 2 75  ? 17.826  13.103  21.459  1.00 0.00  ? 375 GLU B OE1  1  
ATOM 5143   O OE2  . GLU B 2 75  ? 19.455  14.283  20.690  1.00 0.00  ? 375 GLU B OE2  1  
ATOM 5144   H H    . GLU B 2 75  ? 16.117  15.351  17.688  1.00 0.00  ? 375 GLU B H    1  
ATOM 5145   H HA   . GLU B 2 75  ? 16.934  12.919  18.961  1.00 0.00  ? 375 GLU B HA   1  
ATOM 5146   H HB2  . GLU B 2 75  ? 15.172  15.189  19.893  1.00 0.00  ? 375 GLU B HB2  1  
ATOM 5147   H HB3  . GLU B 2 75  ? 15.641  13.845  20.935  1.00 0.00  ? 375 GLU B HB3  1  
ATOM 5148   H HG2  . GLU B 2 75  ? 17.648  15.544  19.437  1.00 0.00  ? 375 GLU B HG2  1  
ATOM 5149   H HG3  . GLU B 2 75  ? 17.139  15.893  21.091  1.00 0.00  ? 375 GLU B HG3  1  
ATOM 5150   N N    . HIS B 2 76  ? 13.675  13.174  18.444  1.00 0.00  ? 376 HIS B N    1  
ATOM 5151   C CA   . HIS B 2 76  ? 12.452  12.324  18.318  1.00 0.00  ? 376 HIS B CA   1  
ATOM 5152   C C    . HIS B 2 76  ? 12.451  11.577  16.982  1.00 0.00  ? 376 HIS B C    1  
ATOM 5153   O O    . HIS B 2 76  ? 12.061  10.429  16.905  1.00 0.00  ? 376 HIS B O    1  
ATOM 5154   C CB   . HIS B 2 76  ? 11.210  13.215  18.396  1.00 0.00  ? 376 HIS B CB   1  
ATOM 5155   C CG   . HIS B 2 76  ? 11.013  13.693  19.809  1.00 0.00  ? 376 HIS B CG   1  
ATOM 5156   N ND1  . HIS B 2 76  ? 11.719  14.763  20.333  1.00 0.00  ? 376 HIS B ND1  1  
ATOM 5157   C CD2  . HIS B 2 76  ? 10.184  13.262  20.816  1.00 0.00  ? 376 HIS B CD2  1  
ATOM 5158   C CE1  . HIS B 2 76  ? 11.305  14.941  21.602  1.00 0.00  ? 376 HIS B CE1  1  
ATOM 5159   N NE2  . HIS B 2 76  ? 10.370  14.052  21.947  1.00 0.00  ? 376 HIS B NE2  1  
ATOM 5160   H H    . HIS B 2 76  ? 13.597  14.138  18.289  1.00 0.00  ? 376 HIS B H    1  
ATOM 5161   H HA   . HIS B 2 76  ? 12.430  11.610  19.127  1.00 0.00  ? 376 HIS B HA   1  
ATOM 5162   H HB2  . HIS B 2 76  ? 11.340  14.067  17.745  1.00 0.00  ? 376 HIS B HB2  1  
ATOM 5163   H HB3  . HIS B 2 76  ? 10.343  12.652  18.083  1.00 0.00  ? 376 HIS B HB3  1  
ATOM 5164   H HD1  . HIS B 2 76  ? 12.398  15.295  19.866  1.00 0.00  ? 376 HIS B HD1  1  
ATOM 5165   H HD2  . HIS B 2 76  ? 9.492   12.437  20.742  1.00 0.00  ? 376 HIS B HD2  1  
ATOM 5166   H HE1  . HIS B 2 76  ? 11.681  15.711  22.260  1.00 0.00  ? 376 HIS B HE1  1  
ATOM 5167   N N    . LEU B 2 77  ? 12.859  12.222  15.924  1.00 0.00  ? 377 LEU B N    1  
ATOM 5168   C CA   . LEU B 2 77  ? 12.850  11.547  14.595  1.00 0.00  ? 377 LEU B CA   1  
ATOM 5169   C C    . LEU B 2 77  ? 13.742  10.307  14.658  1.00 0.00  ? 377 LEU B C    1  
ATOM 5170   O O    . LEU B 2 77  ? 13.415  9.272   14.111  1.00 0.00  ? 377 LEU B O    1  
ATOM 5171   C CB   . LEU B 2 77  ? 13.377  12.499  13.518  1.00 0.00  ? 377 LEU B CB   1  
ATOM 5172   C CG   . LEU B 2 77  ? 12.373  13.634  13.263  1.00 0.00  ? 377 LEU B CG   1  
ATOM 5173   C CD1  . LEU B 2 77  ? 13.005  14.645  12.301  1.00 0.00  ? 377 LEU B CD1  1  
ATOM 5174   C CD2  . LEU B 2 77  ? 11.068  13.079  12.653  1.00 0.00  ? 377 LEU B CD2  1  
ATOM 5175   H H    . LEU B 2 77  ? 13.138  13.159  15.998  1.00 0.00  ? 377 LEU B H    1  
ATOM 5176   H HA   . LEU B 2 77  ? 11.841  11.246  14.352  1.00 0.00  ? 377 LEU B HA   1  
ATOM 5177   H HB2  . LEU B 2 77  ? 14.316  12.921  13.846  1.00 0.00  ? 377 LEU B HB2  1  
ATOM 5178   H HB3  . LEU B 2 77  ? 13.534  11.950  12.602  1.00 0.00  ? 377 LEU B HB3  1  
ATOM 5179   H HG   . LEU B 2 77  ? 12.152  14.128  14.200  1.00 0.00  ? 377 LEU B HG   1  
ATOM 5180   H HD11 . LEU B 2 77  ? 13.299  14.141  11.392  1.00 0.00  ? 377 LEU B HD11 1  
ATOM 5181   H HD12 . LEU B 2 77  ? 12.287  15.418  12.067  1.00 0.00  ? 377 LEU B HD12 1  
ATOM 5182   H HD13 . LEU B 2 77  ? 13.874  15.087  12.763  1.00 0.00  ? 377 LEU B HD13 1  
ATOM 5183   H HD21 . LEU B 2 77  ? 11.283  12.210  12.048  1.00 0.00  ? 377 LEU B HD21 1  
ATOM 5184   H HD22 . LEU B 2 77  ? 10.389  12.804  13.446  1.00 0.00  ? 377 LEU B HD22 1  
ATOM 5185   H HD23 . LEU B 2 77  ? 10.600  13.835  12.036  1.00 0.00  ? 377 LEU B HD23 1  
ATOM 5186   N N    . VAL B 2 78  ? 14.857  10.391  15.330  1.00 0.00  ? 378 VAL B N    1  
ATOM 5187   C CA   . VAL B 2 78  ? 15.743  9.199   15.426  1.00 0.00  ? 378 VAL B CA   1  
ATOM 5188   C C    . VAL B 2 78  ? 14.988  8.063   16.117  1.00 0.00  ? 378 VAL B C    1  
ATOM 5189   O O    . VAL B 2 78  ? 15.075  6.920   15.708  1.00 0.00  ? 378 VAL B O    1  
ATOM 5190   C CB   . VAL B 2 78  ? 17.020  9.554   16.207  1.00 0.00  ? 378 VAL B CB   1  
ATOM 5191   C CG1  . VAL B 2 78  ? 17.796  8.274   16.550  1.00 0.00  ? 378 VAL B CG1  1  
ATOM 5192   C CG2  . VAL B 2 78  ? 17.909  10.466  15.344  1.00 0.00  ? 378 VAL B CG2  1  
ATOM 5193   H H    . VAL B 2 78  ? 15.099  11.226  15.783  1.00 0.00  ? 378 VAL B H    1  
ATOM 5194   H HA   . VAL B 2 78  ? 16.009  8.881   14.432  1.00 0.00  ? 378 VAL B HA   1  
ATOM 5195   H HB   . VAL B 2 78  ? 16.753  10.067  17.120  1.00 0.00  ? 378 VAL B HB   1  
ATOM 5196   H HG11 . VAL B 2 78  ? 17.870  7.651   15.671  1.00 0.00  ? 378 VAL B HG11 1  
ATOM 5197   H HG12 . VAL B 2 78  ? 18.788  8.534   16.891  1.00 0.00  ? 378 VAL B HG12 1  
ATOM 5198   H HG13 . VAL B 2 78  ? 17.278  7.736   17.329  1.00 0.00  ? 378 VAL B HG13 1  
ATOM 5199   H HG21 . VAL B 2 78  ? 17.292  11.151  14.779  1.00 0.00  ? 378 VAL B HG21 1  
ATOM 5200   H HG22 . VAL B 2 78  ? 18.573  11.027  15.983  1.00 0.00  ? 378 VAL B HG22 1  
ATOM 5201   H HG23 . VAL B 2 78  ? 18.493  9.866   14.660  1.00 0.00  ? 378 VAL B HG23 1  
ATOM 5202   N N    . LYS B 2 79  ? 14.234  8.345   17.148  1.00 0.00  ? 379 LYS B N    1  
ATOM 5203   C CA   . LYS B 2 79  ? 13.488  7.241   17.811  1.00 0.00  ? 379 LYS B CA   1  
ATOM 5204   C C    . LYS B 2 79  ? 12.388  6.753   16.860  1.00 0.00  ? 379 LYS B C    1  
ATOM 5205   O O    . LYS B 2 79  ? 12.297  5.583   16.550  1.00 0.00  ? 379 LYS B O    1  
ATOM 5206   C CB   . LYS B 2 79  ? 12.871  7.754   19.115  1.00 0.00  ? 379 LYS B CB   1  
ATOM 5207   C CG   . LYS B 2 79  ? 13.979  8.345   19.994  1.00 0.00  ? 379 LYS B CG   1  
ATOM 5208   C CD   . LYS B 2 79  ? 13.499  8.462   21.442  1.00 0.00  ? 379 LYS B CD   1  
ATOM 5209   C CE   . LYS B 2 79  ? 12.153  9.193   21.505  1.00 0.00  ? 379 LYS B CE   1  
ATOM 5210   N NZ   . LYS B 2 79  ? 11.051  8.220   21.272  1.00 0.00  ? 379 LYS B NZ   1  
ATOM 5211   H H    . LYS B 2 79  ? 14.154  9.268   17.481  1.00 0.00  ? 379 LYS B H    1  
ATOM 5212   H HA   . LYS B 2 79  ? 14.165  6.426   18.027  1.00 0.00  ? 379 LYS B HA   1  
ATOM 5213   H HB2  . LYS B 2 79  ? 12.138  8.516   18.892  1.00 0.00  ? 379 LYS B HB2  1  
ATOM 5214   H HB3  . LYS B 2 79  ? 12.397  6.936   19.636  1.00 0.00  ? 379 LYS B HB3  1  
ATOM 5215   H HG2  . LYS B 2 79  ? 14.849  7.704   19.958  1.00 0.00  ? 379 LYS B HG2  1  
ATOM 5216   H HG3  . LYS B 2 79  ? 14.241  9.322   19.627  1.00 0.00  ? 379 LYS B HG3  1  
ATOM 5217   H HD2  . LYS B 2 79  ? 13.392  7.474   21.862  1.00 0.00  ? 379 LYS B HD2  1  
ATOM 5218   H HD3  . LYS B 2 79  ? 14.231  9.015   22.010  1.00 0.00  ? 379 LYS B HD3  1  
ATOM 5219   H HE2  . LYS B 2 79  ? 12.032  9.643   22.479  1.00 0.00  ? 379 LYS B HE2  1  
ATOM 5220   H HE3  . LYS B 2 79  ? 12.120  9.963   20.749  1.00 0.00  ? 379 LYS B HE3  1  
ATOM 5221   H HZ1  . LYS B 2 79  ? 11.449  7.272   21.124  1.00 0.00  ? 379 LYS B HZ1  1  
ATOM 5222   H HZ2  . LYS B 2 79  ? 10.421  8.206   22.101  1.00 0.00  ? 379 LYS B HZ2  1  
ATOM 5223   H HZ3  . LYS B 2 79  ? 10.511  8.502   20.430  1.00 0.00  ? 379 LYS B HZ3  1  
ATOM 5224   N N    . LEU B 2 80  ? 11.537  7.637   16.407  1.00 0.00  ? 380 LEU B N    1  
ATOM 5225   C CA   . LEU B 2 80  ? 10.427  7.215   15.501  1.00 0.00  ? 380 LEU B CA   1  
ATOM 5226   C C    . LEU B 2 80  ? 11.002  6.495   14.277  1.00 0.00  ? 380 LEU B C    1  
ATOM 5227   O O    . LEU B 2 80  ? 10.436  5.539   13.795  1.00 0.00  ? 380 LEU B O    1  
ATOM 5228   C CB   . LEU B 2 80  ? 9.657   8.468   15.050  1.00 0.00  ? 380 LEU B CB   1  
ATOM 5229   C CG   . LEU B 2 80  ? 8.504   8.094   14.101  1.00 0.00  ? 380 LEU B CG   1  
ATOM 5230   C CD1  . LEU B 2 80  ? 7.474   7.222   14.836  1.00 0.00  ? 380 LEU B CD1  1  
ATOM 5231   C CD2  . LEU B 2 80  ? 7.828   9.381   13.604  1.00 0.00  ? 380 LEU B CD2  1  
ATOM 5232   H H    . LEU B 2 80  ? 11.581  8.566   16.711  1.00 0.00  ? 380 LEU B H    1  
ATOM 5233   H HA   . LEU B 2 80  ? 9.762   6.557   16.031  1.00 0.00  ? 380 LEU B HA   1  
ATOM 5234   H HB2  . LEU B 2 80  ? 9.251   8.965   15.920  1.00 0.00  ? 380 LEU B HB2  1  
ATOM 5235   H HB3  . LEU B 2 80  ? 10.333  9.139   14.542  1.00 0.00  ? 380 LEU B HB3  1  
ATOM 5236   H HG   . LEU B 2 80  ? 8.894   7.549   13.254  1.00 0.00  ? 380 LEU B HG   1  
ATOM 5237   H HD11 . LEU B 2 80  ? 7.365   7.569   15.855  1.00 0.00  ? 380 LEU B HD11 1  
ATOM 5238   H HD12 . LEU B 2 80  ? 6.520   7.283   14.333  1.00 0.00  ? 380 LEU B HD12 1  
ATOM 5239   H HD13 . LEU B 2 80  ? 7.809   6.196   14.840  1.00 0.00  ? 380 LEU B HD13 1  
ATOM 5240   H HD21 . LEU B 2 80  ? 7.630   10.032  14.443  1.00 0.00  ? 380 LEU B HD21 1  
ATOM 5241   H HD22 . LEU B 2 80  ? 8.480   9.886   12.905  1.00 0.00  ? 380 LEU B HD22 1  
ATOM 5242   H HD23 . LEU B 2 80  ? 6.898   9.134   13.114  1.00 0.00  ? 380 LEU B HD23 1  
ATOM 5243   N N    . MET B 2 81  ? 12.138  6.900   13.801  1.00 0.00  ? 381 MET B N    1  
ATOM 5244   C CA   . MET B 2 81  ? 12.731  6.171   12.648  1.00 0.00  ? 381 MET B CA   1  
ATOM 5245   C C    . MET B 2 81  ? 13.194  4.801   13.150  1.00 0.00  ? 381 MET B C    1  
ATOM 5246   O O    . MET B 2 81  ? 13.034  3.794   12.489  1.00 0.00  ? 381 MET B O    1  
ATOM 5247   C CB   . MET B 2 81  ? 13.909  6.961   12.066  1.00 0.00  ? 381 MET B CB   1  
ATOM 5248   C CG   . MET B 2 81  ? 14.449  6.243   10.822  1.00 0.00  ? 381 MET B CG   1  
ATOM 5249   S SD   . MET B 2 81  ? 15.455  7.395   9.843   1.00 0.00  ? 381 MET B SD   1  
ATOM 5250   C CE   . MET B 2 81  ? 14.370  7.527   8.395   1.00 0.00  ? 381 MET B CE   1  
ATOM 5251   H H    . MET B 2 81  ? 12.614  7.629   14.249  1.00 0.00  ? 381 MET B H    1  
ATOM 5252   H HA   . MET B 2 81  ? 11.977  6.025   11.890  1.00 0.00  ? 381 MET B HA   1  
ATOM 5253   H HB2  . MET B 2 81  ? 13.575  7.951   11.794  1.00 0.00  ? 381 MET B HB2  1  
ATOM 5254   H HB3  . MET B 2 81  ? 14.693  7.036   12.805  1.00 0.00  ? 381 MET B HB3  1  
ATOM 5255   H HG2  . MET B 2 81  ? 15.060  5.408   11.130  1.00 0.00  ? 381 MET B HG2  1  
ATOM 5256   H HG3  . MET B 2 81  ? 13.623  5.881   10.226  1.00 0.00  ? 381 MET B HG3  1  
ATOM 5257   H HE1  . MET B 2 81  ? 13.351  7.688   8.722   1.00 0.00  ? 381 MET B HE1  1  
ATOM 5258   H HE2  . MET B 2 81  ? 14.683  8.359   7.784   1.00 0.00  ? 381 MET B HE2  1  
ATOM 5259   H HE3  . MET B 2 81  ? 14.428  6.616   7.817   1.00 0.00  ? 381 MET B HE3  1  
ATOM 5260   N N    . ALA B 2 82  ? 13.755  4.768   14.325  1.00 0.00  ? 382 ALA B N    1  
ATOM 5261   C CA   . ALA B 2 82  ? 14.226  3.481   14.911  1.00 0.00  ? 382 ALA B CA   1  
ATOM 5262   C C    . ALA B 2 82  ? 13.055  2.702   15.527  1.00 0.00  ? 382 ALA B C    1  
ATOM 5263   O O    . ALA B 2 82  ? 13.224  1.573   15.948  1.00 0.00  ? 382 ALA B O    1  
ATOM 5264   C CB   . ALA B 2 82  ? 15.268  3.762   15.995  1.00 0.00  ? 382 ALA B CB   1  
ATOM 5265   H H    . ALA B 2 82  ? 13.856  5.596   14.840  1.00 0.00  ? 382 ALA B H    1  
ATOM 5266   H HA   . ALA B 2 82  ? 14.678  2.883   14.134  1.00 0.00  ? 382 ALA B HA   1  
ATOM 5267   H HB1  . ALA B 2 82  ? 16.065  4.361   15.583  1.00 0.00  ? 382 ALA B HB1  1  
ATOM 5268   H HB2  . ALA B 2 82  ? 14.803  4.296   16.811  1.00 0.00  ? 382 ALA B HB2  1  
ATOM 5269   H HB3  . ALA B 2 82  ? 15.670  2.829   16.358  1.00 0.00  ? 382 ALA B HB3  1  
ATOM 5270   N N    . GLU B 2 83  ? 11.872  3.283   15.598  1.00 0.00  ? 383 GLU B N    1  
ATOM 5271   C CA   . GLU B 2 83  ? 10.701  2.556   16.204  1.00 0.00  ? 383 GLU B CA   1  
ATOM 5272   C C    . GLU B 2 83  ? 9.658   2.212   15.138  1.00 0.00  ? 383 GLU B C    1  
ATOM 5273   O O    . GLU B 2 83  ? 8.632   1.640   15.446  1.00 0.00  ? 383 GLU B O    1  
ATOM 5274   C CB   . GLU B 2 83  ? 10.045  3.428   17.279  1.00 0.00  ? 383 GLU B CB   1  
ATOM 5275   C CG   . GLU B 2 83  ? 10.973  3.539   18.491  1.00 0.00  ? 383 GLU B CG   1  
ATOM 5276   C CD   . GLU B 2 83  ? 10.316  4.416   19.559  1.00 0.00  ? 383 GLU B CD   1  
ATOM 5277   O OE1  . GLU B 2 83  ? 10.409  5.627   19.443  1.00 0.00  ? 383 GLU B OE1  1  
ATOM 5278   O OE2  . GLU B 2 83  ? 9.730   3.861   20.475  1.00 0.00  ? 383 GLU B OE2  1  
ATOM 5279   H H    . GLU B 2 83  ? 11.740  4.184   15.234  1.00 0.00  ? 383 GLU B H    1  
ATOM 5280   H HA   . GLU B 2 83  ? 11.036  1.637   16.666  1.00 0.00  ? 383 GLU B HA   1  
ATOM 5281   H HB2  . GLU B 2 83  ? 9.851   4.409   16.878  1.00 0.00  ? 383 GLU B HB2  1  
ATOM 5282   H HB3  . GLU B 2 83  ? 9.114   2.974   17.585  1.00 0.00  ? 383 GLU B HB3  1  
ATOM 5283   H HG2  . GLU B 2 83  ? 11.153  2.554   18.895  1.00 0.00  ? 383 GLU B HG2  1  
ATOM 5284   H HG3  . GLU B 2 83  ? 11.910  3.980   18.193  1.00 0.00  ? 383 GLU B HG3  1  
ATOM 5285   N N    . LEU B 2 84  ? 9.888   2.528   13.889  1.00 0.00  ? 384 LEU B N    1  
ATOM 5286   C CA   . LEU B 2 84  ? 8.869   2.171   12.851  1.00 0.00  ? 384 LEU B CA   1  
ATOM 5287   C C    . LEU B 2 84  ? 9.135   0.750   12.352  1.00 0.00  ? 384 LEU B C    1  
ATOM 5288   O O    . LEU B 2 84  ? 10.229  0.419   11.939  1.00 0.00  ? 384 LEU B O    1  
ATOM 5289   C CB   . LEU B 2 84  ? 8.949   3.169   11.689  1.00 0.00  ? 384 LEU B CB   1  
ATOM 5290   C CG   . LEU B 2 84  ? 8.203   4.468   12.062  1.00 0.00  ? 384 LEU B CG   1  
ATOM 5291   C CD1  . LEU B 2 84  ? 8.705   5.615   11.186  1.00 0.00  ? 384 LEU B CD1  1  
ATOM 5292   C CD2  . LEU B 2 84  ? 6.686   4.301   11.851  1.00 0.00  ? 384 LEU B CD2  1  
ATOM 5293   H H    . LEU B 2 84  ? 10.727  2.973   13.620  1.00 0.00  ? 384 LEU B H    1  
ATOM 5294   H HA   . LEU B 2 84  ? 7.882   2.208   13.289  1.00 0.00  ? 384 LEU B HA   1  
ATOM 5295   H HB2  . LEU B 2 84  ? 9.988   3.394   11.491  1.00 0.00  ? 384 LEU B HB2  1  
ATOM 5296   H HB3  . LEU B 2 84  ? 8.506   2.735   10.805  1.00 0.00  ? 384 LEU B HB3  1  
ATOM 5297   H HG   . LEU B 2 84  ? 8.394   4.703   13.098  1.00 0.00  ? 384 LEU B HG   1  
ATOM 5298   H HD11 . LEU B 2 84  ? 8.720   5.300   10.153  1.00 0.00  ? 384 LEU B HD11 1  
ATOM 5299   H HD12 . LEU B 2 84  ? 8.048   6.465   11.296  1.00 0.00  ? 384 LEU B HD12 1  
ATOM 5300   H HD13 . LEU B 2 84  ? 9.702   5.889   11.496  1.00 0.00  ? 384 LEU B HD13 1  
ATOM 5301   H HD21 . LEU B 2 84  ? 6.496   3.788   10.921  1.00 0.00  ? 384 LEU B HD21 1  
ATOM 5302   H HD22 . LEU B 2 84  ? 6.267   3.734   12.668  1.00 0.00  ? 384 LEU B HD22 1  
ATOM 5303   H HD23 . LEU B 2 84  ? 6.218   5.275   11.819  1.00 0.00  ? 384 LEU B HD23 1  
ATOM 5304   N N    . GLU B 2 85  ? 8.133   -0.094  12.394  1.00 0.00  ? 385 GLU B N    1  
ATOM 5305   C CA   . GLU B 2 85  ? 8.299   -1.507  11.932  1.00 0.00  ? 385 GLU B CA   1  
ATOM 5306   C C    . GLU B 2 85  ? 7.628   -1.675  10.567  1.00 0.00  ? 385 GLU B C    1  
ATOM 5307   O O    . GLU B 2 85  ? 7.271   -2.795  10.238  1.00 0.00  ? 385 GLU B O    1  
ATOM 5308   C CB   . GLU B 2 85  ? 7.632   -2.444  12.945  1.00 0.00  ? 385 GLU B CB   1  
ATOM 5309   C CG   . GLU B 2 85  ? 8.345   -2.333  14.295  1.00 0.00  ? 385 GLU B CG   1  
ATOM 5310   C CD   . GLU B 2 85  ? 9.768   -2.880  14.171  1.00 0.00  ? 385 GLU B CD   1  
ATOM 5311   O OE1  . GLU B 2 85  ? 9.960   -3.804  13.399  1.00 0.00  ? 385 GLU B OE1  1  
ATOM 5312   O OE2  . GLU B 2 85  ? 10.642  -2.364  14.849  1.00 0.00  ? 385 GLU B OE2  1  
ATOM 5313   O OXT  . GLU B 2 85  ? 7.481   -0.682  9.875   1.00 0.00  ? 385 GLU B OXT  1  
ATOM 5314   H H    . GLU B 2 85  ? 7.263   0.204   12.732  1.00 0.00  ? 385 GLU B H    1  
ATOM 5315   H HA   . GLU B 2 85  ? 9.349   -1.753  11.851  1.00 0.00  ? 385 GLU B HA   1  
ATOM 5316   H HB2  . GLU B 2 85  ? 6.595   -2.167  13.061  1.00 0.00  ? 385 GLU B HB2  1  
ATOM 5317   H HB3  . GLU B 2 85  ? 7.695   -3.463  12.590  1.00 0.00  ? 385 GLU B HB3  1  
ATOM 5318   H HG2  . GLU B 2 85  ? 8.382   -1.296  14.598  1.00 0.00  ? 385 GLU B HG2  1  
ATOM 5319   H HG3  . GLU B 2 85  ? 7.805   -2.904  15.035  1.00 0.00  ? 385 GLU B HG3  1  
ATOM 5320   N N    . MET A 1 1   ? -9.740  -22.909 -20.787 1.00 1.59  ? 1   MET A N    2  
ATOM 5321   C CA   . MET A 1 1   ? -8.290  -22.637 -20.997 1.00 1.39  ? 1   MET A CA   2  
ATOM 5322   C C    . MET A 1 1   ? -7.920  -21.330 -20.291 1.00 1.31  ? 1   MET A C    2  
ATOM 5323   O O    . MET A 1 1   ? -7.163  -20.530 -20.804 1.00 1.94  ? 1   MET A O    2  
ATOM 5324   C CB   . MET A 1 1   ? -8.007  -22.503 -22.496 1.00 2.04  ? 1   MET A CB   2  
ATOM 5325   C CG   . MET A 1 1   ? -8.416  -23.791 -23.217 1.00 2.17  ? 1   MET A CG   2  
ATOM 5326   S SD   . MET A 1 1   ? -7.424  -25.181 -22.609 1.00 2.81  ? 1   MET A SD   2  
ATOM 5327   C CE   . MET A 1 1   ? -5.830  -24.674 -23.303 1.00 2.91  ? 1   MET A CE   2  
ATOM 5328   H H1   . MET A 1 1   ? -10.029 -22.544 -19.856 1.00 2.22  ? 1   MET A H1   2  
ATOM 5329   H H2   . MET A 1 1   ? -10.292 -22.440 -21.532 1.00 1.94  ? 1   MET A H2   2  
ATOM 5330   H H3   . MET A 1 1   ? -9.908  -23.933 -20.826 1.00 1.84  ? 1   MET A H3   2  
ATOM 5331   H HA   . MET A 1 1   ? -7.705  -23.446 -20.587 1.00 1.81  ? 1   MET A HA   2  
ATOM 5332   H HB2  . MET A 1 1   ? -8.570  -21.672 -22.895 1.00 2.38  ? 1   MET A HB2  2  
ATOM 5333   H HB3  . MET A 1 1   ? -6.953  -22.328 -22.648 1.00 2.62  ? 1   MET A HB3  2  
ATOM 5334   H HG2  . MET A 1 1   ? -9.461  -23.988 -23.027 1.00 2.24  ? 1   MET A HG2  2  
ATOM 5335   H HG3  . MET A 1 1   ? -8.264  -23.674 -24.279 1.00 2.61  ? 1   MET A HG3  2  
ATOM 5336   H HE1  . MET A 1 1   ? -5.990  -24.097 -24.201 1.00 3.19  ? 1   MET A HE1  2  
ATOM 5337   H HE2  . MET A 1 1   ? -5.299  -24.073 -22.582 1.00 3.16  ? 1   MET A HE2  2  
ATOM 5338   H HE3  . MET A 1 1   ? -5.245  -25.554 -23.533 1.00 3.10  ? 1   MET A HE3  2  
ATOM 5339   N N    . ILE A 1 2   ? -8.453  -21.112 -19.113 1.00 1.20  ? 2   ILE A N    2  
ATOM 5340   C CA   . ILE A 1 2   ? -8.149  -19.859 -18.350 1.00 1.04  ? 2   ILE A CA   2  
ATOM 5341   C C    . ILE A 1 2   ? -7.288  -20.203 -17.137 1.00 1.00  ? 2   ILE A C    2  
ATOM 5342   O O    . ILE A 1 2   ? -7.611  -21.080 -16.361 1.00 0.91  ? 2   ILE A O    2  
ATOM 5343   C CB   . ILE A 1 2   ? -9.462  -19.229 -17.880 1.00 0.88  ? 2   ILE A CB   2  
ATOM 5344   C CG1  . ILE A 1 2   ? -10.304 -18.849 -19.103 1.00 0.97  ? 2   ILE A CG1  2  
ATOM 5345   C CG2  . ILE A 1 2   ? -9.167  -17.981 -17.046 1.00 0.89  ? 2   ILE A CG2  2  
ATOM 5346   C CD1  . ILE A 1 2   ? -11.714 -18.451 -18.658 1.00 0.97  ? 2   ILE A CD1  2  
ATOM 5347   H H    . ILE A 1 2   ? -9.060  -21.777 -18.727 1.00 1.71  ? 2   ILE A H    2  
ATOM 5348   H HA   . ILE A 1 2   ? -7.619  -19.155 -18.979 1.00 1.18  ? 2   ILE A HA   2  
ATOM 5349   H HB   . ILE A 1 2   ? -10.004 -19.943 -17.277 1.00 0.86  ? 2   ILE A HB   2  
ATOM 5350   H HG12 . ILE A 1 2   ? -9.839  -18.017 -19.611 1.00 1.11  ? 2   ILE A HG12 2  
ATOM 5351   H HG13 . ILE A 1 2   ? -10.365 -19.693 -19.773 1.00 1.05  ? 2   ILE A HG13 2  
ATOM 5352   H HG21 . ILE A 1 2   ? -8.430  -17.376 -17.551 1.00 1.47  ? 2   ILE A HG21 2  
ATOM 5353   H HG22 . ILE A 1 2   ? -10.076 -17.411 -16.918 1.00 1.28  ? 2   ILE A HG22 2  
ATOM 5354   H HG23 . ILE A 1 2   ? -8.790  -18.278 -16.079 1.00 1.28  ? 2   ILE A HG23 2  
ATOM 5355   H HD11 . ILE A 1 2   ? -12.102 -19.194 -17.978 1.00 1.52  ? 2   ILE A HD11 2  
ATOM 5356   H HD12 . ILE A 1 2   ? -11.678 -17.492 -18.162 1.00 1.28  ? 2   ILE A HD12 2  
ATOM 5357   H HD13 . ILE A 1 2   ? -12.357 -18.384 -19.523 1.00 1.44  ? 2   ILE A HD13 2  
ATOM 5358   N N    . SER A 1 3   ? -6.186  -19.518 -16.971 1.00 1.10  ? 3   SER A N    2  
ATOM 5359   C CA   . SER A 1 3   ? -5.283  -19.794 -15.812 1.00 1.11  ? 3   SER A CA   2  
ATOM 5360   C C    . SER A 1 3   ? -4.748  -18.475 -15.251 1.00 1.07  ? 3   SER A C    2  
ATOM 5361   O O    . SER A 1 3   ? -4.575  -17.509 -15.967 1.00 1.17  ? 3   SER A O    2  
ATOM 5362   C CB   . SER A 1 3   ? -4.111  -20.659 -16.276 1.00 1.29  ? 3   SER A CB   2  
ATOM 5363   O OG   . SER A 1 3   ? -4.607  -21.893 -16.775 1.00 1.40  ? 3   SER A OG   2  
ATOM 5364   H H    . SER A 1 3   ? -5.948  -18.817 -17.616 1.00 1.21  ? 3   SER A H    2  
ATOM 5365   H HA   . SER A 1 3   ? -5.827  -20.314 -15.037 1.00 1.05  ? 3   SER A HA   2  
ATOM 5366   H HB2  . SER A 1 3   ? -3.573  -20.150 -17.059 1.00 1.36  ? 3   SER A HB2  2  
ATOM 5367   H HB3  . SER A 1 3   ? -3.444  -20.838 -15.443 1.00 1.30  ? 3   SER A HB3  2  
ATOM 5368   H HG   . SER A 1 3   ? -3.866  -22.495 -16.868 1.00 1.66  ? 3   SER A HG   2  
ATOM 5369   N N    . GLY A 1 4   ? -4.471  -18.435 -13.973 1.00 0.97  ? 4   GLY A N    2  
ATOM 5370   C CA   . GLY A 1 4   ? -3.929  -17.191 -13.343 1.00 0.97  ? 4   GLY A CA   2  
ATOM 5371   C C    . GLY A 1 4   ? -2.803  -17.587 -12.392 1.00 1.00  ? 4   GLY A C    2  
ATOM 5372   O O    . GLY A 1 4   ? -2.273  -18.678 -12.473 1.00 1.05  ? 4   GLY A O    2  
ATOM 5373   H H    . GLY A 1 4   ? -4.609  -19.230 -13.417 1.00 0.93  ? 4   GLY A H    2  
ATOM 5374   H HA2  . GLY A 1 4   ? -3.544  -16.525 -14.105 1.00 1.02  ? 4   GLY A HA2  2  
ATOM 5375   H HA3  . GLY A 1 4   ? -4.708  -16.695 -12.787 1.00 0.91  ? 4   GLY A HA3  2  
ATOM 5376   N N    . ILE A 1 5   ? -2.416  -16.721 -11.492 1.00 1.00  ? 5   ILE A N    2  
ATOM 5377   C CA   . ILE A 1 5   ? -1.310  -17.079 -10.554 1.00 1.05  ? 5   ILE A CA   2  
ATOM 5378   C C    . ILE A 1 5   ? -1.886  -17.730 -9.295  1.00 1.00  ? 5   ILE A C    2  
ATOM 5379   O O    . ILE A 1 5   ? -1.181  -18.381 -8.554  1.00 1.03  ? 5   ILE A O    2  
ATOM 5380   C CB   . ILE A 1 5   ? -0.550  -15.811 -10.163 1.00 1.08  ? 5   ILE A CB   2  
ATOM 5381   C CG1  . ILE A 1 5   ? 0.069   -15.185 -11.415 1.00 1.14  ? 5   ILE A CG1  2  
ATOM 5382   C CG2  . ILE A 1 5   ? 0.554   -16.167 -9.167  1.00 1.12  ? 5   ILE A CG2  2  
ATOM 5383   C CD1  . ILE A 1 5   ? 0.615   -13.797 -11.079 1.00 1.15  ? 5   ILE A CD1  2  
ATOM 5384   H H    . ILE A 1 5   ? -2.839  -15.838 -11.438 1.00 0.98  ? 5   ILE A H    2  
ATOM 5385   H HA   . ILE A 1 5   ? -0.628  -17.768 -11.035 1.00 1.10  ? 5   ILE A HA   2  
ATOM 5386   H HB   . ILE A 1 5   ? -1.234  -15.110 -9.708  1.00 1.03  ? 5   ILE A HB   2  
ATOM 5387   H HG12 . ILE A 1 5   ? 0.873   -15.813 -11.772 1.00 1.20  ? 5   ILE A HG12 2  
ATOM 5388   H HG13 . ILE A 1 5   ? -0.684  -15.097 -12.184 1.00 1.14  ? 5   ILE A HG13 2  
ATOM 5389   H HG21 . ILE A 1 5   ? 1.107   -17.020 -9.531  1.00 1.42  ? 5   ILE A HG21 2  
ATOM 5390   H HG22 . ILE A 1 5   ? 1.223   -15.327 -9.056  1.00 1.59  ? 5   ILE A HG22 2  
ATOM 5391   H HG23 . ILE A 1 5   ? 0.114   -16.405 -8.210  1.00 1.53  ? 5   ILE A HG23 2  
ATOM 5392   H HD11 . ILE A 1 5   ? -0.148  -13.221 -10.577 1.00 1.45  ? 5   ILE A HD11 2  
ATOM 5393   H HD12 . ILE A 1 5   ? 1.475   -13.896 -10.433 1.00 1.52  ? 5   ILE A HD12 2  
ATOM 5394   H HD13 . ILE A 1 5   ? 0.906   -13.294 -11.989 1.00 1.59  ? 5   ILE A HD13 2  
ATOM 5395   N N    . LEU A 1 6   ? -3.161  -17.566 -9.052  1.00 0.94  ? 6   LEU A N    2  
ATOM 5396   C CA   . LEU A 1 6   ? -3.779  -18.180 -7.840  1.00 0.89  ? 6   LEU A CA   2  
ATOM 5397   C C    . LEU A 1 6   ? -2.958  -17.799 -6.605  1.00 0.90  ? 6   LEU A C    2  
ATOM 5398   O O    . LEU A 1 6   ? -1.905  -18.350 -6.353  1.00 0.98  ? 6   LEU A O    2  
ATOM 5399   C CB   . LEU A 1 6   ? -3.808  -19.706 -7.995  1.00 0.93  ? 6   LEU A CB   2  
ATOM 5400   C CG   . LEU A 1 6   ? -4.485  -20.357 -6.777  1.00 0.90  ? 6   LEU A CG   2  
ATOM 5401   C CD1  . LEU A 1 6   ? -5.952  -19.900 -6.673  1.00 0.93  ? 6   LEU A CD1  2  
ATOM 5402   C CD2  . LEU A 1 6   ? -4.429  -21.881 -6.934  1.00 0.93  ? 6   LEU A CD2  2  
ATOM 5403   H H    . LEU A 1 6   ? -3.712  -17.036 -9.665  1.00 0.92  ? 6   LEU A H    2  
ATOM 5404   H HA   . LEU A 1 6   ? -4.786  -17.808 -7.728  1.00 0.84  ? 6   LEU A HA   2  
ATOM 5405   H HB2  . LEU A 1 6   ? -4.359  -19.963 -8.889  1.00 0.96  ? 6   LEU A HB2  2  
ATOM 5406   H HB3  . LEU A 1 6   ? -2.797  -20.075 -8.079  1.00 0.97  ? 6   LEU A HB3  2  
ATOM 5407   H HG   . LEU A 1 6   ? -3.959  -20.072 -5.878  1.00 0.90  ? 6   LEU A HG   2  
ATOM 5408   H HD11 . LEU A 1 6   ? -6.366  -19.767 -7.662  1.00 1.47  ? 6   LEU A HD11 2  
ATOM 5409   H HD12 . LEU A 1 6   ? -6.530  -20.644 -6.142  1.00 1.28  ? 6   LEU A HD12 2  
ATOM 5410   H HD13 . LEU A 1 6   ? -6.001  -18.965 -6.135  1.00 1.40  ? 6   LEU A HD13 2  
ATOM 5411   H HD21 . LEU A 1 6   ? -4.777  -22.155 -7.919  1.00 1.46  ? 6   LEU A HD21 2  
ATOM 5412   H HD22 . LEU A 1 6   ? -3.412  -22.218 -6.805  1.00 1.36  ? 6   LEU A HD22 2  
ATOM 5413   H HD23 . LEU A 1 6   ? -5.059  -22.343 -6.189  1.00 1.33  ? 6   LEU A HD23 2  
ATOM 5414   N N    . ALA A 1 7   ? -3.441  -16.872 -5.818  1.00 0.83  ? 7   ALA A N    2  
ATOM 5415   C CA   . ALA A 1 7   ? -2.701  -16.463 -4.585  1.00 0.85  ? 7   ALA A CA   2  
ATOM 5416   C C    . ALA A 1 7   ? -3.355  -17.122 -3.370  1.00 0.83  ? 7   ALA A C    2  
ATOM 5417   O O    . ALA A 1 7   ? -2.711  -17.391 -2.374  1.00 0.88  ? 7   ALA A O    2  
ATOM 5418   C CB   . ALA A 1 7   ? -2.766  -14.943 -4.435  1.00 0.83  ? 7   ALA A CB   2  
ATOM 5419   H H    . ALA A 1 7   ? -4.310  -16.463 -6.021  1.00 0.78  ? 7   ALA A H    2  
ATOM 5420   H HA   . ALA A 1 7   ? -1.666  -16.773 -4.650  1.00 0.91  ? 7   ALA A HA   2  
ATOM 5421   H HB1  . ALA A 1 7   ? -3.784  -14.610 -4.576  1.00 1.31  ? 7   ALA A HB1  2  
ATOM 5422   H HB2  . ALA A 1 7   ? -2.430  -14.664 -3.447  1.00 1.39  ? 7   ALA A HB2  2  
ATOM 5423   H HB3  . ALA A 1 7   ? -2.130  -14.480 -5.175  1.00 1.23  ? 7   ALA A HB3  2  
ATOM 5424   N N    . SER A 1 8   ? -4.639  -17.378 -3.449  1.00 0.77  ? 8   SER A N    2  
ATOM 5425   C CA   . SER A 1 8   ? -5.372  -18.017 -2.308  1.00 0.77  ? 8   SER A CA   2  
ATOM 5426   C C    . SER A 1 8   ? -6.205  -19.203 -2.838  1.00 0.73  ? 8   SER A C    2  
ATOM 5427   O O    . SER A 1 8   ? -7.120  -19.003 -3.614  1.00 0.70  ? 8   SER A O    2  
ATOM 5428   C CB   . SER A 1 8   ? -6.311  -16.983 -1.690  1.00 0.76  ? 8   SER A CB   2  
ATOM 5429   O OG   . SER A 1 8   ? -5.548  -16.045 -0.942  1.00 1.69  ? 8   SER A OG   2  
ATOM 5430   H H    . SER A 1 8   ? -5.128  -17.143 -4.268  1.00 0.75  ? 8   SER A H    2  
ATOM 5431   H HA   . SER A 1 8   ? -4.672  -18.350 -1.560  1.00 0.83  ? 8   SER A HA   2  
ATOM 5432   H HB2  . SER A 1 8   ? -6.840  -16.465 -2.472  1.00 1.09  ? 8   SER A HB2  2  
ATOM 5433   H HB3  . SER A 1 8   ? -7.022  -17.482 -1.045  1.00 1.25  ? 8   SER A HB3  2  
ATOM 5434   H HG   . SER A 1 8   ? -5.016  -16.534 -0.308  1.00 2.09  ? 8   SER A HG   2  
ATOM 5435   N N    . PRO A 1 9   ? -5.909  -20.429 -2.448  1.00 0.76  ? 9   PRO A N    2  
ATOM 5436   C CA   . PRO A 1 9   ? -6.672  -21.618 -2.933  1.00 0.75  ? 9   PRO A CA   2  
ATOM 5437   C C    . PRO A 1 9   ? -8.000  -21.815 -2.183  1.00 0.70  ? 9   PRO A C    2  
ATOM 5438   O O    . PRO A 1 9   ? -8.140  -21.448 -1.034  1.00 0.70  ? 9   PRO A O    2  
ATOM 5439   C CB   . PRO A 1 9   ? -5.713  -22.782 -2.667  1.00 0.83  ? 9   PRO A CB   2  
ATOM 5440   C CG   . PRO A 1 9   ? -4.939  -22.364 -1.457  1.00 0.85  ? 9   PRO A CG   2  
ATOM 5441   C CD   . PRO A 1 9   ? -4.834  -20.832 -1.515  1.00 0.82  ? 9   PRO A CD   2  
ATOM 5442   H HA   . PRO A 1 9   ? -6.854  -21.535 -3.992  1.00 0.74  ? 9   PRO A HA   2  
ATOM 5443   H HB2  . PRO A 1 9   ? -6.264  -23.695 -2.476  1.00 0.85  ? 9   PRO A HB2  2  
ATOM 5444   H HB3  . PRO A 1 9   ? -5.044  -22.916 -3.505  1.00 0.88  ? 9   PRO A HB3  2  
ATOM 5445   H HG2  . PRO A 1 9   ? -5.465  -22.671 -0.559  1.00 0.84  ? 9   PRO A HG2  2  
ATOM 5446   H HG3  . PRO A 1 9   ? -3.951  -22.801 -1.473  1.00 0.91  ? 9   PRO A HG3  2  
ATOM 5447   H HD2  . PRO A 1 9   ? -4.998  -20.404 -0.535  1.00 0.81  ? 9   PRO A HD2  2  
ATOM 5448   H HD3  . PRO A 1 9   ? -3.873  -20.528 -1.905  1.00 0.86  ? 9   PRO A HD3  2  
ATOM 5449   N N    . GLY A 1 10  ? -8.973  -22.392 -2.840  1.00 0.67  ? 10  GLY A N    2  
ATOM 5450   C CA   . GLY A 1 10  ? -10.304 -22.623 -2.196  1.00 0.64  ? 10  GLY A CA   2  
ATOM 5451   C C    . GLY A 1 10  ? -11.387 -22.585 -3.279  1.00 0.62  ? 10  GLY A C    2  
ATOM 5452   O O    . GLY A 1 10  ? -11.125 -22.207 -4.398  1.00 0.92  ? 10  GLY A O    2  
ATOM 5453   H H    . GLY A 1 10  ? -8.828  -22.672 -3.769  1.00 0.68  ? 10  GLY A H    2  
ATOM 5454   H HA2  . GLY A 1 10  ? -10.306 -23.591 -1.713  1.00 0.70  ? 10  GLY A HA2  2  
ATOM 5455   H HA3  . GLY A 1 10  ? -10.497 -21.855 -1.465  1.00 0.60  ? 10  GLY A HA3  2  
ATOM 5456   N N    . ILE A 1 11  ? -12.601 -22.978 -2.963  1.00 0.64  ? 11  ILE A N    2  
ATOM 5457   C CA   . ILE A 1 11  ? -13.700 -22.973 -3.994  1.00 0.60  ? 11  ILE A CA   2  
ATOM 5458   C C    . ILE A 1 11  ? -14.840 -22.052 -3.536  1.00 0.56  ? 11  ILE A C    2  
ATOM 5459   O O    . ILE A 1 11  ? -15.302 -22.146 -2.416  1.00 0.61  ? 11  ILE A O    2  
ATOM 5460   C CB   . ILE A 1 11  ? -14.239 -24.399 -4.149  1.00 0.67  ? 11  ILE A CB   2  
ATOM 5461   C CG1  . ILE A 1 11  ? -13.103 -25.325 -4.603  1.00 0.74  ? 11  ILE A CG1  2  
ATOM 5462   C CG2  . ILE A 1 11  ? -15.347 -24.414 -5.204  1.00 0.64  ? 11  ILE A CG2  2  
ATOM 5463   C CD1  . ILE A 1 11  ? -13.558 -26.789 -4.550  1.00 0.81  ? 11  ILE A CD1  2  
ATOM 5464   H H    . ILE A 1 11  ? -12.791 -23.279 -2.049  1.00 0.92  ? 11  ILE A H    2  
ATOM 5465   H HA   . ILE A 1 11  ? -13.323 -22.629 -4.944  1.00 0.56  ? 11  ILE A HA   2  
ATOM 5466   H HB   . ILE A 1 11  ? -14.634 -24.740 -3.203  1.00 0.72  ? 11  ILE A HB   2  
ATOM 5467   H HG12 . ILE A 1 11  ? -12.820 -25.077 -5.613  1.00 0.77  ? 11  ILE A HG12 2  
ATOM 5468   H HG13 . ILE A 1 11  ? -12.252 -25.193 -3.951  1.00 0.78  ? 11  ILE A HG13 2  
ATOM 5469   H HG21 . ILE A 1 11  ? -14.979 -23.974 -6.119  1.00 1.09  ? 11  ILE A HG21 2  
ATOM 5470   H HG22 . ILE A 1 11  ? -15.650 -25.434 -5.392  1.00 1.20  ? 11  ILE A HG22 2  
ATOM 5471   H HG23 . ILE A 1 11  ? -16.192 -23.848 -4.847  1.00 1.26  ? 11  ILE A HG23 2  
ATOM 5472   H HD11 . ILE A 1 11  ? -14.163 -26.954 -3.670  1.00 1.21  ? 11  ILE A HD11 2  
ATOM 5473   H HD12 . ILE A 1 11  ? -14.137 -27.017 -5.433  1.00 1.35  ? 11  ILE A HD12 2  
ATOM 5474   H HD13 . ILE A 1 11  ? -12.692 -27.432 -4.514  1.00 1.35  ? 11  ILE A HD13 2  
ATOM 5475   N N    . ALA A 1 12  ? -15.293 -21.149 -4.387  1.00 0.50  ? 12  ALA A N    2  
ATOM 5476   C CA   . ALA A 1 12  ? -16.397 -20.215 -3.983  1.00 0.50  ? 12  ALA A CA   2  
ATOM 5477   C C    . ALA A 1 12  ? -17.455 -20.125 -5.090  1.00 0.47  ? 12  ALA A C    2  
ATOM 5478   O O    . ALA A 1 12  ? -17.165 -20.266 -6.262  1.00 0.51  ? 12  ALA A O    2  
ATOM 5479   C CB   . ALA A 1 12  ? -15.810 -18.823 -3.739  1.00 0.49  ? 12  ALA A CB   2  
ATOM 5480   H H    . ALA A 1 12  ? -14.894 -21.074 -5.284  1.00 0.48  ? 12  ALA A H    2  
ATOM 5481   H HA   . ALA A 1 12  ? -16.868 -20.564 -3.075  1.00 0.55  ? 12  ALA A HA   2  
ATOM 5482   H HB1  . ALA A 1 12  ? -15.236 -18.518 -4.602  1.00 1.14  ? 12  ALA A HB1  2  
ATOM 5483   H HB2  . ALA A 1 12  ? -16.612 -18.117 -3.574  1.00 1.13  ? 12  ALA A HB2  2  
ATOM 5484   H HB3  . ALA A 1 12  ? -15.169 -18.850 -2.871  1.00 1.12  ? 12  ALA A HB3  2  
ATOM 5485   N N    . PHE A 1 13  ? -18.687 -19.879 -4.711  1.00 0.48  ? 13  PHE A N    2  
ATOM 5486   C CA   . PHE A 1 13  ? -19.801 -19.758 -5.706  1.00 0.48  ? 13  PHE A CA   2  
ATOM 5487   C C    . PHE A 1 13  ? -20.515 -18.425 -5.455  1.00 0.49  ? 13  PHE A C    2  
ATOM 5488   O O    . PHE A 1 13  ? -20.898 -18.139 -4.338  1.00 0.54  ? 13  PHE A O    2  
ATOM 5489   C CB   . PHE A 1 13  ? -20.814 -20.894 -5.480  1.00 0.53  ? 13  PHE A CB   2  
ATOM 5490   C CG   . PHE A 1 13  ? -20.112 -22.233 -5.392  1.00 0.52  ? 13  PHE A CG   2  
ATOM 5491   C CD1  . PHE A 1 13  ? -19.337 -22.546 -4.266  1.00 0.56  ? 13  PHE A CD1  2  
ATOM 5492   C CD2  . PHE A 1 13  ? -20.244 -23.169 -6.427  1.00 0.55  ? 13  PHE A CD2  2  
ATOM 5493   C CE1  . PHE A 1 13  ? -18.698 -23.787 -4.179  1.00 0.61  ? 13  PHE A CE1  2  
ATOM 5494   C CE2  . PHE A 1 13  ? -19.602 -24.409 -6.339  1.00 0.60  ? 13  PHE A CE2  2  
ATOM 5495   C CZ   . PHE A 1 13  ? -18.829 -24.718 -5.215  1.00 0.62  ? 13  PHE A CZ   2  
ATOM 5496   H H    . PHE A 1 13  ? -18.881 -19.763 -3.757  1.00 0.55  ? 13  PHE A H    2  
ATOM 5497   H HA   . PHE A 1 13  ? -19.420 -19.794 -6.717  1.00 0.45  ? 13  PHE A HA   2  
ATOM 5498   H HB2  . PHE A 1 13  ? -21.349 -20.716 -4.558  1.00 0.60  ? 13  PHE A HB2  2  
ATOM 5499   H HB3  . PHE A 1 13  ? -21.516 -20.911 -6.300  1.00 0.57  ? 13  PHE A HB3  2  
ATOM 5500   H HD1  . PHE A 1 13  ? -19.234 -21.830 -3.464  1.00 0.59  ? 13  PHE A HD1  2  
ATOM 5501   H HD2  . PHE A 1 13  ? -20.845 -22.937 -7.291  1.00 0.58  ? 13  PHE A HD2  2  
ATOM 5502   H HE1  . PHE A 1 13  ? -18.101 -24.027 -3.311  1.00 0.68  ? 13  PHE A HE1  2  
ATOM 5503   H HE2  . PHE A 1 13  ? -19.703 -25.128 -7.138  1.00 0.66  ? 13  PHE A HE2  2  
ATOM 5504   H HZ   . PHE A 1 13  ? -18.333 -25.675 -5.147  1.00 0.70  ? 13  PHE A HZ   2  
ATOM 5505   N N    . GLY A 1 14  ? -20.711 -17.595 -6.450  1.00 0.49  ? 14  GLY A N    2  
ATOM 5506   C CA   . GLY A 1 14  ? -21.411 -16.306 -6.177  1.00 0.53  ? 14  GLY A CA   2  
ATOM 5507   C C    . GLY A 1 14  ? -21.537 -15.467 -7.457  1.00 0.55  ? 14  GLY A C    2  
ATOM 5508   O O    . GLY A 1 14  ? -21.085 -15.848 -8.518  1.00 0.54  ? 14  GLY A O    2  
ATOM 5509   H H    . GLY A 1 14  ? -20.410 -17.794 -7.361  1.00 0.47  ? 14  GLY A H    2  
ATOM 5510   H HA2  . GLY A 1 14  ? -22.398 -16.513 -5.789  1.00 0.58  ? 14  GLY A HA2  2  
ATOM 5511   H HA3  . GLY A 1 14  ? -20.850 -15.746 -5.442  1.00 0.53  ? 14  GLY A HA3  2  
ATOM 5512   N N    . LYS A 1 15  ? -22.162 -14.325 -7.343  1.00 0.61  ? 15  LYS A N    2  
ATOM 5513   C CA   . LYS A 1 15  ? -22.349 -13.432 -8.528  1.00 0.65  ? 15  LYS A CA   2  
ATOM 5514   C C    . LYS A 1 15  ? -21.057 -12.651 -8.780  1.00 0.63  ? 15  LYS A C    2  
ATOM 5515   O O    . LYS A 1 15  ? -20.231 -12.514 -7.898  1.00 0.61  ? 15  LYS A O    2  
ATOM 5516   C CB   . LYS A 1 15  ? -23.493 -12.456 -8.249  1.00 0.73  ? 15  LYS A CB   2  
ATOM 5517   C CG   . LYS A 1 15  ? -24.798 -13.238 -8.086  1.00 0.82  ? 15  LYS A CG   2  
ATOM 5518   C CD   . LYS A 1 15  ? -25.931 -12.290 -7.666  1.00 0.89  ? 15  LYS A CD   2  
ATOM 5519   C CE   . LYS A 1 15  ? -26.314 -11.353 -8.820  1.00 1.32  ? 15  LYS A CE   2  
ATOM 5520   N NZ   . LYS A 1 15  ? -26.418 -12.124 -10.092 1.00 2.10  ? 15  LYS A NZ   2  
ATOM 5521   H H    . LYS A 1 15  ? -22.515 -14.073 -6.465  1.00 0.63  ? 15  LYS A H    2  
ATOM 5522   H HA   . LYS A 1 15  ? -22.582 -14.027 -9.399  1.00 0.65  ? 15  LYS A HA   2  
ATOM 5523   H HB2  . LYS A 1 15  ? -23.284 -11.906 -7.343  1.00 0.79  ? 15  LYS A HB2  2  
ATOM 5524   H HB3  . LYS A 1 15  ? -23.585 -11.769 -9.075  1.00 0.76  ? 15  LYS A HB3  2  
ATOM 5525   H HG2  . LYS A 1 15  ? -25.049 -13.719 -9.020  1.00 0.91  ? 15  LYS A HG2  2  
ATOM 5526   H HG3  . LYS A 1 15  ? -24.666 -13.991 -7.323  1.00 0.94  ? 15  LYS A HG3  2  
ATOM 5527   H HD2  . LYS A 1 15  ? -26.795 -12.872 -7.379  1.00 1.15  ? 15  LYS A HD2  2  
ATOM 5528   H HD3  . LYS A 1 15  ? -25.606 -11.699 -6.822  1.00 1.21  ? 15  LYS A HD3  2  
ATOM 5529   H HE2  . LYS A 1 15  ? -27.268 -10.895 -8.604  1.00 1.74  ? 15  LYS A HE2  2  
ATOM 5530   H HE3  . LYS A 1 15  ? -25.565 -10.583 -8.924  1.00 1.69  ? 15  LYS A HE3  2  
ATOM 5531   H HZ1  . LYS A 1 15  ? -27.106 -12.894 -9.976  1.00 2.45  ? 15  LYS A HZ1  2  
ATOM 5532   H HZ2  . LYS A 1 15  ? -26.732 -11.493 -10.855 1.00 2.54  ? 15  LYS A HZ2  2  
ATOM 5533   H HZ3  . LYS A 1 15  ? -25.486 -12.524 -10.330 1.00 2.63  ? 15  LYS A HZ3  2  
ATOM 5534   N N    . ALA A 1 16  ? -20.864 -12.151 -9.982  1.00 0.64  ? 16  ALA A N    2  
ATOM 5535   C CA   . ALA A 1 16  ? -19.606 -11.392 -10.296 1.00 0.64  ? 16  ALA A CA   2  
ATOM 5536   C C    . ALA A 1 16  ? -19.888 -9.889  -10.413 1.00 0.67  ? 16  ALA A C    2  
ATOM 5537   O O    . ALA A 1 16  ? -20.763 -9.461  -11.139 1.00 0.77  ? 16  ALA A O    2  
ATOM 5538   C CB   . ALA A 1 16  ? -19.018 -11.916 -11.626 1.00 0.66  ? 16  ALA A CB   2  
ATOM 5539   H H    . ALA A 1 16  ? -21.543 -12.287 -10.683 1.00 0.67  ? 16  ALA A H    2  
ATOM 5540   H HA   . ALA A 1 16  ? -18.881 -11.545 -9.508  1.00 0.61  ? 16  ALA A HA   2  
ATOM 5541   H HB1  . ALA A 1 16  ? -19.497 -12.851 -11.882 1.00 1.18  ? 16  ALA A HB1  2  
ATOM 5542   H HB2  . ALA A 1 16  ? -19.183 -11.200 -12.423 1.00 1.27  ? 16  ALA A HB2  2  
ATOM 5543   H HB3  . ALA A 1 16  ? -17.955 -12.077 -11.517 1.00 1.19  ? 16  ALA A HB3  2  
ATOM 5544   N N    . LEU A 1 17  ? -19.116 -9.087  -9.725  1.00 0.62  ? 17  LEU A N    2  
ATOM 5545   C CA   . LEU A 1 17  ? -19.286 -7.605  -9.808  1.00 0.66  ? 17  LEU A CA   2  
ATOM 5546   C C    . LEU A 1 17  ? -18.207 -7.080  -10.762 1.00 0.68  ? 17  LEU A C    2  
ATOM 5547   O O    . LEU A 1 17  ? -17.056 -7.457  -10.661 1.00 0.68  ? 17  LEU A O    2  
ATOM 5548   C CB   . LEU A 1 17  ? -19.100 -6.986  -8.415  1.00 0.64  ? 17  LEU A CB   2  
ATOM 5549   C CG   . LEU A 1 17  ? -19.279 -5.457  -8.475  1.00 0.73  ? 17  LEU A CG   2  
ATOM 5550   C CD1  . LEU A 1 17  ? -20.738 -5.104  -8.806  1.00 0.91  ? 17  LEU A CD1  2  
ATOM 5551   C CD2  . LEU A 1 17  ? -18.899 -4.852  -7.115  1.00 0.69  ? 17  LEU A CD2  2  
ATOM 5552   H H    . LEU A 1 17  ? -18.402 -9.463  -9.168  1.00 0.57  ? 17  LEU A H    2  
ATOM 5553   H HA   . LEU A 1 17  ? -20.266 -7.363  -10.194 1.00 0.69  ? 17  LEU A HA   2  
ATOM 5554   H HB2  . LEU A 1 17  ? -19.829 -7.408  -7.738  1.00 0.64  ? 17  LEU A HB2  2  
ATOM 5555   H HB3  . LEU A 1 17  ? -18.108 -7.214  -8.055  1.00 0.65  ? 17  LEU A HB3  2  
ATOM 5556   H HG   . LEU A 1 17  ? -18.633 -5.049  -9.238  1.00 0.87  ? 17  LEU A HG   2  
ATOM 5557   H HD11 . LEU A 1 17  ? -21.405 -5.794  -8.309  1.00 1.40  ? 17  LEU A HD11 2  
ATOM 5558   H HD12 . LEU A 1 17  ? -20.953 -4.097  -8.472  1.00 1.41  ? 17  LEU A HD12 2  
ATOM 5559   H HD13 . LEU A 1 17  ? -20.891 -5.161  -9.873  1.00 1.36  ? 17  LEU A HD13 2  
ATOM 5560   H HD21 . LEU A 1 17  ? -19.300 -5.464  -6.321  1.00 1.23  ? 17  LEU A HD21 2  
ATOM 5561   H HD22 . LEU A 1 17  ? -17.825 -4.810  -7.030  1.00 1.33  ? 17  LEU A HD22 2  
ATOM 5562   H HD23 . LEU A 1 17  ? -19.305 -3.853  -7.038  1.00 1.13  ? 17  LEU A HD23 2  
ATOM 5563   N N    . LEU A 1 18  ? -18.565 -6.228  -11.693 1.00 0.72  ? 18  LEU A N    2  
ATOM 5564   C CA   . LEU A 1 18  ? -17.558 -5.689  -12.668 1.00 0.76  ? 18  LEU A CA   2  
ATOM 5565   C C    . LEU A 1 18  ? -17.394 -4.181  -12.454 1.00 0.79  ? 18  LEU A C    2  
ATOM 5566   O O    . LEU A 1 18  ? -18.351 -3.432  -12.434 1.00 0.83  ? 18  LEU A O    2  
ATOM 5567   C CB   . LEU A 1 18  ? -18.049 -5.960  -14.095 1.00 0.80  ? 18  LEU A CB   2  
ATOM 5568   C CG   . LEU A 1 18  ? -17.005 -5.493  -15.123 1.00 0.85  ? 18  LEU A CG   2  
ATOM 5569   C CD1  . LEU A 1 18  ? -15.718 -6.331  -15.000 1.00 0.93  ? 18  LEU A CD1  2  
ATOM 5570   C CD2  . LEU A 1 18  ? -17.590 -5.653  -16.531 1.00 0.91  ? 18  LEU A CD2  2  
ATOM 5571   H H    . LEU A 1 18  ? -19.496 -5.940  -11.755 1.00 0.74  ? 18  LEU A H    2  
ATOM 5572   H HA   . LEU A 1 18  ? -16.603 -6.173  -12.521 1.00 0.74  ? 18  LEU A HA   2  
ATOM 5573   H HB2  . LEU A 1 18  ? -18.223 -7.019  -14.218 1.00 0.79  ? 18  LEU A HB2  2  
ATOM 5574   H HB3  . LEU A 1 18  ? -18.973 -5.426  -14.260 1.00 0.86  ? 18  LEU A HB3  2  
ATOM 5575   H HG   . LEU A 1 18  ? -16.770 -4.453  -14.951 1.00 0.91  ? 18  LEU A HG   2  
ATOM 5576   H HD11 . LEU A 1 18  ? -15.967 -7.349  -14.735 1.00 1.29  ? 18  LEU A HD11 2  
ATOM 5577   H HD12 . LEU A 1 18  ? -15.188 -6.327  -15.942 1.00 1.43  ? 18  LEU A HD12 2  
ATOM 5578   H HD13 . LEU A 1 18  ? -15.084 -5.906  -14.236 1.00 1.46  ? 18  LEU A HD13 2  
ATOM 5579   H HD21 . LEU A 1 18  ? -18.523 -5.113  -16.596 1.00 1.47  ? 18  LEU A HD21 2  
ATOM 5580   H HD22 . LEU A 1 18  ? -16.894 -5.260  -17.257 1.00 1.16  ? 18  LEU A HD22 2  
ATOM 5581   H HD23 . LEU A 1 18  ? -17.766 -6.700  -16.730 1.00 1.49  ? 18  LEU A HD23 2  
ATOM 5582   N N    . LEU A 1 19  ? -16.178 -3.738  -12.282 1.00 0.80  ? 19  LEU A N    2  
ATOM 5583   C CA   . LEU A 1 19  ? -15.932 -2.279  -12.053 1.00 0.85  ? 19  LEU A CA   2  
ATOM 5584   C C    . LEU A 1 19  ? -15.731 -1.557  -13.387 1.00 0.89  ? 19  LEU A C    2  
ATOM 5585   O O    . LEU A 1 19  ? -14.680 -1.620  -13.995 1.00 0.93  ? 19  LEU A O    2  
ATOM 5586   C CB   . LEU A 1 19  ? -14.686 -2.091  -11.185 1.00 0.88  ? 19  LEU A CB   2  
ATOM 5587   C CG   . LEU A 1 19  ? -14.846 -2.826  -9.844  1.00 0.87  ? 19  LEU A CG   2  
ATOM 5588   C CD1  . LEU A 1 19  ? -13.643 -2.504  -8.953  1.00 0.93  ? 19  LEU A CD1  2  
ATOM 5589   C CD2  . LEU A 1 19  ? -16.140 -2.387  -9.137  1.00 0.88  ? 19  LEU A CD2  2  
ATOM 5590   H H    . LEU A 1 19  ? -15.443 -4.386  -12.291 1.00 0.79  ? 19  LEU A H    2  
ATOM 5591   H HA   . LEU A 1 19  ? -16.785 -1.843  -11.555 1.00 0.87  ? 19  LEU A HA   2  
ATOM 5592   H HB2  . LEU A 1 19  ? -13.826 -2.485  -11.707 1.00 0.90  ? 19  LEU A HB2  2  
ATOM 5593   H HB3  . LEU A 1 19  ? -14.541 -1.038  -11.000 1.00 0.93  ? 19  LEU A HB3  2  
ATOM 5594   H HG   . LEU A 1 19  ? -14.878 -3.892  -10.025 1.00 0.85  ? 19  LEU A HG   2  
ATOM 5595   H HD11 . LEU A 1 19  ? -12.731 -2.660  -9.507  1.00 1.52  ? 19  LEU A HD11 2  
ATOM 5596   H HD12 . LEU A 1 19  ? -13.697 -1.473  -8.635  1.00 1.30  ? 19  LEU A HD12 2  
ATOM 5597   H HD13 . LEU A 1 19  ? -13.653 -3.148  -8.087  1.00 1.33  ? 19  LEU A HD13 2  
ATOM 5598   H HD21 . LEU A 1 19  ? -16.304 -1.331  -9.302  1.00 1.31  ? 19  LEU A HD21 2  
ATOM 5599   H HD22 . LEU A 1 19  ? -16.974 -2.946  -9.534  1.00 1.38  ? 19  LEU A HD22 2  
ATOM 5600   H HD23 . LEU A 1 19  ? -16.060 -2.577  -8.077  1.00 1.27  ? 19  LEU A HD23 2  
ATOM 5601   N N    . LYS A 1 20  ? -16.747 -0.870  -13.840 1.00 0.94  ? 20  LYS A N    2  
ATOM 5602   C CA   . LYS A 1 20  ? -16.662 -0.124  -15.134 1.00 1.01  ? 20  LYS A CA   2  
ATOM 5603   C C    . LYS A 1 20  ? -16.476 1.368   -14.842 1.00 1.05  ? 20  LYS A C    2  
ATOM 5604   O O    . LYS A 1 20  ? -17.189 1.939   -14.041 1.00 1.29  ? 20  LYS A O    2  
ATOM 5605   C CB   . LYS A 1 20  ? -17.975 -0.319  -15.897 1.00 1.15  ? 20  LYS A CB   2  
ATOM 5606   C CG   . LYS A 1 20  ? -18.178 -1.808  -16.210 1.00 1.32  ? 20  LYS A CG   2  
ATOM 5607   C CD   . LYS A 1 20  ? -19.658 -2.081  -16.494 1.00 1.42  ? 20  LYS A CD   2  
ATOM 5608   C CE   . LYS A 1 20  ? -20.107 -1.290  -17.724 1.00 2.11  ? 20  LYS A CE   2  
ATOM 5609   N NZ   . LYS A 1 20  ? -21.471 -1.735  -18.128 1.00 2.75  ? 20  LYS A NZ   2  
ATOM 5610   H H    . LYS A 1 20  ? -17.581 -0.853  -13.329 1.00 0.97  ? 20  LYS A H    2  
ATOM 5611   H HA   . LYS A 1 20  ? -15.836 -0.490  -15.727 1.00 1.01  ? 20  LYS A HA   2  
ATOM 5612   H HB2  . LYS A 1 20  ? -18.795 0.040   -15.291 1.00 1.24  ? 20  LYS A HB2  2  
ATOM 5613   H HB3  . LYS A 1 20  ? -17.938 0.239   -16.820 1.00 1.19  ? 20  LYS A HB3  2  
ATOM 5614   H HG2  . LYS A 1 20  ? -17.591 -2.074  -17.077 1.00 1.50  ? 20  LYS A HG2  2  
ATOM 5615   H HG3  . LYS A 1 20  ? -17.861 -2.404  -15.366 1.00 1.50  ? 20  LYS A HG3  2  
ATOM 5616   H HD2  . LYS A 1 20  ? -19.801 -3.137  -16.673 1.00 1.54  ? 20  LYS A HD2  2  
ATOM 5617   H HD3  . LYS A 1 20  ? -20.248 -1.780  -15.640 1.00 1.71  ? 20  LYS A HD3  2  
ATOM 5618   H HE2  . LYS A 1 20  ? -20.130 -0.237  -17.486 1.00 2.58  ? 20  LYS A HE2  2  
ATOM 5619   H HE3  . LYS A 1 20  ? -19.417 -1.461  -18.535 1.00 2.50  ? 20  LYS A HE3  2  
ATOM 5620   H HZ1  . LYS A 1 20  ? -21.990 -2.067  -17.290 1.00 3.07  ? 20  LYS A HZ1  2  
ATOM 5621   H HZ2  . LYS A 1 20  ? -21.982 -0.939  -18.561 1.00 3.13  ? 20  LYS A HZ2  2  
ATOM 5622   H HZ3  . LYS A 1 20  ? -21.394 -2.513  -18.814 1.00 3.17  ? 20  LYS A HZ3  2  
ATOM 5623   N N    . GLU A 1 21  ? -15.530 2.006   -15.489 1.00 0.94  ? 21  GLU A N    2  
ATOM 5624   C CA   . GLU A 1 21  ? -15.299 3.471   -15.260 1.00 1.02  ? 21  GLU A CA   2  
ATOM 5625   C C    . GLU A 1 21  ? -15.229 4.192   -16.610 1.00 0.91  ? 21  GLU A C    2  
ATOM 5626   O O    . GLU A 1 21  ? -14.562 3.750   -17.524 1.00 1.04  ? 21  GLU A O    2  
ATOM 5627   C CB   . GLU A 1 21  ? -13.976 3.665   -14.516 1.00 1.24  ? 21  GLU A CB   2  
ATOM 5628   C CG   . GLU A 1 21  ? -14.107 3.126   -13.090 1.00 1.72  ? 21  GLU A CG   2  
ATOM 5629   C CD   . GLU A 1 21  ? -12.784 3.320   -12.347 1.00 2.36  ? 21  GLU A CD   2  
ATOM 5630   O OE1  . GLU A 1 21  ? -11.813 3.685   -12.991 1.00 2.83  ? 21  GLU A OE1  2  
ATOM 5631   O OE2  . GLU A 1 21  ? -12.762 3.097   -11.148 1.00 3.00  ? 21  GLU A OE2  2  
ATOM 5632   H H    . GLU A 1 21  ? -14.973 1.527   -16.138 1.00 0.92  ? 21  GLU A H    2  
ATOM 5633   H HA   . GLU A 1 21  ? -16.107 3.890   -14.670 1.00 1.20  ? 21  GLU A HA   2  
ATOM 5634   H HB2  . GLU A 1 21  ? -13.192 3.130   -15.033 1.00 1.75  ? 21  GLU A HB2  2  
ATOM 5635   H HB3  . GLU A 1 21  ? -13.732 4.715   -14.481 1.00 1.63  ? 21  GLU A HB3  2  
ATOM 5636   H HG2  . GLU A 1 21  ? -14.892 3.661   -12.575 1.00 2.17  ? 21  GLU A HG2  2  
ATOM 5637   H HG3  . GLU A 1 21  ? -14.348 2.075   -13.123 1.00 2.19  ? 21  GLU A HG3  2  
ATOM 5638   N N    . ASP A 1 22  ? -15.907 5.300   -16.745 1.00 0.93  ? 22  ASP A N    2  
ATOM 5639   C CA   . ASP A 1 22  ? -15.867 6.042   -18.039 1.00 0.97  ? 22  ASP A CA   2  
ATOM 5640   C C    . ASP A 1 22  ? -14.509 6.735   -18.190 1.00 0.73  ? 22  ASP A C    2  
ATOM 5641   O O    . ASP A 1 22  ? -13.853 7.052   -17.217 1.00 0.75  ? 22  ASP A O    2  
ATOM 5642   C CB   . ASP A 1 22  ? -16.983 7.088   -18.072 1.00 1.33  ? 22  ASP A CB   2  
ATOM 5643   C CG   . ASP A 1 22  ? -18.336 6.385   -18.181 1.00 2.11  ? 22  ASP A CG   2  
ATOM 5644   O OD1  . ASP A 1 22  ? -18.348 5.214   -18.523 1.00 2.77  ? 22  ASP A OD1  2  
ATOM 5645   O OD2  . ASP A 1 22  ? -19.340 7.029   -17.923 1.00 2.76  ? 22  ASP A OD2  2  
ATOM 5646   H H    . ASP A 1 22  ? -16.436 5.643   -15.994 1.00 1.07  ? 22  ASP A H    2  
ATOM 5647   H HA   . ASP A 1 22  ? -16.003 5.346   -18.854 1.00 1.16  ? 22  ASP A HA   2  
ATOM 5648   H HB2  . ASP A 1 22  ? -16.953 7.677   -17.167 1.00 1.70  ? 22  ASP A HB2  2  
ATOM 5649   H HB3  . ASP A 1 22  ? -16.846 7.733   -18.927 1.00 1.69  ? 22  ASP A HB3  2  
ATOM 5650   N N    . GLU A 1 23  ? -14.081 6.969   -19.400 1.00 0.86  ? 23  GLU A N    2  
ATOM 5651   C CA   . GLU A 1 23  ? -12.765 7.636   -19.615 1.00 0.99  ? 23  GLU A CA   2  
ATOM 5652   C C    . GLU A 1 23  ? -12.834 9.084   -19.130 1.00 0.91  ? 23  GLU A C    2  
ATOM 5653   O O    . GLU A 1 23  ? -13.837 9.754   -19.277 1.00 0.99  ? 23  GLU A O    2  
ATOM 5654   C CB   . GLU A 1 23  ? -12.415 7.615   -21.103 1.00 1.41  ? 23  GLU A CB   2  
ATOM 5655   C CG   . GLU A 1 23  ? -11.055 8.285   -21.326 1.00 1.68  ? 23  GLU A CG   2  
ATOM 5656   C CD   . GLU A 1 23  ? -10.651 8.147   -22.795 1.00 2.36  ? 23  GLU A CD   2  
ATOM 5657   O OE1  . GLU A 1 23  ? -11.327 7.424   -23.508 1.00 2.91  ? 23  GLU A OE1  2  
ATOM 5658   O OE2  . GLU A 1 23  ? -9.672  8.764   -23.179 1.00 2.94  ? 23  GLU A OE2  2  
ATOM 5659   H H    . GLU A 1 23  ? -14.626 6.703   -20.171 1.00 1.07  ? 23  GLU A H    2  
ATOM 5660   H HA   . GLU A 1 23  ? -12.001 7.109   -19.060 1.00 1.03  ? 23  GLU A HA   2  
ATOM 5661   H HB2  . GLU A 1 23  ? -12.374 6.593   -21.448 1.00 1.51  ? 23  GLU A HB2  2  
ATOM 5662   H HB3  . GLU A 1 23  ? -13.170 8.153   -21.656 1.00 1.54  ? 23  GLU A HB3  2  
ATOM 5663   H HG2  . GLU A 1 23  ? -11.122 9.331   -21.069 1.00 1.87  ? 23  GLU A HG2  2  
ATOM 5664   H HG3  . GLU A 1 23  ? -10.312 7.808   -20.703 1.00 1.89  ? 23  GLU A HG3  2  
ATOM 5665   N N    . ILE A 1 24  ? -11.769 9.575   -18.555 1.00 0.83  ? 24  ILE A N    2  
ATOM 5666   C CA   . ILE A 1 24  ? -11.762 10.982  -18.062 1.00 0.81  ? 24  ILE A CA   2  
ATOM 5667   C C    . ILE A 1 24  ? -11.439 11.924  -19.223 1.00 0.90  ? 24  ILE A C    2  
ATOM 5668   O O    . ILE A 1 24  ? -10.479 11.733  -19.941 1.00 0.95  ? 24  ILE A O    2  
ATOM 5669   C CB   . ILE A 1 24  ? -10.705 11.128  -16.966 1.00 0.77  ? 24  ILE A CB   2  
ATOM 5670   C CG1  . ILE A 1 24  ? -11.051 10.189  -15.808 1.00 0.73  ? 24  ILE A CG1  2  
ATOM 5671   C CG2  . ILE A 1 24  ? -10.687 12.572  -16.467 1.00 0.86  ? 24  ILE A CG2  2  
ATOM 5672   C CD1  . ILE A 1 24  ? -9.885  10.134  -14.819 1.00 0.80  ? 24  ILE A CD1  2  
ATOM 5673   H H    . ILE A 1 24  ? -10.969 9.019   -18.451 1.00 0.85  ? 24  ILE A H    2  
ATOM 5674   H HA   . ILE A 1 24  ? -12.734 11.228  -17.658 1.00 0.84  ? 24  ILE A HA   2  
ATOM 5675   H HB   . ILE A 1 24  ? -9.733  10.874  -17.364 1.00 0.81  ? 24  ILE A HB   2  
ATOM 5676   H HG12 . ILE A 1 24  ? -11.934 10.552  -15.302 1.00 0.75  ? 24  ILE A HG12 2  
ATOM 5677   H HG13 . ILE A 1 24  ? -11.240 9.198   -16.192 1.00 0.71  ? 24  ILE A HG13 2  
ATOM 5678   H HG21 . ILE A 1 24  ? -11.698 12.898  -16.282 1.00 1.23  ? 24  ILE A HG21 2  
ATOM 5679   H HG22 . ILE A 1 24  ? -10.117 12.629  -15.552 1.00 1.35  ? 24  ILE A HG22 2  
ATOM 5680   H HG23 . ILE A 1 24  ? -10.234 13.206  -17.215 1.00 1.46  ? 24  ILE A HG23 2  
ATOM 5681   H HD11 . ILE A 1 24  ? -8.966  9.954   -15.355 1.00 1.33  ? 24  ILE A HD11 2  
ATOM 5682   H HD12 . ILE A 1 24  ? -9.817  11.073  -14.291 1.00 1.33  ? 24  ILE A HD12 2  
ATOM 5683   H HD13 . ILE A 1 24  ? -10.051 9.335   -14.111 1.00 1.20  ? 24  ILE A HD13 2  
ATOM 5684   N N    . VAL A 1 25  ? -12.251 12.929  -19.429 1.00 0.95  ? 25  VAL A N    2  
ATOM 5685   C CA   . VAL A 1 25  ? -12.012 13.875  -20.562 1.00 1.06  ? 25  VAL A CA   2  
ATOM 5686   C C    . VAL A 1 25  ? -11.198 15.085  -20.093 1.00 1.02  ? 25  VAL A C    2  
ATOM 5687   O O    . VAL A 1 25  ? -11.504 15.708  -19.095 1.00 1.02  ? 25  VAL A O    2  
ATOM 5688   C CB   . VAL A 1 25  ? -13.358 14.360  -21.102 1.00 1.18  ? 25  VAL A CB   2  
ATOM 5689   C CG1  . VAL A 1 25  ? -13.130 15.210  -22.352 1.00 1.28  ? 25  VAL A CG1  2  
ATOM 5690   C CG2  . VAL A 1 25  ? -14.230 13.153  -21.458 1.00 1.27  ? 25  VAL A CG2  2  
ATOM 5691   H H    . VAL A 1 25  ? -13.034 13.050  -18.851 1.00 0.94  ? 25  VAL A H    2  
ATOM 5692   H HA   . VAL A 1 25  ? -11.476 13.369  -21.352 1.00 1.10  ? 25  VAL A HA   2  
ATOM 5693   H HB   . VAL A 1 25  ? -13.854 14.955  -20.349 1.00 1.19  ? 25  VAL A HB   2  
ATOM 5694   H HG11 . VAL A 1 25  ? -12.466 14.690  -23.027 1.00 1.70  ? 25  VAL A HG11 2  
ATOM 5695   H HG12 . VAL A 1 25  ? -14.074 15.391  -22.844 1.00 1.57  ? 25  VAL A HG12 2  
ATOM 5696   H HG13 . VAL A 1 25  ? -12.685 16.154  -22.069 1.00 1.67  ? 25  VAL A HG13 2  
ATOM 5697   H HG21 . VAL A 1 25  ? -13.684 12.495  -22.118 1.00 1.58  ? 25  VAL A HG21 2  
ATOM 5698   H HG22 . VAL A 1 25  ? -14.491 12.620  -20.556 1.00 1.64  ? 25  VAL A HG22 2  
ATOM 5699   H HG23 . VAL A 1 25  ? -15.129 13.492  -21.950 1.00 1.69  ? 25  VAL A HG23 2  
ATOM 5700   N N    . ILE A 1 26  ? -10.167 15.422  -20.825 1.00 1.03  ? 26  ILE A N    2  
ATOM 5701   C CA   . ILE A 1 26  ? -9.309  16.597  -20.470 1.00 1.01  ? 26  ILE A CA   2  
ATOM 5702   C C    . ILE A 1 26  ? -9.576  17.724  -21.469 1.00 1.09  ? 26  ILE A C    2  
ATOM 5703   O O    . ILE A 1 26  ? -9.622  17.504  -22.664 1.00 1.21  ? 26  ILE A O    2  
ATOM 5704   C CB   . ILE A 1 26  ? -7.833  16.198  -20.542 1.00 1.01  ? 26  ILE A CB   2  
ATOM 5705   C CG1  . ILE A 1 26  ? -7.568  15.057  -19.555 1.00 0.97  ? 26  ILE A CG1  2  
ATOM 5706   C CG2  . ILE A 1 26  ? -6.957  17.402  -20.182 1.00 1.01  ? 26  ILE A CG2  2  
ATOM 5707   C CD1  . ILE A 1 26  ? -6.162  14.495  -19.778 1.00 1.00  ? 26  ILE A CD1  2  
ATOM 5708   H H    . ILE A 1 26  ? -9.958  14.897  -21.626 1.00 1.06  ? 26  ILE A H    2  
ATOM 5709   H HA   . ILE A 1 26  ? -9.540  16.939  -19.470 1.00 0.97  ? 26  ILE A HA   2  
ATOM 5710   H HB   . ILE A 1 26  ? -7.602  15.873  -21.545 1.00 1.08  ? 26  ILE A HB   2  
ATOM 5711   H HG12 . ILE A 1 26  ? -7.650  15.430  -18.545 1.00 0.94  ? 26  ILE A HG12 2  
ATOM 5712   H HG13 . ILE A 1 26  ? -8.294  14.274  -19.710 1.00 1.04  ? 26  ILE A HG13 2  
ATOM 5713   H HG21 . ILE A 1 26  ? -7.292  17.825  -19.248 1.00 1.50  ? 26  ILE A HG21 2  
ATOM 5714   H HG22 . ILE A 1 26  ? -5.930  17.083  -20.087 1.00 1.30  ? 26  ILE A HG22 2  
ATOM 5715   H HG23 . ILE A 1 26  ? -7.032  18.145  -20.962 1.00 1.49  ? 26  ILE A HG23 2  
ATOM 5716   H HD11 . ILE A 1 26  ? -5.982  14.371  -20.835 1.00 1.54  ? 26  ILE A HD11 2  
ATOM 5717   H HD12 . ILE A 1 26  ? -5.433  15.178  -19.367 1.00 1.37  ? 26  ILE A HD12 2  
ATOM 5718   H HD13 . ILE A 1 26  ? -6.075  13.539  -19.285 1.00 1.39  ? 26  ILE A HD13 2  
ATOM 5719   N N    . ASP A 1 27  ? -9.761  18.929  -20.998 1.00 1.05  ? 27  ASP A N    2  
ATOM 5720   C CA   . ASP A 1 27  ? -10.031 20.066  -21.930 1.00 1.14  ? 27  ASP A CA   2  
ATOM 5721   C C    . ASP A 1 27  ? -8.709  20.743  -22.299 1.00 1.08  ? 27  ASP A C    2  
ATOM 5722   O O    . ASP A 1 27  ? -8.003  21.248  -21.450 1.00 0.99  ? 27  ASP A O    2  
ATOM 5723   C CB   . ASP A 1 27  ? -10.942 21.078  -21.233 1.00 1.17  ? 27  ASP A CB   2  
ATOM 5724   C CG   . ASP A 1 27  ? -12.343 20.483  -21.074 1.00 1.34  ? 27  ASP A CG   2  
ATOM 5725   O OD1  . ASP A 1 27  ? -12.655 19.552  -21.797 1.00 1.81  ? 27  ASP A OD1  2  
ATOM 5726   O OD2  . ASP A 1 27  ? -13.076 20.965  -20.227 1.00 1.76  ? 27  ASP A OD2  2  
ATOM 5727   H H    . ASP A 1 27  ? -9.718  19.094  -20.033 1.00 0.98  ? 27  ASP A H    2  
ATOM 5728   H HA   . ASP A 1 27  ? -10.515 19.702  -22.826 1.00 1.26  ? 27  ASP A HA   2  
ATOM 5729   H HB2  . ASP A 1 27  ? -10.538 21.315  -20.259 1.00 1.06  ? 27  ASP A HB2  2  
ATOM 5730   H HB3  . ASP A 1 27  ? -11.001 21.977  -21.827 1.00 1.26  ? 27  ASP A HB3  2  
ATOM 5731   N N    . ARG A 1 28  ? -8.368  20.755  -23.561 1.00 1.17  ? 28  ARG A N    2  
ATOM 5732   C CA   . ARG A 1 28  ? -7.088  21.398  -23.987 1.00 1.16  ? 28  ARG A CA   2  
ATOM 5733   C C    . ARG A 1 28  ? -7.342  22.867  -24.323 1.00 1.16  ? 28  ARG A C    2  
ATOM 5734   O O    . ARG A 1 28  ? -6.433  23.604  -24.650 1.00 1.22  ? 28  ARG A O    2  
ATOM 5735   C CB   . ARG A 1 28  ? -6.551  20.687  -25.232 1.00 1.29  ? 28  ARG A CB   2  
ATOM 5736   C CG   . ARG A 1 28  ? -6.433  19.180  -24.971 1.00 1.32  ? 28  ARG A CG   2  
ATOM 5737   C CD   . ARG A 1 28  ? -5.411  18.914  -23.863 1.00 1.27  ? 28  ARG A CD   2  
ATOM 5738   N NE   . ARG A 1 28  ? -5.003  17.482  -23.898 1.00 1.77  ? 28  ARG A NE   2  
ATOM 5739   C CZ   . ARG A 1 28  ? -3.935  17.095  -23.258 1.00 2.03  ? 28  ARG A CZ   2  
ATOM 5740   N NH1  . ARG A 1 28  ? -3.223  17.965  -22.595 1.00 2.23  ? 28  ARG A NH1  2  
ATOM 5741   N NH2  . ARG A 1 28  ? -3.578  15.840  -23.281 1.00 2.80  ? 28  ARG A NH2  2  
ATOM 5742   H H    . ARG A 1 28  ? -8.952  20.340  -24.229 1.00 1.26  ? 28  ARG A H    2  
ATOM 5743   H HA   . ARG A 1 28  ? -6.360  21.337  -23.192 1.00 1.08  ? 28  ARG A HA   2  
ATOM 5744   H HB2  . ARG A 1 28  ? -7.226  20.855  -26.058 1.00 1.38  ? 28  ARG A HB2  2  
ATOM 5745   H HB3  . ARG A 1 28  ? -5.577  21.083  -25.478 1.00 1.31  ? 28  ARG A HB3  2  
ATOM 5746   H HG2  . ARG A 1 28  ? -7.396  18.793  -24.671 1.00 1.31  ? 28  ARG A HG2  2  
ATOM 5747   H HG3  . ARG A 1 28  ? -6.115  18.686  -25.875 1.00 1.44  ? 28  ARG A HG3  2  
ATOM 5748   H HD2  . ARG A 1 28  ? -4.544  19.542  -24.009 1.00 1.39  ? 28  ARG A HD2  2  
ATOM 5749   H HD3  . ARG A 1 28  ? -5.854  19.130  -22.902 1.00 1.48  ? 28  ARG A HD3  2  
ATOM 5750   H HE   . ARG A 1 28  ? -5.538  16.832  -24.400 1.00 2.44  ? 28  ARG A HE   2  
ATOM 5751   H HH11 . ARG A 1 28  ? -3.496  18.927  -22.579 1.00 2.10  ? 28  ARG A HH11 2  
ATOM 5752   H HH12 . ARG A 1 28  ? -2.404  17.670  -22.103 1.00 2.94  ? 28  ARG A HH12 2  
ATOM 5753   H HH21 . ARG A 1 28  ? -4.122  15.174  -23.790 1.00 3.22  ? 28  ARG A HH21 2  
ATOM 5754   H HH22 . ARG A 1 28  ? -2.759  15.546  -22.789 1.00 3.23  ? 28  ARG A HH22 2  
ATOM 5755   N N    . LYS A 1 29  ? -8.568  23.302  -24.245 1.00 1.14  ? 29  LYS A N    2  
ATOM 5756   C CA   . LYS A 1 29  ? -8.867  24.724  -24.560 1.00 1.17  ? 29  LYS A CA   2  
ATOM 5757   C C    . LYS A 1 29  ? -8.272  25.617  -23.470 1.00 1.03  ? 29  LYS A C    2  
ATOM 5758   O O    . LYS A 1 29  ? -8.324  25.301  -22.299 1.00 0.96  ? 29  LYS A O    2  
ATOM 5759   C CB   . LYS A 1 29  ? -10.382 24.919  -24.626 1.00 1.27  ? 29  LYS A CB   2  
ATOM 5760   C CG   . LYS A 1 29  ? -10.922 24.212  -25.873 1.00 1.43  ? 29  LYS A CG   2  
ATOM 5761   C CD   . LYS A 1 29  ? -12.443 24.398  -25.971 1.00 1.57  ? 29  LYS A CD   2  
ATOM 5762   C CE   . LYS A 1 29  ? -13.163 23.495  -24.962 1.00 2.19  ? 29  LYS A CE   2  
ATOM 5763   N NZ   . LYS A 1 29  ? -14.607 23.409  -25.324 1.00 2.87  ? 29  LYS A NZ   2  
ATOM 5764   H H    . LYS A 1 29  ? -9.289  22.694  -23.978 1.00 1.12  ? 29  LYS A H    2  
ATOM 5765   H HA   . LYS A 1 29  ? -8.429  24.980  -25.514 1.00 1.27  ? 29  LYS A HA   2  
ATOM 5766   H HB2  . LYS A 1 29  ? -10.834 24.497  -23.740 1.00 1.23  ? 29  LYS A HB2  2  
ATOM 5767   H HB3  . LYS A 1 29  ? -10.609 25.973  -24.681 1.00 1.31  ? 29  LYS A HB3  2  
ATOM 5768   H HG2  . LYS A 1 29  ? -10.454 24.635  -26.750 1.00 1.49  ? 29  LYS A HG2  2  
ATOM 5769   H HG3  . LYS A 1 29  ? -10.689 23.160  -25.818 1.00 1.46  ? 29  LYS A HG3  2  
ATOM 5770   H HD2  . LYS A 1 29  ? -12.690 25.430  -25.767 1.00 1.95  ? 29  LYS A HD2  2  
ATOM 5771   H HD3  . LYS A 1 29  ? -12.768 24.145  -26.969 1.00 1.63  ? 29  LYS A HD3  2  
ATOM 5772   H HE2  . LYS A 1 29  ? -12.730 22.506  -24.981 1.00 2.56  ? 29  LYS A HE2  2  
ATOM 5773   H HE3  . LYS A 1 29  ? -13.069 23.911  -23.971 1.00 2.66  ? 29  LYS A HE3  2  
ATOM 5774   H HZ1  . LYS A 1 29  ? -14.726 23.638  -26.331 1.00 3.27  ? 29  LYS A HZ1  2  
ATOM 5775   H HZ2  . LYS A 1 29  ? -14.952 22.443  -25.143 1.00 3.20  ? 29  LYS A HZ2  2  
ATOM 5776   H HZ3  . LYS A 1 29  ? -15.149 24.085  -24.751 1.00 3.29  ? 29  LYS A HZ3  2  
ATOM 5777   N N    . LYS A 1 30  ? -7.704  26.732  -23.845 1.00 1.01  ? 30  LYS A N    2  
ATOM 5778   C CA   . LYS A 1 30  ? -7.104  27.646  -22.832 1.00 0.90  ? 30  LYS A CA   2  
ATOM 5779   C C    . LYS A 1 30  ? -8.191  28.575  -22.292 1.00 0.88  ? 30  LYS A C    2  
ATOM 5780   O O    . LYS A 1 30  ? -9.164  28.858  -22.963 1.00 0.95  ? 30  LYS A O    2  
ATOM 5781   C CB   . LYS A 1 30  ? -6.004  28.484  -23.493 1.00 0.92  ? 30  LYS A CB   2  
ATOM 5782   C CG   . LYS A 1 30  ? -4.917  27.569  -24.077 1.00 1.02  ? 30  LYS A CG   2  
ATOM 5783   C CD   . LYS A 1 30  ? -4.013  27.023  -22.963 1.00 1.43  ? 30  LYS A CD   2  
ATOM 5784   C CE   . LYS A 1 30  ? -2.813  26.312  -23.591 1.00 1.84  ? 30  LYS A CE   2  
ATOM 5785   N NZ   . LYS A 1 30  ? -2.029  27.283  -24.406 1.00 2.35  ? 30  LYS A NZ   2  
ATOM 5786   H H    . LYS A 1 30  ? -7.672  26.975  -24.795 1.00 1.08  ? 30  LYS A H    2  
ATOM 5787   H HA   . LYS A 1 30  ? -6.689  27.072  -22.019 1.00 0.85  ? 30  LYS A HA   2  
ATOM 5788   H HB2  . LYS A 1 30  ? -6.436  29.078  -24.285 1.00 0.99  ? 30  LYS A HB2  2  
ATOM 5789   H HB3  . LYS A 1 30  ? -5.561  29.139  -22.757 1.00 0.86  ? 30  LYS A HB3  2  
ATOM 5790   H HG2  . LYS A 1 30  ? -5.387  26.742  -24.590 1.00 1.22  ? 30  LYS A HG2  2  
ATOM 5791   H HG3  . LYS A 1 30  ? -4.319  28.129  -24.779 1.00 1.37  ? 30  LYS A HG3  2  
ATOM 5792   H HD2  . LYS A 1 30  ? -3.666  27.840  -22.346 1.00 1.90  ? 30  LYS A HD2  2  
ATOM 5793   H HD3  . LYS A 1 30  ? -4.561  26.321  -22.358 1.00 2.00  ? 30  LYS A HD3  2  
ATOM 5794   H HE2  . LYS A 1 30  ? -2.185  25.908  -22.811 1.00 2.34  ? 30  LYS A HE2  2  
ATOM 5795   H HE3  . LYS A 1 30  ? -3.161  25.510  -24.224 1.00 2.30  ? 30  LYS A HE3  2  
ATOM 5796   H HZ1  . LYS A 1 30  ? -2.095  28.228  -23.979 1.00 2.72  ? 30  LYS A HZ1  2  
ATOM 5797   H HZ2  . LYS A 1 30  ? -1.034  26.987  -24.437 1.00 2.80  ? 30  LYS A HZ2  2  
ATOM 5798   H HZ3  . LYS A 1 30  ? -2.414  27.312  -25.374 1.00 2.66  ? 30  LYS A HZ3  2  
ATOM 5799   N N    . ILE A 1 31  ? -8.035  29.058  -21.086 1.00 0.84  ? 31  ILE A N    2  
ATOM 5800   C CA   . ILE A 1 31  ? -9.059  29.978  -20.505 1.00 0.88  ? 31  ILE A CA   2  
ATOM 5801   C C    . ILE A 1 31  ? -8.600  31.433  -20.669 1.00 0.85  ? 31  ILE A C    2  
ATOM 5802   O O    . ILE A 1 31  ? -7.450  31.702  -20.954 1.00 0.78  ? 31  ILE A O    2  
ATOM 5803   C CB   . ILE A 1 31  ? -9.235  29.681  -19.016 1.00 0.87  ? 31  ILE A CB   2  
ATOM 5804   C CG1  . ILE A 1 31  ? -7.850  29.504  -18.343 1.00 0.75  ? 31  ILE A CG1  2  
ATOM 5805   C CG2  . ILE A 1 31  ? -10.082 28.414  -18.843 1.00 0.97  ? 31  ILE A CG2  2  
ATOM 5806   C CD1  . ILE A 1 31  ? -7.893  29.978  -16.876 1.00 0.79  ? 31  ILE A CD1  2  
ATOM 5807   H H    . ILE A 1 31  ? -7.234  28.827  -20.563 1.00 0.82  ? 31  ILE A H    2  
ATOM 5808   H HA   . ILE A 1 31  ? -10.007 29.845  -21.011 1.00 0.98  ? 31  ILE A HA   2  
ATOM 5809   H HB   . ILE A 1 31  ? -9.749  30.499  -18.564 1.00 0.92  ? 31  ILE A HB   2  
ATOM 5810   H HG12 . ILE A 1 31  ? -7.561  28.462  -18.370 1.00 0.74  ? 31  ILE A HG12 2  
ATOM 5811   H HG13 . ILE A 1 31  ? -7.112  30.088  -18.874 1.00 0.70  ? 31  ILE A HG13 2  
ATOM 5812   H HG21 . ILE A 1 31  ? -11.030 28.549  -19.344 1.00 1.43  ? 31  ILE A HG21 2  
ATOM 5813   H HG22 . ILE A 1 31  ? -9.564  27.571  -19.271 1.00 1.39  ? 31  ILE A HG22 2  
ATOM 5814   H HG23 . ILE A 1 31  ? -10.256 28.238  -17.794 1.00 1.43  ? 31  ILE A HG23 2  
ATOM 5815   H HD11 . ILE A 1 31  ? -8.910  29.987  -16.507 1.00 1.33  ? 31  ILE A HD11 2  
ATOM 5816   H HD12 . ILE A 1 31  ? -7.295  29.316  -16.268 1.00 1.34  ? 31  ILE A HD12 2  
ATOM 5817   H HD13 . ILE A 1 31  ? -7.490  30.977  -16.821 1.00 1.20  ? 31  ILE A HD13 2  
ATOM 5818   N N    . SER A 1 32  ? -9.490  32.374  -20.470 1.00 0.93  ? 32  SER A N    2  
ATOM 5819   C CA   . SER A 1 32  ? -9.112  33.815  -20.589 1.00 0.94  ? 32  SER A CA   2  
ATOM 5820   C C    . SER A 1 32  ? -8.645  34.324  -19.221 1.00 0.95  ? 32  SER A C    2  
ATOM 5821   O O    . SER A 1 32  ? -8.758  33.637  -18.224 1.00 0.99  ? 32  SER A O    2  
ATOM 5822   C CB   . SER A 1 32  ? -10.326 34.624  -21.047 1.00 1.06  ? 32  SER A CB   2  
ATOM 5823   O OG   . SER A 1 32  ? -11.284 34.669  -19.998 1.00 1.17  ? 32  SER A OG   2  
ATOM 5824   H H    . SER A 1 32  ? -10.407 32.142  -20.217 1.00 1.00  ? 32  SER A H    2  
ATOM 5825   H HA   . SER A 1 32  ? -8.311  33.925  -21.308 1.00 0.89  ? 32  SER A HA   2  
ATOM 5826   H HB2  . SER A 1 32  ? -10.020 35.628  -21.292 1.00 1.11  ? 32  SER A HB2  2  
ATOM 5827   H HB3  . SER A 1 32  ? -10.757 34.159  -21.923 1.00 1.08  ? 32  SER A HB3  2  
ATOM 5828   H HG   . SER A 1 32  ? -11.774 35.491  -20.078 1.00 1.54  ? 32  SER A HG   2  
ATOM 5829   N N    . ALA A 1 33  ? -8.116  35.517  -19.161 1.00 0.96  ? 33  ALA A N    2  
ATOM 5830   C CA   . ALA A 1 33  ? -7.639  36.055  -17.852 1.00 1.01  ? 33  ALA A CA   2  
ATOM 5831   C C    . ALA A 1 33  ? -8.818  36.305  -16.911 1.00 1.11  ? 33  ALA A C    2  
ATOM 5832   O O    . ALA A 1 33  ? -8.647  36.422  -15.714 1.00 1.18  ? 33  ALA A O    2  
ATOM 5833   C CB   . ALA A 1 33  ? -6.888  37.365  -18.065 1.00 1.06  ? 33  ALA A CB   2  
ATOM 5834   H H    . ALA A 1 33  ? -8.028  36.055  -19.976 1.00 0.96  ? 33  ALA A H    2  
ATOM 5835   H HA   . ALA A 1 33  ? -6.971  35.340  -17.402 1.00 0.96  ? 33  ALA A HA   2  
ATOM 5836   H HB1  . ALA A 1 33  ? -6.170  37.246  -18.861 1.00 1.35  ? 33  ALA A HB1  2  
ATOM 5837   H HB2  . ALA A 1 33  ? -7.590  38.144  -18.321 1.00 1.46  ? 33  ALA A HB2  2  
ATOM 5838   H HB3  . ALA A 1 33  ? -6.374  37.628  -17.152 1.00 1.60  ? 33  ALA A HB3  2  
ATOM 5839   N N    . ASP A 1 34  ? -10.018 36.365  -17.426 1.00 1.18  ? 34  ASP A N    2  
ATOM 5840   C CA   . ASP A 1 34  ? -11.198 36.580  -16.537 1.00 1.31  ? 34  ASP A CA   2  
ATOM 5841   C C    . ASP A 1 34  ? -11.658 35.217  -16.025 1.00 1.26  ? 34  ASP A C    2  
ATOM 5842   O O    . ASP A 1 34  ? -12.234 35.091  -14.963 1.00 1.36  ? 34  ASP A O    2  
ATOM 5843   C CB   . ASP A 1 34  ? -12.330 37.237  -17.334 1.00 1.44  ? 34  ASP A CB   2  
ATOM 5844   C CG   . ASP A 1 34  ? -13.475 37.602  -16.388 1.00 1.90  ? 34  ASP A CG   2  
ATOM 5845   O OD1  . ASP A 1 34  ? -13.454 37.144  -15.259 1.00 2.39  ? 34  ASP A OD1  2  
ATOM 5846   O OD2  . ASP A 1 34  ? -14.357 38.331  -16.812 1.00 2.56  ? 34  ASP A OD2  2  
ATOM 5847   H H    . ASP A 1 34  ? -10.155 36.231  -18.387 1.00 1.17  ? 34  ASP A H    2  
ATOM 5848   H HA   . ASP A 1 34  ? -10.924 37.211  -15.703 1.00 1.38  ? 34  ASP A HA   2  
ATOM 5849   H HB2  . ASP A 1 34  ? -11.959 38.130  -17.815 1.00 1.64  ? 34  ASP A HB2  2  
ATOM 5850   H HB3  . ASP A 1 34  ? -12.689 36.547  -18.082 1.00 1.89  ? 34  ASP A HB3  2  
ATOM 5851   N N    . GLN A 1 35  ? -11.384 34.197  -16.786 1.00 1.14  ? 35  GLN A N    2  
ATOM 5852   C CA   . GLN A 1 35  ? -11.759 32.820  -16.395 1.00 1.12  ? 35  GLN A CA   2  
ATOM 5853   C C    . GLN A 1 35  ? -10.700 32.275  -15.439 1.00 1.03  ? 35  GLN A C    2  
ATOM 5854   O O    . GLN A 1 35  ? -10.859 31.224  -14.851 1.00 1.01  ? 35  GLN A O    2  
ATOM 5855   C CB   . GLN A 1 35  ? -11.831 31.972  -17.664 1.00 1.14  ? 35  GLN A CB   2  
ATOM 5856   C CG   . GLN A 1 35  ? -13.159 32.212  -18.382 1.00 1.22  ? 35  GLN A CG   2  
ATOM 5857   C CD   . GLN A 1 35  ? -13.099 31.602  -19.783 1.00 1.29  ? 35  GLN A CD   2  
ATOM 5858   O OE1  . GLN A 1 35  ? -12.033 31.286  -20.274 1.00 1.70  ? 35  GLN A OE1  2  
ATOM 5859   N NE2  . GLN A 1 35  ? -14.203 31.430  -20.456 1.00 1.79  ? 35  GLN A NE2  2  
ATOM 5860   H H    . GLN A 1 35  ? -10.902 34.336  -17.625 1.00 1.09  ? 35  GLN A H    2  
ATOM 5861   H HA   . GLN A 1 35  ? -12.722 32.830  -15.905 1.00 1.19  ? 35  GLN A HA   2  
ATOM 5862   H HB2  . GLN A 1 35  ? -11.028 32.267  -18.320 1.00 1.27  ? 35  GLN A HB2  2  
ATOM 5863   H HB3  . GLN A 1 35  ? -11.737 30.926  -17.413 1.00 1.27  ? 35  GLN A HB3  2  
ATOM 5864   H HG2  . GLN A 1 35  ? -13.955 31.744  -17.822 1.00 1.39  ? 35  GLN A HG2  2  
ATOM 5865   H HG3  . GLN A 1 35  ? -13.343 33.271  -18.458 1.00 1.49  ? 35  GLN A HG3  2  
ATOM 5866   H HE21 . GLN A 1 35  ? -15.061 31.691  -20.062 1.00 2.36  ? 35  GLN A HE21 2  
ATOM 5867   H HE22 . GLN A 1 35  ? -14.173 31.042  -21.355 1.00 1.94  ? 35  GLN A HE22 2  
ATOM 5868   N N    . VAL A 1 36  ? -9.620  32.992  -15.275 1.00 1.00  ? 36  VAL A N    2  
ATOM 5869   C CA   . VAL A 1 36  ? -8.551  32.527  -14.352 1.00 0.93  ? 36  VAL A CA   2  
ATOM 5870   C C    . VAL A 1 36  ? -9.156  32.361  -12.961 1.00 0.97  ? 36  VAL A C    2  
ATOM 5871   O O    . VAL A 1 36  ? -9.009  31.335  -12.328 1.00 0.92  ? 36  VAL A O    2  
ATOM 5872   C CB   . VAL A 1 36  ? -7.411  33.569  -14.340 1.00 0.95  ? 36  VAL A CB   2  
ATOM 5873   C CG1  . VAL A 1 36  ? -6.554  33.420  -13.078 1.00 0.96  ? 36  VAL A CG1  2  
ATOM 5874   C CG2  . VAL A 1 36  ? -6.517  33.353  -15.564 1.00 0.92  ? 36  VAL A CG2  2  
ATOM 5875   H H    . VAL A 1 36  ? -9.516  33.841  -15.755 1.00 1.05  ? 36  VAL A H    2  
ATOM 5876   H HA   . VAL A 1 36  ? -8.172  31.575  -14.688 1.00 0.88  ? 36  VAL A HA   2  
ATOM 5877   H HB   . VAL A 1 36  ? -7.830  34.568  -14.379 1.00 1.00  ? 36  VAL A HB   2  
ATOM 5878   H HG11 . VAL A 1 36  ? -6.295  32.381  -12.938 1.00 1.43  ? 36  VAL A HG11 2  
ATOM 5879   H HG12 . VAL A 1 36  ? -5.656  34.007  -13.186 1.00 1.33  ? 36  VAL A HG12 2  
ATOM 5880   H HG13 . VAL A 1 36  ? -7.110  33.771  -12.220 1.00 1.22  ? 36  VAL A HG13 2  
ATOM 5881   H HG21 . VAL A 1 36  ? -7.133  33.241  -16.442 1.00 1.31  ? 36  VAL A HG21 2  
ATOM 5882   H HG22 . VAL A 1 36  ? -5.863  34.204  -15.687 1.00 1.36  ? 36  VAL A HG22 2  
ATOM 5883   H HG23 . VAL A 1 36  ? -5.924  32.462  -15.424 1.00 1.38  ? 36  VAL A HG23 2  
ATOM 5884   N N    . ASP A 1 37  ? -9.847  33.349  -12.487 1.00 1.08  ? 37  ASP A N    2  
ATOM 5885   C CA   . ASP A 1 37  ? -10.474 33.230  -11.148 1.00 1.15  ? 37  ASP A CA   2  
ATOM 5886   C C    . ASP A 1 37  ? -11.446 32.051  -11.165 1.00 1.12  ? 37  ASP A C    2  
ATOM 5887   O O    . ASP A 1 37  ? -11.548 31.300  -10.214 1.00 1.11  ? 37  ASP A O    2  
ATOM 5888   C CB   . ASP A 1 37  ? -11.234 34.517  -10.823 1.00 1.31  ? 37  ASP A CB   2  
ATOM 5889   C CG   . ASP A 1 37  ? -10.238 35.652  -10.581 1.00 1.36  ? 37  ASP A CG   2  
ATOM 5890   O OD1  . ASP A 1 37  ? -9.088  35.356  -10.301 1.00 1.73  ? 37  ASP A OD1  2  
ATOM 5891   O OD2  . ASP A 1 37  ? -10.641 36.799  -10.682 1.00 1.77  ? 37  ASP A OD2  2  
ATOM 5892   H H    . ASP A 1 37  ? -9.962  34.167  -13.012 1.00 1.14  ? 37  ASP A H    2  
ATOM 5893   H HA   . ASP A 1 37  ? -9.711  33.060  -10.405 1.00 1.13  ? 37  ASP A HA   2  
ATOM 5894   H HB2  . ASP A 1 37  ? -11.877 34.773  -11.653 1.00 1.36  ? 37  ASP A HB2  2  
ATOM 5895   H HB3  . ASP A 1 37  ? -11.831 34.369  -9.937  1.00 1.39  ? 37  ASP A HB3  2  
ATOM 5896   N N    . GLN A 1 38  ? -12.170 31.890  -12.240 1.00 1.13  ? 38  GLN A N    2  
ATOM 5897   C CA   . GLN A 1 38  ? -13.150 30.768  -12.322 1.00 1.15  ? 38  GLN A CA   2  
ATOM 5898   C C    . GLN A 1 38  ? -12.442 29.414  -12.212 1.00 1.04  ? 38  GLN A C    2  
ATOM 5899   O O    . GLN A 1 38  ? -12.874 28.541  -11.485 1.00 1.06  ? 38  GLN A O    2  
ATOM 5900   C CB   . GLN A 1 38  ? -13.901 30.842  -13.654 1.00 1.22  ? 38  GLN A CB   2  
ATOM 5901   C CG   . GLN A 1 38  ? -14.838 32.053  -13.645 1.00 1.33  ? 38  GLN A CG   2  
ATOM 5902   C CD   . GLN A 1 38  ? -15.591 32.131  -14.974 1.00 1.99  ? 38  GLN A CD   2  
ATOM 5903   O OE1  . GLN A 1 38  ? -15.445 33.085  -15.712 1.00 2.56  ? 38  GLN A OE1  2  
ATOM 5904   N NE2  . GLN A 1 38  ? -16.400 31.164  -15.309 1.00 2.70  ? 38  GLN A NE2  2  
ATOM 5905   H H    . GLN A 1 38  ? -12.074 32.514  -12.993 1.00 1.14  ? 38  GLN A H    2  
ATOM 5906   H HA   . GLN A 1 38  ? -13.856 30.858  -11.514 1.00 1.22  ? 38  GLN A HA   2  
ATOM 5907   H HB2  . GLN A 1 38  ? -13.191 30.941  -14.463 1.00 1.18  ? 38  GLN A HB2  2  
ATOM 5908   H HB3  . GLN A 1 38  ? -14.481 29.942  -13.792 1.00 1.26  ? 38  GLN A HB3  2  
ATOM 5909   H HG2  . GLN A 1 38  ? -15.545 31.951  -12.834 1.00 1.73  ? 38  GLN A HG2  2  
ATOM 5910   H HG3  . GLN A 1 38  ? -14.259 32.954  -13.507 1.00 1.31  ? 38  GLN A HG3  2  
ATOM 5911   H HE21 . GLN A 1 38  ? -16.521 30.397  -14.712 1.00 2.93  ? 38  GLN A HE21 2  
ATOM 5912   H HE22 . GLN A 1 38  ? -16.888 31.205  -16.158 1.00 3.32  ? 38  GLN A HE22 2  
ATOM 5913   N N    . GLU A 1 39  ? -11.367 29.215  -12.929 1.00 0.96  ? 39  GLU A N    2  
ATOM 5914   C CA   . GLU A 1 39  ? -10.668 27.898  -12.847 1.00 0.90  ? 39  GLU A CA   2  
ATOM 5915   C C    . GLU A 1 39  ? -10.208 27.641  -11.416 1.00 0.84  ? 39  GLU A C    2  
ATOM 5916   O O    . GLU A 1 39  ? -10.355 26.551  -10.900 1.00 0.81  ? 39  GLU A O    2  
ATOM 5917   C CB   . GLU A 1 39  ? -9.449  27.871  -13.780 1.00 0.88  ? 39  GLU A CB   2  
ATOM 5918   C CG   . GLU A 1 39  ? -9.892  27.729  -15.241 1.00 0.96  ? 39  GLU A CG   2  
ATOM 5919   C CD   . GLU A 1 39  ? -10.590 26.381  -15.451 1.00 0.99  ? 39  GLU A CD   2  
ATOM 5920   O OE1  . GLU A 1 39  ? -9.954  25.365  -15.220 1.00 1.51  ? 39  GLU A OE1  2  
ATOM 5921   O OE2  . GLU A 1 39  ? -11.746 26.389  -15.839 1.00 1.44  ? 39  GLU A OE2  2  
ATOM 5922   H H    . GLU A 1 39  ? -11.031 29.921  -13.517 1.00 0.97  ? 39  GLU A H    2  
ATOM 5923   H HA   . GLU A 1 39  ? -11.356 27.122  -13.131 1.00 0.95  ? 39  GLU A HA   2  
ATOM 5924   H HB2  . GLU A 1 39  ? -8.892  28.788  -13.666 1.00 0.91  ? 39  GLU A HB2  2  
ATOM 5925   H HB3  . GLU A 1 39  ? -8.816  27.034  -13.520 1.00 0.84  ? 39  GLU A HB3  2  
ATOM 5926   H HG2  . GLU A 1 39  ? -10.570 28.530  -15.492 1.00 1.07  ? 39  GLU A HG2  2  
ATOM 5927   H HG3  . GLU A 1 39  ? -9.022  27.777  -15.878 1.00 0.98  ? 39  GLU A HG3  2  
ATOM 5928   N N    . VAL A 1 40  ? -9.648  28.619  -10.765 1.00 0.86  ? 40  VAL A N    2  
ATOM 5929   C CA   . VAL A 1 40  ? -9.187  28.389  -9.371  1.00 0.84  ? 40  VAL A CA   2  
ATOM 5930   C C    . VAL A 1 40  ? -10.391 27.985  -8.515  1.00 0.87  ? 40  VAL A C    2  
ATOM 5931   O O    . VAL A 1 40  ? -10.327 27.052  -7.739  1.00 0.84  ? 40  VAL A O    2  
ATOM 5932   C CB   . VAL A 1 40  ? -8.557  29.673  -8.826  1.00 0.90  ? 40  VAL A CB   2  
ATOM 5933   C CG1  . VAL A 1 40  ? -8.213  29.484  -7.348  1.00 0.93  ? 40  VAL A CG1  2  
ATOM 5934   C CG2  . VAL A 1 40  ? -7.281  29.988  -9.613  1.00 0.87  ? 40  VAL A CG2  2  
ATOM 5935   H H    . VAL A 1 40  ? -9.521  29.500  -11.180 1.00 0.89  ? 40  VAL A H    2  
ATOM 5936   H HA   . VAL A 1 40  ? -8.455  27.595  -9.361  1.00 0.80  ? 40  VAL A HA   2  
ATOM 5937   H HB   . VAL A 1 40  ? -9.258  30.488  -8.929  1.00 0.96  ? 40  VAL A HB   2  
ATOM 5938   H HG11 . VAL A 1 40  ? -7.712  28.538  -7.213  1.00 1.40  ? 40  VAL A HG11 2  
ATOM 5939   H HG12 . VAL A 1 40  ? -7.562  30.284  -7.025  1.00 1.29  ? 40  VAL A HG12 2  
ATOM 5940   H HG13 . VAL A 1 40  ? -9.119  29.499  -6.761  1.00 1.41  ? 40  VAL A HG13 2  
ATOM 5941   H HG21 . VAL A 1 40  ? -6.685  29.092  -9.714  1.00 1.41  ? 40  VAL A HG21 2  
ATOM 5942   H HG22 . VAL A 1 40  ? -7.544  30.355  -10.595 1.00 1.22  ? 40  VAL A HG22 2  
ATOM 5943   H HG23 . VAL A 1 40  ? -6.711  30.741  -9.090  1.00 1.37  ? 40  VAL A HG23 2  
ATOM 5944   N N    . GLU A 1 41  ? -11.485 28.689  -8.641  1.00 0.95  ? 41  GLU A N    2  
ATOM 5945   C CA   . GLU A 1 41  ? -12.685 28.352  -7.822  1.00 1.01  ? 41  GLU A CA   2  
ATOM 5946   C C    . GLU A 1 41  ? -13.122 26.922  -8.136  1.00 0.96  ? 41  GLU A C    2  
ATOM 5947   O O    . GLU A 1 41  ? -13.465 26.164  -7.250  1.00 0.95  ? 41  GLU A O    2  
ATOM 5948   C CB   . GLU A 1 41  ? -13.821 29.323  -8.169  1.00 1.14  ? 41  GLU A CB   2  
ATOM 5949   C CG   . GLU A 1 41  ? -15.008 29.103  -7.225  1.00 1.22  ? 41  GLU A CG   2  
ATOM 5950   C CD   . GLU A 1 41  ? -14.633 29.567  -5.817  1.00 1.26  ? 41  GLU A CD   2  
ATOM 5951   O OE1  . GLU A 1 41  ? -13.696 30.339  -5.699  1.00 1.81  ? 41  GLU A OE1  2  
ATOM 5952   O OE2  . GLU A 1 41  ? -15.287 29.140  -4.880  1.00 1.53  ? 41  GLU A OE2  2  
ATOM 5953   H H    . GLU A 1 41  ? -11.505 29.459  -9.249  1.00 0.99  ? 41  GLU A H    2  
ATOM 5954   H HA   . GLU A 1 41  ? -12.446 28.433  -6.772  1.00 1.02  ? 41  GLU A HA   2  
ATOM 5955   H HB2  . GLU A 1 41  ? -13.465 30.339  -8.069  1.00 1.17  ? 41  GLU A HB2  2  
ATOM 5956   H HB3  . GLU A 1 41  ? -14.137 29.153  -9.187  1.00 1.15  ? 41  GLU A HB3  2  
ATOM 5957   H HG2  . GLU A 1 41  ? -15.855 29.672  -7.578  1.00 1.31  ? 41  GLU A HG2  2  
ATOM 5958   H HG3  . GLU A 1 41  ? -15.263 28.056  -7.201  1.00 1.19  ? 41  GLU A HG3  2  
ATOM 5959   N N    . ARG A 1 42  ? -13.097 26.531  -9.380  1.00 0.96  ? 42  ARG A N    2  
ATOM 5960   C CA   . ARG A 1 42  ? -13.496 25.137  -9.710  1.00 0.94  ? 42  ARG A CA   2  
ATOM 5961   C C    . ARG A 1 42  ? -12.555 24.186  -8.970  1.00 0.84  ? 42  ARG A C    2  
ATOM 5962   O O    . ARG A 1 42  ? -12.978 23.240  -8.337  1.00 0.83  ? 42  ARG A O    2  
ATOM 5963   C CB   . ARG A 1 42  ? -13.384 24.920  -11.221 1.00 0.98  ? 42  ARG A CB   2  
ATOM 5964   C CG   . ARG A 1 42  ? -14.482 25.719  -11.928 1.00 1.13  ? 42  ARG A CG   2  
ATOM 5965   C CD   . ARG A 1 42  ? -14.308 25.601  -13.443 1.00 1.26  ? 42  ARG A CD   2  
ATOM 5966   N NE   . ARG A 1 42  ? -14.241 24.164  -13.827 1.00 1.54  ? 42  ARG A NE   2  
ATOM 5967   C CZ   . ARG A 1 42  ? -14.389 23.815  -15.075 1.00 1.98  ? 42  ARG A CZ   2  
ATOM 5968   N NH1  . ARG A 1 42  ? -14.619 24.722  -15.984 1.00 2.34  ? 42  ARG A NH1  2  
ATOM 5969   N NH2  . ARG A 1 42  ? -14.311 22.557  -15.414 1.00 2.78  ? 42  ARG A NH2  2  
ATOM 5970   H H    . ARG A 1 42  ? -12.805 27.144  -10.086 1.00 0.98  ? 42  ARG A H    2  
ATOM 5971   H HA   . ARG A 1 42  ? -14.512 24.964  -9.390  1.00 1.00  ? 42  ARG A HA   2  
ATOM 5972   H HB2  . ARG A 1 42  ? -12.415 25.253  -11.563 1.00 0.95  ? 42  ARG A HB2  2  
ATOM 5973   H HB3  . ARG A 1 42  ? -13.506 23.871  -11.445 1.00 0.99  ? 42  ARG A HB3  2  
ATOM 5974   H HG2  . ARG A 1 42  ? -15.449 25.329  -11.645 1.00 1.18  ? 42  ARG A HG2  2  
ATOM 5975   H HG3  . ARG A 1 42  ? -14.413 26.757  -11.640 1.00 1.18  ? 42  ARG A HG3  2  
ATOM 5976   H HD2  . ARG A 1 42  ? -15.148 26.067  -13.938 1.00 1.67  ? 42  ARG A HD2  2  
ATOM 5977   H HD3  . ARG A 1 42  ? -13.396 26.097  -13.741 1.00 1.70  ? 42  ARG A HD3  2  
ATOM 5978   H HE   . ARG A 1 42  ? -14.077 23.481  -13.143 1.00 2.11  ? 42  ARG A HE   2  
ATOM 5979   H HH11 . ARG A 1 42  ? -14.681 25.686  -15.724 1.00 2.38  ? 42  ARG A HH11 2  
ATOM 5980   H HH12 . ARG A 1 42  ? -14.732 24.454  -16.940 1.00 3.00  ? 42  ARG A HH12 2  
ATOM 5981   H HH21 . ARG A 1 42  ? -14.137 21.861  -14.717 1.00 3.20  ? 42  ARG A HH21 2  
ATOM 5982   H HH22 . ARG A 1 42  ? -14.424 22.289  -16.371 1.00 3.26  ? 42  ARG A HH22 2  
ATOM 5983   N N    . PHE A 1 43  ? -11.279 24.457  -9.022  1.00 0.78  ? 43  PHE A N    2  
ATOM 5984   C CA   . PHE A 1 43  ? -10.298 23.602  -8.298  1.00 0.70  ? 43  PHE A CA   2  
ATOM 5985   C C    . PHE A 1 43  ? -10.614 23.636  -6.801  1.00 0.69  ? 43  PHE A C    2  
ATOM 5986   O O    . PHE A 1 43  ? -10.678 22.616  -6.144  1.00 0.68  ? 43  PHE A O    2  
ATOM 5987   C CB   . PHE A 1 43  ? -8.883  24.133  -8.531  1.00 0.67  ? 43  PHE A CB   2  
ATOM 5988   C CG   . PHE A 1 43  ? -7.903  23.332  -7.706  1.00 0.60  ? 43  PHE A CG   2  
ATOM 5989   C CD1  . PHE A 1 43  ? -7.307  22.184  -8.238  1.00 0.59  ? 43  PHE A CD1  2  
ATOM 5990   C CD2  . PHE A 1 43  ? -7.592  23.743  -6.403  1.00 0.67  ? 43  PHE A CD2  2  
ATOM 5991   C CE1  . PHE A 1 43  ? -6.399  21.445  -7.469  1.00 0.59  ? 43  PHE A CE1  2  
ATOM 5992   C CE2  . PHE A 1 43  ? -6.686  23.004  -5.634  1.00 0.69  ? 43  PHE A CE2  2  
ATOM 5993   C CZ   . PHE A 1 43  ? -6.089  21.857  -6.167  1.00 0.63  ? 43  PHE A CZ   2  
ATOM 5994   H H    . PHE A 1 43  ? -10.968 25.241  -9.521  1.00 0.80  ? 43  PHE A H    2  
ATOM 5995   H HA   . PHE A 1 43  ? -10.369 22.586  -8.659  1.00 0.70  ? 43  PHE A HA   2  
ATOM 5996   H HB2  . PHE A 1 43  ? -8.632  24.041  -9.577  1.00 0.70  ? 43  PHE A HB2  2  
ATOM 5997   H HB3  . PHE A 1 43  ? -8.835  25.170  -8.237  1.00 0.72  ? 43  PHE A HB3  2  
ATOM 5998   H HD1  . PHE A 1 43  ? -7.546  21.867  -9.243  1.00 0.66  ? 43  PHE A HD1  2  
ATOM 5999   H HD2  . PHE A 1 43  ? -8.053  24.628  -5.992  1.00 0.77  ? 43  PHE A HD2  2  
ATOM 6000   H HE1  . PHE A 1 43  ? -5.938  20.559  -7.879  1.00 0.65  ? 43  PHE A HE1  2  
ATOM 6001   H HE2  . PHE A 1 43  ? -6.447  23.322  -4.629  1.00 0.81  ? 43  PHE A HE2  2  
ATOM 6002   H HZ   . PHE A 1 43  ? -5.388  21.287  -5.572  1.00 0.69  ? 43  PHE A HZ   2  
ATOM 6003   N N    . LEU A 1 44  ? -10.807 24.809  -6.259  1.00 0.75  ? 44  LEU A N    2  
ATOM 6004   C CA   . LEU A 1 44  ? -11.113 24.916  -4.808  1.00 0.78  ? 44  LEU A CA   2  
ATOM 6005   C C    . LEU A 1 44  ? -12.400 24.149  -4.517  1.00 0.81  ? 44  LEU A C    2  
ATOM 6006   O O    . LEU A 1 44  ? -12.451 23.326  -3.625  1.00 0.79  ? 44  LEU A O    2  
ATOM 6007   C CB   . LEU A 1 44  ? -11.281 26.395  -4.431  1.00 0.87  ? 44  LEU A CB   2  
ATOM 6008   C CG   . LEU A 1 44  ? -11.655 26.536  -2.948  1.00 0.96  ? 44  LEU A CG   2  
ATOM 6009   C CD1  . LEU A 1 44  ? -10.577 25.891  -2.063  1.00 1.07  ? 44  LEU A CD1  2  
ATOM 6010   C CD2  . LEU A 1 44  ? -11.772 28.027  -2.605  1.00 1.07  ? 44  LEU A CD2  2  
ATOM 6011   H H    . LEU A 1 44  ? -10.747 25.618  -6.808  1.00 0.79  ? 44  LEU A H    2  
ATOM 6012   H HA   . LEU A 1 44  ? -10.301 24.489  -4.240  1.00 0.76  ? 44  LEU A HA   2  
ATOM 6013   H HB2  . LEU A 1 44  ? -10.354 26.917  -4.617  1.00 0.86  ? 44  LEU A HB2  2  
ATOM 6014   H HB3  . LEU A 1 44  ? -12.062 26.829  -5.038  1.00 0.93  ? 44  LEU A HB3  2  
ATOM 6015   H HG   . LEU A 1 44  ? -12.605 26.053  -2.767  1.00 1.03  ? 44  LEU A HG   2  
ATOM 6016   H HD11 . LEU A 1 44  ? -9.600  26.063  -2.492  1.00 1.59  ? 44  LEU A HD11 2  
ATOM 6017   H HD12 . LEU A 1 44  ? -10.613 26.320  -1.071  1.00 1.44  ? 44  LEU A HD12 2  
ATOM 6018   H HD13 . LEU A 1 44  ? -10.758 24.827  -1.996  1.00 1.49  ? 44  LEU A HD13 2  
ATOM 6019   H HD21 . LEU A 1 44  ? -12.346 28.530  -3.369  1.00 1.42  ? 44  LEU A HD21 2  
ATOM 6020   H HD22 . LEU A 1 44  ? -12.266 28.140  -1.650  1.00 1.49  ? 44  LEU A HD22 2  
ATOM 6021   H HD23 . LEU A 1 44  ? -10.785 28.462  -2.551  1.00 1.59  ? 44  LEU A HD23 2  
ATOM 6022   N N    . SER A 1 45  ? -13.435 24.391  -5.272  1.00 0.87  ? 45  SER A N    2  
ATOM 6023   C CA   . SER A 1 45  ? -14.700 23.644  -5.037  1.00 0.92  ? 45  SER A CA   2  
ATOM 6024   C C    . SER A 1 45  ? -14.431 22.153  -5.252  1.00 0.86  ? 45  SER A C    2  
ATOM 6025   O O    . SER A 1 45  ? -14.840 21.318  -4.471  1.00 0.86  ? 45  SER A O    2  
ATOM 6026   C CB   . SER A 1 45  ? -15.770 24.121  -6.015  1.00 1.03  ? 45  SER A CB   2  
ATOM 6027   O OG   . SER A 1 45  ? -16.974 23.401  -5.783  1.00 1.12  ? 45  SER A OG   2  
ATOM 6028   H H    . SER A 1 45  ? -13.375 25.045  -6.002  1.00 0.90  ? 45  SER A H    2  
ATOM 6029   H HA   . SER A 1 45  ? -15.034 23.808  -4.024  1.00 0.95  ? 45  SER A HA   2  
ATOM 6030   H HB2  . SER A 1 45  ? -15.951 25.171  -5.864  1.00 1.09  ? 45  SER A HB2  2  
ATOM 6031   H HB3  . SER A 1 45  ? -15.429 23.957  -7.028  1.00 1.03  ? 45  SER A HB3  2  
ATOM 6032   H HG   . SER A 1 45  ? -17.673 23.824  -6.288  1.00 1.38  ? 45  SER A HG   2  
ATOM 6033   N N    . GLY A 1 46  ? -13.728 21.813  -6.301  1.00 0.84  ? 46  GLY A N    2  
ATOM 6034   C CA   . GLY A 1 46  ? -13.417 20.377  -6.552  1.00 0.82  ? 46  GLY A CA   2  
ATOM 6035   C C    . GLY A 1 46  ? -12.591 19.849  -5.380  1.00 0.74  ? 46  GLY A C    2  
ATOM 6036   O O    . GLY A 1 46  ? -12.827 18.769  -4.871  1.00 0.74  ? 46  GLY A O    2  
ATOM 6037   H H    . GLY A 1 46  ? -13.396 22.501  -6.914  1.00 0.86  ? 46  GLY A H    2  
ATOM 6038   H HA2  . GLY A 1 46  ? -14.337 19.815  -6.634  1.00 0.87  ? 46  GLY A HA2  2  
ATOM 6039   H HA3  . GLY A 1 46  ? -12.849 20.281  -7.464  1.00 0.83  ? 46  GLY A HA3  2  
ATOM 6040   N N    . ARG A 1 47  ? -11.639 20.623  -4.930  1.00 0.70  ? 47  ARG A N    2  
ATOM 6041   C CA   . ARG A 1 47  ? -10.809 20.202  -3.771  1.00 0.67  ? 47  ARG A CA   2  
ATOM 6042   C C    . ARG A 1 47  ? -11.703 20.142  -2.538  1.00 0.68  ? 47  ARG A C    2  
ATOM 6043   O O    . ARG A 1 47  ? -11.496 19.354  -1.636  1.00 0.67  ? 47  ARG A O    2  
ATOM 6044   C CB   . ARG A 1 47  ? -9.694  21.227  -3.547  1.00 0.71  ? 47  ARG A CB   2  
ATOM 6045   C CG   . ARG A 1 47  ? -8.833  20.808  -2.352  1.00 0.83  ? 47  ARG A CG   2  
ATOM 6046   C CD   . ARG A 1 47  ? -7.630  21.749  -2.246  1.00 0.91  ? 47  ARG A CD   2  
ATOM 6047   N NE   . ARG A 1 47  ? -6.904  21.518  -0.950  1.00 1.62  ? 47  ARG A NE   2  
ATOM 6048   C CZ   . ARG A 1 47  ? -7.482  21.698  0.209   1.00 2.11  ? 47  ARG A CZ   2  
ATOM 6049   N NH1  . ARG A 1 47  ? -8.681  22.205  0.280   1.00 2.26  ? 47  ARG A NH1  2  
ATOM 6050   N NH2  . ARG A 1 47  ? -6.837  21.408  1.306   1.00 3.09  ? 47  ARG A NH2  2  
ATOM 6051   H H    . ARG A 1 47  ? -11.483 21.501  -5.337  1.00 0.73  ? 47  ARG A H    2  
ATOM 6052   H HA   . ARG A 1 47  ? -10.380 19.229  -3.960  1.00 0.66  ? 47  ARG A HA   2  
ATOM 6053   H HB2  . ARG A 1 47  ? -9.076  21.284  -4.432  1.00 0.77  ? 47  ARG A HB2  2  
ATOM 6054   H HB3  . ARG A 1 47  ? -10.130 22.195  -3.351  1.00 0.73  ? 47  ARG A HB3  2  
ATOM 6055   H HG2  . ARG A 1 47  ? -9.425  20.856  -1.454  1.00 0.92  ? 47  ARG A HG2  2  
ATOM 6056   H HG3  . ARG A 1 47  ? -8.484  19.797  -2.499  1.00 0.99  ? 47  ARG A HG3  2  
ATOM 6057   H HD2  . ARG A 1 47  ? -6.941  21.530  -3.037  1.00 1.27  ? 47  ARG A HD2  2  
ATOM 6058   H HD3  . ARG A 1 47  ? -7.969  22.780  -2.350  1.00 1.32  ? 47  ARG A HD3  2  
ATOM 6059   H HE   . ARG A 1 47  ? -5.979  21.195  -0.974  1.00 2.29  ? 47  ARG A HE   2  
ATOM 6060   H HH11 . ARG A 1 47  ? -9.167  22.460  -0.555  1.00 2.05  ? 47  ARG A HH11 2  
ATOM 6061   H HH12 . ARG A 1 47  ? -9.116  22.339  1.171   1.00 3.03  ? 47  ARG A HH12 2  
ATOM 6062   H HH21 . ARG A 1 47  ? -5.904  21.050  1.257   1.00 3.52  ? 47  ARG A HH21 2  
ATOM 6063   H HH22 . ARG A 1 47  ? -7.274  21.544  2.194   1.00 3.62  ? 47  ARG A HH22 2  
ATOM 6064   N N    . ALA A 1 48  ? -12.702 20.981  -2.499  1.00 0.73  ? 48  ALA A N    2  
ATOM 6065   C CA   . ALA A 1 48  ? -13.625 20.995  -1.336  1.00 0.78  ? 48  ALA A CA   2  
ATOM 6066   C C    . ALA A 1 48  ? -14.262 19.614  -1.184  1.00 0.76  ? 48  ALA A C    2  
ATOM 6067   O O    . ALA A 1 48  ? -14.420 19.112  -0.086  1.00 0.77  ? 48  ALA A O    2  
ATOM 6068   C CB   . ALA A 1 48  ? -14.713 22.051  -1.561  1.00 0.88  ? 48  ALA A CB   2  
ATOM 6069   H H    . ALA A 1 48  ? -12.843 21.604  -3.241  1.00 0.75  ? 48  ALA A H    2  
ATOM 6070   H HA   . ALA A 1 48  ? -13.070 21.234  -0.442  1.00 0.79  ? 48  ALA A HA   2  
ATOM 6071   H HB1  . ALA A 1 48  ? -14.269 22.938  -1.992  1.00 1.34  ? 48  ALA A HB1  2  
ATOM 6072   H HB2  . ALA A 1 48  ? -15.463 21.663  -2.235  1.00 1.43  ? 48  ALA A HB2  2  
ATOM 6073   H HB3  . ALA A 1 48  ? -15.171 22.302  -0.616  1.00 1.30  ? 48  ALA A HB3  2  
ATOM 6074   N N    . LYS A 1 49  ? -14.620 18.983  -2.269  1.00 0.78  ? 49  LYS A N    2  
ATOM 6075   C CA   . LYS A 1 49  ? -15.230 17.632  -2.151  1.00 0.81  ? 49  LYS A CA   2  
ATOM 6076   C C    . LYS A 1 49  ? -14.134 16.648  -1.756  1.00 0.71  ? 49  LYS A C    2  
ATOM 6077   O O    . LYS A 1 49  ? -14.101 16.182  -0.635  1.00 0.68  ? 49  LYS A O    2  
ATOM 6078   C CB   . LYS A 1 49  ? -15.841 17.227  -3.498  1.00 0.94  ? 49  LYS A CB   2  
ATOM 6079   C CG   . LYS A 1 49  ? -16.237 15.745  -3.464  1.00 1.38  ? 49  LYS A CG   2  
ATOM 6080   C CD   . LYS A 1 49  ? -17.153 15.407  -4.656  1.00 1.43  ? 49  LYS A CD   2  
ATOM 6081   C CE   . LYS A 1 49  ? -18.612 15.755  -4.330  1.00 1.88  ? 49  LYS A CE   2  
ATOM 6082   N NZ   . LYS A 1 49  ? -19.494 15.244  -5.416  1.00 2.59  ? 49  LYS A NZ   2  
ATOM 6083   H H    . LYS A 1 49  ? -14.478 19.390  -3.146  1.00 0.81  ? 49  LYS A H    2  
ATOM 6084   H HA   . LYS A 1 49  ? -15.996 17.645  -1.393  1.00 0.85  ? 49  LYS A HA   2  
ATOM 6085   H HB2  . LYS A 1 49  ? -16.713 17.832  -3.692  1.00 1.52  ? 49  LYS A HB2  2  
ATOM 6086   H HB3  . LYS A 1 49  ? -15.115 17.384  -4.282  1.00 1.54  ? 49  LYS A HB3  2  
ATOM 6087   H HG2  . LYS A 1 49  ? -15.344 15.139  -3.516  1.00 1.99  ? 49  LYS A HG2  2  
ATOM 6088   H HG3  . LYS A 1 49  ? -16.754 15.535  -2.539  1.00 1.99  ? 49  LYS A HG3  2  
ATOM 6089   H HD2  . LYS A 1 49  ? -16.838 15.969  -5.524  1.00 1.83  ? 49  LYS A HD2  2  
ATOM 6090   H HD3  . LYS A 1 49  ? -17.079 14.351  -4.873  1.00 1.76  ? 49  LYS A HD3  2  
ATOM 6091   H HE2  . LYS A 1 49  ? -18.894 15.295  -3.394  1.00 2.30  ? 49  LYS A HE2  2  
ATOM 6092   H HE3  . LYS A 1 49  ? -18.722 16.825  -4.253  1.00 2.32  ? 49  LYS A HE3  2  
ATOM 6093   H HZ1  . LYS A 1 49  ? -18.948 14.619  -6.042  1.00 2.94  ? 49  LYS A HZ1  2  
ATOM 6094   H HZ2  . LYS A 1 49  ? -20.285 14.712  -4.998  1.00 2.93  ? 49  LYS A HZ2  2  
ATOM 6095   H HZ3  . LYS A 1 49  ? -19.867 16.044  -5.967  1.00 3.08  ? 49  LYS A HZ3  2  
ATOM 6096   N N    . ALA A 1 50  ? -13.252 16.302  -2.666  1.00 0.70  ? 50  ALA A N    2  
ATOM 6097   C CA   . ALA A 1 50  ? -12.169 15.320  -2.344  1.00 0.66  ? 50  ALA A CA   2  
ATOM 6098   C C    . ALA A 1 50  ? -11.642 15.541  -0.926  1.00 0.55  ? 50  ALA A C    2  
ATOM 6099   O O    . ALA A 1 50  ? -11.296 14.607  -0.232  1.00 0.55  ? 50  ALA A O    2  
ATOM 6100   C CB   . ALA A 1 50  ? -11.021 15.496  -3.339  1.00 0.69  ? 50  ALA A CB   2  
ATOM 6101   H H    . ALA A 1 50  ? -13.327 16.622  -3.590  1.00 0.75  ? 50  ALA A H    2  
ATOM 6102   H HA   . ALA A 1 50  ? -12.559 14.320  -2.429  1.00 0.71  ? 50  ALA A HA   2  
ATOM 6103   H HB1  . ALA A 1 50  ? -11.419 15.555  -4.341  1.00 1.15  ? 50  ALA A HB1  2  
ATOM 6104   H HB2  . ALA A 1 50  ? -10.482 16.404  -3.112  1.00 1.20  ? 50  ALA A HB2  2  
ATOM 6105   H HB3  . ALA A 1 50  ? -10.350 14.652  -3.267  1.00 1.33  ? 50  ALA A HB3  2  
ATOM 6106   N N    . SER A 1 51  ? -11.590 16.758  -0.473  1.00 0.52  ? 51  SER A N    2  
ATOM 6107   C CA   . SER A 1 51  ? -11.096 16.988  0.908   1.00 0.48  ? 51  SER A CA   2  
ATOM 6108   C C    . SER A 1 51  ? -11.962 16.180  1.875   1.00 0.48  ? 51  SER A C    2  
ATOM 6109   O O    . SER A 1 51  ? -11.483 15.321  2.588   1.00 0.47  ? 51  SER A O    2  
ATOM 6110   C CB   . SER A 1 51  ? -11.199 18.476  1.246   1.00 0.55  ? 51  SER A CB   2  
ATOM 6111   O OG   . SER A 1 51  ? -10.259 19.202  0.466   1.00 1.40  ? 51  SER A OG   2  
ATOM 6112   H H    . SER A 1 51  ? -11.882 17.510  -1.029  1.00 0.56  ? 51  SER A H    2  
ATOM 6113   H HA   . SER A 1 51  ? -10.070 16.667  0.985   1.00 0.48  ? 51  SER A HA   2  
ATOM 6114   H HB2  . SER A 1 51  ? -12.193 18.829  1.024   1.00 1.03  ? 51  SER A HB2  2  
ATOM 6115   H HB3  . SER A 1 51  ? -10.997 18.619  2.299   1.00 1.18  ? 51  SER A HB3  2  
ATOM 6116   H HG   . SER A 1 51  ? -10.206 20.093  0.819   1.00 1.85  ? 51  SER A HG   2  
ATOM 6117   N N    . ALA A 1 52  ? -13.232 16.467  1.917   1.00 0.53  ? 52  ALA A N    2  
ATOM 6118   C CA   . ALA A 1 52  ? -14.138 15.735  2.853   1.00 0.57  ? 52  ALA A CA   2  
ATOM 6119   C C    . ALA A 1 52  ? -14.298 14.264  2.437   1.00 0.58  ? 52  ALA A C    2  
ATOM 6120   O O    . ALA A 1 52  ? -14.339 13.383  3.273   1.00 0.61  ? 52  ALA A O    2  
ATOM 6121   C CB   . ALA A 1 52  ? -15.512 16.410  2.859   1.00 0.67  ? 52  ALA A CB   2  
ATOM 6122   H H    . ALA A 1 52  ? -13.584 17.191  1.354   1.00 0.57  ? 52  ALA A H    2  
ATOM 6123   H HA   . ALA A 1 52  ? -13.722 15.775  3.848   1.00 0.57  ? 52  ALA A HA   2  
ATOM 6124   H HB1  . ALA A 1 52  ? -15.928 16.391  1.863   1.00 1.14  ? 52  ALA A HB1  2  
ATOM 6125   H HB2  . ALA A 1 52  ? -16.169 15.883  3.535   1.00 1.35  ? 52  ALA A HB2  2  
ATOM 6126   H HB3  . ALA A 1 52  ? -15.408 17.434  3.187   1.00 1.21  ? 52  ALA A HB3  2  
ATOM 6127   N N    . GLN A 1 53  ? -14.406 13.984  1.164   1.00 0.62  ? 53  GLN A N    2  
ATOM 6128   C CA   . GLN A 1 53  ? -14.580 12.558  0.744   1.00 0.68  ? 53  GLN A CA   2  
ATOM 6129   C C    . GLN A 1 53  ? -13.322 11.751  1.066   1.00 0.62  ? 53  GLN A C    2  
ATOM 6130   O O    . GLN A 1 53  ? -13.400 10.640  1.552   1.00 0.63  ? 53  GLN A O    2  
ATOM 6131   C CB   . GLN A 1 53  ? -14.866 12.473  -0.755  1.00 0.78  ? 53  GLN A CB   2  
ATOM 6132   C CG   . GLN A 1 53  ? -16.262 13.023  -1.045  1.00 0.87  ? 53  GLN A CG   2  
ATOM 6133   C CD   . GLN A 1 53  ? -16.540 12.934  -2.545  1.00 1.01  ? 53  GLN A CD   2  
ATOM 6134   O OE1  . GLN A 1 53  ? -17.664 13.101  -2.977  1.00 1.41  ? 53  GLN A OE1  2  
ATOM 6135   N NE2  . GLN A 1 53  ? -15.559 12.666  -3.363  1.00 1.66  ? 53  GLN A NE2  2  
ATOM 6136   H H    . GLN A 1 53  ? -14.379 14.706  0.503   1.00 0.65  ? 53  GLN A H    2  
ATOM 6137   H HA   . GLN A 1 53  ? -15.414 12.135  1.285   1.00 0.74  ? 53  GLN A HA   2  
ATOM 6138   H HB2  . GLN A 1 53  ? -14.132 13.049  -1.294  1.00 0.74  ? 53  GLN A HB2  2  
ATOM 6139   H HB3  . GLN A 1 53  ? -14.817 11.442  -1.072  1.00 0.84  ? 53  GLN A HB3  2  
ATOM 6140   H HG2  . GLN A 1 53  ? -16.997 12.444  -0.505  1.00 0.94  ? 53  GLN A HG2  2  
ATOM 6141   H HG3  . GLN A 1 53  ? -16.314 14.055  -0.733  1.00 0.84  ? 53  GLN A HG3  2  
ATOM 6142   H HE21 . GLN A 1 53  ? -14.654 12.525  -3.014  1.00 2.34  ? 53  GLN A HE21 2  
ATOM 6143   H HE22 . GLN A 1 53  ? -15.727 12.606  -4.327  1.00 1.73  ? 53  GLN A HE22 2  
ATOM 6144   N N    . LEU A 1 54  ? -12.160 12.291  0.813   1.00 0.58  ? 54  LEU A N    2  
ATOM 6145   C CA   . LEU A 1 54  ? -10.917 11.532  1.127   1.00 0.55  ? 54  LEU A CA   2  
ATOM 6146   C C    . LEU A 1 54  ? -10.849 11.296  2.634   1.00 0.50  ? 54  LEU A C    2  
ATOM 6147   O O    . LEU A 1 54  ? -10.482 10.232  3.090   1.00 0.59  ? 54  LEU A O    2  
ATOM 6148   C CB   . LEU A 1 54  ? -9.692  12.326  0.661   1.00 0.54  ? 54  LEU A CB   2  
ATOM 6149   C CG   . LEU A 1 54  ? -9.630  12.351  -0.877  1.00 0.76  ? 54  LEU A CG   2  
ATOM 6150   C CD1  . LEU A 1 54  ? -8.563  13.359  -1.321  1.00 1.58  ? 54  LEU A CD1  2  
ATOM 6151   C CD2  . LEU A 1 54  ? -9.274  10.952  -1.425  1.00 1.13  ? 54  LEU A CD2  2  
ATOM 6152   H H    . LEU A 1 54  ? -12.107 13.191  0.427   1.00 0.60  ? 54  LEU A H    2  
ATOM 6153   H HA   . LEU A 1 54  ? -10.945 10.580  0.622   1.00 0.61  ? 54  LEU A HA   2  
ATOM 6154   H HB2  . LEU A 1 54  ? -9.765  13.338  1.031   1.00 0.53  ? 54  LEU A HB2  2  
ATOM 6155   H HB3  . LEU A 1 54  ? -8.796  11.868  1.051   1.00 0.57  ? 54  LEU A HB3  2  
ATOM 6156   H HG   . LEU A 1 54  ? -10.590 12.654  -1.269  1.00 1.56  ? 54  LEU A HG   2  
ATOM 6157   H HD11 . LEU A 1 54  ? -7.672  13.226  -0.727  1.00 2.13  ? 54  LEU A HD11 2  
ATOM 6158   H HD12 . LEU A 1 54  ? -8.328  13.198  -2.364  1.00 2.20  ? 54  LEU A HD12 2  
ATOM 6159   H HD13 . LEU A 1 54  ? -8.938  14.362  -1.188  1.00 1.98  ? 54  LEU A HD13 2  
ATOM 6160   H HD21 . LEU A 1 54  ? -8.596  10.450  -0.749  1.00 1.63  ? 54  LEU A HD21 2  
ATOM 6161   H HD22 . LEU A 1 54  ? -10.174 10.366  -1.531  1.00 1.83  ? 54  LEU A HD22 2  
ATOM 6162   H HD23 . LEU A 1 54  ? -8.803  11.049  -2.394  1.00 1.65  ? 54  LEU A HD23 2  
ATOM 6163   N N    . GLU A 1 55  ? -11.221 12.274  3.411   1.00 0.45  ? 55  GLU A N    2  
ATOM 6164   C CA   . GLU A 1 55  ? -11.199 12.096  4.887   1.00 0.45  ? 55  GLU A CA   2  
ATOM 6165   C C    . GLU A 1 55  ? -12.242 11.046  5.273   1.00 0.49  ? 55  GLU A C    2  
ATOM 6166   O O    . GLU A 1 55  ? -12.053 10.271  6.188   1.00 0.50  ? 55  GLU A O    2  
ATOM 6167   C CB   . GLU A 1 55  ? -11.530 13.423  5.572   1.00 0.46  ? 55  GLU A CB   2  
ATOM 6168   C CG   . GLU A 1 55  ? -10.374 14.405  5.382   1.00 0.48  ? 55  GLU A CG   2  
ATOM 6169   C CD   . GLU A 1 55  ? -9.172  13.941  6.207   1.00 0.56  ? 55  GLU A CD   2  
ATOM 6170   O OE1  . GLU A 1 55  ? -9.354  13.072  7.044   1.00 1.09  ? 55  GLU A OE1  2  
ATOM 6171   O OE2  . GLU A 1 55  ? -8.092  14.461  5.989   1.00 1.35  ? 55  GLU A OE2  2  
ATOM 6172   H H    . GLU A 1 55  ? -11.530 13.121  3.024   1.00 0.49  ? 55  GLU A H    2  
ATOM 6173   H HA   . GLU A 1 55  ? -10.220 11.763  5.197   1.00 0.46  ? 55  GLU A HA   2  
ATOM 6174   H HB2  . GLU A 1 55  ? -12.428 13.837  5.140   1.00 0.47  ? 55  GLU A HB2  2  
ATOM 6175   H HB3  . GLU A 1 55  ? -11.683 13.253  6.627   1.00 0.50  ? 55  GLU A HB3  2  
ATOM 6176   H HG2  . GLU A 1 55  ? -10.102 14.442  4.337   1.00 0.47  ? 55  GLU A HG2  2  
ATOM 6177   H HG3  . GLU A 1 55  ? -10.677 15.387  5.712   1.00 0.51  ? 55  GLU A HG3  2  
ATOM 6178   N N    . THR A 1 56  ? -13.345 11.015  4.575   1.00 0.53  ? 56  THR A N    2  
ATOM 6179   C CA   . THR A 1 56  ? -14.406 10.018  4.890   1.00 0.59  ? 56  THR A CA   2  
ATOM 6180   C C    . THR A 1 56  ? -13.873 8.602   4.654   1.00 0.57  ? 56  THR A C    2  
ATOM 6181   O O    . THR A 1 56  ? -14.116 7.700   5.433   1.00 0.61  ? 56  THR A O    2  
ATOM 6182   C CB   . THR A 1 56  ? -15.615 10.271  3.985   1.00 0.67  ? 56  THR A CB   2  
ATOM 6183   O OG1  . THR A 1 56  ? -16.108 11.584  4.213   1.00 0.70  ? 56  THR A OG1  2  
ATOM 6184   C CG2  . THR A 1 56  ? -16.713 9.252   4.292   1.00 0.77  ? 56  THR A CG2  2  
ATOM 6185   H H    . THR A 1 56  ? -13.475 11.645  3.835   1.00 0.54  ? 56  THR A H    2  
ATOM 6186   H HA   . THR A 1 56  ? -14.702 10.123  5.922   1.00 0.62  ? 56  THR A HA   2  
ATOM 6187   H HB   . THR A 1 56  ? -15.317 10.172  2.953   1.00 0.66  ? 56  THR A HB   2  
ATOM 6188   H HG1  . THR A 1 56  ? -15.534 12.009  4.853   1.00 1.14  ? 56  THR A HG1  2  
ATOM 6189   H HG21 . THR A 1 56  ? -16.866 9.198   5.360   1.00 1.19  ? 56  THR A HG21 2  
ATOM 6190   H HG22 . THR A 1 56  ? -17.631 9.558   3.811   1.00 1.33  ? 56  THR A HG22 2  
ATOM 6191   H HG23 . THR A 1 56  ? -16.418 8.282   3.920   1.00 1.34  ? 56  THR A HG23 2  
ATOM 6192   N N    . ILE A 1 57  ? -13.144 8.397   3.590   1.00 0.55  ? 57  ILE A N    2  
ATOM 6193   C CA   . ILE A 1 57  ? -12.593 7.038   3.310   1.00 0.56  ? 57  ILE A CA   2  
ATOM 6194   C C    . ILE A 1 57  ? -11.647 6.643   4.445   1.00 0.53  ? 57  ILE A C    2  
ATOM 6195   O O    . ILE A 1 57  ? -11.619 5.510   4.882   1.00 0.57  ? 57  ILE A O    2  
ATOM 6196   C CB   . ILE A 1 57  ? -11.825 7.045   1.984   1.00 0.56  ? 57  ILE A CB   2  
ATOM 6197   C CG1  . ILE A 1 57  ? -12.779 7.398   0.840   1.00 0.59  ? 57  ILE A CG1  2  
ATOM 6198   C CG2  . ILE A 1 57  ? -11.237 5.655   1.730   1.00 0.62  ? 57  ILE A CG2  2  
ATOM 6199   C CD1  . ILE A 1 57  ? -11.975 7.650   -0.437  1.00 0.63  ? 57  ILE A CD1  2  
ATOM 6200   H H    . ILE A 1 57  ? -12.958 9.137   2.977   1.00 0.55  ? 57  ILE A H    2  
ATOM 6201   H HA   . ILE A 1 57  ? -13.403 6.326   3.254   1.00 0.60  ? 57  ILE A HA   2  
ATOM 6202   H HB   . ILE A 1 57  ? -11.027 7.773   2.031   1.00 0.55  ? 57  ILE A HB   2  
ATOM 6203   H HG12 . ILE A 1 57  ? -13.461 6.576   0.677   1.00 0.64  ? 57  ILE A HG12 2  
ATOM 6204   H HG13 . ILE A 1 57  ? -13.337 8.286   1.094   1.00 0.60  ? 57  ILE A HG13 2  
ATOM 6205   H HG21 . ILE A 1 57  ? -12.018 4.914   1.814   1.00 1.26  ? 57  ILE A HG21 2  
ATOM 6206   H HG22 . ILE A 1 57  ? -10.813 5.618   0.737   1.00 1.19  ? 57  ILE A HG22 2  
ATOM 6207   H HG23 . ILE A 1 57  ? -10.467 5.449   2.458   1.00 1.15  ? 57  ILE A HG23 2  
ATOM 6208   H HD11 . ILE A 1 57  ? -11.244 8.423   -0.256  1.00 1.16  ? 57  ILE A HD11 2  
ATOM 6209   H HD12 . ILE A 1 57  ? -11.473 6.741   -0.731  1.00 1.19  ? 57  ILE A HD12 2  
ATOM 6210   H HD13 . ILE A 1 57  ? -12.643 7.964   -1.226  1.00 1.22  ? 57  ILE A HD13 2  
ATOM 6211   N N    . LYS A 1 58  ? -10.867 7.574   4.918   1.00 0.50  ? 58  LYS A N    2  
ATOM 6212   C CA   . LYS A 1 58  ? -9.910  7.268   6.018   1.00 0.51  ? 58  LYS A CA   2  
ATOM 6213   C C    . LYS A 1 58  ? -10.662 6.659   7.201   1.00 0.54  ? 58  LYS A C    2  
ATOM 6214   O O    . LYS A 1 58  ? -10.261 5.654   7.751   1.00 0.55  ? 58  LYS A O    2  
ATOM 6215   C CB   . LYS A 1 58  ? -9.258  8.579   6.479   1.00 0.52  ? 58  LYS A CB   2  
ATOM 6216   C CG   . LYS A 1 58  ? -8.287  8.316   7.642   1.00 0.55  ? 58  LYS A CG   2  
ATOM 6217   C CD   . LYS A 1 58  ? -7.768  9.650   8.197   1.00 0.62  ? 58  LYS A CD   2  
ATOM 6218   C CE   . LYS A 1 58  ? -8.841  10.320  9.077   1.00 0.70  ? 58  LYS A CE   2  
ATOM 6219   N NZ   . LYS A 1 58  ? -8.189  11.327  9.961   1.00 1.14  ? 58  LYS A NZ   2  
ATOM 6220   H H    . LYS A 1 58  ? -10.909 8.478   4.541   1.00 0.51  ? 58  LYS A H    2  
ATOM 6221   H HA   . LYS A 1 58  ? -9.152  6.585   5.670   1.00 0.51  ? 58  LYS A HA   2  
ATOM 6222   H HB2  . LYS A 1 58  ? -8.715  9.016   5.653   1.00 0.52  ? 58  LYS A HB2  2  
ATOM 6223   H HB3  . LYS A 1 58  ? -10.026 9.261   6.802   1.00 0.54  ? 58  LYS A HB3  2  
ATOM 6224   H HG2  . LYS A 1 58  ? -8.788  7.773   8.424   1.00 0.57  ? 58  LYS A HG2  2  
ATOM 6225   H HG3  . LYS A 1 58  ? -7.453  7.734   7.284   1.00 0.55  ? 58  LYS A HG3  2  
ATOM 6226   H HD2  . LYS A 1 58  ? -6.882  9.468   8.789   1.00 0.62  ? 58  LYS A HD2  2  
ATOM 6227   H HD3  . LYS A 1 58  ? -7.520  10.307  7.377   1.00 0.66  ? 58  LYS A HD3  2  
ATOM 6228   H HE2  . LYS A 1 58  ? -9.566  10.814  8.450   1.00 1.02  ? 58  LYS A HE2  2  
ATOM 6229   H HE3  . LYS A 1 58  ? -9.342  9.578   9.688   1.00 1.09  ? 58  LYS A HE3  2  
ATOM 6230   H HZ1  . LYS A 1 58  ? -7.310  11.660  9.519   1.00 1.70  ? 58  LYS A HZ1  2  
ATOM 6231   H HZ2  . LYS A 1 58  ? -8.831  12.132  10.101  1.00 1.60  ? 58  LYS A HZ2  2  
ATOM 6232   H HZ3  . LYS A 1 58  ? -7.973  10.892  10.882  1.00 1.59  ? 58  LYS A HZ3  2  
ATOM 6233   N N    . THR A 1 59  ? -11.720 7.283   7.622   1.00 0.58  ? 59  THR A N    2  
ATOM 6234   C CA   . THR A 1 59  ? -12.463 6.766   8.800   1.00 0.64  ? 59  THR A CA   2  
ATOM 6235   C C    . THR A 1 59  ? -12.929 5.331   8.533   1.00 0.63  ? 59  THR A C    2  
ATOM 6236   O O    . THR A 1 59  ? -12.915 4.493   9.413   1.00 0.65  ? 59  THR A O    2  
ATOM 6237   C CB   . THR A 1 59  ? -13.665 7.674   9.076   1.00 0.71  ? 59  THR A CB   2  
ATOM 6238   O OG1  . THR A 1 59  ? -13.287 9.026   8.850   1.00 0.73  ? 59  THR A OG1  2  
ATOM 6239   C CG2  . THR A 1 59  ? -14.094 7.524   10.536  1.00 0.79  ? 59  THR A CG2  2  
ATOM 6240   H H    . THR A 1 59  ? -12.003 8.117   7.191   1.00 0.59  ? 59  THR A H    2  
ATOM 6241   H HA   . THR A 1 59  ? -11.803 6.769   9.657   1.00 0.66  ? 59  THR A HA   2  
ATOM 6242   H HB   . THR A 1 59  ? -14.487 7.409   8.429   1.00 0.72  ? 59  THR A HB   2  
ATOM 6243   H HG1  . THR A 1 59  ? -12.332 9.057   8.763   1.00 1.15  ? 59  THR A HG1  2  
ATOM 6244   H HG21 . THR A 1 59  ? -14.273 6.481   10.753  1.00 1.35  ? 59  THR A HG21 2  
ATOM 6245   H HG22 . THR A 1 59  ? -13.304 7.897   11.175  1.00 1.10  ? 59  THR A HG22 2  
ATOM 6246   H HG23 . THR A 1 59  ? -14.995 8.091   10.708  1.00 1.35  ? 59  THR A HG23 2  
ATOM 6247   N N    . LYS A 1 60  ? -13.325 5.032   7.327   1.00 0.60  ? 60  LYS A N    2  
ATOM 6248   C CA   . LYS A 1 60  ? -13.765 3.642   7.019   1.00 0.61  ? 60  LYS A CA   2  
ATOM 6249   C C    . LYS A 1 60  ? -12.563 2.706   7.090   1.00 0.58  ? 60  LYS A C    2  
ATOM 6250   O O    . LYS A 1 60  ? -12.661 1.579   7.534   1.00 0.62  ? 60  LYS A O    2  
ATOM 6251   C CB   . LYS A 1 60  ? -14.372 3.572   5.615   1.00 0.61  ? 60  LYS A CB   2  
ATOM 6252   C CG   . LYS A 1 60  ? -15.716 4.302   5.591   1.00 0.65  ? 60  LYS A CG   2  
ATOM 6253   C CD   . LYS A 1 60  ? -16.308 4.222   4.181   1.00 0.68  ? 60  LYS A CD   2  
ATOM 6254   C CE   . LYS A 1 60  ? -17.659 4.944   4.141   1.00 1.06  ? 60  LYS A CE   2  
ATOM 6255   N NZ   . LYS A 1 60  ? -18.434 4.471   2.959   1.00 1.53  ? 60  LYS A NZ   2  
ATOM 6256   H H    . LYS A 1 60  ? -13.311 5.713   6.624   1.00 0.59  ? 60  LYS A H    2  
ATOM 6257   H HA   . LYS A 1 60  ? -14.503 3.331   7.745   1.00 0.65  ? 60  LYS A HA   2  
ATOM 6258   H HB2  . LYS A 1 60  ? -13.697 4.036   4.910   1.00 0.59  ? 60  LYS A HB2  2  
ATOM 6259   H HB3  . LYS A 1 60  ? -14.522 2.538   5.341   1.00 0.64  ? 60  LYS A HB3  2  
ATOM 6260   H HG2  . LYS A 1 60  ? -16.392 3.837   6.294   1.00 0.69  ? 60  LYS A HG2  2  
ATOM 6261   H HG3  . LYS A 1 60  ? -15.570 5.336   5.861   1.00 0.64  ? 60  LYS A HG3  2  
ATOM 6262   H HD2  . LYS A 1 60  ? -15.630 4.689   3.481   1.00 0.79  ? 60  LYS A HD2  2  
ATOM 6263   H HD3  . LYS A 1 60  ? -16.447 3.186   3.908   1.00 0.87  ? 60  LYS A HD3  2  
ATOM 6264   H HE2  . LYS A 1 60  ? -18.214 4.727   5.043   1.00 1.69  ? 60  LYS A HE2  2  
ATOM 6265   H HE3  . LYS A 1 60  ? -17.497 6.008   4.064   1.00 1.56  ? 60  LYS A HE3  2  
ATOM 6266   H HZ1  . LYS A 1 60  ? -18.105 3.522   2.687   1.00 2.08  ? 60  LYS A HZ1  2  
ATOM 6267   H HZ2  . LYS A 1 60  ? -19.444 4.433   3.199   1.00 2.00  ? 60  LYS A HZ2  2  
ATOM 6268   H HZ3  . LYS A 1 60  ? -18.293 5.129   2.166   1.00 1.94  ? 60  LYS A HZ3  2  
ATOM 6269   N N    . ALA A 1 61  ? -11.432 3.169   6.648   1.00 0.53  ? 61  ALA A N    2  
ATOM 6270   C CA   . ALA A 1 61  ? -10.211 2.322   6.674   1.00 0.53  ? 61  ALA A CA   2  
ATOM 6271   C C    . ALA A 1 61  ? -9.796  2.050   8.126   1.00 0.55  ? 61  ALA A C    2  
ATOM 6272   O O    . ALA A 1 61  ? -9.485  0.936   8.496   1.00 0.57  ? 61  ALA A O    2  
ATOM 6273   C CB   . ALA A 1 61  ? -9.088  3.071   5.932   1.00 0.54  ? 61  ALA A CB   2  
ATOM 6274   H H    . ALA A 1 61  ? -11.381 4.084   6.299   1.00 0.53  ? 61  ALA A H    2  
ATOM 6275   H HA   . ALA A 1 61  ? -10.414 1.383   6.177   1.00 0.53  ? 61  ALA A HA   2  
ATOM 6276   H HB1  . ALA A 1 61  ? -9.529  3.785   5.252   1.00 1.21  ? 61  ALA A HB1  2  
ATOM 6277   H HB2  . ALA A 1 61  ? -8.462  3.601   6.639   1.00 1.08  ? 61  ALA A HB2  2  
ATOM 6278   H HB3  . ALA A 1 61  ? -8.485  2.368   5.374   1.00 1.16  ? 61  ALA A HB3  2  
ATOM 6279   N N    . GLY A 1 62  ? -9.773  3.067   8.941   1.00 0.58  ? 62  GLY A N    2  
ATOM 6280   C CA   . GLY A 1 62  ? -9.361  2.884   10.359  1.00 0.65  ? 62  GLY A CA   2  
ATOM 6281   C C    . GLY A 1 62  ? -10.288 1.895   11.064  1.00 0.69  ? 62  GLY A C    2  
ATOM 6282   O O    . GLY A 1 62  ? -9.840  0.969   11.713  1.00 0.75  ? 62  GLY A O    2  
ATOM 6283   H H    . GLY A 1 62  ? -10.011 3.959   8.615   1.00 0.58  ? 62  GLY A H    2  
ATOM 6284   H HA2  . GLY A 1 62  ? -8.351  2.511   10.389  1.00 0.65  ? 62  GLY A HA2  2  
ATOM 6285   H HA3  . GLY A 1 62  ? -9.406  3.835   10.868  1.00 0.69  ? 62  GLY A HA3  2  
ATOM 6286   N N    . GLU A 1 63  ? -11.574 2.081   10.961  1.00 0.69  ? 63  GLU A N    2  
ATOM 6287   C CA   . GLU A 1 63  ? -12.505 1.146   11.649  1.00 0.77  ? 63  GLU A CA   2  
ATOM 6288   C C    . GLU A 1 63  ? -12.476 -0.222  10.966  1.00 0.74  ? 63  GLU A C    2  
ATOM 6289   O O    . GLU A 1 63  ? -12.523 -1.249  11.614  1.00 0.82  ? 63  GLU A O    2  
ATOM 6290   C CB   . GLU A 1 63  ? -13.926 1.710   11.589  1.00 0.81  ? 63  GLU A CB   2  
ATOM 6291   C CG   . GLU A 1 63  ? -14.022 2.942   12.490  1.00 0.87  ? 63  GLU A CG   2  
ATOM 6292   C CD   . GLU A 1 63  ? -15.373 3.627   12.277  1.00 0.93  ? 63  GLU A CD   2  
ATOM 6293   O OE1  . GLU A 1 63  ? -16.155 3.120   11.489  1.00 1.59  ? 63  GLU A OE1  2  
ATOM 6294   O OE2  . GLU A 1 63  ? -15.601 4.650   12.901  1.00 1.23  ? 63  GLU A OE2  2  
ATOM 6295   H H    . GLU A 1 63  ? -11.924 2.836   10.444  1.00 0.65  ? 63  GLU A H    2  
ATOM 6296   H HA   . GLU A 1 63  ? -12.207 1.036   12.678  1.00 0.83  ? 63  GLU A HA   2  
ATOM 6297   H HB2  . GLU A 1 63  ? -14.160 1.988   10.571  1.00 0.78  ? 63  GLU A HB2  2  
ATOM 6298   H HB3  . GLU A 1 63  ? -14.626 0.962   11.928  1.00 0.85  ? 63  GLU A HB3  2  
ATOM 6299   H HG2  . GLU A 1 63  ? -13.930 2.640   13.522  1.00 0.95  ? 63  GLU A HG2  2  
ATOM 6300   H HG3  . GLU A 1 63  ? -13.228 3.631   12.243  1.00 0.84  ? 63  GLU A HG3  2  
ATOM 6301   N N    . THR A 1 64  ? -12.431 -0.250  9.665   1.00 0.66  ? 64  THR A N    2  
ATOM 6302   C CA   . THR A 1 64  ? -12.436 -1.552  8.941   1.00 0.66  ? 64  THR A CA   2  
ATOM 6303   C C    . THR A 1 64  ? -11.117 -2.312  9.142   1.00 0.61  ? 64  THR A C    2  
ATOM 6304   O O    . THR A 1 64  ? -11.112 -3.439  9.596   1.00 0.64  ? 64  THR A O    2  
ATOM 6305   C CB   . THR A 1 64  ? -12.638 -1.267  7.448   1.00 0.64  ? 64  THR A CB   2  
ATOM 6306   O OG1  . THR A 1 64  ? -13.888 -0.618  7.260   1.00 0.71  ? 64  THR A OG1  2  
ATOM 6307   C CG2  . THR A 1 64  ? -12.618 -2.572  6.654   1.00 0.73  ? 64  THR A CG2  2  
ATOM 6308   H H    . THR A 1 64  ? -12.432 0.579   9.144   1.00 0.61  ? 64  THR A H    2  
ATOM 6309   H HA   . THR A 1 64  ? -13.254 -2.158  9.299   1.00 0.74  ? 64  THR A HA   2  
ATOM 6310   H HB   . THR A 1 64  ? -11.846 -0.625  7.096   1.00 0.59  ? 64  THR A HB   2  
ATOM 6311   H HG1  . THR A 1 64  ? -14.482 -1.237  6.829   1.00 1.11  ? 64  THR A HG1  2  
ATOM 6312   H HG21 . THR A 1 64  ? -13.328 -3.265  7.079   1.00 1.19  ? 64  THR A HG21 2  
ATOM 6313   H HG22 . THR A 1 64  ? -12.885 -2.367  5.627   1.00 1.41  ? 64  THR A HG22 2  
ATOM 6314   H HG23 . THR A 1 64  ? -11.629 -3.000  6.689   1.00 1.16  ? 64  THR A HG23 2  
ATOM 6315   N N    . PHE A 1 65  ? -10.002 -1.725  8.777   1.00 0.57  ? 65  PHE A N    2  
ATOM 6316   C CA   . PHE A 1 65  ? -8.691  -2.444  8.914   1.00 0.57  ? 65  PHE A CA   2  
ATOM 6317   C C    . PHE A 1 65  ? -7.981  -2.058  10.216  1.00 0.63  ? 65  PHE A C    2  
ATOM 6318   O O    . PHE A 1 65  ? -7.591  -2.920  10.977  1.00 0.75  ? 65  PHE A O    2  
ATOM 6319   C CB   . PHE A 1 65  ? -7.813  -2.114  7.706   1.00 0.55  ? 65  PHE A CB   2  
ATOM 6320   C CG   . PHE A 1 65  ? -8.413  -2.769  6.479   1.00 0.55  ? 65  PHE A CG   2  
ATOM 6321   C CD1  . PHE A 1 65  ? -9.384  -2.084  5.739   1.00 0.57  ? 65  PHE A CD1  2  
ATOM 6322   C CD2  . PHE A 1 65  ? -8.016  -4.060  6.084   1.00 0.61  ? 65  PHE A CD2  2  
ATOM 6323   C CE1  . PHE A 1 65  ? -9.958  -2.681  4.613   1.00 0.62  ? 65  PHE A CE1  2  
ATOM 6324   C CE2  . PHE A 1 65  ? -8.590  -4.652  4.954   1.00 0.68  ? 65  PHE A CE2  2  
ATOM 6325   C CZ   . PHE A 1 65  ? -9.562  -3.964  4.219   1.00 0.67  ? 65  PHE A CZ   2  
ATOM 6326   H H    . PHE A 1 65  ? -10.031 -0.829  8.382   1.00 0.56  ? 65  PHE A H    2  
ATOM 6327   H HA   . PHE A 1 65  ? -8.868  -3.508  8.930   1.00 0.58  ? 65  PHE A HA   2  
ATOM 6328   H HB2  . PHE A 1 65  ? -7.779  -1.043  7.567   1.00 0.55  ? 65  PHE A HB2  2  
ATOM 6329   H HB3  . PHE A 1 65  ? -6.815  -2.493  7.866   1.00 0.59  ? 65  PHE A HB3  2  
ATOM 6330   H HD1  . PHE A 1 65  ? -9.691  -1.094  6.040   1.00 0.62  ? 65  PHE A HD1  2  
ATOM 6331   H HD2  . PHE A 1 65  ? -7.267  -4.600  6.648   1.00 0.66  ? 65  PHE A HD2  2  
ATOM 6332   H HE1  . PHE A 1 65  ? -10.709 -2.150  4.047   1.00 0.68  ? 65  PHE A HE1  2  
ATOM 6333   H HE2  . PHE A 1 65  ? -8.285  -5.643  4.650   1.00 0.79  ? 65  PHE A HE2  2  
ATOM 6334   H HZ   . PHE A 1 65  ? -10.006 -4.423  3.348   1.00 0.75  ? 65  PHE A HZ   2  
ATOM 6335   N N    . GLY A 1 66  ? -7.814  -0.787  10.499  1.00 0.59  ? 66  GLY A N    2  
ATOM 6336   C CA   . GLY A 1 66  ? -7.129  -0.396  11.779  1.00 0.67  ? 66  GLY A CA   2  
ATOM 6337   C C    . GLY A 1 66  ? -6.220  0.826   11.576  1.00 0.84  ? 66  GLY A C    2  
ATOM 6338   O O    . GLY A 1 66  ? -6.268  1.504   10.569  1.00 1.22  ? 66  GLY A O    2  
ATOM 6339   H H    . GLY A 1 66  ? -8.136  -0.092  9.892   1.00 0.55  ? 66  GLY A H    2  
ATOM 6340   H HA2  . GLY A 1 66  ? -7.878  -0.156  12.519  1.00 0.77  ? 66  GLY A HA2  2  
ATOM 6341   H HA3  . GLY A 1 66  ? -6.528  -1.219  12.142  1.00 1.02  ? 66  GLY A HA3  2  
ATOM 6342   N N    . GLU A 1 67  ? -5.392  1.096   12.551  1.00 1.60  ? 67  GLU A N    2  
ATOM 6343   C CA   . GLU A 1 67  ? -4.460  2.265   12.478  1.00 2.17  ? 67  GLU A CA   2  
ATOM 6344   C C    . GLU A 1 67  ? -3.420  2.038   11.375  1.00 1.40  ? 67  GLU A C    2  
ATOM 6345   O O    . GLU A 1 67  ? -2.855  2.968   10.836  1.00 1.44  ? 67  GLU A O    2  
ATOM 6346   C CB   . GLU A 1 67  ? -3.745  2.420   13.825  1.00 3.28  ? 67  GLU A CB   2  
ATOM 6347   C CG   . GLU A 1 67  ? -2.855  3.667   13.801  1.00 4.04  ? 67  GLU A CG   2  
ATOM 6348   C CD   . GLU A 1 67  ? -2.145  3.812   15.149  1.00 5.21  ? 67  GLU A CD   2  
ATOM 6349   O OE1  . GLU A 1 67  ? -2.493  3.080   16.061  1.00 5.73  ? 67  GLU A OE1  2  
ATOM 6350   O OE2  . GLU A 1 67  ? -1.264  4.650   15.245  1.00 5.81  ? 67  GLU A OE2  2  
ATOM 6351   H H    . GLU A 1 67  ? -5.387  0.512   13.338  1.00 2.07  ? 67  GLU A H    2  
ATOM 6352   H HA   . GLU A 1 67  ? -5.024  3.159   12.268  1.00 2.67  ? 67  GLU A HA   2  
ATOM 6353   H HB2  . GLU A 1 67  ? -4.479  2.518   14.612  1.00 3.61  ? 67  GLU A HB2  2  
ATOM 6354   H HB3  . GLU A 1 67  ? -3.134  1.549   14.010  1.00 3.66  ? 67  GLU A HB3  2  
ATOM 6355   H HG2  . GLU A 1 67  ? -2.118  3.572   13.017  1.00 4.17  ? 67  GLU A HG2  2  
ATOM 6356   H HG3  . GLU A 1 67  ? -3.462  4.541   13.621  1.00 4.03  ? 67  GLU A HG3  2  
ATOM 6357   N N    . GLU A 1 68  ? -3.159  0.807   11.057  1.00 1.13  ? 68  GLU A N    2  
ATOM 6358   C CA   . GLU A 1 68  ? -2.148  0.478   10.012  1.00 0.88  ? 68  GLU A CA   2  
ATOM 6359   C C    . GLU A 1 68  ? -2.540  1.092   8.662   1.00 0.77  ? 68  GLU A C    2  
ATOM 6360   O O    . GLU A 1 68  ? -1.694  1.494   7.888   1.00 0.83  ? 68  GLU A O    2  
ATOM 6361   C CB   . GLU A 1 68  ? -2.069  -1.044  9.868   1.00 1.52  ? 68  GLU A CB   2  
ATOM 6362   C CG   . GLU A 1 68  ? -0.849  -1.419  9.027   1.00 2.17  ? 68  GLU A CG   2  
ATOM 6363   C CD   . GLU A 1 68  ? 0.420   -1.214  9.856   1.00 2.89  ? 68  GLU A CD   2  
ATOM 6364   O OE1  . GLU A 1 68  ? 0.397   -1.548  11.030  1.00 3.35  ? 68  GLU A OE1  2  
ATOM 6365   O OE2  . GLU A 1 68  ? 1.391   -0.723  9.306   1.00 3.37  ? 68  GLU A OE2  2  
ATOM 6366   H H    . GLU A 1 68  ? -3.627  0.082   11.512  1.00 1.52  ? 68  GLU A H    2  
ATOM 6367   H HA   . GLU A 1 68  ? -1.184  0.858   10.312  1.00 0.94  ? 68  GLU A HA   2  
ATOM 6368   H HB2  . GLU A 1 68  ? -1.984  -1.494  10.846  1.00 1.89  ? 68  GLU A HB2  2  
ATOM 6369   H HB3  . GLU A 1 68  ? -2.962  -1.407  9.382   1.00 2.03  ? 68  GLU A HB3  2  
ATOM 6370   H HG2  . GLU A 1 68  ? -0.922  -2.457  8.730   1.00 2.52  ? 68  GLU A HG2  2  
ATOM 6371   H HG3  . GLU A 1 68  ? -0.808  -0.794  8.149   1.00 2.43  ? 68  GLU A HG3  2  
ATOM 6372   N N    . LYS A 1 69  ? -3.813  1.156   8.367   1.00 0.69  ? 69  LYS A N    2  
ATOM 6373   C CA   . LYS A 1 69  ? -4.260  1.730   7.057   1.00 0.65  ? 69  LYS A CA   2  
ATOM 6374   C C    . LYS A 1 69  ? -4.685  3.191   7.228   1.00 0.60  ? 69  LYS A C    2  
ATOM 6375   O O    . LYS A 1 69  ? -4.737  3.936   6.274   1.00 0.62  ? 69  LYS A O    2  
ATOM 6376   C CB   . LYS A 1 69  ? -5.450  0.923   6.526   1.00 0.68  ? 69  LYS A CB   2  
ATOM 6377   C CG   . LYS A 1 69  ? -5.040  -0.538  6.281   1.00 0.75  ? 69  LYS A CG   2  
ATOM 6378   C CD   . LYS A 1 69  ? -4.165  -0.652  5.023   1.00 1.01  ? 69  LYS A CD   2  
ATOM 6379   C CE   . LYS A 1 69  ? -4.065  -2.123  4.612   1.00 1.34  ? 69  LYS A CE   2  
ATOM 6380   N NZ   . LYS A 1 69  ? -3.692  -2.944  5.799   1.00 1.77  ? 69  LYS A NZ   2  
ATOM 6381   H H    . LYS A 1 69  ? -4.473  0.834   9.013   1.00 0.70  ? 69  LYS A H    2  
ATOM 6382   H HA   . LYS A 1 69  ? -3.453  1.686   6.344   1.00 0.70  ? 69  LYS A HA   2  
ATOM 6383   H HB2  . LYS A 1 69  ? -6.251  0.952   7.251   1.00 0.71  ? 69  LYS A HB2  2  
ATOM 6384   H HB3  . LYS A 1 69  ? -5.793  1.359   5.600   1.00 0.74  ? 69  LYS A HB3  2  
ATOM 6385   H HG2  . LYS A 1 69  ? -4.486  -0.900  7.134   1.00 0.89  ? 69  LYS A HG2  2  
ATOM 6386   H HG3  . LYS A 1 69  ? -5.927  -1.139  6.152   1.00 0.76  ? 69  LYS A HG3  2  
ATOM 6387   H HD2  . LYS A 1 69  ? -4.607  -0.084  4.218   1.00 1.28  ? 69  LYS A HD2  2  
ATOM 6388   H HD3  . LYS A 1 69  ? -3.176  -0.278  5.231   1.00 1.30  ? 69  LYS A HD3  2  
ATOM 6389   H HE2  . LYS A 1 69  ? -5.017  -2.456  4.227   1.00 1.72  ? 69  LYS A HE2  2  
ATOM 6390   H HE3  . LYS A 1 69  ? -3.309  -2.232  3.848   1.00 2.03  ? 69  LYS A HE3  2  
ATOM 6391   H HZ1  . LYS A 1 69  ? -3.275  -2.332  6.527   1.00 2.10  ? 69  LYS A HZ1  2  
ATOM 6392   H HZ2  . LYS A 1 69  ? -4.545  -3.405  6.179   1.00 2.37  ? 69  LYS A HZ2  2  
ATOM 6393   H HZ3  . LYS A 1 69  ? -3.001  -3.667  5.518   1.00 2.17  ? 69  LYS A HZ3  2  
ATOM 6394   N N    . GLU A 1 70  ? -4.985  3.616   8.424   1.00 0.60  ? 70  GLU A N    2  
ATOM 6395   C CA   . GLU A 1 70  ? -5.400  5.036   8.620   1.00 0.62  ? 70  GLU A CA   2  
ATOM 6396   C C    . GLU A 1 70  ? -4.210  5.965   8.391   1.00 0.61  ? 70  GLU A C    2  
ATOM 6397   O O    . GLU A 1 70  ? -4.340  7.026   7.814   1.00 0.62  ? 70  GLU A O    2  
ATOM 6398   C CB   . GLU A 1 70  ? -5.916  5.215   10.046  1.00 0.70  ? 70  GLU A CB   2  
ATOM 6399   C CG   . GLU A 1 70  ? -6.255  6.686   10.301  1.00 0.99  ? 70  GLU A CG   2  
ATOM 6400   C CD   . GLU A 1 70  ? -6.971  6.821   11.646  1.00 1.02  ? 70  GLU A CD   2  
ATOM 6401   O OE1  . GLU A 1 70  ? -7.279  5.799   12.237  1.00 1.65  ? 70  GLU A OE1  2  
ATOM 6402   O OE2  . GLU A 1 70  ? -7.199  7.944   12.063  1.00 1.33  ? 70  GLU A OE2  2  
ATOM 6403   H H    . GLU A 1 70  ? -4.930  3.017   9.197   1.00 0.63  ? 70  GLU A H    2  
ATOM 6404   H HA   . GLU A 1 70  ? -6.185  5.280   7.922   1.00 0.64  ? 70  GLU A HA   2  
ATOM 6405   H HB2  . GLU A 1 70  ? -6.803  4.612   10.182  1.00 1.17  ? 70  GLU A HB2  2  
ATOM 6406   H HB3  . GLU A 1 70  ? -5.154  4.900   10.740  1.00 1.07  ? 70  GLU A HB3  2  
ATOM 6407   H HG2  . GLU A 1 70  ? -5.345  7.268   10.321  1.00 1.40  ? 70  GLU A HG2  2  
ATOM 6408   H HG3  . GLU A 1 70  ? -6.896  7.048   9.516   1.00 1.46  ? 70  GLU A HG3  2  
ATOM 6409   N N    . ALA A 1 71  ? -3.056  5.581   8.849   1.00 0.64  ? 71  ALA A N    2  
ATOM 6410   C CA   . ALA A 1 71  ? -1.862  6.453   8.668   1.00 0.69  ? 71  ALA A CA   2  
ATOM 6411   C C    . ALA A 1 71  ? -1.562  6.615   7.172   1.00 0.66  ? 71  ALA A C    2  
ATOM 6412   O O    . ALA A 1 71  ? -1.103  7.650   6.732   1.00 0.68  ? 71  ALA A O    2  
ATOM 6413   C CB   . ALA A 1 71  ? -0.664  5.824   9.392   1.00 0.77  ? 71  ALA A CB   2  
ATOM 6414   H H    . ALA A 1 71  ? -2.976  4.721   9.322   1.00 0.65  ? 71  ALA A H    2  
ATOM 6415   H HA   . ALA A 1 71  ? -2.067  7.424   9.092   1.00 0.73  ? 71  ALA A HA   2  
ATOM 6416   H HB1  . ALA A 1 71  ? -0.746  4.751   9.349   1.00 1.17  ? 71  ALA A HB1  2  
ATOM 6417   H HB2  . ALA A 1 71  ? 0.258   6.136   8.919   1.00 1.42  ? 71  ALA A HB2  2  
ATOM 6418   H HB3  . ALA A 1 71  ? -0.660  6.142   10.425  1.00 1.24  ? 71  ALA A HB3  2  
ATOM 6419   N N    . ILE A 1 72  ? -1.809  5.600   6.388   1.00 0.65  ? 72  ILE A N    2  
ATOM 6420   C CA   . ILE A 1 72  ? -1.523  5.710   4.926   1.00 0.65  ? 72  ILE A CA   2  
ATOM 6421   C C    . ILE A 1 72  ? -2.345  6.855   4.320   1.00 0.60  ? 72  ILE A C    2  
ATOM 6422   O O    . ILE A 1 72  ? -1.847  7.633   3.531   1.00 0.60  ? 72  ILE A O    2  
ATOM 6423   C CB   . ILE A 1 72  ? -1.872  4.388   4.229   1.00 0.69  ? 72  ILE A CB   2  
ATOM 6424   C CG1  . ILE A 1 72  ? -0.861  3.310   4.648   1.00 0.77  ? 72  ILE A CG1  2  
ATOM 6425   C CG2  . ILE A 1 72  ? -1.815  4.572   2.708   1.00 0.73  ? 72  ILE A CG2  2  
ATOM 6426   C CD1  . ILE A 1 72  ? -1.325  1.928   4.168   1.00 0.80  ? 72  ILE A CD1  2  
ATOM 6427   H H    . ILE A 1 72  ? -2.172  4.770   6.767   1.00 0.65  ? 72  ILE A H    2  
ATOM 6428   H HA   . ILE A 1 72  ? -0.474  5.918   4.788   1.00 0.70  ? 72  ILE A HA   2  
ATOM 6429   H HB   . ILE A 1 72  ? -2.869  4.087   4.518   1.00 0.69  ? 72  ILE A HB   2  
ATOM 6430   H HG12 . ILE A 1 72  ? 0.102   3.533   4.209   1.00 0.85  ? 72  ILE A HG12 2  
ATOM 6431   H HG13 . ILE A 1 72  ? -0.769  3.302   5.723   1.00 0.82  ? 72  ILE A HG13 2  
ATOM 6432   H HG21 . ILE A 1 72  ? -0.923  5.123   2.446   1.00 1.20  ? 72  ILE A HG21 2  
ATOM 6433   H HG22 . ILE A 1 72  ? -1.795  3.606   2.228   1.00 1.12  ? 72  ILE A HG22 2  
ATOM 6434   H HG23 . ILE A 1 72  ? -2.685  5.121   2.380   1.00 1.38  ? 72  ILE A HG23 2  
ATOM 6435   H HD11 . ILE A 1 72  ? -2.399  1.848   4.257   1.00 1.14  ? 72  ILE A HD11 2  
ATOM 6436   H HD12 . ILE A 1 72  ? -1.038  1.793   3.136   1.00 1.43  ? 72  ILE A HD12 2  
ATOM 6437   H HD13 . ILE A 1 72  ? -0.859  1.165   4.773   1.00 1.30  ? 72  ILE A HD13 2  
ATOM 6438   N N    . PHE A 1 73  ? -3.593  6.975   4.683   1.00 0.56  ? 73  PHE A N    2  
ATOM 6439   C CA   . PHE A 1 73  ? -4.424  8.084   4.121   1.00 0.53  ? 73  PHE A CA   2  
ATOM 6440   C C    . PHE A 1 73  ? -3.860  9.439   4.548   1.00 0.52  ? 73  PHE A C    2  
ATOM 6441   O O    . PHE A 1 73  ? -3.848  10.381  3.779   1.00 0.51  ? 73  PHE A O    2  
ATOM 6442   C CB   . PHE A 1 73  ? -5.881  7.935   4.577   1.00 0.54  ? 73  PHE A CB   2  
ATOM 6443   C CG   . PHE A 1 73  ? -6.587  6.937   3.685   1.00 0.58  ? 73  PHE A CG   2  
ATOM 6444   C CD1  . PHE A 1 73  ? -6.323  5.570   3.810   1.00 0.58  ? 73  PHE A CD1  2  
ATOM 6445   C CD2  . PHE A 1 73  ? -7.499  7.388   2.723   1.00 0.77  ? 73  PHE A CD2  2  
ATOM 6446   C CE1  . PHE A 1 73  ? -6.968  4.654   2.974   1.00 0.66  ? 73  PHE A CE1  2  
ATOM 6447   C CE2  . PHE A 1 73  ? -8.146  6.473   1.888   1.00 0.88  ? 73  PHE A CE2  2  
ATOM 6448   C CZ   . PHE A 1 73  ? -7.881  5.107   2.013   1.00 0.78  ? 73  PHE A CZ   2  
ATOM 6449   H H    . PHE A 1 73  ? -3.979  6.347   5.333   1.00 0.57  ? 73  PHE A H    2  
ATOM 6450   H HA   . PHE A 1 73  ? -4.384  8.029   3.045   1.00 0.54  ? 73  PHE A HA   2  
ATOM 6451   H HB2  . PHE A 1 73  ? -5.897  7.580   5.594   1.00 0.55  ? 73  PHE A HB2  2  
ATOM 6452   H HB3  . PHE A 1 73  ? -6.384  8.891   4.519   1.00 0.58  ? 73  PHE A HB3  2  
ATOM 6453   H HD1  . PHE A 1 73  ? -5.621  5.223   4.548   1.00 0.64  ? 73  PHE A HD1  2  
ATOM 6454   H HD2  . PHE A 1 73  ? -7.703  8.443   2.625   1.00 0.91  ? 73  PHE A HD2  2  
ATOM 6455   H HE1  . PHE A 1 73  ? -6.762  3.600   3.069   1.00 0.73  ? 73  PHE A HE1  2  
ATOM 6456   H HE2  . PHE A 1 73  ? -8.849  6.823   1.147   1.00 1.08  ? 73  PHE A HE2  2  
ATOM 6457   H HZ   . PHE A 1 73  ? -8.380  4.401   1.368   1.00 0.88  ? 73  PHE A HZ   2  
ATOM 6458   N N    . GLU A 1 74  ? -3.393  9.558   5.756   1.00 0.55  ? 74  GLU A N    2  
ATOM 6459   C CA   . GLU A 1 74  ? -2.837  10.867  6.194   1.00 0.58  ? 74  GLU A CA   2  
ATOM 6460   C C    . GLU A 1 74  ? -1.667  11.239  5.288   1.00 0.57  ? 74  GLU A C    2  
ATOM 6461   O O    . GLU A 1 74  ? -1.502  12.381  4.907   1.00 0.58  ? 74  GLU A O    2  
ATOM 6462   C CB   . GLU A 1 74  ? -2.353  10.772  7.643   1.00 0.64  ? 74  GLU A CB   2  
ATOM 6463   C CG   . GLU A 1 74  ? -1.787  12.126  8.075   1.00 0.73  ? 74  GLU A CG   2  
ATOM 6464   C CD   . GLU A 1 74  ? -1.490  12.102  9.574   1.00 0.79  ? 74  GLU A CD   2  
ATOM 6465   O OE1  . GLU A 1 74  ? -1.763  11.088  10.196  1.00 1.34  ? 74  GLU A OE1  2  
ATOM 6466   O OE2  . GLU A 1 74  ? -0.995  13.098  10.077  1.00 1.37  ? 74  GLU A OE2  2  
ATOM 6467   H H    . GLU A 1 74  ? -3.405  8.795   6.369   1.00 0.57  ? 74  GLU A H    2  
ATOM 6468   H HA   . GLU A 1 74  ? -3.602  11.624  6.119   1.00 0.58  ? 74  GLU A HA   2  
ATOM 6469   H HB2  . GLU A 1 74  ? -3.181  10.506  8.283   1.00 0.64  ? 74  GLU A HB2  2  
ATOM 6470   H HB3  . GLU A 1 74  ? -1.581  10.020  7.718   1.00 0.66  ? 74  GLU A HB3  2  
ATOM 6471   H HG2  . GLU A 1 74  ? -0.874  12.324  7.530   1.00 0.81  ? 74  GLU A HG2  2  
ATOM 6472   H HG3  . GLU A 1 74  ? -2.506  12.903  7.865   1.00 0.78  ? 74  GLU A HG3  2  
ATOM 6473   N N    . GLY A 1 75  ? -0.853  10.284  4.931   1.00 0.59  ? 75  GLY A N    2  
ATOM 6474   C CA   . GLY A 1 75  ? 0.299   10.592  4.041   1.00 0.62  ? 75  GLY A CA   2  
ATOM 6475   C C    . GLY A 1 75  ? -0.219  11.122  2.704   1.00 0.59  ? 75  GLY A C    2  
ATOM 6476   O O    . GLY A 1 75  ? 0.155   12.190  2.264   1.00 0.60  ? 75  GLY A O    2  
ATOM 6477   H H    . GLY A 1 75  ? -1.005  9.369   5.242   1.00 0.62  ? 75  GLY A H    2  
ATOM 6478   H HA2  . GLY A 1 75  ? 0.927   11.338  4.508   1.00 0.65  ? 75  GLY A HA2  2  
ATOM 6479   H HA3  . GLY A 1 75  ? 0.871   9.696   3.867   1.00 0.67  ? 75  GLY A HA3  2  
ATOM 6480   N N    . HIS A 1 76  ? -1.081  10.388  2.054   1.00 0.56  ? 76  HIS A N    2  
ATOM 6481   C CA   . HIS A 1 76  ? -1.617  10.862  0.749   1.00 0.56  ? 76  HIS A CA   2  
ATOM 6482   C C    . HIS A 1 76  ? -2.363  12.178  0.959   1.00 0.53  ? 76  HIS A C    2  
ATOM 6483   O O    . HIS A 1 76  ? -2.155  13.141  0.246   1.00 0.57  ? 76  HIS A O    2  
ATOM 6484   C CB   . HIS A 1 76  ? -2.574  9.816   0.171   1.00 0.58  ? 76  HIS A CB   2  
ATOM 6485   C CG   . HIS A 1 76  ? -1.791  8.609   -0.270  1.00 0.64  ? 76  HIS A CG   2  
ATOM 6486   N ND1  . HIS A 1 76  ? -2.400  7.504   -0.849  1.00 1.50  ? 76  HIS A ND1  2  
ATOM 6487   C CD2  . HIS A 1 76  ? -0.449  8.319   -0.231  1.00 1.07  ? 76  HIS A CD2  2  
ATOM 6488   C CE1  . HIS A 1 76  ? -1.434  6.609   -1.132  1.00 1.28  ? 76  HIS A CE1  2  
ATOM 6489   N NE2  . HIS A 1 76  ? -0.231  7.058   -0.776  1.00 0.79  ? 76  HIS A NE2  2  
ATOM 6490   H H    . HIS A 1 76  ? -1.376  9.529   2.424   1.00 0.57  ? 76  HIS A H    2  
ATOM 6491   H HA   . HIS A 1 76  ? -0.802  11.021  0.063   1.00 0.60  ? 76  HIS A HA   2  
ATOM 6492   H HB2  . HIS A 1 76  ? -3.288  9.525   0.927   1.00 0.58  ? 76  HIS A HB2  2  
ATOM 6493   H HB3  . HIS A 1 76  ? -3.095  10.235  -0.676  1.00 0.61  ? 76  HIS A HB3  2  
ATOM 6494   H HD2  . HIS A 1 76  ? 0.319   8.968   0.164   1.00 1.99  ? 76  HIS A HD2  2  
ATOM 6495   H HE1  . HIS A 1 76  ? -1.613  5.648   -1.592  1.00 1.94  ? 76  HIS A HE1  2  
ATOM 6496   H HE2  . HIS A 1 76  ? 0.628   6.598   -0.877  1.00 1.09  ? 76  HIS A HE2  2  
ATOM 6497   N N    . ILE A 1 77  ? -3.224  12.233  1.935   1.00 0.51  ? 77  ILE A N    2  
ATOM 6498   C CA   . ILE A 1 77  ? -3.971  13.495  2.188   1.00 0.51  ? 77  ILE A CA   2  
ATOM 6499   C C    . ILE A 1 77  ? -2.978  14.605  2.541   1.00 0.52  ? 77  ILE A C    2  
ATOM 6500   O O    . ILE A 1 77  ? -3.026  15.688  1.991   1.00 0.52  ? 77  ILE A O    2  
ATOM 6501   C CB   . ILE A 1 77  ? -4.966  13.301  3.341   1.00 0.54  ? 77  ILE A CB   2  
ATOM 6502   C CG1  . ILE A 1 77  ? -6.088  12.353  2.890   1.00 0.58  ? 77  ILE A CG1  2  
ATOM 6503   C CG2  . ILE A 1 77  ? -5.568  14.658  3.733   1.00 0.58  ? 77  ILE A CG2  2  
ATOM 6504   C CD1  . ILE A 1 77  ? -6.962  11.959  4.088   1.00 0.63  ? 77  ILE A CD1  2  
ATOM 6505   H H    . ILE A 1 77  ? -3.374  11.449  2.501   1.00 0.53  ? 77  ILE A H    2  
ATOM 6506   H HA   . ILE A 1 77  ? -4.510  13.773  1.294   1.00 0.53  ? 77  ILE A HA   2  
ATOM 6507   H HB   . ILE A 1 77  ? -4.450  12.877  4.191   1.00 0.55  ? 77  ILE A HB   2  
ATOM 6508   H HG12 . ILE A 1 77  ? -6.697  12.848  2.148   1.00 0.63  ? 77  ILE A HG12 2  
ATOM 6509   H HG13 . ILE A 1 77  ? -5.652  11.463  2.459   1.00 0.58  ? 77  ILE A HG13 2  
ATOM 6510   H HG21 . ILE A 1 77  ? -5.792  15.226  2.842   1.00 1.22  ? 77  ILE A HG21 2  
ATOM 6511   H HG22 . ILE A 1 77  ? -6.475  14.504  4.296   1.00 1.06  ? 77  ILE A HG22 2  
ATOM 6512   H HG23 . ILE A 1 77  ? -4.859  15.204  4.337   1.00 1.21  ? 77  ILE A HG23 2  
ATOM 6513   H HD11 . ILE A 1 77  ? -6.337  11.755  4.944   1.00 1.19  ? 77  ILE A HD11 2  
ATOM 6514   H HD12 . ILE A 1 77  ? -7.640  12.768  4.322   1.00 1.22  ? 77  ILE A HD12 2  
ATOM 6515   H HD13 . ILE A 1 77  ? -7.531  11.075  3.841   1.00 1.16  ? 77  ILE A HD13 2  
ATOM 6516   N N    . MET A 1 78  ? -2.086  14.356  3.466   1.00 0.54  ? 78  MET A N    2  
ATOM 6517   C CA   . MET A 1 78  ? -1.105  15.402  3.863   1.00 0.59  ? 78  MET A CA   2  
ATOM 6518   C C    . MET A 1 78  ? -0.261  15.816  2.660   1.00 0.58  ? 78  MET A C    2  
ATOM 6519   O O    . MET A 1 78  ? 0.020   16.980  2.455   1.00 0.62  ? 78  MET A O    2  
ATOM 6520   C CB   . MET A 1 78  ? -0.210  14.839  4.971   1.00 0.64  ? 78  MET A CB   2  
ATOM 6521   C CG   . MET A 1 78  ? 0.809   15.890  5.401   1.00 0.70  ? 78  MET A CG   2  
ATOM 6522   S SD   . MET A 1 78  ? 1.527   15.418  6.996   1.00 0.84  ? 78  MET A SD   2  
ATOM 6523   C CE   . MET A 1 78  ? 2.114   13.775  6.515   1.00 1.51  ? 78  MET A CE   2  
ATOM 6524   H H    . MET A 1 78  ? -2.056  13.486  3.919   1.00 0.55  ? 78  MET A H    2  
ATOM 6525   H HA   . MET A 1 78  ? -1.632  16.261  4.236   1.00 0.61  ? 78  MET A HA   2  
ATOM 6526   H HB2  . MET A 1 78  ? -0.820  14.563  5.818   1.00 0.69  ? 78  MET A HB2  2  
ATOM 6527   H HB3  . MET A 1 78  ? 0.310   13.967  4.603   1.00 0.64  ? 78  MET A HB3  2  
ATOM 6528   H HG2  . MET A 1 78  ? 1.590   15.950  4.660   1.00 0.70  ? 78  MET A HG2  2  
ATOM 6529   H HG3  . MET A 1 78  ? 0.325   16.851  5.493   1.00 0.79  ? 78  MET A HG3  2  
ATOM 6530   H HE1  . MET A 1 78  ? 2.523   13.812  5.519   1.00 2.11  ? 78  MET A HE1  2  
ATOM 6531   H HE2  . MET A 1 78  ? 2.880   13.452  7.206   1.00 2.01  ? 78  MET A HE2  2  
ATOM 6532   H HE3  . MET A 1 78  ? 1.286   13.078  6.539   1.00 2.02  ? 78  MET A HE3  2  
ATOM 6533   N N    . LEU A 1 79  ? 0.135   14.875  1.858   1.00 0.58  ? 79  LEU A N    2  
ATOM 6534   C CA   . LEU A 1 79  ? 0.952   15.211  0.661   1.00 0.60  ? 79  LEU A CA   2  
ATOM 6535   C C    . LEU A 1 79  ? 0.106   16.024  -0.317  1.00 0.55  ? 79  LEU A C    2  
ATOM 6536   O O    . LEU A 1 79  ? 0.570   16.969  -0.924  1.00 0.58  ? 79  LEU A O    2  
ATOM 6537   C CB   . LEU A 1 79  ? 1.436   13.916  0.010   1.00 0.62  ? 79  LEU A CB   2  
ATOM 6538   C CG   . LEU A 1 79  ? 2.076   14.194  -1.369  1.00 0.67  ? 79  LEU A CG   2  
ATOM 6539   C CD1  . LEU A 1 79  ? 3.266   15.171  -1.223  1.00 0.77  ? 79  LEU A CD1  2  
ATOM 6540   C CD2  . LEU A 1 79  ? 2.539   12.867  -2.017  1.00 0.71  ? 79  LEU A CD2  2  
ATOM 6541   H H    . LEU A 1 79  ? -0.109  13.944  2.039   1.00 0.60  ? 79  LEU A H    2  
ATOM 6542   H HA   . LEU A 1 79  ? 1.805   15.789  0.971   1.00 0.65  ? 79  LEU A HA   2  
ATOM 6543   H HB2  . LEU A 1 79  ? 2.167   13.471  0.661   1.00 0.67  ? 79  LEU A HB2  2  
ATOM 6544   H HB3  . LEU A 1 79  ? 0.603   13.240  -0.109  1.00 0.59  ? 79  LEU A HB3  2  
ATOM 6545   H HG   . LEU A 1 79  ? 1.340   14.643  -2.013  1.00 0.65  ? 79  LEU A HG   2  
ATOM 6546   H HD11 . LEU A 1 79  ? 3.652   15.146  -0.215  1.00 1.33  ? 79  LEU A HD11 2  
ATOM 6547   H HD12 . LEU A 1 79  ? 4.055   14.897  -1.912  1.00 1.25  ? 79  LEU A HD12 2  
ATOM 6548   H HD13 . LEU A 1 79  ? 2.930   16.170  -1.449  1.00 1.31  ? 79  LEU A HD13 2  
ATOM 6549   H HD21 . LEU A 1 79  ? 1.939   12.046  -1.650  1.00 1.26  ? 79  LEU A HD21 2  
ATOM 6550   H HD22 . LEU A 1 79  ? 2.418   12.937  -3.086  1.00 1.14  ? 79  LEU A HD22 2  
ATOM 6551   H HD23 . LEU A 1 79  ? 3.579   12.686  -1.789  1.00 1.24  ? 79  LEU A HD23 2  
ATOM 6552   N N    . LEU A 1 80  ? -1.133  15.664  -0.465  1.00 0.51  ? 80  LEU A N    2  
ATOM 6553   C CA   . LEU A 1 80  ? -2.022  16.408  -1.393  1.00 0.50  ? 80  LEU A CA   2  
ATOM 6554   C C    . LEU A 1 80  ? -2.194  17.845  -0.888  1.00 0.53  ? 80  LEU A C    2  
ATOM 6555   O O    . LEU A 1 80  ? -2.241  18.784  -1.657  1.00 0.57  ? 80  LEU A O    2  
ATOM 6556   C CB   . LEU A 1 80  ? -3.387  15.710  -1.469  1.00 0.51  ? 80  LEU A CB   2  
ATOM 6557   C CG   . LEU A 1 80  ? -4.326  16.464  -2.426  1.00 0.53  ? 80  LEU A CG   2  
ATOM 6558   C CD1  . LEU A 1 80  ? -3.723  16.509  -3.840  1.00 0.58  ? 80  LEU A CD1  2  
ATOM 6559   C CD2  . LEU A 1 80  ? -5.680  15.744  -2.468  1.00 0.62  ? 80  LEU A CD2  2  
ATOM 6560   H H    . LEU A 1 80  ? -1.480  14.910  0.057   1.00 0.52  ? 80  LEU A H    2  
ATOM 6561   H HA   . LEU A 1 80  ? -1.567  16.422  -2.374  1.00 0.51  ? 80  LEU A HA   2  
ATOM 6562   H HB2  . LEU A 1 80  ? -3.252  14.700  -1.824  1.00 0.55  ? 80  LEU A HB2  2  
ATOM 6563   H HB3  . LEU A 1 80  ? -3.829  15.685  -0.484  1.00 0.53  ? 80  LEU A HB3  2  
ATOM 6564   H HG   . LEU A 1 80  ? -4.470  17.473  -2.067  1.00 0.55  ? 80  LEU A HG   2  
ATOM 6565   H HD11 . LEU A 1 80  ? -3.200  15.586  -4.044  1.00 1.10  ? 80  LEU A HD11 2  
ATOM 6566   H HD12 . LEU A 1 80  ? -4.510  16.642  -4.569  1.00 1.18  ? 80  LEU A HD12 2  
ATOM 6567   H HD13 . LEU A 1 80  ? -3.032  17.337  -3.909  1.00 1.19  ? 80  LEU A HD13 2  
ATOM 6568   H HD21 . LEU A 1 80  ? -5.978  15.472  -1.465  1.00 1.29  ? 80  LEU A HD21 2  
ATOM 6569   H HD22 . LEU A 1 80  ? -6.424  16.401  -2.897  1.00 1.13  ? 80  LEU A HD22 2  
ATOM 6570   H HD23 . LEU A 1 80  ? -5.596  14.853  -3.072  1.00 1.18  ? 80  LEU A HD23 2  
ATOM 6571   N N    . GLU A 1 81  ? -2.301  18.019  0.402   1.00 0.57  ? 81  GLU A N    2  
ATOM 6572   C CA   . GLU A 1 81  ? -2.484  19.388  0.967   1.00 0.65  ? 81  GLU A CA   2  
ATOM 6573   C C    . GLU A 1 81  ? -1.136  20.112  1.037   1.00 0.68  ? 81  GLU A C    2  
ATOM 6574   O O    . GLU A 1 81  ? -1.047  21.224  1.521   1.00 0.76  ? 81  GLU A O    2  
ATOM 6575   C CB   . GLU A 1 81  ? -3.061  19.272  2.379   1.00 0.73  ? 81  GLU A CB   2  
ATOM 6576   C CG   . GLU A 1 81  ? -4.438  18.609  2.318   1.00 0.76  ? 81  GLU A CG   2  
ATOM 6577   C CD   . GLU A 1 81  ? -4.991  18.455  3.736   1.00 0.87  ? 81  GLU A CD   2  
ATOM 6578   O OE1  . GLU A 1 81  ? -4.301  18.841  4.665   1.00 1.32  ? 81  GLU A OE1  2  
ATOM 6579   O OE2  . GLU A 1 81  ? -6.093  17.948  3.869   1.00 1.47  ? 81  GLU A OE2  2  
ATOM 6580   H H    . GLU A 1 81  ? -2.264  17.249  1.008   1.00 0.58  ? 81  GLU A H    2  
ATOM 6581   H HA   . GLU A 1 81  ? -3.165  19.948  0.345   1.00 0.67  ? 81  GLU A HA   2  
ATOM 6582   H HB2  . GLU A 1 81  ? -2.400  18.674  2.989   1.00 0.71  ? 81  GLU A HB2  2  
ATOM 6583   H HB3  . GLU A 1 81  ? -3.156  20.257  2.811   1.00 0.84  ? 81  GLU A HB3  2  
ATOM 6584   H HG2  . GLU A 1 81  ? -5.108  19.225  1.735   1.00 0.84  ? 81  GLU A HG2  2  
ATOM 6585   H HG3  . GLU A 1 81  ? -4.350  17.636  1.860   1.00 0.70  ? 81  GLU A HG3  2  
ATOM 6586   N N    . ASP A 1 82  ? -0.087  19.493  0.573   1.00 0.64  ? 82  ASP A N    2  
ATOM 6587   C CA   . ASP A 1 82  ? 1.250   20.154  0.635   1.00 0.71  ? 82  ASP A CA   2  
ATOM 6588   C C    . ASP A 1 82  ? 1.147   21.582  0.082   1.00 0.73  ? 82  ASP A C    2  
ATOM 6589   O O    . ASP A 1 82  ? 0.596   21.819  -0.975  1.00 0.68  ? 82  ASP A O    2  
ATOM 6590   C CB   . ASP A 1 82  ? 2.257   19.347  -0.188  1.00 0.70  ? 82  ASP A CB   2  
ATOM 6591   C CG   . ASP A 1 82  ? 3.649   19.968  -0.048  1.00 0.81  ? 82  ASP A CG   2  
ATOM 6592   O OD1  . ASP A 1 82  ? 3.724   21.146  0.259   1.00 1.28  ? 82  ASP A OD1  2  
ATOM 6593   O OD2  . ASP A 1 82  ? 4.617   19.254  -0.253  1.00 1.47  ? 82  ASP A OD2  2  
ATOM 6594   H H    . ASP A 1 82  ? -0.175  18.592  0.199   1.00 0.60  ? 82  ASP A H    2  
ATOM 6595   H HA   . ASP A 1 82  ? 1.580   20.194  1.663   1.00 0.77  ? 82  ASP A HA   2  
ATOM 6596   H HB2  . ASP A 1 82  ? 2.279   18.329  0.171   1.00 0.69  ? 82  ASP A HB2  2  
ATOM 6597   H HB3  . ASP A 1 82  ? 1.963   19.357  -1.224  1.00 0.66  ? 82  ASP A HB3  2  
ATOM 6598   N N    . GLU A 1 83  ? 1.661   22.533  0.817   1.00 0.83  ? 83  GLU A N    2  
ATOM 6599   C CA   . GLU A 1 83  ? 1.592   23.962  0.386   1.00 0.88  ? 83  GLU A CA   2  
ATOM 6600   C C    . GLU A 1 83  ? 2.360   24.190  -0.920  1.00 0.88  ? 83  GLU A C    2  
ATOM 6601   O O    . GLU A 1 83  ? 2.130   25.160  -1.614  1.00 0.90  ? 83  GLU A O    2  
ATOM 6602   C CB   . GLU A 1 83  ? 2.187   24.851  1.481   1.00 1.02  ? 83  GLU A CB   2  
ATOM 6603   C CG   . GLU A 1 83  ? 1.246   24.877  2.688   1.00 1.08  ? 83  GLU A CG   2  
ATOM 6604   C CD   . GLU A 1 83  ? 1.842   25.765  3.782   1.00 1.23  ? 83  GLU A CD   2  
ATOM 6605   O OE1  . GLU A 1 83  ? 2.994   26.143  3.648   1.00 1.78  ? 83  GLU A OE1  2  
ATOM 6606   O OE2  . GLU A 1 83  ? 1.138   26.047  4.738   1.00 1.57  ? 83  GLU A OE2  2  
ATOM 6607   H H    . GLU A 1 83  ? 2.075   22.307  1.675   1.00 0.89  ? 83  GLU A H    2  
ATOM 6608   H HA   . GLU A 1 83  ? 0.557   24.235  0.238   1.00 0.85  ? 83  GLU A HA   2  
ATOM 6609   H HB2  . GLU A 1 83  ? 3.146   24.456  1.782   1.00 1.06  ? 83  GLU A HB2  2  
ATOM 6610   H HB3  . GLU A 1 83  ? 2.313   25.855  1.103   1.00 1.08  ? 83  GLU A HB3  2  
ATOM 6611   H HG2  . GLU A 1 83  ? 0.286   25.270  2.387   1.00 1.12  ? 83  GLU A HG2  2  
ATOM 6612   H HG3  . GLU A 1 83  ? 1.122   23.875  3.068   1.00 1.07  ? 83  GLU A HG3  2  
ATOM 6613   N N    . GLU A 1 84  ? 3.249   23.309  -1.283  1.00 0.87  ? 84  GLU A N    2  
ATOM 6614   C CA   . GLU A 1 84  ? 3.989   23.498  -2.564  1.00 0.89  ? 84  GLU A CA   2  
ATOM 6615   C C    . GLU A 1 84  ? 3.029   23.231  -3.727  1.00 0.79  ? 84  GLU A C    2  
ATOM 6616   O O    . GLU A 1 84  ? 3.122   23.826  -4.782  1.00 0.79  ? 84  GLU A O    2  
ATOM 6617   C CB   . GLU A 1 84  ? 5.170   22.523  -2.638  1.00 0.96  ? 84  GLU A CB   2  
ATOM 6618   C CG   . GLU A 1 84  ? 6.228   22.912  -1.600  1.00 1.07  ? 84  GLU A CG   2  
ATOM 6619   C CD   . GLU A 1 84  ? 7.407   21.936  -1.675  1.00 1.87  ? 84  GLU A CD   2  
ATOM 6620   O OE1  . GLU A 1 84  ? 7.435   21.140  -2.600  1.00 2.52  ? 84  GLU A OE1  2  
ATOM 6621   O OE2  . GLU A 1 84  ? 8.267   22.005  -0.812  1.00 2.53  ? 84  GLU A OE2  2  
ATOM 6622   H H    . GLU A 1 84  ? 3.401   22.504  -0.747  1.00 0.86  ? 84  GLU A H    2  
ATOM 6623   H HA   . GLU A 1 84  ? 4.353   24.514  -2.622  1.00 0.95  ? 84  GLU A HA   2  
ATOM 6624   H HB2  . GLU A 1 84  ? 4.822   21.520  -2.439  1.00 0.92  ? 84  GLU A HB2  2  
ATOM 6625   H HB3  . GLU A 1 84  ? 5.607   22.564  -3.624  1.00 1.01  ? 84  GLU A HB3  2  
ATOM 6626   H HG2  . GLU A 1 84  ? 6.575   23.916  -1.799  1.00 1.48  ? 84  GLU A HG2  2  
ATOM 6627   H HG3  . GLU A 1 84  ? 5.793   22.872  -0.612  1.00 1.32  ? 84  GLU A HG3  2  
ATOM 6628   N N    . LEU A 1 85  ? 2.101   22.335  -3.523  1.00 0.73  ? 85  LEU A N    2  
ATOM 6629   C CA   . LEU A 1 85  ? 1.112   22.008  -4.593  1.00 0.66  ? 85  LEU A CA   2  
ATOM 6630   C C    . LEU A 1 85  ? 0.138   23.171  -4.776  1.00 0.61  ? 85  LEU A C    2  
ATOM 6631   O O    . LEU A 1 85  ? -0.235  23.520  -5.878  1.00 0.62  ? 85  LEU A O    2  
ATOM 6632   C CB   . LEU A 1 85  ? 0.310   20.771  -4.190  1.00 0.63  ? 85  LEU A CB   2  
ATOM 6633   C CG   . LEU A 1 85  ? 1.225   19.540  -4.111  1.00 0.70  ? 85  LEU A CG   2  
ATOM 6634   C CD1  . LEU A 1 85  ? 0.453   18.380  -3.470  1.00 0.71  ? 85  LEU A CD1  2  
ATOM 6635   C CD2  . LEU A 1 85  ? 1.696   19.129  -5.519  1.00 0.80  ? 85  LEU A CD2  2  
ATOM 6636   H H    . LEU A 1 85  ? 2.054   21.901  -2.646  1.00 0.74  ? 85  LEU A H    2  
ATOM 6637   H HA   . LEU A 1 85  ? 1.627   21.823  -5.520  1.00 0.70  ? 85  LEU A HA   2  
ATOM 6638   H HB2  . LEU A 1 85  ? -0.141  20.946  -3.225  1.00 0.61  ? 85  LEU A HB2  2  
ATOM 6639   H HB3  . LEU A 1 85  ? -0.468  20.595  -4.917  1.00 0.62  ? 85  LEU A HB3  2  
ATOM 6640   H HG   . LEU A 1 85  ? 2.085   19.777  -3.501  1.00 0.73  ? 85  LEU A HG   2  
ATOM 6641   H HD11 . LEU A 1 85  ? -0.086  18.733  -2.603  1.00 1.19  ? 85  LEU A HD11 2  
ATOM 6642   H HD12 . LEU A 1 85  ? -0.246  17.973  -4.185  1.00 1.29  ? 85  LEU A HD12 2  
ATOM 6643   H HD13 . LEU A 1 85  ? 1.145   17.609  -3.168  1.00 1.19  ? 85  LEU A HD13 2  
ATOM 6644   H HD21 . LEU A 1 85  ? 0.898   19.279  -6.231  1.00 1.19  ? 85  LEU A HD21 2  
ATOM 6645   H HD22 . LEU A 1 85  ? 2.547   19.729  -5.803  1.00 1.36  ? 85  LEU A HD22 2  
ATOM 6646   H HD23 . LEU A 1 85  ? 1.982   18.086  -5.518  1.00 1.34  ? 85  LEU A HD23 2  
ATOM 6647   N N    . GLU A 1 86  ? -0.295  23.758  -3.698  1.00 0.62  ? 86  GLU A N    2  
ATOM 6648   C CA   . GLU A 1 86  ? -1.270  24.880  -3.796  1.00 0.62  ? 86  GLU A CA   2  
ATOM 6649   C C    . GLU A 1 86  ? -0.675  26.029  -4.608  1.00 0.66  ? 86  GLU A C    2  
ATOM 6650   O O    . GLU A 1 86  ? -1.325  26.600  -5.461  1.00 0.63  ? 86  GLU A O    2  
ATOM 6651   C CB   . GLU A 1 86  ? -1.616  25.369  -2.388  1.00 0.68  ? 86  GLU A CB   2  
ATOM 6652   C CG   . GLU A 1 86  ? -2.709  26.438  -2.465  1.00 0.81  ? 86  GLU A CG   2  
ATOM 6653   C CD   . GLU A 1 86  ? -3.049  26.922  -1.054  1.00 0.84  ? 86  GLU A CD   2  
ATOM 6654   O OE1  . GLU A 1 86  ? -2.585  26.304  -0.109  1.00 1.35  ? 86  GLU A OE1  2  
ATOM 6655   O OE2  . GLU A 1 86  ? -3.766  27.903  -0.941  1.00 1.42  ? 86  GLU A OE2  2  
ATOM 6656   H H    . GLU A 1 86  ? 0.006   23.445  -2.819  1.00 0.66  ? 86  GLU A H    2  
ATOM 6657   H HA   . GLU A 1 86  ? -2.167  24.530  -4.281  1.00 0.57  ? 86  GLU A HA   2  
ATOM 6658   H HB2  . GLU A 1 86  ? -1.968  24.536  -1.795  1.00 0.69  ? 86  GLU A HB2  2  
ATOM 6659   H HB3  . GLU A 1 86  ? -0.736  25.791  -1.927  1.00 0.74  ? 86  GLU A HB3  2  
ATOM 6660   H HG2  . GLU A 1 86  ? -2.357  27.271  -3.056  1.00 0.94  ? 86  GLU A HG2  2  
ATOM 6661   H HG3  . GLU A 1 86  ? -3.593  26.018  -2.922  1.00 0.93  ? 86  GLU A HG3  2  
ATOM 6662   N N    . GLN A 1 87  ? 0.546   26.386  -4.338  1.00 0.76  ? 87  GLN A N    2  
ATOM 6663   C CA   . GLN A 1 87  ? 1.171   27.516  -5.083  1.00 0.83  ? 87  GLN A CA   2  
ATOM 6664   C C    . GLN A 1 87  ? 1.443   27.121  -6.542  1.00 0.79  ? 87  GLN A C    2  
ATOM 6665   O O    . GLN A 1 87  ? 1.241   27.899  -7.451  1.00 0.81  ? 87  GLN A O    2  
ATOM 6666   C CB   . GLN A 1 87  ? 2.492   27.881  -4.405  1.00 0.95  ? 87  GLN A CB   2  
ATOM 6667   C CG   . GLN A 1 87  ? 2.206   28.525  -3.046  1.00 1.02  ? 87  GLN A CG   2  
ATOM 6668   C CD   . GLN A 1 87  ? 3.526   28.891  -2.364  1.00 1.22  ? 87  GLN A CD   2  
ATOM 6669   O OE1  . GLN A 1 87  ? 4.420   29.424  -2.991  1.00 1.71  ? 87  GLN A OE1  2  
ATOM 6670   N NE2  . GLN A 1 87  ? 3.690   28.611  -1.100  1.00 1.69  ? 87  GLN A NE2  2  
ATOM 6671   H H    . GLN A 1 87  ? 1.048   25.922  -3.635  1.00 0.81  ? 87  GLN A H    2  
ATOM 6672   H HA   . GLN A 1 87  ? 0.512   28.370  -5.059  1.00 0.84  ? 87  GLN A HA   2  
ATOM 6673   H HB2  . GLN A 1 87  ? 3.083   26.986  -4.265  1.00 0.97  ? 87  GLN A HB2  2  
ATOM 6674   H HB3  . GLN A 1 87  ? 3.035   28.579  -5.025  1.00 1.01  ? 87  GLN A HB3  2  
ATOM 6675   H HG2  . GLN A 1 87  ? 1.614   29.417  -3.189  1.00 1.06  ? 87  GLN A HG2  2  
ATOM 6676   H HG3  . GLN A 1 87  ? 1.664   27.827  -2.426  1.00 0.95  ? 87  GLN A HG3  2  
ATOM 6677   H HE21 . GLN A 1 87  ? 2.973   28.170  -0.597  1.00 2.27  ? 87  GLN A HE21 2  
ATOM 6678   H HE22 . GLN A 1 87  ? 4.531   28.843  -0.652  1.00 1.81  ? 87  GLN A HE22 2  
ATOM 6679   N N    . GLU A 1 88  ? 1.923   25.928  -6.768  1.00 0.77  ? 88  GLU A N    2  
ATOM 6680   C CA   . GLU A 1 88  ? 2.235   25.493  -8.165  1.00 0.77  ? 88  GLU A CA   2  
ATOM 6681   C C    . GLU A 1 88  ? 0.960   25.285  -8.994  1.00 0.69  ? 88  GLU A C    2  
ATOM 6682   O O    . GLU A 1 88  ? 0.908   25.632  -10.156 1.00 0.70  ? 88  GLU A O    2  
ATOM 6683   C CB   . GLU A 1 88  ? 3.028   24.187  -8.110  1.00 0.81  ? 88  GLU A CB   2  
ATOM 6684   C CG   . GLU A 1 88  ? 4.429   24.466  -7.560  1.00 0.91  ? 88  GLU A CG   2  
ATOM 6685   C CD   . GLU A 1 88  ? 5.228   23.162  -7.503  1.00 1.00  ? 88  GLU A CD   2  
ATOM 6686   O OE1  . GLU A 1 88  ? 4.632   22.117  -7.700  1.00 1.57  ? 88  GLU A OE1  2  
ATOM 6687   O OE2  . GLU A 1 88  ? 6.422   23.232  -7.258  1.00 1.39  ? 88  GLU A OE2  2  
ATOM 6688   H H    . GLU A 1 88  ? 2.095   25.320  -6.018  1.00 0.76  ? 88  GLU A H    2  
ATOM 6689   H HA   . GLU A 1 88  ? 2.838   26.250  -8.638  1.00 0.83  ? 88  GLU A HA   2  
ATOM 6690   H HB2  . GLU A 1 88  ? 2.521   23.484  -7.466  1.00 0.78  ? 88  GLU A HB2  2  
ATOM 6691   H HB3  . GLU A 1 88  ? 3.109   23.772  -9.105  1.00 0.83  ? 88  GLU A HB3  2  
ATOM 6692   H HG2  . GLU A 1 88  ? 4.935   25.168  -8.208  1.00 0.95  ? 88  GLU A HG2  2  
ATOM 6693   H HG3  . GLU A 1 88  ? 4.351   24.883  -6.568  1.00 0.96  ? 88  GLU A HG3  2  
ATOM 6694   N N    . ILE A 1 89  ? -0.064  24.724  -8.415  1.00 0.62  ? 89  ILE A N    2  
ATOM 6695   C CA   . ILE A 1 89  ? -1.323  24.499  -9.191  1.00 0.58  ? 89  ILE A CA   2  
ATOM 6696   C C    . ILE A 1 89  ? -1.939  25.846  -9.574  1.00 0.59  ? 89  ILE A C    2  
ATOM 6697   O O    . ILE A 1 89  ? -2.306  26.082  -10.709 1.00 0.65  ? 89  ILE A O    2  
ATOM 6698   C CB   . ILE A 1 89  ? -2.315  23.704  -8.335  1.00 0.54  ? 89  ILE A CB   2  
ATOM 6699   C CG1  . ILE A 1 89  ? -1.784  22.282  -8.131  1.00 0.53  ? 89  ILE A CG1  2  
ATOM 6700   C CG2  . ILE A 1 89  ? -3.671  23.640  -9.045  1.00 0.56  ? 89  ILE A CG2  2  
ATOM 6701   C CD1  . ILE A 1 89  ? -2.615  21.575  -7.058  1.00 0.54  ? 89  ILE A CD1  2  
ATOM 6702   H H    . ILE A 1 89  ? -0.008  24.459  -7.475  1.00 0.62  ? 89  ILE A H    2  
ATOM 6703   H HA   . ILE A 1 89  ? -1.096  23.942  -10.089 1.00 0.61  ? 89  ILE A HA   2  
ATOM 6704   H HB   . ILE A 1 89  ? -2.432  24.188  -7.376  1.00 0.54  ? 89  ILE A HB   2  
ATOM 6705   H HG12 . ILE A 1 89  ? -1.855  21.735  -9.060  1.00 0.56  ? 89  ILE A HG12 2  
ATOM 6706   H HG13 . ILE A 1 89  ? -0.752  22.322  -7.817  1.00 0.55  ? 89  ILE A HG13 2  
ATOM 6707   H HG21 . ILE A 1 89  ? -3.521  23.412  -10.090 1.00 1.19  ? 89  ILE A HG21 2  
ATOM 6708   H HG22 . ILE A 1 89  ? -4.281  22.870  -8.593  1.00 1.08  ? 89  ILE A HG22 2  
ATOM 6709   H HG23 . ILE A 1 89  ? -4.170  24.593  -8.953  1.00 1.19  ? 89  ILE A HG23 2  
ATOM 6710   H HD11 . ILE A 1 89  ? -3.664  21.670  -7.294  1.00 1.06  ? 89  ILE A HD11 2  
ATOM 6711   H HD12 . ILE A 1 89  ? -2.347  20.528  -7.026  1.00 1.12  ? 89  ILE A HD12 2  
ATOM 6712   H HD13 . ILE A 1 89  ? -2.420  22.026  -6.096  1.00 1.17  ? 89  ILE A HD13 2  
ATOM 6713   N N    . ILE A 1 90  ? -2.064  26.721  -8.622  1.00 0.60  ? 90  ILE A N    2  
ATOM 6714   C CA   . ILE A 1 90  ? -2.666  28.057  -8.879  1.00 0.65  ? 90  ILE A CA   2  
ATOM 6715   C C    . ILE A 1 90  ? -1.753  28.905  -9.773  1.00 0.69  ? 90  ILE A C    2  
ATOM 6716   O O    . ILE A 1 90  ? -2.216  29.651  -10.613 1.00 0.74  ? 90  ILE A O    2  
ATOM 6717   C CB   . ILE A 1 90  ? -2.880  28.766  -7.542  1.00 0.71  ? 90  ILE A CB   2  
ATOM 6718   C CG1  . ILE A 1 90  ? -3.843  27.938  -6.684  1.00 0.71  ? 90  ILE A CG1  2  
ATOM 6719   C CG2  . ILE A 1 90  ? -3.475  30.150  -7.784  1.00 0.82  ? 90  ILE A CG2  2  
ATOM 6720   C CD1  . ILE A 1 90  ? -3.875  28.495  -5.259  1.00 0.79  ? 90  ILE A CD1  2  
ATOM 6721   H H    . ILE A 1 90  ? -1.771  26.493  -7.718  1.00 0.61  ? 90  ILE A H    2  
ATOM 6722   H HA   . ILE A 1 90  ? -3.618  27.931  -9.366  1.00 0.65  ? 90  ILE A HA   2  
ATOM 6723   H HB   . ILE A 1 90  ? -1.933  28.865  -7.032  1.00 0.72  ? 90  ILE A HB   2  
ATOM 6724   H HG12 . ILE A 1 90  ? -4.834  27.984  -7.112  1.00 0.75  ? 90  ILE A HG12 2  
ATOM 6725   H HG13 . ILE A 1 90  ? -3.510  26.912  -6.660  1.00 0.64  ? 90  ILE A HG13 2  
ATOM 6726   H HG21 . ILE A 1 90  ? -4.330  30.067  -8.439  1.00 1.31  ? 90  ILE A HG21 2  
ATOM 6727   H HG22 . ILE A 1 90  ? -3.784  30.580  -6.842  1.00 1.25  ? 90  ILE A HG22 2  
ATOM 6728   H HG23 . ILE A 1 90  ? -2.731  30.783  -8.241  1.00 1.38  ? 90  ILE A HG23 2  
ATOM 6729   H HD11 . ILE A 1 90  ? -2.866  28.630  -4.901  1.00 1.14  ? 90  ILE A HD11 2  
ATOM 6730   H HD12 . ILE A 1 90  ? -4.389  29.444  -5.256  1.00 1.34  ? 90  ILE A HD12 2  
ATOM 6731   H HD13 . ILE A 1 90  ? -4.396  27.802  -4.615  1.00 1.39  ? 90  ILE A HD13 2  
ATOM 6732   N N    . ALA A 1 91  ? -0.467  28.814  -9.591  1.00 0.68  ? 91  ALA A N    2  
ATOM 6733   C CA   . ALA A 1 91  ? 0.461   29.636  -10.422 1.00 0.73  ? 91  ALA A CA   2  
ATOM 6734   C C    . ALA A 1 91  ? 0.299   29.313  -11.911 1.00 0.69  ? 91  ALA A C    2  
ATOM 6735   O O    . ALA A 1 91  ? 0.203   30.199  -12.736 1.00 0.71  ? 91  ALA A O    2  
ATOM 6736   C CB   . ALA A 1 91  ? 1.905   29.361  -10.009 1.00 0.79  ? 91  ALA A CB   2  
ATOM 6737   H H    . ALA A 1 91  ? -0.110  28.207  -8.909  1.00 0.67  ? 91  ALA A H    2  
ATOM 6738   H HA   . ALA A 1 91  ? 0.244   30.679  -10.265 1.00 0.78  ? 91  ALA A HA   2  
ATOM 6739   H HB1  . ALA A 1 91  ? 2.127   28.314  -10.150 1.00 1.28  ? 91  ALA A HB1  2  
ATOM 6740   H HB2  . ALA A 1 91  ? 2.570   29.955  -10.618 1.00 1.39  ? 91  ALA A HB2  2  
ATOM 6741   H HB3  . ALA A 1 91  ? 2.038   29.621  -8.969  1.00 1.22  ? 91  ALA A HB3  2  
ATOM 6742   N N    . LEU A 1 92  ? 0.287   28.059  -12.270 1.00 0.64  ? 92  LEU A N    2  
ATOM 6743   C CA   . LEU A 1 92  ? 0.154   27.698  -13.714 1.00 0.63  ? 92  LEU A CA   2  
ATOM 6744   C C    . LEU A 1 92  ? -1.180  28.203  -14.266 1.00 0.62  ? 92  LEU A C    2  
ATOM 6745   O O    . LEU A 1 92  ? -1.241  28.794  -15.324 1.00 0.71  ? 92  LEU A O    2  
ATOM 6746   C CB   . LEU A 1 92  ? 0.209   26.177  -13.860 1.00 0.62  ? 92  LEU A CB   2  
ATOM 6747   C CG   . LEU A 1 92  ? 1.548   25.647  -13.329 1.00 0.72  ? 92  LEU A CG   2  
ATOM 6748   C CD1  . LEU A 1 92  ? 1.502   24.118  -13.292 1.00 0.69  ? 92  LEU A CD1  2  
ATOM 6749   C CD2  . LEU A 1 92  ? 2.704   26.107  -14.237 1.00 0.95  ? 92  LEU A CD2  2  
ATOM 6750   H H    . LEU A 1 92  ? 0.375   27.350  -11.601 1.00 0.63  ? 92  LEU A H    2  
ATOM 6751   H HA   . LEU A 1 92  ? 0.961   28.143  -14.274 1.00 0.67  ? 92  LEU A HA   2  
ATOM 6752   H HB2  . LEU A 1 92  ? -0.599  25.735  -13.294 1.00 0.63  ? 92  LEU A HB2  2  
ATOM 6753   H HB3  . LEU A 1 92  ? 0.104   25.910  -14.900 1.00 0.66  ? 92  LEU A HB3  2  
ATOM 6754   H HG   . LEU A 1 92  ? 1.706   26.023  -12.329 1.00 0.83  ? 92  LEU A HG   2  
ATOM 6755   H HD11 . LEU A 1 92  ? 1.100   23.746  -14.223 1.00 1.32  ? 92  LEU A HD11 2  
ATOM 6756   H HD12 . LEU A 1 92  ? 2.500   23.730  -13.150 1.00 1.20  ? 92  LEU A HD12 2  
ATOM 6757   H HD13 . LEU A 1 92  ? 0.873   23.797  -12.475 1.00 1.15  ? 92  LEU A HD13 2  
ATOM 6758   H HD21 . LEU A 1 92  ? 2.386   26.099  -15.269 1.00 1.36  ? 92  LEU A HD21 2  
ATOM 6759   H HD22 . LEU A 1 92  ? 3.002   27.108  -13.962 1.00 1.50  ? 92  LEU A HD22 2  
ATOM 6760   H HD23 . LEU A 1 92  ? 3.548   25.443  -14.117 1.00 1.44  ? 92  LEU A HD23 2  
ATOM 6761   N N    . ILE A 1 93  ? -2.247  27.986  -13.556 1.00 0.56  ? 93  ILE A N    2  
ATOM 6762   C CA   . ILE A 1 93  ? -3.570  28.465  -14.038 1.00 0.58  ? 93  ILE A CA   2  
ATOM 6763   C C    . ILE A 1 93  ? -3.514  29.983  -14.190 1.00 0.64  ? 93  ILE A C    2  
ATOM 6764   O O    . ILE A 1 93  ? -3.881  30.544  -15.199 1.00 0.66  ? 93  ILE A O    2  
ATOM 6765   C CB   . ILE A 1 93  ? -4.635  28.097  -13.007 1.00 0.60  ? 93  ILE A CB   2  
ATOM 6766   C CG1  . ILE A 1 93  ? -4.664  26.578  -12.833 1.00 0.58  ? 93  ILE A CG1  2  
ATOM 6767   C CG2  . ILE A 1 93  ? -6.003  28.581  -13.489 1.00 0.65  ? 93  ILE A CG2  2  
ATOM 6768   C CD1  . ILE A 1 93  ? -5.462  26.228  -11.577 1.00 0.60  ? 93  ILE A CD1  2  
ATOM 6769   H H    . ILE A 1 93  ? -2.178  27.520  -12.696 1.00 0.57  ? 93  ILE A H    2  
ATOM 6770   H HA   . ILE A 1 93  ? -3.805  28.008  -14.988 1.00 0.57  ? 93  ILE A HA   2  
ATOM 6771   H HB   . ILE A 1 93  ? -4.399  28.566  -12.063 1.00 0.63  ? 93  ILE A HB   2  
ATOM 6772   H HG12 . ILE A 1 93  ? -5.131  26.126  -13.696 1.00 0.60  ? 93  ILE A HG12 2  
ATOM 6773   H HG13 . ILE A 1 93  ? -3.656  26.206  -12.731 1.00 0.58  ? 93  ILE A HG13 2  
ATOM 6774   H HG21 . ILE A 1 93  ? -6.194  28.193  -14.478 1.00 1.29  ? 93  ILE A HG21 2  
ATOM 6775   H HG22 . ILE A 1 93  ? -6.768  28.231  -12.811 1.00 1.17  ? 93  ILE A HG22 2  
ATOM 6776   H HG23 . ILE A 1 93  ? -6.014  29.661  -13.517 1.00 1.13  ? 93  ILE A HG23 2  
ATOM 6777   H HD11 . ILE A 1 93  ? -6.415  26.735  -11.604 1.00 1.21  ? 93  ILE A HD11 2  
ATOM 6778   H HD12 . ILE A 1 93  ? -5.622  25.161  -11.538 1.00 1.13  ? 93  ILE A HD12 2  
ATOM 6779   H HD13 . ILE A 1 93  ? -4.910  26.542  -10.704 1.00 1.15  ? 93  ILE A HD13 2  
ATOM 6780   N N    . LYS A 1 94  ? -3.049  30.638  -13.171 1.00 0.69  ? 94  LYS A N    2  
ATOM 6781   C CA   . LYS A 1 94  ? -2.949  32.126  -13.216 1.00 0.78  ? 94  LYS A CA   2  
ATOM 6782   C C    . LYS A 1 94  ? -1.853  32.565  -14.192 1.00 0.80  ? 94  LYS A C    2  
ATOM 6783   O O    . LYS A 1 94  ? -2.002  33.537  -14.906 1.00 0.84  ? 94  LYS A O    2  
ATOM 6784   C CB   . LYS A 1 94  ? -2.623  32.672  -11.824 1.00 0.86  ? 94  LYS A CB   2  
ATOM 6785   C CG   . LYS A 1 94  ? -3.832  32.494  -10.898 1.00 0.94  ? 94  LYS A CG   2  
ATOM 6786   C CD   . LYS A 1 94  ? -3.517  33.054  -9.497  1.00 1.00  ? 94  LYS A CD   2  
ATOM 6787   C CE   . LYS A 1 94  ? -3.787  34.566  -9.449  1.00 1.48  ? 94  LYS A CE   2  
ATOM 6788   N NZ   . LYS A 1 94  ? -5.238  34.800  -9.200  1.00 2.20  ? 94  LYS A NZ   2  
ATOM 6789   H H    . LYS A 1 94  ? -2.764  30.124  -12.388 1.00 0.69  ? 94  LYS A H    2  
ATOM 6790   H HA   . LYS A 1 94  ? -3.892  32.531  -13.542 1.00 0.79  ? 94  LYS A HA   2  
ATOM 6791   H HB2  . LYS A 1 94  ? -1.778  32.132  -11.419 1.00 0.83  ? 94  LYS A HB2  2  
ATOM 6792   H HB3  . LYS A 1 94  ? -2.375  33.718  -11.901 1.00 0.97  ? 94  LYS A HB3  2  
ATOM 6793   H HG2  . LYS A 1 94  ? -4.681  33.016  -11.314 1.00 1.11  ? 94  LYS A HG2  2  
ATOM 6794   H HG3  . LYS A 1 94  ? -4.067  31.443  -10.817 1.00 1.00  ? 94  LYS A HG3  2  
ATOM 6795   H HD2  . LYS A 1 94  ? -4.142  32.561  -8.768  1.00 1.53  ? 94  LYS A HD2  2  
ATOM 6796   H HD3  . LYS A 1 94  ? -2.479  32.870  -9.259  1.00 1.50  ? 94  LYS A HD3  2  
ATOM 6797   H HE2  . LYS A 1 94  ? -3.212  35.009  -8.649  1.00 2.08  ? 94  LYS A HE2  2  
ATOM 6798   H HE3  . LYS A 1 94  ? -3.507  35.021  -10.386 1.00 1.98  ? 94  LYS A HE3  2  
ATOM 6799   H HZ1  . LYS A 1 94  ? -5.552  34.218  -8.398  1.00 2.64  ? 94  LYS A HZ1  2  
ATOM 6800   H HZ2  . LYS A 1 94  ? -5.394  35.804  -8.979  1.00 2.63  ? 94  LYS A HZ2  2  
ATOM 6801   H HZ3  . LYS A 1 94  ? -5.781  34.543  -10.050 1.00 2.62  ? 94  LYS A HZ3  2  
ATOM 6802   N N    . ASP A 1 95  ? -0.743  31.879  -14.213 1.00 0.79  ? 95  ASP A N    2  
ATOM 6803   C CA   . ASP A 1 95  ? 0.373   32.282  -15.125 1.00 0.84  ? 95  ASP A CA   2  
ATOM 6804   C C    . ASP A 1 95  ? 0.182   31.717  -16.542 1.00 0.80  ? 95  ASP A C    2  
ATOM 6805   O O    . ASP A 1 95  ? 0.367   32.411  -17.522 1.00 0.86  ? 95  ASP A O    2  
ATOM 6806   C CB   . ASP A 1 95  ? 1.694   31.766  -14.547 1.00 0.89  ? 95  ASP A CB   2  
ATOM 6807   C CG   . ASP A 1 95  ? 2.866   32.373  -15.322 1.00 1.02  ? 95  ASP A CG   2  
ATOM 6808   O OD1  . ASP A 1 95  ? 2.670   32.729  -16.471 1.00 1.65  ? 95  ASP A OD1  2  
ATOM 6809   O OD2  . ASP A 1 95  ? 3.938   32.474  -14.749 1.00 1.36  ? 95  ASP A OD2  2  
ATOM 6810   H H    . ASP A 1 95  ? -0.631  31.110  -13.613 1.00 0.76  ? 95  ASP A H    2  
ATOM 6811   H HA   . ASP A 1 95  ? 0.415   33.361  -15.179 1.00 0.90  ? 95  ASP A HA   2  
ATOM 6812   H HB2  . ASP A 1 95  ? 1.765   32.047  -13.507 1.00 0.93  ? 95  ASP A HB2  2  
ATOM 6813   H HB3  . ASP A 1 95  ? 1.728   30.691  -14.633 1.00 0.84  ? 95  ASP A HB3  2  
ATOM 6814   N N    . LYS A 1 96  ? -0.137  30.454  -16.661 1.00 0.74  ? 96  LYS A N    2  
ATOM 6815   C CA   . LYS A 1 96  ? -0.280  29.837  -18.024 1.00 0.74  ? 96  LYS A CA   2  
ATOM 6816   C C    . LYS A 1 96  ? -1.738  29.849  -18.510 1.00 0.70  ? 96  LYS A C    2  
ATOM 6817   O O    . LYS A 1 96  ? -2.021  29.416  -19.608 1.00 0.71  ? 96  LYS A O    2  
ATOM 6818   C CB   . LYS A 1 96  ? 0.223   28.391  -17.974 1.00 0.75  ? 96  LYS A CB   2  
ATOM 6819   C CG   . LYS A 1 96  ? 1.684   28.354  -17.499 1.00 0.86  ? 96  LYS A CG   2  
ATOM 6820   C CD   . LYS A 1 96  ? 2.631   28.793  -18.626 1.00 1.02  ? 96  LYS A CD   2  
ATOM 6821   C CE   . LYS A 1 96  ? 4.076   28.511  -18.213 1.00 1.40  ? 96  LYS A CE   2  
ATOM 6822   N NZ   . LYS A 1 96  ? 4.333   27.044  -18.282 1.00 2.03  ? 96  LYS A NZ   2  
ATOM 6823   H H    . LYS A 1 96  ? -0.239  29.912  -15.850 1.00 0.72  ? 96  LYS A H    2  
ATOM 6824   H HA   . LYS A 1 96  ? 0.317   30.390  -18.732 1.00 0.80  ? 96  LYS A HA   2  
ATOM 6825   H HB2  . LYS A 1 96  ? -0.390  27.821  -17.293 1.00 0.71  ? 96  LYS A HB2  2  
ATOM 6826   H HB3  . LYS A 1 96  ? 0.160   27.959  -18.961 1.00 0.79  ? 96  LYS A HB3  2  
ATOM 6827   H HG2  . LYS A 1 96  ? 1.801   29.019  -16.656 1.00 0.92  ? 96  LYS A HG2  2  
ATOM 6828   H HG3  . LYS A 1 96  ? 1.934   27.348  -17.196 1.00 0.86  ? 96  LYS A HG3  2  
ATOM 6829   H HD2  . LYS A 1 96  ? 2.402   28.246  -19.527 1.00 1.13  ? 96  LYS A HD2  2  
ATOM 6830   H HD3  . LYS A 1 96  ? 2.519   29.850  -18.807 1.00 1.41  ? 96  LYS A HD3  2  
ATOM 6831   H HE2  . LYS A 1 96  ? 4.749   29.026  -18.881 1.00 1.82  ? 96  LYS A HE2  2  
ATOM 6832   H HE3  . LYS A 1 96  ? 4.236   28.857  -17.203 1.00 1.96  ? 96  LYS A HE3  2  
ATOM 6833   H HZ1  . LYS A 1 96  ? 3.469   26.528  -18.024 1.00 2.50  ? 96  LYS A HZ1  2  
ATOM 6834   H HZ2  . LYS A 1 96  ? 4.616   26.788  -19.250 1.00 2.39  ? 96  LYS A HZ2  2  
ATOM 6835   H HZ3  . LYS A 1 96  ? 5.095   26.795  -17.620 1.00 2.50  ? 96  LYS A HZ3  2  
ATOM 6836   N N    . HIS A 1 97  ? -2.664  30.324  -17.719 1.00 0.69  ? 97  HIS A N    2  
ATOM 6837   C CA   . HIS A 1 97  ? -4.094  30.344  -18.167 1.00 0.71  ? 97  HIS A CA   2  
ATOM 6838   C C    . HIS A 1 97  ? -4.533  28.927  -18.552 1.00 0.68  ? 97  HIS A C    2  
ATOM 6839   O O    . HIS A 1 97  ? -5.297  28.727  -19.475 1.00 0.74  ? 97  HIS A O    2  
ATOM 6840   C CB   . HIS A 1 97  ? -4.248  31.279  -19.373 1.00 0.79  ? 97  HIS A CB   2  
ATOM 6841   C CG   . HIS A 1 97  ? -3.772  32.655  -18.996 1.00 0.93  ? 97  HIS A CG   2  
ATOM 6842   N ND1  . HIS A 1 97  ? -4.620  33.611  -18.453 1.00 1.42  ? 97  HIS A ND1  2  
ATOM 6843   C CD2  . HIS A 1 97  ? -2.538  33.250  -19.072 1.00 1.28  ? 97  HIS A CD2  2  
ATOM 6844   C CE1  . HIS A 1 97  ? -3.891  34.718  -18.225 1.00 1.41  ? 97  HIS A CE1  2  
ATOM 6845   N NE2  . HIS A 1 97  ? -2.618  34.548  -18.584 1.00 1.26  ? 97  HIS A NE2  2  
ATOM 6846   H H    . HIS A 1 97  ? -2.428  30.653  -16.826 1.00 0.71  ? 97  HIS A H    2  
ATOM 6847   H HA   . HIS A 1 97  ? -4.717  30.700  -17.361 1.00 0.72  ? 97  HIS A HA   2  
ATOM 6848   H HB2  . HIS A 1 97  ? -3.666  30.911  -20.201 1.00 0.82  ? 97  HIS A HB2  2  
ATOM 6849   H HB3  . HIS A 1 97  ? -5.288  31.328  -19.659 1.00 0.80  ? 97  HIS A HB3  2  
ATOM 6850   H HD2  . HIS A 1 97  ? -1.641  32.779  -19.449 1.00 1.88  ? 97  HIS A HD2  2  
ATOM 6851   H HE1  . HIS A 1 97  ? -4.286  35.630  -17.802 1.00 1.88  ? 97  HIS A HE1  2  
ATOM 6852   H HE2  . HIS A 1 97  ? -1.891  35.203  -18.519 1.00 1.51  ? 97  HIS A HE2  2  
ATOM 6853   N N    . MET A 1 98  ? -4.046  27.944  -17.846 1.00 0.62  ? 98  MET A N    2  
ATOM 6854   C CA   . MET A 1 98  ? -4.418  26.528  -18.151 1.00 0.62  ? 98  MET A CA   2  
ATOM 6855   C C    . MET A 1 98  ? -5.636  26.129  -17.319 1.00 0.61  ? 98  MET A C    2  
ATOM 6856   O O    . MET A 1 98  ? -6.023  26.820  -16.398 1.00 0.62  ? 98  MET A O    2  
ATOM 6857   C CB   . MET A 1 98  ? -3.243  25.608  -17.816 1.00 0.61  ? 98  MET A CB   2  
ATOM 6858   C CG   . MET A 1 98  ? -2.114  25.841  -18.819 1.00 0.68  ? 98  MET A CG   2  
ATOM 6859   S SD   . MET A 1 98  ? -0.629  24.956  -18.276 1.00 0.78  ? 98  MET A SD   2  
ATOM 6860   C CE   . MET A 1 98  ? -1.235  23.271  -18.541 1.00 1.18  ? 98  MET A CE   2  
ATOM 6861   H H    . MET A 1 98  ? -3.424  28.147  -17.117 1.00 0.59  ? 98  MET A H    2  
ATOM 6862   H HA   . MET A 1 98  ? -4.657  26.433  -19.202 1.00 0.68  ? 98  MET A HA   2  
ATOM 6863   H HB2  . MET A 1 98  ? -2.889  25.827  -16.819 1.00 0.57  ? 98  MET A HB2  2  
ATOM 6864   H HB3  . MET A 1 98  ? -3.563  24.579  -17.867 1.00 0.62  ? 98  MET A HB3  2  
ATOM 6865   H HG2  . MET A 1 98  ? -2.416  25.479  -19.791 1.00 0.74  ? 98  MET A HG2  2  
ATOM 6866   H HG3  . MET A 1 98  ? -1.903  26.896  -18.880 1.00 0.74  ? 98  MET A HG3  2  
ATOM 6867   H HE1  . MET A 1 98  ? -1.874  23.248  -19.413 1.00 1.69  ? 98  MET A HE1  2  
ATOM 6868   H HE2  . MET A 1 98  ? -0.395  22.606  -18.687 1.00 1.71  ? 98  MET A HE2  2  
ATOM 6869   H HE3  . MET A 1 98  ? -1.797  22.950  -17.679 1.00 1.61  ? 98  MET A HE3  2  
ATOM 6870   N N    . THR A 1 99  ? -6.244  25.015  -17.630 1.00 0.65  ? 99  THR A N    2  
ATOM 6871   C CA   . THR A 1 99  ? -7.434  24.570  -16.853 1.00 0.68  ? 99  THR A CA   2  
ATOM 6872   C C    . THR A 1 99  ? -6.972  23.852  -15.581 1.00 0.62  ? 99  THR A C    2  
ATOM 6873   O O    . THR A 1 99  ? -5.846  23.404  -15.483 1.00 0.62  ? 99  THR A O    2  
ATOM 6874   C CB   . THR A 1 99  ? -8.269  23.616  -17.713 1.00 0.77  ? 99  THR A CB   2  
ATOM 6875   O OG1  . THR A 1 99  ? -7.454  22.539  -18.150 1.00 0.81  ? 99  THR A OG1  2  
ATOM 6876   C CG2  . THR A 1 99  ? -8.823  24.367  -18.927 1.00 0.98  ? 99  THR A CG2  2  
ATOM 6877   H H    . THR A 1 99  ? -5.917  24.461  -18.369 1.00 0.67  ? 99  THR A H    2  
ATOM 6878   H HA   . THR A 1 99  ? -8.032  25.429  -16.584 1.00 0.72  ? 99  THR A HA   2  
ATOM 6879   H HB   . THR A 1 99  ? -9.089  23.230  -17.130 1.00 0.83  ? 99  THR A HB   2  
ATOM 6880   H HG1  . THR A 1 99  ? -7.011  22.811  -18.957 1.00 1.20  ? 99  THR A HG1  2  
ATOM 6881   H HG21 . THR A 1 99  ? -8.045  24.981  -19.357 1.00 1.13  ? 99  THR A HG21 2  
ATOM 6882   H HG22 . THR A 1 99  ? -9.168  23.657  -19.664 1.00 1.61  ? 99  THR A HG22 2  
ATOM 6883   H HG23 . THR A 1 99  ? -9.646  24.994  -18.618 1.00 1.55  ? 99  THR A HG23 2  
ATOM 6884   N N    . ALA A 1 100 ? -7.831  23.745  -14.603 1.00 0.62  ? 100 ALA A N    2  
ATOM 6885   C CA   . ALA A 1 100 ? -7.442  23.065  -13.332 1.00 0.57  ? 100 ALA A CA   2  
ATOM 6886   C C    . ALA A 1 100 ? -7.219  21.570  -13.579 1.00 0.55  ? 100 ALA A C    2  
ATOM 6887   O O    . ALA A 1 100 ? -6.305  20.975  -13.047 1.00 0.49  ? 100 ALA A O    2  
ATOM 6888   C CB   . ALA A 1 100 ? -8.553  23.245  -12.297 1.00 0.64  ? 100 ALA A CB   2  
ATOM 6889   H H    . ALA A 1 100 ? -8.730  24.119  -14.702 1.00 0.68  ? 100 ALA A H    2  
ATOM 6890   H HA   . ALA A 1 100 ? -6.530  23.504  -12.957 1.00 0.54  ? 100 ALA A HA   2  
ATOM 6891   H HB1  . ALA A 1 100 ? -9.510  23.054  -12.758 1.00 1.02  ? 100 ALA A HB1  2  
ATOM 6892   H HB2  . ALA A 1 100 ? -8.400  22.554  -11.480 1.00 1.33  ? 100 ALA A HB2  2  
ATOM 6893   H HB3  . ALA A 1 100 ? -8.531  24.256  -11.918 1.00 1.21  ? 100 ALA A HB3  2  
ATOM 6894   N N    . ASP A 1 101 ? -8.043  20.959  -14.384 1.00 0.62  ? 101 ASP A N    2  
ATOM 6895   C CA   . ASP A 1 101 ? -7.873  19.506  -14.662 1.00 0.64  ? 101 ASP A CA   2  
ATOM 6896   C C    . ASP A 1 101 ? -6.555  19.274  -15.401 1.00 0.62  ? 101 ASP A C    2  
ATOM 6897   O O    . ASP A 1 101 ? -5.864  18.302  -15.167 1.00 0.62  ? 101 ASP A O    2  
ATOM 6898   C CB   . ASP A 1 101 ? -9.034  19.006  -15.525 1.00 0.76  ? 101 ASP A CB   2  
ATOM 6899   C CG   . ASP A 1 101 ? -10.319 18.995  -14.696 1.00 1.32  ? 101 ASP A CG   2  
ATOM 6900   O OD1  . ASP A 1 101 ? -10.217 18.995  -13.480 1.00 2.07  ? 101 ASP A OD1  2  
ATOM 6901   O OD2  . ASP A 1 101 ? -11.384 18.987  -15.291 1.00 2.00  ? 101 ASP A OD2  2  
ATOM 6902   H H    . ASP A 1 101 ? -8.770  21.454  -14.816 1.00 0.69  ? 101 ASP A H    2  
ATOM 6903   H HA   . ASP A 1 101 ? -7.860  18.963  -13.730 1.00 0.61  ? 101 ASP A HA   2  
ATOM 6904   H HB2  . ASP A 1 101 ? -9.158  19.660  -16.376 1.00 1.38  ? 101 ASP A HB2  2  
ATOM 6905   H HB3  . ASP A 1 101 ? -8.821  18.005  -15.868 1.00 1.22  ? 101 ASP A HB3  2  
ATOM 6906   N N    . ALA A 1 102 ? -6.202  20.157  -16.290 1.00 0.65  ? 102 ALA A N    2  
ATOM 6907   C CA   . ALA A 1 102 ? -4.928  19.991  -17.043 1.00 0.67  ? 102 ALA A CA   2  
ATOM 6908   C C    . ALA A 1 102 ? -3.750  20.479  -16.195 1.00 0.59  ? 102 ALA A C    2  
ATOM 6909   O O    . ALA A 1 102 ? -2.747  19.807  -16.060 1.00 0.62  ? 102 ALA A O    2  
ATOM 6910   C CB   . ALA A 1 102 ? -5.000  20.813  -18.332 1.00 0.73  ? 102 ALA A CB   2  
ATOM 6911   H H    . ALA A 1 102 ? -6.762  20.945  -16.452 1.00 0.68  ? 102 ALA A H    2  
ATOM 6912   H HA   . ALA A 1 102 ? -4.787  18.951  -17.290 1.00 0.73  ? 102 ALA A HA   2  
ATOM 6913   H HB1  . ALA A 1 102 ? -5.209  21.845  -18.088 1.00 1.15  ? 102 ALA A HB1  2  
ATOM 6914   H HB2  . ALA A 1 102 ? -4.055  20.750  -18.852 1.00 1.37  ? 102 ALA A HB2  2  
ATOM 6915   H HB3  . ALA A 1 102 ? -5.786  20.427  -18.962 1.00 1.20  ? 102 ALA A HB3  2  
ATOM 6916   N N    . ALA A 1 103 ? -3.863  21.651  -15.635 1.00 0.54  ? 103 ALA A N    2  
ATOM 6917   C CA   . ALA A 1 103 ? -2.751  22.201  -14.808 1.00 0.50  ? 103 ALA A CA   2  
ATOM 6918   C C    . ALA A 1 103 ? -2.503  21.315  -13.584 1.00 0.50  ? 103 ALA A C    2  
ATOM 6919   O O    . ALA A 1 103 ? -1.383  20.943  -13.297 1.00 0.52  ? 103 ALA A O    2  
ATOM 6920   C CB   . ALA A 1 103 ? -3.111  23.618  -14.350 1.00 0.49  ? 103 ALA A CB   2  
ATOM 6921   H H    . ALA A 1 103 ? -4.679  22.175  -15.772 1.00 0.55  ? 103 ALA A H    2  
ATOM 6922   H HA   . ALA A 1 103 ? -1.853  22.237  -15.402 1.00 0.54  ? 103 ALA A HA   2  
ATOM 6923   H HB1  . ALA A 1 103 ? -3.389  24.213  -15.207 1.00 1.14  ? 103 ALA A HB1  2  
ATOM 6924   H HB2  . ALA A 1 103 ? -3.939  23.573  -13.660 1.00 1.08  ? 103 ALA A HB2  2  
ATOM 6925   H HB3  . ALA A 1 103 ? -2.258  24.065  -13.862 1.00 1.13  ? 103 ALA A HB3  2  
ATOM 6926   N N    . ALA A 1 104 ? -3.531  20.981  -12.857 1.00 0.49  ? 104 ALA A N    2  
ATOM 6927   C CA   . ALA A 1 104 ? -3.336  20.129  -11.648 1.00 0.50  ? 104 ALA A CA   2  
ATOM 6928   C C    . ALA A 1 104 ? -2.721  18.788  -12.055 1.00 0.54  ? 104 ALA A C    2  
ATOM 6929   O O    . ALA A 1 104 ? -1.838  18.273  -11.400 1.00 0.56  ? 104 ALA A O    2  
ATOM 6930   C CB   . ALA A 1 104 ? -4.688  19.887  -10.974 1.00 0.51  ? 104 ALA A CB   2  
ATOM 6931   H H    . ALA A 1 104 ? -4.427  21.297  -13.099 1.00 0.50  ? 104 ALA A H    2  
ATOM 6932   H HA   . ALA A 1 104 ? -2.675  20.630  -10.959 1.00 0.51  ? 104 ALA A HA   2  
ATOM 6933   H HB1  . ALA A 1 104 ? -5.213  20.827  -10.874 1.00 1.09  ? 104 ALA A HB1  2  
ATOM 6934   H HB2  . ALA A 1 104 ? -5.276  19.211  -11.577 1.00 1.26  ? 104 ALA A HB2  2  
ATOM 6935   H HB3  . ALA A 1 104 ? -4.532  19.456  -9.997  1.00 1.05  ? 104 ALA A HB3  2  
ATOM 6936   N N    . HIS A 1 105 ? -3.199  18.210  -13.119 1.00 0.57  ? 105 HIS A N    2  
ATOM 6937   C CA   . HIS A 1 105 ? -2.664  16.890  -13.557 1.00 0.65  ? 105 HIS A CA   2  
ATOM 6938   C C    . HIS A 1 105 ? -1.167  16.990  -13.855 1.00 0.65  ? 105 HIS A C    2  
ATOM 6939   O O    . HIS A 1 105 ? -0.405  16.099  -13.536 1.00 0.71  ? 105 HIS A O    2  
ATOM 6940   C CB   . HIS A 1 105 ? -3.397  16.440  -14.820 1.00 0.72  ? 105 HIS A CB   2  
ATOM 6941   C CG   . HIS A 1 105 ? -2.859  15.108  -15.265 1.00 0.84  ? 105 HIS A CG   2  
ATOM 6942   N ND1  . HIS A 1 105 ? -2.921  13.978  -14.461 1.00 1.54  ? 105 HIS A ND1  2  
ATOM 6943   C CD2  . HIS A 1 105 ? -2.242  14.709  -16.425 1.00 1.17  ? 105 HIS A CD2  2  
ATOM 6944   C CE1  . HIS A 1 105 ? -2.354  12.964  -15.142 1.00 1.43  ? 105 HIS A CE1  2  
ATOM 6945   N NE2  . HIS A 1 105 ? -1.926  13.359  -16.342 1.00 1.05  ? 105 HIS A NE2  2  
ATOM 6946   H H    . HIS A 1 105 ? -3.934  18.634  -13.610 1.00 0.58  ? 105 HIS A H    2  
ATOM 6947   H HA   . HIS A 1 105 ? -2.823  16.165  -12.777 1.00 0.68  ? 105 HIS A HA   2  
ATOM 6948   H HB2  . HIS A 1 105 ? -4.451  16.349  -14.609 1.00 0.73  ? 105 HIS A HB2  2  
ATOM 6949   H HB3  . HIS A 1 105 ? -3.248  17.168  -15.603 1.00 0.73  ? 105 HIS A HB3  2  
ATOM 6950   H HD2  . HIS A 1 105 ? -2.036  15.348  -17.272 1.00 1.94  ? 105 HIS A HD2  2  
ATOM 6951   H HE1  . HIS A 1 105 ? -2.259  11.957  -14.763 1.00 2.02  ? 105 HIS A HE1  2  
ATOM 6952   H HE2  . HIS A 1 105 ? -1.480  12.811  -17.022 1.00 1.27  ? 105 HIS A HE2  2  
ATOM 6953   N N    . GLU A 1 106 ? -0.734  18.055  -14.464 1.00 0.61  ? 106 GLU A N    2  
ATOM 6954   C CA   . GLU A 1 106 ? 0.716   18.185  -14.775 1.00 0.64  ? 106 GLU A CA   2  
ATOM 6955   C C    . GLU A 1 106 ? 1.531   18.169  -13.478 1.00 0.64  ? 106 GLU A C    2  
ATOM 6956   O O    . GLU A 1 106 ? 2.601   17.594  -13.414 1.00 0.70  ? 106 GLU A O    2  
ATOM 6957   C CB   . GLU A 1 106 ? 0.965   19.497  -15.526 1.00 0.64  ? 106 GLU A CB   2  
ATOM 6958   C CG   . GLU A 1 106 ? 2.456   19.626  -15.847 1.00 0.72  ? 106 GLU A CG   2  
ATOM 6959   C CD   . GLU A 1 106 ? 2.682   20.848  -16.738 1.00 0.74  ? 106 GLU A CD   2  
ATOM 6960   O OE1  . GLU A 1 106 ? 1.701   21.430  -17.173 1.00 1.28  ? 106 GLU A OE1  2  
ATOM 6961   O OE2  . GLU A 1 106 ? 3.832   21.180  -16.974 1.00 1.33  ? 106 GLU A OE2  2  
ATOM 6962   H H    . GLU A 1 106 ? -1.356  18.772  -14.713 1.00 0.60  ? 106 GLU A H    2  
ATOM 6963   H HA   . GLU A 1 106 ? 1.020   17.356  -15.395 1.00 0.68  ? 106 GLU A HA   2  
ATOM 6964   H HB2  . GLU A 1 106 ? 0.396   19.499  -16.444 1.00 0.66  ? 106 GLU A HB2  2  
ATOM 6965   H HB3  . GLU A 1 106 ? 0.658   20.328  -14.909 1.00 0.63  ? 106 GLU A HB3  2  
ATOM 6966   H HG2  . GLU A 1 106 ? 3.014   19.742  -14.930 1.00 0.79  ? 106 GLU A HG2  2  
ATOM 6967   H HG3  . GLU A 1 106 ? 2.792   18.739  -16.363 1.00 0.80  ? 106 GLU A HG3  2  
ATOM 6968   N N    . VAL A 1 107 ? 1.049   18.816  -12.454 1.00 0.61  ? 107 VAL A N    2  
ATOM 6969   C CA   . VAL A 1 107 ? 1.813   18.861  -11.172 1.00 0.63  ? 107 VAL A CA   2  
ATOM 6970   C C    . VAL A 1 107 ? 1.988   17.454  -10.587 1.00 0.66  ? 107 VAL A C    2  
ATOM 6971   O O    . VAL A 1 107 ? 3.087   17.036  -10.279 1.00 0.70  ? 107 VAL A O    2  
ATOM 6972   C CB   . VAL A 1 107 ? 1.053   19.728  -10.167 1.00 0.64  ? 107 VAL A CB   2  
ATOM 6973   C CG1  . VAL A 1 107 ? 1.801   19.737  -8.832  1.00 0.72  ? 107 VAL A CG1  2  
ATOM 6974   C CG2  . VAL A 1 107 ? 0.945   21.157  -10.702 1.00 0.65  ? 107 VAL A CG2  2  
ATOM 6975   H H    . VAL A 1 107 ? 0.196   19.291  -12.535 1.00 0.60  ? 107 VAL A H    2  
ATOM 6976   H HA   . VAL A 1 107 ? 2.782   19.294  -11.350 1.00 0.66  ? 107 VAL A HA   2  
ATOM 6977   H HB   . VAL A 1 107 ? 0.063   19.320  -10.019 1.00 0.62  ? 107 VAL A HB   2  
ATOM 6978   H HG11 . VAL A 1 107 ? 2.845   19.952  -9.005  1.00 1.30  ? 107 VAL A HG11 2  
ATOM 6979   H HG12 . VAL A 1 107 ? 1.379   20.494  -8.188  1.00 1.26  ? 107 VAL A HG12 2  
ATOM 6980   H HG13 . VAL A 1 107 ? 1.708   18.770  -8.360  1.00 1.21  ? 107 VAL A HG13 2  
ATOM 6981   H HG21 . VAL A 1 107 ? 0.466   21.142  -11.671 1.00 1.15  ? 107 VAL A HG21 2  
ATOM 6982   H HG22 . VAL A 1 107 ? 0.357   21.753  -10.020 1.00 1.21  ? 107 VAL A HG22 2  
ATOM 6983   H HG23 . VAL A 1 107 ? 1.932   21.582  -10.795 1.00 1.20  ? 107 VAL A HG23 2  
ATOM 6984   N N    . ILE A 1 108 ? 0.921   16.726  -10.415 1.00 0.65  ? 108 ILE A N    2  
ATOM 6985   C CA   . ILE A 1 108 ? 1.041   15.354  -9.833  1.00 0.70  ? 108 ILE A CA   2  
ATOM 6986   C C    . ILE A 1 108 ? 1.722   14.431  -10.844 1.00 0.76  ? 108 ILE A C    2  
ATOM 6987   O O    . ILE A 1 108 ? 2.559   13.621  -10.496 1.00 0.85  ? 108 ILE A O    2  
ATOM 6988   C CB   . ILE A 1 108 ? -0.355  14.811  -9.498  1.00 0.70  ? 108 ILE A CB   2  
ATOM 6989   C CG1  . ILE A 1 108 ? -1.052  15.731  -8.475  1.00 0.66  ? 108 ILE A CG1  2  
ATOM 6990   C CG2  . ILE A 1 108 ? -0.233  13.394  -8.920  1.00 0.78  ? 108 ILE A CG2  2  
ATOM 6991   C CD1  . ILE A 1 108 ? -0.183  15.930  -7.224  1.00 0.70  ? 108 ILE A CD1  2  
ATOM 6992   H H    . ILE A 1 108 ? 0.043   17.082  -10.659 1.00 0.62  ? 108 ILE A H    2  
ATOM 6993   H HA   . ILE A 1 108 ? 1.642   15.395  -8.938  1.00 0.73  ? 108 ILE A HA   2  
ATOM 6994   H HB   . ILE A 1 108 ? -0.944  14.773  -10.403 1.00 0.71  ? 108 ILE A HB   2  
ATOM 6995   H HG12 . ILE A 1 108 ? -1.239  16.692  -8.932  1.00 0.64  ? 108 ILE A HG12 2  
ATOM 6996   H HG13 . ILE A 1 108 ? -1.994  15.289  -8.185  1.00 0.68  ? 108 ILE A HG13 2  
ATOM 6997   H HG21 . ILE A 1 108 ? 0.615   13.345  -8.255  1.00 1.32  ? 108 ILE A HG21 2  
ATOM 6998   H HG22 . ILE A 1 108 ? -1.131  13.145  -8.373  1.00 1.22  ? 108 ILE A HG22 2  
ATOM 6999   H HG23 . ILE A 1 108 ? -0.099  12.688  -9.727  1.00 1.28  ? 108 ILE A HG23 2  
ATOM 7000   H HD11 . ILE A 1 108 ? 0.364   15.024  -7.008  1.00 1.28  ? 108 ILE A HD11 2  
ATOM 7001   H HD12 . ILE A 1 108 ? 0.513   16.738  -7.395  1.00 1.27  ? 108 ILE A HD12 2  
ATOM 7002   H HD13 . ILE A 1 108 ? -0.815  16.175  -6.382  1.00 1.16  ? 108 ILE A HD13 2  
ATOM 7003   N N    . GLU A 1 109 ? 1.390   14.564  -12.095 1.00 0.75  ? 109 GLU A N    2  
ATOM 7004   C CA   . GLU A 1 109 ? 2.039   13.714  -13.131 1.00 0.84  ? 109 GLU A CA   2  
ATOM 7005   C C    . GLU A 1 109 ? 3.537   14.020  -13.137 1.00 0.87  ? 109 GLU A C    2  
ATOM 7006   O O    . GLU A 1 109 ? 4.367   13.145  -13.280 1.00 0.93  ? 109 GLU A O    2  
ATOM 7007   C CB   . GLU A 1 109 ? 1.439   14.023  -14.508 1.00 0.88  ? 109 GLU A CB   2  
ATOM 7008   C CG   . GLU A 1 109 ? 2.107   13.142  -15.570 1.00 1.01  ? 109 GLU A CG   2  
ATOM 7009   C CD   . GLU A 1 109 ? 1.470   13.411  -16.936 1.00 1.76  ? 109 GLU A CD   2  
ATOM 7010   O OE1  . GLU A 1 109 ? 0.526   14.180  -16.987 1.00 2.44  ? 109 GLU A OE1  2  
ATOM 7011   O OE2  . GLU A 1 109 ? 1.939   12.841  -17.908 1.00 2.44  ? 109 GLU A OE2  2  
ATOM 7012   H H    . GLU A 1 109 ? 0.736   15.248  -12.351 1.00 0.72  ? 109 GLU A H    2  
ATOM 7013   H HA   . GLU A 1 109 ? 1.882   12.672  -12.891 1.00 0.90  ? 109 GLU A HA   2  
ATOM 7014   H HB2  . GLU A 1 109 ? 0.377   13.824  -14.491 1.00 0.90  ? 109 GLU A HB2  2  
ATOM 7015   H HB3  . GLU A 1 109 ? 1.607   15.063  -14.747 1.00 0.89  ? 109 GLU A HB3  2  
ATOM 7016   H HG2  . GLU A 1 109 ? 3.162   13.370  -15.618 1.00 1.53  ? 109 GLU A HG2  2  
ATOM 7017   H HG3  . GLU A 1 109 ? 1.975   12.103  -15.311 1.00 1.29  ? 109 GLU A HG3  2  
ATOM 7018   N N    . GLY A 1 110 ? 3.876   15.271  -12.993 1.00 0.85  ? 110 GLY A N    2  
ATOM 7019   C CA   . GLY A 1 110 ? 5.311   15.672  -13.001 1.00 0.92  ? 110 GLY A CA   2  
ATOM 7020   C C    . GLY A 1 110 ? 6.074   14.979  -11.866 1.00 0.90  ? 110 GLY A C    2  
ATOM 7021   O O    . GLY A 1 110 ? 7.094   14.360  -12.092 1.00 0.98  ? 110 GLY A O    2  
ATOM 7022   H H    . GLY A 1 110 ? 3.172   15.944  -12.885 1.00 0.82  ? 110 GLY A H    2  
ATOM 7023   H HA2  . GLY A 1 110 ? 5.752   15.398  -13.949 1.00 0.99  ? 110 GLY A HA2  2  
ATOM 7024   H HA3  . GLY A 1 110 ? 5.381   16.742  -12.873 1.00 0.94  ? 110 GLY A HA3  2  
ATOM 7025   N N    . GLN A 1 111 ? 5.607   15.078  -10.647 1.00 0.82  ? 111 GLN A N    2  
ATOM 7026   C CA   . GLN A 1 111 ? 6.344   14.421  -9.527  1.00 0.84  ? 111 GLN A CA   2  
ATOM 7027   C C    . GLN A 1 111 ? 6.230   12.901  -9.651  1.00 0.91  ? 111 GLN A C    2  
ATOM 7028   O O    . GLN A 1 111 ? 7.203   12.192  -9.515  1.00 1.00  ? 111 GLN A O    2  
ATOM 7029   C CB   . GLN A 1 111 ? 5.765   14.869  -8.182  1.00 0.77  ? 111 GLN A CB   2  
ATOM 7030   C CG   . GLN A 1 111 ? 6.005   16.371  -7.988  1.00 0.73  ? 111 GLN A CG   2  
ATOM 7031   C CD   . GLN A 1 111 ? 7.509   16.654  -7.900  1.00 0.87  ? 111 GLN A CD   2  
ATOM 7032   O OE1  . GLN A 1 111 ? 7.961   17.715  -8.280  1.00 1.41  ? 111 GLN A OE1  2  
ATOM 7033   N NE2  . GLN A 1 111 ? 8.309   15.739  -7.422  1.00 1.35  ? 111 GLN A NE2  2  
ATOM 7034   H H    . GLN A 1 111 ? 4.787   15.586  -10.471 1.00 0.77  ? 111 GLN A H    2  
ATOM 7035   H HA   . GLN A 1 111 ? 7.385   14.698  -9.576  1.00 0.89  ? 111 GLN A HA   2  
ATOM 7036   H HB2  . GLN A 1 111 ? 4.703   14.669  -8.163  1.00 0.75  ? 111 GLN A HB2  2  
ATOM 7037   H HB3  . GLN A 1 111 ? 6.248   14.324  -7.384  1.00 0.82  ? 111 GLN A HB3  2  
ATOM 7038   H HG2  . GLN A 1 111 ? 5.586   16.912  -8.823  1.00 0.74  ? 111 GLN A HG2  2  
ATOM 7039   H HG3  . GLN A 1 111 ? 5.529   16.695  -7.075  1.00 0.71  ? 111 GLN A HG3  2  
ATOM 7040   H HE21 . GLN A 1 111 ? 7.948   14.880  -7.122  1.00 1.97  ? 111 GLN A HE21 2  
ATOM 7041   H HE22 . GLN A 1 111 ? 9.272   15.915  -7.362  1.00 1.45  ? 111 GLN A HE22 2  
ATOM 7042   N N    . ALA A 1 112 ? 5.061   12.389  -9.925  1.00 0.89  ? 112 ALA A N    2  
ATOM 7043   C CA   . ALA A 1 112 ? 4.919   10.913  -10.063 1.00 0.98  ? 112 ALA A CA   2  
ATOM 7044   C C    . ALA A 1 112 ? 5.847   10.438  -11.178 1.00 1.09  ? 112 ALA A C    2  
ATOM 7045   O O    . ALA A 1 112 ? 6.541   9.449   -11.045 1.00 1.20  ? 112 ALA A O    2  
ATOM 7046   C CB   . ALA A 1 112 ? 3.473   10.567  -10.420 1.00 0.96  ? 112 ALA A CB   2  
ATOM 7047   H H    . ALA A 1 112 ? 4.283   12.969  -10.039 1.00 0.84  ? 112 ALA A H    2  
ATOM 7048   H HA   . ALA A 1 112 ? 5.191   10.433  -9.133  1.00 1.01  ? 112 ALA A HA   2  
ATOM 7049   H HB1  . ALA A 1 112 ? 3.187   11.095  -11.317 1.00 1.43  ? 112 ALA A HB1  2  
ATOM 7050   H HB2  . ALA A 1 112 ? 3.388   9.503   -10.588 1.00 1.33  ? 112 ALA A HB2  2  
ATOM 7051   H HB3  . ALA A 1 112 ? 2.821   10.856  -9.608  1.00 1.42  ? 112 ALA A HB3  2  
ATOM 7052   N N    . SER A 1 113 ? 5.866   11.138  -12.277 1.00 1.10  ? 113 SER A N    2  
ATOM 7053   C CA   . SER A 1 113 ? 6.752   10.731  -13.401 1.00 1.23  ? 113 SER A CA   2  
ATOM 7054   C C    . SER A 1 113 ? 8.202   10.741  -12.922 1.00 1.28  ? 113 SER A C    2  
ATOM 7055   O O    . SER A 1 113 ? 8.991   9.899   -13.295 1.00 1.41  ? 113 SER A O    2  
ATOM 7056   C CB   . SER A 1 113 ? 6.592   11.713  -14.562 1.00 1.22  ? 113 SER A CB   2  
ATOM 7057   O OG   . SER A 1 113 ? 7.109   12.981  -14.178 1.00 1.70  ? 113 SER A OG   2  
ATOM 7058   H H    . SER A 1 113 ? 5.290   11.926  -12.366 1.00 1.03  ? 113 SER A H    2  
ATOM 7059   H HA   . SER A 1 113 ? 6.485   9.737   -13.728 1.00 1.30  ? 113 SER A HA   2  
ATOM 7060   H HB2  . SER A 1 113 ? 7.138   11.354  -15.418 1.00 1.49  ? 113 SER A HB2  2  
ATOM 7061   H HB3  . SER A 1 113 ? 5.545   11.802  -14.817 1.00 1.47  ? 113 SER A HB3  2  
ATOM 7062   H HG   . SER A 1 113 ? 6.384   13.503  -13.827 1.00 2.12  ? 113 SER A HG   2  
ATOM 7063   N N    . ALA A 1 114 ? 8.555   11.676  -12.085 1.00 1.22  ? 114 ALA A N    2  
ATOM 7064   C CA   . ALA A 1 114 ? 9.954   11.722  -11.576 1.00 1.30  ? 114 ALA A CA   2  
ATOM 7065   C C    . ALA A 1 114 ? 10.222  10.472  -10.739 1.00 1.36  ? 114 ALA A C    2  
ATOM 7066   O O    . ALA A 1 114 ? 11.289  9.892   -10.799 1.00 1.47  ? 114 ALA A O    2  
ATOM 7067   C CB   . ALA A 1 114 ? 10.155  12.969  -10.707 1.00 1.25  ? 114 ALA A CB   2  
ATOM 7068   H H    . ALA A 1 114 ? 7.895   12.333  -11.780 1.00 1.13  ? 114 ALA A H    2  
ATOM 7069   H HA   . ALA A 1 114 ? 10.639  11.748  -12.410 1.00 1.38  ? 114 ALA A HA   2  
ATOM 7070   H HB1  . ALA A 1 114 ? 9.299   13.102  -10.062 1.00 1.64  ? 114 ALA A HB1  2  
ATOM 7071   H HB2  . ALA A 1 114 ? 11.046  12.849  -10.103 1.00 1.60  ? 114 ALA A HB2  2  
ATOM 7072   H HB3  . ALA A 1 114 ? 10.265  13.835  -11.341 1.00 1.56  ? 114 ALA A HB3  2  
ATOM 7073   N N    . LEU A 1 115 ? 9.270   10.053  -9.951  1.00 1.30  ? 115 LEU A N    2  
ATOM 7074   C CA   . LEU A 1 115 ? 9.492   8.845   -9.112  1.00 1.37  ? 115 LEU A CA   2  
ATOM 7075   C C    . LEU A 1 115 ? 9.646   7.620   -10.012 1.00 1.46  ? 115 LEU A C    2  
ATOM 7076   O O    . LEU A 1 115 ? 10.485  6.774   -9.778  1.00 1.56  ? 115 LEU A O    2  
ATOM 7077   C CB   . LEU A 1 115 ? 8.299   8.630   -8.174  1.00 1.32  ? 115 LEU A CB   2  
ATOM 7078   C CG   . LEU A 1 115 ? 8.097   9.851   -7.266  1.00 1.25  ? 115 LEU A CG   2  
ATOM 7079   C CD1  . LEU A 1 115 ? 6.958   9.560   -6.284  1.00 1.20  ? 115 LEU A CD1  2  
ATOM 7080   C CD2  . LEU A 1 115 ? 9.386   10.166  -6.491  1.00 1.49  ? 115 LEU A CD2  2  
ATOM 7081   H H    . LEU A 1 115 ? 8.416   10.534  -9.908  1.00 1.21  ? 115 LEU A H    2  
ATOM 7082   H HA   . LEU A 1 115 ? 10.393  8.970   -8.535  1.00 1.43  ? 115 LEU A HA   2  
ATOM 7083   H HB2  . LEU A 1 115 ? 7.407   8.471   -8.762  1.00 1.28  ? 115 LEU A HB2  2  
ATOM 7084   H HB3  . LEU A 1 115 ? 8.482   7.760   -7.562  1.00 1.41  ? 115 LEU A HB3  2  
ATOM 7085   H HG   . LEU A 1 115 ? 7.829   10.700  -7.872  1.00 1.21  ? 115 LEU A HG   2  
ATOM 7086   H HD11 . LEU A 1 115 ? 6.052   9.352   -6.834  1.00 1.48  ? 115 LEU A HD11 2  
ATOM 7087   H HD12 . LEU A 1 115 ? 7.216   8.704   -5.678  1.00 1.56  ? 115 LEU A HD12 2  
ATOM 7088   H HD13 . LEU A 1 115 ? 6.804   10.419  -5.647  1.00 1.67  ? 115 LEU A HD13 2  
ATOM 7089   H HD21 . LEU A 1 115 ? 9.879   9.246   -6.214  1.00 1.83  ? 115 LEU A HD21 2  
ATOM 7090   H HD22 . LEU A 1 115 ? 10.044  10.754  -7.114  1.00 1.93  ? 115 LEU A HD22 2  
ATOM 7091   H HD23 . LEU A 1 115 ? 9.145   10.727  -5.603  1.00 1.82  ? 115 LEU A HD23 2  
ATOM 7092   N N    . GLU A 1 116 ? 8.838   7.500   -11.032 1.00 1.45  ? 116 GLU A N    2  
ATOM 7093   C CA   . GLU A 1 116 ? 8.940   6.314   -11.925 1.00 1.56  ? 116 GLU A CA   2  
ATOM 7094   C C    . GLU A 1 116 ? 10.330  6.251   -12.557 1.00 1.68  ? 116 GLU A C    2  
ATOM 7095   O O    . GLU A 1 116 ? 10.904  5.190   -12.700 1.00 1.80  ? 116 GLU A O    2  
ATOM 7096   C CB   . GLU A 1 116 ? 7.879   6.401   -13.023 1.00 1.55  ? 116 GLU A CB   2  
ATOM 7097   C CG   . GLU A 1 116 ? 7.840   5.079   -13.794 1.00 1.68  ? 116 GLU A CG   2  
ATOM 7098   C CD   . GLU A 1 116 ? 6.727   5.130   -14.843 1.00 1.73  ? 116 GLU A CD   2  
ATOM 7099   O OE1  . GLU A 1 116 ? 6.025   6.125   -14.885 1.00 1.89  ? 116 GLU A OE1  2  
ATOM 7100   O OE2  . GLU A 1 116 ? 6.595   4.169   -15.583 1.00 2.20  ? 116 GLU A OE2  2  
ATOM 7101   H H    . GLU A 1 116 ? 8.142   8.168   -11.209 1.00 1.38  ? 116 GLU A H    2  
ATOM 7102   H HA   . GLU A 1 116 ? 8.776   5.419   -11.344 1.00 1.59  ? 116 GLU A HA   2  
ATOM 7103   H HB2  . GLU A 1 116 ? 6.912   6.587   -12.576 1.00 1.76  ? 116 GLU A HB2  2  
ATOM 7104   H HB3  . GLU A 1 116 ? 8.124   7.204   -13.701 1.00 1.66  ? 116 GLU A HB3  2  
ATOM 7105   H HG2  . GLU A 1 116 ? 8.789   4.919   -14.283 1.00 1.86  ? 116 GLU A HG2  2  
ATOM 7106   H HG3  . GLU A 1 116 ? 7.646   4.268   -13.107 1.00 1.94  ? 116 GLU A HG3  2  
ATOM 7107   N N    . GLU A 1 117 ? 10.882  7.371   -12.943 1.00 1.67  ? 117 GLU A N    2  
ATOM 7108   C CA   . GLU A 1 117 ? 12.235  7.343   -13.568 1.00 1.80  ? 117 GLU A CA   2  
ATOM 7109   C C    . GLU A 1 117 ? 13.175  6.510   -12.694 1.00 1.86  ? 117 GLU A C    2  
ATOM 7110   O O    . GLU A 1 117 ? 14.214  6.063   -13.137 1.00 1.98  ? 117 GLU A O    2  
ATOM 7111   C CB   . GLU A 1 117 ? 12.781  8.766   -13.707 1.00 1.80  ? 117 GLU A CB   2  
ATOM 7112   C CG   . GLU A 1 117 ? 11.985  9.517   -14.777 1.00 1.70  ? 117 GLU A CG   2  
ATOM 7113   C CD   . GLU A 1 117 ? 12.502  10.952  -14.890 1.00 1.76  ? 117 GLU A CD   2  
ATOM 7114   O OE1  . GLU A 1 117 ? 13.418  11.291  -14.159 1.00 2.04  ? 117 GLU A OE1  2  
ATOM 7115   O OE2  . GLU A 1 117 ? 11.971  11.690  -15.704 1.00 2.12  ? 117 GLU A OE2  2  
ATOM 7116   H H    . GLU A 1 117 ? 10.408  8.221   -12.825 1.00 1.59  ? 117 GLU A H    2  
ATOM 7117   H HA   . GLU A 1 117 ? 12.165  6.889   -14.547 1.00 1.88  ? 117 GLU A HA   2  
ATOM 7118   H HB2  . GLU A 1 117 ? 12.688  9.280   -12.760 1.00 1.75  ? 117 GLU A HB2  2  
ATOM 7119   H HB3  . GLU A 1 117 ? 13.821  8.727   -13.995 1.00 1.94  ? 117 GLU A HB3  2  
ATOM 7120   H HG2  . GLU A 1 117 ? 12.102  9.017   -15.727 1.00 1.80  ? 117 GLU A HG2  2  
ATOM 7121   H HG3  . GLU A 1 117 ? 10.943  9.532   -14.506 1.00 1.55  ? 117 GLU A HG3  2  
ATOM 7122   N N    . LEU A 1 118 ? 12.813  6.287   -11.459 1.00 1.78  ? 118 LEU A N    2  
ATOM 7123   C CA   . LEU A 1 118 ? 13.679  5.473   -10.564 1.00 1.85  ? 118 LEU A CA   2  
ATOM 7124   C C    . LEU A 1 118 ? 13.783  4.056   -11.143 1.00 1.93  ? 118 LEU A C    2  
ATOM 7125   O O    . LEU A 1 118 ? 12.825  3.522   -11.666 1.00 1.92  ? 118 LEU A O    2  
ATOM 7126   C CB   . LEU A 1 118 ? 13.036  5.413   -9.177  1.00 1.77  ? 118 LEU A CB   2  
ATOM 7127   C CG   . LEU A 1 118 ? 13.037  6.817   -8.539  1.00 1.78  ? 118 LEU A CG   2  
ATOM 7128   C CD1  . LEU A 1 118 ? 12.092  6.844   -7.327  1.00 1.69  ? 118 LEU A CD1  2  
ATOM 7129   C CD2  . LEU A 1 118 ? 14.461  7.193   -8.078  1.00 2.00  ? 118 LEU A CD2  2  
ATOM 7130   H H    . LEU A 1 118 ? 11.973  6.654   -11.112 1.00 1.69  ? 118 LEU A H    2  
ATOM 7131   H HA   . LEU A 1 118 ? 14.658  5.918   -10.496 1.00 1.94  ? 118 LEU A HA   2  
ATOM 7132   H HB2  . LEU A 1 118 ? 12.021  5.059   -9.278  1.00 1.65  ? 118 LEU A HB2  2  
ATOM 7133   H HB3  . LEU A 1 118 ? 13.590  4.731   -8.556  1.00 1.85  ? 118 LEU A HB3  2  
ATOM 7134   H HG   . LEU A 1 118 ? 12.697  7.537   -9.269  1.00 1.76  ? 118 LEU A HG   2  
ATOM 7135   H HD11 . LEU A 1 118 ? 11.187  6.302   -7.556  1.00 2.00  ? 118 LEU A HD11 2  
ATOM 7136   H HD12 . LEU A 1 118 ? 12.579  6.391   -6.477  1.00 2.03  ? 118 LEU A HD12 2  
ATOM 7137   H HD13 . LEU A 1 118 ? 11.843  7.867   -7.094  1.00 1.86  ? 118 LEU A HD13 2  
ATOM 7138   H HD21 . LEU A 1 118 ? 14.946  6.330   -7.644  1.00 2.24  ? 118 LEU A HD21 2  
ATOM 7139   H HD22 . LEU A 1 118 ? 15.036  7.542   -8.922  1.00 2.34  ? 118 LEU A HD22 2  
ATOM 7140   H HD23 . LEU A 1 118 ? 14.406  7.979   -7.337  1.00 2.27  ? 118 LEU A HD23 2  
ATOM 7141   N N    . ASP A 1 119 ? 14.943  3.453   -11.086 1.00 2.04  ? 119 ASP A N    2  
ATOM 7142   C CA   . ASP A 1 119 ? 15.114  2.083   -11.669 1.00 2.14  ? 119 ASP A CA   2  
ATOM 7143   C C    . ASP A 1 119 ? 14.909  0.998   -10.602 1.00 2.12  ? 119 ASP A C    2  
ATOM 7144   O O    . ASP A 1 119 ? 15.663  0.047   -10.533 1.00 2.19  ? 119 ASP A O    2  
ATOM 7145   C CB   . ASP A 1 119 ? 16.529  1.962   -12.236 1.00 2.30  ? 119 ASP A CB   2  
ATOM 7146   C CG   . ASP A 1 119 ? 16.643  0.685   -13.069 1.00 2.69  ? 119 ASP A CG   2  
ATOM 7147   O OD1  . ASP A 1 119 ? 15.822  -0.197  -12.881 1.00 3.23  ? 119 ASP A OD1  2  
ATOM 7148   O OD2  . ASP A 1 119 ? 17.549  0.611   -13.882 1.00 3.10  ? 119 ASP A OD2  2  
ATOM 7149   H H    . ASP A 1 119 ? 15.711  3.910   -10.681 1.00 2.08  ? 119 ASP A H    2  
ATOM 7150   H HA   . ASP A 1 119 ? 14.401  1.937   -12.468 1.00 2.15  ? 119 ASP A HA   2  
ATOM 7151   H HB2  . ASP A 1 119 ? 16.741  2.820   -12.860 1.00 2.47  ? 119 ASP A HB2  2  
ATOM 7152   H HB3  . ASP A 1 119 ? 17.240  1.925   -11.425 1.00 2.58  ? 119 ASP A HB3  2  
ATOM 7153   N N    . ASP A 1 120 ? 13.897  1.119   -9.775  1.00 2.03  ? 120 ASP A N    2  
ATOM 7154   C CA   . ASP A 1 120 ? 13.649  0.076   -8.720  1.00 2.03  ? 120 ASP A CA   2  
ATOM 7155   C C    . ASP A 1 120 ? 12.145  -0.230  -8.642  1.00 1.96  ? 120 ASP A C    2  
ATOM 7156   O O    . ASP A 1 120 ? 11.318  0.620   -8.902  1.00 1.85  ? 120 ASP A O    2  
ATOM 7157   C CB   . ASP A 1 120 ? 14.138  0.597   -7.365  1.00 2.01  ? 120 ASP A CB   2  
ATOM 7158   C CG   . ASP A 1 120 ? 14.340  -0.576  -6.400  1.00 2.09  ? 120 ASP A CG   2  
ATOM 7159   O OD1  . ASP A 1 120 ? 13.802  -1.638  -6.670  1.00 2.27  ? 120 ASP A OD1  2  
ATOM 7160   O OD2  . ASP A 1 120 ? 15.029  -0.393  -5.411  1.00 2.49  ? 120 ASP A OD2  2  
ATOM 7161   H H    . ASP A 1 120 ? 13.297  1.890   -9.849  1.00 1.97  ? 120 ASP A H    2  
ATOM 7162   H HA   . ASP A 1 120 ? 14.179  -0.833  -8.971  1.00 2.12  ? 120 ASP A HA   2  
ATOM 7163   H HB2  . ASP A 1 120 ? 15.074  1.122   -7.497  1.00 2.06  ? 120 ASP A HB2  2  
ATOM 7164   H HB3  . ASP A 1 120 ? 13.404  1.271   -6.955  1.00 1.91  ? 120 ASP A HB3  2  
ATOM 7165   N N    . GLU A 1 121 ? 11.786  -1.430  -8.262  1.00 2.04  ? 121 GLU A N    2  
ATOM 7166   C CA   . GLU A 1 121 ? 10.334  -1.764  -8.144  1.00 2.01  ? 121 GLU A CA   2  
ATOM 7167   C C    . GLU A 1 121 ? 9.757   -1.063  -6.914  1.00 1.91  ? 121 GLU A C    2  
ATOM 7168   O O    . GLU A 1 121 ? 8.906   -0.202  -7.018  1.00 1.85  ? 121 GLU A O    2  
ATOM 7169   C CB   . GLU A 1 121 ? 10.162  -3.278  -7.996  1.00 2.17  ? 121 GLU A CB   2  
ATOM 7170   C CG   . GLU A 1 121 ? 10.468  -3.962  -9.329  1.00 2.84  ? 121 GLU A CG   2  
ATOM 7171   C CD   . GLU A 1 121 ? 9.359   -3.637  -10.333 1.00 3.37  ? 121 GLU A CD   2  
ATOM 7172   O OE1  . GLU A 1 121 ? 8.261   -3.334  -9.896  1.00 3.95  ? 121 GLU A OE1  2  
ATOM 7173   O OE2  . GLU A 1 121 ? 9.629   -3.693  -11.522 1.00 3.68  ? 121 GLU A OE2  2  
ATOM 7174   H H    . GLU A 1 121 ? 12.471  -2.091  -8.028  1.00 2.13  ? 121 GLU A H    2  
ATOM 7175   H HA   . GLU A 1 121 ? 9.815   -1.425  -9.027  1.00 1.97  ? 121 GLU A HA   2  
ATOM 7176   H HB2  . GLU A 1 121 ? 10.840  -3.644  -7.239  1.00 2.33  ? 121 GLU A HB2  2  
ATOM 7177   H HB3  . GLU A 1 121 ? 9.145   -3.498  -7.705  1.00 2.29  ? 121 GLU A HB3  2  
ATOM 7178   H HG2  . GLU A 1 121 ? 11.416  -3.607  -9.708  1.00 3.17  ? 121 GLU A HG2  2  
ATOM 7179   H HG3  . GLU A 1 121 ? 10.515  -5.031  -9.183  1.00 3.30  ? 121 GLU A HG3  2  
ATOM 7180   N N    . TYR A 1 122 ? 10.207  -1.451  -5.749  1.00 1.92  ? 122 TYR A N    2  
ATOM 7181   C CA   . TYR A 1 122 ? 9.695   -0.848  -4.478  1.00 1.87  ? 122 TYR A CA   2  
ATOM 7182   C C    . TYR A 1 122 ? 9.479   0.662   -4.651  1.00 1.71  ? 122 TYR A C    2  
ATOM 7183   O O    . TYR A 1 122 ? 8.477   1.206   -4.220  1.00 1.60  ? 122 TYR A O    2  
ATOM 7184   C CB   . TYR A 1 122 ? 10.729  -1.118  -3.363  1.00 1.99  ? 122 TYR A CB   2  
ATOM 7185   C CG   . TYR A 1 122 ? 10.644  -0.067  -2.269  1.00 1.96  ? 122 TYR A CG   2  
ATOM 7186   C CD1  . TYR A 1 122 ? 9.466   0.088   -1.526  1.00 1.93  ? 122 TYR A CD1  2  
ATOM 7187   C CD2  . TYR A 1 122 ? 11.747  0.763   -2.010  1.00 1.99  ? 122 TYR A CD2  2  
ATOM 7188   C CE1  . TYR A 1 122 ? 9.392   1.065   -0.527  1.00 1.94  ? 122 TYR A CE1  2  
ATOM 7189   C CE2  . TYR A 1 122 ? 11.671  1.736   -1.010  1.00 1.98  ? 122 TYR A CE2  2  
ATOM 7190   C CZ   . TYR A 1 122 ? 10.496  1.888   -0.270  1.00 1.96  ? 122 TYR A CZ   2  
ATOM 7191   O OH   . TYR A 1 122 ? 10.427  2.853   0.709   1.00 2.00  ? 122 TYR A OH   2  
ATOM 7192   H H    . TYR A 1 122 ? 10.853  -2.186  -5.712  1.00 1.98  ? 122 TYR A H    2  
ATOM 7193   H HA   . TYR A 1 122 ? 8.757   -1.313  -4.215  1.00 1.89  ? 122 TYR A HA   2  
ATOM 7194   H HB2  . TYR A 1 122 ? 10.539  -2.091  -2.932  1.00 2.10  ? 122 TYR A HB2  2  
ATOM 7195   H HB3  . TYR A 1 122 ? 11.720  -1.112  -3.793  1.00 2.03  ? 122 TYR A HB3  2  
ATOM 7196   H HD1  . TYR A 1 122 ? 8.613   -0.547  -1.722  1.00 1.94  ? 122 TYR A HD1  2  
ATOM 7197   H HD2  . TYR A 1 122 ? 12.655  0.653   -2.585  1.00 2.03  ? 122 TYR A HD2  2  
ATOM 7198   H HE1  . TYR A 1 122 ? 8.484   1.189   0.044   1.00 1.96  ? 122 TYR A HE1  2  
ATOM 7199   H HE2  . TYR A 1 122 ? 12.521  2.371   -0.809  1.00 2.02  ? 122 TYR A HE2  2  
ATOM 7200   H HH   . TYR A 1 122 ? 9.538   3.215   0.705   1.00 2.25  ? 122 TYR A HH   2  
ATOM 7201   N N    . LEU A 1 123 ? 10.380  1.340   -5.295  1.00 1.70  ? 123 LEU A N    2  
ATOM 7202   C CA   . LEU A 1 123 ? 10.186  2.795   -5.502  1.00 1.57  ? 123 LEU A CA   2  
ATOM 7203   C C    . LEU A 1 123 ? 9.049   2.983   -6.513  1.00 1.48  ? 123 LEU A C    2  
ATOM 7204   O O    . LEU A 1 123 ? 8.213   3.854   -6.379  1.00 1.36  ? 123 LEU A O    2  
ATOM 7205   C CB   . LEU A 1 123 ? 11.484  3.407   -6.038  1.00 1.63  ? 123 LEU A CB   2  
ATOM 7206   C CG   . LEU A 1 123 ? 12.638  3.157   -5.048  1.00 1.73  ? 123 LEU A CG   2  
ATOM 7207   C CD1  . LEU A 1 123 ? 13.948  3.706   -5.629  1.00 1.86  ? 123 LEU A CD1  2  
ATOM 7208   C CD2  . LEU A 1 123 ? 12.353  3.854   -3.709  1.00 1.72  ? 123 LEU A CD2  2  
ATOM 7209   H H    . LEU A 1 123 ? 11.164  0.896   -5.680  1.00 1.81  ? 123 LEU A H    2  
ATOM 7210   H HA   . LEU A 1 123 ? 9.914   3.265   -4.571  1.00 1.52  ? 123 LEU A HA   2  
ATOM 7211   H HB2  . LEU A 1 123 ? 11.725  2.961   -6.993  1.00 1.70  ? 123 LEU A HB2  2  
ATOM 7212   H HB3  . LEU A 1 123 ? 11.347  4.465   -6.163  1.00 1.57  ? 123 LEU A HB3  2  
ATOM 7213   H HG   . LEU A 1 123 ? 12.739  2.094   -4.883  1.00 1.80  ? 123 LEU A HG   2  
ATOM 7214   H HD11 . LEU A 1 123 ? 14.012  3.463   -6.675  1.00 2.27  ? 123 LEU A HD11 2  
ATOM 7215   H HD12 . LEU A 1 123 ? 13.975  4.779   -5.510  1.00 2.14  ? 123 LEU A HD12 2  
ATOM 7216   H HD13 . LEU A 1 123 ? 14.784  3.265   -5.107  1.00 2.03  ? 123 LEU A HD13 2  
ATOM 7217   H HD21 . LEU A 1 123 ? 11.908  4.818   -3.894  1.00 1.92  ? 123 LEU A HD21 2  
ATOM 7218   H HD22 . LEU A 1 123 ? 11.680  3.249   -3.124  1.00 2.11  ? 123 LEU A HD22 2  
ATOM 7219   H HD23 . LEU A 1 123 ? 13.277  3.984   -3.163  1.00 1.98  ? 123 LEU A HD23 2  
ATOM 7220   N N    . LYS A 1 124 ? 9.019   2.152   -7.522  1.00 1.56  ? 124 LYS A N    2  
ATOM 7221   C CA   . LYS A 1 124 ? 7.950   2.239   -8.559  1.00 1.52  ? 124 LYS A CA   2  
ATOM 7222   C C    . LYS A 1 124 ? 6.576   1.997   -7.926  1.00 1.43  ? 124 LYS A C    2  
ATOM 7223   O O    . LYS A 1 124 ? 5.593   2.604   -8.302  1.00 1.33  ? 124 LYS A O    2  
ATOM 7224   C CB   . LYS A 1 124 ? 8.197   1.178   -9.638  1.00 1.68  ? 124 LYS A CB   2  
ATOM 7225   C CG   . LYS A 1 124 ? 7.248   1.413   -10.818 1.00 1.69  ? 124 LYS A CG   2  
ATOM 7226   C CD   . LYS A 1 124 ? 7.343   0.242   -11.804 1.00 1.92  ? 124 LYS A CD   2  
ATOM 7227   C CE   . LYS A 1 124 ? 8.748   0.179   -12.416 1.00 2.25  ? 124 LYS A CE   2  
ATOM 7228   N NZ   . LYS A 1 124 ? 8.686   -0.557  -13.713 1.00 2.84  ? 124 LYS A NZ   2  
ATOM 7229   H H    . LYS A 1 124 ? 9.707   1.458   -7.596  1.00 1.67  ? 124 LYS A H    2  
ATOM 7230   H HA   . LYS A 1 124 ? 7.967   3.219   -9.011  1.00 1.47  ? 124 LYS A HA   2  
ATOM 7231   H HB2  . LYS A 1 124 ? 9.220   1.245   -9.980  1.00 1.76  ? 124 LYS A HB2  2  
ATOM 7232   H HB3  . LYS A 1 124 ? 8.019   0.197   -9.225  1.00 1.72  ? 124 LYS A HB3  2  
ATOM 7233   H HG2  . LYS A 1 124 ? 6.233   1.493   -10.453 1.00 1.63  ? 124 LYS A HG2  2  
ATOM 7234   H HG3  . LYS A 1 124 ? 7.519   2.329   -11.322 1.00 1.68  ? 124 LYS A HG3  2  
ATOM 7235   H HD2  . LYS A 1 124 ? 7.138   -0.681  -11.282 1.00 2.27  ? 124 LYS A HD2  2  
ATOM 7236   H HD3  . LYS A 1 124 ? 6.617   0.378   -12.591 1.00 2.19  ? 124 LYS A HD3  2  
ATOM 7237   H HE2  . LYS A 1 124 ? 9.117   1.179   -12.590 1.00 2.63  ? 124 LYS A HE2  2  
ATOM 7238   H HE3  . LYS A 1 124 ? 9.412   -0.339  -11.741 1.00 2.58  ? 124 LYS A HE3  2  
ATOM 7239   H HZ1  . LYS A 1 124 ? 7.931   -0.152  -14.304 1.00 3.24  ? 124 LYS A HZ1  2  
ATOM 7240   H HZ2  . LYS A 1 124 ? 9.597   -0.470  -14.205 1.00 3.31  ? 124 LYS A HZ2  2  
ATOM 7241   H HZ3  . LYS A 1 124 ? 8.485   -1.561  -13.533 1.00 3.06  ? 124 LYS A HZ3  2  
ATOM 7242   N N    . GLU A 1 125 ? 6.491   1.089   -6.992  1.00 1.46  ? 125 GLU A N    2  
ATOM 7243   C CA   . GLU A 1 125 ? 5.169   0.782   -6.369  1.00 1.39  ? 125 GLU A CA   2  
ATOM 7244   C C    . GLU A 1 125 ? 4.587   2.026   -5.701  1.00 1.25  ? 125 GLU A C    2  
ATOM 7245   O O    . GLU A 1 125 ? 3.431   2.353   -5.889  1.00 1.18  ? 125 GLU A O    2  
ATOM 7246   C CB   . GLU A 1 125 ? 5.349   -0.313  -5.313  1.00 1.48  ? 125 GLU A CB   2  
ATOM 7247   C CG   . GLU A 1 125 ? 5.667   -1.642  -6.001  1.00 1.60  ? 125 GLU A CG   2  
ATOM 7248   C CD   . GLU A 1 125 ? 4.426   -2.146  -6.737  1.00 2.07  ? 125 GLU A CD   2  
ATOM 7249   O OE1  . GLU A 1 125 ? 3.333   -1.813  -6.309  1.00 2.49  ? 125 GLU A OE1  2  
ATOM 7250   O OE2  . GLU A 1 125 ? 4.588   -2.857  -7.714  1.00 2.73  ? 125 GLU A OE2  2  
ATOM 7251   H H    . GLU A 1 125 ? 7.289   0.590   -6.721  1.00 1.55  ? 125 GLU A H    2  
ATOM 7252   H HA   . GLU A 1 125 ? 4.488   0.437   -7.129  1.00 1.40  ? 125 GLU A HA   2  
ATOM 7253   H HB2  . GLU A 1 125 ? 6.160   -0.045  -4.653  1.00 1.51  ? 125 GLU A HB2  2  
ATOM 7254   H HB3  . GLU A 1 125 ? 4.438   -0.415  -4.743  1.00 1.43  ? 125 GLU A HB3  2  
ATOM 7255   H HG2  . GLU A 1 125 ? 6.473   -1.498  -6.706  1.00 1.86  ? 125 GLU A HG2  2  
ATOM 7256   H HG3  . GLU A 1 125 ? 5.964   -2.369  -5.259  1.00 1.77  ? 125 GLU A HG3  2  
ATOM 7257   N N    . ARG A 1 126 ? 5.362   2.729   -4.932  1.00 1.23  ? 126 ARG A N    2  
ATOM 7258   C CA   . ARG A 1 126 ? 4.813   3.948   -4.276  1.00 1.11  ? 126 ARG A CA   2  
ATOM 7259   C C    . ARG A 1 126 ? 4.576   5.020   -5.339  1.00 1.04  ? 126 ARG A C    2  
ATOM 7260   O O    . ARG A 1 126 ? 3.672   5.825   -5.229  1.00 0.94  ? 126 ARG A O    2  
ATOM 7261   C CB   . ARG A 1 126 ? 5.780   4.449   -3.206  1.00 1.16  ? 126 ARG A CB   2  
ATOM 7262   C CG   . ARG A 1 126 ? 5.858   3.401   -2.088  1.00 1.12  ? 126 ARG A CG   2  
ATOM 7263   C CD   . ARG A 1 126 ? 6.600   3.963   -0.874  1.00 1.19  ? 126 ARG A CD   2  
ATOM 7264   N NE   . ARG A 1 126 ? 7.824   4.712   -1.307  1.00 1.63  ? 126 ARG A NE   2  
ATOM 7265   C CZ   . ARG A 1 126 ? 8.731   4.165   -2.071  1.00 2.01  ? 126 ARG A CZ   2  
ATOM 7266   N NH1  . ARG A 1 126 ? 8.700   2.888   -2.334  1.00 2.27  ? 126 ARG A NH1  2  
ATOM 7267   N NH2  . ARG A 1 126 ? 9.706   4.892   -2.532  1.00 2.77  ? 126 ARG A NH2  2  
ATOM 7268   H H    . ARG A 1 126 ? 6.295   2.460   -4.788  1.00 1.31  ? 126 ARG A H    2  
ATOM 7269   H HA   . ARG A 1 126 ? 3.867   3.702   -3.815  1.00 1.08  ? 126 ARG A HA   2  
ATOM 7270   H HB2  . ARG A 1 126 ? 6.755   4.594   -3.646  1.00 1.24  ? 126 ARG A HB2  2  
ATOM 7271   H HB3  . ARG A 1 126 ? 5.423   5.383   -2.800  1.00 1.17  ? 126 ARG A HB3  2  
ATOM 7272   H HG2  . ARG A 1 126 ? 4.855   3.131   -1.790  1.00 1.07  ? 126 ARG A HG2  2  
ATOM 7273   H HG3  . ARG A 1 126 ? 6.363   2.524   -2.452  1.00 1.16  ? 126 ARG A HG3  2  
ATOM 7274   H HD2  . ARG A 1 126 ? 5.960   4.651   -0.357  1.00 1.51  ? 126 ARG A HD2  2  
ATOM 7275   H HD3  . ARG A 1 126 ? 6.851   3.146   -0.201  1.00 1.51  ? 126 ARG A HD3  2  
ATOM 7276   H HE   . ARG A 1 126 ? 7.922   5.654   -1.051  1.00 2.21  ? 126 ARG A HE   2  
ATOM 7277   H HH11 . ARG A 1 126 ? 7.982   2.314   -1.946  1.00 2.25  ? 126 ARG A HH11 2  
ATOM 7278   H HH12 . ARG A 1 126 ? 9.397   2.483   -2.926  1.00 2.91  ? 126 ARG A HH12 2  
ATOM 7279   H HH21 . ARG A 1 126 ? 9.760   5.863   -2.300  1.00 3.19  ? 126 ARG A HH21 2  
ATOM 7280   H HH22 . ARG A 1 126 ? 10.394  4.481   -3.123  1.00 3.20  ? 126 ARG A HH22 2  
ATOM 7281   N N    . ALA A 1 127 ? 5.357   5.022   -6.385  1.00 1.10  ? 127 ALA A N    2  
ATOM 7282   C CA   . ALA A 1 127 ? 5.140   6.026   -7.462  1.00 1.06  ? 127 ALA A CA   2  
ATOM 7283   C C    . ALA A 1 127 ? 3.731   5.815   -8.006  1.00 1.02  ? 127 ALA A C    2  
ATOM 7284   O O    . ALA A 1 127 ? 3.078   6.730   -8.469  1.00 0.95  ? 127 ALA A O    2  
ATOM 7285   C CB   . ALA A 1 127 ? 6.161   5.812   -8.584  1.00 1.19  ? 127 ALA A CB   2  
ATOM 7286   H H    . ALA A 1 127 ? 6.067   4.352   -6.471  1.00 1.19  ? 127 ALA A H    2  
ATOM 7287   H HA   . ALA A 1 127 ? 5.235   7.024   -7.059  1.00 1.01  ? 127 ALA A HA   2  
ATOM 7288   H HB1  . ALA A 1 127 ? 6.054   4.815   -8.982  1.00 1.43  ? 127 ALA A HB1  2  
ATOM 7289   H HB2  . ALA A 1 127 ? 5.988   6.534   -9.369  1.00 1.66  ? 127 ALA A HB2  2  
ATOM 7290   H HB3  . ALA A 1 127 ? 7.159   5.938   -8.192  1.00 1.66  ? 127 ALA A HB3  2  
ATOM 7291   N N    . ALA A 1 128 ? 3.251   4.606   -7.914  1.00 1.08  ? 128 ALA A N    2  
ATOM 7292   C CA   . ALA A 1 128 ? 1.874   4.305   -8.380  1.00 1.09  ? 128 ALA A CA   2  
ATOM 7293   C C    . ALA A 1 128 ? 0.880   4.944   -7.404  1.00 0.98  ? 128 ALA A C    2  
ATOM 7294   O O    . ALA A 1 128 ? -0.150  5.458   -7.792  1.00 0.96  ? 128 ALA A O    2  
ATOM 7295   C CB   . ALA A 1 128 ? 1.662   2.788   -8.415  1.00 1.20  ? 128 ALA A CB   2  
ATOM 7296   H H    . ALA A 1 128 ? 3.801   3.907   -7.498  1.00 1.15  ? 128 ALA A H    2  
ATOM 7297   H HA   . ALA A 1 128 ? 1.726   4.716   -9.368  1.00 1.10  ? 128 ALA A HA   2  
ATOM 7298   H HB1  . ALA A 1 128 ? 2.532   2.315   -8.849  1.00 1.53  ? 128 ALA A HB1  2  
ATOM 7299   H HB2  . ALA A 1 128 ? 1.515   2.419   -7.411  1.00 1.54  ? 128 ALA A HB2  2  
ATOM 7300   H HB3  . ALA A 1 128 ? 0.793   2.559   -9.015  1.00 1.67  ? 128 ALA A HB3  2  
ATOM 7301   N N    . ASP A 1 129 ? 1.186   4.897   -6.132  1.00 0.94  ? 129 ASP A N    2  
ATOM 7302   C CA   . ASP A 1 129 ? 0.268   5.483   -5.112  1.00 0.87  ? 129 ASP A CA   2  
ATOM 7303   C C    . ASP A 1 129 ? 0.114   6.990   -5.332  1.00 0.78  ? 129 ASP A C    2  
ATOM 7304   O O    . ASP A 1 129 ? -0.971  7.529   -5.239  1.00 0.74  ? 129 ASP A O    2  
ATOM 7305   C CB   . ASP A 1 129 ? 0.846   5.238   -3.717  1.00 0.88  ? 129 ASP A CB   2  
ATOM 7306   C CG   . ASP A 1 129 ? 0.757   3.749   -3.376  1.00 1.00  ? 129 ASP A CG   2  
ATOM 7307   O OD1  . ASP A 1 129 ? -0.038  3.066   -4.000  1.00 1.55  ? 129 ASP A OD1  2  
ATOM 7308   O OD2  . ASP A 1 129 ? 1.483   3.318   -2.496  1.00 1.46  ? 129 ASP A OD2  2  
ATOM 7309   H H    . ASP A 1 129 ? 2.020   4.465   -5.848  1.00 0.98  ? 129 ASP A H    2  
ATOM 7310   H HA   . ASP A 1 129 ? -0.697  5.011   -5.186  1.00 0.89  ? 129 ASP A HA   2  
ATOM 7311   H HB2  . ASP A 1 129 ? 1.881   5.549   -3.697  1.00 0.89  ? 129 ASP A HB2  2  
ATOM 7312   H HB3  . ASP A 1 129 ? 0.286   5.805   -2.990  1.00 0.87  ? 129 ASP A HB3  2  
ATOM 7313   N N    . VAL A 1 130 ? 1.185   7.678   -5.617  1.00 0.78  ? 130 VAL A N    2  
ATOM 7314   C CA   . VAL A 1 130 ? 1.077   9.151   -5.834  1.00 0.73  ? 130 VAL A CA   2  
ATOM 7315   C C    . VAL A 1 130 ? 0.287   9.412   -7.121  1.00 0.72  ? 130 VAL A C    2  
ATOM 7316   O O    . VAL A 1 130 ? -0.543  10.298  -7.185  1.00 0.67  ? 130 VAL A O    2  
ATOM 7317   C CB   . VAL A 1 130 ? 2.484   9.767   -5.921  1.00 0.77  ? 130 VAL A CB   2  
ATOM 7318   C CG1  . VAL A 1 130 ? 2.390   11.221  -6.387  1.00 0.76  ? 130 VAL A CG1  2  
ATOM 7319   C CG2  . VAL A 1 130 ? 3.135   9.725   -4.535  1.00 0.80  ? 130 VAL A CG2  2  
ATOM 7320   H H    . VAL A 1 130 ? 2.054   7.231   -5.685  1.00 0.84  ? 130 VAL A H    2  
ATOM 7321   H HA   . VAL A 1 130 ? 0.547   9.590   -4.999  1.00 0.70  ? 130 VAL A HA   2  
ATOM 7322   H HB   . VAL A 1 130 ? 3.092   9.210   -6.616  1.00 0.82  ? 130 VAL A HB   2  
ATOM 7323   H HG11 . VAL A 1 130 ? 1.664   11.746  -5.784  1.00 1.17  ? 130 VAL A HG11 2  
ATOM 7324   H HG12 . VAL A 1 130 ? 3.356   11.692  -6.281  1.00 1.29  ? 130 VAL A HG12 2  
ATOM 7325   H HG13 . VAL A 1 130 ? 2.089   11.253  -7.422  1.00 1.32  ? 130 VAL A HG13 2  
ATOM 7326   H HG21 . VAL A 1 130 ? 3.083   8.720   -4.142  1.00 1.28  ? 130 VAL A HG21 2  
ATOM 7327   H HG22 . VAL A 1 130 ? 4.170   10.028  -4.614  1.00 1.30  ? 130 VAL A HG22 2  
ATOM 7328   H HG23 . VAL A 1 130 ? 2.613   10.398  -3.871  1.00 1.31  ? 130 VAL A HG23 2  
ATOM 7329   N N    . ARG A 1 131 ? 0.526   8.634   -8.140  1.00 0.80  ? 131 ARG A N    2  
ATOM 7330   C CA   . ARG A 1 131 ? -0.221  8.820   -9.417  1.00 0.82  ? 131 ARG A CA   2  
ATOM 7331   C C    . ARG A 1 131 ? -1.719  8.625   -9.162  1.00 0.80  ? 131 ARG A C    2  
ATOM 7332   O O    . ARG A 1 131 ? -2.551  9.306   -9.729  1.00 0.79  ? 131 ARG A O    2  
ATOM 7333   C CB   . ARG A 1 131 ? 0.257   7.792   -10.445 1.00 0.93  ? 131 ARG A CB   2  
ATOM 7334   C CG   . ARG A 1 131 ? -0.360  8.110   -11.814 1.00 1.01  ? 131 ARG A CG   2  
ATOM 7335   C CD   . ARG A 1 131 ? 0.068   7.050   -12.849 1.00 1.15  ? 131 ARG A CD   2  
ATOM 7336   N NE   . ARG A 1 131 ? 0.283   7.696   -14.186 1.00 1.66  ? 131 ARG A NE   2  
ATOM 7337   C CZ   . ARG A 1 131 ? -0.595  8.519   -14.699 1.00 2.13  ? 131 ARG A CZ   2  
ATOM 7338   N NH1  . ARG A 1 131 ? -1.751  8.703   -14.125 1.00 2.30  ? 131 ARG A NH1  2  
ATOM 7339   N NH2  . ARG A 1 131 ? -0.327  9.129   -15.821 1.00 3.09  ? 131 ARG A NH2  2  
ATOM 7340   H H    . ARG A 1 131 ? 1.189   7.918   -8.061  1.00 0.86  ? 131 ARG A H    2  
ATOM 7341   H HA   . ARG A 1 131 ? -0.046  9.816   -9.795  1.00 0.80  ? 131 ARG A HA   2  
ATOM 7342   H HB2  . ARG A 1 131 ? 1.335   7.831   -10.518 1.00 0.97  ? 131 ARG A HB2  2  
ATOM 7343   H HB3  . ARG A 1 131 ? -0.049  6.804   -10.137 1.00 0.97  ? 131 ARG A HB3  2  
ATOM 7344   H HG2  . ARG A 1 131 ? -1.435  8.115   -11.716 1.00 1.05  ? 131 ARG A HG2  2  
ATOM 7345   H HG3  . ARG A 1 131 ? -0.026  9.085   -12.140 1.00 1.07  ? 131 ARG A HG3  2  
ATOM 7346   H HD2  . ARG A 1 131 ? 0.999   6.598   -12.549 1.00 1.55  ? 131 ARG A HD2  2  
ATOM 7347   H HD3  . ARG A 1 131 ? -0.694  6.279   -12.913 1.00 1.67  ? 131 ARG A HD3  2  
ATOM 7348   H HE   . ARG A 1 131 ? 1.117   7.524   -14.670 1.00 2.27  ? 131 ARG A HE   2  
ATOM 7349   H HH11 . ARG A 1 131 ? -1.979  8.211   -13.291 1.00 2.21  ? 131 ARG A HH11 2  
ATOM 7350   H HH12 . ARG A 1 131 ? -2.410  9.340   -14.525 1.00 2.97  ? 131 ARG A HH12 2  
ATOM 7351   H HH21 . ARG A 1 131 ? 0.544   8.965   -16.284 1.00 3.56  ? 131 ARG A HH21 2  
ATOM 7352   H HH22 . ARG A 1 131 ? -0.994  9.758   -16.220 1.00 3.58  ? 131 ARG A HH22 2  
ATOM 7353   N N    . ASP A 1 132 ? -2.067  7.680   -8.328  1.00 0.82  ? 132 ASP A N    2  
ATOM 7354   C CA   . ASP A 1 132 ? -3.507  7.409   -8.047  1.00 0.83  ? 132 ASP A CA   2  
ATOM 7355   C C    . ASP A 1 132 ? -4.184  8.652   -7.460  1.00 0.75  ? 132 ASP A C    2  
ATOM 7356   O O    . ASP A 1 132 ? -5.311  8.962   -7.793  1.00 0.76  ? 132 ASP A O    2  
ATOM 7357   C CB   . ASP A 1 132 ? -3.615  6.253   -7.048  1.00 0.88  ? 132 ASP A CB   2  
ATOM 7358   C CG   . ASP A 1 132 ? -5.089  5.963   -6.749  1.00 0.93  ? 132 ASP A CG   2  
ATOM 7359   O OD1  . ASP A 1 132 ? -5.738  5.371   -7.596  1.00 1.46  ? 132 ASP A OD1  2  
ATOM 7360   O OD2  . ASP A 1 132 ? -5.543  6.340   -5.680  1.00 1.36  ? 132 ASP A OD2  2  
ATOM 7361   H H    . ASP A 1 132 ? -1.376  7.133   -7.899  1.00 0.84  ? 132 ASP A H    2  
ATOM 7362   H HA   . ASP A 1 132 ? -4.004  7.132   -8.964  1.00 0.88  ? 132 ASP A HA   2  
ATOM 7363   H HB2  . ASP A 1 132 ? -3.153  5.371   -7.468  1.00 0.94  ? 132 ASP A HB2  2  
ATOM 7364   H HB3  . ASP A 1 132 ? -3.111  6.522   -6.132  1.00 0.86  ? 132 ASP A HB3  2  
ATOM 7365   N N    . ILE A 1 133 ? -3.523  9.368   -6.592  1.00 0.69  ? 133 ILE A N    2  
ATOM 7366   C CA   . ILE A 1 133 ? -4.165  10.581  -6.007  1.00 0.64  ? 133 ILE A CA   2  
ATOM 7367   C C    . ILE A 1 133 ? -4.512  11.564  -7.127  1.00 0.60  ? 133 ILE A C    2  
ATOM 7368   O O    . ILE A 1 133 ? -5.593  12.119  -7.171  1.00 0.66  ? 133 ILE A O    2  
ATOM 7369   C CB   . ILE A 1 133 ? -3.208  11.261  -5.027  1.00 0.63  ? 133 ILE A CB   2  
ATOM 7370   C CG1  . ILE A 1 133 ? -2.871  10.299  -3.886  1.00 0.69  ? 133 ILE A CG1  2  
ATOM 7371   C CG2  . ILE A 1 133 ? -3.880  12.513  -4.457  1.00 0.61  ? 133 ILE A CG2  2  
ATOM 7372   C CD1  . ILE A 1 133 ? -1.731  10.883  -3.050  1.00 0.71  ? 133 ILE A CD1  2  
ATOM 7373   H H    . ILE A 1 133 ? -2.614  9.111   -6.327  1.00 0.70  ? 133 ILE A H    2  
ATOM 7374   H HA   . ILE A 1 133 ? -5.067  10.295  -5.489  1.00 0.68  ? 133 ILE A HA   2  
ATOM 7375   H HB   . ILE A 1 133 ? -2.304  11.543  -5.547  1.00 0.63  ? 133 ILE A HB   2  
ATOM 7376   H HG12 . ILE A 1 133 ? -3.742  10.159  -3.262  1.00 0.71  ? 133 ILE A HG12 2  
ATOM 7377   H HG13 . ILE A 1 133 ? -2.564  9.348   -4.295  1.00 0.74  ? 133 ILE A HG13 2  
ATOM 7378   H HG21 . ILE A 1 133 ? -4.891  12.275  -4.158  1.00 1.07  ? 133 ILE A HG21 2  
ATOM 7379   H HG22 . ILE A 1 133 ? -3.325  12.864  -3.601  1.00 1.20  ? 133 ILE A HG22 2  
ATOM 7380   H HG23 . ILE A 1 133 ? -3.902  13.285  -5.212  1.00 1.20  ? 133 ILE A HG23 2  
ATOM 7381   H HD11 . ILE A 1 133 ? -0.913  11.159  -3.698  1.00 1.22  ? 133 ILE A HD11 2  
ATOM 7382   H HD12 . ILE A 1 133 ? -2.083  11.757  -2.523  1.00 1.05  ? 133 ILE A HD12 2  
ATOM 7383   H HD13 . ILE A 1 133 ? -1.392  10.146  -2.337  1.00 1.15  ? 133 ILE A HD13 2  
ATOM 7384   N N    . GLY A 1 134 ? -3.601  11.780  -8.033  1.00 0.57  ? 134 GLY A N    2  
ATOM 7385   C CA   . GLY A 1 134 ? -3.868  12.728  -9.154  1.00 0.56  ? 134 GLY A CA   2  
ATOM 7386   C C    . GLY A 1 134 ? -4.992  12.185  -10.040 1.00 0.56  ? 134 GLY A C    2  
ATOM 7387   O O    . GLY A 1 134 ? -5.837  12.921  -10.507 1.00 0.55  ? 134 GLY A O    2  
ATOM 7388   H H    . GLY A 1 134 ? -2.740  11.315  -7.974  1.00 0.61  ? 134 GLY A H    2  
ATOM 7389   H HA2  . GLY A 1 134 ? -4.156  13.688  -8.754  1.00 0.55  ? 134 GLY A HA2  2  
ATOM 7390   H HA3  . GLY A 1 134 ? -2.975  12.841  -9.750  1.00 0.59  ? 134 GLY A HA3  2  
ATOM 7391   N N    . LYS A 1 135 ? -5.000  10.905  -10.285 1.00 0.62  ? 135 LYS A N    2  
ATOM 7392   C CA   . LYS A 1 135 ? -6.062  10.317  -11.154 1.00 0.67  ? 135 LYS A CA   2  
ATOM 7393   C C    . LYS A 1 135 ? -7.443  10.576  -10.543 1.00 0.65  ? 135 LYS A C    2  
ATOM 7394   O O    . LYS A 1 135 ? -8.352  11.036  -11.210 1.00 0.65  ? 135 LYS A O    2  
ATOM 7395   C CB   . LYS A 1 135 ? -5.837  8.802   -11.271 1.00 0.75  ? 135 LYS A CB   2  
ATOM 7396   C CG   . LYS A 1 135 ? -6.794  8.193   -12.325 1.00 1.24  ? 135 LYS A CG   2  
ATOM 7397   C CD   . LYS A 1 135 ? -6.128  8.192   -13.718 1.00 1.30  ? 135 LYS A CD   2  
ATOM 7398   C CE   . LYS A 1 135 ? -5.308  6.909   -13.903 1.00 1.98  ? 135 LYS A CE   2  
ATOM 7399   N NZ   . LYS A 1 135 ? -6.220  5.730   -13.873 1.00 2.59  ? 135 LYS A NZ   2  
ATOM 7400   H H    . LYS A 1 135 ? -4.301  10.330  -9.906  1.00 0.65  ? 135 LYS A H    2  
ATOM 7401   H HA   . LYS A 1 135 ? -6.012  10.764  -12.135 1.00 0.68  ? 135 LYS A HA   2  
ATOM 7402   H HB2  . LYS A 1 135 ? -4.812  8.615   -11.556 1.00 1.14  ? 135 LYS A HB2  2  
ATOM 7403   H HB3  . LYS A 1 135 ? -6.027  8.343   -10.311 1.00 1.18  ? 135 LYS A HB3  2  
ATOM 7404   H HG2  . LYS A 1 135 ? -7.038  7.177   -12.041 1.00 1.88  ? 135 LYS A HG2  2  
ATOM 7405   H HG3  . LYS A 1 135 ? -7.706  8.771   -12.370 1.00 1.90  ? 135 LYS A HG3  2  
ATOM 7406   H HD2  . LYS A 1 135 ? -6.892  8.238   -14.482 1.00 1.58  ? 135 LYS A HD2  2  
ATOM 7407   H HD3  . LYS A 1 135 ? -5.476  9.049   -13.812 1.00 1.71  ? 135 LYS A HD3  2  
ATOM 7408   H HE2  . LYS A 1 135 ? -4.794  6.943   -14.852 1.00 2.50  ? 135 LYS A HE2  2  
ATOM 7409   H HE3  . LYS A 1 135 ? -4.585  6.825   -13.105 1.00 2.39  ? 135 LYS A HE3  2  
ATOM 7410   H HZ1  . LYS A 1 135 ? -7.205  6.052   -13.957 1.00 3.03  ? 135 LYS A HZ1  2  
ATOM 7411   H HZ2  . LYS A 1 135 ? -5.993  5.097   -14.667 1.00 3.10  ? 135 LYS A HZ2  2  
ATOM 7412   H HZ3  . LYS A 1 135 ? -6.099  5.220   -12.977 1.00 2.78  ? 135 LYS A HZ3  2  
ATOM 7413   N N    . ARG A 1 136 ? -7.617  10.276  -9.287  1.00 0.65  ? 136 ARG A N    2  
ATOM 7414   C CA   . ARG A 1 136 ? -8.943  10.488  -8.649  1.00 0.67  ? 136 ARG A CA   2  
ATOM 7415   C C    . ARG A 1 136 ? -9.237  11.984  -8.535  1.00 0.63  ? 136 ARG A C    2  
ATOM 7416   O O    . ARG A 1 136 ? -10.374 12.407  -8.601  1.00 0.65  ? 136 ARG A O    2  
ATOM 7417   C CB   . ARG A 1 136 ? -8.937  9.863   -7.255  1.00 0.72  ? 136 ARG A CB   2  
ATOM 7418   C CG   . ARG A 1 136 ? -8.676  8.360   -7.371  1.00 0.86  ? 136 ARG A CG   2  
ATOM 7419   C CD   . ARG A 1 136 ? -8.742  7.725   -5.982  1.00 1.01  ? 136 ARG A CD   2  
ATOM 7420   N NE   . ARG A 1 136 ? -10.110 7.916   -5.428  1.00 1.21  ? 136 ARG A NE   2  
ATOM 7421   C CZ   . ARG A 1 136 ? -10.497 7.242   -4.380  1.00 2.12  ? 136 ARG A CZ   2  
ATOM 7422   N NH1  . ARG A 1 136 ? -9.677  6.414   -3.790  1.00 2.83  ? 136 ARG A NH1  2  
ATOM 7423   N NH2  . ARG A 1 136 ? -11.706 7.403   -3.916  1.00 2.77  ? 136 ARG A NH2  2  
ATOM 7424   H H    . ARG A 1 136 ? -6.888  9.894   -8.754  1.00 0.67  ? 136 ARG A H    2  
ATOM 7425   H HA   . ARG A 1 136 ? -9.709  10.017  -9.248  1.00 0.71  ? 136 ARG A HA   2  
ATOM 7426   H HB2  . ARG A 1 136 ? -8.160  10.319  -6.660  1.00 0.73  ? 136 ARG A HB2  2  
ATOM 7427   H HB3  . ARG A 1 136 ? -9.894  10.024  -6.783  1.00 0.73  ? 136 ARG A HB3  2  
ATOM 7428   H HG2  . ARG A 1 136 ? -9.423  7.912   -8.010  1.00 0.94  ? 136 ARG A HG2  2  
ATOM 7429   H HG3  . ARG A 1 136 ? -7.696  8.197   -7.794  1.00 0.89  ? 136 ARG A HG3  2  
ATOM 7430   H HD2  . ARG A 1 136 ? -8.526  6.670   -6.056  1.00 1.48  ? 136 ARG A HD2  2  
ATOM 7431   H HD3  . ARG A 1 136 ? -8.017  8.197   -5.334  1.00 1.45  ? 136 ARG A HD3  2  
ATOM 7432   H HE   . ARG A 1 136 ? -10.727 8.545   -5.857  1.00 1.45  ? 136 ARG A HE   2  
ATOM 7433   H HH11 . ARG A 1 136 ? -8.746  6.293   -4.139  1.00 2.73  ? 136 ARG A HH11 2  
ATOM 7434   H HH12 . ARG A 1 136 ? -9.980  5.899   -2.989  1.00 3.71  ? 136 ARG A HH12 2  
ATOM 7435   H HH21 . ARG A 1 136 ? -12.332 8.041   -4.363  1.00 2.75  ? 136 ARG A HH21 2  
ATOM 7436   H HH22 . ARG A 1 136 ? -12.006 6.888   -3.113  1.00 3.55  ? 136 ARG A HH22 2  
ATOM 7437   N N    . LEU A 1 137 ? -8.228  12.790  -8.357  1.00 0.59  ? 137 LEU A N    2  
ATOM 7438   C CA   . LEU A 1 137 ? -8.470  14.253  -8.232  1.00 0.57  ? 137 LEU A CA   2  
ATOM 7439   C C    . LEU A 1 137 ? -9.142  14.751  -9.511  1.00 0.56  ? 137 LEU A C    2  
ATOM 7440   O O    . LEU A 1 137 ? -10.056 15.550  -9.472  1.00 0.61  ? 137 LEU A O    2  
ATOM 7441   C CB   . LEU A 1 137 ? -7.129  14.971  -8.028  1.00 0.57  ? 137 LEU A CB   2  
ATOM 7442   C CG   . LEU A 1 137 ? -7.345  16.486  -7.894  1.00 0.63  ? 137 LEU A CG   2  
ATOM 7443   C CD1  . LEU A 1 137 ? -8.221  16.794  -6.666  1.00 1.19  ? 137 LEU A CD1  2  
ATOM 7444   C CD2  . LEU A 1 137 ? -5.980  17.168  -7.736  1.00 1.25  ? 137 LEU A CD2  2  
ATOM 7445   H H    . LEU A 1 137 ? -7.317  12.434  -8.300  1.00 0.60  ? 137 LEU A H    2  
ATOM 7446   H HA   . LEU A 1 137 ? -9.117  14.438  -7.386  1.00 0.59  ? 137 LEU A HA   2  
ATOM 7447   H HB2  . LEU A 1 137 ? -6.658  14.597  -7.131  1.00 0.64  ? 137 LEU A HB2  2  
ATOM 7448   H HB3  . LEU A 1 137 ? -6.489  14.776  -8.874  1.00 0.59  ? 137 LEU A HB3  2  
ATOM 7449   H HG   . LEU A 1 137 ? -7.830  16.862  -8.782  1.00 1.22  ? 137 LEU A HG   2  
ATOM 7450   H HD11 . LEU A 1 137 ? -7.990  16.101  -5.870  1.00 1.68  ? 137 LEU A HD11 2  
ATOM 7451   H HD12 . LEU A 1 137 ? -8.032  17.803  -6.328  1.00 1.68  ? 137 LEU A HD12 2  
ATOM 7452   H HD13 . LEU A 1 137 ? -9.262  16.700  -6.936  1.00 1.82  ? 137 LEU A HD13 2  
ATOM 7453   H HD21 . LEU A 1 137 ? -5.474  16.763  -6.871  1.00 1.65  ? 137 LEU A HD21 2  
ATOM 7454   H HD22 . LEU A 1 137 ? -5.384  16.987  -8.619  1.00 1.87  ? 137 LEU A HD22 2  
ATOM 7455   H HD23 . LEU A 1 137 ? -6.120  18.230  -7.607  1.00 1.86  ? 137 LEU A HD23 2  
ATOM 7456   N N    . LEU A 1 138 ? -8.713  14.271  -10.645 1.00 0.56  ? 138 LEU A N    2  
ATOM 7457   C CA   . LEU A 1 138 ? -9.347  14.706  -11.924 1.00 0.59  ? 138 LEU A CA   2  
ATOM 7458   C C    . LEU A 1 138 ? -10.829 14.341  -11.901 1.00 0.62  ? 138 LEU A C    2  
ATOM 7459   O O    . LEU A 1 138 ? -11.675 15.095  -12.338 1.00 0.67  ? 138 LEU A O    2  
ATOM 7460   C CB   . LEU A 1 138 ? -8.690  13.979  -13.100 1.00 0.62  ? 138 LEU A CB   2  
ATOM 7461   C CG   . LEU A 1 138 ? -7.256  14.481  -13.314 1.00 0.64  ? 138 LEU A CG   2  
ATOM 7462   C CD1  . LEU A 1 138 ? -6.534  13.514  -14.267 1.00 0.67  ? 138 LEU A CD1  2  
ATOM 7463   C CD2  . LEU A 1 138 ? -7.261  15.916  -13.912 1.00 0.70  ? 138 LEU A CD2  2  
ATOM 7464   H H    . LEU A 1 138 ? -7.985  13.616  -10.655 1.00 0.58  ? 138 LEU A H    2  
ATOM 7465   H HA   . LEU A 1 138 ? -9.235  15.772  -12.041 1.00 0.59  ? 138 LEU A HA   2  
ATOM 7466   H HB2  . LEU A 1 138 ? -8.669  12.919  -12.894 1.00 0.62  ? 138 LEU A HB2  2  
ATOM 7467   H HB3  . LEU A 1 138 ? -9.268  14.153  -13.995 1.00 0.66  ? 138 LEU A HB3  2  
ATOM 7468   H HG   . LEU A 1 138 ? -6.740  14.489  -12.363 1.00 0.65  ? 138 LEU A HG   2  
ATOM 7469   H HD11 . LEU A 1 138 ? -7.179  13.279  -15.102 1.00 1.29  ? 138 LEU A HD11 2  
ATOM 7470   H HD12 . LEU A 1 138 ? -5.628  13.975  -14.631 1.00 1.22  ? 138 LEU A HD12 2  
ATOM 7471   H HD13 . LEU A 1 138 ? -6.287  12.605  -13.738 1.00 1.17  ? 138 LEU A HD13 2  
ATOM 7472   H HD21 . LEU A 1 138 ? -8.275  16.252  -14.088 1.00 1.24  ? 138 LEU A HD21 2  
ATOM 7473   H HD22 . LEU A 1 138 ? -6.784  16.590  -13.218 1.00 1.16  ? 138 LEU A HD22 2  
ATOM 7474   H HD23 . LEU A 1 138 ? -6.718  15.934  -14.849 1.00 1.25  ? 138 LEU A HD23 2  
ATOM 7475   N N    . ARG A 1 139 ? -11.146 13.183  -11.394 1.00 0.65  ? 139 ARG A N    2  
ATOM 7476   C CA   . ARG A 1 139 ? -12.571 12.753  -11.340 1.00 0.70  ? 139 ARG A CA   2  
ATOM 7477   C C    . ARG A 1 139 ? -13.327 13.598  -10.311 1.00 0.68  ? 139 ARG A C    2  
ATOM 7478   O O    . ARG A 1 139 ? -14.463 13.977  -10.514 1.00 0.72  ? 139 ARG A O    2  
ATOM 7479   C CB   . ARG A 1 139 ? -12.636 11.278  -10.943 1.00 0.75  ? 139 ARG A CB   2  
ATOM 7480   C CG   . ARG A 1 139 ? -12.077 10.422  -12.081 1.00 0.80  ? 139 ARG A CG   2  
ATOM 7481   C CD   . ARG A 1 139 ? -12.323 8.944   -11.782 1.00 0.85  ? 139 ARG A CD   2  
ATOM 7482   N NE   . ARG A 1 139 ? -11.844 8.624   -10.408 1.00 1.34  ? 139 ARG A NE   2  
ATOM 7483   C CZ   . ARG A 1 139 ? -12.227 7.521   -9.826  1.00 1.71  ? 139 ARG A CZ   2  
ATOM 7484   N NH1  . ARG A 1 139 ? -13.025 6.699   -10.452 1.00 1.82  ? 139 ARG A NH1  2  
ATOM 7485   N NH2  . ARG A 1 139 ? -11.817 7.242   -8.620  1.00 2.57  ? 139 ARG A NH2  2  
ATOM 7486   H H    . ARG A 1 139 ? -10.439 12.596  -11.040 1.00 0.67  ? 139 ARG A H    2  
ATOM 7487   H HA   . ARG A 1 139 ? -13.022 12.883  -12.313 1.00 0.74  ? 139 ARG A HA   2  
ATOM 7488   H HB2  . ARG A 1 139 ? -12.049 11.120  -10.050 1.00 0.74  ? 139 ARG A HB2  2  
ATOM 7489   H HB3  . ARG A 1 139 ? -13.661 10.999  -10.755 1.00 0.85  ? 139 ARG A HB3  2  
ATOM 7490   H HG2  . ARG A 1 139 ? -12.568 10.690  -13.007 1.00 0.95  ? 139 ARG A HG2  2  
ATOM 7491   H HG3  . ARG A 1 139 ? -11.015 10.596  -12.174 1.00 0.82  ? 139 ARG A HG3  2  
ATOM 7492   H HD2  . ARG A 1 139 ? -13.381 8.734   -11.852 1.00 1.33  ? 139 ARG A HD2  2  
ATOM 7493   H HD3  . ARG A 1 139 ? -11.788 8.338   -12.497 1.00 1.24  ? 139 ARG A HD3  2  
ATOM 7494   H HE   . ARG A 1 139 ? -11.245 9.243   -9.941  1.00 1.93  ? 139 ARG A HE   2  
ATOM 7495   H HH11 . ARG A 1 139 ? -13.341 6.914   -11.375 1.00 1.81  ? 139 ARG A HH11 2  
ATOM 7496   H HH12 . ARG A 1 139 ? -13.318 5.852   -10.007 1.00 2.36  ? 139 ARG A HH12 2  
ATOM 7497   H HH21 . ARG A 1 139 ? -11.209 7.875   -8.140  1.00 3.05  ? 139 ARG A HH21 2  
ATOM 7498   H HH22 . ARG A 1 139 ? -12.110 6.395   -8.175  1.00 2.94  ? 139 ARG A HH22 2  
ATOM 7499   N N    . ASN A 1 140 ? -12.705 13.877  -9.201  1.00 0.65  ? 140 ASN A N    2  
ATOM 7500   C CA   . ASN A 1 140 ? -13.374 14.680  -8.137  1.00 0.68  ? 140 ASN A CA   2  
ATOM 7501   C C    . ASN A 1 140 ? -13.709 16.092  -8.634  1.00 0.68  ? 140 ASN A C    2  
ATOM 7502   O O    . ASN A 1 140 ? -14.731 16.646  -8.280  1.00 0.78  ? 140 ASN A O    2  
ATOM 7503   C CB   . ASN A 1 140 ? -12.460 14.767  -6.914  1.00 0.69  ? 140 ASN A CB   2  
ATOM 7504   C CG   . ASN A 1 140 ? -12.388 13.396  -6.241  1.00 0.73  ? 140 ASN A CG   2  
ATOM 7505   O OD1  . ASN A 1 140 ? -13.402 12.818  -5.903  1.00 1.23  ? 140 ASN A OD1  2  
ATOM 7506   N ND2  . ASN A 1 140 ? -11.225 12.842  -6.032  1.00 0.84  ? 140 ASN A ND2  2  
ATOM 7507   H H    . ASN A 1 140 ? -11.793 13.548  -9.058  1.00 0.64  ? 140 ASN A H    2  
ATOM 7508   H HA   . ASN A 1 140 ? -14.291 14.185  -7.851  1.00 0.72  ? 140 ASN A HA   2  
ATOM 7509   H HB2  . ASN A 1 140 ? -11.471 15.072  -7.225  1.00 0.67  ? 140 ASN A HB2  2  
ATOM 7510   H HB3  . ASN A 1 140 ? -12.858 15.489  -6.217  1.00 0.75  ? 140 ASN A HB3  2  
ATOM 7511   H HD21 . ASN A 1 140 ? -10.405 13.306  -6.303  1.00 1.26  ? 140 ASN A HD21 2  
ATOM 7512   H HD22 . ASN A 1 140 ? -11.172 11.962  -5.603  1.00 0.84  ? 140 ASN A HD22 2  
ATOM 7513   N N    . ILE A 1 141 ? -12.879 16.685  -9.454  1.00 0.66  ? 141 ILE A N    2  
ATOM 7514   C CA   . ILE A 1 141 ? -13.189 18.053  -9.959  1.00 0.70  ? 141 ILE A CA   2  
ATOM 7515   C C    . ILE A 1 141 ? -14.321 17.969  -10.978 1.00 0.73  ? 141 ILE A C    2  
ATOM 7516   O O    . ILE A 1 141 ? -15.215 18.789  -11.006 1.00 0.81  ? 141 ILE A O    2  
ATOM 7517   C CB   . ILE A 1 141 ? -11.948 18.633  -10.637 1.00 0.69  ? 141 ILE A CB   2  
ATOM 7518   C CG1  . ILE A 1 141 ? -10.810 18.724  -9.621  1.00 0.68  ? 141 ILE A CG1  2  
ATOM 7519   C CG2  . ILE A 1 141 ? -12.259 20.031  -11.178 1.00 0.78  ? 141 ILE A CG2  2  
ATOM 7520   C CD1  . ILE A 1 141 ? -9.508  19.064  -10.347 1.00 0.70  ? 141 ILE A CD1  2  
ATOM 7521   H H    . ILE A 1 141 ? -12.074 16.234  -9.774  1.00 0.66  ? 141 ILE A H    2  
ATOM 7522   H HA   . ILE A 1 141 ? -13.485 18.688  -9.138  1.00 0.74  ? 141 ILE A HA   2  
ATOM 7523   H HB   . ILE A 1 141 ? -11.653 17.990  -11.454 1.00 0.69  ? 141 ILE A HB   2  
ATOM 7524   H HG12 . ILE A 1 141 ? -11.033 19.495  -8.898  1.00 0.74  ? 141 ILE A HG12 2  
ATOM 7525   H HG13 . ILE A 1 141 ? -10.701 17.777  -9.116  1.00 0.66  ? 141 ILE A HG13 2  
ATOM 7526   H HG21 . ILE A 1 141 ? -12.674 20.639  -10.388 1.00 1.34  ? 141 ILE A HG21 2  
ATOM 7527   H HG22 . ILE A 1 141 ? -11.350 20.487  -11.543 1.00 1.30  ? 141 ILE A HG22 2  
ATOM 7528   H HG23 . ILE A 1 141 ? -12.972 19.956  -11.987 1.00 1.26  ? 141 ILE A HG23 2  
ATOM 7529   H HD11 . ILE A 1 141 ? -9.314  18.320  -11.105 1.00 1.17  ? 141 ILE A HD11 2  
ATOM 7530   H HD12 . ILE A 1 141 ? -9.599  20.035  -10.811 1.00 1.30  ? 141 ILE A HD12 2  
ATOM 7531   H HD13 . ILE A 1 141 ? -8.693  19.078  -9.639  1.00 1.23  ? 141 ILE A HD13 2  
ATOM 7532   N N    . LEU A 1 142 ? -14.274 16.979  -11.824 1.00 0.70  ? 142 LEU A N    2  
ATOM 7533   C CA   . LEU A 1 142 ? -15.329 16.830  -12.859 1.00 0.76  ? 142 LEU A CA   2  
ATOM 7534   C C    . LEU A 1 142 ? -16.641 16.421  -12.193 1.00 0.79  ? 142 LEU A C    2  
ATOM 7535   O O    . LEU A 1 142 ? -17.714 16.670  -12.706 1.00 0.86  ? 142 LEU A O    2  
ATOM 7536   C CB   . LEU A 1 142 ? -14.914 15.757  -13.869 1.00 0.75  ? 142 LEU A CB   2  
ATOM 7537   C CG   . LEU A 1 142 ? -13.738 16.260  -14.720 1.00 0.82  ? 142 LEU A CG   2  
ATOM 7538   C CD1  . LEU A 1 142 ? -13.186 15.093  -15.544 1.00 0.84  ? 142 LEU A CD1  2  
ATOM 7539   C CD2  . LEU A 1 142 ? -14.193 17.395  -15.662 1.00 1.00  ? 142 LEU A CD2  2  
ATOM 7540   H H    . LEU A 1 142 ? -13.536 16.337  -11.784 1.00 0.66  ? 142 LEU A H    2  
ATOM 7541   H HA   . LEU A 1 142 ? -15.463 17.769  -13.363 1.00 0.82  ? 142 LEU A HA   2  
ATOM 7542   H HB2  . LEU A 1 142 ? -14.615 14.866  -13.337 1.00 0.74  ? 142 LEU A HB2  2  
ATOM 7543   H HB3  . LEU A 1 142 ? -15.750 15.524  -14.511 1.00 0.82  ? 142 LEU A HB3  2  
ATOM 7544   H HG   . LEU A 1 142 ? -12.961 16.627  -14.064 1.00 0.87  ? 142 LEU A HG   2  
ATOM 7545   H HD11 . LEU A 1 142 ? -12.963 14.266  -14.887 1.00 1.30  ? 142 LEU A HD11 2  
ATOM 7546   H HD12 . LEU A 1 142 ? -13.922 14.786  -16.272 1.00 1.34  ? 142 LEU A HD12 2  
ATOM 7547   H HD13 . LEU A 1 142 ? -12.285 15.405  -16.051 1.00 1.30  ? 142 LEU A HD13 2  
ATOM 7548   H HD21 . LEU A 1 142 ? -15.218 17.237  -15.967 1.00 1.37  ? 142 LEU A HD21 2  
ATOM 7549   H HD22 . LEU A 1 142 ? -14.115 18.342  -15.149 1.00 1.41  ? 142 LEU A HD22 2  
ATOM 7550   H HD23 . LEU A 1 142 ? -13.560 17.418  -16.539 1.00 1.60  ? 142 LEU A HD23 2  
ATOM 7551   N N    . GLY A 1 143 ? -16.563 15.778  -11.061 1.00 0.79  ? 143 GLY A N    2  
ATOM 7552   C CA   . GLY A 1 143 ? -17.805 15.333  -10.373 1.00 0.88  ? 143 GLY A CA   2  
ATOM 7553   C C    . GLY A 1 143 ? -18.268 14.020  -11.000 1.00 0.84  ? 143 GLY A C    2  
ATOM 7554   O O    . GLY A 1 143 ? -19.447 13.763  -11.139 1.00 0.89  ? 143 GLY A O    2  
ATOM 7555   H H    . GLY A 1 143 ? -15.687 15.577  -10.672 1.00 0.76  ? 143 GLY A H    2  
ATOM 7556   H HA2  . GLY A 1 143 ? -17.601 15.183  -9.321  1.00 0.95  ? 143 GLY A HA2  2  
ATOM 7557   H HA3  . GLY A 1 143 ? -18.578 16.079  -10.491 1.00 0.96  ? 143 GLY A HA3  2  
ATOM 7558   N N    . LEU A 1 144 ? -17.339 13.190  -11.389 1.00 0.79  ? 144 LEU A N    2  
ATOM 7559   C CA   . LEU A 1 144 ? -17.704 11.897  -12.017 1.00 0.83  ? 144 LEU A CA   2  
ATOM 7560   C C    . LEU A 1 144 ? -18.245 10.958  -10.936 1.00 0.96  ? 144 LEU A C    2  
ATOM 7561   O O    . LEU A 1 144 ? -17.804 10.979  -9.803  1.00 1.01  ? 144 LEU A O    2  
ATOM 7562   C CB   . LEU A 1 144 ? -16.447 11.293  -12.662 1.00 0.88  ? 144 LEU A CB   2  
ATOM 7563   C CG   . LEU A 1 144 ? -16.836 10.285  -13.762 1.00 0.98  ? 144 LEU A CG   2  
ATOM 7564   C CD1  . LEU A 1 144 ? -17.058 11.023  -15.088 1.00 1.07  ? 144 LEU A CD1  2  
ATOM 7565   C CD2  . LEU A 1 144 ? -15.706 9.266   -13.948 1.00 1.14  ? 144 LEU A CD2  2  
ATOM 7566   H H    . LEU A 1 144 ? -16.395 13.424  -11.275 1.00 0.75  ? 144 LEU A H    2  
ATOM 7567   H HA   . LEU A 1 144 ? -18.461 12.060  -12.766 1.00 0.84  ? 144 LEU A HA   2  
ATOM 7568   H HB2  . LEU A 1 144 ? -15.852 12.087  -13.091 1.00 0.89  ? 144 LEU A HB2  2  
ATOM 7569   H HB3  . LEU A 1 144 ? -15.865 10.790  -11.901 1.00 0.94  ? 144 LEU A HB3  2  
ATOM 7570   H HG   . LEU A 1 144 ? -17.744 9.769   -13.481 1.00 1.01  ? 144 LEU A HG   2  
ATOM 7571   H HD11 . LEU A 1 144 ? -17.794 11.801  -14.952 1.00 1.48  ? 144 LEU A HD11 2  
ATOM 7572   H HD12 . LEU A 1 144 ? -16.127 11.465  -15.411 1.00 1.44  ? 144 LEU A HD12 2  
ATOM 7573   H HD13 . LEU A 1 144 ? -17.404 10.326  -15.836 1.00 1.59  ? 144 LEU A HD13 2  
ATOM 7574   H HD21 . LEU A 1 144 ? -14.771 9.788   -14.085 1.00 1.50  ? 144 LEU A HD21 2  
ATOM 7575   H HD22 . LEU A 1 144 ? -15.642 8.636   -13.074 1.00 1.51  ? 144 LEU A HD22 2  
ATOM 7576   H HD23 . LEU A 1 144 ? -15.909 8.657   -14.817 1.00 1.67  ? 144 LEU A HD23 2  
ATOM 7577   N N    . LYS A 1 145 ? -19.206 10.145  -11.272 1.00 1.27  ? 145 LYS A N    2  
ATOM 7578   C CA   . LYS A 1 145 ? -19.787 9.219   -10.261 1.00 1.49  ? 145 LYS A CA   2  
ATOM 7579   C C    . LYS A 1 145 ? -18.755 8.172   -9.841  1.00 1.12  ? 145 LYS A C    2  
ATOM 7580   O O    . LYS A 1 145 ? -18.014 7.649   -10.648 1.00 1.12  ? 145 LYS A O    2  
ATOM 7581   C CB   . LYS A 1 145 ? -21.019 8.520   -10.853 1.00 2.04  ? 145 LYS A CB   2  
ATOM 7582   C CG   . LYS A 1 145 ? -21.650 7.549   -9.846  1.00 2.33  ? 145 LYS A CG   2  
ATOM 7583   C CD   . LYS A 1 145 ? -22.174 8.310   -8.623  1.00 3.18  ? 145 LYS A CD   2  
ATOM 7584   C CE   . LYS A 1 145 ? -23.144 7.421   -7.849  1.00 3.88  ? 145 LYS A CE   2  
ATOM 7585   N NZ   . LYS A 1 145 ? -24.455 7.374   -8.555  1.00 4.60  ? 145 LYS A NZ   2  
ATOM 7586   H H    . LYS A 1 145 ? -19.554 10.152  -12.188 1.00 1.46  ? 145 LYS A H    2  
ATOM 7587   H HA   . LYS A 1 145 ? -20.082 9.793   -9.399  1.00 1.68  ? 145 LYS A HA   2  
ATOM 7588   H HB2  . LYS A 1 145 ? -21.751 9.264   -11.121 1.00 2.33  ? 145 LYS A HB2  2  
ATOM 7589   H HB3  . LYS A 1 145 ? -20.727 7.972   -11.733 1.00 2.06  ? 145 LYS A HB3  2  
ATOM 7590   H HG2  . LYS A 1 145 ? -22.471 7.034   -10.323 1.00 2.20  ? 145 LYS A HG2  2  
ATOM 7591   H HG3  . LYS A 1 145 ? -20.917 6.824   -9.527  1.00 2.54  ? 145 LYS A HG3  2  
ATOM 7592   H HD2  . LYS A 1 145 ? -21.350 8.574   -7.977  1.00 3.61  ? 145 LYS A HD2  2  
ATOM 7593   H HD3  . LYS A 1 145 ? -22.686 9.205   -8.944  1.00 3.35  ? 145 LYS A HD3  2  
ATOM 7594   H HE2  . LYS A 1 145 ? -22.738 6.424   -7.781  1.00 4.02  ? 145 LYS A HE2  2  
ATOM 7595   H HE3  . LYS A 1 145 ? -23.284 7.822   -6.857  1.00 4.22  ? 145 LYS A HE3  2  
ATOM 7596   H HZ1  . LYS A 1 145 ? -24.617 8.277   -9.046  1.00 4.96  ? 145 LYS A HZ1  2  
ATOM 7597   H HZ2  . LYS A 1 145 ? -24.447 6.598   -9.249  1.00 4.90  ? 145 LYS A HZ2  2  
ATOM 7598   H HZ3  . LYS A 1 145 ? -25.216 7.216   -7.865  1.00 4.85  ? 145 LYS A HZ3  2  
ATOM 7599   N N    . ILE A 1 146 ? -18.730 7.857   -8.572  1.00 0.99  ? 146 ILE A N    2  
ATOM 7600   C CA   . ILE A 1 146 ? -17.776 6.829   -8.050  1.00 0.75  ? 146 ILE A CA   2  
ATOM 7601   C C    . ILE A 1 146 ? -18.573 5.591   -7.647  1.00 0.75  ? 146 ILE A C    2  
ATOM 7602   O O    . ILE A 1 146 ? -19.558 5.666   -6.939  1.00 0.78  ? 146 ILE A O    2  
ATOM 7603   C CB   . ILE A 1 146 ? -17.026 7.386   -6.839  1.00 0.86  ? 146 ILE A CB   2  
ATOM 7604   C CG1  . ILE A 1 146 ? -16.230 8.626   -7.265  1.00 0.95  ? 146 ILE A CG1  2  
ATOM 7605   C CG2  . ILE A 1 146 ? -16.069 6.323   -6.299  1.00 0.98  ? 146 ILE A CG2  2  
ATOM 7606   C CD1  . ILE A 1 146 ? -15.672 9.345   -6.030  1.00 1.24  ? 146 ILE A CD1  2  
ATOM 7607   H H    . ILE A 1 146 ? -19.357 8.300   -7.964  1.00 1.19  ? 146 ILE A H    2  
ATOM 7608   H HA   . ILE A 1 146 ? -17.064 6.553   -8.819  1.00 0.75  ? 146 ILE A HA   2  
ATOM 7609   H HB   . ILE A 1 146 ? -17.734 7.658   -6.070  1.00 1.05  ? 146 ILE A HB   2  
ATOM 7610   H HG12 . ILE A 1 146 ? -15.412 8.325   -7.903  1.00 0.94  ? 146 ILE A HG12 2  
ATOM 7611   H HG13 . ILE A 1 146 ? -16.878 9.299   -7.805  1.00 1.03  ? 146 ILE A HG13 2  
ATOM 7612   H HG21 . ILE A 1 146 ? -15.449 5.954   -7.103  1.00 1.51  ? 146 ILE A HG21 2  
ATOM 7613   H HG22 . ILE A 1 146 ? -15.443 6.757   -5.532  1.00 1.39  ? 146 ILE A HG22 2  
ATOM 7614   H HG23 . ILE A 1 146 ? -16.638 5.507   -5.879  1.00 1.42  ? 146 ILE A HG23 2  
ATOM 7615   H HD11 . ILE A 1 146 ? -15.351 8.618   -5.297  1.00 1.68  ? 146 ILE A HD11 2  
ATOM 7616   H HD12 . ILE A 1 146 ? -14.829 9.956   -6.321  1.00 1.58  ? 146 ILE A HD12 2  
ATOM 7617   H HD13 . ILE A 1 146 ? -16.439 9.971   -5.601  1.00 1.66  ? 146 ILE A HD13 2  
ATOM 7618   N N    . ILE A 1 147 ? -18.163 4.457   -8.131  1.00 0.77  ? 147 ILE A N    2  
ATOM 7619   C CA   . ILE A 1 147 ? -18.889 3.193   -7.835  1.00 0.84  ? 147 ILE A CA   2  
ATOM 7620   C C    . ILE A 1 147 ? -18.911 2.925   -6.326  1.00 0.78  ? 147 ILE A C    2  
ATOM 7621   O O    . ILE A 1 147 ? -19.921 2.539   -5.775  1.00 0.77  ? 147 ILE A O    2  
ATOM 7622   C CB   . ILE A 1 147 ? -18.174 2.042   -8.545  1.00 0.96  ? 147 ILE A CB   2  
ATOM 7623   C CG1  . ILE A 1 147 ? -17.823 2.458   -9.983  1.00 1.10  ? 147 ILE A CG1  2  
ATOM 7624   C CG2  . ILE A 1 147 ? -19.088 0.815   -8.579  1.00 1.06  ? 147 ILE A CG2  2  
ATOM 7625   C CD1  . ILE A 1 147 ? -19.064 3.004   -10.698 1.00 1.54  ? 147 ILE A CD1  2  
ATOM 7626   H H    . ILE A 1 147 ? -17.383 4.437   -8.721  1.00 0.79  ? 147 ILE A H    2  
ATOM 7627   H HA   . ILE A 1 147 ? -19.902 3.265   -8.200  1.00 0.89  ? 147 ILE A HA   2  
ATOM 7628   H HB   . ILE A 1 147 ? -17.267 1.798   -8.009  1.00 0.95  ? 147 ILE A HB   2  
ATOM 7629   H HG12 . ILE A 1 147 ? -17.061 3.225   -9.959  1.00 1.57  ? 147 ILE A HG12 2  
ATOM 7630   H HG13 . ILE A 1 147 ? -17.451 1.601   -10.521 1.00 1.56  ? 147 ILE A HG13 2  
ATOM 7631   H HG21 . ILE A 1 147 ? -19.999 1.060   -9.104  1.00 1.41  ? 147 ILE A HG21 2  
ATOM 7632   H HG22 . ILE A 1 147 ? -18.586 0.005   -9.089  1.00 1.41  ? 147 ILE A HG22 2  
ATOM 7633   H HG23 . ILE A 1 147 ? -19.323 0.514   -7.570  1.00 1.64  ? 147 ILE A HG23 2  
ATOM 7634   H HD11 . ILE A 1 147 ? -19.906 2.356   -10.510 1.00 1.98  ? 147 ILE A HD11 2  
ATOM 7635   H HD12 . ILE A 1 147 ? -19.282 3.997   -10.331 1.00 1.98  ? 147 ILE A HD12 2  
ATOM 7636   H HD13 . ILE A 1 147 ? -18.872 3.049   -11.761 1.00 2.14  ? 147 ILE A HD13 2  
ATOM 7637   N N    . ASP A 1 148 ? -17.797 3.102   -5.663  1.00 0.79  ? 148 ASP A N    2  
ATOM 7638   C CA   . ASP A 1 148 ? -17.739 2.837   -4.193  1.00 0.77  ? 148 ASP A CA   2  
ATOM 7639   C C    . ASP A 1 148 ? -18.030 1.354   -3.943  1.00 0.72  ? 148 ASP A C    2  
ATOM 7640   O O    . ASP A 1 148 ? -19.113 0.868   -4.198  1.00 0.76  ? 148 ASP A O    2  
ATOM 7641   C CB   . ASP A 1 148 ? -18.768 3.698   -3.450  1.00 0.87  ? 148 ASP A CB   2  
ATOM 7642   C CG   . ASP A 1 148 ? -18.452 3.684   -1.952  1.00 0.97  ? 148 ASP A CG   2  
ATOM 7643   O OD1  . ASP A 1 148 ? -17.638 2.871   -1.547  1.00 1.44  ? 148 ASP A OD1  2  
ATOM 7644   O OD2  . ASP A 1 148 ? -19.030 4.485   -1.237  1.00 1.50  ? 148 ASP A OD2  2  
ATOM 7645   H H    . ASP A 1 148 ? -16.991 3.389   -6.142  1.00 0.84  ? 148 ASP A H    2  
ATOM 7646   H HA   . ASP A 1 148 ? -16.748 3.069   -3.830  1.00 0.77  ? 148 ASP A HA   2  
ATOM 7647   H HB2  . ASP A 1 148 ? -18.723 4.712   -3.819  1.00 0.94  ? 148 ASP A HB2  2  
ATOM 7648   H HB3  . ASP A 1 148 ? -19.758 3.300   -3.605  1.00 0.89  ? 148 ASP A HB3  2  
ATOM 7649   N N    . LEU A 1 149 ? -17.057 0.630   -3.463  1.00 0.67  ? 149 LEU A N    2  
ATOM 7650   C CA   . LEU A 1 149 ? -17.251 -0.829  -3.212  1.00 0.68  ? 149 LEU A CA   2  
ATOM 7651   C C    . LEU A 1 149 ? -17.990 -1.041  -1.887  1.00 0.68  ? 149 LEU A C    2  
ATOM 7652   O O    . LEU A 1 149 ? -18.271 -2.155  -1.497  1.00 0.72  ? 149 LEU A O    2  
ATOM 7653   C CB   . LEU A 1 149 ? -15.885 -1.517  -3.147  1.00 0.70  ? 149 LEU A CB   2  
ATOM 7654   C CG   . LEU A 1 149 ? -15.015 -1.066  -4.326  1.00 0.72  ? 149 LEU A CG   2  
ATOM 7655   C CD1  . LEU A 1 149 ? -13.746 -1.919  -4.376  1.00 0.79  ? 149 LEU A CD1  2  
ATOM 7656   C CD2  . LEU A 1 149 ? -15.788 -1.224  -5.641  1.00 0.79  ? 149 LEU A CD2  2  
ATOM 7657   H H    . LEU A 1 149 ? -16.189 1.046   -3.279  1.00 0.67  ? 149 LEU A H    2  
ATOM 7658   H HA   . LEU A 1 149 ? -17.831 -1.258  -4.015  1.00 0.72  ? 149 LEU A HA   2  
ATOM 7659   H HB2  . LEU A 1 149 ? -15.396 -1.256  -2.219  1.00 0.70  ? 149 LEU A HB2  2  
ATOM 7660   H HB3  . LEU A 1 149 ? -16.020 -2.587  -3.192  1.00 0.74  ? 149 LEU A HB3  2  
ATOM 7661   H HG   . LEU A 1 149 ? -14.741 -0.029  -4.191  1.00 0.72  ? 149 LEU A HG   2  
ATOM 7662   H HD11 . LEU A 1 149 ? -13.273 -1.917  -3.406  1.00 1.34  ? 149 LEU A HD11 2  
ATOM 7663   H HD12 . LEU A 1 149 ? -14.003 -2.932  -4.650  1.00 1.13  ? 149 LEU A HD12 2  
ATOM 7664   H HD13 . LEU A 1 149 ? -13.065 -1.509  -5.108  1.00 1.29  ? 149 LEU A HD13 2  
ATOM 7665   H HD21 . LEU A 1 149 ? -16.310 -2.169  -5.642  1.00 1.35  ? 149 LEU A HD21 2  
ATOM 7666   H HD22 . LEU A 1 149 ? -16.501 -0.418  -5.738  1.00 1.39  ? 149 LEU A HD22 2  
ATOM 7667   H HD23 . LEU A 1 149 ? -15.097 -1.191  -6.471  1.00 1.14  ? 149 LEU A HD23 2  
ATOM 7668   N N    . SER A 1 150 ? -18.295 0.014   -1.181  1.00 0.68  ? 150 SER A N    2  
ATOM 7669   C CA   . SER A 1 150 ? -19.010 -0.134  0.125   1.00 0.72  ? 150 SER A CA   2  
ATOM 7670   C C    . SER A 1 150 ? -20.533 -0.121  -0.089  1.00 0.78  ? 150 SER A C    2  
ATOM 7671   O O    . SER A 1 150 ? -21.293 -0.501  0.779   1.00 0.91  ? 150 SER A O    2  
ATOM 7672   C CB   . SER A 1 150 ? -18.619 1.022   1.046   1.00 0.73  ? 150 SER A CB   2  
ATOM 7673   O OG   . SER A 1 150 ? -17.278 0.842   1.480   1.00 1.40  ? 150 SER A OG   2  
ATOM 7674   H H    . SER A 1 150 ? -18.054 0.905   -1.510  1.00 0.67  ? 150 SER A H    2  
ATOM 7675   H HA   . SER A 1 150 ? -18.725 -1.066  0.588   1.00 0.74  ? 150 SER A HA   2  
ATOM 7676   H HB2  . SER A 1 150 ? -18.696 1.954   0.511   1.00 1.21  ? 150 SER A HB2  2  
ATOM 7677   H HB3  . SER A 1 150 ? -19.285 1.043   1.898   1.00 1.19  ? 150 SER A HB3  2  
ATOM 7678   H HG   . SER A 1 150 ? -16.711 1.389   0.932   1.00 1.83  ? 150 SER A HG   2  
ATOM 7679   N N    . ALA A 1 151 ? -20.983 0.344   -1.224  1.00 0.76  ? 151 ALA A N    2  
ATOM 7680   C CA   . ALA A 1 151 ? -22.456 0.421   -1.480  1.00 0.83  ? 151 ALA A CA   2  
ATOM 7681   C C    . ALA A 1 151 ? -23.049 -0.957  -1.804  1.00 0.81  ? 151 ALA A C    2  
ATOM 7682   O O    . ALA A 1 151 ? -24.130 -1.051  -2.351  1.00 0.87  ? 151 ALA A O    2  
ATOM 7683   C CB   . ALA A 1 151 ? -22.708 1.350   -2.666  1.00 0.92  ? 151 ALA A CB   2  
ATOM 7684   H H    . ALA A 1 151 ? -20.352 0.673   -1.898  1.00 0.77  ? 151 ALA A H    2  
ATOM 7685   H HA   . ALA A 1 151 ? -22.948 0.823   -0.607  1.00 0.86  ? 151 ALA A HA   2  
ATOM 7686   H HB1  . ALA A 1 151 ? -22.083 2.227   -2.576  1.00 1.32  ? 151 ALA A HB1  2  
ATOM 7687   H HB2  . ALA A 1 151 ? -22.473 0.832   -3.586  1.00 1.33  ? 151 ALA A HB2  2  
ATOM 7688   H HB3  . ALA A 1 151 ? -23.746 1.647   -2.675  1.00 1.46  ? 151 ALA A HB3  2  
ATOM 7689   N N    . ILE A 1 152 ? -22.372 -2.025  -1.491  1.00 0.75  ? 152 ILE A N    2  
ATOM 7690   C CA   . ILE A 1 152 ? -22.941 -3.369  -1.813  1.00 0.75  ? 152 ILE A CA   2  
ATOM 7691   C C    . ILE A 1 152 ? -23.976 -3.766  -0.756  1.00 0.81  ? 152 ILE A C    2  
ATOM 7692   O O    . ILE A 1 152 ? -23.738 -3.669  0.431   1.00 0.88  ? 152 ILE A O    2  
ATOM 7693   C CB   . ILE A 1 152 ? -21.821 -4.412  -1.843  1.00 0.70  ? 152 ILE A CB   2  
ATOM 7694   C CG1  . ILE A 1 152 ? -20.689 -3.923  -2.758  1.00 0.71  ? 152 ILE A CG1  2  
ATOM 7695   C CG2  . ILE A 1 152 ? -22.364 -5.750  -2.361  1.00 0.75  ? 152 ILE A CG2  2  
ATOM 7696   C CD1  . ILE A 1 152 ? -21.231 -3.558  -4.145  1.00 0.83  ? 152 ILE A CD1  2  
ATOM 7697   H H    . ILE A 1 152 ? -21.498 -1.949  -1.054  1.00 0.72  ? 152 ILE A H    2  
ATOM 7698   H HA   . ILE A 1 152 ? -23.422 -3.329  -2.780  1.00 0.80  ? 152 ILE A HA   2  
ATOM 7699   H HB   . ILE A 1 152 ? -21.439 -4.549  -0.842  1.00 0.70  ? 152 ILE A HB   2  
ATOM 7700   H HG12 . ILE A 1 152 ? -20.234 -3.053  -2.316  1.00 0.97  ? 152 ILE A HG12 2  
ATOM 7701   H HG13 . ILE A 1 152 ? -19.948 -4.702  -2.857  1.00 0.92  ? 152 ILE A HG13 2  
ATOM 7702   H HG21 . ILE A 1 152 ? -23.295 -5.980  -1.865  1.00 1.20  ? 152 ILE A HG21 2  
ATOM 7703   H HG22 . ILE A 1 152 ? -22.533 -5.686  -3.426  1.00 1.34  ? 152 ILE A HG22 2  
ATOM 7704   H HG23 . ILE A 1 152 ? -21.648 -6.531  -2.157  1.00 1.23  ? 152 ILE A HG23 2  
ATOM 7705   H HD11 . ILE A 1 152 ? -21.988 -4.268  -4.441  1.00 1.37  ? 152 ILE A HD11 2  
ATOM 7706   H HD12 . ILE A 1 152 ? -21.660 -2.567  -4.114  1.00 1.42  ? 152 ILE A HD12 2  
ATOM 7707   H HD13 . ILE A 1 152 ? -20.422 -3.576  -4.861  1.00 1.21  ? 152 ILE A HD13 2  
ATOM 7708   N N    . GLN A 1 153 ? -25.125 -4.222  -1.193  1.00 0.85  ? 153 GLN A N    2  
ATOM 7709   C CA   . GLN A 1 153 ? -26.200 -4.646  -0.241  1.00 0.94  ? 153 GLN A CA   2  
ATOM 7710   C C    . GLN A 1 153 ? -26.367 -6.168  -0.302  1.00 0.90  ? 153 GLN A C    2  
ATOM 7711   O O    . GLN A 1 153 ? -27.042 -6.760  0.516   1.00 0.96  ? 153 GLN A O    2  
ATOM 7712   C CB   . GLN A 1 153 ? -27.513 -3.980  -0.648  1.00 1.08  ? 153 GLN A CB   2  
ATOM 7713   C CG   . GLN A 1 153 ? -27.830 -4.312  -2.107  1.00 1.89  ? 153 GLN A CG   2  
ATOM 7714   C CD   . GLN A 1 153 ? -29.099 -3.572  -2.534  1.00 1.99  ? 153 GLN A CD   2  
ATOM 7715   O OE1  . GLN A 1 153 ? -30.095 -3.595  -1.838  1.00 2.19  ? 153 GLN A OE1  2  
ATOM 7716   N NE2  . GLN A 1 153 ? -29.105 -2.908  -3.657  1.00 2.45  ? 153 GLN A NE2  2  
ATOM 7717   H H    . GLN A 1 153 ? -25.281 -4.291  -2.157  1.00 0.84  ? 153 GLN A H    2  
ATOM 7718   H HA   . GLN A 1 153 ? -25.947 -4.353  0.768   1.00 0.97  ? 153 GLN A HA   2  
ATOM 7719   H HB2  . GLN A 1 153 ? -28.308 -4.345  -0.016  1.00 1.53  ? 153 GLN A HB2  2  
ATOM 7720   H HB3  . GLN A 1 153 ? -27.422 -2.912  -0.536  1.00 1.38  ? 153 GLN A HB3  2  
ATOM 7721   H HG2  . GLN A 1 153 ? -27.004 -4.005  -2.733  1.00 2.40  ? 153 GLN A HG2  2  
ATOM 7722   H HG3  . GLN A 1 153 ? -27.984 -5.376  -2.209  1.00 2.50  ? 153 GLN A HG3  2  
ATOM 7723   H HE21 . GLN A 1 153 ? -28.301 -2.885  -4.217  1.00 2.94  ? 153 GLN A HE21 2  
ATOM 7724   H HE22 . GLN A 1 153 ? -29.912 -2.429  -3.939  1.00 2.55  ? 153 GLN A HE22 2  
ATOM 7725   N N    . ASP A 1 154 ? -25.763 -6.798  -1.277  1.00 0.83  ? 154 ASP A N    2  
ATOM 7726   C CA   . ASP A 1 154 ? -25.881 -8.290  -1.424  1.00 0.81  ? 154 ASP A CA   2  
ATOM 7727   C C    . ASP A 1 154 ? -24.487 -8.914  -1.587  1.00 0.71  ? 154 ASP A C    2  
ATOM 7728   O O    . ASP A 1 154 ? -23.572 -8.287  -2.079  1.00 0.68  ? 154 ASP A O    2  
ATOM 7729   C CB   . ASP A 1 154 ? -26.721 -8.604  -2.664  1.00 0.88  ? 154 ASP A CB   2  
ATOM 7730   C CG   . ASP A 1 154 ? -28.175 -8.199  -2.411  1.00 1.03  ? 154 ASP A CG   2  
ATOM 7731   O OD1  . ASP A 1 154 ? -28.540 -8.066  -1.255  1.00 1.47  ? 154 ASP A OD1  2  
ATOM 7732   O OD2  . ASP A 1 154 ? -28.897 -8.027  -3.379  1.00 1.52  ? 154 ASP A OD2  2  
ATOM 7733   H H    . ASP A 1 154 ? -25.235 -6.285  -1.924  1.00 0.83  ? 154 ASP A H    2  
ATOM 7734   H HA   . ASP A 1 154 ? -26.359 -8.714  -0.551  1.00 0.85  ? 154 ASP A HA   2  
ATOM 7735   H HB2  . ASP A 1 154 ? -26.334 -8.056  -3.509  1.00 0.86  ? 154 ASP A HB2  2  
ATOM 7736   H HB3  . ASP A 1 154 ? -26.676 -9.663  -2.869  1.00 0.91  ? 154 ASP A HB3  2  
ATOM 7737   N N    . GLU A 1 155 ? -24.320 -10.148 -1.181  1.00 0.69  ? 155 GLU A N    2  
ATOM 7738   C CA   . GLU A 1 155 ? -22.986 -10.806 -1.319  1.00 0.62  ? 155 GLU A CA   2  
ATOM 7739   C C    . GLU A 1 155 ? -22.646 -10.967 -2.804  1.00 0.59  ? 155 GLU A C    2  
ATOM 7740   O O    . GLU A 1 155 ? -23.473 -11.365 -3.601  1.00 0.62  ? 155 GLU A O    2  
ATOM 7741   C CB   . GLU A 1 155 ? -23.026 -12.184 -0.655  1.00 0.67  ? 155 GLU A CB   2  
ATOM 7742   C CG   . GLU A 1 155 ? -23.124 -12.019 0.863   1.00 0.75  ? 155 GLU A CG   2  
ATOM 7743   C CD   . GLU A 1 155 ? -23.164 -13.397 1.526   1.00 0.87  ? 155 GLU A CD   2  
ATOM 7744   O OE1  . GLU A 1 155 ? -23.302 -14.374 0.808   1.00 1.58  ? 155 GLU A OE1  2  
ATOM 7745   O OE2  . GLU A 1 155 ? -23.061 -13.451 2.740   1.00 1.23  ? 155 GLU A OE2  2  
ATOM 7746   H H    . GLU A 1 155 ? -25.069 -10.643 -0.791  1.00 0.74  ? 155 GLU A H    2  
ATOM 7747   H HA   . GLU A 1 155 ? -22.233 -10.197 -0.841  1.00 0.61  ? 155 GLU A HA   2  
ATOM 7748   H HB2  . GLU A 1 155 ? -23.884 -12.732 -1.015  1.00 0.69  ? 155 GLU A HB2  2  
ATOM 7749   H HB3  . GLU A 1 155 ? -22.124 -12.726 -0.898  1.00 0.68  ? 155 GLU A HB3  2  
ATOM 7750   H HG2  . GLU A 1 155 ? -22.265 -11.471 1.222   1.00 0.83  ? 155 GLU A HG2  2  
ATOM 7751   H HG3  . GLU A 1 155 ? -24.025 -11.478 1.109   1.00 0.79  ? 155 GLU A HG3  2  
ATOM 7752   N N    . VAL A 1 156 ? -21.428 -10.676 -3.175  1.00 0.55  ? 156 VAL A N    2  
ATOM 7753   C CA   . VAL A 1 156 ? -21.019 -10.823 -4.606  1.00 0.56  ? 156 VAL A CA   2  
ATOM 7754   C C    . VAL A 1 156 ? -19.513 -11.077 -4.692  1.00 0.51  ? 156 VAL A C    2  
ATOM 7755   O O    . VAL A 1 156 ? -18.784 -10.848 -3.747  1.00 0.48  ? 156 VAL A O    2  
ATOM 7756   C CB   . VAL A 1 156 ? -21.352 -9.540  -5.369  1.00 0.62  ? 156 VAL A CB   2  
ATOM 7757   C CG1  . VAL A 1 156 ? -22.868 -9.336  -5.407  1.00 0.69  ? 156 VAL A CG1  2  
ATOM 7758   C CG2  . VAL A 1 156 ? -20.693 -8.350  -4.669  1.00 0.62  ? 156 VAL A CG2  2  
ATOM 7759   H H    . VAL A 1 156 ? -20.777 -10.386 -2.500  1.00 0.54  ? 156 VAL A H    2  
ATOM 7760   H HA   . VAL A 1 156 ? -21.548 -11.654 -5.050  1.00 0.57  ? 156 VAL A HA   2  
ATOM 7761   H HB   . VAL A 1 156 ? -20.976 -9.617  -6.380  1.00 0.65  ? 156 VAL A HB   2  
ATOM 7762   H HG11 . VAL A 1 156 ? -23.350 -10.264 -5.673  1.00 1.14  ? 156 VAL A HG11 2  
ATOM 7763   H HG12 . VAL A 1 156 ? -23.213 -9.017  -4.434  1.00 1.32  ? 156 VAL A HG12 2  
ATOM 7764   H HG13 . VAL A 1 156 ? -23.111 -8.581  -6.140  1.00 1.23  ? 156 VAL A HG13 2  
ATOM 7765   H HG21 . VAL A 1 156 ? -20.997 -8.329  -3.632  1.00 1.16  ? 156 VAL A HG21 2  
ATOM 7766   H HG22 . VAL A 1 156 ? -19.619 -8.448  -4.727  1.00 1.20  ? 156 VAL A HG22 2  
ATOM 7767   H HG23 . VAL A 1 156 ? -20.998 -7.433  -5.151  1.00 1.23  ? 156 VAL A HG23 2  
ATOM 7768   N N    . ILE A 1 157 ? -19.031 -11.491 -5.836  1.00 0.52  ? 157 ILE A N    2  
ATOM 7769   C CA   . ILE A 1 157 ? -17.561 -11.693 -6.005  1.00 0.50  ? 157 ILE A CA   2  
ATOM 7770   C C    . ILE A 1 157 ? -17.029 -10.409 -6.636  1.00 0.52  ? 157 ILE A C    2  
ATOM 7771   O O    . ILE A 1 157 ? -17.746 -9.729  -7.345  1.00 0.55  ? 157 ILE A O    2  
ATOM 7772   C CB   . ILE A 1 157 ? -17.275 -12.896 -6.910  1.00 0.52  ? 157 ILE A CB   2  
ATOM 7773   C CG1  . ILE A 1 157 ? -17.880 -14.156 -6.282  1.00 0.58  ? 157 ILE A CG1  2  
ATOM 7774   C CG2  . ILE A 1 157 ? -15.759 -13.076 -7.049  1.00 0.52  ? 157 ILE A CG2  2  
ATOM 7775   C CD1  . ILE A 1 157 ? -17.821 -15.311 -7.285  1.00 0.61  ? 157 ILE A CD1  2  
ATOM 7776   H H    . ILE A 1 157 ? -19.631 -11.626 -6.600  1.00 0.55  ? 157 ILE A H    2  
ATOM 7777   H HA   . ILE A 1 157 ? -17.093 -11.841 -5.039  1.00 0.47  ? 157 ILE A HA   2  
ATOM 7778   H HB   . ILE A 1 157 ? -17.710 -12.730 -7.883  1.00 0.55  ? 157 ILE A HB   2  
ATOM 7779   H HG12 . ILE A 1 157 ? -17.320 -14.419 -5.396  1.00 0.61  ? 157 ILE A HG12 2  
ATOM 7780   H HG13 . ILE A 1 157 ? -18.908 -13.967 -6.014  1.00 0.63  ? 157 ILE A HG13 2  
ATOM 7781   H HG21 . ILE A 1 157 ? -15.293 -12.987 -6.077  1.00 1.15  ? 157 ILE A HG21 2  
ATOM 7782   H HG22 . ILE A 1 157 ? -15.547 -14.052 -7.460  1.00 1.13  ? 157 ILE A HG22 2  
ATOM 7783   H HG23 . ILE A 1 157 ? -15.365 -12.316 -7.707  1.00 1.16  ? 157 ILE A HG23 2  
ATOM 7784   H HD11 . ILE A 1 157 ? -16.817 -15.404 -7.670  1.00 1.12  ? 157 ILE A HD11 2  
ATOM 7785   H HD12 . ILE A 1 157 ? -18.103 -16.230 -6.792  1.00 1.18  ? 157 ILE A HD12 2  
ATOM 7786   H HD13 . ILE A 1 157 ? -18.502 -15.115 -8.100  1.00 1.27  ? 157 ILE A HD13 2  
ATOM 7787   N N    . LEU A 1 158 ? -15.806 -10.039 -6.365  1.00 0.51  ? 158 LEU A N    2  
ATOM 7788   C CA   . LEU A 1 158 ? -15.267 -8.757  -6.930  1.00 0.54  ? 158 LEU A CA   2  
ATOM 7789   C C    . LEU A 1 158 ? -14.307 -9.035  -8.092  1.00 0.56  ? 158 LEU A C    2  
ATOM 7790   O O    . LEU A 1 158 ? -13.289 -9.677  -7.927  1.00 0.57  ? 158 LEU A O    2  
ATOM 7791   C CB   . LEU A 1 158 ? -14.525 -8.024  -5.807  1.00 0.55  ? 158 LEU A CB   2  
ATOM 7792   C CG   . LEU A 1 158 ? -13.954 -6.690  -6.316  1.00 0.66  ? 158 LEU A CG   2  
ATOM 7793   C CD1  . LEU A 1 158 ? -15.095 -5.773  -6.794  1.00 0.87  ? 158 LEU A CD1  2  
ATOM 7794   C CD2  . LEU A 1 158 ? -13.193 -6.009  -5.173  1.00 0.61  ? 158 LEU A CD2  2  
ATOM 7795   H H    . LEU A 1 158 ? -15.248 -10.592 -5.779  1.00 0.50  ? 158 LEU A H    2  
ATOM 7796   H HA   . LEU A 1 158 ? -16.079 -8.137  -7.279  1.00 0.56  ? 158 LEU A HA   2  
ATOM 7797   H HB2  . LEU A 1 158 ? -15.213 -7.836  -4.994  1.00 0.58  ? 158 LEU A HB2  2  
ATOM 7798   H HB3  . LEU A 1 158 ? -13.717 -8.645  -5.452  1.00 0.54  ? 158 LEU A HB3  2  
ATOM 7799   H HG   . LEU A 1 158 ? -13.277 -6.874  -7.137  1.00 0.81  ? 158 LEU A HG   2  
ATOM 7800   H HD11 . LEU A 1 158 ? -15.963 -5.916  -6.166  1.00 1.41  ? 158 LEU A HD11 2  
ATOM 7801   H HD12 . LEU A 1 158 ? -14.781 -4.740  -6.741  1.00 1.28  ? 158 LEU A HD12 2  
ATOM 7802   H HD13 . LEU A 1 158 ? -15.346 -6.014  -7.816  1.00 1.18  ? 158 LEU A HD13 2  
ATOM 7803   H HD21 . LEU A 1 158 ? -12.446 -6.685  -4.786  1.00 1.06  ? 158 LEU A HD21 2  
ATOM 7804   H HD22 . LEU A 1 158 ? -12.712 -5.115  -5.543  1.00 1.13  ? 158 LEU A HD22 2  
ATOM 7805   H HD23 . LEU A 1 158 ? -13.885 -5.746  -4.386  1.00 1.33  ? 158 LEU A HD23 2  
ATOM 7806   N N    . VAL A 1 159 ? -14.627 -8.540  -9.270  1.00 0.59  ? 159 VAL A N    2  
ATOM 7807   C CA   . VAL A 1 159 ? -13.741 -8.747  -10.464 1.00 0.63  ? 159 VAL A CA   2  
ATOM 7808   C C    . VAL A 1 159 ? -13.362 -7.372  -11.040 1.00 0.68  ? 159 VAL A C    2  
ATOM 7809   O O    . VAL A 1 159 ? -14.207 -6.521  -11.229 1.00 0.71  ? 159 VAL A O    2  
ATOM 7810   C CB   . VAL A 1 159 ? -14.500 -9.556  -11.522 1.00 0.64  ? 159 VAL A CB   2  
ATOM 7811   C CG1  . VAL A 1 159 ? -13.514 -10.104 -12.561 1.00 0.67  ? 159 VAL A CG1  2  
ATOM 7812   C CG2  . VAL A 1 159 ? -15.232 -10.719 -10.845 1.00 0.65  ? 159 VAL A CG2  2  
ATOM 7813   H H    . VAL A 1 159 ? -15.458 -8.024  -9.377  1.00 0.61  ? 159 VAL A H    2  
ATOM 7814   H HA   . VAL A 1 159 ? -12.844 -9.279  -10.177 1.00 0.62  ? 159 VAL A HA   2  
ATOM 7815   H HB   . VAL A 1 159 ? -15.218 -8.916  -12.015 1.00 0.65  ? 159 VAL A HB   2  
ATOM 7816   H HG11 . VAL A 1 159 ? -12.780 -9.349  -12.797 1.00 1.18  ? 159 VAL A HG11 2  
ATOM 7817   H HG12 . VAL A 1 159 ? -13.015 -10.976 -12.165 1.00 1.23  ? 159 VAL A HG12 2  
ATOM 7818   H HG13 . VAL A 1 159 ? -14.051 -10.375 -13.459 1.00 1.17  ? 159 VAL A HG13 2  
ATOM 7819   H HG21 . VAL A 1 159 ? -14.543 -11.261 -10.215 1.00 1.23  ? 159 VAL A HG21 2  
ATOM 7820   H HG22 . VAL A 1 159 ? -16.042 -10.333 -10.245 1.00 1.15  ? 159 VAL A HG22 2  
ATOM 7821   H HG23 . VAL A 1 159 ? -15.628 -11.383 -11.599 1.00 1.21  ? 159 VAL A HG23 2  
ATOM 7822   N N    . ALA A 1 160 ? -12.102 -7.141  -11.317 1.00 0.71  ? 160 ALA A N    2  
ATOM 7823   C CA   . ALA A 1 160 ? -11.692 -5.817  -11.874 1.00 0.77  ? 160 ALA A CA   2  
ATOM 7824   C C    . ALA A 1 160 ? -10.349 -5.957  -12.596 1.00 0.81  ? 160 ALA A C    2  
ATOM 7825   O O    . ALA A 1 160 ? -9.629  -6.908  -12.406 1.00 0.81  ? 160 ALA A O    2  
ATOM 7826   C CB   . ALA A 1 160 ? -11.548 -4.813  -10.729 1.00 0.76  ? 160 ALA A CB   2  
ATOM 7827   H H    . ALA A 1 160 ? -11.431 -7.837  -11.162 1.00 0.70  ? 160 ALA A H    2  
ATOM 7828   H HA   . ALA A 1 160 ? -12.442 -5.466  -12.567 1.00 0.80  ? 160 ALA A HA   2  
ATOM 7829   H HB1  . ALA A 1 160 ? -12.394 -4.904  -10.063 1.00 1.20  ? 160 ALA A HB1  2  
ATOM 7830   H HB2  . ALA A 1 160 ? -10.637 -5.014  -10.184 1.00 1.32  ? 160 ALA A HB2  2  
ATOM 7831   H HB3  . ALA A 1 160 ? -11.513 -3.812  -11.132 1.00 1.23  ? 160 ALA A HB3  2  
ATOM 7832   N N    . ALA A 1 161 ? -9.983  -5.009  -13.406 1.00 0.86  ? 161 ALA A N    2  
ATOM 7833   C CA   . ALA A 1 161 ? -8.668  -5.110  -14.093 1.00 0.91  ? 161 ALA A CA   2  
ATOM 7834   C C    . ALA A 1 161 ? -7.563  -4.893  -13.059 1.00 0.88  ? 161 ALA A C    2  
ATOM 7835   O O    . ALA A 1 161 ? -6.507  -5.489  -13.121 1.00 0.91  ? 161 ALA A O    2  
ATOM 7836   C CB   . ALA A 1 161 ? -8.565  -4.043  -15.179 1.00 0.98  ? 161 ALA A CB   2  
ATOM 7837   H H    . ALA A 1 161 ? -10.547 -4.219  -13.538 1.00 0.88  ? 161 ALA A H    2  
ATOM 7838   H HA   . ALA A 1 161 ? -8.563  -6.092  -14.535 1.00 0.92  ? 161 ALA A HA   2  
ATOM 7839   H HB1  . ALA A 1 161 ? -9.440  -4.088  -15.811 1.00 1.49  ? 161 ALA A HB1  2  
ATOM 7840   H HB2  . ALA A 1 161 ? -8.501  -3.068  -14.721 1.00 1.42  ? 161 ALA A HB2  2  
ATOM 7841   H HB3  . ALA A 1 161 ? -7.682  -4.222  -15.771 1.00 1.36  ? 161 ALA A HB3  2  
ATOM 7842   N N    . ASP A 1 162 ? -7.810  -4.031  -12.108 1.00 0.84  ? 162 ASP A N    2  
ATOM 7843   C CA   . ASP A 1 162 ? -6.793  -3.749  -11.055 1.00 0.82  ? 162 ASP A CA   2  
ATOM 7844   C C    . ASP A 1 162 ? -7.438  -2.915  -9.945  1.00 0.78  ? 162 ASP A C    2  
ATOM 7845   O O    . ASP A 1 162 ? -8.258  -2.056  -10.208 1.00 0.79  ? 162 ASP A O    2  
ATOM 7846   C CB   . ASP A 1 162 ? -5.628  -2.967  -11.667 1.00 0.87  ? 162 ASP A CB   2  
ATOM 7847   C CG   . ASP A 1 162 ? -4.496  -2.848  -10.644 1.00 1.54  ? 162 ASP A CG   2  
ATOM 7848   O OD1  . ASP A 1 162 ? -4.732  -3.164  -9.490  1.00 2.22  ? 162 ASP A OD1  2  
ATOM 7849   O OD2  . ASP A 1 162 ? -3.413  -2.442  -11.032 1.00 2.25  ? 162 ASP A OD2  2  
ATOM 7850   H H    . ASP A 1 162 ? -8.674  -3.569  -12.083 1.00 0.83  ? 162 ASP A H    2  
ATOM 7851   H HA   . ASP A 1 162 ? -6.429  -4.680  -10.644 1.00 0.83  ? 162 ASP A HA   2  
ATOM 7852   H HB2  . ASP A 1 162 ? -5.268  -3.484  -12.545 1.00 1.24  ? 162 ASP A HB2  2  
ATOM 7853   H HB3  . ASP A 1 162 ? -5.964  -1.979  -11.944 1.00 1.35  ? 162 ASP A HB3  2  
ATOM 7854   N N    . LEU A 1 163 ? -7.078  -3.160  -8.708  1.00 0.76  ? 163 LEU A N    2  
ATOM 7855   C CA   . LEU A 1 163 ? -7.672  -2.384  -7.568  1.00 0.73  ? 163 LEU A CA   2  
ATOM 7856   C C    . LEU A 1 163 ? -6.600  -1.490  -6.940  1.00 0.74  ? 163 LEU A C    2  
ATOM 7857   O O    . LEU A 1 163 ? -5.462  -1.887  -6.777  1.00 0.76  ? 163 LEU A O    2  
ATOM 7858   C CB   . LEU A 1 163 ? -8.194  -3.361  -6.511  1.00 0.68  ? 163 LEU A CB   2  
ATOM 7859   C CG   . LEU A 1 163 ? -9.336  -4.204  -7.093  1.00 0.72  ? 163 LEU A CG   2  
ATOM 7860   C CD1  . LEU A 1 163 ? -9.697  -5.312  -6.099  1.00 0.72  ? 163 LEU A CD1  2  
ATOM 7861   C CD2  . LEU A 1 163 ? -10.573 -3.322  -7.359  1.00 0.78  ? 163 LEU A CD2  2  
ATOM 7862   H H    . LEU A 1 163 ? -6.421  -3.863  -8.527  1.00 0.78  ? 163 LEU A H    2  
ATOM 7863   H HA   . LEU A 1 163 ? -8.486  -1.766  -7.916  1.00 0.75  ? 163 LEU A HA   2  
ATOM 7864   H HB2  . LEU A 1 163 ? -7.389  -4.014  -6.203  1.00 0.68  ? 163 LEU A HB2  2  
ATOM 7865   H HB3  . LEU A 1 163 ? -8.552  -2.810  -5.655  1.00 0.67  ? 163 LEU A HB3  2  
ATOM 7866   H HG   . LEU A 1 163 ? -9.008  -4.653  -8.021  1.00 0.80  ? 163 LEU A HG   2  
ATOM 7867   H HD11 . LEU A 1 163 ? -9.830  -4.885  -5.116  1.00 1.26  ? 163 LEU A HD11 2  
ATOM 7868   H HD12 . LEU A 1 163 ? -10.614 -5.790  -6.410  1.00 1.33  ? 163 LEU A HD12 2  
ATOM 7869   H HD13 . LEU A 1 163 ? -8.903  -6.044  -6.071  1.00 1.16  ? 163 LEU A HD13 2  
ATOM 7870   H HD21 . LEU A 1 163 ? -10.651 -2.557  -6.599  1.00 1.29  ? 163 LEU A HD21 2  
ATOM 7871   H HD22 . LEU A 1 163 ? -10.481 -2.856  -8.329  1.00 1.35  ? 163 LEU A HD22 2  
ATOM 7872   H HD23 . LEU A 1 163 ? -11.466 -3.932  -7.345  1.00 1.23  ? 163 LEU A HD23 2  
ATOM 7873   N N    . THR A 1 164 ? -6.957  -0.281  -6.585  1.00 0.75  ? 164 THR A N    2  
ATOM 7874   C CA   . THR A 1 164 ? -5.967  0.653   -5.965  1.00 0.78  ? 164 THR A CA   2  
ATOM 7875   C C    . THR A 1 164 ? -6.070  0.563   -4.428  1.00 0.70  ? 164 THR A C    2  
ATOM 7876   O O    . THR A 1 164 ? -7.153  0.426   -3.895  1.00 0.65  ? 164 THR A O    2  
ATOM 7877   C CB   . THR A 1 164 ? -6.287  2.084   -6.404  1.00 0.85  ? 164 THR A CB   2  
ATOM 7878   O OG1  . THR A 1 164 ? -7.579  2.443   -5.935  1.00 0.89  ? 164 THR A OG1  2  
ATOM 7879   C CG2  . THR A 1 164 ? -6.255  2.172   -7.931  1.00 0.98  ? 164 THR A CG2  2  
ATOM 7880   H H    . THR A 1 164 ? -7.881  0.014   -6.727  1.00 0.76  ? 164 THR A H    2  
ATOM 7881   H HA   . THR A 1 164 ? -4.976  0.392   -6.295  1.00 0.81  ? 164 THR A HA   2  
ATOM 7882   H HB   . THR A 1 164 ? -5.554  2.761   -5.993  1.00 0.88  ? 164 THR A HB   2  
ATOM 7883   H HG1  . THR A 1 164 ? -8.225  1.910   -6.404  1.00 1.28  ? 164 THR A HG1  2  
ATOM 7884   H HG21 . THR A 1 164 ? -5.282  1.867   -8.289  1.00 1.33  ? 164 THR A HG21 2  
ATOM 7885   H HG22 . THR A 1 164 ? -7.011  1.522   -8.345  1.00 1.42  ? 164 THR A HG22 2  
ATOM 7886   H HG23 . THR A 1 164 ? -6.448  3.189   -8.237  1.00 1.56  ? 164 THR A HG23 2  
ATOM 7887   N N    . PRO A 1 165 ? -4.966  0.647   -3.709  1.00 0.71  ? 165 PRO A N    2  
ATOM 7888   C CA   . PRO A 1 165 ? -4.981  0.580   -2.217  1.00 0.68  ? 165 PRO A CA   2  
ATOM 7889   C C    . PRO A 1 165 ? -6.156  1.351   -1.600  1.00 0.64  ? 165 PRO A C    2  
ATOM 7890   O O    . PRO A 1 165 ? -6.743  0.929   -0.620  1.00 0.63  ? 165 PRO A O    2  
ATOM 7891   C CB   . PRO A 1 165 ? -3.647  1.219   -1.822  1.00 0.74  ? 165 PRO A CB   2  
ATOM 7892   C CG   . PRO A 1 165 ? -2.720  0.902   -2.953  1.00 0.81  ? 165 PRO A CG   2  
ATOM 7893   C CD   . PRO A 1 165 ? -3.588  0.811   -4.221  1.00 0.80  ? 165 PRO A CD   2  
ATOM 7894   H HA   . PRO A 1 165 ? -4.998  -0.445  -1.893  1.00 0.67  ? 165 PRO A HA   2  
ATOM 7895   H HB2  . PRO A 1 165 ? -3.760  2.291   -1.713  1.00 0.74  ? 165 PRO A HB2  2  
ATOM 7896   H HB3  . PRO A 1 165 ? -3.278  0.785   -0.904  1.00 0.75  ? 165 PRO A HB3  2  
ATOM 7897   H HG2  . PRO A 1 165 ? -1.978  1.686   -3.058  1.00 0.87  ? 165 PRO A HG2  2  
ATOM 7898   H HG3  . PRO A 1 165 ? -2.230  -0.047  -2.779  1.00 0.84  ? 165 PRO A HG3  2  
ATOM 7899   H HD2  . PRO A 1 165 ? -3.503  1.718   -4.806  1.00 0.85  ? 165 PRO A HD2  2  
ATOM 7900   H HD3  . PRO A 1 165 ? -3.305  -0.049  -4.810  1.00 0.83  ? 165 PRO A HD3  2  
ATOM 7901   N N    . SER A 1 166 ? -6.498  2.481   -2.154  1.00 0.67  ? 166 SER A N    2  
ATOM 7902   C CA   . SER A 1 166 ? -7.624  3.271   -1.581  1.00 0.69  ? 166 SER A CA   2  
ATOM 7903   C C    . SER A 1 166 ? -8.868  2.390   -1.552  1.00 0.67  ? 166 SER A C    2  
ATOM 7904   O O    . SER A 1 166 ? -9.638  2.415   -0.612  1.00 0.72  ? 166 SER A O    2  
ATOM 7905   C CB   . SER A 1 166 ? -7.907  4.493   -2.462  1.00 0.76  ? 166 SER A CB   2  
ATOM 7906   O OG   . SER A 1 166 ? -6.749  5.316   -2.531  1.00 0.90  ? 166 SER A OG   2  
ATOM 7907   H H    . SER A 1 166 ? -6.006  2.817   -2.932  1.00 0.72  ? 166 SER A H    2  
ATOM 7908   H HA   . SER A 1 166 ? -7.375  3.592   -0.578  1.00 0.68  ? 166 SER A HA   2  
ATOM 7909   H HB2  . SER A 1 166 ? -8.170  4.170   -3.455  1.00 0.77  ? 166 SER A HB2  2  
ATOM 7910   H HB3  . SER A 1 166 ? -8.732  5.052   -2.037  1.00 0.81  ? 166 SER A HB3  2  
ATOM 7911   H HG   . SER A 1 166 ? -6.656  5.623   -3.438  1.00 1.36  ? 166 SER A HG   2  
ATOM 7912   N N    . GLU A 1 167 ? -9.074  1.614   -2.577  1.00 0.68  ? 167 GLU A N    2  
ATOM 7913   C CA   . GLU A 1 167 ? -10.270 0.733   -2.613  1.00 0.67  ? 167 GLU A CA   2  
ATOM 7914   C C    . GLU A 1 167 ? -10.164 -0.335  -1.520  1.00 0.62  ? 167 GLU A C    2  
ATOM 7915   O O    . GLU A 1 167 ? -11.138 -0.670  -0.878  1.00 0.63  ? 167 GLU A O    2  
ATOM 7916   C CB   . GLU A 1 167 ? -10.351 0.055   -3.982  1.00 0.72  ? 167 GLU A CB   2  
ATOM 7917   C CG   . GLU A 1 167 ? -10.712 1.096   -5.043  1.00 0.83  ? 167 GLU A CG   2  
ATOM 7918   C CD   . GLU A 1 167 ? -10.756 0.428   -6.419  1.00 0.93  ? 167 GLU A CD   2  
ATOM 7919   O OE1  . GLU A 1 167 ? -9.698  0.230   -6.993  1.00 1.61  ? 167 GLU A OE1  2  
ATOM 7920   O OE2  . GLU A 1 167 ? -11.847 0.125   -6.874  1.00 1.26  ? 167 GLU A OE2  2  
ATOM 7921   H H    . GLU A 1 167 ? -8.441  1.612   -3.326  1.00 0.71  ? 167 GLU A H    2  
ATOM 7922   H HA   . GLU A 1 167 ? -11.156 1.324   -2.452  1.00 0.70  ? 167 GLU A HA   2  
ATOM 7923   H HB2  . GLU A 1 167 ? -9.395  -0.389  -4.221  1.00 0.71  ? 167 GLU A HB2  2  
ATOM 7924   H HB3  . GLU A 1 167 ? -11.111 -0.712  -3.960  1.00 0.73  ? 167 GLU A HB3  2  
ATOM 7925   H HG2  . GLU A 1 167 ? -11.679 1.521   -4.816  1.00 0.87  ? 167 GLU A HG2  2  
ATOM 7926   H HG3  . GLU A 1 167 ? -9.967  1.878   -5.049  1.00 0.87  ? 167 GLU A HG3  2  
ATOM 7927   N N    . THR A 1 168 ? -8.997  -0.891  -1.314  1.00 0.58  ? 168 THR A N    2  
ATOM 7928   C CA   . THR A 1 168 ? -8.863  -1.955  -0.274  1.00 0.55  ? 168 THR A CA   2  
ATOM 7929   C C    . THR A 1 168 ? -9.354  -1.434  1.076   1.00 0.54  ? 168 THR A C    2  
ATOM 7930   O O    . THR A 1 168 ? -9.754  -2.196  1.930   1.00 0.55  ? 168 THR A O    2  
ATOM 7931   C CB   . THR A 1 168 ? -7.399  -2.431  -0.156  1.00 0.57  ? 168 THR A CB   2  
ATOM 7932   O OG1  . THR A 1 168 ? -6.532  -1.343  0.167   1.00 0.61  ? 168 THR A OG1  2  
ATOM 7933   C CG2  . THR A 1 168 ? -6.948  -3.062  -1.478  1.00 0.60  ? 168 THR A CG2  2  
ATOM 7934   H H    . THR A 1 168 ? -8.228  -0.635  -1.864  1.00 0.60  ? 168 THR A H    2  
ATOM 7935   H HA   . THR A 1 168 ? -9.480  -2.795  -0.561  1.00 0.55  ? 168 THR A HA   2  
ATOM 7936   H HB   . THR A 1 168 ? -7.339  -3.171  0.623   1.00 0.57  ? 168 THR A HB   2  
ATOM 7937   H HG1  . THR A 1 168 ? -5.633  -1.692  0.261   1.00 0.61  ? 168 THR A HG1  2  
ATOM 7938   H HG21 . THR A 1 168 ? -7.767  -3.610  -1.922  1.00 1.14  ? 168 THR A HG21 2  
ATOM 7939   H HG22 . THR A 1 168 ? -6.628  -2.285  -2.155  1.00 1.13  ? 168 THR A HG22 2  
ATOM 7940   H HG23 . THR A 1 168 ? -6.126  -3.737  -1.292  1.00 1.21  ? 168 THR A HG23 2  
ATOM 7941   N N    . ALA A 1 169 ? -9.338  -0.149  1.276   1.00 0.55  ? 169 ALA A N    2  
ATOM 7942   C CA   . ALA A 1 169 ? -9.818  0.413   2.574   1.00 0.56  ? 169 ALA A CA   2  
ATOM 7943   C C    . ALA A 1 169 ? -11.350 0.400   2.610   1.00 0.58  ? 169 ALA A C    2  
ATOM 7944   O O    . ALA A 1 169 ? -11.959 -0.190  3.480   1.00 0.60  ? 169 ALA A O    2  
ATOM 7945   C CB   . ALA A 1 169 ? -9.322  1.851   2.718   1.00 0.59  ? 169 ALA A CB   2  
ATOM 7946   H H    . ALA A 1 169 ? -9.019  0.451   0.571   1.00 0.56  ? 169 ALA A H    2  
ATOM 7947   H HA   . ALA A 1 169 ? -9.433  -0.183  3.388   1.00 0.56  ? 169 ALA A HA   2  
ATOM 7948   H HB1  . ALA A 1 169 ? -9.402  2.353   1.766   1.00 1.10  ? 169 ALA A HB1  2  
ATOM 7949   H HB2  . ALA A 1 169 ? -9.922  2.372   3.450   1.00 1.16  ? 169 ALA A HB2  2  
ATOM 7950   H HB3  . ALA A 1 169 ? -8.292  1.844   3.035   1.00 1.21  ? 169 ALA A HB3  2  
ATOM 7951   N N    . GLN A 1 170 ? -11.971 1.052   1.666   1.00 0.59  ? 170 GLN A N    2  
ATOM 7952   C CA   . GLN A 1 170 ? -13.456 1.094   1.629   1.00 0.63  ? 170 GLN A CA   2  
ATOM 7953   C C    . GLN A 1 170 ? -13.960 -0.181  0.971   1.00 0.60  ? 170 GLN A C    2  
ATOM 7954   O O    . GLN A 1 170 ? -14.912 -0.175  0.215   1.00 0.65  ? 170 GLN A O    2  
ATOM 7955   C CB   . GLN A 1 170 ? -13.923 2.315   0.829   1.00 0.69  ? 170 GLN A CB   2  
ATOM 7956   C CG   . GLN A 1 170 ? -13.332 2.267   -0.581  1.00 0.70  ? 170 GLN A CG   2  
ATOM 7957   C CD   . GLN A 1 170 ? -13.680 3.562   -1.319  1.00 0.78  ? 170 GLN A CD   2  
ATOM 7958   O OE1  . GLN A 1 170 ? -13.811 4.605   -0.710  1.00 1.33  ? 170 GLN A OE1  2  
ATOM 7959   N NE2  . GLN A 1 170 ? -13.831 3.541   -2.616  1.00 1.40  ? 170 GLN A NE2  2  
ATOM 7960   H H    . GLN A 1 170 ? -11.456 1.512   0.980   1.00 0.59  ? 170 GLN A H    2  
ATOM 7961   H HA   . GLN A 1 170 ? -13.843 1.155   2.637   1.00 0.65  ? 170 GLN A HA   2  
ATOM 7962   H HB2  . GLN A 1 170 ? -15.001 2.313   0.768   1.00 0.72  ? 170 GLN A HB2  2  
ATOM 7963   H HB3  . GLN A 1 170 ? -13.592 3.215   1.324   1.00 0.72  ? 170 GLN A HB3  2  
ATOM 7964   H HG2  . GLN A 1 170 ? -12.260 2.163   -0.519  1.00 0.72  ? 170 GLN A HG2  2  
ATOM 7965   H HG3  . GLN A 1 170 ? -13.747 1.427   -1.118  1.00 0.77  ? 170 GLN A HG3  2  
ATOM 7966   H HE21 . GLN A 1 170 ? -13.723 2.701   -3.108  1.00 2.11  ? 170 GLN A HE21 2  
ATOM 7967   H HE22 . GLN A 1 170 ? -14.055 4.365   -3.096  1.00 1.45  ? 170 GLN A HE22 2  
ATOM 7968   N N    . LEU A 1 171 ? -13.335 -1.285  1.277   1.00 0.54  ? 171 LEU A N    2  
ATOM 7969   C CA   . LEU A 1 171 ? -13.760 -2.594  0.712   1.00 0.53  ? 171 LEU A CA   2  
ATOM 7970   C C    . LEU A 1 171 ? -14.502 -3.381  1.795   1.00 0.57  ? 171 LEU A C    2  
ATOM 7971   O O    . LEU A 1 171 ? -14.050 -3.485  2.918   1.00 0.63  ? 171 LEU A O    2  
ATOM 7972   C CB   . LEU A 1 171 ? -12.508 -3.360  0.291   1.00 0.49  ? 171 LEU A CB   2  
ATOM 7973   C CG   . LEU A 1 171 ? -12.866 -4.757  -0.219  1.00 0.48  ? 171 LEU A CG   2  
ATOM 7974   C CD1  . LEU A 1 171 ? -13.800 -4.649  -1.432  1.00 0.70  ? 171 LEU A CD1  2  
ATOM 7975   C CD2  . LEU A 1 171 ? -11.569 -5.462  -0.620  1.00 0.48  ? 171 LEU A CD2  2  
ATOM 7976   H H    . LEU A 1 171 ? -12.592 -1.275  1.914   1.00 0.53  ? 171 LEU A H    2  
ATOM 7977   H HA   . LEU A 1 171 ? -14.404 -2.444  -0.143  1.00 0.55  ? 171 LEU A HA   2  
ATOM 7978   H HB2  . LEU A 1 171 ? -12.008 -2.817  -0.493  1.00 0.53  ? 171 LEU A HB2  2  
ATOM 7979   H HB3  . LEU A 1 171 ? -11.849 -3.452  1.139   1.00 0.52  ? 171 LEU A HB3  2  
ATOM 7980   H HG   . LEU A 1 171 ? -13.351 -5.320  0.563   1.00 0.59  ? 171 LEU A HG   2  
ATOM 7981   H HD11 . LEU A 1 171 ? -13.513 -3.802  -2.037  1.00 1.25  ? 171 LEU A HD11 2  
ATOM 7982   H HD12 . LEU A 1 171 ? -13.735 -5.552  -2.021  1.00 1.29  ? 171 LEU A HD12 2  
ATOM 7983   H HD13 . LEU A 1 171 ? -14.815 -4.520  -1.089  1.00 1.26  ? 171 LEU A HD13 2  
ATOM 7984   H HD21 . LEU A 1 171 ? -10.914 -5.518  0.236   1.00 1.19  ? 171 LEU A HD21 2  
ATOM 7985   H HD22 . LEU A 1 171 ? -11.791 -6.457  -0.972  1.00 1.03  ? 171 LEU A HD22 2  
ATOM 7986   H HD23 . LEU A 1 171 ? -11.085 -4.900  -1.405  1.00 1.06  ? 171 LEU A HD23 2  
ATOM 7987   N N    . ASN A 1 172 ? -15.628 -3.950  1.466   1.00 0.58  ? 172 ASN A N    2  
ATOM 7988   C CA   . ASN A 1 172 ? -16.392 -4.748  2.476   1.00 0.65  ? 172 ASN A CA   2  
ATOM 7989   C C    . ASN A 1 172 ? -15.984 -6.213  2.354   1.00 0.58  ? 172 ASN A C    2  
ATOM 7990   O O    . ASN A 1 172 ? -16.388 -6.909  1.445   1.00 0.58  ? 172 ASN A O    2  
ATOM 7991   C CB   . ASN A 1 172 ? -17.896 -4.615  2.220   1.00 0.77  ? 172 ASN A CB   2  
ATOM 7992   C CG   . ASN A 1 172 ? -18.360 -3.206  2.592   1.00 1.52  ? 172 ASN A CG   2  
ATOM 7993   O OD1  . ASN A 1 172 ? -17.697 -2.511  3.336   1.00 2.35  ? 172 ASN A OD1  2  
ATOM 7994   N ND2  . ASN A 1 172 ? -19.487 -2.755  2.111   1.00 2.12  ? 172 ASN A ND2  2  
ATOM 7995   H H    . ASN A 1 172 ? -15.963 -3.866  0.553   1.00 0.57  ? 172 ASN A H    2  
ATOM 7996   H HA   . ASN A 1 172 ? -16.164 -4.393  3.472   1.00 0.72  ? 172 ASN A HA   2  
ATOM 7997   H HB2  . ASN A 1 172 ? -18.099 -4.796  1.174   1.00 1.13  ? 172 ASN A HB2  2  
ATOM 7998   H HB3  . ASN A 1 172 ? -18.428 -5.337  2.820   1.00 1.26  ? 172 ASN A HB3  2  
ATOM 7999   H HD21 . ASN A 1 172 ? -20.027 -3.318  1.518   1.00 2.32  ? 172 ASN A HD21 2  
ATOM 8000   H HD22 . ASN A 1 172 ? -19.793 -1.854  2.343   1.00 2.81  ? 172 ASN A HD22 2  
ATOM 8001   N N    . LEU A 1 173 ? -15.174 -6.685  3.258   1.00 0.63  ? 173 LEU A N    2  
ATOM 8002   C CA   . LEU A 1 173 ? -14.726 -8.101  3.189   1.00 0.60  ? 173 LEU A CA   2  
ATOM 8003   C C    . LEU A 1 173 ? -15.926 -9.041  3.348   1.00 0.62  ? 173 LEU A C    2  
ATOM 8004   O O    . LEU A 1 173 ? -16.051 -10.019 2.637   1.00 0.65  ? 173 LEU A O    2  
ATOM 8005   C CB   . LEU A 1 173 ? -13.722 -8.367  4.317   1.00 0.68  ? 173 LEU A CB   2  
ATOM 8006   C CG   . LEU A 1 173 ? -12.498 -7.451  4.165   1.00 0.76  ? 173 LEU A CG   2  
ATOM 8007   C CD1  . LEU A 1 173 ? -11.667 -7.506  5.451   1.00 1.51  ? 173 LEU A CD1  2  
ATOM 8008   C CD2  . LEU A 1 173 ? -11.628 -7.907  2.982   1.00 1.29  ? 173 LEU A CD2  2  
ATOM 8009   H H    . LEU A 1 173 ? -14.851 -6.103  3.978   1.00 0.73  ? 173 LEU A H    2  
ATOM 8010   H HA   . LEU A 1 173 ? -14.255 -8.284  2.236   1.00 0.55  ? 173 LEU A HA   2  
ATOM 8011   H HB2  . LEU A 1 173 ? -14.198 -8.172  5.268   1.00 0.81  ? 173 LEU A HB2  2  
ATOM 8012   H HB3  . LEU A 1 173 ? -13.408 -9.398  4.282   1.00 0.76  ? 173 LEU A HB3  2  
ATOM 8013   H HG   . LEU A 1 173 ? -12.831 -6.435  4.000   1.00 1.47  ? 173 LEU A HG   2  
ATOM 8014   H HD11 . LEU A 1 173 ? -12.285 -7.229  6.291   1.00 2.03  ? 173 LEU A HD11 2  
ATOM 8015   H HD12 . LEU A 1 173 ? -11.293 -8.509  5.594   1.00 2.01  ? 173 LEU A HD12 2  
ATOM 8016   H HD13 . LEU A 1 173 ? -10.836 -6.820  5.373   1.00 2.09  ? 173 LEU A HD13 2  
ATOM 8017   H HD21 . LEU A 1 173 ? -11.553 -8.984  2.976   1.00 1.96  ? 173 LEU A HD21 2  
ATOM 8018   H HD22 . LEU A 1 173 ? -12.071 -7.572  2.056   1.00 1.75  ? 173 LEU A HD22 2  
ATOM 8019   H HD23 . LEU A 1 173 ? -10.638 -7.481  3.077   1.00 1.81  ? 173 LEU A HD23 2  
ATOM 8020   N N    . LYS A 1 174 ? -16.784 -8.788  4.300   1.00 0.67  ? 174 LYS A N    2  
ATOM 8021   C CA   . LYS A 1 174 ? -17.944 -9.700  4.536   1.00 0.73  ? 174 LYS A CA   2  
ATOM 8022   C C    . LYS A 1 174 ? -18.904 -9.737  3.342   1.00 0.72  ? 174 LYS A C    2  
ATOM 8023   O O    . LYS A 1 174 ? -19.579 -10.724 3.128   1.00 0.83  ? 174 LYS A O    2  
ATOM 8024   C CB   . LYS A 1 174 ? -18.706 -9.229  5.778   1.00 0.83  ? 174 LYS A CB   2  
ATOM 8025   C CG   . LYS A 1 174 ? -17.857 -9.493  7.024   1.00 0.97  ? 174 LYS A CG   2  
ATOM 8026   C CD   . LYS A 1 174 ? -18.632 -9.081  8.282   1.00 1.10  ? 174 LYS A CD   2  
ATOM 8027   C CE   . LYS A 1 174 ? -18.935 -7.571  8.262   1.00 1.59  ? 174 LYS A CE   2  
ATOM 8028   N NZ   . LYS A 1 174 ? -20.285 -7.347  7.672   1.00 2.33  ? 174 LYS A NZ   2  
ATOM 8029   H H    . LYS A 1 174 ? -16.661 -8.031  4.911   1.00 0.69  ? 174 LYS A H    2  
ATOM 8030   H HA   . LYS A 1 174 ? -17.573 -10.696 4.715   1.00 0.76  ? 174 LYS A HA   2  
ATOM 8031   H HB2  . LYS A 1 174 ? -18.910 -8.171  5.696   1.00 0.85  ? 174 LYS A HB2  2  
ATOM 8032   H HB3  . LYS A 1 174 ? -19.636 -9.771  5.857   1.00 0.89  ? 174 LYS A HB3  2  
ATOM 8033   H HG2  . LYS A 1 174 ? -17.615 -10.545 7.077   1.00 1.05  ? 174 LYS A HG2  2  
ATOM 8034   H HG3  . LYS A 1 174 ? -16.944 -8.918  6.963   1.00 1.02  ? 174 LYS A HG3  2  
ATOM 8035   H HD2  . LYS A 1 174 ? -19.562 -9.630  8.323   1.00 1.54  ? 174 LYS A HD2  2  
ATOM 8036   H HD3  . LYS A 1 174 ? -18.042 -9.316  9.156   1.00 1.28  ? 174 LYS A HD3  2  
ATOM 8037   H HE2  . LYS A 1 174 ? -18.922 -7.186  9.272   1.00 2.03  ? 174 LYS A HE2  2  
ATOM 8038   H HE3  . LYS A 1 174 ? -18.194 -7.049  7.672   1.00 2.07  ? 174 LYS A HE3  2  
ATOM 8039   H HZ1  . LYS A 1 174 ? -20.721 -8.266  7.447   1.00 2.70  ? 174 LYS A HZ1  2  
ATOM 8040   H HZ2  . LYS A 1 174 ? -20.882 -6.839  8.354   1.00 2.67  ? 174 LYS A HZ2  2  
ATOM 8041   H HZ3  . LYS A 1 174 ? -20.197 -6.783  6.804   1.00 2.86  ? 174 LYS A HZ3  2  
ATOM 8042   N N    . LYS A 1 175 ? -19.000 -8.685  2.568   1.00 0.66  ? 175 LYS A N    2  
ATOM 8043   C CA   . LYS A 1 175 ? -19.957 -8.710  1.414   1.00 0.72  ? 175 LYS A CA   2  
ATOM 8044   C C    . LYS A 1 175 ? -19.237 -9.188  0.154   1.00 0.62  ? 175 LYS A C    2  
ATOM 8045   O O    . LYS A 1 175 ? -19.862 -9.488  -0.845  1.00 0.63  ? 175 LYS A O    2  
ATOM 8046   C CB   . LYS A 1 175 ? -20.518 -7.306  1.187   1.00 0.85  ? 175 LYS A CB   2  
ATOM 8047   C CG   . LYS A 1 175 ? -21.355 -6.899  2.401   1.00 1.02  ? 175 LYS A CG   2  
ATOM 8048   C CD   . LYS A 1 175 ? -21.924 -5.496  2.189   1.00 1.42  ? 175 LYS A CD   2  
ATOM 8049   C CE   . LYS A 1 175 ? -22.759 -5.097  3.407   1.00 1.50  ? 175 LYS A CE   2  
ATOM 8050   N NZ   . LYS A 1 175 ? -23.421 -3.786  3.148   1.00 1.92  ? 175 LYS A NZ   2  
ATOM 8051   H H    . LYS A 1 175 ? -18.466 -7.885  2.750   1.00 0.64  ? 175 LYS A H    2  
ATOM 8052   H HA   . LYS A 1 175 ? -20.778 -9.385  1.630   1.00 0.79  ? 175 LYS A HA   2  
ATOM 8053   H HB2  . LYS A 1 175 ? -19.704 -6.609  1.055   1.00 0.83  ? 175 LYS A HB2  2  
ATOM 8054   H HB3  . LYS A 1 175 ? -21.142 -7.306  0.305   1.00 0.93  ? 175 LYS A HB3  2  
ATOM 8055   H HG2  . LYS A 1 175 ? -22.165 -7.602  2.532   1.00 1.54  ? 175 LYS A HG2  2  
ATOM 8056   H HG3  . LYS A 1 175 ? -20.732 -6.902  3.282   1.00 1.47  ? 175 LYS A HG3  2  
ATOM 8057   H HD2  . LYS A 1 175 ? -21.113 -4.794  2.060   1.00 1.92  ? 175 LYS A HD2  2  
ATOM 8058   H HD3  . LYS A 1 175 ? -22.549 -5.492  1.309   1.00 1.97  ? 175 LYS A HD3  2  
ATOM 8059   H HE2  . LYS A 1 175 ? -23.511 -5.849  3.590   1.00 1.87  ? 175 LYS A HE2  2  
ATOM 8060   H HE3  . LYS A 1 175 ? -22.117 -5.011  4.271   1.00 1.94  ? 175 LYS A HE3  2  
ATOM 8061   H HZ1  . LYS A 1 175 ? -22.760 -3.155  2.656   1.00 2.39  ? 175 LYS A HZ1  2  
ATOM 8062   H HZ2  . LYS A 1 175 ? -24.263 -3.934  2.556   1.00 2.27  ? 175 LYS A HZ2  2  
ATOM 8063   H HZ3  . LYS A 1 175 ? -23.704 -3.357  4.053   1.00 2.38  ? 175 LYS A HZ3  2  
ATOM 8064   N N    . VAL A 1 176 ? -17.930 -9.293  0.197   1.00 0.60  ? 176 VAL A N    2  
ATOM 8065   C CA   . VAL A 1 176 ? -17.166 -9.787  -0.992  1.00 0.54  ? 176 VAL A CA   2  
ATOM 8066   C C    . VAL A 1 176 ? -16.627 -11.180 -0.655  1.00 0.53  ? 176 VAL A C    2  
ATOM 8067   O O    . VAL A 1 176 ? -15.908 -11.361 0.308   1.00 0.67  ? 176 VAL A O    2  
ATOM 8068   C CB   . VAL A 1 176 ? -16.002 -8.837  -1.280  1.00 0.56  ? 176 VAL A CB   2  
ATOM 8069   C CG1  . VAL A 1 176 ? -15.219 -9.340  -2.494  1.00 0.55  ? 176 VAL A CG1  2  
ATOM 8070   C CG2  . VAL A 1 176 ? -16.552 -7.438  -1.572  1.00 0.66  ? 176 VAL A CG2  2  
ATOM 8071   H H    . VAL A 1 176 ? -17.448 -9.056  1.016   1.00 0.66  ? 176 VAL A H    2  
ATOM 8072   H HA   . VAL A 1 176 ? -17.809 -9.848  -1.859  1.00 0.56  ? 176 VAL A HA   2  
ATOM 8073   H HB   . VAL A 1 176 ? -15.348 -8.798  -0.421  1.00 0.59  ? 176 VAL A HB   2  
ATOM 8074   H HG11 . VAL A 1 176 ? -15.908 -9.628  -3.274  1.00 1.08  ? 176 VAL A HG11 2  
ATOM 8075   H HG12 . VAL A 1 176 ? -14.574 -8.554  -2.858  1.00 1.10  ? 176 VAL A HG12 2  
ATOM 8076   H HG13 . VAL A 1 176 ? -14.621 -10.193 -2.209  1.00 1.16  ? 176 VAL A HG13 2  
ATOM 8077   H HG21 . VAL A 1 176 ? -17.191 -7.126  -0.758  1.00 1.22  ? 176 VAL A HG21 2  
ATOM 8078   H HG22 . VAL A 1 176 ? -15.732 -6.741  -1.673  1.00 1.27  ? 176 VAL A HG22 2  
ATOM 8079   H HG23 . VAL A 1 176 ? -17.123 -7.459  -2.487  1.00 1.20  ? 176 VAL A HG23 2  
ATOM 8080   N N    . LEU A 1 177 ? -17.008 -12.174 -1.411  1.00 0.48  ? 177 LEU A N    2  
ATOM 8081   C CA   . LEU A 1 177 ? -16.562 -13.571 -1.101  1.00 0.55  ? 177 LEU A CA   2  
ATOM 8082   C C    . LEU A 1 177 ? -15.238 -13.901 -1.792  1.00 0.52  ? 177 LEU A C    2  
ATOM 8083   O O    . LEU A 1 177 ? -14.765 -15.018 -1.723  1.00 0.62  ? 177 LEU A O    2  
ATOM 8084   C CB   . LEU A 1 177 ? -17.631 -14.558 -1.578  1.00 0.66  ? 177 LEU A CB   2  
ATOM 8085   C CG   . LEU A 1 177 ? -18.962 -14.281 -0.867  1.00 0.88  ? 177 LEU A CG   2  
ATOM 8086   C CD1  . LEU A 1 177 ? -20.037 -15.216 -1.432  1.00 1.44  ? 177 LEU A CD1  2  
ATOM 8087   C CD2  . LEU A 1 177 ? -18.813 -14.519 0.649   1.00 1.53  ? 177 LEU A CD2  2  
ATOM 8088   H H    . LEU A 1 177 ? -17.632 -12.016 -2.153  1.00 0.49  ? 177 LEU A H    2  
ATOM 8089   H HA   . LEU A 1 177 ? -16.434 -13.680 -0.034  1.00 0.62  ? 177 LEU A HA   2  
ATOM 8090   H HB2  . LEU A 1 177 ? -17.766 -14.448 -2.645  1.00 0.66  ? 177 LEU A HB2  2  
ATOM 8091   H HB3  . LEU A 1 177 ? -17.311 -15.565 -1.360  1.00 0.75  ? 177 LEU A HB3  2  
ATOM 8092   H HG   . LEU A 1 177 ? -19.254 -13.255 -1.044  1.00 1.41  ? 177 LEU A HG   2  
ATOM 8093   H HD11 . LEU A 1 177 ? -20.021 -15.174 -2.511  1.00 2.04  ? 177 LEU A HD11 2  
ATOM 8094   H HD12 . LEU A 1 177 ? -19.840 -16.228 -1.109  1.00 1.90  ? 177 LEU A HD12 2  
ATOM 8095   H HD13 . LEU A 1 177 ? -21.007 -14.906 -1.074  1.00 1.90  ? 177 LEU A HD13 2  
ATOM 8096   H HD21 . LEU A 1 177 ? -18.123 -15.332 0.827   1.00 1.96  ? 177 LEU A HD21 2  
ATOM 8097   H HD22 . LEU A 1 177 ? -18.438 -13.621 1.119   1.00 1.98  ? 177 LEU A HD22 2  
ATOM 8098   H HD23 . LEU A 1 177 ? -19.775 -14.765 1.078   1.00 2.17  ? 177 LEU A HD23 2  
ATOM 8099   N N    . GLY A 1 178 ? -14.626 -12.961 -2.450  1.00 0.48  ? 178 GLY A N    2  
ATOM 8100   C CA   . GLY A 1 178 ? -13.332 -13.270 -3.122  1.00 0.47  ? 178 GLY A CA   2  
ATOM 8101   C C    . GLY A 1 178 ? -12.916 -12.095 -4.000  1.00 0.46  ? 178 GLY A C    2  
ATOM 8102   O O    . GLY A 1 178 ? -13.650 -11.141 -4.163  1.00 0.47  ? 178 GLY A O    2  
ATOM 8103   H H    . GLY A 1 178 ? -15.002 -12.057 -2.496  1.00 0.52  ? 178 GLY A H    2  
ATOM 8104   H HA2  . GLY A 1 178 ? -12.573 -13.449 -2.374  1.00 0.48  ? 178 GLY A HA2  2  
ATOM 8105   H HA3  . GLY A 1 178 ? -13.447 -14.150 -3.736  1.00 0.48  ? 178 GLY A HA3  2  
ATOM 8106   N N    . PHE A 1 179 ? -11.735 -12.151 -4.564  1.00 0.47  ? 179 PHE A N    2  
ATOM 8107   C CA   . PHE A 1 179 ? -11.258 -11.032 -5.432  1.00 0.49  ? 179 PHE A CA   2  
ATOM 8108   C C    . PHE A 1 179 ? -10.580 -11.622 -6.671  1.00 0.53  ? 179 PHE A C    2  
ATOM 8109   O O    . PHE A 1 179 ? -9.707  -12.460 -6.565  1.00 0.55  ? 179 PHE A O    2  
ATOM 8110   C CB   . PHE A 1 179 ? -10.227 -10.188 -4.664  1.00 0.48  ? 179 PHE A CB   2  
ATOM 8111   C CG   . PHE A 1 179 ? -10.632 -10.057 -3.211  1.00 0.46  ? 179 PHE A CG   2  
ATOM 8112   C CD1  . PHE A 1 179 ? -11.714 -9.245  -2.849  1.00 0.45  ? 179 PHE A CD1  2  
ATOM 8113   C CD2  . PHE A 1 179 ? -9.912  -10.745 -2.224  1.00 0.48  ? 179 PHE A CD2  2  
ATOM 8114   C CE1  . PHE A 1 179 ? -12.077 -9.125  -1.500  1.00 0.46  ? 179 PHE A CE1  2  
ATOM 8115   C CE2  . PHE A 1 179 ? -10.273 -10.622 -0.879  1.00 0.47  ? 179 PHE A CE2  2  
ATOM 8116   C CZ   . PHE A 1 179 ? -11.356 -9.812  -0.516  1.00 0.46  ? 179 PHE A CZ   2  
ATOM 8117   H H    . PHE A 1 179 ? -11.155 -12.925 -4.410  1.00 0.48  ? 179 PHE A H    2  
ATOM 8118   H HA   . PHE A 1 179 ? -12.088 -10.408 -5.736  1.00 0.50  ? 179 PHE A HA   2  
ATOM 8119   H HB2  . PHE A 1 179 ? -9.253  -10.656 -4.722  1.00 0.51  ? 179 PHE A HB2  2  
ATOM 8120   H HB3  . PHE A 1 179 ? -10.173 -9.205  -5.107  1.00 0.49  ? 179 PHE A HB3  2  
ATOM 8121   H HD1  . PHE A 1 179 ? -12.269 -8.715  -3.608  1.00 0.48  ? 179 PHE A HD1  2  
ATOM 8122   H HD2  . PHE A 1 179 ? -9.078  -11.371 -2.501  1.00 0.52  ? 179 PHE A HD2  2  
ATOM 8123   H HE1  . PHE A 1 179 ? -12.911 -8.499  -1.219  1.00 0.49  ? 179 PHE A HE1  2  
ATOM 8124   H HE2  . PHE A 1 179 ? -9.715  -11.151 -0.120  1.00 0.52  ? 179 PHE A HE2  2  
ATOM 8125   H HZ   . PHE A 1 179 ? -11.634 -9.718  0.523   1.00 0.47  ? 179 PHE A HZ   2  
ATOM 8126   N N    . ILE A 1 180 ? -10.949 -11.170 -7.841  1.00 0.55  ? 180 ILE A N    2  
ATOM 8127   C CA   . ILE A 1 180 ? -10.306 -11.673 -9.094  1.00 0.59  ? 180 ILE A CA   2  
ATOM 8128   C C    . ILE A 1 180 ? -9.835  -10.474 -9.910  1.00 0.64  ? 180 ILE A C    2  
ATOM 8129   O O    . ILE A 1 180 ? -10.593 -9.575  -10.197 1.00 0.65  ? 180 ILE A O    2  
ATOM 8130   C CB   . ILE A 1 180 ? -11.313 -12.498 -9.896  1.00 0.58  ? 180 ILE A CB   2  
ATOM 8131   C CG1  . ILE A 1 180 ? -11.732 -13.708 -9.054  1.00 0.58  ? 180 ILE A CG1  2  
ATOM 8132   C CG2  . ILE A 1 180 ? -10.667 -12.974 -11.202 1.00 0.64  ? 180 ILE A CG2  2  
ATOM 8133   C CD1  . ILE A 1 180 ? -12.793 -14.517 -9.797  1.00 0.55  ? 180 ILE A CD1  2  
ATOM 8134   H H    . ILE A 1 180 ? -11.637 -10.475 -7.896  1.00 0.54  ? 180 ILE A H    2  
ATOM 8135   H HA   . ILE A 1 180 ? -9.455  -12.291 -8.854  1.00 0.61  ? 180 ILE A HA   2  
ATOM 8136   H HB   . ILE A 1 180 ? -12.181 -11.893 -10.120 1.00 0.59  ? 180 ILE A HB   2  
ATOM 8137   H HG12 . ILE A 1 180 ? -10.870 -14.332 -8.868  1.00 0.66  ? 180 ILE A HG12 2  
ATOM 8138   H HG13 . ILE A 1 180 ? -12.137 -13.367 -8.113  1.00 0.62  ? 180 ILE A HG13 2  
ATOM 8139   H HG21 . ILE A 1 180 ? -9.766  -13.526 -10.977 1.00 1.14  ? 180 ILE A HG21 2  
ATOM 8140   H HG22 . ILE A 1 180 ? -11.355 -13.611 -11.737 1.00 1.27  ? 180 ILE A HG22 2  
ATOM 8141   H HG23 . ILE A 1 180 ? -10.420 -12.120 -11.816 1.00 1.18  ? 180 ILE A HG23 2  
ATOM 8142   H HD11 . ILE A 1 180 ? -13.514 -13.846 -10.239 1.00 1.07  ? 180 ILE A HD11 2  
ATOM 8143   H HD12 . ILE A 1 180 ? -12.318 -15.101 -10.571 1.00 1.23  ? 180 ILE A HD12 2  
ATOM 8144   H HD13 . ILE A 1 180 ? -13.292 -15.176 -9.104  1.00 1.13  ? 180 ILE A HD13 2  
ATOM 8145   N N    . THR A 1 181 ? -8.583  -10.434 -10.277 1.00 0.68  ? 181 THR A N    2  
ATOM 8146   C CA   . THR A 1 181 ? -8.080  -9.268  -11.065 1.00 0.74  ? 181 THR A CA   2  
ATOM 8147   C C    . THR A 1 181 ? -7.014  -9.700  -12.065 1.00 0.79  ? 181 THR A C    2  
ATOM 8148   O O    . THR A 1 181 ? -6.366  -10.716 -11.914 1.00 0.80  ? 181 THR A O    2  
ATOM 8149   C CB   . THR A 1 181 ? -7.484  -8.223  -10.119 1.00 0.79  ? 181 THR A CB   2  
ATOM 8150   O OG1  . THR A 1 181 ? -6.602  -8.860  -9.206  1.00 0.82  ? 181 THR A OG1  2  
ATOM 8151   C CG2  . THR A 1 181 ? -8.604  -7.524  -9.351  1.00 0.77  ? 181 THR A CG2  2  
ATOM 8152   H H    . THR A 1 181 ? -7.980  -11.157 -10.028 1.00 0.69  ? 181 THR A H    2  
ATOM 8153   H HA   . THR A 1 181 ? -8.895  -8.831  -11.607 1.00 0.73  ? 181 THR A HA   2  
ATOM 8154   H HB   . THR A 1 181 ? -6.938  -7.489  -10.692 1.00 0.84  ? 181 THR A HB   2  
ATOM 8155   H HG1  . THR A 1 181 ? -7.060  -9.614  -8.829  1.00 1.30  ? 181 THR A HG1  2  
ATOM 8156   H HG21 . THR A 1 181 ? -9.288  -7.069  -10.052 1.00 1.31  ? 181 THR A HG21 2  
ATOM 8157   H HG22 . THR A 1 181 ? -9.132  -8.246  -8.747  1.00 1.08  ? 181 THR A HG22 2  
ATOM 8158   H HG23 . THR A 1 181 ? -8.180  -6.762  -8.716  1.00 1.39  ? 181 THR A HG23 2  
ATOM 8159   N N    . ASP A 1 182 ? -6.835  -8.920  -13.099 1.00 0.84  ? 182 ASP A N    2  
ATOM 8160   C CA   . ASP A 1 182 ? -5.811  -9.254  -14.134 1.00 0.90  ? 182 ASP A CA   2  
ATOM 8161   C C    . ASP A 1 182 ? -4.559  -8.403  -13.903 1.00 0.96  ? 182 ASP A C    2  
ATOM 8162   O O    . ASP A 1 182 ? -3.835  -8.102  -14.829 1.00 1.04  ? 182 ASP A O    2  
ATOM 8163   C CB   . ASP A 1 182 ? -6.380  -8.949  -15.522 1.00 0.95  ? 182 ASP A CB   2  
ATOM 8164   C CG   . ASP A 1 182 ? -7.710  -9.683  -15.700 1.00 1.71  ? 182 ASP A CG   2  
ATOM 8165   O OD1  . ASP A 1 182 ? -8.438  -9.792  -14.727 1.00 2.46  ? 182 ASP A OD1  2  
ATOM 8166   O OD2  . ASP A 1 182 ? -7.981  -10.117 -16.806 1.00 2.37  ? 182 ASP A OD2  2  
ATOM 8167   H H    . ASP A 1 182 ? -7.387  -8.107  -13.199 1.00 0.85  ? 182 ASP A H    2  
ATOM 8168   H HA   . ASP A 1 182 ? -5.551  -10.303 -14.077 1.00 0.90  ? 182 ASP A HA   2  
ATOM 8169   H HB2  . ASP A 1 182 ? -6.539  -7.884  -15.619 1.00 1.38  ? 182 ASP A HB2  2  
ATOM 8170   H HB3  . ASP A 1 182 ? -5.684  -9.280  -16.277 1.00 1.36  ? 182 ASP A HB3  2  
ATOM 8171   N N    . ALA A 1 183 ? -4.316  -7.979  -12.685 1.00 0.95  ? 183 ALA A N    2  
ATOM 8172   C CA   . ALA A 1 183 ? -3.131  -7.113  -12.391 1.00 1.03  ? 183 ALA A CA   2  
ATOM 8173   C C    . ALA A 1 183 ? -1.839  -7.659  -13.012 1.00 1.08  ? 183 ALA A C    2  
ATOM 8174   O O    . ALA A 1 183 ? -1.834  -8.599  -13.781 1.00 1.28  ? 183 ALA A O    2  
ATOM 8175   C CB   . ALA A 1 183 ? -2.950  -7.012  -10.877 1.00 1.03  ? 183 ALA A CB   2  
ATOM 8176   H H    . ALA A 1 183 ? -4.919  -8.190  -11.938 1.00 0.91  ? 183 ALA A H    2  
ATOM 8177   H HA   . ALA A 1 183 ? -3.315  -6.124  -12.784 1.00 1.09  ? 183 ALA A HA   2  
ATOM 8178   H HB1  . ALA A 1 183 ? -2.850  -8.003  -10.460 1.00 1.49  ? 183 ALA A HB1  2  
ATOM 8179   H HB2  . ALA A 1 183 ? -2.062  -6.439  -10.658 1.00 1.35  ? 183 ALA A HB2  2  
ATOM 8180   H HB3  . ALA A 1 183 ? -3.810  -6.524  -10.444 1.00 1.51  ? 183 ALA A HB3  2  
ATOM 8181   N N    . GLY A 1 184 ? -0.735  -7.046  -12.667 1.00 1.51  ? 184 GLY A N    2  
ATOM 8182   C CA   . GLY A 1 184 ? 0.583   -7.474  -13.216 1.00 1.61  ? 184 GLY A CA   2  
ATOM 8183   C C    . GLY A 1 184 ? 1.071   -8.757  -12.538 1.00 1.55  ? 184 GLY A C    2  
ATOM 8184   O O    . GLY A 1 184 ? 1.377   -9.728  -13.201 1.00 2.19  ? 184 GLY A O    2  
ATOM 8185   H H    . GLY A 1 184 ? -0.780  -6.293  -12.042 1.00 1.99  ? 184 GLY A H    2  
ATOM 8186   H HA2  . GLY A 1 184 ? 0.484   -7.648  -14.278 1.00 1.61  ? 184 GLY A HA2  2  
ATOM 8187   H HA3  . GLY A 1 184 ? 1.307   -6.690  -13.050 1.00 2.23  ? 184 GLY A HA3  2  
ATOM 8188   N N    . GLY A 1 185 ? 1.172   -8.783  -11.231 1.00 1.40  ? 185 GLY A N    2  
ATOM 8189   C CA   . GLY A 1 185 ? 1.670   -10.028 -10.570 1.00 1.79  ? 185 GLY A CA   2  
ATOM 8190   C C    . GLY A 1 185 ? 1.278   -10.062 -9.091  1.00 1.91  ? 185 GLY A C    2  
ATOM 8191   O O    . GLY A 1 185 ? 0.323   -9.442  -8.667  1.00 2.13  ? 185 GLY A O    2  
ATOM 8192   H H    . GLY A 1 185 ? 0.937   -7.993  -10.693 1.00 1.53  ? 185 GLY A H    2  
ATOM 8193   H HA2  . GLY A 1 185 ? 1.246   -10.890 -11.067 1.00 2.23  ? 185 GLY A HA2  2  
ATOM 8194   H HA3  . GLY A 1 185 ? 2.746   -10.065 -10.651 1.00 2.23  ? 185 GLY A HA3  2  
ATOM 8195   N N    . ARG A 1 186 ? 2.015   -10.806 -8.310  1.00 2.13  ? 186 ARG A N    2  
ATOM 8196   C CA   . ARG A 1 186 ? 1.712   -10.927 -6.854  1.00 2.75  ? 186 ARG A CA   2  
ATOM 8197   C C    . ARG A 1 186 ? 2.248   -9.705  -6.107  1.00 2.72  ? 186 ARG A C    2  
ATOM 8198   O O    . ARG A 1 186 ? 1.965   -9.505  -4.943  1.00 3.16  ? 186 ARG A O    2  
ATOM 8199   C CB   . ARG A 1 186 ? 2.394   -12.184 -6.313  1.00 3.24  ? 186 ARG A CB   2  
ATOM 8200   C CG   . ARG A 1 186 ? 1.789   -13.421 -6.977  1.00 3.69  ? 186 ARG A CG   2  
ATOM 8201   C CD   . ARG A 1 186 ? 2.627   -14.653 -6.623  1.00 4.28  ? 186 ARG A CD   2  
ATOM 8202   N NE   . ARG A 1 186 ? 3.906   -14.619 -7.387  1.00 4.62  ? 186 ARG A NE   2  
ATOM 8203   C CZ   . ARG A 1 186 ? 4.897   -15.391 -7.034  1.00 5.22  ? 186 ARG A CZ   2  
ATOM 8204   N NH1  . ARG A 1 186 ? 4.772   -16.182 -6.004  1.00 5.53  ? 186 ARG A NH1  2  
ATOM 8205   N NH2  . ARG A 1 186 ? 6.012   -15.372 -7.711  1.00 5.86  ? 186 ARG A NH2  2  
ATOM 8206   H H    . ARG A 1 186 ? 2.771   -11.303 -8.687  1.00 2.07  ? 186 ARG A H    2  
ATOM 8207   H HA   . ARG A 1 186 ? 0.645   -11.004 -6.710  1.00 3.09  ? 186 ARG A HA   2  
ATOM 8208   H HB2  . ARG A 1 186 ? 3.452   -12.140 -6.528  1.00 3.28  ? 186 ARG A HB2  2  
ATOM 8209   H HB3  . ARG A 1 186 ? 2.245   -12.243 -5.246  1.00 3.66  ? 186 ARG A HB3  2  
ATOM 8210   H HG2  . ARG A 1 186 ? 0.776   -13.560 -6.627  1.00 4.01  ? 186 ARG A HG2  2  
ATOM 8211   H HG3  . ARG A 1 186 ? 1.785   -13.288 -8.049  1.00 3.67  ? 186 ARG A HG3  2  
ATOM 8212   H HD2  . ARG A 1 186 ? 2.841   -14.649 -5.564  1.00 4.60  ? 186 ARG A HD2  2  
ATOM 8213   H HD3  . ARG A 1 186 ? 2.078   -15.547 -6.876  1.00 4.53  ? 186 ARG A HD3  2  
ATOM 8214   H HE   . ARG A 1 186 ? 4.001   -14.020 -8.157  1.00 4.71  ? 186 ARG A HE   2  
ATOM 8215   H HH11 . ARG A 1 186 ? 3.917   -16.197 -5.485  1.00 5.36  ? 186 ARG A HH11 2  
ATOM 8216   H HH12 . ARG A 1 186 ? 5.531   -16.774 -5.732  1.00 6.16  ? 186 ARG A HH12 2  
ATOM 8217   H HH21 . ARG A 1 186 ? 6.108   -14.765 -8.501  1.00 5.95  ? 186 ARG A HH21 2  
ATOM 8218   H HH22 . ARG A 1 186 ? 6.772   -15.963 -7.442  1.00 6.44  ? 186 ARG A HH22 2  
ATOM 8219   N N    . THR A 1 187 ? 3.025   -8.890  -6.761  1.00 2.51  ? 187 THR A N    2  
ATOM 8220   C CA   . THR A 1 187 ? 3.584   -7.687  -6.082  1.00 2.54  ? 187 THR A CA   2  
ATOM 8221   C C    . THR A 1 187 ? 2.485   -6.634  -5.923  1.00 2.01  ? 187 THR A C    2  
ATOM 8222   O O    . THR A 1 187 ? 2.724   -5.541  -5.450  1.00 2.27  ? 187 THR A O    2  
ATOM 8223   C CB   . THR A 1 187 ? 4.722   -7.109  -6.927  1.00 3.16  ? 187 THR A CB   2  
ATOM 8224   O OG1  . THR A 1 187 ? 4.238   -6.818  -8.230  1.00 3.23  ? 187 THR A OG1  2  
ATOM 8225   C CG2  . THR A 1 187 ? 5.864   -8.123  -7.018  1.00 3.72  ? 187 THR A CG2  2  
ATOM 8226   H H    . THR A 1 187 ? 3.247   -9.071  -7.699  1.00 2.59  ? 187 THR A H    2  
ATOM 8227   H HA   . THR A 1 187 ? 3.962   -7.965  -5.109  1.00 2.63  ? 187 THR A HA   2  
ATOM 8228   H HB   . THR A 1 187 ? 5.087   -6.203  -6.467  1.00 3.28  ? 187 THR A HB   2  
ATOM 8229   H HG1  . THR A 1 187 ? 3.431   -7.321  -8.366  1.00 3.45  ? 187 THR A HG1  2  
ATOM 8230   H HG21 . THR A 1 187 ? 5.495   -9.042  -7.449  1.00 4.09  ? 187 THR A HG21 2  
ATOM 8231   H HG22 . THR A 1 187 ? 6.650   -7.723  -7.641  1.00 3.91  ? 187 THR A HG22 2  
ATOM 8232   H HG23 . THR A 1 187 ? 6.252   -8.318  -6.029  1.00 3.97  ? 187 THR A HG23 2  
ATOM 8233   N N    . SER A 1 188 ? 1.285   -6.953  -6.320  1.00 1.47  ? 188 SER A N    2  
ATOM 8234   C CA   . SER A 1 188 ? 0.172   -5.968  -6.200  1.00 1.20  ? 188 SER A CA   2  
ATOM 8235   C C    . SER A 1 188 ? -0.309  -5.891  -4.741  1.00 1.05  ? 188 SER A C    2  
ATOM 8236   O O    . SER A 1 188 ? -0.515  -6.896  -4.092  1.00 1.13  ? 188 SER A O    2  
ATOM 8237   C CB   . SER A 1 188 ? -0.987  -6.401  -7.096  1.00 1.08  ? 188 SER A CB   2  
ATOM 8238   O OG   . SER A 1 188 ? -1.941  -5.350  -7.168  1.00 1.74  ? 188 SER A OG   2  
ATOM 8239   H H    . SER A 1 188 ? 1.114   -7.839  -6.703  1.00 1.47  ? 188 SER A H    2  
ATOM 8240   H HA   . SER A 1 188 ? 0.523   -4.999  -6.519  1.00 1.57  ? 188 SER A HA   2  
ATOM 8241   H HB2  . SER A 1 188 ? -0.620  -6.616  -8.085  1.00 1.46  ? 188 SER A HB2  2  
ATOM 8242   H HB3  . SER A 1 188 ? -1.445  -7.289  -6.683  1.00 1.56  ? 188 SER A HB3  2  
ATOM 8243   H HG   . SER A 1 188 ? -2.817  -5.741  -7.142  1.00 2.20  ? 188 SER A HG   2  
ATOM 8244   N N    . HIS A 1 189 ? -0.481  -4.700  -4.224  1.00 0.95  ? 189 HIS A N    2  
ATOM 8245   C CA   . HIS A 1 189 ? -0.939  -4.527  -2.808  1.00 0.83  ? 189 HIS A CA   2  
ATOM 8246   C C    . HIS A 1 189 ? -2.155  -5.425  -2.535  1.00 0.76  ? 189 HIS A C    2  
ATOM 8247   O O    . HIS A 1 189 ? -2.197  -6.157  -1.564  1.00 0.71  ? 189 HIS A O    2  
ATOM 8248   C CB   . HIS A 1 189 ? -1.324  -3.049  -2.636  1.00 0.85  ? 189 HIS A CB   2  
ATOM 8249   C CG   . HIS A 1 189 ? -1.867  -2.760  -1.259  1.00 0.77  ? 189 HIS A CG   2  
ATOM 8250   N ND1  . HIS A 1 189 ? -1.040  -2.526  -0.168  1.00 0.87  ? 189 HIS A ND1  2  
ATOM 8251   C CD2  . HIS A 1 189 ? -3.152  -2.587  -0.802  1.00 0.88  ? 189 HIS A CD2  2  
ATOM 8252   C CE1  . HIS A 1 189 ? -1.829  -2.220  0.882   1.00 0.86  ? 189 HIS A CE1  2  
ATOM 8253   N NE2  . HIS A 1 189 ? -3.135  -2.243  0.548   1.00 0.84  ? 189 HIS A NE2  2  
ATOM 8254   H H    . HIS A 1 189 ? -0.291  -3.900  -4.758  1.00 1.04  ? 189 HIS A H    2  
ATOM 8255   H HA   . HIS A 1 189 ? -0.140  -4.776  -2.130  1.00 0.84  ? 189 HIS A HA   2  
ATOM 8256   H HB2  . HIS A 1 189 ? -0.450  -2.437  -2.801  1.00 0.93  ? 189 HIS A HB2  2  
ATOM 8257   H HB3  . HIS A 1 189 ? -2.073  -2.795  -3.372  1.00 0.92  ? 189 HIS A HB3  2  
ATOM 8258   H HD1  . HIS A 1 189 ? -0.062  -2.576  -0.161  1.00 1.09  ? 189 HIS A HD1  2  
ATOM 8259   H HD2  . HIS A 1 189 ? -4.042  -2.697  -1.402  1.00 1.15  ? 189 HIS A HD2  2  
ATOM 8260   H HE1  . HIS A 1 189 ? -1.460  -1.987  1.870   1.00 1.04  ? 189 HIS A HE1  2  
ATOM 8261   N N    . THR A 1 190 ? -3.146  -5.360  -3.375  1.00 0.83  ? 190 THR A N    2  
ATOM 8262   C CA   . THR A 1 190 ? -4.371  -6.189  -3.164  1.00 0.82  ? 190 THR A CA   2  
ATOM 8263   C C    . THR A 1 190 ? -4.011  -7.683  -3.116  1.00 0.80  ? 190 THR A C    2  
ATOM 8264   O O    . THR A 1 190 ? -4.576  -8.438  -2.351  1.00 0.80  ? 190 THR A O    2  
ATOM 8265   C CB   . THR A 1 190 ? -5.361  -5.939  -4.307  1.00 0.92  ? 190 THR A CB   2  
ATOM 8266   O OG1  . THR A 1 190 ? -6.602  -6.561  -4.001  1.00 1.55  ? 190 THR A OG1  2  
ATOM 8267   C CG2  . THR A 1 190 ? -4.807  -6.516  -5.611  1.00 1.46  ? 190 THR A CG2  2  
ATOM 8268   H H    . THR A 1 190 ? -3.089  -4.735  -4.127  1.00 0.92  ? 190 THR A H    2  
ATOM 8269   H HA   . THR A 1 190 ? -4.833  -5.908  -2.228  1.00 0.80  ? 190 THR A HA   2  
ATOM 8270   H HB   . THR A 1 190 ? -5.512  -4.876  -4.424  1.00 1.45  ? 190 THR A HB   2  
ATOM 8271   H HG1  . THR A 1 190 ? -6.887  -6.248  -3.140  1.00 1.99  ? 190 THR A HG1  2  
ATOM 8272   H HG21 . THR A 1 190 ? -3.760  -6.267  -5.699  1.00 2.01  ? 190 THR A HG21 2  
ATOM 8273   H HG22 . THR A 1 190 ? -4.923  -7.589  -5.607  1.00 1.88  ? 190 THR A HG22 2  
ATOM 8274   H HG23 . THR A 1 190 ? -5.348  -6.099  -6.447  1.00 2.00  ? 190 THR A HG23 2  
ATOM 8275   N N    . SER A 1 191 ? -3.091  -8.119  -3.935  1.00 0.85  ? 191 SER A N    2  
ATOM 8276   C CA   . SER A 1 191 ? -2.718  -9.569  -3.937  1.00 0.89  ? 191 SER A CA   2  
ATOM 8277   C C    . SER A 1 191 ? -2.195  -9.985  -2.558  1.00 0.82  ? 191 SER A C    2  
ATOM 8278   O O    . SER A 1 191 ? -2.489  -11.058 -2.068  1.00 0.85  ? 191 SER A O    2  
ATOM 8279   C CB   . SER A 1 191 ? -1.621  -9.805  -4.976  1.00 1.00  ? 191 SER A CB   2  
ATOM 8280   O OG   . SER A 1 191 ? -1.360  -11.199 -5.075  1.00 1.51  ? 191 SER A OG   2  
ATOM 8281   H H    . SER A 1 191 ? -2.652  -7.500  -4.553  1.00 0.90  ? 191 SER A H    2  
ATOM 8282   H HA   . SER A 1 191 ? -3.584  -10.163 -4.188  1.00 0.91  ? 191 SER A HA   2  
ATOM 8283   H HB2  . SER A 1 191 ? -1.943  -9.437  -5.935  1.00 1.43  ? 191 SER A HB2  2  
ATOM 8284   H HB3  . SER A 1 191 ? -0.724  -9.281  -4.677  1.00 1.59  ? 191 SER A HB3  2  
ATOM 8285   H HG   . SER A 1 191 ? -2.159  -11.630 -5.384  1.00 1.93  ? 191 SER A HG   2  
ATOM 8286   N N    . ILE A 1 192 ? -1.421  -9.146  -1.933  1.00 0.80  ? 192 ILE A N    2  
ATOM 8287   C CA   . ILE A 1 192 ? -0.868  -9.482  -0.590  1.00 0.78  ? 192 ILE A CA   2  
ATOM 8288   C C    . ILE A 1 192 ? -2.013  -9.711  0.398   1.00 0.71  ? 192 ILE A C    2  
ATOM 8289   O O    . ILE A 1 192 ? -1.961  -10.597 1.229   1.00 0.72  ? 192 ILE A O    2  
ATOM 8290   C CB   . ILE A 1 192 ? 0.016   -8.333  -0.095  1.00 0.82  ? 192 ILE A CB   2  
ATOM 8291   C CG1  . ILE A 1 192 ? 1.223   -8.186  -1.025  1.00 0.97  ? 192 ILE A CG1  2  
ATOM 8292   C CG2  . ILE A 1 192 ? 0.504   -8.639  1.323   1.00 0.85  ? 192 ILE A CG2  2  
ATOM 8293   C CD1  . ILE A 1 192 ? 1.974   -6.895  -0.690  1.00 1.67  ? 192 ILE A CD1  2  
ATOM 8294   H H    . ILE A 1 192 ? -1.198  -8.292  -2.348  1.00 0.85  ? 192 ILE A H    2  
ATOM 8295   H HA   . ILE A 1 192 ? -0.274  -10.381 -0.664  1.00 0.83  ? 192 ILE A HA   2  
ATOM 8296   H HB   . ILE A 1 192 ? -0.554  -7.416  -0.090  1.00 0.80  ? 192 ILE A HB   2  
ATOM 8297   H HG12 . ILE A 1 192 ? 1.884   -9.031  -0.895  1.00 1.38  ? 192 ILE A HG12 2  
ATOM 8298   H HG13 . ILE A 1 192 ? 0.886   -8.147  -2.050  1.00 1.44  ? 192 ILE A HG13 2  
ATOM 8299   H HG21 . ILE A 1 192 ? 0.906   -9.642  1.358   1.00 1.41  ? 192 ILE A HG21 2  
ATOM 8300   H HG22 . ILE A 1 192 ? 1.275   -7.934  1.599   1.00 1.39  ? 192 ILE A HG22 2  
ATOM 8301   H HG23 . ILE A 1 192 ? -0.320  -8.558  2.015   1.00 1.19  ? 192 ILE A HG23 2  
ATOM 8302   H HD11 . ILE A 1 192 ? 1.310   -6.052  -0.807  1.00 2.20  ? 192 ILE A HD11 2  
ATOM 8303   H HD12 . ILE A 1 192 ? 2.324   -6.938  0.331   1.00 2.12  ? 192 ILE A HD12 2  
ATOM 8304   H HD13 . ILE A 1 192 ? 2.816   -6.785  -1.356  1.00 2.20  ? 192 ILE A HD13 2  
ATOM 8305   N N    . MET A 1 193 ? -3.044  -8.916  0.321   1.00 0.67  ? 193 MET A N    2  
ATOM 8306   C CA   . MET A 1 193 ? -4.189  -9.084  1.261   1.00 0.64  ? 193 MET A CA   2  
ATOM 8307   C C    . MET A 1 193 ? -4.821  -10.468 1.109   1.00 0.61  ? 193 MET A C    2  
ATOM 8308   O O    . MET A 1 193 ? -5.172  -11.102 2.081   1.00 0.62  ? 193 MET A O    2  
ATOM 8309   C CB   . MET A 1 193 ? -5.246  -8.018  0.972   1.00 0.67  ? 193 MET A CB   2  
ATOM 8310   C CG   . MET A 1 193 ? -4.723  -6.646  1.393   1.00 0.69  ? 193 MET A CG   2  
ATOM 8311   S SD   . MET A 1 193 ? -5.883  -5.376  0.841   1.00 1.02  ? 193 MET A SD   2  
ATOM 8312   C CE   . MET A 1 193 ? -7.288  -5.879  1.867   1.00 0.71  ? 193 MET A CE   2  
ATOM 8313   H H    . MET A 1 193 ? -3.070  -8.216  -0.364  1.00 0.70  ? 193 MET A H    2  
ATOM 8314   H HA   . MET A 1 193 ? -3.837  -8.967  2.272   1.00 0.67  ? 193 MET A HA   2  
ATOM 8315   H HB2  . MET A 1 193 ? -5.468  -8.010  -0.085  1.00 0.70  ? 193 MET A HB2  2  
ATOM 8316   H HB3  . MET A 1 193 ? -6.144  -8.243  1.527   1.00 0.74  ? 193 MET A HB3  2  
ATOM 8317   H HG2  . MET A 1 193 ? -4.633  -6.608  2.471   1.00 0.86  ? 193 MET A HG2  2  
ATOM 8318   H HG3  . MET A 1 193 ? -3.757  -6.472  0.943   1.00 0.74  ? 193 MET A HG3  2  
ATOM 8319   H HE1  . MET A 1 193 ? -6.926  -6.281  2.802   1.00 1.28  ? 193 MET A HE1  2  
ATOM 8320   H HE2  . MET A 1 193 ? -7.916  -5.025  2.064   1.00 1.19  ? 193 MET A HE2  2  
ATOM 8321   H HE3  . MET A 1 193 ? -7.863  -6.631  1.343   1.00 1.32  ? 193 MET A HE3  2  
ATOM 8322   N N    . ALA A 1 194 ? -4.983  -10.951 -0.091  1.00 0.61  ? 194 ALA A N    2  
ATOM 8323   C CA   . ALA A 1 194 ? -5.613  -12.290 -0.262  1.00 0.62  ? 194 ALA A CA   2  
ATOM 8324   C C    . ALA A 1 194 ? -4.776  -13.347 0.454   1.00 0.64  ? 194 ALA A C    2  
ATOM 8325   O O    . ALA A 1 194 ? -5.300  -14.225 1.110   1.00 0.68  ? 194 ALA A O    2  
ATOM 8326   C CB   . ALA A 1 194 ? -5.697  -12.628 -1.752  1.00 0.67  ? 194 ALA A CB   2  
ATOM 8327   H H    . ALA A 1 194 ? -4.714  -10.443 -0.882  1.00 0.63  ? 194 ALA A H    2  
ATOM 8328   H HA   . ALA A 1 194 ? -6.605  -12.276 0.159   1.00 0.62  ? 194 ALA A HA   2  
ATOM 8329   H HB1  . ALA A 1 194 ? -4.726  -12.497 -2.205  1.00 1.16  ? 194 ALA A HB1  2  
ATOM 8330   H HB2  . ALA A 1 194 ? -6.017  -13.652 -1.871  1.00 1.21  ? 194 ALA A HB2  2  
ATOM 8331   H HB3  . ALA A 1 194 ? -6.409  -11.970 -2.229  1.00 1.30  ? 194 ALA A HB3  2  
ATOM 8332   N N    . ARG A 1 195 ? -3.482  -13.285 0.325   1.00 0.66  ? 195 ARG A N    2  
ATOM 8333   C CA   . ARG A 1 195 ? -2.632  -14.309 0.994   1.00 0.72  ? 195 ARG A CA   2  
ATOM 8334   C C    . ARG A 1 195 ? -2.857  -14.267 2.506   1.00 0.72  ? 195 ARG A C    2  
ATOM 8335   O O    . ARG A 1 195 ? -3.025  -15.288 3.143   1.00 0.74  ? 195 ARG A O    2  
ATOM 8336   C CB   . ARG A 1 195 ? -1.155  -14.025 0.701   1.00 0.80  ? 195 ARG A CB   2  
ATOM 8337   C CG   . ARG A 1 195 ? -0.840  -14.343 -0.762  1.00 0.87  ? 195 ARG A CG   2  
ATOM 8338   C CD   . ARG A 1 195 ? 0.624   -14.001 -1.044  1.00 0.97  ? 195 ARG A CD   2  
ATOM 8339   N NE   . ARG A 1 195 ? 0.953   -14.330 -2.471  1.00 1.61  ? 195 ARG A NE   2  
ATOM 8340   C CZ   . ARG A 1 195 ? 0.881   -15.551 -2.925  1.00 2.06  ? 195 ARG A CZ   2  
ATOM 8341   N NH1  . ARG A 1 195 ? 0.667   -16.546 -2.108  1.00 2.26  ? 195 ARG A NH1  2  
ATOM 8342   N NH2  . ARG A 1 195 ? 1.066   -15.784 -4.194  1.00 2.93  ? 195 ARG A NH2  2  
ATOM 8343   H H    . ARG A 1 195 ? -3.077  -12.585 -0.235  1.00 0.68  ? 195 ARG A H    2  
ATOM 8344   H HA   . ARG A 1 195 ? -2.890  -15.287 0.622   1.00 0.72  ? 195 ARG A HA   2  
ATOM 8345   H HB2  . ARG A 1 195 ? -0.946  -12.983 0.893   1.00 0.81  ? 195 ARG A HB2  2  
ATOM 8346   H HB3  . ARG A 1 195 ? -0.538  -14.638 1.339   1.00 0.86  ? 195 ARG A HB3  2  
ATOM 8347   H HG2  . ARG A 1 195 ? -1.015  -15.391 -0.944  1.00 0.90  ? 195 ARG A HG2  2  
ATOM 8348   H HG3  . ARG A 1 195 ? -1.476  -13.754 -1.405  1.00 0.88  ? 195 ARG A HG3  2  
ATOM 8349   H HD2  . ARG A 1 195 ? 0.771   -12.948 -0.920  1.00 1.25  ? 195 ARG A HD2  2  
ATOM 8350   H HD3  . ARG A 1 195 ? 1.260   -14.532 -0.335  1.00 1.40  ? 195 ARG A HD3  2  
ATOM 8351   H HE   . ARG A 1 195 ? 1.186   -13.604 -3.087  1.00 2.23  ? 195 ARG A HE   2  
ATOM 8352   H HH11 . ARG A 1 195 ? 0.557   -16.374 -1.129  1.00 2.16  ? 195 ARG A HH11 2  
ATOM 8353   H HH12 . ARG A 1 195 ? 0.616   -17.480 -2.462  1.00 2.92  ? 195 ARG A HH12 2  
ATOM 8354   H HH21 . ARG A 1 195 ? 1.260   -15.027 -4.818  1.00 3.38  ? 195 ARG A HH21 2  
ATOM 8355   H HH22 . ARG A 1 195 ? 1.014   -16.719 -4.543  1.00 3.38  ? 195 ARG A HH22 2  
ATOM 8356   N N    . SER A 1 196 ? -2.835  -13.106 3.094   1.00 0.72  ? 196 SER A N    2  
ATOM 8357   C CA   . SER A 1 196 ? -3.018  -13.010 4.573   1.00 0.75  ? 196 SER A CA   2  
ATOM 8358   C C    . SER A 1 196 ? -4.488  -13.187 4.978   1.00 0.71  ? 196 SER A C    2  
ATOM 8359   O O    . SER A 1 196 ? -4.777  -13.685 6.048   1.00 0.76  ? 196 SER A O    2  
ATOM 8360   C CB   . SER A 1 196 ? -2.529  -11.643 5.049   1.00 0.79  ? 196 SER A CB   2  
ATOM 8361   O OG   . SER A 1 196 ? -1.127  -11.549 4.842   1.00 0.86  ? 196 SER A OG   2  
ATOM 8362   H H    . SER A 1 196 ? -2.670  -12.289 2.581   1.00 0.71  ? 196 SER A H    2  
ATOM 8363   H HA   . SER A 1 196 ? -2.428  -13.776 5.049   1.00 0.81  ? 196 SER A HA   2  
ATOM 8364   H HB2  . SER A 1 196 ? -3.023  -10.867 4.489   1.00 0.78  ? 196 SER A HB2  2  
ATOM 8365   H HB3  . SER A 1 196 ? -2.758  -11.527 6.100   1.00 0.84  ? 196 SER A HB3  2  
ATOM 8366   H HG   . SER A 1 196 ? -0.975  -11.381 3.909   1.00 1.15  ? 196 SER A HG   2  
ATOM 8367   N N    . LEU A 1 197 ? -5.422  -12.765 4.165   1.00 0.64  ? 197 LEU A N    2  
ATOM 8368   C CA   . LEU A 1 197 ? -6.855  -12.903 4.569   1.00 0.61  ? 197 LEU A CA   2  
ATOM 8369   C C    . LEU A 1 197 ? -7.342  -14.330 4.322   1.00 0.61  ? 197 LEU A C    2  
ATOM 8370   O O    . LEU A 1 197 ? -8.399  -14.711 4.781   1.00 0.61  ? 197 LEU A O    2  
ATOM 8371   C CB   . LEU A 1 197 ? -7.717  -11.926 3.767   1.00 0.57  ? 197 LEU A CB   2  
ATOM 8372   C CG   . LEU A 1 197 ? -7.339  -10.478 4.115   1.00 0.60  ? 197 LEU A CG   2  
ATOM 8373   C CD1  . LEU A 1 197 ? -8.101  -9.533  3.185   1.00 0.59  ? 197 LEU A CD1  2  
ATOM 8374   C CD2  . LEU A 1 197 ? -7.695  -10.166 5.581   1.00 0.67  ? 197 LEU A CD2  2  
ATOM 8375   H H    . LEU A 1 197 ? -5.185  -12.343 3.313   1.00 0.62  ? 197 LEU A H    2  
ATOM 8376   H HA   . LEU A 1 197 ? -6.952  -12.681 5.621   1.00 0.66  ? 197 LEU A HA   2  
ATOM 8377   H HB2  . LEU A 1 197 ? -7.556  -12.093 2.712   1.00 0.54  ? 197 LEU A HB2  2  
ATOM 8378   H HB3  . LEU A 1 197 ? -8.758  -12.090 4.000   1.00 0.57  ? 197 LEU A HB3  2  
ATOM 8379   H HG   . LEU A 1 197 ? -6.278  -10.342 3.969   1.00 0.63  ? 197 LEU A HG   2  
ATOM 8380   H HD11 . LEU A 1 197 ? -9.162  -9.687  3.309   1.00 1.10  ? 197 LEU A HD11 2  
ATOM 8381   H HD12 . LEU A 1 197 ? -7.854  -8.510  3.429   1.00 1.14  ? 197 LEU A HD12 2  
ATOM 8382   H HD13 . LEU A 1 197 ? -7.824  -9.738  2.163   1.00 1.26  ? 197 LEU A HD13 2  
ATOM 8383   H HD21 . LEU A 1 197 ? -8.589  -10.702 5.864   1.00 1.14  ? 197 LEU A HD21 2  
ATOM 8384   H HD22 . LEU A 1 197 ? -6.878  -10.468 6.219   1.00 1.15  ? 197 LEU A HD22 2  
ATOM 8385   H HD23 . LEU A 1 197 ? -7.860  -9.101  5.700   1.00 1.28  ? 197 LEU A HD23 2  
ATOM 8386   N N    . GLU A 1 198 ? -6.588  -15.119 3.607   1.00 0.63  ? 198 GLU A N    2  
ATOM 8387   C CA   . GLU A 1 198 ? -7.003  -16.533 3.342   1.00 0.65  ? 198 GLU A CA   2  
ATOM 8388   C C    . GLU A 1 198 ? -8.360  -16.581 2.637   1.00 0.59  ? 198 GLU A C    2  
ATOM 8389   O O    . GLU A 1 198 ? -9.260  -17.281 3.060   1.00 0.61  ? 198 GLU A O    2  
ATOM 8390   C CB   . GLU A 1 198 ? -7.064  -17.324 4.654   1.00 0.73  ? 198 GLU A CB   2  
ATOM 8391   C CG   . GLU A 1 198 ? -5.645  -17.535 5.185   1.00 0.88  ? 198 GLU A CG   2  
ATOM 8392   C CD   . GLU A 1 198 ? -5.706  -18.182 6.570   1.00 0.95  ? 198 GLU A CD   2  
ATOM 8393   O OE1  . GLU A 1 198 ? -6.440  -17.680 7.405   1.00 1.40  ? 198 GLU A OE1  2  
ATOM 8394   O OE2  . GLU A 1 198 ? -5.015  -19.167 6.773   1.00 1.50  ? 198 GLU A OE2  2  
ATOM 8395   H H    . GLU A 1 198 ? -5.744  -14.800 3.227   1.00 0.64  ? 198 GLU A H    2  
ATOM 8396   H HA   . GLU A 1 198 ? -6.266  -16.991 2.696   1.00 0.68  ? 198 GLU A HA   2  
ATOM 8397   H HB2  . GLU A 1 198 ? -7.645  -16.784 5.384   1.00 0.73  ? 198 GLU A HB2  2  
ATOM 8398   H HB3  . GLU A 1 198 ? -7.522  -18.285 4.472   1.00 0.76  ? 198 GLU A HB3  2  
ATOM 8399   H HG2  . GLU A 1 198 ? -5.101  -18.180 4.510   1.00 0.94  ? 198 GLU A HG2  2  
ATOM 8400   H HG3  . GLU A 1 198 ? -5.143  -16.583 5.257   1.00 0.98  ? 198 GLU A HG3  2  
ATOM 8401   N N    . LEU A 1 199 ? -8.509  -15.852 1.556   1.00 0.54  ? 199 LEU A N    2  
ATOM 8402   C CA   . LEU A 1 199 ? -9.804  -15.856 0.796   1.00 0.50  ? 199 LEU A CA   2  
ATOM 8403   C C    . LEU A 1 199 ? -9.511  -16.164 -0.691  1.00 0.51  ? 199 LEU A C    2  
ATOM 8404   O O    . LEU A 1 199 ? -8.631  -15.561 -1.271  1.00 0.59  ? 199 LEU A O    2  
ATOM 8405   C CB   . LEU A 1 199 ? -10.452 -14.472 0.901   1.00 0.48  ? 199 LEU A CB   2  
ATOM 8406   C CG   . LEU A 1 199 ? -10.697 -14.118 2.374   1.00 0.54  ? 199 LEU A CG   2  
ATOM 8407   C CD1  . LEU A 1 199 ? -11.198 -12.674 2.470   1.00 0.52  ? 199 LEU A CD1  2  
ATOM 8408   C CD2  . LEU A 1 199 ? -11.744 -15.070 2.982   1.00 0.72  ? 199 LEU A CD2  2  
ATOM 8409   H H    . LEU A 1 199 ? -7.760  -15.306 1.234   1.00 0.54  ? 199 LEU A H    2  
ATOM 8410   H HA   . LEU A 1 199 ? -10.471 -16.593 1.207   1.00 0.53  ? 199 LEU A HA   2  
ATOM 8411   H HB2  . LEU A 1 199 ? -9.795  -13.735 0.460   1.00 0.49  ? 199 LEU A HB2  2  
ATOM 8412   H HB3  . LEU A 1 199 ? -11.393 -14.473 0.372   1.00 0.54  ? 199 LEU A HB3  2  
ATOM 8413   H HG   . LEU A 1 199 ? -9.767  -14.209 2.920   1.00 0.62  ? 199 LEU A HG   2  
ATOM 8414   H HD11 . LEU A 1 199 ? -11.988 -12.519 1.749   1.00 1.22  ? 199 LEU A HD11 2  
ATOM 8415   H HD12 . LEU A 1 199 ? -11.577 -12.489 3.463   1.00 1.14  ? 199 LEU A HD12 2  
ATOM 8416   H HD13 . LEU A 1 199 ? -10.383 -11.996 2.263   1.00 1.01  ? 199 LEU A HD13 2  
ATOM 8417   H HD21 . LEU A 1 199 ? -12.503 -15.296 2.248   1.00 1.37  ? 199 LEU A HD21 2  
ATOM 8418   H HD22 . LEU A 1 199 ? -11.261 -15.984 3.293   1.00 1.24  ? 199 LEU A HD22 2  
ATOM 8419   H HD23 . LEU A 1 199 ? -12.205 -14.603 3.842   1.00 1.19  ? 199 LEU A HD23 2  
ATOM 8420   N N    . PRO A 1 200 ? -10.230 -17.082 -1.318  1.00 0.52  ? 200 PRO A N    2  
ATOM 8421   C CA   . PRO A 1 200 ? -9.997  -17.424 -2.758  1.00 0.55  ? 200 PRO A CA   2  
ATOM 8422   C C    . PRO A 1 200 ? -9.790  -16.174 -3.622  1.00 0.52  ? 200 PRO A C    2  
ATOM 8423   O O    . PRO A 1 200 ? -10.626 -15.292 -3.649  1.00 0.48  ? 200 PRO A O    2  
ATOM 8424   C CB   . PRO A 1 200 ? -11.291 -18.143 -3.168  1.00 0.59  ? 200 PRO A CB   2  
ATOM 8425   C CG   . PRO A 1 200 ? -11.810 -18.769 -1.911  1.00 0.61  ? 200 PRO A CG   2  
ATOM 8426   C CD   . PRO A 1 200 ? -11.326 -17.893 -0.744  1.00 0.61  ? 200 PRO A CD   2  
ATOM 8427   H HA   . PRO A 1 200 ? -9.161  -18.095 -2.857  1.00 0.60  ? 200 PRO A HA   2  
ATOM 8428   H HB2  . PRO A 1 200 ? -12.010 -17.432 -3.559  1.00 0.65  ? 200 PRO A HB2  2  
ATOM 8429   H HB3  . PRO A 1 200 ? -11.081 -18.905 -3.905  1.00 0.63  ? 200 PRO A HB3  2  
ATOM 8430   H HG2  . PRO A 1 200 ? -12.894 -18.803 -1.932  1.00 0.71  ? 200 PRO A HG2  2  
ATOM 8431   H HG3  . PRO A 1 200 ? -11.415 -19.767 -1.803  1.00 0.67  ? 200 PRO A HG3  2  
ATOM 8432   H HD2  . PRO A 1 200 ? -12.125 -17.254 -0.390  1.00 0.76  ? 200 PRO A HD2  2  
ATOM 8433   H HD3  . PRO A 1 200 ? -10.950 -18.510 0.060   1.00 0.73  ? 200 PRO A HD3  2  
ATOM 8434   N N    . ALA A 1 201 ? -8.689  -16.074 -4.326  1.00 0.56  ? 201 ALA A N    2  
ATOM 8435   C CA   . ALA A 1 201 ? -8.477  -14.856 -5.161  1.00 0.56  ? 201 ALA A CA   2  
ATOM 8436   C C    . ALA A 1 201 ? -7.399  -15.086 -6.234  1.00 0.61  ? 201 ALA A C    2  
ATOM 8437   O O    . ALA A 1 201 ? -6.372  -15.690 -5.986  1.00 0.66  ? 201 ALA A O    2  
ATOM 8438   C CB   . ALA A 1 201 ? -8.042  -13.704 -4.253  1.00 0.55  ? 201 ALA A CB   2  
ATOM 8439   H H    . ALA A 1 201 ? -8.010  -16.780 -4.296  1.00 0.60  ? 201 ALA A H    2  
ATOM 8440   H HA   . ALA A 1 201 ? -9.405  -14.593 -5.645  1.00 0.55  ? 201 ALA A HA   2  
ATOM 8441   H HB1  . ALA A 1 201 ? -8.597  -13.747 -3.328  1.00 1.19  ? 201 ALA A HB1  2  
ATOM 8442   H HB2  . ALA A 1 201 ? -6.985  -13.786 -4.041  1.00 1.11  ? 201 ALA A HB2  2  
ATOM 8443   H HB3  . ALA A 1 201 ? -8.238  -12.764 -4.746  1.00 1.15  ? 201 ALA A HB3  2  
ATOM 8444   N N    . ILE A 1 202 ? -7.628  -14.563 -7.417  1.00 0.63  ? 202 ILE A N    2  
ATOM 8445   C CA   . ILE A 1 202 ? -6.640  -14.675 -8.537  1.00 0.69  ? 202 ILE A CA   2  
ATOM 8446   C C    . ILE A 1 202 ? -6.302  -13.249 -8.986  1.00 0.72  ? 202 ILE A C    2  
ATOM 8447   O O    . ILE A 1 202 ? -7.154  -12.388 -8.995  1.00 0.70  ? 202 ILE A O    2  
ATOM 8448   C CB   . ILE A 1 202 ? -7.253  -15.462 -9.703  1.00 0.70  ? 202 ILE A CB   2  
ATOM 8449   C CG1  . ILE A 1 202 ? -7.629  -16.866 -9.226  1.00 0.69  ? 202 ILE A CG1  2  
ATOM 8450   C CG2  . ILE A 1 202 ? -6.235  -15.576 -10.842 1.00 0.79  ? 202 ILE A CG2  2  
ATOM 8451   C CD1  . ILE A 1 202 ? -8.461  -17.564 -10.304 1.00 0.71  ? 202 ILE A CD1  2  
ATOM 8452   H H    . ILE A 1 202 ? -8.457  -14.064 -7.569  1.00 0.60  ? 202 ILE A H    2  
ATOM 8453   H HA   . ILE A 1 202 ? -5.741  -15.169 -8.193  1.00 0.73  ? 202 ILE A HA   2  
ATOM 8454   H HB   . ILE A 1 202 ? -8.141  -14.952 -10.058 1.00 0.68  ? 202 ILE A HB   2  
ATOM 8455   H HG12 . ILE A 1 202 ? -6.730  -17.435 -9.038  1.00 0.76  ? 202 ILE A HG12 2  
ATOM 8456   H HG13 . ILE A 1 202 ? -8.208  -16.796 -8.318  1.00 0.67  ? 202 ILE A HG13 2  
ATOM 8457   H HG21 . ILE A 1 202 ? -5.939  -14.591 -11.167 1.00 1.24  ? 202 ILE A HG21 2  
ATOM 8458   H HG22 . ILE A 1 202 ? -5.366  -16.115 -10.495 1.00 1.28  ? 202 ILE A HG22 2  
ATOM 8459   H HG23 . ILE A 1 202 ? -6.682  -16.109 -11.669 1.00 1.31  ? 202 ILE A HG23 2  
ATOM 8460   H HD11 . ILE A 1 202 ? -7.949  -17.498 -11.253 1.00 1.28  ? 202 ILE A HD11 2  
ATOM 8461   H HD12 . ILE A 1 202 ? -8.592  -18.604 -10.041 1.00 1.14  ? 202 ILE A HD12 2  
ATOM 8462   H HD13 . ILE A 1 202 ? -9.425  -17.087 -10.383 1.00 1.29  ? 202 ILE A HD13 2  
ATOM 8463   N N    . VAL A 1 203 ? -5.064  -12.977 -9.325  1.00 0.79  ? 203 VAL A N    2  
ATOM 8464   C CA   . VAL A 1 203 ? -4.680  -11.581 -9.734  1.00 0.83  ? 203 VAL A CA   2  
ATOM 8465   C C    . VAL A 1 203 ? -4.015  -11.569 -11.118 1.00 0.89  ? 203 VAL A C    2  
ATOM 8466   O O    . VAL A 1 203 ? -3.765  -10.518 -11.678 1.00 0.91  ? 203 VAL A O    2  
ATOM 8467   C CB   . VAL A 1 203 ? -3.700  -11.029 -8.694  1.00 0.87  ? 203 VAL A CB   2  
ATOM 8468   C CG1  . VAL A 1 203 ? -4.422  -10.873 -7.347  1.00 0.83  ? 203 VAL A CG1  2  
ATOM 8469   C CG2  . VAL A 1 203 ? -2.525  -12.002 -8.537  1.00 0.91  ? 203 VAL A CG2  2  
ATOM 8470   H H    . VAL A 1 203 ? -4.384  -13.681 -9.287  1.00 0.83  ? 203 VAL A H    2  
ATOM 8471   H HA   . VAL A 1 203 ? -5.552  -10.943 -9.757  1.00 0.81  ? 203 VAL A HA   2  
ATOM 8472   H HB   . VAL A 1 203 ? -3.334  -10.067 -9.020  1.00 0.93  ? 203 VAL A HB   2  
ATOM 8473   H HG11 . VAL A 1 203 ? -5.078  -11.717 -7.184  1.00 1.29  ? 203 VAL A HG11 2  
ATOM 8474   H HG12 . VAL A 1 203 ? -3.697  -10.828 -6.548  1.00 1.36  ? 203 VAL A HG12 2  
ATOM 8475   H HG13 . VAL A 1 203 ? -5.003  -9.963  -7.355  1.00 1.27  ? 203 VAL A HG13 2  
ATOM 8476   H HG21 . VAL A 1 203 ? -2.065  -12.172 -9.499  1.00 1.38  ? 203 VAL A HG21 2  
ATOM 8477   H HG22 . VAL A 1 203 ? -1.798  -11.579 -7.859  1.00 1.30  ? 203 VAL A HG22 2  
ATOM 8478   H HG23 . VAL A 1 203 ? -2.885  -12.939 -8.139  1.00 1.31  ? 203 VAL A HG23 2  
ATOM 8479   N N    . GLY A 1 204 ? -3.717  -12.723 -11.669 1.00 0.92  ? 204 GLY A N    2  
ATOM 8480   C CA   . GLY A 1 204 ? -3.049  -12.788 -13.012 1.00 0.99  ? 204 GLY A CA   2  
ATOM 8481   C C    . GLY A 1 204 ? -4.011  -13.327 -14.074 1.00 0.96  ? 204 GLY A C    2  
ATOM 8482   O O    . GLY A 1 204 ? -3.588  -13.827 -15.097 1.00 1.01  ? 204 GLY A O    2  
ATOM 8483   H H    . GLY A 1 204 ? -3.924  -13.552 -11.196 1.00 0.92  ? 204 GLY A H    2  
ATOM 8484   H HA2  . GLY A 1 204 ? -2.714  -11.802 -13.307 1.00 1.01  ? 204 GLY A HA2  2  
ATOM 8485   H HA3  . GLY A 1 204 ? -2.195  -13.445 -12.950 1.00 1.03  ? 204 GLY A HA3  2  
ATOM 8486   N N    . THR A 1 205 ? -5.296  -13.252 -13.845 1.00 0.90  ? 205 THR A N    2  
ATOM 8487   C CA   . THR A 1 205 ? -6.265  -13.783 -14.850 1.00 0.90  ? 205 THR A CA   2  
ATOM 8488   C C    . THR A 1 205 ? -5.863  -13.329 -16.259 1.00 0.97  ? 205 THR A C    2  
ATOM 8489   O O    . THR A 1 205 ? -5.863  -14.106 -17.193 1.00 0.99  ? 205 THR A O    2  
ATOM 8490   C CB   . THR A 1 205 ? -7.665  -13.255 -14.521 1.00 0.83  ? 205 THR A CB   2  
ATOM 8491   O OG1  . THR A 1 205 ? -7.570  -11.900 -14.111 1.00 0.85  ? 205 THR A OG1  2  
ATOM 8492   C CG2  . THR A 1 205 ? -8.292  -14.085 -13.398 1.00 0.78  ? 205 THR A CG2  2  
ATOM 8493   H H    . THR A 1 205 ? -5.626  -12.864 -13.008 1.00 0.88  ? 205 THR A H    2  
ATOM 8494   H HA   . THR A 1 205 ? -6.265  -14.862 -14.812 1.00 0.90  ? 205 THR A HA   2  
ATOM 8495   H HB   . THR A 1 205 ? -8.286  -13.318 -15.395 1.00 0.83  ? 205 THR A HB   2  
ATOM 8496   H HG1  . THR A 1 205 ? -7.022  -11.867 -13.322 1.00 1.23  ? 205 THR A HG1  2  
ATOM 8497   H HG21 . THR A 1 205 ? -8.252  -15.133 -13.655 1.00 1.38  ? 205 THR A HG21 2  
ATOM 8498   H HG22 . THR A 1 205 ? -7.749  -13.918 -12.481 1.00 1.19  ? 205 THR A HG22 2  
ATOM 8499   H HG23 . THR A 1 205 ? -9.321  -13.788 -13.267 1.00 1.25  ? 205 THR A HG23 2  
ATOM 8500   N N    . GLY A 1 206 ? -5.495  -12.086 -16.417 1.00 1.02  ? 206 GLY A N    2  
ATOM 8501   C CA   . GLY A 1 206 ? -5.062  -11.596 -17.767 1.00 1.10  ? 206 GLY A CA   2  
ATOM 8502   C C    . GLY A 1 206 ? -6.233  -10.981 -18.552 1.00 1.08  ? 206 GLY A C    2  
ATOM 8503   O O    . GLY A 1 206 ? -6.124  -9.884  -19.062 1.00 1.12  ? 206 GLY A O    2  
ATOM 8504   H H    . GLY A 1 206 ? -5.478  -11.479 -15.646 1.00 1.03  ? 206 GLY A H    2  
ATOM 8505   H HA2  . GLY A 1 206 ? -4.297  -10.845 -17.636 1.00 1.17  ? 206 GLY A HA2  2  
ATOM 8506   H HA3  . GLY A 1 206 ? -4.651  -12.419 -18.335 1.00 1.12  ? 206 GLY A HA3  2  
ATOM 8507   N N    . SER A 1 207 ? -7.344  -11.667 -18.678 1.00 1.05  ? 207 SER A N    2  
ATOM 8508   C CA   . SER A 1 207 ? -8.482  -11.081 -19.460 1.00 1.05  ? 207 SER A CA   2  
ATOM 8509   C C    . SER A 1 207 ? -9.820  -11.703 -19.043 1.00 0.97  ? 207 SER A C    2  
ATOM 8510   O O    . SER A 1 207 ? -10.693 -11.916 -19.860 1.00 0.99  ? 207 SER A O    2  
ATOM 8511   C CB   . SER A 1 207 ? -8.250  -11.338 -20.951 1.00 1.13  ? 207 SER A CB   2  
ATOM 8512   O OG   . SER A 1 207 ? -6.887  -11.085 -21.265 1.00 1.72  ? 207 SER A OG   2  
ATOM 8513   H H    . SER A 1 207 ? -7.422  -12.557 -18.271 1.00 1.03  ? 207 SER A H    2  
ATOM 8514   H HA   . SER A 1 207 ? -8.524  -10.015 -19.290 1.00 1.07  ? 207 SER A HA   2  
ATOM 8515   H HB2  . SER A 1 207 ? -8.483  -12.363 -21.184 1.00 1.61  ? 207 SER A HB2  2  
ATOM 8516   H HB3  . SER A 1 207 ? -8.891  -10.686 -21.530 1.00 1.43  ? 207 SER A HB3  2  
ATOM 8517   H HG   . SER A 1 207 ? -6.777  -10.138 -21.370 1.00 2.07  ? 207 SER A HG   2  
ATOM 8518   N N    . VAL A 1 208 ? -10.004 -11.964 -17.781 1.00 0.89  ? 208 VAL A N    2  
ATOM 8519   C CA   . VAL A 1 208 ? -11.306 -12.536 -17.323 1.00 0.82  ? 208 VAL A CA   2  
ATOM 8520   C C    . VAL A 1 208 ? -12.327 -11.396 -17.212 1.00 0.83  ? 208 VAL A C    2  
ATOM 8521   O O    . VAL A 1 208 ? -13.512 -11.585 -17.402 1.00 0.83  ? 208 VAL A O    2  
ATOM 8522   C CB   . VAL A 1 208 ? -11.111 -13.237 -15.968 1.00 0.76  ? 208 VAL A CB   2  
ATOM 8523   C CG1  . VAL A 1 208 ? -12.467 -13.491 -15.297 1.00 0.72  ? 208 VAL A CG1  2  
ATOM 8524   C CG2  . VAL A 1 208 ? -10.406 -14.583 -16.193 1.00 0.77  ? 208 VAL A CG2  2  
ATOM 8525   H H    . VAL A 1 208 ? -9.297  -11.756 -17.135 1.00 0.88  ? 208 VAL A H    2  
ATOM 8526   H HA   . VAL A 1 208 ? -11.655 -13.254 -18.052 1.00 0.83  ? 208 VAL A HA   2  
ATOM 8527   H HB   . VAL A 1 208 ? -10.506 -12.614 -15.326 1.00 0.77  ? 208 VAL A HB   2  
ATOM 8528   H HG11 . VAL A 1 208 ? -13.133 -13.959 -16.004 1.00 1.27  ? 208 VAL A HG11 2  
ATOM 8529   H HG12 . VAL A 1 208 ? -12.329 -14.144 -14.448 1.00 1.14  ? 208 VAL A HG12 2  
ATOM 8530   H HG13 . VAL A 1 208 ? -12.890 -12.555 -14.965 1.00 1.29  ? 208 VAL A HG13 2  
ATOM 8531   H HG21 . VAL A 1 208 ? -9.616  -14.462 -16.921 1.00 1.23  ? 208 VAL A HG21 2  
ATOM 8532   H HG22 . VAL A 1 208 ? -9.987  -14.929 -15.261 1.00 1.22  ? 208 VAL A HG22 2  
ATOM 8533   H HG23 . VAL A 1 208 ? -11.119 -15.308 -16.558 1.00 1.35  ? 208 VAL A HG23 2  
ATOM 8534   N N    . THR A 1 209 ? -11.868 -10.215 -16.892 1.00 0.86  ? 209 THR A N    2  
ATOM 8535   C CA   . THR A 1 209 ? -12.797 -9.056  -16.752 1.00 0.89  ? 209 THR A CA   2  
ATOM 8536   C C    . THR A 1 209 ? -13.556 -8.814  -18.059 1.00 0.95  ? 209 THR A C    2  
ATOM 8537   O O    . THR A 1 209 ? -14.677 -8.346  -18.054 1.00 0.99  ? 209 THR A O    2  
ATOM 8538   C CB   . THR A 1 209 ? -11.992 -7.801  -16.406 1.00 0.94  ? 209 THR A CB   2  
ATOM 8539   O OG1  . THR A 1 209 ? -10.998 -7.592  -17.400 1.00 1.03  ? 209 THR A OG1  2  
ATOM 8540   C CG2  . THR A 1 209 ? -11.324 -7.964  -15.038 1.00 0.95  ? 209 THR A CG2  2  
ATOM 8541   H H    . THR A 1 209 ? -10.905 -10.101 -16.731 1.00 0.87  ? 209 THR A H    2  
ATOM 8542   H HA   . THR A 1 209 ? -13.502 -9.256  -15.959 1.00 0.84  ? 209 THR A HA   2  
ATOM 8543   H HB   . THR A 1 209 ? -12.654 -6.948  -16.377 1.00 1.01  ? 209 THR A HB   2  
ATOM 8544   H HG1  . THR A 1 209 ? -10.247 -8.151  -17.191 1.00 1.44  ? 209 THR A HG1  2  
ATOM 8545   H HG21 . THR A 1 209 ? -10.993 -8.987  -14.911 1.00 1.30  ? 209 THR A HG21 2  
ATOM 8546   H HG22 . THR A 1 209 ? -10.476 -7.305  -14.975 1.00 1.38  ? 209 THR A HG22 2  
ATOM 8547   H HG23 . THR A 1 209 ? -12.030 -7.716  -14.261 1.00 1.49  ? 209 THR A HG23 2  
ATOM 8548   N N    . SER A 1 210 ? -12.960 -9.115  -19.180 1.00 0.98  ? 210 SER A N    2  
ATOM 8549   C CA   . SER A 1 210 ? -13.662 -8.883  -20.474 1.00 1.06  ? 210 SER A CA   2  
ATOM 8550   C C    . SER A 1 210 ? -14.669 -10.005 -20.723 1.00 1.04  ? 210 SER A C    2  
ATOM 8551   O O    . SER A 1 210 ? -15.563 -9.877  -21.537 1.00 1.11  ? 210 SER A O    2  
ATOM 8552   C CB   . SER A 1 210 ? -12.639 -8.856  -21.611 1.00 1.14  ? 210 SER A CB   2  
ATOM 8553   O OG   . SER A 1 210 ? -13.282 -8.443  -22.809 1.00 1.83  ? 210 SER A OG   2  
ATOM 8554   H H    . SER A 1 210 ? -12.054 -9.489  -19.174 1.00 0.97  ? 210 SER A H    2  
ATOM 8555   H HA   . SER A 1 210 ? -14.181 -7.937  -20.437 1.00 1.09  ? 210 SER A HA   2  
ATOM 8556   H HB2  . SER A 1 210 ? -11.851 -8.162  -21.373 1.00 1.49  ? 210 SER A HB2  2  
ATOM 8557   H HB3  . SER A 1 210 ? -12.219 -9.845  -21.738 1.00 1.53  ? 210 SER A HB3  2  
ATOM 8558   H HG   . SER A 1 210 ? -12.605 -8.138  -23.419 1.00 2.16  ? 210 SER A HG   2  
ATOM 8559   N N    . GLN A 1 211 ? -14.527 -11.111 -20.040 1.00 0.96  ? 211 GLN A N    2  
ATOM 8560   C CA   . GLN A 1 211 ? -15.470 -12.252 -20.244 1.00 0.96  ? 211 GLN A CA   2  
ATOM 8561   C C    . GLN A 1 211 ? -16.546 -12.256 -19.154 1.00 0.90  ? 211 GLN A C    2  
ATOM 8562   O O    . GLN A 1 211 ? -17.492 -13.018 -19.212 1.00 0.90  ? 211 GLN A O    2  
ATOM 8563   C CB   . GLN A 1 211 ? -14.687 -13.565 -20.182 1.00 0.95  ? 211 GLN A CB   2  
ATOM 8564   C CG   . GLN A 1 211 ? -13.796 -13.683 -21.420 1.00 1.05  ? 211 GLN A CG   2  
ATOM 8565   C CD   . GLN A 1 211 ? -12.971 -14.967 -21.335 1.00 1.53  ? 211 GLN A CD   2  
ATOM 8566   O OE1  . GLN A 1 211 ? -12.791 -15.519 -20.267 1.00 2.13  ? 211 GLN A OE1  2  
ATOM 8567   N NE2  . GLN A 1 211 ? -12.459 -15.470 -22.424 1.00 2.27  ? 211 GLN A NE2  2  
ATOM 8568   H H    . GLN A 1 211 ? -13.794 -11.194 -19.395 1.00 0.92  ? 211 GLN A H    2  
ATOM 8569   H HA   . GLN A 1 211 ? -15.940 -12.168 -21.213 1.00 1.03  ? 211 GLN A HA   2  
ATOM 8570   H HB2  . GLN A 1 211 ? -14.074 -13.577 -19.292 1.00 0.94  ? 211 GLN A HB2  2  
ATOM 8571   H HB3  . GLN A 1 211 ? -15.377 -14.395 -20.157 1.00 0.98  ? 211 GLN A HB3  2  
ATOM 8572   H HG2  . GLN A 1 211 ? -14.413 -13.707 -22.306 1.00 1.40  ? 211 GLN A HG2  2  
ATOM 8573   H HG3  . GLN A 1 211 ? -13.131 -12.833 -21.466 1.00 1.44  ? 211 GLN A HG3  2  
ATOM 8574   H HE21 . GLN A 1 211 ? -12.604 -15.025 -23.285 1.00 2.59  ? 211 GLN A HE21 2  
ATOM 8575   H HE22 . GLN A 1 211 ? -11.928 -16.293 -22.381 1.00 2.89  ? 211 GLN A HE22 2  
ATOM 8576   N N    . VAL A 1 212 ? -16.399 -11.429 -18.148 1.00 0.87  ? 212 VAL A N    2  
ATOM 8577   C CA   . VAL A 1 212 ? -17.401 -11.400 -17.029 1.00 0.82  ? 212 VAL A CA   2  
ATOM 8578   C C    . VAL A 1 212 ? -18.302 -10.171 -17.137 1.00 0.87  ? 212 VAL A C    2  
ATOM 8579   O O    . VAL A 1 212 ? -17.842 -9.053  -17.261 1.00 0.92  ? 212 VAL A O    2  
ATOM 8580   C CB   . VAL A 1 212 ? -16.654 -11.365 -15.687 1.00 0.76  ? 212 VAL A CB   2  
ATOM 8581   C CG1  . VAL A 1 212 ? -17.630 -11.081 -14.538 1.00 0.76  ? 212 VAL A CG1  2  
ATOM 8582   C CG2  . VAL A 1 212 ? -15.968 -12.716 -15.462 1.00 0.75  ? 212 VAL A CG2  2  
ATOM 8583   H H    . VAL A 1 212 ? -15.611 -10.847 -18.116 1.00 0.89  ? 212 VAL A H    2  
ATOM 8584   H HA   . VAL A 1 212 ? -18.016 -12.289 -17.064 1.00 0.83  ? 212 VAL A HA   2  
ATOM 8585   H HB   . VAL A 1 212 ? -15.912 -10.587 -15.709 1.00 0.78  ? 212 VAL A HB   2  
ATOM 8586   H HG11 . VAL A 1 212 ? -18.562 -11.591 -14.717 1.00 1.27  ? 212 VAL A HG11 2  
ATOM 8587   H HG12 . VAL A 1 212 ? -17.201 -11.422 -13.609 1.00 1.33  ? 212 VAL A HG12 2  
ATOM 8588   H HG13 . VAL A 1 212 ? -17.813 -10.018 -14.479 1.00 1.19  ? 212 VAL A HG13 2  
ATOM 8589   H HG21 . VAL A 1 212 ? -16.679 -13.513 -15.611 1.00 1.25  ? 212 VAL A HG21 2  
ATOM 8590   H HG22 . VAL A 1 212 ? -15.155 -12.824 -16.163 1.00 1.32  ? 212 VAL A HG22 2  
ATOM 8591   H HG23 . VAL A 1 212 ? -15.582 -12.761 -14.454 1.00 1.21  ? 212 VAL A HG23 2  
ATOM 8592   N N    . LYS A 1 213 ? -19.594 -10.383 -17.057 1.00 0.87  ? 213 LYS A N    2  
ATOM 8593   C CA   . LYS A 1 213 ? -20.566 -9.254  -17.115 1.00 0.93  ? 213 LYS A CA   2  
ATOM 8594   C C    . LYS A 1 213 ? -21.144 -9.079  -15.716 1.00 0.90  ? 213 LYS A C    2  
ATOM 8595   O O    . LYS A 1 213 ? -21.256 -10.024 -14.960 1.00 0.91  ? 213 LYS A O    2  
ATOM 8596   C CB   . LYS A 1 213 ? -21.705 -9.584  -18.091 1.00 1.00  ? 213 LYS A CB   2  
ATOM 8597   C CG   . LYS A 1 213 ? -21.221 -9.476  -19.548 1.00 1.20  ? 213 LYS A CG   2  
ATOM 8598   C CD   . LYS A 1 213 ? -20.496 -10.761 -19.967 1.00 1.17  ? 213 LYS A CD   2  
ATOM 8599   C CE   . LYS A 1 213 ? -20.204 -10.707 -21.467 1.00 1.60  ? 213 LYS A CE   2  
ATOM 8600   N NZ   . LYS A 1 213 ? -19.267 -11.806 -21.833 1.00 2.20  ? 213 LYS A NZ   2  
ATOM 8601   H H    . LYS A 1 213 ? -19.929 -11.295 -16.938 1.00 0.84  ? 213 LYS A H    2  
ATOM 8602   H HA   . LYS A 1 213 ? -20.070 -8.341  -17.418 1.00 0.96  ? 213 LYS A HA   2  
ATOM 8603   H HB2  . LYS A 1 213 ? -22.058 -10.587 -17.899 1.00 1.00  ? 213 LYS A HB2  2  
ATOM 8604   H HB3  . LYS A 1 213 ? -22.515 -8.889  -17.934 1.00 1.10  ? 213 LYS A HB3  2  
ATOM 8605   H HG2  . LYS A 1 213 ? -22.074 -9.325  -20.194 1.00 1.75  ? 213 LYS A HG2  2  
ATOM 8606   H HG3  . LYS A 1 213 ? -20.548 -8.638  -19.649 1.00 1.74  ? 213 LYS A HG3  2  
ATOM 8607   H HD2  . LYS A 1 213 ? -19.569 -10.847 -19.420 1.00 1.43  ? 213 LYS A HD2  2  
ATOM 8608   H HD3  . LYS A 1 213 ? -21.120 -11.615 -19.756 1.00 1.53  ? 213 LYS A HD3  2  
ATOM 8609   H HE2  . LYS A 1 213 ? -21.126 -10.821 -22.017 1.00 2.07  ? 213 LYS A HE2  2  
ATOM 8610   H HE3  . LYS A 1 213 ? -19.755 -9.755  -21.712 1.00 2.04  ? 213 LYS A HE3  2  
ATOM 8611   H HZ1  . LYS A 1 213 ? -19.355 -12.580 -21.144 1.00 2.73  ? 213 LYS A HZ1  2  
ATOM 8612   H HZ2  . LYS A 1 213 ? -19.502 -12.161 -22.781 1.00 2.55  ? 213 LYS A HZ2  2  
ATOM 8613   H HZ3  . LYS A 1 213 ? -18.291 -11.446 -21.828 1.00 2.56  ? 213 LYS A HZ3  2  
ATOM 8614   N N    . ASN A 1 214 ? -21.491 -7.885  -15.351 1.00 0.95  ? 214 ASN A N    2  
ATOM 8615   C CA   . ASN A 1 214 ? -22.036 -7.660  -13.987 1.00 0.93  ? 214 ASN A CA   2  
ATOM 8616   C C    . ASN A 1 214 ? -23.314 -8.480  -13.766 1.00 0.92  ? 214 ASN A C    2  
ATOM 8617   O O    . ASN A 1 214 ? -24.184 -8.532  -14.608 1.00 0.97  ? 214 ASN A O    2  
ATOM 8618   C CB   . ASN A 1 214 ? -22.352 -6.174  -13.814 1.00 1.00  ? 214 ASN A CB   2  
ATOM 8619   C CG   . ASN A 1 214 ? -23.284 -5.719  -14.939 1.00 1.51  ? 214 ASN A CG   2  
ATOM 8620   O OD1  . ASN A 1 214 ? -23.468 -6.422  -15.913 1.00 2.36  ? 214 ASN A OD1  2  
ATOM 8621   N ND2  . ASN A 1 214 ? -23.881 -4.562  -14.850 1.00 1.98  ? 214 ASN A ND2  2  
ATOM 8622   H H    . ASN A 1 214 ? -21.378 -7.130  -15.966 1.00 1.04  ? 214 ASN A H    2  
ATOM 8623   H HA   . ASN A 1 214 ? -21.296 -7.952  -13.256 1.00 0.88  ? 214 ASN A HA   2  
ATOM 8624   H HB2  . ASN A 1 214 ? -22.834 -6.017  -12.860 1.00 1.51  ? 214 ASN A HB2  2  
ATOM 8625   H HB3  . ASN A 1 214 ? -21.436 -5.603  -13.854 1.00 1.48  ? 214 ASN A HB3  2  
ATOM 8626   H HD21 . ASN A 1 214 ? -23.732 -3.992  -14.066 1.00 2.03  ? 214 ASN A HD21 2  
ATOM 8627   H HD22 . ASN A 1 214 ? -24.478 -4.262  -15.567 1.00 2.70  ? 214 ASN A HD22 2  
ATOM 8628   N N    . ASP A 1 215 ? -23.420 -9.086  -12.607 1.00 0.88  ? 215 ASP A N    2  
ATOM 8629   C CA   . ASP A 1 215 ? -24.633 -9.890  -12.233 1.00 0.89  ? 215 ASP A CA   2  
ATOM 8630   C C    . ASP A 1 215 ? -24.566 -11.309 -12.806 1.00 0.84  ? 215 ASP A C    2  
ATOM 8631   O O    . ASP A 1 215 ? -25.458 -12.106 -12.586 1.00 0.84  ? 215 ASP A O    2  
ATOM 8632   C CB   . ASP A 1 215 ? -25.915 -9.202  -12.734 1.00 0.98  ? 215 ASP A CB   2  
ATOM 8633   C CG   . ASP A 1 215 ? -25.785 -7.685  -12.574 1.00 1.68  ? 215 ASP A CG   2  
ATOM 8634   O OD1  . ASP A 1 215 ? -25.166 -7.261  -11.613 1.00 2.38  ? 215 ASP A OD1  2  
ATOM 8635   O OD2  . ASP A 1 215 ? -26.308 -6.975  -13.418 1.00 2.32  ? 215 ASP A OD2  2  
ATOM 8636   H H    . ASP A 1 215 ? -22.687 -8.989  -11.963 1.00 0.85  ? 215 ASP A H    2  
ATOM 8637   H HA   . ASP A 1 215 ? -24.677 -9.959  -11.157 1.00 0.88  ? 215 ASP A HA   2  
ATOM 8638   H HB2  . ASP A 1 215 ? -26.088 -9.448  -13.771 1.00 1.17  ? 215 ASP A HB2  2  
ATOM 8639   H HB3  . ASP A 1 215 ? -26.754 -9.547  -12.145 1.00 1.54  ? 215 ASP A HB3  2  
ATOM 8640   N N    . ASP A 1 216 ? -23.531 -11.657 -13.516 1.00 0.81  ? 216 ASP A N    2  
ATOM 8641   C CA   . ASP A 1 216 ? -23.464 -13.046 -14.051 1.00 0.77  ? 216 ASP A CA   2  
ATOM 8642   C C    . ASP A 1 216 ? -23.138 -13.993 -12.895 1.00 0.71  ? 216 ASP A C    2  
ATOM 8643   O O    . ASP A 1 216 ? -22.601 -13.584 -11.884 1.00 0.67  ? 216 ASP A O    2  
ATOM 8644   C CB   . ASP A 1 216 ? -22.374 -13.155 -15.118 1.00 0.77  ? 216 ASP A CB   2  
ATOM 8645   C CG   . ASP A 1 216 ? -21.023 -12.830 -14.494 1.00 1.31  ? 216 ASP A CG   2  
ATOM 8646   O OD1  . ASP A 1 216 ? -21.001 -12.039 -13.569 1.00 2.09  ? 216 ASP A OD1  2  
ATOM 8647   O OD2  . ASP A 1 216 ? -20.034 -13.379 -14.952 1.00 1.80  ? 216 ASP A OD2  2  
ATOM 8648   H H    . ASP A 1 216 ? -22.804 -11.022 -13.684 1.00 0.83  ? 216 ASP A H    2  
ATOM 8649   H HA   . ASP A 1 216 ? -24.420 -13.315 -14.478 1.00 0.81  ? 216 ASP A HA   2  
ATOM 8650   H HB2  . ASP A 1 216 ? -22.355 -14.160 -15.511 1.00 1.09  ? 216 ASP A HB2  2  
ATOM 8651   H HB3  . ASP A 1 216 ? -22.577 -12.458 -15.915 1.00 1.04  ? 216 ASP A HB3  2  
ATOM 8652   N N    . TYR A 1 217 ? -23.446 -15.254 -13.035 1.00 0.69  ? 217 TYR A N    2  
ATOM 8653   C CA   . TYR A 1 217 ? -23.141 -16.230 -11.943 1.00 0.64  ? 217 TYR A CA   2  
ATOM 8654   C C    . TYR A 1 217 ? -21.851 -16.966 -12.301 1.00 0.60  ? 217 TYR A C    2  
ATOM 8655   O O    . TYR A 1 217 ? -21.772 -17.624 -13.319 1.00 0.65  ? 217 TYR A O    2  
ATOM 8656   C CB   . TYR A 1 217 ? -24.291 -17.239 -11.837 1.00 0.66  ? 217 TYR A CB   2  
ATOM 8657   C CG   . TYR A 1 217 ? -24.098 -18.129 -10.630 1.00 0.70  ? 217 TYR A CG   2  
ATOM 8658   C CD1  . TYR A 1 217 ? -24.637 -17.752 -9.395  1.00 0.87  ? 217 TYR A CD1  2  
ATOM 8659   C CD2  . TYR A 1 217 ? -23.392 -19.335 -10.749 1.00 0.77  ? 217 TYR A CD2  2  
ATOM 8660   C CE1  . TYR A 1 217 ? -24.474 -18.580 -8.278  1.00 1.03  ? 217 TYR A CE1  2  
ATOM 8661   C CE2  . TYR A 1 217 ? -23.228 -20.161 -9.630  1.00 0.95  ? 217 TYR A CE2  2  
ATOM 8662   C CZ   . TYR A 1 217 ? -23.770 -19.783 -8.396  1.00 1.04  ? 217 TYR A CZ   2  
ATOM 8663   O OH   . TYR A 1 217 ? -23.614 -20.600 -7.295  1.00 1.27  ? 217 TYR A OH   2  
ATOM 8664   H H    . TYR A 1 217 ? -23.868 -15.560 -13.864 1.00 0.73  ? 217 TYR A H    2  
ATOM 8665   H HA   . TYR A 1 217 ? -23.016 -15.709 -10.998 1.00 0.63  ? 217 TYR A HA   2  
ATOM 8666   H HB2  . TYR A 1 217 ? -25.225 -16.706 -11.741 1.00 0.76  ? 217 TYR A HB2  2  
ATOM 8667   H HB3  . TYR A 1 217 ? -24.315 -17.847 -12.729 1.00 0.68  ? 217 TYR A HB3  2  
ATOM 8668   H HD1  . TYR A 1 217 ? -25.181 -16.823 -9.303  1.00 0.98  ? 217 TYR A HD1  2  
ATOM 8669   H HD2  . TYR A 1 217 ? -22.972 -19.626 -11.699 1.00 0.82  ? 217 TYR A HD2  2  
ATOM 8670   H HE1  . TYR A 1 217 ? -24.891 -18.289 -7.325  1.00 1.22  ? 217 TYR A HE1  2  
ATOM 8671   H HE2  . TYR A 1 217 ? -22.685 -21.089 -9.719  1.00 1.10  ? 217 TYR A HE2  2  
ATOM 8672   H HH   . TYR A 1 217 ? -23.631 -21.512 -7.598  1.00 1.45  ? 217 TYR A HH   2  
ATOM 8673   N N    . LEU A 1 218 ? -20.837 -16.855 -11.477 1.00 0.54  ? 218 LEU A N    2  
ATOM 8674   C CA   . LEU A 1 218 ? -19.534 -17.538 -11.773 1.00 0.52  ? 218 LEU A CA   2  
ATOM 8675   C C    . LEU A 1 218 ? -19.123 -18.406 -10.595 1.00 0.46  ? 218 LEU A C    2  
ATOM 8676   O O    . LEU A 1 218 ? -19.379 -18.076 -9.453  1.00 0.47  ? 218 LEU A O    2  
ATOM 8677   C CB   . LEU A 1 218 ? -18.436 -16.491 -11.949 1.00 0.58  ? 218 LEU A CB   2  
ATOM 8678   C CG   . LEU A 1 218 ? -18.797 -15.504 -13.058 1.00 0.62  ? 218 LEU A CG   2  
ATOM 8679   C CD1  . LEU A 1 218 ? -17.670 -14.475 -13.191 1.00 0.67  ? 218 LEU A CD1  2  
ATOM 8680   C CD2  . LEU A 1 218 ? -18.976 -16.252 -14.388 1.00 0.75  ? 218 LEU A CD2  2  
ATOM 8681   H H    . LEU A 1 218 ? -20.927 -16.313 -10.665 1.00 0.53  ? 218 LEU A H    2  
ATOM 8682   H HA   . LEU A 1 218 ? -19.607 -18.141 -12.665 1.00 0.55  ? 218 LEU A HA   2  
ATOM 8683   H HB2  . LEU A 1 218 ? -18.307 -15.952 -11.022 1.00 0.61  ? 218 LEU A HB2  2  
ATOM 8684   H HB3  . LEU A 1 218 ? -17.510 -16.987 -12.204 1.00 0.67  ? 218 LEU A HB3  2  
ATOM 8685   H HG   . LEU A 1 218 ? -19.717 -14.998 -12.801 1.00 0.62  ? 218 LEU A HG   2  
ATOM 8686   H HD11 . LEU A 1 218 ? -17.323 -14.185 -12.210 1.00 1.23  ? 218 LEU A HD11 2  
ATOM 8687   H HD12 . LEU A 1 218 ? -16.850 -14.906 -13.746 1.00 1.17  ? 218 LEU A HD12 2  
ATOM 8688   H HD13 . LEU A 1 218 ? -18.040 -13.607 -13.711 1.00 1.22  ? 218 LEU A HD13 2  
ATOM 8689   H HD21 . LEU A 1 218 ? -18.260 -17.060 -14.451 1.00 1.31  ? 218 LEU A HD21 2  
ATOM 8690   H HD22 . LEU A 1 218 ? -19.974 -16.654 -14.441 1.00 1.31  ? 218 LEU A HD22 2  
ATOM 8691   H HD23 . LEU A 1 218 ? -18.822 -15.571 -15.213 1.00 1.22  ? 218 LEU A HD23 2  
ATOM 8692   N N    . ILE A 1 219 ? -18.439 -19.490 -10.860 1.00 0.46  ? 219 ILE A N    2  
ATOM 8693   C CA   . ILE A 1 219 ? -17.947 -20.367 -9.749  1.00 0.44  ? 219 ILE A CA   2  
ATOM 8694   C C    . ILE A 1 219 ? -16.420 -20.337 -9.796  1.00 0.44  ? 219 ILE A C    2  
ATOM 8695   O O    . ILE A 1 219 ? -15.830 -20.519 -10.843 1.00 0.48  ? 219 ILE A O    2  
ATOM 8696   C CB   . ILE A 1 219 ? -18.453 -21.794 -9.941  1.00 0.47  ? 219 ILE A CB   2  
ATOM 8697   C CG1  . ILE A 1 219 ? -19.984 -21.779 -9.956  1.00 0.53  ? 219 ILE A CG1  2  
ATOM 8698   C CG2  . ILE A 1 219 ? -17.964 -22.658 -8.778  1.00 0.52  ? 219 ILE A CG2  2  
ATOM 8699   C CD1  . ILE A 1 219 ? -20.516 -23.178 -10.277 1.00 0.63  ? 219 ILE A CD1  2  
ATOM 8700   H H    . ILE A 1 219 ? -18.218 -19.712 -11.800 1.00 0.50  ? 219 ILE A H    2  
ATOM 8701   H HA   . ILE A 1 219 ? -18.281 -19.990 -8.789  1.00 0.44  ? 219 ILE A HA   2  
ATOM 8702   H HB   . ILE A 1 219 ? -18.080 -22.191 -10.869 1.00 0.50  ? 219 ILE A HB   2  
ATOM 8703   H HG12 . ILE A 1 219 ? -20.349 -21.464 -8.992  1.00 0.60  ? 219 ILE A HG12 2  
ATOM 8704   H HG13 . ILE A 1 219 ? -20.325 -21.086 -10.709 1.00 0.55  ? 219 ILE A HG13 2  
ATOM 8705   H HG21 . ILE A 1 219 ? -18.239 -22.190 -7.844  1.00 1.11  ? 219 ILE A HG21 2  
ATOM 8706   H HG22 . ILE A 1 219 ? -18.418 -23.634 -8.836  1.00 1.12  ? 219 ILE A HG22 2  
ATOM 8707   H HG23 . ILE A 1 219 ? -16.890 -22.755 -8.829  1.00 1.19  ? 219 ILE A HG23 2  
ATOM 8708   H HD11 . ILE A 1 219 ? -20.135 -23.883 -9.554  1.00 1.04  ? 219 ILE A HD11 2  
ATOM 8709   H HD12 . ILE A 1 219 ? -21.595 -23.172 -10.237 1.00 1.29  ? 219 ILE A HD12 2  
ATOM 8710   H HD13 . ILE A 1 219 ? -20.193 -23.468 -11.266 1.00 1.24  ? 219 ILE A HD13 2  
ATOM 8711   N N    . LEU A 1 220 ? -15.766 -20.088 -8.685  1.00 0.43  ? 220 LEU A N    2  
ATOM 8712   C CA   . LEU A 1 220 ? -14.272 -20.021 -8.683  1.00 0.46  ? 220 LEU A CA   2  
ATOM 8713   C C    . LEU A 1 220 ? -13.716 -21.282 -8.026  1.00 0.50  ? 220 LEU A C    2  
ATOM 8714   O O    . LEU A 1 220 ? -14.054 -21.604 -6.906  1.00 0.52  ? 220 LEU A O    2  
ATOM 8715   C CB   . LEU A 1 220 ? -13.858 -18.773 -7.884  1.00 0.47  ? 220 LEU A CB   2  
ATOM 8716   C CG   . LEU A 1 220 ? -12.343 -18.741 -7.656  1.00 0.55  ? 220 LEU A CG   2  
ATOM 8717   C CD1  . LEU A 1 220 ? -11.610 -18.763 -9.000  1.00 0.70  ? 220 LEU A CD1  2  
ATOM 8718   C CD2  . LEU A 1 220 ? -11.981 -17.457 -6.899  1.00 0.56  ? 220 LEU A CD2  2  
ATOM 8719   H H    . LEU A 1 220 ? -16.246 -19.936 -7.842  1.00 0.43  ? 220 LEU A H    2  
ATOM 8720   H HA   . LEU A 1 220 ? -13.897 -19.941 -9.694  1.00 0.50  ? 220 LEU A HA   2  
ATOM 8721   H HB2  . LEU A 1 220 ? -14.152 -17.889 -8.429  1.00 0.52  ? 220 LEU A HB2  2  
ATOM 8722   H HB3  . LEU A 1 220 ? -14.359 -18.783 -6.928  1.00 0.48  ? 220 LEU A HB3  2  
ATOM 8723   H HG   . LEU A 1 220 ? -12.047 -19.595 -7.071  1.00 0.61  ? 220 LEU A HG   2  
ATOM 8724   H HD11 . LEU A 1 220 ? -12.114 -18.115 -9.701  1.00 1.14  ? 220 LEU A HD11 2  
ATOM 8725   H HD12 . LEU A 1 220 ? -10.595 -18.422 -8.862  1.00 1.31  ? 220 LEU A HD12 2  
ATOM 8726   H HD13 . LEU A 1 220 ? -11.596 -19.772 -9.387  1.00 1.28  ? 220 LEU A HD13 2  
ATOM 8727   H HD21 . LEU A 1 220 ? -12.451 -16.610 -7.377  1.00 1.12  ? 220 LEU A HD21 2  
ATOM 8728   H HD22 . LEU A 1 220 ? -12.328 -17.531 -5.879  1.00 1.13  ? 220 LEU A HD22 2  
ATOM 8729   H HD23 . LEU A 1 220 ? -10.909 -17.324 -6.903  1.00 1.11  ? 220 LEU A HD23 2  
ATOM 8730   N N    . ASP A 1 221 ? -12.864 -22.006 -8.709  1.00 0.55  ? 221 ASP A N    2  
ATOM 8731   C CA   . ASP A 1 221 ? -12.297 -23.247 -8.108  1.00 0.62  ? 221 ASP A CA   2  
ATOM 8732   C C    . ASP A 1 221 ? -11.040 -22.909 -7.308  1.00 0.63  ? 221 ASP A C    2  
ATOM 8733   O O    . ASP A 1 221 ? -10.773 -23.497 -6.282  1.00 0.69  ? 221 ASP A O    2  
ATOM 8734   C CB   . ASP A 1 221 ? -11.918 -24.220 -9.220  1.00 0.74  ? 221 ASP A CB   2  
ATOM 8735   C CG   . ASP A 1 221 ? -10.939 -23.533 -10.163 1.00 1.52  ? 221 ASP A CG   2  
ATOM 8736   O OD1  . ASP A 1 221 ? -10.903 -22.314 -10.163 1.00 2.20  ? 221 ASP A OD1  2  
ATOM 8737   O OD2  . ASP A 1 221 ? -10.239 -24.235 -10.872 1.00 2.31  ? 221 ASP A OD2  2  
ATOM 8738   H H    . ASP A 1 221 ? -12.599 -21.736 -9.617  1.00 0.58  ? 221 ASP A H    2  
ATOM 8739   H HA   . ASP A 1 221 ? -13.028 -23.706 -7.463  1.00 0.64  ? 221 ASP A HA   2  
ATOM 8740   H HB2  . ASP A 1 221 ? -11.446 -25.093 -8.791  1.00 1.28  ? 221 ASP A HB2  2  
ATOM 8741   H HB3  . ASP A 1 221 ? -12.800 -24.513 -9.767  1.00 1.31  ? 221 ASP A HB3  2  
ATOM 8742   N N    . ALA A 1 222 ? -10.251 -21.986 -7.793  1.00 0.62  ? 222 ALA A N    2  
ATOM 8743   C CA   . ALA A 1 222 ? -8.984  -21.620 -7.087  1.00 0.66  ? 222 ALA A CA   2  
ATOM 8744   C C    . ALA A 1 222 ? -8.252  -22.907 -6.675  1.00 0.73  ? 222 ALA A C    2  
ATOM 8745   O O    . ALA A 1 222 ? -7.357  -22.893 -5.855  1.00 0.78  ? 222 ALA A O    2  
ATOM 8746   C CB   . ALA A 1 222 ? -9.305  -20.748 -5.852  1.00 0.62  ? 222 ALA A CB   2  
ATOM 8747   H H    . ALA A 1 222 ? -10.480 -21.556 -8.643  1.00 0.64  ? 222 ALA A H    2  
ATOM 8748   H HA   . ALA A 1 222 ? -8.354  -21.064 -7.770  1.00 0.70  ? 222 ALA A HA   2  
ATOM 8749   H HB1  . ALA A 1 222 ? -10.360 -20.540 -5.829  1.00 1.19  ? 222 ALA A HB1  2  
ATOM 8750   H HB2  . ALA A 1 222 ? -9.027  -21.266 -4.945  1.00 1.17  ? 222 ALA A HB2  2  
ATOM 8751   H HB3  . ALA A 1 222 ? -8.760  -19.815 -5.911  1.00 1.19  ? 222 ALA A HB3  2  
ATOM 8752   N N    . VAL A 1 223 ? -8.635  -24.015 -7.258  1.00 0.77  ? 223 VAL A N    2  
ATOM 8753   C CA   . VAL A 1 223 ? -7.989  -25.325 -6.948  1.00 0.86  ? 223 VAL A CA   2  
ATOM 8754   C C    . VAL A 1 223 ? -7.529  -25.936 -8.273  1.00 0.93  ? 223 VAL A C    2  
ATOM 8755   O O    . VAL A 1 223 ? -6.442  -26.470 -8.380  1.00 1.04  ? 223 VAL A O    2  
ATOM 8756   C CB   . VAL A 1 223 ? -9.008  -26.244 -6.256  1.00 0.86  ? 223 VAL A CB   2  
ATOM 8757   C CG1  . VAL A 1 223 ? -8.513  -27.695 -6.276  1.00 0.96  ? 223 VAL A CG1  2  
ATOM 8758   C CG2  . VAL A 1 223 ? -9.185  -25.792 -4.803  1.00 0.86  ? 223 VAL A CG2  2  
ATOM 8759   H H    . VAL A 1 223 ? -9.357  -23.983 -7.919  1.00 0.75  ? 223 VAL A H    2  
ATOM 8760   H HA   . VAL A 1 223 ? -7.132  -25.178 -6.303  1.00 0.89  ? 223 VAL A HA   2  
ATOM 8761   H HB   . VAL A 1 223 ? -9.955  -26.180 -6.770  1.00 0.83  ? 223 VAL A HB   2  
ATOM 8762   H HG11 . VAL A 1 223 ? -7.467  -27.722 -6.009  1.00 1.45  ? 223 VAL A HG11 2  
ATOM 8763   H HG12 . VAL A 1 223 ? -9.081  -28.280 -5.568  1.00 1.40  ? 223 VAL A HG12 2  
ATOM 8764   H HG13 . VAL A 1 223 ? -8.642  -28.104 -7.267  1.00 1.40  ? 223 VAL A HG13 2  
ATOM 8765   H HG21 . VAL A 1 223 ? -9.344  -24.725 -4.773  1.00 1.33  ? 223 VAL A HG21 2  
ATOM 8766   H HG22 . VAL A 1 223 ? -10.037 -26.295 -4.371  1.00 1.29  ? 223 VAL A HG22 2  
ATOM 8767   H HG23 . VAL A 1 223 ? -8.298  -26.039 -4.239  1.00 1.37  ? 223 VAL A HG23 2  
ATOM 8768   N N    . ASN A 1 224 ? -8.346  -25.828 -9.293  1.00 0.92  ? 224 ASN A N    2  
ATOM 8769   C CA   . ASN A 1 224 ? -7.974  -26.361 -10.638 1.00 1.01  ? 224 ASN A CA   2  
ATOM 8770   C C    . ASN A 1 224 ? -7.648  -25.171 -11.539 1.00 0.99  ? 224 ASN A C    2  
ATOM 8771   O O    . ASN A 1 224 ? -7.307  -25.321 -12.694 1.00 1.04  ? 224 ASN A O    2  
ATOM 8772   C CB   . ASN A 1 224 ? -9.145  -27.155 -11.224 1.00 1.03  ? 224 ASN A CB   2  
ATOM 8773   C CG   . ASN A 1 224 ? -9.485  -28.322 -10.296 1.00 1.73  ? 224 ASN A CG   2  
ATOM 8774   O OD1  . ASN A 1 224 ? -8.614  -29.072 -9.900  1.00 2.43  ? 224 ASN A OD1  2  
ATOM 8775   N ND2  . ASN A 1 224 ? -10.722 -28.508 -9.926  1.00 2.44  ? 224 ASN A ND2  2  
ATOM 8776   H H    . ASN A 1 224 ? -9.206  -25.366 -9.178  1.00 0.90  ? 224 ASN A H    2  
ATOM 8777   H HA   . ASN A 1 224 ? -7.104  -27.001 -10.559 1.00 1.08  ? 224 ASN A HA   2  
ATOM 8778   H HB2  . ASN A 1 224 ? -10.006 -26.511 -11.323 1.00 1.16  ? 224 ASN A HB2  2  
ATOM 8779   H HB3  . ASN A 1 224 ? -8.869  -27.538 -12.195 1.00 1.52  ? 224 ASN A HB3  2  
ATOM 8780   H HD21 . ASN A 1 224 ? -11.425 -27.901 -10.242 1.00 2.63  ? 224 ASN A HD21 2  
ATOM 8781   H HD22 . ASN A 1 224 ? -10.949 -29.253 -9.332  1.00 3.13  ? 224 ASN A HD22 2  
ATOM 8782   N N    . ASN A 1 225 ? -7.752  -23.983 -11.000 1.00 0.95  ? 225 ASN A N    2  
ATOM 8783   C CA   . ASN A 1 225 ? -7.452  -22.758 -11.797 1.00 0.96  ? 225 ASN A CA   2  
ATOM 8784   C C    . ASN A 1 225 ? -8.416  -22.662 -12.981 1.00 0.93  ? 225 ASN A C    2  
ATOM 8785   O O    . ASN A 1 225 ? -8.014  -22.463 -14.110 1.00 1.00  ? 225 ASN A O    2  
ATOM 8786   C CB   . ASN A 1 225 ? -6.006  -22.819 -12.306 1.00 1.05  ? 225 ASN A CB   2  
ATOM 8787   C CG   . ASN A 1 225 ? -5.527  -21.415 -12.690 1.00 1.09  ? 225 ASN A CG   2  
ATOM 8788   O OD1  . ASN A 1 225 ? -4.385  -21.233 -13.061 1.00 1.54  ? 225 ASN A OD1  2  
ATOM 8789   N ND2  . ASN A 1 225 ? -6.357  -20.409 -12.621 1.00 1.55  ? 225 ASN A ND2  2  
ATOM 8790   H H    . ASN A 1 225 ? -8.036  -23.898 -10.062 1.00 0.93  ? 225 ASN A H    2  
ATOM 8791   H HA   . ASN A 1 225 ? -7.575  -21.889 -11.166 1.00 0.92  ? 225 ASN A HA   2  
ATOM 8792   H HB2  . ASN A 1 225 ? -5.370  -23.213 -11.526 1.00 1.07  ? 225 ASN A HB2  2  
ATOM 8793   H HB3  . ASN A 1 225 ? -5.952  -23.463 -13.171 1.00 1.12  ? 225 ASN A HB3  2  
ATOM 8794   H HD21 . ASN A 1 225 ? -7.280  -20.554 -12.326 1.00 2.20  ? 225 ASN A HD21 2  
ATOM 8795   H HD22 . ASN A 1 225 ? -6.056  -19.509 -12.864 1.00 1.59  ? 225 ASN A HD22 2  
ATOM 8796   N N    . GLN A 1 226 ? -9.692  -22.801 -12.725 1.00 0.85  ? 226 GLN A N    2  
ATOM 8797   C CA   . GLN A 1 226 ? -10.703 -22.717 -13.824 1.00 0.84  ? 226 GLN A CA   2  
ATOM 8798   C C    . GLN A 1 226 ? -11.929 -21.947 -13.332 1.00 0.75  ? 226 GLN A C    2  
ATOM 8799   O O    . GLN A 1 226 ? -12.268 -21.973 -12.163 1.00 0.72  ? 226 GLN A O    2  
ATOM 8800   C CB   . GLN A 1 226 ? -11.140 -24.126 -14.230 1.00 0.88  ? 226 GLN A CB   2  
ATOM 8801   C CG   . GLN A 1 226 ? -9.990  -24.834 -14.947 1.00 1.57  ? 226 GLN A CG   2  
ATOM 8802   C CD   . GLN A 1 226 ? -10.418 -26.256 -15.316 1.00 1.54  ? 226 GLN A CD   2  
ATOM 8803   O OE1  . GLN A 1 226 ? -10.846 -26.505 -16.426 1.00 1.99  ? 226 GLN A OE1  2  
ATOM 8804   N NE2  . GLN A 1 226 ? -10.321 -27.206 -14.426 1.00 1.77  ? 226 GLN A NE2  2  
ATOM 8805   H H    . GLN A 1 226 ? -9.986  -22.958 -11.804 1.00 0.81  ? 226 GLN A H    2  
ATOM 8806   H HA   . GLN A 1 226 ? -10.281 -22.209 -14.680 1.00 0.88  ? 226 GLN A HA   2  
ATOM 8807   H HB2  . GLN A 1 226 ? -11.415 -24.685 -13.347 1.00 1.26  ? 226 GLN A HB2  2  
ATOM 8808   H HB3  . GLN A 1 226 ? -11.992 -24.060 -14.893 1.00 1.27  ? 226 GLN A HB3  2  
ATOM 8809   H HG2  . GLN A 1 226 ? -9.735  -24.289 -15.845 1.00 2.14  ? 226 GLN A HG2  2  
ATOM 8810   H HG3  . GLN A 1 226 ? -9.130  -24.878 -14.295 1.00 2.13  ? 226 GLN A HG3  2  
ATOM 8811   H HE21 . GLN A 1 226 ? -9.977  -27.005 -13.531 1.00 2.32  ? 226 GLN A HE21 2  
ATOM 8812   H HE22 . GLN A 1 226 ? -10.592 -28.120 -14.653 1.00 1.77  ? 226 GLN A HE22 2  
ATOM 8813   N N    . VAL A 1 227 ? -12.604 -21.275 -14.230 1.00 0.73  ? 227 VAL A N    2  
ATOM 8814   C CA   . VAL A 1 227 ? -13.831 -20.504 -13.860 1.00 0.68  ? 227 VAL A CA   2  
ATOM 8815   C C    . VAL A 1 227 ? -14.991 -21.018 -14.709 1.00 0.66  ? 227 VAL A C    2  
ATOM 8816   O O    . VAL A 1 227 ? -14.884 -21.122 -15.916 1.00 0.69  ? 227 VAL A O    2  
ATOM 8817   C CB   . VAL A 1 227 ? -13.610 -19.018 -14.148 1.00 0.71  ? 227 VAL A CB   2  
ATOM 8818   C CG1  . VAL A 1 227 ? -14.868 -18.233 -13.769 1.00 0.73  ? 227 VAL A CG1  2  
ATOM 8819   C CG2  . VAL A 1 227 ? -12.424 -18.513 -13.324 1.00 0.77  ? 227 VAL A CG2  2  
ATOM 8820   H H    . VAL A 1 227 ? -12.307 -21.287 -15.163 1.00 0.78  ? 227 VAL A H    2  
ATOM 8821   H HA   . VAL A 1 227 ? -14.062 -20.640 -12.812 1.00 0.67  ? 227 VAL A HA   2  
ATOM 8822   H HB   . VAL A 1 227 ? -13.405 -18.882 -15.201 1.00 0.73  ? 227 VAL A HB   2  
ATOM 8823   H HG11 . VAL A 1 227 ? -15.149 -18.472 -12.754 1.00 1.21  ? 227 VAL A HG11 2  
ATOM 8824   H HG12 . VAL A 1 227 ? -14.669 -17.175 -13.848 1.00 1.32  ? 227 VAL A HG12 2  
ATOM 8825   H HG13 . VAL A 1 227 ? -15.675 -18.498 -14.438 1.00 1.13  ? 227 VAL A HG13 2  
ATOM 8826   H HG21 . VAL A 1 227 ? -12.598 -18.720 -12.279 1.00 1.40  ? 227 VAL A HG21 2  
ATOM 8827   H HG22 . VAL A 1 227 ? -11.523 -19.014 -13.645 1.00 1.24  ? 227 VAL A HG22 2  
ATOM 8828   H HG23 . VAL A 1 227 ? -12.314 -17.448 -13.467 1.00 1.15  ? 227 VAL A HG23 2  
ATOM 8829   N N    . TYR A 1 228 ? -16.101 -21.339 -14.096 1.00 0.63  ? 228 TYR A N    2  
ATOM 8830   C CA   . TYR A 1 228 ? -17.272 -21.845 -14.877 1.00 0.63  ? 228 TYR A CA   2  
ATOM 8831   C C    . TYR A 1 228 ? -18.282 -20.712 -15.060 1.00 0.63  ? 228 TYR A C    2  
ATOM 8832   O O    . TYR A 1 228 ? -18.840 -20.200 -14.111 1.00 0.59  ? 228 TYR A O    2  
ATOM 8833   C CB   . TYR A 1 228 ? -17.934 -22.996 -14.121 1.00 0.64  ? 228 TYR A CB   2  
ATOM 8834   C CG   . TYR A 1 228 ? -17.017 -24.196 -14.135 1.00 0.69  ? 228 TYR A CG   2  
ATOM 8835   C CD1  . TYR A 1 228 ? -15.955 -24.272 -13.229 1.00 0.75  ? 228 TYR A CD1  2  
ATOM 8836   C CD2  . TYR A 1 228 ? -17.236 -25.237 -15.047 1.00 0.82  ? 228 TYR A CD2  2  
ATOM 8837   C CE1  . TYR A 1 228 ? -15.108 -25.386 -13.233 1.00 0.83  ? 228 TYR A CE1  2  
ATOM 8838   C CE2  . TYR A 1 228 ? -16.389 -26.351 -15.052 1.00 0.91  ? 228 TYR A CE2  2  
ATOM 8839   C CZ   . TYR A 1 228 ? -15.325 -26.425 -14.145 1.00 0.87  ? 228 TYR A CZ   2  
ATOM 8840   O OH   . TYR A 1 228 ? -14.491 -27.526 -14.149 1.00 0.98  ? 228 TYR A OH   2  
ATOM 8841   H H    . TYR A 1 228 ? -16.163 -21.233 -13.123 1.00 0.62  ? 228 TYR A H    2  
ATOM 8842   H HA   . TYR A 1 228 ? -16.945 -22.200 -15.846 1.00 0.67  ? 228 TYR A HA   2  
ATOM 8843   H HB2  . TYR A 1 228 ? -18.122 -22.697 -13.104 1.00 0.64  ? 228 TYR A HB2  2  
ATOM 8844   H HB3  . TYR A 1 228 ? -18.866 -23.252 -14.600 1.00 0.65  ? 228 TYR A HB3  2  
ATOM 8845   H HD1  . TYR A 1 228 ? -15.786 -23.467 -12.530 1.00 0.83  ? 228 TYR A HD1  2  
ATOM 8846   H HD2  . TYR A 1 228 ? -18.057 -25.178 -15.746 1.00 0.94  ? 228 TYR A HD2  2  
ATOM 8847   H HE1  . TYR A 1 228 ? -14.288 -25.444 -12.532 1.00 0.95  ? 228 TYR A HE1  2  
ATOM 8848   H HE2  . TYR A 1 228 ? -16.555 -27.152 -15.756 1.00 1.08  ? 228 TYR A HE2  2  
ATOM 8849   H HH   . TYR A 1 228 ? -13.602 -27.225 -13.947 1.00 1.29  ? 228 TYR A HH   2  
ATOM 8850   N N    . VAL A 1 229 ? -18.515 -20.319 -16.279 1.00 0.70  ? 229 VAL A N    2  
ATOM 8851   C CA   . VAL A 1 229 ? -19.485 -19.216 -16.556 1.00 0.73  ? 229 VAL A CA   2  
ATOM 8852   C C    . VAL A 1 229 ? -20.833 -19.819 -16.961 1.00 0.77  ? 229 VAL A C    2  
ATOM 8853   O O    . VAL A 1 229 ? -20.936 -20.495 -17.963 1.00 0.80  ? 229 VAL A O    2  
ATOM 8854   C CB   . VAL A 1 229 ? -18.965 -18.363 -17.720 1.00 0.82  ? 229 VAL A CB   2  
ATOM 8855   C CG1  . VAL A 1 229 ? -19.881 -17.153 -17.914 1.00 0.85  ? 229 VAL A CG1  2  
ATOM 8856   C CG2  . VAL A 1 229 ? -17.541 -17.879 -17.427 1.00 0.83  ? 229 VAL A CG2  2  
ATOM 8857   H H    . VAL A 1 229 ? -18.048 -20.746 -17.017 1.00 0.75  ? 229 VAL A H    2  
ATOM 8858   H HA   . VAL A 1 229 ? -19.605 -18.598 -15.678 1.00 0.70  ? 229 VAL A HA   2  
ATOM 8859   H HB   . VAL A 1 229 ? -18.965 -18.957 -18.624 1.00 0.89  ? 229 VAL A HB   2  
ATOM 8860   H HG11 . VAL A 1 229 ? -19.947 -16.599 -16.990 1.00 1.36  ? 229 VAL A HG11 2  
ATOM 8861   H HG12 . VAL A 1 229 ? -19.478 -16.517 -18.687 1.00 1.17  ? 229 VAL A HG12 2  
ATOM 8862   H HG13 . VAL A 1 229 ? -20.866 -17.491 -18.203 1.00 1.38  ? 229 VAL A HG13 2  
ATOM 8863   H HG21 . VAL A 1 229 ? -16.939 -18.709 -17.088 1.00 1.34  ? 229 VAL A HG21 2  
ATOM 8864   H HG22 . VAL A 1 229 ? -17.110 -17.467 -18.327 1.00 1.32  ? 229 VAL A HG22 2  
ATOM 8865   H HG23 . VAL A 1 229 ? -17.569 -17.119 -16.663 1.00 1.21  ? 229 VAL A HG23 2  
ATOM 8866   N N    . ASN A 1 230 ? -21.865 -19.585 -16.190 1.00 0.79  ? 230 ASN A N    2  
ATOM 8867   C CA   . ASN A 1 230 ? -23.208 -20.150 -16.531 1.00 0.85  ? 230 ASN A CA   2  
ATOM 8868   C C    . ASN A 1 230 ? -23.177 -21.674 -16.364 1.00 0.83  ? 230 ASN A C    2  
ATOM 8869   O O    . ASN A 1 230 ? -23.217 -22.417 -17.325 1.00 0.88  ? 230 ASN A O    2  
ATOM 8870   C CB   . ASN A 1 230 ? -23.580 -19.785 -17.981 1.00 0.94  ? 230 ASN A CB   2  
ATOM 8871   C CG   . ASN A 1 230 ? -25.102 -19.820 -18.151 1.00 1.05  ? 230 ASN A CG   2  
ATOM 8872   O OD1  . ASN A 1 230 ? -25.655 -20.818 -18.568 1.00 1.44  ? 230 ASN A OD1  2  
ATOM 8873   N ND2  . ASN A 1 230 ? -25.806 -18.765 -17.844 1.00 1.66  ? 230 ASN A ND2  2  
ATOM 8874   H H    . ASN A 1 230 ? -21.758 -19.049 -15.375 1.00 0.79  ? 230 ASN A H    2  
ATOM 8875   H HA   . ASN A 1 230 ? -23.943 -19.736 -15.855 1.00 0.88  ? 230 ASN A HA   2  
ATOM 8876   H HB2  . ASN A 1 230 ? -23.218 -18.793 -18.204 1.00 1.00  ? 230 ASN A HB2  2  
ATOM 8877   H HB3  . ASN A 1 230 ? -23.133 -20.492 -18.665 1.00 0.93  ? 230 ASN A HB3  2  
ATOM 8878   H HD21 . ASN A 1 230 ? -25.359 -17.960 -17.507 1.00 2.33  ? 230 ASN A HD21 2  
ATOM 8879   H HD22 . ASN A 1 230 ? -26.779 -18.778 -17.950 1.00 1.75  ? 230 ASN A HD22 2  
ATOM 8880   N N    . PRO A 1 231 ? -23.097 -22.130 -15.142 1.00 0.81  ? 231 PRO A N    2  
ATOM 8881   C CA   . PRO A 1 231 ? -23.049 -23.579 -14.811 1.00 0.84  ? 231 PRO A CA   2  
ATOM 8882   C C    . PRO A 1 231 ? -24.442 -24.186 -14.602 1.00 0.93  ? 231 PRO A C    2  
ATOM 8883   O O    . PRO A 1 231 ? -25.170 -23.796 -13.712 1.00 0.95  ? 231 PRO A O    2  
ATOM 8884   C CB   . PRO A 1 231 ? -22.266 -23.578 -13.501 1.00 0.81  ? 231 PRO A CB   2  
ATOM 8885   C CG   . PRO A 1 231 ? -22.703 -22.319 -12.811 1.00 0.80  ? 231 PRO A CG   2  
ATOM 8886   C CD   . PRO A 1 231 ? -23.040 -21.306 -13.923 1.00 0.79  ? 231 PRO A CD   2  
ATOM 8887   H HA   . PRO A 1 231 ? -22.502 -24.124 -15.562 1.00 0.86  ? 231 PRO A HA   2  
ATOM 8888   H HB2  . PRO A 1 231 ? -22.512 -24.451 -12.908 1.00 0.86  ? 231 PRO A HB2  2  
ATOM 8889   H HB3  . PRO A 1 231 ? -21.205 -23.543 -13.698 1.00 0.79  ? 231 PRO A HB3  2  
ATOM 8890   H HG2  . PRO A 1 231 ? -23.579 -22.516 -12.204 1.00 0.85  ? 231 PRO A HG2  2  
ATOM 8891   H HG3  . PRO A 1 231 ? -21.906 -21.933 -12.194 1.00 0.79  ? 231 PRO A HG3  2  
ATOM 8892   H HD2  . PRO A 1 231 ? -23.997 -20.835 -13.735 1.00 0.83  ? 231 PRO A HD2  2  
ATOM 8893   H HD3  . PRO A 1 231 ? -22.262 -20.562 -14.014 1.00 0.78  ? 231 PRO A HD3  2  
ATOM 8894   N N    . THR A 1 232 ? -24.814 -25.141 -15.409 1.00 1.01  ? 232 THR A N    2  
ATOM 8895   C CA   . THR A 1 232 ? -26.154 -25.773 -15.247 1.00 1.12  ? 232 THR A CA   2  
ATOM 8896   C C    . THR A 1 232 ? -26.175 -26.567 -13.940 1.00 1.12  ? 232 THR A C    2  
ATOM 8897   O O    . THR A 1 232 ? -25.158 -26.745 -13.297 1.00 1.09  ? 232 THR A O    2  
ATOM 8898   C CB   . THR A 1 232 ? -26.422 -26.712 -16.429 1.00 1.24  ? 232 THR A CB   2  
ATOM 8899   O OG1  . THR A 1 232 ? -26.401 -25.965 -17.637 1.00 1.61  ? 232 THR A OG1  2  
ATOM 8900   C CG2  . THR A 1 232 ? -27.791 -27.381 -16.268 1.00 1.84  ? 232 THR A CG2  2  
ATOM 8901   H H    . THR A 1 232 ? -24.215 -25.442 -16.124 1.00 1.03  ? 232 THR A H    2  
ATOM 8902   H HA   . THR A 1 232 ? -26.914 -25.005 -15.215 1.00 1.15  ? 232 THR A HA   2  
ATOM 8903   H HB   . THR A 1 232 ? -25.657 -27.473 -16.464 1.00 1.48  ? 232 THR A HB   2  
ATOM 8904   H HG1  . THR A 1 232 ? -27.014 -26.376 -18.251 1.00 1.90  ? 232 THR A HG1  2  
ATOM 8905   H HG21 . THR A 1 232 ? -28.502 -26.668 -15.877 1.00 2.28  ? 232 THR A HG21 2  
ATOM 8906   H HG22 . THR A 1 232 ? -28.132 -27.736 -17.230 1.00 2.31  ? 232 THR A HG22 2  
ATOM 8907   H HG23 . THR A 1 232 ? -27.707 -28.216 -15.589 1.00 2.28  ? 232 THR A HG23 2  
ATOM 8908   N N    . ASN A 1 233 ? -27.321 -27.037 -13.529 1.00 1.21  ? 233 ASN A N    2  
ATOM 8909   C CA   . ASN A 1 233 ? -27.391 -27.807 -12.255 1.00 1.26  ? 233 ASN A CA   2  
ATOM 8910   C C    . ASN A 1 233 ? -26.491 -29.040 -12.361 1.00 1.29  ? 233 ASN A C    2  
ATOM 8911   O O    . ASN A 1 233 ? -25.803 -29.402 -11.427 1.00 1.31  ? 233 ASN A O    2  
ATOM 8912   C CB   . ASN A 1 233 ? -28.834 -28.258 -12.015 1.00 1.41  ? 233 ASN A CB   2  
ATOM 8913   C CG   . ASN A 1 233 ? -29.725 -27.041 -11.743 1.00 2.02  ? 233 ASN A CG   2  
ATOM 8914   O OD1  . ASN A 1 233 ? -30.910 -27.076 -12.005 1.00 2.65  ? 233 ASN A OD1  2  
ATOM 8915   N ND2  . ASN A 1 233 ? -29.204 -25.960 -11.228 1.00 2.74  ? 233 ASN A ND2  2  
ATOM 8916   H H    . ASN A 1 233 ? -28.133 -26.879 -14.054 1.00 1.29  ? 233 ASN A H    2  
ATOM 8917   H HA   . ASN A 1 233 ? -27.061 -27.186 -11.436 1.00 1.19  ? 233 ASN A HA   2  
ATOM 8918   H HB2  . ASN A 1 233 ? -29.195 -28.779 -12.890 1.00 1.71  ? 233 ASN A HB2  2  
ATOM 8919   H HB3  . ASN A 1 233 ? -28.865 -28.921 -11.164 1.00 1.78  ? 233 ASN A HB3  2  
ATOM 8920   H HD21 . ASN A 1 233 ? -28.250 -25.927 -11.016 1.00 2.93  ? 233 ASN A HD21 2  
ATOM 8921   H HD22 . ASN A 1 233 ? -29.772 -25.180 -11.053 1.00 3.45  ? 233 ASN A HD22 2  
ATOM 8922   N N    . GLU A 1 234 ? -26.486 -29.682 -13.497 1.00 1.35  ? 234 GLU A N    2  
ATOM 8923   C CA   . GLU A 1 234 ? -25.625 -30.886 -13.673 1.00 1.43  ? 234 GLU A CA   2  
ATOM 8924   C C    . GLU A 1 234 ? -24.157 -30.485 -13.500 1.00 1.33  ? 234 GLU A C    2  
ATOM 8925   O O    . GLU A 1 234 ? -23.375 -31.197 -12.902 1.00 1.37  ? 234 GLU A O    2  
ATOM 8926   C CB   . GLU A 1 234 ? -25.849 -31.473 -15.072 1.00 1.54  ? 234 GLU A CB   2  
ATOM 8927   C CG   . GLU A 1 234 ? -24.987 -32.725 -15.257 1.00 1.95  ? 234 GLU A CG   2  
ATOM 8928   C CD   . GLU A 1 234 ? -25.219 -33.302 -16.655 1.00 2.35  ? 234 GLU A CD   2  
ATOM 8929   O OE1  . GLU A 1 234 ? -26.135 -32.844 -17.317 1.00 2.77  ? 234 GLU A OE1  2  
ATOM 8930   O OE2  . GLU A 1 234 ? -24.477 -34.191 -17.038 1.00 2.89  ? 234 GLU A OE2  2  
ATOM 8931   H H    . GLU A 1 234 ? -27.044 -29.367 -14.239 1.00 1.37  ? 234 GLU A H    2  
ATOM 8932   H HA   . GLU A 1 234 ? -25.886 -31.624 -12.928 1.00 1.50  ? 234 GLU A HA   2  
ATOM 8933   H HB2  . GLU A 1 234 ? -26.891 -31.735 -15.188 1.00 1.86  ? 234 GLU A HB2  2  
ATOM 8934   H HB3  . GLU A 1 234 ? -25.578 -30.739 -15.816 1.00 1.89  ? 234 GLU A HB3  2  
ATOM 8935   H HG2  . GLU A 1 234 ? -23.943 -32.468 -15.145 1.00 2.39  ? 234 GLU A HG2  2  
ATOM 8936   H HG3  . GLU A 1 234 ? -25.257 -33.463 -14.516 1.00 2.49  ? 234 GLU A HG3  2  
ATOM 8937   N N    . VAL A 1 235 ? -23.780 -29.345 -14.015 1.00 1.24  ? 235 VAL A N    2  
ATOM 8938   C CA   . VAL A 1 235 ? -22.366 -28.890 -13.880 1.00 1.19  ? 235 VAL A CA   2  
ATOM 8939   C C    . VAL A 1 235 ? -22.021 -28.692 -12.399 1.00 1.10  ? 235 VAL A C    2  
ATOM 8940   O O    . VAL A 1 235 ? -20.960 -29.069 -11.946 1.00 1.11  ? 235 VAL A O    2  
ATOM 8941   C CB   . VAL A 1 235 ? -22.188 -27.567 -14.638 1.00 1.16  ? 235 VAL A CB   2  
ATOM 8942   C CG1  . VAL A 1 235 ? -20.822 -26.955 -14.310 1.00 1.13  ? 235 VAL A CG1  2  
ATOM 8943   C CG2  . VAL A 1 235 ? -22.274 -27.834 -16.146 1.00 1.30  ? 235 VAL A CG2  2  
ATOM 8944   H H    . VAL A 1 235 ? -24.430 -28.780 -14.481 1.00 1.23  ? 235 VAL A H    2  
ATOM 8945   H HA   . VAL A 1 235 ? -21.708 -29.634 -14.303 1.00 1.26  ? 235 VAL A HA   2  
ATOM 8946   H HB   . VAL A 1 235 ? -22.970 -26.879 -14.349 1.00 1.10  ? 235 VAL A HB   2  
ATOM 8947   H HG11 . VAL A 1 235 ? -20.066 -27.724 -14.340 1.00 1.68  ? 235 VAL A HG11 2  
ATOM 8948   H HG12 . VAL A 1 235 ? -20.586 -26.189 -15.034 1.00 1.31  ? 235 VAL A HG12 2  
ATOM 8949   H HG13 . VAL A 1 235 ? -20.853 -26.518 -13.322 1.00 1.51  ? 235 VAL A HG13 2  
ATOM 8950   H HG21 . VAL A 1 235 ? -23.097 -28.501 -16.350 1.00 1.57  ? 235 VAL A HG21 2  
ATOM 8951   H HG22 . VAL A 1 235 ? -22.429 -26.901 -16.667 1.00 1.72  ? 235 VAL A HG22 2  
ATOM 8952   H HG23 . VAL A 1 235 ? -21.352 -28.286 -16.484 1.00 1.73  ? 235 VAL A HG23 2  
ATOM 8953   N N    . ILE A 1 236 ? -22.907 -28.103 -11.644 1.00 1.06  ? 236 ILE A N    2  
ATOM 8954   C CA   . ILE A 1 236 ? -22.619 -27.882 -10.197 1.00 1.00  ? 236 ILE A CA   2  
ATOM 8955   C C    . ILE A 1 236 ? -22.425 -29.229 -9.502  1.00 1.09  ? 236 ILE A C    2  
ATOM 8956   O O    . ILE A 1 236 ? -21.553 -29.383 -8.675  1.00 1.08  ? 236 ILE A O    2  
ATOM 8957   C CB   . ILE A 1 236 ? -23.784 -27.122 -9.557  1.00 1.00  ? 236 ILE A CB   2  
ATOM 8958   C CG1  . ILE A 1 236 ? -23.842 -25.708 -10.144 1.00 0.99  ? 236 ILE A CG1  2  
ATOM 8959   C CG2  . ILE A 1 236 ? -23.569 -27.028 -8.043  1.00 1.00  ? 236 ILE A CG2  2  
ATOM 8960   C CD1  . ILE A 1 236 ? -25.137 -25.023 -9.706  1.00 1.03  ? 236 ILE A CD1  2  
ATOM 8961   H H    . ILE A 1 236 ? -23.758 -27.804 -12.025 1.00 1.08  ? 236 ILE A H    2  
ATOM 8962   H HA   . ILE A 1 236 ? -21.715 -27.303 -10.094 1.00 0.94  ? 236 ILE A HA   2  
ATOM 8963   H HB   . ILE A 1 236 ? -24.710 -27.639 -9.760  1.00 1.07  ? 236 ILE A HB   2  
ATOM 8964   H HG12 . ILE A 1 236 ? -22.996 -25.136 -9.792  1.00 0.98  ? 236 ILE A HG12 2  
ATOM 8965   H HG13 . ILE A 1 236 ? -23.814 -25.764 -11.222 1.00 1.00  ? 236 ILE A HG13 2  
ATOM 8966   H HG21 . ILE A 1 236 ? -22.569 -26.672 -7.843  1.00 1.32  ? 236 ILE A HG21 2  
ATOM 8967   H HG22 . ILE A 1 236 ? -24.285 -26.340 -7.621  1.00 1.40  ? 236 ILE A HG22 2  
ATOM 8968   H HG23 . ILE A 1 236 ? -23.701 -28.003 -7.598  1.00 1.57  ? 236 ILE A HG23 2  
ATOM 8969   H HD11 . ILE A 1 236 ? -25.980 -25.646 -9.965  1.00 1.49  ? 236 ILE A HD11 2  
ATOM 8970   H HD12 . ILE A 1 236 ? -25.119 -24.868 -8.637  1.00 1.45  ? 236 ILE A HD12 2  
ATOM 8971   H HD13 . ILE A 1 236 ? -25.227 -24.070 -10.205 1.00 1.38  ? 236 ILE A HD13 2  
ATOM 8972   N N    . ASP A 1 237 ? -23.217 -30.210 -9.828  1.00 1.21  ? 237 ASP A N    2  
ATOM 8973   C CA   . ASP A 1 237 ? -23.046 -31.531 -9.164  1.00 1.34  ? 237 ASP A CA   2  
ATOM 8974   C C    . ASP A 1 237 ? -21.637 -32.049 -9.457  1.00 1.37  ? 237 ASP A C    2  
ATOM 8975   O O    . ASP A 1 237 ? -20.962 -32.566 -8.590  1.00 1.42  ? 237 ASP A O    2  
ATOM 8976   C CB   . ASP A 1 237 ? -24.084 -32.518 -9.707  1.00 1.48  ? 237 ASP A CB   2  
ATOM 8977   C CG   . ASP A 1 237 ? -23.914 -33.880 -9.029  1.00 1.86  ? 237 ASP A CG   2  
ATOM 8978   O OD1  . ASP A 1 237 ? -22.858 -34.118 -8.468  1.00 2.43  ? 237 ASP A OD1  2  
ATOM 8979   O OD2  . ASP A 1 237 ? -24.848 -34.664 -9.078  1.00 2.33  ? 237 ASP A OD2  2  
ATOM 8980   H H    . ASP A 1 237 ? -23.917 -30.081 -10.501 1.00 1.24  ? 237 ASP A H    2  
ATOM 8981   H HA   . ASP A 1 237 ? -23.175 -31.420 -8.099  1.00 1.34  ? 237 ASP A HA   2  
ATOM 8982   H HB2  . ASP A 1 237 ? -25.077 -32.140 -9.510  1.00 1.62  ? 237 ASP A HB2  2  
ATOM 8983   H HB3  . ASP A 1 237 ? -23.949 -32.631 -10.772 1.00 1.79  ? 237 ASP A HB3  2  
ATOM 8984   N N    . LYS A 1 238 ? -21.185 -31.906 -10.672 1.00 1.38  ? 238 LYS A N    2  
ATOM 8985   C CA   . LYS A 1 238 ? -19.814 -32.380 -11.016 1.00 1.47  ? 238 LYS A CA   2  
ATOM 8986   C C    . LYS A 1 238 ? -18.785 -31.595 -10.198 1.00 1.39  ? 238 LYS A C    2  
ATOM 8987   O O    . LYS A 1 238 ? -17.865 -32.154 -9.633  1.00 1.48  ? 238 LYS A O    2  
ATOM 8988   C CB   . LYS A 1 238 ? -19.561 -32.166 -12.509 1.00 1.52  ? 238 LYS A CB   2  
ATOM 8989   C CG   . LYS A 1 238 ? -18.239 -32.826 -12.904 1.00 1.65  ? 238 LYS A CG   2  
ATOM 8990   C CD   . LYS A 1 238 ? -17.987 -32.611 -14.399 1.00 1.77  ? 238 LYS A CD   2  
ATOM 8991   C CE   . LYS A 1 238 ? -16.664 -33.271 -14.802 1.00 2.22  ? 238 LYS A CE   2  
ATOM 8992   N NZ   . LYS A 1 238 ? -15.528 -32.405 -14.377 1.00 2.78  ? 238 LYS A NZ   2  
ATOM 8993   H H    . LYS A 1 238 ? -21.742 -31.479 -11.354 1.00 1.36  ? 238 LYS A H    2  
ATOM 8994   H HA   . LYS A 1 238 ? -19.730 -33.429 -10.783 1.00 1.58  ? 238 LYS A HA   2  
ATOM 8995   H HB2  . LYS A 1 238 ? -20.368 -32.605 -13.077 1.00 1.58  ? 238 LYS A HB2  2  
ATOM 8996   H HB3  . LYS A 1 238 ? -19.508 -31.108 -12.717 1.00 1.45  ? 238 LYS A HB3  2  
ATOM 8997   H HG2  . LYS A 1 238 ? -17.432 -32.385 -12.336 1.00 1.64  ? 238 LYS A HG2  2  
ATOM 8998   H HG3  . LYS A 1 238 ? -18.288 -33.885 -12.697 1.00 1.73  ? 238 LYS A HG3  2  
ATOM 8999   H HD2  . LYS A 1 238 ? -18.795 -33.051 -14.966 1.00 1.95  ? 238 LYS A HD2  2  
ATOM 9000   H HD3  . LYS A 1 238 ? -17.936 -31.553 -14.606 1.00 2.03  ? 238 LYS A HD3  2  
ATOM 9001   H HE2  . LYS A 1 238 ? -16.580 -34.237 -14.324 1.00 2.64  ? 238 LYS A HE2  2  
ATOM 9002   H HE3  . LYS A 1 238 ? -16.638 -33.397 -15.874 1.00 2.62  ? 238 LYS A HE3  2  
ATOM 9003   H HZ1  . LYS A 1 238 ? -15.657 -31.449 -14.766 1.00 3.08  ? 238 LYS A HZ1  2  
ATOM 9004   H HZ2  . LYS A 1 238 ? -15.499 -32.356 -13.339 1.00 3.18  ? 238 LYS A HZ2  2  
ATOM 9005   H HZ3  . LYS A 1 238 ? -14.636 -32.807 -14.729 1.00 3.18  ? 238 LYS A HZ3  2  
ATOM 9006   N N    . MET A 1 239 ? -18.934 -30.299 -10.130 1.00 1.25  ? 239 MET A N    2  
ATOM 9007   C CA   . MET A 1 239 ? -17.967 -29.476 -9.349  1.00 1.20  ? 239 MET A CA   2  
ATOM 9008   C C    . MET A 1 239 ? -18.095 -29.805 -7.864  1.00 1.18  ? 239 MET A C    2  
ATOM 9009   O O    . MET A 1 239 ? -17.129 -29.774 -7.129  1.00 1.23  ? 239 MET A O    2  
ATOM 9010   C CB   . MET A 1 239 ? -18.244 -27.988 -9.556  1.00 1.09  ? 239 MET A CB   2  
ATOM 9011   C CG   . MET A 1 239 ? -17.868 -27.584 -10.983 1.00 1.15  ? 239 MET A CG   2  
ATOM 9012   S SD   . MET A 1 239 ? -17.984 -25.782 -11.161 1.00 1.13  ? 239 MET A SD   2  
ATOM 9013   C CE   . MET A 1 239 ? -16.550 -25.329 -10.146 1.00 1.08  ? 239 MET A CE   2  
ATOM 9014   H H    . MET A 1 239 ? -19.682 -29.870 -10.595 1.00 1.21  ? 239 MET A H    2  
ATOM 9015   H HA   . MET A 1 239 ? -16.964 -29.700 -9.677  1.00 1.29  ? 239 MET A HA   2  
ATOM 9016   H HB2  . MET A 1 239 ? -19.294 -27.792 -9.390  1.00 1.07  ? 239 MET A HB2  2  
ATOM 9017   H HB3  . MET A 1 239 ? -17.660 -27.420 -8.853  1.00 1.07  ? 239 MET A HB3  2  
ATOM 9018   H HG2  . MET A 1 239 ? -16.857 -27.902 -11.191 1.00 1.24  ? 239 MET A HG2  2  
ATOM 9019   H HG3  . MET A 1 239 ? -18.543 -28.058 -11.679 1.00 1.23  ? 239 MET A HG3  2  
ATOM 9020   H HE1  . MET A 1 239 ? -15.757 -26.046 -10.300 1.00 1.56  ? 239 MET A HE1  2  
ATOM 9021   H HE2  . MET A 1 239 ? -16.203 -24.350 -10.430 1.00 1.59  ? 239 MET A HE2  2  
ATOM 9022   H HE3  . MET A 1 239 ? -16.831 -25.312 -9.104  1.00 1.38  ? 239 MET A HE3  2  
ATOM 9023   N N    . ARG A 1 240 ? -19.270 -30.147 -7.416  1.00 1.15  ? 240 ARG A N    2  
ATOM 9024   C CA   . ARG A 1 240 ? -19.440 -30.506 -5.985  1.00 1.19  ? 240 ARG A CA   2  
ATOM 9025   C C    . ARG A 1 240 ? -18.720 -31.831 -5.733  1.00 1.32  ? 240 ARG A C    2  
ATOM 9026   O O    . ARG A 1 240 ? -18.182 -32.066 -4.670  1.00 1.33  ? 240 ARG A O    2  
ATOM 9027   C CB   . ARG A 1 240 ? -20.936 -30.645 -5.673  1.00 1.24  ? 240 ARG A CB   2  
ATOM 9028   C CG   . ARG A 1 240 ? -21.626 -29.270 -5.699  1.00 1.14  ? 240 ARG A CG   2  
ATOM 9029   C CD   . ARG A 1 240 ? -21.396 -28.523 -4.379  1.00 1.16  ? 240 ARG A CD   2  
ATOM 9030   N NE   . ARG A 1 240 ? -22.269 -27.315 -4.346  1.00 1.59  ? 240 ARG A NE   2  
ATOM 9031   C CZ   . ARG A 1 240 ? -22.478 -26.689 -3.220  1.00 1.84  ? 240 ARG A CZ   2  
ATOM 9032   N NH1  . ARG A 1 240 ? -21.917 -27.114 -2.122  1.00 2.05  ? 240 ARG A NH1  2  
ATOM 9033   N NH2  . ARG A 1 240 ? -23.250 -25.637 -3.194  1.00 2.63  ? 240 ARG A NH2  2  
ATOM 9034   H H    . ARG A 1 240 ? -20.042 -30.208 -8.017  1.00 1.14  ? 240 ARG A H    2  
ATOM 9035   H HA   . ARG A 1 240 ? -19.006 -29.739 -5.366  1.00 1.13  ? 240 ARG A HA   2  
ATOM 9036   H HB2  . ARG A 1 240 ? -21.393 -31.278 -6.422  1.00 1.29  ? 240 ARG A HB2  2  
ATOM 9037   H HB3  . ARG A 1 240 ? -21.061 -31.094 -4.701  1.00 1.33  ? 240 ARG A HB3  2  
ATOM 9038   H HG2  . ARG A 1 240 ? -21.220 -28.682 -6.507  1.00 1.07  ? 240 ARG A HG2  2  
ATOM 9039   H HG3  . ARG A 1 240 ? -22.685 -29.404 -5.852  1.00 1.20  ? 240 ARG A HG3  2  
ATOM 9040   H HD2  . ARG A 1 240 ? -21.642 -29.166 -3.548  1.00 1.50  ? 240 ARG A HD2  2  
ATOM 9041   H HD3  . ARG A 1 240 ? -20.364 -28.216 -4.306  1.00 1.40  ? 240 ARG A HD3  2  
ATOM 9042   H HE   . ARG A 1 240 ? -22.691 -26.994 -5.170  1.00 2.25  ? 240 ARG A HE   2  
ATOM 9043   H HH11 . ARG A 1 240 ? -21.326 -27.920 -2.142  1.00 2.04  ? 240 ARG A HH11 2  
ATOM 9044   H HH12 . ARG A 1 240 ? -22.078 -26.633 -1.260  1.00 2.69  ? 240 ARG A HH12 2  
ATOM 9045   H HH21 . ARG A 1 240 ? -23.681 -25.311 -4.037  1.00 3.11  ? 240 ARG A HH21 2  
ATOM 9046   H HH22 . ARG A 1 240 ? -23.411 -25.156 -2.332  1.00 3.01  ? 240 ARG A HH22 2  
ATOM 9047   N N    . ALA A 1 241 ? -18.696 -32.697 -6.710  1.00 1.45  ? 241 ALA A N    2  
ATOM 9048   C CA   . ALA A 1 241 ? -17.998 -33.998 -6.528  1.00 1.61  ? 241 ALA A CA   2  
ATOM 9049   C C    . ALA A 1 241 ? -16.525 -33.726 -6.220  1.00 1.62  ? 241 ALA A C    2  
ATOM 9050   O O    . ALA A 1 241 ? -15.926 -34.368 -5.384  1.00 1.63  ? 241 ALA A O    2  
ATOM 9051   C CB   . ALA A 1 241 ? -18.110 -34.827 -7.810  1.00 1.80  ? 241 ALA A CB   2  
ATOM 9052   H H    . ALA A 1 241 ? -19.129 -32.487 -7.564  1.00 1.47  ? 241 ALA A H    2  
ATOM 9053   H HA   . ALA A 1 241 ? -18.445 -34.538 -5.706  1.00 1.63  ? 241 ALA A HA   2  
ATOM 9054   H HB1  . ALA A 1 241 ? -19.144 -34.876 -8.117  1.00 2.07  ? 241 ALA A HB1  2  
ATOM 9055   H HB2  . ALA A 1 241 ? -17.524 -34.365 -8.590  1.00 2.02  ? 241 ALA A HB2  2  
ATOM 9056   H HB3  . ALA A 1 241 ? -17.741 -35.825 -7.627  1.00 2.17  ? 241 ALA A HB3  2  
ATOM 9057   N N    . VAL A 1 242 ? -15.934 -32.766 -6.878  1.00 1.66  ? 242 VAL A N    2  
ATOM 9058   C CA   . VAL A 1 242 ? -14.506 -32.457 -6.592  1.00 1.74  ? 242 VAL A CA   2  
ATOM 9059   C C    . VAL A 1 242 ? -14.395 -32.036 -5.124  1.00 1.58  ? 242 VAL A C    2  
ATOM 9060   O O    . VAL A 1 242 ? -13.485 -32.417 -4.414  1.00 1.58  ? 242 VAL A O    2  
ATOM 9061   C CB   . VAL A 1 242 ? -14.039 -31.313 -7.495  1.00 1.93  ? 242 VAL A CB   2  
ATOM 9062   C CG1  . VAL A 1 242 ? -12.624 -30.890 -7.093  1.00 2.11  ? 242 VAL A CG1  2  
ATOM 9063   C CG2  . VAL A 1 242 ? -14.039 -31.782 -8.952  1.00 2.13  ? 242 VAL A CG2  2  
ATOM 9064   H H    . VAL A 1 242 ? -16.430 -32.245 -7.545  1.00 1.67  ? 242 VAL A H    2  
ATOM 9065   H HA   . VAL A 1 242 ? -13.900 -33.334 -6.766  1.00 1.84  ? 242 VAL A HA   2  
ATOM 9066   H HB   . VAL A 1 242 ? -14.709 -30.474 -7.385  1.00 1.87  ? 242 VAL A HB   2  
ATOM 9067   H HG11 . VAL A 1 242 ? -12.000 -31.766 -6.999  1.00 2.51  ? 242 VAL A HG11 2  
ATOM 9068   H HG12 . VAL A 1 242 ? -12.216 -30.237 -7.851  1.00 2.40  ? 242 VAL A HG12 2  
ATOM 9069   H HG13 . VAL A 1 242 ? -12.659 -30.369 -6.148  1.00 2.26  ? 242 VAL A HG13 2  
ATOM 9070   H HG21 . VAL A 1 242 ? -15.022 -32.147 -9.213  1.00 2.32  ? 242 VAL A HG21 2  
ATOM 9071   H HG22 . VAL A 1 242 ? -13.780 -30.955 -9.597  1.00 2.41  ? 242 VAL A HG22 2  
ATOM 9072   H HG23 . VAL A 1 242 ? -13.317 -32.575 -9.077  1.00 2.46  ? 242 VAL A HG23 2  
ATOM 9073   N N    . GLN A 1 243 ? -15.335 -31.261 -4.660  1.00 1.51  ? 243 GLN A N    2  
ATOM 9074   C CA   . GLN A 1 243 ? -15.311 -30.825 -3.238  1.00 1.47  ? 243 GLN A CA   2  
ATOM 9075   C C    . GLN A 1 243 ? -15.367 -32.069 -2.348  1.00 1.40  ? 243 GLN A C    2  
ATOM 9076   O O    . GLN A 1 243 ? -14.705 -32.153 -1.335  1.00 1.47  ? 243 GLN A O    2  
ATOM 9077   C CB   . GLN A 1 243 ? -16.513 -29.918 -2.958  1.00 1.44  ? 243 GLN A CB   2  
ATOM 9078   C CG   . GLN A 1 243 ? -16.492 -29.468 -1.497  1.00 1.70  ? 243 GLN A CG   2  
ATOM 9079   C CD   . GLN A 1 243 ? -17.595 -28.431 -1.272  1.00 2.52  ? 243 GLN A CD   2  
ATOM 9080   O OE1  . GLN A 1 243 ? -18.199 -27.957 -2.213  1.00 3.17  ? 243 GLN A OE1  2  
ATOM 9081   N NE2  . GLN A 1 243 ? -17.881 -28.053 -0.056  1.00 3.13  ? 243 GLN A NE2  2  
ATOM 9082   H H    . GLN A 1 243 ? -16.068 -30.977 -5.245  1.00 1.53  ? 243 GLN A H    2  
ATOM 9083   H HA   . GLN A 1 243 ? -14.397 -30.285 -3.043  1.00 1.60  ? 243 GLN A HA   2  
ATOM 9084   H HB2  . GLN A 1 243 ? -16.468 -29.052 -3.602  1.00 1.68  ? 243 GLN A HB2  2  
ATOM 9085   H HB3  . GLN A 1 243 ? -17.426 -30.460 -3.149  1.00 1.19  ? 243 GLN A HB3  2  
ATOM 9086   H HG2  . GLN A 1 243 ? -16.660 -30.321 -0.854  1.00 1.93  ? 243 GLN A HG2  2  
ATOM 9087   H HG3  . GLN A 1 243 ? -15.534 -29.026 -1.270  1.00 1.88  ? 243 GLN A HG3  2  
ATOM 9088   H HE21 . GLN A 1 243 ? -17.390 -28.431 0.702   1.00 3.20  ? 243 GLN A HE21 2  
ATOM 9089   H HE22 . GLN A 1 243 ? -18.587 -27.390 0.097   1.00 3.82  ? 243 GLN A HE22 2  
ATOM 9090   N N    . GLU A 1 244 ? -16.157 -33.041 -2.726  1.00 1.34  ? 244 GLU A N    2  
ATOM 9091   C CA   . GLU A 1 244 ? -16.259 -34.284 -1.909  1.00 1.41  ? 244 GLU A CA   2  
ATOM 9092   C C    . GLU A 1 244 ? -14.877 -34.936 -1.818  1.00 1.52  ? 244 GLU A C    2  
ATOM 9093   O O    . GLU A 1 244 ? -14.541 -35.562 -0.833  1.00 1.68  ? 244 GLU A O    2  
ATOM 9094   C CB   . GLU A 1 244 ? -17.241 -35.260 -2.564  1.00 1.41  ? 244 GLU A CB   2  
ATOM 9095   C CG   . GLU A 1 244 ? -18.663 -34.707 -2.457  1.00 1.31  ? 244 GLU A CG   2  
ATOM 9096   C CD   . GLU A 1 244 ? -19.639 -35.685 -3.112  1.00 1.37  ? 244 GLU A CD   2  
ATOM 9097   O OE1  . GLU A 1 244 ? -19.175 -36.609 -3.761  1.00 1.78  ? 244 GLU A OE1  2  
ATOM 9098   O OE2  . GLU A 1 244 ? -20.834 -35.494 -2.956  1.00 1.77  ? 244 GLU A OE2  2  
ATOM 9099   H H    . GLU A 1 244 ? -16.682 -32.952 -3.549  1.00 1.32  ? 244 GLU A H    2  
ATOM 9100   H HA   . GLU A 1 244 ? -16.605 -34.035 -0.917  1.00 1.45  ? 244 GLU A HA   2  
ATOM 9101   H HB2  . GLU A 1 244 ? -16.983 -35.392 -3.602  1.00 1.42  ? 244 GLU A HB2  2  
ATOM 9102   H HB3  . GLU A 1 244 ? -17.190 -36.211 -2.058  1.00 1.54  ? 244 GLU A HB3  2  
ATOM 9103   H HG2  . GLU A 1 244 ? -18.922 -34.580 -1.416  1.00 1.35  ? 244 GLU A HG2  2  
ATOM 9104   H HG3  . GLU A 1 244 ? -18.719 -33.754 -2.961  1.00 1.23  ? 244 GLU A HG3  2  
ATOM 9105   N N    . GLN A 1 245 ? -14.066 -34.793 -2.836  1.00 1.52  ? 245 GLN A N    2  
ATOM 9106   C CA   . GLN A 1 245 ? -12.706 -35.404 -2.790  1.00 1.69  ? 245 GLN A CA   2  
ATOM 9107   C C    . GLN A 1 245 ? -11.966 -34.800 -1.599  1.00 1.73  ? 245 GLN A C    2  
ATOM 9108   O O    . GLN A 1 245 ? -11.254 -35.476 -0.882  1.00 1.89  ? 245 GLN A O    2  
ATOM 9109   C CB   . GLN A 1 245 ? -11.943 -35.092 -4.083  1.00 1.74  ? 245 GLN A CB   2  
ATOM 9110   C CG   . GLN A 1 245 ? -10.552 -35.732 -4.034  1.00 2.02  ? 245 GLN A CG   2  
ATOM 9111   C CD   . GLN A 1 245 ? -9.799  -35.415 -5.329  1.00 2.17  ? 245 GLN A CD   2  
ATOM 9112   O OE1  . GLN A 1 245 ? -10.374 -34.907 -6.271  1.00 2.47  ? 245 GLN A OE1  2  
ATOM 9113   N NE2  . GLN A 1 245 ? -8.528  -35.698 -5.416  1.00 2.44  ? 245 GLN A NE2  2  
ATOM 9114   H H    . GLN A 1 245 ? -14.350 -34.281 -3.623  1.00 1.46  ? 245 GLN A H    2  
ATOM 9115   H HA   . GLN A 1 245 ? -12.791 -36.472 -2.661  1.00 1.81  ? 245 GLN A HA   2  
ATOM 9116   H HB2  . GLN A 1 245 ? -12.490 -35.484 -4.928  1.00 1.90  ? 245 GLN A HB2  2  
ATOM 9117   H HB3  . GLN A 1 245 ? -11.837 -34.026 -4.188  1.00 1.90  ? 245 GLN A HB3  2  
ATOM 9118   H HG2  . GLN A 1 245 ? -10.000 -35.337 -3.193  1.00 2.27  ? 245 GLN A HG2  2  
ATOM 9119   H HG3  . GLN A 1 245 ? -10.649 -36.801 -3.931  1.00 2.24  ? 245 GLN A HG3  2  
ATOM 9120   H HE21 . GLN A 1 245 ? -8.063  -36.108 -4.657  1.00 2.77  ? 245 GLN A HE21 2  
ATOM 9121   H HE22 . GLN A 1 245 ? -8.038  -35.500 -6.242  1.00 2.59  ? 245 GLN A HE22 2  
ATOM 9122   N N    . VAL A 1 246 ? -12.145 -33.528 -1.372  1.00 1.64  ? 246 VAL A N    2  
ATOM 9123   C CA   . VAL A 1 246 ? -11.467 -32.882 -0.217  1.00 1.76  ? 246 VAL A CA   2  
ATOM 9124   C C    . VAL A 1 246 ? -11.937 -33.583 1.056   1.00 1.89  ? 246 VAL A C    2  
ATOM 9125   O O    . VAL A 1 246 ? -11.166 -33.846 1.959   1.00 2.09  ? 246 VAL A O    2  
ATOM 9126   C CB   . VAL A 1 246 ? -11.848 -31.402 -0.156  1.00 1.73  ? 246 VAL A CB   2  
ATOM 9127   C CG1  . VAL A 1 246 ? -11.190 -30.750 1.062   1.00 1.89  ? 246 VAL A CG1  2  
ATOM 9128   C CG2  . VAL A 1 246 ? -11.379 -30.700 -1.431  1.00 1.74  ? 246 VAL A CG2  2  
ATOM 9129   H H    . VAL A 1 246 ? -12.734 -33.003 -1.959  1.00 1.55  ? 246 VAL A H    2  
ATOM 9130   H HA   . VAL A 1 246 ? -10.396 -32.983 -0.317  1.00 1.85  ? 246 VAL A HA   2  
ATOM 9131   H HB   . VAL A 1 246 ? -12.921 -31.313 -0.069  1.00 1.68  ? 246 VAL A HB   2  
ATOM 9132   H HG11 . VAL A 1 246 ? -10.157 -31.057 1.119   1.00 2.25  ? 246 VAL A HG11 2  
ATOM 9133   H HG12 . VAL A 1 246 ? -11.241 -29.675 0.967   1.00 2.16  ? 246 VAL A HG12 2  
ATOM 9134   H HG13 . VAL A 1 246 ? -11.708 -31.057 1.958   1.00 2.12  ? 246 VAL A HG13 2  
ATOM 9135   H HG21 . VAL A 1 246 ? -11.843 -31.163 -2.288  1.00 2.04  ? 246 VAL A HG21 2  
ATOM 9136   H HG22 . VAL A 1 246 ? -11.657 -29.657 -1.392  1.00 1.95  ? 246 VAL A HG22 2  
ATOM 9137   H HG23 . VAL A 1 246 ? -10.306 -30.783 -1.513  1.00 2.06  ? 246 VAL A HG23 2  
ATOM 9138   N N    . ALA A 1 247 ? -13.199 -33.908 1.123   1.00 1.85  ? 247 ALA A N    2  
ATOM 9139   C CA   . ALA A 1 247 ? -13.727 -34.614 2.321   1.00 2.06  ? 247 ALA A CA   2  
ATOM 9140   C C    . ALA A 1 247 ? -12.983 -35.942 2.474   1.00 2.28  ? 247 ALA A C    2  
ATOM 9141   O O    . ALA A 1 247 ? -12.770 -36.425 3.568   1.00 2.54  ? 247 ALA A O    2  
ATOM 9142   C CB   . ALA A 1 247 ? -15.225 -34.878 2.144   1.00 2.02  ? 247 ALA A CB   2  
ATOM 9143   H H    . ALA A 1 247 ? -13.796 -33.700 0.375   1.00 1.71  ? 247 ALA A H    2  
ATOM 9144   H HA   . ALA A 1 247 ? -13.566 -34.006 3.200   1.00 2.17  ? 247 ALA A HA   2  
ATOM 9145   H HB1  . ALA A 1 247 ? -15.701 -33.995 1.743   1.00 2.13  ? 247 ALA A HB1  2  
ATOM 9146   H HB2  . ALA A 1 247 ? -15.370 -35.704 1.464   1.00 2.34  ? 247 ALA A HB2  2  
ATOM 9147   H HB3  . ALA A 1 247 ? -15.664 -35.119 3.102   1.00 2.28  ? 247 ALA A HB3  2  
ATOM 9148   N N    . SER A 1 248 ? -12.579 -36.532 1.379   1.00 2.23  ? 248 SER A N    2  
ATOM 9149   C CA   . SER A 1 248 ? -11.842 -37.824 1.457   1.00 2.52  ? 248 SER A CA   2  
ATOM 9150   C C    . SER A 1 248 ? -10.566 -37.609 2.266   1.00 2.66  ? 248 SER A C    2  
ATOM 9151   O O    . SER A 1 248 ? -10.179 -38.435 3.067   1.00 2.99  ? 248 SER A O    2  
ATOM 9152   C CB   . SER A 1 248 ? -11.485 -38.304 0.050   1.00 2.50  ? 248 SER A CB   2  
ATOM 9153   O OG   . SER A 1 248 ? -11.073 -39.663 0.111   1.00 2.82  ? 248 SER A OG   2  
ATOM 9154   H H    . SER A 1 248 ? -12.758 -36.121 0.508   1.00 2.05  ? 248 SER A H    2  
ATOM 9155   H HA   . SER A 1 248 ? -12.458 -38.562 1.946   1.00 2.70  ? 248 SER A HA   2  
ATOM 9156   H HB2  . SER A 1 248 ? -12.349 -38.224 -0.589  1.00 2.55  ? 248 SER A HB2  2  
ATOM 9157   H HB3  . SER A 1 248 ? -10.687 -37.693 -0.347  1.00 2.55  ? 248 SER A HB3  2  
ATOM 9158   H HG   . SER A 1 248 ? -11.723 -40.147 0.626   1.00 3.03  ? 248 SER A HG   2  
ATOM 9159   N N    . GLU A 1 249 ? -9.916  -36.495 2.085   1.00 2.48  ? 249 GLU A N    2  
ATOM 9160   C CA   . GLU A 1 249 ? -8.683  -36.233 2.874   1.00 2.68  ? 249 GLU A CA   2  
ATOM 9161   C C    . GLU A 1 249 ? -9.080  -36.247 4.349   1.00 2.88  ? 249 GLU A C    2  
ATOM 9162   O O    . GLU A 1 249 ? -8.369  -36.748 5.197   1.00 3.19  ? 249 GLU A O    2  
ATOM 9163   C CB   . GLU A 1 249 ? -8.096  -34.870 2.493   1.00 2.51  ? 249 GLU A CB   2  
ATOM 9164   C CG   . GLU A 1 249 ? -6.823  -34.612 3.304   1.00 2.79  ? 249 GLU A CG   2  
ATOM 9165   C CD   . GLU A 1 249 ? -6.235  -33.254 2.917   1.00 2.93  ? 249 GLU A CD   2  
ATOM 9166   O OE1  . GLU A 1 249 ? -6.702  -32.685 1.945   1.00 3.34  ? 249 GLU A OE1  2  
ATOM 9167   O OE2  . GLU A 1 249 ? -5.326  -32.808 3.597   1.00 3.27  ? 249 GLU A OE2  2  
ATOM 9168   H H    . GLU A 1 249 ? -10.248 -35.829 1.446   1.00 2.25  ? 249 GLU A H    2  
ATOM 9169   H HA   . GLU A 1 249 ? -7.958  -37.012 2.685   1.00 2.89  ? 249 GLU A HA   2  
ATOM 9170   H HB2  . GLU A 1 249 ? -7.859  -34.863 1.439   1.00 2.41  ? 249 GLU A HB2  2  
ATOM 9171   H HB3  . GLU A 1 249 ? -8.818  -34.095 2.705   1.00 2.38  ? 249 GLU A HB3  2  
ATOM 9172   H HG2  . GLU A 1 249 ? -7.060  -34.613 4.359   1.00 3.00  ? 249 GLU A HG2  2  
ATOM 9173   H HG3  . GLU A 1 249 ? -6.101  -35.386 3.098   1.00 3.17  ? 249 GLU A HG3  2  
ATOM 9174   N N    . LYS A 1 250 ? -10.240 -35.725 4.648   1.00 2.69  ? 250 LYS A N    2  
ATOM 9175   C CA   . LYS A 1 250 ? -10.735 -35.725 6.051   1.00 2.94  ? 250 LYS A CA   2  
ATOM 9176   C C    . LYS A 1 250 ? -11.435 -37.065 6.284   1.00 3.28  ? 250 LYS A C    2  
ATOM 9177   O O    . LYS A 1 250 ? -12.486 -37.147 6.888   1.00 3.61  ? 250 LYS A O    2  
ATOM 9178   C CB   . LYS A 1 250 ? -11.726 -34.574 6.249   1.00 2.81  ? 250 LYS A CB   2  
ATOM 9179   C CG   . LYS A 1 250 ? -11.946 -34.335 7.748   1.00 3.05  ? 250 LYS A CG   2  
ATOM 9180   C CD   . LYS A 1 250 ? -12.843 -33.104 7.964   1.00 3.04  ? 250 LYS A CD   2  
ATOM 9181   C CE   . LYS A 1 250 ? -14.319 -33.488 7.801   1.00 3.46  ? 250 LYS A CE   2  
ATOM 9182   N NZ   . LYS A 1 250 ? -14.661 -34.573 8.764   1.00 3.88  ? 250 LYS A NZ   2  
ATOM 9183   H H    . LYS A 1 250 ? -10.801 -35.357 3.939   1.00 2.47  ? 250 LYS A H    2  
ATOM 9184   H HA   . LYS A 1 250 ? -9.904  -35.620 6.736   1.00 3.07  ? 250 LYS A HA   2  
ATOM 9185   H HB2  . LYS A 1 250 ? -11.328 -33.678 5.794   1.00 2.84  ? 250 LYS A HB2  2  
ATOM 9186   H HB3  . LYS A 1 250 ? -12.666 -34.827 5.782   1.00 3.04  ? 250 LYS A HB3  2  
ATOM 9187   H HG2  . LYS A 1 250 ? -12.413 -35.204 8.187   1.00 3.44  ? 250 LYS A HG2  2  
ATOM 9188   H HG3  . LYS A 1 250 ? -10.992 -34.166 8.224   1.00 3.29  ? 250 LYS A HG3  2  
ATOM 9189   H HD2  . LYS A 1 250 ? -12.683 -32.718 8.960   1.00 3.17  ? 250 LYS A HD2  2  
ATOM 9190   H HD3  . LYS A 1 250 ? -12.591 -32.340 7.243   1.00 3.16  ? 250 LYS A HD3  2  
ATOM 9191   H HE2  . LYS A 1 250 ? -14.937 -32.624 8.000   1.00 3.77  ? 250 LYS A HE2  2  
ATOM 9192   H HE3  . LYS A 1 250 ? -14.496 -33.830 6.793   1.00 3.80  ? 250 LYS A HE3  2  
ATOM 9193   H HZ1  . LYS A 1 250 ? -13.809 -34.849 9.292   1.00 4.15  ? 250 LYS A HZ1  2  
ATOM 9194   H HZ2  . LYS A 1 250 ? -15.385 -34.231 9.428   1.00 4.14  ? 250 LYS A HZ2  2  
ATOM 9195   H HZ3  . LYS A 1 250 ? -15.026 -35.396 8.245   1.00 4.18  ? 250 LYS A HZ3  2  
ATOM 9196   N N    . ALA A 1 251 ? -10.834 -38.116 5.802   1.00 3.26  ? 251 ALA A N    2  
ATOM 9197   C CA   . ALA A 1 251 ? -11.421 -39.480 5.975   1.00 3.68  ? 251 ALA A CA   2  
ATOM 9198   C C    . ALA A 1 251 ? -10.854 -40.107 7.249   1.00 4.00  ? 251 ALA A C    2  
ATOM 9199   O O    . ALA A 1 251 ? -11.193 -41.215 7.612   1.00 4.43  ? 251 ALA A O    2  
ATOM 9200   C CB   . ALA A 1 251 ? -11.070 -40.355 4.770   1.00 3.68  ? 251 ALA A CB   2  
ATOM 9201   H H    . ALA A 1 251 ? -9.976  -37.988 5.342   1.00 3.03  ? 251 ALA A H    2  
ATOM 9202   H HA   . ALA A 1 251 ? -12.497 -39.405 6.062   1.00 3.85  ? 251 ALA A HA   2  
ATOM 9203   H HB1  . ALA A 1 251 ? -10.017 -40.263 4.551   1.00 3.91  ? 251 ALA A HB1  2  
ATOM 9204   H HB2  . ALA A 1 251 ? -11.306 -41.384 4.993   1.00 3.80  ? 251 ALA A HB2  2  
ATOM 9205   H HB3  . ALA A 1 251 ? -11.646 -40.035 3.914   1.00 3.78  ? 251 ALA A HB3  2  
ATOM 9206   N N    . GLU A 1 252 ? -9.992  -39.395 7.925   1.00 3.92  ? 252 GLU A N    2  
ATOM 9207   C CA   . GLU A 1 252 ? -9.388  -39.919 9.185   1.00 4.33  ? 252 GLU A CA   2  
ATOM 9208   C C    . GLU A 1 252 ? -8.689  -41.252 8.912   1.00 4.64  ? 252 GLU A C    2  
ATOM 9209   O O    . GLU A 1 252 ? -8.535  -42.071 9.796   1.00 5.15  ? 252 GLU A O    2  
ATOM 9210   C CB   . GLU A 1 252 ? -10.482 -40.123 10.240  1.00 4.36  ? 252 GLU A CB   2  
ATOM 9211   C CG   . GLU A 1 252 ? -11.219 -38.804 10.474  1.00 4.72  ? 252 GLU A CG   2  
ATOM 9212   C CD   . GLU A 1 252 ? -12.309 -39.009 11.526  1.00 5.00  ? 252 GLU A CD   2  
ATOM 9213   O OE1  . GLU A 1 252 ? -12.563 -40.151 11.873  1.00 5.06  ? 252 GLU A OE1  2  
ATOM 9214   O OE2  . GLU A 1 252 ? -12.880 -38.022 11.961  1.00 5.42  ? 252 GLU A OE2  2  
ATOM 9215   H H    . GLU A 1 252 ? -9.742  -38.504 7.604   1.00 3.67  ? 252 GLU A H    2  
ATOM 9216   H HA   . GLU A 1 252 ? -8.665  -39.207 9.556   1.00 4.57  ? 252 GLU A HA   2  
ATOM 9217   H HB2  . GLU A 1 252 ? -11.180 -40.873 9.903   1.00 4.28  ? 252 GLU A HB2  2  
ATOM 9218   H HB3  . GLU A 1 252 ? -10.029 -40.445 11.166  1.00 4.57  ? 252 GLU A HB3  2  
ATOM 9219   H HG2  . GLU A 1 252 ? -10.520 -38.056 10.820  1.00 5.03  ? 252 GLU A HG2  2  
ATOM 9220   H HG3  . GLU A 1 252 ? -11.671 -38.475 9.550   1.00 4.78  ? 252 GLU A HG3  2  
ATOM 9221   N N    . LEU A 1 253 ? -8.256  -41.478 7.697   1.00 4.50  ? 253 LEU A N    2  
ATOM 9222   C CA   . LEU A 1 253 ? -7.557  -42.761 7.374   1.00 5.00  ? 253 LEU A CA   2  
ATOM 9223   C C    . LEU A 1 253 ? -6.045  -42.547 7.440   1.00 5.53  ? 253 LEU A C    2  
ATOM 9224   O O    . LEU A 1 253 ? -5.283  -43.487 7.557   1.00 6.10  ? 253 LEU A O    2  
ATOM 9225   C CB   . LEU A 1 253 ? -7.949  -43.226 5.968   1.00 4.97  ? 253 LEU A CB   2  
ATOM 9226   C CG   . LEU A 1 253 ? -9.434  -43.619 5.944   1.00 5.34  ? 253 LEU A CG   2  
ATOM 9227   C CD1  . LEU A 1 253 ? -9.850  -43.919 4.499   1.00 5.76  ? 253 LEU A CD1  2  
ATOM 9228   C CD2  . LEU A 1 253 ? -9.679  -44.863 6.827   1.00 5.62  ? 253 LEU A CD2  2  
ATOM 9229   H H    . LEU A 1 253 ? -8.383  -40.800 7.001   1.00 4.17  ? 253 LEU A H    2  
ATOM 9230   H HA   . LEU A 1 253 ? -7.834  -43.521 8.091   1.00 5.22  ? 253 LEU A HA   2  
ATOM 9231   H HB2  . LEU A 1 253 ? -7.780  -42.422 5.266   1.00 5.01  ? 253 LEU A HB2  2  
ATOM 9232   H HB3  . LEU A 1 253 ? -7.348  -44.078 5.689   1.00 5.02  ? 253 LEU A HB3  2  
ATOM 9233   H HG   . LEU A 1 253 ? -10.022 -42.795 6.317   1.00 5.57  ? 253 LEU A HG   2  
ATOM 9234   H HD11 . LEU A 1 253 ? -9.558  -43.098 3.863   1.00 5.96  ? 253 LEU A HD11 2  
ATOM 9235   H HD12 . LEU A 1 253 ? -9.365  -44.825 4.166   1.00 6.11  ? 253 LEU A HD12 2  
ATOM 9236   H HD13 . LEU A 1 253 ? -10.922 -44.048 4.453   1.00 5.87  ? 253 LEU A HD13 2  
ATOM 9237   H HD21 . LEU A 1 253 ? -8.807  -45.501 6.818   1.00 5.81  ? 253 LEU A HD21 2  
ATOM 9238   H HD22 . LEU A 1 253 ? -9.882  -44.547 7.840   1.00 5.78  ? 253 LEU A HD22 2  
ATOM 9239   H HD23 . LEU A 1 253 ? -10.530 -45.416 6.453   1.00 5.87  ? 253 LEU A HD23 2  
ATOM 9240   N N    . ALA A 1 254 ? -5.600  -41.320 7.386   1.00 5.50  ? 254 ALA A N    2  
ATOM 9241   C CA   . ALA A 1 254 ? -4.135  -41.053 7.467   1.00 6.24  ? 254 ALA A CA   2  
ATOM 9242   C C    . ALA A 1 254 ? -3.745  -40.907 8.937   1.00 6.70  ? 254 ALA A C    2  
ATOM 9243   O O    . ALA A 1 254 ? -2.793  -41.503 9.401   1.00 7.37  ? 254 ALA A O    2  
ATOM 9244   C CB   . ALA A 1 254 ? -3.812  -39.756 6.720   1.00 6.30  ? 254 ALA A CB   2  
ATOM 9245   H H    . ALA A 1 254 ? -6.224  -40.569 7.307   1.00 5.10  ? 254 ALA A H    2  
ATOM 9246   H HA   . ALA A 1 254 ? -3.586  -41.873 7.024   1.00 6.59  ? 254 ALA A HA   2  
ATOM 9247   H HB1  . ALA A 1 254 ? -4.417  -38.953 7.115   1.00 6.48  ? 254 ALA A HB1  2  
ATOM 9248   H HB2  . ALA A 1 254 ? -2.767  -39.517 6.850   1.00 6.32  ? 254 ALA A HB2  2  
ATOM 9249   H HB3  . ALA A 1 254 ? -4.024  -39.883 5.668   1.00 6.42  ? 254 ALA A HB3  2  
ATOM 9250   N N    . LYS A 1 255 ? -4.485  -40.121 9.674   1.00 6.47  ? 255 LYS A N    2  
ATOM 9251   C CA   . LYS A 1 255 ? -4.179  -39.931 11.120  1.00 7.08  ? 255 LYS A CA   2  
ATOM 9252   C C    . LYS A 1 255 ? -2.717  -39.528 11.291  1.00 7.46  ? 255 LYS A C    2  
ATOM 9253   O O    . LYS A 1 255 ? -2.136  -39.697 12.344  1.00 8.01  ? 255 LYS A O    2  
ATOM 9254   C CB   . LYS A 1 255 ? -4.425  -41.238 11.873  1.00 6.96  ? 255 LYS A CB   2  
ATOM 9255   C CG   . LYS A 1 255 ? -5.900  -41.627 11.765  1.00 7.15  ? 255 LYS A CG   2  
ATOM 9256   C CD   . LYS A 1 255 ? -6.135  -42.937 12.521  1.00 7.28  ? 255 LYS A CD   2  
ATOM 9257   C CE   . LYS A 1 255 ? -7.608  -43.333 12.418  1.00 7.65  ? 255 LYS A CE   2  
ATOM 9258   N NZ   . LYS A 1 255 ? -7.882  -44.470 13.341  1.00 8.01  ? 255 LYS A NZ   2  
ATOM 9259   H H    . LYS A 1 255 ? -5.250  -39.658 9.273   1.00 6.00  ? 255 LYS A H    2  
ATOM 9260   H HA   . LYS A 1 255 ? -4.816  -39.158 11.524  1.00 7.51  ? 255 LYS A HA   2  
ATOM 9261   H HB2  . LYS A 1 255 ? -3.814  -42.016 11.444  1.00 6.73  ? 255 LYS A HB2  2  
ATOM 9262   H HB3  . LYS A 1 255 ? -4.165  -41.107 12.911  1.00 7.26  ? 255 LYS A HB3  2  
ATOM 9263   H HG2  . LYS A 1 255 ? -6.511  -40.846 12.195  1.00 7.56  ? 255 LYS A HG2  2  
ATOM 9264   H HG3  . LYS A 1 255 ? -6.165  -41.761 10.726  1.00 7.05  ? 255 LYS A HG3  2  
ATOM 9265   H HD2  . LYS A 1 255 ? -5.520  -43.715 12.094  1.00 7.13  ? 255 LYS A HD2  2  
ATOM 9266   H HD3  . LYS A 1 255 ? -5.874  -42.802 13.561  1.00 7.55  ? 255 LYS A HD3  2  
ATOM 9267   H HE2  . LYS A 1 255 ? -8.230  -42.492 12.687  1.00 7.78  ? 255 LYS A HE2  2  
ATOM 9268   H HE3  . LYS A 1 255 ? -7.829  -43.632 11.404  1.00 7.84  ? 255 LYS A HE3  2  
ATOM 9269   H HZ1  . LYS A 1 255 ? -7.072  -44.603 13.976  1.00 8.18  ? 255 LYS A HZ1  2  
ATOM 9270   H HZ2  . LYS A 1 255 ? -8.731  -44.263 13.904  1.00 8.30  ? 255 LYS A HZ2  2  
ATOM 9271   H HZ3  . LYS A 1 255 ? -8.036  -45.337 12.786  1.00 8.09  ? 255 LYS A HZ3  2  
ATOM 9272   N N    . LEU A 1 256 ? -2.113  -38.998 10.267  1.00 7.33  ? 256 LEU A N    2  
ATOM 9273   C CA   . LEU A 1 256 ? -0.683  -38.591 10.382  1.00 7.85  ? 256 LEU A CA   2  
ATOM 9274   C C    . LEU A 1 256 ? 0.115   -39.758 10.967  1.00 8.47  ? 256 LEU A C    2  
ATOM 9275   O O    . LEU A 1 256 ? 1.120   -39.577 11.625  1.00 9.05  ? 256 LEU A O    2  
ATOM 9276   C CB   . LEU A 1 256 ? -0.583  -37.396 11.323  1.00 7.76  ? 256 LEU A CB   2  
ATOM 9277   C CG   . LEU A 1 256 ? -1.593  -36.320 10.910  1.00 7.82  ? 256 LEU A CG   2  
ATOM 9278   C CD1  . LEU A 1 256 ? -1.480  -35.128 11.864  1.00 8.10  ? 256 LEU A CD1  2  
ATOM 9279   C CD2  . LEU A 1 256 ? -1.306  -35.857 9.476   1.00 8.05  ? 256 LEU A CD2  2  
ATOM 9280   H H    . LEU A 1 256 ? -2.596  -38.875 9.425   1.00 7.00  ? 256 LEU A H    2  
ATOM 9281   H HA   . LEU A 1 256 ? -0.292  -38.331 9.410   1.00 8.05  ? 256 LEU A HA   2  
ATOM 9282   H HB2  . LEU A 1 256 ? -0.795  -37.723 12.330  1.00 7.62  ? 256 LEU A HB2  2  
ATOM 9283   H HB3  . LEU A 1 256 ? 0.414   -36.988 11.280  1.00 8.08  ? 256 LEU A HB3  2  
ATOM 9284   H HG   . LEU A 1 256 ? -2.593  -36.728 10.965  1.00 7.87  ? 256 LEU A HG   2  
ATOM 9285   H HD11 . LEU A 1 256 ? -1.552  -35.475 12.885  1.00 8.13  ? 256 LEU A HD11 2  
ATOM 9286   H HD12 . LEU A 1 256 ? -0.530  -34.637 11.717  1.00 8.28  ? 256 LEU A HD12 2  
ATOM 9287   H HD13 . LEU A 1 256 ? -2.281  -34.430 11.664  1.00 8.36  ? 256 LEU A HD13 2  
ATOM 9288   H HD21 . LEU A 1 256 ? -0.241  -35.755 9.334   1.00 8.28  ? 256 LEU A HD21 2  
ATOM 9289   H HD22 . LEU A 1 256 ? -1.694  -36.585 8.779   1.00 8.17  ? 256 LEU A HD22 2  
ATOM 9290   H HD23 . LEU A 1 256 ? -1.786  -34.904 9.300   1.00 8.18  ? 256 LEU A HD23 2  
ATOM 9291   N N    . LYS A 1 257 ? -0.342  -40.952 10.726  1.00 8.53  ? 257 LYS A N    2  
ATOM 9292   C CA   . LYS A 1 257 ? 0.361   -42.158 11.257  1.00 9.34  ? 257 LYS A CA   2  
ATOM 9293   C C    . LYS A 1 257 ? 0.720   -41.940 12.729  1.00 9.86  ? 257 LYS A C    2  
ATOM 9294   O O    . LYS A 1 257 ? 0.319   -40.971 13.342  1.00 10.56 ? 257 LYS A O    2  
ATOM 9295   C CB   . LYS A 1 257 ? 1.643   -42.400 10.455  1.00 9.48  ? 257 LYS A CB   2  
ATOM 9296   C CG   . LYS A 1 257 ? 1.286   -42.869 9.043   1.00 9.24  ? 257 LYS A CG   2  
ATOM 9297   C CD   . LYS A 1 257 ? 2.561   -42.984 8.197   1.00 9.67  ? 257 LYS A CD   2  
ATOM 9298   C CE   . LYS A 1 257 ? 3.432   -44.141 8.703   1.00 9.79  ? 257 LYS A CE   2  
ATOM 9299   N NZ   . LYS A 1 257 ? 4.388   -44.545 7.632   1.00 10.04 ? 257 LYS A NZ   2  
ATOM 9300   H H    . LYS A 1 257 ? -1.151  -41.048 10.188  1.00 8.16  ? 257 LYS A H    2  
ATOM 9301   H HA   . LYS A 1 257 ? -0.286  -43.018 11.168  1.00 9.65  ? 257 LYS A HA   2  
ATOM 9302   H HB2  . LYS A 1 257 ? 2.210   -41.482 10.399  1.00 9.27  ? 257 LYS A HB2  2  
ATOM 9303   H HB3  . LYS A 1 257 ? 2.232   -43.158 10.947  1.00 10.15 ? 257 LYS A HB3  2  
ATOM 9304   H HG2  . LYS A 1 257 ? 0.795   -43.830 9.095   1.00 9.55  ? 257 LYS A HG2  2  
ATOM 9305   H HG3  . LYS A 1 257 ? 0.619   -42.152 8.586   1.00 8.62  ? 257 LYS A HG3  2  
ATOM 9306   H HD2  . LYS A 1 257 ? 2.291   -43.163 7.166   1.00 9.81  ? 257 LYS A HD2  2  
ATOM 9307   H HD3  . LYS A 1 257 ? 3.119   -42.061 8.264   1.00 9.97  ? 257 LYS A HD3  2  
ATOM 9308   H HE2  . LYS A 1 257 ? 3.987   -43.822 9.572   1.00 9.79  ? 257 LYS A HE2  2  
ATOM 9309   H HE3  . LYS A 1 257 ? 2.807   -44.982 8.961   1.00 9.95  ? 257 LYS A HE3  2  
ATOM 9310   H HZ1  . LYS A 1 257 ? 4.400   -43.818 6.886   1.00 10.08 ? 257 LYS A HZ1  2  
ATOM 9311   H HZ2  . LYS A 1 257 ? 5.341   -44.644 8.036   1.00 10.27 ? 257 LYS A HZ2  2  
ATOM 9312   H HZ3  . LYS A 1 257 ? 4.090   -45.454 7.226   1.00 10.18 ? 257 LYS A HZ3  2  
ATOM 9313   N N    . ASP A 1 258 ? 1.477   -42.838 13.302  1.00 9.69  ? 258 ASP A N    2  
ATOM 9314   C CA   . ASP A 1 258 ? 1.873   -42.695 14.727  1.00 10.39 ? 258 ASP A CA   2  
ATOM 9315   C C    . ASP A 1 258 ? 3.230   -43.369 14.917  1.00 10.68 ? 258 ASP A C    2  
ATOM 9316   O O    . ASP A 1 258 ? 4.198   -43.037 14.263  1.00 11.32 ? 258 ASP A O    2  
ATOM 9317   C CB   . ASP A 1 258 ? 0.828   -43.372 15.617  1.00 10.40 ? 258 ASP A CB   2  
ATOM 9318   C CG   . ASP A 1 258 ? -0.489  -42.598 15.537  1.00 10.43 ? 258 ASP A CG   2  
ATOM 9319   O OD1  . ASP A 1 258 ? -0.445  -41.382 15.625  1.00 10.51 ? 258 ASP A OD1  2  
ATOM 9320   O OD2  . ASP A 1 258 ? -1.519  -43.233 15.385  1.00 10.57 ? 258 ASP A OD2  2  
ATOM 9321   H H    . ASP A 1 258 ? 1.791   -43.613 12.792  1.00 9.22  ? 258 ASP A H    2  
ATOM 9322   H HA   . ASP A 1 258 ? 1.950   -41.647 14.985  1.00 10.89 ? 258 ASP A HA   2  
ATOM 9323   H HB2  . ASP A 1 258 ? 0.671   -44.387 15.279  1.00 9.98  ? 258 ASP A HB2  2  
ATOM 9324   H HB3  . ASP A 1 258 ? 1.175   -43.381 16.639  1.00 11.00 ? 258 ASP A HB3  2  
ATOM 9325   N N    . ARG A 1 259 ? 3.311   -44.312 15.808  1.00 10.38 ? 259 ARG A N    2  
ATOM 9326   C CA   . ARG A 1 259 ? 4.609   -45.004 16.039  1.00 10.85 ? 259 ARG A CA   2  
ATOM 9327   C C    . ARG A 1 259 ? 4.366   -46.298 16.818  1.00 11.04 ? 259 ARG A C    2  
ATOM 9328   O O    . ARG A 1 259 ? 4.098   -46.210 18.004  1.00 11.20 ? 259 ARG A O    2  
ATOM 9329   C CB   . ARG A 1 259 ? 5.534   -44.089 16.844  1.00 10.75 ? 259 ARG A CB   2  
ATOM 9330   C CG   . ARG A 1 259 ? 6.946   -44.676 16.864  1.00 11.03 ? 259 ARG A CG   2  
ATOM 9331   C CD   . ARG A 1 259 ? 7.864   -43.755 17.672  1.00 11.23 ? 259 ARG A CD   2  
ATOM 9332   N NE   . ARG A 1 259 ? 9.300   -44.102 17.406  1.00 11.63 ? 259 ARG A NE   2  
ATOM 9333   C CZ   . ARG A 1 259 ? 9.761   -45.313 17.581  1.00 11.88 ? 259 ARG A CZ   2  
ATOM 9334   N NH1  . ARG A 1 259 ? 9.039   -46.219 18.180  1.00 11.80 ? 259 ARG A NH1  2  
ATOM 9335   N NH2  . ARG A 1 259 ? 10.977  -45.601 17.204  1.00 12.42 ? 259 ARG A NH2  2  
ATOM 9336   O OXT  . ARG A 1 259 ? 4.452   -47.356 16.215  1.00 11.20 ? 259 ARG A OXT  2  
ATOM 9337   H H    . ARG A 1 259 ? 2.521   -44.558 16.327  1.00 9.95  ? 259 ARG A H    2  
ATOM 9338   H HA   . ARG A 1 259 ? 5.068   -45.236 15.089  1.00 11.34 ? 259 ARG A HA   2  
ATOM 9339   H HB2  . ARG A 1 259 ? 5.558   -43.110 16.388  1.00 10.61 ? 259 ARG A HB2  2  
ATOM 9340   H HB3  . ARG A 1 259 ? 5.166   -44.006 17.855  1.00 10.87 ? 259 ARG A HB3  2  
ATOM 9341   H HG2  . ARG A 1 259 ? 6.915   -45.655 17.313  1.00 11.30 ? 259 ARG A HG2  2  
ATOM 9342   H HG3  . ARG A 1 259 ? 7.317   -44.755 15.853  1.00 11.06 ? 259 ARG A HG3  2  
ATOM 9343   H HD2  . ARG A 1 259 ? 7.711   -42.740 17.360  1.00 11.30 ? 259 ARG A HD2  2  
ATOM 9344   H HD3  . ARG A 1 259 ? 7.619   -43.842 18.728  1.00 11.24 ? 259 ARG A HD3  2  
ATOM 9345   H HE   . ARG A 1 259 ? 9.896   -43.414 17.042  1.00 11.85 ? 259 ARG A HE   2  
ATOM 9346   H HH11 . ARG A 1 259 ? 8.128   -45.990 18.517  1.00 11.53 ? 259 ARG A HH11 2  
ATOM 9347   H HH12 . ARG A 1 259 ? 9.401   -47.143 18.304  1.00 12.13 ? 259 ARG A HH12 2  
ATOM 9348   H HH21 . ARG A 1 259 ? 11.549  -44.896 16.785  1.00 12.63 ? 259 ARG A HH21 2  
ATOM 9349   H HH22 . ARG A 1 259 ? 11.335  -46.525 17.332  1.00 12.74 ? 259 ARG A HH22 2  
ATOM 9350   N N    . MET B 2 1   ? 24.059  23.890  13.376  1.00 0.00  ? 301 MET B N    2  
ATOM 9351   C CA   . MET B 2 1   ? 23.392  22.722  12.736  1.00 0.00  ? 301 MET B CA   2  
ATOM 9352   C C    . MET B 2 1   ? 23.630  21.471  13.585  1.00 0.00  ? 301 MET B C    2  
ATOM 9353   O O    . MET B 2 1   ? 24.450  21.460  14.482  1.00 0.00  ? 301 MET B O    2  
ATOM 9354   C CB   . MET B 2 1   ? 23.965  22.515  11.329  1.00 0.00  ? 301 MET B CB   2  
ATOM 9355   C CG   . MET B 2 1   ? 23.185  21.413  10.601  1.00 0.00  ? 301 MET B CG   2  
ATOM 9356   S SD   . MET B 2 1   ? 23.560  21.480  8.831   1.00 0.00  ? 301 MET B SD   2  
ATOM 9357   C CE   . MET B 2 1   ? 25.261  20.870  8.932   1.00 0.00  ? 301 MET B CE   2  
ATOM 9358   H H1   . MET B 2 1   ? 24.640  23.564  14.173  1.00 0.00  ? 301 MET B H1   2  
ATOM 9359   H H2   . MET B 2 1   ? 24.665  24.368  12.680  1.00 0.00  ? 301 MET B H2   2  
ATOM 9360   H H3   . MET B 2 1   ? 23.336  24.555  13.722  1.00 0.00  ? 301 MET B H3   2  
ATOM 9361   H HA   . MET B 2 1   ? 22.330  22.910  12.666  1.00 0.00  ? 301 MET B HA   2  
ATOM 9362   H HB2  . MET B 2 1   ? 23.890  23.437  10.772  1.00 0.00  ? 301 MET B HB2  2  
ATOM 9363   H HB3  . MET B 2 1   ? 25.002  22.226  11.405  1.00 0.00  ? 301 MET B HB3  2  
ATOM 9364   H HG2  . MET B 2 1   ? 23.475  20.449  10.987  1.00 0.00  ? 301 MET B HG2  2  
ATOM 9365   H HG3  . MET B 2 1   ? 22.126  21.559  10.752  1.00 0.00  ? 301 MET B HG3  2  
ATOM 9366   H HE1  . MET B 2 1   ? 25.301  20.016  9.587   1.00 0.00  ? 301 MET B HE1  2  
ATOM 9367   H HE2  . MET B 2 1   ? 25.597  20.580  7.946   1.00 0.00  ? 301 MET B HE2  2  
ATOM 9368   H HE3  . MET B 2 1   ? 25.899  21.651  9.322   1.00 0.00  ? 301 MET B HE3  2  
ATOM 9369   N N    . PHE B 2 2   ? 22.921  20.417  13.298  1.00 0.00  ? 302 PHE B N    2  
ATOM 9370   C CA   . PHE B 2 2   ? 23.097  19.153  14.070  1.00 0.00  ? 302 PHE B CA   2  
ATOM 9371   C C    . PHE B 2 2   ? 22.779  17.974  13.144  1.00 0.00  ? 302 PHE B C    2  
ATOM 9372   O O    . PHE B 2 2   ? 21.955  18.086  12.257  1.00 0.00  ? 302 PHE B O    2  
ATOM 9373   C CB   . PHE B 2 2   ? 22.136  19.161  15.266  1.00 0.00  ? 302 PHE B CB   2  
ATOM 9374   C CG   . PHE B 2 2   ? 22.593  18.162  16.303  1.00 0.00  ? 302 PHE B CG   2  
ATOM 9375   C CD1  . PHE B 2 2   ? 22.328  16.805  16.121  1.00 0.00  ? 302 PHE B CD1  2  
ATOM 9376   C CD2  . PHE B 2 2   ? 23.276  18.594  17.448  1.00 0.00  ? 302 PHE B CD2  2  
ATOM 9377   C CE1  . PHE B 2 2   ? 22.742  15.872  17.077  1.00 0.00  ? 302 PHE B CE1  2  
ATOM 9378   C CE2  . PHE B 2 2   ? 23.691  17.663  18.407  1.00 0.00  ? 302 PHE B CE2  2  
ATOM 9379   C CZ   . PHE B 2 2   ? 23.424  16.300  18.222  1.00 0.00  ? 302 PHE B CZ   2  
ATOM 9380   H H    . PHE B 2 2   ? 22.279  20.460  12.557  1.00 0.00  ? 302 PHE B H    2  
ATOM 9381   H HA   . PHE B 2 2   ? 24.118  19.075  14.419  1.00 0.00  ? 302 PHE B HA   2  
ATOM 9382   H HB2  . PHE B 2 2   ? 22.118  20.148  15.703  1.00 0.00  ? 302 PHE B HB2  2  
ATOM 9383   H HB3  . PHE B 2 2   ? 21.142  18.899  14.932  1.00 0.00  ? 302 PHE B HB3  2  
ATOM 9384   H HD1  . PHE B 2 2   ? 21.808  16.478  15.238  1.00 0.00  ? 302 PHE B HD1  2  
ATOM 9385   H HD2  . PHE B 2 2   ? 23.481  19.645  17.590  1.00 0.00  ? 302 PHE B HD2  2  
ATOM 9386   H HE1  . PHE B 2 2   ? 22.534  14.821  16.933  1.00 0.00  ? 302 PHE B HE1  2  
ATOM 9387   H HE2  . PHE B 2 2   ? 24.219  17.994  19.289  1.00 0.00  ? 302 PHE B HE2  2  
ATOM 9388   H HZ   . PHE B 2 2   ? 23.742  15.582  18.961  1.00 0.00  ? 302 PHE B HZ   2  
ATOM 9389   N N    . GLN B 2 3   ? 23.433  16.852  13.316  1.00 0.00  ? 303 GLN B N    2  
ATOM 9390   C CA   . GLN B 2 3   ? 23.159  15.692  12.408  1.00 0.00  ? 303 GLN B CA   2  
ATOM 9391   C C    . GLN B 2 3   ? 23.333  14.366  13.152  1.00 0.00  ? 303 GLN B C    2  
ATOM 9392   O O    . GLN B 2 3   ? 24.020  14.280  14.150  1.00 0.00  ? 303 GLN B O    2  
ATOM 9393   C CB   . GLN B 2 3   ? 24.133  15.741  11.226  1.00 0.00  ? 303 GLN B CB   2  
ATOM 9394   C CG   . GLN B 2 3   ? 25.576  15.661  11.738  1.00 0.00  ? 303 GLN B CG   2  
ATOM 9395   C CD   . GLN B 2 3   ? 26.542  15.767  10.556  1.00 0.00  ? 303 GLN B CD   2  
ATOM 9396   O OE1  . GLN B 2 3   ? 26.375  16.608  9.695   1.00 0.00  ? 303 GLN B OE1  2  
ATOM 9397   N NE2  . GLN B 2 3   ? 27.552  14.945  10.480  1.00 0.00  ? 303 GLN B NE2  2  
ATOM 9398   H H    . GLN B 2 3   ? 24.115  16.784  14.016  1.00 0.00  ? 303 GLN B H    2  
ATOM 9399   H HA   . GLN B 2 3   ? 22.150  15.755  12.036  1.00 0.00  ? 303 GLN B HA   2  
ATOM 9400   H HB2  . GLN B 2 3   ? 23.939  14.907  10.566  1.00 0.00  ? 303 GLN B HB2  2  
ATOM 9401   H HB3  . GLN B 2 3   ? 23.997  16.665  10.686  1.00 0.00  ? 303 GLN B HB3  2  
ATOM 9402   H HG2  . GLN B 2 3   ? 25.757  16.472  12.427  1.00 0.00  ? 303 GLN B HG2  2  
ATOM 9403   H HG3  . GLN B 2 3   ? 25.731  14.719  12.240  1.00 0.00  ? 303 GLN B HG3  2  
ATOM 9404   H HE21 . GLN B 2 3   ? 27.686  14.266  11.174  1.00 0.00  ? 303 GLN B HE21 2  
ATOM 9405   H HE22 . GLN B 2 3   ? 28.176  15.005  9.727   1.00 0.00  ? 303 GLN B HE22 2  
ATOM 9406   N N    . GLN B 2 4   ? 22.703  13.330  12.658  1.00 0.00  ? 304 GLN B N    2  
ATOM 9407   C CA   . GLN B 2 4   ? 22.808  11.993  13.308  1.00 0.00  ? 304 GLN B CA   2  
ATOM 9408   C C    . GLN B 2 4   ? 22.577  10.898  12.255  1.00 0.00  ? 304 GLN B C    2  
ATOM 9409   O O    . GLN B 2 4   ? 21.827  11.090  11.317  1.00 0.00  ? 304 GLN B O    2  
ATOM 9410   C CB   . GLN B 2 4   ? 21.741  11.885  14.398  1.00 0.00  ? 304 GLN B CB   2  
ATOM 9411   C CG   . GLN B 2 4   ? 21.975  10.619  15.225  1.00 0.00  ? 304 GLN B CG   2  
ATOM 9412   C CD   . GLN B 2 4   ? 23.249  10.780  16.057  1.00 0.00  ? 304 GLN B CD   2  
ATOM 9413   O OE1  . GLN B 2 4   ? 23.305  11.601  16.951  1.00 0.00  ? 304 GLN B OE1  2  
ATOM 9414   N NE2  . GLN B 2 4   ? 24.279  10.020  15.803  1.00 0.00  ? 304 GLN B NE2  2  
ATOM 9415   H H    . GLN B 2 4   ? 22.160  13.436  11.849  1.00 0.00  ? 304 GLN B H    2  
ATOM 9416   H HA   . GLN B 2 4   ? 23.784  11.879  13.748  1.00 0.00  ? 304 GLN B HA   2  
ATOM 9417   H HB2  . GLN B 2 4   ? 21.798  12.751  15.043  1.00 0.00  ? 304 GLN B HB2  2  
ATOM 9418   H HB3  . GLN B 2 4   ? 20.766  11.840  13.941  1.00 0.00  ? 304 GLN B HB3  2  
ATOM 9419   H HG2  . GLN B 2 4   ? 21.132  10.459  15.882  1.00 0.00  ? 304 GLN B HG2  2  
ATOM 9420   H HG3  . GLN B 2 4   ? 22.082  9.772   14.564  1.00 0.00  ? 304 GLN B HG3  2  
ATOM 9421   H HE21 . GLN B 2 4   ? 24.231  9.354   15.086  1.00 0.00  ? 304 GLN B HE21 2  
ATOM 9422   H HE22 . GLN B 2 4   ? 25.100  10.116  16.330  1.00 0.00  ? 304 GLN B HE22 2  
ATOM 9423   N N    . GLU B 2 5   ? 23.197  9.745   12.407  1.00 0.00  ? 305 GLU B N    2  
ATOM 9424   C CA   . GLU B 2 5   ? 22.997  8.627   11.425  1.00 0.00  ? 305 GLU B CA   2  
ATOM 9425   C C    . GLU B 2 5   ? 22.259  7.478   12.100  1.00 0.00  ? 305 GLU B C    2  
ATOM 9426   O O    . GLU B 2 5   ? 22.595  7.076   13.196  1.00 0.00  ? 305 GLU B O    2  
ATOM 9427   C CB   . GLU B 2 5   ? 24.340  8.108   10.918  1.00 0.00  ? 305 GLU B CB   2  
ATOM 9428   C CG   . GLU B 2 5   ? 24.992  9.153   10.017  1.00 0.00  ? 305 GLU B CG   2  
ATOM 9429   C CD   . GLU B 2 5   ? 26.338  8.625   9.514   1.00 0.00  ? 305 GLU B CD   2  
ATOM 9430   O OE1  . GLU B 2 5   ? 26.773  7.601   10.012  1.00 0.00  ? 305 GLU B OE1  2  
ATOM 9431   O OE2  . GLU B 2 5   ? 26.907  9.253   8.637   1.00 0.00  ? 305 GLU B OE2  2  
ATOM 9432   H H    . GLU B 2 5   ? 23.780  9.607   13.174  1.00 0.00  ? 305 GLU B H    2  
ATOM 9433   H HA   . GLU B 2 5   ? 22.415  8.974   10.597  1.00 0.00  ? 305 GLU B HA   2  
ATOM 9434   H HB2  . GLU B 2 5   ? 24.985  7.898   11.757  1.00 0.00  ? 305 GLU B HB2  2  
ATOM 9435   H HB3  . GLU B 2 5   ? 24.174  7.202   10.354  1.00 0.00  ? 305 GLU B HB3  2  
ATOM 9436   H HG2  . GLU B 2 5   ? 24.346  9.348   9.176   1.00 0.00  ? 305 GLU B HG2  2  
ATOM 9437   H HG3  . GLU B 2 5   ? 25.148  10.065  10.573  1.00 0.00  ? 305 GLU B HG3  2  
ATOM 9438   N N    . VAL B 2 6   ? 21.223  6.977   11.469  1.00 0.00  ? 306 VAL B N    2  
ATOM 9439   C CA   . VAL B 2 6   ? 20.420  5.875   12.106  1.00 0.00  ? 306 VAL B CA   2  
ATOM 9440   C C    . VAL B 2 6   ? 20.146  4.720   11.128  1.00 0.00  ? 306 VAL B C    2  
ATOM 9441   O O    . VAL B 2 6   ? 19.648  4.903   10.034  1.00 0.00  ? 306 VAL B O    2  
ATOM 9442   C CB   . VAL B 2 6   ? 19.098  6.480   12.613  1.00 0.00  ? 306 VAL B CB   2  
ATOM 9443   C CG1  . VAL B 2 6   ? 18.502  7.391   11.543  1.00 0.00  ? 306 VAL B CG1  2  
ATOM 9444   C CG2  . VAL B 2 6   ? 18.086  5.378   12.950  1.00 0.00  ? 306 VAL B CG2  2  
ATOM 9445   H H    . VAL B 2 6   ? 20.949  7.374   10.607  1.00 0.00  ? 306 VAL B H    2  
ATOM 9446   H HA   . VAL B 2 6   ? 20.958  5.475   12.954  1.00 0.00  ? 306 VAL B HA   2  
ATOM 9447   H HB   . VAL B 2 6   ? 19.298  7.064   13.500  1.00 0.00  ? 306 VAL B HB   2  
ATOM 9448   H HG11 . VAL B 2 6   ? 18.349  6.828   10.634  1.00 0.00  ? 306 VAL B HG11 2  
ATOM 9449   H HG12 . VAL B 2 6   ? 17.559  7.779   11.894  1.00 0.00  ? 306 VAL B HG12 2  
ATOM 9450   H HG13 . VAL B 2 6   ? 19.176  8.214   11.350  1.00 0.00  ? 306 VAL B HG13 2  
ATOM 9451   H HG21 . VAL B 2 6   ? 18.551  4.641   13.589  1.00 0.00  ? 306 VAL B HG21 2  
ATOM 9452   H HG22 . VAL B 2 6   ? 17.244  5.817   13.462  1.00 0.00  ? 306 VAL B HG22 2  
ATOM 9453   H HG23 . VAL B 2 6   ? 17.744  4.905   12.041  1.00 0.00  ? 306 VAL B HG23 2  
ATOM 9454   N N    . THR B 2 7   ? 20.520  3.534   11.538  1.00 0.00  ? 307 THR B N    2  
ATOM 9455   C CA   . THR B 2 7   ? 20.351  2.324   10.680  1.00 0.00  ? 307 THR B CA   2  
ATOM 9456   C C    . THR B 2 7   ? 18.892  1.852   10.687  1.00 0.00  ? 307 THR B C    2  
ATOM 9457   O O    . THR B 2 7   ? 18.398  1.301   11.649  1.00 0.00  ? 307 THR B O    2  
ATOM 9458   C CB   . THR B 2 7   ? 21.241  1.206   11.230  1.00 0.00  ? 307 THR B CB   2  
ATOM 9459   O OG1  . THR B 2 7   ? 22.557  1.701   11.430  1.00 0.00  ? 307 THR B OG1  2  
ATOM 9460   C CG2  . THR B 2 7   ? 21.274  0.043   10.242  1.00 0.00  ? 307 THR B CG2  2  
ATOM 9461   H H    . THR B 2 7   ? 20.987  3.468   12.395  1.00 0.00  ? 307 THR B H    2  
ATOM 9462   H HA   . THR B 2 7   ? 20.647  2.549   9.673   1.00 0.00  ? 307 THR B HA   2  
ATOM 9463   H HB   . THR B 2 7   ? 20.842  0.861   12.172  1.00 0.00  ? 307 THR B HB   2  
ATOM 9464   H HG1  . THR B 2 7   ? 22.558  2.224   12.234  1.00 0.00  ? 307 THR B HG1  2  
ATOM 9465   H HG21 . THR B 2 7   ? 21.628  0.393   9.284   1.00 0.00  ? 307 THR B HG21 2  
ATOM 9466   H HG22 . THR B 2 7   ? 21.937  -0.725  10.614  1.00 0.00  ? 307 THR B HG22 2  
ATOM 9467   H HG23 . THR B 2 7   ? 20.280  -0.360  10.136  1.00 0.00  ? 307 THR B HG23 2  
ATOM 9468   N N    . ILE B 2 8   ? 18.201  2.116   9.610   1.00 0.00  ? 308 ILE B N    2  
ATOM 9469   C CA   . ILE B 2 8   ? 16.757  1.746   9.512   1.00 0.00  ? 308 ILE B CA   2  
ATOM 9470   C C    . ILE B 2 8   ? 16.546  0.266   9.839   1.00 0.00  ? 308 ILE B C    2  
ATOM 9471   O O    . ILE B 2 8   ? 17.141  -0.620  9.260   1.00 0.00  ? 308 ILE B O    2  
ATOM 9472   C CB   . ILE B 2 8   ? 16.255  2.052   8.100   1.00 0.00  ? 308 ILE B CB   2  
ATOM 9473   C CG1  . ILE B 2 8   ? 16.375  3.558   7.861   1.00 0.00  ? 308 ILE B CG1  2  
ATOM 9474   C CG2  . ILE B 2 8   ? 14.787  1.628   7.964   1.00 0.00  ? 308 ILE B CG2  2  
ATOM 9475   C CD1  . ILE B 2 8   ? 16.120  3.864   6.389   1.00 0.00  ? 308 ILE B CD1  2  
ATOM 9476   H H    . ILE B 2 8   ? 18.639  2.626   8.895   1.00 0.00  ? 308 ILE B H    2  
ATOM 9477   H HA   . ILE B 2 8   ? 16.193  2.339   10.218  1.00 0.00  ? 308 ILE B HA   2  
ATOM 9478   H HB   . ILE B 2 8   ? 16.859  1.520   7.375   1.00 0.00  ? 308 ILE B HB   2  
ATOM 9479   H HG12 . ILE B 2 8   ? 15.648  4.077   8.468   1.00 0.00  ? 308 ILE B HG12 2  
ATOM 9480   H HG13 . ILE B 2 8   ? 17.368  3.886   8.128   1.00 0.00  ? 308 ILE B HG13 2  
ATOM 9481   H HG21 . ILE B 2 8   ? 14.209  2.072   8.761   1.00 0.00  ? 308 ILE B HG21 2  
ATOM 9482   H HG22 . ILE B 2 8   ? 14.403  1.963   7.013   1.00 0.00  ? 308 ILE B HG22 2  
ATOM 9483   H HG23 . ILE B 2 8   ? 14.712  0.552   8.022   1.00 0.00  ? 308 ILE B HG23 2  
ATOM 9484   H HD11 . ILE B 2 8   ? 16.799  3.291   5.779   1.00 0.00  ? 308 ILE B HD11 2  
ATOM 9485   H HD12 . ILE B 2 8   ? 15.102  3.604   6.139   1.00 0.00  ? 308 ILE B HD12 2  
ATOM 9486   H HD13 . ILE B 2 8   ? 16.276  4.918   6.210   1.00 0.00  ? 308 ILE B HD13 2  
ATOM 9487   N N    . THR B 2 9   ? 15.686  0.024   10.796  1.00 0.00  ? 309 THR B N    2  
ATOM 9488   C CA   . THR B 2 9   ? 15.379  -1.370  11.244  1.00 0.00  ? 309 THR B CA   2  
ATOM 9489   C C    . THR B 2 9   ? 13.940  -1.725  10.872  1.00 0.00  ? 309 THR B C    2  
ATOM 9490   O O    . THR B 2 9   ? 13.355  -2.632  11.431  1.00 0.00  ? 309 THR B O    2  
ATOM 9491   C CB   . THR B 2 9   ? 15.536  -1.463  12.763  1.00 0.00  ? 309 THR B CB   2  
ATOM 9492   O OG1  . THR B 2 9   ? 14.601  -0.594  13.386  1.00 0.00  ? 309 THR B OG1  2  
ATOM 9493   C CG2  . THR B 2 9   ? 16.954  -1.054  13.160  1.00 0.00  ? 309 THR B CG2  2  
ATOM 9494   H H    . THR B 2 9   ? 15.260  0.795   11.225  1.00 0.00  ? 309 THR B H    2  
ATOM 9495   H HA   . THR B 2 9   ? 16.055  -2.070  10.770  1.00 0.00  ? 309 THR B HA   2  
ATOM 9496   H HB   . THR B 2 9   ? 15.356  -2.478  13.083  1.00 0.00  ? 309 THR B HB   2  
ATOM 9497   H HG1  . THR B 2 9   ? 14.216  -0.035  12.707  1.00 0.00  ? 309 THR B HG1  2  
ATOM 9498   H HG21 . THR B 2 9   ? 17.665  -1.525  12.496  1.00 0.00  ? 309 THR B HG21 2  
ATOM 9499   H HG22 . THR B 2 9   ? 17.052  0.019   13.089  1.00 0.00  ? 309 THR B HG22 2  
ATOM 9500   H HG23 . THR B 2 9   ? 17.148  -1.367  14.175  1.00 0.00  ? 309 THR B HG23 2  
ATOM 9501   N N    . ALA B 2 10  ? 13.360  -1.029  9.936   1.00 0.00  ? 310 ALA B N    2  
ATOM 9502   C CA   . ALA B 2 10  ? 11.960  -1.350  9.543   1.00 0.00  ? 310 ALA B CA   2  
ATOM 9503   C C    . ALA B 2 10  ? 11.932  -2.751  8.891   1.00 0.00  ? 310 ALA B C    2  
ATOM 9504   O O    . ALA B 2 10  ? 12.567  -2.952  7.880   1.00 0.00  ? 310 ALA B O    2  
ATOM 9505   C CB   . ALA B 2 10  ? 11.478  -0.308  8.529   1.00 0.00  ? 310 ALA B CB   2  
ATOM 9506   H H    . ALA B 2 10  ? 13.845  -0.304  9.481   1.00 0.00  ? 310 ALA B H    2  
ATOM 9507   H HA   . ALA B 2 10  ? 11.335  -1.311  10.415  1.00 0.00  ? 310 ALA B HA   2  
ATOM 9508   H HB1  . ALA B 2 10  ? 12.279  -0.080  7.842   1.00 0.00  ? 310 ALA B HB1  2  
ATOM 9509   H HB2  . ALA B 2 10  ? 10.633  -0.699  7.979   1.00 0.00  ? 310 ALA B HB2  2  
ATOM 9510   H HB3  . ALA B 2 10  ? 11.184  0.591   9.048   1.00 0.00  ? 310 ALA B HB3  2  
ATOM 9511   N N    . PRO B 2 11  ? 11.221  -3.728  9.434   1.00 0.00  ? 311 PRO B N    2  
ATOM 9512   C CA   . PRO B 2 11  ? 11.202  -5.081  8.802   1.00 0.00  ? 311 PRO B CA   2  
ATOM 9513   C C    . PRO B 2 11  ? 10.905  -5.028  7.294   1.00 0.00  ? 311 PRO B C    2  
ATOM 9514   O O    . PRO B 2 11  ? 11.286  -5.907  6.548   1.00 0.00  ? 311 PRO B O    2  
ATOM 9515   C CB   . PRO B 2 11  ? 10.074  -5.788  9.576   1.00 0.00  ? 311 PRO B CB   2  
ATOM 9516   C CG   . PRO B 2 11  ? 9.806   -4.986  10.860  1.00 0.00  ? 311 PRO B CG   2  
ATOM 9517   C CD   . PRO B 2 11  ? 10.402  -3.579  10.676  1.00 0.00  ? 311 PRO B CD   2  
ATOM 9518   H HA   . PRO B 2 11  ? 12.135  -5.588  8.982   1.00 0.00  ? 311 PRO B HA   2  
ATOM 9519   H HB2  . PRO B 2 11  ? 9.175   -5.823  8.971   1.00 0.00  ? 311 PRO B HB2  2  
ATOM 9520   H HB3  . PRO B 2 11  ? 10.375  -6.796  9.831   1.00 0.00  ? 311 PRO B HB3  2  
ATOM 9521   H HG2  . PRO B 2 11  ? 8.739   -4.919  11.036  1.00 0.00  ? 311 PRO B HG2  2  
ATOM 9522   H HG3  . PRO B 2 11  ? 10.281  -5.473  11.702  1.00 0.00  ? 311 PRO B HG3  2  
ATOM 9523   H HD2  . PRO B 2 11  ? 9.614   -2.848  10.535  1.00 0.00  ? 311 PRO B HD2  2  
ATOM 9524   H HD3  . PRO B 2 11  ? 11.032  -3.314  11.512  1.00 0.00  ? 311 PRO B HD3  2  
ATOM 9525   N N    . ASN B 2 12  ? 10.218  -4.003  6.854   1.00 0.00  ? 312 ASN B N    2  
ATOM 9526   C CA   . ASN B 2 12  ? 9.871   -3.869  5.403   1.00 0.00  ? 312 ASN B CA   2  
ATOM 9527   C C    . ASN B 2 12  ? 10.463  -2.571  4.859   1.00 0.00  ? 312 ASN B C    2  
ATOM 9528   O O    . ASN B 2 12  ? 10.055  -2.081  3.824   1.00 0.00  ? 312 ASN B O    2  
ATOM 9529   C CB   . ASN B 2 12  ? 8.347   -3.823  5.255   1.00 0.00  ? 312 ASN B CB   2  
ATOM 9530   C CG   . ASN B 2 12  ? 7.754   -5.171  5.672   1.00 0.00  ? 312 ASN B CG   2  
ATOM 9531   O OD1  . ASN B 2 12  ? 8.412   -6.189  5.588   1.00 0.00  ? 312 ASN B OD1  2  
ATOM 9532   N ND2  . ASN B 2 12  ? 6.531   -5.219  6.124   1.00 0.00  ? 312 ASN B ND2  2  
ATOM 9533   H H    . ASN B 2 12  ? 9.926   -3.316  7.483   1.00 0.00  ? 312 ASN B H    2  
ATOM 9534   H HA   . ASN B 2 12  ? 10.262  -4.706  4.842   1.00 0.00  ? 312 ASN B HA   2  
ATOM 9535   H HB2  . ASN B 2 12  ? 7.946   -3.039  5.882   1.00 0.00  ? 312 ASN B HB2  2  
ATOM 9536   H HB3  . ASN B 2 12  ? 8.092   -3.625  4.225   1.00 0.00  ? 312 ASN B HB3  2  
ATOM 9537   H HD21 . ASN B 2 12  ? 6.000   -4.398  6.193   1.00 0.00  ? 312 ASN B HD21 2  
ATOM 9538   H HD22 . ASN B 2 12  ? 6.143   -6.078  6.395   1.00 0.00  ? 312 ASN B HD22 2  
ATOM 9539   N N    . GLY B 2 13  ? 11.411  -1.997  5.546   1.00 0.00  ? 313 GLY B N    2  
ATOM 9540   C CA   . GLY B 2 13  ? 12.000  -0.724  5.057   1.00 0.00  ? 313 GLY B CA   2  
ATOM 9541   C C    . GLY B 2 13  ? 10.973  0.391   5.247   1.00 0.00  ? 313 GLY B C    2  
ATOM 9542   O O    . GLY B 2 13  ? 9.885   0.166   5.740   1.00 0.00  ? 313 GLY B O    2  
ATOM 9543   H H    . GLY B 2 13  ? 11.728  -2.401  6.382   1.00 0.00  ? 313 GLY B H    2  
ATOM 9544   H HA2  . GLY B 2 13  ? 12.895  -0.498  5.621   1.00 0.00  ? 313 GLY B HA2  2  
ATOM 9545   H HA3  . GLY B 2 13  ? 12.242  -0.814  4.010   1.00 0.00  ? 313 GLY B HA3  2  
ATOM 9546   N N    . LEU B 2 14  ? 11.309  1.593   4.879   1.00 0.00  ? 314 LEU B N    2  
ATOM 9547   C CA   . LEU B 2 14  ? 10.356  2.726   5.060   1.00 0.00  ? 314 LEU B CA   2  
ATOM 9548   C C    . LEU B 2 14  ? 9.444   2.828   3.821   1.00 0.00  ? 314 LEU B C    2  
ATOM 9549   O O    . LEU B 2 14  ? 9.798   3.467   2.853   1.00 0.00  ? 314 LEU B O    2  
ATOM 9550   C CB   . LEU B 2 14  ? 11.186  4.017   5.195   1.00 0.00  ? 314 LEU B CB   2  
ATOM 9551   C CG   . LEU B 2 14  ? 10.364  5.132   5.884   1.00 0.00  ? 314 LEU B CG   2  
ATOM 9552   C CD1  . LEU B 2 14  ? 10.572  5.066   7.405   1.00 0.00  ? 314 LEU B CD1  2  
ATOM 9553   C CD2  . LEU B 2 14  ? 10.823  6.507   5.375   1.00 0.00  ? 314 LEU B CD2  2  
ATOM 9554   H H    . LEU B 2 14  ? 12.198  1.767   4.508   1.00 0.00  ? 314 LEU B H    2  
ATOM 9555   H HA   . LEU B 2 14  ? 9.761   2.577   5.948   1.00 0.00  ? 314 LEU B HA   2  
ATOM 9556   H HB2  . LEU B 2 14  ? 12.071  3.805   5.779   1.00 0.00  ? 314 LEU B HB2  2  
ATOM 9557   H HB3  . LEU B 2 14  ? 11.490  4.349   4.211   1.00 0.00  ? 314 LEU B HB3  2  
ATOM 9558   H HG   . LEU B 2 14  ? 9.314   5.000   5.661   1.00 0.00  ? 314 LEU B HG   2  
ATOM 9559   H HD11 . LEU B 2 14  ? 10.376  4.063   7.754   1.00 0.00  ? 314 LEU B HD11 2  
ATOM 9560   H HD12 . LEU B 2 14  ? 11.592  5.335   7.640   1.00 0.00  ? 314 LEU B HD12 2  
ATOM 9561   H HD13 . LEU B 2 14  ? 9.901   5.757   7.892   1.00 0.00  ? 314 LEU B HD13 2  
ATOM 9562   H HD21 . LEU B 2 14  ? 11.903  6.531   5.328   1.00 0.00  ? 314 LEU B HD21 2  
ATOM 9563   H HD22 . LEU B 2 14  ? 10.416  6.678   4.390   1.00 0.00  ? 314 LEU B HD22 2  
ATOM 9564   H HD23 . LEU B 2 14  ? 10.475  7.277   6.047   1.00 0.00  ? 314 LEU B HD23 2  
ATOM 9565   N N    . HIS B 2 15  ? 8.263   2.229   3.847   1.00 0.00  ? 315 HIS B N    2  
ATOM 9566   C CA   . HIS B 2 15  ? 7.345   2.332   2.657   1.00 0.00  ? 315 HIS B CA   2  
ATOM 9567   C C    . HIS B 2 15  ? 6.332   3.466   2.869   1.00 0.00  ? 315 HIS B C    2  
ATOM 9568   O O    . HIS B 2 15  ? 6.573   4.385   3.626   1.00 0.00  ? 315 HIS B O    2  
ATOM 9569   C CB   . HIS B 2 15  ? 6.657   0.980   2.341   1.00 0.00  ? 315 HIS B CB   2  
ATOM 9570   C CG   . HIS B 2 15  ? 5.544   0.633   3.298   1.00 0.00  ? 315 HIS B CG   2  
ATOM 9571   N ND1  . HIS B 2 15  ? 4.207   0.583   2.895   1.00 0.00  ? 315 HIS B ND1  2  
ATOM 9572   C CD2  . HIS B 2 15  ? 5.555   0.226   4.608   1.00 0.00  ? 315 HIS B CD2  2  
ATOM 9573   C CE1  . HIS B 2 15  ? 3.486   0.156   3.946   1.00 0.00  ? 315 HIS B CE1  2  
ATOM 9574   N NE2  . HIS B 2 15  ? 4.257   -0.077  5.015   1.00 0.00  ? 315 HIS B NE2  2  
ATOM 9575   H H    . HIS B 2 15  ? 7.985   1.746   4.653   1.00 0.00  ? 315 HIS B H    2  
ATOM 9576   H HA   . HIS B 2 15  ? 7.941   2.603   1.796   1.00 0.00  ? 315 HIS B HA   2  
ATOM 9577   H HB2  . HIS B 2 15  ? 6.248   1.025   1.344   1.00 0.00  ? 315 HIS B HB2  2  
ATOM 9578   H HB3  . HIS B 2 15  ? 7.403   0.198   2.372   1.00 0.00  ? 315 HIS B HB3  2  
ATOM 9579   H HD1  . HIS B 2 15  ? 3.858   0.817   2.009   1.00 0.00  ? 315 HIS B HD1  2  
ATOM 9580   H HD2  . HIS B 2 15  ? 6.437   0.134   5.226   1.00 0.00  ? 315 HIS B HD2  2  
ATOM 9581   H HE1  . HIS B 2 15  ? 2.416   0.017   3.929   1.00 0.00  ? 315 HIS B HE1  2  
ATOM 9582   N N    . THR B 2 16  ? 5.246   3.453   2.153   1.00 0.00  ? 316 THR B N    2  
ATOM 9583   C CA   . THR B 2 16  ? 4.264   4.579   2.250   1.00 0.00  ? 316 THR B CA   2  
ATOM 9584   C C    . THR B 2 16  ? 3.724   4.769   3.677   1.00 0.00  ? 316 THR B C    2  
ATOM 9585   O O    . THR B 2 16  ? 3.576   5.884   4.138   1.00 0.00  ? 316 THR B O    2  
ATOM 9586   C CB   . THR B 2 16  ? 3.096   4.287   1.305   1.00 0.00  ? 316 THR B CB   2  
ATOM 9587   O OG1  . THR B 2 16  ? 3.605   3.912   0.033   1.00 0.00  ? 316 THR B OG1  2  
ATOM 9588   C CG2  . THR B 2 16  ? 2.233   5.539   1.144   1.00 0.00  ? 316 THR B CG2  2  
ATOM 9589   H H    . THR B 2 16  ? 5.098   2.734   1.505   1.00 0.00  ? 316 THR B H    2  
ATOM 9590   H HA   . THR B 2 16  ? 4.745   5.492   1.933   1.00 0.00  ? 316 THR B HA   2  
ATOM 9591   H HB   . THR B 2 16  ? 2.494   3.487   1.705   1.00 0.00  ? 316 THR B HB   2  
ATOM 9592   H HG1  . THR B 2 16  ? 3.121   3.139   -0.263  1.00 0.00  ? 316 THR B HG1  2  
ATOM 9593   H HG21 . THR B 2 16  ? 1.992   5.939   2.117   1.00 0.00  ? 316 THR B HG21 2  
ATOM 9594   H HG22 . THR B 2 16  ? 2.777   6.277   0.573   1.00 0.00  ? 316 THR B HG22 2  
ATOM 9595   H HG23 . THR B 2 16  ? 1.323   5.282   0.625   1.00 0.00  ? 316 THR B HG23 2  
ATOM 9596   N N    . ARG B 2 17  ? 3.396   3.718   4.373   1.00 0.00  ? 317 ARG B N    2  
ATOM 9597   C CA   . ARG B 2 17  ? 2.833   3.890   5.750   1.00 0.00  ? 317 ARG B CA   2  
ATOM 9598   C C    . ARG B 2 17  ? 3.825   4.599   6.700   1.00 0.00  ? 317 ARG B C    2  
ATOM 9599   O O    . ARG B 2 17  ? 3.517   5.662   7.200   1.00 0.00  ? 317 ARG B O    2  
ATOM 9600   C CB   . ARG B 2 17  ? 2.372   2.511   6.283   1.00 0.00  ? 317 ARG B CB   2  
ATOM 9601   C CG   . ARG B 2 17  ? 2.310   2.450   7.824   1.00 0.00  ? 317 ARG B CG   2  
ATOM 9602   C CD   . ARG B 2 17  ? 1.255   3.419   8.361   1.00 0.00  ? 317 ARG B CD   2  
ATOM 9603   N NE   . ARG B 2 17  ? 1.534   3.719   9.805   1.00 0.00  ? 317 ARG B NE   2  
ATOM 9604   C CZ   . ARG B 2 17  ? 1.685   2.763   10.686  1.00 0.00  ? 317 ARG B CZ   2  
ATOM 9605   N NH1  . ARG B 2 17  ? 1.384   1.530   10.387  1.00 0.00  ? 317 ARG B NH1  2  
ATOM 9606   N NH2  . ARG B 2 17  ? 2.081   3.056   11.895  1.00 0.00  ? 317 ARG B NH2  2  
ATOM 9607   H H    . ARG B 2 17  ? 3.495   2.822   3.988   1.00 0.00  ? 317 ARG B H    2  
ATOM 9608   H HA   . ARG B 2 17  ? 1.968   4.529   5.657   1.00 0.00  ? 317 ARG B HA   2  
ATOM 9609   H HB2  . ARG B 2 17  ? 1.385   2.302   5.894   1.00 0.00  ? 317 ARG B HB2  2  
ATOM 9610   H HB3  . ARG B 2 17  ? 3.041   1.754   5.925   1.00 0.00  ? 317 ARG B HB3  2  
ATOM 9611   H HG2  . ARG B 2 17  ? 2.050   1.446   8.111   1.00 0.00  ? 317 ARG B HG2  2  
ATOM 9612   H HG3  . ARG B 2 17  ? 3.271   2.693   8.248   1.00 0.00  ? 317 ARG B HG3  2  
ATOM 9613   H HD2  . ARG B 2 17  ? 1.304   4.342   7.823   1.00 0.00  ? 317 ARG B HD2  2  
ATOM 9614   H HD3  . ARG B 2 17  ? 0.268   2.982   8.229   1.00 0.00  ? 317 ARG B HD3  2  
ATOM 9615   H HE   . ARG B 2 17  ? 1.667   4.650   10.081  1.00 0.00  ? 317 ARG B HE   2  
ATOM 9616   H HH11 . ARG B 2 17  ? 1.030   1.306   9.483   1.00 0.00  ? 317 ARG B HH11 2  
ATOM 9617   H HH12 . ARG B 2 17  ? 1.510   0.807   11.067  1.00 0.00  ? 317 ARG B HH12 2  
ATOM 9618   H HH21 . ARG B 2 17  ? 2.266   4.006   12.144  1.00 0.00  ? 317 ARG B HH21 2  
ATOM 9619   H HH22 . ARG B 2 17  ? 2.198   2.329   12.572  1.00 0.00  ? 317 ARG B HH22 2  
ATOM 9620   N N    . PRO B 2 18  ? 4.994   4.054   6.971   1.00 0.00  ? 318 PRO B N    2  
ATOM 9621   C CA   . PRO B 2 18  ? 5.947   4.740   7.895   1.00 0.00  ? 318 PRO B CA   2  
ATOM 9622   C C    . PRO B 2 18  ? 6.328   6.135   7.382   1.00 0.00  ? 318 PRO B C    2  
ATOM 9623   O O    . PRO B 2 18  ? 6.536   7.057   8.147   1.00 0.00  ? 318 PRO B O    2  
ATOM 9624   C CB   . PRO B 2 18  ? 7.152   3.785   7.888   1.00 0.00  ? 318 PRO B CB   2  
ATOM 9625   C CG   . PRO B 2 18  ? 6.966   2.819   6.714   1.00 0.00  ? 318 PRO B CG   2  
ATOM 9626   C CD   . PRO B 2 18  ? 5.467   2.760   6.403   1.00 0.00  ? 318 PRO B CD   2  
ATOM 9627   H HA   . PRO B 2 18  ? 5.531   4.805   8.888   1.00 0.00  ? 318 PRO B HA   2  
ATOM 9628   H HB2  . PRO B 2 18  ? 8.071   4.341   7.769   1.00 0.00  ? 318 PRO B HB2  2  
ATOM 9629   H HB3  . PRO B 2 18  ? 7.186   3.225   8.813   1.00 0.00  ? 318 PRO B HB3  2  
ATOM 9630   H HG2  . PRO B 2 18  ? 7.503   3.191   5.854   1.00 0.00  ? 318 PRO B HG2  2  
ATOM 9631   H HG3  . PRO B 2 18  ? 7.326   1.835   6.975   1.00 0.00  ? 318 PRO B HG3  2  
ATOM 9632   H HD2  . PRO B 2 18  ? 5.294   2.704   5.338   1.00 0.00  ? 318 PRO B HD2  2  
ATOM 9633   H HD3  . PRO B 2 18  ? 5.012   1.933   6.921   1.00 0.00  ? 318 PRO B HD3  2  
ATOM 9634   N N    . ALA B 2 19  ? 6.404   6.295   6.090   1.00 0.00  ? 319 ALA B N    2  
ATOM 9635   C CA   . ALA B 2 19  ? 6.750   7.628   5.531   1.00 0.00  ? 319 ALA B CA   2  
ATOM 9636   C C    . ALA B 2 19  ? 5.691   8.630   5.988   1.00 0.00  ? 319 ALA B C    2  
ATOM 9637   O O    . ALA B 2 19  ? 5.997   9.696   6.484   1.00 0.00  ? 319 ALA B O    2  
ATOM 9638   C CB   . ALA B 2 19  ? 6.771   7.560   4.003   1.00 0.00  ? 319 ALA B CB   2  
ATOM 9639   H H    . ALA B 2 19  ? 6.213   5.536   5.498   1.00 0.00  ? 319 ALA B H    2  
ATOM 9640   H HA   . ALA B 2 19  ? 7.720   7.934   5.895   1.00 0.00  ? 319 ALA B HA   2  
ATOM 9641   H HB1  . ALA B 2 19  ? 7.447   6.779   3.688   1.00 0.00  ? 319 ALA B HB1  2  
ATOM 9642   H HB2  . ALA B 2 19  ? 5.777   7.344   3.639   1.00 0.00  ? 319 ALA B HB2  2  
ATOM 9643   H HB3  . ALA B 2 19  ? 7.102   8.507   3.605   1.00 0.00  ? 319 ALA B HB3  2  
ATOM 9644   N N    . ALA B 2 20  ? 4.442   8.295   5.809   1.00 0.00  ? 320 ALA B N    2  
ATOM 9645   C CA   . ALA B 2 20  ? 3.357   9.229   6.214   1.00 0.00  ? 320 ALA B CA   2  
ATOM 9646   C C    . ALA B 2 20  ? 3.548   9.643   7.672   1.00 0.00  ? 320 ALA B C    2  
ATOM 9647   O O    . ALA B 2 20  ? 3.396   10.797  8.020   1.00 0.00  ? 320 ALA B O    2  
ATOM 9648   C CB   . ALA B 2 20  ? 2.003   8.533   6.060   1.00 0.00  ? 320 ALA B CB   2  
ATOM 9649   H H    . ALA B 2 20  ? 4.226   7.437   5.376   1.00 0.00  ? 320 ALA B H    2  
ATOM 9650   H HA   . ALA B 2 20  ? 3.387   10.109  5.589   1.00 0.00  ? 320 ALA B HA   2  
ATOM 9651   H HB1  . ALA B 2 20  ? 1.958   8.047   5.096   1.00 0.00  ? 320 ALA B HB1  2  
ATOM 9652   H HB2  . ALA B 2 20  ? 1.887   7.797   6.839   1.00 0.00  ? 320 ALA B HB2  2  
ATOM 9653   H HB3  . ALA B 2 20  ? 1.212   9.264   6.134   1.00 0.00  ? 320 ALA B HB3  2  
ATOM 9654   N N    . GLN B 2 21  ? 3.907   8.728   8.525   1.00 0.00  ? 321 GLN B N    2  
ATOM 9655   C CA   . GLN B 2 21  ? 4.132   9.110   9.943   1.00 0.00  ? 321 GLN B CA   2  
ATOM 9656   C C    . GLN B 2 21  ? 5.401   9.961   10.014  1.00 0.00  ? 321 GLN B C    2  
ATOM 9657   O O    . GLN B 2 21  ? 5.483   10.926  10.744  1.00 0.00  ? 321 GLN B O    2  
ATOM 9658   C CB   . GLN B 2 21  ? 4.291   7.857   10.809  1.00 0.00  ? 321 GLN B CB   2  
ATOM 9659   C CG   . GLN B 2 21  ? 4.454   8.268   12.275  1.00 0.00  ? 321 GLN B CG   2  
ATOM 9660   C CD   . GLN B 2 21  ? 4.578   7.019   13.150  1.00 0.00  ? 321 GLN B CD   2  
ATOM 9661   O OE1  . GLN B 2 21  ? 4.918   7.109   14.313  1.00 0.00  ? 321 GLN B OE1  2  
ATOM 9662   N NE2  . GLN B 2 21  ? 4.308   5.849   12.639  1.00 0.00  ? 321 GLN B NE2  2  
ATOM 9663   H H    . GLN B 2 21  ? 4.063   7.807   8.226   1.00 0.00  ? 321 GLN B H    2  
ATOM 9664   H HA   . GLN B 2 21  ? 3.291   9.691   10.296  1.00 0.00  ? 321 GLN B HA   2  
ATOM 9665   H HB2  . GLN B 2 21  ? 3.413   7.234   10.704  1.00 0.00  ? 321 GLN B HB2  2  
ATOM 9666   H HB3  . GLN B 2 21  ? 5.163   7.307   10.491  1.00 0.00  ? 321 GLN B HB3  2  
ATOM 9667   H HG2  . GLN B 2 21  ? 5.346   8.871   12.382  1.00 0.00  ? 321 GLN B HG2  2  
ATOM 9668   H HG3  . GLN B 2 21  ? 3.594   8.840   12.586  1.00 0.00  ? 321 GLN B HG3  2  
ATOM 9669   H HE21 . GLN B 2 21  ? 4.030   5.775   11.702  1.00 0.00  ? 321 GLN B HE21 2  
ATOM 9670   H HE22 . GLN B 2 21  ? 4.384   5.043   13.193  1.00 0.00  ? 321 GLN B HE22 2  
ATOM 9671   N N    . PHE B 2 22  ? 6.403   9.595   9.262   1.00 0.00  ? 322 PHE B N    2  
ATOM 9672   C CA   . PHE B 2 22  ? 7.674   10.368  9.286   1.00 0.00  ? 322 PHE B CA   2  
ATOM 9673   C C    . PHE B 2 22  ? 7.430   11.816  8.832   1.00 0.00  ? 322 PHE B C    2  
ATOM 9674   O O    . PHE B 2 22  ? 7.810   12.751  9.509   1.00 0.00  ? 322 PHE B O    2  
ATOM 9675   C CB   . PHE B 2 22  ? 8.692   9.700   8.364   1.00 0.00  ? 322 PHE B CB   2  
ATOM 9676   C CG   . PHE B 2 22  ? 10.040  10.349  8.559   1.00 0.00  ? 322 PHE B CG   2  
ATOM 9677   C CD1  . PHE B 2 22  ? 10.868  9.929   9.605   1.00 0.00  ? 322 PHE B CD1  2  
ATOM 9678   C CD2  . PHE B 2 22  ? 10.461  11.368  7.697   1.00 0.00  ? 322 PHE B CD2  2  
ATOM 9679   C CE1  . PHE B 2 22  ? 12.118  10.527  9.791   1.00 0.00  ? 322 PHE B CE1  2  
ATOM 9680   C CE2  . PHE B 2 22  ? 11.712  11.968  7.882   1.00 0.00  ? 322 PHE B CE2  2  
ATOM 9681   C CZ   . PHE B 2 22  ? 12.542  11.547  8.930   1.00 0.00  ? 322 PHE B CZ   2  
ATOM 9682   H H    . PHE B 2 22  ? 6.318   8.801   8.695   1.00 0.00  ? 322 PHE B H    2  
ATOM 9683   H HA   . PHE B 2 22  ? 8.062   10.376  10.294  1.00 0.00  ? 322 PHE B HA   2  
ATOM 9684   H HB2  . PHE B 2 22  ? 8.761   8.648   8.603   1.00 0.00  ? 322 PHE B HB2  2  
ATOM 9685   H HB3  . PHE B 2 22  ? 8.382   9.817   7.337   1.00 0.00  ? 322 PHE B HB3  2  
ATOM 9686   H HD1  . PHE B 2 22  ? 10.541  9.142   10.269  1.00 0.00  ? 322 PHE B HD1  2  
ATOM 9687   H HD2  . PHE B 2 22  ? 9.821   11.691  6.889   1.00 0.00  ? 322 PHE B HD2  2  
ATOM 9688   H HE1  . PHE B 2 22  ? 12.755  10.203  10.600  1.00 0.00  ? 322 PHE B HE1  2  
ATOM 9689   H HE2  . PHE B 2 22  ? 12.038  12.754  7.218   1.00 0.00  ? 322 PHE B HE2  2  
ATOM 9690   H HZ   . PHE B 2 22  ? 13.507  12.009  9.074   1.00 0.00  ? 322 PHE B HZ   2  
ATOM 9691   N N    . VAL B 2 23  ? 6.814   12.022  7.693   1.00 0.00  ? 323 VAL B N    2  
ATOM 9692   C CA   . VAL B 2 23  ? 6.574   13.421  7.219   1.00 0.00  ? 323 VAL B CA   2  
ATOM 9693   C C    . VAL B 2 23  ? 5.662   14.148  8.208   1.00 0.00  ? 323 VAL B C    2  
ATOM 9694   O O    . VAL B 2 23  ? 5.728   15.351  8.367   1.00 0.00  ? 323 VAL B O    2  
ATOM 9695   C CB   . VAL B 2 23  ? 5.918   13.398  5.834   1.00 0.00  ? 323 VAL B CB   2  
ATOM 9696   C CG1  . VAL B 2 23  ? 5.582   14.829  5.403   1.00 0.00  ? 323 VAL B CG1  2  
ATOM 9697   C CG2  . VAL B 2 23  ? 6.887   12.784  4.821   1.00 0.00  ? 323 VAL B CG2  2  
ATOM 9698   H H    . VAL B 2 23  ? 6.523   11.266  7.131   1.00 0.00  ? 323 VAL B H    2  
ATOM 9699   H HA   . VAL B 2 23  ? 7.519   13.942  7.158   1.00 0.00  ? 323 VAL B HA   2  
ATOM 9700   H HB   . VAL B 2 23  ? 5.013   12.811  5.874   1.00 0.00  ? 323 VAL B HB   2  
ATOM 9701   H HG11 . VAL B 2 23  ? 6.432   15.470  5.586   1.00 0.00  ? 323 VAL B HG11 2  
ATOM 9702   H HG12 . VAL B 2 23  ? 5.345   14.841  4.348   1.00 0.00  ? 323 VAL B HG12 2  
ATOM 9703   H HG13 . VAL B 2 23  ? 4.733   15.186  5.967   1.00 0.00  ? 323 VAL B HG13 2  
ATOM 9704   H HG21 . VAL B 2 23  ? 7.314   11.881  5.232   1.00 0.00  ? 323 VAL B HG21 2  
ATOM 9705   H HG22 . VAL B 2 23  ? 6.356   12.552  3.910   1.00 0.00  ? 323 VAL B HG22 2  
ATOM 9706   H HG23 . VAL B 2 23  ? 7.677   13.489  4.608   1.00 0.00  ? 323 VAL B HG23 2  
ATOM 9707   N N    . LYS B 2 24  ? 4.819   13.419  8.877   1.00 0.00  ? 324 LYS B N    2  
ATOM 9708   C CA   . LYS B 2 24  ? 3.906   14.054  9.867   1.00 0.00  ? 324 LYS B CA   2  
ATOM 9709   C C    . LYS B 2 24  ? 4.743   14.748  10.945  1.00 0.00  ? 324 LYS B C    2  
ATOM 9710   O O    . LYS B 2 24  ? 4.454   15.855  11.356  1.00 0.00  ? 324 LYS B O    2  
ATOM 9711   C CB   . LYS B 2 24  ? 3.042   12.970  10.521  1.00 0.00  ? 324 LYS B CB   2  
ATOM 9712   C CG   . LYS B 2 24  ? 1.981   13.608  11.442  1.00 0.00  ? 324 LYS B CG   2  
ATOM 9713   C CD   . LYS B 2 24  ? 1.493   12.585  12.488  1.00 0.00  ? 324 LYS B CD   2  
ATOM 9714   C CE   . LYS B 2 24  ? 0.551   11.549  11.848  1.00 0.00  ? 324 LYS B CE   2  
ATOM 9715   N NZ   . LYS B 2 24  ? 0.794   10.217  12.472  1.00 0.00  ? 324 LYS B NZ   2  
ATOM 9716   H H    . LYS B 2 24  ? 4.813   12.449  8.737   1.00 0.00  ? 324 LYS B H    2  
ATOM 9717   H HA   . LYS B 2 24  ? 3.273   14.775  9.373   1.00 0.00  ? 324 LYS B HA   2  
ATOM 9718   H HB2  . LYS B 2 24  ? 2.553   12.400  9.746   1.00 0.00  ? 324 LYS B HB2  2  
ATOM 9719   H HB3  . LYS B 2 24  ? 3.675   12.318  11.097  1.00 0.00  ? 324 LYS B HB3  2  
ATOM 9720   H HG2  . LYS B 2 24  ? 2.403   14.460  11.953  1.00 0.00  ? 324 LYS B HG2  2  
ATOM 9721   H HG3  . LYS B 2 24  ? 1.142   13.930  10.847  1.00 0.00  ? 324 LYS B HG3  2  
ATOM 9722   H HD2  . LYS B 2 24  ? 2.342   12.076  12.921  1.00 0.00  ? 324 LYS B HD2  2  
ATOM 9723   H HD3  . LYS B 2 24  ? 0.966   13.111  13.272  1.00 0.00  ? 324 LYS B HD3  2  
ATOM 9724   H HE2  . LYS B 2 24  ? -0.477  11.839  12.015  1.00 0.00  ? 324 LYS B HE2  2  
ATOM 9725   H HE3  . LYS B 2 24  ? 0.733   11.482  10.785  1.00 0.00  ? 324 LYS B HE3  2  
ATOM 9726   H HZ1  . LYS B 2 24  ? 1.790   10.146  12.761  1.00 0.00  ? 324 LYS B HZ1  2  
ATOM 9727   H HZ2  . LYS B 2 24  ? 0.184   10.108  13.306  1.00 0.00  ? 324 LYS B HZ2  2  
ATOM 9728   H HZ3  . LYS B 2 24  ? 0.578   9.467   11.783  1.00 0.00  ? 324 LYS B HZ3  2  
ATOM 9729   N N    . GLU B 2 25  ? 5.763   14.091  11.427  1.00 0.00  ? 325 GLU B N    2  
ATOM 9730   C CA   . GLU B 2 25  ? 6.603   14.690  12.502  1.00 0.00  ? 325 GLU B CA   2  
ATOM 9731   C C    . GLU B 2 25  ? 7.389   15.904  11.987  1.00 0.00  ? 325 GLU B C    2  
ATOM 9732   O O    . GLU B 2 25  ? 7.498   16.904  12.668  1.00 0.00  ? 325 GLU B O    2  
ATOM 9733   C CB   . GLU B 2 25  ? 7.584   13.632  13.021  1.00 0.00  ? 325 GLU B CB   2  
ATOM 9734   C CG   . GLU B 2 25  ? 8.304   14.155  14.269  1.00 0.00  ? 325 GLU B CG   2  
ATOM 9735   C CD   . GLU B 2 25  ? 7.303   14.310  15.417  1.00 0.00  ? 325 GLU B CD   2  
ATOM 9736   O OE1  . GLU B 2 25  ? 6.298   13.617  15.397  1.00 0.00  ? 325 GLU B OE1  2  
ATOM 9737   O OE2  . GLU B 2 25  ? 7.559   15.115  16.296  1.00 0.00  ? 325 GLU B OE2  2  
ATOM 9738   H H    . GLU B 2 25  ? 5.960   13.189  11.097  1.00 0.00  ? 325 GLU B H    2  
ATOM 9739   H HA   . GLU B 2 25  ? 5.963   15.003  13.312  1.00 0.00  ? 325 GLU B HA   2  
ATOM 9740   H HB2  . GLU B 2 25  ? 7.041   12.732  13.270  1.00 0.00  ? 325 GLU B HB2  2  
ATOM 9741   H HB3  . GLU B 2 25  ? 8.312   13.412  12.254  1.00 0.00  ? 325 GLU B HB3  2  
ATOM 9742   H HG2  . GLU B 2 25  ? 9.074   13.454  14.558  1.00 0.00  ? 325 GLU B HG2  2  
ATOM 9743   H HG3  . GLU B 2 25  ? 8.753   15.112  14.054  1.00 0.00  ? 325 GLU B HG3  2  
ATOM 9744   N N    . ALA B 2 26  ? 7.960   15.834  10.812  1.00 0.00  ? 326 ALA B N    2  
ATOM 9745   C CA   . ALA B 2 26  ? 8.754   16.997  10.303  1.00 0.00  ? 326 ALA B CA   2  
ATOM 9746   C C    . ALA B 2 26  ? 7.882   18.251  10.196  1.00 0.00  ? 326 ALA B C    2  
ATOM 9747   O O    . ALA B 2 26  ? 8.209   19.293  10.728  1.00 0.00  ? 326 ALA B O    2  
ATOM 9748   C CB   . ALA B 2 26  ? 9.318   16.657  8.922   1.00 0.00  ? 326 ALA B CB   2  
ATOM 9749   H H    . ALA B 2 26  ? 7.896   15.023  10.262  1.00 0.00  ? 326 ALA B H    2  
ATOM 9750   H HA   . ALA B 2 26  ? 9.571   17.191  10.979  1.00 0.00  ? 326 ALA B HA   2  
ATOM 9751   H HB1  . ALA B 2 26  ? 8.510   16.362  8.268   1.00 0.00  ? 326 ALA B HB1  2  
ATOM 9752   H HB2  . ALA B 2 26  ? 9.814   17.523  8.512   1.00 0.00  ? 326 ALA B HB2  2  
ATOM 9753   H HB3  . ALA B 2 26  ? 10.023  15.845  9.011   1.00 0.00  ? 326 ALA B HB3  2  
ATOM 9754   N N    . LYS B 2 27  ? 6.780   18.163  9.508   1.00 0.00  ? 327 LYS B N    2  
ATOM 9755   C CA   . LYS B 2 27  ? 5.893   19.353  9.363   1.00 0.00  ? 327 LYS B CA   2  
ATOM 9756   C C    . LYS B 2 27  ? 5.569   19.928  10.743  1.00 0.00  ? 327 LYS B C    2  
ATOM 9757   O O    . LYS B 2 27  ? 5.071   21.031  10.863  1.00 0.00  ? 327 LYS B O    2  
ATOM 9758   C CB   . LYS B 2 27  ? 4.602   18.947  8.642   1.00 0.00  ? 327 LYS B CB   2  
ATOM 9759   C CG   . LYS B 2 27  ? 4.894   18.776  7.148   1.00 0.00  ? 327 LYS B CG   2  
ATOM 9760   C CD   . LYS B 2 27  ? 3.687   18.154  6.442   1.00 0.00  ? 327 LYS B CD   2  
ATOM 9761   C CE   . LYS B 2 27  ? 3.881   18.246  4.923   1.00 0.00  ? 327 LYS B CE   2  
ATOM 9762   N NZ   . LYS B 2 27  ? 5.311   18.005  4.583   1.00 0.00  ? 327 LYS B NZ   2  
ATOM 9763   H H    . LYS B 2 27  ? 6.539   17.317  9.080   1.00 0.00  ? 327 LYS B H    2  
ATOM 9764   H HA   . LYS B 2 27  ? 6.405   20.106  8.782   1.00 0.00  ? 327 LYS B HA   2  
ATOM 9765   H HB2  . LYS B 2 27  ? 4.238   18.016  9.051   1.00 0.00  ? 327 LYS B HB2  2  
ATOM 9766   H HB3  . LYS B 2 27  ? 3.857   19.718  8.775   1.00 0.00  ? 327 LYS B HB3  2  
ATOM 9767   H HG2  . LYS B 2 27  ? 5.103   19.742  6.713   1.00 0.00  ? 327 LYS B HG2  2  
ATOM 9768   H HG3  . LYS B 2 27  ? 5.752   18.133  7.025   1.00 0.00  ? 327 LYS B HG3  2  
ATOM 9769   H HD2  . LYS B 2 27  ? 3.597   17.117  6.732   1.00 0.00  ? 327 LYS B HD2  2  
ATOM 9770   H HD3  . LYS B 2 27  ? 2.791   18.687  6.722   1.00 0.00  ? 327 LYS B HD3  2  
ATOM 9771   H HE2  . LYS B 2 27  ? 3.269   17.502  4.433   1.00 0.00  ? 327 LYS B HE2  2  
ATOM 9772   H HE3  . LYS B 2 27  ? 3.592   19.229  4.583   1.00 0.00  ? 327 LYS B HE3  2  
ATOM 9773   H HZ1  . LYS B 2 27  ? 5.770   17.488  5.360   1.00 0.00  ? 327 LYS B HZ1  2  
ATOM 9774   H HZ2  . LYS B 2 27  ? 5.371   17.444  3.710   1.00 0.00  ? 327 LYS B HZ2  2  
ATOM 9775   H HZ3  . LYS B 2 27  ? 5.792   18.917  4.441   1.00 0.00  ? 327 LYS B HZ3  2  
ATOM 9776   N N    . GLY B 2 28  ? 5.864   19.206  11.788  1.00 0.00  ? 328 GLY B N    2  
ATOM 9777   C CA   . GLY B 2 28  ? 5.589   19.736  13.153  1.00 0.00  ? 328 GLY B CA   2  
ATOM 9778   C C    . GLY B 2 28  ? 6.678   20.749  13.516  1.00 0.00  ? 328 GLY B C    2  
ATOM 9779   O O    . GLY B 2 28  ? 6.481   21.627  14.331  1.00 0.00  ? 328 GLY B O    2  
ATOM 9780   H H    . GLY B 2 28  ? 6.285   18.328  11.677  1.00 0.00  ? 328 GLY B H    2  
ATOM 9781   H HA2  . GLY B 2 28  ? 4.622   20.220  13.166  1.00 0.00  ? 328 GLY B HA2  2  
ATOM 9782   H HA3  . GLY B 2 28  ? 5.599   18.927  13.867  1.00 0.00  ? 328 GLY B HA3  2  
ATOM 9783   N N    . PHE B 2 29  ? 7.830   20.630  12.900  1.00 0.00  ? 329 PHE B N    2  
ATOM 9784   C CA   . PHE B 2 29  ? 8.957   21.577  13.178  1.00 0.00  ? 329 PHE B CA   2  
ATOM 9785   C C    . PHE B 2 29  ? 9.104   22.540  11.998  1.00 0.00  ? 329 PHE B C    2  
ATOM 9786   O O    . PHE B 2 29  ? 8.980   22.153  10.853  1.00 0.00  ? 329 PHE B O    2  
ATOM 9787   C CB   . PHE B 2 29  ? 10.256  20.785  13.352  1.00 0.00  ? 329 PHE B CB   2  
ATOM 9788   C CG   . PHE B 2 29  ? 10.144  19.892  14.569  1.00 0.00  ? 329 PHE B CG   2  
ATOM 9789   C CD1  . PHE B 2 29  ? 10.021  20.459  15.844  1.00 0.00  ? 329 PHE B CD1  2  
ATOM 9790   C CD2  . PHE B 2 29  ? 10.165  18.498  14.424  1.00 0.00  ? 329 PHE B CD2  2  
ATOM 9791   C CE1  . PHE B 2 29  ? 9.918   19.635  16.972  1.00 0.00  ? 329 PHE B CE1  2  
ATOM 9792   C CE2  . PHE B 2 29  ? 10.063  17.674  15.552  1.00 0.00  ? 329 PHE B CE2  2  
ATOM 9793   C CZ   . PHE B 2 29  ? 9.938   18.243  16.825  1.00 0.00  ? 329 PHE B CZ   2  
ATOM 9794   H H    . PHE B 2 29  ? 7.954   19.914  12.243  1.00 0.00  ? 329 PHE B H    2  
ATOM 9795   H HA   . PHE B 2 29  ? 8.756   22.140  14.080  1.00 0.00  ? 329 PHE B HA   2  
ATOM 9796   H HB2  . PHE B 2 29  ? 10.428  20.183  12.471  1.00 0.00  ? 329 PHE B HB2  2  
ATOM 9797   H HB3  . PHE B 2 29  ? 11.079  21.471  13.485  1.00 0.00  ? 329 PHE B HB3  2  
ATOM 9798   H HD1  . PHE B 2 29  ? 10.005  21.533  15.959  1.00 0.00  ? 329 PHE B HD1  2  
ATOM 9799   H HD2  . PHE B 2 29  ? 10.260  18.058  13.443  1.00 0.00  ? 329 PHE B HD2  2  
ATOM 9800   H HE1  . PHE B 2 29  ? 9.822   20.073  17.954  1.00 0.00  ? 329 PHE B HE1  2  
ATOM 9801   H HE2  . PHE B 2 29  ? 10.078  16.601  15.440  1.00 0.00  ? 329 PHE B HE2  2  
ATOM 9802   H HZ   . PHE B 2 29  ? 9.859   17.608  17.695  1.00 0.00  ? 329 PHE B HZ   2  
ATOM 9803   N N    . THR B 2 30  ? 9.365   23.794  12.263  1.00 0.00  ? 330 THR B N    2  
ATOM 9804   C CA   . THR B 2 30  ? 9.518   24.782  11.157  1.00 0.00  ? 330 THR B CA   2  
ATOM 9805   C C    . THR B 2 30  ? 10.983  24.854  10.721  1.00 0.00  ? 330 THR B C    2  
ATOM 9806   O O    . THR B 2 30  ? 11.313  25.448  9.714   1.00 0.00  ? 330 THR B O    2  
ATOM 9807   C CB   . THR B 2 30  ? 9.076   26.155  11.657  1.00 0.00  ? 330 THR B CB   2  
ATOM 9808   O OG1  . THR B 2 30  ? 9.731   26.441  12.885  1.00 0.00  ? 330 THR B OG1  2  
ATOM 9809   C CG2  . THR B 2 30  ? 7.561   26.164  11.866  1.00 0.00  ? 330 THR B CG2  2  
ATOM 9810   H H    . THR B 2 30  ? 9.463   24.094  13.189  1.00 0.00  ? 330 THR B H    2  
ATOM 9811   H HA   . THR B 2 30  ? 8.904   24.492  10.315  1.00 0.00  ? 330 THR B HA   2  
ATOM 9812   H HB   . THR B 2 30  ? 9.340   26.901  10.930  1.00 0.00  ? 330 THR B HB   2  
ATOM 9813   H HG1  . THR B 2 30  ? 9.626   27.379  13.065  1.00 0.00  ? 330 THR B HG1  2  
ATOM 9814   H HG21 . THR B 2 30  ? 7.273   25.298  12.443  1.00 0.00  ? 330 THR B HG21 2  
ATOM 9815   H HG22 . THR B 2 30  ? 7.276   27.060  12.396  1.00 0.00  ? 330 THR B HG22 2  
ATOM 9816   H HG23 . THR B 2 30  ? 7.066   26.139  10.907  1.00 0.00  ? 330 THR B HG23 2  
ATOM 9817   N N    . SER B 2 31  ? 11.866  24.260  11.475  1.00 0.00  ? 331 SER B N    2  
ATOM 9818   C CA   . SER B 2 31  ? 13.311  24.302  11.107  1.00 0.00  ? 331 SER B CA   2  
ATOM 9819   C C    . SER B 2 31  ? 13.535  23.498  9.827   1.00 0.00  ? 331 SER B C    2  
ATOM 9820   O O    . SER B 2 31  ? 12.810  22.567  9.534   1.00 0.00  ? 331 SER B O    2  
ATOM 9821   C CB   . SER B 2 31  ? 14.141  23.688  12.233  1.00 0.00  ? 331 SER B CB   2  
ATOM 9822   O OG   . SER B 2 31  ? 13.907  22.286  12.278  1.00 0.00  ? 331 SER B OG   2  
ATOM 9823   H H    . SER B 2 31  ? 11.580  23.792  12.285  1.00 0.00  ? 331 SER B H    2  
ATOM 9824   H HA   . SER B 2 31  ? 13.616  25.326  10.948  1.00 0.00  ? 331 SER B HA   2  
ATOM 9825   H HB2  . SER B 2 31  ? 15.188  23.868  12.051  1.00 0.00  ? 331 SER B HB2  2  
ATOM 9826   H HB3  . SER B 2 31  ? 13.858  24.141  13.173  1.00 0.00  ? 331 SER B HB3  2  
ATOM 9827   H HG   . SER B 2 31  ? 13.327  22.059  11.549  1.00 0.00  ? 331 SER B HG   2  
ATOM 9828   N N    . GLU B 2 32  ? 14.536  23.841  9.062   1.00 0.00  ? 332 GLU B N    2  
ATOM 9829   C CA   . GLU B 2 32  ? 14.794  23.080  7.811   1.00 0.00  ? 332 GLU B CA   2  
ATOM 9830   C C    . GLU B 2 32  ? 15.302  21.690  8.184   1.00 0.00  ? 332 GLU B C    2  
ATOM 9831   O O    . GLU B 2 32  ? 16.109  21.536  9.079   1.00 0.00  ? 332 GLU B O    2  
ATOM 9832   C CB   . GLU B 2 32  ? 15.846  23.802  6.969   1.00 0.00  ? 332 GLU B CB   2  
ATOM 9833   C CG   . GLU B 2 32  ? 16.017  23.077  5.632   1.00 0.00  ? 332 GLU B CG   2  
ATOM 9834   C CD   . GLU B 2 32  ? 17.069  23.801  4.790   1.00 0.00  ? 332 GLU B CD   2  
ATOM 9835   O OE1  . GLU B 2 32  ? 17.462  24.889  5.176   1.00 0.00  ? 332 GLU B OE1  2  
ATOM 9836   O OE2  . GLU B 2 32  ? 17.465  23.255  3.774   1.00 0.00  ? 332 GLU B OE2  2  
ATOM 9837   H H    . GLU B 2 32  ? 15.116  24.591  9.314   1.00 0.00  ? 332 GLU B H    2  
ATOM 9838   H HA   . GLU B 2 32  ? 13.878  22.989  7.247   1.00 0.00  ? 332 GLU B HA   2  
ATOM 9839   H HB2  . GLU B 2 32  ? 15.527  24.818  6.790   1.00 0.00  ? 332 GLU B HB2  2  
ATOM 9840   H HB3  . GLU B 2 32  ? 16.786  23.805  7.496   1.00 0.00  ? 332 GLU B HB3  2  
ATOM 9841   H HG2  . GLU B 2 32  ? 16.337  22.061  5.813   1.00 0.00  ? 332 GLU B HG2  2  
ATOM 9842   H HG3  . GLU B 2 32  ? 15.077  23.070  5.102   1.00 0.00  ? 332 GLU B HG3  2  
ATOM 9843   N N    . ILE B 2 33  ? 14.828  20.680  7.508   1.00 0.00  ? 333 ILE B N    2  
ATOM 9844   C CA   . ILE B 2 33  ? 15.262  19.280  7.816   1.00 0.00  ? 333 ILE B CA   2  
ATOM 9845   C C    . ILE B 2 33  ? 15.640  18.571  6.516   1.00 0.00  ? 333 ILE B C    2  
ATOM 9846   O O    . ILE B 2 33  ? 14.911  18.613  5.545   1.00 0.00  ? 333 ILE B O    2  
ATOM 9847   C CB   . ILE B 2 33  ? 14.109  18.525  8.473   1.00 0.00  ? 333 ILE B CB   2  
ATOM 9848   C CG1  . ILE B 2 33  ? 13.682  19.250  9.750   1.00 0.00  ? 333 ILE B CG1  2  
ATOM 9849   C CG2  . ILE B 2 33  ? 14.578  17.113  8.831   1.00 0.00  ? 333 ILE B CG2  2  
ATOM 9850   C CD1  . ILE B 2 33  ? 12.358  18.667  10.247  1.00 0.00  ? 333 ILE B CD1  2  
ATOM 9851   H H    . ILE B 2 33  ? 14.179  20.843  6.799   1.00 0.00  ? 333 ILE B H    2  
ATOM 9852   H HA   . ILE B 2 33  ? 16.114  19.286  8.481   1.00 0.00  ? 333 ILE B HA   2  
ATOM 9853   H HB   . ILE B 2 33  ? 13.275  18.468  7.787   1.00 0.00  ? 333 ILE B HB   2  
ATOM 9854   H HG12 . ILE B 2 33  ? 14.440  19.121  10.508  1.00 0.00  ? 333 ILE B HG12 2  
ATOM 9855   H HG13 . ILE B 2 33  ? 13.555  20.301  9.542   1.00 0.00  ? 333 ILE B HG13 2  
ATOM 9856   H HG21 . ILE B 2 33  ? 15.489  17.174  9.410   1.00 0.00  ? 333 ILE B HG21 2  
ATOM 9857   H HG22 . ILE B 2 33  ? 13.815  16.616  9.412   1.00 0.00  ? 333 ILE B HG22 2  
ATOM 9858   H HG23 . ILE B 2 33  ? 14.764  16.554  7.927   1.00 0.00  ? 333 ILE B HG23 2  
ATOM 9859   H HD11 . ILE B 2 33  ? 12.398  17.588  10.200  1.00 0.00  ? 333 ILE B HD11 2  
ATOM 9860   H HD12 . ILE B 2 33  ? 12.188  18.977  11.267  1.00 0.00  ? 333 ILE B HD12 2  
ATOM 9861   H HD13 . ILE B 2 33  ? 11.551  19.024  9.623   1.00 0.00  ? 333 ILE B HD13 2  
ATOM 9862   N N    . THR B 2 34  ? 16.769  17.908  6.497   1.00 0.00  ? 334 THR B N    2  
ATOM 9863   C CA   . THR B 2 34  ? 17.206  17.174  5.268   1.00 0.00  ? 334 THR B CA   2  
ATOM 9864   C C    . THR B 2 34  ? 17.584  15.745  5.648   1.00 0.00  ? 334 THR B C    2  
ATOM 9865   O O    . THR B 2 34  ? 18.083  15.490  6.726   1.00 0.00  ? 334 THR B O    2  
ATOM 9866   C CB   . THR B 2 34  ? 18.422  17.866  4.648   1.00 0.00  ? 334 THR B CB   2  
ATOM 9867   O OG1  . THR B 2 34  ? 18.149  19.251  4.496   1.00 0.00  ? 334 THR B OG1  2  
ATOM 9868   C CG2  . THR B 2 34  ? 18.718  17.246  3.277   1.00 0.00  ? 334 THR B CG2  2  
ATOM 9869   H H    . THR B 2 34  ? 17.330  17.886  7.300   1.00 0.00  ? 334 THR B H    2  
ATOM 9870   H HA   . THR B 2 34  ? 16.403  17.144  4.543   1.00 0.00  ? 334 THR B HA   2  
ATOM 9871   H HB   . THR B 2 34  ? 19.279  17.734  5.290   1.00 0.00  ? 334 THR B HB   2  
ATOM 9872   H HG1  . THR B 2 34  ? 18.393  19.505  3.602   1.00 0.00  ? 334 THR B HG1  2  
ATOM 9873   H HG21 . THR B 2 34  ? 18.836  16.175  3.380   1.00 0.00  ? 334 THR B HG21 2  
ATOM 9874   H HG22 . THR B 2 34  ? 17.899  17.452  2.604   1.00 0.00  ? 334 THR B HG22 2  
ATOM 9875   H HG23 . THR B 2 34  ? 19.627  17.671  2.878   1.00 0.00  ? 334 THR B HG23 2  
ATOM 9876   N N    . VAL B 2 35  ? 17.382  14.821  4.749   1.00 0.00  ? 335 VAL B N    2  
ATOM 9877   C CA   . VAL B 2 35  ? 17.756  13.397  5.006   1.00 0.00  ? 335 VAL B CA   2  
ATOM 9878   C C    . VAL B 2 35  ? 18.711  12.982  3.894   1.00 0.00  ? 335 VAL B C    2  
ATOM 9879   O O    . VAL B 2 35  ? 18.337  12.970  2.742   1.00 0.00  ? 335 VAL B O    2  
ATOM 9880   C CB   . VAL B 2 35  ? 16.501  12.523  4.954   1.00 0.00  ? 335 VAL B CB   2  
ATOM 9881   C CG1  . VAL B 2 35  ? 16.898  11.045  5.011   1.00 0.00  ? 335 VAL B CG1  2  
ATOM 9882   C CG2  . VAL B 2 35  ? 15.599  12.858  6.146   1.00 0.00  ? 335 VAL B CG2  2  
ATOM 9883   H H    . VAL B 2 35  ? 17.020  15.068  3.873   1.00 0.00  ? 335 VAL B H    2  
ATOM 9884   H HA   . VAL B 2 35  ? 18.243  13.294  5.966   1.00 0.00  ? 335 VAL B HA   2  
ATOM 9885   H HB   . VAL B 2 35  ? 15.968  12.715  4.034   1.00 0.00  ? 335 VAL B HB   2  
ATOM 9886   H HG11 . VAL B 2 35  ? 17.656  10.903  5.767   1.00 0.00  ? 335 VAL B HG11 2  
ATOM 9887   H HG12 . VAL B 2 35  ? 16.032  10.447  5.254   1.00 0.00  ? 335 VAL B HG12 2  
ATOM 9888   H HG13 . VAL B 2 35  ? 17.287  10.741  4.049   1.00 0.00  ? 335 VAL B HG13 2  
ATOM 9889   H HG21 . VAL B 2 35  ? 15.325  13.901  6.108   1.00 0.00  ? 335 VAL B HG21 2  
ATOM 9890   H HG22 . VAL B 2 35  ? 14.706  12.250  6.103   1.00 0.00  ? 335 VAL B HG22 2  
ATOM 9891   H HG23 . VAL B 2 35  ? 16.128  12.657  7.065   1.00 0.00  ? 335 VAL B HG23 2  
ATOM 9892   N N    . THR B 2 36  ? 19.941  12.662  4.214   1.00 0.00  ? 336 THR B N    2  
ATOM 9893   C CA   . THR B 2 36  ? 20.919  12.274  3.152   1.00 0.00  ? 336 THR B CA   2  
ATOM 9894   C C    . THR B 2 36  ? 21.141  10.770  3.197   1.00 0.00  ? 336 THR B C    2  
ATOM 9895   O O    . THR B 2 36  ? 21.386  10.202  4.243   1.00 0.00  ? 336 THR B O    2  
ATOM 9896   C CB   . THR B 2 36  ? 22.247  12.996  3.398   1.00 0.00  ? 336 THR B CB   2  
ATOM 9897   O OG1  . THR B 2 36  ? 22.065  14.393  3.213   1.00 0.00  ? 336 THR B OG1  2  
ATOM 9898   C CG2  . THR B 2 36  ? 23.309  12.485  2.419   1.00 0.00  ? 336 THR B CG2  2  
ATOM 9899   H H    . THR B 2 36  ? 20.231  12.692  5.149   1.00 0.00  ? 336 THR B H    2  
ATOM 9900   H HA   . THR B 2 36  ? 20.538  12.552  2.179   1.00 0.00  ? 336 THR B HA   2  
ATOM 9901   H HB   . THR B 2 36  ? 22.576  12.808  4.408   1.00 0.00  ? 336 THR B HB   2  
ATOM 9902   H HG1  . THR B 2 36  ? 21.316  14.520  2.627   1.00 0.00  ? 336 THR B HG1  2  
ATOM 9903   H HG21 . THR B 2 36  ? 22.871  12.365  1.438   1.00 0.00  ? 336 THR B HG21 2  
ATOM 9904   H HG22 . THR B 2 36  ? 24.120  13.196  2.365   1.00 0.00  ? 336 THR B HG22 2  
ATOM 9905   H HG23 . THR B 2 36  ? 23.687  11.534  2.763   1.00 0.00  ? 336 THR B HG23 2  
ATOM 9906   N N    . SER B 2 37  ? 21.045  10.115  2.068   1.00 0.00  ? 337 SER B N    2  
ATOM 9907   C CA   . SER B 2 37  ? 21.239  8.636   2.043   1.00 0.00  ? 337 SER B CA   2  
ATOM 9908   C C    . SER B 2 37  ? 22.049  8.202   0.816   1.00 0.00  ? 337 SER B C    2  
ATOM 9909   O O    . SER B 2 37  ? 21.637  8.358   -0.316  1.00 0.00  ? 337 SER B O    2  
ATOM 9910   C CB   . SER B 2 37  ? 19.875  7.953   2.015   1.00 0.00  ? 337 SER B CB   2  
ATOM 9911   O OG   . SER B 2 37  ? 20.056  6.544   1.945   1.00 0.00  ? 337 SER B OG   2  
ATOM 9912   H H    . SER B 2 37  ? 20.839  10.604  1.244   1.00 0.00  ? 337 SER B H    2  
ATOM 9913   H HA   . SER B 2 37  ? 21.767  8.325   2.934   1.00 0.00  ? 337 SER B HA   2  
ATOM 9914   H HB2  . SER B 2 37  ? 19.334  8.194   2.916   1.00 0.00  ? 337 SER B HB2  2  
ATOM 9915   H HB3  . SER B 2 37  ? 19.315  8.299   1.156   1.00 0.00  ? 337 SER B HB3  2  
ATOM 9916   H HG   . SER B 2 37  ? 19.203  6.128   2.084   1.00 0.00  ? 337 SER B HG   2  
ATOM 9917   N N    . ASN B 2 38  ? 23.178  7.603   1.061   1.00 0.00  ? 338 ASN B N    2  
ATOM 9918   C CA   . ASN B 2 38  ? 24.036  7.069   -0.037  1.00 0.00  ? 338 ASN B CA   2  
ATOM 9919   C C    . ASN B 2 38  ? 24.173  8.042   -1.222  1.00 0.00  ? 338 ASN B C    2  
ATOM 9920   O O    . ASN B 2 38  ? 24.036  7.641   -2.361  1.00 0.00  ? 338 ASN B O    2  
ATOM 9921   C CB   . ASN B 2 38  ? 23.422  5.761   -0.539  1.00 0.00  ? 338 ASN B CB   2  
ATOM 9922   C CG   . ASN B 2 38  ? 23.585  4.679   0.532   1.00 0.00  ? 338 ASN B CG   2  
ATOM 9923   O OD1  . ASN B 2 38  ? 24.531  4.700   1.295   1.00 0.00  ? 338 ASN B OD1  2  
ATOM 9924   N ND2  . ASN B 2 38  ? 22.693  3.731   0.627   1.00 0.00  ? 338 ASN B ND2  2  
ATOM 9925   H H    . ASN B 2 38  ? 23.440  7.457   1.995   1.00 0.00  ? 338 ASN B H    2  
ATOM 9926   H HA   . ASN B 2 38  ? 25.017  6.859   0.358   1.00 0.00  ? 338 ASN B HA   2  
ATOM 9927   H HB2  . ASN B 2 38  ? 22.372  5.912   -0.742  1.00 0.00  ? 338 ASN B HB2  2  
ATOM 9928   H HB3  . ASN B 2 38  ? 23.924  5.450   -1.441  1.00 0.00  ? 338 ASN B HB3  2  
ATOM 9929   H HD21 . ASN B 2 38  ? 21.927  3.716   0.017   1.00 0.00  ? 338 ASN B HD21 2  
ATOM 9930   H HD22 . ASN B 2 38  ? 22.789  3.035   1.310   1.00 0.00  ? 338 ASN B HD22 2  
ATOM 9931   N N    . GLY B 2 39  ? 24.505  9.290   -0.999  1.00 0.00  ? 339 GLY B N    2  
ATOM 9932   C CA   . GLY B 2 39  ? 24.711  10.222  -2.158  1.00 0.00  ? 339 GLY B CA   2  
ATOM 9933   C C    . GLY B 2 39  ? 23.420  10.931  -2.587  1.00 0.00  ? 339 GLY B C    2  
ATOM 9934   O O    . GLY B 2 39  ? 23.473  11.894  -3.327  1.00 0.00  ? 339 GLY B O    2  
ATOM 9935   H H    . GLY B 2 39  ? 24.674  9.616   -0.091  1.00 0.00  ? 339 GLY B H    2  
ATOM 9936   H HA2  . GLY B 2 39  ? 25.437  10.970  -1.874  1.00 0.00  ? 339 GLY B HA2  2  
ATOM 9937   H HA3  . GLY B 2 39  ? 25.101  9.663   -2.998  1.00 0.00  ? 339 GLY B HA3  2  
ATOM 9938   N N    . LYS B 2 40  ? 22.268  10.483  -2.149  1.00 0.00  ? 340 LYS B N    2  
ATOM 9939   C CA   . LYS B 2 40  ? 20.985  11.160  -2.557  1.00 0.00  ? 340 LYS B CA   2  
ATOM 9940   C C    . LYS B 2 40  ? 20.283  11.734  -1.331  1.00 0.00  ? 340 LYS B C    2  
ATOM 9941   O O    . LYS B 2 40  ? 20.087  11.053  -0.343  1.00 0.00  ? 340 LYS B O    2  
ATOM 9942   C CB   . LYS B 2 40  ? 20.060  10.146  -3.237  1.00 0.00  ? 340 LYS B CB   2  
ATOM 9943   C CG   . LYS B 2 40  ? 20.629  9.762   -4.604  1.00 0.00  ? 340 LYS B CG   2  
ATOM 9944   C CD   . LYS B 2 40  ? 19.698  8.748   -5.275  1.00 0.00  ? 340 LYS B CD   2  
ATOM 9945   C CE   . LYS B 2 40  ? 20.242  8.380   -6.657  1.00 0.00  ? 340 LYS B CE   2  
ATOM 9946   N NZ   . LYS B 2 40  ? 21.590  7.760   -6.517  1.00 0.00  ? 340 LYS B NZ   2  
ATOM 9947   H H    . LYS B 2 40  ? 22.242  9.705   -1.554  1.00 0.00  ? 340 LYS B H    2  
ATOM 9948   H HA   . LYS B 2 40  ? 21.189  11.965  -3.250  1.00 0.00  ? 340 LYS B HA   2  
ATOM 9949   H HB2  . LYS B 2 40  ? 19.978  9.264   -2.619  1.00 0.00  ? 340 LYS B HB2  2  
ATOM 9950   H HB3  . LYS B 2 40  ? 19.082  10.584  -3.369  1.00 0.00  ? 340 LYS B HB3  2  
ATOM 9951   H HG2  . LYS B 2 40  ? 20.709  10.645  -5.221  1.00 0.00  ? 340 LYS B HG2  2  
ATOM 9952   H HG3  . LYS B 2 40  ? 21.608  9.321   -4.477  1.00 0.00  ? 340 LYS B HG3  2  
ATOM 9953   H HD2  . LYS B 2 40  ? 19.637  7.859   -4.664  1.00 0.00  ? 340 LYS B HD2  2  
ATOM 9954   H HD3  . LYS B 2 40  ? 18.714  9.179   -5.381  1.00 0.00  ? 340 LYS B HD3  2  
ATOM 9955   H HE2  . LYS B 2 40  ? 19.571  7.678   -7.132  1.00 0.00  ? 340 LYS B HE2  2  
ATOM 9956   H HE3  . LYS B 2 40  ? 20.316  9.271   -7.263  1.00 0.00  ? 340 LYS B HE3  2  
ATOM 9957   H HZ1  . LYS B 2 40  ? 21.641  7.237   -5.622  1.00 0.00  ? 340 LYS B HZ1  2  
ATOM 9958   H HZ2  . LYS B 2 40  ? 21.756  7.107   -7.309  1.00 0.00  ? 340 LYS B HZ2  2  
ATOM 9959   H HZ3  . LYS B 2 40  ? 22.315  8.507   -6.526  1.00 0.00  ? 340 LYS B HZ3  2  
ATOM 9960   N N    . SER B 2 41  ? 19.919  12.998  -1.378  1.00 0.00  ? 341 SER B N    2  
ATOM 9961   C CA   . SER B 2 41  ? 19.244  13.646  -0.208  1.00 0.00  ? 341 SER B CA   2  
ATOM 9962   C C    . SER B 2 41  ? 17.932  14.294  -0.641  1.00 0.00  ? 341 SER B C    2  
ATOM 9963   O O    . SER B 2 41  ? 17.782  14.752  -1.757  1.00 0.00  ? 341 SER B O    2  
ATOM 9964   C CB   . SER B 2 41  ? 20.168  14.720  0.367   1.00 0.00  ? 341 SER B CB   2  
ATOM 9965   O OG   . SER B 2 41  ? 20.433  15.693  -0.634  1.00 0.00  ? 341 SER B OG   2  
ATOM 9966   H H    . SER B 2 41  ? 20.116  13.539  -2.172  1.00 0.00  ? 341 SER B H    2  
ATOM 9967   H HA   . SER B 2 41  ? 19.031  12.916  0.549   1.00 0.00  ? 341 SER B HA   2  
ATOM 9968   H HB2  . SER B 2 41  ? 19.693  15.196  1.208   1.00 0.00  ? 341 SER B HB2  2  
ATOM 9969   H HB3  . SER B 2 41  ? 21.095  14.263  0.691   1.00 0.00  ? 341 SER B HB3  2  
ATOM 9970   H HG   . SER B 2 41  ? 20.923  15.266  -1.341  1.00 0.00  ? 341 SER B HG   2  
ATOM 9971   N N    . ALA B 2 42  ? 16.972  14.319  0.250   1.00 0.00  ? 342 ALA B N    2  
ATOM 9972   C CA   . ALA B 2 42  ? 15.637  14.920  -0.081  1.00 0.00  ? 342 ALA B CA   2  
ATOM 9973   C C    . ALA B 2 42  ? 15.073  15.658  1.139   1.00 0.00  ? 342 ALA B C    2  
ATOM 9974   O O    . ALA B 2 42  ? 15.551  15.513  2.246   1.00 0.00  ? 342 ALA B O    2  
ATOM 9975   C CB   . ALA B 2 42  ? 14.665  13.811  -0.493  1.00 0.00  ? 342 ALA B CB   2  
ATOM 9976   H H    . ALA B 2 42  ? 17.131  13.918  1.135   1.00 0.00  ? 342 ALA B H    2  
ATOM 9977   H HA   . ALA B 2 42  ? 15.746  15.621  -0.899  1.00 0.00  ? 342 ALA B HA   2  
ATOM 9978   H HB1  . ALA B 2 42  ? 14.623  13.062  0.280   1.00 0.00  ? 342 ALA B HB1  2  
ATOM 9979   H HB2  . ALA B 2 42  ? 13.681  14.229  -0.635  1.00 0.00  ? 342 ALA B HB2  2  
ATOM 9980   H HB3  . ALA B 2 42  ? 15.001  13.359  -1.414  1.00 0.00  ? 342 ALA B HB3  2  
ATOM 9981   N N    . SER B 2 43  ? 14.062  16.464  0.931   1.00 0.00  ? 343 SER B N    2  
ATOM 9982   C CA   . SER B 2 43  ? 13.458  17.240  2.057   1.00 0.00  ? 343 SER B CA   2  
ATOM 9983   C C    . SER B 2 43  ? 12.375  16.410  2.757   1.00 0.00  ? 343 SER B C    2  
ATOM 9984   O O    . SER B 2 43  ? 11.537  15.804  2.119   1.00 0.00  ? 343 SER B O    2  
ATOM 9985   C CB   . SER B 2 43  ? 12.821  18.509  1.491   1.00 0.00  ? 343 SER B CB   2  
ATOM 9986   O OG   . SER B 2 43  ? 13.797  19.237  0.754   1.00 0.00  ? 343 SER B OG   2  
ATOM 9987   H H    . SER B 2 43  ? 13.705  16.569  0.024   1.00 0.00  ? 343 SER B H    2  
ATOM 9988   H HA   . SER B 2 43  ? 14.225  17.508  2.768   1.00 0.00  ? 343 SER B HA   2  
ATOM 9989   H HB2  . SER B 2 43  ? 12.007  18.242  0.834   1.00 0.00  ? 343 SER B HB2  2  
ATOM 9990   H HB3  . SER B 2 43  ? 12.441  19.114  2.304   1.00 0.00  ? 343 SER B HB3  2  
ATOM 9991   H HG   . SER B 2 43  ? 14.659  19.034  1.123   1.00 0.00  ? 343 SER B HG   2  
ATOM 9992   N N    . ALA B 2 44  ? 12.386  16.372  4.066   1.00 0.00  ? 344 ALA B N    2  
ATOM 9993   C CA   . ALA B 2 44  ? 11.365  15.580  4.808   1.00 0.00  ? 344 ALA B CA   2  
ATOM 9994   C C    . ALA B 2 44  ? 10.007  16.281  4.734   1.00 0.00  ? 344 ALA B C    2  
ATOM 9995   O O    . ALA B 2 44  ? 8.974   15.685  4.970   1.00 0.00  ? 344 ALA B O    2  
ATOM 9996   C CB   . ALA B 2 44  ? 11.792  15.456  6.273   1.00 0.00  ? 344 ALA B CB   2  
ATOM 9997   H H    . ALA B 2 44  ? 13.069  16.848  4.573   1.00 0.00  ? 344 ALA B H    2  
ATOM 9998   H HA   . ALA B 2 44  ? 11.289  14.599  4.375   1.00 0.00  ? 344 ALA B HA   2  
ATOM 9999   H HB1  . ALA B 2 44  ? 11.908  16.442  6.699   1.00 0.00  ? 344 ALA B HB1  2  
ATOM 10000  H HB2  . ALA B 2 44  ? 11.038  14.912  6.823   1.00 0.00  ? 344 ALA B HB2  2  
ATOM 10001  H HB3  . ALA B 2 44  ? 12.732  14.927  6.330   1.00 0.00  ? 344 ALA B HB3  2  
ATOM 10002  N N    . LYS B 2 45  ? 9.998   17.540  4.389   1.00 0.00  ? 345 LYS B N    2  
ATOM 10003  C CA   . LYS B 2 45  ? 8.710   18.282  4.277   1.00 0.00  ? 345 LYS B CA   2  
ATOM 10004  C C    . LYS B 2 45  ? 8.185   18.062  2.857   1.00 0.00  ? 345 LYS B C    2  
ATOM 10005  O O    . LYS B 2 45  ? 7.382   18.805  2.332   1.00 0.00  ? 345 LYS B O    2  
ATOM 10006  C CB   . LYS B 2 45  ? 8.967   19.769  4.553   1.00 0.00  ? 345 LYS B CB   2  
ATOM 10007  C CG   . LYS B 2 45  ? 7.647   20.512  4.776   1.00 0.00  ? 345 LYS B CG   2  
ATOM 10008  C CD   . LYS B 2 45  ? 7.941   21.987  5.061   1.00 0.00  ? 345 LYS B CD   2  
ATOM 10009  C CE   . LYS B 2 45  ? 6.629   22.734  5.306   1.00 0.00  ? 345 LYS B CE   2  
ATOM 10010  N NZ   . LYS B 2 45  ? 6.926   24.156  5.641   1.00 0.00  ? 345 LYS B NZ   2  
ATOM 10011  H H    . LYS B 2 45  ? 10.844  17.993  4.188   1.00 0.00  ? 345 LYS B H    2  
ATOM 10012  H HA   . LYS B 2 45  ? 7.997   17.893  4.992   1.00 0.00  ? 345 LYS B HA   2  
ATOM 10013  H HB2  . LYS B 2 45  ? 9.576   19.860  5.441   1.00 0.00  ? 345 LYS B HB2  2  
ATOM 10014  H HB3  . LYS B 2 45  ? 9.487   20.206  3.714   1.00 0.00  ? 345 LYS B HB3  2  
ATOM 10015  H HG2  . LYS B 2 45  ? 7.029   20.435  3.896   1.00 0.00  ? 345 LYS B HG2  2  
ATOM 10016  H HG3  . LYS B 2 45  ? 7.130   20.083  5.619   1.00 0.00  ? 345 LYS B HG3  2  
ATOM 10017  H HD2  . LYS B 2 45  ? 8.570   22.064  5.937   1.00 0.00  ? 345 LYS B HD2  2  
ATOM 10018  H HD3  . LYS B 2 45  ? 8.448   22.422  4.214   1.00 0.00  ? 345 LYS B HD3  2  
ATOM 10019  H HE2  . LYS B 2 45  ? 6.019   22.692  4.417   1.00 0.00  ? 345 LYS B HE2  2  
ATOM 10020  H HE3  . LYS B 2 45  ? 6.101   22.274  6.128   1.00 0.00  ? 345 LYS B HE3  2  
ATOM 10021  H HZ1  . LYS B 2 45  ? 7.918   24.243  5.940   1.00 0.00  ? 345 LYS B HZ1  2  
ATOM 10022  H HZ2  . LYS B 2 45  ? 6.763   24.750  4.802   1.00 0.00  ? 345 LYS B HZ2  2  
ATOM 10023  H HZ3  . LYS B 2 45  ? 6.305   24.468  6.413   1.00 0.00  ? 345 LYS B HZ3  2  
ATOM 10024  N N    . SER B 2 46  ? 8.662   17.017  2.236   1.00 0.00  ? 346 SER B N    2  
ATOM 10025  C CA   . SER B 2 46  ? 8.216   16.717  0.844   1.00 0.00  ? 346 SER B CA   2  
ATOM 10026  C C    . SER B 2 46  ? 8.219   15.220  0.558   1.00 0.00  ? 346 SER B C    2  
ATOM 10027  O O    . SER B 2 46  ? 9.223   14.646  0.188   1.00 0.00  ? 346 SER B O    2  
ATOM 10028  C CB   . SER B 2 46  ? 9.138   17.425  -0.144  1.00 0.00  ? 346 SER B CB   2  
ATOM 10029  O OG   . SER B 2 46  ? 9.313   18.776  0.262   1.00 0.00  ? 346 SER B OG   2  
ATOM 10030  H H    . SER B 2 46  ? 9.313   16.466  2.730   1.00 0.00  ? 346 SER B H    2  
ATOM 10031  H HA   . SER B 2 46  ? 7.209   17.087  0.708   1.00 0.00  ? 346 SER B HA   2  
ATOM 10032  H HB2  . SER B 2 46  ? 10.095  16.933  -0.160  1.00 0.00  ? 346 SER B HB2  2  
ATOM 10033  H HB3  . SER B 2 46  ? 8.699   17.388  -1.133  1.00 0.00  ? 346 SER B HB3  2  
ATOM 10034  H HG   . SER B 2 46  ? 9.448   19.307  -0.526  1.00 0.00  ? 346 SER B HG   2  
ATOM 10035  N N    . LEU B 2 47  ? 7.084   14.592  0.701   1.00 0.00  ? 347 LEU B N    2  
ATOM 10036  C CA   . LEU B 2 47  ? 6.992   13.140  0.417   1.00 0.00  ? 347 LEU B CA   2  
ATOM 10037  C C    . LEU B 2 47  ? 7.419   12.893  -1.031  1.00 0.00  ? 347 LEU B C    2  
ATOM 10038  O O    . LEU B 2 47  ? 8.051   11.907  -1.334  1.00 0.00  ? 347 LEU B O    2  
ATOM 10039  C CB   . LEU B 2 47  ? 5.545   12.680  0.642   1.00 0.00  ? 347 LEU B CB   2  
ATOM 10040  C CG   . LEU B 2 47  ? 5.365   11.197  0.286   1.00 0.00  ? 347 LEU B CG   2  
ATOM 10041  C CD1  . LEU B 2 47  ? 6.281   10.324  1.158   1.00 0.00  ? 347 LEU B CD1  2  
ATOM 10042  C CD2  . LEU B 2 47  ? 3.895   10.800  0.525   1.00 0.00  ? 347 LEU B CD2  2  
ATOM 10043  H H    . LEU B 2 47  ? 6.286   15.079  0.999   1.00 0.00  ? 347 LEU B H    2  
ATOM 10044  H HA   . LEU B 2 47  ? 7.644   12.605  1.078   1.00 0.00  ? 347 LEU B HA   2  
ATOM 10045  H HB2  . LEU B 2 47  ? 5.282   12.831  1.678   1.00 0.00  ? 347 LEU B HB2  2  
ATOM 10046  H HB3  . LEU B 2 47  ? 4.894   13.269  0.025   1.00 0.00  ? 347 LEU B HB3  2  
ATOM 10047  H HG   . LEU B 2 47  ? 5.612   11.044  -0.754  1.00 0.00  ? 347 LEU B HG   2  
ATOM 10048  H HD11 . LEU B 2 47  ? 6.301   10.713  2.165   1.00 0.00  ? 347 LEU B HD11 2  
ATOM 10049  H HD12 . LEU B 2 47  ? 5.910   9.309   1.170   1.00 0.00  ? 347 LEU B HD12 2  
ATOM 10050  H HD13 . LEU B 2 47  ? 7.281   10.332  0.749   1.00 0.00  ? 347 LEU B HD13 2  
ATOM 10051  H HD21 . LEU B 2 47  ? 3.245   11.599  0.204   1.00 0.00  ? 347 LEU B HD21 2  
ATOM 10052  H HD22 . LEU B 2 47  ? 3.666   9.909   -0.038  1.00 0.00  ? 347 LEU B HD22 2  
ATOM 10053  H HD23 . LEU B 2 47  ? 3.733   10.615  1.577   1.00 0.00  ? 347 LEU B HD23 2  
ATOM 10054  N N    . PHE B 2 48  ? 7.097   13.784  -1.931  1.00 0.00  ? 348 PHE B N    2  
ATOM 10055  C CA   . PHE B 2 48  ? 7.505   13.574  -3.354  1.00 0.00  ? 348 PHE B CA   2  
ATOM 10056  C C    . PHE B 2 48  ? 9.018   13.352  -3.443  1.00 0.00  ? 348 PHE B C    2  
ATOM 10057  O O    . PHE B 2 48  ? 9.485   12.401  -4.033  1.00 0.00  ? 348 PHE B O    2  
ATOM 10058  C CB   . PHE B 2 48  ? 7.199   14.824  -4.190  1.00 0.00  ? 348 PHE B CB   2  
ATOM 10059  C CG   . PHE B 2 48  ? 5.712   15.109  -4.255  1.00 0.00  ? 348 PHE B CG   2  
ATOM 10060  C CD1  . PHE B 2 48  ? 4.842   14.175  -4.830  1.00 0.00  ? 348 PHE B CD1  2  
ATOM 10061  C CD2  . PHE B 2 48  ? 5.208   16.324  -3.767  1.00 0.00  ? 348 PHE B CD2  2  
ATOM 10062  C CE1  . PHE B 2 48  ? 3.473   14.456  -4.915  1.00 0.00  ? 348 PHE B CE1  2  
ATOM 10063  C CE2  . PHE B 2 48  ? 3.839   16.600  -3.851  1.00 0.00  ? 348 PHE B CE2  2  
ATOM 10064  C CZ   . PHE B 2 48  ? 2.973   15.664  -4.427  1.00 0.00  ? 348 PHE B CZ   2  
ATOM 10065  H H    . PHE B 2 48  ? 6.598   14.586  -1.674  1.00 0.00  ? 348 PHE B H    2  
ATOM 10066  H HA   . PHE B 2 48  ? 6.985   12.725  -3.765  1.00 0.00  ? 348 PHE B HA   2  
ATOM 10067  H HB2  . PHE B 2 48  ? 7.707   15.670  -3.753  1.00 0.00  ? 348 PHE B HB2  2  
ATOM 10068  H HB3  . PHE B 2 48  ? 7.573   14.670  -5.193  1.00 0.00  ? 348 PHE B HB3  2  
ATOM 10069  H HD1  . PHE B 2 48  ? 5.225   13.238  -5.207  1.00 0.00  ? 348 PHE B HD1  2  
ATOM 10070  H HD2  . PHE B 2 48  ? 5.875   17.047  -3.323  1.00 0.00  ? 348 PHE B HD2  2  
ATOM 10071  H HE1  . PHE B 2 48  ? 2.802   13.739  -5.358  1.00 0.00  ? 348 PHE B HE1  2  
ATOM 10072  H HE2  . PHE B 2 48  ? 3.453   17.534  -3.474  1.00 0.00  ? 348 PHE B HE2  2  
ATOM 10073  H HZ   . PHE B 2 48  ? 1.916   15.875  -4.496  1.00 0.00  ? 348 PHE B HZ   2  
ATOM 10074  N N    . LYS B 2 49  ? 9.786   14.254  -2.901  1.00 0.00  ? 349 LYS B N    2  
ATOM 10075  C CA   . LYS B 2 49  ? 11.268  14.139  -2.996  1.00 0.00  ? 349 LYS B CA   2  
ATOM 10076  C C    . LYS B 2 49  ? 11.807  12.998  -2.118  1.00 0.00  ? 349 LYS B C    2  
ATOM 10077  O O    . LYS B 2 49  ? 12.901  12.517  -2.337  1.00 0.00  ? 349 LYS B O    2  
ATOM 10078  C CB   . LYS B 2 49  ? 11.874  15.486  -2.586  1.00 0.00  ? 349 LYS B CB   2  
ATOM 10079  C CG   . LYS B 2 49  ? 11.540  16.545  -3.665  1.00 0.00  ? 349 LYS B CG   2  
ATOM 10080  C CD   . LYS B 2 49  ? 11.413  17.937  -3.033  1.00 0.00  ? 349 LYS B CD   2  
ATOM 10081  C CE   . LYS B 2 49  ? 12.760  18.385  -2.468  1.00 0.00  ? 349 LYS B CE   2  
ATOM 10082  N NZ   . LYS B 2 49  ? 12.637  19.785  -1.965  1.00 0.00  ? 349 LYS B NZ   2  
ATOM 10083  H H    . LYS B 2 49  ? 9.390   15.037  -2.460  1.00 0.00  ? 349 LYS B H    2  
ATOM 10084  H HA   . LYS B 2 49  ? 11.534  13.939  -4.023  1.00 0.00  ? 349 LYS B HA   2  
ATOM 10085  H HB2  . LYS B 2 49  ? 11.467  15.784  -1.632  1.00 0.00  ? 349 LYS B HB2  2  
ATOM 10086  H HB3  . LYS B 2 49  ? 12.947  15.386  -2.504  1.00 0.00  ? 349 LYS B HB3  2  
ATOM 10087  H HG2  . LYS B 2 49  ? 12.325  16.562  -4.408  1.00 0.00  ? 349 LYS B HG2  2  
ATOM 10088  H HG3  . LYS B 2 49  ? 10.603  16.294  -4.150  1.00 0.00  ? 349 LYS B HG3  2  
ATOM 10089  H HD2  . LYS B 2 49  ? 11.089  18.642  -3.784  1.00 0.00  ? 349 LYS B HD2  2  
ATOM 10090  H HD3  . LYS B 2 49  ? 10.686  17.905  -2.237  1.00 0.00  ? 349 LYS B HD3  2  
ATOM 10091  H HE2  . LYS B 2 49  ? 13.045  17.733  -1.656  1.00 0.00  ? 349 LYS B HE2  2  
ATOM 10092  H HE3  . LYS B 2 49  ? 13.509  18.345  -3.245  1.00 0.00  ? 349 LYS B HE3  2  
ATOM 10093  H HZ1  . LYS B 2 49  ? 11.774  20.218  -2.349  1.00 0.00  ? 349 LYS B HZ1  2  
ATOM 10094  H HZ2  . LYS B 2 49  ? 12.589  19.775  -0.925  1.00 0.00  ? 349 LYS B HZ2  2  
ATOM 10095  H HZ3  . LYS B 2 49  ? 13.463  20.337  -2.269  1.00 0.00  ? 349 LYS B HZ3  2  
ATOM 10096  N N    . LEU B 2 50  ? 11.064  12.540  -1.142  1.00 0.00  ? 350 LEU B N    2  
ATOM 10097  C CA   . LEU B 2 50  ? 11.586  11.414  -0.305  1.00 0.00  ? 350 LEU B CA   2  
ATOM 10098  C C    . LEU B 2 50  ? 11.598  10.108  -1.115  1.00 0.00  ? 350 LEU B C    2  
ATOM 10099  O O    . LEU B 2 50  ? 12.612  9.448   -1.228  1.00 0.00  ? 350 LEU B O    2  
ATOM 10100  C CB   . LEU B 2 50  ? 10.703  11.200  0.933   1.00 0.00  ? 350 LEU B CB   2  
ATOM 10101  C CG   . LEU B 2 50  ? 10.871  12.345  1.944   1.00 0.00  ? 350 LEU B CG   2  
ATOM 10102  C CD1  . LEU B 2 50  ? 9.918   12.113  3.130   1.00 0.00  ? 350 LEU B CD1  2  
ATOM 10103  C CD2  . LEU B 2 50  ? 12.331  12.399  2.451   1.00 0.00  ? 350 LEU B CD2  2  
ATOM 10104  H H    . LEU B 2 50  ? 10.169  12.913  -0.979  1.00 0.00  ? 350 LEU B H    2  
ATOM 10105  H HA   . LEU B 2 50  ? 12.592  11.640  0.006   1.00 0.00  ? 350 LEU B HA   2  
ATOM 10106  H HB2  . LEU B 2 50  ? 9.671   11.150  0.623   1.00 0.00  ? 350 LEU B HB2  2  
ATOM 10107  H HB3  . LEU B 2 50  ? 10.977  10.269  1.406   1.00 0.00  ? 350 LEU B HB3  2  
ATOM 10108  H HG   . LEU B 2 50  ? 10.622  13.281  1.466   1.00 0.00  ? 350 LEU B HG   2  
ATOM 10109  H HD11 . LEU B 2 50  ? 8.974   11.727  2.773   1.00 0.00  ? 350 LEU B HD11 2  
ATOM 10110  H HD12 . LEU B 2 50  ? 10.358  11.404  3.815   1.00 0.00  ? 350 LEU B HD12 2  
ATOM 10111  H HD13 . LEU B 2 50  ? 9.748   13.046  3.640   1.00 0.00  ? 350 LEU B HD13 2  
ATOM 10112  H HD21 . LEU B 2 50  ? 12.776  11.413  2.404   1.00 0.00  ? 350 LEU B HD21 2  
ATOM 10113  H HD22 . LEU B 2 50  ? 12.898  13.075  1.831   1.00 0.00  ? 350 LEU B HD22 2  
ATOM 10114  H HD23 . LEU B 2 50  ? 12.357  12.750  3.472   1.00 0.00  ? 350 LEU B HD23 2  
ATOM 10115  N N    . GLN B 2 51  ? 10.457  9.705   -1.612  1.00 0.00  ? 351 GLN B N    2  
ATOM 10116  C CA   . GLN B 2 51  ? 10.356  8.408   -2.357  1.00 0.00  ? 351 GLN B CA   2  
ATOM 10117  C C    . GLN B 2 51  ? 11.533  8.224   -3.317  1.00 0.00  ? 351 GLN B C    2  
ATOM 10118  O O    . GLN B 2 51  ? 11.736  7.151   -3.845  1.00 0.00  ? 351 GLN B O    2  
ATOM 10119  C CB   . GLN B 2 51  ? 9.061   8.365   -3.185  1.00 0.00  ? 351 GLN B CB   2  
ATOM 10120  C CG   . GLN B 2 51  ? 7.844   8.742   -2.332  1.00 0.00  ? 351 GLN B CG   2  
ATOM 10121  C CD   . GLN B 2 51  ? 7.611   7.704   -1.235  1.00 0.00  ? 351 GLN B CD   2  
ATOM 10122  O OE1  . GLN B 2 51  ? 8.425   7.541   -0.348  1.00 0.00  ? 351 GLN B OE1  2  
ATOM 10123  N NE2  . GLN B 2 51  ? 6.513   7.004   -1.246  1.00 0.00  ? 351 GLN B NE2  2  
ATOM 10124  H H    . GLN B 2 51  ? 9.650   10.223  -1.438  1.00 0.00  ? 351 GLN B H    2  
ATOM 10125  H HA   . GLN B 2 51  ? 10.350  7.592   -1.651  1.00 0.00  ? 351 GLN B HA   2  
ATOM 10126  H HB2  . GLN B 2 51  ? 9.144   9.055   -4.005  1.00 0.00  ? 351 GLN B HB2  2  
ATOM 10127  H HB3  . GLN B 2 51  ? 8.924   7.366   -3.574  1.00 0.00  ? 351 GLN B HB3  2  
ATOM 10128  H HG2  . GLN B 2 51  ? 8.009   9.701   -1.881  1.00 0.00  ? 351 GLN B HG2  2  
ATOM 10129  H HG3  . GLN B 2 51  ? 6.967   8.791   -2.966  1.00 0.00  ? 351 GLN B HG3  2  
ATOM 10130  H HE21 . GLN B 2 51  ? 5.850   7.143   -1.953  1.00 0.00  ? 351 GLN B HE21 2  
ATOM 10131  H HE22 . GLN B 2 51  ? 6.348   6.346   -0.543  1.00 0.00  ? 351 GLN B HE22 2  
ATOM 10132  N N    . THR B 2 52  ? 12.308  9.242   -3.574  1.00 0.00  ? 352 THR B N    2  
ATOM 10133  C CA   . THR B 2 52  ? 13.447  9.072   -4.522  1.00 0.00  ? 352 THR B CA   2  
ATOM 10134  C C    . THR B 2 52  ? 14.675  8.543   -3.779  1.00 0.00  ? 352 THR B C    2  
ATOM 10135  O O    . THR B 2 52  ? 15.641  8.127   -4.387  1.00 0.00  ? 352 THR B O    2  
ATOM 10136  C CB   . THR B 2 52  ? 13.752  10.416  -5.183  1.00 0.00  ? 352 THR B CB   2  
ATOM 10137  O OG1  . THR B 2 52  ? 14.102  11.369  -4.189  1.00 0.00  ? 352 THR B OG1  2  
ATOM 10138  C CG2  . THR B 2 52  ? 12.506  10.886  -5.934  1.00 0.00  ? 352 THR B CG2  2  
ATOM 10139  H H    . THR B 2 52  ? 12.146  10.116  -3.160  1.00 0.00  ? 352 THR B H    2  
ATOM 10140  H HA   . THR B 2 52  ? 13.174  8.361   -5.286  1.00 0.00  ? 352 THR B HA   2  
ATOM 10141  H HB   . THR B 2 52  ? 14.565  10.304  -5.884  1.00 0.00  ? 352 THR B HB   2  
ATOM 10142  H HG1  . THR B 2 52  ? 14.413  12.161  -4.633  1.00 0.00  ? 352 THR B HG1  2  
ATOM 10143  H HG21 . THR B 2 52  ? 11.639  10.790  -5.291  1.00 0.00  ? 352 THR B HG21 2  
ATOM 10144  H HG22 . THR B 2 52  ? 12.626  11.919  -6.225  1.00 0.00  ? 352 THR B HG22 2  
ATOM 10145  H HG23 . THR B 2 52  ? 12.370  10.276  -6.819  1.00 0.00  ? 352 THR B HG23 2  
ATOM 10146  N N    . LEU B 2 53  ? 14.644  8.529   -2.472  1.00 0.00  ? 353 LEU B N    2  
ATOM 10147  C CA   . LEU B 2 53  ? 15.813  7.995   -1.709  1.00 0.00  ? 353 LEU B CA   2  
ATOM 10148  C C    . LEU B 2 53  ? 15.586  6.514   -1.424  1.00 0.00  ? 353 LEU B C    2  
ATOM 10149  O O    . LEU B 2 53  ? 14.649  6.139   -0.749  1.00 0.00  ? 353 LEU B O    2  
ATOM 10150  C CB   . LEU B 2 53  ? 15.959  8.732   -0.379  1.00 0.00  ? 353 LEU B CB   2  
ATOM 10151  C CG   . LEU B 2 53  ? 16.028  10.239  -0.624  1.00 0.00  ? 353 LEU B CG   2  
ATOM 10152  C CD1  . LEU B 2 53  ? 16.239  10.963  0.714   1.00 0.00  ? 353 LEU B CD1  2  
ATOM 10153  C CD2  . LEU B 2 53  ? 17.180  10.567  -1.587  1.00 0.00  ? 353 LEU B CD2  2  
ATOM 10154  H H    . LEU B 2 53  ? 13.850  8.853   -1.996  1.00 0.00  ? 353 LEU B H    2  
ATOM 10155  H HA   . LEU B 2 53  ? 16.718  8.109   -2.289  1.00 0.00  ? 353 LEU B HA   2  
ATOM 10156  H HB2  . LEU B 2 53  ? 15.110  8.509   0.250   1.00 0.00  ? 353 LEU B HB2  2  
ATOM 10157  H HB3  . LEU B 2 53  ? 16.864  8.408   0.113   1.00 0.00  ? 353 LEU B HB3  2  
ATOM 10158  H HG   . LEU B 2 53  ? 15.095  10.559  -1.062  1.00 0.00  ? 353 LEU B HG   2  
ATOM 10159  H HD11 . LEU B 2 53  ? 16.939  10.408  1.324   1.00 0.00  ? 353 LEU B HD11 2  
ATOM 10160  H HD12 . LEU B 2 53  ? 16.633  11.952  0.532   1.00 0.00  ? 353 LEU B HD12 2  
ATOM 10161  H HD13 . LEU B 2 53  ? 15.295  11.041  1.232   1.00 0.00  ? 353 LEU B HD13 2  
ATOM 10162  H HD21 . LEU B 2 53  ? 18.026  9.928   -1.377  1.00 0.00  ? 353 LEU B HD21 2  
ATOM 10163  H HD22 . LEU B 2 53  ? 16.851  10.407  -2.603  1.00 0.00  ? 353 LEU B HD22 2  
ATOM 10164  H HD23 . LEU B 2 53  ? 17.471  11.600  -1.466  1.00 0.00  ? 353 LEU B HD23 2  
ATOM 10165  N N    . GLY B 2 54  ? 16.435  5.673   -1.931  1.00 0.00  ? 354 GLY B N    2  
ATOM 10166  C CA   . GLY B 2 54  ? 16.268  4.214   -1.681  1.00 0.00  ? 354 GLY B CA   2  
ATOM 10167  C C    . GLY B 2 54  ? 16.623  3.912   -0.226  1.00 0.00  ? 354 GLY B C    2  
ATOM 10168  O O    . GLY B 2 54  ? 17.758  3.618   0.097   1.00 0.00  ? 354 GLY B O    2  
ATOM 10169  H H    . GLY B 2 54  ? 17.182  5.999   -2.474  1.00 0.00  ? 354 GLY B H    2  
ATOM 10170  H HA2  . GLY B 2 54  ? 15.243  3.930   -1.872  1.00 0.00  ? 354 GLY B HA2  2  
ATOM 10171  H HA3  . GLY B 2 54  ? 16.925  3.658   -2.332  1.00 0.00  ? 354 GLY B HA3  2  
ATOM 10172  N N    . LEU B 2 55  ? 15.657  3.967   0.655   1.00 0.00  ? 355 LEU B N    2  
ATOM 10173  C CA   . LEU B 2 55  ? 15.922  3.670   2.095   1.00 0.00  ? 355 LEU B CA   2  
ATOM 10174  C C    . LEU B 2 55  ? 15.471  2.241   2.401   1.00 0.00  ? 355 LEU B C    2  
ATOM 10175  O O    . LEU B 2 55  ? 14.333  2.007   2.758   1.00 0.00  ? 355 LEU B O    2  
ATOM 10176  C CB   . LEU B 2 55  ? 15.135  4.652   2.971   1.00 0.00  ? 355 LEU B CB   2  
ATOM 10177  C CG   . LEU B 2 55  ? 15.416  6.098   2.540   1.00 0.00  ? 355 LEU B CG   2  
ATOM 10178  C CD1  . LEU B 2 55  ? 14.814  7.054   3.573   1.00 0.00  ? 355 LEU B CD1  2  
ATOM 10179  C CD2  . LEU B 2 55  ? 16.930  6.337   2.441   1.00 0.00  ? 355 LEU B CD2  2  
ATOM 10180  H H    . LEU B 2 55  ? 14.745  4.182   0.369   1.00 0.00  ? 355 LEU B H    2  
ATOM 10181  H HA   . LEU B 2 55  ? 16.979  3.760   2.307   1.00 0.00  ? 355 LEU B HA   2  
ATOM 10182  H HB2  . LEU B 2 55  ? 14.078  4.449   2.870   1.00 0.00  ? 355 LEU B HB2  2  
ATOM 10183  H HB3  . LEU B 2 55  ? 15.425  4.524   3.998   1.00 0.00  ? 355 LEU B HB3  2  
ATOM 10184  H HG   . LEU B 2 55  ? 14.956  6.279   1.580   1.00 0.00  ? 355 LEU B HG   2  
ATOM 10185  H HD11 . LEU B 2 55  ? 13.795  6.766   3.782   1.00 0.00  ? 355 LEU B HD11 2  
ATOM 10186  H HD12 . LEU B 2 55  ? 15.394  7.010   4.484   1.00 0.00  ? 355 LEU B HD12 2  
ATOM 10187  H HD13 . LEU B 2 55  ? 14.831  8.062   3.185   1.00 0.00  ? 355 LEU B HD13 2  
ATOM 10188  H HD21 . LEU B 2 55  ? 17.428  5.846   3.263   1.00 0.00  ? 355 LEU B HD21 2  
ATOM 10189  H HD22 . LEU B 2 55  ? 17.296  5.935   1.508   1.00 0.00  ? 355 LEU B HD22 2  
ATOM 10190  H HD23 . LEU B 2 55  ? 17.134  7.397   2.478   1.00 0.00  ? 355 LEU B HD23 2  
ATOM 10191  N N    . THR B 2 56  ? 16.340  1.276   2.253   1.00 0.00  ? 356 THR B N    2  
ATOM 10192  C CA   . THR B 2 56  ? 15.939  -0.138  2.523   1.00 0.00  ? 356 THR B CA   2  
ATOM 10193  C C    . THR B 2 56  ? 16.255  -0.516  3.974   1.00 0.00  ? 356 THR B C    2  
ATOM 10194  O O    . THR B 2 56  ? 17.121  0.054   4.608   1.00 0.00  ? 356 THR B O    2  
ATOM 10195  C CB   . THR B 2 56  ? 16.706  -1.067  1.583   1.00 0.00  ? 356 THR B CB   2  
ATOM 10196  O OG1  . THR B 2 56  ? 18.079  -1.078  1.950   1.00 0.00  ? 356 THR B OG1  2  
ATOM 10197  C CG2  . THR B 2 56  ? 16.563  -0.570  0.143   1.00 0.00  ? 356 THR B CG2  2  
ATOM 10198  H H    . THR B 2 56  ? 17.250  1.474   1.949   1.00 0.00  ? 356 THR B H    2  
ATOM 10199  H HA   . THR B 2 56  ? 14.879  -0.256  2.349   1.00 0.00  ? 356 THR B HA   2  
ATOM 10200  H HB   . THR B 2 56  ? 16.305  -2.066  1.656   1.00 0.00  ? 356 THR B HB   2  
ATOM 10201  H HG1  . THR B 2 56  ? 18.600  -1.173  1.149   1.00 0.00  ? 356 THR B HG1  2  
ATOM 10202  H HG21 . THR B 2 56  ? 15.536  -0.286  -0.042  1.00 0.00  ? 356 THR B HG21 2  
ATOM 10203  H HG22 . THR B 2 56  ? 17.205  0.286   -0.008  1.00 0.00  ? 356 THR B HG22 2  
ATOM 10204  H HG23 . THR B 2 56  ? 16.848  -1.357  -0.540  1.00 0.00  ? 356 THR B HG23 2  
ATOM 10205  N N    . GLN B 2 57  ? 15.538  -1.470  4.495   1.00 0.00  ? 357 GLN B N    2  
ATOM 10206  C CA   . GLN B 2 57  ? 15.767  -1.891  5.904   1.00 0.00  ? 357 GLN B CA   2  
ATOM 10207  C C    . GLN B 2 57  ? 17.259  -2.169  6.122   1.00 0.00  ? 357 GLN B C    2  
ATOM 10208  O O    . GLN B 2 57  ? 17.839  -3.027  5.488   1.00 0.00  ? 357 GLN B O    2  
ATOM 10209  C CB   . GLN B 2 57  ? 14.978  -3.170  6.185   1.00 0.00  ? 357 GLN B CB   2  
ATOM 10210  C CG   . GLN B 2 57  ? 15.197  -3.594  7.641   1.00 0.00  ? 357 GLN B CG   2  
ATOM 10211  C CD   . GLN B 2 57  ? 14.398  -4.858  7.937   1.00 0.00  ? 357 GLN B CD   2  
ATOM 10212  O OE1  . GLN B 2 57  ? 13.579  -5.278  7.145   1.00 0.00  ? 357 GLN B OE1  2  
ATOM 10213  N NE2  . GLN B 2 57  ? 14.606  -5.483  9.061   1.00 0.00  ? 357 GLN B NE2  2  
ATOM 10214  H H    . GLN B 2 57  ? 14.834  -1.878  3.946   1.00 0.00  ? 357 GLN B H    2  
ATOM 10215  H HA   . GLN B 2 57  ? 15.443  -1.112  6.572   1.00 0.00  ? 357 GLN B HA   2  
ATOM 10216  H HB2  . GLN B 2 57  ? 13.929  -2.990  6.009   1.00 0.00  ? 357 GLN B HB2  2  
ATOM 10217  H HB3  . GLN B 2 57  ? 15.322  -3.955  5.530   1.00 0.00  ? 357 GLN B HB3  2  
ATOM 10218  H HG2  . GLN B 2 57  ? 16.245  -3.794  7.810   1.00 0.00  ? 357 GLN B HG2  2  
ATOM 10219  H HG3  . GLN B 2 57  ? 14.873  -2.803  8.300   1.00 0.00  ? 357 GLN B HG3  2  
ATOM 10220  H HE21 . GLN B 2 57  ? 15.267  -5.137  9.696   1.00 0.00  ? 357 GLN B HE21 2  
ATOM 10221  H HE22 . GLN B 2 57  ? 14.103  -6.298  9.269   1.00 0.00  ? 357 GLN B HE22 2  
ATOM 10222  N N    . GLY B 2 58  ? 17.884  -1.444  7.019   1.00 0.00  ? 358 GLY B N    2  
ATOM 10223  C CA   . GLY B 2 58  ? 19.344  -1.653  7.290   1.00 0.00  ? 358 GLY B CA   2  
ATOM 10224  C C    . GLY B 2 58  ? 20.166  -0.556  6.601   1.00 0.00  ? 358 GLY B C    2  
ATOM 10225  O O    . GLY B 2 58  ? 21.381  -0.574  6.622   1.00 0.00  ? 358 GLY B O    2  
ATOM 10226  H H    . GLY B 2 58  ? 17.402  -0.743  7.503   1.00 0.00  ? 358 GLY B H    2  
ATOM 10227  H HA2  . GLY B 2 58  ? 19.515  -1.614  8.354   1.00 0.00  ? 358 GLY B HA2  2  
ATOM 10228  H HA3  . GLY B 2 58  ? 19.655  -2.617  6.915   1.00 0.00  ? 358 GLY B HA3  2  
ATOM 10229  N N    . THR B 2 59  ? 19.513  0.384   5.969   1.00 0.00  ? 359 THR B N    2  
ATOM 10230  C CA   . THR B 2 59  ? 20.255  1.468   5.249   1.00 0.00  ? 359 THR B CA   2  
ATOM 10231  C C    . THR B 2 59  ? 20.581  2.652   6.176   1.00 0.00  ? 359 THR B C    2  
ATOM 10232  O O    . THR B 2 59  ? 19.702  3.316   6.691   1.00 0.00  ? 359 THR B O    2  
ATOM 10233  C CB   . THR B 2 59  ? 19.393  1.966   4.084   1.00 0.00  ? 359 THR B CB   2  
ATOM 10234  O OG1  . THR B 2 59  ? 19.260  0.929   3.122   1.00 0.00  ? 359 THR B OG1  2  
ATOM 10235  C CG2  . THR B 2 59  ? 20.051  3.188   3.433   1.00 0.00  ? 359 THR B CG2  2  
ATOM 10236  H H    . THR B 2 59  ? 18.534  0.360   5.946   1.00 0.00  ? 359 THR B H    2  
ATOM 10237  H HA   . THR B 2 59  ? 21.176  1.067   4.853   1.00 0.00  ? 359 THR B HA   2  
ATOM 10238  H HB   . THR B 2 59  ? 18.417  2.241   4.455   1.00 0.00  ? 359 THR B HB   2  
ATOM 10239  H HG1  . THR B 2 59  ? 18.339  0.663   3.098   1.00 0.00  ? 359 THR B HG1  2  
ATOM 10240  H HG21 . THR B 2 59  ? 21.105  2.999   3.296   1.00 0.00  ? 359 THR B HG21 2  
ATOM 10241  H HG22 . THR B 2 59  ? 19.591  3.376   2.474   1.00 0.00  ? 359 THR B HG22 2  
ATOM 10242  H HG23 . THR B 2 59  ? 19.920  4.051   4.070   1.00 0.00  ? 359 THR B HG23 2  
ATOM 10243  N N    . VAL B 2 60  ? 21.846  2.884   6.420   1.00 0.00  ? 360 VAL B N    2  
ATOM 10244  C CA   . VAL B 2 60  ? 22.239  3.990   7.349   1.00 0.00  ? 360 VAL B CA   2  
ATOM 10245  C C    . VAL B 2 60  ? 22.109  5.335   6.641   1.00 0.00  ? 360 VAL B C    2  
ATOM 10246  O O    . VAL B 2 60  ? 22.783  5.624   5.673   1.00 0.00  ? 360 VAL B O    2  
ATOM 10247  C CB   . VAL B 2 60  ? 23.695  3.805   7.780   1.00 0.00  ? 360 VAL B CB   2  
ATOM 10248  C CG1  . VAL B 2 60  ? 24.068  4.886   8.797   1.00 0.00  ? 360 VAL B CG1  2  
ATOM 10249  C CG2  . VAL B 2 60  ? 23.872  2.423   8.411   1.00 0.00  ? 360 VAL B CG2  2  
ATOM 10250  H H    . VAL B 2 60  ? 22.510  2.258   6.065   1.00 0.00  ? 360 VAL B H    2  
ATOM 10251  H HA   . VAL B 2 60  ? 21.604  3.982   8.215   1.00 0.00  ? 360 VAL B HA   2  
ATOM 10252  H HB   . VAL B 2 60  ? 24.337  3.891   6.914   1.00 0.00  ? 360 VAL B HB   2  
ATOM 10253  H HG11 . VAL B 2 60  ? 23.304  4.944   9.558   1.00 0.00  ? 360 VAL B HG11 2  
ATOM 10254  H HG12 . VAL B 2 60  ? 25.014  4.638   9.256   1.00 0.00  ? 360 VAL B HG12 2  
ATOM 10255  H HG13 . VAL B 2 60  ? 24.151  5.841   8.297   1.00 0.00  ? 360 VAL B HG13 2  
ATOM 10256  H HG21 . VAL B 2 60  ? 23.563  1.664   7.708   1.00 0.00  ? 360 VAL B HG21 2  
ATOM 10257  H HG22 . VAL B 2 60  ? 24.910  2.275   8.667   1.00 0.00  ? 360 VAL B HG22 2  
ATOM 10258  H HG23 . VAL B 2 60  ? 23.269  2.357   9.302   1.00 0.00  ? 360 VAL B HG23 2  
ATOM 10259  N N    . VAL B 2 61  ? 21.204  6.149   7.128   1.00 0.00  ? 361 VAL B N    2  
ATOM 10260  C CA   . VAL B 2 61  ? 20.946  7.483   6.519   1.00 0.00  ? 361 VAL B CA   2  
ATOM 10261  C C    . VAL B 2 61  ? 21.439  8.554   7.482   1.00 0.00  ? 361 VAL B C    2  
ATOM 10262  O O    . VAL B 2 61  ? 21.865  8.245   8.568   1.00 0.00  ? 361 VAL B O    2  
ATOM 10263  C CB   . VAL B 2 61  ? 19.440  7.645   6.308   1.00 0.00  ? 361 VAL B CB   2  
ATOM 10264  C CG1  . VAL B 2 61  ? 18.901  6.461   5.505   1.00 0.00  ? 361 VAL B CG1  2  
ATOM 10265  C CG2  . VAL B 2 61  ? 18.728  7.700   7.664   1.00 0.00  ? 361 VAL B CG2  2  
ATOM 10266  H H    . VAL B 2 61  ? 20.658  5.858   7.895   1.00 0.00  ? 361 VAL B H    2  
ATOM 10267  H HA   . VAL B 2 61  ? 21.458  7.571   5.568   1.00 0.00  ? 361 VAL B HA   2  
ATOM 10268  H HB   . VAL B 2 61  ? 19.255  8.556   5.768   1.00 0.00  ? 361 VAL B HB   2  
ATOM 10269  H HG11 . VAL B 2 61  ? 19.181  5.538   5.991   1.00 0.00  ? 361 VAL B HG11 2  
ATOM 10270  H HG12 . VAL B 2 61  ? 17.825  6.526   5.453   1.00 0.00  ? 361 VAL B HG12 2  
ATOM 10271  H HG13 . VAL B 2 61  ? 19.313  6.482   4.509   1.00 0.00  ? 361 VAL B HG13 2  
ATOM 10272  H HG21 . VAL B 2 61  ? 19.105  6.915   8.302   1.00 0.00  ? 361 VAL B HG21 2  
ATOM 10273  H HG22 . VAL B 2 61  ? 18.911  8.659   8.127   1.00 0.00  ? 361 VAL B HG22 2  
ATOM 10274  H HG23 . VAL B 2 61  ? 17.666  7.568   7.520   1.00 0.00  ? 361 VAL B HG23 2  
ATOM 10275  N N    . THR B 2 62  ? 21.353  9.807   7.110   1.00 0.00  ? 362 THR B N    2  
ATOM 10276  C CA   . THR B 2 62  ? 21.781  10.907  8.034   1.00 0.00  ? 362 THR B CA   2  
ATOM 10277  C C    . THR B 2 62  ? 20.676  11.950  8.093   1.00 0.00  ? 362 THR B C    2  
ATOM 10278  O O    . THR B 2 62  ? 20.215  12.423  7.073   1.00 0.00  ? 362 THR B O    2  
ATOM 10279  C CB   . THR B 2 62  ? 23.057  11.577  7.526   1.00 0.00  ? 362 THR B CB   2  
ATOM 10280  O OG1  . THR B 2 62  ? 24.034  10.588  7.231   1.00 0.00  ? 362 THR B OG1  2  
ATOM 10281  C CG2  . THR B 2 62  ? 23.586  12.527  8.608   1.00 0.00  ? 362 THR B CG2  2  
ATOM 10282  H H    . THR B 2 62  ? 20.961  10.028  6.242   1.00 0.00  ? 362 THR B H    2  
ATOM 10283  H HA   . THR B 2 62  ? 21.948  10.518  9.025   1.00 0.00  ? 362 THR B HA   2  
ATOM 10284  H HB   . THR B 2 62  ? 22.837  12.140  6.637   1.00 0.00  ? 362 THR B HB   2  
ATOM 10285  H HG1  . THR B 2 62  ? 24.142  10.554  6.277   1.00 0.00  ? 362 THR B HG1  2  
ATOM 10286  H HG21 . THR B 2 62  ? 23.763  11.973  9.521   1.00 0.00  ? 362 THR B HG21 2  
ATOM 10287  H HG22 . THR B 2 62  ? 24.510  12.975  8.274   1.00 0.00  ? 362 THR B HG22 2  
ATOM 10288  H HG23 . THR B 2 62  ? 22.855  13.307  8.796   1.00 0.00  ? 362 THR B HG23 2  
ATOM 10289  N N    . ILE B 2 63  ? 20.254  12.339  9.266   1.00 0.00  ? 363 ILE B N    2  
ATOM 10290  C CA   . ILE B 2 63  ? 19.190  13.376  9.375   1.00 0.00  ? 363 ILE B CA   2  
ATOM 10291  C C    . ILE B 2 63  ? 19.871  14.689  9.746   1.00 0.00  ? 363 ILE B C    2  
ATOM 10292  O O    . ILE B 2 63  ? 20.404  14.816  10.827  1.00 0.00  ? 363 ILE B O    2  
ATOM 10293  C CB   . ILE B 2 63  ? 18.227  12.990  10.502  1.00 0.00  ? 363 ILE B CB   2  
ATOM 10294  C CG1  . ILE B 2 63  ? 17.678  11.578  10.267  1.00 0.00  ? 363 ILE B CG1  2  
ATOM 10295  C CG2  . ILE B 2 63  ? 17.068  13.986  10.543  1.00 0.00  ? 363 ILE B CG2  2  
ATOM 10296  C CD1  . ILE B 2 63  ? 17.054  11.054  11.561  1.00 0.00  ? 363 ILE B CD1  2  
ATOM 10297  H H    . ILE B 2 63  ? 20.631  11.980  10.098  1.00 0.00  ? 363 ILE B H    2  
ATOM 10298  H HA   . ILE B 2 63  ? 18.651  13.482  8.443   1.00 0.00  ? 363 ILE B HA   2  
ATOM 10299  H HB   . ILE B 2 63  ? 18.756  13.019  11.446  1.00 0.00  ? 363 ILE B HB   2  
ATOM 10300  H HG12 . ILE B 2 63  ? 16.928  11.606  9.490   1.00 0.00  ? 363 ILE B HG12 2  
ATOM 10301  H HG13 . ILE B 2 63  ? 18.480  10.920  9.970   1.00 0.00  ? 363 ILE B HG13 2  
ATOM 10302  H HG21 . ILE B 2 63  ? 16.557  13.984  9.591   1.00 0.00  ? 363 ILE B HG21 2  
ATOM 10303  H HG22 . ILE B 2 63  ? 16.376  13.703  11.323  1.00 0.00  ? 363 ILE B HG22 2  
ATOM 10304  H HG23 . ILE B 2 63  ? 17.450  14.976  10.743  1.00 0.00  ? 363 ILE B HG23 2  
ATOM 10305  H HD11 . ILE B 2 63  ? 16.287  11.736  11.893  1.00 0.00  ? 363 ILE B HD11 2  
ATOM 10306  H HD12 . ILE B 2 63  ? 16.620  10.081  11.384  1.00 0.00  ? 363 ILE B HD12 2  
ATOM 10307  H HD13 . ILE B 2 63  ? 17.818  10.974  12.322  1.00 0.00  ? 363 ILE B HD13 2  
ATOM 10308  N N    . SER B 2 64  ? 19.871  15.665  8.871   1.00 0.00  ? 364 SER B N    2  
ATOM 10309  C CA   . SER B 2 64  ? 20.540  16.969  9.190   1.00 0.00  ? 364 SER B CA   2  
ATOM 10310  C C    . SER B 2 64  ? 19.499  18.091  9.164   1.00 0.00  ? 364 SER B C    2  
ATOM 10311  O O    . SER B 2 64  ? 18.720  18.204  8.239   1.00 0.00  ? 364 SER B O    2  
ATOM 10312  C CB   . SER B 2 64  ? 21.611  17.262  8.140   1.00 0.00  ? 364 SER B CB   2  
ATOM 10313  O OG   . SER B 2 64  ? 21.013  17.283  6.850   1.00 0.00  ? 364 SER B OG   2  
ATOM 10314  H H    . SER B 2 64  ? 19.441  15.543  7.998   1.00 0.00  ? 364 SER B H    2  
ATOM 10315  H HA   . SER B 2 64  ? 21.004  16.925  10.166  1.00 0.00  ? 364 SER B HA   2  
ATOM 10316  H HB2  . SER B 2 64  ? 22.060  18.223  8.339   1.00 0.00  ? 364 SER B HB2  2  
ATOM 10317  H HB3  . SER B 2 64  ? 22.374  16.496  8.183   1.00 0.00  ? 364 SER B HB3  2  
ATOM 10318  H HG   . SER B 2 64  ? 21.553  17.837  6.281   1.00 0.00  ? 364 SER B HG   2  
ATOM 10319  N N    . ALA B 2 65  ? 19.469  18.915  10.180  1.00 0.00  ? 365 ALA B N    2  
ATOM 10320  C CA   . ALA B 2 65  ? 18.465  20.022  10.223  1.00 0.00  ? 365 ALA B CA   2  
ATOM 10321  C C    . ALA B 2 65  ? 19.091  21.259  10.872  1.00 0.00  ? 365 ALA B C    2  
ATOM 10322  O O    . ALA B 2 65  ? 19.976  21.157  11.701  1.00 0.00  ? 365 ALA B O    2  
ATOM 10323  C CB   . ALA B 2 65  ? 17.262  19.573  11.054  1.00 0.00  ? 365 ALA B CB   2  
ATOM 10324  H H    . ALA B 2 65  ? 20.090  18.791  10.929  1.00 0.00  ? 365 ALA B H    2  
ATOM 10325  H HA   . ALA B 2 65  ? 18.139  20.266  9.221   1.00 0.00  ? 365 ALA B HA   2  
ATOM 10326  H HB1  . ALA B 2 65  ? 16.841  18.675  10.624  1.00 0.00  ? 365 ALA B HB1  2  
ATOM 10327  H HB2  . ALA B 2 65  ? 17.579  19.372  12.067  1.00 0.00  ? 365 ALA B HB2  2  
ATOM 10328  H HB3  . ALA B 2 65  ? 16.515  20.352  11.061  1.00 0.00  ? 365 ALA B HB3  2  
ATOM 10329  N N    . GLU B 2 66  ? 18.634  22.431  10.503  1.00 0.00  ? 366 GLU B N    2  
ATOM 10330  C CA   . GLU B 2 66  ? 19.199  23.682  11.100  1.00 0.00  ? 366 GLU B CA   2  
ATOM 10331  C C    . GLU B 2 66  ? 18.093  24.737  11.212  1.00 0.00  ? 366 GLU B C    2  
ATOM 10332  O O    . GLU B 2 66  ? 17.433  25.053  10.241  1.00 0.00  ? 366 GLU B O    2  
ATOM 10333  C CB   . GLU B 2 66  ? 20.310  24.223  10.197  1.00 0.00  ? 366 GLU B CB   2  
ATOM 10334  C CG   . GLU B 2 66  ? 21.027  25.376  10.903  1.00 0.00  ? 366 GLU B CG   2  
ATOM 10335  C CD   . GLU B 2 66  ? 22.138  25.917  10.002  1.00 0.00  ? 366 GLU B CD   2  
ATOM 10336  O OE1  . GLU B 2 66  ? 22.423  25.282  9.000   1.00 0.00  ? 366 GLU B OE1  2  
ATOM 10337  O OE2  . GLU B 2 66  ? 22.687  26.957  10.330  1.00 0.00  ? 366 GLU B OE2  2  
ATOM 10338  H H    . GLU B 2 66  ? 17.917  22.487  9.834   1.00 0.00  ? 366 GLU B H    2  
ATOM 10339  H HA   . GLU B 2 66  ? 19.602  23.472  12.078  1.00 0.00  ? 366 GLU B HA   2  
ATOM 10340  H HB2  . GLU B 2 66  ? 21.015  23.437  9.982   1.00 0.00  ? 366 GLU B HB2  2  
ATOM 10341  H HB3  . GLU B 2 66  ? 19.880  24.582  9.274   1.00 0.00  ? 366 GLU B HB3  2  
ATOM 10342  H HG2  . GLU B 2 66  ? 20.319  26.164  11.117  1.00 0.00  ? 366 GLU B HG2  2  
ATOM 10343  H HG3  . GLU B 2 66  ? 21.458  25.020  11.826  1.00 0.00  ? 366 GLU B HG3  2  
ATOM 10344  N N    . GLY B 2 67  ? 17.874  25.290  12.381  1.00 0.00  ? 367 GLY B N    2  
ATOM 10345  C CA   . GLY B 2 67  ? 16.805  26.320  12.517  1.00 0.00  ? 367 GLY B CA   2  
ATOM 10346  C C    . GLY B 2 67  ? 16.302  26.409  13.963  1.00 0.00  ? 367 GLY B C    2  
ATOM 10347  O O    . GLY B 2 67  ? 16.998  26.099  14.911  1.00 0.00  ? 367 GLY B O    2  
ATOM 10348  H H    . GLY B 2 67  ? 18.402  25.028  13.161  1.00 0.00  ? 367 GLY B H    2  
ATOM 10349  H HA2  . GLY B 2 67  ? 17.201  27.280  12.220  1.00 0.00  ? 367 GLY B HA2  2  
ATOM 10350  H HA3  . GLY B 2 67  ? 15.976  26.065  11.871  1.00 0.00  ? 367 GLY B HA3  2  
ATOM 10351  N N    . GLU B 2 68  ? 15.097  26.887  14.114  1.00 0.00  ? 368 GLU B N    2  
ATOM 10352  C CA   . GLU B 2 68  ? 14.510  27.076  15.477  1.00 0.00  ? 368 GLU B CA   2  
ATOM 10353  C C    . GLU B 2 68  ? 14.421  25.760  16.259  1.00 0.00  ? 368 GLU B C    2  
ATOM 10354  O O    . GLU B 2 68  ? 14.824  25.702  17.404  1.00 0.00  ? 368 GLU B O    2  
ATOM 10355  C CB   . GLU B 2 68  ? 13.100  27.661  15.340  1.00 0.00  ? 368 GLU B CB   2  
ATOM 10356  C CG   . GLU B 2 68  ? 12.480  27.859  16.730  1.00 0.00  ? 368 GLU B CG   2  
ATOM 10357  C CD   . GLU B 2 68  ? 11.107  28.518  16.586  1.00 0.00  ? 368 GLU B CD   2  
ATOM 10358  O OE1  . GLU B 2 68  ? 10.791  28.948  15.489  1.00 0.00  ? 368 GLU B OE1  2  
ATOM 10359  O OE2  . GLU B 2 68  ? 10.395  28.580  17.575  1.00 0.00  ? 368 GLU B OE2  2  
ATOM 10360  H H    . GLU B 2 68  ? 14.618  27.162  13.306  1.00 0.00  ? 368 GLU B H    2  
ATOM 10361  H HA   . GLU B 2 68  ? 15.122  27.773  16.029  1.00 0.00  ? 368 GLU B HA   2  
ATOM 10362  H HB2  . GLU B 2 68  ? 13.154  28.613  14.832  1.00 0.00  ? 368 GLU B HB2  2  
ATOM 10363  H HB3  . GLU B 2 68  ? 12.484  26.983  14.767  1.00 0.00  ? 368 GLU B HB3  2  
ATOM 10364  H HG2  . GLU B 2 68  ? 12.364  26.898  17.218  1.00 0.00  ? 368 GLU B HG2  2  
ATOM 10365  H HG3  . GLU B 2 68  ? 13.121  28.491  17.325  1.00 0.00  ? 368 GLU B HG3  2  
ATOM 10366  N N    . ASP B 2 69  ? 13.863  24.720  15.689  1.00 0.00  ? 369 ASP B N    2  
ATOM 10367  C CA   . ASP B 2 69  ? 13.709  23.433  16.453  1.00 0.00  ? 369 ASP B CA   2  
ATOM 10368  C C    . ASP B 2 69  ? 14.705  22.372  15.966  1.00 0.00  ? 369 ASP B C    2  
ATOM 10369  O O    . ASP B 2 69  ? 14.591  21.209  16.298  1.00 0.00  ? 369 ASP B O    2  
ATOM 10370  C CB   . ASP B 2 69  ? 12.289  22.911  16.239  1.00 0.00  ? 369 ASP B CB   2  
ATOM 10371  C CG   . ASP B 2 69  ? 11.295  23.818  16.968  1.00 0.00  ? 369 ASP B CG   2  
ATOM 10372  O OD1  . ASP B 2 69  ? 11.707  24.491  17.898  1.00 0.00  ? 369 ASP B OD1  2  
ATOM 10373  O OD2  . ASP B 2 69  ? 10.136  23.822  16.584  1.00 0.00  ? 369 ASP B OD2  2  
ATOM 10374  H H    . ASP B 2 69  ? 13.499  24.790  14.784  1.00 0.00  ? 369 ASP B H    2  
ATOM 10375  H HA   . ASP B 2 69  ? 13.859  23.613  17.508  1.00 0.00  ? 369 ASP B HA   2  
ATOM 10376  H HB2  . ASP B 2 69  ? 12.065  22.904  15.183  1.00 0.00  ? 369 ASP B HB2  2  
ATOM 10377  H HB3  . ASP B 2 69  ? 12.212  21.909  16.629  1.00 0.00  ? 369 ASP B HB3  2  
ATOM 10378  N N    . GLU B 2 70  ? 15.663  22.751  15.170  1.00 0.00  ? 370 GLU B N    2  
ATOM 10379  C CA   . GLU B 2 70  ? 16.646  21.751  14.651  1.00 0.00  ? 370 GLU B CA   2  
ATOM 10380  C C    . GLU B 2 70  ? 17.126  20.816  15.769  1.00 0.00  ? 370 GLU B C    2  
ATOM 10381  O O    . GLU B 2 70  ? 17.365  19.642  15.542  1.00 0.00  ? 370 GLU B O    2  
ATOM 10382  C CB   . GLU B 2 70  ? 17.854  22.489  14.066  1.00 0.00  ? 370 GLU B CB   2  
ATOM 10383  C CG   . GLU B 2 70  ? 18.539  23.306  15.168  1.00 0.00  ? 370 GLU B CG   2  
ATOM 10384  C CD   . GLU B 2 70  ? 19.640  24.178  14.563  1.00 0.00  ? 370 GLU B CD   2  
ATOM 10385  O OE1  . GLU B 2 70  ? 20.728  23.667  14.356  1.00 0.00  ? 370 GLU B OE1  2  
ATOM 10386  O OE2  . GLU B 2 70  ? 19.377  25.345  14.319  1.00 0.00  ? 370 GLU B OE2  2  
ATOM 10387  H H    . GLU B 2 70  ? 15.722  23.688  14.891  1.00 0.00  ? 370 GLU B H    2  
ATOM 10388  H HA   . GLU B 2 70  ? 16.179  21.166  13.873  1.00 0.00  ? 370 GLU B HA   2  
ATOM 10389  H HB2  . GLU B 2 70  ? 18.552  21.770  13.662  1.00 0.00  ? 370 GLU B HB2  2  
ATOM 10390  H HB3  . GLU B 2 70  ? 17.523  23.146  13.283  1.00 0.00  ? 370 GLU B HB3  2  
ATOM 10391  H HG2  . GLU B 2 70  ? 17.809  23.934  15.657  1.00 0.00  ? 370 GLU B HG2  2  
ATOM 10392  H HG3  . GLU B 2 70  ? 18.977  22.635  15.888  1.00 0.00  ? 370 GLU B HG3  2  
ATOM 10393  N N    . GLN B 2 71  ? 17.277  21.313  16.970  1.00 0.00  ? 371 GLN B N    2  
ATOM 10394  C CA   . GLN B 2 71  ? 17.754  20.431  18.077  1.00 0.00  ? 371 GLN B CA   2  
ATOM 10395  C C    . GLN B 2 71  ? 16.662  19.429  18.456  1.00 0.00  ? 371 GLN B C    2  
ATOM 10396  O O    . GLN B 2 71  ? 16.924  18.263  18.682  1.00 0.00  ? 371 GLN B O    2  
ATOM 10397  C CB   . GLN B 2 71  ? 18.095  21.284  19.304  1.00 0.00  ? 371 GLN B CB   2  
ATOM 10398  C CG   . GLN B 2 71  ? 19.353  22.110  19.030  1.00 0.00  ? 371 GLN B CG   2  
ATOM 10399  C CD   . GLN B 2 71  ? 19.685  22.958  20.260  1.00 0.00  ? 371 GLN B CD   2  
ATOM 10400  O OE1  . GLN B 2 71  ? 18.803  23.350  20.997  1.00 0.00  ? 371 GLN B OE1  2  
ATOM 10401  N NE2  . GLN B 2 71  ? 20.930  23.261  20.512  1.00 0.00  ? 371 GLN B NE2  2  
ATOM 10402  H H    . GLN B 2 71  ? 17.073  22.256  17.142  1.00 0.00  ? 371 GLN B H    2  
ATOM 10403  H HA   . GLN B 2 71  ? 18.634  19.898  17.758  1.00 0.00  ? 371 GLN B HA   2  
ATOM 10404  H HB2  . GLN B 2 71  ? 17.270  21.948  19.521  1.00 0.00  ? 371 GLN B HB2  2  
ATOM 10405  H HB3  . GLN B 2 71  ? 18.268  20.640  20.153  1.00 0.00  ? 371 GLN B HB3  2  
ATOM 10406  H HG2  . GLN B 2 71  ? 20.179  21.449  18.814  1.00 0.00  ? 371 GLN B HG2  2  
ATOM 10407  H HG3  . GLN B 2 71  ? 19.181  22.759  18.188  1.00 0.00  ? 371 GLN B HG3  2  
ATOM 10408  H HE21 . GLN B 2 71  ? 21.641  22.946  19.916  1.00 0.00  ? 371 GLN B HE21 2  
ATOM 10409  H HE22 . GLN B 2 71  ? 21.152  23.804  21.296  1.00 0.00  ? 371 GLN B HE22 2  
ATOM 10410  N N    . LYS B 2 72  ? 15.441  19.874  18.537  1.00 0.00  ? 372 LYS B N    2  
ATOM 10411  C CA   . LYS B 2 72  ? 14.340  18.945  18.913  1.00 0.00  ? 372 LYS B CA   2  
ATOM 10412  C C    . LYS B 2 72  ? 14.145  17.915  17.804  1.00 0.00  ? 372 LYS B C    2  
ATOM 10413  O O    . LYS B 2 72  ? 14.058  16.729  18.050  1.00 0.00  ? 372 LYS B O    2  
ATOM 10414  C CB   . LYS B 2 72  ? 13.041  19.733  19.093  1.00 0.00  ? 372 LYS B CB   2  
ATOM 10415  C CG   . LYS B 2 72  ? 13.127  20.603  20.349  1.00 0.00  ? 372 LYS B CG   2  
ATOM 10416  C CD   . LYS B 2 72  ? 11.820  21.383  20.512  1.00 0.00  ? 372 LYS B CD   2  
ATOM 10417  C CE   . LYS B 2 72  ? 11.894  22.256  21.766  1.00 0.00  ? 372 LYS B CE   2  
ATOM 10418  N NZ   . LYS B 2 72  ? 12.005  21.388  22.971  1.00 0.00  ? 372 LYS B NZ   2  
ATOM 10419  H H    . LYS B 2 72  ? 15.257  20.819  18.361  1.00 0.00  ? 372 LYS B H    2  
ATOM 10420  H HA   . LYS B 2 72  ? 14.589  18.443  19.833  1.00 0.00  ? 372 LYS B HA   2  
ATOM 10421  H HB2  . LYS B 2 72  ? 12.883  20.362  18.232  1.00 0.00  ? 372 LYS B HB2  2  
ATOM 10422  H HB3  . LYS B 2 72  ? 12.215  19.046  19.192  1.00 0.00  ? 372 LYS B HB3  2  
ATOM 10423  H HG2  . LYS B 2 72  ? 13.284  19.974  21.214  1.00 0.00  ? 372 LYS B HG2  2  
ATOM 10424  H HG3  . LYS B 2 72  ? 13.949  21.297  20.254  1.00 0.00  ? 372 LYS B HG3  2  
ATOM 10425  H HD2  . LYS B 2 72  ? 11.664  22.009  19.646  1.00 0.00  ? 372 LYS B HD2  2  
ATOM 10426  H HD3  . LYS B 2 72  ? 10.998  20.690  20.607  1.00 0.00  ? 372 LYS B HD3  2  
ATOM 10427  H HE2  . LYS B 2 72  ? 12.759  22.900  21.705  1.00 0.00  ? 372 LYS B HE2  2  
ATOM 10428  H HE3  . LYS B 2 72  ? 11.001  22.860  21.837  1.00 0.00  ? 372 LYS B HE3  2  
ATOM 10429  H HZ1  . LYS B 2 72  ? 11.559  20.469  22.779  1.00 0.00  ? 372 LYS B HZ1  2  
ATOM 10430  H HZ2  . LYS B 2 72  ? 13.007  21.243  23.204  1.00 0.00  ? 372 LYS B HZ2  2  
ATOM 10431  H HZ3  . LYS B 2 72  ? 11.524  21.847  23.772  1.00 0.00  ? 372 LYS B HZ3  2  
ATOM 10432  N N    . ALA B 2 73  ? 14.053  18.364  16.586  1.00 0.00  ? 373 ALA B N    2  
ATOM 10433  C CA   . ALA B 2 73  ? 13.836  17.426  15.453  1.00 0.00  ? 373 ALA B CA   2  
ATOM 10434  C C    . ALA B 2 73  ? 14.783  16.223  15.550  1.00 0.00  ? 373 ALA B C    2  
ATOM 10435  O O    . ALA B 2 73  ? 14.364  15.125  15.860  1.00 0.00  ? 373 ALA B O    2  
ATOM 10436  C CB   . ALA B 2 73  ? 14.072  18.178  14.134  1.00 0.00  ? 373 ALA B CB   2  
ATOM 10437  H H    . ALA B 2 73  ? 14.093  19.326  16.410  1.00 0.00  ? 373 ALA B H    2  
ATOM 10438  H HA   . ALA B 2 73  ? 12.814  17.075  15.479  1.00 0.00  ? 373 ALA B HA   2  
ATOM 10439  H HB1  . ALA B 2 73  ? 13.745  19.201  14.243  1.00 0.00  ? 373 ALA B HB1  2  
ATOM 10440  H HB2  . ALA B 2 73  ? 15.124  18.165  13.887  1.00 0.00  ? 373 ALA B HB2  2  
ATOM 10441  H HB3  . ALA B 2 73  ? 13.509  17.706  13.343  1.00 0.00  ? 373 ALA B HB3  2  
ATOM 10442  N N    . VAL B 2 74  ? 16.041  16.402  15.236  1.00 0.00  ? 374 VAL B N    2  
ATOM 10443  C CA   . VAL B 2 74  ? 16.981  15.239  15.259  1.00 0.00  ? 374 VAL B CA   2  
ATOM 10444  C C    . VAL B 2 74  ? 16.777  14.395  16.521  1.00 0.00  ? 374 VAL B C    2  
ATOM 10445  O O    . VAL B 2 74  ? 16.906  13.189  16.487  1.00 0.00  ? 374 VAL B O    2  
ATOM 10446  C CB   . VAL B 2 74  ? 18.436  15.721  15.198  1.00 0.00  ? 374 VAL B CB   2  
ATOM 10447  C CG1  . VAL B 2 74  ? 19.373  14.506  15.072  1.00 0.00  ? 374 VAL B CG1  2  
ATOM 10448  C CG2  . VAL B 2 74  ? 18.620  16.634  13.982  1.00 0.00  ? 374 VAL B CG2  2  
ATOM 10449  H H    . VAL B 2 74  ? 16.348  17.284  14.927  1.00 0.00  ? 374 VAL B H    2  
ATOM 10450  H HA   . VAL B 2 74  ? 16.784  14.623  14.397  1.00 0.00  ? 374 VAL B HA   2  
ATOM 10451  H HB   . VAL B 2 74  ? 18.673  16.267  16.100  1.00 0.00  ? 374 VAL B HB   2  
ATOM 10452  H HG11 . VAL B 2 74  ? 18.961  13.801  14.370  1.00 0.00  ? 374 VAL B HG11 2  
ATOM 10453  H HG12 . VAL B 2 74  ? 20.341  14.824  14.722  1.00 0.00  ? 374 VAL B HG12 2  
ATOM 10454  H HG13 . VAL B 2 74  ? 19.480  14.034  16.037  1.00 0.00  ? 374 VAL B HG13 2  
ATOM 10455  H HG21 . VAL B 2 74  ? 18.138  16.191  13.123  1.00 0.00  ? 374 VAL B HG21 2  
ATOM 10456  H HG22 . VAL B 2 74  ? 18.179  17.598  14.185  1.00 0.00  ? 374 VAL B HG22 2  
ATOM 10457  H HG23 . VAL B 2 74  ? 19.675  16.755  13.779  1.00 0.00  ? 374 VAL B HG23 2  
ATOM 10458  N N    . GLU B 2 75  ? 16.456  14.993  17.633  1.00 0.00  ? 375 GLU B N    2  
ATOM 10459  C CA   . GLU B 2 75  ? 16.254  14.168  18.860  1.00 0.00  ? 375 GLU B CA   2  
ATOM 10460  C C    . GLU B 2 75  ? 15.022  13.267  18.699  1.00 0.00  ? 375 GLU B C    2  
ATOM 10461  O O    . GLU B 2 75  ? 15.063  12.082  18.988  1.00 0.00  ? 375 GLU B O    2  
ATOM 10462  C CB   . GLU B 2 75  ? 16.067  15.079  20.076  1.00 0.00  ? 375 GLU B CB   2  
ATOM 10463  C CG   . GLU B 2 75  ? 17.391  15.770  20.408  1.00 0.00  ? 375 GLU B CG   2  
ATOM 10464  C CD   . GLU B 2 75  ? 18.380  14.740  20.959  1.00 0.00  ? 375 GLU B CD   2  
ATOM 10465  O OE1  . GLU B 2 75  ? 18.074  14.136  21.974  1.00 0.00  ? 375 GLU B OE1  2  
ATOM 10466  O OE2  . GLU B 2 75  ? 19.428  14.570  20.357  1.00 0.00  ? 375 GLU B OE2  2  
ATOM 10467  H H    . GLU B 2 75  ? 16.343  15.968  17.661  1.00 0.00  ? 375 GLU B H    2  
ATOM 10468  H HA   . GLU B 2 75  ? 17.122  13.548  19.013  1.00 0.00  ? 375 GLU B HA   2  
ATOM 10469  H HB2  . GLU B 2 75  ? 15.316  15.824  19.855  1.00 0.00  ? 375 GLU B HB2  2  
ATOM 10470  H HB3  . GLU B 2 75  ? 15.748  14.489  20.922  1.00 0.00  ? 375 GLU B HB3  2  
ATOM 10471  H HG2  . GLU B 2 75  ? 17.797  16.218  19.513  1.00 0.00  ? 375 GLU B HG2  2  
ATOM 10472  H HG3  . GLU B 2 75  ? 17.222  16.535  21.151  1.00 0.00  ? 375 GLU B HG3  2  
ATOM 10473  N N    . HIS B 2 76  ? 13.928  13.802  18.225  1.00 0.00  ? 376 HIS B N    2  
ATOM 10474  C CA   . HIS B 2 76  ? 12.708  12.963  18.044  1.00 0.00  ? 376 HIS B CA   2  
ATOM 10475  C C    . HIS B 2 76  ? 12.820  12.162  16.747  1.00 0.00  ? 376 HIS B C    2  
ATOM 10476  O O    . HIS B 2 76  ? 12.472  10.999  16.689  1.00 0.00  ? 376 HIS B O    2  
ATOM 10477  C CB   . HIS B 2 76  ? 11.477  13.870  17.977  1.00 0.00  ? 376 HIS B CB   2  
ATOM 10478  C CG   . HIS B 2 76  ? 11.269  14.533  19.312  1.00 0.00  ? 376 HIS B CG   2  
ATOM 10479  N ND1  . HIS B 2 76  ? 10.804  13.840  20.419  1.00 0.00  ? 376 HIS B ND1  2  
ATOM 10480  C CD2  . HIS B 2 76  ? 11.460  15.826  19.733  1.00 0.00  ? 376 HIS B CD2  2  
ATOM 10481  C CE1  . HIS B 2 76  ? 10.730  14.712  21.442  1.00 0.00  ? 376 HIS B CE1  2  
ATOM 10482  N NE2  . HIS B 2 76  ? 11.119  15.937  21.077  1.00 0.00  ? 376 HIS B NE2  2  
ATOM 10483  H H    . HIS B 2 76  ? 13.901  14.745  17.967  1.00 0.00  ? 376 HIS B H    2  
ATOM 10484  H HA   . HIS B 2 76  ? 12.610  12.284  18.878  1.00 0.00  ? 376 HIS B HA   2  
ATOM 10485  H HB2  . HIS B 2 76  ? 11.625  14.624  17.219  1.00 0.00  ? 376 HIS B HB2  2  
ATOM 10486  H HB3  . HIS B 2 76  ? 10.607  13.279  17.731  1.00 0.00  ? 376 HIS B HB3  2  
ATOM 10487  H HD1  . HIS B 2 76  ? 10.570  12.889  20.450  1.00 0.00  ? 376 HIS B HD1  2  
ATOM 10488  H HD2  . HIS B 2 76  ? 11.819  16.635  19.114  1.00 0.00  ? 376 HIS B HD2  2  
ATOM 10489  H HE1  . HIS B 2 76  ? 10.397  14.452  22.435  1.00 0.00  ? 376 HIS B HE1  2  
ATOM 10490  N N    . LEU B 2 77  ? 13.288  12.782  15.700  1.00 0.00  ? 377 LEU B N    2  
ATOM 10491  C CA   . LEU B 2 77  ? 13.405  12.070  14.397  1.00 0.00  ? 377 LEU B CA   2  
ATOM 10492  C C    . LEU B 2 77  ? 14.333  10.868  14.555  1.00 0.00  ? 377 LEU B C    2  
ATOM 10493  O O    . LEU B 2 77  ? 14.081  9.807   14.020  1.00 0.00  ? 377 LEU B O    2  
ATOM 10494  C CB   . LEU B 2 77  ? 13.987  13.014  13.342  1.00 0.00  ? 377 LEU B CB   2  
ATOM 10495  C CG   . LEU B 2 77  ? 13.032  14.187  13.083  1.00 0.00  ? 377 LEU B CG   2  
ATOM 10496  C CD1  . LEU B 2 77  ? 13.741  15.213  12.195  1.00 0.00  ? 377 LEU B CD1  2  
ATOM 10497  C CD2  . LEU B 2 77  ? 11.751  13.695  12.381  1.00 0.00  ? 377 LEU B CD2  2  
ATOM 10498  H H    . LEU B 2 77  ? 13.537  13.728  15.765  1.00 0.00  ? 377 LEU B H    2  
ATOM 10499  H HA   . LEU B 2 77  ? 12.431  11.730  14.082  1.00 0.00  ? 377 LEU B HA   2  
ATOM 10500  H HB2  . LEU B 2 77  ? 14.933  13.396  13.691  1.00 0.00  ? 377 LEU B HB2  2  
ATOM 10501  H HB3  . LEU B 2 77  ? 14.141  12.470  12.423  1.00 0.00  ? 377 LEU B HB3  2  
ATOM 10502  H HG   . LEU B 2 77  ? 12.774  14.650  14.026  1.00 0.00  ? 377 LEU B HG   2  
ATOM 10503  H HD11 . LEU B 2 77  ? 14.162  14.715  11.334  1.00 0.00  ? 377 LEU B HD11 2  
ATOM 10504  H HD12 . LEU B 2 77  ? 13.030  15.959  11.868  1.00 0.00  ? 377 LEU B HD12 2  
ATOM 10505  H HD13 . LEU B 2 77  ? 14.532  15.690  12.756  1.00 0.00  ? 377 LEU B HD13 2  
ATOM 10506  H HD21 . LEU B 2 77  ? 11.994  12.907  11.682  1.00 0.00  ? 377 LEU B HD21 2  
ATOM 10507  H HD22 . LEU B 2 77  ? 11.059  13.320  13.119  1.00 0.00  ? 377 LEU B HD22 2  
ATOM 10508  H HD23 . LEU B 2 77  ? 11.291  14.516  11.849  1.00 0.00  ? 377 LEU B HD23 2  
ATOM 10509  N N    . VAL B 2 78  ? 15.401  11.013  15.290  1.00 0.00  ? 378 VAL B N    2  
ATOM 10510  C CA   . VAL B 2 78  ? 16.320  9.857   15.473  1.00 0.00  ? 378 VAL B CA   2  
ATOM 10511  C C    . VAL B 2 78  ? 15.578  8.722   16.170  1.00 0.00  ? 378 VAL B C    2  
ATOM 10512  O O    . VAL B 2 78  ? 15.707  7.574   15.791  1.00 0.00  ? 378 VAL B O    2  
ATOM 10513  C CB   . VAL B 2 78  ? 17.547  10.289  16.288  1.00 0.00  ? 378 VAL B CB   2  
ATOM 10514  C CG1  . VAL B 2 78  ? 18.337  9.054   16.741  1.00 0.00  ? 378 VAL B CG1  2  
ATOM 10515  C CG2  . VAL B 2 78  ? 18.447  11.160  15.404  1.00 0.00  ? 378 VAL B CG2  2  
ATOM 10516  H H    . VAL B 2 78  ? 15.584  11.867  15.734  1.00 0.00  ? 378 VAL B H    2  
ATOM 10517  H HA   . VAL B 2 78  ? 16.640  9.513   14.504  1.00 0.00  ? 378 VAL B HA   2  
ATOM 10518  H HB   . VAL B 2 78  ? 17.229  10.853  17.152  1.00 0.00  ? 378 VAL B HB   2  
ATOM 10519  H HG11 . VAL B 2 78  ? 18.446  8.372   15.911  1.00 0.00  ? 378 VAL B HG11 2  
ATOM 10520  H HG12 . VAL B 2 78  ? 19.314  9.358   17.088  1.00 0.00  ? 378 VAL B HG12 2  
ATOM 10521  H HG13 . VAL B 2 78  ? 17.807  8.562   17.544  1.00 0.00  ? 378 VAL B HG13 2  
ATOM 10522  H HG21 . VAL B 2 78  ? 17.839  11.839  14.827  1.00 0.00  ? 378 VAL B HG21 2  
ATOM 10523  H HG22 . VAL B 2 78  ? 19.128  11.721  16.026  1.00 0.00  ? 378 VAL B HG22 2  
ATOM 10524  H HG23 . VAL B 2 78  ? 19.011  10.530  14.731  1.00 0.00  ? 378 VAL B HG23 2  
ATOM 10525  N N    . LYS B 2 79  ? 14.784  9.009   17.163  1.00 0.00  ? 379 LYS B N    2  
ATOM 10526  C CA   . LYS B 2 79  ? 14.040  7.901   17.818  1.00 0.00  ? 379 LYS B CA   2  
ATOM 10527  C C    . LYS B 2 79  ? 12.981  7.398   16.833  1.00 0.00  ? 379 LYS B C    2  
ATOM 10528  O O    . LYS B 2 79  ? 12.899  6.223   16.537  1.00 0.00  ? 379 LYS B O    2  
ATOM 10529  C CB   . LYS B 2 79  ? 13.375  8.410   19.100  1.00 0.00  ? 379 LYS B CB   2  
ATOM 10530  C CG   . LYS B 2 79  ? 14.447  8.700   20.145  1.00 0.00  ? 379 LYS B CG   2  
ATOM 10531  C CD   . LYS B 2 79  ? 13.780  9.209   21.423  1.00 0.00  ? 379 LYS B CD   2  
ATOM 10532  C CE   . LYS B 2 79  ? 14.792  9.185   22.563  1.00 0.00  ? 379 LYS B CE   2  
ATOM 10533  N NZ   . LYS B 2 79  ? 15.899  10.138  22.270  1.00 0.00  ? 379 LYS B NZ   2  
ATOM 10534  H H    . LYS B 2 79  ? 14.652  9.936   17.465  1.00 0.00  ? 379 LYS B H    2  
ATOM 10535  H HA   . LYS B 2 79  ? 14.723  7.098   18.056  1.00 0.00  ? 379 LYS B HA   2  
ATOM 10536  H HB2  . LYS B 2 79  ? 12.824  9.314   18.888  1.00 0.00  ? 379 LYS B HB2  2  
ATOM 10537  H HB3  . LYS B 2 79  ? 12.702  7.658   19.483  1.00 0.00  ? 379 LYS B HB3  2  
ATOM 10538  H HG2  . LYS B 2 79  ? 14.999  7.795   20.359  1.00 0.00  ? 379 LYS B HG2  2  
ATOM 10539  H HG3  . LYS B 2 79  ? 15.123  9.455   19.770  1.00 0.00  ? 379 LYS B HG3  2  
ATOM 10540  H HD2  . LYS B 2 79  ? 13.431  10.219  21.269  1.00 0.00  ? 379 LYS B HD2  2  
ATOM 10541  H HD3  . LYS B 2 79  ? 12.945  8.571   21.671  1.00 0.00  ? 379 LYS B HD3  2  
ATOM 10542  H HE2  . LYS B 2 79  ? 14.303  9.471   23.481  1.00 0.00  ? 379 LYS B HE2  2  
ATOM 10543  H HE3  . LYS B 2 79  ? 15.190  8.187   22.662  1.00 0.00  ? 379 LYS B HE3  2  
ATOM 10544  H HZ1  . LYS B 2 79  ? 15.744  10.576  21.341  1.00 0.00  ? 379 LYS B HZ1  2  
ATOM 10545  H HZ2  . LYS B 2 79  ? 15.923  10.878  23.000  1.00 0.00  ? 379 LYS B HZ2  2  
ATOM 10546  H HZ3  . LYS B 2 79  ? 16.805  9.624   22.265  1.00 0.00  ? 379 LYS B HZ3  2  
ATOM 10547  N N    . LEU B 2 80  ? 12.143  8.277   16.353  1.00 0.00  ? 380 LEU B N    2  
ATOM 10548  C CA   . LEU B 2 80  ? 11.052  7.860   15.426  1.00 0.00  ? 380 LEU B CA   2  
ATOM 10549  C C    . LEU B 2 80  ? 11.642  7.162   14.191  1.00 0.00  ? 380 LEU B C    2  
ATOM 10550  O O    . LEU B 2 80  ? 11.080  6.213   13.692  1.00 0.00  ? 380 LEU B O    2  
ATOM 10551  C CB   . LEU B 2 80  ? 10.277  9.115   14.991  1.00 0.00  ? 380 LEU B CB   2  
ATOM 10552  C CG   . LEU B 2 80  ? 9.102   8.744   14.070  1.00 0.00  ? 380 LEU B CG   2  
ATOM 10553  C CD1  . LEU B 2 80  ? 8.041   7.953   14.855  1.00 0.00  ? 380 LEU B CD1  2  
ATOM 10554  C CD2  . LEU B 2 80  ? 8.474   10.031  13.514  1.00 0.00  ? 380 LEU B CD2  2  
ATOM 10555  H H    . LEU B 2 80  ? 12.168  9.205   16.670  1.00 0.00  ? 380 LEU B H    2  
ATOM 10556  H HA   . LEU B 2 80  ? 10.386  7.189   15.936  1.00 0.00  ? 380 LEU B HA   2  
ATOM 10557  H HB2  . LEU B 2 80  ? 9.900   9.622   15.866  1.00 0.00  ? 380 LEU B HB2  2  
ATOM 10558  H HB3  . LEU B 2 80  ? 10.947  9.777   14.459  1.00 0.00  ? 380 LEU B HB3  2  
ATOM 10559  H HG   . LEU B 2 80  ? 9.460   8.141   13.251  1.00 0.00  ? 380 LEU B HG   2  
ATOM 10560  H HD11 . LEU B 2 80  ? 7.951   8.354   15.854  1.00 0.00  ? 380 LEU B HD11 2  
ATOM 10561  H HD12 . LEU B 2 80  ? 7.087   8.029   14.353  1.00 0.00  ? 380 LEU B HD12 2  
ATOM 10562  H HD13 . LEU B 2 80  ? 8.332   6.915   14.909  1.00 0.00  ? 380 LEU B HD13 2  
ATOM 10563  H HD21 . LEU B 2 80  ? 9.246   10.653  13.081  1.00 0.00  ? 380 LEU B HD21 2  
ATOM 10564  H HD22 . LEU B 2 80  ? 7.749   9.780   12.754  1.00 0.00  ? 380 LEU B HD22 2  
ATOM 10565  H HD23 . LEU B 2 80  ? 7.987   10.569  14.313  1.00 0.00  ? 380 LEU B HD23 2  
ATOM 10566  N N    . MET B 2 81  ? 12.784  7.572   13.716  1.00 0.00  ? 381 MET B N    2  
ATOM 10567  C CA   . MET B 2 81  ? 13.364  6.848   12.546  1.00 0.00  ? 381 MET B CA   2  
ATOM 10568  C C    . MET B 2 81  ? 13.827  5.467   13.015  1.00 0.00  ? 381 MET B C    2  
ATOM 10569  O O    . MET B 2 81  ? 13.656  4.476   12.334  1.00 0.00  ? 381 MET B O    2  
ATOM 10570  C CB   . MET B 2 81  ? 14.539  7.619   11.935  1.00 0.00  ? 381 MET B CB   2  
ATOM 10571  C CG   . MET B 2 81  ? 15.075  6.838   10.724  1.00 0.00  ? 381 MET B CG   2  
ATOM 10572  S SD   . MET B 2 81  ? 16.091  7.921   9.681   1.00 0.00  ? 381 MET B SD   2  
ATOM 10573  C CE   . MET B 2 81  ? 14.767  8.929   8.963   1.00 0.00  ? 381 MET B CE   2  
ATOM 10574  H H    . MET B 2 81  ? 13.268  8.296   14.171  1.00 0.00  ? 381 MET B H    2  
ATOM 10575  H HA   . MET B 2 81  ? 12.597  6.715   11.798  1.00 0.00  ? 381 MET B HA   2  
ATOM 10576  H HB2  . MET B 2 81  ? 14.204  8.596   11.617  1.00 0.00  ? 381 MET B HB2  2  
ATOM 10577  H HB3  . MET B 2 81  ? 15.324  7.726   12.669  1.00 0.00  ? 381 MET B HB3  2  
ATOM 10578  H HG2  . MET B 2 81  ? 15.680  6.014   11.074  1.00 0.00  ? 381 MET B HG2  2  
ATOM 10579  H HG3  . MET B 2 81  ? 14.249  6.448   10.146  1.00 0.00  ? 381 MET B HG3  2  
ATOM 10580  H HE1  . MET B 2 81  ? 13.815  8.447   9.105   1.00 0.00  ? 381 MET B HE1  2  
ATOM 10581  H HE2  . MET B 2 81  ? 14.754  9.896   9.444   1.00 0.00  ? 381 MET B HE2  2  
ATOM 10582  H HE3  . MET B 2 81  ? 14.949  9.054   7.904   1.00 0.00  ? 381 MET B HE3  2  
ATOM 10583  N N    . ALA B 2 82  ? 14.404  5.402   14.184  1.00 0.00  ? 382 ALA B N    2  
ATOM 10584  C CA   . ALA B 2 82  ? 14.876  4.096   14.726  1.00 0.00  ? 382 ALA B CA   2  
ATOM 10585  C C    . ALA B 2 82  ? 13.712  3.338   15.381  1.00 0.00  ? 382 ALA B C    2  
ATOM 10586  O O    . ALA B 2 82  ? 13.879  2.213   15.810  1.00 0.00  ? 382 ALA B O    2  
ATOM 10587  C CB   . ALA B 2 82  ? 15.970  4.349   15.778  1.00 0.00  ? 382 ALA B CB   2  
ATOM 10588  H H    . ALA B 2 82  ? 14.514  6.214   14.720  1.00 0.00  ? 382 ALA B H    2  
ATOM 10589  H HA   . ALA B 2 82  ? 15.284  3.500   13.923  1.00 0.00  ? 382 ALA B HA   2  
ATOM 10590  H HB1  . ALA B 2 82  ? 15.743  5.257   16.319  1.00 0.00  ? 382 ALA B HB1  2  
ATOM 10591  H HB2  . ALA B 2 82  ? 16.015  3.519   16.472  1.00 0.00  ? 382 ALA B HB2  2  
ATOM 10592  H HB3  . ALA B 2 82  ? 16.926  4.453   15.290  1.00 0.00  ? 382 ALA B HB3  2  
ATOM 10593  N N    . GLU B 2 83  ? 12.539  3.933   15.472  1.00 0.00  ? 383 GLU B N    2  
ATOM 10594  C CA   . GLU B 2 83  ? 11.377  3.227   16.113  1.00 0.00  ? 383 GLU B CA   2  
ATOM 10595  C C    . GLU B 2 83  ? 10.279  2.930   15.087  1.00 0.00  ? 383 GLU B C    2  
ATOM 10596  O O    . GLU B 2 83  ? 9.292   2.296   15.408  1.00 0.00  ? 383 GLU B O    2  
ATOM 10597  C CB   . GLU B 2 83  ? 10.804  4.097   17.233  1.00 0.00  ? 383 GLU B CB   2  
ATOM 10598  C CG   . GLU B 2 83  ? 11.796  4.152   18.399  1.00 0.00  ? 383 GLU B CG   2  
ATOM 10599  C CD   . GLU B 2 83  ? 11.855  2.787   19.090  1.00 0.00  ? 383 GLU B CD   2  
ATOM 10600  O OE1  . GLU B 2 83  ? 10.923  2.018   18.921  1.00 0.00  ? 383 GLU B OE1  2  
ATOM 10601  O OE2  . GLU B 2 83  ? 12.833  2.534   19.773  1.00 0.00  ? 383 GLU B OE2  2  
ATOM 10602  H H    . GLU B 2 83  ? 12.405  4.829   15.094  1.00 0.00  ? 383 GLU B H    2  
ATOM 10603  H HA   . GLU B 2 83  ? 11.706  2.289   16.540  1.00 0.00  ? 383 GLU B HA   2  
ATOM 10604  H HB2  . GLU B 2 83  ? 10.630  5.092   16.862  1.00 0.00  ? 383 GLU B HB2  2  
ATOM 10605  H HB3  . GLU B 2 83  ? 9.873   3.672   17.578  1.00 0.00  ? 383 GLU B HB3  2  
ATOM 10606  H HG2  . GLU B 2 83  ? 12.776  4.407   18.025  1.00 0.00  ? 383 GLU B HG2  2  
ATOM 10607  H HG3  . GLU B 2 83  ? 11.475  4.898   19.110  1.00 0.00  ? 383 GLU B HG3  2  
ATOM 10608  N N    . LEU B 2 84  ? 10.421  3.354   13.857  1.00 0.00  ? 384 LEU B N    2  
ATOM 10609  C CA   . LEU B 2 84  ? 9.356   3.047   12.855  1.00 0.00  ? 384 LEU B CA   2  
ATOM 10610  C C    . LEU B 2 84  ? 9.519   1.609   12.364  1.00 0.00  ? 384 LEU B C    2  
ATOM 10611  O O    . LEU B 2 84  ? 10.610  1.160   12.073  1.00 0.00  ? 384 LEU B O    2  
ATOM 10612  C CB   . LEU B 2 84  ? 9.444   4.027   11.672  1.00 0.00  ? 384 LEU B CB   2  
ATOM 10613  C CG   . LEU B 2 84  ? 8.764   5.366   12.039  1.00 0.00  ? 384 LEU B CG   2  
ATOM 10614  C CD1  . LEU B 2 84  ? 9.333   6.492   11.170  1.00 0.00  ? 384 LEU B CD1  2  
ATOM 10615  C CD2  . LEU B 2 84  ? 7.247   5.274   11.799  1.00 0.00  ? 384 LEU B CD2  2  
ATOM 10616  H H    . LEU B 2 84  ? 11.230  3.840   13.576  1.00 0.00  ? 384 LEU B H    2  
ATOM 10617  H HA   . LEU B 2 84  ? 8.390   3.143   13.328  1.00 0.00  ? 384 LEU B HA   2  
ATOM 10618  H HB2  . LEU B 2 84  ? 10.486  4.203   11.441  1.00 0.00  ? 384 LEU B HB2  2  
ATOM 10619  H HB3  . LEU B 2 84  ? 8.957   3.598   10.809  1.00 0.00  ? 384 LEU B HB3  2  
ATOM 10620  H HG   . LEU B 2 84  ? 8.945   5.590   13.079  1.00 0.00  ? 384 LEU B HG   2  
ATOM 10621  H HD11 . LEU B 2 84  ? 9.429   6.148   10.152  1.00 0.00  ? 384 LEU B HD11 2  
ATOM 10622  H HD12 . LEU B 2 84  ? 8.672   7.347   11.200  1.00 0.00  ? 384 LEU B HD12 2  
ATOM 10623  H HD13 . LEU B 2 84  ? 10.302  6.777   11.546  1.00 0.00  ? 384 LEU B HD13 2  
ATOM 10624  H HD21 . LEU B 2 84  ? 7.058   4.910   10.800  1.00 0.00  ? 384 LEU B HD21 2  
ATOM 10625  H HD22 . LEU B 2 84  ? 6.804   4.602   12.517  1.00 0.00  ? 384 LEU B HD22 2  
ATOM 10626  H HD23 . LEU B 2 84  ? 6.809   6.255   11.910  1.00 0.00  ? 384 LEU B HD23 2  
ATOM 10627  N N    . GLU B 2 85  ? 8.434   0.884   12.279  1.00 0.00  ? 385 GLU B N    2  
ATOM 10628  C CA   . GLU B 2 85  ? 8.492   -0.538  11.818  1.00 0.00  ? 385 GLU B CA   2  
ATOM 10629  C C    . GLU B 2 85  ? 7.896   -0.644  10.412  1.00 0.00  ? 385 GLU B C    2  
ATOM 10630  O O    . GLU B 2 85  ? 8.636   -0.455  9.461   1.00 0.00  ? 385 GLU B O    2  
ATOM 10631  C CB   . GLU B 2 85  ? 7.684   -1.405  12.783  1.00 0.00  ? 385 GLU B CB   2  
ATOM 10632  C CG   . GLU B 2 85  ? 8.351   -1.378  14.158  1.00 0.00  ? 385 GLU B CG   2  
ATOM 10633  C CD   . GLU B 2 85  ? 7.553   -2.243  15.134  1.00 0.00  ? 385 GLU B CD   2  
ATOM 10634  O OE1  . GLU B 2 85  ? 6.462   -2.654  14.774  1.00 0.00  ? 385 GLU B OE1  2  
ATOM 10635  O OE2  . GLU B 2 85  ? 8.047   -2.481  16.224  1.00 0.00  ? 385 GLU B OE2  2  
ATOM 10636  O OXT  . GLU B 2 85  ? 6.711   -0.916  10.312  1.00 0.00  ? 385 GLU B OXT  2  
ATOM 10637  H H    . GLU B 2 85  ? 7.572   1.277   12.530  1.00 0.00  ? 385 GLU B H    2  
ATOM 10638  H HA   . GLU B 2 85  ? 9.516   -0.883  11.802  1.00 0.00  ? 385 GLU B HA   2  
ATOM 10639  H HB2  . GLU B 2 85  ? 6.678   -1.017  12.859  1.00 0.00  ? 385 GLU B HB2  2  
ATOM 10640  H HB3  . GLU B 2 85  ? 7.654   -2.419  12.418  1.00 0.00  ? 385 GLU B HB3  2  
ATOM 10641  H HG2  . GLU B 2 85  ? 9.358   -1.762  14.077  1.00 0.00  ? 385 GLU B HG2  2  
ATOM 10642  H HG3  . GLU B 2 85  ? 8.383   -0.362  14.523  1.00 0.00  ? 385 GLU B HG3  2  
ATOM 10643  N N    . MET A 1 1   ? -9.697  -21.793 -21.647 1.00 1.59  ? 1   MET A N    3  
ATOM 10644  C CA   . MET A 1 1   ? -8.215  -21.887 -21.540 1.00 1.39  ? 1   MET A CA   3  
ATOM 10645  C C    . MET A 1 1   ? -7.668  -20.609 -20.903 1.00 1.31  ? 1   MET A C    3  
ATOM 10646  O O    . MET A 1 1   ? -6.728  -20.015 -21.395 1.00 1.94  ? 1   MET A O    3  
ATOM 10647  C CB   . MET A 1 1   ? -7.613  -22.063 -22.935 1.00 2.04  ? 1   MET A CB   3  
ATOM 10648  C CG   . MET A 1 1   ? -8.074  -23.399 -23.521 1.00 2.17  ? 1   MET A CG   3  
ATOM 10649  S SD   . MET A 1 1   ? -7.284  -24.757 -22.620 1.00 2.81  ? 1   MET A SD   3  
ATOM 10650  C CE   . MET A 1 1   ? -8.639  -25.949 -22.759 1.00 2.91  ? 1   MET A CE   3  
ATOM 10651  H H1   . MET A 1 1   ? -10.097 -21.532 -20.724 1.00 1.94  ? 1   MET A H1   3  
ATOM 10652  H H2   . MET A 1 1   ? -9.948  -21.069 -22.349 1.00 1.84  ? 1   MET A H2   3  
ATOM 10653  H H3   . MET A 1 1   ? -10.081 -22.713 -21.944 1.00 2.22  ? 1   MET A H3   3  
ATOM 10654  H HA   . MET A 1 1   ? -7.952  -22.734 -20.925 1.00 1.81  ? 1   MET A HA   3  
ATOM 10655  H HB2  . MET A 1 1   ? -7.944  -21.255 -23.573 1.00 2.38  ? 1   MET A HB2  3  
ATOM 10656  H HB3  . MET A 1 1   ? -6.536  -22.053 -22.868 1.00 2.62  ? 1   MET A HB3  3  
ATOM 10657  H HG2  . MET A 1 1   ? -9.147  -23.481 -23.430 1.00 2.24  ? 1   MET A HG2  3  
ATOM 10658  H HG3  . MET A 1 1   ? -7.797  -23.450 -24.564 1.00 2.61  ? 1   MET A HG3  3  
ATOM 10659  H HE1  . MET A 1 1   ? -8.893  -26.084 -23.801 1.00 3.10  ? 1   MET A HE1  3  
ATOM 10660  H HE2  . MET A 1 1   ? -8.331  -26.893 -22.331 1.00 3.19  ? 1   MET A HE2  3  
ATOM 10661  H HE3  . MET A 1 1   ? -9.501  -25.581 -22.227 1.00 3.16  ? 1   MET A HE3  3  
ATOM 10662  N N    . ILE A 1 2   ? -8.248  -20.188 -19.806 1.00 1.20  ? 2   ILE A N    3  
ATOM 10663  C CA   . ILE A 1 2   ? -7.767  -18.950 -19.113 1.00 1.04  ? 2   ILE A CA   3  
ATOM 10664  C C    . ILE A 1 2   ? -7.104  -19.352 -17.797 1.00 1.00  ? 2   ILE A C    3  
ATOM 10665  O O    . ILE A 1 2   ? -7.665  -20.090 -17.010 1.00 0.91  ? 2   ILE A O    3  
ATOM 10666  C CB   . ILE A 1 2   ? -8.960  -18.034 -18.821 1.00 0.88  ? 2   ILE A CB   3  
ATOM 10667  C CG1  . ILE A 1 2   ? -9.645  -17.650 -20.136 1.00 0.97  ? 2   ILE A CG1  3  
ATOM 10668  C CG2  . ILE A 1 2   ? -8.471  -16.766 -18.117 1.00 0.89  ? 2   ILE A CG2  3  
ATOM 10669  C CD1  . ILE A 1 2   ? -10.969 -16.948 -19.834 1.00 0.97  ? 2   ILE A CD1  3  
ATOM 10670  H H    . ILE A 1 2   ? -8.999  -20.691 -19.430 1.00 1.71  ? 2   ILE A H    3  
ATOM 10671  H HA   . ILE A 1 2   ? -7.052  -18.424 -19.731 1.00 1.18  ? 2   ILE A HA   3  
ATOM 10672  H HB   . ILE A 1 2   ? -9.663  -18.551 -18.184 1.00 0.86  ? 2   ILE A HB   3  
ATOM 10673  H HG12 . ILE A 1 2   ? -9.002  -16.985 -20.696 1.00 1.11  ? 2   ILE A HG12 3  
ATOM 10674  H HG13 . ILE A 1 2   ? -9.835  -18.540 -20.716 1.00 1.05  ? 2   ILE A HG13 3  
ATOM 10675  H HG21 . ILE A 1 2   ? -7.655  -16.335 -18.678 1.00 1.28  ? 2   ILE A HG21 3  
ATOM 10676  H HG22 . ILE A 1 2   ? -9.281  -16.053 -18.055 1.00 1.47  ? 2   ILE A HG22 3  
ATOM 10677  H HG23 . ILE A 1 2   ? -8.134  -17.014 -17.121 1.00 1.28  ? 2   ILE A HG23 3  
ATOM 10678  H HD11 . ILE A 1 2   ? -10.793 -16.118 -19.165 1.00 1.52  ? 2   ILE A HD11 3  
ATOM 10679  H HD12 . ILE A 1 2   ? -11.402 -16.584 -20.753 1.00 1.28  ? 2   ILE A HD12 3  
ATOM 10680  H HD13 . ILE A 1 2   ? -11.649 -17.646 -19.368 1.00 1.44  ? 2   ILE A HD13 3  
ATOM 10681  N N    . SER A 1 3   ? -5.914  -18.871 -17.547 1.00 1.10  ? 3   SER A N    3  
ATOM 10682  C CA   . SER A 1 3   ? -5.205  -19.219 -16.278 1.00 1.11  ? 3   SER A CA   3  
ATOM 10683  C C    . SER A 1 3   ? -4.528  -17.967 -15.726 1.00 1.07  ? 3   SER A C    3  
ATOM 10684  O O    . SER A 1 3   ? -3.678  -17.378 -16.366 1.00 1.17  ? 3   SER A O    3  
ATOM 10685  C CB   . SER A 1 3   ? -4.141  -20.282 -16.569 1.00 1.29  ? 3   SER A CB   3  
ATOM 10686  O OG   . SER A 1 3   ? -4.778  -21.519 -16.857 1.00 1.40  ? 3   SER A OG   3  
ATOM 10687  H H    . SER A 1 3   ? -5.484  -18.278 -18.197 1.00 1.21  ? 3   SER A H    3  
ATOM 10688  H HA   . SER A 1 3   ? -5.906  -19.600 -15.549 1.00 1.05  ? 3   SER A HA   3  
ATOM 10689  H HB2  . SER A 1 3   ? -3.553  -19.981 -17.420 1.00 1.36  ? 3   SER A HB2  3  
ATOM 10690  H HB3  . SER A 1 3   ? -3.495  -20.388 -15.709 1.00 1.30  ? 3   SER A HB3  3  
ATOM 10691  H HG   . SER A 1 3   ? -4.393  -22.190 -16.288 1.00 1.66  ? 3   SER A HG   3  
ATOM 10692  N N    . GLY A 1 4   ? -4.891  -17.551 -14.541 1.00 0.97  ? 4   GLY A N    3  
ATOM 10693  C CA   . GLY A 1 4   ? -4.262  -16.335 -13.945 1.00 0.97  ? 4   GLY A CA   3  
ATOM 10694  C C    . GLY A 1 4   ? -3.072  -16.757 -13.087 1.00 1.00  ? 4   GLY A C    3  
ATOM 10695  O O    . GLY A 1 4   ? -2.555  -17.850 -13.219 1.00 1.05  ? 4   GLY A O    3  
ATOM 10696  H H    . GLY A 1 4   ? -5.574  -18.035 -14.032 1.00 0.93  ? 4   GLY A H    3  
ATOM 10697  H HA2  . GLY A 1 4   ? -3.925  -15.672 -14.732 1.00 1.02  ? 4   GLY A HA2  3  
ATOM 10698  H HA3  . GLY A 1 4   ? -4.983  -15.824 -13.328 1.00 0.91  ? 4   GLY A HA3  3  
ATOM 10699  N N    . ILE A 1 5   ? -2.620  -15.899 -12.211 1.00 1.00  ? 5   ILE A N    3  
ATOM 10700  C CA   . ILE A 1 5   ? -1.451  -16.246 -11.350 1.00 1.05  ? 5   ILE A CA   3  
ATOM 10701  C C    . ILE A 1 5   ? -1.934  -16.831 -10.019 1.00 1.00  ? 5   ILE A C    3  
ATOM 10702  O O    . ILE A 1 5   ? -1.151  -17.338 -9.241  1.00 1.03  ? 5   ILE A O    3  
ATOM 10703  C CB   . ILE A 1 5   ? -0.639  -14.976 -11.088 1.00 1.08  ? 5   ILE A CB   3  
ATOM 10704  C CG1  . ILE A 1 5   ? -0.017  -14.501 -12.404 1.00 1.14  ? 5   ILE A CG1  3  
ATOM 10705  C CG2  . ILE A 1 5   ? 0.471   -15.268 -10.073 1.00 1.12  ? 5   ILE A CG2  3  
ATOM 10706  C CD1  . ILE A 1 5   ? 0.552   -13.094 -12.223 1.00 1.15  ? 5   ILE A CD1  3  
ATOM 10707  H H    . ILE A 1 5   ? -3.037  -15.014 -12.128 1.00 0.98  ? 5   ILE A H    3  
ATOM 10708  H HA   . ILE A 1 5   ? -0.825  -16.970 -11.855 1.00 1.10  ? 5   ILE A HA   3  
ATOM 10709  H HB   . ILE A 1 5   ? -1.291  -14.207 -10.698 1.00 1.03  ? 5   ILE A HB   3  
ATOM 10710  H HG12 . ILE A 1 5   ? 0.777   -15.176 -12.690 1.00 1.20  ? 5   ILE A HG12 3  
ATOM 10711  H HG13 . ILE A 1 5   ? -0.773  -14.486 -13.176 1.00 1.14  ? 5   ILE A HG13 3  
ATOM 10712  H HG21 . ILE A 1 5   ? 0.942   -16.210 -10.314 1.00 1.53  ? 5   ILE A HG21 3  
ATOM 10713  H HG22 . ILE A 1 5   ? 1.209   -14.479 -10.107 1.00 1.42  ? 5   ILE A HG22 3  
ATOM 10714  H HG23 . ILE A 1 5   ? 0.047   -15.320 -9.082  1.00 1.59  ? 5   ILE A HG23 3  
ATOM 10715  H HD11 . ILE A 1 5   ? 1.155   -13.061 -11.329 1.00 1.59  ? 5   ILE A HD11 3  
ATOM 10716  H HD12 . ILE A 1 5   ? 1.159   -12.839 -13.078 1.00 1.45  ? 5   ILE A HD12 3  
ATOM 10717  H HD13 . ILE A 1 5   ? -0.260  -12.387 -12.136 1.00 1.52  ? 5   ILE A HD13 3  
ATOM 10718  N N    . LEU A 1 6   ? -3.210  -16.760 -9.745  1.00 0.94  ? 6   LEU A N    3  
ATOM 10719  C CA   . LEU A 1 6   ? -3.727  -17.311 -8.458  1.00 0.89  ? 6   LEU A CA   3  
ATOM 10720  C C    . LEU A 1 6   ? -2.963  -16.676 -7.297  1.00 0.90  ? 6   LEU A C    3  
ATOM 10721  O O    . LEU A 1 6   ? -1.892  -17.115 -6.928  1.00 0.98  ? 6   LEU A O    3  
ATOM 10722  C CB   . LEU A 1 6   ? -3.561  -18.839 -8.443  1.00 0.93  ? 6   LEU A CB   3  
ATOM 10723  C CG   . LEU A 1 6   ? -4.089  -19.421 -7.122  1.00 0.90  ? 6   LEU A CG   3  
ATOM 10724  C CD1  . LEU A 1 6   ? -5.581  -19.086 -6.952  1.00 0.93  ? 6   LEU A CD1  3  
ATOM 10725  C CD2  . LEU A 1 6   ? -3.904  -20.944 -7.147  1.00 0.93  ? 6   LEU A CD2  3  
ATOM 10726  H H    . LEU A 1 6   ? -3.831  -16.338 -10.374 1.00 0.92  ? 6   LEU A H    3  
ATOM 10727  H HA   . LEU A 1 6   ? -4.773  -17.062 -8.364  1.00 0.84  ? 6   LEU A HA   3  
ATOM 10728  H HB2  . LEU A 1 6   ? -4.113  -19.265 -9.267  1.00 0.96  ? 6   LEU A HB2  3  
ATOM 10729  H HB3  . LEU A 1 6   ? -2.516  -19.088 -8.547  1.00 0.97  ? 6   LEU A HB3  3  
ATOM 10730  H HG   . LEU A 1 6   ? -3.531  -19.006 -6.296  1.00 0.90  ? 6   LEU A HG   3  
ATOM 10731  H HD11 . LEU A 1 6   ? -6.069  -19.088 -7.917  1.00 1.28  ? 6   LEU A HD11 3  
ATOM 10732  H HD12 . LEU A 1 6   ? -6.051  -19.820 -6.311  1.00 1.40  ? 6   LEU A HD12 3  
ATOM 10733  H HD13 . LEU A 1 6   ? -5.680  -18.110 -6.503  1.00 1.47  ? 6   LEU A HD13 3  
ATOM 10734  H HD21 . LEU A 1 6   ? -2.863  -21.179 -7.312  1.00 1.46  ? 6   LEU A HD21 3  
ATOM 10735  H HD22 . LEU A 1 6   ? -4.221  -21.361 -6.202  1.00 1.36  ? 6   LEU A HD22 3  
ATOM 10736  H HD23 . LEU A 1 6   ? -4.499  -21.366 -7.944  1.00 1.33  ? 6   LEU A HD23 3  
ATOM 10737  N N    . ALA A 1 7   ? -3.517  -15.650 -6.712  1.00 0.83  ? 7   ALA A N    3  
ATOM 10738  C CA   . ALA A 1 7   ? -2.837  -14.991 -5.565  1.00 0.85  ? 7   ALA A CA   3  
ATOM 10739  C C    . ALA A 1 7   ? -2.895  -15.926 -4.360  1.00 0.83  ? 7   ALA A C    3  
ATOM 10740  O O    . ALA A 1 7   ? -1.945  -16.060 -3.613  1.00 0.88  ? 7   ALA A O    3  
ATOM 10741  C CB   . ALA A 1 7   ? -3.546  -13.678 -5.229  1.00 0.83  ? 7   ALA A CB   3  
ATOM 10742  H H    . ALA A 1 7   ? -4.394  -15.332 -7.013  1.00 0.78  ? 7   ALA A H    3  
ATOM 10743  H HA   . ALA A 1 7   ? -1.807  -14.795 -5.820  1.00 0.91  ? 7   ALA A HA   3  
ATOM 10744  H HB1  . ALA A 1 7   ? -4.614  -13.835 -5.233  1.00 1.39  ? 7   ALA A HB1  3  
ATOM 10745  H HB2  . ALA A 1 7   ? -3.235  -13.340 -4.252  1.00 1.23  ? 7   ALA A HB2  3  
ATOM 10746  H HB3  . ALA A 1 7   ? -3.288  -12.932 -5.966  1.00 1.31  ? 7   ALA A HB3  3  
ATOM 10747  N N    . SER A 1 8   ? -4.011  -16.581 -4.170  1.00 0.77  ? 8   SER A N    3  
ATOM 10748  C CA   . SER A 1 8   ? -4.149  -17.521 -3.016  1.00 0.77  ? 8   SER A CA   3  
ATOM 10749  C C    . SER A 1 8   ? -5.044  -18.704 -3.435  1.00 0.73  ? 8   SER A C    3  
ATOM 10750  O O    . SER A 1 8   ? -5.996  -18.521 -4.171  1.00 0.70  ? 8   SER A O    3  
ATOM 10751  C CB   . SER A 1 8   ? -4.792  -16.780 -1.842  1.00 0.76  ? 8   SER A CB   3  
ATOM 10752  O OG   . SER A 1 8   ? -5.828  -15.938 -2.331  1.00 1.69  ? 8   SER A OG   3  
ATOM 10753  H H    . SER A 1 8   ? -4.759  -16.454 -4.793  1.00 0.75  ? 8   SER A H    3  
ATOM 10754  H HA   . SER A 1 8   ? -3.175  -17.874 -2.727  1.00 0.83  ? 8   SER A HA   3  
ATOM 10755  H HB2  . SER A 1 8   ? -5.210  -17.489 -1.146  1.00 1.09  ? 8   SER A HB2  3  
ATOM 10756  H HB3  . SER A 1 8   ? -4.039  -16.187 -1.338  1.00 1.25  ? 8   SER A HB3  3  
ATOM 10757  H HG   . SER A 1 8   ? -5.928  -16.105 -3.271  1.00 2.09  ? 8   SER A HG   3  
ATOM 10758  N N    . PRO A 1 9   ? -4.755  -19.910 -2.977  1.00 0.76  ? 9   PRO A N    3  
ATOM 10759  C CA   . PRO A 1 9   ? -5.568  -21.113 -3.332  1.00 0.75  ? 9   PRO A CA   3  
ATOM 10760  C C    . PRO A 1 9   ? -6.860  -21.218 -2.511  1.00 0.70  ? 9   PRO A C    3  
ATOM 10761  O O    . PRO A 1 9   ? -6.895  -20.892 -1.341  1.00 0.70  ? 9   PRO A O    3  
ATOM 10762  C CB   . PRO A 1 9   ? -4.628  -22.273 -2.997  1.00 0.83  ? 9   PRO A CB   3  
ATOM 10763  C CG   . PRO A 1 9   ? -3.839  -21.775 -1.834  1.00 0.85  ? 9   PRO A CG   3  
ATOM 10764  C CD   . PRO A 1 9   ? -3.633  -20.275 -2.082  1.00 0.82  ? 9   PRO A CD   3  
ATOM 10765  H HA   . PRO A 1 9   ? -5.790  -21.122 -4.385  1.00 0.74  ? 9   PRO A HA   3  
ATOM 10766  H HB2  . PRO A 1 9   ? -5.190  -23.160 -2.730  1.00 0.85  ? 9   PRO A HB2  3  
ATOM 10767  H HB3  . PRO A 1 9   ? -3.971  -22.478 -3.829  1.00 0.88  ? 9   PRO A HB3  3  
ATOM 10768  H HG2  . PRO A 1 9   ? -4.392  -21.933 -0.916  1.00 0.84  ? 9   PRO A HG2  3  
ATOM 10769  H HG3  . PRO A 1 9   ? -2.882  -22.274 -1.784  1.00 0.91  ? 9   PRO A HG3  3  
ATOM 10770  H HD2  . PRO A 1 9   ? -3.685  -19.723 -1.153  1.00 0.81  ? 9   PRO A HD2  3  
ATOM 10771  H HD3  . PRO A 1 9   ? -2.689  -20.104 -2.578  1.00 0.86  ? 9   PRO A HD3  3  
ATOM 10772  N N    . GLY A 1 10  ? -7.918  -21.672 -3.122  1.00 0.67  ? 10  GLY A N    3  
ATOM 10773  C CA   . GLY A 1 10  ? -9.210  -21.805 -2.391  1.00 0.64  ? 10  GLY A CA   3  
ATOM 10774  C C    . GLY A 1 10  ? -10.343 -22.003 -3.399  1.00 0.62  ? 10  GLY A C    3  
ATOM 10775  O O    . GLY A 1 10  ? -10.110 -22.314 -4.547  1.00 0.92  ? 10  GLY A O    3  
ATOM 10776  H H    . GLY A 1 10  ? -7.862  -21.923 -4.069  1.00 0.68  ? 10  GLY A H    3  
ATOM 10777  H HA2  . GLY A 1 10  ? -9.160  -22.657 -1.727  1.00 0.70  ? 10  GLY A HA2  3  
ATOM 10778  H HA3  . GLY A 1 10  ? -9.390  -20.912 -1.816  1.00 0.60  ? 10  GLY A HA3  3  
ATOM 10779  N N    . ILE A 1 11  ? -11.572 -21.819 -2.985  1.00 0.64  ? 11  ILE A N    3  
ATOM 10780  C CA   . ILE A 1 11  ? -12.727 -21.981 -3.928  1.00 0.60  ? 11  ILE A CA   3  
ATOM 10781  C C    . ILE A 1 11  ? -13.847 -21.030 -3.487  1.00 0.56  ? 11  ILE A C    3  
ATOM 10782  O O    . ILE A 1 11  ? -13.991 -20.734 -2.317  1.00 0.61  ? 11  ILE A O    3  
ATOM 10783  C CB   . ILE A 1 11  ? -13.247 -23.436 -3.919  1.00 0.67  ? 11  ILE A CB   3  
ATOM 10784  C CG1  . ILE A 1 11  ? -12.166 -24.388 -4.462  1.00 0.74  ? 11  ILE A CG1  3  
ATOM 10785  C CG2  . ILE A 1 11  ? -14.493 -23.542 -4.813  1.00 0.64  ? 11  ILE A CG2  3  
ATOM 10786  C CD1  . ILE A 1 11  ? -12.666 -25.835 -4.392  1.00 0.81  ? 11  ILE A CD1  3  
ATOM 10787  H H    . ILE A 1 11  ? -11.734 -21.549 -2.057  1.00 0.92  ? 11  ILE A H    3  
ATOM 10788  H HA   . ILE A 1 11  ? -12.414 -21.716 -4.928  1.00 0.56  ? 11  ILE A HA   3  
ATOM 10789  H HB   . ILE A 1 11  ? -13.506 -23.718 -2.908  1.00 0.72  ? 11  ILE A HB   3  
ATOM 10790  H HG12 . ILE A 1 11  ? -11.945 -24.132 -5.490  1.00 0.77  ? 11  ILE A HG12 3  
ATOM 10791  H HG13 . ILE A 1 11  ? -11.274 -24.301 -3.868  1.00 0.78  ? 11  ILE A HG13 3  
ATOM 10792  H HG21 . ILE A 1 11  ? -14.244 -23.227 -5.814  1.00 1.26  ? 11  ILE A HG21 3  
ATOM 10793  H HG22 . ILE A 1 11  ? -14.837 -24.564 -4.837  1.00 1.09  ? 11  ILE A HG22 3  
ATOM 10794  H HG23 . ILE A 1 11  ? -15.279 -22.915 -4.423  1.00 1.20  ? 11  ILE A HG23 3  
ATOM 10795  H HD11 . ILE A 1 11  ? -13.107 -26.017 -3.423  1.00 1.35  ? 11  ILE A HD11 3  
ATOM 10796  H HD12 . ILE A 1 11  ? -13.408 -25.996 -5.160  1.00 1.21  ? 11  ILE A HD12 3  
ATOM 10797  H HD13 . ILE A 1 11  ? -11.837 -26.510 -4.543  1.00 1.35  ? 11  ILE A HD13 3  
ATOM 10798  N N    . ALA A 1 12  ? -14.645 -20.548 -4.407  1.00 0.50  ? 12  ALA A N    3  
ATOM 10799  C CA   . ALA A 1 12  ? -15.753 -19.618 -4.020  1.00 0.50  ? 12  ALA A CA   3  
ATOM 10800  C C    . ALA A 1 12  ? -16.913 -19.733 -5.017  1.00 0.47  ? 12  ALA A C    3  
ATOM 10801  O O    . ALA A 1 12  ? -16.720 -20.038 -6.178  1.00 0.51  ? 12  ALA A O    3  
ATOM 10802  C CB   . ALA A 1 12  ? -15.232 -18.181 -4.023  1.00 0.49  ? 12  ALA A CB   3  
ATOM 10803  H H    . ALA A 1 12  ? -14.519 -20.798 -5.347  1.00 0.48  ? 12  ALA A H    3  
ATOM 10804  H HA   . ALA A 1 12  ? -16.109 -19.869 -3.031  1.00 0.55  ? 12  ALA A HA   3  
ATOM 10805  H HB1  . ALA A 1 12  ? -14.726 -17.982 -4.956  1.00 1.14  ? 12  ALA A HB1  3  
ATOM 10806  H HB2  . ALA A 1 12  ? -16.061 -17.498 -3.910  1.00 1.13  ? 12  ALA A HB2  3  
ATOM 10807  H HB3  . ALA A 1 12  ? -14.542 -18.046 -3.203  1.00 1.12  ? 12  ALA A HB3  3  
ATOM 10808  N N    . PHE A 1 13  ? -18.116 -19.470 -4.568  1.00 0.48  ? 13  PHE A N    3  
ATOM 10809  C CA   . PHE A 1 13  ? -19.308 -19.536 -5.475  1.00 0.48  ? 13  PHE A CA   3  
ATOM 10810  C C    . PHE A 1 13  ? -20.175 -18.295 -5.226  1.00 0.49  ? 13  PHE A C    3  
ATOM 10811  O O    . PHE A 1 13  ? -20.568 -18.033 -4.106  1.00 0.54  ? 13  PHE A O    3  
ATOM 10812  C CB   . PHE A 1 13  ? -20.147 -20.787 -5.153  1.00 0.53  ? 13  PHE A CB   3  
ATOM 10813  C CG   . PHE A 1 13  ? -19.258 -21.986 -4.899  1.00 0.52  ? 13  PHE A CG   3  
ATOM 10814  C CD1  . PHE A 1 13  ? -18.494 -22.056 -3.726  1.00 0.56  ? 13  PHE A CD1  3  
ATOM 10815  C CD2  . PHE A 1 13  ? -19.214 -23.038 -5.825  1.00 0.55  ? 13  PHE A CD2  3  
ATOM 10816  C CE1  . PHE A 1 13  ? -17.689 -23.175 -3.481  1.00 0.61  ? 13  PHE A CE1  3  
ATOM 10817  C CE2  . PHE A 1 13  ? -18.406 -24.154 -5.579  1.00 0.60  ? 13  PHE A CE2  3  
ATOM 10818  C CZ   . PHE A 1 13  ? -17.644 -24.223 -4.407  1.00 0.62  ? 13  PHE A CZ   3  
ATOM 10819  H H    . PHE A 1 13  ? -18.237 -19.214 -3.630  1.00 0.55  ? 13  PHE A H    3  
ATOM 10820  H HA   . PHE A 1 13  ? -18.995 -19.560 -6.510  1.00 0.45  ? 13  PHE A HA   3  
ATOM 10821  H HB2  . PHE A 1 13  ? -20.745 -20.603 -4.270  1.00 0.60  ? 13  PHE A HB2  3  
ATOM 10822  H HB3  . PHE A 1 13  ? -20.803 -20.996 -5.985  1.00 0.57  ? 13  PHE A HB3  3  
ATOM 10823  H HD1  . PHE A 1 13  ? -18.527 -21.249 -3.011  1.00 0.59  ? 13  PHE A HD1  3  
ATOM 10824  H HD2  . PHE A 1 13  ? -19.803 -22.988 -6.728  1.00 0.58  ? 13  PHE A HD2  3  
ATOM 10825  H HE1  . PHE A 1 13  ? -17.100 -23.228 -2.577  1.00 0.68  ? 13  PHE A HE1  3  
ATOM 10826  H HE2  . PHE A 1 13  ? -18.370 -24.962 -6.295  1.00 0.66  ? 13  PHE A HE2  3  
ATOM 10827  H HZ   . PHE A 1 13  ? -17.024 -25.087 -4.216  1.00 0.70  ? 13  PHE A HZ   3  
ATOM 10828  N N    . GLY A 1 14  ? -20.492 -17.522 -6.234  1.00 0.49  ? 14  GLY A N    3  
ATOM 10829  C CA   . GLY A 1 14  ? -21.340 -16.322 -5.982  1.00 0.53  ? 14  GLY A CA   3  
ATOM 10830  C C    . GLY A 1 14  ? -21.527 -15.513 -7.271  1.00 0.55  ? 14  GLY A C    3  
ATOM 10831  O O    . GLY A 1 14  ? -21.015 -15.852 -8.318  1.00 0.54  ? 14  GLY A O    3  
ATOM 10832  H H    . GLY A 1 14  ? -20.182 -17.710 -7.144  1.00 0.47  ? 14  GLY A H    3  
ATOM 10833  H HA2  . GLY A 1 14  ? -22.306 -16.640 -5.616  1.00 0.58  ? 14  GLY A HA2  3  
ATOM 10834  H HA3  . GLY A 1 14  ? -20.864 -15.699 -5.239  1.00 0.53  ? 14  GLY A HA3  3  
ATOM 10835  N N    . LYS A 1 15  ? -22.266 -14.440 -7.183  1.00 0.61  ? 15  LYS A N    3  
ATOM 10836  C CA   . LYS A 1 15  ? -22.509 -13.585 -8.383  1.00 0.65  ? 15  LYS A CA   3  
ATOM 10837  C C    . LYS A 1 15  ? -21.265 -12.740 -8.652  1.00 0.63  ? 15  LYS A C    3  
ATOM 10838  O O    . LYS A 1 15  ? -20.479 -12.482 -7.762  1.00 0.61  ? 15  LYS A O    3  
ATOM 10839  C CB   . LYS A 1 15  ? -23.709 -12.670 -8.128  1.00 0.73  ? 15  LYS A CB   3  
ATOM 10840  C CG   . LYS A 1 15  ? -24.949 -13.522 -7.851  1.00 0.82  ? 15  LYS A CG   3  
ATOM 10841  C CD   . LYS A 1 15  ? -26.152 -12.612 -7.595  1.00 0.89  ? 15  LYS A CD   3  
ATOM 10842  C CE   . LYS A 1 15  ? -27.388 -13.470 -7.319  1.00 1.32  ? 15  LYS A CE   3  
ATOM 10843  N NZ   . LYS A 1 15  ? -28.493 -12.603 -6.819  1.00 2.10  ? 15  LYS A NZ   3  
ATOM 10844  H H    . LYS A 1 15  ? -22.661 -14.209 -6.319  1.00 0.63  ? 15  LYS A H    3  
ATOM 10845  H HA   . LYS A 1 15  ? -22.707 -14.210 -9.239  1.00 0.65  ? 15  LYS A HA   3  
ATOM 10846  H HB2  . LYS A 1 15  ? -23.506 -12.041 -7.275  1.00 0.79  ? 15  LYS A HB2  3  
ATOM 10847  H HB3  . LYS A 1 15  ? -23.884 -12.054 -8.996  1.00 0.76  ? 15  LYS A HB3  3  
ATOM 10848  H HG2  . LYS A 1 15  ? -25.150 -14.153 -8.704  1.00 0.91  ? 15  LYS A HG2  3  
ATOM 10849  H HG3  . LYS A 1 15  ? -24.775 -14.136 -6.980  1.00 0.94  ? 15  LYS A HG3  3  
ATOM 10850  H HD2  . LYS A 1 15  ? -25.953 -11.981 -6.742  1.00 1.15  ? 15  LYS A HD2  3  
ATOM 10851  H HD3  . LYS A 1 15  ? -26.331 -11.998 -8.464  1.00 1.21  ? 15  LYS A HD3  3  
ATOM 10852  H HE2  . LYS A 1 15  ? -27.698 -13.959 -8.231  1.00 1.74  ? 15  LYS A HE2  3  
ATOM 10853  H HE3  . LYS A 1 15  ? -27.150 -14.214 -6.575  1.00 1.69  ? 15  LYS A HE3  3  
ATOM 10854  H HZ1  . LYS A 1 15  ? -28.216 -11.604 -6.908  1.00 2.63  ? 15  LYS A HZ1  3  
ATOM 10855  H HZ2  . LYS A 1 15  ? -29.351 -12.778 -7.378  1.00 2.45  ? 15  LYS A HZ2  3  
ATOM 10856  H HZ3  . LYS A 1 15  ? -28.681 -12.825 -5.821  1.00 2.54  ? 15  LYS A HZ3  3  
ATOM 10857  N N    . ALA A 1 16  ? -21.065 -12.326 -9.879  1.00 0.64  ? 16  ALA A N    3  
ATOM 10858  C CA   . ALA A 1 16  ? -19.850 -11.517 -10.214 1.00 0.64  ? 16  ALA A CA   3  
ATOM 10859  C C    . ALA A 1 16  ? -20.187 -10.023 -10.291 1.00 0.67  ? 16  ALA A C    3  
ATOM 10860  O O    . ALA A 1 16  ? -21.176 -9.621  -10.872 1.00 0.77  ? 16  ALA A O    3  
ATOM 10861  C CB   . ALA A 1 16  ? -19.296 -11.995 -11.565 1.00 0.66  ? 16  ALA A CB   3  
ATOM 10862  H H    . ALA A 1 16  ? -21.705 -12.563 -10.587 1.00 0.67  ? 16  ALA A H    3  
ATOM 10863  H HA   . ALA A 1 16  ? -19.094 -11.665 -9.453  1.00 0.61  ? 16  ALA A HA   3  
ATOM 10864  H HB1  . ALA A 1 16  ? -19.552 -13.036 -11.700 1.00 1.18  ? 16  ALA A HB1  3  
ATOM 10865  H HB2  . ALA A 1 16  ? -19.722 -11.415 -12.373 1.00 1.27  ? 16  ALA A HB2  3  
ATOM 10866  H HB3  . ALA A 1 16  ? -18.221 -11.884 -11.575 1.00 1.19  ? 16  ALA A HB3  3  
ATOM 10867  N N    . LEU A 1 17  ? -19.341 -9.200  -9.723  1.00 0.62  ? 17  LEU A N    3  
ATOM 10868  C CA   . LEU A 1 17  ? -19.549 -7.719  -9.764  1.00 0.66  ? 17  LEU A CA   3  
ATOM 10869  C C    . LEU A 1 17  ? -18.560 -7.143  -10.777 1.00 0.68  ? 17  LEU A C    3  
ATOM 10870  O O    . LEU A 1 17  ? -17.398 -7.487  -10.765 1.00 0.68  ? 17  LEU A O    3  
ATOM 10871  C CB   . LEU A 1 17  ? -19.276 -7.131  -8.375  1.00 0.64  ? 17  LEU A CB   3  
ATOM 10872  C CG   . LEU A 1 17  ? -19.477 -5.607  -8.388  1.00 0.73  ? 17  LEU A CG   3  
ATOM 10873  C CD1  . LEU A 1 17  ? -20.929 -5.261  -8.763  1.00 0.91  ? 17  LEU A CD1  3  
ATOM 10874  C CD2  . LEU A 1 17  ? -19.158 -5.054  -6.995  1.00 0.69  ? 17  LEU A CD2  3  
ATOM 10875  H H    . LEU A 1 17  ? -18.543 -9.561  -9.283  1.00 0.57  ? 17  LEU A H    3  
ATOM 10876  H HA   . LEU A 1 17  ? -20.562 -7.493  -10.069 1.00 0.69  ? 17  LEU A HA   3  
ATOM 10877  H HB2  . LEU A 1 17  ? -19.955 -7.574  -7.661  1.00 0.64  ? 17  LEU A HB2  3  
ATOM 10878  H HB3  . LEU A 1 17  ? -18.259 -7.352  -8.087  1.00 0.65  ? 17  LEU A HB3  3  
ATOM 10879  H HG   . LEU A 1 17  ? -18.808 -5.164  -9.111  1.00 0.87  ? 17  LEU A HG   3  
ATOM 10880  H HD11 . LEU A 1 17  ? -21.599 -6.004  -8.354  1.00 1.40  ? 17  LEU A HD11 3  
ATOM 10881  H HD12 . LEU A 1 17  ? -21.187 -4.290  -8.364  1.00 1.41  ? 17  LEU A HD12 3  
ATOM 10882  H HD13 . LEU A 1 17  ? -21.028 -5.240  -9.837  1.00 1.36  ? 17  LEU A HD13 3  
ATOM 10883  H HD21 . LEU A 1 17  ? -18.137 -5.296  -6.736  1.00 1.33  ? 17  LEU A HD21 3  
ATOM 10884  H HD22 . LEU A 1 17  ? -19.285 -3.982  -6.995  1.00 1.13  ? 17  LEU A HD22 3  
ATOM 10885  H HD23 . LEU A 1 17  ? -19.826 -5.496  -6.271  1.00 1.23  ? 17  LEU A HD23 3  
ATOM 10886  N N    . LEU A 1 18  ? -19.004 -6.279  -11.656 1.00 0.72  ? 18  LEU A N    3  
ATOM 10887  C CA   . LEU A 1 18  ? -18.084 -5.692  -12.688 1.00 0.76  ? 18  LEU A CA   3  
ATOM 10888  C C    . LEU A 1 18  ? -17.934 -4.184  -12.467 1.00 0.79  ? 18  LEU A C    3  
ATOM 10889  O O    . LEU A 1 18  ? -18.895 -3.441  -12.470 1.00 0.83  ? 18  LEU A O    3  
ATOM 10890  C CB   . LEU A 1 18  ? -18.672 -5.949  -14.081 1.00 0.80  ? 18  LEU A CB   3  
ATOM 10891  C CG   . LEU A 1 18  ? -17.759 -5.364  -15.173 1.00 0.85  ? 18  LEU A CG   3  
ATOM 10892  C CD1  . LEU A 1 18  ? -16.382 -6.052  -15.142 1.00 0.93  ? 18  LEU A CD1  3  
ATOM 10893  C CD2  . LEU A 1 18  ? -18.416 -5.587  -16.539 1.00 0.91  ? 18  LEU A CD2  3  
ATOM 10894  H H    . LEU A 1 18  ? -19.942 -6.011  -11.639 1.00 0.74  ? 18  LEU A H    3  
ATOM 10895  H HA   . LEU A 1 18  ? -17.111 -6.156  -12.624 1.00 0.74  ? 18  LEU A HA   3  
ATOM 10896  H HB2  . LEU A 1 18  ? -18.771 -7.014  -14.234 1.00 0.79  ? 18  LEU A HB2  3  
ATOM 10897  H HB3  . LEU A 1 18  ? -19.645 -5.488  -14.148 1.00 0.86  ? 18  LEU A HB3  3  
ATOM 10898  H HG   . LEU A 1 18  ? -17.631 -4.304  -15.010 1.00 0.91  ? 18  LEU A HG   3  
ATOM 10899  H HD11 . LEU A 1 18  ? -16.501 -7.095  -14.886 1.00 1.43  ? 18  LEU A HD11 3  
ATOM 10900  H HD12 . LEU A 1 18  ? -15.913 -5.973  -16.113 1.00 1.46  ? 18  LEU A HD12 3  
ATOM 10901  H HD13 . LEU A 1 18  ? -15.755 -5.570  -14.407 1.00 1.29  ? 18  LEU A HD13 3  
ATOM 10902  H HD21 . LEU A 1 18  ? -19.457 -5.305  -16.488 1.00 1.16  ? 18  LEU A HD21 3  
ATOM 10903  H HD22 . LEU A 1 18  ? -17.917 -4.984  -17.282 1.00 1.49  ? 18  LEU A HD22 3  
ATOM 10904  H HD23 . LEU A 1 18  ? -18.339 -6.629  -16.810 1.00 1.47  ? 18  LEU A HD23 3  
ATOM 10905  N N    . LEU A 1 19  ? -16.723 -3.737  -12.278 1.00 0.80  ? 19  LEU A N    3  
ATOM 10906  C CA   . LEU A 1 19  ? -16.488 -2.278  -12.058 1.00 0.85  ? 19  LEU A CA   3  
ATOM 10907  C C    . LEU A 1 19  ? -16.287 -1.578  -13.403 1.00 0.89  ? 19  LEU A C    3  
ATOM 10908  O O    . LEU A 1 19  ? -15.217 -1.609  -13.979 1.00 0.93  ? 19  LEU A O    3  
ATOM 10909  C CB   . LEU A 1 19  ? -15.238 -2.060  -11.204 1.00 0.88  ? 19  LEU A CB   3  
ATOM 10910  C CG   . LEU A 1 19  ? -15.341 -2.821  -9.875  1.00 0.87  ? 19  LEU A CG   3  
ATOM 10911  C CD1  . LEU A 1 19  ? -14.170 -2.409  -8.977  1.00 0.93  ? 19  LEU A CD1  3  
ATOM 10912  C CD2  . LEU A 1 19  ? -16.666 -2.492  -9.171  1.00 0.88  ? 19  LEU A CD2  3  
ATOM 10913  H H    . LEU A 1 19  ? -15.985 -4.383  -12.278 1.00 0.79  ? 19  LEU A H    3  
ATOM 10914  H HA   . LEU A 1 19  ? -17.344 -1.841  -11.564 1.00 0.87  ? 19  LEU A HA   3  
ATOM 10915  H HB2  . LEU A 1 19  ? -14.372 -2.408  -11.748 1.00 0.90  ? 19  LEU A HB2  3  
ATOM 10916  H HB3  . LEU A 1 19  ? -15.130 -1.006  -11.003 1.00 0.93  ? 19  LEU A HB3  3  
ATOM 10917  H HG   . LEU A 1 19  ? -15.286 -3.884  -10.066 1.00 0.85  ? 19  LEU A HG   3  
ATOM 10918  H HD11 . LEU A 1 19  ? -13.250 -2.461  -9.538  1.00 1.52  ? 19  LEU A HD11 3  
ATOM 10919  H HD12 . LEU A 1 19  ? -14.323 -1.397  -8.634  1.00 1.30  ? 19  LEU A HD12 3  
ATOM 10920  H HD13 . LEU A 1 19  ? -14.116 -3.074  -8.128  1.00 1.33  ? 19  LEU A HD13 3  
ATOM 10921  H HD21 . LEU A 1 19  ? -16.890 -1.442  -9.292  1.00 1.31  ? 19  LEU A HD21 3  
ATOM 10922  H HD22 . LEU A 1 19  ? -17.460 -3.082  -9.605  1.00 1.38  ? 19  LEU A HD22 3  
ATOM 10923  H HD23 . LEU A 1 19  ? -16.587 -2.724  -8.118  1.00 1.27  ? 19  LEU A HD23 3  
ATOM 10924  N N    . LYS A 1 20  ? -17.305 -0.930  -13.895 1.00 0.94  ? 20  LYS A N    3  
ATOM 10925  C CA   . LYS A 1 20  ? -17.183 -0.206  -15.189 1.00 1.01  ? 20  LYS A CA   3  
ATOM 10926  C C    . LYS A 1 20  ? -16.649 1.197   -14.899 1.00 1.05  ? 20  LYS A C    3  
ATOM 10927  O O    . LYS A 1 20  ? -17.047 1.820   -13.938 1.00 1.29  ? 20  LYS A O    3  
ATOM 10928  C CB   . LYS A 1 20  ? -18.570 -0.100  -15.810 1.00 1.15  ? 20  LYS A CB   3  
ATOM 10929  C CG   . LYS A 1 20  ? -19.124 -1.504  -16.042 1.00 1.32  ? 20  LYS A CG   3  
ATOM 10930  C CD   . LYS A 1 20  ? -20.510 -1.391  -16.662 1.00 1.42  ? 20  LYS A CD   3  
ATOM 10931  C CE   . LYS A 1 20  ? -21.084 -2.788  -16.904 1.00 2.11  ? 20  LYS A CE   3  
ATOM 10932  N NZ   . LYS A 1 20  ? -20.434 -3.393  -18.100 1.00 2.75  ? 20  LYS A NZ   3  
ATOM 10933  H H    . LYS A 1 20  ? -18.157 -0.913  -13.409 1.00 0.97  ? 20  LYS A H    3  
ATOM 10934  H HA   . LYS A 1 20  ? -16.515 -0.732  -15.855 1.00 1.01  ? 20  LYS A HA   3  
ATOM 10935  H HB2  . LYS A 1 20  ? -19.224 0.440   -15.140 1.00 1.24  ? 20  LYS A HB2  3  
ATOM 10936  H HB3  . LYS A 1 20  ? -18.507 0.420   -16.753 1.00 1.19  ? 20  LYS A HB3  3  
ATOM 10937  H HG2  . LYS A 1 20  ? -18.470 -2.046  -16.709 1.00 1.50  ? 20  LYS A HG2  3  
ATOM 10938  H HG3  . LYS A 1 20  ? -19.194 -2.025  -15.100 1.00 1.50  ? 20  LYS A HG3  3  
ATOM 10939  H HD2  . LYS A 1 20  ? -21.152 -0.847  -15.985 1.00 1.54  ? 20  LYS A HD2  3  
ATOM 10940  H HD3  . LYS A 1 20  ? -20.441 -0.862  -17.600 1.00 1.71  ? 20  LYS A HD3  3  
ATOM 10941  H HE2  . LYS A 1 20  ? -20.898 -3.409  -16.041 1.00 2.58  ? 20  LYS A HE2  3  
ATOM 10942  H HE3  . LYS A 1 20  ? -22.149 -2.715  -17.071 1.00 2.50  ? 20  LYS A HE3  3  
ATOM 10943  H HZ1  . LYS A 1 20  ? -19.405 -3.257  -18.043 1.00 3.07  ? 20  LYS A HZ1  3  
ATOM 10944  H HZ2  . LYS A 1 20  ? -20.650 -4.411  -18.133 1.00 3.13  ? 20  LYS A HZ2  3  
ATOM 10945  H HZ3  . LYS A 1 20  ? -20.795 -2.934  -18.960 1.00 3.17  ? 20  LYS A HZ3  3  
ATOM 10946  N N    . GLU A 1 21  ? -15.754 1.706   -15.711 1.00 0.94  ? 21  GLU A N    3  
ATOM 10947  C CA   . GLU A 1 21  ? -15.200 3.078   -15.465 1.00 1.02  ? 21  GLU A CA   3  
ATOM 10948  C C    . GLU A 1 21  ? -15.265 3.891   -16.757 1.00 0.91  ? 21  GLU A C    3  
ATOM 10949  O O    . GLU A 1 21  ? -14.939 3.406   -17.822 1.00 1.04  ? 21  GLU A O    3  
ATOM 10950  C CB   . GLU A 1 21  ? -13.744 2.958   -15.012 1.00 1.24  ? 21  GLU A CB   3  
ATOM 10951  C CG   . GLU A 1 21  ? -13.696 2.352   -13.608 1.00 1.72  ? 21  GLU A CG   3  
ATOM 10952  C CD   . GLU A 1 21  ? -12.241 2.231   -13.151 1.00 2.36  ? 21  GLU A CD   3  
ATOM 10953  O OE1  . GLU A 1 21  ? -11.364 2.490   -13.958 1.00 3.00  ? 21  GLU A OE1  3  
ATOM 10954  O OE2  . GLU A 1 21  ? -12.029 1.889   -11.999 1.00 2.83  ? 21  GLU A OE2  3  
ATOM 10955  H H    . GLU A 1 21  ? -15.442 1.197   -16.488 1.00 0.92  ? 21  GLU A H    3  
ATOM 10956  H HA   . GLU A 1 21  ? -15.772 3.584   -14.699 1.00 1.20  ? 21  GLU A HA   3  
ATOM 10957  H HB2  . GLU A 1 21  ? -13.207 2.320   -15.699 1.00 1.75  ? 21  GLU A HB2  3  
ATOM 10958  H HB3  . GLU A 1 21  ? -13.289 3.936   -14.996 1.00 1.63  ? 21  GLU A HB3  3  
ATOM 10959  H HG2  . GLU A 1 21  ? -14.238 2.988   -12.923 1.00 2.17  ? 21  GLU A HG2  3  
ATOM 10960  H HG3  . GLU A 1 21  ? -14.148 1.372   -13.623 1.00 2.19  ? 21  GLU A HG3  3  
ATOM 10961  N N    . ASP A 1 22  ? -15.675 5.131   -16.676 1.00 0.93  ? 22  ASP A N    3  
ATOM 10962  C CA   . ASP A 1 22  ? -15.751 5.976   -17.905 1.00 0.97  ? 22  ASP A CA   3  
ATOM 10963  C C    . ASP A 1 22  ? -14.431 6.730   -18.078 1.00 0.73  ? 22  ASP A C    3  
ATOM 10964  O O    . ASP A 1 22  ? -13.863 7.234   -17.131 1.00 0.75  ? 22  ASP A O    3  
ATOM 10965  C CB   . ASP A 1 22  ? -16.899 6.976   -17.761 1.00 1.33  ? 22  ASP A CB   3  
ATOM 10966  C CG   . ASP A 1 22  ? -18.232 6.230   -17.828 1.00 2.11  ? 22  ASP A CG   3  
ATOM 10967  O OD1  . ASP A 1 22  ? -18.235 5.105   -18.303 1.00 2.77  ? 22  ASP A OD1  3  
ATOM 10968  O OD2  . ASP A 1 22  ? -19.227 6.793   -17.405 1.00 2.76  ? 22  ASP A OD2  3  
ATOM 10969  H H    . ASP A 1 22  ? -15.927 5.512   -15.808 1.00 1.07  ? 22  ASP A H    3  
ATOM 10970  H HA   . ASP A 1 22  ? -15.926 5.350   -18.770 1.00 1.16  ? 22  ASP A HA   3  
ATOM 10971  H HB2  . ASP A 1 22  ? -16.817 7.488   -16.813 1.00 1.70  ? 22  ASP A HB2  3  
ATOM 10972  H HB3  . ASP A 1 22  ? -16.852 7.696   -18.566 1.00 1.69  ? 22  ASP A HB3  3  
ATOM 10973  N N    . GLU A 1 23  ? -13.938 6.804   -19.282 1.00 0.86  ? 23  GLU A N    3  
ATOM 10974  C CA   . GLU A 1 23  ? -12.651 7.518   -19.526 1.00 0.99  ? 23  GLU A CA   3  
ATOM 10975  C C    . GLU A 1 23  ? -12.788 8.989   -19.124 1.00 0.91  ? 23  GLU A C    3  
ATOM 10976  O O    . GLU A 1 23  ? -13.801 9.617   -19.362 1.00 0.99  ? 23  GLU A O    3  
ATOM 10977  C CB   . GLU A 1 23  ? -12.296 7.423   -21.007 1.00 1.41  ? 23  GLU A CB   3  
ATOM 10978  C CG   . GLU A 1 23  ? -10.925 8.056   -21.253 1.00 1.68  ? 23  GLU A CG   3  
ATOM 10979  C CD   . GLU A 1 23  ? -10.578 7.957   -22.739 1.00 2.36  ? 23  GLU A CD   3  
ATOM 10980  O OE1  . GLU A 1 23  ? -11.334 7.330   -23.462 1.00 2.91  ? 23  GLU A OE1  3  
ATOM 10981  O OE2  . GLU A 1 23  ? -9.561  8.505   -23.127 1.00 2.94  ? 23  GLU A OE2  3  
ATOM 10982  H H    . GLU A 1 23  ? -14.412 6.385   -20.031 1.00 1.07  ? 23  GLU A H    3  
ATOM 10983  H HA   . GLU A 1 23  ? -11.869 7.057   -18.939 1.00 1.03  ? 23  GLU A HA   3  
ATOM 10984  H HB2  . GLU A 1 23  ? -12.271 6.385   -21.303 1.00 1.51  ? 23  GLU A HB2  3  
ATOM 10985  H HB3  . GLU A 1 23  ? -13.040 7.945   -21.586 1.00 1.54  ? 23  GLU A HB3  3  
ATOM 10986  H HG2  . GLU A 1 23  ? -10.949 9.095   -20.958 1.00 1.87  ? 23  GLU A HG2  3  
ATOM 10987  H HG3  . GLU A 1 23  ? -10.177 7.533   -20.675 1.00 1.89  ? 23  GLU A HG3  3  
ATOM 10988  N N    . ILE A 1 24  ? -11.773 9.539   -18.514 1.00 0.83  ? 24  ILE A N    3  
ATOM 10989  C CA   . ILE A 1 24  ? -11.835 10.968  -18.089 1.00 0.81  ? 24  ILE A CA   3  
ATOM 10990  C C    . ILE A 1 24  ? -11.488 11.872  -19.275 1.00 0.90  ? 24  ILE A C    3  
ATOM 10991  O O    . ILE A 1 24  ? -10.496 11.675  -19.948 1.00 0.95  ? 24  ILE A O    3  
ATOM 10992  C CB   . ILE A 1 24  ? -10.824 11.213  -16.967 1.00 0.77  ? 24  ILE A CB   3  
ATOM 10993  C CG1  . ILE A 1 24  ? -11.157 10.313  -15.777 1.00 0.73  ? 24  ILE A CG1  3  
ATOM 10994  C CG2  . ILE A 1 24  ? -10.901 12.677  -16.531 1.00 0.86  ? 24  ILE A CG2  3  
ATOM 10995  C CD1  . ILE A 1 24  ? -10.017 10.370  -14.760 1.00 0.80  ? 24  ILE A CD1  3  
ATOM 10996  H H    . ILE A 1 24  ? -10.970 9.008   -18.333 1.00 0.85  ? 24  ILE A H    3  
ATOM 10997  H HA   . ILE A 1 24  ? -12.828 11.200  -17.734 1.00 0.84  ? 24  ILE A HA   3  
ATOM 10998  H HB   . ILE A 1 24  ? -9.828  10.994  -17.324 1.00 0.81  ? 24  ILE A HB   3  
ATOM 10999  H HG12 . ILE A 1 24  ? -12.072 10.655  -15.314 1.00 0.75  ? 24  ILE A HG12 3  
ATOM 11000  H HG13 . ILE A 1 24  ? -11.284 9.296   -16.118 1.00 0.71  ? 24  ILE A HG13 3  
ATOM 11001  H HG21 . ILE A 1 24  ? -11.935 12.957  -16.393 1.00 1.23  ? 24  ILE A HG21 3  
ATOM 11002  H HG22 . ILE A 1 24  ? -10.367 12.806  -15.601 1.00 1.35  ? 24  ILE A HG22 3  
ATOM 11003  H HG23 . ILE A 1 24  ? -10.457 13.303  -17.290 1.00 1.46  ? 24  ILE A HG23 3  
ATOM 11004  H HD11 . ILE A 1 24  ? -9.076  10.204  -15.263 1.00 1.33  ? 24  ILE A HD11 3  
ATOM 11005  H HD12 . ILE A 1 24  ? -10.005 11.339  -14.285 1.00 1.20  ? 24  ILE A HD12 3  
ATOM 11006  H HD13 . ILE A 1 24  ? -10.162 9.605   -14.013 1.00 1.33  ? 24  ILE A HD13 3  
ATOM 11007  N N    . VAL A 1 25  ? -12.301 12.862  -19.539 1.00 0.95  ? 25  VAL A N    3  
ATOM 11008  C CA   . VAL A 1 25  ? -12.029 13.780  -20.689 1.00 1.06  ? 25  VAL A CA   3  
ATOM 11009  C C    . VAL A 1 25  ? -11.324 15.049  -20.194 1.00 1.02  ? 25  VAL A C    3  
ATOM 11010  O O    . VAL A 1 25  ? -11.782 15.712  -19.284 1.00 1.02  ? 25  VAL A O    3  
ATOM 11011  C CB   . VAL A 1 25  ? -13.356 14.163  -21.346 1.00 1.18  ? 25  VAL A CB   3  
ATOM 11012  C CG1  . VAL A 1 25  ? -13.095 15.119  -22.511 1.00 1.28  ? 25  VAL A CG1  3  
ATOM 11013  C CG2  . VAL A 1 25  ? -14.051 12.900  -21.866 1.00 1.27  ? 25  VAL A CG2  3  
ATOM 11014  H H    . VAL A 1 25  ? -13.100 12.996  -18.988 1.00 0.94  ? 25  VAL A H    3  
ATOM 11015  H HA   . VAL A 1 25  ? -11.401 13.283  -21.416 1.00 1.10  ? 25  VAL A HA   3  
ATOM 11016  H HB   . VAL A 1 25  ? -13.989 14.650  -20.616 1.00 1.19  ? 25  VAL A HB   3  
ATOM 11017  H HG11 . VAL A 1 25  ? -12.341 14.699  -23.160 1.00 1.67  ? 25  VAL A HG11 3  
ATOM 11018  H HG12 . VAL A 1 25  ? -14.009 15.265  -23.068 1.00 1.70  ? 25  VAL A HG12 3  
ATOM 11019  H HG13 . VAL A 1 25  ? -12.753 16.069  -22.128 1.00 1.57  ? 25  VAL A HG13 3  
ATOM 11020  H HG21 . VAL A 1 25  ? -13.984 12.119  -21.123 1.00 1.64  ? 25  VAL A HG21 3  
ATOM 11021  H HG22 . VAL A 1 25  ? -15.089 13.119  -22.066 1.00 1.69  ? 25  VAL A HG22 3  
ATOM 11022  H HG23 . VAL A 1 25  ? -13.570 12.572  -22.776 1.00 1.58  ? 25  VAL A HG23 3  
ATOM 11023  N N    . ILE A 1 26  ? -10.217 15.393  -20.805 1.00 1.03  ? 26  ILE A N    3  
ATOM 11024  C CA   . ILE A 1 26  ? -9.457  16.624  -20.411 1.00 1.01  ? 26  ILE A CA   3  
ATOM 11025  C C    . ILE A 1 26  ? -9.592  17.664  -21.527 1.00 1.09  ? 26  ILE A C    3  
ATOM 11026  O O    . ILE A 1 26  ? -9.382  17.367  -22.687 1.00 1.21  ? 26  ILE A O    3  
ATOM 11027  C CB   . ILE A 1 26  ? -7.983  16.272  -20.206 1.00 1.01  ? 26  ILE A CB   3  
ATOM 11028  C CG1  . ILE A 1 26  ? -7.864  15.222  -19.100 1.00 0.97  ? 26  ILE A CG1  3  
ATOM 11029  C CG2  . ILE A 1 26  ? -7.201  17.527  -19.808 1.00 1.01  ? 26  ILE A CG2  3  
ATOM 11030  C CD1  . ILE A 1 26  ? -6.434  14.680  -19.053 1.00 1.00  ? 26  ILE A CD1  3  
ATOM 11031  H H    . ILE A 1 26  ? -9.883  14.841  -21.543 1.00 1.06  ? 26  ILE A H    3  
ATOM 11032  H HA   . ILE A 1 26  ? -9.860  17.031  -19.493 1.00 0.97  ? 26  ILE A HA   3  
ATOM 11033  H HB   . ILE A 1 26  ? -7.577  15.876  -21.126 1.00 1.08  ? 26  ILE A HB   3  
ATOM 11034  H HG12 . ILE A 1 26  ? -8.111  15.671  -18.148 1.00 0.94  ? 26  ILE A HG12 3  
ATOM 11035  H HG13 . ILE A 1 26  ? -8.547  14.410  -19.302 1.00 1.04  ? 26  ILE A HG13 3  
ATOM 11036  H HG21 . ILE A 1 26  ? -7.684  18.000  -18.965 1.00 1.30  ? 26  ILE A HG21 3  
ATOM 11037  H HG22 . ILE A 1 26  ? -6.193  17.252  -19.537 1.00 1.49  ? 26  ILE A HG22 3  
ATOM 11038  H HG23 . ILE A 1 26  ? -7.175  18.215  -20.641 1.00 1.50  ? 26  ILE A HG23 3  
ATOM 11039  H HD11 . ILE A 1 26  ? -6.148  14.336  -20.035 1.00 1.39  ? 26  ILE A HD11 3  
ATOM 11040  H HD12 . ILE A 1 26  ? -5.763  15.464  -18.736 1.00 1.54  ? 26  ILE A HD12 3  
ATOM 11041  H HD13 . ILE A 1 26  ? -6.383  13.859  -18.354 1.00 1.37  ? 26  ILE A HD13 3  
ATOM 11042  N N    . ASP A 1 27  ? -9.951  18.876  -21.195 1.00 1.05  ? 27  ASP A N    3  
ATOM 11043  C CA   . ASP A 1 27  ? -10.107 19.923  -22.249 1.00 1.14  ? 27  ASP A CA   3  
ATOM 11044  C C    . ASP A 1 27  ? -8.746  20.525  -22.607 1.00 1.08  ? 27  ASP A C    3  
ATOM 11045  O O    . ASP A 1 27  ? -8.009  20.975  -21.754 1.00 0.99  ? 27  ASP A O    3  
ATOM 11046  C CB   . ASP A 1 27  ? -11.022 21.031  -21.722 1.00 1.17  ? 27  ASP A CB   3  
ATOM 11047  C CG   . ASP A 1 27  ? -12.453 20.504  -21.610 1.00 1.34  ? 27  ASP A CG   3  
ATOM 11048  O OD1  . ASP A 1 27  ? -12.770 19.554  -22.307 1.00 1.81  ? 27  ASP A OD1  3  
ATOM 11049  O OD2  . ASP A 1 27  ? -13.209 21.059  -20.830 1.00 1.76  ? 27  ASP A OD2  3  
ATOM 11050  H H    . ASP A 1 27  ? -10.117 19.108  -20.258 1.00 0.98  ? 27  ASP A H    3  
ATOM 11051  H HA   . ASP A 1 27  ? -10.550 19.484  -23.131 1.00 1.26  ? 27  ASP A HA   3  
ATOM 11052  H HB2  . ASP A 1 27  ? -10.678 21.345  -20.746 1.00 1.06  ? 27  ASP A HB2  3  
ATOM 11053  H HB3  . ASP A 1 27  ? -11.000 21.870  -22.399 1.00 1.26  ? 27  ASP A HB3  3  
ATOM 11054  N N    . ARG A 1 28  ? -8.411  20.536  -23.872 1.00 1.17  ? 28  ARG A N    3  
ATOM 11055  C CA   . ARG A 1 28  ? -7.100  21.111  -24.298 1.00 1.16  ? 28  ARG A CA   3  
ATOM 11056  C C    . ARG A 1 28  ? -7.278  22.603  -24.593 1.00 1.16  ? 28  ARG A C    3  
ATOM 11057  O O    . ARG A 1 28  ? -6.339  23.296  -24.930 1.00 1.22  ? 28  ARG A O    3  
ATOM 11058  C CB   . ARG A 1 28  ? -6.609  20.403  -25.567 1.00 1.29  ? 28  ARG A CB   3  
ATOM 11059  C CG   . ARG A 1 28  ? -6.667  18.879  -25.390 1.00 1.32  ? 28  ARG A CG   3  
ATOM 11060  C CD   . ARG A 1 28  ? -5.605  18.411  -24.387 1.00 1.27  ? 28  ARG A CD   3  
ATOM 11061  N NE   . ARG A 1 28  ? -4.278  18.987  -24.744 1.00 1.77  ? 28  ARG A NE   3  
ATOM 11062  C CZ   . ARG A 1 28  ? -3.305  18.957  -23.876 1.00 2.03  ? 28  ARG A CZ   3  
ATOM 11063  N NH1  . ARG A 1 28  ? -3.492  18.405  -22.708 1.00 2.23  ? 28  ARG A NH1  3  
ATOM 11064  N NH2  . ARG A 1 28  ? -2.144  19.474  -24.176 1.00 2.80  ? 28  ARG A NH2  3  
ATOM 11065  H H    . ARG A 1 28  ? -9.025  20.158  -24.536 1.00 1.26  ? 28  ARG A H    3  
ATOM 11066  H HA   . ARG A 1 28  ? -6.370  20.987  -23.510 1.00 1.08  ? 28  ARG A HA   3  
ATOM 11067  H HB2  . ARG A 1 28  ? -7.238  20.690  -26.398 1.00 1.38  ? 28  ARG A HB2  3  
ATOM 11068  H HB3  . ARG A 1 28  ? -5.592  20.702  -25.772 1.00 1.31  ? 28  ARG A HB3  3  
ATOM 11069  H HG2  . ARG A 1 28  ? -7.645  18.595  -25.032 1.00 1.31  ? 28  ARG A HG2  3  
ATOM 11070  H HG3  . ARG A 1 28  ? -6.488  18.404  -26.344 1.00 1.44  ? 28  ARG A HG3  3  
ATOM 11071  H HD2  . ARG A 1 28  ? -5.879  18.728  -23.394 1.00 1.39  ? 28  ARG A HD2  3  
ATOM 11072  H HD3  . ARG A 1 28  ? -5.546  17.333  -24.412 1.00 1.48  ? 28  ARG A HD3  3  
ATOM 11073  H HE   . ARG A 1 28  ? -4.139  19.391  -25.626 1.00 2.44  ? 28  ARG A HE   3  
ATOM 11074  H HH11 . ARG A 1 28  ? -4.380  18.005  -22.480 1.00 2.10  ? 28  ARG A HH11 3  
ATOM 11075  H HH12 . ARG A 1 28  ? -2.748  18.382  -22.040 1.00 2.94  ? 28  ARG A HH12 3  
ATOM 11076  H HH21 . ARG A 1 28  ? -2.000  19.892  -25.071 1.00 3.22  ? 28  ARG A HH21 3  
ATOM 11077  H HH22 . ARG A 1 28  ? -1.400  19.451  -23.508 1.00 3.23  ? 28  ARG A HH22 3  
ATOM 11078  N N    . LYS A 1 29  ? -8.479  23.102  -24.468 1.00 1.14  ? 29  LYS A N    3  
ATOM 11079  C CA   . LYS A 1 29  ? -8.724  24.548  -24.739 1.00 1.17  ? 29  LYS A CA   3  
ATOM 11080  C C    . LYS A 1 29  ? -8.084  25.396  -23.634 1.00 1.03  ? 29  LYS A C    3  
ATOM 11081  O O    . LYS A 1 29  ? -8.103  25.035  -22.475 1.00 0.96  ? 29  LYS A O    3  
ATOM 11082  C CB   . LYS A 1 29  ? -10.231 24.818  -24.767 1.00 1.27  ? 29  LYS A CB   3  
ATOM 11083  C CG   . LYS A 1 29  ? -10.864 24.102  -25.952 1.00 1.43  ? 29  LYS A CG   3  
ATOM 11084  C CD   . LYS A 1 29  ? -12.363 24.385  -25.957 1.00 1.57  ? 29  LYS A CD   3  
ATOM 11085  C CE   . LYS A 1 29  ? -13.002 23.672  -27.138 1.00 2.19  ? 29  LYS A CE   3  
ATOM 11086  N NZ   . LYS A 1 29  ? -12.573 24.332  -28.404 1.00 2.87  ? 29  LYS A NZ   3  
ATOM 11087  H H    . LYS A 1 29  ? -9.221  22.524  -24.195 1.00 1.12  ? 29  LYS A H    3  
ATOM 11088  H HA   . LYS A 1 29  ? -8.293  24.815  -25.693 1.00 1.27  ? 29  LYS A HA   3  
ATOM 11089  H HB2  . LYS A 1 29  ? -10.680 24.455  -23.856 1.00 1.23  ? 29  LYS A HB2  3  
ATOM 11090  H HB3  . LYS A 1 29  ? -10.408 25.877  -24.858 1.00 1.31  ? 29  LYS A HB3  3  
ATOM 11091  H HG2  . LYS A 1 29  ? -10.422 24.461  -26.872 1.00 1.49  ? 29  LYS A HG2  3  
ATOM 11092  H HG3  . LYS A 1 29  ? -10.701 23.038  -25.863 1.00 1.46  ? 29  LYS A HG3  3  
ATOM 11093  H HD2  . LYS A 1 29  ? -12.802 24.027  -25.036 1.00 1.95  ? 29  LYS A HD2  3  
ATOM 11094  H HD3  . LYS A 1 29  ? -12.530 25.449  -26.047 1.00 1.63  ? 29  LYS A HD3  3  
ATOM 11095  H HE2  . LYS A 1 29  ? -12.684 22.642  -27.142 1.00 2.56  ? 29  LYS A HE2  3  
ATOM 11096  H HE3  . LYS A 1 29  ? -14.075 23.721  -27.049 1.00 2.66  ? 29  LYS A HE3  3  
ATOM 11097  H HZ1  . LYS A 1 29  ? -11.708 24.882  -28.231 1.00 3.20  ? 29  LYS A HZ1  3  
ATOM 11098  H HZ2  . LYS A 1 29  ? -12.386 23.608  -29.127 1.00 3.29  ? 29  LYS A HZ2  3  
ATOM 11099  H HZ3  . LYS A 1 29  ? -13.327 24.965  -28.739 1.00 3.27  ? 29  LYS A HZ3  3  
ATOM 11100  N N    . LYS A 1 30  ? -7.525  26.523  -23.984 1.00 1.01  ? 30  LYS A N    3  
ATOM 11101  C CA   . LYS A 1 30  ? -6.891  27.400  -22.954 1.00 0.90  ? 30  LYS A CA   3  
ATOM 11102  C C    . LYS A 1 30  ? -7.960  28.298  -22.328 1.00 0.88  ? 30  LYS A C    3  
ATOM 11103  O O    . LYS A 1 30  ? -8.934  28.652  -22.962 1.00 0.95  ? 30  LYS A O    3  
ATOM 11104  C CB   . LYS A 1 30  ? -5.819  28.266  -23.615 1.00 0.92  ? 30  LYS A CB   3  
ATOM 11105  C CG   . LYS A 1 30  ? -4.678  27.371  -24.097 1.00 1.02  ? 30  LYS A CG   3  
ATOM 11106  C CD   . LYS A 1 30  ? -3.598  28.226  -24.760 1.00 1.43  ? 30  LYS A CD   3  
ATOM 11107  C CE   . LYS A 1 30  ? -2.479  27.319  -25.276 1.00 1.84  ? 30  LYS A CE   3  
ATOM 11108  N NZ   . LYS A 1 30  ? -3.049  26.328  -26.234 1.00 2.35  ? 30  LYS A NZ   3  
ATOM 11109  H H    . LYS A 1 30  ? -7.526  26.799  -24.925 1.00 1.08  ? 30  LYS A H    3  
ATOM 11110  H HA   . LYS A 1 30  ? -6.438  26.789  -22.186 1.00 0.85  ? 30  LYS A HA   3  
ATOM 11111  H HB2  . LYS A 1 30  ? -6.248  28.790  -24.458 1.00 0.99  ? 30  LYS A HB2  3  
ATOM 11112  H HB3  . LYS A 1 30  ? -5.439  28.979  -22.900 1.00 0.86  ? 30  LYS A HB3  3  
ATOM 11113  H HG2  . LYS A 1 30  ? -4.253  26.848  -23.252 1.00 1.22  ? 30  LYS A HG2  3  
ATOM 11114  H HG3  . LYS A 1 30  ? -5.057  26.654  -24.809 1.00 1.37  ? 30  LYS A HG3  3  
ATOM 11115  H HD2  . LYS A 1 30  ? -4.030  28.776  -25.585 1.00 1.90  ? 30  LYS A HD2  3  
ATOM 11116  H HD3  . LYS A 1 30  ? -3.193  28.918  -24.037 1.00 2.00  ? 30  LYS A HD3  3  
ATOM 11117  H HE2  . LYS A 1 30  ? -1.734  27.917  -25.778 1.00 2.34  ? 30  LYS A HE2  3  
ATOM 11118  H HE3  . LYS A 1 30  ? -2.025  26.798  -24.447 1.00 2.30  ? 30  LYS A HE3  3  
ATOM 11119  H HZ1  . LYS A 1 30  ? -3.882  26.738  -26.704 1.00 2.72  ? 30  LYS A HZ1  3  
ATOM 11120  H HZ2  . LYS A 1 30  ? -2.336  26.084  -26.949 1.00 2.80  ? 30  LYS A HZ2  3  
ATOM 11121  H HZ3  . LYS A 1 30  ? -3.330  25.469  -25.717 1.00 2.66  ? 30  LYS A HZ3  3  
ATOM 11122  N N    . ILE A 1 31  ? -7.788  28.672  -21.086 1.00 0.84  ? 31  ILE A N    3  
ATOM 11123  C CA   . ILE A 1 31  ? -8.793  29.549  -20.418 1.00 0.88  ? 31  ILE A CA   3  
ATOM 11124  C C    . ILE A 1 31  ? -8.416  31.020  -20.609 1.00 0.85  ? 31  ILE A C    3  
ATOM 11125  O O    . ILE A 1 31  ? -7.296  31.345  -20.954 1.00 0.78  ? 31  ILE A O    3  
ATOM 11126  C CB   . ILE A 1 31  ? -8.831  29.233  -18.918 1.00 0.87  ? 31  ILE A CB   3  
ATOM 11127  C CG1  . ILE A 1 31  ? -7.392  29.239  -18.346 1.00 0.75  ? 31  ILE A CG1  3  
ATOM 11128  C CG2  . ILE A 1 31  ? -9.507  27.862  -18.682 1.00 0.97  ? 31  ILE A CG2  3  
ATOM 11129  C CD1  . ILE A 1 31  ? -7.413  29.604  -16.852 1.00 0.79  ? 31  ILE A CD1  3  
ATOM 11130  H H    . ILE A 1 31  ? -6.992  28.380  -20.592 1.00 0.82  ? 31  ILE A H    3  
ATOM 11131  H HA   . ILE A 1 31  ? -9.772  29.371  -20.843 1.00 0.98  ? 31  ILE A HA   3  
ATOM 11132  H HB   . ILE A 1 31  ? -9.410  29.992  -18.432 1.00 0.92  ? 31  ILE A HB   3  
ATOM 11133  H HG12 . ILE A 1 31  ? -6.956  28.259  -18.465 1.00 0.74  ? 31  ILE A HG12 3  
ATOM 11134  H HG13 . ILE A 1 31  ? -6.789  29.963  -18.876 1.00 0.70  ? 31  ILE A HG13 3  
ATOM 11135  H HG21 . ILE A 1 31  ? -9.391  27.237  -19.557 1.00 1.43  ? 31  ILE A HG21 3  
ATOM 11136  H HG22 . ILE A 1 31  ? -9.055  27.371  -17.832 1.00 1.43  ? 31  ILE A HG22 3  
ATOM 11137  H HG23 . ILE A 1 31  ? -10.564 28.010  -18.488 1.00 1.39  ? 31  ILE A HG23 3  
ATOM 11138  H HD11 . ILE A 1 31  ? -8.031  30.481  -16.694 1.00 1.34  ? 31  ILE A HD11 3  
ATOM 11139  H HD12 . ILE A 1 31  ? -7.808  28.778  -16.284 1.00 1.20  ? 31  ILE A HD12 3  
ATOM 11140  H HD13 . ILE A 1 31  ? -6.406  29.815  -16.523 1.00 1.33  ? 31  ILE A HD13 3  
ATOM 11141  N N    . SER A 1 32  ? -9.338  31.915  -20.360 1.00 0.93  ? 32  SER A N    3  
ATOM 11142  C CA   . SER A 1 32  ? -9.038  33.371  -20.493 1.00 0.94  ? 32  SER A CA   3  
ATOM 11143  C C    . SER A 1 32  ? -8.514  33.882  -19.148 1.00 0.95  ? 32  SER A C    3  
ATOM 11144  O O    . SER A 1 32  ? -8.552  33.179  -18.157 1.00 0.99  ? 32  SER A O    3  
ATOM 11145  C CB   . SER A 1 32  ? -10.317 34.123  -20.866 1.00 1.06  ? 32  SER A CB   3  
ATOM 11146  O OG   . SER A 1 32  ? -11.267 33.981  -19.818 1.00 1.17  ? 32  SER A OG   3  
ATOM 11147  H H    . SER A 1 32  ? -10.226 31.636  -20.053 1.00 1.00  ? 32  SER A H    3  
ATOM 11148  H HA   . SER A 1 32  ? -8.289  33.524  -21.258 1.00 0.89  ? 32  SER A HA   3  
ATOM 11149  H HB2  . SER A 1 32  ? -10.095 35.169  -21.004 1.00 1.11  ? 32  SER A HB2  3  
ATOM 11150  H HB3  . SER A 1 32  ? -10.717 33.719  -21.786 1.00 1.08  ? 32  SER A HB3  3  
ATOM 11151  H HG   . SER A 1 32  ? -12.089 34.386  -20.107 1.00 1.54  ? 32  SER A HG   3  
ATOM 11152  N N    . ALA A 1 33  ? -8.016  35.086  -19.095 1.00 0.96  ? 33  ALA A N    3  
ATOM 11153  C CA   . ALA A 1 33  ? -7.488  35.607  -17.801 1.00 1.01  ? 33  ALA A CA   3  
ATOM 11154  C C    . ALA A 1 33  ? -8.634  35.845  -16.814 1.00 1.11  ? 33  ALA A C    3  
ATOM 11155  O O    . ALA A 1 33  ? -8.424  35.892  -15.618 1.00 1.18  ? 33  ALA A O    3  
ATOM 11156  C CB   . ALA A 1 33  ? -6.740  36.919  -18.029 1.00 1.06  ? 33  ALA A CB   3  
ATOM 11157  H H    . ALA A 1 33  ? -7.983  35.646  -19.900 1.00 0.96  ? 33  ALA A H    3  
ATOM 11158  H HA   . ALA A 1 33  ? -6.806  34.881  -17.382 1.00 0.96  ? 33  ALA A HA   3  
ATOM 11159  H HB1  . ALA A 1 33  ? -5.986  36.778  -18.789 1.00 1.35  ? 33  ALA A HB1  3  
ATOM 11160  H HB2  . ALA A 1 33  ? -7.436  37.681  -18.346 1.00 1.46  ? 33  ALA A HB2  3  
ATOM 11161  H HB3  . ALA A 1 33  ? -6.269  37.221  -17.104 1.00 1.60  ? 33  ALA A HB3  3  
ATOM 11162  N N    . ASP A 1 34  ? -9.849  35.966  -17.286 1.00 1.18  ? 34  ASP A N    3  
ATOM 11163  C CA   . ASP A 1 34  ? -10.989 36.162  -16.342 1.00 1.31  ? 34  ASP A CA   3  
ATOM 11164  C C    . ASP A 1 34  ? -11.406 34.792  -15.819 1.00 1.26  ? 34  ASP A C    3  
ATOM 11165  O O    . ASP A 1 34  ? -11.967 34.658  -14.749 1.00 1.36  ? 34  ASP A O    3  
ATOM 11166  C CB   . ASP A 1 34  ? -12.165 36.814  -17.072 1.00 1.44  ? 34  ASP A CB   3  
ATOM 11167  C CG   . ASP A 1 34  ? -11.855 38.289  -17.331 1.00 1.90  ? 34  ASP A CG   3  
ATOM 11168  O OD1  . ASP A 1 34  ? -10.990 38.820  -16.653 1.00 2.39  ? 34  ASP A OD1  3  
ATOM 11169  O OD2  . ASP A 1 34  ? -12.490 38.865  -18.198 1.00 2.56  ? 34  ASP A OD2  3  
ATOM 11170  H H    . ASP A 1 34  ? -10.024 35.884  -18.247 1.00 1.17  ? 34  ASP A H    3  
ATOM 11171  H HA   . ASP A 1 34  ? -10.678 36.787  -15.517 1.00 1.38  ? 34  ASP A HA   3  
ATOM 11172  H HB2  . ASP A 1 34  ? -12.328 36.309  -18.014 1.00 1.64  ? 34  ASP A HB2  3  
ATOM 11173  H HB3  . ASP A 1 34  ? -13.054 36.736  -16.464 1.00 1.89  ? 34  ASP A HB3  3  
ATOM 11174  N N    . GLN A 1 35  ? -11.108 33.773  -16.573 1.00 1.14  ? 35  GLN A N    3  
ATOM 11175  C CA   . GLN A 1 35  ? -11.443 32.393  -16.157 1.00 1.12  ? 35  GLN A CA   3  
ATOM 11176  C C    . GLN A 1 35  ? -10.370 31.893  -15.195 1.00 1.03  ? 35  GLN A C    3  
ATOM 11177  O O    . GLN A 1 35  ? -10.507 30.854  -14.583 1.00 1.01  ? 35  GLN A O    3  
ATOM 11178  C CB   . GLN A 1 35  ? -11.493 31.503  -17.403 1.00 1.14  ? 35  GLN A CB   3  
ATOM 11179  C CG   . GLN A 1 35  ? -12.829 31.680  -18.124 1.00 1.22  ? 35  GLN A CG   3  
ATOM 11180  C CD   . GLN A 1 35  ? -12.764 31.009  -19.497 1.00 1.29  ? 35  GLN A CD   3  
ATOM 11181  O OE1  . GLN A 1 35  ? -11.693 30.773  -20.019 1.00 1.70  ? 35  GLN A OE1  3  
ATOM 11182  N NE2  . GLN A 1 35  ? -13.873 30.688  -20.107 1.00 1.79  ? 35  GLN A NE2  3  
ATOM 11183  H H    . GLN A 1 35  ? -10.639 33.917  -17.416 1.00 1.09  ? 35  GLN A H    3  
ATOM 11184  H HA   . GLN A 1 35  ? -12.404 32.385  -15.665 1.00 1.19  ? 35  GLN A HA   3  
ATOM 11185  H HB2  . GLN A 1 35  ? -10.697 31.796  -18.067 1.00 1.27  ? 35  GLN A HB2  3  
ATOM 11186  H HB3  . GLN A 1 35  ? -11.369 30.468  -17.120 1.00 1.27  ? 35  GLN A HB3  3  
ATOM 11187  H HG2  . GLN A 1 35  ? -13.610 31.219  -17.539 1.00 1.39  ? 35  GLN A HG2  3  
ATOM 11188  H HG3  . GLN A 1 35  ? -13.038 32.730  -18.246 1.00 1.49  ? 35  GLN A HG3  3  
ATOM 11189  H HE21 . GLN A 1 35  ? -14.737 30.877  -19.684 1.00 2.36  ? 35  GLN A HE21 3  
ATOM 11190  H HE22 . GLN A 1 35  ? -13.841 30.258  -20.987 1.00 1.94  ? 35  GLN A HE22 3  
ATOM 11191  N N    . VAL A 1 36  ? -9.303  32.630  -15.042 1.00 1.00  ? 36  VAL A N    3  
ATOM 11192  C CA   . VAL A 1 36  ? -8.236  32.192  -14.108 1.00 0.93  ? 36  VAL A CA   3  
ATOM 11193  C C    . VAL A 1 36  ? -8.809  32.165  -12.688 1.00 0.97  ? 36  VAL A C    3  
ATOM 11194  O O    . VAL A 1 36  ? -8.732  31.167  -11.999 1.00 0.92  ? 36  VAL A O    3  
ATOM 11195  C CB   . VAL A 1 36  ? -7.053  33.175  -14.208 1.00 0.95  ? 36  VAL A CB   3  
ATOM 11196  C CG1  . VAL A 1 36  ? -6.118  33.011  -13.006 1.00 0.96  ? 36  VAL A CG1  3  
ATOM 11197  C CG2  . VAL A 1 36  ? -6.269  32.882  -15.490 1.00 0.92  ? 36  VAL A CG2  3  
ATOM 11198  H H    . VAL A 1 36  ? -9.204  33.480  -15.520 1.00 1.05  ? 36  VAL A H    3  
ATOM 11199  H HA   . VAL A 1 36  ? -7.908  31.201  -14.377 1.00 0.88  ? 36  VAL A HA   3  
ATOM 11200  H HB   . VAL A 1 36  ? -7.425  34.192  -14.243 1.00 1.00  ? 36  VAL A HB   3  
ATOM 11201  H HG11 . VAL A 1 36  ? -5.901  31.964  -12.856 1.00 1.22  ? 36  VAL A HG11 3  
ATOM 11202  H HG12 . VAL A 1 36  ? -5.198  33.546  -13.193 1.00 1.43  ? 36  VAL A HG12 3  
ATOM 11203  H HG13 . VAL A 1 36  ? -6.592  33.411  -12.122 1.00 1.33  ? 36  VAL A HG13 3  
ATOM 11204  H HG21 . VAL A 1 36  ? -6.955  32.781  -16.317 1.00 1.36  ? 36  VAL A HG21 3  
ATOM 11205  H HG22 . VAL A 1 36  ? -5.584  33.694  -15.687 1.00 1.38  ? 36  VAL A HG22 3  
ATOM 11206  H HG23 . VAL A 1 36  ? -5.712  31.964  -15.369 1.00 1.31  ? 36  VAL A HG23 3  
ATOM 11207  N N    . ASP A 1 37  ? -9.380  33.248  -12.243 1.00 1.08  ? 37  ASP A N    3  
ATOM 11208  C CA   . ASP A 1 37  ? -9.950  33.270  -10.868 1.00 1.15  ? 37  ASP A CA   3  
ATOM 11209  C C    . ASP A 1 37  ? -11.083 32.249  -10.765 1.00 1.12  ? 37  ASP A C    3  
ATOM 11210  O O    . ASP A 1 37  ? -11.224 31.565  -9.770  1.00 1.11  ? 37  ASP A O    3  
ATOM 11211  C CB   . ASP A 1 37  ? -10.508 34.664  -10.564 1.00 1.31  ? 37  ASP A CB   3  
ATOM 11212  C CG   . ASP A 1 37  ? -9.356  35.659  -10.418 1.00 1.36  ? 37  ASP A CG   3  
ATOM 11213  O OD1  . ASP A 1 37  ? -8.240  35.218  -10.199 1.00 1.77  ? 37  ASP A OD1  3  
ATOM 11214  O OD2  . ASP A 1 37  ? -9.610  36.848  -10.533 1.00 1.73  ? 37  ASP A OD2  3  
ATOM 11215  H H    . ASP A 1 37  ? -9.423  34.051  -12.802 1.00 1.14  ? 37  ASP A H    3  
ATOM 11216  H HA   . ASP A 1 37  ? -9.180  33.027  -10.153 1.00 1.13  ? 37  ASP A HA   3  
ATOM 11217  H HB2  . ASP A 1 37  ? -11.154 34.977  -11.371 1.00 1.36  ? 37  ASP A HB2  3  
ATOM 11218  H HB3  . ASP A 1 37  ? -11.072 34.632  -9.643  1.00 1.39  ? 37  ASP A HB3  3  
ATOM 11219  N N    . GLN A 1 38  ? -11.898 32.139  -11.780 1.00 1.13  ? 38  GLN A N    3  
ATOM 11220  C CA   . GLN A 1 38  ? -13.018 31.158  -11.718 1.00 1.15  ? 38  GLN A CA   3  
ATOM 11221  C C    . GLN A 1 38  ? -12.468 29.732  -11.784 1.00 1.04  ? 38  GLN A C    3  
ATOM 11222  O O    . GLN A 1 38  ? -12.929 28.848  -11.092 1.00 1.06  ? 38  GLN A O    3  
ATOM 11223  C CB   . GLN A 1 38  ? -13.987 31.400  -12.878 1.00 1.22  ? 38  GLN A CB   3  
ATOM 11224  C CG   . GLN A 1 38  ? -14.735 32.716  -12.645 1.00 1.33  ? 38  GLN A CG   3  
ATOM 11225  C CD   . GLN A 1 38  ? -15.707 32.971  -13.798 1.00 1.99  ? 38  GLN A CD   3  
ATOM 11226  O OE1  . GLN A 1 38  ? -16.629 33.752  -13.667 1.00 2.56  ? 38  GLN A OE1  3  
ATOM 11227  N NE2  . GLN A 1 38  ? -15.543 32.343  -14.931 1.00 2.70  ? 38  GLN A NE2  3  
ATOM 11228  H H    . GLN A 1 38  ? -11.772 32.700  -12.577 1.00 1.14  ? 38  GLN A H    3  
ATOM 11229  H HA   . GLN A 1 38  ? -13.545 31.286  -10.784 1.00 1.22  ? 38  GLN A HA   3  
ATOM 11230  H HB2  . GLN A 1 38  ? -13.434 31.456  -13.802 1.00 1.18  ? 38  GLN A HB2  3  
ATOM 11231  H HB3  . GLN A 1 38  ? -14.696 30.589  -12.931 1.00 1.26  ? 38  GLN A HB3  3  
ATOM 11232  H HG2  . GLN A 1 38  ? -15.285 32.655  -11.717 1.00 1.73  ? 38  GLN A HG2  3  
ATOM 11233  H HG3  . GLN A 1 38  ? -14.025 33.527  -12.590 1.00 1.31  ? 38  GLN A HG3  3  
ATOM 11234