data_3F2B
# 
_entry.id   3F2B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3F2B         
NDB   PD1200       
RCSB  RCSB050057   
WWPDB D_1000050057 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3F2C 'Same protein-DNA complex crystallized with Mn'                      unspecified 
PDB 3F2D 'Same protein-DNA complex crystallized with complex dGTP, Mn and Zn' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3F2B 
_pdbx_database_status.recvd_initial_deposition_date   2008-10-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Davies, D.R.'    1 
'Evans, R.J.'     2 
'Bullard, J.M.'   3 
'Christensen, J.' 4 
'Green, L.S.'     5 
'Guiles, J.W.'    6 
'Ribble, W.K.'    7 
'Janjic, N.'      8 
'Jarvis, T.C.'    9 
# 
_citation.id                        primary 
_citation.title                     'Structure of PolC reveals unique DNA binding and fidelity determinants.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            105 
_citation.page_first                20695 
_citation.page_last                 20700 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19106298 
_citation.pdbx_database_id_DOI      10.1073/pnas.0809989106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Evans, R.J.'     1  
primary 'Davies, D.R.'    2  
primary 'Bullard, J.M.'   3  
primary 'Christensen, J.' 4  
primary 'Green, L.S.'     5  
primary 'Guiles, J.W.'    6  
primary 'Pata, J.D.'      7  
primary 'Ribble, W.K.'    8  
primary 'Janjic, N.'      9  
primary 'Jarvis, T.C.'    10 
# 
_cell.entry_id           3F2B 
_cell.length_a           116.174 
_cell.length_b           140.793 
_cell.length_c           184.524 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3F2B 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA-directed DNA polymerase III alpha chain'                                                      117248.508 1  
2.7.7.7 ? 'GKAPOLC, DELTA 1-227, DELTA 412-617' ?                     
2 polymer     syn "5'-D(*DCP*DAP*DGP*DTP*DGP*DAP*DGP*DAP*DCP*DGP*DGP*DGP*DCP*DAP*DAP*DCP*DC)-3'"                     5246.413   1  
?       ? ?                                     'DNA primer strand'   
3 polymer     syn "5'-D(*DAP*DTP*DAP*DAP*DCP*DGP*DGP*DTP*DTP*DGP*DCP*DCP*DCP*DGP*DTP*DCP*DTP*DCP*DAP*DCP*DTP*DG)-3'" 6703.328   1  
?       ? ?                                     'DNA Template strand' 
4 non-polymer syn 'PHOSPHATE ION'                                                                                    94.971     3  
?       ? ?                                     ?                     
5 non-polymer syn 'ZINC ION'                                                                                         65.409     1  
?       ? ?                                     ?                     
6 non-polymer syn 'MAGNESIUM ION'                                                                                    24.305     3  
?       ? ?                                     ?                     
7 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                                                507.181    1  
?       ? ?                                     ?                     
8 water       nat water                                                                                              18.015     95 
?       ? ?                                     ?                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MRDEEPVRRLETIVEEERRVVVQGYVFDAEVSELKSGRTLLTMKITDYTNSILVKMFSRDKEDAELMSGVKKGMWVKVRG
SVQNDTFVRDLVIIANDLNEIAANERQDTAPEGEKRVELHLHTPMSQMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSF
PEAYSAAKKHGMKVIYGLEANIVDDGVPIAYNETHRRLGSGSGPFHVTLLAQNETGLKNLFKLVSLSHIQYFHRVPRIPR
SVLVKHRDGLLVGSGCDKGELFDNLIQKAPEEVEDIARFYDFLEVHPPDVYKPLIEMDYVKDEEMIKNIIRSIVALGEKL
DIPVVATGNVHYLNPEDKIYRKILIHSQGGANPLNRHELPDVYFRTTNEMLDCFSFLGPEKAKEIVVDNTQKIASLIGDV
KPIKDELYTPRIEGADEEIREMSYRRAKEIYGDPLPKLVEERLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRG
SVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFNDGSVGSGFDLPDKNCPRCGTKYKKDGHDIPFETFLGFKGDKVPDI
DLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAYGFVKAYASDHNLELRGAEIDRLAAGCTGVKRTTGQHPGGI
IVVPDYMEIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPDVMGIFS
STEPLGVTPEQIMCNVGTIGIPEFGTRFVRQMLEETRPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRD
DIMVYLIYRGLEPSLAFKIMESVRKGKGLTPEFEAEMRKHDVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHP
LLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGIQATAKEKSLLTVLEVALEMCERGFSFKNIDLYRSQATEFVI
DGNSLIPPFNAIPGLGTNVAQAIVRAREEGEFLSKEDLQQRGKLSKTLLEYLESRGCLDSLPDHNQLSLFSGGHHHHHHH
H
;
;MRDEEPVRRLETIVEEERRVVVQGYVFDAEVSELKSGRTLLTMKITDYTNSILVKMFSRDKEDAELMSGVKKGMWVKVRG
SVQNDTFVRDLVIIANDLNEIAANERQDTAPEGEKRVELHLHTPMSQMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSF
PEAYSAAKKHGMKVIYGLEANIVDDGVPIAYNETHRRLGSGSGPFHVTLLAQNETGLKNLFKLVSLSHIQYFHRVPRIPR
SVLVKHRDGLLVGSGCDKGELFDNLIQKAPEEVEDIARFYDFLEVHPPDVYKPLIEMDYVKDEEMIKNIIRSIVALGEKL
DIPVVATGNVHYLNPEDKIYRKILIHSQGGANPLNRHELPDVYFRTTNEMLDCFSFLGPEKAKEIVVDNTQKIASLIGDV
KPIKDELYTPRIEGADEEIREMSYRRAKEIYGDPLPKLVEERLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRG
SVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFNDGSVGSGFDLPDKNCPRCGTKYKKDGHDIPFETFLGFKGDKVPDI
DLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAYGFVKAYASDHNLELRGAEIDRLAAGCTGVKRTTGQHPGGI
IVVPDYMEIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPDVMGIFS
STEPLGVTPEQIMCNVGTIGIPEFGTRFVRQMLEETRPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRD
DIMVYLIYRGLEPSLAFKIMESVRKGKGLTPEFEAEMRKHDVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHP
LLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGIQATAKEKSLLTVLEVALEMCERGFSFKNIDLYRSQATEFVI
DGNSLIPPFNAIPGLGTNVAQAIVRAREEGEFLSKEDLQQRGKLSKTLLEYLESRGCLDSLPDHNQLSLFSGGHHHHHHH
H
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DT)(DG)(DA)(DG)(DA)(DC)(DG)(DG)(DG)(DC)(DA)(DA)(DC)(DC)' CAGTGAGACGGGCAACC P ? 
3 polydeoxyribonucleotide no no 
;(DA)(DT)(DA)(DA)(DC)(DG)(DG)(DT)(DT)(DG)(DC)(DC)(DC)(DG)(DT)(DC)(DT)(DC)(DA)(DC)
(DT)(DG)
;
ATAACGGTTGCCCGTCTCACTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ARG n 
1 3    ASP n 
1 4    GLU n 
1 5    GLU n 
1 6    PRO n 
1 7    VAL n 
1 8    ARG n 
1 9    ARG n 
1 10   LEU n 
1 11   GLU n 
1 12   THR n 
1 13   ILE n 
1 14   VAL n 
1 15   GLU n 
1 16   GLU n 
1 17   GLU n 
1 18   ARG n 
1 19   ARG n 
1 20   VAL n 
1 21   VAL n 
1 22   VAL n 
1 23   GLN n 
1 24   GLY n 
1 25   TYR n 
1 26   VAL n 
1 27   PHE n 
1 28   ASP n 
1 29   ALA n 
1 30   GLU n 
1 31   VAL n 
1 32   SER n 
1 33   GLU n 
1 34   LEU n 
1 35   LYS n 
1 36   SER n 
1 37   GLY n 
1 38   ARG n 
1 39   THR n 
1 40   LEU n 
1 41   LEU n 
1 42   THR n 
1 43   MET n 
1 44   LYS n 
1 45   ILE n 
1 46   THR n 
1 47   ASP n 
1 48   TYR n 
1 49   THR n 
1 50   ASN n 
1 51   SER n 
1 52   ILE n 
1 53   LEU n 
1 54   VAL n 
1 55   LYS n 
1 56   MET n 
1 57   PHE n 
1 58   SER n 
1 59   ARG n 
1 60   ASP n 
1 61   LYS n 
1 62   GLU n 
1 63   ASP n 
1 64   ALA n 
1 65   GLU n 
1 66   LEU n 
1 67   MET n 
1 68   SER n 
1 69   GLY n 
1 70   VAL n 
1 71   LYS n 
1 72   LYS n 
1 73   GLY n 
1 74   MET n 
1 75   TRP n 
1 76   VAL n 
1 77   LYS n 
1 78   VAL n 
1 79   ARG n 
1 80   GLY n 
1 81   SER n 
1 82   VAL n 
1 83   GLN n 
1 84   ASN n 
1 85   ASP n 
1 86   THR n 
1 87   PHE n 
1 88   VAL n 
1 89   ARG n 
1 90   ASP n 
1 91   LEU n 
1 92   VAL n 
1 93   ILE n 
1 94   ILE n 
1 95   ALA n 
1 96   ASN n 
1 97   ASP n 
1 98   LEU n 
1 99   ASN n 
1 100  GLU n 
1 101  ILE n 
1 102  ALA n 
1 103  ALA n 
1 104  ASN n 
1 105  GLU n 
1 106  ARG n 
1 107  GLN n 
1 108  ASP n 
1 109  THR n 
1 110  ALA n 
1 111  PRO n 
1 112  GLU n 
1 113  GLY n 
1 114  GLU n 
1 115  LYS n 
1 116  ARG n 
1 117  VAL n 
1 118  GLU n 
1 119  LEU n 
1 120  HIS n 
1 121  LEU n 
1 122  HIS n 
1 123  THR n 
1 124  PRO n 
1 125  MET n 
1 126  SER n 
1 127  GLN n 
1 128  MET n 
1 129  ASP n 
1 130  ALA n 
1 131  VAL n 
1 132  THR n 
1 133  SER n 
1 134  VAL n 
1 135  THR n 
1 136  LYS n 
1 137  LEU n 
1 138  ILE n 
1 139  GLU n 
1 140  GLN n 
1 141  ALA n 
1 142  LYS n 
1 143  LYS n 
1 144  TRP n 
1 145  GLY n 
1 146  HIS n 
1 147  PRO n 
1 148  ALA n 
1 149  ILE n 
1 150  ALA n 
1 151  VAL n 
1 152  THR n 
1 153  ASP n 
1 154  HIS n 
1 155  ALA n 
1 156  VAL n 
1 157  VAL n 
1 158  GLN n 
1 159  SER n 
1 160  PHE n 
1 161  PRO n 
1 162  GLU n 
1 163  ALA n 
1 164  TYR n 
1 165  SER n 
1 166  ALA n 
1 167  ALA n 
1 168  LYS n 
1 169  LYS n 
1 170  HIS n 
1 171  GLY n 
1 172  MET n 
1 173  LYS n 
1 174  VAL n 
1 175  ILE n 
1 176  TYR n 
1 177  GLY n 
1 178  LEU n 
1 179  GLU n 
1 180  ALA n 
1 181  ASN n 
1 182  ILE n 
1 183  VAL n 
1 184  ASP n 
1 185  ASP n 
1 186  GLY n 
1 187  VAL n 
1 188  PRO n 
1 189  ILE n 
1 190  ALA n 
1 191  TYR n 
1 192  ASN n 
1 193  GLU n 
1 194  THR n 
1 195  HIS n 
1 196  ARG n 
1 197  ARG n 
1 198  LEU n 
1 199  GLY n 
1 200  SER n 
1 201  GLY n 
1 202  SER n 
1 203  GLY n 
1 204  PRO n 
1 205  PHE n 
1 206  HIS n 
1 207  VAL n 
1 208  THR n 
1 209  LEU n 
1 210  LEU n 
1 211  ALA n 
1 212  GLN n 
1 213  ASN n 
1 214  GLU n 
1 215  THR n 
1 216  GLY n 
1 217  LEU n 
1 218  LYS n 
1 219  ASN n 
1 220  LEU n 
1 221  PHE n 
1 222  LYS n 
1 223  LEU n 
1 224  VAL n 
1 225  SER n 
1 226  LEU n 
1 227  SER n 
1 228  HIS n 
1 229  ILE n 
1 230  GLN n 
1 231  TYR n 
1 232  PHE n 
1 233  HIS n 
1 234  ARG n 
1 235  VAL n 
1 236  PRO n 
1 237  ARG n 
1 238  ILE n 
1 239  PRO n 
1 240  ARG n 
1 241  SER n 
1 242  VAL n 
1 243  LEU n 
1 244  VAL n 
1 245  LYS n 
1 246  HIS n 
1 247  ARG n 
1 248  ASP n 
1 249  GLY n 
1 250  LEU n 
1 251  LEU n 
1 252  VAL n 
1 253  GLY n 
1 254  SER n 
1 255  GLY n 
1 256  CYS n 
1 257  ASP n 
1 258  LYS n 
1 259  GLY n 
1 260  GLU n 
1 261  LEU n 
1 262  PHE n 
1 263  ASP n 
1 264  ASN n 
1 265  LEU n 
1 266  ILE n 
1 267  GLN n 
1 268  LYS n 
1 269  ALA n 
1 270  PRO n 
1 271  GLU n 
1 272  GLU n 
1 273  VAL n 
1 274  GLU n 
1 275  ASP n 
1 276  ILE n 
1 277  ALA n 
1 278  ARG n 
1 279  PHE n 
1 280  TYR n 
1 281  ASP n 
1 282  PHE n 
1 283  LEU n 
1 284  GLU n 
1 285  VAL n 
1 286  HIS n 
1 287  PRO n 
1 288  PRO n 
1 289  ASP n 
1 290  VAL n 
1 291  TYR n 
1 292  LYS n 
1 293  PRO n 
1 294  LEU n 
1 295  ILE n 
1 296  GLU n 
1 297  MET n 
1 298  ASP n 
1 299  TYR n 
1 300  VAL n 
1 301  LYS n 
1 302  ASP n 
1 303  GLU n 
1 304  GLU n 
1 305  MET n 
1 306  ILE n 
1 307  LYS n 
1 308  ASN n 
1 309  ILE n 
1 310  ILE n 
1 311  ARG n 
1 312  SER n 
1 313  ILE n 
1 314  VAL n 
1 315  ALA n 
1 316  LEU n 
1 317  GLY n 
1 318  GLU n 
1 319  LYS n 
1 320  LEU n 
1 321  ASP n 
1 322  ILE n 
1 323  PRO n 
1 324  VAL n 
1 325  VAL n 
1 326  ALA n 
1 327  THR n 
1 328  GLY n 
1 329  ASN n 
1 330  VAL n 
1 331  HIS n 
1 332  TYR n 
1 333  LEU n 
1 334  ASN n 
1 335  PRO n 
1 336  GLU n 
1 337  ASP n 
1 338  LYS n 
1 339  ILE n 
1 340  TYR n 
1 341  ARG n 
1 342  LYS n 
1 343  ILE n 
1 344  LEU n 
1 345  ILE n 
1 346  HIS n 
1 347  SER n 
1 348  GLN n 
1 349  GLY n 
1 350  GLY n 
1 351  ALA n 
1 352  ASN n 
1 353  PRO n 
1 354  LEU n 
1 355  ASN n 
1 356  ARG n 
1 357  HIS n 
1 358  GLU n 
1 359  LEU n 
1 360  PRO n 
1 361  ASP n 
1 362  VAL n 
1 363  TYR n 
1 364  PHE n 
1 365  ARG n 
1 366  THR n 
1 367  THR n 
1 368  ASN n 
1 369  GLU n 
1 370  MET n 
1 371  LEU n 
1 372  ASP n 
1 373  CYS n 
1 374  PHE n 
1 375  SER n 
1 376  PHE n 
1 377  LEU n 
1 378  GLY n 
1 379  PRO n 
1 380  GLU n 
1 381  LYS n 
1 382  ALA n 
1 383  LYS n 
1 384  GLU n 
1 385  ILE n 
1 386  VAL n 
1 387  VAL n 
1 388  ASP n 
1 389  ASN n 
1 390  THR n 
1 391  GLN n 
1 392  LYS n 
1 393  ILE n 
1 394  ALA n 
1 395  SER n 
1 396  LEU n 
1 397  ILE n 
1 398  GLY n 
1 399  ASP n 
1 400  VAL n 
1 401  LYS n 
1 402  PRO n 
1 403  ILE n 
1 404  LYS n 
1 405  ASP n 
1 406  GLU n 
1 407  LEU n 
1 408  TYR n 
1 409  THR n 
1 410  PRO n 
1 411  ARG n 
1 412  ILE n 
1 413  GLU n 
1 414  GLY n 
1 415  ALA n 
1 416  ASP n 
1 417  GLU n 
1 418  GLU n 
1 419  ILE n 
1 420  ARG n 
1 421  GLU n 
1 422  MET n 
1 423  SER n 
1 424  TYR n 
1 425  ARG n 
1 426  ARG n 
1 427  ALA n 
1 428  LYS n 
1 429  GLU n 
1 430  ILE n 
1 431  TYR n 
1 432  GLY n 
1 433  ASP n 
1 434  PRO n 
1 435  LEU n 
1 436  PRO n 
1 437  LYS n 
1 438  LEU n 
1 439  VAL n 
1 440  GLU n 
1 441  GLU n 
1 442  ARG n 
1 443  LEU n 
1 444  GLU n 
1 445  LYS n 
1 446  GLU n 
1 447  LEU n 
1 448  LYS n 
1 449  SER n 
1 450  ILE n 
1 451  ILE n 
1 452  GLY n 
1 453  HIS n 
1 454  GLY n 
1 455  PHE n 
1 456  ALA n 
1 457  VAL n 
1 458  ILE n 
1 459  TYR n 
1 460  LEU n 
1 461  ILE n 
1 462  SER n 
1 463  HIS n 
1 464  LYS n 
1 465  LEU n 
1 466  VAL n 
1 467  LYS n 
1 468  LYS n 
1 469  SER n 
1 470  LEU n 
1 471  ASP n 
1 472  ASP n 
1 473  GLY n 
1 474  TYR n 
1 475  LEU n 
1 476  VAL n 
1 477  GLY n 
1 478  SER n 
1 479  ARG n 
1 480  GLY n 
1 481  SER n 
1 482  VAL n 
1 483  GLY n 
1 484  SER n 
1 485  SER n 
1 486  PHE n 
1 487  VAL n 
1 488  ALA n 
1 489  THR n 
1 490  MET n 
1 491  THR n 
1 492  GLU n 
1 493  ILE n 
1 494  THR n 
1 495  GLU n 
1 496  VAL n 
1 497  ASN n 
1 498  PRO n 
1 499  LEU n 
1 500  PRO n 
1 501  PRO n 
1 502  HIS n 
1 503  TYR n 
1 504  VAL n 
1 505  CYS n 
1 506  PRO n 
1 507  ASN n 
1 508  CYS n 
1 509  LYS n 
1 510  HIS n 
1 511  SER n 
1 512  GLU n 
1 513  PHE n 
1 514  PHE n 
1 515  ASN n 
1 516  ASP n 
1 517  GLY n 
1 518  SER n 
1 519  VAL n 
1 520  GLY n 
1 521  SER n 
1 522  GLY n 
1 523  PHE n 
1 524  ASP n 
1 525  LEU n 
1 526  PRO n 
1 527  ASP n 
1 528  LYS n 
1 529  ASN n 
1 530  CYS n 
1 531  PRO n 
1 532  ARG n 
1 533  CYS n 
1 534  GLY n 
1 535  THR n 
1 536  LYS n 
1 537  TYR n 
1 538  LYS n 
1 539  LYS n 
1 540  ASP n 
1 541  GLY n 
1 542  HIS n 
1 543  ASP n 
1 544  ILE n 
1 545  PRO n 
1 546  PHE n 
1 547  GLU n 
1 548  THR n 
1 549  PHE n 
1 550  LEU n 
1 551  GLY n 
1 552  PHE n 
1 553  LYS n 
1 554  GLY n 
1 555  ASP n 
1 556  LYS n 
1 557  VAL n 
1 558  PRO n 
1 559  ASP n 
1 560  ILE n 
1 561  ASP n 
1 562  LEU n 
1 563  ASN n 
1 564  PHE n 
1 565  SER n 
1 566  GLY n 
1 567  GLU n 
1 568  TYR n 
1 569  GLN n 
1 570  PRO n 
1 571  ARG n 
1 572  ALA n 
1 573  HIS n 
1 574  ASN n 
1 575  TYR n 
1 576  THR n 
1 577  LYS n 
1 578  VAL n 
1 579  LEU n 
1 580  PHE n 
1 581  GLY n 
1 582  GLU n 
1 583  ASP n 
1 584  ASN n 
1 585  VAL n 
1 586  TYR n 
1 587  ARG n 
1 588  ALA n 
1 589  GLY n 
1 590  THR n 
1 591  ILE n 
1 592  GLY n 
1 593  THR n 
1 594  VAL n 
1 595  ALA n 
1 596  ASP n 
1 597  LYS n 
1 598  THR n 
1 599  ALA n 
1 600  TYR n 
1 601  GLY n 
1 602  PHE n 
1 603  VAL n 
1 604  LYS n 
1 605  ALA n 
1 606  TYR n 
1 607  ALA n 
1 608  SER n 
1 609  ASP n 
1 610  HIS n 
1 611  ASN n 
1 612  LEU n 
1 613  GLU n 
1 614  LEU n 
1 615  ARG n 
1 616  GLY n 
1 617  ALA n 
1 618  GLU n 
1 619  ILE n 
1 620  ASP n 
1 621  ARG n 
1 622  LEU n 
1 623  ALA n 
1 624  ALA n 
1 625  GLY n 
1 626  CYS n 
1 627  THR n 
1 628  GLY n 
1 629  VAL n 
1 630  LYS n 
1 631  ARG n 
1 632  THR n 
1 633  THR n 
1 634  GLY n 
1 635  GLN n 
1 636  HIS n 
1 637  PRO n 
1 638  GLY n 
1 639  GLY n 
1 640  ILE n 
1 641  ILE n 
1 642  VAL n 
1 643  VAL n 
1 644  PRO n 
1 645  ASP n 
1 646  TYR n 
1 647  MET n 
1 648  GLU n 
1 649  ILE n 
1 650  TYR n 
1 651  ASP n 
1 652  PHE n 
1 653  THR n 
1 654  PRO n 
1 655  ILE n 
1 656  GLN n 
1 657  TYR n 
1 658  PRO n 
1 659  ALA n 
1 660  ASP n 
1 661  ASP n 
1 662  THR n 
1 663  SER n 
1 664  SER n 
1 665  GLU n 
1 666  TRP n 
1 667  ARG n 
1 668  THR n 
1 669  THR n 
1 670  HIS n 
1 671  PHE n 
1 672  ASP n 
1 673  PHE n 
1 674  HIS n 
1 675  SER n 
1 676  ILE n 
1 677  HIS n 
1 678  ASP n 
1 679  ASN n 
1 680  LEU n 
1 681  LEU n 
1 682  LYS n 
1 683  LEU n 
1 684  ASP n 
1 685  ILE n 
1 686  LEU n 
1 687  GLY n 
1 688  HIS n 
1 689  ASP n 
1 690  ASP n 
1 691  PRO n 
1 692  THR n 
1 693  VAL n 
1 694  ILE n 
1 695  ARG n 
1 696  MET n 
1 697  LEU n 
1 698  GLN n 
1 699  ASP n 
1 700  LEU n 
1 701  SER n 
1 702  GLY n 
1 703  ILE n 
1 704  ASP n 
1 705  PRO n 
1 706  LYS n 
1 707  THR n 
1 708  ILE n 
1 709  PRO n 
1 710  THR n 
1 711  ASP n 
1 712  ASP n 
1 713  PRO n 
1 714  ASP n 
1 715  VAL n 
1 716  MET n 
1 717  GLY n 
1 718  ILE n 
1 719  PHE n 
1 720  SER n 
1 721  SER n 
1 722  THR n 
1 723  GLU n 
1 724  PRO n 
1 725  LEU n 
1 726  GLY n 
1 727  VAL n 
1 728  THR n 
1 729  PRO n 
1 730  GLU n 
1 731  GLN n 
1 732  ILE n 
1 733  MET n 
1 734  CYS n 
1 735  ASN n 
1 736  VAL n 
1 737  GLY n 
1 738  THR n 
1 739  ILE n 
1 740  GLY n 
1 741  ILE n 
1 742  PRO n 
1 743  GLU n 
1 744  PHE n 
1 745  GLY n 
1 746  THR n 
1 747  ARG n 
1 748  PHE n 
1 749  VAL n 
1 750  ARG n 
1 751  GLN n 
1 752  MET n 
1 753  LEU n 
1 754  GLU n 
1 755  GLU n 
1 756  THR n 
1 757  ARG n 
1 758  PRO n 
1 759  LYS n 
1 760  THR n 
1 761  PHE n 
1 762  SER n 
1 763  GLU n 
1 764  LEU n 
1 765  VAL n 
1 766  GLN n 
1 767  ILE n 
1 768  SER n 
1 769  GLY n 
1 770  LEU n 
1 771  SER n 
1 772  HIS n 
1 773  GLY n 
1 774  THR n 
1 775  ASP n 
1 776  VAL n 
1 777  TRP n 
1 778  LEU n 
1 779  GLY n 
1 780  ASN n 
1 781  ALA n 
1 782  GLN n 
1 783  GLU n 
1 784  LEU n 
1 785  ILE n 
1 786  GLN n 
1 787  ASN n 
1 788  GLY n 
1 789  THR n 
1 790  CYS n 
1 791  THR n 
1 792  LEU n 
1 793  SER n 
1 794  GLU n 
1 795  VAL n 
1 796  ILE n 
1 797  GLY n 
1 798  CYS n 
1 799  ARG n 
1 800  ASP n 
1 801  ASP n 
1 802  ILE n 
1 803  MET n 
1 804  VAL n 
1 805  TYR n 
1 806  LEU n 
1 807  ILE n 
1 808  TYR n 
1 809  ARG n 
1 810  GLY n 
1 811  LEU n 
1 812  GLU n 
1 813  PRO n 
1 814  SER n 
1 815  LEU n 
1 816  ALA n 
1 817  PHE n 
1 818  LYS n 
1 819  ILE n 
1 820  MET n 
1 821  GLU n 
1 822  SER n 
1 823  VAL n 
1 824  ARG n 
1 825  LYS n 
1 826  GLY n 
1 827  LYS n 
1 828  GLY n 
1 829  LEU n 
1 830  THR n 
1 831  PRO n 
1 832  GLU n 
1 833  PHE n 
1 834  GLU n 
1 835  ALA n 
1 836  GLU n 
1 837  MET n 
1 838  ARG n 
1 839  LYS n 
1 840  HIS n 
1 841  ASP n 
1 842  VAL n 
1 843  PRO n 
1 844  GLU n 
1 845  TRP n 
1 846  TYR n 
1 847  ILE n 
1 848  ASP n 
1 849  SER n 
1 850  CYS n 
1 851  LYS n 
1 852  LYS n 
1 853  ILE n 
1 854  LYS n 
1 855  TYR n 
1 856  MET n 
1 857  PHE n 
1 858  PRO n 
1 859  LYS n 
1 860  ALA n 
1 861  HIS n 
1 862  ALA n 
1 863  ALA n 
1 864  ALA n 
1 865  TYR n 
1 866  VAL n 
1 867  LEU n 
1 868  MET n 
1 869  ALA n 
1 870  VAL n 
1 871  ARG n 
1 872  ILE n 
1 873  ALA n 
1 874  TYR n 
1 875  PHE n 
1 876  LYS n 
1 877  VAL n 
1 878  HIS n 
1 879  HIS n 
1 880  PRO n 
1 881  LEU n 
1 882  LEU n 
1 883  TYR n 
1 884  TYR n 
1 885  ALA n 
1 886  SER n 
1 887  TYR n 
1 888  PHE n 
1 889  THR n 
1 890  VAL n 
1 891  ARG n 
1 892  ALA n 
1 893  GLU n 
1 894  ASP n 
1 895  PHE n 
1 896  ASP n 
1 897  LEU n 
1 898  ASP n 
1 899  ALA n 
1 900  MET n 
1 901  ILE n 
1 902  LYS n 
1 903  GLY n 
1 904  SER n 
1 905  ALA n 
1 906  ALA n 
1 907  ILE n 
1 908  ARG n 
1 909  LYS n 
1 910  ARG n 
1 911  ILE n 
1 912  GLU n 
1 913  GLU n 
1 914  ILE n 
1 915  ASN n 
1 916  ALA n 
1 917  LYS n 
1 918  GLY n 
1 919  ILE n 
1 920  GLN n 
1 921  ALA n 
1 922  THR n 
1 923  ALA n 
1 924  LYS n 
1 925  GLU n 
1 926  LYS n 
1 927  SER n 
1 928  LEU n 
1 929  LEU n 
1 930  THR n 
1 931  VAL n 
1 932  LEU n 
1 933  GLU n 
1 934  VAL n 
1 935  ALA n 
1 936  LEU n 
1 937  GLU n 
1 938  MET n 
1 939  CYS n 
1 940  GLU n 
1 941  ARG n 
1 942  GLY n 
1 943  PHE n 
1 944  SER n 
1 945  PHE n 
1 946  LYS n 
1 947  ASN n 
1 948  ILE n 
1 949  ASP n 
1 950  LEU n 
1 951  TYR n 
1 952  ARG n 
1 953  SER n 
1 954  GLN n 
1 955  ALA n 
1 956  THR n 
1 957  GLU n 
1 958  PHE n 
1 959  VAL n 
1 960  ILE n 
1 961  ASP n 
1 962  GLY n 
1 963  ASN n 
1 964  SER n 
1 965  LEU n 
1 966  ILE n 
1 967  PRO n 
1 968  PRO n 
1 969  PHE n 
1 970  ASN n 
1 971  ALA n 
1 972  ILE n 
1 973  PRO n 
1 974  GLY n 
1 975  LEU n 
1 976  GLY n 
1 977  THR n 
1 978  ASN n 
1 979  VAL n 
1 980  ALA n 
1 981  GLN n 
1 982  ALA n 
1 983  ILE n 
1 984  VAL n 
1 985  ARG n 
1 986  ALA n 
1 987  ARG n 
1 988  GLU n 
1 989  GLU n 
1 990  GLY n 
1 991  GLU n 
1 992  PHE n 
1 993  LEU n 
1 994  SER n 
1 995  LYS n 
1 996  GLU n 
1 997  ASP n 
1 998  LEU n 
1 999  GLN n 
1 1000 GLN n 
1 1001 ARG n 
1 1002 GLY n 
1 1003 LYS n 
1 1004 LEU n 
1 1005 SER n 
1 1006 LYS n 
1 1007 THR n 
1 1008 LEU n 
1 1009 LEU n 
1 1010 GLU n 
1 1011 TYR n 
1 1012 LEU n 
1 1013 GLU n 
1 1014 SER n 
1 1015 ARG n 
1 1016 GLY n 
1 1017 CYS n 
1 1018 LEU n 
1 1019 ASP n 
1 1020 SER n 
1 1021 LEU n 
1 1022 PRO n 
1 1023 ASP n 
1 1024 HIS n 
1 1025 ASN n 
1 1026 GLN n 
1 1027 LEU n 
1 1028 SER n 
1 1029 LEU n 
1 1030 PHE n 
1 1031 SER n 
1 1032 GLY n 
1 1033 GLY n 
1 1034 HIS n 
1 1035 HIS n 
1 1036 HIS n 
1 1037 HIS n 
1 1038 HIS n 
1 1039 HIS n 
1 1040 HIS n 
1 1041 HIS n 
2 1    DC  n 
2 2    DA  n 
2 3    DG  n 
2 4    DT  n 
2 5    DG  n 
2 6    DA  n 
2 7    DG  n 
2 8    DA  n 
2 9    DC  n 
2 10   DG  n 
2 11   DG  n 
2 12   DG  n 
2 13   DC  n 
2 14   DA  n 
2 15   DA  n 
2 16   DC  n 
2 17   DC  n 
3 1    DA  n 
3 2    DT  n 
3 3    DA  n 
3 4    DA  n 
3 5    DC  n 
3 6    DG  n 
3 7    DG  n 
3 8    DT  n 
3 9    DT  n 
3 10   DG  n 
3 11   DC  n 
3 12   DC  n 
3 13   DC  n 
3 14   DG  n 
3 15   DT  n 
3 16   DC  n 
3 17   DT  n 
3 18   DC  n 
3 19   DA  n 
3 20   DC  n 
3 21   DT  n 
3 22   DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 2   198  ? ? 'GK1258, polC' ? ? ? ? ? ? 'Geobacillus kaustophilus' 1462 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 204 1030 ? ? 'GK1258, polC' ? ? ? ? ? ? 'Geobacillus kaustophilus' 1462 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Primer strand synthetic oligonucleotide'   
3 1 sample ? ? ? ? ? 'Template strand synthetic oligonucleotide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q5L0J3_GEOKA Q5L0J3 1 
;RDEEPVRRLETIVEEERRVVVQGYVFDAEVSELKSGRTLLTMKITDYTNSILVKMFSRDKEDAELMSGVKKGMWVKVRGS
VQNDTFVRDLVIIANDLNEIAANERQDTAPEGEKRVELHLHTPMSQMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFP
EAYSAAKKHGMKVIYGLEANIVDDGVPIAYNETHRRL
;
227 ? 
2 PDB 3F2B         3F2B   2 CAGTGAGACGGGCAACC 1   ? 
3 PDB 3F2B         3F2B   3 ATAACGGTTGCCCGTCTCACTG 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3F2B A 2   ? 198  ? Q5L0J3 227 ? 423  ? 228 424  
2 1 3F2B A 204 ? 1030 ? Q5L0J3 618 ? 1444 ? 618 1444 
3 2 3F2B P 1   ? 17   ? 3F2B   1   ? 17   ? 1   17   
4 3 3F2B T 1   ? 22   ? 3F2B   1   ? 22   ? 1   22   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3F2B MET A 1    ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 227  1  
1 3F2B GLY A 199  ? UNP Q5L0J3 ? ? LINKER           425  2  
1 3F2B SER A 200  ? UNP Q5L0J3 ? ? LINKER           426  3  
1 3F2B GLY A 201  ? UNP Q5L0J3 ? ? LINKER           427  4  
1 3F2B SER A 202  ? UNP Q5L0J3 ? ? LINKER           428  5  
1 3F2B GLY A 203  ? UNP Q5L0J3 ? ? LINKER           429  6  
2 3F2B SER A 1031 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1445 7  
2 3F2B GLY A 1032 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1446 8  
2 3F2B GLY A 1033 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1447 9  
2 3F2B HIS A 1034 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1448 10 
2 3F2B HIS A 1035 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1449 11 
2 3F2B HIS A 1036 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1450 12 
2 3F2B HIS A 1037 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1451 13 
2 3F2B HIS A 1038 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1452 14 
2 3F2B HIS A 1039 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1453 15 
2 3F2B HIS A 1040 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1454 16 
2 3F2B HIS A 1041 ? UNP Q5L0J3 ? ? 'EXPRESSION TAG' 1455 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O13 P3' 507.181 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                      ? 'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.entry_id          3F2B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.92 
_exptl_crystal.density_percent_sol   57.88 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.30 
_exptl_crystal_grow.pdbx_details    
;20% PEG 2000 MME, 0.1M PHOSPHATE- CITRATE, 200MM LITHIUM SULFATE, PH 5.3, VAPOR DIFFUSION, pH 5.30, VAPOR DIFFUSION, SITTING DROP, temperature 289K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 2000 MME'       ? ? ? 
1 2 1 'PHOSPHATE- CITRATE' ? ? ? 
1 3 1 'LITHIUM SULFATE'    ? ? ? 
1 4 2 'PEG 2000 MME'       ? ? ? 
1 5 2 'PHOSPHATE- CITRATE' ? ? ? 
1 6 2 'LITHIUM SULFATE'    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2008-04-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97     1.0 
2 0.999887 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.1 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        0.999887 
# 
_reflns.entry_id                     3F2B 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             43.52 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   59793 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.10100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.800 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.82400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3F2B 
_refine.ls_number_reflns_obs                     59703 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.52 
_refine.ls_d_res_high                            2.39 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.231 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  3017 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.B_iso_mean                               43.59 
_refine.aniso_B[1][1]                            -1.77000 
_refine.aniso_B[2][2]                            2.29000 
_refine.aniso_B[3][3]                            -0.52000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.345 
_refine.pdbx_overall_ESU_R_Free                  0.259 
_refine.overall_SU_ML                            0.203 
_refine.overall_SU_B                             17.074 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7815 
_refine_hist.pdbx_number_atoms_nucleic_acid   631 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             95 
_refine_hist.number_atoms_total               8591 
_refine_hist.d_res_high                       2.39 
_refine_hist.d_res_low                        43.52 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.012  0.022  ? 8731  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.609  2.068  ? 11954 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 6.088  5.000  ? 990   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 38.326 24.254 ? 362   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 20.471 15.000 ? 1398  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 20.495 15.000 ? 47    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.108  0.200  ? 1334  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.007  0.021  ? 6347  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.512  1.500  ? 4945  'X-RAY DIFFRACTION' ? 
r_mcangle_it           0.981  2.000  ? 8003  'X-RAY DIFFRACTION' ? 
r_scbond_it            1.593  3.000  ? 3786  'X-RAY DIFFRACTION' ? 
r_scangle_it           2.553  4.500  ? 3951  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.39 
_refine_ls_shell.d_res_low                        2.45 
_refine_ls_shell.number_reflns_R_work             3979 
_refine_ls_shell.R_factor_R_work                  0.4060 
_refine_ls_shell.percent_reflns_obs               95.95 
_refine_ls_shell.R_factor_R_free                  0.4500 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             209 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3F2B 
_struct.title                     'DNA Polymerase PolC from Geobacillus kaustophilus complex with DNA, dGTP, Mg and Zn' 
_struct.pdbx_descriptor           'GEOBACILLUS KAUSTOPHILUS DNA POLC/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3F2B 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;DNA Polymerase C, DNA Polymerase III, Ternary Complex, Protein-DNA complex, Replicative DNA Polymerase, DNA replication, DNA-directed DNA polymerase, Exonuclease, Hydrolase, Nuclease, Nucleotidyltransferase, Transferase, TRANSFERASE-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 9    ? ILE A 13   ? ARG A 235  ILE A 239  5 ? 5  
HELX_P HELX_P2  2  ASP A 60   ? GLY A 69   ? ASP A 286  GLY A 295  1 ? 10 
HELX_P HELX_P3  3  SER A 133  ? TRP A 144  ? SER A 359  TRP A 370  1 ? 12 
HELX_P HELX_P4  4  SER A 159  ? GLY A 171  ? SER A 385  GLY A 397  1 ? 13 
HELX_P HELX_P5  5  ASN A 213  ? ILE A 229  ? ASN A 627  ILE A 643  1 ? 17 
HELX_P HELX_P6  6  ARG A 240  ? HIS A 246  ? ARG A 654  HIS A 660  1 ? 7  
HELX_P HELX_P7  7  ILE A 276  ? TYR A 280  ? ILE A 690  TYR A 694  5 ? 5  
HELX_P HELX_P8  8  PRO A 287  ? LYS A 292  ? PRO A 701  LYS A 706  5 ? 6  
HELX_P HELX_P9  9  ASP A 302  ? LEU A 320  ? ASP A 716  LEU A 734  1 ? 19 
HELX_P HELX_P10 10 ASN A 334  ? GLU A 336  ? ASN A 748  GLU A 750  5 ? 3  
HELX_P HELX_P11 11 ASP A 337  ? SER A 347  ? ASP A 751  SER A 761  1 ? 11 
HELX_P HELX_P12 12 GLN A 348  ? ASN A 352  ? GLN A 762  ASN A 766  5 ? 5  
HELX_P HELX_P13 13 THR A 366  ? SER A 375  ? THR A 780  SER A 789  1 ? 10 
HELX_P HELX_P14 14 LEU A 377  ? VAL A 387  ? LEU A 791  VAL A 801  1 ? 11 
HELX_P HELX_P15 15 VAL A 387  ? LEU A 396  ? VAL A 801  LEU A 810  1 ? 10 
HELX_P HELX_P16 16 GLY A 414  ? GLY A 432  ? GLY A 828  GLY A 846  1 ? 19 
HELX_P HELX_P17 17 PRO A 436  ? HIS A 453  ? PRO A 850  HIS A 867  1 ? 18 
HELX_P HELX_P18 18 PHE A 455  ? ASP A 472  ? PHE A 869  ASP A 886  1 ? 18 
HELX_P HELX_P19 19 GLY A 480  ? SER A 484  ? GLY A 894  SER A 898  5 ? 5  
HELX_P HELX_P20 20 SER A 485  ? THR A 491  ? SER A 899  THR A 905  1 ? 7  
HELX_P HELX_P21 21 SER A 521  ? LEU A 525  ? SER A 935  LEU A 939  5 ? 5  
HELX_P HELX_P22 22 PHE A 546  ? GLY A 551  ? PHE A 960  GLY A 965  1 ? 6  
HELX_P HELX_P23 23 TYR A 568  ? GLY A 581  ? TYR A 982  GLY A 995  1 ? 14 
HELX_P HELX_P24 24 ALA A 595  ? HIS A 610  ? ALA A 1009 HIS A 1024 1 ? 16 
HELX_P HELX_P25 25 ARG A 615  ? THR A 627  ? ARG A 1029 THR A 1041 1 ? 13 
HELX_P HELX_P26 26 GLU A 648  ? PHE A 652  ? GLU A 1062 PHE A 1066 5 ? 5  
HELX_P HELX_P27 27 TYR A 657  ? ASP A 661  ? TYR A 1071 ASP A 1075 5 ? 5  
HELX_P HELX_P28 28 PHE A 673  ? HIS A 677  ? PHE A 1087 HIS A 1091 1 ? 5  
HELX_P HELX_P29 29 ASP A 689  ? GLY A 702  ? ASP A 1103 GLY A 1116 1 ? 14 
HELX_P HELX_P30 30 ASP A 704  ? ILE A 708  ? ASP A 1118 ILE A 1122 5 ? 5  
HELX_P HELX_P31 31 ASP A 712  ? ILE A 718  ? ASP A 1126 ILE A 1132 1 ? 7  
HELX_P HELX_P32 32 THR A 722  ? GLY A 726  ? THR A 1136 GLY A 1140 5 ? 5  
HELX_P HELX_P33 33 THR A 728  ? MET A 733  ? THR A 1142 MET A 1147 1 ? 6  
HELX_P HELX_P34 34 THR A 746  ? ARG A 757  ? THR A 1160 ARG A 1171 1 ? 12 
HELX_P HELX_P35 35 THR A 760  ? SER A 771  ? THR A 1174 SER A 1185 1 ? 12 
HELX_P HELX_P36 36 ASN A 780  ? ASN A 787  ? ASN A 1194 ASN A 1201 1 ? 8  
HELX_P HELX_P37 37 THR A 791  ? VAL A 795  ? THR A 1205 VAL A 1209 5 ? 5  
HELX_P HELX_P38 38 CYS A 798  ? ARG A 809  ? CYS A 1212 ARG A 1223 1 ? 12 
HELX_P HELX_P39 39 GLU A 812  ? ARG A 824  ? GLU A 1226 ARG A 1238 1 ? 13 
HELX_P HELX_P40 40 THR A 830  ? HIS A 840  ? THR A 1244 HIS A 1254 1 ? 11 
HELX_P HELX_P41 41 PRO A 843  ? ILE A 853  ? PRO A 1257 ILE A 1267 1 ? 11 
HELX_P HELX_P42 42 PRO A 858  ? HIS A 879  ? PRO A 1272 HIS A 1293 1 ? 22 
HELX_P HELX_P43 43 HIS A 879  ? ARG A 891  ? HIS A 1293 ARG A 1305 1 ? 13 
HELX_P HELX_P44 44 ASP A 896  ? GLY A 903  ? ASP A 1310 GLY A 1317 1 ? 8  
HELX_P HELX_P45 45 GLY A 903  ? LYS A 917  ? GLY A 1317 LYS A 1331 1 ? 15 
HELX_P HELX_P46 46 GLY A 918  ? ALA A 921  ? GLY A 1332 ALA A 1335 5 ? 4  
HELX_P HELX_P47 47 THR A 922  ? ARG A 941  ? THR A 1336 ARG A 1355 1 ? 20 
HELX_P HELX_P48 48 PRO A 968  ? ILE A 972  ? PRO A 1382 ILE A 1386 5 ? 5  
HELX_P HELX_P49 49 GLY A 976  ? GLU A 989  ? GLY A 1390 GLU A 1403 1 ? 14 
HELX_P HELX_P50 50 SER A 994  ? LYS A 1003 ? SER A 1408 LYS A 1417 1 ? 10 
HELX_P HELX_P51 51 SER A 1005 ? ARG A 1015 ? SER A 1419 ARG A 1429 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 120 NE2 ? ? ? 1_555 J MG  .  MG  ? ? A HIS 346 A MG  7    1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc2  metalc ? ? A HIS 122 NE2 ? ? ? 1_555 J MG  .  MG  ? ? A HIS 348 A MG  7    1_555 ? ? ? ? ? ? ?            2.475 ? 
metalc3  metalc ? ? A GLU 179 OE1 ? ? ? 1_555 I MG  .  MG  ? ? A GLU 405 A MG  6    1_555 ? ? ? ? ? ? ?            2.183 ? 
metalc4  metalc ? ? A GLU 179 OE1 ? ? ? 1_555 J MG  .  MG  ? ? A GLU 405 A MG  7    1_555 ? ? ? ? ? ? ?            2.475 ? 
metalc5  metalc ? ? A ASN 329 OD1 ? ? ? 1_555 J MG  .  MG  ? ? A ASN 743 A MG  7    1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc6  metalc ? ? A CYS 505 SG  ? ? ? 1_555 G ZN  .  ZN  ? ? A CYS 919 A ZN  4    1_555 ? ? ? ? ? ? ?            2.623 ? 
metalc7  metalc ? ? A CYS 508 SG  ? ? ? 1_555 G ZN  .  ZN  ? ? A CYS 922 A ZN  4    1_555 ? ? ? ? ? ? ?            2.256 ? 
metalc8  metalc ? ? A CYS 530 SG  ? ? ? 1_555 G ZN  .  ZN  ? ? A CYS 944 A ZN  4    1_555 ? ? ? ? ? ? ?            2.151 ? 
metalc9  metalc ? ? A CYS 533 SG  ? ? ? 1_555 G ZN  .  ZN  ? ? A CYS 947 A ZN  4    1_555 ? ? ? ? ? ? ?            2.532 ? 
metalc10 metalc ? ? A ASP 559 OD2 ? ? ? 1_555 H MG  .  MG  ? ? A ASP 973 A MG  5    1_555 ? ? ? ? ? ? ?            2.192 ? 
metalc11 metalc ? ? A ASP 561 OD2 ? ? ? 1_555 H MG  .  MG  ? ? A ASP 975 A MG  5    1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc12 metalc ? ? H MG  .   MG  ? ? ? 1_555 K DGT .  O2A ? ? A MG  5   A DGT 1456 1_555 ? ? ? ? ? ? ?            1.860 ? 
metalc13 metalc ? ? H MG  .   MG  ? ? ? 1_555 K DGT .  O2G ? ? A MG  5   A DGT 1456 1_555 ? ? ? ? ? ? ?            2.176 ? 
metalc14 metalc ? ? H MG  .   MG  ? ? ? 1_555 L HOH .  O   ? ? A MG  5   A HOH 1457 1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc15 metalc ? ? H MG  .   MG  ? ? ? 1_555 K DGT .  O1B ? ? A MG  5   A DGT 1456 1_555 ? ? ? ? ? ? ?            1.966 ? 
metalc16 metalc ? ? I MG  .   MG  ? ? ? 1_555 L HOH .  O   ? ? A MG  6   A HOH 92   1_555 ? ? ? ? ? ? ?            2.297 ? 
metalc17 metalc ? ? J MG  .   MG  ? ? ? 1_555 L HOH .  O   ? ? A MG  7   A HOH 92   1_555 ? ? ? ? ? ? ?            2.487 ? 
hydrog1  hydrog ? ? B DG  5   N1  ? ? ? 1_555 C DC  18 N3  ? ? P DG  5   T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  5   N2  ? ? ? 1_555 C DC  18 O2  ? ? P DG  5   T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  5   O6  ? ? ? 1_555 C DC  18 N4  ? ? P DG  5   T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  6   N1  ? ? ? 1_555 C DT  17 N3  ? ? P DA  6   T DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  6   N6  ? ? ? 1_555 C DT  17 O4  ? ? P DA  6   T DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC  16 N3  ? ? P DG  7   T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC  16 O2  ? ? P DG  7   T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC  16 N4  ? ? P DG  7   T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N1  ? ? ? 1_555 C DT  15 N3  ? ? P DA  8   T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  8   N6  ? ? ? 1_555 C DT  15 O4  ? ? P DA  8   T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N3  ? ? ? 1_555 C DG  14 N1  ? ? P DC  9   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   N4  ? ? ? 1_555 C DG  14 O6  ? ? P DC  9   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  9   O2  ? ? ? 1_555 C DG  14 N2  ? ? P DC  9   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC  13 N3  ? ? P DG  10  T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC  13 O2  ? ? P DG  10  T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC  13 N4  ? ? P DG  10  T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  11  N1  ? ? ? 1_555 C DC  12 N3  ? ? P DG  11  T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  11  N2  ? ? ? 1_555 C DC  12 O2  ? ? P DG  11  T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  11  O6  ? ? ? 1_555 C DC  12 N4  ? ? P DG  11  T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  12  N1  ? ? ? 1_555 C DC  11 N3  ? ? P DG  12  T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  12  N2  ? ? ? 1_555 C DC  11 O2  ? ? P DG  12  T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  12  O6  ? ? ? 1_555 C DC  11 N4  ? ? P DG  12  T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  13  N3  ? ? ? 1_555 C DG  10 N1  ? ? P DC  13  T DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  13  N4  ? ? ? 1_555 C DG  10 O6  ? ? P DC  13  T DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  13  O2  ? ? ? 1_555 C DG  10 N2  ? ? P DC  13  T DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DA  14  N1  ? ? ? 1_555 C DT  9  N3  ? ? P DA  14  T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  14  N6  ? ? ? 1_555 C DT  9  O4  ? ? P DA  14  T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DA  15  N1  ? ? ? 1_555 C DT  8  N3  ? ? P DA  15  T DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DA  15  N6  ? ? ? 1_555 C DT  8  O4  ? ? P DA  15  T DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DC  16  N3  ? ? ? 1_555 C DG  7  N1  ? ? P DC  16  T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DC  16  N4  ? ? ? 1_555 C DG  7  O6  ? ? P DC  16  T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  16  O2  ? ? ? 1_555 C DG  7  N2  ? ? P DC  16  T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  17  N3  ? ? ? 1_555 C DG  6  N1  ? ? P DC  17  T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  17  N4  ? ? ? 1_555 C DG  6  O6  ? ? P DC  17  T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  17  O2  ? ? ? 1_555 C DG  6  N2  ? ? P DC  17  T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           433 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            847 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    434 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     848 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 4 ? 
D ? 2 ? 
E ? 7 ? 
F ? 3 ? 
G ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 17  ? GLU A 33  ? GLU A 243  GLU A 259  
A 2 THR A 39  ? THR A 46  ? THR A 265  THR A 272  
A 3 SER A 51  ? PHE A 57  ? SER A 277  PHE A 283  
A 4 ASP A 90  ? ILE A 101 ? ASP A 316  ILE A 327  
A 5 TRP A 75  ? ASP A 85  ? TRP A 301  ASP A 311  
A 6 GLU A 17  ? GLU A 33  ? GLU A 243  GLU A 259  
B 1 ILE A 149 ? VAL A 151 ? ILE A 375  VAL A 377  
B 2 VAL A 174 ? VAL A 183 ? VAL A 400  VAL A 409  
B 3 ILE A 238 ? PRO A 239 ? ILE A 652  PRO A 653  
C 1 ILE A 149 ? VAL A 151 ? ILE A 375  VAL A 377  
C 2 VAL A 174 ? VAL A 183 ? VAL A 400  VAL A 409  
C 3 PHE A 205 ? ALA A 211 ? PHE A 619  ALA A 625  
C 4 LEU A 250 ? GLY A 253 ? LEU A 664  GLY A 667  
D 1 LEU A 283 ? VAL A 285 ? LEU A 697  VAL A 699  
D 2 VAL A 324 ? ALA A 326 ? VAL A 738  ALA A 740  
E 1 GLY A 477 ? SER A 478 ? GLY A 891  SER A 892  
E 2 ILE A 560 ? SER A 565 ? ILE A 974  SER A 979  
E 3 LYS A 682 ? HIS A 688 ? LYS A 1096 HIS A 1102 
E 4 LYS A 630 ? VAL A 642 ? LYS A 1044 VAL A 1056 
E 5 VAL A 585 ? THR A 593 ? VAL A 999  THR A 1007 
E 6 THR A 668 ? ASP A 672 ? THR A 1082 ASP A 1086 
E 7 ILE A 655 ? GLN A 656 ? ILE A 1069 GLN A 1070 
F 1 SER A 511 ? PHE A 513 ? SER A 925  PHE A 927  
F 2 HIS A 502 ? VAL A 504 ? HIS A 916  VAL A 918  
F 3 LYS A 538 ? ASP A 540 ? LYS A 952  ASP A 954  
G 1 SER A 944 ? PHE A 945 ? SER A 1358 PHE A 1359 
G 2 SER A 964 ? ILE A 966 ? SER A 1378 ILE A 1380 
G 3 VAL A 959 ? ASP A 961 ? VAL A 1373 ASP A 1375 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 30  ? N GLU A 256  O THR A 42  ? O THR A 268  
A 2 3 N MET A 43  ? N MET A 269  O VAL A 54  ? O VAL A 280  
A 3 4 N LYS A 55  ? N LYS A 281  O ILE A 93  ? O ILE A 319  
A 4 5 O ASN A 99  ? O ASN A 325  N LYS A 77  ? N LYS A 303  
A 5 6 O VAL A 78  ? O VAL A 304  N VAL A 22  ? N VAL A 248  
B 1 2 N VAL A 151 ? N VAL A 377  O ILE A 175 ? O ILE A 401  
B 2 3 N ASN A 181 ? N ASN A 407  O ILE A 238 ? O ILE A 652  
C 1 2 N VAL A 151 ? N VAL A 377  O ILE A 175 ? O ILE A 401  
C 2 3 N LEU A 178 ? N LEU A 404  O LEU A 209 ? O LEU A 623  
C 3 4 N THR A 208 ? N THR A 622  O GLY A 253 ? O GLY A 667  
D 1 2 N LEU A 283 ? N LEU A 697  O VAL A 325 ? O VAL A 739  
E 1 2 N GLY A 477 ? N GLY A 891  O ASN A 563 ? O ASN A 977  
E 2 3 N LEU A 562 ? N LEU A 976  O ASP A 684 ? O ASP A 1098 
E 3 4 O LEU A 683 ? O LEU A 1097 N ILE A 640 ? N ILE A 1054 
E 4 5 O ARG A 631 ? O ARG A 1045 N GLY A 592 ? N GLY A 1006 
E 5 6 N ARG A 587 ? N ARG A 1001 O THR A 669 ? O THR A 1083 
E 6 7 O THR A 668 ? O THR A 1082 N GLN A 656 ? N GLN A 1070 
F 1 2 O GLU A 512 ? O GLU A 926  N TYR A 503 ? N TYR A 917  
F 2 3 N VAL A 504 ? N VAL A 918  O LYS A 538 ? O LYS A 952  
G 1 2 N SER A 944 ? N SER A 1358 O LEU A 965 ? O LEU A 1379 
G 2 3 O ILE A 966 ? O ILE A 1380 N VAL A 959 ? N VAL A 1373 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PO4 A 1'   
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PO4 A 2'   
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PO4 A 3'   
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 4'    
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 5'    
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 6'    
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 7'    
AC8 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE DGT A1456' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HOH L .   ? HOH A 83   . ? 7_554 ? 
2  AC1 4  SER A 375 ? SER A 789  . ? 7_554 ? 
3  AC1 4  LYS A 468 ? LYS A 882  . ? 1_555 ? 
4  AC1 4  ARG A 571 ? ARG A 985  . ? 1_555 ? 
5  AC2 5  LYS A 342 ? LYS A 756  . ? 1_555 ? 
6  AC2 5  HIS A 346 ? HIS A 760  . ? 1_555 ? 
7  AC2 5  ASN A 355 ? ASN A 769  . ? 1_555 ? 
8  AC2 5  TYR A 606 ? TYR A 1020 . ? 1_555 ? 
9  AC2 5  HIS A 610 ? HIS A 1024 . ? 1_555 ? 
10 AC3 2  LYS A 222 ? LYS A 636  . ? 1_555 ? 
11 AC3 2  HIS A 246 ? HIS A 660  . ? 1_555 ? 
12 AC4 4  CYS A 505 ? CYS A 919  . ? 1_555 ? 
13 AC4 4  CYS A 508 ? CYS A 922  . ? 1_555 ? 
14 AC4 4  CYS A 530 ? CYS A 944  . ? 1_555 ? 
15 AC4 4  CYS A 533 ? CYS A 947  . ? 1_555 ? 
16 AC5 4  ASP A 559 ? ASP A 973  . ? 1_555 ? 
17 AC5 4  ASP A 561 ? ASP A 975  . ? 1_555 ? 
18 AC5 4  DGT K .   ? DGT A 1456 . ? 1_555 ? 
19 AC5 4  HOH L .   ? HOH A 1457 . ? 1_555 ? 
20 AC6 5  MG  J .   ? MG  A 7    . ? 1_555 ? 
21 AC6 5  HOH L .   ? HOH A 92   . ? 1_555 ? 
22 AC6 5  GLU A 179 ? GLU A 405  . ? 1_555 ? 
23 AC6 5  HIS A 206 ? HIS A 620  . ? 1_555 ? 
24 AC6 5  CYS A 256 ? CYS A 670  . ? 1_555 ? 
25 AC7 6  MG  I .   ? MG  A 6    . ? 1_555 ? 
26 AC7 6  HOH L .   ? HOH A 92   . ? 1_555 ? 
27 AC7 6  HIS A 120 ? HIS A 346  . ? 1_555 ? 
28 AC7 6  HIS A 122 ? HIS A 348  . ? 1_555 ? 
29 AC7 6  GLU A 179 ? GLU A 405  . ? 1_555 ? 
30 AC7 6  ASN A 329 ? ASN A 743  . ? 1_555 ? 
31 AC8 24 MG  H .   ? MG  A 5    . ? 1_555 ? 
32 AC8 24 HOH L .   ? HOH A 10   . ? 1_555 ? 
33 AC8 24 HOH L .   ? HOH A 11   . ? 1_555 ? 
34 AC8 24 HOH L .   ? HOH A 12   . ? 1_555 ? 
35 AC8 24 HOH L .   ? HOH A 68   . ? 1_555 ? 
36 AC8 24 HOH L .   ? HOH A 99   . ? 1_555 ? 
37 AC8 24 ARG A 479 ? ARG A 893  . ? 1_555 ? 
38 AC8 24 GLY A 480 ? GLY A 894  . ? 1_555 ? 
39 AC8 24 SER A 481 ? SER A 895  . ? 1_555 ? 
40 AC8 24 LYS A 556 ? LYS A 970  . ? 1_555 ? 
41 AC8 24 PRO A 558 ? PRO A 972  . ? 1_555 ? 
42 AC8 24 ASP A 559 ? ASP A 973  . ? 1_555 ? 
43 AC8 24 ASP A 561 ? ASP A 975  . ? 1_555 ? 
44 AC8 24 HIS A 772 ? HIS A 1186 . ? 1_555 ? 
45 AC8 24 ARG A 799 ? ARG A 1213 . ? 1_555 ? 
46 AC8 24 ARG A 824 ? ARG A 1238 . ? 1_555 ? 
47 AC8 24 TYR A 855 ? TYR A 1269 . ? 1_555 ? 
48 AC8 24 PHE A 857 ? PHE A 1271 . ? 1_555 ? 
49 AC8 24 PRO A 858 ? PRO A 1272 . ? 1_555 ? 
50 AC8 24 HIS A 861 ? HIS A 1275 . ? 1_555 ? 
51 AC8 24 HOH L .   ? HOH A 1457 . ? 1_555 ? 
52 AC8 24 DC  B 17  ? DC  P 17   . ? 1_555 ? 
53 AC8 24 DC  C 5   ? DC  T 5    . ? 1_555 ? 
54 AC8 24 DG  C 6   ? DG  T 6    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3F2B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3F2B 
_atom_sites.fract_transf_matrix[1][1]   0.008608 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007103 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005419 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 7    ? 33.522  -23.764 -24.938 1.00 48.27  ? 233  VAL A N     1 
ATOM   2    C  CA    . VAL A 1 7    ? 33.775  -22.289 -25.077 1.00 48.11  ? 233  VAL A CA    1 
ATOM   3    C  C     . VAL A 1 7    ? 32.488  -21.475 -25.332 1.00 47.86  ? 233  VAL A C     1 
ATOM   4    O  O     . VAL A 1 7    ? 31.918  -21.496 -26.426 1.00 47.84  ? 233  VAL A O     1 
ATOM   5    C  CB    . VAL A 1 7    ? 34.836  -21.996 -26.161 1.00 48.20  ? 233  VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 7    ? 34.515  -22.775 -27.462 1.00 48.81  ? 233  VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 7    ? 34.968  -20.485 -26.395 1.00 47.90  ? 233  VAL A CG2   1 
ATOM   8    N  N     . ARG A 1 8    ? 32.060  -20.745 -24.302 1.00 47.44  ? 234  ARG A N     1 
ATOM   9    C  CA    . ARG A 1 8    ? 30.767  -20.084 -24.275 1.00 46.68  ? 234  ARG A CA    1 
ATOM   10   C  C     . ARG A 1 8    ? 30.840  -18.637 -24.750 1.00 46.97  ? 234  ARG A C     1 
ATOM   11   O  O     . ARG A 1 8    ? 31.739  -17.867 -24.355 1.00 46.95  ? 234  ARG A O     1 
ATOM   12   C  CB    . ARG A 1 8    ? 30.204  -20.121 -22.848 1.00 46.48  ? 234  ARG A CB    1 
ATOM   13   C  CG    . ARG A 1 8    ? 29.846  -21.521 -22.319 1.00 45.02  ? 234  ARG A CG    1 
ATOM   14   C  CD    . ARG A 1 8    ? 28.373  -21.896 -22.587 1.00 43.34  ? 234  ARG A CD    1 
ATOM   15   N  NE    . ARG A 1 8    ? 27.456  -21.022 -21.858 1.00 40.37  ? 234  ARG A NE    1 
ATOM   16   C  CZ    . ARG A 1 8    ? 27.217  -21.102 -20.551 1.00 39.72  ? 234  ARG A CZ    1 
ATOM   17   N  NH1   . ARG A 1 8    ? 27.809  -22.045 -19.812 1.00 37.94  ? 234  ARG A NH1   1 
ATOM   18   N  NH2   . ARG A 1 8    ? 26.376  -20.240 -19.988 1.00 38.32  ? 234  ARG A NH2   1 
ATOM   19   N  N     . ARG A 1 9    ? 29.885  -18.266 -25.594 1.00 46.70  ? 235  ARG A N     1 
ATOM   20   C  CA    . ARG A 1 9    ? 29.738  -16.888 -26.017 1.00 46.50  ? 235  ARG A CA    1 
ATOM   21   C  C     . ARG A 1 9    ? 29.168  -16.121 -24.834 1.00 46.27  ? 235  ARG A C     1 
ATOM   22   O  O     . ARG A 1 9    ? 28.293  -16.627 -24.140 1.00 46.25  ? 235  ARG A O     1 
ATOM   23   C  CB    . ARG A 1 9    ? 28.795  -16.798 -27.221 1.00 46.82  ? 235  ARG A CB    1 
ATOM   24   C  CG    . ARG A 1 9    ? 29.271  -17.563 -28.451 1.00 47.52  ? 235  ARG A CG    1 
ATOM   25   C  CD    . ARG A 1 9    ? 28.430  -17.216 -29.682 1.00 49.24  ? 235  ARG A CD    1 
ATOM   26   N  NE    . ARG A 1 9    ? 27.014  -17.495 -29.459 1.00 49.67  ? 235  ARG A NE    1 
ATOM   27   C  CZ    . ARG A 1 9    ? 26.534  -18.710 -29.207 1.00 50.29  ? 235  ARG A CZ    1 
ATOM   28   N  NH1   . ARG A 1 9    ? 27.360  -19.749 -29.145 1.00 50.96  ? 235  ARG A NH1   1 
ATOM   29   N  NH2   . ARG A 1 9    ? 25.232  -18.892 -29.015 1.00 49.51  ? 235  ARG A NH2   1 
ATOM   30   N  N     . LEU A 1 10   ? 29.669  -14.909 -24.607 1.00 46.25  ? 236  LEU A N     1 
ATOM   31   C  CA    . LEU A 1 10   ? 29.263  -14.063 -23.474 1.00 46.15  ? 236  LEU A CA    1 
ATOM   32   C  C     . LEU A 1 10   ? 27.756  -13.728 -23.401 1.00 46.62  ? 236  LEU A C     1 
ATOM   33   O  O     . LEU A 1 10   ? 27.223  -13.480 -22.315 1.00 46.41  ? 236  LEU A O     1 
ATOM   34   C  CB    . LEU A 1 10   ? 30.105  -12.780 -23.456 1.00 45.62  ? 236  LEU A CB    1 
ATOM   35   C  CG    . LEU A 1 10   ? 31.166  -12.496 -22.376 1.00 45.48  ? 236  LEU A CG    1 
ATOM   36   C  CD1   . LEU A 1 10   ? 31.778  -13.762 -21.695 1.00 43.52  ? 236  LEU A CD1   1 
ATOM   37   C  CD2   . LEU A 1 10   ? 32.262  -11.530 -22.914 1.00 43.37  ? 236  LEU A CD2   1 
ATOM   38   N  N     . GLU A 1 11   ? 27.065  -13.734 -24.540 1.00 47.12  ? 237  GLU A N     1 
ATOM   39   C  CA    . GLU A 1 11   ? 25.615  -13.528 -24.526 1.00 47.88  ? 237  GLU A CA    1 
ATOM   40   C  C     . GLU A 1 11   ? 24.881  -14.707 -23.898 1.00 47.96  ? 237  GLU A C     1 
ATOM   41   O  O     . GLU A 1 11   ? 23.723  -14.576 -23.521 1.00 47.68  ? 237  GLU A O     1 
ATOM   42   C  CB    . GLU A 1 11   ? 25.064  -13.245 -25.933 1.00 47.90  ? 237  GLU A CB    1 
ATOM   43   C  CG    . GLU A 1 11   ? 25.854  -13.934 -27.040 1.00 49.15  ? 237  GLU A CG    1 
ATOM   44   C  CD    . GLU A 1 11   ? 25.021  -14.311 -28.262 1.00 50.80  ? 237  GLU A CD    1 
ATOM   45   O  OE1   . GLU A 1 11   ? 24.024  -13.609 -28.562 1.00 51.27  ? 237  GLU A OE1   1 
ATOM   46   O  OE2   . GLU A 1 11   ? 25.386  -15.309 -28.934 1.00 51.02  ? 237  GLU A OE2   1 
ATOM   47   N  N     . THR A 1 12   ? 25.544  -15.854 -23.789 1.00 48.61  ? 238  THR A N     1 
ATOM   48   C  CA    . THR A 1 12   ? 24.905  -17.031 -23.183 1.00 49.52  ? 238  THR A CA    1 
ATOM   49   C  C     . THR A 1 12   ? 25.138  -17.127 -21.675 1.00 50.00  ? 238  THR A C     1 
ATOM   50   O  O     . THR A 1 12   ? 24.684  -18.072 -21.040 1.00 50.16  ? 238  THR A O     1 
ATOM   51   C  CB    . THR A 1 12   ? 25.375  -18.376 -23.819 1.00 49.60  ? 238  THR A CB    1 
ATOM   52   O  OG1   . THR A 1 12   ? 26.734  -18.648 -23.440 1.00 49.56  ? 238  THR A OG1   1 
ATOM   53   C  CG2   . THR A 1 12   ? 25.251  -18.348 -25.341 1.00 49.35  ? 238  THR A CG2   1 
ATOM   54   N  N     . ILE A 1 13   ? 25.860  -16.172 -21.097 1.00 50.51  ? 239  ILE A N     1 
ATOM   55   C  CA    . ILE A 1 13   ? 26.145  -16.249 -19.662 1.00 50.94  ? 239  ILE A CA    1 
ATOM   56   C  C     . ILE A 1 13   ? 25.076  -15.511 -18.892 1.00 51.11  ? 239  ILE A C     1 
ATOM   57   O  O     . ILE A 1 13   ? 25.114  -14.290 -18.819 1.00 51.08  ? 239  ILE A O     1 
ATOM   58   C  CB    . ILE A 1 13   ? 27.462  -15.563 -19.297 1.00 50.99  ? 239  ILE A CB    1 
ATOM   59   C  CG1   . ILE A 1 13   ? 28.611  -16.030 -20.205 1.00 51.34  ? 239  ILE A CG1   1 
ATOM   60   C  CG2   . ILE A 1 13   ? 27.749  -15.777 -17.828 1.00 50.53  ? 239  ILE A CG2   1 
ATOM   61   C  CD1   . ILE A 1 13   ? 29.238  -17.363 -19.803 1.00 51.22  ? 239  ILE A CD1   1 
ATOM   62   N  N     . VAL A 1 14   ? 24.123  -16.227 -18.308 1.00 51.44  ? 240  VAL A N     1 
ATOM   63   C  CA    . VAL A 1 14   ? 22.985  -15.519 -17.735 1.00 51.84  ? 240  VAL A CA    1 
ATOM   64   C  C     . VAL A 1 14   ? 22.739  -15.764 -16.269 1.00 52.18  ? 240  VAL A C     1 
ATOM   65   O  O     . VAL A 1 14   ? 21.947  -15.050 -15.672 1.00 52.42  ? 240  VAL A O     1 
ATOM   66   C  CB    . VAL A 1 14   ? 21.655  -15.782 -18.490 1.00 52.02  ? 240  VAL A CB    1 
ATOM   67   C  CG1   . VAL A 1 14   ? 21.697  -15.192 -19.906 1.00 50.97  ? 240  VAL A CG1   1 
ATOM   68   C  CG2   . VAL A 1 14   ? 21.326  -17.284 -18.493 1.00 51.45  ? 240  VAL A CG2   1 
ATOM   69   N  N     . GLU A 1 15   ? 23.370  -16.774 -15.686 1.00 52.58  ? 241  GLU A N     1 
ATOM   70   C  CA    . GLU A 1 15   ? 23.278  -16.934 -14.225 1.00 53.36  ? 241  GLU A CA    1 
ATOM   71   C  C     . GLU A 1 15   ? 24.489  -17.578 -13.596 1.00 53.45  ? 241  GLU A C     1 
ATOM   72   O  O     . GLU A 1 15   ? 25.368  -18.076 -14.291 1.00 53.32  ? 241  GLU A O     1 
ATOM   73   C  CB    . GLU A 1 15   ? 21.987  -17.638 -13.738 1.00 53.20  ? 241  GLU A CB    1 
ATOM   74   C  CG    . GLU A 1 15   ? 21.133  -18.331 -14.796 1.00 54.58  ? 241  GLU A CG    1 
ATOM   75   C  CD    . GLU A 1 15   ? 21.419  -19.814 -14.931 1.00 55.63  ? 241  GLU A CD    1 
ATOM   76   O  OE1   . GLU A 1 15   ? 22.585  -20.182 -15.216 1.00 56.86  ? 241  GLU A OE1   1 
ATOM   77   O  OE2   . GLU A 1 15   ? 20.470  -20.607 -14.763 1.00 53.24  ? 241  GLU A OE2   1 
ATOM   78   N  N     . GLU A 1 16   ? 24.509  -17.558 -12.265 1.00 53.83  ? 242  GLU A N     1 
ATOM   79   C  CA    . GLU A 1 16   ? 25.584  -18.145 -11.504 1.00 54.27  ? 242  GLU A CA    1 
ATOM   80   C  C     . GLU A 1 16   ? 25.821  -19.541 -12.056 1.00 54.50  ? 242  GLU A C     1 
ATOM   81   O  O     . GLU A 1 16   ? 24.900  -20.171 -12.562 1.00 54.59  ? 242  GLU A O     1 
ATOM   82   C  CB    . GLU A 1 16   ? 25.235  -18.178 -10.015 1.00 54.52  ? 242  GLU A CB    1 
ATOM   83   C  CG    . GLU A 1 16   ? 25.234  -16.811 -9.330  1.00 55.27  ? 242  GLU A CG    1 
ATOM   84   C  CD    . GLU A 1 16   ? 25.380  -16.919 -7.813  1.00 57.28  ? 242  GLU A CD    1 
ATOM   85   O  OE1   . GLU A 1 16   ? 24.624  -17.696 -7.182  1.00 55.97  ? 242  GLU A OE1   1 
ATOM   86   O  OE2   . GLU A 1 16   ? 26.257  -16.220 -7.253  1.00 58.29  ? 242  GLU A OE2   1 
ATOM   87   N  N     . GLU A 1 17   ? 27.057  -20.016 -11.978 1.00 54.81  ? 243  GLU A N     1 
ATOM   88   C  CA    . GLU A 1 17   ? 27.420  -21.265 -12.630 1.00 54.95  ? 243  GLU A CA    1 
ATOM   89   C  C     . GLU A 1 17   ? 28.826  -21.714 -12.222 1.00 55.22  ? 243  GLU A C     1 
ATOM   90   O  O     . GLU A 1 17   ? 29.790  -20.944 -12.292 1.00 55.17  ? 243  GLU A O     1 
ATOM   91   C  CB    . GLU A 1 17   ? 27.314  -21.107 -14.152 1.00 54.86  ? 243  GLU A CB    1 
ATOM   92   C  CG    . GLU A 1 17   ? 27.374  -22.415 -14.927 1.00 54.29  ? 243  GLU A CG    1 
ATOM   93   C  CD    . GLU A 1 17   ? 27.404  -22.207 -16.439 1.00 53.58  ? 243  GLU A CD    1 
ATOM   94   O  OE1   . GLU A 1 17   ? 27.803  -23.158 -17.147 1.00 54.58  ? 243  GLU A OE1   1 
ATOM   95   O  OE2   . GLU A 1 17   ? 27.043  -21.106 -16.920 1.00 49.68  ? 243  GLU A OE2   1 
ATOM   96   N  N     . ARG A 1 18   ? 28.910  -22.968 -11.784 1.00 55.59  ? 244  ARG A N     1 
ATOM   97   C  CA    . ARG A 1 18   ? 30.145  -23.607 -11.326 1.00 55.75  ? 244  ARG A CA    1 
ATOM   98   C  C     . ARG A 1 18   ? 31.354  -23.301 -12.226 1.00 55.46  ? 244  ARG A C     1 
ATOM   99   O  O     . ARG A 1 18   ? 32.418  -22.909 -11.735 1.00 55.01  ? 244  ARG A O     1 
ATOM   100  C  CB    . ARG A 1 18   ? 29.912  -25.125 -11.230 1.00 55.91  ? 244  ARG A CB    1 
ATOM   101  C  CG    . ARG A 1 18   ? 30.861  -25.923 -10.325 1.00 57.90  ? 244  ARG A CG    1 
ATOM   102  C  CD    . ARG A 1 18   ? 30.154  -27.148 -9.665  1.00 61.16  ? 244  ARG A CD    1 
ATOM   103  N  NE    . ARG A 1 18   ? 29.714  -28.211 -10.587 1.00 63.18  ? 244  ARG A NE    1 
ATOM   104  C  CZ    . ARG A 1 18   ? 28.566  -28.217 -11.281 1.00 64.42  ? 244  ARG A CZ    1 
ATOM   105  N  NH1   . ARG A 1 18   ? 27.704  -27.204 -11.201 1.00 64.53  ? 244  ARG A NH1   1 
ATOM   106  N  NH2   . ARG A 1 18   ? 28.269  -29.250 -12.067 1.00 63.92  ? 244  ARG A NH2   1 
ATOM   107  N  N     . ARG A 1 19   ? 31.186  -23.466 -13.537 1.00 55.13  ? 245  ARG A N     1 
ATOM   108  C  CA    . ARG A 1 19   ? 32.342  -23.444 -14.425 1.00 55.07  ? 245  ARG A CA    1 
ATOM   109  C  C     . ARG A 1 19   ? 32.056  -23.129 -15.904 1.00 54.66  ? 245  ARG A C     1 
ATOM   110  O  O     . ARG A 1 19   ? 31.226  -23.785 -16.541 1.00 55.09  ? 245  ARG A O     1 
ATOM   111  C  CB    . ARG A 1 19   ? 33.110  -24.766 -14.284 1.00 55.06  ? 245  ARG A CB    1 
ATOM   112  C  CG    . ARG A 1 19   ? 34.473  -24.769 -14.935 1.00 56.31  ? 245  ARG A CG    1 
ATOM   113  C  CD    . ARG A 1 19   ? 34.456  -25.541 -16.247 1.00 58.62  ? 245  ARG A CD    1 
ATOM   114  N  NE    . ARG A 1 19   ? 34.553  -26.977 -16.006 1.00 59.63  ? 245  ARG A NE    1 
ATOM   115  C  CZ    . ARG A 1 19   ? 35.700  -27.626 -15.823 1.00 60.44  ? 245  ARG A CZ    1 
ATOM   116  N  NH1   . ARG A 1 19   ? 36.852  -26.957 -15.868 1.00 59.92  ? 245  ARG A NH1   1 
ATOM   117  N  NH2   . ARG A 1 19   ? 35.694  -28.945 -15.598 1.00 60.33  ? 245  ARG A NH2   1 
ATOM   118  N  N     . VAL A 1 20   ? 32.762  -22.130 -16.434 1.00 53.95  ? 246  VAL A N     1 
ATOM   119  C  CA    . VAL A 1 20   ? 32.711  -21.789 -17.854 1.00 53.48  ? 246  VAL A CA    1 
ATOM   120  C  C     . VAL A 1 20   ? 34.092  -21.433 -18.424 1.00 53.30  ? 246  VAL A C     1 
ATOM   121  O  O     . VAL A 1 20   ? 34.964  -20.914 -17.706 1.00 52.88  ? 246  VAL A O     1 
ATOM   122  C  CB    . VAL A 1 20   ? 31.740  -20.607 -18.131 1.00 53.53  ? 246  VAL A CB    1 
ATOM   123  C  CG1   . VAL A 1 20   ? 30.364  -20.935 -17.633 1.00 53.42  ? 246  VAL A CG1   1 
ATOM   124  C  CG2   . VAL A 1 20   ? 32.231  -19.327 -17.475 1.00 53.04  ? 246  VAL A CG2   1 
ATOM   125  N  N     . VAL A 1 21   ? 34.286  -21.728 -19.713 1.00 53.04  ? 247  VAL A N     1 
ATOM   126  C  CA    . VAL A 1 21   ? 35.410  -21.160 -20.473 1.00 52.82  ? 247  VAL A CA    1 
ATOM   127  C  C     . VAL A 1 21   ? 34.930  -20.137 -21.501 1.00 52.64  ? 247  VAL A C     1 
ATOM   128  O  O     . VAL A 1 21   ? 33.925  -20.340 -22.181 1.00 52.65  ? 247  VAL A O     1 
ATOM   129  C  CB    . VAL A 1 21   ? 36.364  -22.221 -21.104 1.00 52.62  ? 247  VAL A CB    1 
ATOM   130  C  CG1   . VAL A 1 21   ? 35.675  -23.537 -21.282 1.00 52.79  ? 247  VAL A CG1   1 
ATOM   131  C  CG2   . VAL A 1 21   ? 36.962  -21.707 -22.412 1.00 51.64  ? 247  VAL A CG2   1 
ATOM   132  N  N     . VAL A 1 22   ? 35.673  -19.042 -21.600 1.00 52.61  ? 248  VAL A N     1 
ATOM   133  C  CA    . VAL A 1 22   ? 35.204  -17.842 -22.266 1.00 52.50  ? 248  VAL A CA    1 
ATOM   134  C  C     . VAL A 1 22   ? 36.367  -17.073 -22.904 1.00 52.72  ? 248  VAL A C     1 
ATOM   135  O  O     . VAL A 1 22   ? 37.521  -17.174 -22.453 1.00 52.94  ? 248  VAL A O     1 
ATOM   136  C  CB    . VAL A 1 22   ? 34.526  -16.941 -21.238 1.00 52.54  ? 248  VAL A CB    1 
ATOM   137  C  CG1   . VAL A 1 22   ? 34.662  -15.490 -21.631 1.00 53.36  ? 248  VAL A CG1   1 
ATOM   138  C  CG2   . VAL A 1 22   ? 33.090  -17.334 -21.066 1.00 51.60  ? 248  VAL A CG2   1 
ATOM   139  N  N     . GLN A 1 23   ? 36.062  -16.304 -23.946 1.00 52.14  ? 249  GLN A N     1 
ATOM   140  C  CA    . GLN A 1 23   ? 37.076  -15.578 -24.699 1.00 51.95  ? 249  GLN A CA    1 
ATOM   141  C  C     . GLN A 1 23   ? 36.687  -14.132 -24.851 1.00 51.57  ? 249  GLN A C     1 
ATOM   142  O  O     . GLN A 1 23   ? 35.504  -13.800 -24.778 1.00 52.10  ? 249  GLN A O     1 
ATOM   143  C  CB    . GLN A 1 23   ? 37.190  -16.149 -26.105 1.00 52.31  ? 249  GLN A CB    1 
ATOM   144  C  CG    . GLN A 1 23   ? 38.229  -17.227 -26.254 1.00 53.68  ? 249  GLN A CG    1 
ATOM   145  C  CD    . GLN A 1 23   ? 38.274  -17.764 -27.655 1.00 54.69  ? 249  GLN A CD    1 
ATOM   146  O  OE1   . GLN A 1 23   ? 37.377  -17.503 -28.451 1.00 55.58  ? 249  GLN A OE1   1 
ATOM   147  N  NE2   . GLN A 1 23   ? 39.320  -18.518 -27.972 1.00 55.92  ? 249  GLN A NE2   1 
ATOM   148  N  N     . GLY A 1 24   ? 37.666  -13.268 -25.104 1.00 50.64  ? 250  GLY A N     1 
ATOM   149  C  CA    . GLY A 1 24   ? 37.340  -11.884 -25.388 1.00 49.63  ? 250  GLY A CA    1 
ATOM   150  C  C     . GLY A 1 24   ? 38.439  -10.845 -25.341 1.00 48.99  ? 250  GLY A C     1 
ATOM   151  O  O     . GLY A 1 24   ? 39.526  -11.060 -24.797 1.00 48.73  ? 250  GLY A O     1 
ATOM   152  N  N     . TYR A 1 25   ? 38.106  -9.697  -25.909 1.00 48.09  ? 251  TYR A N     1 
ATOM   153  C  CA    . TYR A 1 25   ? 38.986  -8.556  -26.012 1.00 47.45  ? 251  TYR A CA    1 
ATOM   154  C  C     . TYR A 1 25   ? 38.964  -7.844  -24.675 1.00 46.95  ? 251  TYR A C     1 
ATOM   155  O  O     . TYR A 1 25   ? 37.901  -7.571  -24.117 1.00 46.56  ? 251  TYR A O     1 
ATOM   156  C  CB    . TYR A 1 25   ? 38.470  -7.645  -27.138 1.00 47.18  ? 251  TYR A CB    1 
ATOM   157  C  CG    . TYR A 1 25   ? 39.178  -6.324  -27.323 1.00 47.47  ? 251  TYR A CG    1 
ATOM   158  C  CD1   . TYR A 1 25   ? 40.273  -6.210  -28.177 1.00 47.94  ? 251  TYR A CD1   1 
ATOM   159  C  CD2   . TYR A 1 25   ? 38.723  -5.175  -26.690 1.00 48.42  ? 251  TYR A CD2   1 
ATOM   160  C  CE1   . TYR A 1 25   ? 40.921  -4.994  -28.364 1.00 47.62  ? 251  TYR A CE1   1 
ATOM   161  C  CE2   . TYR A 1 25   ? 39.358  -3.943  -26.889 1.00 48.78  ? 251  TYR A CE2   1 
ATOM   162  C  CZ    . TYR A 1 25   ? 40.457  -3.863  -27.725 1.00 47.51  ? 251  TYR A CZ    1 
ATOM   163  O  OH    . TYR A 1 25   ? 41.099  -2.661  -27.917 1.00 46.24  ? 251  TYR A OH    1 
ATOM   164  N  N     . VAL A 1 26   ? 40.139  -7.574  -24.135 1.00 46.55  ? 252  VAL A N     1 
ATOM   165  C  CA    . VAL A 1 26   ? 40.193  -6.833  -22.907 1.00 46.49  ? 252  VAL A CA    1 
ATOM   166  C  C     . VAL A 1 26   ? 40.247  -5.351  -23.198 1.00 46.73  ? 252  VAL A C     1 
ATOM   167  O  O     . VAL A 1 26   ? 41.228  -4.837  -23.779 1.00 46.59  ? 252  VAL A O     1 
ATOM   168  C  CB    . VAL A 1 26   ? 41.322  -7.319  -21.976 1.00 46.74  ? 252  VAL A CB    1 
ATOM   169  C  CG1   . VAL A 1 26   ? 42.191  -8.309  -22.694 1.00 46.12  ? 252  VAL A CG1   1 
ATOM   170  C  CG2   . VAL A 1 26   ? 42.123  -6.153  -21.432 1.00 45.56  ? 252  VAL A CG2   1 
ATOM   171  N  N     . PHE A 1 27   ? 39.151  -4.680  -22.839 1.00 46.52  ? 253  PHE A N     1 
ATOM   172  C  CA    . PHE A 1 27   ? 39.020  -3.248  -23.074 1.00 46.89  ? 253  PHE A CA    1 
ATOM   173  C  C     . PHE A 1 27   ? 39.196  -2.469  -21.788 1.00 47.03  ? 253  PHE A C     1 
ATOM   174  O  O     . PHE A 1 27   ? 39.046  -1.252  -21.767 1.00 47.05  ? 253  PHE A O     1 
ATOM   175  C  CB    . PHE A 1 27   ? 37.713  -2.879  -23.797 1.00 46.40  ? 253  PHE A CB    1 
ATOM   176  C  CG    . PHE A 1 27   ? 36.471  -3.170  -23.017 1.00 46.50  ? 253  PHE A CG    1 
ATOM   177  C  CD1   . PHE A 1 27   ? 35.845  -4.417  -23.107 1.00 46.96  ? 253  PHE A CD1   1 
ATOM   178  C  CD2   . PHE A 1 27   ? 35.903  -2.195  -22.217 1.00 45.82  ? 253  PHE A CD2   1 
ATOM   179  C  CE1   . PHE A 1 27   ? 34.675  -4.686  -22.404 1.00 46.59  ? 253  PHE A CE1   1 
ATOM   180  C  CE2   . PHE A 1 27   ? 34.741  -2.461  -21.499 1.00 45.67  ? 253  PHE A CE2   1 
ATOM   181  C  CZ    . PHE A 1 27   ? 34.121  -3.706  -21.592 1.00 45.85  ? 253  PHE A CZ    1 
ATOM   182  N  N     . ASP A 1 28   ? 39.536  -3.178  -20.718 1.00 47.24  ? 254  ASP A N     1 
ATOM   183  C  CA    . ASP A 1 28   ? 39.964  -2.514  -19.505 1.00 47.80  ? 254  ASP A CA    1 
ATOM   184  C  C     . ASP A 1 28   ? 40.603  -3.483  -18.529 1.00 47.90  ? 254  ASP A C     1 
ATOM   185  O  O     . ASP A 1 28   ? 40.124  -4.593  -18.362 1.00 47.97  ? 254  ASP A O     1 
ATOM   186  C  CB    . ASP A 1 28   ? 38.799  -1.804  -18.835 1.00 48.03  ? 254  ASP A CB    1 
ATOM   187  C  CG    . ASP A 1 28   ? 39.250  -0.930  -17.708 1.00 48.89  ? 254  ASP A CG    1 
ATOM   188  O  OD1   . ASP A 1 28   ? 40.108  -0.064  -17.963 1.00 51.80  ? 254  ASP A OD1   1 
ATOM   189  O  OD2   . ASP A 1 28   ? 38.792  -1.133  -16.566 1.00 49.53  ? 254  ASP A OD2   1 
ATOM   190  N  N     . ALA A 1 29   ? 41.679  -3.051  -17.877 1.00 48.53  ? 255  ALA A N     1 
ATOM   191  C  CA    . ALA A 1 29   ? 42.370  -3.894  -16.908 1.00 49.13  ? 255  ALA A CA    1 
ATOM   192  C  C     . ALA A 1 29   ? 43.067  -3.070  -15.846 1.00 49.53  ? 255  ALA A C     1 
ATOM   193  O  O     . ALA A 1 29   ? 43.874  -2.192  -16.153 1.00 49.53  ? 255  ALA A O     1 
ATOM   194  C  CB    . ALA A 1 29   ? 43.381  -4.798  -17.609 1.00 49.58  ? 255  ALA A CB    1 
ATOM   195  N  N     . GLU A 1 30   ? 42.758  -3.360  -14.590 1.00 49.80  ? 256  GLU A N     1 
ATOM   196  C  CA    . GLU A 1 30   ? 43.427  -2.699  -13.481 1.00 50.24  ? 256  GLU A CA    1 
ATOM   197  C  C     . GLU A 1 30   ? 43.838  -3.743  -12.471 1.00 49.80  ? 256  GLU A C     1 
ATOM   198  O  O     . GLU A 1 30   ? 43.179  -4.762  -12.310 1.00 50.11  ? 256  GLU A O     1 
ATOM   199  C  CB    . GLU A 1 30   ? 42.536  -1.635  -12.819 1.00 50.44  ? 256  GLU A CB    1 
ATOM   200  C  CG    . GLU A 1 30   ? 42.083  -0.490  -13.759 1.00 53.17  ? 256  GLU A CG    1 
ATOM   201  C  CD    . GLU A 1 30   ? 43.241  0.316   -14.404 1.00 56.11  ? 256  GLU A CD    1 
ATOM   202  O  OE1   . GLU A 1 30   ? 44.262  0.597   -13.723 1.00 57.19  ? 256  GLU A OE1   1 
ATOM   203  O  OE2   . GLU A 1 30   ? 43.115  0.688   -15.599 1.00 57.09  ? 256  GLU A OE2   1 
ATOM   204  N  N     . VAL A 1 31   ? 44.943  -3.472  -11.805 1.00 49.65  ? 257  VAL A N     1 
ATOM   205  C  CA    . VAL A 1 31   ? 45.517  -4.337  -10.801 1.00 49.69  ? 257  VAL A CA    1 
ATOM   206  C  C     . VAL A 1 31   ? 45.600  -3.593  -9.468  1.00 49.45  ? 257  VAL A C     1 
ATOM   207  O  O     . VAL A 1 31   ? 45.903  -2.402  -9.447  1.00 49.70  ? 257  VAL A O     1 
ATOM   208  C  CB    . VAL A 1 31   ? 46.920  -4.741  -11.264 1.00 49.59  ? 257  VAL A CB    1 
ATOM   209  C  CG1   . VAL A 1 31   ? 47.882  -4.819  -10.104 1.00 50.14  ? 257  VAL A CG1   1 
ATOM   210  C  CG2   . VAL A 1 31   ? 46.840  -6.062  -12.004 1.00 49.90  ? 257  VAL A CG2   1 
ATOM   211  N  N     . SER A 1 32   ? 45.328  -4.283  -8.362  1.00 49.44  ? 258  SER A N     1 
ATOM   212  C  CA    . SER A 1 32   ? 45.372  -3.663  -7.025  1.00 49.15  ? 258  SER A CA    1 
ATOM   213  C  C     . SER A 1 32   ? 45.911  -4.629  -5.970  1.00 49.34  ? 258  SER A C     1 
ATOM   214  O  O     . SER A 1 32   ? 45.992  -5.833  -6.215  1.00 49.46  ? 258  SER A O     1 
ATOM   215  C  CB    . SER A 1 32   ? 43.984  -3.153  -6.607  1.00 48.92  ? 258  SER A CB    1 
ATOM   216  O  OG    . SER A 1 32   ? 43.028  -4.200  -6.655  1.00 48.60  ? 258  SER A OG    1 
ATOM   217  N  N     . GLU A 1 33   ? 46.266  -4.102  -4.799  1.00 49.40  ? 259  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 33   ? 46.900  -4.906  -3.752  1.00 49.61  ? 259  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 33   ? 46.017  -5.084  -2.525  1.00 49.11  ? 259  GLU A C     1 
ATOM   220  O  O     . GLU A 1 33   ? 45.630  -4.104  -1.906  1.00 49.34  ? 259  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 33   ? 48.226  -4.271  -3.321  1.00 49.77  ? 259  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 33   ? 49.394  -4.542  -4.261  1.00 51.62  ? 259  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 33   ? 50.736  -4.623  -3.524  1.00 54.70  ? 259  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 33   ? 50.858  -4.067  -2.404  1.00 54.69  ? 259  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 33   ? 51.673  -5.257  -4.062  1.00 56.10  ? 259  GLU A OE2   1 
ATOM   226  N  N     . LEU A 1 34   ? 45.730  -6.332  -2.160  1.00 48.58  ? 260  LEU A N     1 
ATOM   227  C  CA    . LEU A 1 34   ? 44.897  -6.642  -0.985  1.00 48.40  ? 260  LEU A CA    1 
ATOM   228  C  C     . LEU A 1 34   ? 45.685  -6.666  0.341   1.00 48.53  ? 260  LEU A C     1 
ATOM   229  O  O     . LEU A 1 34   ? 46.891  -6.948  0.373   1.00 48.19  ? 260  LEU A O     1 
ATOM   230  C  CB    . LEU A 1 34   ? 44.207  -7.992  -1.184  1.00 48.21  ? 260  LEU A CB    1 
ATOM   231  C  CG    . LEU A 1 34   ? 42.985  -8.137  -2.097  1.00 48.69  ? 260  LEU A CG    1 
ATOM   232  C  CD1   . LEU A 1 34   ? 42.930  -7.046  -3.139  1.00 47.99  ? 260  LEU A CD1   1 
ATOM   233  C  CD2   . LEU A 1 34   ? 42.985  -9.515  -2.763  1.00 47.23  ? 260  LEU A CD2   1 
ATOM   234  N  N     . LYS A 1 35   ? 45.008  -6.394  1.447   1.00 48.81  ? 261  LYS A N     1 
ATOM   235  C  CA    . LYS A 1 35   ? 45.702  -6.403  2.735   1.00 49.31  ? 261  LYS A CA    1 
ATOM   236  C  C     . LYS A 1 35   ? 46.590  -7.647  2.845   1.00 49.22  ? 261  LYS A C     1 
ATOM   237  O  O     . LYS A 1 35   ? 47.739  -7.576  3.282   1.00 49.08  ? 261  LYS A O     1 
ATOM   238  C  CB    . LYS A 1 35   ? 44.698  -6.355  3.901   1.00 49.64  ? 261  LYS A CB    1 
ATOM   239  C  CG    . LYS A 1 35   ? 45.263  -5.869  5.254   1.00 50.99  ? 261  LYS A CG    1 
ATOM   240  C  CD    . LYS A 1 35   ? 46.057  -6.940  6.026   1.00 52.56  ? 261  LYS A CD    1 
ATOM   241  C  CE    . LYS A 1 35   ? 45.191  -8.119  6.469   1.00 53.35  ? 261  LYS A CE    1 
ATOM   242  N  NZ    . LYS A 1 35   ? 44.528  -7.855  7.779   1.00 52.94  ? 261  LYS A NZ    1 
ATOM   243  N  N     . SER A 1 36   ? 46.054  -8.786  2.422   1.00 49.06  ? 262  SER A N     1 
ATOM   244  C  CA    . SER A 1 36   ? 46.702  -10.065 2.660   1.00 48.93  ? 262  SER A CA    1 
ATOM   245  C  C     . SER A 1 36   ? 48.076  -10.178 1.999   1.00 48.99  ? 262  SER A C     1 
ATOM   246  O  O     . SER A 1 36   ? 48.859  -11.065 2.332   1.00 49.05  ? 262  SER A O     1 
ATOM   247  C  CB    . SER A 1 36   ? 45.803  -11.186 2.151   1.00 48.97  ? 262  SER A CB    1 
ATOM   248  O  OG    . SER A 1 36   ? 45.574  -11.035 0.753   1.00 49.38  ? 262  SER A OG    1 
ATOM   249  N  N     . GLY A 1 37   ? 48.361  -9.290  1.050   1.00 48.95  ? 263  GLY A N     1 
ATOM   250  C  CA    . GLY A 1 37   ? 49.579  -9.384  0.247   1.00 48.31  ? 263  GLY A CA    1 
ATOM   251  C  C     . GLY A 1 37   ? 49.191  -9.669  -1.188  1.00 47.96  ? 263  GLY A C     1 
ATOM   252  O  O     . GLY A 1 37   ? 49.707  -9.065  -2.125  1.00 48.65  ? 263  GLY A O     1 
ATOM   253  N  N     . ARG A 1 38   ? 48.256  -10.597 -1.343  1.00 47.10  ? 264  ARG A N     1 
ATOM   254  C  CA    . ARG A 1 38   ? 47.688  -10.988 -2.631  1.00 46.18  ? 264  ARG A CA    1 
ATOM   255  C  C     . ARG A 1 38   ? 47.399  -9.798  -3.571  1.00 45.33  ? 264  ARG A C     1 
ATOM   256  O  O     . ARG A 1 38   ? 47.053  -8.709  -3.124  1.00 45.23  ? 264  ARG A O     1 
ATOM   257  C  CB    . ARG A 1 38   ? 46.377  -11.735 -2.366  1.00 46.32  ? 264  ARG A CB    1 
ATOM   258  C  CG    . ARG A 1 38   ? 46.214  -12.999 -3.143  1.00 46.80  ? 264  ARG A CG    1 
ATOM   259  C  CD    . ARG A 1 38   ? 46.149  -14.229 -2.240  1.00 48.21  ? 264  ARG A CD    1 
ATOM   260  N  NE    . ARG A 1 38   ? 44.763  -14.658 -2.057  1.00 50.05  ? 264  ARG A NE    1 
ATOM   261  C  CZ    . ARG A 1 38   ? 44.050  -15.369 -2.938  1.00 49.64  ? 264  ARG A CZ    1 
ATOM   262  N  NH1   . ARG A 1 38   ? 44.572  -15.782 -4.078  1.00 47.96  ? 264  ARG A NH1   1 
ATOM   263  N  NH2   . ARG A 1 38   ? 42.800  -15.684 -2.664  1.00 49.48  ? 264  ARG A NH2   1 
ATOM   264  N  N     . THR A 1 39   ? 47.523  -10.028 -4.875  1.00 44.31  ? 265  THR A N     1 
ATOM   265  C  CA    . THR A 1 39   ? 47.132  -9.056  -5.890  1.00 43.02  ? 265  THR A CA    1 
ATOM   266  C  C     . THR A 1 39   ? 45.832  -9.470  -6.590  1.00 42.42  ? 265  THR A C     1 
ATOM   267  O  O     . THR A 1 39   ? 45.616  -10.635 -6.894  1.00 41.68  ? 265  THR A O     1 
ATOM   268  C  CB    . THR A 1 39   ? 48.216  -8.936  -6.962  1.00 43.24  ? 265  THR A CB    1 
ATOM   269  O  OG1   . THR A 1 39   ? 49.359  -8.282  -6.405  1.00 44.20  ? 265  THR A OG1   1 
ATOM   270  C  CG2   . THR A 1 39   ? 47.720  -8.151  -8.183  1.00 42.59  ? 265  THR A CG2   1 
ATOM   271  N  N     . LEU A 1 40   ? 44.979  -8.495  -6.860  1.00 41.62  ? 266  LEU A N     1 
ATOM   272  C  CA    . LEU A 1 40   ? 43.741  -8.732  -7.565  1.00 41.24  ? 266  LEU A CA    1 
ATOM   273  C  C     . LEU A 1 40   ? 43.830  -8.073  -8.938  1.00 41.54  ? 266  LEU A C     1 
ATOM   274  O  O     . LEU A 1 40   ? 44.288  -6.922  -9.053  1.00 41.99  ? 266  LEU A O     1 
ATOM   275  C  CB    . LEU A 1 40   ? 42.567  -8.135  -6.773  1.00 40.76  ? 266  LEU A CB    1 
ATOM   276  C  CG    . LEU A 1 40   ? 41.298  -7.788  -7.551  1.00 39.87  ? 266  LEU A CG    1 
ATOM   277  C  CD1   . LEU A 1 40   ? 40.596  -9.040  -8.080  1.00 38.07  ? 266  LEU A CD1   1 
ATOM   278  C  CD2   . LEU A 1 40   ? 40.357  -6.970  -6.678  1.00 40.30  ? 266  LEU A CD2   1 
ATOM   279  N  N     . LEU A 1 41   ? 43.421  -8.810  -9.971  1.00 41.62  ? 267  LEU A N     1 
ATOM   280  C  CA    . LEU A 1 41   ? 43.317  -8.291  -11.345 1.00 41.65  ? 267  LEU A CA    1 
ATOM   281  C  C     . LEU A 1 41   ? 41.840  -8.135  -11.665 1.00 42.01  ? 267  LEU A C     1 
ATOM   282  O  O     . LEU A 1 41   ? 41.047  -9.068  -11.455 1.00 41.69  ? 267  LEU A O     1 
ATOM   283  C  CB    . LEU A 1 41   ? 43.951  -9.251  -12.355 1.00 41.17  ? 267  LEU A CB    1 
ATOM   284  C  CG    . LEU A 1 41   ? 43.576  -8.990  -13.822 1.00 41.88  ? 267  LEU A CG    1 
ATOM   285  C  CD1   . LEU A 1 41   ? 44.318  -7.757  -14.383 1.00 40.77  ? 267  LEU A CD1   1 
ATOM   286  C  CD2   . LEU A 1 41   ? 43.794  -10.222 -14.714 1.00 40.59  ? 267  LEU A CD2   1 
ATOM   287  N  N     . THR A 1 42   ? 41.474  -6.950  -12.155 1.00 42.78  ? 268  THR A N     1 
ATOM   288  C  CA    . THR A 1 42   ? 40.082  -6.631  -12.526 1.00 43.36  ? 268  THR A CA    1 
ATOM   289  C  C     . THR A 1 42   ? 40.026  -6.218  -14.000 1.00 44.32  ? 268  THR A C     1 
ATOM   290  O  O     . THR A 1 42   ? 40.542  -5.155  -14.358 1.00 45.09  ? 268  THR A O     1 
ATOM   291  C  CB    . THR A 1 42   ? 39.545  -5.500  -11.639 1.00 43.08  ? 268  THR A CB    1 
ATOM   292  O  OG1   . THR A 1 42   ? 39.826  -5.811  -10.264 1.00 42.01  ? 268  THR A OG1   1 
ATOM   293  C  CG2   . THR A 1 42   ? 38.039  -5.283  -11.831 1.00 42.24  ? 268  THR A CG2   1 
ATOM   294  N  N     . MET A 1 43   ? 39.441  -7.069  -14.848 1.00 44.64  ? 269  MET A N     1 
ATOM   295  C  CA    . MET A 1 43   ? 39.361  -6.827  -16.303 1.00 45.30  ? 269  MET A CA    1 
ATOM   296  C  C     . MET A 1 43   ? 37.912  -6.744  -16.709 1.00 45.52  ? 269  MET A C     1 
ATOM   297  O  O     . MET A 1 43   ? 37.041  -7.363  -16.071 1.00 45.75  ? 269  MET A O     1 
ATOM   298  C  CB    . MET A 1 43   ? 39.831  -8.034  -17.136 1.00 45.35  ? 269  MET A CB    1 
ATOM   299  C  CG    . MET A 1 43   ? 41.216  -8.585  -16.963 1.00 46.40  ? 269  MET A CG    1 
ATOM   300  S  SD    . MET A 1 43   ? 41.505  -9.844  -18.256 1.00 47.89  ? 269  MET A SD    1 
ATOM   301  C  CE    . MET A 1 43   ? 40.504  -11.234 -17.716 1.00 47.52  ? 269  MET A CE    1 
ATOM   302  N  N     . LYS A 1 44   ? 37.675  -6.044  -17.814 1.00 44.68  ? 270  LYS A N     1 
ATOM   303  C  CA    . LYS A 1 44   ? 36.435  -6.170  -18.559 1.00 44.13  ? 270  LYS A CA    1 
ATOM   304  C  C     . LYS A 1 44   ? 36.768  -6.794  -19.914 1.00 43.63  ? 270  LYS A C     1 
ATOM   305  O  O     . LYS A 1 44   ? 37.755  -6.420  -20.543 1.00 43.10  ? 270  LYS A O     1 
ATOM   306  C  CB    . LYS A 1 44   ? 35.779  -4.807  -18.737 1.00 44.00  ? 270  LYS A CB    1 
ATOM   307  C  CG    . LYS A 1 44   ? 35.373  -4.182  -17.419 1.00 44.42  ? 270  LYS A CG    1 
ATOM   308  C  CD    . LYS A 1 44   ? 34.977  -2.707  -17.569 1.00 44.34  ? 270  LYS A CD    1 
ATOM   309  C  CE    . LYS A 1 44   ? 34.379  -2.151  -16.261 1.00 42.78  ? 270  LYS A CE    1 
ATOM   310  N  NZ    . LYS A 1 44   ? 34.369  -0.665  -16.221 1.00 41.27  ? 270  LYS A NZ    1 
ATOM   311  N  N     . ILE A 1 45   ? 35.965  -7.764  -20.346 1.00 43.19  ? 271  ILE A N     1 
ATOM   312  C  CA    . ILE A 1 45   ? 36.181  -8.401  -21.647 1.00 42.83  ? 271  ILE A CA    1 
ATOM   313  C  C     . ILE A 1 45   ? 34.907  -8.484  -22.460 1.00 42.54  ? 271  ILE A C     1 
ATOM   314  O  O     . ILE A 1 45   ? 33.828  -8.583  -21.902 1.00 43.20  ? 271  ILE A O     1 
ATOM   315  C  CB    . ILE A 1 45   ? 36.786  -9.826  -21.510 1.00 42.23  ? 271  ILE A CB    1 
ATOM   316  C  CG1   . ILE A 1 45   ? 35.807  -10.768 -20.825 1.00 41.43  ? 271  ILE A CG1   1 
ATOM   317  C  CG2   . ILE A 1 45   ? 38.084  -9.778  -20.742 1.00 42.14  ? 271  ILE A CG2   1 
ATOM   318  C  CD1   . ILE A 1 45   ? 36.301  -12.197 -20.782 1.00 38.38  ? 271  ILE A CD1   1 
ATOM   319  N  N     . THR A 1 46   ? 35.034  -8.463  -23.778 1.00 42.45  ? 272  THR A N     1 
ATOM   320  C  CA    . THR A 1 46   ? 33.876  -8.578  -24.646 1.00 42.24  ? 272  THR A CA    1 
ATOM   321  C  C     . THR A 1 46   ? 34.219  -9.509  -25.793 1.00 42.57  ? 272  THR A C     1 
ATOM   322  O  O     . THR A 1 46   ? 35.275  -9.378  -26.413 1.00 42.22  ? 272  THR A O     1 
ATOM   323  C  CB    . THR A 1 46   ? 33.480  -7.217  -25.262 1.00 42.75  ? 272  THR A CB    1 
ATOM   324  O  OG1   . THR A 1 46   ? 32.316  -7.374  -26.094 1.00 42.56  ? 272  THR A OG1   1 
ATOM   325  C  CG2   . THR A 1 46   ? 34.607  -6.675  -26.115 1.00 41.34  ? 272  THR A CG2   1 
ATOM   326  N  N     . ASP A 1 47   ? 33.344  -10.460 -26.084 1.00 42.34  ? 273  ASP A N     1 
ATOM   327  C  CA    . ASP A 1 47   ? 33.551  -11.235 -27.290 1.00 42.80  ? 273  ASP A CA    1 
ATOM   328  C  C     . ASP A 1 47   ? 32.709  -10.655 -28.424 1.00 42.96  ? 273  ASP A C     1 
ATOM   329  O  O     . ASP A 1 47   ? 32.682  -11.197 -29.527 1.00 43.00  ? 273  ASP A O     1 
ATOM   330  C  CB    . ASP A 1 47   ? 33.256  -12.721 -27.064 1.00 42.87  ? 273  ASP A CB    1 
ATOM   331  C  CG    . ASP A 1 47   ? 31.818  -12.980 -26.685 1.00 42.96  ? 273  ASP A CG    1 
ATOM   332  O  OD1   . ASP A 1 47   ? 30.975  -12.066 -26.837 1.00 43.80  ? 273  ASP A OD1   1 
ATOM   333  O  OD2   . ASP A 1 47   ? 31.535  -14.103 -26.221 1.00 42.84  ? 273  ASP A OD2   1 
ATOM   334  N  N     . TYR A 1 48   ? 32.038  -9.542  -28.132 1.00 43.01  ? 274  TYR A N     1 
ATOM   335  C  CA    . TYR A 1 48   ? 31.255  -8.782  -29.117 1.00 43.26  ? 274  TYR A CA    1 
ATOM   336  C  C     . TYR A 1 48   ? 29.855  -9.354  -29.360 1.00 43.06  ? 274  TYR A C     1 
ATOM   337  O  O     . TYR A 1 48   ? 29.082  -8.834  -30.167 1.00 43.40  ? 274  TYR A O     1 
ATOM   338  C  CB    . TYR A 1 48   ? 32.050  -8.533  -30.411 1.00 43.23  ? 274  TYR A CB    1 
ATOM   339  C  CG    . TYR A 1 48   ? 33.209  -7.575  -30.190 1.00 44.54  ? 274  TYR A CG    1 
ATOM   340  C  CD1   . TYR A 1 48   ? 32.983  -6.266  -29.784 1.00 46.02  ? 274  TYR A CD1   1 
ATOM   341  C  CD2   . TYR A 1 48   ? 34.527  -7.986  -30.356 1.00 45.33  ? 274  TYR A CD2   1 
ATOM   342  C  CE1   . TYR A 1 48   ? 34.034  -5.386  -29.559 1.00 46.89  ? 274  TYR A CE1   1 
ATOM   343  C  CE2   . TYR A 1 48   ? 35.586  -7.115  -30.142 1.00 46.49  ? 274  TYR A CE2   1 
ATOM   344  C  CZ    . TYR A 1 48   ? 35.337  -5.814  -29.743 1.00 47.54  ? 274  TYR A CZ    1 
ATOM   345  O  OH    . TYR A 1 48   ? 36.386  -4.939  -29.519 1.00 48.21  ? 274  TYR A OH    1 
ATOM   346  N  N     . THR A 1 49   ? 29.532  -10.416 -28.642 1.00 42.67  ? 275  THR A N     1 
ATOM   347  C  CA    . THR A 1 49   ? 28.139  -10.807 -28.475 1.00 42.67  ? 275  THR A CA    1 
ATOM   348  C  C     . THR A 1 49   ? 27.628  -10.280 -27.137 1.00 42.32  ? 275  THR A C     1 
ATOM   349  O  O     . THR A 1 49   ? 26.434  -10.067 -26.971 1.00 42.30  ? 275  THR A O     1 
ATOM   350  C  CB    . THR A 1 49   ? 27.976  -12.314 -28.438 1.00 42.51  ? 275  THR A CB    1 
ATOM   351  O  OG1   . THR A 1 49   ? 28.637  -12.815 -27.270 1.00 42.66  ? 275  THR A OG1   1 
ATOM   352  C  CG2   . THR A 1 49   ? 28.567  -12.953 -29.693 1.00 43.03  ? 275  THR A CG2   1 
ATOM   353  N  N     . ASN A 1 50   ? 28.543  -10.119 -26.183 1.00 41.81  ? 276  ASN A N     1 
ATOM   354  C  CA    . ASN A 1 50   ? 28.295  -9.389  -24.935 1.00 42.05  ? 276  ASN A CA    1 
ATOM   355  C  C     . ASN A 1 50   ? 29.630  -9.107  -24.241 1.00 41.92  ? 276  ASN A C     1 
ATOM   356  O  O     . ASN A 1 50   ? 30.690  -9.165  -24.871 1.00 42.10  ? 276  ASN A O     1 
ATOM   357  C  CB    . ASN A 1 50   ? 27.362  -10.161 -23.992 1.00 42.10  ? 276  ASN A CB    1 
ATOM   358  C  CG    . ASN A 1 50   ? 26.604  -9.250  -23.034 1.00 42.56  ? 276  ASN A CG    1 
ATOM   359  O  OD1   . ASN A 1 50   ? 27.141  -8.808  -22.024 1.00 43.43  ? 276  ASN A OD1   1 
ATOM   360  N  ND2   . ASN A 1 50   ? 25.343  -8.978  -23.347 1.00 42.16  ? 276  ASN A ND2   1 
ATOM   361  N  N     . SER A 1 51   ? 29.579  -8.803  -22.949 1.00 41.54  ? 277  SER A N     1 
ATOM   362  C  CA    . SER A 1 51   ? 30.783  -8.439  -22.207 1.00 41.34  ? 277  SER A CA    1 
ATOM   363  C  C     . SER A 1 51   ? 30.598  -8.817  -20.761 1.00 41.36  ? 277  SER A C     1 
ATOM   364  O  O     . SER A 1 51   ? 29.478  -9.056  -20.322 1.00 41.36  ? 277  SER A O     1 
ATOM   365  C  CB    . SER A 1 51   ? 31.070  -6.945  -22.323 1.00 41.21  ? 277  SER A CB    1 
ATOM   366  O  OG    . SER A 1 51   ? 31.201  -6.559  -23.690 1.00 40.19  ? 277  SER A OG    1 
ATOM   367  N  N     . ILE A 1 52   ? 31.697  -8.894  -20.022 1.00 41.44  ? 278  ILE A N     1 
ATOM   368  C  CA    . ILE A 1 52   ? 31.609  -9.205  -18.601 1.00 41.46  ? 278  ILE A CA    1 
ATOM   369  C  C     . ILE A 1 52   ? 32.862  -8.767  -17.843 1.00 41.40  ? 278  ILE A C     1 
ATOM   370  O  O     . ILE A 1 52   ? 33.940  -8.597  -18.438 1.00 41.33  ? 278  ILE A O     1 
ATOM   371  C  CB    . ILE A 1 52   ? 31.354  -10.693 -18.366 1.00 41.36  ? 278  ILE A CB    1 
ATOM   372  C  CG1   . ILE A 1 52   ? 30.652  -10.885 -17.021 1.00 42.50  ? 278  ILE A CG1   1 
ATOM   373  C  CG2   . ILE A 1 52   ? 32.650  -11.495 -18.455 1.00 41.08  ? 278  ILE A CG2   1 
ATOM   374  C  CD1   . ILE A 1 52   ? 30.468  -12.342 -16.629 1.00 41.40  ? 278  ILE A CD1   1 
ATOM   375  N  N     . LEU A 1 53   ? 32.678  -8.542  -16.546 1.00 40.90  ? 279  LEU A N     1 
ATOM   376  C  CA    . LEU A 1 53   ? 33.731  -8.195  -15.620 1.00 41.02  ? 279  LEU A CA    1 
ATOM   377  C  C     . LEU A 1 53   ? 34.371  -9.503  -15.138 1.00 41.17  ? 279  LEU A C     1 
ATOM   378  O  O     . LEU A 1 53   ? 33.645  -10.468 -14.840 1.00 41.97  ? 279  LEU A O     1 
ATOM   379  C  CB    . LEU A 1 53   ? 33.120  -7.449  -14.438 1.00 40.69  ? 279  LEU A CB    1 
ATOM   380  C  CG    . LEU A 1 53   ? 34.118  -6.848  -13.453 1.00 42.34  ? 279  LEU A CG    1 
ATOM   381  C  CD1   . LEU A 1 53   ? 34.968  -5.812  -14.154 1.00 41.13  ? 279  LEU A CD1   1 
ATOM   382  C  CD2   . LEU A 1 53   ? 33.400  -6.217  -12.288 1.00 43.47  ? 279  LEU A CD2   1 
ATOM   383  N  N     . VAL A 1 54   ? 35.704  -9.548  -15.090 1.00 40.81  ? 280  VAL A N     1 
ATOM   384  C  CA    . VAL A 1 54   ? 36.461  -10.728 -14.642 1.00 40.89  ? 280  VAL A CA    1 
ATOM   385  C  C     . VAL A 1 54   ? 37.380  -10.345 -13.495 1.00 41.66  ? 280  VAL A C     1 
ATOM   386  O  O     . VAL A 1 54   ? 38.109  -9.344  -13.581 1.00 42.24  ? 280  VAL A O     1 
ATOM   387  C  CB    . VAL A 1 54   ? 37.381  -11.319 -15.742 1.00 40.57  ? 280  VAL A CB    1 
ATOM   388  C  CG1   . VAL A 1 54   ? 38.157  -12.509 -15.220 1.00 39.85  ? 280  VAL A CG1   1 
ATOM   389  C  CG2   . VAL A 1 54   ? 36.603  -11.698 -16.987 1.00 40.08  ? 280  VAL A CG2   1 
ATOM   390  N  N     . LYS A 1 55   ? 37.346  -11.133 -12.419 1.00 42.20  ? 281  LYS A N     1 
ATOM   391  C  CA    . LYS A 1 55   ? 38.266  -10.949 -11.302 1.00 42.55  ? 281  LYS A CA    1 
ATOM   392  C  C     . LYS A 1 55   ? 39.186  -12.173 -11.157 1.00 42.68  ? 281  LYS A C     1 
ATOM   393  O  O     . LYS A 1 55   ? 38.763  -13.309 -11.364 1.00 42.24  ? 281  LYS A O     1 
ATOM   394  C  CB    . LYS A 1 55   ? 37.509  -10.680 -9.995  1.00 42.82  ? 281  LYS A CB    1 
ATOM   395  C  CG    . LYS A 1 55   ? 36.738  -9.343  -9.910  1.00 43.90  ? 281  LYS A CG    1 
ATOM   396  C  CD    . LYS A 1 55   ? 35.755  -9.346  -8.685  1.00 46.89  ? 281  LYS A CD    1 
ATOM   397  C  CE    . LYS A 1 55   ? 36.341  -8.656  -7.439  1.00 48.11  ? 281  LYS A CE    1 
ATOM   398  N  NZ    . LYS A 1 55   ? 35.743  -9.090  -6.140  1.00 49.69  ? 281  LYS A NZ    1 
ATOM   399  N  N     . MET A 1 56   ? 40.451  -11.921 -10.809 1.00 43.04  ? 282  MET A N     1 
ATOM   400  C  CA    . MET A 1 56   ? 41.420  -12.984 -10.557 1.00 43.01  ? 282  MET A CA    1 
ATOM   401  C  C     . MET A 1 56   ? 42.306  -12.649 -9.355  1.00 42.76  ? 282  MET A C     1 
ATOM   402  O  O     . MET A 1 56   ? 42.825  -11.538 -9.247  1.00 43.33  ? 282  MET A O     1 
ATOM   403  C  CB    . MET A 1 56   ? 42.280  -13.218 -11.793 1.00 43.45  ? 282  MET A CB    1 
ATOM   404  C  CG    . MET A 1 56   ? 42.815  -14.610 -11.905 1.00 44.04  ? 282  MET A CG    1 
ATOM   405  S  SD    . MET A 1 56   ? 43.745  -14.743 -13.442 1.00 49.96  ? 282  MET A SD    1 
ATOM   406  C  CE    . MET A 1 56   ? 44.047  -16.508 -13.371 1.00 47.52  ? 282  MET A CE    1 
ATOM   407  N  N     . PHE A 1 57   ? 42.481  -13.615 -8.461  1.00 41.70  ? 283  PHE A N     1 
ATOM   408  C  CA    . PHE A 1 57   ? 43.232  -13.397 -7.241  1.00 41.33  ? 283  PHE A CA    1 
ATOM   409  C  C     . PHE A 1 57   ? 44.550  -14.210 -7.265  1.00 41.45  ? 283  PHE A C     1 
ATOM   410  O  O     . PHE A 1 57   ? 44.524  -15.430 -7.213  1.00 40.88  ? 283  PHE A O     1 
ATOM   411  C  CB    . PHE A 1 57   ? 42.383  -13.808 -6.023  1.00 41.36  ? 283  PHE A CB    1 
ATOM   412  C  CG    . PHE A 1 57   ? 41.117  -12.984 -5.823  1.00 40.35  ? 283  PHE A CG    1 
ATOM   413  C  CD1   . PHE A 1 57   ? 41.113  -11.877 -4.965  1.00 39.69  ? 283  PHE A CD1   1 
ATOM   414  C  CD2   . PHE A 1 57   ? 39.927  -13.336 -6.452  1.00 40.46  ? 283  PHE A CD2   1 
ATOM   415  C  CE1   . PHE A 1 57   ? 39.950  -11.126 -4.749  1.00 38.99  ? 283  PHE A CE1   1 
ATOM   416  C  CE2   . PHE A 1 57   ? 38.745  -12.581 -6.255  1.00 40.37  ? 283  PHE A CE2   1 
ATOM   417  C  CZ    . PHE A 1 57   ? 38.762  -11.478 -5.397  1.00 40.30  ? 283  PHE A CZ    1 
ATOM   418  N  N     . SER A 1 58   ? 45.695  -13.529 -7.327  1.00 41.24  ? 284  SER A N     1 
ATOM   419  C  CA    . SER A 1 58   ? 46.996  -14.198 -7.467  1.00 41.29  ? 284  SER A CA    1 
ATOM   420  C  C     . SER A 1 58   ? 47.290  -15.144 -6.304  1.00 42.15  ? 284  SER A C     1 
ATOM   421  O  O     . SER A 1 58   ? 46.955  -14.862 -5.156  1.00 41.75  ? 284  SER A O     1 
ATOM   422  C  CB    . SER A 1 58   ? 48.119  -13.160 -7.539  1.00 40.81  ? 284  SER A CB    1 
ATOM   423  O  OG    . SER A 1 58   ? 48.364  -12.563 -6.266  1.00 40.28  ? 284  SER A OG    1 
ATOM   424  N  N     . ARG A 1 59   ? 47.964  -16.245 -6.586  1.00 42.70  ? 285  ARG A N     1 
ATOM   425  C  CA    . ARG A 1 59   ? 48.360  -17.139 -5.509  1.00 43.67  ? 285  ARG A CA    1 
ATOM   426  C  C     . ARG A 1 59   ? 49.863  -17.007 -5.233  1.00 43.19  ? 285  ARG A C     1 
ATOM   427  O  O     . ARG A 1 59   ? 50.398  -17.707 -4.392  1.00 43.43  ? 285  ARG A O     1 
ATOM   428  C  CB    . ARG A 1 59   ? 48.017  -18.585 -5.870  1.00 44.38  ? 285  ARG A CB    1 
ATOM   429  C  CG    . ARG A 1 59   ? 47.394  -19.415 -4.746  1.00 48.10  ? 285  ARG A CG    1 
ATOM   430  C  CD    . ARG A 1 59   ? 45.934  -19.770 -5.045  1.00 54.29  ? 285  ARG A CD    1 
ATOM   431  N  NE    . ARG A 1 59   ? 45.724  -20.053 -6.472  1.00 59.15  ? 285  ARG A NE    1 
ATOM   432  C  CZ    . ARG A 1 59   ? 44.626  -20.627 -6.974  1.00 61.86  ? 285  ARG A CZ    1 
ATOM   433  N  NH1   . ARG A 1 59   ? 43.633  -20.987 -6.164  1.00 61.73  ? 285  ARG A NH1   1 
ATOM   434  N  NH2   . ARG A 1 59   ? 44.518  -20.835 -8.287  1.00 62.76  ? 285  ARG A NH2   1 
ATOM   435  N  N     . ASP A 1 60   ? 50.540  -16.102 -5.936  1.00 42.69  ? 286  ASP A N     1 
ATOM   436  C  CA    . ASP A 1 60   ? 52.000  -15.979 -5.838  1.00 42.42  ? 286  ASP A CA    1 
ATOM   437  C  C     . ASP A 1 60   ? 52.474  -14.767 -6.614  1.00 42.37  ? 286  ASP A C     1 
ATOM   438  O  O     . ASP A 1 60   ? 51.767  -14.256 -7.490  1.00 42.35  ? 286  ASP A O     1 
ATOM   439  C  CB    . ASP A 1 60   ? 52.707  -17.230 -6.370  1.00 41.68  ? 286  ASP A CB    1 
ATOM   440  C  CG    . ASP A 1 60   ? 52.032  -17.799 -7.608  1.00 41.10  ? 286  ASP A CG    1 
ATOM   441  O  OD1   . ASP A 1 60   ? 51.431  -18.880 -7.496  1.00 38.89  ? 286  ASP A OD1   1 
ATOM   442  O  OD2   . ASP A 1 60   ? 52.083  -17.167 -8.688  1.00 40.14  ? 286  ASP A OD2   1 
ATOM   443  N  N     . LYS A 1 61   ? 53.680  -14.314 -6.307  1.00 42.44  ? 287  LYS A N     1 
ATOM   444  C  CA    . LYS A 1 61   ? 54.105  -13.034 -6.820  1.00 42.60  ? 287  LYS A CA    1 
ATOM   445  C  C     . LYS A 1 61   ? 54.413  -13.142 -8.312  1.00 42.28  ? 287  LYS A C     1 
ATOM   446  O  O     . LYS A 1 61   ? 54.467  -12.123 -9.013  1.00 42.59  ? 287  LYS A O     1 
ATOM   447  C  CB    . LYS A 1 61   ? 55.264  -12.460 -6.002  1.00 42.70  ? 287  LYS A CB    1 
ATOM   448  C  CG    . LYS A 1 61   ? 56.635  -12.659 -6.581  1.00 44.94  ? 287  LYS A CG    1 
ATOM   449  C  CD    . LYS A 1 61   ? 57.678  -12.670 -5.453  1.00 48.89  ? 287  LYS A CD    1 
ATOM   450  C  CE    . LYS A 1 61   ? 59.056  -13.178 -5.920  1.00 50.74  ? 287  LYS A CE    1 
ATOM   451  N  NZ    . LYS A 1 61   ? 59.842  -13.844 -4.807  1.00 50.91  ? 287  LYS A NZ    1 
ATOM   452  N  N     . GLU A 1 62   ? 54.564  -14.371 -8.808  1.00 41.28  ? 288  GLU A N     1 
ATOM   453  C  CA    . GLU A 1 62   ? 54.877  -14.558 -10.221 1.00 40.26  ? 288  GLU A CA    1 
ATOM   454  C  C     . GLU A 1 62   ? 53.619  -14.296 -11.035 1.00 40.41  ? 288  GLU A C     1 
ATOM   455  O  O     . GLU A 1 62   ? 53.649  -13.614 -12.068 1.00 40.07  ? 288  GLU A O     1 
ATOM   456  C  CB    . GLU A 1 62   ? 55.393  -15.974 -10.499 1.00 39.61  ? 288  GLU A CB    1 
ATOM   457  C  CG    . GLU A 1 62   ? 56.831  -16.237 -10.122 1.00 37.00  ? 288  GLU A CG    1 
ATOM   458  C  CD    . GLU A 1 62   ? 57.045  -16.514 -8.633  1.00 32.78  ? 288  GLU A CD    1 
ATOM   459  O  OE1   . GLU A 1 62   ? 56.062  -16.746 -7.899  1.00 30.57  ? 288  GLU A OE1   1 
ATOM   460  O  OE2   . GLU A 1 62   ? 58.211  -16.498 -8.189  1.00 30.60  ? 288  GLU A OE2   1 
ATOM   461  N  N     . ASP A 1 63   ? 52.518  -14.863 -10.562 1.00 40.51  ? 289  ASP A N     1 
ATOM   462  C  CA    . ASP A 1 63   ? 51.211  -14.656 -11.180 1.00 40.87  ? 289  ASP A CA    1 
ATOM   463  C  C     . ASP A 1 63   ? 50.769  -13.212 -10.967 1.00 41.38  ? 289  ASP A C     1 
ATOM   464  O  O     . ASP A 1 63   ? 50.100  -12.629 -11.814 1.00 42.07  ? 289  ASP A O     1 
ATOM   465  C  CB    . ASP A 1 63   ? 50.161  -15.621 -10.602 1.00 40.55  ? 289  ASP A CB    1 
ATOM   466  C  CG    . ASP A 1 63   ? 50.147  -16.977 -11.302 1.00 39.83  ? 289  ASP A CG    1 
ATOM   467  O  OD1   . ASP A 1 63   ? 51.027  -17.216 -12.147 1.00 39.43  ? 289  ASP A OD1   1 
ATOM   468  O  OD2   . ASP A 1 63   ? 49.245  -17.798 -11.022 1.00 38.16  ? 289  ASP A OD2   1 
ATOM   469  N  N     . ALA A 1 64   ? 51.151  -12.629 -9.837  1.00 41.88  ? 290  ALA A N     1 
ATOM   470  C  CA    . ALA A 1 64   ? 50.813  -11.238 -9.582  1.00 42.08  ? 290  ALA A CA    1 
ATOM   471  C  C     . ALA A 1 64   ? 51.433  -10.299 -10.623 1.00 42.49  ? 290  ALA A C     1 
ATOM   472  O  O     . ALA A 1 64   ? 50.777  -9.378  -11.102 1.00 42.80  ? 290  ALA A O     1 
ATOM   473  C  CB    . ALA A 1 64   ? 51.202  -10.821 -8.156  1.00 41.27  ? 290  ALA A CB    1 
ATOM   474  N  N     . GLU A 1 65   ? 52.689  -10.516 -10.986 1.00 43.30  ? 291  GLU A N     1 
ATOM   475  C  CA    . GLU A 1 65   ? 53.308  -9.601  -11.925 1.00 44.45  ? 291  GLU A CA    1 
ATOM   476  C  C     . GLU A 1 65   ? 52.831  -9.879  -13.367 1.00 44.34  ? 291  GLU A C     1 
ATOM   477  O  O     . GLU A 1 65   ? 52.700  -8.964  -14.176 1.00 44.30  ? 291  GLU A O     1 
ATOM   478  C  CB    . GLU A 1 65   ? 54.838  -9.532  -11.759 1.00 44.85  ? 291  GLU A CB    1 
ATOM   479  C  CG    . GLU A 1 65   ? 55.538  -10.885 -11.640 1.00 48.18  ? 291  GLU A CG    1 
ATOM   480  C  CD    . GLU A 1 65   ? 56.970  -10.795 -11.064 1.00 52.55  ? 291  GLU A CD    1 
ATOM   481  O  OE1   . GLU A 1 65   ? 57.329  -9.753  -10.445 1.00 53.04  ? 291  GLU A OE1   1 
ATOM   482  O  OE2   . GLU A 1 65   ? 57.728  -11.791 -11.218 1.00 52.71  ? 291  GLU A OE2   1 
ATOM   483  N  N     . LEU A 1 66   ? 52.507  -11.131 -13.665 1.00 44.43  ? 292  LEU A N     1 
ATOM   484  C  CA    . LEU A 1 66   ? 51.890  -11.445 -14.953 1.00 44.26  ? 292  LEU A CA    1 
ATOM   485  C  C     . LEU A 1 66   ? 50.580  -10.684 -15.046 1.00 44.74  ? 292  LEU A C     1 
ATOM   486  O  O     . LEU A 1 66   ? 50.169  -10.211 -16.115 1.00 44.60  ? 292  LEU A O     1 
ATOM   487  C  CB    . LEU A 1 66   ? 51.657  -12.949 -15.111 1.00 43.25  ? 292  LEU A CB    1 
ATOM   488  C  CG    . LEU A 1 66   ? 52.932  -13.768 -15.363 1.00 43.00  ? 292  LEU A CG    1 
ATOM   489  C  CD1   . LEU A 1 66   ? 52.681  -15.254 -15.188 1.00 40.86  ? 292  LEU A CD1   1 
ATOM   490  C  CD2   . LEU A 1 66   ? 53.560  -13.480 -16.744 1.00 40.96  ? 292  LEU A CD2   1 
ATOM   491  N  N     . MET A 1 67   ? 49.912  -10.555 -13.917 1.00 44.92  ? 293  MET A N     1 
ATOM   492  C  CA    . MET A 1 67   ? 48.666  -9.830  -13.945 1.00 45.59  ? 293  MET A CA    1 
ATOM   493  C  C     . MET A 1 67   ? 48.888  -8.392  -14.414 1.00 45.83  ? 293  MET A C     1 
ATOM   494  O  O     . MET A 1 67   ? 48.102  -7.874  -15.188 1.00 45.46  ? 293  MET A O     1 
ATOM   495  C  CB    . MET A 1 67   ? 47.992  -9.861  -12.582 1.00 45.67  ? 293  MET A CB    1 
ATOM   496  C  CG    . MET A 1 67   ? 47.227  -11.132 -12.325 1.00 44.71  ? 293  MET A CG    1 
ATOM   497  S  SD    . MET A 1 67   ? 46.746  -11.141 -10.600 1.00 45.53  ? 293  MET A SD    1 
ATOM   498  C  CE    . MET A 1 67   ? 45.689  -12.616 -10.551 1.00 42.76  ? 293  MET A CE    1 
ATOM   499  N  N     . SER A 1 68   ? 49.963  -7.766  -13.932 1.00 46.42  ? 294  SER A N     1 
ATOM   500  C  CA    . SER A 1 68   ? 50.350  -6.418  -14.338 1.00 46.80  ? 294  SER A CA    1 
ATOM   501  C  C     . SER A 1 68   ? 50.589  -6.295  -15.839 1.00 47.17  ? 294  SER A C     1 
ATOM   502  O  O     . SER A 1 68   ? 50.573  -5.189  -16.377 1.00 46.96  ? 294  SER A O     1 
ATOM   503  C  CB    . SER A 1 68   ? 51.613  -5.990  -13.597 1.00 46.98  ? 294  SER A CB    1 
ATOM   504  O  OG    . SER A 1 68   ? 51.301  -5.610  -12.271 1.00 48.36  ? 294  SER A OG    1 
ATOM   505  N  N     . GLY A 1 69   ? 50.813  -7.431  -16.503 1.00 47.56  ? 295  GLY A N     1 
ATOM   506  C  CA    . GLY A 1 69   ? 51.073  -7.461  -17.948 1.00 48.19  ? 295  GLY A CA    1 
ATOM   507  C  C     . GLY A 1 69   ? 49.854  -7.669  -18.845 1.00 48.64  ? 295  GLY A C     1 
ATOM   508  O  O     . GLY A 1 69   ? 49.973  -7.685  -20.068 1.00 48.28  ? 295  GLY A O     1 
ATOM   509  N  N     . VAL A 1 70   ? 48.682  -7.846  -18.237 1.00 49.04  ? 296  VAL A N     1 
ATOM   510  C  CA    . VAL A 1 70   ? 47.443  -7.918  -18.989 1.00 49.58  ? 296  VAL A CA    1 
ATOM   511  C  C     . VAL A 1 70   ? 47.039  -6.483  -19.338 1.00 50.41  ? 296  VAL A C     1 
ATOM   512  O  O     . VAL A 1 70   ? 46.841  -5.662  -18.445 1.00 50.94  ? 296  VAL A O     1 
ATOM   513  C  CB    . VAL A 1 70   ? 46.336  -8.625  -18.154 1.00 49.31  ? 296  VAL A CB    1 
ATOM   514  C  CG1   . VAL A 1 70   ? 44.980  -8.454  -18.800 1.00 48.59  ? 296  VAL A CG1   1 
ATOM   515  C  CG2   . VAL A 1 70   ? 46.658  -10.103 -17.985 1.00 48.53  ? 296  VAL A CG2   1 
ATOM   516  N  N     . LYS A 1 71   ? 46.943  -6.158  -20.620 1.00 51.16  ? 297  LYS A N     1 
ATOM   517  C  CA    . LYS A 1 71   ? 46.666  -4.772  -21.011 1.00 52.08  ? 297  LYS A CA    1 
ATOM   518  C  C     . LYS A 1 71   ? 45.482  -4.673  -21.963 1.00 52.22  ? 297  LYS A C     1 
ATOM   519  O  O     . LYS A 1 71   ? 45.089  -5.674  -22.555 1.00 52.33  ? 297  LYS A O     1 
ATOM   520  C  CB    . LYS A 1 71   ? 47.901  -4.134  -21.649 1.00 52.15  ? 297  LYS A CB    1 
ATOM   521  C  CG    . LYS A 1 71   ? 48.795  -3.368  -20.667 1.00 54.60  ? 297  LYS A CG    1 
ATOM   522  C  CD    . LYS A 1 71   ? 49.988  -4.201  -20.171 1.00 57.24  ? 297  LYS A CD    1 
ATOM   523  C  CE    . LYS A 1 71   ? 51.129  -3.310  -19.647 1.00 58.22  ? 297  LYS A CE    1 
ATOM   524  N  NZ    . LYS A 1 71   ? 50.864  -2.745  -18.281 1.00 58.70  ? 297  LYS A NZ    1 
ATOM   525  N  N     . LYS A 1 72   ? 44.897  -3.481  -22.091 1.00 52.26  ? 298  LYS A N     1 
ATOM   526  C  CA    . LYS A 1 72   ? 43.885  -3.263  -23.114 1.00 52.57  ? 298  LYS A CA    1 
ATOM   527  C  C     . LYS A 1 72   ? 44.471  -3.629  -24.468 1.00 52.25  ? 298  LYS A C     1 
ATOM   528  O  O     . LYS A 1 72   ? 45.621  -3.291  -24.770 1.00 52.13  ? 298  LYS A O     1 
ATOM   529  C  CB    . LYS A 1 72   ? 43.483  -1.788  -23.203 1.00 53.28  ? 298  LYS A CB    1 
ATOM   530  C  CG    . LYS A 1 72   ? 43.003  -1.108  -21.925 1.00 55.16  ? 298  LYS A CG    1 
ATOM   531  C  CD    . LYS A 1 72   ? 42.314  0.211   -22.305 1.00 58.24  ? 298  LYS A CD    1 
ATOM   532  C  CE    . LYS A 1 72   ? 42.534  1.307   -21.270 1.00 59.21  ? 298  LYS A CE    1 
ATOM   533  N  NZ    . LYS A 1 72   ? 43.981  1.587   -21.092 1.00 58.51  ? 298  LYS A NZ    1 
ATOM   534  N  N     . GLY A 1 73   ? 43.670  -4.277  -25.304 1.00 52.03  ? 299  GLY A N     1 
ATOM   535  C  CA    . GLY A 1 73   ? 44.112  -4.641  -26.650 1.00 51.62  ? 299  GLY A CA    1 
ATOM   536  C  C     . GLY A 1 73   ? 44.448  -6.120  -26.759 1.00 51.34  ? 299  GLY A C     1 
ATOM   537  O  O     . GLY A 1 73   ? 44.540  -6.677  -27.851 1.00 51.10  ? 299  GLY A O     1 
ATOM   538  N  N     . MET A 1 74   ? 44.639  -6.766  -25.620 1.00 50.89  ? 300  MET A N     1 
ATOM   539  C  CA    . MET A 1 74   ? 44.917  -8.186  -25.634 1.00 50.89  ? 300  MET A CA    1 
ATOM   540  C  C     . MET A 1 74   ? 43.632  -8.973  -25.841 1.00 50.22  ? 300  MET A C     1 
ATOM   541  O  O     . MET A 1 74   ? 42.544  -8.485  -25.551 1.00 49.81  ? 300  MET A O     1 
ATOM   542  C  CB    . MET A 1 74   ? 45.594  -8.605  -24.329 1.00 51.27  ? 300  MET A CB    1 
ATOM   543  C  CG    . MET A 1 74   ? 46.948  -7.926  -24.106 1.00 53.47  ? 300  MET A CG    1 
ATOM   544  S  SD    . MET A 1 74   ? 47.872  -8.796  -22.841 1.00 56.48  ? 300  MET A SD    1 
ATOM   545  C  CE    . MET A 1 74   ? 47.003  -10.349 -22.942 1.00 56.86  ? 300  MET A CE    1 
ATOM   546  N  N     . TRP A 1 75   ? 43.755  -10.177 -26.385 1.00 49.74  ? 301  TRP A N     1 
ATOM   547  C  CA    . TRP A 1 75   ? 42.663  -11.137 -26.324 1.00 49.36  ? 301  TRP A CA    1 
ATOM   548  C  C     . TRP A 1 75   ? 43.092  -12.229 -25.368 1.00 49.07  ? 301  TRP A C     1 
ATOM   549  O  O     . TRP A 1 75   ? 44.284  -12.551 -25.261 1.00 48.63  ? 301  TRP A O     1 
ATOM   550  C  CB    . TRP A 1 75   ? 42.341  -11.737 -27.685 1.00 49.30  ? 301  TRP A CB    1 
ATOM   551  C  CG    . TRP A 1 75   ? 41.625  -10.804 -28.605 1.00 50.52  ? 301  TRP A CG    1 
ATOM   552  C  CD1   . TRP A 1 75   ? 42.119  -9.658  -29.163 1.00 49.84  ? 301  TRP A CD1   1 
ATOM   553  C  CD2   . TRP A 1 75   ? 40.280  -10.938 -29.082 1.00 51.58  ? 301  TRP A CD2   1 
ATOM   554  N  NE1   . TRP A 1 75   ? 41.160  -9.067  -29.953 1.00 51.11  ? 301  TRP A NE1   1 
ATOM   555  C  CE2   . TRP A 1 75   ? 40.023  -9.834  -29.920 1.00 51.88  ? 301  TRP A CE2   1 
ATOM   556  C  CE3   . TRP A 1 75   ? 39.267  -11.882 -28.874 1.00 51.73  ? 301  TRP A CE3   1 
ATOM   557  C  CZ2   . TRP A 1 75   ? 38.798  -9.652  -30.558 1.00 52.55  ? 301  TRP A CZ2   1 
ATOM   558  C  CZ3   . TRP A 1 75   ? 38.055  -11.704 -29.503 1.00 52.70  ? 301  TRP A CZ3   1 
ATOM   559  C  CH2   . TRP A 1 75   ? 37.827  -10.596 -30.337 1.00 53.50  ? 301  TRP A CH2   1 
ATOM   560  N  N     . VAL A 1 76   ? 42.109  -12.822 -24.704 1.00 48.66  ? 302  VAL A N     1 
ATOM   561  C  CA    . VAL A 1 76   ? 42.375  -13.636 -23.557 1.00 48.34  ? 302  VAL A CA    1 
ATOM   562  C  C     . VAL A 1 76   ? 41.332  -14.747 -23.512 1.00 48.42  ? 302  VAL A C     1 
ATOM   563  O  O     . VAL A 1 76   ? 40.174  -14.496 -23.807 1.00 48.44  ? 302  VAL A O     1 
ATOM   564  C  CB    . VAL A 1 76   ? 42.316  -12.694 -22.354 1.00 48.27  ? 302  VAL A CB    1 
ATOM   565  C  CG1   . VAL A 1 76   ? 41.617  -13.304 -21.195 1.00 49.08  ? 302  VAL A CG1   1 
ATOM   566  C  CG2   . VAL A 1 76   ? 43.721  -12.199 -22.004 1.00 47.36  ? 302  VAL A CG2   1 
ATOM   567  N  N     . LYS A 1 77   ? 41.748  -15.981 -23.216 1.00 48.58  ? 303  LYS A N     1 
ATOM   568  C  CA    . LYS A 1 77   ? 40.803  -17.063 -22.882 1.00 48.57  ? 303  LYS A CA    1 
ATOM   569  C  C     . LYS A 1 77   ? 40.809  -17.250 -21.372 1.00 48.46  ? 303  LYS A C     1 
ATOM   570  O  O     . LYS A 1 77   ? 41.859  -17.417 -20.789 1.00 48.62  ? 303  LYS A O     1 
ATOM   571  C  CB    . LYS A 1 77   ? 41.212  -18.375 -23.533 1.00 48.69  ? 303  LYS A CB    1 
ATOM   572  C  CG    . LYS A 1 77   ? 40.126  -19.456 -23.482 1.00 49.39  ? 303  LYS A CG    1 
ATOM   573  C  CD    . LYS A 1 77   ? 40.616  -20.838 -23.957 1.00 51.19  ? 303  LYS A CD    1 
ATOM   574  C  CE    . LYS A 1 77   ? 40.804  -21.797 -22.759 1.00 53.30  ? 303  LYS A CE    1 
ATOM   575  N  NZ    . LYS A 1 77   ? 41.613  -23.033 -23.036 1.00 52.50  ? 303  LYS A NZ    1 
ATOM   576  N  N     . VAL A 1 78   ? 39.641  -17.223 -20.743 1.00 48.65  ? 304  VAL A N     1 
ATOM   577  C  CA    . VAL A 1 78   ? 39.533  -17.273 -19.278 1.00 48.44  ? 304  VAL A CA    1 
ATOM   578  C  C     . VAL A 1 78   ? 38.653  -18.443 -18.873 1.00 48.40  ? 304  VAL A C     1 
ATOM   579  O  O     . VAL A 1 78   ? 37.599  -18.666 -19.465 1.00 48.32  ? 304  VAL A O     1 
ATOM   580  C  CB    . VAL A 1 78   ? 38.902  -15.967 -18.719 1.00 48.29  ? 304  VAL A CB    1 
ATOM   581  C  CG1   . VAL A 1 78   ? 38.589  -16.099 -17.257 1.00 47.80  ? 304  VAL A CG1   1 
ATOM   582  C  CG2   . VAL A 1 78   ? 39.830  -14.798 -18.935 1.00 48.82  ? 304  VAL A CG2   1 
ATOM   583  N  N     . ARG A 1 79   ? 39.076  -19.210 -17.878 1.00 48.76  ? 305  ARG A N     1 
ATOM   584  C  CA    . ARG A 1 79   ? 38.204  -20.263 -17.361 1.00 49.38  ? 305  ARG A CA    1 
ATOM   585  C  C     . ARG A 1 79   ? 37.957  -19.961 -15.901 1.00 49.48  ? 305  ARG A C     1 
ATOM   586  O  O     . ARG A 1 79   ? 38.884  -19.603 -15.173 1.00 49.90  ? 305  ARG A O     1 
ATOM   587  C  CB    . ARG A 1 79   ? 38.813  -21.660 -17.547 1.00 48.92  ? 305  ARG A CB    1 
ATOM   588  N  N     . GLY A 1 80   ? 36.711  -20.074 -15.469 1.00 49.44  ? 306  GLY A N     1 
ATOM   589  C  CA    . GLY A 1 80   ? 36.399  -19.787 -14.079 1.00 49.71  ? 306  GLY A CA    1 
ATOM   590  C  C     . GLY A 1 80   ? 34.926  -19.895 -13.786 1.00 50.04  ? 306  GLY A C     1 
ATOM   591  O  O     . GLY A 1 80   ? 34.143  -20.331 -14.630 1.00 50.12  ? 306  GLY A O     1 
ATOM   592  N  N     . SER A 1 81   ? 34.546  -19.505 -12.577 1.00 50.37  ? 307  SER A N     1 
ATOM   593  C  CA    . SER A 1 81   ? 33.166  -19.642 -12.139 1.00 50.97  ? 307  SER A CA    1 
ATOM   594  C  C     . SER A 1 81   ? 32.393  -18.346 -12.359 1.00 51.34  ? 307  SER A C     1 
ATOM   595  O  O     . SER A 1 81   ? 32.999  -17.269 -12.443 1.00 51.72  ? 307  SER A O     1 
ATOM   596  C  CB    . SER A 1 81   ? 33.129  -20.055 -10.665 1.00 51.00  ? 307  SER A CB    1 
ATOM   597  O  OG    . SER A 1 81   ? 33.668  -19.038 -9.846  1.00 50.68  ? 307  SER A OG    1 
ATOM   598  N  N     . VAL A 1 82   ? 31.065  -18.444 -12.465 1.00 51.45  ? 308  VAL A N     1 
ATOM   599  C  CA    . VAL A 1 82   ? 30.218  -17.250 -12.603 1.00 51.69  ? 308  VAL A CA    1 
ATOM   600  C  C     . VAL A 1 82   ? 29.474  -16.965 -11.300 1.00 52.12  ? 308  VAL A C     1 
ATOM   601  O  O     . VAL A 1 82   ? 28.672  -17.777 -10.842 1.00 52.19  ? 308  VAL A O     1 
ATOM   602  C  CB    . VAL A 1 82   ? 29.195  -17.369 -13.774 1.00 51.77  ? 308  VAL A CB    1 
ATOM   603  C  CG1   . VAL A 1 82   ? 28.217  -16.208 -13.742 1.00 51.82  ? 308  VAL A CG1   1 
ATOM   604  C  CG2   . VAL A 1 82   ? 29.903  -17.425 -15.132 1.00 51.12  ? 308  VAL A CG2   1 
ATOM   605  N  N     . GLN A 1 83   ? 29.741  -15.810 -10.703 1.00 52.57  ? 309  GLN A N     1 
ATOM   606  C  CA    . GLN A 1 83   ? 29.154  -15.475 -9.414  1.00 53.25  ? 309  GLN A CA    1 
ATOM   607  C  C     . GLN A 1 83   ? 28.489  -14.108 -9.426  1.00 53.44  ? 309  GLN A C     1 
ATOM   608  O  O     . GLN A 1 83   ? 28.990  -13.175 -10.035 1.00 53.56  ? 309  GLN A O     1 
ATOM   609  C  CB    . GLN A 1 83   ? 30.233  -15.473 -8.333  1.00 53.21  ? 309  GLN A CB    1 
ATOM   610  C  CG    . GLN A 1 83   ? 30.695  -16.860 -7.926  1.00 55.23  ? 309  GLN A CG    1 
ATOM   611  C  CD    . GLN A 1 83   ? 31.986  -16.855 -7.111  1.00 55.91  ? 309  GLN A CD    1 
ATOM   612  O  OE1   . GLN A 1 83   ? 32.091  -16.201 -6.069  1.00 55.25  ? 309  GLN A OE1   1 
ATOM   613  N  NE2   . GLN A 1 83   ? 32.969  -17.609 -7.579  1.00 56.93  ? 309  GLN A NE2   1 
ATOM   614  N  N     . ASN A 1 84   ? 27.361  -13.984 -8.741  1.00 53.89  ? 310  ASN A N     1 
ATOM   615  C  CA    . ASN A 1 84   ? 26.880  -12.667 -8.386  1.00 53.98  ? 310  ASN A CA    1 
ATOM   616  C  C     . ASN A 1 84   ? 27.933  -12.012 -7.485  1.00 53.89  ? 310  ASN A C     1 
ATOM   617  O  O     . ASN A 1 84   ? 28.418  -12.610 -6.519  1.00 53.54  ? 310  ASN A O     1 
ATOM   618  C  CB    . ASN A 1 84   ? 25.530  -12.749 -7.665  1.00 54.12  ? 310  ASN A CB    1 
ATOM   619  C  CG    . ASN A 1 84   ? 24.847  -11.391 -7.553  1.00 55.32  ? 310  ASN A CG    1 
ATOM   620  O  OD1   . ASN A 1 84   ? 24.454  -10.962 -6.456  1.00 55.91  ? 310  ASN A OD1   1 
ATOM   621  N  ND2   . ASN A 1 84   ? 24.727  -10.690 -8.692  1.00 55.07  ? 310  ASN A ND2   1 
ATOM   622  N  N     . ASP A 1 85   ? 28.306  -10.791 -7.826  1.00 53.91  ? 311  ASP A N     1 
ATOM   623  C  CA    . ASP A 1 85   ? 29.203  -10.008 -7.005  1.00 54.01  ? 311  ASP A CA    1 
ATOM   624  C  C     . ASP A 1 85   ? 28.318  -8.872  -6.533  1.00 54.67  ? 311  ASP A C     1 
ATOM   625  O  O     . ASP A 1 85   ? 27.709  -8.175  -7.348  1.00 54.55  ? 311  ASP A O     1 
ATOM   626  C  CB    . ASP A 1 85   ? 30.379  -9.518  -7.860  1.00 53.88  ? 311  ASP A CB    1 
ATOM   627  C  CG    . ASP A 1 85   ? 31.294  -8.546  -7.132  1.00 52.74  ? 311  ASP A CG    1 
ATOM   628  O  OD1   . ASP A 1 85   ? 30.815  -7.510  -6.638  1.00 51.55  ? 311  ASP A OD1   1 
ATOM   629  O  OD2   . ASP A 1 85   ? 32.514  -8.800  -7.103  1.00 52.95  ? 311  ASP A OD2   1 
ATOM   630  N  N     . THR A 1 86   ? 28.180  -8.715  -5.224  1.00 55.20  ? 312  THR A N     1 
ATOM   631  C  CA    . THR A 1 86   ? 27.148  -7.809  -4.737  1.00 55.74  ? 312  THR A CA    1 
ATOM   632  C  C     . THR A 1 86   ? 27.616  -6.353  -4.721  1.00 56.16  ? 312  THR A C     1 
ATOM   633  O  O     . THR A 1 86   ? 26.797  -5.435  -4.792  1.00 56.39  ? 312  THR A O     1 
ATOM   634  C  CB    . THR A 1 86   ? 26.525  -8.265  -3.375  1.00 55.88  ? 312  THR A CB    1 
ATOM   635  O  OG1   . THR A 1 86   ? 27.557  -8.735  -2.500  1.00 55.31  ? 312  THR A OG1   1 
ATOM   636  C  CG2   . THR A 1 86   ? 25.490  -9.395  -3.597  1.00 55.64  ? 312  THR A CG2   1 
ATOM   637  N  N     . PHE A 1 87   ? 28.925  -6.134  -4.662  1.00 56.49  ? 313  PHE A N     1 
ATOM   638  C  CA    . PHE A 1 87   ? 29.426  -4.765  -4.743  1.00 56.93  ? 313  PHE A CA    1 
ATOM   639  C  C     . PHE A 1 87   ? 29.263  -4.169  -6.143  1.00 56.54  ? 313  PHE A C     1 
ATOM   640  O  O     . PHE A 1 87   ? 29.081  -2.965  -6.289  1.00 56.85  ? 313  PHE A O     1 
ATOM   641  C  CB    . PHE A 1 87   ? 30.892  -4.636  -4.306  1.00 57.23  ? 313  PHE A CB    1 
ATOM   642  C  CG    . PHE A 1 87   ? 31.494  -3.294  -4.655  1.00 58.97  ? 313  PHE A CG    1 
ATOM   643  C  CD1   . PHE A 1 87   ? 32.279  -3.146  -5.793  1.00 60.36  ? 313  PHE A CD1   1 
ATOM   644  C  CD2   . PHE A 1 87   ? 31.219  -2.161  -3.879  1.00 60.59  ? 313  PHE A CD2   1 
ATOM   645  C  CE1   . PHE A 1 87   ? 32.819  -1.899  -6.138  1.00 60.71  ? 313  PHE A CE1   1 
ATOM   646  C  CE2   . PHE A 1 87   ? 31.746  -0.911  -4.218  1.00 60.56  ? 313  PHE A CE2   1 
ATOM   647  C  CZ    . PHE A 1 87   ? 32.550  -0.783  -5.348  1.00 60.60  ? 313  PHE A CZ    1 
ATOM   648  N  N     . VAL A 1 88   ? 29.340  -5.005  -7.170  1.00 56.00  ? 314  VAL A N     1 
ATOM   649  C  CA    . VAL A 1 88   ? 29.218  -4.524  -8.548  1.00 55.65  ? 314  VAL A CA    1 
ATOM   650  C  C     . VAL A 1 88   ? 27.778  -4.640  -9.088  1.00 54.75  ? 314  VAL A C     1 
ATOM   651  O  O     . VAL A 1 88   ? 27.459  -4.101  -10.153 1.00 54.61  ? 314  VAL A O     1 
ATOM   652  C  CB    . VAL A 1 88   ? 30.193  -5.272  -9.482  1.00 56.07  ? 314  VAL A CB    1 
ATOM   653  C  CG1   . VAL A 1 88   ? 29.663  -6.652  -9.809  1.00 56.98  ? 314  VAL A CG1   1 
ATOM   654  C  CG2   . VAL A 1 88   ? 30.440  -4.482  -10.768 1.00 57.33  ? 314  VAL A CG2   1 
ATOM   655  N  N     . ARG A 1 89   ? 26.921  -5.340  -8.339  1.00 53.56  ? 315  ARG A N     1 
ATOM   656  C  CA    . ARG A 1 89   ? 25.502  -5.584  -8.695  1.00 52.38  ? 315  ARG A CA    1 
ATOM   657  C  C     . ARG A 1 89   ? 25.301  -6.282  -10.058 1.00 51.11  ? 315  ARG A C     1 
ATOM   658  O  O     . ARG A 1 89   ? 24.316  -6.043  -10.748 1.00 51.22  ? 315  ARG A O     1 
ATOM   659  C  CB    . ARG A 1 89   ? 24.668  -4.293  -8.599  1.00 52.72  ? 315  ARG A CB    1 
ATOM   660  C  CG    . ARG A 1 89   ? 25.156  -3.315  -7.540  1.00 53.54  ? 315  ARG A CG    1 
ATOM   661  C  CD    . ARG A 1 89   ? 24.011  -2.658  -6.797  1.00 55.71  ? 315  ARG A CD    1 
ATOM   662  N  NE    . ARG A 1 89   ? 23.405  -1.557  -7.543  1.00 56.51  ? 315  ARG A NE    1 
ATOM   663  C  CZ    . ARG A 1 89   ? 22.417  -0.803  -7.063  1.00 56.49  ? 315  ARG A CZ    1 
ATOM   664  N  NH1   . ARG A 1 89   ? 21.902  0.186   -7.796  1.00 55.36  ? 315  ARG A NH1   1 
ATOM   665  N  NH2   . ARG A 1 89   ? 21.944  -1.045  -5.843  1.00 54.95  ? 315  ARG A NH2   1 
ATOM   666  N  N     . ASP A 1 90   ? 26.238  -7.154  -10.413 1.00 49.26  ? 316  ASP A N     1 
ATOM   667  C  CA    . ASP A 1 90   ? 26.230  -7.883  -11.672 1.00 47.90  ? 316  ASP A CA    1 
ATOM   668  C  C     . ASP A 1 90   ? 26.875  -9.240  -11.474 1.00 46.82  ? 316  ASP A C     1 
ATOM   669  O  O     . ASP A 1 90   ? 27.728  -9.407  -10.601 1.00 46.46  ? 316  ASP A O     1 
ATOM   670  C  CB    . ASP A 1 90   ? 27.067  -7.131  -12.728 1.00 47.92  ? 316  ASP A CB    1 
ATOM   671  C  CG    . ASP A 1 90   ? 26.311  -5.983  -13.369 1.00 47.71  ? 316  ASP A CG    1 
ATOM   672  O  OD1   . ASP A 1 90   ? 25.117  -6.154  -13.689 1.00 48.44  ? 316  ASP A OD1   1 
ATOM   673  O  OD2   . ASP A 1 90   ? 26.910  -4.910  -13.567 1.00 47.17  ? 316  ASP A OD2   1 
ATOM   674  N  N     . LEU A 1 91   ? 26.499  -10.203 -12.303 1.00 45.75  ? 317  LEU A N     1 
ATOM   675  C  CA    . LEU A 1 91   ? 27.292  -11.415 -12.424 1.00 44.83  ? 317  LEU A CA    1 
ATOM   676  C  C     . LEU A 1 91   ? 28.724  -11.031 -12.846 1.00 45.24  ? 317  LEU A C     1 
ATOM   677  O  O     . LEU A 1 91   ? 28.978  -9.929  -13.333 1.00 45.30  ? 317  LEU A O     1 
ATOM   678  C  CB    . LEU A 1 91   ? 26.688  -12.334 -13.466 1.00 44.32  ? 317  LEU A CB    1 
ATOM   679  C  CG    . LEU A 1 91   ? 25.300  -12.871 -13.163 1.00 43.45  ? 317  LEU A CG    1 
ATOM   680  C  CD1   . LEU A 1 91   ? 24.775  -13.612 -14.372 1.00 40.41  ? 317  LEU A CD1   1 
ATOM   681  C  CD2   . LEU A 1 91   ? 25.386  -13.781 -11.944 1.00 42.58  ? 317  LEU A CD2   1 
ATOM   682  N  N     . VAL A 1 92   ? 29.649  -11.962 -12.694 1.00 44.92  ? 318  VAL A N     1 
ATOM   683  C  CA    . VAL A 1 92   ? 31.034  -11.653 -12.843 1.00 44.87  ? 318  VAL A CA    1 
ATOM   684  C  C     . VAL A 1 92   ? 31.750  -12.995 -12.948 1.00 44.86  ? 318  VAL A C     1 
ATOM   685  O  O     . VAL A 1 92   ? 31.271  -13.976 -12.405 1.00 44.88  ? 318  VAL A O     1 
ATOM   686  C  CB    . VAL A 1 92   ? 31.486  -10.892 -11.599 1.00 44.80  ? 318  VAL A CB    1 
ATOM   687  C  CG1   . VAL A 1 92   ? 32.388  -11.747 -10.747 1.00 43.91  ? 318  VAL A CG1   1 
ATOM   688  C  CG2   . VAL A 1 92   ? 32.175  -9.654  -11.980 1.00 45.27  ? 318  VAL A CG2   1 
ATOM   689  N  N     . ILE A 1 93   ? 32.868  -13.068 -13.666 1.00 45.19  ? 319  ILE A N     1 
ATOM   690  C  CA    . ILE A 1 93   ? 33.667  -14.302 -13.645 1.00 45.21  ? 319  ILE A CA    1 
ATOM   691  C  C     . ILE A 1 93   ? 34.818  -14.230 -12.646 1.00 44.95  ? 319  ILE A C     1 
ATOM   692  O  O     . ILE A 1 93   ? 35.581  -13.271 -12.630 1.00 44.93  ? 319  ILE A O     1 
ATOM   693  C  CB    . ILE A 1 93   ? 34.260  -14.660 -15.011 1.00 45.37  ? 319  ILE A CB    1 
ATOM   694  C  CG1   . ILE A 1 93   ? 33.150  -15.075 -15.977 1.00 46.04  ? 319  ILE A CG1   1 
ATOM   695  C  CG2   . ILE A 1 93   ? 35.213  -15.825 -14.844 1.00 44.66  ? 319  ILE A CG2   1 
ATOM   696  C  CD1   . ILE A 1 93   ? 33.577  -15.082 -17.436 1.00 45.71  ? 319  ILE A CD1   1 
ATOM   697  N  N     . ILE A 1 94   ? 34.920  -15.240 -11.800 1.00 44.90  ? 320  ILE A N     1 
ATOM   698  C  CA    . ILE A 1 94   ? 36.094  -15.408 -10.966 1.00 45.05  ? 320  ILE A CA    1 
ATOM   699  C  C     . ILE A 1 94   ? 36.981  -16.404 -11.693 1.00 45.18  ? 320  ILE A C     1 
ATOM   700  O  O     . ILE A 1 94   ? 36.640  -17.586 -11.820 1.00 44.80  ? 320  ILE A O     1 
ATOM   701  C  CB    . ILE A 1 94   ? 35.744  -15.998 -9.586  1.00 45.31  ? 320  ILE A CB    1 
ATOM   702  C  CG1   . ILE A 1 94   ? 34.695  -15.142 -8.853  1.00 45.28  ? 320  ILE A CG1   1 
ATOM   703  C  CG2   . ILE A 1 94   ? 37.034  -16.241 -8.766  1.00 44.59  ? 320  ILE A CG2   1 
ATOM   704  C  CD1   . ILE A 1 94   ? 35.016  -13.651 -8.786  1.00 46.59  ? 320  ILE A CD1   1 
ATOM   705  N  N     . ALA A 1 95   ? 38.112  -15.939 -12.195 1.00 45.58  ? 321  ALA A N     1 
ATOM   706  C  CA    . ALA A 1 95   ? 38.891  -16.783 -13.084 1.00 46.70  ? 321  ALA A CA    1 
ATOM   707  C  C     . ALA A 1 95   ? 39.907  -17.618 -12.323 1.00 47.78  ? 321  ALA A C     1 
ATOM   708  O  O     . ALA A 1 95   ? 40.571  -17.119 -11.406 1.00 48.45  ? 321  ALA A O     1 
ATOM   709  C  CB    . ALA A 1 95   ? 39.586  -15.939 -14.112 1.00 46.60  ? 321  ALA A CB    1 
ATOM   710  N  N     . ASN A 1 96   ? 40.025  -18.887 -12.703 1.00 48.79  ? 322  ASN A N     1 
ATOM   711  C  CA    . ASN A 1 96   ? 41.123  -19.731 -12.241 1.00 49.77  ? 322  ASN A CA    1 
ATOM   712  C  C     . ASN A 1 96   ? 42.267  -19.731 -13.232 1.00 49.59  ? 322  ASN A C     1 
ATOM   713  O  O     . ASN A 1 96   ? 43.408  -20.000 -12.872 1.00 49.28  ? 322  ASN A O     1 
ATOM   714  C  CB    . ASN A 1 96   ? 40.631  -21.160 -12.046 1.00 50.22  ? 322  ASN A CB    1 
ATOM   715  C  CG    . ASN A 1 96   ? 39.305  -21.207 -11.328 1.00 53.39  ? 322  ASN A CG    1 
ATOM   716  O  OD1   . ASN A 1 96   ? 39.167  -20.667 -10.220 1.00 57.04  ? 322  ASN A OD1   1 
ATOM   717  N  ND2   . ASN A 1 96   ? 38.306  -21.834 -11.957 1.00 55.64  ? 322  ASN A ND2   1 
ATOM   718  N  N     . ASP A 1 97   ? 41.953  -19.408 -14.483 1.00 49.88  ? 323  ASP A N     1 
ATOM   719  C  CA    . ASP A 1 97   ? 42.878  -19.630 -15.571 1.00 50.16  ? 323  ASP A CA    1 
ATOM   720  C  C     . ASP A 1 97   ? 42.806  -18.522 -16.624 1.00 50.12  ? 323  ASP A C     1 
ATOM   721  O  O     . ASP A 1 97   ? 41.716  -18.087 -17.010 1.00 50.31  ? 323  ASP A O     1 
ATOM   722  C  CB    . ASP A 1 97   ? 42.530  -20.963 -16.210 1.00 50.62  ? 323  ASP A CB    1 
ATOM   723  C  CG    . ASP A 1 97   ? 43.740  -21.715 -16.642 1.00 52.75  ? 323  ASP A CG    1 
ATOM   724  O  OD1   . ASP A 1 97   ? 44.281  -22.476 -15.802 1.00 54.30  ? 323  ASP A OD1   1 
ATOM   725  O  OD2   . ASP A 1 97   ? 44.154  -21.534 -17.816 1.00 54.81  ? 323  ASP A OD2   1 
ATOM   726  N  N     . LEU A 1 98   ? 43.964  -18.077 -17.107 1.00 49.84  ? 324  LEU A N     1 
ATOM   727  C  CA    . LEU A 1 98   ? 44.003  -17.025 -18.118 1.00 49.46  ? 324  LEU A CA    1 
ATOM   728  C  C     . LEU A 1 98   ? 45.138  -17.268 -19.095 1.00 49.66  ? 324  LEU A C     1 
ATOM   729  O  O     . LEU A 1 98   ? 46.273  -17.454 -18.674 1.00 49.17  ? 324  LEU A O     1 
ATOM   730  C  CB    . LEU A 1 98   ? 44.192  -15.666 -17.451 1.00 49.15  ? 324  LEU A CB    1 
ATOM   731  C  CG    . LEU A 1 98   ? 43.822  -14.415 -18.245 1.00 48.74  ? 324  LEU A CG    1 
ATOM   732  C  CD1   . LEU A 1 98   ? 43.450  -13.297 -17.292 1.00 46.49  ? 324  LEU A CD1   1 
ATOM   733  C  CD2   . LEU A 1 98   ? 44.938  -13.989 -19.190 1.00 46.79  ? 324  LEU A CD2   1 
ATOM   734  N  N     . ASN A 1 99   ? 44.823  -17.282 -20.394 1.00 50.21  ? 325  ASN A N     1 
ATOM   735  C  CA    . ASN A 1 99   ? 45.841  -17.375 -21.453 1.00 50.72  ? 325  ASN A CA    1 
ATOM   736  C  C     . ASN A 1 99   ? 45.640  -16.298 -22.511 1.00 50.54  ? 325  ASN A C     1 
ATOM   737  O  O     . ASN A 1 99   ? 44.541  -16.145 -23.047 1.00 51.16  ? 325  ASN A O     1 
ATOM   738  C  CB    . ASN A 1 99   ? 45.834  -18.754 -22.140 1.00 50.93  ? 325  ASN A CB    1 
ATOM   739  C  CG    . ASN A 1 99   ? 45.913  -19.929 -21.154 1.00 52.23  ? 325  ASN A CG    1 
ATOM   740  O  OD1   . ASN A 1 99   ? 46.736  -19.940 -20.233 1.00 53.58  ? 325  ASN A OD1   1 
ATOM   741  N  ND2   . ASN A 1 99   ? 45.070  -20.940 -21.371 1.00 52.84  ? 325  ASN A ND2   1 
ATOM   742  N  N     . GLU A 1 100  ? 46.686  -15.538 -22.818 1.00 50.36  ? 326  GLU A N     1 
ATOM   743  C  CA    . GLU A 1 100  ? 46.617  -14.617 -23.948 1.00 49.93  ? 326  GLU A CA    1 
ATOM   744  C  C     . GLU A 1 100  ? 46.462  -15.437 -25.216 1.00 49.89  ? 326  GLU A C     1 
ATOM   745  O  O     . GLU A 1 100  ? 47.082  -16.477 -25.354 1.00 50.07  ? 326  GLU A O     1 
ATOM   746  C  CB    . GLU A 1 100  ? 47.873  -13.750 -24.035 1.00 49.76  ? 326  GLU A CB    1 
ATOM   747  C  CG    . GLU A 1 100  ? 47.883  -12.788 -25.238 1.00 49.98  ? 326  GLU A CG    1 
ATOM   748  C  CD    . GLU A 1 100  ? 48.936  -11.679 -25.144 1.00 51.17  ? 326  GLU A CD    1 
ATOM   749  O  OE1   . GLU A 1 100  ? 49.929  -11.829 -24.387 1.00 51.09  ? 326  GLU A OE1   1 
ATOM   750  O  OE2   . GLU A 1 100  ? 48.782  -10.656 -25.861 1.00 51.83  ? 326  GLU A OE2   1 
ATOM   751  N  N     . ILE A 1 101  ? 45.617  -14.989 -26.137 1.00 50.21  ? 327  ILE A N     1 
ATOM   752  C  CA    . ILE A 1 101  ? 45.453  -15.675 -27.424 1.00 50.14  ? 327  ILE A CA    1 
ATOM   753  C  C     . ILE A 1 101  ? 45.591  -14.706 -28.597 1.00 50.31  ? 327  ILE A C     1 
ATOM   754  O  O     . ILE A 1 101  ? 45.695  -13.493 -28.407 1.00 50.08  ? 327  ILE A O     1 
ATOM   755  C  CB    . ILE A 1 101  ? 44.074  -16.386 -27.555 1.00 50.10  ? 327  ILE A CB    1 
ATOM   756  C  CG1   . ILE A 1 101  ? 42.943  -15.428 -27.177 1.00 50.04  ? 327  ILE A CG1   1 
ATOM   757  C  CG2   . ILE A 1 101  ? 44.033  -17.688 -26.750 1.00 49.41  ? 327  ILE A CG2   1 
ATOM   758  C  CD1   . ILE A 1 101  ? 41.552  -15.982 -27.408 1.00 50.69  ? 327  ILE A CD1   1 
ATOM   759  N  N     . ALA A 1 102  ? 45.590  -15.254 -29.808 1.00 50.50  ? 328  ALA A N     1 
ATOM   760  C  CA    . ALA A 1 102  ? 45.597  -14.435 -31.012 1.00 50.97  ? 328  ALA A CA    1 
ATOM   761  C  C     . ALA A 1 102  ? 44.223  -13.827 -31.220 1.00 51.29  ? 328  ALA A C     1 
ATOM   762  O  O     . ALA A 1 102  ? 43.204  -14.451 -30.914 1.00 51.19  ? 328  ALA A O     1 
ATOM   763  C  CB    . ALA A 1 102  ? 45.987  -15.268 -32.219 1.00 50.82  ? 328  ALA A CB    1 
ATOM   764  N  N     . ALA A 1 103  ? 44.195  -12.606 -31.741 1.00 51.71  ? 329  ALA A N     1 
ATOM   765  C  CA    . ALA A 1 103  ? 42.935  -11.975 -32.094 1.00 52.16  ? 329  ALA A CA    1 
ATOM   766  C  C     . ALA A 1 103  ? 42.256  -12.773 -33.215 1.00 52.39  ? 329  ALA A C     1 
ATOM   767  O  O     . ALA A 1 103  ? 41.041  -12.664 -33.437 1.00 52.47  ? 329  ALA A O     1 
ATOM   768  C  CB    . ALA A 1 103  ? 43.181  -10.543 -32.522 1.00 52.17  ? 329  ALA A CB    1 
ATOM   769  N  N     . ASN A 1 104  ? 43.066  -13.592 -33.889 1.00 52.73  ? 330  ASN A N     1 
ATOM   770  C  CA    . ASN A 1 104  ? 42.681  -14.358 -35.089 1.00 53.18  ? 330  ASN A CA    1 
ATOM   771  C  C     . ASN A 1 104  ? 41.511  -13.781 -35.893 1.00 53.22  ? 330  ASN A C     1 
ATOM   772  O  O     . ASN A 1 104  ? 40.601  -14.524 -36.267 1.00 53.24  ? 330  ASN A O     1 
ATOM   773  C  CB    . ASN A 1 104  ? 42.420  -15.835 -34.748 1.00 53.08  ? 330  ASN A CB    1 
ATOM   774  N  N     . GLU A 1 105  ? 41.558  -12.471 -36.163 1.00 53.29  ? 331  GLU A N     1 
ATOM   775  C  CA    . GLU A 1 105  ? 40.505  -11.749 -36.909 1.00 53.08  ? 331  GLU A CA    1 
ATOM   776  C  C     . GLU A 1 105  ? 40.434  -12.093 -38.397 1.00 52.73  ? 331  GLU A C     1 
ATOM   777  O  O     . GLU A 1 105  ? 41.330  -12.725 -38.952 1.00 52.39  ? 331  GLU A O     1 
ATOM   778  C  CB    . GLU A 1 105  ? 40.694  -10.230 -36.791 1.00 53.31  ? 331  GLU A CB    1 
ATOM   779  C  CG    . GLU A 1 105  ? 41.874  -9.681  -37.612 1.00 52.11  ? 331  GLU A CG    1 
ATOM   780  C  CD    . GLU A 1 105  ? 43.127  -9.460  -36.772 1.00 51.09  ? 331  GLU A CD    1 
ATOM   781  O  OE1   . GLU A 1 105  ? 44.240  -9.483  -37.337 1.00 49.65  ? 331  GLU A OE1   1 
ATOM   782  O  OE2   . GLU A 1 105  ? 42.989  -9.262  -35.543 1.00 49.82  ? 331  GLU A OE2   1 
ATOM   783  N  N     . ARG A 1 106  ? 39.363  -11.640 -39.035 1.00 52.60  ? 332  ARG A N     1 
ATOM   784  C  CA    . ARG A 1 106  ? 39.140  -11.888 -40.449 1.00 52.51  ? 332  ARG A CA    1 
ATOM   785  C  C     . ARG A 1 106  ? 40.424  -11.797 -41.280 1.00 52.54  ? 332  ARG A C     1 
ATOM   786  O  O     . ARG A 1 106  ? 41.159  -10.801 -41.218 1.00 52.33  ? 332  ARG A O     1 
ATOM   787  C  CB    . ARG A 1 106  ? 38.041  -10.962 -40.989 1.00 52.49  ? 332  ARG A CB    1 
ATOM   788  C  CG    . ARG A 1 106  ? 36.677  -11.647 -41.106 1.00 52.19  ? 332  ARG A CG    1 
ATOM   789  C  CD    . ARG A 1 106  ? 35.536  -10.771 -40.626 1.00 51.28  ? 332  ARG A CD    1 
ATOM   790  N  NE    . ARG A 1 106  ? 35.876  -9.350  -40.671 1.00 50.30  ? 332  ARG A NE    1 
ATOM   791  C  CZ    . ARG A 1 106  ? 35.623  -8.535  -41.687 1.00 48.01  ? 332  ARG A CZ    1 
ATOM   792  N  NH1   . ARG A 1 106  ? 35.019  -8.975  -42.777 1.00 47.83  ? 332  ARG A NH1   1 
ATOM   793  N  NH2   . ARG A 1 106  ? 35.977  -7.263  -41.608 1.00 48.36  ? 332  ARG A NH2   1 
ATOM   794  N  N     . GLN A 1 107  ? 40.678  -12.846 -42.057 1.00 52.38  ? 333  GLN A N     1 
ATOM   795  C  CA    . GLN A 1 107  ? 41.876  -12.944 -42.881 1.00 52.60  ? 333  GLN A CA    1 
ATOM   796  C  C     . GLN A 1 107  ? 41.469  -12.753 -44.351 1.00 52.45  ? 333  GLN A C     1 
ATOM   797  O  O     . GLN A 1 107  ? 40.379  -13.169 -44.758 1.00 52.48  ? 333  GLN A O     1 
ATOM   798  C  CB    . GLN A 1 107  ? 42.524  -14.326 -42.663 1.00 52.88  ? 333  GLN A CB    1 
ATOM   799  C  CG    . GLN A 1 107  ? 44.060  -14.358 -42.576 1.00 53.78  ? 333  GLN A CG    1 
ATOM   800  C  CD    . GLN A 1 107  ? 44.624  -13.584 -41.374 1.00 55.28  ? 333  GLN A CD    1 
ATOM   801  O  OE1   . GLN A 1 107  ? 43.928  -13.342 -40.386 1.00 55.60  ? 333  GLN A OE1   1 
ATOM   802  N  NE2   . GLN A 1 107  ? 45.895  -13.199 -41.462 1.00 54.71  ? 333  GLN A NE2   1 
ATOM   803  N  N     . ASP A 1 108  ? 42.324  -12.109 -45.141 1.00 52.08  ? 334  ASP A N     1 
ATOM   804  C  CA    . ASP A 1 108  ? 42.055  -11.940 -46.571 1.00 51.92  ? 334  ASP A CA    1 
ATOM   805  C  C     . ASP A 1 108  ? 42.860  -12.935 -47.388 1.00 51.70  ? 334  ASP A C     1 
ATOM   806  O  O     . ASP A 1 108  ? 44.066  -12.803 -47.502 1.00 51.39  ? 334  ASP A O     1 
ATOM   807  C  CB    . ASP A 1 108  ? 42.403  -10.523 -47.018 1.00 51.96  ? 334  ASP A CB    1 
ATOM   808  C  CG    . ASP A 1 108  ? 42.062  -10.265 -48.478 1.00 52.72  ? 334  ASP A CG    1 
ATOM   809  O  OD1   . ASP A 1 108  ? 42.613  -10.962 -49.357 1.00 53.30  ? 334  ASP A OD1   1 
ATOM   810  O  OD2   . ASP A 1 108  ? 41.260  -9.348  -48.755 1.00 53.85  ? 334  ASP A OD2   1 
ATOM   811  N  N     . THR A 1 109  ? 42.198  -13.918 -47.979 1.00 51.91  ? 335  THR A N     1 
ATOM   812  C  CA    . THR A 1 109  ? 42.930  -15.069 -48.506 1.00 52.32  ? 335  THR A CA    1 
ATOM   813  C  C     . THR A 1 109  ? 43.282  -15.040 -49.995 1.00 52.76  ? 335  THR A C     1 
ATOM   814  O  O     . THR A 1 109  ? 43.949  -15.953 -50.479 1.00 53.09  ? 335  THR A O     1 
ATOM   815  C  CB    . THR A 1 109  ? 42.235  -16.422 -48.157 1.00 52.23  ? 335  THR A CB    1 
ATOM   816  O  OG1   . THR A 1 109  ? 41.040  -16.583 -48.930 1.00 51.83  ? 335  THR A OG1   1 
ATOM   817  C  CG2   . THR A 1 109  ? 41.893  -16.487 -46.673 1.00 52.27  ? 335  THR A CG2   1 
ATOM   818  N  N     . ALA A 1 110  ? 42.836  -14.028 -50.732 1.00 53.17  ? 336  ALA A N     1 
ATOM   819  C  CA    . ALA A 1 110  ? 43.248  -13.914 -52.133 1.00 53.83  ? 336  ALA A CA    1 
ATOM   820  C  C     . ALA A 1 110  ? 44.775  -13.809 -52.177 1.00 54.25  ? 336  ALA A C     1 
ATOM   821  O  O     . ALA A 1 110  ? 45.393  -13.452 -51.172 1.00 54.54  ? 336  ALA A O     1 
ATOM   822  C  CB    . ALA A 1 110  ? 42.611  -12.702 -52.783 1.00 53.69  ? 336  ALA A CB    1 
ATOM   823  N  N     . PRO A 1 111  ? 45.391  -14.132 -53.329 1.00 54.47  ? 337  PRO A N     1 
ATOM   824  C  CA    . PRO A 1 111  ? 46.850  -14.076 -53.457 1.00 54.79  ? 337  PRO A CA    1 
ATOM   825  C  C     . PRO A 1 111  ? 47.342  -12.639 -53.502 1.00 55.21  ? 337  PRO A C     1 
ATOM   826  O  O     . PRO A 1 111  ? 46.599  -11.751 -53.932 1.00 55.55  ? 337  PRO A O     1 
ATOM   827  C  CB    . PRO A 1 111  ? 47.120  -14.751 -54.811 1.00 54.82  ? 337  PRO A CB    1 
ATOM   828  C  CG    . PRO A 1 111  ? 45.815  -15.396 -55.223 1.00 54.60  ? 337  PRO A CG    1 
ATOM   829  C  CD    . PRO A 1 111  ? 44.746  -14.567 -54.576 1.00 54.65  ? 337  PRO A CD    1 
ATOM   830  N  N     . GLU A 1 112  ? 48.571  -12.399 -53.044 1.00 55.41  ? 338  GLU A N     1 
ATOM   831  C  CA    . GLU A 1 112  ? 49.168  -11.068 -53.164 1.00 55.34  ? 338  GLU A CA    1 
ATOM   832  C  C     . GLU A 1 112  ? 49.187  -10.653 -54.640 1.00 54.85  ? 338  GLU A C     1 
ATOM   833  O  O     . GLU A 1 112  ? 49.419  -11.480 -55.523 1.00 55.12  ? 338  GLU A O     1 
ATOM   834  C  CB    . GLU A 1 112  ? 50.590  -11.045 -52.585 1.00 55.81  ? 338  GLU A CB    1 
ATOM   835  C  CG    . GLU A 1 112  ? 51.265  -9.638  -52.599 1.00 57.11  ? 338  GLU A CG    1 
ATOM   836  C  CD    . GLU A 1 112  ? 52.743  -9.654  -52.181 1.00 58.84  ? 338  GLU A CD    1 
ATOM   837  O  OE1   . GLU A 1 112  ? 53.347  -10.749 -52.080 1.00 59.82  ? 338  GLU A OE1   1 
ATOM   838  O  OE2   . GLU A 1 112  ? 53.309  -8.559  -51.956 1.00 59.94  ? 338  GLU A OE2   1 
ATOM   839  N  N     . GLY A 1 113  ? 48.963  -9.372  -54.904 1.00 54.24  ? 339  GLY A N     1 
ATOM   840  C  CA    . GLY A 1 113  ? 48.885  -8.896  -56.275 1.00 52.95  ? 339  GLY A CA    1 
ATOM   841  C  C     . GLY A 1 113  ? 47.472  -9.004  -56.805 1.00 52.09  ? 339  GLY A C     1 
ATOM   842  O  O     . GLY A 1 113  ? 47.084  -8.265  -57.704 1.00 52.31  ? 339  GLY A O     1 
ATOM   843  N  N     . GLU A 1 114  ? 46.689  -9.914  -56.235 1.00 51.04  ? 340  GLU A N     1 
ATOM   844  C  CA    . GLU A 1 114  ? 45.318  -10.132 -56.709 1.00 50.37  ? 340  GLU A CA    1 
ATOM   845  C  C     . GLU A 1 114  ? 44.266  -9.682  -55.690 1.00 49.70  ? 340  GLU A C     1 
ATOM   846  O  O     . GLU A 1 114  ? 43.217  -10.314 -55.543 1.00 49.71  ? 340  GLU A O     1 
ATOM   847  C  CB    . GLU A 1 114  ? 45.097  -11.601 -57.108 1.00 50.12  ? 340  GLU A CB    1 
ATOM   848  N  N     . LYS A 1 115  ? 44.551  -8.578  -55.012 1.00 48.79  ? 341  LYS A N     1 
ATOM   849  C  CA    . LYS A 1 115  ? 43.678  -8.050  -53.973 1.00 48.05  ? 341  LYS A CA    1 
ATOM   850  C  C     . LYS A 1 115  ? 42.693  -6.977  -54.460 1.00 47.18  ? 341  LYS A C     1 
ATOM   851  O  O     . LYS A 1 115  ? 42.901  -6.307  -55.464 1.00 46.91  ? 341  LYS A O     1 
ATOM   852  C  CB    . LYS A 1 115  ? 44.511  -7.532  -52.784 1.00 48.14  ? 341  LYS A CB    1 
ATOM   853  C  CG    . LYS A 1 115  ? 44.500  -8.433  -51.528 1.00 49.33  ? 341  LYS A CG    1 
ATOM   854  C  CD    . LYS A 1 115  ? 45.377  -9.687  -51.654 1.00 50.89  ? 341  LYS A CD    1 
ATOM   855  C  CE    . LYS A 1 115  ? 45.918  -10.171 -50.293 1.00 52.16  ? 341  LYS A CE    1 
ATOM   856  N  NZ    . LYS A 1 115  ? 44.983  -10.969 -49.432 1.00 51.38  ? 341  LYS A NZ    1 
ATOM   857  N  N     . ARG A 1 116  ? 41.625  -6.842  -53.692 1.00 46.37  ? 342  ARG A N     1 
ATOM   858  C  CA    . ARG A 1 116  ? 40.530  -5.914  -53.879 1.00 45.74  ? 342  ARG A CA    1 
ATOM   859  C  C     . ARG A 1 116  ? 40.851  -4.461  -53.442 1.00 45.40  ? 342  ARG A C     1 
ATOM   860  O  O     . ARG A 1 116  ? 41.690  -4.250  -52.552 1.00 45.49  ? 342  ARG A O     1 
ATOM   861  C  CB    . ARG A 1 116  ? 39.436  -6.448  -52.962 1.00 46.08  ? 342  ARG A CB    1 
ATOM   862  C  CG    . ARG A 1 116  ? 38.099  -5.836  -53.145 1.00 46.81  ? 342  ARG A CG    1 
ATOM   863  C  CD    . ARG A 1 116  ? 37.267  -5.916  -51.881 1.00 45.44  ? 342  ARG A CD    1 
ATOM   864  N  NE    . ARG A 1 116  ? 36.180  -4.977  -52.077 1.00 47.02  ? 342  ARG A NE    1 
ATOM   865  C  CZ    . ARG A 1 116  ? 35.556  -4.333  -51.111 1.00 48.19  ? 342  ARG A CZ    1 
ATOM   866  N  NH1   . ARG A 1 116  ? 35.891  -4.544  -49.839 1.00 47.82  ? 342  ARG A NH1   1 
ATOM   867  N  NH2   . ARG A 1 116  ? 34.583  -3.490  -51.432 1.00 48.83  ? 342  ARG A NH2   1 
ATOM   868  N  N     . VAL A 1 117  ? 40.179  -3.465  -54.036 1.00 44.45  ? 343  VAL A N     1 
ATOM   869  C  CA    . VAL A 1 117  ? 40.180  -2.081  -53.493 1.00 43.42  ? 343  VAL A CA    1 
ATOM   870  C  C     . VAL A 1 117  ? 38.760  -1.603  -53.163 1.00 42.93  ? 343  VAL A C     1 
ATOM   871  O  O     . VAL A 1 117  ? 37.862  -1.686  -54.003 1.00 42.69  ? 343  VAL A O     1 
ATOM   872  C  CB    . VAL A 1 117  ? 40.832  -1.013  -54.457 1.00 43.69  ? 343  VAL A CB    1 
ATOM   873  C  CG1   . VAL A 1 117  ? 40.590  0.419   -53.942 1.00 42.33  ? 343  VAL A CG1   1 
ATOM   874  C  CG2   . VAL A 1 117  ? 42.325  -1.262  -54.654 1.00 43.06  ? 343  VAL A CG2   1 
ATOM   875  N  N     . GLU A 1 118  ? 38.579  -1.081  -51.949 1.00 42.11  ? 344  GLU A N     1 
ATOM   876  C  CA    . GLU A 1 118  ? 37.313  -0.504  -51.502 1.00 41.56  ? 344  GLU A CA    1 
ATOM   877  C  C     . GLU A 1 118  ? 37.177  0.943   -51.967 1.00 41.58  ? 344  GLU A C     1 
ATOM   878  O  O     . GLU A 1 118  ? 38.076  1.772   -51.721 1.00 42.17  ? 344  GLU A O     1 
ATOM   879  C  CB    . GLU A 1 118  ? 37.213  -0.577  -49.972 1.00 41.63  ? 344  GLU A CB    1 
ATOM   880  C  CG    . GLU A 1 118  ? 35.909  -0.075  -49.440 1.00 40.97  ? 344  GLU A CG    1 
ATOM   881  C  CD    . GLU A 1 118  ? 34.743  -0.668  -50.204 1.00 42.94  ? 344  GLU A CD    1 
ATOM   882  O  OE1   . GLU A 1 118  ? 34.272  -1.769  -49.839 1.00 43.05  ? 344  GLU A OE1   1 
ATOM   883  O  OE2   . GLU A 1 118  ? 34.286  -0.017  -51.166 1.00 43.94  ? 344  GLU A OE2   1 
ATOM   884  N  N     . LEU A 1 119  ? 36.057  1.260   -52.617 1.00 41.29  ? 345  LEU A N     1 
ATOM   885  C  CA    . LEU A 1 119  ? 35.914  2.546   -53.329 1.00 41.03  ? 345  LEU A CA    1 
ATOM   886  C  C     . LEU A 1 119  ? 34.804  3.385   -52.740 1.00 40.98  ? 345  LEU A C     1 
ATOM   887  O  O     . LEU A 1 119  ? 34.553  4.508   -53.195 1.00 41.09  ? 345  LEU A O     1 
ATOM   888  C  CB    . LEU A 1 119  ? 35.615  2.328   -54.818 1.00 40.31  ? 345  LEU A CB    1 
ATOM   889  C  CG    . LEU A 1 119  ? 36.673  1.526   -55.569 1.00 40.74  ? 345  LEU A CG    1 
ATOM   890  C  CD1   . LEU A 1 119  ? 36.226  1.107   -56.990 1.00 40.47  ? 345  LEU A CD1   1 
ATOM   891  C  CD2   . LEU A 1 119  ? 37.958  2.345   -55.616 1.00 41.07  ? 345  LEU A CD2   1 
ATOM   892  N  N     . HIS A 1 120  ? 34.134  2.839   -51.738 1.00 40.46  ? 346  HIS A N     1 
ATOM   893  C  CA    . HIS A 1 120  ? 32.964  3.487   -51.195 1.00 40.61  ? 346  HIS A CA    1 
ATOM   894  C  C     . HIS A 1 120  ? 32.880  3.217   -49.707 1.00 40.00  ? 346  HIS A C     1 
ATOM   895  O  O     . HIS A 1 120  ? 32.439  2.141   -49.315 1.00 39.69  ? 346  HIS A O     1 
ATOM   896  C  CB    . HIS A 1 120  ? 31.723  2.905   -51.859 1.00 40.98  ? 346  HIS A CB    1 
ATOM   897  C  CG    . HIS A 1 120  ? 30.481  3.691   -51.593 1.00 43.03  ? 346  HIS A CG    1 
ATOM   898  N  ND1   . HIS A 1 120  ? 29.516  3.912   -52.552 1.00 45.16  ? 346  HIS A ND1   1 
ATOM   899  C  CD2   . HIS A 1 120  ? 30.059  4.332   -50.479 1.00 44.55  ? 346  HIS A CD2   1 
ATOM   900  C  CE1   . HIS A 1 120  ? 28.547  4.646   -52.035 1.00 44.43  ? 346  HIS A CE1   1 
ATOM   901  N  NE2   . HIS A 1 120  ? 28.854  4.916   -50.779 1.00 44.91  ? 346  HIS A NE2   1 
ATOM   902  N  N     . LEU A 1 121  ? 33.286  4.177   -48.872 1.00 39.06  ? 347  LEU A N     1 
ATOM   903  C  CA    . LEU A 1 121  ? 33.463  3.876   -47.452 1.00 37.93  ? 347  LEU A CA    1 
ATOM   904  C  C     . LEU A 1 121  ? 33.204  5.077   -46.551 1.00 37.92  ? 347  LEU A C     1 
ATOM   905  O  O     . LEU A 1 121  ? 33.622  6.187   -46.870 1.00 38.53  ? 347  LEU A O     1 
ATOM   906  C  CB    . LEU A 1 121  ? 34.868  3.297   -47.228 1.00 37.41  ? 347  LEU A CB    1 
ATOM   907  C  CG    . LEU A 1 121  ? 35.484  3.256   -45.821 1.00 37.67  ? 347  LEU A CG    1 
ATOM   908  C  CD1   . LEU A 1 121  ? 36.504  2.123   -45.721 1.00 36.35  ? 347  LEU A CD1   1 
ATOM   909  C  CD2   . LEU A 1 121  ? 36.146  4.583   -45.471 1.00 35.64  ? 347  LEU A CD2   1 
ATOM   910  N  N     . HIS A 1 122  ? 32.524  4.852   -45.426 1.00 37.35  ? 348  HIS A N     1 
ATOM   911  C  CA    . HIS A 1 122  ? 32.191  5.904   -44.475 1.00 37.07  ? 348  HIS A CA    1 
ATOM   912  C  C     . HIS A 1 122  ? 32.937  5.777   -43.157 1.00 36.97  ? 348  HIS A C     1 
ATOM   913  O  O     . HIS A 1 122  ? 33.121  4.679   -42.634 1.00 36.38  ? 348  HIS A O     1 
ATOM   914  C  CB    . HIS A 1 122  ? 30.710  5.883   -44.151 1.00 37.56  ? 348  HIS A CB    1 
ATOM   915  C  CG    . HIS A 1 122  ? 29.835  6.201   -45.317 1.00 39.84  ? 348  HIS A CG    1 
ATOM   916  N  ND1   . HIS A 1 122  ? 29.309  7.457   -45.532 1.00 41.19  ? 348  HIS A ND1   1 
ATOM   917  C  CD2   . HIS A 1 122  ? 29.395  5.427   -46.335 1.00 39.74  ? 348  HIS A CD2   1 
ATOM   918  C  CE1   . HIS A 1 122  ? 28.581  7.443   -46.632 1.00 40.49  ? 348  HIS A CE1   1 
ATOM   919  N  NE2   . HIS A 1 122  ? 28.618  6.223   -47.137 1.00 41.70  ? 348  HIS A NE2   1 
ATOM   920  N  N     . THR A 1 123  ? 33.329  6.932   -42.625 1.00 36.58  ? 349  THR A N     1 
ATOM   921  C  CA    . THR A 1 123  ? 34.028  7.060   -41.364 1.00 36.22  ? 349  THR A CA    1 
ATOM   922  C  C     . THR A 1 123  ? 33.102  7.732   -40.328 1.00 36.79  ? 349  THR A C     1 
ATOM   923  O  O     . THR A 1 123  ? 32.007  8.187   -40.688 1.00 36.63  ? 349  THR A O     1 
ATOM   924  C  CB    . THR A 1 123  ? 35.262  7.945   -41.573 1.00 35.96  ? 349  THR A CB    1 
ATOM   925  O  OG1   . THR A 1 123  ? 34.834  9.303   -41.696 1.00 34.99  ? 349  THR A OG1   1 
ATOM   926  C  CG2   . THR A 1 123  ? 35.992  7.533   -42.850 1.00 35.24  ? 349  THR A CG2   1 
ATOM   927  N  N     . PRO A 1 124  ? 33.533  7.813   -39.044 1.00 37.10  ? 350  PRO A N     1 
ATOM   928  C  CA    . PRO A 1 124  ? 32.715  8.477   -38.006 1.00 37.39  ? 350  PRO A CA    1 
ATOM   929  C  C     . PRO A 1 124  ? 32.352  9.940   -38.313 1.00 37.87  ? 350  PRO A C     1 
ATOM   930  O  O     . PRO A 1 124  ? 31.518  10.521  -37.606 1.00 37.57  ? 350  PRO A O     1 
ATOM   931  C  CB    . PRO A 1 124  ? 33.605  8.403   -36.755 1.00 37.44  ? 350  PRO A CB    1 
ATOM   932  C  CG    . PRO A 1 124  ? 34.478  7.184   -37.010 1.00 37.20  ? 350  PRO A CG    1 
ATOM   933  C  CD    . PRO A 1 124  ? 34.768  7.241   -38.481 1.00 36.70  ? 350  PRO A CD    1 
ATOM   934  N  N     . MET A 1 125  ? 32.991  10.527  -39.330 1.00 37.93  ? 351  MET A N     1 
ATOM   935  C  CA    . MET A 1 125  ? 32.622  11.868  -39.814 1.00 38.54  ? 351  MET A CA    1 
ATOM   936  C  C     . MET A 1 125  ? 31.300  11.914  -40.635 1.00 38.75  ? 351  MET A C     1 
ATOM   937  O  O     . MET A 1 125  ? 30.739  12.994  -40.884 1.00 37.39  ? 351  MET A O     1 
ATOM   938  C  CB    . MET A 1 125  ? 33.767  12.496  -40.618 1.00 38.53  ? 351  MET A CB    1 
ATOM   939  C  CG    . MET A 1 125  ? 34.961  12.904  -39.789 1.00 37.42  ? 351  MET A CG    1 
ATOM   940  S  SD    . MET A 1 125  ? 34.511  13.810  -38.300 1.00 38.45  ? 351  MET A SD    1 
ATOM   941  C  CE    . MET A 1 125  ? 34.515  12.545  -37.014 1.00 38.76  ? 351  MET A CE    1 
ATOM   942  N  N     . SER A 1 126  ? 30.800  10.742  -41.038 1.00 39.74  ? 352  SER A N     1 
ATOM   943  C  CA    . SER A 1 126  ? 29.472  10.662  -41.665 1.00 39.96  ? 352  SER A CA    1 
ATOM   944  C  C     . SER A 1 126  ? 28.468  10.757  -40.557 1.00 40.66  ? 352  SER A C     1 
ATOM   945  O  O     . SER A 1 126  ? 28.132  9.760   -39.914 1.00 41.30  ? 352  SER A O     1 
ATOM   946  C  CB    . SER A 1 126  ? 29.303  9.379   -42.446 1.00 39.52  ? 352  SER A CB    1 
ATOM   947  O  OG    . SER A 1 126  ? 29.833  9.534   -43.755 1.00 40.81  ? 352  SER A OG    1 
ATOM   948  N  N     . GLN A 1 127  ? 28.022  11.987  -40.325 1.00 41.02  ? 353  GLN A N     1 
ATOM   949  C  CA    . GLN A 1 127  ? 27.324  12.367  -39.122 1.00 41.51  ? 353  GLN A CA    1 
ATOM   950  C  C     . GLN A 1 127  ? 26.420  11.261  -38.568 1.00 41.12  ? 353  GLN A C     1 
ATOM   951  O  O     . GLN A 1 127  ? 25.433  10.897  -39.194 1.00 40.78  ? 353  GLN A O     1 
ATOM   952  C  CB    . GLN A 1 127  ? 26.510  13.634  -39.386 1.00 41.87  ? 353  GLN A CB    1 
ATOM   953  C  CG    . GLN A 1 127  ? 26.168  14.410  -38.120 1.00 45.75  ? 353  GLN A CG    1 
ATOM   954  C  CD    . GLN A 1 127  ? 24.853  15.174  -38.246 1.00 51.11  ? 353  GLN A CD    1 
ATOM   955  O  OE1   . GLN A 1 127  ? 24.834  16.354  -38.630 1.00 51.91  ? 353  GLN A OE1   1 
ATOM   956  N  NE2   . GLN A 1 127  ? 23.740  14.496  -37.932 1.00 52.11  ? 353  GLN A NE2   1 
ATOM   957  N  N     . MET A 1 128  ? 26.758  10.744  -37.387 1.00 41.05  ? 354  MET A N     1 
ATOM   958  C  CA    . MET A 1 128  ? 25.868  9.822   -36.659 1.00 40.77  ? 354  MET A CA    1 
ATOM   959  C  C     . MET A 1 128  ? 25.517  8.618   -37.514 1.00 40.60  ? 354  MET A C     1 
ATOM   960  O  O     . MET A 1 128  ? 24.421  8.077   -37.385 1.00 41.35  ? 354  MET A O     1 
ATOM   961  C  CB    . MET A 1 128  ? 24.554  10.512  -36.268 1.00 40.19  ? 354  MET A CB    1 
ATOM   962  C  CG    . MET A 1 128  ? 24.655  11.595  -35.235 1.00 40.60  ? 354  MET A CG    1 
ATOM   963  S  SD    . MET A 1 128  ? 24.882  10.913  -33.576 1.00 45.68  ? 354  MET A SD    1 
ATOM   964  C  CE    . MET A 1 128  ? 26.640  11.166  -33.420 1.00 47.90  ? 354  MET A CE    1 
ATOM   965  N  N     . ASP A 1 129  ? 26.420  8.191   -38.390 1.00 40.09  ? 355  ASP A N     1 
ATOM   966  C  CA    . ASP A 1 129  ? 26.051  7.154   -39.360 1.00 39.63  ? 355  ASP A CA    1 
ATOM   967  C  C     . ASP A 1 129  ? 27.075  6.021   -39.504 1.00 39.15  ? 355  ASP A C     1 
ATOM   968  O  O     . ASP A 1 129  ? 26.745  4.947   -40.004 1.00 39.25  ? 355  ASP A O     1 
ATOM   969  C  CB    . ASP A 1 129  ? 25.769  7.780   -40.744 1.00 39.64  ? 355  ASP A CB    1 
ATOM   970  C  CG    . ASP A 1 129  ? 24.860  6.903   -41.619 1.00 40.82  ? 355  ASP A CG    1 
ATOM   971  O  OD1   . ASP A 1 129  ? 25.201  6.706   -42.804 1.00 39.95  ? 355  ASP A OD1   1 
ATOM   972  O  OD2   . ASP A 1 129  ? 23.804  6.402   -41.121 1.00 42.92  ? 355  ASP A OD2   1 
ATOM   973  N  N     . ALA A 1 130  ? 28.311  6.260   -39.088 1.00 38.56  ? 356  ALA A N     1 
ATOM   974  C  CA    . ALA A 1 130  ? 29.365  5.281   -39.291 1.00 38.37  ? 356  ALA A CA    1 
ATOM   975  C  C     . ALA A 1 130  ? 30.199  5.224   -38.012 1.00 38.25  ? 356  ALA A C     1 
ATOM   976  O  O     . ALA A 1 130  ? 30.056  6.092   -37.163 1.00 38.43  ? 356  ALA A O     1 
ATOM   977  C  CB    . ALA A 1 130  ? 30.201  5.644   -40.515 1.00 37.80  ? 356  ALA A CB    1 
ATOM   978  N  N     . VAL A 1 131  ? 31.064  4.229   -37.856 1.00 37.90  ? 357  VAL A N     1 
ATOM   979  C  CA    . VAL A 1 131  ? 31.456  3.871   -36.503 1.00 38.60  ? 357  VAL A CA    1 
ATOM   980  C  C     . VAL A 1 131  ? 32.935  3.506   -36.273 1.00 38.72  ? 357  VAL A C     1 
ATOM   981  O  O     . VAL A 1 131  ? 33.438  3.614   -35.152 1.00 38.42  ? 357  VAL A O     1 
ATOM   982  C  CB    . VAL A 1 131  ? 30.498  2.740   -35.997 1.00 38.78  ? 357  VAL A CB    1 
ATOM   983  C  CG1   . VAL A 1 131  ? 31.224  1.700   -35.189 1.00 38.43  ? 357  VAL A CG1   1 
ATOM   984  C  CG2   . VAL A 1 131  ? 29.296  3.337   -35.265 1.00 38.91  ? 357  VAL A CG2   1 
ATOM   985  N  N     . THR A 1 132  ? 33.627  3.076   -37.320 1.00 38.76  ? 358  THR A N     1 
ATOM   986  C  CA    . THR A 1 132  ? 35.017  2.692   -37.174 1.00 38.85  ? 358  THR A CA    1 
ATOM   987  C  C     . THR A 1 132  ? 35.940  3.782   -37.706 1.00 39.22  ? 358  THR A C     1 
ATOM   988  O  O     . THR A 1 132  ? 35.795  4.224   -38.842 1.00 38.56  ? 358  THR A O     1 
ATOM   989  C  CB    . THR A 1 132  ? 35.312  1.397   -37.932 1.00 39.04  ? 358  THR A CB    1 
ATOM   990  O  OG1   . THR A 1 132  ? 34.408  0.373   -37.500 1.00 39.52  ? 358  THR A OG1   1 
ATOM   991  C  CG2   . THR A 1 132  ? 36.739  0.959   -37.674 1.00 38.19  ? 358  THR A CG2   1 
ATOM   992  N  N     . SER A 1 133  ? 36.905  4.202   -36.891 1.00 39.73  ? 359  SER A N     1 
ATOM   993  C  CA    . SER A 1 133  ? 37.766  5.308   -37.269 1.00 40.21  ? 359  SER A CA    1 
ATOM   994  C  C     . SER A 1 133  ? 38.474  5.003   -38.581 1.00 40.94  ? 359  SER A C     1 
ATOM   995  O  O     . SER A 1 133  ? 38.756  3.852   -38.890 1.00 41.43  ? 359  SER A O     1 
ATOM   996  C  CB    . SER A 1 133  ? 38.792  5.589   -36.180 1.00 40.13  ? 359  SER A CB    1 
ATOM   997  O  OG    . SER A 1 133  ? 39.775  4.574   -36.152 1.00 39.91  ? 359  SER A OG    1 
ATOM   998  N  N     . VAL A 1 134  ? 38.780  6.038   -39.347 1.00 41.58  ? 360  VAL A N     1 
ATOM   999  C  CA    . VAL A 1 134  ? 39.390  5.846   -40.646 1.00 42.25  ? 360  VAL A CA    1 
ATOM   1000 C  C     . VAL A 1 134  ? 40.762  5.187   -40.490 1.00 42.39  ? 360  VAL A C     1 
ATOM   1001 O  O     . VAL A 1 134  ? 41.215  4.448   -41.360 1.00 42.49  ? 360  VAL A O     1 
ATOM   1002 C  CB    . VAL A 1 134  ? 39.451  7.202   -41.412 1.00 42.41  ? 360  VAL A CB    1 
ATOM   1003 C  CG1   . VAL A 1 134  ? 40.372  8.195   -40.706 1.00 42.82  ? 360  VAL A CG1   1 
ATOM   1004 C  CG2   . VAL A 1 134  ? 39.832  6.996   -42.874 1.00 42.74  ? 360  VAL A CG2   1 
ATOM   1005 N  N     . THR A 1 135  ? 41.414  5.465   -39.367 1.00 43.08  ? 361  THR A N     1 
ATOM   1006 C  CA    . THR A 1 135  ? 42.714  4.898   -39.037 1.00 43.64  ? 361  THR A CA    1 
ATOM   1007 C  C     . THR A 1 135  ? 42.622  3.381   -38.896 1.00 43.91  ? 361  THR A C     1 
ATOM   1008 O  O     . THR A 1 135  ? 43.466  2.652   -39.407 1.00 44.87  ? 361  THR A O     1 
ATOM   1009 C  CB    . THR A 1 135  ? 43.285  5.551   -37.754 1.00 43.96  ? 361  THR A CB    1 
ATOM   1010 O  OG1   . THR A 1 135  ? 43.426  6.959   -37.979 1.00 44.27  ? 361  THR A OG1   1 
ATOM   1011 C  CG2   . THR A 1 135  ? 44.652  4.981   -37.393 1.00 43.74  ? 361  THR A CG2   1 
ATOM   1012 N  N     . LYS A 1 136  ? 41.576  2.888   -38.253 1.00 43.75  ? 362  LYS A N     1 
ATOM   1013 C  CA    . LYS A 1 136  ? 41.416  1.429   -38.147 1.00 43.70  ? 362  LYS A CA    1 
ATOM   1014 C  C     . LYS A 1 136  ? 41.070  0.769   -39.477 1.00 42.83  ? 362  LYS A C     1 
ATOM   1015 O  O     . LYS A 1 136  ? 41.584  -0.306  -39.778 1.00 43.10  ? 362  LYS A O     1 
ATOM   1016 C  CB    . LYS A 1 136  ? 40.491  1.012   -36.978 1.00 43.56  ? 362  LYS A CB    1 
ATOM   1017 C  CG    . LYS A 1 136  ? 41.204  1.162   -35.616 1.00 46.29  ? 362  LYS A CG    1 
ATOM   1018 C  CD    . LYS A 1 136  ? 40.341  0.924   -34.340 1.00 51.52  ? 362  LYS A CD    1 
ATOM   1019 C  CE    . LYS A 1 136  ? 40.228  -0.582  -33.981 1.00 54.69  ? 362  LYS A CE    1 
ATOM   1020 N  NZ    . LYS A 1 136  ? 39.809  -0.842  -32.550 1.00 55.16  ? 362  LYS A NZ    1 
ATOM   1021 N  N     . LEU A 1 137  ? 40.229  1.405   -40.288 1.00 42.46  ? 363  LEU A N     1 
ATOM   1022 C  CA    . LEU A 1 137  ? 39.957  0.880   -41.632 1.00 41.94  ? 363  LEU A CA    1 
ATOM   1023 C  C     . LEU A 1 137  ? 41.224  0.838   -42.484 1.00 42.18  ? 363  LEU A C     1 
ATOM   1024 O  O     . LEU A 1 137  ? 41.544  -0.174  -43.116 1.00 41.78  ? 363  LEU A O     1 
ATOM   1025 C  CB    . LEU A 1 137  ? 38.902  1.701   -42.356 1.00 41.76  ? 363  LEU A CB    1 
ATOM   1026 C  CG    . LEU A 1 137  ? 37.423  1.533   -42.017 1.00 41.75  ? 363  LEU A CG    1 
ATOM   1027 C  CD1   . LEU A 1 137  ? 37.148  0.291   -41.176 1.00 41.76  ? 363  LEU A CD1   1 
ATOM   1028 C  CD2   . LEU A 1 137  ? 36.890  2.779   -41.362 1.00 41.55  ? 363  LEU A CD2   1 
ATOM   1029 N  N     . ILE A 1 138  ? 41.942  1.951   -42.514 1.00 42.25  ? 364  ILE A N     1 
ATOM   1030 C  CA    . ILE A 1 138  ? 43.201  1.986   -43.234 1.00 42.56  ? 364  ILE A CA    1 
ATOM   1031 C  C     . ILE A 1 138  ? 44.170  0.877   -42.763 1.00 43.33  ? 364  ILE A C     1 
ATOM   1032 O  O     . ILE A 1 138  ? 44.765  0.192   -43.599 1.00 43.76  ? 364  ILE A O     1 
ATOM   1033 C  CB    . ILE A 1 138  ? 43.809  3.414   -43.235 1.00 42.52  ? 364  ILE A CB    1 
ATOM   1034 C  CG1   . ILE A 1 138  ? 42.946  4.323   -44.136 1.00 41.70  ? 364  ILE A CG1   1 
ATOM   1035 C  CG2   . ILE A 1 138  ? 45.255  3.391   -43.694 1.00 41.82  ? 364  ILE A CG2   1 
ATOM   1036 C  CD1   . ILE A 1 138  ? 43.171  5.809   -43.978 1.00 39.71  ? 364  ILE A CD1   1 
ATOM   1037 N  N     . GLU A 1 139  ? 44.314  0.669   -41.450 1.00 43.63  ? 365  GLU A N     1 
ATOM   1038 C  CA    . GLU A 1 139  ? 45.153  -0.445  -40.961 1.00 43.99  ? 365  GLU A CA    1 
ATOM   1039 C  C     . GLU A 1 139  ? 44.674  -1.781  -41.506 1.00 43.63  ? 365  GLU A C     1 
ATOM   1040 O  O     . GLU A 1 139  ? 45.468  -2.615  -41.940 1.00 43.68  ? 365  GLU A O     1 
ATOM   1041 C  CB    . GLU A 1 139  ? 45.105  -0.560  -39.446 1.00 44.24  ? 365  GLU A CB    1 
ATOM   1042 C  CG    . GLU A 1 139  ? 45.980  0.365   -38.682 1.00 47.42  ? 365  GLU A CG    1 
ATOM   1043 C  CD    . GLU A 1 139  ? 45.696  0.297   -37.185 1.00 52.33  ? 365  GLU A CD    1 
ATOM   1044 O  OE1   . GLU A 1 139  ? 45.318  -0.815  -36.699 1.00 52.36  ? 365  GLU A OE1   1 
ATOM   1045 O  OE2   . GLU A 1 139  ? 45.858  1.353   -36.509 1.00 51.99  ? 365  GLU A OE2   1 
ATOM   1046 N  N     . GLN A 1 140  ? 43.369  -2.007  -41.427 1.00 43.38  ? 366  GLN A N     1 
ATOM   1047 C  CA    . GLN A 1 140  ? 42.819  -3.284  -41.851 1.00 43.61  ? 366  GLN A CA    1 
ATOM   1048 C  C     . GLN A 1 140  ? 43.104  -3.541  -43.332 1.00 43.82  ? 366  GLN A C     1 
ATOM   1049 O  O     . GLN A 1 140  ? 43.512  -4.649  -43.699 1.00 44.15  ? 366  GLN A O     1 
ATOM   1050 C  CB    . GLN A 1 140  ? 41.319  -3.381  -41.555 1.00 43.43  ? 366  GLN A CB    1 
ATOM   1051 C  CG    . GLN A 1 140  ? 40.700  -4.738  -41.897 1.00 43.49  ? 366  GLN A CG    1 
ATOM   1052 C  CD    . GLN A 1 140  ? 41.232  -5.859  -41.027 1.00 42.14  ? 366  GLN A CD    1 
ATOM   1053 O  OE1   . GLN A 1 140  ? 42.223  -6.509  -41.361 1.00 42.00  ? 366  GLN A OE1   1 
ATOM   1054 N  NE2   . GLN A 1 140  ? 40.580  -6.084  -39.904 1.00 42.01  ? 366  GLN A NE2   1 
ATOM   1055 N  N     . ALA A 1 141  ? 42.902  -2.526  -44.171 1.00 43.62  ? 367  ALA A N     1 
ATOM   1056 C  CA    . ALA A 1 141  ? 43.183  -2.659  -45.594 1.00 43.98  ? 367  ALA A CA    1 
ATOM   1057 C  C     . ALA A 1 141  ? 44.635  -3.043  -45.811 1.00 44.38  ? 367  ALA A C     1 
ATOM   1058 O  O     . ALA A 1 141  ? 44.943  -3.885  -46.667 1.00 44.49  ? 367  ALA A O     1 
ATOM   1059 C  CB    . ALA A 1 141  ? 42.866  -1.362  -46.339 1.00 43.83  ? 367  ALA A CB    1 
ATOM   1060 N  N     . LYS A 1 142  ? 45.523  -2.419  -45.042 1.00 44.62  ? 368  LYS A N     1 
ATOM   1061 C  CA    . LYS A 1 142  ? 46.951  -2.652  -45.181 1.00 45.63  ? 368  LYS A CA    1 
ATOM   1062 C  C     . LYS A 1 142  ? 47.248  -4.109  -44.836 1.00 45.95  ? 368  LYS A C     1 
ATOM   1063 O  O     . LYS A 1 142  ? 47.967  -4.812  -45.556 1.00 45.83  ? 368  LYS A O     1 
ATOM   1064 C  CB    . LYS A 1 142  ? 47.732  -1.709  -44.253 1.00 46.03  ? 368  LYS A CB    1 
ATOM   1065 C  CG    . LYS A 1 142  ? 49.262  -1.928  -44.212 1.00 47.69  ? 368  LYS A CG    1 
ATOM   1066 C  CD    . LYS A 1 142  ? 49.896  -1.951  -45.618 1.00 50.39  ? 368  LYS A CD    1 
ATOM   1067 C  CE    . LYS A 1 142  ? 51.318  -1.381  -45.612 1.00 52.81  ? 368  LYS A CE    1 
ATOM   1068 N  NZ    . LYS A 1 142  ? 51.938  -1.443  -44.241 1.00 53.73  ? 368  LYS A NZ    1 
ATOM   1069 N  N     . LYS A 1 143  ? 46.670  -4.564  -43.734 1.00 46.00  ? 369  LYS A N     1 
ATOM   1070 C  CA    . LYS A 1 143  ? 46.904  -5.915  -43.294 1.00 46.43  ? 369  LYS A CA    1 
ATOM   1071 C  C     . LYS A 1 143  ? 46.364  -6.910  -44.328 1.00 45.86  ? 369  LYS A C     1 
ATOM   1072 O  O     . LYS A 1 143  ? 46.992  -7.936  -44.601 1.00 46.04  ? 369  LYS A O     1 
ATOM   1073 C  CB    . LYS A 1 143  ? 46.268  -6.144  -41.913 1.00 46.84  ? 369  LYS A CB    1 
ATOM   1074 C  CG    . LYS A 1 143  ? 47.153  -6.880  -40.886 1.00 48.59  ? 369  LYS A CG    1 
ATOM   1075 C  CD    . LYS A 1 143  ? 47.767  -8.195  -41.449 1.00 51.46  ? 369  LYS A CD    1 
ATOM   1076 C  CE    . LYS A 1 143  ? 47.736  -9.348  -40.436 1.00 50.98  ? 369  LYS A CE    1 
ATOM   1077 N  NZ    . LYS A 1 143  ? 46.528  -10.194 -40.661 1.00 50.94  ? 369  LYS A NZ    1 
ATOM   1078 N  N     . TRP A 1 144  ? 45.202  -6.610  -44.895 1.00 45.17  ? 370  TRP A N     1 
ATOM   1079 C  CA    . TRP A 1 144  ? 44.614  -7.473  -45.914 1.00 44.47  ? 370  TRP A CA    1 
ATOM   1080 C  C     . TRP A 1 144  ? 45.328  -7.361  -47.263 1.00 44.24  ? 370  TRP A C     1 
ATOM   1081 O  O     . TRP A 1 144  ? 44.938  -8.023  -48.219 1.00 44.26  ? 370  TRP A O     1 
ATOM   1082 C  CB    . TRP A 1 144  ? 43.138  -7.141  -46.122 1.00 44.29  ? 370  TRP A CB    1 
ATOM   1083 C  CG    . TRP A 1 144  ? 42.217  -7.629  -45.033 1.00 43.36  ? 370  TRP A CG    1 
ATOM   1084 C  CD1   . TRP A 1 144  ? 42.478  -8.587  -44.102 1.00 41.91  ? 370  TRP A CD1   1 
ATOM   1085 C  CD2   . TRP A 1 144  ? 40.870  -7.196  -44.796 1.00 42.51  ? 370  TRP A CD2   1 
ATOM   1086 N  NE1   . TRP A 1 144  ? 41.383  -8.767  -43.288 1.00 40.93  ? 370  TRP A NE1   1 
ATOM   1087 C  CE2   . TRP A 1 144  ? 40.386  -7.922  -43.692 1.00 41.37  ? 370  TRP A CE2   1 
ATOM   1088 C  CE3   . TRP A 1 144  ? 40.035  -6.245  -45.398 1.00 42.29  ? 370  TRP A CE3   1 
ATOM   1089 C  CZ2   . TRP A 1 144  ? 39.105  -7.740  -43.187 1.00 41.30  ? 370  TRP A CZ2   1 
ATOM   1090 C  CZ3   . TRP A 1 144  ? 38.769  -6.060  -44.897 1.00 41.28  ? 370  TRP A CZ3   1 
ATOM   1091 C  CH2   . TRP A 1 144  ? 38.311  -6.804  -43.804 1.00 41.89  ? 370  TRP A CH2   1 
ATOM   1092 N  N     . GLY A 1 145  ? 46.337  -6.494  -47.350 1.00 43.88  ? 371  GLY A N     1 
ATOM   1093 C  CA    . GLY A 1 145  ? 47.125  -6.319  -48.580 1.00 42.92  ? 371  GLY A CA    1 
ATOM   1094 C  C     . GLY A 1 145  ? 46.452  -5.559  -49.719 1.00 42.47  ? 371  GLY A C     1 
ATOM   1095 O  O     . GLY A 1 145  ? 46.907  -5.617  -50.862 1.00 41.53  ? 371  GLY A O     1 
ATOM   1096 N  N     . HIS A 1 146  ? 45.365  -4.849  -49.422 1.00 42.35  ? 372  HIS A N     1 
ATOM   1097 C  CA    . HIS A 1 146  ? 44.713  -4.043  -50.446 1.00 42.34  ? 372  HIS A CA    1 
ATOM   1098 C  C     . HIS A 1 146  ? 45.676  -2.962  -50.877 1.00 42.30  ? 372  HIS A C     1 
ATOM   1099 O  O     . HIS A 1 146  ? 46.301  -2.317  -50.026 1.00 42.21  ? 372  HIS A O     1 
ATOM   1100 C  CB    . HIS A 1 146  ? 43.454  -3.395  -49.902 1.00 42.33  ? 372  HIS A CB    1 
ATOM   1101 C  CG    . HIS A 1 146  ? 42.437  -4.373  -49.423 1.00 43.02  ? 372  HIS A CG    1 
ATOM   1102 N  ND1   . HIS A 1 146  ? 41.125  -4.027  -49.190 1.00 44.61  ? 372  HIS A ND1   1 
ATOM   1103 C  CD2   . HIS A 1 146  ? 42.531  -5.698  -49.162 1.00 44.09  ? 372  HIS A CD2   1 
ATOM   1104 C  CE1   . HIS A 1 146  ? 40.455  -5.093  -48.786 1.00 44.82  ? 372  HIS A CE1   1 
ATOM   1105 N  NE2   . HIS A 1 146  ? 41.284  -6.122  -48.766 1.00 44.83  ? 372  HIS A NE2   1 
ATOM   1106 N  N     . PRO A 1 147  ? 45.807  -2.757  -52.197 1.00 41.86  ? 373  PRO A N     1 
ATOM   1107 C  CA    . PRO A 1 147  ? 46.754  -1.770  -52.697 1.00 41.76  ? 373  PRO A CA    1 
ATOM   1108 C  C     . PRO A 1 147  ? 46.295  -0.311  -52.469 1.00 41.56  ? 373  PRO A C     1 
ATOM   1109 O  O     . PRO A 1 147  ? 47.100  0.611   -52.598 1.00 41.10  ? 373  PRO A O     1 
ATOM   1110 C  CB    . PRO A 1 147  ? 46.853  -2.109  -54.203 1.00 41.61  ? 373  PRO A CB    1 
ATOM   1111 C  CG    . PRO A 1 147  ? 45.607  -2.811  -54.522 1.00 41.05  ? 373  PRO A CG    1 
ATOM   1112 C  CD    . PRO A 1 147  ? 45.112  -3.474  -53.282 1.00 41.70  ? 373  PRO A CD    1 
ATOM   1113 N  N     . ALA A 1 148  ? 45.014  -0.112  -52.153 1.00 41.36  ? 374  ALA A N     1 
ATOM   1114 C  CA    . ALA A 1 148  ? 44.500  1.214   -51.811 1.00 41.21  ? 374  ALA A CA    1 
ATOM   1115 C  C     . ALA A 1 148  ? 43.128  1.137   -51.132 1.00 41.20  ? 374  ALA A C     1 
ATOM   1116 O  O     . ALA A 1 148  ? 42.507  0.090   -51.099 1.00 41.40  ? 374  ALA A O     1 
ATOM   1117 C  CB    . ALA A 1 148  ? 44.451  2.111   -53.047 1.00 41.31  ? 374  ALA A CB    1 
ATOM   1118 N  N     . ILE A 1 149  ? 42.665  2.252   -50.583 1.00 41.17  ? 375  ILE A N     1 
ATOM   1119 C  CA    . ILE A 1 149  ? 41.370  2.312   -49.913 1.00 40.98  ? 375  ILE A CA    1 
ATOM   1120 C  C     . ILE A 1 149  ? 40.914  3.750   -50.029 1.00 41.09  ? 375  ILE A C     1 
ATOM   1121 O  O     . ILE A 1 149  ? 41.725  4.662   -49.939 1.00 41.93  ? 375  ILE A O     1 
ATOM   1122 C  CB    . ILE A 1 149  ? 41.459  1.897   -48.417 1.00 40.86  ? 375  ILE A CB    1 
ATOM   1123 C  CG1   . ILE A 1 149  ? 40.057  1.783   -47.794 1.00 41.18  ? 375  ILE A CG1   1 
ATOM   1124 C  CG2   . ILE A 1 149  ? 42.317  2.857   -47.639 1.00 40.35  ? 375  ILE A CG2   1 
ATOM   1125 C  CD1   . ILE A 1 149  ? 40.052  1.548   -46.274 1.00 39.52  ? 375  ILE A CD1   1 
ATOM   1126 N  N     . ALA A 1 150  ? 39.624  3.943   -50.273 1.00 41.33  ? 376  ALA A N     1 
ATOM   1127 C  CA    . ALA A 1 150  ? 39.044  5.256   -50.534 1.00 41.10  ? 376  ALA A CA    1 
ATOM   1128 C  C     . ALA A 1 150  ? 38.253  5.735   -49.327 1.00 41.00  ? 376  ALA A C     1 
ATOM   1129 O  O     . ALA A 1 150  ? 37.730  4.933   -48.552 1.00 41.30  ? 376  ALA A O     1 
ATOM   1130 C  CB    . ALA A 1 150  ? 38.118  5.182   -51.753 1.00 41.20  ? 376  ALA A CB    1 
ATOM   1131 N  N     . VAL A 1 151  ? 38.146  7.045   -49.190 1.00 40.75  ? 377  VAL A N     1 
ATOM   1132 C  CA    . VAL A 1 151  ? 37.371  7.640   -48.127 1.00 40.97  ? 377  VAL A CA    1 
ATOM   1133 C  C     . VAL A 1 151  ? 36.317  8.526   -48.748 1.00 40.61  ? 377  VAL A C     1 
ATOM   1134 O  O     . VAL A 1 151  ? 36.638  9.529   -49.383 1.00 41.36  ? 377  VAL A O     1 
ATOM   1135 C  CB    . VAL A 1 151  ? 38.254  8.486   -47.193 1.00 41.10  ? 377  VAL A CB    1 
ATOM   1136 C  CG1   . VAL A 1 151  ? 37.394  9.202   -46.182 1.00 41.84  ? 377  VAL A CG1   1 
ATOM   1137 C  CG2   . VAL A 1 151  ? 39.226  7.589   -46.486 1.00 41.43  ? 377  VAL A CG2   1 
ATOM   1138 N  N     . THR A 1 152  ? 35.061  8.155   -48.567 1.00 40.04  ? 378  THR A N     1 
ATOM   1139 C  CA    . THR A 1 152  ? 33.975  8.837   -49.226 1.00 39.89  ? 378  THR A CA    1 
ATOM   1140 C  C     . THR A 1 152  ? 32.827  9.070   -48.253 1.00 39.82  ? 378  THR A C     1 
ATOM   1141 O  O     . THR A 1 152  ? 31.786  8.443   -48.364 1.00 40.23  ? 378  THR A O     1 
ATOM   1142 C  CB    . THR A 1 152  ? 33.448  7.990   -50.390 1.00 39.92  ? 378  THR A CB    1 
ATOM   1143 O  OG1   . THR A 1 152  ? 32.987  6.735   -49.878 1.00 40.31  ? 378  THR A OG1   1 
ATOM   1144 C  CG2   . THR A 1 152  ? 34.546  7.739   -51.412 1.00 38.86  ? 378  THR A CG2   1 
ATOM   1145 N  N     . ASP A 1 153  ? 33.014  9.977   -47.308 1.00 39.35  ? 379  ASP A N     1 
ATOM   1146 C  CA    . ASP A 1 153  ? 31.983  10.285  -46.351 1.00 39.30  ? 379  ASP A CA    1 
ATOM   1147 C  C     . ASP A 1 153  ? 30.870  11.095  -47.006 1.00 39.42  ? 379  ASP A C     1 
ATOM   1148 O  O     . ASP A 1 153  ? 31.045  11.671  -48.074 1.00 39.68  ? 379  ASP A O     1 
ATOM   1149 C  CB    . ASP A 1 153  ? 32.577  11.097  -45.205 1.00 39.08  ? 379  ASP A CB    1 
ATOM   1150 C  CG    . ASP A 1 153  ? 33.149  10.228  -44.102 1.00 39.35  ? 379  ASP A CG    1 
ATOM   1151 O  OD1   . ASP A 1 153  ? 32.487  9.233   -43.695 1.00 35.80  ? 379  ASP A OD1   1 
ATOM   1152 O  OD2   . ASP A 1 153  ? 34.253  10.572  -43.624 1.00 39.06  ? 379  ASP A OD2   1 
ATOM   1153 N  N     . HIS A 1 154  ? 29.742  11.180  -46.320 1.00 38.97  ? 380  HIS A N     1 
ATOM   1154 C  CA    . HIS A 1 154  ? 28.566  11.872  -46.834 1.00 38.92  ? 380  HIS A CA    1 
ATOM   1155 C  C     . HIS A 1 154  ? 28.677  13.384  -46.717 1.00 37.82  ? 380  HIS A C     1 
ATOM   1156 O  O     . HIS A 1 154  ? 28.711  13.956  -45.622 1.00 37.39  ? 380  HIS A O     1 
ATOM   1157 C  CB    . HIS A 1 154  ? 27.295  11.346  -46.117 1.00 39.72  ? 380  HIS A CB    1 
ATOM   1158 C  CG    . HIS A 1 154  ? 26.020  11.999  -46.553 1.00 42.79  ? 380  HIS A CG    1 
ATOM   1159 N  ND1   . HIS A 1 154  ? 25.623  12.062  -47.878 1.00 46.93  ? 380  HIS A ND1   1 
ATOM   1160 C  CD2   . HIS A 1 154  ? 25.036  12.593  -45.835 1.00 44.77  ? 380  HIS A CD2   1 
ATOM   1161 C  CE1   . HIS A 1 154  ? 24.455  12.677  -47.954 1.00 46.38  ? 380  HIS A CE1   1 
ATOM   1162 N  NE2   . HIS A 1 154  ? 24.075  13.008  -46.731 1.00 45.80  ? 380  HIS A NE2   1 
ATOM   1163 N  N     . ALA A 1 155  ? 28.741  14.040  -47.863 1.00 36.74  ? 381  ALA A N     1 
ATOM   1164 C  CA    . ALA A 1 155  ? 28.682  15.494  -47.893 1.00 35.93  ? 381  ALA A CA    1 
ATOM   1165 C  C     . ALA A 1 155  ? 29.876  16.188  -47.233 1.00 35.55  ? 381  ALA A C     1 
ATOM   1166 O  O     . ALA A 1 155  ? 29.978  17.416  -47.276 1.00 34.90  ? 381  ALA A O     1 
ATOM   1167 C  CB    . ALA A 1 155  ? 27.361  15.988  -47.280 1.00 35.38  ? 381  ALA A CB    1 
ATOM   1168 N  N     . VAL A 1 156  ? 30.773  15.420  -46.614 1.00 35.36  ? 382  VAL A N     1 
ATOM   1169 C  CA    . VAL A 1 156  ? 31.919  16.050  -45.979 1.00 35.31  ? 382  VAL A CA    1 
ATOM   1170 C  C     . VAL A 1 156  ? 33.262  15.366  -46.280 1.00 35.66  ? 382  VAL A C     1 
ATOM   1171 O  O     . VAL A 1 156  ? 33.297  14.202  -46.684 1.00 35.54  ? 382  VAL A O     1 
ATOM   1172 C  CB    . VAL A 1 156  ? 31.675  16.252  -44.459 1.00 35.45  ? 382  VAL A CB    1 
ATOM   1173 C  CG1   . VAL A 1 156  ? 30.316  16.872  -44.237 1.00 34.18  ? 382  VAL A CG1   1 
ATOM   1174 C  CG2   . VAL A 1 156  ? 31.762  14.925  -43.694 1.00 36.03  ? 382  VAL A CG2   1 
ATOM   1175 N  N     . VAL A 1 157  ? 34.359  16.115  -46.123 1.00 35.96  ? 383  VAL A N     1 
ATOM   1176 C  CA    . VAL A 1 157  ? 35.706  15.534  -46.158 1.00 36.15  ? 383  VAL A CA    1 
ATOM   1177 C  C     . VAL A 1 157  ? 36.484  15.657  -44.814 1.00 36.60  ? 383  VAL A C     1 
ATOM   1178 O  O     . VAL A 1 157  ? 37.722  15.607  -44.781 1.00 37.01  ? 383  VAL A O     1 
ATOM   1179 C  CB    . VAL A 1 157  ? 36.526  16.091  -47.345 1.00 35.91  ? 383  VAL A CB    1 
ATOM   1180 C  CG1   . VAL A 1 157  ? 35.909  15.603  -48.656 1.00 35.80  ? 383  VAL A CG1   1 
ATOM   1181 C  CG2   . VAL A 1 157  ? 36.534  17.612  -47.299 1.00 35.10  ? 383  VAL A CG2   1 
ATOM   1182 N  N     . GLN A 1 158  ? 35.764  15.757  -43.702 1.00 36.74  ? 384  GLN A N     1 
ATOM   1183 C  CA    . GLN A 1 158  ? 36.417  15.855  -42.385 1.00 37.21  ? 384  GLN A CA    1 
ATOM   1184 C  C     . GLN A 1 158  ? 37.352  14.715  -41.901 1.00 37.32  ? 384  GLN A C     1 
ATOM   1185 O  O     . GLN A 1 158  ? 38.063  14.886  -40.902 1.00 37.62  ? 384  GLN A O     1 
ATOM   1186 C  CB    . GLN A 1 158  ? 35.393  16.265  -41.319 1.00 36.98  ? 384  GLN A CB    1 
ATOM   1187 C  CG    . GLN A 1 158  ? 35.089  17.753  -41.472 1.00 38.40  ? 384  GLN A CG    1 
ATOM   1188 C  CD    . GLN A 1 158  ? 33.703  18.212  -41.009 1.00 38.61  ? 384  GLN A CD    1 
ATOM   1189 O  OE1   . GLN A 1 158  ? 32.735  17.445  -41.007 1.00 37.29  ? 384  GLN A OE1   1 
ATOM   1190 N  NE2   . GLN A 1 158  ? 33.607  19.500  -40.646 1.00 37.10  ? 384  GLN A NE2   1 
ATOM   1191 N  N     . SER A 1 159  ? 37.383  13.574  -42.591 1.00 36.98  ? 385  SER A N     1 
ATOM   1192 C  CA    . SER A 1 159  ? 38.297  12.480  -42.206 1.00 37.20  ? 385  SER A CA    1 
ATOM   1193 C  C     . SER A 1 159  ? 39.632  12.570  -42.910 1.00 37.07  ? 385  SER A C     1 
ATOM   1194 O  O     . SER A 1 159  ? 40.582  11.889  -42.539 1.00 36.70  ? 385  SER A O     1 
ATOM   1195 C  CB    . SER A 1 159  ? 37.683  11.104  -42.473 1.00 37.43  ? 385  SER A CB    1 
ATOM   1196 O  OG    . SER A 1 159  ? 37.115  10.588  -41.273 1.00 40.06  ? 385  SER A OG    1 
ATOM   1197 N  N     . PHE A 1 160  ? 39.689  13.416  -43.934 1.00 37.26  ? 386  PHE A N     1 
ATOM   1198 C  CA    . PHE A 1 160  ? 40.915  13.614  -44.714 1.00 37.75  ? 386  PHE A CA    1 
ATOM   1199 C  C     . PHE A 1 160  ? 42.215  13.751  -43.894 1.00 38.05  ? 386  PHE A C     1 
ATOM   1200 O  O     . PHE A 1 160  ? 43.182  13.020  -44.141 1.00 38.11  ? 386  PHE A O     1 
ATOM   1201 C  CB    . PHE A 1 160  ? 40.739  14.777  -45.703 1.00 37.35  ? 386  PHE A CB    1 
ATOM   1202 C  CG    . PHE A 1 160  ? 39.958  14.400  -46.927 1.00 35.42  ? 386  PHE A CG    1 
ATOM   1203 C  CD1   . PHE A 1 160  ? 39.119  13.291  -46.909 1.00 36.97  ? 386  PHE A CD1   1 
ATOM   1204 C  CD2   . PHE A 1 160  ? 40.048  15.145  -48.073 1.00 33.90  ? 386  PHE A CD2   1 
ATOM   1205 C  CE1   . PHE A 1 160  ? 38.389  12.927  -48.036 1.00 35.99  ? 386  PHE A CE1   1 
ATOM   1206 C  CE2   . PHE A 1 160  ? 39.353  14.805  -49.201 1.00 35.19  ? 386  PHE A CE2   1 
ATOM   1207 C  CZ    . PHE A 1 160  ? 38.507  13.681  -49.191 1.00 38.29  ? 386  PHE A CZ    1 
ATOM   1208 N  N     . PRO A 1 161  ? 42.244  14.675  -42.924 1.00 38.39  ? 387  PRO A N     1 
ATOM   1209 C  CA    . PRO A 1 161  ? 43.463  14.918  -42.120 1.00 38.83  ? 387  PRO A CA    1 
ATOM   1210 C  C     . PRO A 1 161  ? 43.915  13.675  -41.359 1.00 39.56  ? 387  PRO A C     1 
ATOM   1211 O  O     . PRO A 1 161  ? 45.089  13.355  -41.356 1.00 39.63  ? 387  PRO A O     1 
ATOM   1212 C  CB    . PRO A 1 161  ? 43.022  16.010  -41.138 1.00 38.67  ? 387  PRO A CB    1 
ATOM   1213 C  CG    . PRO A 1 161  ? 41.928  16.742  -41.904 1.00 38.47  ? 387  PRO A CG    1 
ATOM   1214 C  CD    . PRO A 1 161  ? 41.174  15.634  -42.605 1.00 38.09  ? 387  PRO A CD    1 
ATOM   1215 N  N     . GLU A 1 162  ? 42.976  12.953  -40.746 1.00 40.49  ? 388  GLU A N     1 
ATOM   1216 C  CA    . GLU A 1 162  ? 43.331  11.729  -40.069 1.00 40.35  ? 388  GLU A CA    1 
ATOM   1217 C  C     . GLU A 1 162  ? 43.709  10.689  -41.107 1.00 40.03  ? 388  GLU A C     1 
ATOM   1218 O  O     . GLU A 1 162  ? 44.645  9.914   -40.918 1.00 40.04  ? 388  GLU A O     1 
ATOM   1219 C  CB    . GLU A 1 162  ? 42.184  11.225  -39.212 1.00 40.95  ? 388  GLU A CB    1 
ATOM   1220 C  CG    . GLU A 1 162  ? 42.593  10.088  -38.293 1.00 42.73  ? 388  GLU A CG    1 
ATOM   1221 C  CD    . GLU A 1 162  ? 41.421  9.477   -37.579 1.00 44.80  ? 388  GLU A CD    1 
ATOM   1222 O  OE1   . GLU A 1 162  ? 40.415  10.186  -37.361 1.00 46.42  ? 388  GLU A OE1   1 
ATOM   1223 O  OE2   . GLU A 1 162  ? 41.501  8.287   -37.230 1.00 45.71  ? 388  GLU A OE2   1 
ATOM   1224 N  N     . ALA A 1 163  ? 42.995  10.658  -42.219 1.00 39.92  ? 389  ALA A N     1 
ATOM   1225 C  CA    . ALA A 1 163  ? 43.309  9.640   -43.231 1.00 39.64  ? 389  ALA A CA    1 
ATOM   1226 C  C     . ALA A 1 163  ? 44.764  9.824   -43.710 1.00 39.66  ? 389  ALA A C     1 
ATOM   1227 O  O     . ALA A 1 163  ? 45.552  8.882   -43.757 1.00 39.21  ? 389  ALA A O     1 
ATOM   1228 C  CB    . ALA A 1 163  ? 42.323  9.702   -44.375 1.00 38.67  ? 389  ALA A CB    1 
ATOM   1229 N  N     . TYR A 1 164  ? 45.122  11.066  -44.016 1.00 40.09  ? 390  TYR A N     1 
ATOM   1230 C  CA    . TYR A 1 164  ? 46.481  11.397  -44.423 1.00 40.22  ? 390  TYR A CA    1 
ATOM   1231 C  C     . TYR A 1 164  ? 47.528  10.846  -43.444 1.00 40.13  ? 390  TYR A C     1 
ATOM   1232 O  O     . TYR A 1 164  ? 48.431  10.085  -43.832 1.00 39.92  ? 390  TYR A O     1 
ATOM   1233 C  CB    . TYR A 1 164  ? 46.637  12.909  -44.505 1.00 40.25  ? 390  TYR A CB    1 
ATOM   1234 C  CG    . TYR A 1 164  ? 47.917  13.348  -45.159 1.00 41.64  ? 390  TYR A CG    1 
ATOM   1235 C  CD1   . TYR A 1 164  ? 48.540  12.532  -46.123 1.00 42.39  ? 390  TYR A CD1   1 
ATOM   1236 C  CD2   . TYR A 1 164  ? 48.482  14.590  -44.873 1.00 40.55  ? 390  TYR A CD2   1 
ATOM   1237 C  CE1   . TYR A 1 164  ? 49.698  12.925  -46.750 1.00 40.87  ? 390  TYR A CE1   1 
ATOM   1238 C  CE2   . TYR A 1 164  ? 49.645  15.003  -45.514 1.00 42.32  ? 390  TYR A CE2   1 
ATOM   1239 C  CZ    . TYR A 1 164  ? 50.240  14.163  -46.452 1.00 42.72  ? 390  TYR A CZ    1 
ATOM   1240 O  OH    . TYR A 1 164  ? 51.397  14.538  -47.088 1.00 44.72  ? 390  TYR A OH    1 
ATOM   1241 N  N     . SER A 1 165  ? 47.415  11.252  -42.185 1.00 39.36  ? 391  SER A N     1 
ATOM   1242 C  CA    . SER A 1 165  ? 48.327  10.773  -41.155 1.00 39.28  ? 391  SER A CA    1 
ATOM   1243 C  C     . SER A 1 165  ? 48.450  9.261   -41.188 1.00 39.27  ? 391  SER A C     1 
ATOM   1244 O  O     . SER A 1 165  ? 49.550  8.715   -41.077 1.00 39.05  ? 391  SER A O     1 
ATOM   1245 C  CB    . SER A 1 165  ? 47.809  11.142  -39.771 1.00 38.86  ? 391  SER A CB    1 
ATOM   1246 O  OG    . SER A 1 165  ? 47.745  12.533  -39.614 1.00 39.11  ? 391  SER A OG    1 
ATOM   1247 N  N     . ALA A 1 166  ? 47.310  8.579   -41.277 1.00 39.05  ? 392  ALA A N     1 
ATOM   1248 C  CA    . ALA A 1 166  ? 47.339  7.143   -41.208 1.00 39.46  ? 392  ALA A CA    1 
ATOM   1249 C  C     . ALA A 1 166  ? 47.880  6.600   -42.533 1.00 40.24  ? 392  ALA A C     1 
ATOM   1250 O  O     . ALA A 1 166  ? 48.608  5.614   -42.547 1.00 40.32  ? 392  ALA A O     1 
ATOM   1251 C  CB    . ALA A 1 166  ? 45.968  6.586   -40.887 1.00 39.19  ? 392  ALA A CB    1 
ATOM   1252 N  N     . ALA A 1 167  ? 47.554  7.247   -43.647 1.00 40.73  ? 393  ALA A N     1 
ATOM   1253 C  CA    . ALA A 1 167  ? 48.218  6.866   -44.887 1.00 42.18  ? 393  ALA A CA    1 
ATOM   1254 C  C     . ALA A 1 167  ? 49.733  6.916   -44.748 1.00 43.09  ? 393  ALA A C     1 
ATOM   1255 O  O     . ALA A 1 167  ? 50.423  6.029   -45.256 1.00 43.35  ? 393  ALA A O     1 
ATOM   1256 C  CB    . ALA A 1 167  ? 47.757  7.708   -46.082 1.00 41.80  ? 393  ALA A CB    1 
ATOM   1257 N  N     . LYS A 1 168  ? 50.251  7.948   -44.085 1.00 44.34  ? 394  LYS A N     1 
ATOM   1258 C  CA    . LYS A 1 168  ? 51.700  8.098   -43.917 1.00 46.06  ? 394  LYS A CA    1 
ATOM   1259 C  C     . LYS A 1 168  ? 52.286  7.091   -42.911 1.00 46.99  ? 394  LYS A C     1 
ATOM   1260 O  O     . LYS A 1 168  ? 53.288  6.424   -43.183 1.00 46.92  ? 394  LYS A O     1 
ATOM   1261 C  CB    . LYS A 1 168  ? 52.084  9.538   -43.521 1.00 45.62  ? 394  LYS A CB    1 
ATOM   1262 C  CG    . LYS A 1 168  ? 52.090  10.548  -44.687 1.00 46.37  ? 394  LYS A CG    1 
ATOM   1263 C  CD    . LYS A 1 168  ? 52.569  11.960  -44.237 1.00 46.98  ? 394  LYS A CD    1 
ATOM   1264 C  CE    . LYS A 1 168  ? 51.498  12.714  -43.433 1.00 46.70  ? 394  LYS A CE    1 
ATOM   1265 N  NZ    . LYS A 1 168  ? 52.033  13.860  -42.653 1.00 45.88  ? 394  LYS A NZ    1 
ATOM   1266 N  N     . LYS A 1 169  ? 51.669  6.983   -41.745 1.00 48.45  ? 395  LYS A N     1 
ATOM   1267 C  CA    . LYS A 1 169  ? 52.197  6.096   -40.729 1.00 50.00  ? 395  LYS A CA    1 
ATOM   1268 C  C     . LYS A 1 169  ? 52.199  4.663   -41.282 1.00 50.73  ? 395  LYS A C     1 
ATOM   1269 O  O     . LYS A 1 169  ? 53.165  3.915   -41.087 1.00 50.81  ? 395  LYS A O     1 
ATOM   1270 C  CB    . LYS A 1 169  ? 51.385  6.218   -39.430 1.00 50.26  ? 395  LYS A CB    1 
ATOM   1271 C  CG    . LYS A 1 169  ? 51.581  5.078   -38.423 1.00 52.76  ? 395  LYS A CG    1 
ATOM   1272 C  CD    . LYS A 1 169  ? 52.419  5.464   -37.191 1.00 55.39  ? 395  LYS A CD    1 
ATOM   1273 C  CE    . LYS A 1 169  ? 51.542  5.679   -35.941 1.00 57.37  ? 395  LYS A CE    1 
ATOM   1274 N  NZ    . LYS A 1 169  ? 50.506  4.603   -35.775 1.00 56.84  ? 395  LYS A NZ    1 
ATOM   1275 N  N     . HIS A 1 170  ? 51.147  4.293   -42.014 1.00 51.07  ? 396  HIS A N     1 
ATOM   1276 C  CA    . HIS A 1 170  ? 50.982  2.890   -42.414 1.00 51.80  ? 396  HIS A CA    1 
ATOM   1277 C  C     . HIS A 1 170  ? 51.484  2.509   -43.816 1.00 51.41  ? 396  HIS A C     1 
ATOM   1278 O  O     . HIS A 1 170  ? 51.486  1.325   -44.173 1.00 51.54  ? 396  HIS A O     1 
ATOM   1279 C  CB    . HIS A 1 170  ? 49.527  2.429   -42.197 1.00 52.21  ? 396  HIS A CB    1 
ATOM   1280 C  CG    . HIS A 1 170  ? 49.183  2.218   -40.752 1.00 54.90  ? 396  HIS A CG    1 
ATOM   1281 N  ND1   . HIS A 1 170  ? 48.934  0.972   -40.217 1.00 56.63  ? 396  HIS A ND1   1 
ATOM   1282 C  CD2   . HIS A 1 170  ? 49.102  3.092   -39.717 1.00 56.61  ? 396  HIS A CD2   1 
ATOM   1283 C  CE1   . HIS A 1 170  ? 48.692  1.089   -38.923 1.00 56.94  ? 396  HIS A CE1   1 
ATOM   1284 N  NE2   . HIS A 1 170  ? 48.792  2.364   -38.594 1.00 57.82  ? 396  HIS A NE2   1 
ATOM   1285 N  N     . GLY A 1 171  ? 51.917  3.499   -44.597 1.00 50.87  ? 397  GLY A N     1 
ATOM   1286 C  CA    . GLY A 1 171  ? 52.289  3.264   -45.996 1.00 49.68  ? 397  GLY A CA    1 
ATOM   1287 C  C     . GLY A 1 171  ? 51.137  2.735   -46.848 1.00 49.09  ? 397  GLY A C     1 
ATOM   1288 O  O     . GLY A 1 171  ? 51.331  1.862   -47.695 1.00 49.34  ? 397  GLY A O     1 
ATOM   1289 N  N     . MET A 1 172  ? 49.935  3.257   -46.622 1.00 48.02  ? 398  MET A N     1 
ATOM   1290 C  CA    . MET A 1 172  ? 48.770  2.872   -47.408 1.00 47.15  ? 398  MET A CA    1 
ATOM   1291 C  C     . MET A 1 172  ? 48.432  4.009   -48.365 1.00 46.49  ? 398  MET A C     1 
ATOM   1292 O  O     . MET A 1 172  ? 48.626  5.174   -48.046 1.00 46.69  ? 398  MET A O     1 
ATOM   1293 C  CB    . MET A 1 172  ? 47.599  2.574   -46.468 1.00 47.36  ? 398  MET A CB    1 
ATOM   1294 C  CG    . MET A 1 172  ? 46.277  2.174   -47.105 1.00 47.91  ? 398  MET A CG    1 
ATOM   1295 S  SD    . MET A 1 172  ? 46.323  0.672   -48.106 1.00 50.58  ? 398  MET A SD    1 
ATOM   1296 C  CE    . MET A 1 172  ? 47.200  -0.408  -47.001 1.00 48.84  ? 398  MET A CE    1 
ATOM   1297 N  N     . LYS A 1 173  ? 47.970  3.680   -49.560 1.00 45.52  ? 399  LYS A N     1 
ATOM   1298 C  CA    . LYS A 1 173  ? 47.544  4.720   -50.477 1.00 44.48  ? 399  LYS A CA    1 
ATOM   1299 C  C     . LYS A 1 173  ? 46.076  4.976   -50.208 1.00 43.82  ? 399  LYS A C     1 
ATOM   1300 O  O     . LYS A 1 173  ? 45.265  4.070   -50.319 1.00 43.66  ? 399  LYS A O     1 
ATOM   1301 C  CB    . LYS A 1 173  ? 47.712  4.262   -51.922 1.00 44.75  ? 399  LYS A CB    1 
ATOM   1302 C  CG    . LYS A 1 173  ? 47.328  5.291   -52.969 1.00 43.79  ? 399  LYS A CG    1 
ATOM   1303 C  CD    . LYS A 1 173  ? 47.385  4.632   -54.350 1.00 43.88  ? 399  LYS A CD    1 
ATOM   1304 C  CE    . LYS A 1 173  ? 46.765  5.497   -55.435 1.00 43.28  ? 399  LYS A CE    1 
ATOM   1305 N  NZ    . LYS A 1 173  ? 46.560  4.774   -56.725 1.00 45.24  ? 399  LYS A NZ    1 
ATOM   1306 N  N     . VAL A 1 174  ? 45.731  6.211   -49.860 1.00 42.78  ? 400  VAL A N     1 
ATOM   1307 C  CA    . VAL A 1 174  ? 44.342  6.566   -49.645 1.00 41.64  ? 400  VAL A CA    1 
ATOM   1308 C  C     . VAL A 1 174  ? 43.751  7.323   -50.841 1.00 41.57  ? 400  VAL A C     1 
ATOM   1309 O  O     . VAL A 1 174  ? 44.371  8.226   -51.398 1.00 41.18  ? 400  VAL A O     1 
ATOM   1310 C  CB    . VAL A 1 174  ? 44.205  7.410   -48.368 1.00 41.46  ? 400  VAL A CB    1 
ATOM   1311 C  CG1   . VAL A 1 174  ? 42.834  8.012   -48.257 1.00 40.53  ? 400  VAL A CG1   1 
ATOM   1312 C  CG2   . VAL A 1 174  ? 44.549  6.576   -47.142 1.00 40.62  ? 400  VAL A CG2   1 
ATOM   1313 N  N     . ILE A 1 175  ? 42.537  6.961   -51.233 1.00 41.67  ? 401  ILE A N     1 
ATOM   1314 C  CA    . ILE A 1 175  ? 41.841  7.727   -52.269 1.00 41.52  ? 401  ILE A CA    1 
ATOM   1315 C  C     . ILE A 1 175  ? 40.842  8.679   -51.626 1.00 41.76  ? 401  ILE A C     1 
ATOM   1316 O  O     . ILE A 1 175  ? 39.841  8.235   -51.060 1.00 42.69  ? 401  ILE A O     1 
ATOM   1317 C  CB    . ILE A 1 175  ? 41.094  6.799   -53.273 1.00 41.02  ? 401  ILE A CB    1 
ATOM   1318 C  CG1   . ILE A 1 175  ? 42.058  5.736   -53.820 1.00 39.98  ? 401  ILE A CG1   1 
ATOM   1319 C  CG2   . ILE A 1 175  ? 40.461  7.629   -54.370 1.00 39.75  ? 401  ILE A CG2   1 
ATOM   1320 C  CD1   . ILE A 1 175  ? 41.422  4.648   -54.669 1.00 38.01  ? 401  ILE A CD1   1 
ATOM   1321 N  N     . TYR A 1 176  ? 41.108  9.973   -51.730 1.00 41.50  ? 402  TYR A N     1 
ATOM   1322 C  CA    . TYR A 1 176  ? 40.284  11.016  -51.102 1.00 41.50  ? 402  TYR A CA    1 
ATOM   1323 C  C     . TYR A 1 176  ? 39.011  11.325  -51.895 1.00 42.22  ? 402  TYR A C     1 
ATOM   1324 O  O     . TYR A 1 176  ? 39.061  11.769  -53.053 1.00 42.63  ? 402  TYR A O     1 
ATOM   1325 C  CB    . TYR A 1 176  ? 41.131  12.278  -50.876 1.00 41.05  ? 402  TYR A CB    1 
ATOM   1326 C  CG    . TYR A 1 176  ? 42.317  11.988  -49.978 1.00 38.99  ? 402  TYR A CG    1 
ATOM   1327 C  CD1   . TYR A 1 176  ? 43.534  11.620  -50.511 1.00 37.85  ? 402  TYR A CD1   1 
ATOM   1328 C  CD2   . TYR A 1 176  ? 42.195  12.017  -48.584 1.00 40.27  ? 402  TYR A CD2   1 
ATOM   1329 C  CE1   . TYR A 1 176  ? 44.627  11.325  -49.689 1.00 38.68  ? 402  TYR A CE1   1 
ATOM   1330 C  CE2   . TYR A 1 176  ? 43.291  11.726  -47.737 1.00 37.66  ? 402  TYR A CE2   1 
ATOM   1331 C  CZ    . TYR A 1 176  ? 44.494  11.383  -48.307 1.00 37.07  ? 402  TYR A CZ    1 
ATOM   1332 O  OH    . TYR A 1 176  ? 45.556  11.079  -47.528 1.00 36.36  ? 402  TYR A OH    1 
ATOM   1333 N  N     . GLY A 1 177  ? 37.862  11.050  -51.282 1.00 42.66  ? 403  GLY A N     1 
ATOM   1334 C  CA    . GLY A 1 177  ? 36.584  11.219  -51.962 1.00 42.85  ? 403  GLY A CA    1 
ATOM   1335 C  C     . GLY A 1 177  ? 35.468  11.857  -51.159 1.00 43.22  ? 403  GLY A C     1 
ATOM   1336 O  O     . GLY A 1 177  ? 35.684  12.469  -50.105 1.00 43.61  ? 403  GLY A O     1 
ATOM   1337 N  N     . LEU A 1 178  ? 34.261  11.691  -51.675 1.00 43.61  ? 404  LEU A N     1 
ATOM   1338 C  CA    . LEU A 1 178  ? 33.088  12.392  -51.206 1.00 43.84  ? 404  LEU A CA    1 
ATOM   1339 C  C     . LEU A 1 178  ? 31.884  11.646  -51.772 1.00 44.04  ? 404  LEU A C     1 
ATOM   1340 O  O     . LEU A 1 178  ? 31.821  11.415  -52.988 1.00 44.27  ? 404  LEU A O     1 
ATOM   1341 C  CB    . LEU A 1 178  ? 33.083  13.785  -51.829 1.00 43.60  ? 404  LEU A CB    1 
ATOM   1342 C  CG    . LEU A 1 178  ? 32.557  15.030  -51.120 1.00 43.46  ? 404  LEU A CG    1 
ATOM   1343 C  CD1   . LEU A 1 178  ? 32.045  16.035  -52.167 1.00 40.77  ? 404  LEU A CD1   1 
ATOM   1344 C  CD2   . LEU A 1 178  ? 31.509  14.738  -50.055 1.00 40.37  ? 404  LEU A CD2   1 
ATOM   1345 N  N     . GLU A 1 179  ? 30.936  11.285  -50.915 1.00 44.18  ? 405  GLU A N     1 
ATOM   1346 C  CA    . GLU A 1 179  ? 29.605  10.875  -51.366 1.00 45.01  ? 405  GLU A CA    1 
ATOM   1347 C  C     . GLU A 1 179  ? 28.750  12.138  -51.352 1.00 44.89  ? 405  GLU A C     1 
ATOM   1348 O  O     . GLU A 1 179  ? 28.507  12.697  -50.289 1.00 44.85  ? 405  GLU A O     1 
ATOM   1349 C  CB    . GLU A 1 179  ? 29.011  9.818   -50.430 1.00 45.41  ? 405  GLU A CB    1 
ATOM   1350 C  CG    . GLU A 1 179  ? 27.629  9.301   -50.825 1.00 48.36  ? 405  GLU A CG    1 
ATOM   1351 C  CD    . GLU A 1 179  ? 27.087  8.225   -49.869 1.00 53.49  ? 405  GLU A CD    1 
ATOM   1352 O  OE1   . GLU A 1 179  ? 26.708  7.122   -50.341 1.00 56.55  ? 405  GLU A OE1   1 
ATOM   1353 O  OE2   . GLU A 1 179  ? 27.018  8.459   -48.643 1.00 55.83  ? 405  GLU A OE2   1 
ATOM   1354 N  N     . ALA A 1 180  ? 28.322  12.611  -52.523 1.00 44.85  ? 406  ALA A N     1 
ATOM   1355 C  CA    . ALA A 1 180  ? 27.650  13.921  -52.601 1.00 45.07  ? 406  ALA A CA    1 
ATOM   1356 C  C     . ALA A 1 180  ? 26.170  13.863  -52.954 1.00 45.05  ? 406  ALA A C     1 
ATOM   1357 O  O     . ALA A 1 180  ? 25.692  12.895  -53.554 1.00 45.34  ? 406  ALA A O     1 
ATOM   1358 C  CB    . ALA A 1 180  ? 28.384  14.857  -53.567 1.00 44.42  ? 406  ALA A CB    1 
ATOM   1359 N  N     . ASN A 1 181  ? 25.452  14.916  -52.578 1.00 45.31  ? 407  ASN A N     1 
ATOM   1360 C  CA    . ASN A 1 181  ? 24.053  15.073  -52.953 1.00 45.42  ? 407  ASN A CA    1 
ATOM   1361 C  C     . ASN A 1 181  ? 23.902  15.938  -54.196 1.00 45.03  ? 407  ASN A C     1 
ATOM   1362 O  O     . ASN A 1 181  ? 24.103  17.144  -54.152 1.00 44.84  ? 407  ASN A O     1 
ATOM   1363 C  CB    . ASN A 1 181  ? 23.254  15.685  -51.796 1.00 45.65  ? 407  ASN A CB    1 
ATOM   1364 C  CG    . ASN A 1 181  ? 23.254  14.811  -50.549 1.00 46.63  ? 407  ASN A CG    1 
ATOM   1365 O  OD1   . ASN A 1 181  ? 23.012  13.601  -50.610 1.00 46.52  ? 407  ASN A OD1   1 
ATOM   1366 N  ND2   . ASN A 1 181  ? 23.505  15.432  -49.404 1.00 47.85  ? 407  ASN A ND2   1 
ATOM   1367 N  N     . ILE A 1 182  ? 23.537  15.311  -55.306 1.00 45.22  ? 408  ILE A N     1 
ATOM   1368 C  CA    . ILE A 1 182  ? 23.365  16.011  -56.568 1.00 44.95  ? 408  ILE A CA    1 
ATOM   1369 C  C     . ILE A 1 182  ? 21.888  16.223  -56.833 1.00 45.63  ? 408  ILE A C     1 
ATOM   1370 O  O     . ILE A 1 182  ? 21.085  15.302  -56.657 1.00 45.87  ? 408  ILE A O     1 
ATOM   1371 C  CB    . ILE A 1 182  ? 23.941  15.182  -57.721 1.00 44.77  ? 408  ILE A CB    1 
ATOM   1372 C  CG1   . ILE A 1 182  ? 25.341  14.693  -57.358 1.00 43.96  ? 408  ILE A CG1   1 
ATOM   1373 C  CG2   . ILE A 1 182  ? 23.962  16.001  -59.020 1.00 43.95  ? 408  ILE A CG2   1 
ATOM   1374 C  CD1   . ILE A 1 182  ? 26.300  15.828  -57.056 1.00 43.07  ? 408  ILE A CD1   1 
ATOM   1375 N  N     . VAL A 1 183  ? 21.524  17.441  -57.224 1.00 46.10  ? 409  VAL A N     1 
ATOM   1376 C  CA    . VAL A 1 183  ? 20.178  17.729  -57.704 1.00 46.80  ? 409  VAL A CA    1 
ATOM   1377 C  C     . VAL A 1 183  ? 20.247  18.221  -59.150 1.00 47.40  ? 409  VAL A C     1 
ATOM   1378 O  O     . VAL A 1 183  ? 21.193  18.922  -59.536 1.00 47.15  ? 409  VAL A O     1 
ATOM   1379 C  CB    . VAL A 1 183  ? 19.438  18.768  -56.816 1.00 46.77  ? 409  VAL A CB    1 
ATOM   1380 C  CG1   . VAL A 1 183  ? 19.576  18.416  -55.351 1.00 47.23  ? 409  VAL A CG1   1 
ATOM   1381 C  CG2   . VAL A 1 183  ? 19.954  20.181  -57.060 1.00 47.14  ? 409  VAL A CG2   1 
ATOM   1382 N  N     . ASP A 1 184  ? 19.251  17.839  -59.946 1.00 48.31  ? 410  ASP A N     1 
ATOM   1383 C  CA    . ASP A 1 184  ? 19.165  18.215  -61.366 1.00 49.17  ? 410  ASP A CA    1 
ATOM   1384 C  C     . ASP A 1 184  ? 18.768  19.675  -61.581 1.00 49.56  ? 410  ASP A C     1 
ATOM   1385 O  O     . ASP A 1 184  ? 17.811  20.152  -60.980 1.00 49.76  ? 410  ASP A O     1 
ATOM   1386 C  CB    . ASP A 1 184  ? 18.130  17.337  -62.078 1.00 49.31  ? 410  ASP A CB    1 
ATOM   1387 C  CG    . ASP A 1 184  ? 18.764  16.258  -62.943 1.00 50.36  ? 410  ASP A CG    1 
ATOM   1388 O  OD1   . ASP A 1 184  ? 19.457  15.373  -62.395 1.00 51.15  ? 410  ASP A OD1   1 
ATOM   1389 O  OD2   . ASP A 1 184  ? 18.556  16.293  -64.176 1.00 51.39  ? 410  ASP A OD2   1 
ATOM   1390 N  N     . ASP A 1 185  ? 19.477  20.379  -62.457 1.00 50.13  ? 411  ASP A N     1 
ATOM   1391 C  CA    . ASP A 1 185  ? 19.089  21.753  -62.799 1.00 50.64  ? 411  ASP A CA    1 
ATOM   1392 C  C     . ASP A 1 185  ? 19.113  22.021  -64.308 1.00 50.70  ? 411  ASP A C     1 
ATOM   1393 O  O     . ASP A 1 185  ? 18.849  21.130  -65.115 1.00 50.61  ? 411  ASP A O     1 
ATOM   1394 C  CB    . ASP A 1 185  ? 19.931  22.798  -62.028 1.00 50.90  ? 411  ASP A CB    1 
ATOM   1395 C  CG    . ASP A 1 185  ? 21.415  22.767  -62.397 1.00 51.25  ? 411  ASP A CG    1 
ATOM   1396 O  OD1   . ASP A 1 185  ? 21.909  21.705  -62.828 1.00 52.08  ? 411  ASP A OD1   1 
ATOM   1397 O  OD2   . ASP A 1 185  ? 22.089  23.812  -62.250 1.00 51.13  ? 411  ASP A OD2   1 
ATOM   1398 N  N     . PRO A 1 204  ? 16.970  14.279  -55.902 1.00 59.87  ? 618  PRO A N     1 
ATOM   1399 C  CA    . PRO A 1 204  ? 18.099  14.419  -54.969 1.00 59.59  ? 618  PRO A CA    1 
ATOM   1400 C  C     . PRO A 1 204  ? 18.821  13.094  -54.744 1.00 58.86  ? 618  PRO A C     1 
ATOM   1401 O  O     . PRO A 1 204  ? 18.332  12.253  -53.995 1.00 59.34  ? 618  PRO A O     1 
ATOM   1402 C  CB    . PRO A 1 204  ? 17.418  14.906  -53.686 1.00 59.82  ? 618  PRO A CB    1 
ATOM   1403 C  CG    . PRO A 1 204  ? 16.216  15.763  -54.221 1.00 60.26  ? 618  PRO A CG    1 
ATOM   1404 C  CD    . PRO A 1 204  ? 15.955  15.329  -55.681 1.00 60.28  ? 618  PRO A CD    1 
ATOM   1405 N  N     . PHE A 1 205  ? 19.979  12.920  -55.382 1.00 57.39  ? 619  PHE A N     1 
ATOM   1406 C  CA    . PHE A 1 205  ? 20.587  11.600  -55.496 1.00 56.07  ? 619  PHE A CA    1 
ATOM   1407 C  C     . PHE A 1 205  ? 22.083  11.603  -55.180 1.00 55.15  ? 619  PHE A C     1 
ATOM   1408 O  O     . PHE A 1 205  ? 22.759  12.613  -55.312 1.00 55.25  ? 619  PHE A O     1 
ATOM   1409 C  CB    . PHE A 1 205  ? 20.314  10.998  -56.897 1.00 55.88  ? 619  PHE A CB    1 
ATOM   1410 C  CG    . PHE A 1 205  ? 20.925  11.784  -58.040 1.00 56.35  ? 619  PHE A CG    1 
ATOM   1411 C  CD1   . PHE A 1 205  ? 20.217  12.824  -58.645 1.00 55.88  ? 619  PHE A CD1   1 
ATOM   1412 C  CD2   . PHE A 1 205  ? 22.206  11.477  -58.527 1.00 55.44  ? 619  PHE A CD2   1 
ATOM   1413 C  CE1   . PHE A 1 205  ? 20.770  13.545  -59.700 1.00 55.34  ? 619  PHE A CE1   1 
ATOM   1414 C  CE2   . PHE A 1 205  ? 22.759  12.189  -59.582 1.00 55.10  ? 619  PHE A CE2   1 
ATOM   1415 C  CZ    . PHE A 1 205  ? 22.044  13.230  -60.174 1.00 55.03  ? 619  PHE A CZ    1 
ATOM   1416 N  N     . HIS A 1 206  ? 22.580  10.440  -54.777 1.00 54.05  ? 620  HIS A N     1 
ATOM   1417 C  CA    . HIS A 1 206  ? 23.938  10.257  -54.264 1.00 52.87  ? 620  HIS A CA    1 
ATOM   1418 C  C     . HIS A 1 206  ? 24.900  9.911   -55.429 1.00 51.93  ? 620  HIS A C     1 
ATOM   1419 O  O     . HIS A 1 206  ? 24.547  9.081   -56.281 1.00 51.87  ? 620  HIS A O     1 
ATOM   1420 C  CB    . HIS A 1 206  ? 23.925  9.072   -53.248 1.00 52.87  ? 620  HIS A CB    1 
ATOM   1421 C  CG    . HIS A 1 206  ? 23.150  9.311   -51.963 1.00 53.64  ? 620  HIS A CG    1 
ATOM   1422 N  ND1   . HIS A 1 206  ? 23.338  8.470   -50.840 1.00 54.38  ? 620  HIS A ND1   1 
ATOM   1423 C  CD2   . HIS A 1 206  ? 22.260  10.280  -51.619 1.00 53.78  ? 620  HIS A CD2   1 
ATOM   1424 C  CE1   . HIS A 1 206  ? 22.614  8.917   -49.864 1.00 54.63  ? 620  HIS A CE1   1 
ATOM   1425 N  NE2   . HIS A 1 206  ? 21.874  10.009  -50.307 1.00 54.53  ? 620  HIS A NE2   1 
ATOM   1426 N  N     . VAL A 1 207  ? 26.085  10.538  -55.480 1.00 50.13  ? 621  VAL A N     1 
ATOM   1427 C  CA    . VAL A 1 207  ? 27.186  10.031  -56.313 1.00 48.95  ? 621  VAL A CA    1 
ATOM   1428 C  C     . VAL A 1 207  ? 28.482  9.894   -55.521 1.00 48.33  ? 621  VAL A C     1 
ATOM   1429 O  O     . VAL A 1 207  ? 28.631  10.451  -54.430 1.00 48.25  ? 621  VAL A O     1 
ATOM   1430 C  CB    . VAL A 1 207  ? 27.501  10.912  -57.541 1.00 48.82  ? 621  VAL A CB    1 
ATOM   1431 C  CG1   . VAL A 1 207  ? 26.317  10.990  -58.457 1.00 48.68  ? 621  VAL A CG1   1 
ATOM   1432 C  CG2   . VAL A 1 207  ? 27.943  12.293  -57.105 1.00 48.19  ? 621  VAL A CG2   1 
ATOM   1433 N  N     . THR A 1 208  ? 29.432  9.168   -56.094 1.00 47.30  ? 622  THR A N     1 
ATOM   1434 C  CA    . THR A 1 208  ? 30.722  8.958   -55.452 1.00 46.47  ? 622  THR A CA    1 
ATOM   1435 C  C     . THR A 1 208  ? 31.754  9.788   -56.205 1.00 45.36  ? 622  THR A C     1 
ATOM   1436 O  O     . THR A 1 208  ? 31.902  9.637   -57.414 1.00 44.92  ? 622  THR A O     1 
ATOM   1437 C  CB    . THR A 1 208  ? 31.093  7.454   -55.484 1.00 46.55  ? 622  THR A CB    1 
ATOM   1438 O  OG1   . THR A 1 208  ? 30.016  6.692   -54.919 1.00 47.43  ? 622  THR A OG1   1 
ATOM   1439 C  CG2   . THR A 1 208  ? 32.349  7.184   -54.697 1.00 45.43  ? 622  THR A CG2   1 
ATOM   1440 N  N     . LEU A 1 209  ? 32.443  10.685  -55.507 1.00 44.52  ? 623  LEU A N     1 
ATOM   1441 C  CA    . LEU A 1 209  ? 33.536  11.455  -56.134 1.00 43.57  ? 623  LEU A CA    1 
ATOM   1442 C  C     . LEU A 1 209  ? 34.881  11.003  -55.588 1.00 43.88  ? 623  LEU A C     1 
ATOM   1443 O  O     . LEU A 1 209  ? 35.098  10.984  -54.351 1.00 43.68  ? 623  LEU A O     1 
ATOM   1444 C  CB    . LEU A 1 209  ? 33.353  12.959  -55.924 1.00 42.88  ? 623  LEU A CB    1 
ATOM   1445 C  CG    . LEU A 1 209  ? 31.972  13.482  -56.328 1.00 43.61  ? 623  LEU A CG    1 
ATOM   1446 C  CD1   . LEU A 1 209  ? 31.696  14.907  -55.844 1.00 42.52  ? 623  LEU A CD1   1 
ATOM   1447 C  CD2   . LEU A 1 209  ? 31.758  13.353  -57.846 1.00 43.22  ? 623  LEU A CD2   1 
ATOM   1448 N  N     . LEU A 1 210  ? 35.783  10.632  -56.500 1.00 43.99  ? 624  LEU A N     1 
ATOM   1449 C  CA    . LEU A 1 210  ? 37.155  10.268  -56.132 1.00 43.93  ? 624  LEU A CA    1 
ATOM   1450 C  C     . LEU A 1 210  ? 38.120  11.268  -56.743 1.00 44.29  ? 624  LEU A C     1 
ATOM   1451 O  O     . LEU A 1 210  ? 38.115  11.475  -57.952 1.00 45.20  ? 624  LEU A O     1 
ATOM   1452 C  CB    . LEU A 1 210  ? 37.488  8.858   -56.615 1.00 43.65  ? 624  LEU A CB    1 
ATOM   1453 C  CG    . LEU A 1 210  ? 36.519  7.738   -56.213 1.00 43.49  ? 624  LEU A CG    1 
ATOM   1454 C  CD1   . LEU A 1 210  ? 36.911  6.441   -56.869 1.00 43.27  ? 624  LEU A CD1   1 
ATOM   1455 C  CD2   . LEU A 1 210  ? 36.495  7.564   -54.711 1.00 42.09  ? 624  LEU A CD2   1 
ATOM   1456 N  N     . ALA A 1 211  ? 38.955  11.900  -55.924 1.00 44.27  ? 625  ALA A N     1 
ATOM   1457 C  CA    . ALA A 1 211  ? 39.915  12.881  -56.457 1.00 43.94  ? 625  ALA A CA    1 
ATOM   1458 C  C     . ALA A 1 211  ? 41.132  12.167  -57.035 1.00 43.67  ? 625  ALA A C     1 
ATOM   1459 O  O     . ALA A 1 211  ? 41.733  11.314  -56.363 1.00 43.96  ? 625  ALA A O     1 
ATOM   1460 C  CB    . ALA A 1 211  ? 40.352  13.836  -55.365 1.00 43.89  ? 625  ALA A CB    1 
ATOM   1461 N  N     . GLN A 1 212  ? 41.523  12.510  -58.256 1.00 42.41  ? 626  GLN A N     1 
ATOM   1462 C  CA    . GLN A 1 212  ? 42.650  11.813  -58.873 1.00 41.51  ? 626  GLN A CA    1 
ATOM   1463 C  C     . GLN A 1 212  ? 43.962  12.498  -58.556 1.00 40.55  ? 626  GLN A C     1 
ATOM   1464 O  O     . GLN A 1 212  ? 45.028  11.877  -58.562 1.00 40.17  ? 626  GLN A O     1 
ATOM   1465 C  CB    . GLN A 1 212  ? 42.518  11.789  -60.382 1.00 41.11  ? 626  GLN A CB    1 
ATOM   1466 C  CG    . GLN A 1 212  ? 41.198  11.333  -60.914 1.00 41.91  ? 626  GLN A CG    1 
ATOM   1467 C  CD    . GLN A 1 212  ? 41.209  11.344  -62.436 1.00 43.02  ? 626  GLN A CD    1 
ATOM   1468 O  OE1   . GLN A 1 212  ? 40.475  12.115  -63.070 1.00 44.10  ? 626  GLN A OE1   1 
ATOM   1469 N  NE2   . GLN A 1 212  ? 42.085  10.520  -63.029 1.00 40.25  ? 626  GLN A NE2   1 
ATOM   1470 N  N     . ASN A 1 213  ? 43.869  13.799  -58.335 1.00 40.03  ? 627  ASN A N     1 
ATOM   1471 C  CA    . ASN A 1 213  ? 45.028  14.668  -58.276 1.00 39.52  ? 627  ASN A CA    1 
ATOM   1472 C  C     . ASN A 1 213  ? 44.650  15.928  -57.511 1.00 39.95  ? 627  ASN A C     1 
ATOM   1473 O  O     . ASN A 1 213  ? 43.512  16.024  -57.003 1.00 39.78  ? 627  ASN A O     1 
ATOM   1474 C  CB    . ASN A 1 213  ? 45.524  14.992  -59.693 1.00 39.00  ? 627  ASN A CB    1 
ATOM   1475 C  CG    . ASN A 1 213  ? 44.435  15.560  -60.588 1.00 38.28  ? 627  ASN A CG    1 
ATOM   1476 O  OD1   . ASN A 1 213  ? 43.629  16.386  -60.159 1.00 37.32  ? 627  ASN A OD1   1 
ATOM   1477 N  ND2   . ASN A 1 213  ? 44.412  15.120  -61.852 1.00 36.71  ? 627  ASN A ND2   1 
ATOM   1478 N  N     . GLU A 1 214  ? 45.578  16.878  -57.407 1.00 39.81  ? 628  GLU A N     1 
ATOM   1479 C  CA    . GLU A 1 214  ? 45.338  18.048  -56.564 1.00 41.36  ? 628  GLU A CA    1 
ATOM   1480 C  C     . GLU A 1 214  ? 44.257  18.979  -57.127 1.00 40.76  ? 628  GLU A C     1 
ATOM   1481 O  O     . GLU A 1 214  ? 43.607  19.727  -56.390 1.00 40.13  ? 628  GLU A O     1 
ATOM   1482 C  CB    . GLU A 1 214  ? 46.638  18.833  -56.244 1.00 41.91  ? 628  GLU A CB    1 
ATOM   1483 C  CG    . GLU A 1 214  ? 47.875  18.410  -57.014 1.00 47.40  ? 628  GLU A CG    1 
ATOM   1484 C  CD    . GLU A 1 214  ? 48.529  19.593  -57.734 1.00 54.19  ? 628  GLU A CD    1 
ATOM   1485 O  OE1   . GLU A 1 214  ? 47.774  20.546  -58.046 1.00 58.29  ? 628  GLU A OE1   1 
ATOM   1486 O  OE2   . GLU A 1 214  ? 49.765  19.579  -57.991 1.00 53.58  ? 628  GLU A OE2   1 
ATOM   1487 N  N     . THR A 1 215  ? 44.092  18.953  -58.441 1.00 40.62  ? 629  THR A N     1 
ATOM   1488 C  CA    . THR A 1 215  ? 43.017  19.691  -59.057 1.00 41.04  ? 629  THR A CA    1 
ATOM   1489 C  C     . THR A 1 215  ? 41.712  19.088  -58.549 1.00 40.85  ? 629  THR A C     1 
ATOM   1490 O  O     . THR A 1 215  ? 40.825  19.797  -58.087 1.00 40.54  ? 629  THR A O     1 
ATOM   1491 C  CB    . THR A 1 215  ? 43.079  19.543  -60.559 1.00 41.00  ? 629  THR A CB    1 
ATOM   1492 O  OG1   . THR A 1 215  ? 44.402  19.879  -60.985 1.00 42.44  ? 629  THR A OG1   1 
ATOM   1493 C  CG2   . THR A 1 215  ? 42.080  20.468  -61.221 1.00 40.88  ? 629  THR A CG2   1 
ATOM   1494 N  N     . GLY A 1 216  ? 41.620  17.769  -58.610 1.00 41.08  ? 630  GLY A N     1 
ATOM   1495 C  CA    . GLY A 1 216  ? 40.448  17.057  -58.083 1.00 41.88  ? 630  GLY A CA    1 
ATOM   1496 C  C     . GLY A 1 216  ? 40.257  17.359  -56.604 1.00 42.22  ? 630  GLY A C     1 
ATOM   1497 O  O     . GLY A 1 216  ? 39.145  17.597  -56.152 1.00 42.05  ? 630  GLY A O     1 
ATOM   1498 N  N     . LEU A 1 217  ? 41.344  17.373  -55.844 1.00 42.19  ? 631  LEU A N     1 
ATOM   1499 C  CA    . LEU A 1 217  ? 41.200  17.607  -54.415 1.00 42.62  ? 631  LEU A CA    1 
ATOM   1500 C  C     . LEU A 1 217  ? 40.629  19.007  -54.193 1.00 43.22  ? 631  LEU A C     1 
ATOM   1501 O  O     . LEU A 1 217  ? 39.679  19.199  -53.406 1.00 43.93  ? 631  LEU A O     1 
ATOM   1502 C  CB    . LEU A 1 217  ? 42.530  17.463  -53.672 1.00 41.98  ? 631  LEU A CB    1 
ATOM   1503 C  CG    . LEU A 1 217  ? 42.482  17.914  -52.207 1.00 41.13  ? 631  LEU A CG    1 
ATOM   1504 C  CD1   . LEU A 1 217  ? 41.904  16.848  -51.273 1.00 37.46  ? 631  LEU A CD1   1 
ATOM   1505 C  CD2   . LEU A 1 217  ? 43.855  18.396  -51.742 1.00 37.35  ? 631  LEU A CD2   1 
ATOM   1506 N  N     . LYS A 1 218  ? 41.196  19.990  -54.881 1.00 42.57  ? 632  LYS A N     1 
ATOM   1507 C  CA    . LYS A 1 218  ? 40.700  21.347  -54.694 1.00 42.40  ? 632  LYS A CA    1 
ATOM   1508 C  C     . LYS A 1 218  ? 39.223  21.489  -55.130 1.00 42.20  ? 632  LYS A C     1 
ATOM   1509 O  O     . LYS A 1 218  ? 38.422  22.147  -54.466 1.00 42.46  ? 632  LYS A O     1 
ATOM   1510 C  CB    . LYS A 1 218  ? 41.602  22.374  -55.369 1.00 41.22  ? 632  LYS A CB    1 
ATOM   1511 C  CG    . LYS A 1 218  ? 41.095  23.800  -55.175 1.00 41.58  ? 632  LYS A CG    1 
ATOM   1512 C  CD    . LYS A 1 218  ? 42.022  24.870  -55.799 1.00 41.31  ? 632  LYS A CD    1 
ATOM   1513 C  CE    . LYS A 1 218  ? 43.274  25.125  -54.948 1.00 38.93  ? 632  LYS A CE    1 
ATOM   1514 N  NZ    . LYS A 1 218  ? 43.784  26.503  -55.172 1.00 38.54  ? 632  LYS A NZ    1 
ATOM   1515 N  N     . ASN A 1 219  ? 38.846  20.854  -56.225 1.00 42.24  ? 633  ASN A N     1 
ATOM   1516 C  CA    . ASN A 1 219  ? 37.433  20.857  -56.604 1.00 42.56  ? 633  ASN A CA    1 
ATOM   1517 C  C     . ASN A 1 219  ? 36.533  20.207  -55.536 1.00 42.85  ? 633  ASN A C     1 
ATOM   1518 O  O     . ASN A 1 219  ? 35.398  20.635  -55.316 1.00 43.35  ? 633  ASN A O     1 
ATOM   1519 C  CB    . ASN A 1 219  ? 37.224  20.209  -57.981 1.00 42.09  ? 633  ASN A CB    1 
ATOM   1520 C  CG    . ASN A 1 219  ? 37.595  21.143  -59.140 1.00 41.74  ? 633  ASN A CG    1 
ATOM   1521 O  OD1   . ASN A 1 219  ? 38.168  20.711  -60.143 1.00 40.80  ? 633  ASN A OD1   1 
ATOM   1522 N  ND2   . ASN A 1 219  ? 37.252  22.417  -59.012 1.00 41.26  ? 633  ASN A ND2   1 
ATOM   1523 N  N     . LEU A 1 220  ? 37.024  19.162  -54.877 1.00 43.17  ? 634  LEU A N     1 
ATOM   1524 C  CA    . LEU A 1 220  ? 36.294  18.598  -53.725 1.00 42.93  ? 634  LEU A CA    1 
ATOM   1525 C  C     . LEU A 1 220  ? 36.070  19.666  -52.665 1.00 42.86  ? 634  LEU A C     1 
ATOM   1526 O  O     . LEU A 1 220  ? 34.970  19.735  -52.100 1.00 42.35  ? 634  LEU A O     1 
ATOM   1527 C  CB    . LEU A 1 220  ? 37.042  17.430  -53.081 1.00 42.59  ? 634  LEU A CB    1 
ATOM   1528 C  CG    . LEU A 1 220  ? 36.858  16.105  -53.793 1.00 42.97  ? 634  LEU A CG    1 
ATOM   1529 C  CD1   . LEU A 1 220  ? 37.277  14.987  -52.854 1.00 43.85  ? 634  LEU A CD1   1 
ATOM   1530 C  CD2   . LEU A 1 220  ? 35.418  15.955  -54.229 1.00 41.49  ? 634  LEU A CD2   1 
ATOM   1531 N  N     . PHE A 1 221  ? 37.113  20.468  -52.373 1.00 41.92  ? 635  PHE A N     1 
ATOM   1532 C  CA    . PHE A 1 221  ? 37.013  21.467  -51.309 1.00 42.30  ? 635  PHE A CA    1 
ATOM   1533 C  C     . PHE A 1 221  ? 35.996  22.541  -51.723 1.00 42.31  ? 635  PHE A C     1 
ATOM   1534 O  O     . PHE A 1 221  ? 35.204  23.028  -50.900 1.00 42.10  ? 635  PHE A O     1 
ATOM   1535 C  CB    . PHE A 1 221  ? 38.378  22.105  -50.968 1.00 42.09  ? 635  PHE A CB    1 
ATOM   1536 C  CG    . PHE A 1 221  ? 39.306  21.210  -50.163 1.00 42.01  ? 635  PHE A CG    1 
ATOM   1537 C  CD1   . PHE A 1 221  ? 40.477  21.726  -49.599 1.00 42.66  ? 635  PHE A CD1   1 
ATOM   1538 C  CD2   . PHE A 1 221  ? 39.021  19.868  -49.965 1.00 41.19  ? 635  PHE A CD2   1 
ATOM   1539 C  CE1   . PHE A 1 221  ? 41.361  20.919  -48.861 1.00 40.72  ? 635  PHE A CE1   1 
ATOM   1540 C  CE2   . PHE A 1 221  ? 39.901  19.057  -49.225 1.00 42.39  ? 635  PHE A CE2   1 
ATOM   1541 C  CZ    . PHE A 1 221  ? 41.077  19.598  -48.678 1.00 41.03  ? 635  PHE A CZ    1 
ATOM   1542 N  N     . LYS A 1 222  ? 36.020  22.897  -53.005 1.00 41.96  ? 636  LYS A N     1 
ATOM   1543 C  CA    . LYS A 1 222  ? 35.048  23.862  -53.550 1.00 41.82  ? 636  LYS A CA    1 
ATOM   1544 C  C     . LYS A 1 222  ? 33.597  23.360  -53.472 1.00 41.89  ? 636  LYS A C     1 
ATOM   1545 O  O     . LYS A 1 222  ? 32.719  24.060  -52.974 1.00 41.79  ? 636  LYS A O     1 
ATOM   1546 C  CB    . LYS A 1 222  ? 35.428  24.270  -54.971 1.00 41.11  ? 636  LYS A CB    1 
ATOM   1547 C  CG    . LYS A 1 222  ? 36.582  25.283  -55.013 1.00 40.26  ? 636  LYS A CG    1 
ATOM   1548 C  CD    . LYS A 1 222  ? 37.055  25.496  -56.451 1.00 38.30  ? 636  LYS A CD    1 
ATOM   1549 C  CE    . LYS A 1 222  ? 38.215  26.500  -56.548 1.00 38.62  ? 636  LYS A CE    1 
ATOM   1550 N  NZ    . LYS A 1 222  ? 38.618  26.741  -57.983 1.00 33.50  ? 636  LYS A NZ    1 
ATOM   1551 N  N     . LEU A 1 223  ? 33.380  22.134  -53.940 1.00 42.00  ? 637  LEU A N     1 
ATOM   1552 C  CA    . LEU A 1 223  ? 32.096  21.441  -53.847 1.00 42.31  ? 637  LEU A CA    1 
ATOM   1553 C  C     . LEU A 1 223  ? 31.532  21.345  -52.425 1.00 42.03  ? 637  LEU A C     1 
ATOM   1554 O  O     . LEU A 1 223  ? 30.353  21.638  -52.185 1.00 41.66  ? 637  LEU A O     1 
ATOM   1555 C  CB    . LEU A 1 223  ? 32.213  20.045  -54.490 1.00 42.38  ? 637  LEU A CB    1 
ATOM   1556 C  CG    . LEU A 1 223  ? 31.710  19.826  -55.935 1.00 43.03  ? 637  LEU A CG    1 
ATOM   1557 C  CD1   . LEU A 1 223  ? 31.322  21.084  -56.671 1.00 42.31  ? 637  LEU A CD1   1 
ATOM   1558 C  CD2   . LEU A 1 223  ? 32.743  19.087  -56.740 1.00 44.04  ? 637  LEU A CD2   1 
ATOM   1559 N  N     . VAL A 1 224  ? 32.345  20.936  -51.459 1.00 42.22  ? 638  VAL A N     1 
ATOM   1560 C  CA    . VAL A 1 224  ? 31.793  20.927  -50.106 1.00 42.28  ? 638  VAL A CA    1 
ATOM   1561 C  C     . VAL A 1 224  ? 31.469  22.333  -49.618 1.00 41.94  ? 638  VAL A C     1 
ATOM   1562 O  O     . VAL A 1 224  ? 30.459  22.541  -48.923 1.00 41.80  ? 638  VAL A O     1 
ATOM   1563 C  CB    . VAL A 1 224  ? 32.596  20.053  -49.100 1.00 42.55  ? 638  VAL A CB    1 
ATOM   1564 C  CG1   . VAL A 1 224  ? 33.891  19.618  -49.695 1.00 43.74  ? 638  VAL A CG1   1 
ATOM   1565 C  CG2   . VAL A 1 224  ? 32.791  20.748  -47.732 1.00 42.89  ? 638  VAL A CG2   1 
ATOM   1566 N  N     . SER A 1 225  ? 32.283  23.308  -50.022 1.00 41.29  ? 639  SER A N     1 
ATOM   1567 C  CA    . SER A 1 225  ? 32.011  24.703  -49.683 1.00 41.37  ? 639  SER A CA    1 
ATOM   1568 C  C     . SER A 1 225  ? 30.680  25.211  -50.265 1.00 41.32  ? 639  SER A C     1 
ATOM   1569 O  O     . SER A 1 225  ? 29.825  25.745  -49.539 1.00 40.60  ? 639  SER A O     1 
ATOM   1570 C  CB    . SER A 1 225  ? 33.159  25.615  -50.135 1.00 41.05  ? 639  SER A CB    1 
ATOM   1571 O  OG    . SER A 1 225  ? 34.344  25.309  -49.432 1.00 41.63  ? 639  SER A OG    1 
ATOM   1572 N  N     . LEU A 1 226  ? 30.525  25.061  -51.579 1.00 41.34  ? 640  LEU A N     1 
ATOM   1573 C  CA    . LEU A 1 226  ? 29.340  25.530  -52.265 1.00 41.32  ? 640  LEU A CA    1 
ATOM   1574 C  C     . LEU A 1 226  ? 28.098  24.811  -51.750 1.00 41.62  ? 640  LEU A C     1 
ATOM   1575 O  O     . LEU A 1 226  ? 27.040  25.423  -51.593 1.00 41.73  ? 640  LEU A O     1 
ATOM   1576 C  CB    . LEU A 1 226  ? 29.491  25.307  -53.764 1.00 41.19  ? 640  LEU A CB    1 
ATOM   1577 C  CG    . LEU A 1 226  ? 30.488  26.226  -54.483 1.00 42.25  ? 640  LEU A CG    1 
ATOM   1578 C  CD1   . LEU A 1 226  ? 30.737  25.755  -55.916 1.00 42.40  ? 640  LEU A CD1   1 
ATOM   1579 C  CD2   . LEU A 1 226  ? 29.999  27.675  -54.481 1.00 41.83  ? 640  LEU A CD2   1 
ATOM   1580 N  N     . SER A 1 227  ? 28.226  23.511  -51.497 1.00 41.54  ? 641  SER A N     1 
ATOM   1581 C  CA    . SER A 1 227  ? 27.083  22.717  -51.080 1.00 42.07  ? 641  SER A CA    1 
ATOM   1582 C  C     . SER A 1 227  ? 26.623  23.116  -49.667 1.00 42.18  ? 641  SER A C     1 
ATOM   1583 O  O     . SER A 1 227  ? 25.482  22.844  -49.263 1.00 41.93  ? 641  SER A O     1 
ATOM   1584 C  CB    . SER A 1 227  ? 27.415  21.215  -51.144 1.00 41.95  ? 641  SER A CB    1 
ATOM   1585 O  OG    . SER A 1 227  ? 28.210  20.806  -50.034 1.00 43.55  ? 641  SER A OG    1 
ATOM   1586 N  N     . HIS A 1 228  ? 27.513  23.758  -48.914 1.00 41.85  ? 642  HIS A N     1 
ATOM   1587 C  CA    . HIS A 1 228  ? 27.194  24.097  -47.536 1.00 42.09  ? 642  HIS A CA    1 
ATOM   1588 C  C     . HIS A 1 228  ? 26.758  25.541  -47.434 1.00 42.40  ? 642  HIS A C     1 
ATOM   1589 O  O     . HIS A 1 228  ? 26.179  25.955  -46.429 1.00 42.47  ? 642  HIS A O     1 
ATOM   1590 C  CB    . HIS A 1 228  ? 28.381  23.841  -46.609 1.00 41.59  ? 642  HIS A CB    1 
ATOM   1591 C  CG    . HIS A 1 228  ? 28.481  22.426  -46.121 1.00 41.30  ? 642  HIS A CG    1 
ATOM   1592 N  ND1   . HIS A 1 228  ? 28.953  21.397  -46.906 1.00 41.44  ? 642  HIS A ND1   1 
ATOM   1593 C  CD2   . HIS A 1 228  ? 28.195  21.877  -44.916 1.00 41.02  ? 642  HIS A CD2   1 
ATOM   1594 C  CE1   . HIS A 1 228  ? 28.928  20.269  -46.216 1.00 40.87  ? 642  HIS A CE1   1 
ATOM   1595 N  NE2   . HIS A 1 228  ? 28.483  20.535  -45.002 1.00 41.37  ? 642  HIS A NE2   1 
ATOM   1596 N  N     . ILE A 1 229  ? 27.044  26.315  -48.471 1.00 42.77  ? 643  ILE A N     1 
ATOM   1597 C  CA    . ILE A 1 229  ? 26.816  27.753  -48.394 1.00 43.08  ? 643  ILE A CA    1 
ATOM   1598 C  C     . ILE A 1 229  ? 25.757  28.221  -49.416 1.00 43.73  ? 643  ILE A C     1 
ATOM   1599 O  O     . ILE A 1 229  ? 24.618  28.489  -49.054 1.00 43.21  ? 643  ILE A O     1 
ATOM   1600 C  CB    . ILE A 1 229  ? 28.160  28.564  -48.469 1.00 42.63  ? 643  ILE A CB    1 
ATOM   1601 C  CG1   . ILE A 1 229  ? 29.073  28.219  -47.282 1.00 42.76  ? 643  ILE A CG1   1 
ATOM   1602 C  CG2   . ILE A 1 229  ? 27.903  30.053  -48.445 1.00 41.07  ? 643  ILE A CG2   1 
ATOM   1603 C  CD1   . ILE A 1 229  ? 30.467  28.897  -47.341 1.00 41.09  ? 643  ILE A CD1   1 
ATOM   1604 N  N     . GLN A 1 230  ? 26.128  28.301  -50.687 1.00 44.82  ? 644  GLN A N     1 
ATOM   1605 C  CA    . GLN A 1 230  ? 25.219  28.823  -51.703 1.00 45.75  ? 644  GLN A CA    1 
ATOM   1606 C  C     . GLN A 1 230  ? 24.054  27.861  -51.898 1.00 46.33  ? 644  GLN A C     1 
ATOM   1607 O  O     . GLN A 1 230  ? 22.899  28.282  -52.071 1.00 45.94  ? 644  GLN A O     1 
ATOM   1608 C  CB    . GLN A 1 230  ? 25.957  29.046  -53.034 1.00 45.69  ? 644  GLN A CB    1 
ATOM   1609 C  CG    . GLN A 1 230  ? 26.796  30.352  -53.123 1.00 47.50  ? 644  GLN A CG    1 
ATOM   1610 C  CD    . GLN A 1 230  ? 28.272  30.233  -52.608 1.00 49.42  ? 644  GLN A CD    1 
ATOM   1611 O  OE1   . GLN A 1 230  ? 29.164  30.939  -53.102 1.00 49.31  ? 644  GLN A OE1   1 
ATOM   1612 N  NE2   . GLN A 1 230  ? 28.515  29.355  -51.621 1.00 47.70  ? 644  GLN A NE2   1 
ATOM   1613 N  N     . TYR A 1 231  ? 24.347  26.563  -51.845 1.00 47.15  ? 645  TYR A N     1 
ATOM   1614 C  CA    . TYR A 1 231  ? 23.357  25.569  -52.275 1.00 48.08  ? 645  TYR A CA    1 
ATOM   1615 C  C     . TYR A 1 231  ? 22.811  24.687  -51.171 1.00 48.51  ? 645  TYR A C     1 
ATOM   1616 O  O     . TYR A 1 231  ? 22.292  23.616  -51.440 1.00 48.12  ? 645  TYR A O     1 
ATOM   1617 C  CB    . TYR A 1 231  ? 23.910  24.709  -53.414 1.00 48.23  ? 645  TYR A CB    1 
ATOM   1618 C  CG    . TYR A 1 231  ? 24.307  25.529  -54.622 1.00 49.00  ? 645  TYR A CG    1 
ATOM   1619 C  CD1   . TYR A 1 231  ? 23.355  26.215  -55.354 1.00 48.89  ? 645  TYR A CD1   1 
ATOM   1620 C  CD2   . TYR A 1 231  ? 25.642  25.632  -55.016 1.00 49.77  ? 645  TYR A CD2   1 
ATOM   1621 C  CE1   . TYR A 1 231  ? 23.712  26.968  -56.458 1.00 50.71  ? 645  TYR A CE1   1 
ATOM   1622 C  CE2   . TYR A 1 231  ? 26.012  26.386  -56.113 1.00 49.57  ? 645  TYR A CE2   1 
ATOM   1623 C  CZ    . TYR A 1 231  ? 25.046  27.056  -56.828 1.00 51.00  ? 645  TYR A CZ    1 
ATOM   1624 O  OH    . TYR A 1 231  ? 25.400  27.811  -57.929 1.00 51.88  ? 645  TYR A OH    1 
ATOM   1625 N  N     . PHE A 1 232  ? 22.927  25.136  -49.928 1.00 49.55  ? 646  PHE A N     1 
ATOM   1626 C  CA    . PHE A 1 232  ? 22.422  24.359  -48.824 1.00 50.65  ? 646  PHE A CA    1 
ATOM   1627 C  C     . PHE A 1 232  ? 20.920  24.557  -48.781 1.00 51.81  ? 646  PHE A C     1 
ATOM   1628 O  O     . PHE A 1 232  ? 20.444  25.691  -48.700 1.00 52.08  ? 646  PHE A O     1 
ATOM   1629 C  CB    . PHE A 1 232  ? 23.042  24.816  -47.515 1.00 50.40  ? 646  PHE A CB    1 
ATOM   1630 C  CG    . PHE A 1 232  ? 22.634  23.982  -46.344 1.00 50.68  ? 646  PHE A CG    1 
ATOM   1631 C  CD1   . PHE A 1 232  ? 21.554  24.352  -45.558 1.00 50.26  ? 646  PHE A CD1   1 
ATOM   1632 C  CD2   . PHE A 1 232  ? 23.321  22.816  -46.036 1.00 51.39  ? 646  PHE A CD2   1 
ATOM   1633 C  CE1   . PHE A 1 232  ? 21.165  23.581  -44.473 1.00 50.71  ? 646  PHE A CE1   1 
ATOM   1634 C  CE2   . PHE A 1 232  ? 22.937  22.030  -44.954 1.00 52.47  ? 646  PHE A CE2   1 
ATOM   1635 C  CZ    . PHE A 1 232  ? 21.854  22.419  -44.164 1.00 51.47  ? 646  PHE A CZ    1 
ATOM   1636 N  N     . HIS A 1 233  ? 20.165  23.467  -48.858 1.00 52.75  ? 647  HIS A N     1 
ATOM   1637 C  CA    . HIS A 1 233  ? 18.716  23.585  -48.822 1.00 53.73  ? 647  HIS A CA    1 
ATOM   1638 C  C     . HIS A 1 233  ? 18.233  23.219  -47.427 1.00 53.88  ? 647  HIS A C     1 
ATOM   1639 O  O     . HIS A 1 233  ? 17.957  24.105  -46.612 1.00 54.71  ? 647  HIS A O     1 
ATOM   1640 C  CB    . HIS A 1 233  ? 18.040  22.741  -49.912 1.00 53.88  ? 647  HIS A CB    1 
ATOM   1641 C  CG    . HIS A 1 233  ? 16.652  23.207  -50.260 1.00 55.68  ? 647  HIS A CG    1 
ATOM   1642 N  ND1   . HIS A 1 233  ? 15.618  23.231  -49.344 1.00 56.35  ? 647  HIS A ND1   1 
ATOM   1643 C  CD2   . HIS A 1 233  ? 16.129  23.664  -51.426 1.00 56.62  ? 647  HIS A CD2   1 
ATOM   1644 C  CE1   . HIS A 1 233  ? 14.524  23.683  -49.930 1.00 56.99  ? 647  HIS A CE1   1 
ATOM   1645 N  NE2   . HIS A 1 233  ? 14.806  23.951  -51.194 1.00 57.22  ? 647  HIS A NE2   1 
ATOM   1646 N  N     . ARG A 1 234  ? 18.134  21.925  -47.138 1.00 53.73  ? 648  ARG A N     1 
ATOM   1647 C  CA    . ARG A 1 234  ? 17.936  21.472  -45.755 1.00 53.24  ? 648  ARG A CA    1 
ATOM   1648 C  C     . ARG A 1 234  ? 19.083  20.520  -45.491 1.00 52.90  ? 648  ARG A C     1 
ATOM   1649 O  O     . ARG A 1 234  ? 19.236  19.950  -44.418 1.00 53.33  ? 648  ARG A O     1 
ATOM   1650 C  CB    . ARG A 1 234  ? 16.581  20.771  -45.579 1.00 53.06  ? 648  ARG A CB    1 
ATOM   1651 N  N     . VAL A 1 235  ? 19.922  20.390  -46.499 1.00 52.63  ? 649  VAL A N     1 
ATOM   1652 C  CA    . VAL A 1 235  ? 20.983  19.413  -46.492 1.00 52.23  ? 649  VAL A CA    1 
ATOM   1653 C  C     . VAL A 1 235  ? 21.985  19.890  -47.543 1.00 51.72  ? 649  VAL A C     1 
ATOM   1654 O  O     . VAL A 1 235  ? 21.605  20.589  -48.482 1.00 51.54  ? 649  VAL A O     1 
ATOM   1655 C  CB    . VAL A 1 235  ? 20.376  18.010  -46.792 1.00 52.68  ? 649  VAL A CB    1 
ATOM   1656 C  CG1   . VAL A 1 235  ? 20.944  17.392  -48.077 1.00 52.52  ? 649  VAL A CG1   1 
ATOM   1657 C  CG2   . VAL A 1 235  ? 20.491  17.081  -45.578 1.00 51.93  ? 649  VAL A CG2   1 
ATOM   1658 N  N     . PRO A 1 236  ? 23.275  19.563  -47.385 1.00 51.12  ? 650  PRO A N     1 
ATOM   1659 C  CA    . PRO A 1 236  ? 24.165  20.090  -48.418 1.00 50.53  ? 650  PRO A CA    1 
ATOM   1660 C  C     . PRO A 1 236  ? 23.840  19.468  -49.776 1.00 50.40  ? 650  PRO A C     1 
ATOM   1661 O  O     . PRO A 1 236  ? 23.588  18.264  -49.859 1.00 50.57  ? 650  PRO A O     1 
ATOM   1662 C  CB    . PRO A 1 236  ? 25.546  19.632  -47.966 1.00 50.58  ? 650  PRO A CB    1 
ATOM   1663 C  CG    . PRO A 1 236  ? 25.394  19.231  -46.499 1.00 50.62  ? 650  PRO A CG    1 
ATOM   1664 C  CD    . PRO A 1 236  ? 23.985  18.756  -46.376 1.00 51.18  ? 650  PRO A CD    1 
ATOM   1665 N  N     . ARG A 1 237  ? 23.837  20.267  -50.837 1.00 49.60  ? 651  ARG A N     1 
ATOM   1666 C  CA    . ARG A 1 237  ? 23.616  19.688  -52.156 1.00 49.36  ? 651  ARG A CA    1 
ATOM   1667 C  C     . ARG A 1 237  ? 24.332  20.379  -53.330 1.00 48.49  ? 651  ARG A C     1 
ATOM   1668 O  O     . ARG A 1 237  ? 24.724  21.545  -53.257 1.00 47.60  ? 651  ARG A O     1 
ATOM   1669 C  CB    . ARG A 1 237  ? 22.120  19.524  -52.431 1.00 49.98  ? 651  ARG A CB    1 
ATOM   1670 C  CG    . ARG A 1 237  ? 21.372  20.828  -52.529 1.00 51.59  ? 651  ARG A CG    1 
ATOM   1671 C  CD    . ARG A 1 237  ? 19.867  20.634  -52.430 1.00 53.43  ? 651  ARG A CD    1 
ATOM   1672 N  NE    . ARG A 1 237  ? 19.166  21.757  -53.053 1.00 55.03  ? 651  ARG A NE    1 
ATOM   1673 C  CZ    . ARG A 1 237  ? 17.874  21.749  -53.371 1.00 57.13  ? 651  ARG A CZ    1 
ATOM   1674 N  NH1   . ARG A 1 237  ? 17.128  20.674  -53.117 1.00 57.01  ? 651  ARG A NH1   1 
ATOM   1675 N  NH2   . ARG A 1 237  ? 17.323  22.821  -53.935 1.00 57.29  ? 651  ARG A NH2   1 
ATOM   1676 N  N     . ILE A 1 238  ? 24.509  19.633  -54.407 1.00 47.77  ? 652  ILE A N     1 
ATOM   1677 C  CA    . ILE A 1 238  ? 25.209  20.155  -55.554 1.00 47.98  ? 652  ILE A CA    1 
ATOM   1678 C  C     . ILE A 1 238  ? 24.409  20.031  -56.858 1.00 47.83  ? 652  ILE A C     1 
ATOM   1679 O  O     . ILE A 1 238  ? 24.199  18.922  -57.352 1.00 47.78  ? 652  ILE A O     1 
ATOM   1680 C  CB    . ILE A 1 238  ? 26.562  19.465  -55.712 1.00 48.24  ? 652  ILE A CB    1 
ATOM   1681 C  CG1   . ILE A 1 238  ? 27.306  19.473  -54.377 1.00 48.25  ? 652  ILE A CG1   1 
ATOM   1682 C  CG2   . ILE A 1 238  ? 27.389  20.163  -56.777 1.00 47.61  ? 652  ILE A CG2   1 
ATOM   1683 C  CD1   . ILE A 1 238  ? 28.479  18.538  -54.355 1.00 48.08  ? 652  ILE A CD1   1 
ATOM   1684 N  N     . PRO A 1 239  ? 23.962  21.168  -57.424 1.00 47.74  ? 653  PRO A N     1 
ATOM   1685 C  CA    . PRO A 1 239  ? 23.344  21.058  -58.745 1.00 47.63  ? 653  PRO A CA    1 
ATOM   1686 C  C     . PRO A 1 239  ? 24.290  20.329  -59.680 1.00 47.46  ? 653  PRO A C     1 
ATOM   1687 O  O     . PRO A 1 239  ? 25.501  20.530  -59.608 1.00 47.46  ? 653  PRO A O     1 
ATOM   1688 C  CB    . PRO A 1 239  ? 23.194  22.515  -59.202 1.00 47.39  ? 653  PRO A CB    1 
ATOM   1689 C  CG    . PRO A 1 239  ? 23.175  23.311  -57.954 1.00 47.99  ? 653  PRO A CG    1 
ATOM   1690 C  CD    . PRO A 1 239  ? 24.075  22.568  -56.974 1.00 47.83  ? 653  PRO A CD    1 
ATOM   1691 N  N     . ARG A 1 240  ? 23.737  19.478  -60.539 1.00 47.93  ? 654  ARG A N     1 
ATOM   1692 C  CA    . ARG A 1 240  ? 24.535  18.720  -61.495 1.00 47.90  ? 654  ARG A CA    1 
ATOM   1693 C  C     . ARG A 1 240  ? 25.400  19.650  -62.329 1.00 47.39  ? 654  ARG A C     1 
ATOM   1694 O  O     . ARG A 1 240  ? 26.547  19.328  -62.604 1.00 48.14  ? 654  ARG A O     1 
ATOM   1695 C  CB    . ARG A 1 240  ? 23.667  17.804  -62.380 1.00 48.06  ? 654  ARG A CB    1 
ATOM   1696 C  CG    . ARG A 1 240  ? 24.052  17.825  -63.867 1.00 49.96  ? 654  ARG A CG    1 
ATOM   1697 C  CD    . ARG A 1 240  ? 23.582  16.605  -64.696 1.00 52.32  ? 654  ARG A CD    1 
ATOM   1698 N  NE    . ARG A 1 240  ? 22.466  15.845  -64.121 1.00 54.79  ? 654  ARG A NE    1 
ATOM   1699 C  CZ    . ARG A 1 240  ? 22.556  14.573  -63.732 1.00 54.74  ? 654  ARG A CZ    1 
ATOM   1700 N  NH1   . ARG A 1 240  ? 21.500  13.951  -63.228 1.00 55.60  ? 654  ARG A NH1   1 
ATOM   1701 N  NH2   . ARG A 1 240  ? 23.705  13.919  -63.855 1.00 55.39  ? 654  ARG A NH2   1 
ATOM   1702 N  N     . SER A 1 241  ? 24.892  20.818  -62.695 1.00 46.52  ? 655  SER A N     1 
ATOM   1703 C  CA    . SER A 1 241  ? 25.728  21.732  -63.476 1.00 46.09  ? 655  SER A CA    1 
ATOM   1704 C  C     . SER A 1 241  ? 26.972  22.182  -62.678 1.00 45.91  ? 655  SER A C     1 
ATOM   1705 O  O     . SER A 1 241  ? 28.062  22.318  -63.240 1.00 46.15  ? 655  SER A O     1 
ATOM   1706 C  CB    . SER A 1 241  ? 24.931  22.924  -64.040 1.00 45.85  ? 655  SER A CB    1 
ATOM   1707 O  OG    . SER A 1 241  ? 24.696  23.932  -63.069 1.00 45.05  ? 655  SER A OG    1 
ATOM   1708 N  N     . VAL A 1 242  ? 26.818  22.408  -61.375 1.00 44.95  ? 656  VAL A N     1 
ATOM   1709 C  CA    . VAL A 1 242  ? 27.937  22.873  -60.581 1.00 44.14  ? 656  VAL A CA    1 
ATOM   1710 C  C     . VAL A 1 242  ? 28.960  21.752  -60.415 1.00 44.01  ? 656  VAL A C     1 
ATOM   1711 O  O     . VAL A 1 242  ? 30.138  22.008  -60.247 1.00 44.18  ? 656  VAL A O     1 
ATOM   1712 C  CB    . VAL A 1 242  ? 27.456  23.479  -59.244 1.00 44.33  ? 656  VAL A CB    1 
ATOM   1713 C  CG1   . VAL A 1 242  ? 28.613  23.695  -58.243 1.00 43.67  ? 656  VAL A CG1   1 
ATOM   1714 C  CG2   . VAL A 1 242  ? 26.711  24.789  -59.517 1.00 43.43  ? 656  VAL A CG2   1 
ATOM   1715 N  N     . LEU A 1 243  ? 28.512  20.508  -60.492 1.00 43.83  ? 657  LEU A N     1 
ATOM   1716 C  CA    . LEU A 1 243  ? 29.431  19.376  -60.426 1.00 43.64  ? 657  LEU A CA    1 
ATOM   1717 C  C     . LEU A 1 243  ? 30.317  19.368  -61.665 1.00 43.89  ? 657  LEU A C     1 
ATOM   1718 O  O     . LEU A 1 243  ? 31.539  19.172  -61.583 1.00 43.62  ? 657  LEU A O     1 
ATOM   1719 C  CB    . LEU A 1 243  ? 28.644  18.066  -60.369 1.00 43.67  ? 657  LEU A CB    1 
ATOM   1720 C  CG    . LEU A 1 243  ? 29.193  16.821  -59.664 1.00 43.22  ? 657  LEU A CG    1 
ATOM   1721 C  CD1   . LEU A 1 243  ? 28.618  15.552  -60.323 1.00 42.57  ? 657  LEU A CD1   1 
ATOM   1722 C  CD2   . LEU A 1 243  ? 30.708  16.779  -59.648 1.00 40.66  ? 657  LEU A CD2   1 
ATOM   1723 N  N     . VAL A 1 244  ? 29.688  19.555  -62.824 1.00 43.90  ? 658  VAL A N     1 
ATOM   1724 C  CA    . VAL A 1 244  ? 30.391  19.530  -64.101 1.00 43.99  ? 658  VAL A CA    1 
ATOM   1725 C  C     . VAL A 1 244  ? 31.451  20.641  -64.131 1.00 44.40  ? 658  VAL A C     1 
ATOM   1726 O  O     . VAL A 1 244  ? 32.611  20.416  -64.489 1.00 44.33  ? 658  VAL A O     1 
ATOM   1727 C  CB    . VAL A 1 244  ? 29.379  19.654  -65.293 1.00 44.44  ? 658  VAL A CB    1 
ATOM   1728 C  CG1   . VAL A 1 244  ? 30.066  20.157  -66.580 1.00 43.97  ? 658  VAL A CG1   1 
ATOM   1729 C  CG2   . VAL A 1 244  ? 28.639  18.320  -65.533 1.00 43.50  ? 658  VAL A CG2   1 
ATOM   1730 N  N     . LYS A 1 245  ? 31.046  21.839  -63.737 1.00 44.73  ? 659  LYS A N     1 
ATOM   1731 C  CA    . LYS A 1 245  ? 31.967  22.951  -63.584 1.00 45.06  ? 659  LYS A CA    1 
ATOM   1732 C  C     . LYS A 1 245  ? 33.208  22.514  -62.798 1.00 44.79  ? 659  LYS A C     1 
ATOM   1733 O  O     . LYS A 1 245  ? 34.319  22.941  -63.087 1.00 44.68  ? 659  LYS A O     1 
ATOM   1734 C  CB    . LYS A 1 245  ? 31.262  24.072  -62.824 1.00 45.33  ? 659  LYS A CB    1 
ATOM   1735 C  CG    . LYS A 1 245  ? 31.351  25.428  -63.452 1.00 46.73  ? 659  LYS A CG    1 
ATOM   1736 C  CD    . LYS A 1 245  ? 30.101  26.227  -63.050 1.00 49.82  ? 659  LYS A CD    1 
ATOM   1737 C  CE    . LYS A 1 245  ? 29.316  26.770  -64.273 1.00 48.81  ? 659  LYS A CE    1 
ATOM   1738 N  NZ    . LYS A 1 245  ? 29.964  27.954  -64.899 1.00 49.88  ? 659  LYS A NZ    1 
ATOM   1739 N  N     . HIS A 1 246  ? 33.015  21.663  -61.799 1.00 44.65  ? 660  HIS A N     1 
ATOM   1740 C  CA    . HIS A 1 246  ? 34.104  21.313  -60.882 1.00 44.51  ? 660  HIS A CA    1 
ATOM   1741 C  C     . HIS A 1 246  ? 34.510  19.866  -60.989 1.00 43.82  ? 660  HIS A C     1 
ATOM   1742 O  O     . HIS A 1 246  ? 35.027  19.290  -60.033 1.00 43.33  ? 660  HIS A O     1 
ATOM   1743 C  CB    . HIS A 1 246  ? 33.693  21.619  -59.443 1.00 44.86  ? 660  HIS A CB    1 
ATOM   1744 C  CG    . HIS A 1 246  ? 33.503  23.077  -59.194 1.00 46.61  ? 660  HIS A CG    1 
ATOM   1745 N  ND1   . HIS A 1 246  ? 32.258  23.660  -59.085 1.00 48.64  ? 660  HIS A ND1   1 
ATOM   1746 C  CD2   . HIS A 1 246  ? 34.401  24.086  -59.108 1.00 46.74  ? 660  HIS A CD2   1 
ATOM   1747 C  CE1   . HIS A 1 246  ? 32.399  24.964  -58.910 1.00 47.95  ? 660  HIS A CE1   1 
ATOM   1748 N  NE2   . HIS A 1 246  ? 33.689  25.247  -58.915 1.00 47.42  ? 660  HIS A NE2   1 
ATOM   1749 N  N     . ARG A 1 247  ? 34.280  19.279  -62.155 1.00 43.33  ? 661  ARG A N     1 
ATOM   1750 C  CA    . ARG A 1 247  ? 34.564  17.871  -62.334 1.00 43.15  ? 661  ARG A CA    1 
ATOM   1751 C  C     . ARG A 1 247  ? 36.027  17.521  -62.623 1.00 42.47  ? 661  ARG A C     1 
ATOM   1752 O  O     . ARG A 1 247  ? 36.422  16.393  -62.392 1.00 42.66  ? 661  ARG A O     1 
ATOM   1753 C  CB    . ARG A 1 247  ? 33.658  17.266  -63.407 1.00 43.49  ? 661  ARG A CB    1 
ATOM   1754 C  CG    . ARG A 1 247  ? 33.824  15.762  -63.571 1.00 43.71  ? 661  ARG A CG    1 
ATOM   1755 C  CD    . ARG A 1 247  ? 32.920  15.241  -64.700 1.00 45.80  ? 661  ARG A CD    1 
ATOM   1756 N  NE    . ARG A 1 247  ? 33.032  13.792  -64.863 1.00 45.64  ? 661  ARG A NE    1 
ATOM   1757 C  CZ    . ARG A 1 247  ? 32.008  12.978  -65.092 1.00 43.14  ? 661  ARG A CZ    1 
ATOM   1758 N  NH1   . ARG A 1 247  ? 30.785  13.462  -65.182 1.00 42.68  ? 661  ARG A NH1   1 
ATOM   1759 N  NH2   . ARG A 1 247  ? 32.217  11.680  -65.222 1.00 42.11  ? 661  ARG A NH2   1 
ATOM   1760 N  N     . ASP A 1 248  ? 36.831  18.457  -63.114 1.00 41.58  ? 662  ASP A N     1 
ATOM   1761 C  CA    . ASP A 1 248  ? 38.206  18.122  -63.481 1.00 41.16  ? 662  ASP A CA    1 
ATOM   1762 C  C     . ASP A 1 248  ? 38.950  17.482  -62.287 1.00 40.81  ? 662  ASP A C     1 
ATOM   1763 O  O     . ASP A 1 248  ? 38.902  17.992  -61.170 1.00 40.40  ? 662  ASP A O     1 
ATOM   1764 C  CB    . ASP A 1 248  ? 38.949  19.363  -64.022 1.00 41.04  ? 662  ASP A CB    1 
ATOM   1765 C  CG    . ASP A 1 248  ? 40.300  19.018  -64.668 1.00 41.87  ? 662  ASP A CG    1 
ATOM   1766 O  OD1   . ASP A 1 248  ? 40.535  17.827  -64.961 1.00 41.78  ? 662  ASP A OD1   1 
ATOM   1767 O  OD2   . ASP A 1 248  ? 41.127  19.944  -64.903 1.00 43.51  ? 662  ASP A OD2   1 
ATOM   1768 N  N     . GLY A 1 249  ? 39.616  16.359  -62.531 1.00 40.52  ? 663  GLY A N     1 
ATOM   1769 C  CA    . GLY A 1 249  ? 40.364  15.671  -61.497 1.00 41.64  ? 663  GLY A CA    1 
ATOM   1770 C  C     . GLY A 1 249  ? 39.524  14.753  -60.623 1.00 42.71  ? 663  GLY A C     1 
ATOM   1771 O  O     . GLY A 1 249  ? 40.024  14.187  -59.652 1.00 42.95  ? 663  GLY A O     1 
ATOM   1772 N  N     . LEU A 1 250  ? 38.245  14.603  -60.958 1.00 43.14  ? 664  LEU A N     1 
ATOM   1773 C  CA    . LEU A 1 250  ? 37.387  13.695  -60.231 1.00 44.05  ? 664  LEU A CA    1 
ATOM   1774 C  C     . LEU A 1 250  ? 36.835  12.562  -61.100 1.00 44.24  ? 664  LEU A C     1 
ATOM   1775 O  O     . LEU A 1 250  ? 36.280  12.812  -62.159 1.00 44.26  ? 664  LEU A O     1 
ATOM   1776 C  CB    . LEU A 1 250  ? 36.202  14.460  -59.651 1.00 44.34  ? 664  LEU A CB    1 
ATOM   1777 C  CG    . LEU A 1 250  ? 36.520  15.698  -58.833 1.00 43.90  ? 664  LEU A CG    1 
ATOM   1778 C  CD1   . LEU A 1 250  ? 35.212  16.426  -58.555 1.00 44.49  ? 664  LEU A CD1   1 
ATOM   1779 C  CD2   . LEU A 1 250  ? 37.228  15.304  -57.549 1.00 42.45  ? 664  LEU A CD2   1 
ATOM   1780 N  N     . LEU A 1 251  ? 36.962  11.325  -60.632 1.00 44.76  ? 665  LEU A N     1 
ATOM   1781 C  CA    . LEU A 1 251  ? 36.231  10.216  -61.238 1.00 45.43  ? 665  LEU A CA    1 
ATOM   1782 C  C     . LEU A 1 251  ? 34.865  10.124  -60.558 1.00 45.47  ? 665  LEU A C     1 
ATOM   1783 O  O     . LEU A 1 251  ? 34.774  10.111  -59.335 1.00 45.80  ? 665  LEU A O     1 
ATOM   1784 C  CB    . LEU A 1 251  ? 37.007  8.901   -61.096 1.00 45.22  ? 665  LEU A CB    1 
ATOM   1785 C  CG    . LEU A 1 251  ? 38.435  8.899   -61.655 1.00 45.96  ? 665  LEU A CG    1 
ATOM   1786 C  CD1   . LEU A 1 251  ? 39.126  7.575   -61.353 1.00 45.38  ? 665  LEU A CD1   1 
ATOM   1787 C  CD2   . LEU A 1 251  ? 38.496  9.246   -63.185 1.00 44.65  ? 665  LEU A CD2   1 
ATOM   1788 N  N     . VAL A 1 252  ? 33.802  10.083  -61.346 1.00 45.86  ? 666  VAL A N     1 
ATOM   1789 C  CA    . VAL A 1 252  ? 32.448  10.104  -60.794 1.00 46.54  ? 666  VAL A CA    1 
ATOM   1790 C  C     . VAL A 1 252  ? 31.783  8.737   -60.851 1.00 47.65  ? 666  VAL A C     1 
ATOM   1791 O  O     . VAL A 1 252  ? 31.776  8.088   -61.904 1.00 48.16  ? 666  VAL A O     1 
ATOM   1792 C  CB    . VAL A 1 252  ? 31.550  11.132  -61.537 1.00 46.45  ? 666  VAL A CB    1 
ATOM   1793 C  CG1   . VAL A 1 252  ? 30.175  11.203  -60.904 1.00 45.50  ? 666  VAL A CG1   1 
ATOM   1794 C  CG2   . VAL A 1 252  ? 32.216  12.516  -61.557 1.00 44.97  ? 666  VAL A CG2   1 
ATOM   1795 N  N     . GLY A 1 253  ? 31.198  8.320   -59.730 1.00 48.64  ? 667  GLY A N     1 
ATOM   1796 C  CA    . GLY A 1 253  ? 30.485  7.038   -59.634 1.00 50.23  ? 667  GLY A CA    1 
ATOM   1797 C  C     . GLY A 1 253  ? 28.993  7.121   -59.328 1.00 51.42  ? 667  GLY A C     1 
ATOM   1798 O  O     . GLY A 1 253  ? 28.536  8.018   -58.621 1.00 51.28  ? 667  GLY A O     1 
ATOM   1799 N  N     . SER A 1 254  ? 28.226  6.174   -59.866 1.00 53.13  ? 668  SER A N     1 
ATOM   1800 C  CA    . SER A 1 254  ? 26.765  6.163   -59.718 1.00 54.88  ? 668  SER A CA    1 
ATOM   1801 C  C     . SER A 1 254  ? 26.381  5.658   -58.347 1.00 56.55  ? 668  SER A C     1 
ATOM   1802 O  O     . SER A 1 254  ? 25.788  6.388   -57.558 1.00 57.29  ? 668  SER A O     1 
ATOM   1803 C  CB    . SER A 1 254  ? 26.137  5.284   -60.783 1.00 54.52  ? 668  SER A CB    1 
ATOM   1804 O  OG    . SER A 1 254  ? 26.772  4.017   -60.802 1.00 54.23  ? 668  SER A OG    1 
ATOM   1805 N  N     . GLY A 1 255  ? 26.720  4.402   -58.067 1.00 58.18  ? 669  GLY A N     1 
ATOM   1806 C  CA    . GLY A 1 255  ? 26.778  3.924   -56.691 1.00 59.71  ? 669  GLY A CA    1 
ATOM   1807 C  C     . GLY A 1 255  ? 25.556  3.305   -56.045 1.00 60.82  ? 669  GLY A C     1 
ATOM   1808 O  O     . GLY A 1 255  ? 24.958  2.344   -56.557 1.00 61.55  ? 669  GLY A O     1 
ATOM   1809 N  N     . CYS A 1 256  ? 25.226  3.857   -54.885 1.00 61.29  ? 670  CYS A N     1 
ATOM   1810 C  CA    . CYS A 1 256  ? 24.134  3.422   -54.023 1.00 61.86  ? 670  CYS A CA    1 
ATOM   1811 C  C     . CYS A 1 256  ? 22.819  2.930   -54.675 1.00 61.87  ? 670  CYS A C     1 
ATOM   1812 O  O     . CYS A 1 256  ? 22.679  2.817   -55.908 1.00 61.20  ? 670  CYS A O     1 
ATOM   1813 C  CB    . CYS A 1 256  ? 23.767  4.622   -53.169 1.00 61.63  ? 670  CYS A CB    1 
ATOM   1814 S  SG    . CYS A 1 256  ? 23.732  4.274   -51.478 1.00 64.47  ? 670  CYS A SG    1 
ATOM   1815 N  N     . ASP A 1 257  ? 21.851  2.652   -53.804 1.00 62.26  ? 671  ASP A N     1 
ATOM   1816 C  CA    . ASP A 1 257  ? 20.466  2.466   -54.223 1.00 62.88  ? 671  ASP A CA    1 
ATOM   1817 C  C     . ASP A 1 257  ? 19.770  3.826   -54.162 1.00 63.32  ? 671  ASP A C     1 
ATOM   1818 O  O     . ASP A 1 257  ? 18.660  3.992   -54.697 1.00 62.98  ? 671  ASP A O     1 
ATOM   1819 C  CB    . ASP A 1 257  ? 19.752  1.479   -53.311 1.00 62.71  ? 671  ASP A CB    1 
ATOM   1820 C  CG    . ASP A 1 257  ? 19.424  2.082   -51.978 1.00 62.41  ? 671  ASP A CG    1 
ATOM   1821 O  OD1   . ASP A 1 257  ? 18.456  2.867   -51.909 1.00 61.98  ? 671  ASP A OD1   1 
ATOM   1822 O  OD2   . ASP A 1 257  ? 20.143  1.785   -51.003 1.00 61.70  ? 671  ASP A OD2   1 
ATOM   1823 N  N     . LYS A 1 258  ? 20.424  4.784   -53.492 1.00 63.71  ? 672  LYS A N     1 
ATOM   1824 C  CA    . LYS A 1 258  ? 20.023  6.187   -53.580 1.00 64.07  ? 672  LYS A CA    1 
ATOM   1825 C  C     . LYS A 1 258  ? 20.753  6.806   -54.762 1.00 64.06  ? 672  LYS A C     1 
ATOM   1826 O  O     . LYS A 1 258  ? 20.774  8.029   -54.928 1.00 63.92  ? 672  LYS A O     1 
ATOM   1827 C  CB    . LYS A 1 258  ? 20.327  6.946   -52.286 1.00 64.36  ? 672  LYS A CB    1 
ATOM   1828 C  CG    . LYS A 1 258  ? 19.234  6.774   -51.228 1.00 65.24  ? 672  LYS A CG    1 
ATOM   1829 C  CD    . LYS A 1 258  ? 19.988  6.519   -49.818 1.00 67.05  ? 672  LYS A CD    1 
ATOM   1830 C  CE    . LYS A 1 258  ? 20.834  5.242   -49.986 1.00 67.72  ? 672  LYS A CE    1 
ATOM   1831 N  NZ    . LYS A 1 258  ? 20.947  4.472   -48.699 1.00 67.55  ? 672  LYS A NZ    1 
ATOM   1832 N  N     . GLY A 1 259  ? 21.359  5.946   -55.578 1.00 64.19  ? 673  GLY A N     1 
ATOM   1833 C  CA    . GLY A 1 259  ? 21.952  6.363   -56.848 1.00 64.76  ? 673  GLY A CA    1 
ATOM   1834 C  C     . GLY A 1 259  ? 20.905  6.840   -57.848 1.00 65.13  ? 673  GLY A C     1 
ATOM   1835 O  O     . GLY A 1 259  ? 19.700  6.661   -57.650 1.00 64.91  ? 673  GLY A O     1 
ATOM   1836 N  N     . GLU A 1 260  ? 21.375  7.457   -58.927 1.00 65.67  ? 674  GLU A N     1 
ATOM   1837 C  CA    . GLU A 1 260  ? 20.508  7.995   -59.985 1.00 65.94  ? 674  GLU A CA    1 
ATOM   1838 C  C     . GLU A 1 260  ? 19.972  6.880   -60.882 1.00 66.13  ? 674  GLU A C     1 
ATOM   1839 O  O     . GLU A 1 260  ? 18.781  6.830   -61.185 1.00 66.02  ? 674  GLU A O     1 
ATOM   1840 C  CB    . GLU A 1 260  ? 21.294  9.028   -60.810 1.00 65.83  ? 674  GLU A CB    1 
ATOM   1841 C  CG    . GLU A 1 260  ? 20.504  9.844   -61.823 1.00 65.70  ? 674  GLU A CG    1 
ATOM   1842 C  CD    . GLU A 1 260  ? 21.400  10.789  -62.637 1.00 65.57  ? 674  GLU A CD    1 
ATOM   1843 O  OE1   . GLU A 1 260  ? 22.600  10.477  -62.831 1.00 64.83  ? 674  GLU A OE1   1 
ATOM   1844 O  OE2   . GLU A 1 260  ? 20.907  11.852  -63.076 1.00 65.26  ? 674  GLU A OE2   1 
ATOM   1845 N  N     . LEU A 1 261  ? 20.850  5.969   -61.285 1.00 66.59  ? 675  LEU A N     1 
ATOM   1846 C  CA    . LEU A 1 261  ? 20.445  4.925   -62.212 1.00 67.35  ? 675  LEU A CA    1 
ATOM   1847 C  C     . LEU A 1 261  ? 19.796  3.744   -61.500 1.00 67.90  ? 675  LEU A C     1 
ATOM   1848 O  O     . LEU A 1 261  ? 18.765  3.253   -61.954 1.00 68.22  ? 675  LEU A O     1 
ATOM   1849 C  CB    . LEU A 1 261  ? 21.596  4.496   -63.151 1.00 67.42  ? 675  LEU A CB    1 
ATOM   1850 C  CG    . LEU A 1 261  ? 22.624  3.399   -62.832 1.00 67.13  ? 675  LEU A CG    1 
ATOM   1851 C  CD1   . LEU A 1 261  ? 23.730  3.332   -63.887 1.00 66.03  ? 675  LEU A CD1   1 
ATOM   1852 C  CD2   . LEU A 1 261  ? 23.229  3.592   -61.469 1.00 67.11  ? 675  LEU A CD2   1 
ATOM   1853 N  N     . PHE A 1 262  ? 20.367  3.296   -60.382 1.00 68.69  ? 676  PHE A N     1 
ATOM   1854 C  CA    . PHE A 1 262  ? 19.824  2.108   -59.713 1.00 69.23  ? 676  PHE A CA    1 
ATOM   1855 C  C     . PHE A 1 262  ? 18.308  2.207   -59.484 1.00 69.59  ? 676  PHE A C     1 
ATOM   1856 O  O     . PHE A 1 262  ? 17.605  1.189   -59.460 1.00 69.62  ? 676  PHE A O     1 
ATOM   1857 C  CB    . PHE A 1 262  ? 20.562  1.769   -58.398 1.00 69.43  ? 676  PHE A CB    1 
ATOM   1858 C  CG    . PHE A 1 262  ? 20.289  0.357   -57.903 1.00 70.10  ? 676  PHE A CG    1 
ATOM   1859 C  CD1   . PHE A 1 262  ? 19.082  0.059   -57.251 1.00 70.84  ? 676  PHE A CD1   1 
ATOM   1860 C  CD2   . PHE A 1 262  ? 21.203  -0.689  -58.125 1.00 71.01  ? 676  PHE A CD2   1 
ATOM   1861 C  CE1   . PHE A 1 262  ? 18.796  -1.255  -56.815 1.00 71.01  ? 676  PHE A CE1   1 
ATOM   1862 C  CE2   . PHE A 1 262  ? 20.939  -2.022  -57.688 1.00 72.00  ? 676  PHE A CE2   1 
ATOM   1863 C  CZ    . PHE A 1 262  ? 19.721  -2.295  -57.028 1.00 71.62  ? 676  PHE A CZ    1 
ATOM   1864 N  N     . ASP A 1 263  ? 17.790  3.419   -59.335 1.00 69.95  ? 677  ASP A N     1 
ATOM   1865 C  CA    . ASP A 1 263  ? 16.357  3.553   -59.086 1.00 70.40  ? 677  ASP A CA    1 
ATOM   1866 C  C     . ASP A 1 263  ? 15.456  3.391   -60.319 1.00 70.41  ? 677  ASP A C     1 
ATOM   1867 O  O     . ASP A 1 263  ? 14.301  3.827   -60.306 1.00 70.70  ? 677  ASP A O     1 
ATOM   1868 C  CB    . ASP A 1 263  ? 16.044  4.854   -58.343 1.00 70.59  ? 677  ASP A CB    1 
ATOM   1869 C  CG    . ASP A 1 263  ? 15.512  4.594   -56.948 1.00 71.28  ? 677  ASP A CG    1 
ATOM   1870 O  OD1   . ASP A 1 263  ? 16.188  3.858   -56.194 1.00 71.81  ? 677  ASP A OD1   1 
ATOM   1871 O  OD2   . ASP A 1 263  ? 14.412  5.099   -56.614 1.00 71.64  ? 677  ASP A OD2   1 
ATOM   1872 N  N     . ASN A 1 264  ? 15.976  2.760   -61.376 1.00 70.31  ? 678  ASN A N     1 
ATOM   1873 C  CA    . ASN A 1 264  ? 15.192  2.505   -62.599 1.00 69.92  ? 678  ASN A CA    1 
ATOM   1874 C  C     . ASN A 1 264  ? 15.372  1.069   -63.075 1.00 69.86  ? 678  ASN A C     1 
ATOM   1875 O  O     . ASN A 1 264  ? 16.490  0.546   -63.068 1.00 69.69  ? 678  ASN A O     1 
ATOM   1876 C  CB    . ASN A 1 264  ? 15.574  3.482   -63.733 1.00 69.80  ? 678  ASN A CB    1 
ATOM   1877 C  CG    . ASN A 1 264  ? 15.842  4.909   -63.237 1.00 69.40  ? 678  ASN A CG    1 
ATOM   1878 O  OD1   . ASN A 1 264  ? 15.019  5.505   -62.540 1.00 69.76  ? 678  ASN A OD1   1 
ATOM   1879 N  ND2   . ASN A 1 264  ? 17.004  5.454   -63.592 1.00 67.53  ? 678  ASN A ND2   1 
ATOM   1880 N  N     . VAL A 1 273  ? 18.217  6.167   -69.452 1.00 61.50  ? 687  VAL A N     1 
ATOM   1881 C  CA    . VAL A 1 273  ? 18.486  4.733   -69.427 1.00 61.07  ? 687  VAL A CA    1 
ATOM   1882 C  C     . VAL A 1 273  ? 20.006  4.484   -69.506 1.00 60.46  ? 687  VAL A C     1 
ATOM   1883 O  O     . VAL A 1 273  ? 20.629  4.119   -68.501 1.00 60.01  ? 687  VAL A O     1 
ATOM   1884 C  CB    . VAL A 1 273  ? 17.609  3.926   -70.491 1.00 61.71  ? 687  VAL A CB    1 
ATOM   1885 C  CG1   . VAL A 1 273  ? 17.422  4.683   -71.858 1.00 61.36  ? 687  VAL A CG1   1 
ATOM   1886 C  CG2   . VAL A 1 273  ? 18.110  2.479   -70.679 1.00 62.60  ? 687  VAL A CG2   1 
ATOM   1887 N  N     . GLU A 1 274  ? 20.601  4.731   -70.678 1.00 59.56  ? 688  GLU A N     1 
ATOM   1888 C  CA    . GLU A 1 274  ? 22.047  4.563   -70.883 1.00 58.45  ? 688  GLU A CA    1 
ATOM   1889 C  C     . GLU A 1 274  ? 22.672  5.944   -70.818 1.00 57.63  ? 688  GLU A C     1 
ATOM   1890 O  O     . GLU A 1 274  ? 23.847  6.089   -70.474 1.00 57.21  ? 688  GLU A O     1 
ATOM   1891 C  CB    . GLU A 1 274  ? 22.377  3.935   -72.249 1.00 58.44  ? 688  GLU A CB    1 
ATOM   1892 C  CG    . GLU A 1 274  ? 21.736  2.557   -72.582 1.00 58.32  ? 688  GLU A CG    1 
ATOM   1893 C  CD    . GLU A 1 274  ? 22.236  1.979   -74.014 1.00 57.74  ? 688  GLU A CD    1 
ATOM   1894 O  OE1   . GLU A 1 274  ? 22.120  2.700   -75.059 1.00 58.24  ? 688  GLU A OE1   1 
ATOM   1895 O  OE2   . GLU A 1 274  ? 22.387  0.767   -74.070 1.00 58.15  ? 688  GLU A OE2   1 
ATOM   1896 N  N     . ASP A 1 275  ? 21.867  6.948   -71.173 1.00 56.71  ? 689  ASP A N     1 
ATOM   1897 C  CA    . ASP A 1 275  ? 22.268  8.348   -71.116 1.00 56.20  ? 689  ASP A CA    1 
ATOM   1898 C  C     . ASP A 1 275  ? 22.668  8.723   -69.695 1.00 55.78  ? 689  ASP A C     1 
ATOM   1899 O  O     . ASP A 1 275  ? 23.793  9.166   -69.447 1.00 56.08  ? 689  ASP A O     1 
ATOM   1900 C  CB    . ASP A 1 275  ? 21.121  9.249   -71.579 1.00 56.10  ? 689  ASP A CB    1 
ATOM   1901 C  CG    . ASP A 1 275  ? 20.968  9.272   -73.096 1.00 56.97  ? 689  ASP A CG    1 
ATOM   1902 O  OD1   . ASP A 1 275  ? 21.972  9.010   -73.802 1.00 57.17  ? 689  ASP A OD1   1 
ATOM   1903 O  OD2   . ASP A 1 275  ? 19.846  9.556   -73.583 1.00 57.04  ? 689  ASP A OD2   1 
ATOM   1904 N  N     . ILE A 1 276  ? 21.752  8.516   -68.758 1.00 54.68  ? 690  ILE A N     1 
ATOM   1905 C  CA    . ILE A 1 276  ? 22.058  8.696   -67.359 1.00 53.91  ? 690  ILE A CA    1 
ATOM   1906 C  C     . ILE A 1 276  ? 23.443  8.121   -67.048 1.00 53.49  ? 690  ILE A C     1 
ATOM   1907 O  O     . ILE A 1 276  ? 24.271  8.792   -66.428 1.00 53.24  ? 690  ILE A O     1 
ATOM   1908 C  CB    . ILE A 1 276  ? 21.002  8.028   -66.444 1.00 53.76  ? 690  ILE A CB    1 
ATOM   1909 C  CG1   . ILE A 1 276  ? 19.782  8.937   -66.268 1.00 53.69  ? 690  ILE A CG1   1 
ATOM   1910 C  CG2   . ILE A 1 276  ? 21.588  7.729   -65.088 1.00 53.06  ? 690  ILE A CG2   1 
ATOM   1911 C  CD1   . ILE A 1 276  ? 18.506  8.199   -65.875 1.00 52.54  ? 690  ILE A CD1   1 
ATOM   1912 N  N     . ALA A 1 277  ? 23.691  6.896   -67.512 1.00 52.63  ? 691  ALA A N     1 
ATOM   1913 C  CA    . ALA A 1 277  ? 24.873  6.132   -67.100 1.00 51.71  ? 691  ALA A CA    1 
ATOM   1914 C  C     . ALA A 1 277  ? 26.191  6.626   -67.704 1.00 51.14  ? 691  ALA A C     1 
ATOM   1915 O  O     . ALA A 1 277  ? 27.220  6.638   -67.017 1.00 50.65  ? 691  ALA A O     1 
ATOM   1916 C  CB    . ALA A 1 277  ? 24.679  4.654   -67.382 1.00 51.55  ? 691  ALA A CB    1 
ATOM   1917 N  N     . ARG A 1 278  ? 26.154  7.016   -68.976 1.00 50.20  ? 692  ARG A N     1 
ATOM   1918 C  CA    . ARG A 1 278  ? 27.350  7.487   -69.686 1.00 50.12  ? 692  ARG A CA    1 
ATOM   1919 C  C     . ARG A 1 278  ? 27.952  8.729   -69.023 1.00 49.78  ? 692  ARG A C     1 
ATOM   1920 O  O     . ARG A 1 278  ? 29.005  9.231   -69.438 1.00 49.79  ? 692  ARG A O     1 
ATOM   1921 C  CB    . ARG A 1 278  ? 27.057  7.753   -71.188 1.00 50.22  ? 692  ARG A CB    1 
ATOM   1922 C  CG    . ARG A 1 278  ? 27.100  6.498   -72.067 1.00 50.17  ? 692  ARG A CG    1 
ATOM   1923 C  CD    . ARG A 1 278  ? 27.117  6.793   -73.568 1.00 51.74  ? 692  ARG A CD    1 
ATOM   1924 N  NE    . ARG A 1 278  ? 25.867  7.380   -74.048 1.00 52.59  ? 692  ARG A NE    1 
ATOM   1925 C  CZ    . ARG A 1 278  ? 24.823  6.679   -74.488 1.00 53.19  ? 692  ARG A CZ    1 
ATOM   1926 N  NH1   . ARG A 1 278  ? 24.864  5.351   -74.513 1.00 53.40  ? 692  ARG A NH1   1 
ATOM   1927 N  NH2   . ARG A 1 278  ? 23.731  7.306   -74.906 1.00 53.10  ? 692  ARG A NH2   1 
ATOM   1928 N  N     . PHE A 1 279  ? 27.268  9.217   -67.994 1.00 49.14  ? 693  PHE A N     1 
ATOM   1929 C  CA    . PHE A 1 279  ? 27.721  10.379  -67.246 1.00 48.68  ? 693  PHE A CA    1 
ATOM   1930 C  C     . PHE A 1 279  ? 28.833  9.976   -66.264 1.00 48.20  ? 693  PHE A C     1 
ATOM   1931 O  O     . PHE A 1 279  ? 29.635  10.813  -65.819 1.00 48.08  ? 693  PHE A O     1 
ATOM   1932 C  CB    . PHE A 1 279  ? 26.536  11.018  -66.512 1.00 48.54  ? 693  PHE A CB    1 
ATOM   1933 C  CG    . PHE A 1 279  ? 26.911  12.185  -65.639 1.00 48.78  ? 693  PHE A CG    1 
ATOM   1934 C  CD1   . PHE A 1 279  ? 27.402  13.356  -66.200 1.00 48.54  ? 693  PHE A CD1   1 
ATOM   1935 C  CD2   . PHE A 1 279  ? 26.764  12.110  -64.257 1.00 48.44  ? 693  PHE A CD2   1 
ATOM   1936 C  CE1   . PHE A 1 279  ? 27.745  14.438  -65.397 1.00 49.30  ? 693  PHE A CE1   1 
ATOM   1937 C  CE2   . PHE A 1 279  ? 27.101  13.176  -63.450 1.00 49.07  ? 693  PHE A CE2   1 
ATOM   1938 C  CZ    . PHE A 1 279  ? 27.600  14.344  -64.012 1.00 49.16  ? 693  PHE A CZ    1 
ATOM   1939 N  N     . TYR A 1 280  ? 28.893  8.683   -65.970 1.00 47.12  ? 694  TYR A N     1 
ATOM   1940 C  CA    . TYR A 1 280  ? 29.740  8.173   -64.923 1.00 46.37  ? 694  TYR A CA    1 
ATOM   1941 C  C     . TYR A 1 280  ? 31.020  7.519   -65.444 1.00 46.30  ? 694  TYR A C     1 
ATOM   1942 O  O     . TYR A 1 280  ? 31.002  6.861   -66.469 1.00 45.76  ? 694  TYR A O     1 
ATOM   1943 C  CB    . TYR A 1 280  ? 28.928  7.183   -64.084 1.00 46.07  ? 694  TYR A CB    1 
ATOM   1944 C  CG    . TYR A 1 280  ? 27.785  7.853   -63.352 1.00 45.88  ? 694  TYR A CG    1 
ATOM   1945 C  CD1   . TYR A 1 280  ? 26.495  7.863   -63.881 1.00 45.98  ? 694  TYR A CD1   1 
ATOM   1946 C  CD2   . TYR A 1 280  ? 27.997  8.496   -62.128 1.00 45.49  ? 694  TYR A CD2   1 
ATOM   1947 C  CE1   . TYR A 1 280  ? 25.429  8.485   -63.201 1.00 45.40  ? 694  TYR A CE1   1 
ATOM   1948 C  CE2   . TYR A 1 280  ? 26.939  9.119   -61.435 1.00 44.89  ? 694  TYR A CE2   1 
ATOM   1949 C  CZ    . TYR A 1 280  ? 25.661  9.108   -61.979 1.00 45.59  ? 694  TYR A CZ    1 
ATOM   1950 O  OH    . TYR A 1 280  ? 24.622  9.723   -61.312 1.00 44.40  ? 694  TYR A OH    1 
ATOM   1951 N  N     . ASP A 1 281  ? 32.127  7.684   -64.725 1.00 46.60  ? 695  ASP A N     1 
ATOM   1952 C  CA    . ASP A 1 281  ? 33.363  6.978   -65.083 1.00 47.20  ? 695  ASP A CA    1 
ATOM   1953 C  C     . ASP A 1 281  ? 33.407  5.572   -64.490 1.00 47.25  ? 695  ASP A C     1 
ATOM   1954 O  O     . ASP A 1 281  ? 34.181  4.723   -64.943 1.00 47.39  ? 695  ASP A O     1 
ATOM   1955 C  CB    . ASP A 1 281  ? 34.601  7.743   -64.611 1.00 47.53  ? 695  ASP A CB    1 
ATOM   1956 C  CG    . ASP A 1 281  ? 34.585  9.177   -65.034 1.00 47.73  ? 695  ASP A CG    1 
ATOM   1957 O  OD1   . ASP A 1 281  ? 34.269  10.030  -64.178 1.00 47.54  ? 695  ASP A OD1   1 
ATOM   1958 O  OD2   . ASP A 1 281  ? 34.865  9.451   -66.220 1.00 48.83  ? 695  ASP A OD2   1 
ATOM   1959 N  N     . PHE A 1 282  ? 32.600  5.331   -63.461 1.00 47.09  ? 696  PHE A N     1 
ATOM   1960 C  CA    . PHE A 1 282  ? 32.403  3.961   -63.000 1.00 47.31  ? 696  PHE A CA    1 
ATOM   1961 C  C     . PHE A 1 282  ? 31.017  3.667   -62.433 1.00 47.93  ? 696  PHE A C     1 
ATOM   1962 O  O     . PHE A 1 282  ? 30.343  4.551   -61.905 1.00 48.09  ? 696  PHE A O     1 
ATOM   1963 C  CB    . PHE A 1 282  ? 33.495  3.494   -62.038 1.00 46.92  ? 696  PHE A CB    1 
ATOM   1964 C  CG    . PHE A 1 282  ? 33.526  4.228   -60.741 1.00 45.73  ? 696  PHE A CG    1 
ATOM   1965 C  CD1   . PHE A 1 282  ? 34.223  5.433   -60.622 1.00 43.88  ? 696  PHE A CD1   1 
ATOM   1966 C  CD2   . PHE A 1 282  ? 32.913  3.692   -59.624 1.00 45.48  ? 696  PHE A CD2   1 
ATOM   1967 C  CE1   . PHE A 1 282  ? 34.267  6.108   -59.423 1.00 43.39  ? 696  PHE A CE1   1 
ATOM   1968 C  CE2   . PHE A 1 282  ? 32.958  4.352   -58.396 1.00 43.00  ? 696  PHE A CE2   1 
ATOM   1969 C  CZ    . PHE A 1 282  ? 33.633  5.561   -58.297 1.00 44.64  ? 696  PHE A CZ    1 
ATOM   1970 N  N     . LEU A 1 283  ? 30.612  2.405   -62.573 1.00 48.24  ? 697  LEU A N     1 
ATOM   1971 C  CA    . LEU A 1 283  ? 29.268  1.945   -62.206 1.00 48.61  ? 697  LEU A CA    1 
ATOM   1972 C  C     . LEU A 1 283  ? 29.266  1.063   -60.956 1.00 48.74  ? 697  LEU A C     1 
ATOM   1973 O  O     . LEU A 1 283  ? 29.934  0.025   -60.893 1.00 48.56  ? 697  LEU A O     1 
ATOM   1974 C  CB    . LEU A 1 283  ? 28.625  1.204   -63.374 1.00 48.28  ? 697  LEU A CB    1 
ATOM   1975 C  CG    . LEU A 1 283  ? 27.759  2.055   -64.310 1.00 48.53  ? 697  LEU A CG    1 
ATOM   1976 C  CD1   . LEU A 1 283  ? 28.284  3.480   -64.504 1.00 46.52  ? 697  LEU A CD1   1 
ATOM   1977 C  CD2   . LEU A 1 283  ? 27.562  1.319   -65.640 1.00 49.47  ? 697  LEU A CD2   1 
ATOM   1978 N  N     . GLU A 1 284  ? 28.507  1.487   -59.958 1.00 48.97  ? 698  GLU A N     1 
ATOM   1979 C  CA    . GLU A 1 284  ? 28.557  0.818   -58.688 1.00 49.71  ? 698  GLU A CA    1 
ATOM   1980 C  C     . GLU A 1 284  ? 27.470  -0.208  -58.561 1.00 50.02  ? 698  GLU A C     1 
ATOM   1981 O  O     . GLU A 1 284  ? 26.346  -0.027  -59.028 1.00 50.04  ? 698  GLU A O     1 
ATOM   1982 C  CB    . GLU A 1 284  ? 28.485  1.804   -57.532 1.00 50.01  ? 698  GLU A CB    1 
ATOM   1983 C  CG    . GLU A 1 284  ? 29.817  2.527   -57.218 1.00 51.19  ? 698  GLU A CG    1 
ATOM   1984 C  CD    . GLU A 1 284  ? 29.756  3.221   -55.865 1.00 53.62  ? 698  GLU A CD    1 
ATOM   1985 O  OE1   . GLU A 1 284  ? 29.705  2.523   -54.818 1.00 52.95  ? 698  GLU A OE1   1 
ATOM   1986 O  OE2   . GLU A 1 284  ? 29.710  4.469   -55.853 1.00 55.77  ? 698  GLU A OE2   1 
ATOM   1987 N  N     . VAL A 1 285  ? 27.857  -1.283  -57.899 1.00 50.31  ? 699  VAL A N     1 
ATOM   1988 C  CA    . VAL A 1 285  ? 26.996  -2.401  -57.551 1.00 50.37  ? 699  VAL A CA    1 
ATOM   1989 C  C     . VAL A 1 285  ? 27.482  -2.894  -56.171 1.00 50.66  ? 699  VAL A C     1 
ATOM   1990 O  O     . VAL A 1 285  ? 28.694  -3.024  -55.907 1.00 50.77  ? 699  VAL A O     1 
ATOM   1991 C  CB    . VAL A 1 285  ? 27.002  -3.515  -58.688 1.00 50.23  ? 699  VAL A CB    1 
ATOM   1992 C  CG1   . VAL A 1 285  ? 27.448  -4.890  -58.140 1.00 50.67  ? 699  VAL A CG1   1 
ATOM   1993 C  CG2   . VAL A 1 285  ? 25.694  -3.617  -59.409 1.00 49.26  ? 699  VAL A CG2   1 
ATOM   1994 N  N     . HIS A 1 286  ? 26.528  -3.094  -55.277 1.00 50.99  ? 700  HIS A N     1 
ATOM   1995 C  CA    . HIS A 1 286  ? 26.817  -3.551  -53.927 1.00 51.69  ? 700  HIS A CA    1 
ATOM   1996 C  C     . HIS A 1 286  ? 26.536  -5.067  -53.789 1.00 51.63  ? 700  HIS A C     1 
ATOM   1997 O  O     . HIS A 1 286  ? 25.750  -5.634  -54.572 1.00 51.05  ? 700  HIS A O     1 
ATOM   1998 C  CB    . HIS A 1 286  ? 25.927  -2.739  -52.977 1.00 52.02  ? 700  HIS A CB    1 
ATOM   1999 C  CG    . HIS A 1 286  ? 26.398  -1.304  -52.823 1.00 53.25  ? 700  HIS A CG    1 
ATOM   2000 N  ND1   . HIS A 1 286  ? 25.553  -0.267  -52.464 1.00 54.27  ? 700  HIS A ND1   1 
ATOM   2001 C  CD2   . HIS A 1 286  ? 27.619  -0.738  -53.001 1.00 53.27  ? 700  HIS A CD2   1 
ATOM   2002 C  CE1   . HIS A 1 286  ? 26.231  0.868   -52.410 1.00 53.83  ? 700  HIS A CE1   1 
ATOM   2003 N  NE2   . HIS A 1 286  ? 27.484  0.610   -52.745 1.00 54.86  ? 700  HIS A NE2   1 
ATOM   2004 N  N     . PRO A 1 287  ? 27.180  -5.736  -52.801 1.00 51.99  ? 701  PRO A N     1 
ATOM   2005 C  CA    . PRO A 1 287  ? 26.782  -7.128  -52.554 1.00 52.38  ? 701  PRO A CA    1 
ATOM   2006 C  C     . PRO A 1 287  ? 25.255  -7.224  -52.407 1.00 52.90  ? 701  PRO A C     1 
ATOM   2007 O  O     . PRO A 1 287  ? 24.646  -6.314  -51.822 1.00 52.31  ? 701  PRO A O     1 
ATOM   2008 C  CB    . PRO A 1 287  ? 27.460  -7.459  -51.223 1.00 52.26  ? 701  PRO A CB    1 
ATOM   2009 C  CG    . PRO A 1 287  ? 28.675  -6.569  -51.190 1.00 51.82  ? 701  PRO A CG    1 
ATOM   2010 C  CD    . PRO A 1 287  ? 28.307  -5.309  -51.940 1.00 51.68  ? 701  PRO A CD    1 
ATOM   2011 N  N     . PRO A 1 288  ? 24.647  -8.314  -52.943 1.00 53.68  ? 702  PRO A N     1 
ATOM   2012 C  CA    . PRO A 1 288  ? 23.195  -8.565  -52.922 1.00 54.47  ? 702  PRO A CA    1 
ATOM   2013 C  C     . PRO A 1 288  ? 22.604  -8.346  -51.531 1.00 55.29  ? 702  PRO A C     1 
ATOM   2014 O  O     . PRO A 1 288  ? 21.577  -7.671  -51.400 1.00 55.52  ? 702  PRO A O     1 
ATOM   2015 C  CB    . PRO A 1 288  ? 23.060  -10.042 -53.339 1.00 54.24  ? 702  PRO A CB    1 
ATOM   2016 C  CG    . PRO A 1 288  ? 24.453  -10.565 -53.524 1.00 53.91  ? 702  PRO A CG    1 
ATOM   2017 C  CD    . PRO A 1 288  ? 25.376  -9.389  -53.638 1.00 53.74  ? 702  PRO A CD    1 
ATOM   2018 N  N     . ASP A 1 289  ? 23.238  -8.900  -50.499 1.00 55.99  ? 703  ASP A N     1 
ATOM   2019 C  CA    . ASP A 1 289  ? 22.779  -8.650  -49.136 1.00 57.42  ? 703  ASP A CA    1 
ATOM   2020 C  C     . ASP A 1 289  ? 22.468  -7.160  -48.914 1.00 58.32  ? 703  ASP A C     1 
ATOM   2021 O  O     . ASP A 1 289  ? 21.371  -6.826  -48.485 1.00 58.82  ? 703  ASP A O     1 
ATOM   2022 C  CB    . ASP A 1 289  ? 23.799  -9.143  -48.090 1.00 57.63  ? 703  ASP A CB    1 
ATOM   2023 C  CG    . ASP A 1 289  ? 23.668  -10.639 -47.776 1.00 57.31  ? 703  ASP A CG    1 
ATOM   2024 O  OD1   . ASP A 1 289  ? 24.611  -11.183 -47.165 1.00 57.86  ? 703  ASP A OD1   1 
ATOM   2025 O  OD2   . ASP A 1 289  ? 22.648  -11.274 -48.126 1.00 57.01  ? 703  ASP A OD2   1 
ATOM   2026 N  N     . VAL A 1 290  ? 23.418  -6.274  -49.224 1.00 58.91  ? 704  VAL A N     1 
ATOM   2027 C  CA    . VAL A 1 290  ? 23.293  -4.826  -48.936 1.00 59.83  ? 704  VAL A CA    1 
ATOM   2028 C  C     . VAL A 1 290  ? 21.970  -4.152  -49.327 1.00 60.27  ? 704  VAL A C     1 
ATOM   2029 O  O     . VAL A 1 290  ? 21.519  -3.222  -48.637 1.00 60.52  ? 704  VAL A O     1 
ATOM   2030 C  CB    . VAL A 1 290  ? 24.478  -4.025  -49.523 1.00 59.67  ? 704  VAL A CB    1 
ATOM   2031 C  CG1   . VAL A 1 290  ? 24.175  -2.512  -49.545 1.00 59.36  ? 704  VAL A CG1   1 
ATOM   2032 C  CG2   . VAL A 1 290  ? 25.752  -4.332  -48.706 1.00 59.79  ? 704  VAL A CG2   1 
ATOM   2033 N  N     . TYR A 1 291  ? 21.353  -4.639  -50.405 1.00 60.62  ? 705  TYR A N     1 
ATOM   2034 C  CA    . TYR A 1 291  ? 20.063  -4.115  -50.863 1.00 61.48  ? 705  TYR A CA    1 
ATOM   2035 C  C     . TYR A 1 291  ? 18.836  -4.729  -50.165 1.00 61.58  ? 705  TYR A C     1 
ATOM   2036 O  O     . TYR A 1 291  ? 17.693  -4.346  -50.461 1.00 61.58  ? 705  TYR A O     1 
ATOM   2037 C  CB    . TYR A 1 291  ? 19.883  -4.312  -52.411 1.00 61.71  ? 705  TYR A CB    1 
ATOM   2038 C  CG    . TYR A 1 291  ? 20.952  -3.704  -53.304 1.00 63.14  ? 705  TYR A CG    1 
ATOM   2039 C  CD1   . TYR A 1 291  ? 21.969  -4.492  -53.796 1.00 64.46  ? 705  TYR A CD1   1 
ATOM   2040 C  CD2   . TYR A 1 291  ? 20.925  -2.354  -53.670 1.00 65.48  ? 705  TYR A CD2   1 
ATOM   2041 C  CE1   . TYR A 1 291  ? 22.985  -3.946  -54.612 1.00 67.10  ? 705  TYR A CE1   1 
ATOM   2042 C  CE2   . TYR A 1 291  ? 21.902  -1.811  -54.490 1.00 68.20  ? 705  TYR A CE2   1 
ATOM   2043 C  CZ    . TYR A 1 291  ? 22.923  -2.610  -54.984 1.00 68.80  ? 705  TYR A CZ    1 
ATOM   2044 O  OH    . TYR A 1 291  ? 23.924  -2.074  -55.795 1.00 69.93  ? 705  TYR A OH    1 
ATOM   2045 N  N     . LYS A 1 292  ? 19.072  -5.661  -49.237 1.00 61.62  ? 706  LYS A N     1 
ATOM   2046 C  CA    . LYS A 1 292  ? 18.006  -6.430  -48.535 1.00 61.51  ? 706  LYS A CA    1 
ATOM   2047 C  C     . LYS A 1 292  ? 16.761  -5.677  -48.010 1.00 61.58  ? 706  LYS A C     1 
ATOM   2048 O  O     . LYS A 1 292  ? 15.692  -6.286  -47.881 1.00 61.65  ? 706  LYS A O     1 
ATOM   2049 C  CB    . LYS A 1 292  ? 18.592  -7.297  -47.408 1.00 61.45  ? 706  LYS A CB    1 
ATOM   2050 N  N     . PRO A 1 293  ? 16.897  -4.376  -47.666 1.00 61.55  ? 707  PRO A N     1 
ATOM   2051 C  CA    . PRO A 1 293  ? 15.693  -3.550  -47.534 1.00 61.47  ? 707  PRO A CA    1 
ATOM   2052 C  C     . PRO A 1 293  ? 14.848  -3.567  -48.823 1.00 61.37  ? 707  PRO A C     1 
ATOM   2053 O  O     . PRO A 1 293  ? 15.152  -2.832  -49.771 1.00 61.30  ? 707  PRO A O     1 
ATOM   2054 C  CB    . PRO A 1 293  ? 16.255  -2.134  -47.251 1.00 61.63  ? 707  PRO A CB    1 
ATOM   2055 C  CG    . PRO A 1 293  ? 17.773  -2.244  -47.330 1.00 61.26  ? 707  PRO A CG    1 
ATOM   2056 C  CD    . PRO A 1 293  ? 18.079  -3.697  -47.099 1.00 61.65  ? 707  PRO A CD    1 
ATOM   2057 N  N     . LEU A 1 294  ? 13.800  -4.400  -48.837 1.00 61.33  ? 708  LEU A N     1 
ATOM   2058 C  CA    . LEU A 1 294  ? 12.894  -4.562  -49.980 1.00 60.89  ? 708  LEU A CA    1 
ATOM   2059 C  C     . LEU A 1 294  ? 11.603  -5.246  -49.526 1.00 60.54  ? 708  LEU A C     1 
ATOM   2060 O  O     . LEU A 1 294  ? 11.045  -4.905  -48.483 1.00 59.86  ? 708  LEU A O     1 
ATOM   2061 C  CB    . LEU A 1 294  ? 13.558  -5.372  -51.087 1.00 60.97  ? 708  LEU A CB    1 
ATOM   2062 N  N     . TYR A 1 299  ? 9.807   -2.516  -52.571 1.00 79.20  ? 713  TYR A N     1 
ATOM   2063 C  CA    . TYR A 1 299  ? 10.620  -1.971  -53.663 1.00 79.28  ? 713  TYR A CA    1 
ATOM   2064 C  C     . TYR A 1 299  ? 11.165  -3.061  -54.612 1.00 79.20  ? 713  TYR A C     1 
ATOM   2065 O  O     . TYR A 1 299  ? 11.333  -2.823  -55.803 1.00 79.27  ? 713  TYR A O     1 
ATOM   2066 C  CB    . TYR A 1 299  ? 11.748  -1.082  -53.115 1.00 79.13  ? 713  TYR A CB    1 
ATOM   2067 N  N     . VAL A 1 300  ? 11.439  -4.250  -54.083 1.00 79.11  ? 714  VAL A N     1 
ATOM   2068 C  CA    . VAL A 1 300  ? 11.727  -5.422  -54.922 1.00 78.89  ? 714  VAL A CA    1 
ATOM   2069 C  C     . VAL A 1 300  ? 10.852  -6.644  -54.532 1.00 78.61  ? 714  VAL A C     1 
ATOM   2070 O  O     . VAL A 1 300  ? 10.201  -6.649  -53.474 1.00 78.70  ? 714  VAL A O     1 
ATOM   2071 C  CB    . VAL A 1 300  ? 13.230  -5.792  -54.894 1.00 78.87  ? 714  VAL A CB    1 
ATOM   2072 N  N     . LYS A 1 301  ? 10.812  -7.656  -55.398 1.00 78.10  ? 715  LYS A N     1 
ATOM   2073 C  CA    . LYS A 1 301  ? 10.022  -8.870  -55.105 1.00 77.53  ? 715  LYS A CA    1 
ATOM   2074 C  C     . LYS A 1 301  ? 10.772  -9.808  -54.126 1.00 76.83  ? 715  LYS A C     1 
ATOM   2075 O  O     . LYS A 1 301  ? 10.238  -10.120 -53.042 1.00 76.80  ? 715  LYS A O     1 
ATOM   2076 C  CB    . LYS A 1 301  ? 9.534   -9.592  -56.402 1.00 77.49  ? 715  LYS A CB    1 
ATOM   2077 N  N     . ASP A 1 302  ? 12.002  -10.222 -54.523 1.00 75.79  ? 716  ASP A N     1 
ATOM   2078 C  CA    . ASP A 1 302  ? 12.907  -11.163 -53.831 1.00 74.73  ? 716  ASP A CA    1 
ATOM   2079 C  C     . ASP A 1 302  ? 14.391  -10.957 -54.235 1.00 74.01  ? 716  ASP A C     1 
ATOM   2080 O  O     . ASP A 1 302  ? 14.706  -10.036 -55.027 1.00 74.07  ? 716  ASP A O     1 
ATOM   2081 C  CB    . ASP A 1 302  ? 12.433  -12.620 -54.071 1.00 74.66  ? 716  ASP A CB    1 
ATOM   2082 C  CG    . ASP A 1 302  ? 12.515  -13.042 -55.549 1.00 74.21  ? 716  ASP A CG    1 
ATOM   2083 O  OD1   . ASP A 1 302  ? 12.575  -12.209 -56.496 1.00 73.67  ? 716  ASP A OD1   1 
ATOM   2084 O  OD2   . ASP A 1 302  ? 12.706  -14.259 -55.788 1.00 73.27  ? 716  ASP A OD2   1 
ATOM   2085 N  N     . GLU A 1 303  ? 15.276  -11.783 -53.664 1.00 73.14  ? 717  GLU A N     1 
ATOM   2086 C  CA    . GLU A 1 303  ? 16.731  -11.799 -53.907 1.00 72.38  ? 717  GLU A CA    1 
ATOM   2087 C  C     . GLU A 1 303  ? 17.034  -12.059 -55.369 1.00 71.45  ? 717  GLU A C     1 
ATOM   2088 O  O     . GLU A 1 303  ? 18.057  -11.612 -55.876 1.00 71.32  ? 717  GLU A O     1 
ATOM   2089 C  CB    . GLU A 1 303  ? 17.389  -12.853 -53.022 1.00 72.64  ? 717  GLU A CB    1 
ATOM   2090 C  CG    . GLU A 1 303  ? 18.915  -12.840 -53.100 1.00 73.06  ? 717  GLU A CG    1 
ATOM   2091 C  CD    . GLU A 1 303  ? 19.572  -14.107 -52.434 1.00 73.40  ? 717  GLU A CD    1 
ATOM   2092 O  OE1   . GLU A 1 303  ? 18.886  -15.198 -52.136 1.00 73.41  ? 717  GLU A OE1   1 
ATOM   2093 O  OE2   . GLU A 1 303  ? 20.776  -13.988 -52.122 1.00 73.57  ? 717  GLU A OE2   1 
ATOM   2094 N  N     . GLU A 1 304  ? 16.123  -12.758 -56.045 1.00 70.22  ? 718  GLU A N     1 
ATOM   2095 C  CA    . GLU A 1 304  ? 16.342  -13.063 -57.457 1.00 69.13  ? 718  GLU A CA    1 
ATOM   2096 C  C     . GLU A 1 304  ? 16.117  -11.842 -58.363 1.00 68.14  ? 718  GLU A C     1 
ATOM   2097 O  O     . GLU A 1 304  ? 16.621  -11.824 -59.495 1.00 67.80  ? 718  GLU A O     1 
ATOM   2098 C  CB    . GLU A 1 304  ? 15.432  -14.194 -57.852 1.00 69.33  ? 718  GLU A CB    1 
ATOM   2099 C  CG    . GLU A 1 304  ? 15.990  -14.917 -59.130 1.00 69.64  ? 718  GLU A CG    1 
ATOM   2100 C  CD    . GLU A 1 304  ? 17.262  -15.870 -58.947 1.00 70.34  ? 718  GLU A CD    1 
ATOM   2101 O  OE1   . GLU A 1 304  ? 17.286  -16.579 -58.001 1.00 69.82  ? 718  GLU A OE1   1 
ATOM   2102 O  OE2   . GLU A 1 304  ? 18.211  -15.944 -59.697 1.00 71.05  ? 718  GLU A OE2   1 
ATOM   2103 N  N     . MET A 1 305  ? 15.328  -10.843 -57.896 1.00 67.01  ? 719  MET A N     1 
ATOM   2104 C  CA    . MET A 1 305  ? 15.187  -9.589  -58.630 1.00 65.98  ? 719  MET A CA    1 
ATOM   2105 C  C     . MET A 1 305  ? 16.475  -8.749  -58.512 1.00 65.09  ? 719  MET A C     1 
ATOM   2106 O  O     . MET A 1 305  ? 16.957  -8.163  -59.516 1.00 65.00  ? 719  MET A O     1 
ATOM   2107 C  CB    . MET A 1 305  ? 13.977  -8.795  -58.126 1.00 65.97  ? 719  MET A CB    1 
ATOM   2108 C  CG    . MET A 1 305  ? 13.707  -7.520  -58.912 1.00 65.97  ? 719  MET A CG    1 
ATOM   2109 S  SD    . MET A 1 305  ? 12.227  -6.610  -58.304 1.00 65.63  ? 719  MET A SD    1 
ATOM   2110 C  CE    . MET A 1 305  ? 11.848  -5.548  -60.054 1.00 64.81  ? 719  MET A CE    1 
ATOM   2111 N  N     . ILE A 1 306  ? 16.986  -8.616  -57.279 1.00 63.88  ? 720  ILE A N     1 
ATOM   2112 C  CA    . ILE A 1 306  ? 18.175  -7.805  -57.020 1.00 63.06  ? 720  ILE A CA    1 
ATOM   2113 C  C     . ILE A 1 306  ? 19.330  -8.408  -57.776 1.00 62.31  ? 720  ILE A C     1 
ATOM   2114 O  O     . ILE A 1 306  ? 19.997  -7.717  -58.545 1.00 62.39  ? 720  ILE A O     1 
ATOM   2115 C  CB    . ILE A 1 306  ? 18.555  -7.719  -55.520 1.00 63.08  ? 720  ILE A CB    1 
ATOM   2116 C  CG1   . ILE A 1 306  ? 17.312  -7.380  -54.688 1.00 62.94  ? 720  ILE A CG1   1 
ATOM   2117 C  CG2   . ILE A 1 306  ? 19.712  -6.678  -55.301 1.00 63.02  ? 720  ILE A CG2   1 
ATOM   2118 C  CD1   . ILE A 1 306  ? 17.508  -7.646  -53.182 1.00 64.05  ? 720  ILE A CD1   1 
ATOM   2119 N  N     . LYS A 1 307  ? 19.540  -9.712  -57.594 1.00 61.41  ? 721  LYS A N     1 
ATOM   2120 C  CA    . LYS A 1 307  ? 20.603  -10.406 -58.322 1.00 60.41  ? 721  LYS A CA    1 
ATOM   2121 C  C     . LYS A 1 307  ? 20.571  -10.026 -59.790 1.00 59.85  ? 721  LYS A C     1 
ATOM   2122 O  O     . LYS A 1 307  ? 21.629  -9.801  -60.393 1.00 60.03  ? 721  LYS A O     1 
ATOM   2123 C  CB    . LYS A 1 307  ? 20.555  -11.939 -58.149 1.00 60.16  ? 721  LYS A CB    1 
ATOM   2124 C  CG    . LYS A 1 307  ? 21.615  -12.473 -57.156 1.00 59.97  ? 721  LYS A CG    1 
ATOM   2125 C  CD    . LYS A 1 307  ? 21.333  -13.902 -56.690 1.00 58.29  ? 721  LYS A CD    1 
ATOM   2126 C  CE    . LYS A 1 307  ? 22.185  -14.927 -57.462 1.00 57.39  ? 721  LYS A CE    1 
ATOM   2127 N  NZ    . LYS A 1 307  ? 22.083  -16.418 -56.906 1.00 55.03  ? 721  LYS A NZ    1 
ATOM   2128 N  N     . ASN A 1 308  ? 19.367  -9.930  -60.356 1.00 58.86  ? 722  ASN A N     1 
ATOM   2129 C  CA    . ASN A 1 308  ? 19.212  -9.585  -61.770 1.00 57.86  ? 722  ASN A CA    1 
ATOM   2130 C  C     . ASN A 1 308  ? 19.405  -8.119  -62.097 1.00 57.40  ? 722  ASN A C     1 
ATOM   2131 O  O     . ASN A 1 308  ? 19.851  -7.777  -63.192 1.00 57.34  ? 722  ASN A O     1 
ATOM   2132 C  CB    . ASN A 1 308  ? 17.869  -10.073 -62.303 1.00 57.65  ? 722  ASN A CB    1 
ATOM   2133 C  CG    . ASN A 1 308  ? 17.796  -11.579 -62.383 1.00 56.96  ? 722  ASN A CG    1 
ATOM   2134 O  OD1   . ASN A 1 308  ? 18.802  -12.264 -62.588 1.00 55.92  ? 722  ASN A OD1   1 
ATOM   2135 N  ND2   . ASN A 1 308  ? 16.587  -12.116 -62.191 1.00 56.45  ? 722  ASN A ND2   1 
ATOM   2136 N  N     . ILE A 1 309  ? 19.055  -7.247  -61.155 1.00 56.88  ? 723  ILE A N     1 
ATOM   2137 C  CA    . ILE A 1 309  ? 19.265  -5.815  -61.381 1.00 56.27  ? 723  ILE A CA    1 
ATOM   2138 C  C     . ILE A 1 309  ? 20.759  -5.536  -61.472 1.00 55.79  ? 723  ILE A C     1 
ATOM   2139 O  O     . ILE A 1 309  ? 21.231  -4.967  -62.450 1.00 55.79  ? 723  ILE A O     1 
ATOM   2140 C  CB    . ILE A 1 309  ? 18.606  -4.952  -60.296 1.00 56.23  ? 723  ILE A CB    1 
ATOM   2141 C  CG1   . ILE A 1 309  ? 17.076  -5.024  -60.429 1.00 56.39  ? 723  ILE A CG1   1 
ATOM   2142 C  CG2   . ILE A 1 309  ? 19.078  -3.520  -60.427 1.00 55.87  ? 723  ILE A CG2   1 
ATOM   2143 C  CD1   . ILE A 1 309  ? 16.330  -4.821  -59.136 1.00 57.18  ? 723  ILE A CD1   1 
ATOM   2144 N  N     . ILE A 1 310  ? 21.497  -5.963  -60.454 1.00 55.46  ? 724  ILE A N     1 
ATOM   2145 C  CA    . ILE A 1 310  ? 22.953  -6.051  -60.537 1.00 55.27  ? 724  ILE A CA    1 
ATOM   2146 C  C     . ILE A 1 310  ? 23.386  -6.560  -61.927 1.00 55.08  ? 724  ILE A C     1 
ATOM   2147 O  O     . ILE A 1 310  ? 24.331  -6.044  -62.521 1.00 55.09  ? 724  ILE A O     1 
ATOM   2148 C  CB    . ILE A 1 310  ? 23.449  -7.039  -59.465 1.00 55.13  ? 724  ILE A CB    1 
ATOM   2149 C  CG1   . ILE A 1 310  ? 23.097  -6.471  -58.065 1.00 55.74  ? 724  ILE A CG1   1 
ATOM   2150 C  CG2   . ILE A 1 310  ? 24.944  -7.367  -59.709 1.00 55.25  ? 724  ILE A CG2   1 
ATOM   2151 C  CD1   . ILE A 1 310  ? 23.953  -7.130  -56.840 1.00 56.00  ? 724  ILE A CD1   1 
ATOM   2152 N  N     . ARG A 1 311  ? 22.698  -7.573  -62.436 1.00 54.76  ? 725  ARG A N     1 
ATOM   2153 C  CA    . ARG A 1 311  ? 23.062  -8.156  -63.725 1.00 54.68  ? 725  ARG A CA    1 
ATOM   2154 C  C     . ARG A 1 311  ? 22.668  -7.264  -64.921 1.00 54.34  ? 725  ARG A C     1 
ATOM   2155 O  O     . ARG A 1 311  ? 23.200  -7.419  -66.027 1.00 54.02  ? 725  ARG A O     1 
ATOM   2156 C  CB    . ARG A 1 311  ? 22.453  -9.550  -63.868 1.00 54.87  ? 725  ARG A CB    1 
ATOM   2157 C  CG    . ARG A 1 311  ? 23.474  -10.662 -64.250 1.00 55.27  ? 725  ARG A CG    1 
ATOM   2158 C  CD    . ARG A 1 311  ? 22.775  -12.028 -64.438 1.00 55.93  ? 725  ARG A CD    1 
ATOM   2159 N  NE    . ARG A 1 311  ? 22.484  -12.707 -63.159 1.00 56.47  ? 725  ARG A NE    1 
ATOM   2160 C  CZ    . ARG A 1 311  ? 22.802  -13.969 -62.803 1.00 56.69  ? 725  ARG A CZ    1 
ATOM   2161 N  NH1   . ARG A 1 311  ? 22.462  -14.388 -61.584 1.00 55.67  ? 725  ARG A NH1   1 
ATOM   2162 N  NH2   . ARG A 1 311  ? 23.445  -14.817 -63.616 1.00 56.23  ? 725  ARG A NH2   1 
ATOM   2163 N  N     . SER A 1 312  ? 21.722  -6.352  -64.731 1.00 53.99  ? 726  SER A N     1 
ATOM   2164 C  CA    . SER A 1 312  ? 21.444  -5.385  -65.779 1.00 53.61  ? 726  SER A CA    1 
ATOM   2165 C  C     . SER A 1 312  ? 22.646  -4.446  -65.830 1.00 53.56  ? 726  SER A C     1 
ATOM   2166 O  O     . SER A 1 312  ? 23.189  -4.133  -66.900 1.00 53.13  ? 726  SER A O     1 
ATOM   2167 C  CB    . SER A 1 312  ? 20.193  -4.592  -65.453 1.00 53.50  ? 726  SER A CB    1 
ATOM   2168 O  OG    . SER A 1 312  ? 19.234  -5.425  -64.836 1.00 53.99  ? 726  SER A OG    1 
ATOM   2169 N  N     . ILE A 1 313  ? 23.040  -3.983  -64.649 1.00 53.45  ? 727  ILE A N     1 
ATOM   2170 C  CA    . ILE A 1 313  ? 24.146  -3.040  -64.559 1.00 53.71  ? 727  ILE A CA    1 
ATOM   2171 C  C     . ILE A 1 313  ? 25.433  -3.662  -65.091 1.00 54.05  ? 727  ILE A C     1 
ATOM   2172 O  O     . ILE A 1 313  ? 26.257  -3.000  -65.749 1.00 54.01  ? 727  ILE A O     1 
ATOM   2173 C  CB    . ILE A 1 313  ? 24.349  -2.558  -63.122 1.00 53.70  ? 727  ILE A CB    1 
ATOM   2174 C  CG1   . ILE A 1 313  ? 23.334  -1.442  -62.815 1.00 53.49  ? 727  ILE A CG1   1 
ATOM   2175 C  CG2   . ILE A 1 313  ? 25.806  -2.148  -62.909 1.00 53.19  ? 727  ILE A CG2   1 
ATOM   2176 C  CD1   . ILE A 1 313  ? 23.105  -1.139  -61.339 1.00 53.03  ? 727  ILE A CD1   1 
ATOM   2177 N  N     . VAL A 1 314  ? 25.634  -4.942  -64.792 1.00 54.51  ? 728  VAL A N     1 
ATOM   2178 C  CA    . VAL A 1 314  ? 26.730  -5.696  -65.406 1.00 54.98  ? 728  VAL A CA    1 
ATOM   2179 C  C     . VAL A 1 314  ? 26.644  -5.707  -66.938 1.00 55.18  ? 728  VAL A C     1 
ATOM   2180 O  O     . VAL A 1 314  ? 27.659  -5.559  -67.622 1.00 55.60  ? 728  VAL A O     1 
ATOM   2181 C  CB    . VAL A 1 314  ? 26.817  -7.158  -64.868 1.00 55.05  ? 728  VAL A CB    1 
ATOM   2182 C  CG1   . VAL A 1 314  ? 27.778  -8.028  -65.729 1.00 54.49  ? 728  VAL A CG1   1 
ATOM   2183 C  CG2   . VAL A 1 314  ? 27.243  -7.150  -63.399 1.00 55.28  ? 728  VAL A CG2   1 
ATOM   2184 N  N     . ALA A 1 315  ? 25.440  -5.884  -67.486 1.00 55.23  ? 729  ALA A N     1 
ATOM   2185 C  CA    . ALA A 1 315  ? 25.267  -5.838  -68.948 1.00 55.31  ? 729  ALA A CA    1 
ATOM   2186 C  C     . ALA A 1 315  ? 25.613  -4.436  -69.454 1.00 55.16  ? 729  ALA A C     1 
ATOM   2187 O  O     . ALA A 1 315  ? 26.285  -4.274  -70.469 1.00 55.16  ? 729  ALA A O     1 
ATOM   2188 C  CB    . ALA A 1 315  ? 23.835  -6.231  -69.349 1.00 54.82  ? 729  ALA A CB    1 
ATOM   2189 N  N     . LEU A 1 316  ? 25.158  -3.445  -68.694 1.00 55.23  ? 730  LEU A N     1 
ATOM   2190 C  CA    . LEU A 1 316  ? 25.141  -2.055  -69.103 1.00 55.39  ? 730  LEU A CA    1 
ATOM   2191 C  C     . LEU A 1 316  ? 26.534  -1.402  -69.096 1.00 55.51  ? 730  LEU A C     1 
ATOM   2192 O  O     . LEU A 1 316  ? 26.842  -0.584  -69.962 1.00 55.49  ? 730  LEU A O     1 
ATOM   2193 C  CB    . LEU A 1 316  ? 24.169  -1.316  -68.183 1.00 55.49  ? 730  LEU A CB    1 
ATOM   2194 C  CG    . LEU A 1 316  ? 23.490  0.005   -68.525 1.00 55.70  ? 730  LEU A CG    1 
ATOM   2195 C  CD1   . LEU A 1 316  ? 22.898  0.002   -69.910 1.00 54.82  ? 730  LEU A CD1   1 
ATOM   2196 C  CD2   . LEU A 1 316  ? 22.379  0.231   -67.486 1.00 55.87  ? 730  LEU A CD2   1 
ATOM   2197 N  N     . GLY A 1 317  ? 27.380  -1.784  -68.141 1.00 55.48  ? 731  GLY A N     1 
ATOM   2198 C  CA    . GLY A 1 317  ? 28.767  -1.282  -68.091 1.00 56.00  ? 731  GLY A CA    1 
ATOM   2199 C  C     . GLY A 1 317  ? 29.630  -1.885  -69.185 1.00 56.17  ? 731  GLY A C     1 
ATOM   2200 O  O     . GLY A 1 317  ? 30.493  -1.220  -69.769 1.00 56.13  ? 731  GLY A O     1 
ATOM   2201 N  N     . GLU A 1 318  ? 29.382  -3.161  -69.449 1.00 56.31  ? 732  GLU A N     1 
ATOM   2202 C  CA    . GLU A 1 318  ? 30.044  -3.913  -70.500 1.00 56.70  ? 732  GLU A CA    1 
ATOM   2203 C  C     . GLU A 1 318  ? 29.675  -3.380  -71.893 1.00 56.29  ? 732  GLU A C     1 
ATOM   2204 O  O     . GLU A 1 318  ? 30.533  -3.288  -72.777 1.00 56.34  ? 732  GLU A O     1 
ATOM   2205 C  CB    . GLU A 1 318  ? 29.631  -5.383  -70.385 1.00 56.92  ? 732  GLU A CB    1 
ATOM   2206 C  CG    . GLU A 1 318  ? 30.551  -6.353  -71.098 1.00 59.38  ? 732  GLU A CG    1 
ATOM   2207 C  CD    . GLU A 1 318  ? 30.470  -7.790  -70.556 1.00 63.09  ? 732  GLU A CD    1 
ATOM   2208 O  OE1   . GLU A 1 318  ? 29.323  -8.307  -70.386 1.00 65.94  ? 732  GLU A OE1   1 
ATOM   2209 O  OE2   . GLU A 1 318  ? 31.568  -8.417  -70.449 1.00 64.54  ? 732  GLU A OE2   1 
ATOM   2210 N  N     . LYS A 1 319  ? 28.398  -3.045  -72.083 1.00 55.52  ? 733  LYS A N     1 
ATOM   2211 C  CA    . LYS A 1 319  ? 27.929  -2.507  -73.355 1.00 54.87  ? 733  LYS A CA    1 
ATOM   2212 C  C     . LYS A 1 319  ? 28.529  -1.127  -73.627 1.00 54.10  ? 733  LYS A C     1 
ATOM   2213 O  O     . LYS A 1 319  ? 28.836  -0.792  -74.766 1.00 54.03  ? 733  LYS A O     1 
ATOM   2214 C  CB    . LYS A 1 319  ? 26.397  -2.443  -73.376 1.00 55.11  ? 733  LYS A CB    1 
ATOM   2215 C  CG    . LYS A 1 319  ? 25.776  -2.294  -74.774 1.00 56.01  ? 733  LYS A CG    1 
ATOM   2216 C  CD    . LYS A 1 319  ? 25.684  -0.819  -75.193 1.00 57.65  ? 733  LYS A CD    1 
ATOM   2217 C  CE    . LYS A 1 319  ? 25.885  -0.605  -76.708 1.00 57.65  ? 733  LYS A CE    1 
ATOM   2218 N  NZ    . LYS A 1 319  ? 24.671  -0.925  -77.515 1.00 58.16  ? 733  LYS A NZ    1 
ATOM   2219 N  N     . LEU A 1 320  ? 28.707  -0.333  -72.577 1.00 53.32  ? 734  LEU A N     1 
ATOM   2220 C  CA    . LEU A 1 320  ? 29.188  1.037   -72.736 1.00 52.36  ? 734  LEU A CA    1 
ATOM   2221 C  C     . LEU A 1 320  ? 30.684  1.234   -72.484 1.00 52.13  ? 734  LEU A C     1 
ATOM   2222 O  O     . LEU A 1 320  ? 31.171  2.371   -72.443 1.00 51.79  ? 734  LEU A O     1 
ATOM   2223 C  CB    . LEU A 1 320  ? 28.382  1.979   -71.843 1.00 52.07  ? 734  LEU A CB    1 
ATOM   2224 C  CG    . LEU A 1 320  ? 26.892  1.998   -72.174 1.00 51.80  ? 734  LEU A CG    1 
ATOM   2225 C  CD1   . LEU A 1 320  ? 26.129  2.870   -71.173 1.00 51.10  ? 734  LEU A CD1   1 
ATOM   2226 C  CD2   . LEU A 1 320  ? 26.653  2.437   -73.623 1.00 50.89  ? 734  LEU A CD2   1 
ATOM   2227 N  N     . ASP A 1 321  ? 31.421  0.142   -72.327 1.00 51.84  ? 735  ASP A N     1 
ATOM   2228 C  CA    . ASP A 1 321  ? 32.836  0.247   -71.973 1.00 51.75  ? 735  ASP A CA    1 
ATOM   2229 C  C     . ASP A 1 321  ? 33.032  1.151   -70.745 1.00 51.35  ? 735  ASP A C     1 
ATOM   2230 O  O     . ASP A 1 321  ? 33.877  2.058   -70.735 1.00 51.28  ? 735  ASP A O     1 
ATOM   2231 C  CB    . ASP A 1 321  ? 33.680  0.754   -73.154 1.00 51.87  ? 735  ASP A CB    1 
ATOM   2232 C  CG    . ASP A 1 321  ? 35.159  0.407   -72.998 1.00 53.34  ? 735  ASP A CG    1 
ATOM   2233 O  OD1   . ASP A 1 321  ? 35.474  -0.783  -72.786 1.00 55.05  ? 735  ASP A OD1   1 
ATOM   2234 O  OD2   . ASP A 1 321  ? 36.010  1.322   -73.065 1.00 55.77  ? 735  ASP A OD2   1 
ATOM   2235 N  N     . ILE A 1 322  ? 32.229  0.905   -69.711 1.00 50.58  ? 736  ILE A N     1 
ATOM   2236 C  CA    . ILE A 1 322  ? 32.376  1.599   -68.439 1.00 49.58  ? 736  ILE A CA    1 
ATOM   2237 C  C     . ILE A 1 322  ? 32.694  0.524   -67.402 1.00 49.31  ? 736  ILE A C     1 
ATOM   2238 O  O     . ILE A 1 322  ? 32.001  -0.495  -67.344 1.00 50.12  ? 736  ILE A O     1 
ATOM   2239 C  CB    . ILE A 1 322  ? 31.089  2.384   -68.058 1.00 49.09  ? 736  ILE A CB    1 
ATOM   2240 C  CG1   . ILE A 1 322  ? 30.732  3.401   -69.159 1.00 47.79  ? 736  ILE A CG1   1 
ATOM   2241 C  CG2   . ILE A 1 322  ? 31.264  3.050   -66.715 1.00 48.99  ? 736  ILE A CG2   1 
ATOM   2242 C  CD1   . ILE A 1 322  ? 29.607  4.370   -68.819 1.00 45.73  ? 736  ILE A CD1   1 
ATOM   2243 N  N     . PRO A 1 323  ? 33.766  0.721   -66.610 1.00 48.91  ? 737  PRO A N     1 
ATOM   2244 C  CA    . PRO A 1 323  ? 34.104  -0.263  -65.585 1.00 48.40  ? 737  PRO A CA    1 
ATOM   2245 C  C     . PRO A 1 323  ? 32.987  -0.366  -64.544 1.00 48.19  ? 737  PRO A C     1 
ATOM   2246 O  O     . PRO A 1 323  ? 32.548  0.660   -64.003 1.00 47.68  ? 737  PRO A O     1 
ATOM   2247 C  CB    . PRO A 1 323  ? 35.381  0.323   -64.938 1.00 48.60  ? 737  PRO A CB    1 
ATOM   2248 C  CG    . PRO A 1 323  ? 35.909  1.311   -65.920 1.00 48.15  ? 737  PRO A CG    1 
ATOM   2249 C  CD    . PRO A 1 323  ? 34.716  1.853   -66.631 1.00 48.62  ? 737  PRO A CD    1 
ATOM   2250 N  N     . VAL A 1 324  ? 32.506  -1.596  -64.316 1.00 48.10  ? 738  VAL A N     1 
ATOM   2251 C  CA    . VAL A 1 324  ? 31.549  -1.902  -63.257 1.00 47.61  ? 738  VAL A CA    1 
ATOM   2252 C  C     . VAL A 1 324  ? 32.366  -2.363  -62.055 1.00 47.64  ? 738  VAL A C     1 
ATOM   2253 O  O     . VAL A 1 324  ? 33.164  -3.291  -62.174 1.00 47.87  ? 738  VAL A O     1 
ATOM   2254 C  CB    . VAL A 1 324  ? 30.557  -3.031  -63.674 1.00 47.78  ? 738  VAL A CB    1 
ATOM   2255 C  CG1   . VAL A 1 324  ? 29.771  -3.568  -62.462 1.00 46.66  ? 738  VAL A CG1   1 
ATOM   2256 C  CG2   . VAL A 1 324  ? 29.575  -2.550  -64.772 1.00 47.92  ? 738  VAL A CG2   1 
ATOM   2257 N  N     . VAL A 1 325  ? 32.186  -1.714  -60.908 1.00 47.22  ? 739  VAL A N     1 
ATOM   2258 C  CA    . VAL A 1 325  ? 32.940  -2.082  -59.708 1.00 46.81  ? 739  VAL A CA    1 
ATOM   2259 C  C     . VAL A 1 325  ? 32.048  -2.564  -58.560 1.00 47.11  ? 739  VAL A C     1 
ATOM   2260 O  O     . VAL A 1 325  ? 30.995  -1.973  -58.274 1.00 47.22  ? 739  VAL A O     1 
ATOM   2261 C  CB    . VAL A 1 325  ? 33.829  -0.932  -59.211 1.00 46.31  ? 739  VAL A CB    1 
ATOM   2262 C  CG1   . VAL A 1 325  ? 35.015  -0.751  -60.132 1.00 46.12  ? 739  VAL A CG1   1 
ATOM   2263 C  CG2   . VAL A 1 325  ? 33.028  0.343   -59.105 1.00 45.89  ? 739  VAL A CG2   1 
ATOM   2264 N  N     . ALA A 1 326  ? 32.480  -3.657  -57.932 1.00 46.94  ? 740  ALA A N     1 
ATOM   2265 C  CA    . ALA A 1 326  ? 31.876  -4.160  -56.707 1.00 46.86  ? 740  ALA A CA    1 
ATOM   2266 C  C     . ALA A 1 326  ? 32.385  -3.344  -55.517 1.00 46.69  ? 740  ALA A C     1 
ATOM   2267 O  O     . ALA A 1 326  ? 33.505  -3.584  -55.039 1.00 46.50  ? 740  ALA A O     1 
ATOM   2268 C  CB    . ALA A 1 326  ? 32.217  -5.637  -56.523 1.00 46.63  ? 740  ALA A CB    1 
ATOM   2269 N  N     . THR A 1 327  ? 31.576  -2.389  -55.045 1.00 46.59  ? 741  THR A N     1 
ATOM   2270 C  CA    . THR A 1 327  ? 31.924  -1.626  -53.834 1.00 46.45  ? 741  THR A CA    1 
ATOM   2271 C  C     . THR A 1 327  ? 31.040  -2.009  -52.660 1.00 46.44  ? 741  THR A C     1 
ATOM   2272 O  O     . THR A 1 327  ? 29.880  -2.449  -52.836 1.00 46.84  ? 741  THR A O     1 
ATOM   2273 C  CB    . THR A 1 327  ? 31.809  -0.104  -54.028 1.00 46.64  ? 741  THR A CB    1 
ATOM   2274 O  OG1   . THR A 1 327  ? 30.444  0.300   -53.832 1.00 46.03  ? 741  THR A OG1   1 
ATOM   2275 C  CG2   . THR A 1 327  ? 32.300  0.318   -55.414 1.00 45.76  ? 741  THR A CG2   1 
ATOM   2276 N  N     . GLY A 1 328  ? 31.575  -1.811  -51.460 1.00 46.14  ? 742  GLY A N     1 
ATOM   2277 C  CA    . GLY A 1 328  ? 30.929  -2.298  -50.250 1.00 45.87  ? 742  GLY A CA    1 
ATOM   2278 C  C     . GLY A 1 328  ? 30.061  -1.345  -49.426 1.00 45.29  ? 742  GLY A C     1 
ATOM   2279 O  O     . GLY A 1 328  ? 29.265  -1.787  -48.608 1.00 45.33  ? 742  GLY A O     1 
ATOM   2280 N  N     . ASN A 1 329  ? 30.193  -0.046  -49.643 1.00 44.44  ? 743  ASN A N     1 
ATOM   2281 C  CA    . ASN A 1 329  ? 29.455  0.925   -48.843 1.00 44.08  ? 743  ASN A CA    1 
ATOM   2282 C  C     . ASN A 1 329  ? 29.726  0.788   -47.317 1.00 44.12  ? 743  ASN A C     1 
ATOM   2283 O  O     . ASN A 1 329  ? 28.815  0.837   -46.472 1.00 44.36  ? 743  ASN A O     1 
ATOM   2284 C  CB    . ASN A 1 329  ? 27.969  0.871   -49.187 1.00 43.73  ? 743  ASN A CB    1 
ATOM   2285 C  CG    . ASN A 1 329  ? 27.253  2.114   -48.773 1.00 44.19  ? 743  ASN A CG    1 
ATOM   2286 O  OD1   . ASN A 1 329  ? 27.860  3.025   -48.242 1.00 46.24  ? 743  ASN A OD1   1 
ATOM   2287 N  ND2   . ASN A 1 329  ? 25.964  2.175   -49.018 1.00 46.36  ? 743  ASN A ND2   1 
ATOM   2288 N  N     . VAL A 1 330  ? 30.998  0.623   -46.969 1.00 43.43  ? 744  VAL A N     1 
ATOM   2289 C  CA    . VAL A 1 330  ? 31.377  0.339   -45.595 1.00 42.48  ? 744  VAL A CA    1 
ATOM   2290 C  C     . VAL A 1 330  ? 30.981  1.434   -44.605 1.00 42.42  ? 744  VAL A C     1 
ATOM   2291 O  O     . VAL A 1 330  ? 31.143  2.621   -44.883 1.00 41.94  ? 744  VAL A O     1 
ATOM   2292 C  CB    . VAL A 1 330  ? 32.882  0.121   -45.488 1.00 42.71  ? 744  VAL A CB    1 
ATOM   2293 C  CG1   . VAL A 1 330  ? 33.263  -0.278  -44.047 1.00 41.71  ? 744  VAL A CG1   1 
ATOM   2294 C  CG2   . VAL A 1 330  ? 33.325  -0.931  -46.501 1.00 41.80  ? 744  VAL A CG2   1 
ATOM   2295 N  N     . HIS A 1 331  ? 30.468  1.018   -43.451 1.00 41.98  ? 745  HIS A N     1 
ATOM   2296 C  CA    . HIS A 1 331  ? 30.090  1.912   -42.354 1.00 41.99  ? 745  HIS A CA    1 
ATOM   2297 C  C     . HIS A 1 331  ? 30.692  1.466   -41.016 1.00 42.29  ? 745  HIS A C     1 
ATOM   2298 O  O     . HIS A 1 331  ? 30.447  2.091   -39.989 1.00 42.31  ? 745  HIS A O     1 
ATOM   2299 C  CB    . HIS A 1 331  ? 28.581  1.931   -42.172 1.00 41.41  ? 745  HIS A CB    1 
ATOM   2300 C  CG    . HIS A 1 331  ? 27.851  2.764   -43.173 1.00 40.49  ? 745  HIS A CG    1 
ATOM   2301 N  ND1   . HIS A 1 331  ? 27.690  2.379   -44.489 1.00 38.13  ? 745  HIS A ND1   1 
ATOM   2302 C  CD2   . HIS A 1 331  ? 27.206  3.948   -43.042 1.00 38.82  ? 745  HIS A CD2   1 
ATOM   2303 C  CE1   . HIS A 1 331  ? 26.989  3.300   -45.125 1.00 38.24  ? 745  HIS A CE1   1 
ATOM   2304 N  NE2   . HIS A 1 331  ? 26.681  4.261   -44.271 1.00 37.19  ? 745  HIS A NE2   1 
ATOM   2305 N  N     . TYR A 1 332  ? 31.428  0.356   -41.029 1.00 42.79  ? 746  TYR A N     1 
ATOM   2306 C  CA    . TYR A 1 332  ? 32.169  -0.126  -39.866 1.00 42.94  ? 746  TYR A CA    1 
ATOM   2307 C  C     . TYR A 1 332  ? 33.099  -1.242  -40.313 1.00 43.36  ? 746  TYR A C     1 
ATOM   2308 O  O     . TYR A 1 332  ? 32.945  -1.771  -41.420 1.00 43.57  ? 746  TYR A O     1 
ATOM   2309 C  CB    . TYR A 1 332  ? 31.227  -0.615  -38.752 1.00 43.31  ? 746  TYR A CB    1 
ATOM   2310 C  CG    . TYR A 1 332  ? 29.928  -1.251  -39.227 1.00 42.52  ? 746  TYR A CG    1 
ATOM   2311 C  CD1   . TYR A 1 332  ? 28.789  -0.483  -39.405 1.00 42.88  ? 746  TYR A CD1   1 
ATOM   2312 C  CD2   . TYR A 1 332  ? 29.839  -2.613  -39.489 1.00 41.74  ? 746  TYR A CD2   1 
ATOM   2313 C  CE1   . TYR A 1 332  ? 27.598  -1.042  -39.840 1.00 42.03  ? 746  TYR A CE1   1 
ATOM   2314 C  CE2   . TYR A 1 332  ? 28.643  -3.189  -39.913 1.00 40.02  ? 746  TYR A CE2   1 
ATOM   2315 C  CZ    . TYR A 1 332  ? 27.525  -2.392  -40.084 1.00 41.44  ? 746  TYR A CZ    1 
ATOM   2316 O  OH    . TYR A 1 332  ? 26.323  -2.921  -40.519 1.00 42.94  ? 746  TYR A OH    1 
ATOM   2317 N  N     . LEU A 1 333  ? 34.063  -1.587  -39.458 1.00 43.76  ? 747  LEU A N     1 
ATOM   2318 C  CA    . LEU A 1 333  ? 35.002  -2.688  -39.709 1.00 43.71  ? 747  LEU A CA    1 
ATOM   2319 C  C     . LEU A 1 333  ? 34.320  -4.046  -39.831 1.00 43.94  ? 747  LEU A C     1 
ATOM   2320 O  O     . LEU A 1 333  ? 34.272  -4.630  -40.911 1.00 44.24  ? 747  LEU A O     1 
ATOM   2321 C  CB    . LEU A 1 333  ? 36.040  -2.783  -38.584 1.00 43.36  ? 747  LEU A CB    1 
ATOM   2322 C  CG    . LEU A 1 333  ? 37.481  -3.172  -38.942 1.00 42.53  ? 747  LEU A CG    1 
ATOM   2323 C  CD1   . LEU A 1 333  ? 38.105  -3.985  -37.821 1.00 40.77  ? 747  LEU A CD1   1 
ATOM   2324 C  CD2   . LEU A 1 333  ? 37.592  -3.890  -40.289 1.00 39.99  ? 747  LEU A CD2   1 
ATOM   2325 N  N     . ASN A 1 334  ? 33.821  -4.560  -38.712 1.00 44.32  ? 748  ASN A N     1 
ATOM   2326 C  CA    . ASN A 1 334  ? 33.383  -5.967  -38.630 1.00 44.65  ? 748  ASN A CA    1 
ATOM   2327 C  C     . ASN A 1 334  ? 31.869  -6.157  -38.539 1.00 45.07  ? 748  ASN A C     1 
ATOM   2328 O  O     . ASN A 1 334  ? 31.161  -5.280  -38.064 1.00 45.35  ? 748  ASN A O     1 
ATOM   2329 C  CB    . ASN A 1 334  ? 34.045  -6.656  -37.432 1.00 44.39  ? 748  ASN A CB    1 
ATOM   2330 C  CG    . ASN A 1 334  ? 35.546  -6.807  -37.596 1.00 44.05  ? 748  ASN A CG    1 
ATOM   2331 O  OD1   . ASN A 1 334  ? 36.023  -7.298  -38.618 1.00 43.56  ? 748  ASN A OD1   1 
ATOM   2332 N  ND2   . ASN A 1 334  ? 36.302  -6.390  -36.576 1.00 42.93  ? 748  ASN A ND2   1 
ATOM   2333 N  N     . PRO A 1 335  ? 31.371  -7.323  -38.968 1.00 45.63  ? 749  PRO A N     1 
ATOM   2334 C  CA    . PRO A 1 335  ? 29.950  -7.655  -38.931 1.00 46.19  ? 749  PRO A CA    1 
ATOM   2335 C  C     . PRO A 1 335  ? 29.245  -7.278  -37.632 1.00 47.05  ? 749  PRO A C     1 
ATOM   2336 O  O     . PRO A 1 335  ? 28.126  -6.780  -37.670 1.00 47.18  ? 749  PRO A O     1 
ATOM   2337 C  CB    . PRO A 1 335  ? 29.950  -9.171  -39.086 1.00 46.09  ? 749  PRO A CB    1 
ATOM   2338 C  CG    . PRO A 1 335  ? 31.139  -9.451  -39.913 1.00 46.19  ? 749  PRO A CG    1 
ATOM   2339 C  CD    . PRO A 1 335  ? 32.170  -8.402  -39.573 1.00 45.82  ? 749  PRO A CD    1 
ATOM   2340 N  N     . GLU A 1 336  ? 29.878  -7.519  -36.489 1.00 48.12  ? 750  GLU A N     1 
ATOM   2341 C  CA    . GLU A 1 336  ? 29.222  -7.252  -35.206 1.00 49.42  ? 750  GLU A CA    1 
ATOM   2342 C  C     . GLU A 1 336  ? 29.217  -5.765  -34.802 1.00 49.22  ? 750  GLU A C     1 
ATOM   2343 O  O     . GLU A 1 336  ? 28.435  -5.364  -33.933 1.00 49.51  ? 750  GLU A O     1 
ATOM   2344 C  CB    . GLU A 1 336  ? 29.824  -8.102  -34.073 1.00 50.12  ? 750  GLU A CB    1 
ATOM   2345 C  CG    . GLU A 1 336  ? 30.514  -9.409  -34.509 1.00 53.27  ? 750  GLU A CG    1 
ATOM   2346 C  CD    . GLU A 1 336  ? 32.021  -9.248  -34.814 1.00 57.14  ? 750  GLU A CD    1 
ATOM   2347 O  OE1   . GLU A 1 336  ? 32.640  -8.215  -34.418 1.00 57.96  ? 750  GLU A OE1   1 
ATOM   2348 O  OE2   . GLU A 1 336  ? 32.578  -10.176 -35.452 1.00 57.17  ? 750  GLU A OE2   1 
ATOM   2349 N  N     . ASP A 1 337  ? 30.080  -4.953  -35.415 1.00 48.66  ? 751  ASP A N     1 
ATOM   2350 C  CA    . ASP A 1 337  ? 30.124  -3.514  -35.111 1.00 48.12  ? 751  ASP A CA    1 
ATOM   2351 C  C     . ASP A 1 337  ? 28.814  -2.840  -35.490 1.00 47.86  ? 751  ASP A C     1 
ATOM   2352 O  O     . ASP A 1 337  ? 28.573  -1.680  -35.171 1.00 47.39  ? 751  ASP A O     1 
ATOM   2353 C  CB    . ASP A 1 337  ? 31.280  -2.832  -35.847 1.00 47.82  ? 751  ASP A CB    1 
ATOM   2354 C  CG    . ASP A 1 337  ? 32.654  -3.351  -35.412 1.00 47.67  ? 751  ASP A CG    1 
ATOM   2355 O  OD1   . ASP A 1 337  ? 32.854  -3.621  -34.213 1.00 45.55  ? 751  ASP A OD1   1 
ATOM   2356 O  OD2   . ASP A 1 337  ? 33.553  -3.465  -36.277 1.00 49.05  ? 751  ASP A OD2   1 
ATOM   2357 N  N     . LYS A 1 338  ? 27.985  -3.581  -36.209 1.00 48.13  ? 752  LYS A N     1 
ATOM   2358 C  CA    . LYS A 1 338  ? 26.679  -3.102  -36.631 1.00 48.39  ? 752  LYS A CA    1 
ATOM   2359 C  C     . LYS A 1 338  ? 25.915  -2.480  -35.467 1.00 48.33  ? 752  LYS A C     1 
ATOM   2360 O  O     . LYS A 1 338  ? 25.305  -1.418  -35.621 1.00 48.37  ? 752  LYS A O     1 
ATOM   2361 C  CB    . LYS A 1 338  ? 25.874  -4.275  -37.194 1.00 48.74  ? 752  LYS A CB    1 
ATOM   2362 C  CG    . LYS A 1 338  ? 24.485  -3.929  -37.677 1.00 48.94  ? 752  LYS A CG    1 
ATOM   2363 C  CD    . LYS A 1 338  ? 23.866  -5.172  -38.293 1.00 50.75  ? 752  LYS A CD    1 
ATOM   2364 C  CE    . LYS A 1 338  ? 22.608  -4.871  -39.077 1.00 50.73  ? 752  LYS A CE    1 
ATOM   2365 N  NZ    . LYS A 1 338  ? 22.344  -5.989  -40.007 1.00 51.19  ? 752  LYS A NZ    1 
ATOM   2366 N  N     . ILE A 1 339  ? 25.955  -3.143  -34.308 1.00 47.61  ? 753  ILE A N     1 
ATOM   2367 C  CA    . ILE A 1 339  ? 25.188  -2.712  -33.132 1.00 47.19  ? 753  ILE A CA    1 
ATOM   2368 C  C     . ILE A 1 339  ? 25.423  -1.251  -32.732 1.00 46.88  ? 753  ILE A C     1 
ATOM   2369 O  O     . ILE A 1 339  ? 24.484  -0.558  -32.344 1.00 46.80  ? 753  ILE A O     1 
ATOM   2370 C  CB    . ILE A 1 339  ? 25.429  -3.646  -31.909 1.00 47.26  ? 753  ILE A CB    1 
ATOM   2371 C  CG1   . ILE A 1 339  ? 24.591  -3.213  -30.701 1.00 46.55  ? 753  ILE A CG1   1 
ATOM   2372 C  CG2   . ILE A 1 339  ? 26.916  -3.700  -31.549 1.00 47.20  ? 753  ILE A CG2   1 
ATOM   2373 C  CD1   . ILE A 1 339  ? 23.136  -3.609  -30.782 1.00 45.17  ? 753  ILE A CD1   1 
ATOM   2374 N  N     . TYR A 1 340  ? 26.662  -0.775  -32.836 1.00 46.54  ? 754  TYR A N     1 
ATOM   2375 C  CA    . TYR A 1 340  ? 26.957  0.592   -32.409 1.00 46.08  ? 754  TYR A CA    1 
ATOM   2376 C  C     . TYR A 1 340  ? 26.177  1.570   -33.288 1.00 46.70  ? 754  TYR A C     1 
ATOM   2377 O  O     . TYR A 1 340  ? 25.582  2.534   -32.792 1.00 47.19  ? 754  TYR A O     1 
ATOM   2378 C  CB    . TYR A 1 340  ? 28.460  0.894   -32.477 1.00 45.48  ? 754  TYR A CB    1 
ATOM   2379 C  CG    . TYR A 1 340  ? 29.340  -0.104  -31.762 1.00 43.30  ? 754  TYR A CG    1 
ATOM   2380 C  CD1   . TYR A 1 340  ? 29.357  -0.181  -30.373 1.00 42.61  ? 754  TYR A CD1   1 
ATOM   2381 C  CD2   . TYR A 1 340  ? 30.172  -0.955  -32.469 1.00 41.53  ? 754  TYR A CD2   1 
ATOM   2382 C  CE1   . TYR A 1 340  ? 30.151  -1.101  -29.711 1.00 41.00  ? 754  TYR A CE1   1 
ATOM   2383 C  CE2   . TYR A 1 340  ? 30.981  -1.878  -31.805 1.00 40.67  ? 754  TYR A CE2   1 
ATOM   2384 C  CZ    . TYR A 1 340  ? 30.961  -1.940  -30.431 1.00 40.21  ? 754  TYR A CZ    1 
ATOM   2385 O  OH    . TYR A 1 340  ? 31.744  -2.855  -29.773 1.00 39.68  ? 754  TYR A OH    1 
ATOM   2386 N  N     . ARG A 1 341  ? 26.170  1.324   -34.596 1.00 46.81  ? 755  ARG A N     1 
ATOM   2387 C  CA    . ARG A 1 341  ? 25.436  2.209   -35.497 1.00 47.12  ? 755  ARG A CA    1 
ATOM   2388 C  C     . ARG A 1 341  ? 23.958  2.182   -35.200 1.00 47.49  ? 755  ARG A C     1 
ATOM   2389 O  O     . ARG A 1 341  ? 23.281  3.212   -35.272 1.00 47.40  ? 755  ARG A O     1 
ATOM   2390 C  CB    . ARG A 1 341  ? 25.626  1.861   -36.977 1.00 46.73  ? 755  ARG A CB    1 
ATOM   2391 C  CG    . ARG A 1 341  ? 24.624  2.624   -37.838 1.00 46.91  ? 755  ARG A CG    1 
ATOM   2392 C  CD    . ARG A 1 341  ? 25.157  2.975   -39.212 1.00 47.97  ? 755  ARG A CD    1 
ATOM   2393 N  NE    . ARG A 1 341  ? 24.806  1.999   -40.234 1.00 49.76  ? 755  ARG A NE    1 
ATOM   2394 C  CZ    . ARG A 1 341  ? 24.202  2.286   -41.397 1.00 49.69  ? 755  ARG A CZ    1 
ATOM   2395 N  NH1   . ARG A 1 341  ? 23.875  3.535   -41.715 1.00 48.73  ? 755  ARG A NH1   1 
ATOM   2396 N  NH2   . ARG A 1 341  ? 23.935  1.312   -42.255 1.00 48.23  ? 755  ARG A NH2   1 
ATOM   2397 N  N     . LYS A 1 342  ? 23.461  0.987   -34.894 1.00 47.63  ? 756  LYS A N     1 
ATOM   2398 C  CA    . LYS A 1 342  ? 22.054  0.805   -34.634 1.00 48.25  ? 756  LYS A CA    1 
ATOM   2399 C  C     . LYS A 1 342  ? 21.691  1.688   -33.458 1.00 48.10  ? 756  LYS A C     1 
ATOM   2400 O  O     . LYS A 1 342  ? 20.703  2.396   -33.486 1.00 48.26  ? 756  LYS A O     1 
ATOM   2401 C  CB    . LYS A 1 342  ? 21.741  -0.668  -34.361 1.00 48.22  ? 756  LYS A CB    1 
ATOM   2402 C  CG    . LYS A 1 342  ? 20.272  -0.971  -34.326 1.00 50.22  ? 756  LYS A CG    1 
ATOM   2403 C  CD    . LYS A 1 342  ? 20.009  -2.450  -33.966 1.00 54.63  ? 756  LYS A CD    1 
ATOM   2404 C  CE    . LYS A 1 342  ? 19.507  -3.287  -35.169 1.00 57.38  ? 756  LYS A CE    1 
ATOM   2405 N  NZ    . LYS A 1 342  ? 20.338  -3.209  -36.436 1.00 58.74  ? 756  LYS A NZ    1 
ATOM   2406 N  N     . ILE A 1 343  ? 22.542  1.694   -32.445 1.00 48.45  ? 757  ILE A N     1 
ATOM   2407 C  CA    . ILE A 1 343  ? 22.328  2.556   -31.295 1.00 48.56  ? 757  ILE A CA    1 
ATOM   2408 C  C     . ILE A 1 343  ? 22.310  4.053   -31.625 1.00 48.97  ? 757  ILE A C     1 
ATOM   2409 O  O     . ILE A 1 343  ? 21.452  4.789   -31.131 1.00 49.09  ? 757  ILE A O     1 
ATOM   2410 C  CB    . ILE A 1 343  ? 23.378  2.302   -30.209 1.00 48.25  ? 757  ILE A CB    1 
ATOM   2411 C  CG1   . ILE A 1 343  ? 23.212  0.876   -29.662 1.00 48.09  ? 757  ILE A CG1   1 
ATOM   2412 C  CG2   . ILE A 1 343  ? 23.256  3.376   -29.142 1.00 46.92  ? 757  ILE A CG2   1 
ATOM   2413 C  CD1   . ILE A 1 343  ? 24.239  0.451   -28.615 1.00 47.43  ? 757  ILE A CD1   1 
ATOM   2414 N  N     . LEU A 1 344  ? 23.250  4.515   -32.442 1.00 49.22  ? 758  LEU A N     1 
ATOM   2415 C  CA    . LEU A 1 344  ? 23.286  5.942   -32.793 1.00 49.88  ? 758  LEU A CA    1 
ATOM   2416 C  C     . LEU A 1 344  ? 22.026  6.364   -33.578 1.00 50.69  ? 758  LEU A C     1 
ATOM   2417 O  O     . LEU A 1 344  ? 21.351  7.347   -33.260 1.00 50.73  ? 758  LEU A O     1 
ATOM   2418 C  CB    . LEU A 1 344  ? 24.557  6.267   -33.581 1.00 49.25  ? 758  LEU A CB    1 
ATOM   2419 C  CG    . LEU A 1 344  ? 25.841  6.432   -32.761 1.00 49.51  ? 758  LEU A CG    1 
ATOM   2420 C  CD1   . LEU A 1 344  ? 27.051  6.559   -33.646 1.00 49.00  ? 758  LEU A CD1   1 
ATOM   2421 C  CD2   . LEU A 1 344  ? 25.745  7.645   -31.839 1.00 49.49  ? 758  LEU A CD2   1 
ATOM   2422 N  N     . ILE A 1 345  ? 21.693  5.603   -34.600 1.00 51.53  ? 759  ILE A N     1 
ATOM   2423 C  CA    . ILE A 1 345  ? 20.551  5.952   -35.403 1.00 52.79  ? 759  ILE A CA    1 
ATOM   2424 C  C     . ILE A 1 345  ? 19.293  5.983   -34.537 1.00 53.87  ? 759  ILE A C     1 
ATOM   2425 O  O     . ILE A 1 345  ? 18.432  6.855   -34.697 1.00 53.92  ? 759  ILE A O     1 
ATOM   2426 C  CB    . ILE A 1 345  ? 20.431  4.987   -36.580 1.00 52.63  ? 759  ILE A CB    1 
ATOM   2427 C  CG1   . ILE A 1 345  ? 21.511  5.334   -37.609 1.00 52.00  ? 759  ILE A CG1   1 
ATOM   2428 C  CG2   . ILE A 1 345  ? 19.046  5.020   -37.176 1.00 53.04  ? 759  ILE A CG2   1 
ATOM   2429 C  CD1   . ILE A 1 345  ? 21.713  4.307   -38.682 1.00 51.55  ? 759  ILE A CD1   1 
ATOM   2430 N  N     . HIS A 1 346  ? 19.196  5.045   -33.600 1.00 55.13  ? 760  HIS A N     1 
ATOM   2431 C  CA    . HIS A 1 346  ? 17.989  4.944   -32.784 1.00 56.29  ? 760  HIS A CA    1 
ATOM   2432 C  C     . HIS A 1 346  ? 17.756  6.192   -31.946 1.00 57.41  ? 760  HIS A C     1 
ATOM   2433 O  O     . HIS A 1 346  ? 16.619  6.524   -31.607 1.00 57.27  ? 760  HIS A O     1 
ATOM   2434 C  CB    . HIS A 1 346  ? 18.025  3.726   -31.867 1.00 56.05  ? 760  HIS A CB    1 
ATOM   2435 C  CG    . HIS A 1 346  ? 16.931  3.728   -30.846 1.00 55.72  ? 760  HIS A CG    1 
ATOM   2436 N  ND1   . HIS A 1 346  ? 15.745  3.044   -31.018 1.00 55.55  ? 760  HIS A ND1   1 
ATOM   2437 C  CD2   . HIS A 1 346  ? 16.826  4.374   -29.661 1.00 55.44  ? 760  HIS A CD2   1 
ATOM   2438 C  CE1   . HIS A 1 346  ? 14.966  3.250   -29.973 1.00 56.30  ? 760  HIS A CE1   1 
ATOM   2439 N  NE2   . HIS A 1 346  ? 15.600  4.050   -29.132 1.00 57.17  ? 760  HIS A NE2   1 
ATOM   2440 N  N     . SER A 1 347  ? 18.839  6.876   -31.599 1.00 58.88  ? 761  SER A N     1 
ATOM   2441 C  CA    . SER A 1 347  ? 18.746  8.074   -30.773 1.00 60.18  ? 761  SER A CA    1 
ATOM   2442 C  C     . SER A 1 347  ? 18.049  9.247   -31.482 1.00 61.33  ? 761  SER A C     1 
ATOM   2443 O  O     . SER A 1 347  ? 17.811  10.290  -30.879 1.00 61.66  ? 761  SER A O     1 
ATOM   2444 C  CB    . SER A 1 347  ? 20.144  8.505   -30.314 1.00 60.04  ? 761  SER A CB    1 
ATOM   2445 O  OG    . SER A 1 347  ? 20.868  9.110   -31.378 1.00 59.15  ? 761  SER A OG    1 
ATOM   2446 N  N     . GLN A 1 348  ? 17.723  9.091   -32.757 1.00 62.69  ? 762  GLN A N     1 
ATOM   2447 C  CA    . GLN A 1 348  ? 17.170  10.217  -33.508 1.00 64.10  ? 762  GLN A CA    1 
ATOM   2448 C  C     . GLN A 1 348  ? 15.653  10.136  -33.740 1.00 65.01  ? 762  GLN A C     1 
ATOM   2449 O  O     . GLN A 1 348  ? 15.092  10.951  -34.481 1.00 64.98  ? 762  GLN A O     1 
ATOM   2450 C  CB    . GLN A 1 348  ? 17.932  10.410  -34.830 1.00 64.09  ? 762  GLN A CB    1 
ATOM   2451 C  CG    . GLN A 1 348  ? 19.351  10.981  -34.667 1.00 64.21  ? 762  GLN A CG    1 
ATOM   2452 C  CD    . GLN A 1 348  ? 20.172  10.874  -35.943 1.00 65.13  ? 762  GLN A CD    1 
ATOM   2453 O  OE1   . GLN A 1 348  ? 20.255  9.806   -36.547 1.00 64.46  ? 762  GLN A OE1   1 
ATOM   2454 N  NE2   . GLN A 1 348  ? 20.784  11.984  -36.356 1.00 65.03  ? 762  GLN A NE2   1 
ATOM   2455 N  N     . GLY A 1 349  ? 14.998  9.166   -33.099 1.00 66.09  ? 763  GLY A N     1 
ATOM   2456 C  CA    . GLY A 1 349  ? 13.536  8.998   -33.193 1.00 67.62  ? 763  GLY A CA    1 
ATOM   2457 C  C     . GLY A 1 349  ? 13.024  8.791   -34.612 1.00 68.69  ? 763  GLY A C     1 
ATOM   2458 O  O     . GLY A 1 349  ? 13.790  8.401   -35.501 1.00 68.97  ? 763  GLY A O     1 
ATOM   2459 N  N     . GLY A 1 350  ? 11.736  9.061   -34.829 1.00 69.57  ? 764  GLY A N     1 
ATOM   2460 C  CA    . GLY A 1 350  ? 11.142  9.008   -36.174 1.00 70.68  ? 764  GLY A CA    1 
ATOM   2461 C  C     . GLY A 1 350  ? 11.589  10.154  -37.080 1.00 71.50  ? 764  GLY A C     1 
ATOM   2462 O  O     . GLY A 1 350  ? 11.086  10.320  -38.200 1.00 71.46  ? 764  GLY A O     1 
ATOM   2463 N  N     . ALA A 1 351  ? 12.534  10.950  -36.580 1.00 72.33  ? 765  ALA A N     1 
ATOM   2464 C  CA    . ALA A 1 351  ? 13.074  12.087  -37.322 1.00 73.10  ? 765  ALA A CA    1 
ATOM   2465 C  C     . ALA A 1 351  ? 14.079  11.611  -38.368 1.00 73.65  ? 765  ALA A C     1 
ATOM   2466 O  O     . ALA A 1 351  ? 14.347  12.309  -39.359 1.00 73.89  ? 765  ALA A O     1 
ATOM   2467 C  CB    . ALA A 1 351  ? 13.717  13.102  -36.372 1.00 73.00  ? 765  ALA A CB    1 
ATOM   2468 N  N     . ASN A 1 352  ? 14.603  10.404  -38.164 1.00 74.11  ? 766  ASN A N     1 
ATOM   2469 C  CA    . ASN A 1 352  ? 15.584  9.829   -39.082 1.00 74.58  ? 766  ASN A CA    1 
ATOM   2470 C  C     . ASN A 1 352  ? 15.035  9.112   -40.335 1.00 75.19  ? 766  ASN A C     1 
ATOM   2471 O  O     . ASN A 1 352  ? 15.644  9.197   -41.412 1.00 75.03  ? 766  ASN A O     1 
ATOM   2472 C  CB    . ASN A 1 352  ? 16.539  8.901   -38.325 1.00 74.43  ? 766  ASN A CB    1 
ATOM   2473 C  CG    . ASN A 1 352  ? 17.771  8.555   -39.140 1.00 73.97  ? 766  ASN A CG    1 
ATOM   2474 O  OD1   . ASN A 1 352  ? 18.895  8.880   -38.761 1.00 73.56  ? 766  ASN A OD1   1 
ATOM   2475 N  ND2   . ASN A 1 352  ? 17.560  7.918   -40.282 1.00 72.94  ? 766  ASN A ND2   1 
ATOM   2476 N  N     . PRO A 1 353  ? 13.855  8.459   -40.216 1.00 75.74  ? 767  PRO A N     1 
ATOM   2477 C  CA    . PRO A 1 353  ? 13.395  7.382   -41.093 1.00 75.87  ? 767  PRO A CA    1 
ATOM   2478 C  C     . PRO A 1 353  ? 14.427  6.487   -41.829 1.00 75.71  ? 767  PRO A C     1 
ATOM   2479 O  O     . PRO A 1 353  ? 14.402  6.380   -43.060 1.00 75.84  ? 767  PRO A O     1 
ATOM   2480 C  CB    . PRO A 1 353  ? 12.411  8.117   -42.014 1.00 75.91  ? 767  PRO A CB    1 
ATOM   2481 C  CG    . PRO A 1 353  ? 11.733  9.151   -40.996 1.00 75.81  ? 767  PRO A CG    1 
ATOM   2482 C  CD    . PRO A 1 353  ? 12.663  9.191   -39.746 1.00 75.87  ? 767  PRO A CD    1 
ATOM   2483 N  N     . LEU A 1 354  ? 15.324  5.886   -41.041 1.00 75.40  ? 768  LEU A N     1 
ATOM   2484 C  CA    . LEU A 1 354  ? 16.017  4.643   -41.381 1.00 75.02  ? 768  LEU A CA    1 
ATOM   2485 C  C     . LEU A 1 354  ? 15.680  3.626   -40.289 1.00 74.64  ? 768  LEU A C     1 
ATOM   2486 O  O     . LEU A 1 354  ? 15.917  2.429   -40.448 1.00 74.82  ? 768  LEU A O     1 
ATOM   2487 C  CB    . LEU A 1 354  ? 17.534  4.824   -41.461 1.00 74.97  ? 768  LEU A CB    1 
ATOM   2488 C  CG    . LEU A 1 354  ? 18.209  4.931   -42.834 1.00 75.37  ? 768  LEU A CG    1 
ATOM   2489 C  CD1   . LEU A 1 354  ? 17.612  6.048   -43.689 1.00 75.66  ? 768  LEU A CD1   1 
ATOM   2490 C  CD2   . LEU A 1 354  ? 19.730  5.110   -42.680 1.00 75.42  ? 768  LEU A CD2   1 
ATOM   2491 N  N     . ASN A 1 355  ? 15.131  4.109   -39.175 1.00 73.83  ? 769  ASN A N     1 
ATOM   2492 C  CA    . ASN A 1 355  ? 14.588  3.221   -38.147 1.00 73.15  ? 769  ASN A CA    1 
ATOM   2493 C  C     . ASN A 1 355  ? 13.349  2.452   -38.660 1.00 72.69  ? 769  ASN A C     1 
ATOM   2494 O  O     . ASN A 1 355  ? 12.780  1.616   -37.956 1.00 72.56  ? 769  ASN A O     1 
ATOM   2495 C  CB    . ASN A 1 355  ? 14.269  4.006   -36.866 1.00 73.05  ? 769  ASN A CB    1 
ATOM   2496 C  CG    . ASN A 1 355  ? 15.526  4.476   -36.133 1.00 73.05  ? 769  ASN A CG    1 
ATOM   2497 O  OD1   . ASN A 1 355  ? 16.394  3.676   -35.785 1.00 72.70  ? 769  ASN A OD1   1 
ATOM   2498 N  ND2   . ASN A 1 355  ? 15.614  5.777   -35.881 1.00 72.84  ? 769  ASN A ND2   1 
ATOM   2499 N  N     . ARG A 1 356  ? 12.950  2.739   -39.897 1.00 71.99  ? 770  ARG A N     1 
ATOM   2500 C  CA    . ARG A 1 356  ? 11.803  2.085   -40.527 1.00 71.54  ? 770  ARG A CA    1 
ATOM   2501 C  C     . ARG A 1 356  ? 12.025  0.591   -40.796 1.00 71.08  ? 770  ARG A C     1 
ATOM   2502 O  O     . ARG A 1 356  ? 11.067  -0.156  -40.998 1.00 71.01  ? 770  ARG A O     1 
ATOM   2503 C  CB    . ARG A 1 356  ? 11.433  2.799   -41.838 1.00 71.47  ? 770  ARG A CB    1 
ATOM   2504 N  N     . HIS A 1 357  ? 13.281  0.151   -40.798 1.00 70.37  ? 771  HIS A N     1 
ATOM   2505 C  CA    . HIS A 1 357  ? 13.572  -1.232  -41.161 1.00 69.50  ? 771  HIS A CA    1 
ATOM   2506 C  C     . HIS A 1 357  ? 14.997  -1.667  -40.836 1.00 68.76  ? 771  HIS A C     1 
ATOM   2507 O  O     . HIS A 1 357  ? 15.896  -0.844  -40.714 1.00 68.72  ? 771  HIS A O     1 
ATOM   2508 C  CB    . HIS A 1 357  ? 13.284  -1.452  -42.648 1.00 69.68  ? 771  HIS A CB    1 
ATOM   2509 N  N     . GLU A 1 358  ? 15.196  -2.973  -40.714 1.00 67.97  ? 772  GLU A N     1 
ATOM   2510 C  CA    . GLU A 1 358  ? 16.494  -3.522  -40.345 1.00 67.25  ? 772  GLU A CA    1 
ATOM   2511 C  C     . GLU A 1 358  ? 17.636  -2.969  -41.191 1.00 66.61  ? 772  GLU A C     1 
ATOM   2512 O  O     . GLU A 1 358  ? 17.483  -2.738  -42.397 1.00 66.60  ? 772  GLU A O     1 
ATOM   2513 C  CB    . GLU A 1 358  ? 16.472  -5.050  -40.415 1.00 67.39  ? 772  GLU A CB    1 
ATOM   2514 C  CG    . GLU A 1 358  ? 16.070  -5.702  -39.102 1.00 68.25  ? 772  GLU A CG    1 
ATOM   2515 C  CD    . GLU A 1 358  ? 16.912  -5.216  -37.919 1.00 69.33  ? 772  GLU A CD    1 
ATOM   2516 O  OE1   . GLU A 1 358  ? 16.478  -5.425  -36.760 1.00 68.66  ? 772  GLU A OE1   1 
ATOM   2517 O  OE2   . GLU A 1 358  ? 18.004  -4.624  -38.145 1.00 70.24  ? 772  GLU A OE2   1 
ATOM   2518 N  N     . LEU A 1 359  ? 18.784  -2.766  -40.547 1.00 65.57  ? 773  LEU A N     1 
ATOM   2519 C  CA    . LEU A 1 359  ? 19.959  -2.220  -41.222 1.00 64.51  ? 773  LEU A CA    1 
ATOM   2520 C  C     . LEU A 1 359  ? 20.718  -3.310  -41.997 1.00 63.56  ? 773  LEU A C     1 
ATOM   2521 O  O     . LEU A 1 359  ? 20.907  -4.422  -41.490 1.00 63.40  ? 773  LEU A O     1 
ATOM   2522 C  CB    . LEU A 1 359  ? 20.892  -1.524  -40.217 1.00 64.61  ? 773  LEU A CB    1 
ATOM   2523 C  CG    . LEU A 1 359  ? 20.215  -0.505  -39.289 1.00 65.03  ? 773  LEU A CG    1 
ATOM   2524 C  CD1   . LEU A 1 359  ? 21.160  0.033   -38.195 1.00 65.35  ? 773  LEU A CD1   1 
ATOM   2525 C  CD2   . LEU A 1 359  ? 19.652  0.616   -40.133 1.00 65.65  ? 773  LEU A CD2   1 
ATOM   2526 N  N     . PRO A 1 360  ? 21.170  -2.983  -43.224 1.00 62.80  ? 774  PRO A N     1 
ATOM   2527 C  CA    . PRO A 1 360  ? 21.935  -3.913  -44.080 1.00 62.05  ? 774  PRO A CA    1 
ATOM   2528 C  C     . PRO A 1 360  ? 23.320  -4.197  -43.483 1.00 61.32  ? 774  PRO A C     1 
ATOM   2529 O  O     . PRO A 1 360  ? 23.847  -3.372  -42.733 1.00 61.45  ? 774  PRO A O     1 
ATOM   2530 C  CB    . PRO A 1 360  ? 22.085  -3.145  -45.415 1.00 61.96  ? 774  PRO A CB    1 
ATOM   2531 C  CG    . PRO A 1 360  ? 21.268  -1.869  -45.250 1.00 62.24  ? 774  PRO A CG    1 
ATOM   2532 C  CD    . PRO A 1 360  ? 21.102  -1.623  -43.795 1.00 62.67  ? 774  PRO A CD    1 
ATOM   2533 N  N     . ASP A 1 361  ? 23.891  -5.355  -43.803 1.00 60.33  ? 775  ASP A N     1 
ATOM   2534 C  CA    . ASP A 1 361  ? 25.252  -5.666  -43.383 1.00 59.46  ? 775  ASP A CA    1 
ATOM   2535 C  C     . ASP A 1 361  ? 26.246  -4.883  -44.254 1.00 58.87  ? 775  ASP A C     1 
ATOM   2536 O  O     . ASP A 1 361  ? 26.435  -5.189  -45.439 1.00 58.10  ? 775  ASP A O     1 
ATOM   2537 C  CB    . ASP A 1 361  ? 25.540  -7.168  -43.497 1.00 59.50  ? 775  ASP A CB    1 
ATOM   2538 C  CG    . ASP A 1 361  ? 24.715  -8.014  -42.534 1.00 60.09  ? 775  ASP A CG    1 
ATOM   2539 O  OD1   . ASP A 1 361  ? 24.734  -7.754  -41.302 1.00 58.00  ? 775  ASP A OD1   1 
ATOM   2540 O  OD2   . ASP A 1 361  ? 24.075  -8.974  -43.024 1.00 60.90  ? 775  ASP A OD2   1 
ATOM   2541 N  N     . VAL A 1 362  ? 26.864  -3.859  -43.664 1.00 58.10  ? 776  VAL A N     1 
ATOM   2542 C  CA    . VAL A 1 362  ? 27.819  -3.031  -44.403 1.00 57.43  ? 776  VAL A CA    1 
ATOM   2543 C  C     . VAL A 1 362  ? 29.157  -2.936  -43.657 1.00 56.69  ? 776  VAL A C     1 
ATOM   2544 O  O     . VAL A 1 362  ? 29.619  -1.857  -43.290 1.00 56.14  ? 776  VAL A O     1 
ATOM   2545 C  CB    . VAL A 1 362  ? 27.227  -1.637  -44.797 1.00 57.13  ? 776  VAL A CB    1 
ATOM   2546 C  CG1   . VAL A 1 362  ? 26.226  -1.798  -45.916 1.00 57.60  ? 776  VAL A CG1   1 
ATOM   2547 C  CG2   . VAL A 1 362  ? 26.556  -0.941  -43.610 1.00 57.35  ? 776  VAL A CG2   1 
ATOM   2548 N  N     . TYR A 1 363  ? 29.764  -4.092  -43.416 1.00 56.02  ? 777  TYR A N     1 
ATOM   2549 C  CA    . TYR A 1 363  ? 31.093  -4.133  -42.804 1.00 55.40  ? 777  TYR A CA    1 
ATOM   2550 C  C     . TYR A 1 363  ? 32.169  -4.173  -43.903 1.00 54.45  ? 777  TYR A C     1 
ATOM   2551 O  O     . TYR A 1 363  ? 31.862  -4.324  -45.079 1.00 54.33  ? 777  TYR A O     1 
ATOM   2552 C  CB    . TYR A 1 363  ? 31.213  -5.333  -41.860 1.00 55.11  ? 777  TYR A CB    1 
ATOM   2553 C  CG    . TYR A 1 363  ? 30.912  -6.652  -42.543 1.00 56.53  ? 777  TYR A CG    1 
ATOM   2554 C  CD1   . TYR A 1 363  ? 29.611  -7.158  -42.599 1.00 57.91  ? 777  TYR A CD1   1 
ATOM   2555 C  CD2   . TYR A 1 363  ? 31.924  -7.385  -43.150 1.00 57.05  ? 777  TYR A CD2   1 
ATOM   2556 C  CE1   . TYR A 1 363  ? 29.333  -8.365  -43.236 1.00 57.73  ? 777  TYR A CE1   1 
ATOM   2557 C  CE2   . TYR A 1 363  ? 31.656  -8.587  -43.784 1.00 57.82  ? 777  TYR A CE2   1 
ATOM   2558 C  CZ    . TYR A 1 363  ? 30.366  -9.066  -43.821 1.00 57.92  ? 777  TYR A CZ    1 
ATOM   2559 O  OH    . TYR A 1 363  ? 30.124  -10.252 -44.445 1.00 60.15  ? 777  TYR A OH    1 
ATOM   2560 N  N     . PHE A 1 364  ? 33.426  -4.022  -43.520 1.00 53.47  ? 778  PHE A N     1 
ATOM   2561 C  CA    . PHE A 1 364  ? 34.503  -4.002  -44.494 1.00 52.55  ? 778  PHE A CA    1 
ATOM   2562 C  C     . PHE A 1 364  ? 34.763  -5.408  -45.017 1.00 52.46  ? 778  PHE A C     1 
ATOM   2563 O  O     . PHE A 1 364  ? 35.281  -6.256  -44.280 1.00 52.56  ? 778  PHE A O     1 
ATOM   2564 C  CB    . PHE A 1 364  ? 35.764  -3.422  -43.856 1.00 52.07  ? 778  PHE A CB    1 
ATOM   2565 C  CG    . PHE A 1 364  ? 36.799  -3.016  -44.845 1.00 50.89  ? 778  PHE A CG    1 
ATOM   2566 C  CD1   . PHE A 1 364  ? 38.014  -2.488  -44.421 1.00 49.86  ? 778  PHE A CD1   1 
ATOM   2567 C  CD2   . PHE A 1 364  ? 36.565  -3.161  -46.207 1.00 46.90  ? 778  PHE A CD2   1 
ATOM   2568 C  CE1   . PHE A 1 364  ? 38.978  -2.101  -45.353 1.00 48.94  ? 778  PHE A CE1   1 
ATOM   2569 C  CE2   . PHE A 1 364  ? 37.516  -2.781  -47.132 1.00 47.27  ? 778  PHE A CE2   1 
ATOM   2570 C  CZ    . PHE A 1 364  ? 38.726  -2.248  -46.712 1.00 47.28  ? 778  PHE A CZ    1 
ATOM   2571 N  N     . ARG A 1 365  ? 34.422  -5.657  -46.280 1.00 52.04  ? 779  ARG A N     1 
ATOM   2572 C  CA    . ARG A 1 365  ? 34.472  -7.024  -46.804 1.00 52.25  ? 779  ARG A CA    1 
ATOM   2573 C  C     . ARG A 1 365  ? 35.792  -7.399  -47.444 1.00 52.67  ? 779  ARG A C     1 
ATOM   2574 O  O     . ARG A 1 365  ? 36.392  -6.631  -48.182 1.00 52.92  ? 779  ARG A O     1 
ATOM   2575 C  CB    . ARG A 1 365  ? 33.329  -7.296  -47.777 1.00 51.95  ? 779  ARG A CB    1 
ATOM   2576 C  CG    . ARG A 1 365  ? 31.973  -7.443  -47.121 1.00 51.29  ? 779  ARG A CG    1 
ATOM   2577 C  CD    . ARG A 1 365  ? 30.896  -7.456  -48.173 1.00 52.33  ? 779  ARG A CD    1 
ATOM   2578 N  NE    . ARG A 1 365  ? 29.777  -8.284  -47.751 1.00 52.31  ? 779  ARG A NE    1 
ATOM   2579 C  CZ    . ARG A 1 365  ? 28.629  -7.818  -47.274 1.00 52.22  ? 779  ARG A CZ    1 
ATOM   2580 N  NH1   . ARG A 1 365  ? 28.400  -6.512  -47.193 1.00 51.81  ? 779  ARG A NH1   1 
ATOM   2581 N  NH2   . ARG A 1 365  ? 27.687  -8.672  -46.899 1.00 52.15  ? 779  ARG A NH2   1 
ATOM   2582 N  N     . THR A 1 366  ? 36.231  -8.610  -47.154 1.00 53.44  ? 780  THR A N     1 
ATOM   2583 C  CA    . THR A 1 366  ? 37.495  -9.112  -47.658 1.00 54.10  ? 780  THR A CA    1 
ATOM   2584 C  C     . THR A 1 366  ? 37.372  -9.327  -49.181 1.00 54.33  ? 780  THR A C     1 
ATOM   2585 O  O     . THR A 1 366  ? 36.267  -9.261  -49.727 1.00 53.98  ? 780  THR A O     1 
ATOM   2586 C  CB    . THR A 1 366  ? 37.882  -10.405 -46.883 1.00 54.25  ? 780  THR A CB    1 
ATOM   2587 O  OG1   . THR A 1 366  ? 39.231  -10.304 -46.407 1.00 55.32  ? 780  THR A OG1   1 
ATOM   2588 C  CG2   . THR A 1 366  ? 37.696  -11.654 -47.721 1.00 53.50  ? 780  THR A CG2   1 
ATOM   2589 N  N     . THR A 1 367  ? 38.487  -9.543  -49.881 1.00 54.63  ? 781  THR A N     1 
ATOM   2590 C  CA    . THR A 1 367  ? 38.381  -9.753  -51.323 1.00 54.95  ? 781  THR A CA    1 
ATOM   2591 C  C     . THR A 1 367  ? 37.869  -11.150 -51.647 1.00 55.00  ? 781  THR A C     1 
ATOM   2592 O  O     . THR A 1 367  ? 36.953  -11.297 -52.453 1.00 54.91  ? 781  THR A O     1 
ATOM   2593 C  CB    . THR A 1 367  ? 39.661  -9.362  -52.124 1.00 55.10  ? 781  THR A CB    1 
ATOM   2594 O  OG1   . THR A 1 367  ? 39.694  -10.084 -53.365 1.00 55.73  ? 781  THR A OG1   1 
ATOM   2595 C  CG2   . THR A 1 367  ? 40.920  -9.653  -51.338 1.00 55.28  ? 781  THR A CG2   1 
ATOM   2596 N  N     . ASN A 1 368  ? 38.413  -12.173 -50.991 1.00 55.20  ? 782  ASN A N     1 
ATOM   2597 C  CA    . ASN A 1 368  ? 37.828  -13.520 -51.111 1.00 55.34  ? 782  ASN A CA    1 
ATOM   2598 C  C     . ASN A 1 368  ? 36.349  -13.605 -50.703 1.00 55.45  ? 782  ASN A C     1 
ATOM   2599 O  O     . ASN A 1 368  ? 35.589  -14.350 -51.308 1.00 55.28  ? 782  ASN A O     1 
ATOM   2600 C  CB    . ASN A 1 368  ? 38.669  -14.624 -50.428 1.00 55.15  ? 782  ASN A CB    1 
ATOM   2601 C  CG    . ASN A 1 368  ? 38.893  -14.375 -48.943 1.00 54.71  ? 782  ASN A CG    1 
ATOM   2602 O  OD1   . ASN A 1 368  ? 38.277  -15.019 -48.092 1.00 54.08  ? 782  ASN A OD1   1 
ATOM   2603 N  ND2   . ASN A 1 368  ? 39.791  -13.451 -48.629 1.00 53.70  ? 782  ASN A ND2   1 
ATOM   2604 N  N     . GLU A 1 369  ? 35.920  -12.844 -49.703 1.00 55.74  ? 783  GLU A N     1 
ATOM   2605 C  CA    . GLU A 1 369  ? 34.504  -12.910 -49.366 1.00 56.23  ? 783  GLU A CA    1 
ATOM   2606 C  C     . GLU A 1 369  ? 33.635  -12.064 -50.298 1.00 56.08  ? 783  GLU A C     1 
ATOM   2607 O  O     . GLU A 1 369  ? 32.434  -12.292 -50.417 1.00 55.80  ? 783  GLU A O     1 
ATOM   2608 C  CB    . GLU A 1 369  ? 34.234  -12.641 -47.877 1.00 56.30  ? 783  GLU A CB    1 
ATOM   2609 C  CG    . GLU A 1 369  ? 34.591  -11.277 -47.387 1.00 57.69  ? 783  GLU A CG    1 
ATOM   2610 C  CD    . GLU A 1 369  ? 34.554  -11.193 -45.868 1.00 59.45  ? 783  GLU A CD    1 
ATOM   2611 O  OE1   . GLU A 1 369  ? 34.337  -12.237 -45.201 1.00 60.82  ? 783  GLU A OE1   1 
ATOM   2612 O  OE2   . GLU A 1 369  ? 34.744  -10.080 -45.342 1.00 59.30  ? 783  GLU A OE2   1 
ATOM   2613 N  N     . MET A 1 370  ? 34.260  -11.118 -50.985 1.00 56.12  ? 784  MET A N     1 
ATOM   2614 C  CA    . MET A 1 370  ? 33.567  -10.276 -51.965 1.00 56.25  ? 784  MET A CA    1 
ATOM   2615 C  C     . MET A 1 370  ? 33.311  -11.085 -53.245 1.00 55.94  ? 784  MET A C     1 
ATOM   2616 O  O     . MET A 1 370  ? 32.278  -10.943 -53.903 1.00 55.64  ? 784  MET A O     1 
ATOM   2617 C  CB    . MET A 1 370  ? 34.410  -9.028  -52.263 1.00 56.69  ? 784  MET A CB    1 
ATOM   2618 C  CG    . MET A 1 370  ? 33.628  -7.779  -52.759 1.00 57.85  ? 784  MET A CG    1 
ATOM   2619 S  SD    . MET A 1 370  ? 32.243  -7.259  -51.711 1.00 60.47  ? 784  MET A SD    1 
ATOM   2620 C  CE    . MET A 1 370  ? 32.027  -5.533  -52.188 1.00 61.81  ? 784  MET A CE    1 
ATOM   2621 N  N     . LEU A 1 371  ? 34.269  -11.943 -53.579 1.00 55.60  ? 785  LEU A N     1 
ATOM   2622 C  CA    . LEU A 1 371  ? 34.103  -12.927 -54.637 1.00 55.02  ? 785  LEU A CA    1 
ATOM   2623 C  C     . LEU A 1 371  ? 32.921  -13.858 -54.339 1.00 54.92  ? 785  LEU A C     1 
ATOM   2624 O  O     . LEU A 1 371  ? 32.038  -14.019 -55.186 1.00 55.18  ? 785  LEU A O     1 
ATOM   2625 C  CB    . LEU A 1 371  ? 35.402  -13.725 -54.813 1.00 54.89  ? 785  LEU A CB    1 
ATOM   2626 C  CG    . LEU A 1 371  ? 36.592  -12.832 -55.191 1.00 54.71  ? 785  LEU A CG    1 
ATOM   2627 C  CD1   . LEU A 1 371  ? 37.905  -13.599 -55.344 1.00 53.82  ? 785  LEU A CD1   1 
ATOM   2628 C  CD2   . LEU A 1 371  ? 36.262  -12.073 -56.451 1.00 53.57  ? 785  LEU A CD2   1 
ATOM   2629 N  N     . ASP A 1 372  ? 32.917  -14.465 -53.144 1.00 54.46  ? 786  ASP A N     1 
ATOM   2630 C  CA    . ASP A 1 372  ? 31.818  -15.340 -52.666 1.00 53.92  ? 786  ASP A CA    1 
ATOM   2631 C  C     . ASP A 1 372  ? 30.429  -14.714 -52.875 1.00 54.08  ? 786  ASP A C     1 
ATOM   2632 O  O     . ASP A 1 372  ? 29.497  -15.402 -53.314 1.00 54.27  ? 786  ASP A O     1 
ATOM   2633 C  CB    . ASP A 1 372  ? 31.987  -15.745 -51.175 1.00 53.01  ? 786  ASP A CB    1 
ATOM   2634 C  CG    . ASP A 1 372  ? 33.284  -16.532 -50.896 1.00 51.91  ? 786  ASP A CG    1 
ATOM   2635 O  OD1   . ASP A 1 372  ? 34.001  -16.886 -51.863 1.00 50.15  ? 786  ASP A OD1   1 
ATOM   2636 O  OD2   . ASP A 1 372  ? 33.596  -16.790 -49.697 1.00 48.90  ? 786  ASP A OD2   1 
ATOM   2637 N  N     . CYS A 1 373  ? 30.309  -13.419 -52.564 1.00 54.10  ? 787  CYS A N     1 
ATOM   2638 C  CA    . CYS A 1 373  ? 29.064  -12.659 -52.707 1.00 54.05  ? 787  CYS A CA    1 
ATOM   2639 C  C     . CYS A 1 373  ? 28.668  -12.511 -54.166 1.00 54.06  ? 787  CYS A C     1 
ATOM   2640 O  O     . CYS A 1 373  ? 27.482  -12.411 -54.476 1.00 54.34  ? 787  CYS A O     1 
ATOM   2641 C  CB    . CYS A 1 373  ? 29.205  -11.247 -52.125 1.00 54.03  ? 787  CYS A CB    1 
ATOM   2642 S  SG    . CYS A 1 373  ? 29.969  -11.109 -50.494 1.00 54.15  ? 787  CYS A SG    1 
ATOM   2643 N  N     . PHE A 1 374  ? 29.668  -12.473 -55.046 1.00 53.78  ? 788  PHE A N     1 
ATOM   2644 C  CA    . PHE A 1 374  ? 29.450  -12.233 -56.474 1.00 53.92  ? 788  PHE A CA    1 
ATOM   2645 C  C     . PHE A 1 374  ? 29.713  -13.481 -57.342 1.00 54.19  ? 788  PHE A C     1 
ATOM   2646 O  O     . PHE A 1 374  ? 29.720  -13.414 -58.576 1.00 53.79  ? 788  PHE A O     1 
ATOM   2647 C  CB    . PHE A 1 374  ? 30.270  -11.022 -56.955 1.00 53.58  ? 788  PHE A CB    1 
ATOM   2648 C  CG    . PHE A 1 374  ? 29.693  -9.693  -56.530 1.00 52.47  ? 788  PHE A CG    1 
ATOM   2649 C  CD1   . PHE A 1 374  ? 28.647  -9.117  -57.242 1.00 51.76  ? 788  PHE A CD1   1 
ATOM   2650 C  CD2   . PHE A 1 374  ? 30.186  -9.031  -55.422 1.00 50.71  ? 788  PHE A CD2   1 
ATOM   2651 C  CE1   . PHE A 1 374  ? 28.099  -7.921  -56.856 1.00 50.17  ? 788  PHE A CE1   1 
ATOM   2652 C  CE2   . PHE A 1 374  ? 29.639  -7.816  -55.027 1.00 50.00  ? 788  PHE A CE2   1 
ATOM   2653 C  CZ    . PHE A 1 374  ? 28.599  -7.251  -55.755 1.00 50.76  ? 788  PHE A CZ    1 
ATOM   2654 N  N     . SER A 1 375  ? 29.907  -14.614 -56.662 1.00 54.54  ? 789  SER A N     1 
ATOM   2655 C  CA    . SER A 1 375  ? 30.077  -15.932 -57.278 1.00 54.69  ? 789  SER A CA    1 
ATOM   2656 C  C     . SER A 1 375  ? 29.086  -16.223 -58.406 1.00 54.74  ? 789  SER A C     1 
ATOM   2657 O  O     . SER A 1 375  ? 29.451  -16.835 -59.420 1.00 54.55  ? 789  SER A O     1 
ATOM   2658 C  CB    . SER A 1 375  ? 29.924  -17.010 -56.212 1.00 54.81  ? 789  SER A CB    1 
ATOM   2659 O  OG    . SER A 1 375  ? 28.592  -17.020 -55.728 1.00 55.19  ? 789  SER A OG    1 
ATOM   2660 N  N     . PHE A 1 376  ? 27.841  -15.782 -58.225 1.00 54.77  ? 790  PHE A N     1 
ATOM   2661 C  CA    . PHE A 1 376  ? 26.780  -16.107 -59.171 1.00 54.75  ? 790  PHE A CA    1 
ATOM   2662 C  C     . PHE A 1 376  ? 27.018  -15.628 -60.619 1.00 54.84  ? 790  PHE A C     1 
ATOM   2663 O  O     . PHE A 1 376  ? 26.556  -16.260 -61.562 1.00 55.05  ? 790  PHE A O     1 
ATOM   2664 C  CB    . PHE A 1 376  ? 25.411  -15.658 -58.633 1.00 54.71  ? 790  PHE A CB    1 
ATOM   2665 C  CG    . PHE A 1 376  ? 25.166  -14.195 -58.732 1.00 55.84  ? 790  PHE A CG    1 
ATOM   2666 C  CD1   . PHE A 1 376  ? 25.550  -13.348 -57.703 1.00 56.86  ? 790  PHE A CD1   1 
ATOM   2667 C  CD2   . PHE A 1 376  ? 24.547  -13.655 -59.858 1.00 57.08  ? 790  PHE A CD2   1 
ATOM   2668 C  CE1   . PHE A 1 376  ? 25.308  -11.977 -57.786 1.00 57.54  ? 790  PHE A CE1   1 
ATOM   2669 C  CE2   . PHE A 1 376  ? 24.328  -12.296 -59.962 1.00 58.10  ? 790  PHE A CE2   1 
ATOM   2670 C  CZ    . PHE A 1 376  ? 24.724  -11.446 -58.935 1.00 57.08  ? 790  PHE A CZ    1 
ATOM   2671 N  N     . LEU A 1 377  ? 27.739  -14.521 -60.793 1.00 55.13  ? 791  LEU A N     1 
ATOM   2672 C  CA    . LEU A 1 377  ? 28.044  -13.983 -62.135 1.00 55.26  ? 791  LEU A CA    1 
ATOM   2673 C  C     . LEU A 1 377  ? 29.171  -14.792 -62.796 1.00 55.58  ? 791  LEU A C     1 
ATOM   2674 O  O     . LEU A 1 377  ? 29.618  -14.492 -63.917 1.00 54.89  ? 791  LEU A O     1 
ATOM   2675 C  CB    . LEU A 1 377  ? 28.453  -12.502 -62.043 1.00 54.93  ? 791  LEU A CB    1 
ATOM   2676 C  CG    . LEU A 1 377  ? 27.521  -11.428 -61.455 1.00 54.10  ? 791  LEU A CG    1 
ATOM   2677 C  CD1   . LEU A 1 377  ? 28.348  -10.241 -60.953 1.00 52.99  ? 791  LEU A CD1   1 
ATOM   2678 C  CD2   . LEU A 1 377  ? 26.472  -10.967 -62.471 1.00 52.34  ? 791  LEU A CD2   1 
ATOM   2679 N  N     . GLY A 1 378  ? 29.611  -15.828 -62.080 1.00 56.07  ? 792  GLY A N     1 
ATOM   2680 C  CA    . GLY A 1 378  ? 30.689  -16.691 -62.531 1.00 56.61  ? 792  GLY A CA    1 
ATOM   2681 C  C     . GLY A 1 378  ? 32.071  -16.143 -62.218 1.00 57.25  ? 792  GLY A C     1 
ATOM   2682 O  O     . GLY A 1 378  ? 32.246  -14.937 -62.010 1.00 56.52  ? 792  GLY A O     1 
ATOM   2683 N  N     . PRO A 1 379  ? 33.070  -17.043 -62.226 1.00 57.63  ? 793  PRO A N     1 
ATOM   2684 C  CA    . PRO A 1 379  ? 34.474  -16.845 -61.863 1.00 57.65  ? 793  PRO A CA    1 
ATOM   2685 C  C     . PRO A 1 379  ? 35.178  -15.693 -62.602 1.00 57.71  ? 793  PRO A C     1 
ATOM   2686 O  O     . PRO A 1 379  ? 36.024  -15.023 -62.006 1.00 57.73  ? 793  PRO A O     1 
ATOM   2687 C  CB    . PRO A 1 379  ? 35.128  -18.190 -62.224 1.00 57.79  ? 793  PRO A CB    1 
ATOM   2688 C  CG    . PRO A 1 379  ? 34.012  -19.169 -62.302 1.00 57.67  ? 793  PRO A CG    1 
ATOM   2689 C  CD    . PRO A 1 379  ? 32.826  -18.391 -62.771 1.00 57.59  ? 793  PRO A CD    1 
ATOM   2690 N  N     . GLU A 1 380  ? 34.845  -15.456 -63.869 1.00 57.52  ? 794  GLU A N     1 
ATOM   2691 C  CA    . GLU A 1 380  ? 35.485  -14.370 -64.612 1.00 57.54  ? 794  GLU A CA    1 
ATOM   2692 C  C     . GLU A 1 380  ? 34.937  -12.977 -64.253 1.00 57.45  ? 794  GLU A C     1 
ATOM   2693 O  O     . GLU A 1 380  ? 35.719  -12.041 -64.007 1.00 57.11  ? 794  GLU A O     1 
ATOM   2694 C  CB    . GLU A 1 380  ? 35.427  -14.621 -66.125 1.00 57.88  ? 794  GLU A CB    1 
ATOM   2695 C  CG    . GLU A 1 380  ? 36.425  -15.666 -66.636 1.00 58.61  ? 794  GLU A CG    1 
ATOM   2696 C  CD    . GLU A 1 380  ? 35.872  -17.096 -66.656 1.00 59.94  ? 794  GLU A CD    1 
ATOM   2697 O  OE1   . GLU A 1 380  ? 34.956  -17.417 -65.864 1.00 60.55  ? 794  GLU A OE1   1 
ATOM   2698 O  OE2   . GLU A 1 380  ? 36.366  -17.909 -67.470 1.00 60.38  ? 794  GLU A OE2   1 
ATOM   2699 N  N     . LYS A 1 381  ? 33.609  -12.833 -64.221 1.00 57.12  ? 795  LYS A N     1 
ATOM   2700 C  CA    . LYS A 1 381  ? 32.995  -11.551 -63.833 1.00 57.15  ? 795  LYS A CA    1 
ATOM   2701 C  C     . LYS A 1 381  ? 33.227  -11.210 -62.354 1.00 57.00  ? 795  LYS A C     1 
ATOM   2702 O  O     . LYS A 1 381  ? 33.521  -10.064 -62.009 1.00 56.79  ? 795  LYS A O     1 
ATOM   2703 C  CB    . LYS A 1 381  ? 31.500  -11.518 -64.162 1.00 56.84  ? 795  LYS A CB    1 
ATOM   2704 C  CG    . LYS A 1 381  ? 31.169  -10.731 -65.424 1.00 58.46  ? 795  LYS A CG    1 
ATOM   2705 C  CD    . LYS A 1 381  ? 31.178  -9.215  -65.178 1.00 57.98  ? 795  LYS A CD    1 
ATOM   2706 C  CE    . LYS A 1 381  ? 30.887  -8.426  -66.465 1.00 58.17  ? 795  LYS A CE    1 
ATOM   2707 N  NZ    . LYS A 1 381  ? 32.099  -8.276  -67.343 1.00 56.43  ? 795  LYS A NZ    1 
ATOM   2708 N  N     . ALA A 1 382  ? 33.086  -12.205 -61.484 1.00 56.73  ? 796  ALA A N     1 
ATOM   2709 C  CA    . ALA A 1 382  ? 33.444  -12.009 -60.102 1.00 56.69  ? 796  ALA A CA    1 
ATOM   2710 C  C     . ALA A 1 382  ? 34.797  -11.321 -60.102 1.00 56.67  ? 796  ALA A C     1 
ATOM   2711 O  O     . ALA A 1 382  ? 34.912  -10.162 -59.723 1.00 56.74  ? 796  ALA A O     1 
ATOM   2712 C  CB    . ALA A 1 382  ? 33.529  -13.338 -59.364 1.00 56.53  ? 796  ALA A CB    1 
ATOM   2713 N  N     . LYS A 1 383  ? 35.815  -12.050 -60.545 1.00 56.79  ? 797  LYS A N     1 
ATOM   2714 C  CA    . LYS A 1 383  ? 37.186  -11.563 -60.517 1.00 57.19  ? 797  LYS A CA    1 
ATOM   2715 C  C     . LYS A 1 383  ? 37.374  -10.190 -61.184 1.00 57.05  ? 797  LYS A C     1 
ATOM   2716 O  O     . LYS A 1 383  ? 38.102  -9.353  -60.660 1.00 57.11  ? 797  LYS A O     1 
ATOM   2717 C  CB    . LYS A 1 383  ? 38.136  -12.603 -61.120 1.00 57.36  ? 797  LYS A CB    1 
ATOM   2718 C  CG    . LYS A 1 383  ? 39.595  -12.194 -61.086 1.00 58.60  ? 797  LYS A CG    1 
ATOM   2719 C  CD    . LYS A 1 383  ? 40.456  -13.106 -61.971 1.00 61.22  ? 797  LYS A CD    1 
ATOM   2720 C  CE    . LYS A 1 383  ? 41.741  -12.395 -62.449 1.00 62.35  ? 797  LYS A CE    1 
ATOM   2721 N  NZ    . LYS A 1 383  ? 42.487  -11.710 -61.331 1.00 61.97  ? 797  LYS A NZ    1 
ATOM   2722 N  N     . GLU A 1 384  ? 36.717  -9.963  -62.325 1.00 56.92  ? 798  GLU A N     1 
ATOM   2723 C  CA    . GLU A 1 384  ? 36.826  -8.694  -63.054 1.00 56.52  ? 798  GLU A CA    1 
ATOM   2724 C  C     . GLU A 1 384  ? 36.351  -7.507  -62.212 1.00 56.43  ? 798  GLU A C     1 
ATOM   2725 O  O     . GLU A 1 384  ? 37.083  -6.514  -62.033 1.00 56.82  ? 798  GLU A O     1 
ATOM   2726 C  CB    . GLU A 1 384  ? 36.062  -8.760  -64.395 1.00 56.52  ? 798  GLU A CB    1 
ATOM   2727 C  CG    . GLU A 1 384  ? 36.126  -7.495  -65.266 1.00 56.63  ? 798  GLU A CG    1 
ATOM   2728 C  CD    . GLU A 1 384  ? 35.197  -7.558  -66.496 1.00 57.42  ? 798  GLU A CD    1 
ATOM   2729 O  OE1   . GLU A 1 384  ? 34.941  -6.505  -67.121 1.00 56.00  ? 798  GLU A OE1   1 
ATOM   2730 O  OE2   . GLU A 1 384  ? 34.723  -8.665  -66.842 1.00 58.82  ? 798  GLU A OE2   1 
ATOM   2731 N  N     . ILE A 1 385  ? 35.140  -7.596  -61.676 1.00 55.75  ? 799  ILE A N     1 
ATOM   2732 C  CA    . ILE A 1 385  ? 34.542  -6.424  -61.047 1.00 55.50  ? 799  ILE A CA    1 
ATOM   2733 C  C     . ILE A 1 385  ? 34.913  -6.238  -59.583 1.00 55.51  ? 799  ILE A C     1 
ATOM   2734 O  O     . ILE A 1 385  ? 34.580  -5.222  -58.974 1.00 55.72  ? 799  ILE A O     1 
ATOM   2735 C  CB    . ILE A 1 385  ? 33.036  -6.470  -61.153 1.00 55.50  ? 799  ILE A CB    1 
ATOM   2736 C  CG1   . ILE A 1 385  ? 32.476  -7.471  -60.136 1.00 55.49  ? 799  ILE A CG1   1 
ATOM   2737 C  CG2   . ILE A 1 385  ? 32.650  -6.807  -62.596 1.00 55.20  ? 799  ILE A CG2   1 
ATOM   2738 C  CD1   . ILE A 1 385  ? 31.038  -7.211  -59.730 1.00 55.38  ? 799  ILE A CD1   1 
ATOM   2739 N  N     . VAL A 1 386  ? 35.587  -7.222  -59.006 1.00 55.23  ? 800  VAL A N     1 
ATOM   2740 C  CA    . VAL A 1 386  ? 35.942  -7.135  -57.610 1.00 54.60  ? 800  VAL A CA    1 
ATOM   2741 C  C     . VAL A 1 386  ? 37.399  -6.775  -57.484 1.00 54.29  ? 800  VAL A C     1 
ATOM   2742 O  O     . VAL A 1 386  ? 37.777  -6.071  -56.553 1.00 54.51  ? 800  VAL A O     1 
ATOM   2743 C  CB    . VAL A 1 386  ? 35.683  -8.450  -56.877 1.00 54.83  ? 800  VAL A CB    1 
ATOM   2744 C  CG1   . VAL A 1 386  ? 36.278  -8.407  -55.474 1.00 54.25  ? 800  VAL A CG1   1 
ATOM   2745 C  CG2   . VAL A 1 386  ? 34.188  -8.754  -56.821 1.00 55.15  ? 800  VAL A CG2   1 
ATOM   2746 N  N     . VAL A 1 387  ? 38.223  -7.230  -58.421 1.00 53.68  ? 801  VAL A N     1 
ATOM   2747 C  CA    . VAL A 1 387  ? 39.650  -6.930  -58.313 1.00 53.62  ? 801  VAL A CA    1 
ATOM   2748 C  C     . VAL A 1 387  ? 40.311  -6.211  -59.505 1.00 53.55  ? 801  VAL A C     1 
ATOM   2749 O  O     . VAL A 1 387  ? 41.020  -5.227  -59.305 1.00 52.99  ? 801  VAL A O     1 
ATOM   2750 C  CB    . VAL A 1 387  ? 40.477  -8.136  -57.789 1.00 53.41  ? 801  VAL A CB    1 
ATOM   2751 C  CG1   . VAL A 1 387  ? 39.671  -9.406  -57.860 1.00 53.70  ? 801  VAL A CG1   1 
ATOM   2752 C  CG2   . VAL A 1 387  ? 41.787  -8.271  -58.540 1.00 53.65  ? 801  VAL A CG2   1 
ATOM   2753 N  N     . ASP A 1 388  ? 40.071  -6.664  -60.731 1.00 53.42  ? 802  ASP A N     1 
ATOM   2754 C  CA    . ASP A 1 388  ? 40.700  -6.008  -61.871 1.00 53.43  ? 802  ASP A CA    1 
ATOM   2755 C  C     . ASP A 1 388  ? 40.223  -4.562  -62.025 1.00 53.36  ? 802  ASP A C     1 
ATOM   2756 O  O     . ASP A 1 388  ? 41.041  -3.644  -62.186 1.00 53.30  ? 802  ASP A O     1 
ATOM   2757 C  CB    . ASP A 1 388  ? 40.448  -6.793  -63.155 1.00 53.70  ? 802  ASP A CB    1 
ATOM   2758 C  CG    . ASP A 1 388  ? 40.736  -8.268  -62.993 1.00 54.96  ? 802  ASP A CG    1 
ATOM   2759 O  OD1   . ASP A 1 388  ? 40.078  -9.086  -63.666 1.00 55.34  ? 802  ASP A OD1   1 
ATOM   2760 O  OD2   . ASP A 1 388  ? 41.611  -8.612  -62.170 1.00 57.42  ? 802  ASP A OD2   1 
ATOM   2761 N  N     . ASN A 1 389  ? 38.905  -4.360  -61.971 1.00 53.01  ? 803  ASN A N     1 
ATOM   2762 C  CA    . ASN A 1 389  ? 38.318  -3.038  -62.207 1.00 52.52  ? 803  ASN A CA    1 
ATOM   2763 C  C     . ASN A 1 389  ? 38.455  -2.115  -60.990 1.00 52.45  ? 803  ASN A C     1 
ATOM   2764 O  O     . ASN A 1 389  ? 38.712  -0.916  -61.110 1.00 52.36  ? 803  ASN A O     1 
ATOM   2765 C  CB    . ASN A 1 389  ? 36.854  -3.171  -62.643 1.00 52.08  ? 803  ASN A CB    1 
ATOM   2766 C  CG    . ASN A 1 389  ? 36.721  -3.750  -64.041 1.00 51.64  ? 803  ASN A CG    1 
ATOM   2767 O  OD1   . ASN A 1 389  ? 35.678  -4.291  -64.411 1.00 51.16  ? 803  ASN A OD1   1 
ATOM   2768 N  ND2   . ASN A 1 389  ? 37.794  -3.670  -64.811 1.00 49.04  ? 803  ASN A ND2   1 
ATOM   2769 N  N     . THR A 1 390  ? 38.291  -2.702  -59.818 1.00 52.24  ? 804  THR A N     1 
ATOM   2770 C  CA    . THR A 1 390  ? 38.472  -2.007  -58.557 1.00 52.24  ? 804  THR A CA    1 
ATOM   2771 C  C     . THR A 1 390  ? 39.925  -1.507  -58.479 1.00 52.73  ? 804  THR A C     1 
ATOM   2772 O  O     . THR A 1 390  ? 40.184  -0.335  -58.194 1.00 52.81  ? 804  THR A O     1 
ATOM   2773 C  CB    . THR A 1 390  ? 38.108  -2.985  -57.419 1.00 52.00  ? 804  THR A CB    1 
ATOM   2774 O  OG1   . THR A 1 390  ? 37.113  -2.410  -56.578 1.00 50.85  ? 804  THR A OG1   1 
ATOM   2775 C  CG2   . THR A 1 390  ? 39.318  -3.446  -56.635 1.00 51.16  ? 804  THR A CG2   1 
ATOM   2776 N  N     . GLN A 1 391  ? 40.856  -2.403  -58.808 1.00 53.19  ? 805  GLN A N     1 
ATOM   2777 C  CA    . GLN A 1 391  ? 42.288  -2.117  -58.928 1.00 53.39  ? 805  GLN A CA    1 
ATOM   2778 C  C     . GLN A 1 391  ? 42.594  -1.097  -60.016 1.00 53.32  ? 805  GLN A C     1 
ATOM   2779 O  O     . GLN A 1 391  ? 43.480  -0.255  -59.864 1.00 53.54  ? 805  GLN A O     1 
ATOM   2780 C  CB    . GLN A 1 391  ? 43.030  -3.413  -59.267 1.00 53.59  ? 805  GLN A CB    1 
ATOM   2781 C  CG    . GLN A 1 391  ? 44.265  -3.669  -58.427 1.00 54.31  ? 805  GLN A CG    1 
ATOM   2782 C  CD    . GLN A 1 391  ? 44.739  -5.102  -58.525 1.00 53.08  ? 805  GLN A CD    1 
ATOM   2783 O  OE1   . GLN A 1 391  ? 44.613  -5.880  -57.583 1.00 52.07  ? 805  GLN A OE1   1 
ATOM   2784 N  NE2   . GLN A 1 391  ? 45.289  -5.456  -59.671 1.00 53.64  ? 805  GLN A NE2   1 
ATOM   2785 N  N     . LYS A 1 392  ? 41.875  -1.187  -61.126 1.00 53.21  ? 806  LYS A N     1 
ATOM   2786 C  CA    . LYS A 1 392  ? 42.114  -0.285  -62.241 1.00 53.39  ? 806  LYS A CA    1 
ATOM   2787 C  C     . LYS A 1 392  ? 41.739  1.160   -61.892 1.00 52.79  ? 806  LYS A C     1 
ATOM   2788 O  O     . LYS A 1 392  ? 42.499  2.096   -62.171 1.00 52.76  ? 806  LYS A O     1 
ATOM   2789 C  CB    . LYS A 1 392  ? 41.384  -0.759  -63.505 1.00 53.65  ? 806  LYS A CB    1 
ATOM   2790 C  CG    . LYS A 1 392  ? 41.259  0.308   -64.620 1.00 55.90  ? 806  LYS A CG    1 
ATOM   2791 C  CD    . LYS A 1 392  ? 42.605  0.718   -65.306 1.00 58.98  ? 806  LYS A CD    1 
ATOM   2792 C  CE    . LYS A 1 392  ? 43.179  -0.333  -66.313 1.00 60.98  ? 806  LYS A CE    1 
ATOM   2793 N  NZ    . LYS A 1 392  ? 42.205  -1.012  -67.252 1.00 61.11  ? 806  LYS A NZ    1 
ATOM   2794 N  N     . ILE A 1 393  ? 40.569  1.337   -61.283 1.00 51.96  ? 807  ILE A N     1 
ATOM   2795 C  CA    . ILE A 1 393  ? 40.144  2.655   -60.823 1.00 51.02  ? 807  ILE A CA    1 
ATOM   2796 C  C     . ILE A 1 393  ? 41.194  3.262   -59.879 1.00 50.96  ? 807  ILE A C     1 
ATOM   2797 O  O     . ILE A 1 393  ? 41.562  4.436   -60.013 1.00 51.17  ? 807  ILE A O     1 
ATOM   2798 C  CB    . ILE A 1 393  ? 38.754  2.584   -60.135 1.00 50.78  ? 807  ILE A CB    1 
ATOM   2799 C  CG1   . ILE A 1 393  ? 37.655  2.286   -61.170 1.00 48.98  ? 807  ILE A CG1   1 
ATOM   2800 C  CG2   . ILE A 1 393  ? 38.465  3.856   -59.366 1.00 50.13  ? 807  ILE A CG2   1 
ATOM   2801 C  CD1   . ILE A 1 393  ? 37.480  3.336   -62.258 1.00 45.77  ? 807  ILE A CD1   1 
ATOM   2802 N  N     . ALA A 1 394  ? 41.692  2.451   -58.946 1.00 50.39  ? 808  ALA A N     1 
ATOM   2803 C  CA    . ALA A 1 394  ? 42.756  2.878   -58.027 1.00 50.02  ? 808  ALA A CA    1 
ATOM   2804 C  C     . ALA A 1 394  ? 44.012  3.365   -58.764 1.00 49.75  ? 808  ALA A C     1 
ATOM   2805 O  O     . ALA A 1 394  ? 44.723  4.250   -58.279 1.00 49.69  ? 808  ALA A O     1 
ATOM   2806 C  CB    . ALA A 1 394  ? 43.119  1.736   -57.061 1.00 49.73  ? 808  ALA A CB    1 
ATOM   2807 N  N     . SER A 1 395  ? 44.288  2.757   -59.916 1.00 49.26  ? 809  SER A N     1 
ATOM   2808 C  CA    . SER A 1 395  ? 45.440  3.107   -60.730 1.00 49.16  ? 809  SER A CA    1 
ATOM   2809 C  C     . SER A 1 395  ? 45.262  4.457   -61.402 1.00 48.65  ? 809  SER A C     1 
ATOM   2810 O  O     . SER A 1 395  ? 46.229  5.060   -61.856 1.00 48.14  ? 809  SER A O     1 
ATOM   2811 C  CB    . SER A 1 395  ? 45.663  2.050   -61.818 1.00 49.81  ? 809  SER A CB    1 
ATOM   2812 O  OG    . SER A 1 395  ? 46.466  0.976   -61.350 1.00 51.05  ? 809  SER A OG    1 
ATOM   2813 N  N     . LEU A 1 396  ? 44.020  4.920   -61.495 1.00 48.03  ? 810  LEU A N     1 
ATOM   2814 C  CA    . LEU A 1 396  ? 43.760  6.199   -62.138 1.00 47.66  ? 810  LEU A CA    1 
ATOM   2815 C  C     . LEU A 1 396  ? 43.957  7.357   -61.144 1.00 47.43  ? 810  LEU A C     1 
ATOM   2816 O  O     . LEU A 1 396  ? 43.944  8.532   -61.527 1.00 46.48  ? 810  LEU A O     1 
ATOM   2817 C  CB    . LEU A 1 396  ? 42.360  6.199   -62.737 1.00 47.58  ? 810  LEU A CB    1 
ATOM   2818 C  CG    . LEU A 1 396  ? 42.289  5.270   -63.948 1.00 47.90  ? 810  LEU A CG    1 
ATOM   2819 C  CD1   . LEU A 1 396  ? 40.846  5.044   -64.374 1.00 48.58  ? 810  LEU A CD1   1 
ATOM   2820 C  CD2   . LEU A 1 396  ? 43.118  5.823   -65.101 1.00 45.37  ? 810  LEU A CD2   1 
ATOM   2821 N  N     . ILE A 1 397  ? 44.169  6.990   -59.877 1.00 47.29  ? 811  ILE A N     1 
ATOM   2822 C  CA    . ILE A 1 397  ? 44.371  7.937   -58.791 1.00 47.21  ? 811  ILE A CA    1 
ATOM   2823 C  C     . ILE A 1 397  ? 45.846  8.178   -58.505 1.00 47.87  ? 811  ILE A C     1 
ATOM   2824 O  O     . ILE A 1 397  ? 46.615  7.232   -58.360 1.00 47.98  ? 811  ILE A O     1 
ATOM   2825 C  CB    . ILE A 1 397  ? 43.736  7.415   -57.518 1.00 47.14  ? 811  ILE A CB    1 
ATOM   2826 C  CG1   . ILE A 1 397  ? 42.265  7.059   -57.767 1.00 45.12  ? 811  ILE A CG1   1 
ATOM   2827 C  CG2   . ILE A 1 397  ? 43.920  8.431   -56.368 1.00 47.48  ? 811  ILE A CG2   1 
ATOM   2828 C  CD1   . ILE A 1 397  ? 41.380  8.240   -58.085 1.00 42.03  ? 811  ILE A CD1   1 
ATOM   2829 N  N     . GLY A 1 398  ? 46.244  9.448   -58.430 1.00 48.56  ? 812  GLY A N     1 
ATOM   2830 C  CA    . GLY A 1 398  ? 47.631  9.799   -58.142 1.00 49.21  ? 812  GLY A CA    1 
ATOM   2831 C  C     . GLY A 1 398  ? 47.917  9.786   -56.647 1.00 50.21  ? 812  GLY A C     1 
ATOM   2832 O  O     . GLY A 1 398  ? 47.236  9.115   -55.860 1.00 49.83  ? 812  GLY A O     1 
ATOM   2833 N  N     . ASP A 1 399  ? 48.942  10.528  -56.254 1.00 51.10  ? 813  ASP A N     1 
ATOM   2834 C  CA    . ASP A 1 399  ? 49.347  10.605  -54.853 1.00 52.08  ? 813  ASP A CA    1 
ATOM   2835 C  C     . ASP A 1 399  ? 48.971  11.989  -54.318 1.00 51.63  ? 813  ASP A C     1 
ATOM   2836 O  O     . ASP A 1 399  ? 49.763  12.926  -54.407 1.00 51.77  ? 813  ASP A O     1 
ATOM   2837 C  CB    . ASP A 1 399  ? 50.866  10.323  -54.743 1.00 52.83  ? 813  ASP A CB    1 
ATOM   2838 C  CG    . ASP A 1 399  ? 51.486  10.813  -53.421 1.00 55.43  ? 813  ASP A CG    1 
ATOM   2839 O  OD1   . ASP A 1 399  ? 50.724  11.123  -52.475 1.00 56.98  ? 813  ASP A OD1   1 
ATOM   2840 O  OD2   . ASP A 1 399  ? 52.737  10.899  -53.343 1.00 57.28  ? 813  ASP A OD2   1 
ATOM   2841 N  N     . VAL A 1 400  ? 47.764  12.131  -53.775 1.00 51.25  ? 814  VAL A N     1 
ATOM   2842 C  CA    . VAL A 1 400  ? 47.318  13.465  -53.355 1.00 51.36  ? 814  VAL A CA    1 
ATOM   2843 C  C     . VAL A 1 400  ? 47.575  13.796  -51.883 1.00 51.33  ? 814  VAL A C     1 
ATOM   2844 O  O     . VAL A 1 400  ? 47.356  12.956  -51.015 1.00 51.78  ? 814  VAL A O     1 
ATOM   2845 C  CB    . VAL A 1 400  ? 45.858  13.791  -53.794 1.00 51.54  ? 814  VAL A CB    1 
ATOM   2846 C  CG1   . VAL A 1 400  ? 45.273  12.680  -54.646 1.00 50.81  ? 814  VAL A CG1   1 
ATOM   2847 C  CG2   . VAL A 1 400  ? 44.984  14.149  -52.601 1.00 50.67  ? 814  VAL A CG2   1 
ATOM   2848 N  N     . LYS A 1 401  ? 48.098  14.996  -51.613 1.00 50.89  ? 815  LYS A N     1 
ATOM   2849 C  CA    . LYS A 1 401  ? 48.358  15.418  -50.217 1.00 50.62  ? 815  LYS A CA    1 
ATOM   2850 C  C     . LYS A 1 401  ? 47.351  16.465  -49.732 1.00 49.90  ? 815  LYS A C     1 
ATOM   2851 O  O     . LYS A 1 401  ? 47.456  17.652  -50.054 1.00 49.37  ? 815  LYS A O     1 
ATOM   2852 C  CB    . LYS A 1 401  ? 49.792  15.906  -50.030 1.00 50.15  ? 815  LYS A CB    1 
ATOM   2853 C  CG    . LYS A 1 401  ? 50.841  14.887  -50.456 1.00 52.55  ? 815  LYS A CG    1 
ATOM   2854 C  CD    . LYS A 1 401  ? 52.244  15.519  -50.446 1.00 56.51  ? 815  LYS A CD    1 
ATOM   2855 C  CE    . LYS A 1 401  ? 53.359  14.515  -50.067 1.00 58.10  ? 815  LYS A CE    1 
ATOM   2856 N  NZ    . LYS A 1 401  ? 53.418  13.322  -50.966 1.00 58.60  ? 815  LYS A NZ    1 
ATOM   2857 N  N     . PRO A 1 402  ? 46.372  16.020  -48.938 1.00 49.17  ? 816  PRO A N     1 
ATOM   2858 C  CA    . PRO A 1 402  ? 45.223  16.842  -48.617 1.00 49.19  ? 816  PRO A CA    1 
ATOM   2859 C  C     . PRO A 1 402  ? 45.521  17.998  -47.654 1.00 48.55  ? 816  PRO A C     1 
ATOM   2860 O  O     . PRO A 1 402  ? 44.717  18.895  -47.545 1.00 48.73  ? 816  PRO A O     1 
ATOM   2861 C  CB    . PRO A 1 402  ? 44.249  15.833  -47.977 1.00 49.40  ? 816  PRO A CB    1 
ATOM   2862 C  CG    . PRO A 1 402  ? 45.147  14.863  -47.292 1.00 49.43  ? 816  PRO A CG    1 
ATOM   2863 C  CD    . PRO A 1 402  ? 46.370  14.749  -48.202 1.00 49.33  ? 816  PRO A CD    1 
ATOM   2864 N  N     . ILE A 1 403  ? 46.656  17.957  -46.967 1.00 48.14  ? 817  ILE A N     1 
ATOM   2865 C  CA    . ILE A 1 403  ? 47.052  18.967  -45.998 1.00 47.75  ? 817  ILE A CA    1 
ATOM   2866 C  C     . ILE A 1 403  ? 48.486  19.367  -46.321 1.00 48.65  ? 817  ILE A C     1 
ATOM   2867 O  O     . ILE A 1 403  ? 49.340  18.507  -46.564 1.00 48.85  ? 817  ILE A O     1 
ATOM   2868 C  CB    . ILE A 1 403  ? 47.100  18.379  -44.587 1.00 48.00  ? 817  ILE A CB    1 
ATOM   2869 C  CG1   . ILE A 1 403  ? 45.711  17.931  -44.104 1.00 46.65  ? 817  ILE A CG1   1 
ATOM   2870 C  CG2   . ILE A 1 403  ? 47.781  19.354  -43.610 1.00 46.12  ? 817  ILE A CG2   1 
ATOM   2871 C  CD1   . ILE A 1 403  ? 44.979  18.983  -43.342 1.00 45.60  ? 817  ILE A CD1   1 
ATOM   2872 N  N     . LYS A 1 404  ? 48.781  20.655  -46.335 1.00 48.69  ? 818  LYS A N     1 
ATOM   2873 C  CA    . LYS A 1 404  ? 50.125  21.052  -46.738 1.00 48.80  ? 818  LYS A CA    1 
ATOM   2874 C  C     . LYS A 1 404  ? 51.148  20.963  -45.628 1.00 48.71  ? 818  LYS A C     1 
ATOM   2875 O  O     . LYS A 1 404  ? 50.819  20.869  -44.448 1.00 48.81  ? 818  LYS A O     1 
ATOM   2876 C  CB    . LYS A 1 404  ? 50.099  22.456  -47.310 1.00 48.83  ? 818  LYS A CB    1 
ATOM   2877 C  CG    . LYS A 1 404  ? 49.045  22.589  -48.381 1.00 48.40  ? 818  LYS A CG    1 
ATOM   2878 C  CD    . LYS A 1 404  ? 49.128  23.925  -49.036 1.00 48.02  ? 818  LYS A CD    1 
ATOM   2879 C  CE    . LYS A 1 404  ? 48.325  23.911  -50.305 1.00 48.92  ? 818  LYS A CE    1 
ATOM   2880 N  NZ    . LYS A 1 404  ? 48.790  22.827  -51.165 1.00 46.73  ? 818  LYS A NZ    1 
ATOM   2881 N  N     . ASP A 1 405  ? 52.402  21.036  -46.034 1.00 48.51  ? 819  ASP A N     1 
ATOM   2882 C  CA    . ASP A 1 405  ? 53.519  20.991  -45.120 1.00 48.72  ? 819  ASP A CA    1 
ATOM   2883 C  C     . ASP A 1 405  ? 53.905  22.341  -44.571 1.00 47.71  ? 819  ASP A C     1 
ATOM   2884 O  O     . ASP A 1 405  ? 54.351  22.460  -43.443 1.00 48.20  ? 819  ASP A O     1 
ATOM   2885 C  CB    . ASP A 1 405  ? 54.727  20.392  -45.833 1.00 49.36  ? 819  ASP A CB    1 
ATOM   2886 C  CG    . ASP A 1 405  ? 54.556  18.919  -46.067 1.00 52.70  ? 819  ASP A CG    1 
ATOM   2887 O  OD1   . ASP A 1 405  ? 54.534  18.488  -47.247 1.00 54.26  ? 819  ASP A OD1   1 
ATOM   2888 O  OD2   . ASP A 1 405  ? 54.391  18.197  -45.047 1.00 56.07  ? 819  ASP A OD2   1 
ATOM   2889 N  N     . GLU A 1 406  ? 53.775  23.397  -45.334 1.00 46.51  ? 820  GLU A N     1 
ATOM   2890 C  CA    . GLU A 1 406  ? 54.391  24.576  -44.777 1.00 45.19  ? 820  GLU A CA    1 
ATOM   2891 C  C     . GLU A 1 406  ? 53.437  25.635  -44.260 1.00 43.92  ? 820  GLU A C     1 
ATOM   2892 O  O     . GLU A 1 406  ? 52.216  25.537  -44.390 1.00 42.56  ? 820  GLU A O     1 
ATOM   2893 C  CB    . GLU A 1 406  ? 55.446  25.135  -45.724 1.00 45.07  ? 820  GLU A CB    1 
ATOM   2894 C  CG    . GLU A 1 406  ? 54.980  25.227  -47.118 1.00 48.36  ? 820  GLU A CG    1 
ATOM   2895 C  CD    . GLU A 1 406  ? 56.134  25.406  -48.090 1.00 53.50  ? 820  GLU A CD    1 
ATOM   2896 O  OE1   . GLU A 1 406  ? 57.056  24.552  -48.060 1.00 53.86  ? 820  GLU A OE1   1 
ATOM   2897 O  OE2   . GLU A 1 406  ? 56.117  26.404  -48.869 1.00 53.96  ? 820  GLU A OE2   1 
ATOM   2898 N  N     . LEU A 1 407  ? 54.035  26.617  -43.601 1.00 42.93  ? 821  LEU A N     1 
ATOM   2899 C  CA    . LEU A 1 407  ? 53.323  27.765  -43.113 1.00 42.08  ? 821  LEU A CA    1 
ATOM   2900 C  C     . LEU A 1 407  ? 53.242  28.777  -44.250 1.00 41.80  ? 821  LEU A C     1 
ATOM   2901 O  O     . LEU A 1 407  ? 54.253  29.061  -44.897 1.00 41.91  ? 821  LEU A O     1 
ATOM   2902 C  CB    . LEU A 1 407  ? 54.091  28.359  -41.944 1.00 41.37  ? 821  LEU A CB    1 
ATOM   2903 C  CG    . LEU A 1 407  ? 53.474  29.613  -41.338 1.00 41.46  ? 821  LEU A CG    1 
ATOM   2904 C  CD1   . LEU A 1 407  ? 52.063  29.285  -40.939 1.00 39.80  ? 821  LEU A CD1   1 
ATOM   2905 C  CD2   . LEU A 1 407  ? 54.290  30.091  -40.114 1.00 40.64  ? 821  LEU A CD2   1 
ATOM   2906 N  N     . TYR A 1 408  ? 52.056  29.318  -44.503 1.00 41.40  ? 822  TYR A N     1 
ATOM   2907 C  CA    . TYR A 1 408  ? 51.934  30.431  -45.442 1.00 41.50  ? 822  TYR A CA    1 
ATOM   2908 C  C     . TYR A 1 408  ? 51.581  31.716  -44.707 1.00 41.93  ? 822  TYR A C     1 
ATOM   2909 O  O     . TYR A 1 408  ? 50.590  31.801  -44.002 1.00 42.16  ? 822  TYR A O     1 
ATOM   2910 C  CB    . TYR A 1 408  ? 50.927  30.120  -46.553 1.00 41.59  ? 822  TYR A CB    1 
ATOM   2911 C  CG    . TYR A 1 408  ? 51.323  28.911  -47.364 1.00 40.45  ? 822  TYR A CG    1 
ATOM   2912 C  CD1   . TYR A 1 408  ? 51.840  29.049  -48.641 1.00 41.44  ? 822  TYR A CD1   1 
ATOM   2913 C  CD2   . TYR A 1 408  ? 51.222  27.633  -46.827 1.00 39.23  ? 822  TYR A CD2   1 
ATOM   2914 C  CE1   . TYR A 1 408  ? 52.212  27.934  -49.388 1.00 42.35  ? 822  TYR A CE1   1 
ATOM   2915 C  CE2   . TYR A 1 408  ? 51.579  26.537  -47.538 1.00 39.58  ? 822  TYR A CE2   1 
ATOM   2916 C  CZ    . TYR A 1 408  ? 52.075  26.680  -48.829 1.00 42.82  ? 822  TYR A CZ    1 
ATOM   2917 O  OH    . TYR A 1 408  ? 52.462  25.571  -49.544 1.00 43.12  ? 822  TYR A OH    1 
ATOM   2918 N  N     . THR A 1 409  ? 52.415  32.717  -44.905 1.00 42.49  ? 823  THR A N     1 
ATOM   2919 C  CA    . THR A 1 409  ? 52.478  33.895  -44.078 1.00 42.90  ? 823  THR A CA    1 
ATOM   2920 C  C     . THR A 1 409  ? 51.946  35.084  -44.882 1.00 42.88  ? 823  THR A C     1 
ATOM   2921 O  O     . THR A 1 409  ? 52.293  35.217  -46.054 1.00 43.28  ? 823  THR A O     1 
ATOM   2922 C  CB    . THR A 1 409  ? 53.969  34.091  -43.683 1.00 42.86  ? 823  THR A CB    1 
ATOM   2923 O  OG1   . THR A 1 409  ? 54.111  33.782  -42.300 1.00 45.94  ? 823  THR A OG1   1 
ATOM   2924 C  CG2   . THR A 1 409  ? 54.489  35.491  -43.943 1.00 44.03  ? 823  THR A CG2   1 
ATOM   2925 N  N     . PRO A 1 410  ? 51.110  35.949  -44.264 1.00 42.63  ? 824  PRO A N     1 
ATOM   2926 C  CA    . PRO A 1 410  ? 50.479  37.055  -44.992 1.00 42.49  ? 824  PRO A CA    1 
ATOM   2927 C  C     . PRO A 1 410  ? 51.450  38.201  -45.259 1.00 42.11  ? 824  PRO A C     1 
ATOM   2928 O  O     . PRO A 1 410  ? 52.431  38.344  -44.553 1.00 42.43  ? 824  PRO A O     1 
ATOM   2929 C  CB    . PRO A 1 410  ? 49.382  37.520  -44.027 1.00 42.80  ? 824  PRO A CB    1 
ATOM   2930 C  CG    . PRO A 1 410  ? 49.963  37.191  -42.648 1.00 42.19  ? 824  PRO A CG    1 
ATOM   2931 C  CD    . PRO A 1 410  ? 50.806  35.981  -42.815 1.00 42.21  ? 824  PRO A CD    1 
ATOM   2932 N  N     . ARG A 1 411  ? 51.173  39.001  -46.277 1.00 41.48  ? 825  ARG A N     1 
ATOM   2933 C  CA    . ARG A 1 411  ? 51.931  40.220  -46.512 1.00 41.73  ? 825  ARG A CA    1 
ATOM   2934 C  C     . ARG A 1 411  ? 50.968  41.433  -46.543 1.00 41.65  ? 825  ARG A C     1 
ATOM   2935 O  O     . ARG A 1 411  ? 49.904  41.369  -47.152 1.00 42.38  ? 825  ARG A O     1 
ATOM   2936 C  CB    . ARG A 1 411  ? 52.733  40.133  -47.832 1.00 41.56  ? 825  ARG A CB    1 
ATOM   2937 C  CG    . ARG A 1 411  ? 53.762  38.998  -47.926 1.00 40.71  ? 825  ARG A CG    1 
ATOM   2938 C  CD    . ARG A 1 411  ? 55.164  39.356  -47.373 1.00 37.85  ? 825  ARG A CD    1 
ATOM   2939 N  NE    . ARG A 1 411  ? 56.110  38.249  -47.617 1.00 38.68  ? 825  ARG A NE    1 
ATOM   2940 C  CZ    . ARG A 1 411  ? 57.432  38.378  -47.772 1.00 38.68  ? 825  ARG A CZ    1 
ATOM   2941 N  NH1   . ARG A 1 411  ? 58.009  39.571  -47.729 1.00 33.95  ? 825  ARG A NH1   1 
ATOM   2942 N  NH2   . ARG A 1 411  ? 58.189  37.302  -47.973 1.00 39.76  ? 825  ARG A NH2   1 
ATOM   2943 N  N     . ILE A 1 412  ? 51.333  42.514  -45.864 1.00 41.29  ? 826  ILE A N     1 
ATOM   2944 C  CA    . ILE A 1 412  ? 50.639  43.789  -46.003 1.00 40.74  ? 826  ILE A CA    1 
ATOM   2945 C  C     . ILE A 1 412  ? 51.676  44.900  -46.072 1.00 40.10  ? 826  ILE A C     1 
ATOM   2946 O  O     . ILE A 1 412  ? 52.461  45.091  -45.145 1.00 39.57  ? 826  ILE A O     1 
ATOM   2947 C  CB    . ILE A 1 412  ? 49.735  44.094  -44.810 1.00 41.22  ? 826  ILE A CB    1 
ATOM   2948 C  CG1   . ILE A 1 412  ? 48.559  43.126  -44.745 1.00 41.28  ? 826  ILE A CG1   1 
ATOM   2949 C  CG2   . ILE A 1 412  ? 49.220  45.530  -44.903 1.00 41.54  ? 826  ILE A CG2   1 
ATOM   2950 C  CD1   . ILE A 1 412  ? 47.626  43.429  -43.595 1.00 38.34  ? 826  ILE A CD1   1 
ATOM   2951 N  N     . GLU A 1 413  ? 51.678  45.642  -47.166 1.00 40.03  ? 827  GLU A N     1 
ATOM   2952 C  CA    . GLU A 1 413  ? 52.723  46.648  -47.393 1.00 40.28  ? 827  GLU A CA    1 
ATOM   2953 C  C     . GLU A 1 413  ? 53.024  47.529  -46.164 1.00 39.75  ? 827  GLU A C     1 
ATOM   2954 O  O     . GLU A 1 413  ? 52.118  48.124  -45.579 1.00 39.38  ? 827  GLU A O     1 
ATOM   2955 C  CB    . GLU A 1 413  ? 52.380  47.514  -48.616 1.00 40.19  ? 827  GLU A CB    1 
ATOM   2956 C  CG    . GLU A 1 413  ? 53.047  48.876  -48.606 1.00 42.41  ? 827  GLU A CG    1 
ATOM   2957 C  CD    . GLU A 1 413  ? 52.852  49.650  -49.912 1.00 45.79  ? 827  GLU A CD    1 
ATOM   2958 O  OE1   . GLU A 1 413  ? 53.480  49.282  -50.944 1.00 45.89  ? 827  GLU A OE1   1 
ATOM   2959 O  OE2   . GLU A 1 413  ? 52.070  50.635  -49.897 1.00 47.02  ? 827  GLU A OE2   1 
ATOM   2960 N  N     . GLY A 1 414  ? 54.304  47.588  -45.783 1.00 39.67  ? 828  GLY A N     1 
ATOM   2961 C  CA    . GLY A 1 414  ? 54.792  48.477  -44.725 1.00 39.04  ? 828  GLY A CA    1 
ATOM   2962 C  C     . GLY A 1 414  ? 54.896  47.805  -43.366 1.00 39.22  ? 828  GLY A C     1 
ATOM   2963 O  O     . GLY A 1 414  ? 55.407  48.389  -42.417 1.00 39.56  ? 828  GLY A O     1 
ATOM   2964 N  N     . ALA A 1 415  ? 54.427  46.568  -43.269 1.00 39.03  ? 829  ALA A N     1 
ATOM   2965 C  CA    . ALA A 1 415  ? 54.300  45.911  -41.976 1.00 39.35  ? 829  ALA A CA    1 
ATOM   2966 C  C     . ALA A 1 415  ? 55.597  45.574  -41.247 1.00 39.66  ? 829  ALA A C     1 
ATOM   2967 O  O     . ALA A 1 415  ? 55.702  45.790  -40.023 1.00 39.83  ? 829  ALA A O     1 
ATOM   2968 C  CB    . ALA A 1 415  ? 53.458  44.669  -42.109 1.00 39.36  ? 829  ALA A CB    1 
ATOM   2969 N  N     . ASP A 1 416  ? 56.557  45.003  -41.967 1.00 39.74  ? 830  ASP A N     1 
ATOM   2970 C  CA    . ASP A 1 416  ? 57.821  44.638  -41.354 1.00 40.64  ? 830  ASP A CA    1 
ATOM   2971 C  C     . ASP A 1 416  ? 58.436  45.918  -40.809 1.00 41.70  ? 830  ASP A C     1 
ATOM   2972 O  O     . ASP A 1 416  ? 58.889  45.994  -39.661 1.00 41.80  ? 830  ASP A O     1 
ATOM   2973 C  CB    . ASP A 1 416  ? 58.781  43.992  -42.372 1.00 40.23  ? 830  ASP A CB    1 
ATOM   2974 C  CG    . ASP A 1 416  ? 58.336  42.599  -42.825 1.00 39.93  ? 830  ASP A CG    1 
ATOM   2975 O  OD1   . ASP A 1 416  ? 58.927  42.063  -43.789 1.00 39.37  ? 830  ASP A OD1   1 
ATOM   2976 O  OD2   . ASP A 1 416  ? 57.405  42.029  -42.219 1.00 41.38  ? 830  ASP A OD2   1 
ATOM   2977 N  N     . GLU A 1 417  ? 58.440  46.935  -41.653 1.00 42.82  ? 831  GLU A N     1 
ATOM   2978 C  CA    . GLU A 1 417  ? 59.183  48.124  -41.350 1.00 44.05  ? 831  GLU A CA    1 
ATOM   2979 C  C     . GLU A 1 417  ? 58.455  48.961  -40.289 1.00 44.16  ? 831  GLU A C     1 
ATOM   2980 O  O     . GLU A 1 417  ? 59.090  49.648  -39.498 1.00 43.58  ? 831  GLU A O     1 
ATOM   2981 C  CB    . GLU A 1 417  ? 59.481  48.864  -42.648 1.00 44.23  ? 831  GLU A CB    1 
ATOM   2982 C  CG    . GLU A 1 417  ? 58.718  50.117  -42.882 1.00 48.16  ? 831  GLU A CG    1 
ATOM   2983 C  CD    . GLU A 1 417  ? 59.601  51.320  -42.677 1.00 52.02  ? 831  GLU A CD    1 
ATOM   2984 O  OE1   . GLU A 1 417  ? 59.876  52.032  -43.678 1.00 51.78  ? 831  GLU A OE1   1 
ATOM   2985 O  OE2   . GLU A 1 417  ? 60.046  51.507  -41.515 1.00 54.54  ? 831  GLU A OE2   1 
ATOM   2986 N  N     . GLU A 1 418  ? 57.130  48.854  -40.235 1.00 44.48  ? 832  GLU A N     1 
ATOM   2987 C  CA    . GLU A 1 418  ? 56.370  49.618  -39.268 1.00 45.54  ? 832  GLU A CA    1 
ATOM   2988 C  C     . GLU A 1 418  ? 56.528  49.038  -37.870 1.00 45.73  ? 832  GLU A C     1 
ATOM   2989 O  O     . GLU A 1 418  ? 56.594  49.776  -36.880 1.00 45.43  ? 832  GLU A O     1 
ATOM   2990 C  CB    . GLU A 1 418  ? 54.896  49.662  -39.661 1.00 45.93  ? 832  GLU A CB    1 
ATOM   2991 C  CG    . GLU A 1 418  ? 53.997  50.420  -38.681 1.00 48.43  ? 832  GLU A CG    1 
ATOM   2992 C  CD    . GLU A 1 418  ? 52.546  50.471  -39.159 1.00 51.73  ? 832  GLU A CD    1 
ATOM   2993 O  OE1   . GLU A 1 418  ? 52.299  50.116  -40.343 1.00 51.06  ? 832  GLU A OE1   1 
ATOM   2994 O  OE2   . GLU A 1 418  ? 51.666  50.871  -38.354 1.00 51.78  ? 832  GLU A OE2   1 
ATOM   2995 N  N     . ILE A 1 419  ? 56.597  47.710  -37.795 1.00 46.08  ? 833  ILE A N     1 
ATOM   2996 C  CA    . ILE A 1 419  ? 56.807  47.021  -36.523 1.00 46.60  ? 833  ILE A CA    1 
ATOM   2997 C  C     . ILE A 1 419  ? 58.176  47.422  -35.947 1.00 46.82  ? 833  ILE A C     1 
ATOM   2998 O  O     . ILE A 1 419  ? 58.324  47.653  -34.737 1.00 46.29  ? 833  ILE A O     1 
ATOM   2999 C  CB    . ILE A 1 419  ? 56.629  45.465  -36.676 1.00 47.21  ? 833  ILE A CB    1 
ATOM   3000 C  CG1   . ILE A 1 419  ? 55.153  45.115  -36.919 1.00 47.37  ? 833  ILE A CG1   1 
ATOM   3001 C  CG2   . ILE A 1 419  ? 57.129  44.698  -35.459 1.00 46.22  ? 833  ILE A CG2   1 
ATOM   3002 C  CD1   . ILE A 1 419  ? 54.238  45.611  -35.840 1.00 48.07  ? 833  ILE A CD1   1 
ATOM   3003 N  N     . ARG A 1 420  ? 59.164  47.533  -36.830 1.00 46.91  ? 834  ARG A N     1 
ATOM   3004 C  CA    . ARG A 1 420  ? 60.484  48.001  -36.441 1.00 47.57  ? 834  ARG A CA    1 
ATOM   3005 C  C     . ARG A 1 420  ? 60.423  49.413  -35.845 1.00 47.52  ? 834  ARG A C     1 
ATOM   3006 O  O     . ARG A 1 420  ? 60.886  49.630  -34.733 1.00 47.38  ? 834  ARG A O     1 
ATOM   3007 C  CB    . ARG A 1 420  ? 61.448  47.966  -37.627 1.00 47.71  ? 834  ARG A CB    1 
ATOM   3008 C  CG    . ARG A 1 420  ? 62.904  47.986  -37.233 1.00 49.77  ? 834  ARG A CG    1 
ATOM   3009 C  CD    . ARG A 1 420  ? 63.640  49.014  -38.040 1.00 55.89  ? 834  ARG A CD    1 
ATOM   3010 N  NE    . ARG A 1 420  ? 63.556  50.342  -37.422 1.00 60.16  ? 834  ARG A NE    1 
ATOM   3011 C  CZ    . ARG A 1 420  ? 63.536  51.497  -38.097 1.00 62.07  ? 834  ARG A CZ    1 
ATOM   3012 N  NH1   . ARG A 1 420  ? 63.572  51.497  -39.434 1.00 60.60  ? 834  ARG A NH1   1 
ATOM   3013 N  NH2   . ARG A 1 420  ? 63.468  52.654  -37.429 1.00 62.21  ? 834  ARG A NH2   1 
ATOM   3014 N  N     . GLU A 1 421  ? 59.855  50.374  -36.560 1.00 47.80  ? 835  GLU A N     1 
ATOM   3015 C  CA    . GLU A 1 421  ? 59.850  51.728  -36.029 1.00 48.87  ? 835  GLU A CA    1 
ATOM   3016 C  C     . GLU A 1 421  ? 58.933  51.884  -34.825 1.00 48.82  ? 835  GLU A C     1 
ATOM   3017 O  O     . GLU A 1 421  ? 59.244  52.644  -33.920 1.00 48.74  ? 835  GLU A O     1 
ATOM   3018 C  CB    . GLU A 1 421  ? 59.603  52.810  -37.105 1.00 49.45  ? 835  GLU A CB    1 
ATOM   3019 C  CG    . GLU A 1 421  ? 58.153  53.047  -37.554 1.00 51.99  ? 835  GLU A CG    1 
ATOM   3020 C  CD    . GLU A 1 421  ? 57.270  53.778  -36.523 1.00 55.50  ? 835  GLU A CD    1 
ATOM   3021 O  OE1   . GLU A 1 421  ? 57.731  54.758  -35.869 1.00 55.29  ? 835  GLU A OE1   1 
ATOM   3022 O  OE2   . GLU A 1 421  ? 56.087  53.361  -36.390 1.00 57.44  ? 835  GLU A OE2   1 
ATOM   3023 N  N     . MET A 1 422  ? 57.817  51.158  -34.799 1.00 49.31  ? 836  MET A N     1 
ATOM   3024 C  CA    . MET A 1 422  ? 56.919  51.229  -33.651 1.00 49.54  ? 836  MET A CA    1 
ATOM   3025 C  C     . MET A 1 422  ? 57.688  50.847  -32.411 1.00 49.30  ? 836  MET A C     1 
ATOM   3026 O  O     . MET A 1 422  ? 57.716  51.597  -31.424 1.00 48.97  ? 836  MET A O     1 
ATOM   3027 C  CB    . MET A 1 422  ? 55.730  50.282  -33.794 1.00 50.13  ? 836  MET A CB    1 
ATOM   3028 C  CG    . MET A 1 422  ? 54.419  50.929  -34.265 1.00 51.59  ? 836  MET A CG    1 
ATOM   3029 S  SD    . MET A 1 422  ? 52.983  49.989  -33.684 1.00 54.32  ? 836  MET A SD    1 
ATOM   3030 C  CE    . MET A 1 422  ? 53.349  50.023  -31.945 1.00 52.80  ? 836  MET A CE    1 
ATOM   3031 N  N     . SER A 1 423  ? 58.324  49.679  -32.469 1.00 48.50  ? 837  SER A N     1 
ATOM   3032 C  CA    . SER A 1 423  ? 59.028  49.171  -31.292 1.00 47.90  ? 837  SER A CA    1 
ATOM   3033 C  C     . SER A 1 423  ? 60.256  49.974  -30.874 1.00 47.22  ? 837  SER A C     1 
ATOM   3034 O  O     . SER A 1 423  ? 60.405  50.269  -29.689 1.00 47.53  ? 837  SER A O     1 
ATOM   3035 C  CB    . SER A 1 423  ? 59.325  47.670  -31.384 1.00 47.58  ? 837  SER A CB    1 
ATOM   3036 O  OG    . SER A 1 423  ? 59.650  47.298  -32.694 1.00 48.66  ? 837  SER A OG    1 
ATOM   3037 N  N     . TYR A 1 424  ? 61.113  50.371  -31.814 1.00 46.40  ? 838  TYR A N     1 
ATOM   3038 C  CA    . TYR A 1 424  ? 62.216  51.290  -31.457 1.00 45.40  ? 838  TYR A CA    1 
ATOM   3039 C  C     . TYR A 1 424  ? 61.760  52.644  -30.897 1.00 45.55  ? 838  TYR A C     1 
ATOM   3040 O  O     . TYR A 1 424  ? 62.302  53.106  -29.906 1.00 45.82  ? 838  TYR A O     1 
ATOM   3041 C  CB    . TYR A 1 424  ? 63.217  51.498  -32.604 1.00 44.71  ? 838  TYR A CB    1 
ATOM   3042 C  CG    . TYR A 1 424  ? 64.272  50.407  -32.717 1.00 42.84  ? 838  TYR A CG    1 
ATOM   3043 C  CD1   . TYR A 1 424  ? 65.396  50.400  -31.907 1.00 40.63  ? 838  TYR A CD1   1 
ATOM   3044 C  CD2   . TYR A 1 424  ? 64.151  49.408  -33.654 1.00 41.51  ? 838  TYR A CD2   1 
ATOM   3045 C  CE1   . TYR A 1 424  ? 66.347  49.408  -32.018 1.00 39.91  ? 838  TYR A CE1   1 
ATOM   3046 C  CE2   . TYR A 1 424  ? 65.093  48.418  -33.770 1.00 40.90  ? 838  TYR A CE2   1 
ATOM   3047 C  CZ    . TYR A 1 424  ? 66.183  48.416  -32.953 1.00 40.67  ? 838  TYR A CZ    1 
ATOM   3048 O  OH    . TYR A 1 424  ? 67.106  47.404  -33.095 1.00 42.20  ? 838  TYR A OH    1 
ATOM   3049 N  N     . ARG A 1 425  ? 60.777  53.289  -31.514 1.00 45.74  ? 839  ARG A N     1 
ATOM   3050 C  CA    . ARG A 1 425  ? 60.312  54.593  -31.020 1.00 46.24  ? 839  ARG A CA    1 
ATOM   3051 C  C     . ARG A 1 425  ? 59.776  54.493  -29.579 1.00 46.37  ? 839  ARG A C     1 
ATOM   3052 O  O     . ARG A 1 425  ? 60.137  55.286  -28.713 1.00 46.19  ? 839  ARG A O     1 
ATOM   3053 C  CB    . ARG A 1 425  ? 59.248  55.177  -31.961 1.00 46.56  ? 839  ARG A CB    1 
ATOM   3054 C  CG    . ARG A 1 425  ? 58.571  56.454  -31.478 1.00 48.66  ? 839  ARG A CG    1 
ATOM   3055 C  CD    . ARG A 1 425  ? 57.602  57.031  -32.526 1.00 52.17  ? 839  ARG A CD    1 
ATOM   3056 N  NE    . ARG A 1 425  ? 56.657  56.037  -33.038 1.00 55.58  ? 839  ARG A NE    1 
ATOM   3057 C  CZ    . ARG A 1 425  ? 55.692  55.474  -32.309 1.00 57.16  ? 839  ARG A CZ    1 
ATOM   3058 N  NH1   . ARG A 1 425  ? 55.547  55.806  -31.033 1.00 56.65  ? 839  ARG A NH1   1 
ATOM   3059 N  NH2   . ARG A 1 425  ? 54.874  54.572  -32.852 1.00 57.41  ? 839  ARG A NH2   1 
ATOM   3060 N  N     . ARG A 1 426  ? 58.932  53.497  -29.329 1.00 46.36  ? 840  ARG A N     1 
ATOM   3061 C  CA    . ARG A 1 426  ? 58.312  53.313  -28.026 1.00 46.72  ? 840  ARG A CA    1 
ATOM   3062 C  C     . ARG A 1 426  ? 59.351  52.938  -26.942 1.00 46.13  ? 840  ARG A C     1 
ATOM   3063 O  O     . ARG A 1 426  ? 59.280  53.433  -25.817 1.00 45.27  ? 840  ARG A O     1 
ATOM   3064 C  CB    . ARG A 1 426  ? 57.184  52.274  -28.146 1.00 47.06  ? 840  ARG A CB    1 
ATOM   3065 C  CG    . ARG A 1 426  ? 56.360  52.018  -26.896 1.00 51.13  ? 840  ARG A CG    1 
ATOM   3066 C  CD    . ARG A 1 426  ? 54.957  52.654  -26.962 1.00 57.17  ? 840  ARG A CD    1 
ATOM   3067 N  NE    . ARG A 1 426  ? 54.895  53.911  -26.218 1.00 61.23  ? 840  ARG A NE    1 
ATOM   3068 C  CZ    . ARG A 1 426  ? 54.629  54.002  -24.914 1.00 63.86  ? 840  ARG A CZ    1 
ATOM   3069 N  NH1   . ARG A 1 426  ? 54.604  55.199  -24.316 1.00 64.18  ? 840  ARG A NH1   1 
ATOM   3070 N  NH2   . ARG A 1 426  ? 54.386  52.900  -24.205 1.00 64.07  ? 840  ARG A NH2   1 
ATOM   3071 N  N     . ALA A 1 427  ? 60.312  52.074  -27.287 1.00 45.83  ? 841  ALA A N     1 
ATOM   3072 C  CA    . ALA A 1 427  ? 61.375  51.690  -26.361 1.00 45.56  ? 841  ALA A CA    1 
ATOM   3073 C  C     . ALA A 1 427  ? 62.261  52.884  -26.025 1.00 46.05  ? 841  ALA A C     1 
ATOM   3074 O  O     . ALA A 1 427  ? 62.725  53.037  -24.886 1.00 46.02  ? 841  ALA A O     1 
ATOM   3075 C  CB    . ALA A 1 427  ? 62.218  50.573  -26.943 1.00 45.36  ? 841  ALA A CB    1 
ATOM   3076 N  N     . LYS A 1 428  ? 62.514  53.732  -27.014 1.00 45.96  ? 842  LYS A N     1 
ATOM   3077 C  CA    . LYS A 1 428  ? 63.331  54.881  -26.746 1.00 46.37  ? 842  LYS A CA    1 
ATOM   3078 C  C     . LYS A 1 428  ? 62.598  55.798  -25.778 1.00 46.79  ? 842  LYS A C     1 
ATOM   3079 O  O     . LYS A 1 428  ? 63.191  56.258  -24.795 1.00 47.24  ? 842  LYS A O     1 
ATOM   3080 C  CB    . LYS A 1 428  ? 63.745  55.598  -28.036 1.00 46.34  ? 842  LYS A CB    1 
ATOM   3081 C  CG    . LYS A 1 428  ? 64.953  54.939  -28.709 1.00 45.66  ? 842  LYS A CG    1 
ATOM   3082 C  CD    . LYS A 1 428  ? 65.181  55.428  -30.126 1.00 44.45  ? 842  LYS A CD    1 
ATOM   3083 C  CE    . LYS A 1 428  ? 66.434  54.786  -30.734 1.00 43.38  ? 842  LYS A CE    1 
ATOM   3084 N  NZ    . LYS A 1 428  ? 66.552  55.015  -32.202 1.00 40.28  ? 842  LYS A NZ    1 
ATOM   3085 N  N     . GLU A 1 429  ? 61.311  56.045  -26.018 1.00 46.59  ? 843  GLU A N     1 
ATOM   3086 C  CA    . GLU A 1 429  ? 60.613  56.997  -25.170 1.00 46.97  ? 843  GLU A CA    1 
ATOM   3087 C  C     . GLU A 1 429  ? 60.516  56.542  -23.716 1.00 46.41  ? 843  GLU A C     1 
ATOM   3088 O  O     . GLU A 1 429  ? 60.263  57.344  -22.822 1.00 46.38  ? 843  GLU A O     1 
ATOM   3089 C  CB    . GLU A 1 429  ? 59.261  57.468  -25.751 1.00 47.28  ? 843  GLU A CB    1 
ATOM   3090 C  CG    . GLU A 1 429  ? 58.429  56.425  -26.462 1.00 49.64  ? 843  GLU A CG    1 
ATOM   3091 C  CD    . GLU A 1 429  ? 57.043  56.940  -26.915 1.00 52.75  ? 843  GLU A CD    1 
ATOM   3092 O  OE1   . GLU A 1 429  ? 56.023  56.492  -26.327 1.00 53.22  ? 843  GLU A OE1   1 
ATOM   3093 O  OE2   . GLU A 1 429  ? 56.972  57.764  -27.869 1.00 52.23  ? 843  GLU A OE2   1 
ATOM   3094 N  N     . ILE A 1 430  ? 60.742  55.254  -23.483 1.00 46.35  ? 844  ILE A N     1 
ATOM   3095 C  CA    . ILE A 1 430  ? 60.768  54.715  -22.122 1.00 45.75  ? 844  ILE A CA    1 
ATOM   3096 C  C     . ILE A 1 430  ? 62.186  54.545  -21.590 1.00 45.96  ? 844  ILE A C     1 
ATOM   3097 O  O     . ILE A 1 430  ? 62.456  54.887  -20.450 1.00 45.86  ? 844  ILE A O     1 
ATOM   3098 C  CB    . ILE A 1 430  ? 60.076  53.345  -22.008 1.00 45.63  ? 844  ILE A CB    1 
ATOM   3099 C  CG1   . ILE A 1 430  ? 58.647  53.400  -22.563 1.00 45.44  ? 844  ILE A CG1   1 
ATOM   3100 C  CG2   . ILE A 1 430  ? 60.089  52.867  -20.547 1.00 43.78  ? 844  ILE A CG2   1 
ATOM   3101 C  CD1   . ILE A 1 430  ? 57.954  52.024  -22.671 1.00 41.74  ? 844  ILE A CD1   1 
ATOM   3102 N  N     . TYR A 1 431  ? 63.080  54.002  -22.415 1.00 46.17  ? 845  TYR A N     1 
ATOM   3103 C  CA    . TYR A 1 431  ? 64.432  53.646  -21.974 1.00 46.26  ? 845  TYR A CA    1 
ATOM   3104 C  C     . TYR A 1 431  ? 65.537  54.573  -22.446 1.00 46.49  ? 845  TYR A C     1 
ATOM   3105 O  O     . TYR A 1 431  ? 66.694  54.400  -22.054 1.00 46.59  ? 845  TYR A O     1 
ATOM   3106 C  CB    . TYR A 1 431  ? 64.772  52.208  -22.372 1.00 46.23  ? 845  TYR A CB    1 
ATOM   3107 C  CG    . TYR A 1 431  ? 63.895  51.194  -21.679 1.00 46.25  ? 845  TYR A CG    1 
ATOM   3108 C  CD1   . TYR A 1 431  ? 64.204  50.740  -20.400 1.00 46.02  ? 845  TYR A CD1   1 
ATOM   3109 C  CD2   . TYR A 1 431  ? 62.748  50.714  -22.287 1.00 45.21  ? 845  TYR A CD2   1 
ATOM   3110 C  CE1   . TYR A 1 431  ? 63.392  49.832  -19.752 1.00 46.63  ? 845  TYR A CE1   1 
ATOM   3111 C  CE2   . TYR A 1 431  ? 61.927  49.800  -21.640 1.00 45.38  ? 845  TYR A CE2   1 
ATOM   3112 C  CZ    . TYR A 1 431  ? 62.259  49.362  -20.380 1.00 45.92  ? 845  TYR A CZ    1 
ATOM   3113 O  OH    . TYR A 1 431  ? 61.459  48.458  -19.732 1.00 46.49  ? 845  TYR A OH    1 
ATOM   3114 N  N     . GLY A 1 432  ? 65.191  55.534  -23.297 1.00 46.67  ? 846  GLY A N     1 
ATOM   3115 C  CA    . GLY A 1 432  ? 66.135  56.577  -23.695 1.00 47.18  ? 846  GLY A CA    1 
ATOM   3116 C  C     . GLY A 1 432  ? 67.007  56.318  -24.908 1.00 47.54  ? 846  GLY A C     1 
ATOM   3117 O  O     . GLY A 1 432  ? 67.140  55.185  -25.389 1.00 47.55  ? 846  GLY A O     1 
ATOM   3118 N  N     . ASP A 1 433  ? 67.619  57.388  -25.397 1.00 47.72  ? 847  ASP A N     1 
ATOM   3119 C  CA    . ASP A 1 433  ? 68.381  57.329  -26.630 1.00 48.23  ? 847  ASP A CA    1 
ATOM   3120 C  C     . ASP A 1 433  ? 69.815  57.790  -26.380 1.00 48.24  ? 847  ASP A C     1 
ATOM   3121 O  O     . ASP A 1 433  ? 70.038  58.931  -25.983 1.00 48.31  ? 847  ASP A O     1 
ATOM   3122 C  CB    . ASP A 1 433  ? 67.704  58.220  -27.681 1.00 48.56  ? 847  ASP A CB    1 
ATOM   3123 C  CG    . ASP A 1 433  ? 68.194  57.949  -29.096 1.00 49.11  ? 847  ASP A CG    1 
ATOM   3124 O  OD1   . ASP A 1 433  ? 69.335  57.454  -29.269 1.00 49.07  ? 847  ASP A OD1   1 
ATOM   3125 O  OD2   . ASP A 1 433  ? 67.425  58.245  -30.038 1.00 50.00  ? 847  ASP A OD2   1 
ATOM   3126 N  N     . PRO A 1 434  ? 70.800  56.912  -26.630 1.00 48.38  ? 848  PRO A N     1 
ATOM   3127 C  CA    . PRO A 1 434  ? 70.630  55.579  -27.180 1.00 48.31  ? 848  PRO A CA    1 
ATOM   3128 C  C     . PRO A 1 434  ? 70.076  54.659  -26.119 1.00 48.12  ? 848  PRO A C     1 
ATOM   3129 O  O     . PRO A 1 434  ? 70.090  55.015  -24.947 1.00 48.28  ? 848  PRO A O     1 
ATOM   3130 C  CB    . PRO A 1 434  ? 72.061  55.166  -27.534 1.00 48.46  ? 848  PRO A CB    1 
ATOM   3131 C  CG    . PRO A 1 434  ? 72.897  55.874  -26.541 1.00 48.77  ? 848  PRO A CG    1 
ATOM   3132 C  CD    . PRO A 1 434  ? 72.218  57.211  -26.350 1.00 48.54  ? 848  PRO A CD    1 
ATOM   3133 N  N     . LEU A 1 435  ? 69.594  53.494  -26.541 1.00 47.87  ? 849  LEU A N     1 
ATOM   3134 C  CA    . LEU A 1 435  ? 69.019  52.498  -25.650 1.00 47.81  ? 849  LEU A CA    1 
ATOM   3135 C  C     . LEU A 1 435  ? 70.112  51.825  -24.857 1.00 47.73  ? 849  LEU A C     1 
ATOM   3136 O  O     . LEU A 1 435  ? 71.234  51.705  -25.334 1.00 47.82  ? 849  LEU A O     1 
ATOM   3137 C  CB    . LEU A 1 435  ? 68.312  51.422  -26.467 1.00 47.69  ? 849  LEU A CB    1 
ATOM   3138 C  CG    . LEU A 1 435  ? 67.127  51.875  -27.304 1.00 48.40  ? 849  LEU A CG    1 
ATOM   3139 C  CD1   . LEU A 1 435  ? 66.798  50.802  -28.329 1.00 49.55  ? 849  LEU A CD1   1 
ATOM   3140 C  CD2   . LEU A 1 435  ? 65.925  52.164  -26.417 1.00 48.04  ? 849  LEU A CD2   1 
ATOM   3141 N  N     . PRO A 1 436  ? 69.793  51.370  -23.641 1.00 47.54  ? 850  PRO A N     1 
ATOM   3142 C  CA    . PRO A 1 436  ? 70.764  50.537  -22.952 1.00 47.55  ? 850  PRO A CA    1 
ATOM   3143 C  C     . PRO A 1 436  ? 71.030  49.283  -23.782 1.00 47.64  ? 850  PRO A C     1 
ATOM   3144 O  O     . PRO A 1 436  ? 70.154  48.844  -24.523 1.00 47.13  ? 850  PRO A O     1 
ATOM   3145 C  CB    . PRO A 1 436  ? 70.052  50.192  -21.648 1.00 47.54  ? 850  PRO A CB    1 
ATOM   3146 C  CG    . PRO A 1 436  ? 69.096  51.333  -21.431 1.00 47.28  ? 850  PRO A CG    1 
ATOM   3147 C  CD    . PRO A 1 436  ? 68.634  51.707  -22.798 1.00 47.43  ? 850  PRO A CD    1 
ATOM   3148 N  N     . LYS A 1 437  ? 72.233  48.726  -23.670 1.00 48.01  ? 851  LYS A N     1 
ATOM   3149 C  CA    . LYS A 1 437  ? 72.645  47.586  -24.488 1.00 48.51  ? 851  LYS A CA    1 
ATOM   3150 C  C     . LYS A 1 437  ? 71.636  46.436  -24.401 1.00 48.76  ? 851  LYS A C     1 
ATOM   3151 O  O     . LYS A 1 437  ? 71.263  45.823  -25.406 1.00 48.99  ? 851  LYS A O     1 
ATOM   3152 C  CB    . LYS A 1 437  ? 74.019  47.097  -24.025 1.00 48.94  ? 851  LYS A CB    1 
ATOM   3153 C  CG    . LYS A 1 437  ? 74.963  46.636  -25.146 1.00 49.94  ? 851  LYS A CG    1 
ATOM   3154 C  CD    . LYS A 1 437  ? 76.323  46.155  -24.594 1.00 51.92  ? 851  LYS A CD    1 
ATOM   3155 C  CE    . LYS A 1 437  ? 77.170  47.311  -23.985 1.00 53.64  ? 851  LYS A CE    1 
ATOM   3156 N  NZ    . LYS A 1 437  ? 78.601  46.945  -23.670 1.00 52.27  ? 851  LYS A NZ    1 
ATOM   3157 N  N     . LEU A 1 438  ? 71.208  46.148  -23.178 1.00 48.48  ? 852  LEU A N     1 
ATOM   3158 C  CA    . LEU A 1 438  ? 70.250  45.108  -22.921 1.00 47.89  ? 852  LEU A CA    1 
ATOM   3159 C  C     . LEU A 1 438  ? 69.069  45.269  -23.878 1.00 47.29  ? 852  LEU A C     1 
ATOM   3160 O  O     . LEU A 1 438  ? 68.651  44.319  -24.547 1.00 47.46  ? 852  LEU A O     1 
ATOM   3161 C  CB    . LEU A 1 438  ? 69.769  45.247  -21.477 1.00 48.45  ? 852  LEU A CB    1 
ATOM   3162 C  CG    . LEU A 1 438  ? 69.383  44.041  -20.610 1.00 50.18  ? 852  LEU A CG    1 
ATOM   3163 C  CD1   . LEU A 1 438  ? 68.745  42.928  -21.434 1.00 51.00  ? 852  LEU A CD1   1 
ATOM   3164 C  CD2   . LEU A 1 438  ? 70.592  43.530  -19.802 1.00 51.98  ? 852  LEU A CD2   1 
ATOM   3165 N  N     . VAL A 1 439  ? 68.518  46.476  -23.931 1.00 46.06  ? 853  VAL A N     1 
ATOM   3166 C  CA    . VAL A 1 439  ? 67.293  46.704  -24.669 1.00 44.78  ? 853  VAL A CA    1 
ATOM   3167 C  C     . VAL A 1 439  ? 67.564  46.609  -26.171 1.00 44.66  ? 853  VAL A C     1 
ATOM   3168 O  O     . VAL A 1 439  ? 66.834  45.944  -26.912 1.00 44.41  ? 853  VAL A O     1 
ATOM   3169 C  CB    . VAL A 1 439  ? 66.656  48.052  -24.291 1.00 44.68  ? 853  VAL A CB    1 
ATOM   3170 C  CG1   . VAL A 1 439  ? 65.321  48.236  -24.994 1.00 43.74  ? 853  VAL A CG1   1 
ATOM   3171 C  CG2   . VAL A 1 439  ? 66.462  48.121  -22.797 1.00 43.75  ? 853  VAL A CG2   1 
ATOM   3172 N  N     . GLU A 1 440  ? 68.631  47.269  -26.604 1.00 44.34  ? 854  GLU A N     1 
ATOM   3173 C  CA    . GLU A 1 440  ? 69.051  47.260  -27.992 1.00 44.12  ? 854  GLU A CA    1 
ATOM   3174 C  C     . GLU A 1 440  ? 69.147  45.841  -28.527 1.00 43.54  ? 854  GLU A C     1 
ATOM   3175 O  O     . GLU A 1 440  ? 68.668  45.567  -29.619 1.00 43.16  ? 854  GLU A O     1 
ATOM   3176 C  CB    . GLU A 1 440  ? 70.415  47.951  -28.139 1.00 44.35  ? 854  GLU A CB    1 
ATOM   3177 C  CG    . GLU A 1 440  ? 70.862  48.178  -29.598 1.00 45.73  ? 854  GLU A CG    1 
ATOM   3178 C  CD    . GLU A 1 440  ? 70.339  49.489  -30.173 1.00 47.54  ? 854  GLU A CD    1 
ATOM   3179 O  OE1   . GLU A 1 440  ? 69.650  49.459  -31.215 1.00 48.84  ? 854  GLU A OE1   1 
ATOM   3180 O  OE2   . GLU A 1 440  ? 70.607  50.551  -29.574 1.00 48.41  ? 854  GLU A OE2   1 
ATOM   3181 N  N     . GLU A 1 441  ? 69.775  44.949  -27.763 1.00 43.21  ? 855  GLU A N     1 
ATOM   3182 C  CA    . GLU A 1 441  ? 70.028  43.589  -28.238 1.00 43.36  ? 855  GLU A CA    1 
ATOM   3183 C  C     . GLU A 1 441  ? 68.760  42.752  -28.260 1.00 43.12  ? 855  GLU A C     1 
ATOM   3184 O  O     . GLU A 1 441  ? 68.620  41.861  -29.091 1.00 43.11  ? 855  GLU A O     1 
ATOM   3185 C  CB    . GLU A 1 441  ? 71.081  42.881  -27.386 1.00 43.55  ? 855  GLU A CB    1 
ATOM   3186 C  CG    . GLU A 1 441  ? 72.489  43.479  -27.501 1.00 44.44  ? 855  GLU A CG    1 
ATOM   3187 C  CD    . GLU A 1 441  ? 73.460  42.956  -26.425 1.00 47.08  ? 855  GLU A CD    1 
ATOM   3188 O  OE1   . GLU A 1 441  ? 73.083  42.874  -25.222 1.00 47.81  ? 855  GLU A OE1   1 
ATOM   3189 O  OE2   . GLU A 1 441  ? 74.611  42.631  -26.786 1.00 48.74  ? 855  GLU A OE2   1 
ATOM   3190 N  N     . ARG A 1 442  ? 67.842  43.038  -27.341 1.00 42.37  ? 856  ARG A N     1 
ATOM   3191 C  CA    . ARG A 1 442  ? 66.609  42.283  -27.262 1.00 41.69  ? 856  ARG A CA    1 
ATOM   3192 C  C     . ARG A 1 442  ? 65.782  42.661  -28.478 1.00 41.70  ? 856  ARG A C     1 
ATOM   3193 O  O     . ARG A 1 442  ? 65.210  41.807  -29.146 1.00 41.58  ? 856  ARG A O     1 
ATOM   3194 C  CB    . ARG A 1 442  ? 65.867  42.594  -25.945 1.00 41.44  ? 856  ARG A CB    1 
ATOM   3195 C  CG    . ARG A 1 442  ? 64.581  41.814  -25.703 1.00 39.75  ? 856  ARG A CG    1 
ATOM   3196 C  CD    . ARG A 1 442  ? 64.850  40.369  -25.262 1.00 37.18  ? 856  ARG A CD    1 
ATOM   3197 N  NE    . ARG A 1 442  ? 63.613  39.597  -25.207 1.00 35.98  ? 856  ARG A NE    1 
ATOM   3198 C  CZ    . ARG A 1 442  ? 63.179  38.965  -24.121 1.00 36.56  ? 856  ARG A CZ    1 
ATOM   3199 N  NH1   . ARG A 1 442  ? 63.908  39.017  -23.018 1.00 36.48  ? 856  ARG A NH1   1 
ATOM   3200 N  NH2   . ARG A 1 442  ? 62.034  38.275  -24.136 1.00 34.80  ? 856  ARG A NH2   1 
ATOM   3201 N  N     . LEU A 1 443  ? 65.740  43.948  -28.782 1.00 41.76  ? 857  LEU A N     1 
ATOM   3202 C  CA    . LEU A 1 443  ? 65.054  44.396  -29.982 1.00 42.27  ? 857  LEU A CA    1 
ATOM   3203 C  C     . LEU A 1 443  ? 65.657  43.791  -31.274 1.00 42.95  ? 857  LEU A C     1 
ATOM   3204 O  O     . LEU A 1 443  ? 64.935  43.187  -32.079 1.00 43.14  ? 857  LEU A O     1 
ATOM   3205 C  CB    . LEU A 1 443  ? 65.030  45.923  -30.046 1.00 41.84  ? 857  LEU A CB    1 
ATOM   3206 C  CG    . LEU A 1 443  ? 64.015  46.595  -29.117 1.00 41.72  ? 857  LEU A CG    1 
ATOM   3207 C  CD1   . LEU A 1 443  ? 64.233  48.088  -29.074 1.00 40.43  ? 857  LEU A CD1   1 
ATOM   3208 C  CD2   . LEU A 1 443  ? 62.608  46.298  -29.566 1.00 40.82  ? 857  LEU A CD2   1 
ATOM   3209 N  N     . GLU A 1 444  ? 66.964  43.950  -31.485 1.00 43.14  ? 858  GLU A N     1 
ATOM   3210 C  CA    . GLU A 1 444  ? 67.571  43.452  -32.719 1.00 43.88  ? 858  GLU A CA    1 
ATOM   3211 C  C     . GLU A 1 444  ? 67.359  41.949  -32.909 1.00 43.33  ? 858  GLU A C     1 
ATOM   3212 O  O     . GLU A 1 444  ? 67.091  41.483  -34.016 1.00 43.86  ? 858  GLU A O     1 
ATOM   3213 C  CB    . GLU A 1 444  ? 69.057  43.824  -32.823 1.00 44.33  ? 858  GLU A CB    1 
ATOM   3214 C  CG    . GLU A 1 444  ? 69.320  45.131  -33.645 1.00 48.28  ? 858  GLU A CG    1 
ATOM   3215 C  CD    . GLU A 1 444  ? 70.804  45.611  -33.636 1.00 52.81  ? 858  GLU A CD    1 
ATOM   3216 O  OE1   . GLU A 1 444  ? 71.335  45.978  -32.543 1.00 52.91  ? 858  GLU A OE1   1 
ATOM   3217 O  OE2   . GLU A 1 444  ? 71.424  45.649  -34.736 1.00 52.95  ? 858  GLU A OE2   1 
ATOM   3218 N  N     . LYS A 1 445  ? 67.475  41.190  -31.831 1.00 42.30  ? 859  LYS A N     1 
ATOM   3219 C  CA    . LYS A 1 445  ? 67.343  39.751  -31.911 1.00 41.78  ? 859  LYS A CA    1 
ATOM   3220 C  C     . LYS A 1 445  ? 65.885  39.379  -32.124 1.00 41.12  ? 859  LYS A C     1 
ATOM   3221 O  O     . LYS A 1 445  ? 65.545  38.512  -32.925 1.00 41.06  ? 859  LYS A O     1 
ATOM   3222 C  CB    . LYS A 1 445  ? 67.895  39.133  -30.631 1.00 41.83  ? 859  LYS A CB    1 
ATOM   3223 C  CG    . LYS A 1 445  ? 67.393  37.763  -30.248 1.00 43.07  ? 859  LYS A CG    1 
ATOM   3224 C  CD    . LYS A 1 445  ? 68.114  37.329  -28.963 1.00 45.34  ? 859  LYS A CD    1 
ATOM   3225 C  CE    . LYS A 1 445  ? 67.380  36.242  -28.224 1.00 46.14  ? 859  LYS A CE    1 
ATOM   3226 N  NZ    . LYS A 1 445  ? 66.272  36.853  -27.466 1.00 48.44  ? 859  LYS A NZ    1 
ATOM   3227 N  N     . GLU A 1 446  ? 65.010  40.067  -31.424 1.00 40.38  ? 860  GLU A N     1 
ATOM   3228 C  CA    . GLU A 1 446  ? 63.617  39.750  -31.516 1.00 39.88  ? 860  GLU A CA    1 
ATOM   3229 C  C     . GLU A 1 446  ? 63.016  40.097  -32.890 1.00 39.72  ? 860  GLU A C     1 
ATOM   3230 O  O     . GLU A 1 446  ? 62.302  39.297  -33.506 1.00 39.34  ? 860  GLU A O     1 
ATOM   3231 C  CB    . GLU A 1 446  ? 62.906  40.461  -30.390 1.00 40.28  ? 860  GLU A CB    1 
ATOM   3232 C  CG    . GLU A 1 446  ? 61.975  39.546  -29.695 1.00 39.77  ? 860  GLU A CG    1 
ATOM   3233 C  CD    . GLU A 1 446  ? 61.370  40.081  -28.425 1.00 38.04  ? 860  GLU A CD    1 
ATOM   3234 O  OE1   . GLU A 1 446  ? 60.413  40.903  -28.503 1.00 39.41  ? 860  GLU A OE1   1 
ATOM   3235 O  OE2   . GLU A 1 446  ? 61.797  39.607  -27.348 1.00 34.84  ? 860  GLU A OE2   1 
ATOM   3236 N  N     . LEU A 1 447  ? 63.350  41.282  -33.391 1.00 39.40  ? 861  LEU A N     1 
ATOM   3237 C  CA    . LEU A 1 447  ? 62.783  41.771  -34.632 1.00 38.92  ? 861  LEU A CA    1 
ATOM   3238 C  C     . LEU A 1 447  ? 63.218  40.937  -35.830 1.00 38.53  ? 861  LEU A C     1 
ATOM   3239 O  O     . LEU A 1 447  ? 62.433  40.691  -36.739 1.00 37.98  ? 861  LEU A O     1 
ATOM   3240 C  CB    . LEU A 1 447  ? 63.174  43.232  -34.851 1.00 39.40  ? 861  LEU A CB    1 
ATOM   3241 C  CG    . LEU A 1 447  ? 62.351  44.292  -34.131 1.00 39.57  ? 861  LEU A CG    1 
ATOM   3242 C  CD1   . LEU A 1 447  ? 62.971  45.661  -34.405 1.00 39.66  ? 861  LEU A CD1   1 
ATOM   3243 C  CD2   . LEU A 1 447  ? 60.876  44.243  -34.569 1.00 39.18  ? 861  LEU A CD2   1 
ATOM   3244 N  N     . LYS A 1 448  ? 64.467  40.489  -35.864 1.00 37.87  ? 862  LYS A N     1 
ATOM   3245 C  CA    . LYS A 1 448  ? 64.842  39.709  -37.038 1.00 37.20  ? 862  LYS A CA    1 
ATOM   3246 C  C     . LYS A 1 448  ? 64.174  38.338  -37.065 1.00 36.29  ? 862  LYS A C     1 
ATOM   3247 O  O     . LYS A 1 448  ? 64.009  37.738  -38.122 1.00 36.27  ? 862  LYS A O     1 
ATOM   3248 C  CB    . LYS A 1 448  ? 66.354  39.620  -37.220 1.00 37.40  ? 862  LYS A CB    1 
ATOM   3249 C  CG    . LYS A 1 448  ? 67.093  38.741  -36.250 1.00 39.18  ? 862  LYS A CG    1 
ATOM   3250 C  CD    . LYS A 1 448  ? 68.480  38.367  -36.819 1.00 41.53  ? 862  LYS A CD    1 
ATOM   3251 C  CE    . LYS A 1 448  ? 69.182  39.551  -37.477 1.00 42.49  ? 862  LYS A CE    1 
ATOM   3252 N  NZ    . LYS A 1 448  ? 70.267  40.119  -36.615 1.00 46.25  ? 862  LYS A NZ    1 
ATOM   3253 N  N     . SER A 1 449  ? 63.784  37.839  -35.905 1.00 35.33  ? 863  SER A N     1 
ATOM   3254 C  CA    . SER A 1 449  ? 63.053  36.579  -35.873 1.00 34.76  ? 863  SER A CA    1 
ATOM   3255 C  C     . SER A 1 449  ? 61.572  36.770  -36.247 1.00 34.15  ? 863  SER A C     1 
ATOM   3256 O  O     . SER A 1 449  ? 61.037  36.045  -37.072 1.00 33.52  ? 863  SER A O     1 
ATOM   3257 C  CB    . SER A 1 449  ? 63.187  35.904  -34.507 1.00 34.49  ? 863  SER A CB    1 
ATOM   3258 O  OG    . SER A 1 449  ? 62.548  34.652  -34.526 1.00 35.12  ? 863  SER A OG    1 
ATOM   3259 N  N     . ILE A 1 450  ? 60.908  37.743  -35.637 1.00 33.71  ? 864  ILE A N     1 
ATOM   3260 C  CA    . ILE A 1 450  ? 59.495  37.986  -35.936 1.00 33.12  ? 864  ILE A CA    1 
ATOM   3261 C  C     . ILE A 1 450  ? 59.292  38.266  -37.426 1.00 33.57  ? 864  ILE A C     1 
ATOM   3262 O  O     . ILE A 1 450  ? 58.434  37.672  -38.084 1.00 33.91  ? 864  ILE A O     1 
ATOM   3263 C  CB    . ILE A 1 450  ? 58.982  39.159  -35.112 1.00 33.07  ? 864  ILE A CB    1 
ATOM   3264 C  CG1   . ILE A 1 450  ? 59.048  38.801  -33.622 1.00 33.28  ? 864  ILE A CG1   1 
ATOM   3265 C  CG2   . ILE A 1 450  ? 57.591  39.574  -35.531 1.00 31.65  ? 864  ILE A CG2   1 
ATOM   3266 C  CD1   . ILE A 1 450  ? 59.006  39.995  -32.727 1.00 32.58  ? 864  ILE A CD1   1 
ATOM   3267 N  N     . ILE A 1 451  ? 60.095  39.173  -37.956 1.00 33.46  ? 865  ILE A N     1 
ATOM   3268 C  CA    . ILE A 1 451  ? 60.045  39.520  -39.346 1.00 33.61  ? 865  ILE A CA    1 
ATOM   3269 C  C     . ILE A 1 451  ? 60.407  38.335  -40.246 1.00 34.14  ? 865  ILE A C     1 
ATOM   3270 O  O     . ILE A 1 451  ? 59.670  38.007  -41.198 1.00 34.24  ? 865  ILE A O     1 
ATOM   3271 C  CB    . ILE A 1 451  ? 60.973  40.711  -39.619 1.00 33.68  ? 865  ILE A CB    1 
ATOM   3272 C  CG1   . ILE A 1 451  ? 60.319  41.998  -39.093 1.00 34.46  ? 865  ILE A CG1   1 
ATOM   3273 C  CG2   . ILE A 1 451  ? 61.237  40.847  -41.101 1.00 34.11  ? 865  ILE A CG2   1 
ATOM   3274 C  CD1   . ILE A 1 451  ? 61.284  43.110  -38.804 1.00 34.50  ? 865  ILE A CD1   1 
ATOM   3275 N  N     . GLY A 1 452  ? 61.531  37.682  -39.950 1.00 33.68  ? 866  GLY A N     1 
ATOM   3276 C  CA    . GLY A 1 452  ? 62.028  36.623  -40.825 1.00 33.46  ? 866  GLY A CA    1 
ATOM   3277 C  C     . GLY A 1 452  ? 61.112  35.426  -40.990 1.00 33.57  ? 866  GLY A C     1 
ATOM   3278 O  O     . GLY A 1 452  ? 61.056  34.823  -42.069 1.00 33.18  ? 866  GLY A O     1 
ATOM   3279 N  N     . HIS A 1 453  ? 60.424  35.056  -39.913 1.00 33.50  ? 867  HIS A N     1 
ATOM   3280 C  CA    . HIS A 1 453  ? 59.473  33.954  -39.953 1.00 34.14  ? 867  HIS A CA    1 
ATOM   3281 C  C     . HIS A 1 453  ? 58.067  34.456  -40.316 1.00 34.76  ? 867  HIS A C     1 
ATOM   3282 O  O     . HIS A 1 453  ? 57.099  33.720  -40.289 1.00 35.21  ? 867  HIS A O     1 
ATOM   3283 C  CB    . HIS A 1 453  ? 59.532  33.182  -38.635 1.00 34.03  ? 867  HIS A CB    1 
ATOM   3284 C  CG    . HIS A 1 453  ? 60.908  32.657  -38.322 1.00 35.79  ? 867  HIS A CG    1 
ATOM   3285 N  ND1   . HIS A 1 453  ? 61.543  31.711  -39.109 1.00 37.00  ? 867  HIS A ND1   1 
ATOM   3286 C  CD2   . HIS A 1 453  ? 61.775  32.950  -37.322 1.00 35.55  ? 867  HIS A CD2   1 
ATOM   3287 C  CE1   . HIS A 1 453  ? 62.740  31.449  -38.609 1.00 36.53  ? 867  HIS A CE1   1 
ATOM   3288 N  NE2   . HIS A 1 453  ? 62.902  32.183  -37.521 1.00 36.59  ? 867  HIS A NE2   1 
ATOM   3289 N  N     . GLY A 1 454  ? 57.964  35.731  -40.682 1.00 35.49  ? 868  GLY A N     1 
ATOM   3290 C  CA    . GLY A 1 454  ? 56.731  36.263  -41.242 1.00 34.96  ? 868  GLY A CA    1 
ATOM   3291 C  C     . GLY A 1 454  ? 55.568  36.528  -40.296 1.00 35.17  ? 868  GLY A C     1 
ATOM   3292 O  O     . GLY A 1 454  ? 54.391  36.318  -40.661 1.00 34.97  ? 868  GLY A O     1 
ATOM   3293 N  N     . PHE A 1 455  ? 55.883  37.017  -39.099 1.00 34.24  ? 869  PHE A N     1 
ATOM   3294 C  CA    . PHE A 1 455  ? 54.873  37.308  -38.116 1.00 33.74  ? 869  PHE A CA    1 
ATOM   3295 C  C     . PHE A 1 455  ? 54.635  38.797  -37.938 1.00 33.52  ? 869  PHE A C     1 
ATOM   3296 O  O     . PHE A 1 455  ? 53.810  39.194  -37.135 1.00 33.51  ? 869  PHE A O     1 
ATOM   3297 C  CB    . PHE A 1 455  ? 55.267  36.708  -36.757 1.00 34.40  ? 869  PHE A CB    1 
ATOM   3298 C  CG    . PHE A 1 455  ? 55.018  35.238  -36.653 1.00 33.55  ? 869  PHE A CG    1 
ATOM   3299 C  CD1   . PHE A 1 455  ? 54.007  34.756  -35.836 1.00 32.51  ? 869  PHE A CD1   1 
ATOM   3300 C  CD2   . PHE A 1 455  ? 55.820  34.332  -37.347 1.00 34.87  ? 869  PHE A CD2   1 
ATOM   3301 C  CE1   . PHE A 1 455  ? 53.758  33.378  -35.734 1.00 32.11  ? 869  PHE A CE1   1 
ATOM   3302 C  CE2   . PHE A 1 455  ? 55.595  32.954  -37.249 1.00 34.92  ? 869  PHE A CE2   1 
ATOM   3303 C  CZ    . PHE A 1 455  ? 54.550  32.481  -36.434 1.00 33.15  ? 869  PHE A CZ    1 
ATOM   3304 N  N     . ALA A 1 456  ? 55.362  39.646  -38.641 1.00 33.55  ? 870  ALA A N     1 
ATOM   3305 C  CA    . ALA A 1 456  ? 55.169  41.070  -38.389 1.00 33.43  ? 870  ALA A CA    1 
ATOM   3306 C  C     . ALA A 1 456  ? 53.709  41.507  -38.645 1.00 33.65  ? 870  ALA A C     1 
ATOM   3307 O  O     . ALA A 1 456  ? 53.136  42.287  -37.875 1.00 34.51  ? 870  ALA A O     1 
ATOM   3308 C  CB    . ALA A 1 456  ? 56.159  41.914  -39.207 1.00 33.65  ? 870  ALA A CB    1 
ATOM   3309 N  N     . VAL A 1 457  ? 53.086  41.006  -39.695 1.00 33.19  ? 871  VAL A N     1 
ATOM   3310 C  CA    . VAL A 1 457  ? 51.693  41.397  -39.952 1.00 33.40  ? 871  VAL A CA    1 
ATOM   3311 C  C     . VAL A 1 457  ? 50.743  41.183  -38.769 1.00 34.34  ? 871  VAL A C     1 
ATOM   3312 O  O     . VAL A 1 457  ? 49.959  42.083  -38.419 1.00 34.61  ? 871  VAL A O     1 
ATOM   3313 C  CB    . VAL A 1 457  ? 51.111  40.746  -41.254 1.00 32.95  ? 871  VAL A CB    1 
ATOM   3314 C  CG1   . VAL A 1 457  ? 49.610  40.901  -41.337 1.00 31.76  ? 871  VAL A CG1   1 
ATOM   3315 C  CG2   . VAL A 1 457  ? 51.779  41.370  -42.489 1.00 31.34  ? 871  VAL A CG2   1 
ATOM   3316 N  N     . ILE A 1 458  ? 50.790  40.008  -38.157 1.00 35.09  ? 872  ILE A N     1 
ATOM   3317 C  CA    . ILE A 1 458  ? 49.817  39.708  -37.119 1.00 35.91  ? 872  ILE A CA    1 
ATOM   3318 C  C     . ILE A 1 458  ? 50.114  40.472  -35.829 1.00 36.74  ? 872  ILE A C     1 
ATOM   3319 O  O     . ILE A 1 458  ? 49.194  40.800  -35.091 1.00 36.94  ? 872  ILE A O     1 
ATOM   3320 C  CB    . ILE A 1 458  ? 49.611  38.195  -36.876 1.00 36.12  ? 872  ILE A CB    1 
ATOM   3321 C  CG1   . ILE A 1 458  ? 50.843  37.543  -36.236 1.00 37.26  ? 872  ILE A CG1   1 
ATOM   3322 C  CG2   . ILE A 1 458  ? 49.199  37.494  -38.171 1.00 33.86  ? 872  ILE A CG2   1 
ATOM   3323 C  CD1   . ILE A 1 458  ? 50.541  36.135  -35.723 1.00 37.77  ? 872  ILE A CD1   1 
ATOM   3324 N  N     . TYR A 1 459  ? 51.379  40.822  -35.595 1.00 37.25  ? 873  TYR A N     1 
ATOM   3325 C  CA    . TYR A 1 459  ? 51.715  41.694  -34.462 1.00 37.39  ? 873  TYR A CA    1 
ATOM   3326 C  C     . TYR A 1 459  ? 50.953  43.027  -34.648 1.00 38.07  ? 873  TYR A C     1 
ATOM   3327 O  O     . TYR A 1 459  ? 50.226  43.510  -33.737 1.00 38.73  ? 873  TYR A O     1 
ATOM   3328 C  CB    . TYR A 1 459  ? 53.233  41.933  -34.412 1.00 37.02  ? 873  TYR A CB    1 
ATOM   3329 C  CG    . TYR A 1 459  ? 54.047  41.032  -33.498 1.00 36.15  ? 873  TYR A CG    1 
ATOM   3330 C  CD1   . TYR A 1 459  ? 54.274  39.687  -33.804 1.00 36.24  ? 873  TYR A CD1   1 
ATOM   3331 C  CD2   . TYR A 1 459  ? 54.642  41.543  -32.347 1.00 36.79  ? 873  TYR A CD2   1 
ATOM   3332 C  CE1   . TYR A 1 459  ? 55.035  38.877  -32.970 1.00 33.82  ? 873  TYR A CE1   1 
ATOM   3333 C  CE2   . TYR A 1 459  ? 55.406  40.744  -31.506 1.00 33.52  ? 873  TYR A CE2   1 
ATOM   3334 C  CZ    . TYR A 1 459  ? 55.605  39.421  -31.818 1.00 35.07  ? 873  TYR A CZ    1 
ATOM   3335 O  OH    . TYR A 1 459  ? 56.381  38.644  -30.962 1.00 33.45  ? 873  TYR A OH    1 
ATOM   3336 N  N     . LEU A 1 460  ? 51.074  43.573  -35.859 1.00 38.02  ? 874  LEU A N     1 
ATOM   3337 C  CA    . LEU A 1 460  ? 50.510  44.867  -36.209 1.00 38.34  ? 874  LEU A CA    1 
ATOM   3338 C  C     . LEU A 1 460  ? 49.005  44.856  -36.197 1.00 37.58  ? 874  LEU A C     1 
ATOM   3339 O  O     . LEU A 1 460  ? 48.406  45.754  -35.631 1.00 37.89  ? 874  LEU A O     1 
ATOM   3340 C  CB    . LEU A 1 460  ? 50.984  45.309  -37.602 1.00 38.96  ? 874  LEU A CB    1 
ATOM   3341 C  CG    . LEU A 1 460  ? 50.814  46.817  -37.825 1.00 40.72  ? 874  LEU A CG    1 
ATOM   3342 C  CD1   . LEU A 1 460  ? 51.935  47.568  -37.094 1.00 42.21  ? 874  LEU A CD1   1 
ATOM   3343 C  CD2   . LEU A 1 460  ? 50.765  47.211  -39.316 1.00 42.22  ? 874  LEU A CD2   1 
ATOM   3344 N  N     . ILE A 1 461  ? 48.400  43.863  -36.853 1.00 37.45  ? 875  ILE A N     1 
ATOM   3345 C  CA    . ILE A 1 461  ? 46.952  43.666  -36.794 1.00 37.37  ? 875  ILE A CA    1 
ATOM   3346 C  C     . ILE A 1 461  ? 46.531  43.528  -35.318 1.00 37.54  ? 875  ILE A C     1 
ATOM   3347 O  O     . ILE A 1 461  ? 45.566  44.159  -34.880 1.00 38.39  ? 875  ILE A O     1 
ATOM   3348 C  CB    . ILE A 1 461  ? 46.450  42.459  -37.674 1.00 37.70  ? 875  ILE A CB    1 
ATOM   3349 C  CG1   . ILE A 1 461  ? 46.208  42.875  -39.129 1.00 38.06  ? 875  ILE A CG1   1 
ATOM   3350 C  CG2   . ILE A 1 461  ? 45.108  41.915  -37.172 1.00 36.76  ? 875  ILE A CG2   1 
ATOM   3351 C  CD1   . ILE A 1 461  ? 47.262  43.809  -39.720 1.00 40.42  ? 875  ILE A CD1   1 
ATOM   3352 N  N     . SER A 1 462  ? 47.280  42.760  -34.532 1.00 37.13  ? 876  SER A N     1 
ATOM   3353 C  CA    . SER A 1 462  ? 46.989  42.651  -33.087 1.00 36.97  ? 876  SER A CA    1 
ATOM   3354 C  C     . SER A 1 462  ? 47.101  43.980  -32.364 1.00 37.32  ? 876  SER A C     1 
ATOM   3355 O  O     . SER A 1 462  ? 46.392  44.226  -31.389 1.00 37.12  ? 876  SER A O     1 
ATOM   3356 C  CB    . SER A 1 462  ? 47.907  41.645  -32.415 1.00 37.02  ? 876  SER A CB    1 
ATOM   3357 O  OG    . SER A 1 462  ? 47.529  40.320  -32.763 1.00 36.54  ? 876  SER A OG    1 
ATOM   3358 N  N     . HIS A 1 463  ? 48.003  44.840  -32.831 1.00 37.44  ? 877  HIS A N     1 
ATOM   3359 C  CA    . HIS A 1 463  ? 48.143  46.159  -32.234 1.00 37.03  ? 877  HIS A CA    1 
ATOM   3360 C  C     . HIS A 1 463  ? 46.879  46.963  -32.496 1.00 36.95  ? 877  HIS A C     1 
ATOM   3361 O  O     . HIS A 1 463  ? 46.313  47.564  -31.585 1.00 36.98  ? 877  HIS A O     1 
ATOM   3362 C  CB    . HIS A 1 463  ? 49.388  46.847  -32.796 1.00 37.13  ? 877  HIS A CB    1 
ATOM   3363 C  CG    . HIS A 1 463  ? 49.460  48.319  -32.532 1.00 38.00  ? 877  HIS A CG    1 
ATOM   3364 N  ND1   . HIS A 1 463  ? 49.673  48.845  -31.278 1.00 38.34  ? 877  HIS A ND1   1 
ATOM   3365 C  CD2   . HIS A 1 463  ? 49.415  49.379  -33.379 1.00 38.92  ? 877  HIS A CD2   1 
ATOM   3366 C  CE1   . HIS A 1 463  ? 49.722  50.163  -31.355 1.00 38.48  ? 877  HIS A CE1   1 
ATOM   3367 N  NE2   . HIS A 1 463  ? 49.565  50.513  -32.621 1.00 37.65  ? 877  HIS A NE2   1 
ATOM   3368 N  N     . LYS A 1 464  ? 46.399  46.950  -33.733 1.00 37.02  ? 878  LYS A N     1 
ATOM   3369 C  CA    . LYS A 1 464  ? 45.228  47.789  -34.075 1.00 36.41  ? 878  LYS A CA    1 
ATOM   3370 C  C     . LYS A 1 464  ? 43.963  47.285  -33.389 1.00 36.48  ? 878  LYS A C     1 
ATOM   3371 O  O     . LYS A 1 464  ? 43.115  48.075  -32.947 1.00 35.96  ? 878  LYS A O     1 
ATOM   3372 C  CB    . LYS A 1 464  ? 45.011  47.815  -35.575 1.00 36.71  ? 878  LYS A CB    1 
ATOM   3373 C  CG    . LYS A 1 464  ? 46.172  48.381  -36.368 1.00 36.27  ? 878  LYS A CG    1 
ATOM   3374 C  CD    . LYS A 1 464  ? 45.978  48.056  -37.826 1.00 36.71  ? 878  LYS A CD    1 
ATOM   3375 C  CE    . LYS A 1 464  ? 46.645  49.073  -38.740 1.00 38.10  ? 878  LYS A CE    1 
ATOM   3376 N  NZ    . LYS A 1 464  ? 48.060  49.287  -38.372 1.00 36.84  ? 878  LYS A NZ    1 
ATOM   3377 N  N     . LEU A 1 465  ? 43.845  45.965  -33.277 1.00 36.19  ? 879  LEU A N     1 
ATOM   3378 C  CA    . LEU A 1 465  ? 42.722  45.384  -32.571 1.00 36.21  ? 879  LEU A CA    1 
ATOM   3379 C  C     . LEU A 1 465  ? 42.688  45.880  -31.131 1.00 36.36  ? 879  LEU A C     1 
ATOM   3380 O  O     . LEU A 1 465  ? 41.658  46.317  -30.648 1.00 35.97  ? 879  LEU A O     1 
ATOM   3381 C  CB    . LEU A 1 465  ? 42.847  43.885  -32.573 1.00 36.71  ? 879  LEU A CB    1 
ATOM   3382 C  CG    . LEU A 1 465  ? 42.415  43.224  -33.872 1.00 37.32  ? 879  LEU A CG    1 
ATOM   3383 C  CD1   . LEU A 1 465  ? 42.903  41.800  -33.849 1.00 35.63  ? 879  LEU A CD1   1 
ATOM   3384 C  CD2   . LEU A 1 465  ? 40.895  43.305  -33.977 1.00 37.41  ? 879  LEU A CD2   1 
ATOM   3385 N  N     . VAL A 1 466  ? 43.816  45.805  -30.433 1.00 36.37  ? 880  VAL A N     1 
ATOM   3386 C  CA    . VAL A 1 466  ? 43.846  46.335  -29.091 1.00 35.95  ? 880  VAL A CA    1 
ATOM   3387 C  C     . VAL A 1 466  ? 43.572  47.826  -29.074 1.00 36.09  ? 880  VAL A C     1 
ATOM   3388 O  O     . VAL A 1 466  ? 42.771  48.284  -28.292 1.00 35.64  ? 880  VAL A O     1 
ATOM   3389 C  CB    . VAL A 1 466  ? 45.165  46.097  -28.379 1.00 36.39  ? 880  VAL A CB    1 
ATOM   3390 C  CG1   . VAL A 1 466  ? 45.212  46.981  -27.124 1.00 34.76  ? 880  VAL A CG1   1 
ATOM   3391 C  CG2   . VAL A 1 466  ? 45.331  44.628  -28.038 1.00 35.37  ? 880  VAL A CG2   1 
ATOM   3392 N  N     . LYS A 1 467  ? 44.231  48.597  -29.929 1.00 36.54  ? 881  LYS A N     1 
ATOM   3393 C  CA    . LYS A 1 467  ? 43.990  50.043  -29.929 1.00 37.17  ? 881  LYS A CA    1 
ATOM   3394 C  C     . LYS A 1 467  ? 42.494  50.444  -30.156 1.00 37.21  ? 881  LYS A C     1 
ATOM   3395 O  O     . LYS A 1 467  ? 41.929  51.263  -29.416 1.00 36.82  ? 881  LYS A O     1 
ATOM   3396 C  CB    . LYS A 1 467  ? 44.916  50.723  -30.931 1.00 37.34  ? 881  LYS A CB    1 
ATOM   3397 C  CG    . LYS A 1 467  ? 44.902  52.240  -30.885 1.00 40.18  ? 881  LYS A CG    1 
ATOM   3398 C  CD    . LYS A 1 467  ? 45.859  52.767  -31.969 1.00 45.08  ? 881  LYS A CD    1 
ATOM   3399 C  CE    . LYS A 1 467  ? 45.909  54.286  -32.026 1.00 45.61  ? 881  LYS A CE    1 
ATOM   3400 N  NZ    . LYS A 1 467  ? 46.414  54.713  -33.368 1.00 46.37  ? 881  LYS A NZ    1 
ATOM   3401 N  N     . LYS A 1 468  ? 41.847  49.851  -31.154 1.00 37.33  ? 882  LYS A N     1 
ATOM   3402 C  CA    . LYS A 1 468  ? 40.423  50.105  -31.375 1.00 37.65  ? 882  LYS A CA    1 
ATOM   3403 C  C     . LYS A 1 468  ? 39.567  49.726  -30.150 1.00 37.56  ? 882  LYS A C     1 
ATOM   3404 O  O     . LYS A 1 468  ? 38.669  50.465  -29.731 1.00 37.39  ? 882  LYS A O     1 
ATOM   3405 C  CB    . LYS A 1 468  ? 39.939  49.328  -32.584 1.00 37.84  ? 882  LYS A CB    1 
ATOM   3406 C  CG    . LYS A 1 468  ? 38.484  49.542  -32.875 1.00 38.69  ? 882  LYS A CG    1 
ATOM   3407 C  CD    . LYS A 1 468  ? 37.945  48.400  -33.709 1.00 39.66  ? 882  LYS A CD    1 
ATOM   3408 C  CE    . LYS A 1 468  ? 36.875  48.856  -34.657 1.00 40.66  ? 882  LYS A CE    1 
ATOM   3409 N  NZ    . LYS A 1 468  ? 35.880  49.716  -33.971 1.00 40.32  ? 882  LYS A NZ    1 
ATOM   3410 N  N     . SER A 1 469  ? 39.842  48.575  -29.554 1.00 37.28  ? 883  SER A N     1 
ATOM   3411 C  CA    . SER A 1 469  ? 39.107  48.224  -28.339 1.00 37.15  ? 883  SER A CA    1 
ATOM   3412 C  C     . SER A 1 469  ? 39.198  49.299  -27.262 1.00 36.78  ? 883  SER A C     1 
ATOM   3413 O  O     . SER A 1 469  ? 38.194  49.650  -26.657 1.00 36.92  ? 883  SER A O     1 
ATOM   3414 C  CB    . SER A 1 469  ? 39.580  46.898  -27.767 1.00 36.55  ? 883  SER A CB    1 
ATOM   3415 O  OG    . SER A 1 469  ? 38.834  46.616  -26.596 1.00 35.29  ? 883  SER A OG    1 
ATOM   3416 N  N     . LEU A 1 470  ? 40.404  49.804  -27.018 1.00 36.47  ? 884  LEU A N     1 
ATOM   3417 C  CA    . LEU A 1 470  ? 40.612  50.883  -26.068 1.00 36.71  ? 884  LEU A CA    1 
ATOM   3418 C  C     . LEU A 1 470  ? 39.848  52.152  -26.452 1.00 36.28  ? 884  LEU A C     1 
ATOM   3419 O  O     . LEU A 1 470  ? 39.147  52.759  -25.624 1.00 35.34  ? 884  LEU A O     1 
ATOM   3420 C  CB    . LEU A 1 470  ? 42.103  51.158  -25.921 1.00 36.81  ? 884  LEU A CB    1 
ATOM   3421 C  CG    . LEU A 1 470  ? 42.691  50.036  -25.063 1.00 39.61  ? 884  LEU A CG    1 
ATOM   3422 C  CD1   . LEU A 1 470  ? 44.193  49.865  -25.281 1.00 41.21  ? 884  LEU A CD1   1 
ATOM   3423 C  CD2   . LEU A 1 470  ? 42.369  50.281  -23.574 1.00 39.93  ? 884  LEU A CD2   1 
ATOM   3424 N  N     . ASP A 1 471  ? 39.969  52.537  -27.717 1.00 35.99  ? 885  ASP A N     1 
ATOM   3425 C  CA    . ASP A 1 471  ? 39.268  53.713  -28.181 1.00 36.05  ? 885  ASP A CA    1 
ATOM   3426 C  C     . ASP A 1 471  ? 37.785  53.508  -28.020 1.00 35.46  ? 885  ASP A C     1 
ATOM   3427 O  O     . ASP A 1 471  ? 37.054  54.468  -27.791 1.00 35.35  ? 885  ASP A O     1 
ATOM   3428 C  CB    . ASP A 1 471  ? 39.606  54.028  -29.639 1.00 36.85  ? 885  ASP A CB    1 
ATOM   3429 C  CG    . ASP A 1 471  ? 41.038  54.500  -29.811 1.00 37.88  ? 885  ASP A CG    1 
ATOM   3430 O  OD1   . ASP A 1 471  ? 41.612  55.046  -28.849 1.00 40.33  ? 885  ASP A OD1   1 
ATOM   3431 O  OD2   . ASP A 1 471  ? 41.588  54.321  -30.903 1.00 39.08  ? 885  ASP A OD2   1 
ATOM   3432 N  N     . ASP A 1 472  ? 37.336  52.262  -28.137 1.00 34.60  ? 886  ASP A N     1 
ATOM   3433 C  CA    . ASP A 1 472  ? 35.917  51.993  -27.965 1.00 34.33  ? 886  ASP A CA    1 
ATOM   3434 C  C     . ASP A 1 472  ? 35.530  51.842  -26.487 1.00 34.09  ? 886  ASP A C     1 
ATOM   3435 O  O     . ASP A 1 472  ? 34.361  51.629  -26.162 1.00 33.92  ? 886  ASP A O     1 
ATOM   3436 C  CB    . ASP A 1 472  ? 35.484  50.757  -28.745 1.00 34.31  ? 886  ASP A CB    1 
ATOM   3437 C  CG    . ASP A 1 472  ? 35.545  50.951  -30.248 1.00 35.45  ? 886  ASP A CG    1 
ATOM   3438 O  OD1   . ASP A 1 472  ? 35.470  52.106  -30.739 1.00 36.56  ? 886  ASP A OD1   1 
ATOM   3439 O  OD2   . ASP A 1 472  ? 35.677  49.921  -30.949 1.00 36.47  ? 886  ASP A OD2   1 
ATOM   3440 N  N     . GLY A 1 473  ? 36.496  51.954  -25.587 1.00 33.53  ? 887  GLY A N     1 
ATOM   3441 C  CA    . GLY A 1 473  ? 36.145  51.964  -24.161 1.00 33.83  ? 887  GLY A CA    1 
ATOM   3442 C  C     . GLY A 1 473  ? 36.235  50.615  -23.450 1.00 33.85  ? 887  GLY A C     1 
ATOM   3443 O  O     . GLY A 1 473  ? 35.685  50.445  -22.350 1.00 34.27  ? 887  GLY A O     1 
ATOM   3444 N  N     . TYR A 1 474  ? 36.934  49.664  -24.069 1.00 33.48  ? 888  TYR A N     1 
ATOM   3445 C  CA    . TYR A 1 474  ? 37.161  48.343  -23.480 1.00 33.66  ? 888  TYR A CA    1 
ATOM   3446 C  C     . TYR A 1 474  ? 38.633  47.998  -23.360 1.00 33.37  ? 888  TYR A C     1 
ATOM   3447 O  O     . TYR A 1 474  ? 39.301  47.781  -24.372 1.00 33.26  ? 888  TYR A O     1 
ATOM   3448 C  CB    . TYR A 1 474  ? 36.519  47.253  -24.325 1.00 33.39  ? 888  TYR A CB    1 
ATOM   3449 C  CG    . TYR A 1 474  ? 35.031  47.245  -24.258 1.00 33.89  ? 888  TYR A CG    1 
ATOM   3450 C  CD1   . TYR A 1 474  ? 34.359  46.384  -23.395 1.00 33.82  ? 888  TYR A CD1   1 
ATOM   3451 C  CD2   . TYR A 1 474  ? 34.278  48.105  -25.053 1.00 35.53  ? 888  TYR A CD2   1 
ATOM   3452 C  CE1   . TYR A 1 474  ? 32.975  46.371  -23.341 1.00 34.42  ? 888  TYR A CE1   1 
ATOM   3453 C  CE2   . TYR A 1 474  ? 32.890  48.097  -24.999 1.00 34.56  ? 888  TYR A CE2   1 
ATOM   3454 C  CZ    . TYR A 1 474  ? 32.255  47.229  -24.145 1.00 33.80  ? 888  TYR A CZ    1 
ATOM   3455 O  OH    . TYR A 1 474  ? 30.886  47.229  -24.085 1.00 36.01  ? 888  TYR A OH    1 
ATOM   3456 N  N     . LEU A 1 475  ? 39.134  47.923  -22.130 1.00 33.32  ? 889  LEU A N     1 
ATOM   3457 C  CA    . LEU A 1 475  ? 40.499  47.474  -21.929 1.00 33.58  ? 889  LEU A CA    1 
ATOM   3458 C  C     . LEU A 1 475  ? 40.695  46.017  -22.371 1.00 32.94  ? 889  LEU A C     1 
ATOM   3459 O  O     . LEU A 1 475  ? 39.758  45.223  -22.428 1.00 32.10  ? 889  LEU A O     1 
ATOM   3460 C  CB    . LEU A 1 475  ? 40.986  47.737  -20.498 1.00 33.74  ? 889  LEU A CB    1 
ATOM   3461 C  CG    . LEU A 1 475  ? 40.208  47.197  -19.298 1.00 35.38  ? 889  LEU A CG    1 
ATOM   3462 C  CD1   . LEU A 1 475  ? 40.869  45.924  -18.738 1.00 36.80  ? 889  LEU A CD1   1 
ATOM   3463 C  CD2   . LEU A 1 475  ? 40.090  48.279  -18.210 1.00 34.32  ? 889  LEU A CD2   1 
ATOM   3464 N  N     . VAL A 1 476  ? 41.919  45.670  -22.724 1.00 32.92  ? 890  VAL A N     1 
ATOM   3465 C  CA    . VAL A 1 476  ? 42.162  44.306  -23.183 1.00 33.15  ? 890  VAL A CA    1 
ATOM   3466 C  C     . VAL A 1 476  ? 43.089  43.568  -22.249 1.00 33.45  ? 890  VAL A C     1 
ATOM   3467 O  O     . VAL A 1 476  ? 44.121  44.105  -21.878 1.00 34.47  ? 890  VAL A O     1 
ATOM   3468 C  CB    . VAL A 1 476  ? 42.766  44.314  -24.582 1.00 32.31  ? 890  VAL A CB    1 
ATOM   3469 C  CG1   . VAL A 1 476  ? 43.140  42.911  -25.004 1.00 32.14  ? 890  VAL A CG1   1 
ATOM   3470 C  CG2   . VAL A 1 476  ? 41.756  44.911  -25.549 1.00 32.10  ? 890  VAL A CG2   1 
ATOM   3471 N  N     . GLY A 1 477  ? 42.764  42.335  -21.891 1.00 33.81  ? 891  GLY A N     1 
ATOM   3472 C  CA    . GLY A 1 477  ? 43.671  41.551  -21.042 1.00 34.07  ? 891  GLY A CA    1 
ATOM   3473 C  C     . GLY A 1 477  ? 44.677  40.702  -21.809 1.00 34.65  ? 891  GLY A C     1 
ATOM   3474 O  O     . GLY A 1 477  ? 44.324  40.045  -22.791 1.00 34.98  ? 891  GLY A O     1 
ATOM   3475 N  N     . SER A 1 478  ? 45.917  40.679  -21.320 1.00 34.30  ? 892  SER A N     1 
ATOM   3476 C  CA    . SER A 1 478  ? 47.014  39.909  -21.911 1.00 33.88  ? 892  SER A CA    1 
ATOM   3477 C  C     . SER A 1 478  ? 46.892  38.409  -21.700 1.00 34.82  ? 892  SER A C     1 
ATOM   3478 O  O     . SER A 1 478  ? 46.324  37.983  -20.696 1.00 36.11  ? 892  SER A O     1 
ATOM   3479 C  CB    . SER A 1 478  ? 48.329  40.388  -21.304 1.00 32.88  ? 892  SER A CB    1 
ATOM   3480 O  OG    . SER A 1 478  ? 48.629  41.701  -21.742 1.00 31.53  ? 892  SER A OG    1 
ATOM   3481 N  N     . ARG A 1 479  ? 47.435  37.602  -22.623 1.00 34.61  ? 893  ARG A N     1 
ATOM   3482 C  CA    . ARG A 1 479  ? 47.307  36.158  -22.533 1.00 33.97  ? 893  ARG A CA    1 
ATOM   3483 C  C     . ARG A 1 479  ? 48.419  35.403  -23.285 1.00 34.41  ? 893  ARG A C     1 
ATOM   3484 O  O     . ARG A 1 479  ? 49.045  35.935  -24.197 1.00 34.48  ? 893  ARG A O     1 
ATOM   3485 C  CB    . ARG A 1 479  ? 45.936  35.716  -23.072 1.00 33.96  ? 893  ARG A CB    1 
ATOM   3486 C  CG    . ARG A 1 479  ? 45.521  34.255  -22.705 1.00 32.55  ? 893  ARG A CG    1 
ATOM   3487 C  CD    . ARG A 1 479  ? 44.078  33.964  -23.151 1.00 33.23  ? 893  ARG A CD    1 
ATOM   3488 N  NE    . ARG A 1 479  ? 43.555  32.632  -22.787 1.00 32.43  ? 893  ARG A NE    1 
ATOM   3489 C  CZ    . ARG A 1 479  ? 42.272  32.409  -22.482 1.00 33.08  ? 893  ARG A CZ    1 
ATOM   3490 N  NH1   . ARG A 1 479  ? 41.832  31.186  -22.181 1.00 29.72  ? 893  ARG A NH1   1 
ATOM   3491 N  NH2   . ARG A 1 479  ? 41.414  33.428  -22.479 1.00 31.97  ? 893  ARG A NH2   1 
ATOM   3492 N  N     . GLY A 1 480  ? 48.678  34.162  -22.885 1.00 34.24  ? 894  GLY A N     1 
ATOM   3493 C  CA    . GLY A 1 480  ? 49.456  33.281  -23.723 1.00 34.36  ? 894  GLY A CA    1 
ATOM   3494 C  C     . GLY A 1 480  ? 50.896  33.689  -23.885 1.00 34.59  ? 894  GLY A C     1 
ATOM   3495 O  O     . GLY A 1 480  ? 51.409  34.505  -23.125 1.00 34.78  ? 894  GLY A O     1 
ATOM   3496 N  N     . SER A 1 481  ? 51.546  33.136  -24.902 1.00 34.83  ? 895  SER A N     1 
ATOM   3497 C  CA    . SER A 1 481  ? 52.996  33.190  -24.984 1.00 34.76  ? 895  SER A CA    1 
ATOM   3498 C  C     . SER A 1 481  ? 53.588  34.424  -25.643 1.00 35.10  ? 895  SER A C     1 
ATOM   3499 O  O     . SER A 1 481  ? 54.825  34.539  -25.624 1.00 36.34  ? 895  SER A O     1 
ATOM   3500 C  CB    . SER A 1 481  ? 53.526  31.987  -25.724 1.00 34.38  ? 895  SER A CB    1 
ATOM   3501 O  OG    . SER A 1 481  ? 52.994  32.009  -27.027 1.00 35.05  ? 895  SER A OG    1 
ATOM   3502 N  N     . VAL A 1 482  ? 52.781  35.324  -26.236 1.00 33.97  ? 896  VAL A N     1 
ATOM   3503 C  CA    . VAL A 1 482  ? 53.381  36.543  -26.803 1.00 33.03  ? 896  VAL A CA    1 
ATOM   3504 C  C     . VAL A 1 482  ? 53.924  37.449  -25.745 1.00 32.76  ? 896  VAL A C     1 
ATOM   3505 O  O     . VAL A 1 482  ? 54.666  38.338  -26.071 1.00 33.03  ? 896  VAL A O     1 
ATOM   3506 C  CB    . VAL A 1 482  ? 52.450  37.547  -27.557 1.00 33.53  ? 896  VAL A CB    1 
ATOM   3507 C  CG1   . VAL A 1 482  ? 52.741  37.607  -29.082 1.00 32.25  ? 896  VAL A CG1   1 
ATOM   3508 C  CG2   . VAL A 1 482  ? 51.010  37.468  -27.133 1.00 30.83  ? 896  VAL A CG2   1 
ATOM   3509 N  N     . GLY A 1 483  ? 53.488  37.303  -24.505 1.00 32.98  ? 897  GLY A N     1 
ATOM   3510 C  CA    . GLY A 1 483  ? 54.085  38.095  -23.421 1.00 33.38  ? 897  GLY A CA    1 
ATOM   3511 C  C     . GLY A 1 483  ? 55.578  37.794  -23.278 1.00 33.51  ? 897  GLY A C     1 
ATOM   3512 O  O     . GLY A 1 483  ? 56.286  38.453  -22.523 1.00 33.84  ? 897  GLY A O     1 
ATOM   3513 N  N     . SER A 1 484  ? 56.070  36.805  -24.020 1.00 33.41  ? 898  SER A N     1 
ATOM   3514 C  CA    . SER A 1 484  ? 57.487  36.475  -23.953 1.00 33.38  ? 898  SER A CA    1 
ATOM   3515 C  C     . SER A 1 484  ? 58.306  37.408  -24.849 1.00 33.54  ? 898  SER A C     1 
ATOM   3516 O  O     . SER A 1 484  ? 59.540  37.316  -24.901 1.00 32.81  ? 898  SER A O     1 
ATOM   3517 C  CB    . SER A 1 484  ? 57.709  35.018  -24.360 1.00 33.32  ? 898  SER A CB    1 
ATOM   3518 O  OG    . SER A 1 484  ? 56.721  34.192  -23.775 1.00 33.47  ? 898  SER A OG    1 
ATOM   3519 N  N     . SER A 1 485  ? 57.618  38.321  -25.543 1.00 34.09  ? 899  SER A N     1 
ATOM   3520 C  CA    . SER A 1 485  ? 58.265  39.125  -26.570 1.00 33.95  ? 899  SER A CA    1 
ATOM   3521 C  C     . SER A 1 485  ? 58.281  40.603  -26.264 1.00 34.25  ? 899  SER A C     1 
ATOM   3522 O  O     . SER A 1 485  ? 57.246  41.252  -26.313 1.00 35.12  ? 899  SER A O     1 
ATOM   3523 C  CB    . SER A 1 485  ? 57.559  38.918  -27.899 1.00 34.17  ? 899  SER A CB    1 
ATOM   3524 O  OG    . SER A 1 485  ? 57.967  39.929  -28.800 1.00 35.73  ? 899  SER A OG    1 
ATOM   3525 N  N     . PHE A 1 486  ? 59.455  41.157  -25.977 1.00 34.61  ? 900  PHE A N     1 
ATOM   3526 C  CA    . PHE A 1 486  ? 59.569  42.600  -25.713 1.00 34.49  ? 900  PHE A CA    1 
ATOM   3527 C  C     . PHE A 1 486  ? 59.039  43.470  -26.874 1.00 34.70  ? 900  PHE A C     1 
ATOM   3528 O  O     . PHE A 1 486  ? 58.475  44.559  -26.660 1.00 34.91  ? 900  PHE A O     1 
ATOM   3529 C  CB    . PHE A 1 486  ? 61.015  42.958  -25.346 1.00 34.26  ? 900  PHE A CB    1 
ATOM   3530 C  CG    . PHE A 1 486  ? 61.240  44.423  -25.074 1.00 33.98  ? 900  PHE A CG    1 
ATOM   3531 C  CD1   . PHE A 1 486  ? 60.782  45.004  -23.899 1.00 33.31  ? 900  PHE A CD1   1 
ATOM   3532 C  CD2   . PHE A 1 486  ? 61.923  45.209  -25.984 1.00 32.09  ? 900  PHE A CD2   1 
ATOM   3533 C  CE1   . PHE A 1 486  ? 60.986  46.351  -23.643 1.00 33.58  ? 900  PHE A CE1   1 
ATOM   3534 C  CE2   . PHE A 1 486  ? 62.134  46.548  -25.740 1.00 34.05  ? 900  PHE A CE2   1 
ATOM   3535 C  CZ    . PHE A 1 486  ? 61.679  47.126  -24.560 1.00 34.01  ? 900  PHE A CZ    1 
ATOM   3536 N  N     . VAL A 1 487  ? 59.195  43.000  -28.106 1.00 34.85  ? 901  VAL A N     1 
ATOM   3537 C  CA    . VAL A 1 487  ? 58.617  43.735  -29.232 1.00 35.06  ? 901  VAL A CA    1 
ATOM   3538 C  C     . VAL A 1 487  ? 57.088  43.806  -29.049 1.00 35.77  ? 901  VAL A C     1 
ATOM   3539 O  O     . VAL A 1 487  ? 56.456  44.843  -29.328 1.00 35.38  ? 901  VAL A O     1 
ATOM   3540 C  CB    . VAL A 1 487  ? 58.976  43.091  -30.587 1.00 35.28  ? 901  VAL A CB    1 
ATOM   3541 C  CG1   . VAL A 1 487  ? 58.180  43.724  -31.724 1.00 34.71  ? 901  VAL A CG1   1 
ATOM   3542 C  CG2   . VAL A 1 487  ? 60.481  43.210  -30.855 1.00 36.28  ? 901  VAL A CG2   1 
ATOM   3543 N  N     . ALA A 1 488  ? 56.496  42.710  -28.556 1.00 35.77  ? 902  ALA A N     1 
ATOM   3544 C  CA    . ALA A 1 488  ? 55.068  42.718  -28.259 1.00 36.47  ? 902  ALA A CA    1 
ATOM   3545 C  C     . ALA A 1 488  ? 54.747  43.721  -27.134 1.00 36.84  ? 902  ALA A C     1 
ATOM   3546 O  O     . ALA A 1 488  ? 53.705  44.393  -27.156 1.00 37.34  ? 902  ALA A O     1 
ATOM   3547 C  CB    . ALA A 1 488  ? 54.580  41.319  -27.886 1.00 36.27  ? 902  ALA A CB    1 
ATOM   3548 N  N     . THR A 1 489  ? 55.619  43.816  -26.133 1.00 36.54  ? 903  THR A N     1 
ATOM   3549 C  CA    . THR A 1 489  ? 55.417  44.827  -25.092 1.00 35.99  ? 903  THR A CA    1 
ATOM   3550 C  C     . THR A 1 489  ? 55.424  46.191  -25.778 1.00 36.33  ? 903  THR A C     1 
ATOM   3551 O  O     . THR A 1 489  ? 54.499  46.979  -25.655 1.00 36.25  ? 903  THR A O     1 
ATOM   3552 C  CB    . THR A 1 489  ? 56.526  44.751  -24.017 1.00 35.68  ? 903  THR A CB    1 
ATOM   3553 O  OG1   . THR A 1 489  ? 56.693  43.380  -23.609 1.00 34.88  ? 903  THR A OG1   1 
ATOM   3554 C  CG2   . THR A 1 489  ? 56.188  45.635  -22.787 1.00 34.90  ? 903  THR A CG2   1 
ATOM   3555 N  N     . MET A 1 490  ? 56.472  46.463  -26.537 1.00 36.99  ? 904  MET A N     1 
ATOM   3556 C  CA    . MET A 1 490  ? 56.599  47.766  -27.190 1.00 37.33  ? 904  MET A CA    1 
ATOM   3557 C  C     . MET A 1 490  ? 55.490  48.092  -28.186 1.00 37.58  ? 904  MET A C     1 
ATOM   3558 O  O     . MET A 1 490  ? 55.229  49.266  -28.455 1.00 37.53  ? 904  MET A O     1 
ATOM   3559 C  CB    . MET A 1 490  ? 57.955  47.862  -27.881 1.00 37.55  ? 904  MET A CB    1 
ATOM   3560 C  CG    . MET A 1 490  ? 59.127  47.833  -26.888 1.00 37.74  ? 904  MET A CG    1 
ATOM   3561 S  SD    . MET A 1 490  ? 58.963  49.180  -25.700 1.00 37.26  ? 904  MET A SD    1 
ATOM   3562 C  CE    . MET A 1 490  ? 58.153  48.395  -24.314 1.00 33.72  ? 904  MET A CE    1 
ATOM   3563 N  N     . THR A 1 491  ? 54.848  47.067  -28.750 1.00 38.17  ? 905  THR A N     1 
ATOM   3564 C  CA    . THR A 1 491  ? 53.737  47.302  -29.694 1.00 38.49  ? 905  THR A CA    1 
ATOM   3565 C  C     . THR A 1 491  ? 52.348  47.268  -29.031 1.00 38.33  ? 905  THR A C     1 
ATOM   3566 O  O     . THR A 1 491  ? 51.322  47.345  -29.702 1.00 37.75  ? 905  THR A O     1 
ATOM   3567 C  CB    . THR A 1 491  ? 53.777  46.330  -30.901 1.00 38.52  ? 905  THR A CB    1 
ATOM   3568 O  OG1   . THR A 1 491  ? 53.727  44.981  -30.422 1.00 40.76  ? 905  THR A OG1   1 
ATOM   3569 C  CG2   . THR A 1 491  ? 55.036  46.541  -31.729 1.00 37.18  ? 905  THR A CG2   1 
ATOM   3570 N  N     . GLU A 1 492  ? 52.333  47.138  -27.711 1.00 38.88  ? 906  GLU A N     1 
ATOM   3571 C  CA    . GLU A 1 492  ? 51.106  47.234  -26.925 1.00 39.78  ? 906  GLU A CA    1 
ATOM   3572 C  C     . GLU A 1 492  ? 50.085  46.132  -27.221 1.00 39.41  ? 906  GLU A C     1 
ATOM   3573 O  O     . GLU A 1 492  ? 48.865  46.341  -27.251 1.00 39.74  ? 906  GLU A O     1 
ATOM   3574 C  CB    . GLU A 1 492  ? 50.534  48.654  -26.995 1.00 39.79  ? 906  GLU A CB    1 
ATOM   3575 C  CG    . GLU A 1 492  ? 51.536  49.647  -26.411 1.00 42.86  ? 906  GLU A CG    1 
ATOM   3576 C  CD    . GLU A 1 492  ? 51.008  51.075  -26.286 1.00 47.35  ? 906  GLU A CD    1 
ATOM   3577 O  OE1   . GLU A 1 492  ? 50.434  51.596  -27.271 1.00 48.67  ? 906  GLU A OE1   1 
ATOM   3578 O  OE2   . GLU A 1 492  ? 51.190  51.678  -25.202 1.00 48.33  ? 906  GLU A OE2   1 
ATOM   3579 N  N     . ILE A 1 493  ? 50.642  44.943  -27.362 1.00 38.91  ? 907  ILE A N     1 
ATOM   3580 C  CA    . ILE A 1 493  ? 49.936  43.712  -27.631 1.00 38.87  ? 907  ILE A CA    1 
ATOM   3581 C  C     . ILE A 1 493  ? 49.919  42.851  -26.358 1.00 38.13  ? 907  ILE A C     1 
ATOM   3582 O  O     . ILE A 1 493  ? 49.246  41.822  -26.281 1.00 37.84  ? 907  ILE A O     1 
ATOM   3583 C  CB    . ILE A 1 493  ? 50.600  43.062  -28.886 1.00 40.37  ? 907  ILE A CB    1 
ATOM   3584 C  CG1   . ILE A 1 493  ? 49.717  43.342  -30.098 1.00 41.24  ? 907  ILE A CG1   1 
ATOM   3585 C  CG2   . ILE A 1 493  ? 51.012  41.576  -28.739 1.00 39.81  ? 907  ILE A CG2   1 
ATOM   3586 C  CD1   . ILE A 1 493  ? 49.457  44.834  -30.252 1.00 43.93  ? 907  ILE A CD1   1 
ATOM   3587 N  N     . THR A 1 494  ? 50.606  43.345  -25.330 1.00 36.97  ? 908  THR A N     1 
ATOM   3588 C  CA    . THR A 1 494  ? 50.728  42.669  -24.047 1.00 36.48  ? 908  THR A CA    1 
ATOM   3589 C  C     . THR A 1 494  ? 51.170  43.690  -23.002 1.00 36.23  ? 908  THR A C     1 
ATOM   3590 O  O     . THR A 1 494  ? 51.873  44.649  -23.315 1.00 36.48  ? 908  THR A O     1 
ATOM   3591 C  CB    . THR A 1 494  ? 51.748  41.464  -24.108 1.00 36.06  ? 908  THR A CB    1 
ATOM   3592 O  OG1   . THR A 1 494  ? 51.845  40.832  -22.823 1.00 35.88  ? 908  THR A OG1   1 
ATOM   3593 C  CG2   . THR A 1 494  ? 53.111  41.931  -24.501 1.00 35.35  ? 908  THR A CG2   1 
ATOM   3594 N  N     . GLU A 1 495  ? 50.747  43.511  -21.763 1.00 36.19  ? 909  GLU A N     1 
ATOM   3595 C  CA    . GLU A 1 495  ? 51.255  44.371  -20.680 1.00 36.13  ? 909  GLU A CA    1 
ATOM   3596 C  C     . GLU A 1 495  ? 52.424  43.690  -19.976 1.00 34.98  ? 909  GLU A C     1 
ATOM   3597 O  O     . GLU A 1 495  ? 52.993  44.234  -19.033 1.00 35.27  ? 909  GLU A O     1 
ATOM   3598 C  CB    . GLU A 1 495  ? 50.165  44.657  -19.650 1.00 36.46  ? 909  GLU A CB    1 
ATOM   3599 C  CG    . GLU A 1 495  ? 49.097  45.615  -20.137 1.00 39.31  ? 909  GLU A CG    1 
ATOM   3600 C  CD    . GLU A 1 495  ? 48.129  45.981  -19.028 1.00 43.90  ? 909  GLU A CD    1 
ATOM   3601 O  OE1   . GLU A 1 495  ? 47.343  45.096  -18.582 1.00 43.31  ? 909  GLU A OE1   1 
ATOM   3602 O  OE2   . GLU A 1 495  ? 48.161  47.161  -18.610 1.00 46.21  ? 909  GLU A OE2   1 
ATOM   3603 N  N     . VAL A 1 496  ? 52.767  42.487  -20.415 1.00 33.13  ? 910  VAL A N     1 
ATOM   3604 C  CA    . VAL A 1 496  ? 53.865  41.779  -19.792 1.00 31.83  ? 910  VAL A CA    1 
ATOM   3605 C  C     . VAL A 1 496  ? 55.193  42.260  -20.398 1.00 31.16  ? 910  VAL A C     1 
ATOM   3606 O  O     . VAL A 1 496  ? 55.397  42.200  -21.616 1.00 29.84  ? 910  VAL A O     1 
ATOM   3607 C  CB    . VAL A 1 496  ? 53.693  40.248  -19.951 1.00 32.16  ? 910  VAL A CB    1 
ATOM   3608 C  CG1   . VAL A 1 496  ? 54.862  39.488  -19.328 1.00 30.47  ? 910  VAL A CG1   1 
ATOM   3609 C  CG2   . VAL A 1 496  ? 52.351  39.803  -19.361 1.00 30.95  ? 910  VAL A CG2   1 
ATOM   3610 N  N     . ASN A 1 497  ? 56.073  42.790  -19.552 1.00 30.94  ? 911  ASN A N     1 
ATOM   3611 C  CA    . ASN A 1 497  ? 57.383  43.193  -20.016 1.00 31.61  ? 911  ASN A CA    1 
ATOM   3612 C  C     . ASN A 1 497  ? 58.349  42.095  -19.618 1.00 31.70  ? 911  ASN A C     1 
ATOM   3613 O  O     . ASN A 1 497  ? 58.510  41.839  -18.430 1.00 31.81  ? 911  ASN A O     1 
ATOM   3614 C  CB    . ASN A 1 497  ? 57.794  44.533  -19.409 1.00 31.97  ? 911  ASN A CB    1 
ATOM   3615 C  CG    . ASN A 1 497  ? 59.185  44.974  -19.852 1.00 33.23  ? 911  ASN A CG    1 
ATOM   3616 O  OD1   . ASN A 1 497  ? 59.399  46.139  -20.215 1.00 33.70  ? 911  ASN A OD1   1 
ATOM   3617 N  ND2   . ASN A 1 497  ? 60.140  44.038  -19.837 1.00 33.83  ? 911  ASN A ND2   1 
ATOM   3618 N  N     . PRO A 1 498  ? 58.985  41.438  -20.607 1.00 31.57  ? 912  PRO A N     1 
ATOM   3619 C  CA    . PRO A 1 498  ? 59.773  40.232  -20.355 1.00 31.94  ? 912  PRO A CA    1 
ATOM   3620 C  C     . PRO A 1 498  ? 61.232  40.459  -20.050 1.00 32.53  ? 912  PRO A C     1 
ATOM   3621 O  O     . PRO A 1 498  ? 61.951  39.490  -19.822 1.00 32.68  ? 912  PRO A O     1 
ATOM   3622 C  CB    . PRO A 1 498  ? 59.689  39.491  -21.677 1.00 32.67  ? 912  PRO A CB    1 
ATOM   3623 C  CG    . PRO A 1 498  ? 59.599  40.605  -22.721 1.00 31.88  ? 912  PRO A CG    1 
ATOM   3624 C  CD    . PRO A 1 498  ? 58.922  41.775  -22.038 1.00 31.21  ? 912  PRO A CD    1 
ATOM   3625 N  N     . LEU A 1 499  ? 61.688  41.706  -20.087 1.00 33.00  ? 913  LEU A N     1 
ATOM   3626 C  CA    . LEU A 1 499  ? 63.084  41.994  -19.768 1.00 33.57  ? 913  LEU A CA    1 
ATOM   3627 C  C     . LEU A 1 499  ? 63.367  41.541  -18.328 1.00 34.32  ? 913  LEU A C     1 
ATOM   3628 O  O     . LEU A 1 499  ? 62.426  41.270  -17.562 1.00 34.08  ? 913  LEU A O     1 
ATOM   3629 C  CB    . LEU A 1 499  ? 63.377  43.495  -19.920 1.00 33.18  ? 913  LEU A CB    1 
ATOM   3630 C  CG    . LEU A 1 499  ? 63.116  44.147  -21.283 1.00 33.40  ? 913  LEU A CG    1 
ATOM   3631 C  CD1   . LEU A 1 499  ? 63.404  45.636  -21.235 1.00 33.27  ? 913  LEU A CD1   1 
ATOM   3632 C  CD2   . LEU A 1 499  ? 63.958  43.512  -22.350 1.00 30.61  ? 913  LEU A CD2   1 
ATOM   3633 N  N     . PRO A 1 500  ? 64.659  41.462  -17.951 1.00 34.83  ? 914  PRO A N     1 
ATOM   3634 C  CA    . PRO A 1 500  ? 64.988  41.210  -16.551 1.00 35.83  ? 914  PRO A CA    1 
ATOM   3635 C  C     . PRO A 1 500  ? 64.435  42.344  -15.692 1.00 36.49  ? 914  PRO A C     1 
ATOM   3636 O  O     . PRO A 1 500  ? 64.108  43.402  -16.223 1.00 36.17  ? 914  PRO A O     1 
ATOM   3637 C  CB    . PRO A 1 500  ? 66.523  41.226  -16.531 1.00 35.35  ? 914  PRO A CB    1 
ATOM   3638 C  CG    . PRO A 1 500  ? 66.941  40.987  -17.945 1.00 34.80  ? 914  PRO A CG    1 
ATOM   3639 C  CD    . PRO A 1 500  ? 65.864  41.642  -18.775 1.00 35.03  ? 914  PRO A CD    1 
ATOM   3640 N  N     . PRO A 1 501  ? 64.339  42.128  -14.372 1.00 37.36  ? 915  PRO A N     1 
ATOM   3641 C  CA    . PRO A 1 501  ? 63.726  43.108  -13.471 1.00 38.14  ? 915  PRO A CA    1 
ATOM   3642 C  C     . PRO A 1 501  ? 64.532  44.383  -13.476 1.00 39.01  ? 915  PRO A C     1 
ATOM   3643 O  O     . PRO A 1 501  ? 65.747  44.354  -13.685 1.00 39.57  ? 915  PRO A O     1 
ATOM   3644 C  CB    . PRO A 1 501  ? 63.825  42.445  -12.093 1.00 38.12  ? 915  PRO A CB    1 
ATOM   3645 C  CG    . PRO A 1 501  ? 64.115  40.977  -12.379 1.00 38.24  ? 915  PRO A CG    1 
ATOM   3646 C  CD    . PRO A 1 501  ? 64.947  41.013  -13.636 1.00 37.32  ? 915  PRO A CD    1 
ATOM   3647 N  N     . HIS A 1 502  ? 63.877  45.508  -13.258 1.00 39.72  ? 916  HIS A N     1 
ATOM   3648 C  CA    . HIS A 1 502  ? 64.577  46.745  -13.416 1.00 40.38  ? 916  HIS A CA    1 
ATOM   3649 C  C     . HIS A 1 502  ? 63.752  47.915  -12.929 1.00 41.12  ? 916  HIS A C     1 
ATOM   3650 O  O     . HIS A 1 502  ? 62.525  47.820  -12.827 1.00 41.81  ? 916  HIS A O     1 
ATOM   3651 C  CB    . HIS A 1 502  ? 64.949  46.930  -14.886 1.00 40.17  ? 916  HIS A CB    1 
ATOM   3652 C  CG    . HIS A 1 502  ? 63.777  46.931  -15.827 1.00 41.17  ? 916  HIS A CG    1 
ATOM   3653 N  ND1   . HIS A 1 502  ? 63.308  45.788  -16.442 1.00 41.34  ? 916  HIS A ND1   1 
ATOM   3654 C  CD2   . HIS A 1 502  ? 63.016  47.946  -16.304 1.00 41.61  ? 916  HIS A CD2   1 
ATOM   3655 C  CE1   . HIS A 1 502  ? 62.291  46.095  -17.229 1.00 40.13  ? 916  HIS A CE1   1 
ATOM   3656 N  NE2   . HIS A 1 502  ? 62.095  47.398  -17.168 1.00 39.42  ? 916  HIS A NE2   1 
ATOM   3657 N  N     . TYR A 1 503  ? 64.441  49.011  -12.622 1.00 41.26  ? 917  TYR A N     1 
ATOM   3658 C  CA    . TYR A 1 503  ? 63.804  50.286  -12.362 1.00 41.56  ? 917  TYR A CA    1 
ATOM   3659 C  C     . TYR A 1 503  ? 63.905  51.102  -13.643 1.00 42.15  ? 917  TYR A C     1 
ATOM   3660 O  O     . TYR A 1 503  ? 64.880  50.944  -14.383 1.00 42.47  ? 917  TYR A O     1 
ATOM   3661 C  CB    . TYR A 1 503  ? 64.564  51.013  -11.271 1.00 41.03  ? 917  TYR A CB    1 
ATOM   3662 C  CG    . TYR A 1 503  ? 64.455  50.423  -9.884  1.00 41.46  ? 917  TYR A CG    1 
ATOM   3663 C  CD1   . TYR A 1 503  ? 65.575  49.909  -9.231  1.00 41.90  ? 917  TYR A CD1   1 
ATOM   3664 C  CD2   . TYR A 1 503  ? 63.240  50.400  -9.208  1.00 41.66  ? 917  TYR A CD2   1 
ATOM   3665 C  CE1   . TYR A 1 503  ? 65.483  49.383  -7.934  1.00 41.76  ? 917  TYR A CE1   1 
ATOM   3666 C  CE2   . TYR A 1 503  ? 63.137  49.888  -7.920  1.00 41.50  ? 917  TYR A CE2   1 
ATOM   3667 C  CZ    . TYR A 1 503  ? 64.257  49.381  -7.281  1.00 41.84  ? 917  TYR A CZ    1 
ATOM   3668 O  OH    . TYR A 1 503  ? 64.138  48.877  -5.992  1.00 41.69  ? 917  TYR A OH    1 
ATOM   3669 N  N     . VAL A 1 504  ? 62.918  51.964  -13.916 1.00 42.54  ? 918  VAL A N     1 
ATOM   3670 C  CA    . VAL A 1 504  ? 63.046  52.964  -14.994 1.00 42.89  ? 918  VAL A CA    1 
ATOM   3671 C  C     . VAL A 1 504  ? 62.382  54.260  -14.582 1.00 43.23  ? 918  VAL A C     1 
ATOM   3672 O  O     . VAL A 1 504  ? 61.248  54.240  -14.124 1.00 43.56  ? 918  VAL A O     1 
ATOM   3673 C  CB    . VAL A 1 504  ? 62.314  52.570  -16.283 1.00 42.59  ? 918  VAL A CB    1 
ATOM   3674 C  CG1   . VAL A 1 504  ? 63.184  52.866  -17.491 1.00 42.43  ? 918  VAL A CG1   1 
ATOM   3675 C  CG2   . VAL A 1 504  ? 61.888  51.145  -16.243 1.00 42.61  ? 918  VAL A CG2   1 
ATOM   3676 N  N     . CYS A 1 505  ? 63.052  55.386  -14.783 1.00 43.78  ? 919  CYS A N     1 
ATOM   3677 C  CA    . CYS A 1 505  ? 62.456  56.682  -14.419 1.00 44.83  ? 919  CYS A CA    1 
ATOM   3678 C  C     . CYS A 1 505  ? 61.480  57.200  -15.485 1.00 45.08  ? 919  CYS A C     1 
ATOM   3679 O  O     . CYS A 1 505  ? 61.833  57.342  -16.652 1.00 45.32  ? 919  CYS A O     1 
ATOM   3680 C  CB    . CYS A 1 505  ? 63.532  57.731  -14.144 1.00 44.41  ? 919  CYS A CB    1 
ATOM   3681 S  SG    . CYS A 1 505  ? 62.847  59.309  -13.548 1.00 46.27  ? 919  CYS A SG    1 
ATOM   3682 N  N     . PRO A 1 506  ? 60.230  57.460  -15.091 1.00 45.36  ? 920  PRO A N     1 
ATOM   3683 C  CA    . PRO A 1 506  ? 59.205  57.849  -16.055 1.00 45.63  ? 920  PRO A CA    1 
ATOM   3684 C  C     . PRO A 1 506  ? 59.443  59.263  -16.544 1.00 46.32  ? 920  PRO A C     1 
ATOM   3685 O  O     . PRO A 1 506  ? 58.714  59.776  -17.390 1.00 46.44  ? 920  PRO A O     1 
ATOM   3686 C  CB    . PRO A 1 506  ? 57.916  57.775  -15.246 1.00 45.30  ? 920  PRO A CB    1 
ATOM   3687 C  CG    . PRO A 1 506  ? 58.341  57.974  -13.840 1.00 45.37  ? 920  PRO A CG    1 
ATOM   3688 C  CD    . PRO A 1 506  ? 59.762  57.520  -13.701 1.00 45.17  ? 920  PRO A CD    1 
ATOM   3689 N  N     . ASN A 1 507  ? 60.491  59.876  -16.021 1.00 47.04  ? 921  ASN A N     1 
ATOM   3690 C  CA    . ASN A 1 507  ? 60.746  61.262  -16.281 1.00 47.69  ? 921  ASN A CA    1 
ATOM   3691 C  C     . ASN A 1 507  ? 62.060  61.469  -17.004 1.00 48.11  ? 921  ASN A C     1 
ATOM   3692 O  O     . ASN A 1 507  ? 62.100  62.074  -18.086 1.00 48.47  ? 921  ASN A O     1 
ATOM   3693 C  CB    . ASN A 1 507  ? 60.784  62.030  -14.969 1.00 47.78  ? 921  ASN A CB    1 
ATOM   3694 C  CG    . ASN A 1 507  ? 61.249  63.458  -15.156 1.00 48.35  ? 921  ASN A CG    1 
ATOM   3695 O  OD1   . ASN A 1 507  ? 62.264  63.874  -14.596 1.00 48.70  ? 921  ASN A OD1   1 
ATOM   3696 N  ND2   . ASN A 1 507  ? 60.503  64.223  -15.952 1.00 47.76  ? 921  ASN A ND2   1 
ATOM   3697 N  N     . CYS A 1 508  ? 63.137  60.976  -16.401 1.00 48.07  ? 922  CYS A N     1 
ATOM   3698 C  CA    . CYS A 1 508  ? 64.468  61.184  -16.961 1.00 47.97  ? 922  CYS A CA    1 
ATOM   3699 C  C     . CYS A 1 508  ? 65.015  59.962  -17.725 1.00 48.09  ? 922  CYS A C     1 
ATOM   3700 O  O     . CYS A 1 508  ? 66.106  60.023  -18.286 1.00 48.22  ? 922  CYS A O     1 
ATOM   3701 C  CB    . CYS A 1 508  ? 65.447  61.615  -15.869 1.00 47.62  ? 922  CYS A CB    1 
ATOM   3702 S  SG    . CYS A 1 508  ? 66.388  60.239  -15.210 1.00 46.63  ? 922  CYS A SG    1 
ATOM   3703 N  N     . LYS A 1 509  ? 64.262  58.865  -17.754 1.00 48.19  ? 923  LYS A N     1 
ATOM   3704 C  CA    . LYS A 1 509  ? 64.672  57.662  -18.510 1.00 48.45  ? 923  LYS A CA    1 
ATOM   3705 C  C     . LYS A 1 509  ? 65.827  56.786  -17.985 1.00 48.12  ? 923  LYS A C     1 
ATOM   3706 O  O     . LYS A 1 509  ? 66.156  55.804  -18.619 1.00 47.72  ? 923  LYS A O     1 
ATOM   3707 C  CB    . LYS A 1 509  ? 65.034  58.038  -19.938 1.00 48.91  ? 923  LYS A CB    1 
ATOM   3708 C  CG    . LYS A 1 509  ? 63.910  57.890  -20.885 1.00 49.43  ? 923  LYS A CG    1 
ATOM   3709 C  CD    . LYS A 1 509  ? 62.883  58.916  -20.599 1.00 50.33  ? 923  LYS A CD    1 
ATOM   3710 C  CE    . LYS A 1 509  ? 62.487  59.516  -21.949 1.00 50.53  ? 923  LYS A CE    1 
ATOM   3711 N  NZ    . LYS A 1 509  ? 61.199  60.252  -21.941 1.00 51.26  ? 923  LYS A NZ    1 
ATOM   3712 N  N     . HIS A 1 510  ? 66.465  57.137  -16.871 1.00 48.36  ? 924  HIS A N     1 
ATOM   3713 C  CA    . HIS A 1 510  ? 67.589  56.325  -16.357 1.00 48.23  ? 924  HIS A CA    1 
ATOM   3714 C  C     . HIS A 1 510  ? 67.089  54.952  -15.897 1.00 48.09  ? 924  HIS A C     1 
ATOM   3715 O  O     . HIS A 1 510  ? 65.974  54.829  -15.378 1.00 48.11  ? 924  HIS A O     1 
ATOM   3716 C  CB    . HIS A 1 510  ? 68.330  57.082  -15.229 1.00 48.41  ? 924  HIS A CB    1 
ATOM   3717 C  CG    . HIS A 1 510  ? 69.399  56.285  -14.530 1.00 48.48  ? 924  HIS A CG    1 
ATOM   3718 N  ND1   . HIS A 1 510  ? 70.699  56.212  -14.989 1.00 48.72  ? 924  HIS A ND1   1 
ATOM   3719 C  CD2   . HIS A 1 510  ? 69.370  55.571  -13.377 1.00 47.96  ? 924  HIS A CD2   1 
ATOM   3720 C  CE1   . HIS A 1 510  ? 71.414  55.460  -14.168 1.00 48.49  ? 924  HIS A CE1   1 
ATOM   3721 N  NE2   . HIS A 1 510  ? 70.632  55.061  -13.180 1.00 48.12  ? 924  HIS A NE2   1 
ATOM   3722 N  N     . SER A 1 511  ? 67.900  53.914  -16.095 1.00 47.86  ? 925  SER A N     1 
ATOM   3723 C  CA    . SER A 1 511  ? 67.489  52.570  -15.689 1.00 47.50  ? 925  SER A CA    1 
ATOM   3724 C  C     . SER A 1 511  ? 68.549  51.817  -14.898 1.00 47.61  ? 925  SER A C     1 
ATOM   3725 O  O     . SER A 1 511  ? 69.739  52.148  -14.944 1.00 47.63  ? 925  SER A O     1 
ATOM   3726 C  CB    . SER A 1 511  ? 67.034  51.736  -16.900 1.00 47.56  ? 925  SER A CB    1 
ATOM   3727 O  OG    . SER A 1 511  ? 68.024  51.660  -17.919 1.00 47.36  ? 925  SER A OG    1 
ATOM   3728 N  N     . GLU A 1 512  ? 68.092  50.824  -14.142 1.00 47.48  ? 926  GLU A N     1 
ATOM   3729 C  CA    . GLU A 1 512  ? 68.976  49.857  -13.507 1.00 47.48  ? 926  GLU A CA    1 
ATOM   3730 C  C     . GLU A 1 512  ? 68.355  48.475  -13.628 1.00 47.36  ? 926  GLU A C     1 
ATOM   3731 O  O     . GLU A 1 512  ? 67.203  48.272  -13.254 1.00 47.38  ? 926  GLU A O     1 
ATOM   3732 C  CB    . GLU A 1 512  ? 69.308  50.208  -12.036 1.00 47.40  ? 926  GLU A CB    1 
ATOM   3733 C  CG    . GLU A 1 512  ? 68.403  51.237  -11.327 1.00 47.62  ? 926  GLU A CG    1 
ATOM   3734 C  CD    . GLU A 1 512  ? 69.016  51.783  -10.003 1.00 48.66  ? 926  GLU A CD    1 
ATOM   3735 O  OE1   . GLU A 1 512  ? 69.102  53.033  -9.837  1.00 47.02  ? 926  GLU A OE1   1 
ATOM   3736 O  OE2   . GLU A 1 512  ? 69.406  50.961  -9.130  1.00 47.46  ? 926  GLU A OE2   1 
ATOM   3737 N  N     . PHE A 1 513  ? 69.125  47.538  -14.172 1.00 47.28  ? 927  PHE A N     1 
ATOM   3738 C  CA    . PHE A 1 513  ? 68.667  46.177  -14.399 1.00 47.32  ? 927  PHE A CA    1 
ATOM   3739 C  C     . PHE A 1 513  ? 69.377  45.204  -13.486 1.00 48.30  ? 927  PHE A C     1 
ATOM   3740 O  O     . PHE A 1 513  ? 70.537  45.399  -13.151 1.00 48.09  ? 927  PHE A O     1 
ATOM   3741 C  CB    . PHE A 1 513  ? 68.963  45.750  -15.836 1.00 46.83  ? 927  PHE A CB    1 
ATOM   3742 C  CG    . PHE A 1 513  ? 68.070  46.380  -16.860 1.00 44.63  ? 927  PHE A CG    1 
ATOM   3743 C  CD1   . PHE A 1 513  ? 68.320  47.655  -17.317 1.00 42.41  ? 927  PHE A CD1   1 
ATOM   3744 C  CD2   . PHE A 1 513  ? 66.989  45.678  -17.383 1.00 41.42  ? 927  PHE A CD2   1 
ATOM   3745 C  CE1   . PHE A 1 513  ? 67.505  48.226  -18.271 1.00 42.18  ? 927  PHE A CE1   1 
ATOM   3746 C  CE2   . PHE A 1 513  ? 66.180  46.241  -18.326 1.00 40.22  ? 927  PHE A CE2   1 
ATOM   3747 C  CZ    . PHE A 1 513  ? 66.434  47.519  -18.776 1.00 39.96  ? 927  PHE A CZ    1 
ATOM   3748 N  N     . PHE A 1 514  ? 68.694  44.127  -13.121 1.00 49.58  ? 928  PHE A N     1 
ATOM   3749 C  CA    . PHE A 1 514  ? 69.299  43.127  -12.262 1.00 50.88  ? 928  PHE A CA    1 
ATOM   3750 C  C     . PHE A 1 514  ? 69.381  41.748  -12.929 1.00 51.74  ? 928  PHE A C     1 
ATOM   3751 O  O     . PHE A 1 514  ? 68.372  41.067  -13.123 1.00 51.84  ? 928  PHE A O     1 
ATOM   3752 C  CB    . PHE A 1 514  ? 68.557  43.085  -10.924 1.00 50.77  ? 928  PHE A CB    1 
ATOM   3753 C  CG    . PHE A 1 514  ? 68.464  44.428  -10.252 1.00 51.77  ? 928  PHE A CG    1 
ATOM   3754 C  CD1   . PHE A 1 514  ? 67.277  45.151  -10.267 1.00 51.76  ? 928  PHE A CD1   1 
ATOM   3755 C  CD2   . PHE A 1 514  ? 69.584  44.989  -9.626  1.00 52.73  ? 928  PHE A CD2   1 
ATOM   3756 C  CE1   . PHE A 1 514  ? 67.199  46.400  -9.656  1.00 51.75  ? 928  PHE A CE1   1 
ATOM   3757 C  CE2   . PHE A 1 514  ? 69.518  46.235  -9.014  1.00 51.87  ? 928  PHE A CE2   1 
ATOM   3758 C  CZ    . PHE A 1 514  ? 68.325  46.942  -9.029  1.00 52.19  ? 928  PHE A CZ    1 
ATOM   3759 N  N     . ASN A 1 515  ? 70.593  41.338  -13.287 1.00 52.87  ? 929  ASN A N     1 
ATOM   3760 C  CA    . ASN A 1 515  ? 70.774  40.027  -13.894 1.00 53.71  ? 929  ASN A CA    1 
ATOM   3761 C  C     . ASN A 1 515  ? 71.336  38.999  -12.928 1.00 54.25  ? 929  ASN A C     1 
ATOM   3762 O  O     . ASN A 1 515  ? 71.653  37.874  -13.312 1.00 54.27  ? 929  ASN A O     1 
ATOM   3763 C  CB    . ASN A 1 515  ? 71.621  40.122  -15.148 1.00 53.69  ? 929  ASN A CB    1 
ATOM   3764 C  CG    . ASN A 1 515  ? 70.821  40.636  -16.328 1.00 54.85  ? 929  ASN A CG    1 
ATOM   3765 O  OD1   . ASN A 1 515  ? 70.567  41.839  -16.448 1.00 54.21  ? 929  ASN A OD1   1 
ATOM   3766 N  ND2   . ASN A 1 515  ? 70.388  39.717  -17.197 1.00 55.29  ? 929  ASN A ND2   1 
ATOM   3767 N  N     . ASP A 1 516  ? 71.427  39.385  -11.661 1.00 54.85  ? 930  ASP A N     1 
ATOM   3768 C  CA    . ASP A 1 516  ? 71.871  38.477  -10.605 1.00 55.79  ? 930  ASP A CA    1 
ATOM   3769 C  C     . ASP A 1 516  ? 71.051  37.185  -10.626 1.00 55.75  ? 930  ASP A C     1 
ATOM   3770 O  O     . ASP A 1 516  ? 71.536  36.126  -10.217 1.00 55.77  ? 930  ASP A O     1 
ATOM   3771 C  CB    . ASP A 1 516  ? 71.719  39.149  -9.232  1.00 56.12  ? 930  ASP A CB    1 
ATOM   3772 C  CG    . ASP A 1 516  ? 71.465  40.650  -9.340  1.00 57.45  ? 930  ASP A CG    1 
ATOM   3773 O  OD1   . ASP A 1 516  ? 72.185  41.343  -10.103 1.00 59.48  ? 930  ASP A OD1   1 
ATOM   3774 O  OD2   . ASP A 1 516  ? 70.536  41.138  -8.662  1.00 58.36  ? 930  ASP A OD2   1 
ATOM   3775 N  N     . GLY A 1 517  ? 69.821  37.279  -11.132 1.00 55.67  ? 931  GLY A N     1 
ATOM   3776 C  CA    . GLY A 1 517  ? 68.881  36.165  -11.101 1.00 55.61  ? 931  GLY A CA    1 
ATOM   3777 C  C     . GLY A 1 517  ? 68.348  36.075  -9.683  1.00 55.82  ? 931  GLY A C     1 
ATOM   3778 O  O     . GLY A 1 517  ? 67.473  35.267  -9.376  1.00 56.13  ? 931  GLY A O     1 
ATOM   3779 N  N     . SER A 1 518  ? 68.881  36.915  -8.802  1.00 55.42  ? 932  SER A N     1 
ATOM   3780 C  CA    . SER A 1 518  ? 68.406  36.905  -7.424  1.00 55.07  ? 932  SER A CA    1 
ATOM   3781 C  C     . SER A 1 518  ? 66.989  37.484  -7.262  1.00 54.47  ? 932  SER A C     1 
ATOM   3782 O  O     . SER A 1 518  ? 66.292  37.145  -6.300  1.00 54.67  ? 932  SER A O     1 
ATOM   3783 C  CB    . SER A 1 518  ? 69.397  37.616  -6.493  1.00 55.26  ? 932  SER A CB    1 
ATOM   3784 O  OG    . SER A 1 518  ? 69.766  38.875  -7.022  1.00 56.04  ? 932  SER A OG    1 
ATOM   3785 N  N     . VAL A 1 519  ? 66.568  38.370  -8.169  1.00 53.24  ? 933  VAL A N     1 
ATOM   3786 C  CA    . VAL A 1 519  ? 65.236  38.985  -8.082  1.00 51.50  ? 933  VAL A CA    1 
ATOM   3787 C  C     . VAL A 1 519  ? 64.304  38.457  -9.168  1.00 50.57  ? 933  VAL A C     1 
ATOM   3788 O  O     . VAL A 1 519  ? 64.619  38.530  -10.367 1.00 50.11  ? 933  VAL A O     1 
ATOM   3789 C  CB    . VAL A 1 519  ? 65.328  40.525  -8.141  1.00 51.54  ? 933  VAL A CB    1 
ATOM   3790 C  CG1   . VAL A 1 519  ? 63.957  41.166  -7.928  1.00 51.57  ? 933  VAL A CG1   1 
ATOM   3791 C  CG2   . VAL A 1 519  ? 66.316  41.016  -7.101  1.00 50.35  ? 933  VAL A CG2   1 
ATOM   3792 N  N     . GLY A 1 520  ? 63.151  37.938  -8.743  1.00 49.35  ? 934  GLY A N     1 
ATOM   3793 C  CA    . GLY A 1 520  ? 62.242  37.225  -9.648  1.00 47.64  ? 934  GLY A CA    1 
ATOM   3794 C  C     . GLY A 1 520  ? 61.495  38.077  -10.660 1.00 46.72  ? 934  GLY A C     1 
ATOM   3795 O  O     . GLY A 1 520  ? 61.393  37.707  -11.833 1.00 45.76  ? 934  GLY A O     1 
ATOM   3796 N  N     . SER A 1 521  ? 60.970  39.208  -10.190 1.00 46.02  ? 935  SER A N     1 
ATOM   3797 C  CA    . SER A 1 521  ? 60.213  40.155  -11.003 1.00 45.59  ? 935  SER A CA    1 
ATOM   3798 C  C     . SER A 1 521  ? 60.493  41.550  -10.522 1.00 45.28  ? 935  SER A C     1 
ATOM   3799 O  O     . SER A 1 521  ? 60.610  41.762  -9.330  1.00 45.08  ? 935  SER A O     1 
ATOM   3800 C  CB    . SER A 1 521  ? 58.706  39.938  -10.835 1.00 45.81  ? 935  SER A CB    1 
ATOM   3801 O  OG    . SER A 1 521  ? 57.972  41.014  -11.414 1.00 44.46  ? 935  SER A OG    1 
ATOM   3802 N  N     . GLY A 1 522  ? 60.554  42.508  -11.438 1.00 45.38  ? 936  GLY A N     1 
ATOM   3803 C  CA    . GLY A 1 522  ? 60.688  43.915  -11.059 1.00 45.60  ? 936  GLY A CA    1 
ATOM   3804 C  C     . GLY A 1 522  ? 59.545  44.364  -10.157 1.00 46.31  ? 936  GLY A C     1 
ATOM   3805 O  O     . GLY A 1 522  ? 59.720  45.263  -9.324  1.00 46.28  ? 936  GLY A O     1 
ATOM   3806 N  N     . PHE A 1 523  ? 58.374  43.730  -10.301 1.00 46.58  ? 937  PHE A N     1 
ATOM   3807 C  CA    . PHE A 1 523  ? 57.208  44.092  -9.493  1.00 46.70  ? 937  PHE A CA    1 
ATOM   3808 C  C     . PHE A 1 523  ? 57.516  43.803  -8.030  1.00 47.01  ? 937  PHE A C     1 
ATOM   3809 O  O     . PHE A 1 523  ? 56.838  44.304  -7.140  1.00 47.00  ? 937  PHE A O     1 
ATOM   3810 C  CB    . PHE A 1 523  ? 55.947  43.333  -9.926  1.00 46.69  ? 937  PHE A CB    1 
ATOM   3811 C  CG    . PHE A 1 523  ? 55.343  43.817  -11.224 1.00 46.55  ? 937  PHE A CG    1 
ATOM   3812 C  CD1   . PHE A 1 523  ? 54.081  43.395  -11.603 1.00 46.15  ? 937  PHE A CD1   1 
ATOM   3813 C  CD2   . PHE A 1 523  ? 56.031  44.686  -12.061 1.00 46.13  ? 937  PHE A CD2   1 
ATOM   3814 C  CE1   . PHE A 1 523  ? 53.507  43.821  -12.795 1.00 46.17  ? 937  PHE A CE1   1 
ATOM   3815 C  CE2   . PHE A 1 523  ? 55.469  45.124  -13.255 1.00 45.97  ? 937  PHE A CE2   1 
ATOM   3816 C  CZ    . PHE A 1 523  ? 54.198  44.692  -13.623 1.00 46.47  ? 937  PHE A CZ    1 
ATOM   3817 N  N     . ASP A 1 524  ? 58.557  43.007  -7.785  1.00 47.16  ? 938  ASP A N     1 
ATOM   3818 C  CA    . ASP A 1 524  ? 58.967  42.679  -6.411  1.00 47.45  ? 938  ASP A CA    1 
ATOM   3819 C  C     . ASP A 1 524  ? 59.842  43.752  -5.773  1.00 47.10  ? 938  ASP A C     1 
ATOM   3820 O  O     . ASP A 1 524  ? 60.054  43.736  -4.567  1.00 47.18  ? 938  ASP A O     1 
ATOM   3821 C  CB    . ASP A 1 524  ? 59.750  41.360  -6.363  1.00 47.84  ? 938  ASP A CB    1 
ATOM   3822 C  CG    . ASP A 1 524  ? 58.898  40.157  -6.697  1.00 48.95  ? 938  ASP A CG    1 
ATOM   3823 O  OD1   . ASP A 1 524  ? 57.664  40.231  -6.510  1.00 49.73  ? 938  ASP A OD1   1 
ATOM   3824 O  OD2   . ASP A 1 524  ? 59.473  39.142  -7.149  1.00 50.19  ? 938  ASP A OD2   1 
ATOM   3825 N  N     . LEU A 1 525  ? 60.373  44.668  -6.572  1.00 46.78  ? 939  LEU A N     1 
ATOM   3826 C  CA    . LEU A 1 525  ? 61.343  45.614  -6.033  1.00 46.43  ? 939  LEU A CA    1 
ATOM   3827 C  C     . LEU A 1 525  ? 60.728  46.511  -4.966  1.00 46.90  ? 939  LEU A C     1 
ATOM   3828 O  O     . LEU A 1 525  ? 59.519  46.756  -4.976  1.00 46.46  ? 939  LEU A O     1 
ATOM   3829 C  CB    . LEU A 1 525  ? 62.009  46.438  -7.153  1.00 45.54  ? 939  LEU A CB    1 
ATOM   3830 C  CG    . LEU A 1 525  ? 62.893  45.620  -8.107  1.00 43.08  ? 939  LEU A CG    1 
ATOM   3831 C  CD1   . LEU A 1 525  ? 63.267  46.406  -9.346  1.00 40.62  ? 939  LEU A CD1   1 
ATOM   3832 C  CD2   . LEU A 1 525  ? 64.146  45.109  -7.420  1.00 40.55  ? 939  LEU A CD2   1 
ATOM   3833 N  N     . PRO A 1 526  ? 61.564  46.988  -4.023  1.00 47.59  ? 940  PRO A N     1 
ATOM   3834 C  CA    . PRO A 1 526  ? 61.083  48.035  -3.134  1.00 47.98  ? 940  PRO A CA    1 
ATOM   3835 C  C     . PRO A 1 526  ? 61.084  49.376  -3.861  1.00 48.59  ? 940  PRO A C     1 
ATOM   3836 O  O     . PRO A 1 526  ? 61.993  49.665  -4.654  1.00 48.31  ? 940  PRO A O     1 
ATOM   3837 C  CB    . PRO A 1 526  ? 62.098  48.030  -1.977  1.00 47.86  ? 940  PRO A CB    1 
ATOM   3838 C  CG    . PRO A 1 526  ? 63.338  47.373  -2.506  1.00 47.28  ? 940  PRO A CG    1 
ATOM   3839 C  CD    . PRO A 1 526  ? 62.983  46.645  -3.789  1.00 47.64  ? 940  PRO A CD    1 
ATOM   3840 N  N     . ASP A 1 527  ? 60.048  50.168  -3.606  1.00 49.65  ? 941  ASP A N     1 
ATOM   3841 C  CA    . ASP A 1 527  ? 59.943  51.511  -4.147  1.00 50.92  ? 941  ASP A CA    1 
ATOM   3842 C  C     . ASP A 1 527  ? 61.266  52.229  -3.966  1.00 51.34  ? 941  ASP A C     1 
ATOM   3843 O  O     . ASP A 1 527  ? 61.932  52.058  -2.943  1.00 51.42  ? 941  ASP A O     1 
ATOM   3844 C  CB    . ASP A 1 527  ? 58.832  52.284  -3.441  1.00 51.28  ? 941  ASP A CB    1 
ATOM   3845 C  CG    . ASP A 1 527  ? 57.474  51.629  -3.611  1.00 53.15  ? 941  ASP A CG    1 
ATOM   3846 O  OD1   . ASP A 1 527  ? 57.167  50.678  -2.850  1.00 55.78  ? 941  ASP A OD1   1 
ATOM   3847 O  OD2   . ASP A 1 527  ? 56.715  52.062  -4.508  1.00 54.54  ? 941  ASP A OD2   1 
ATOM   3848 N  N     . LYS A 1 528  ? 61.637  53.030  -4.961  1.00 51.90  ? 942  LYS A N     1 
ATOM   3849 C  CA    . LYS A 1 528  ? 62.924  53.715  -4.972  1.00 52.55  ? 942  LYS A CA    1 
ATOM   3850 C  C     . LYS A 1 528  ? 62.868  54.905  -5.917  1.00 53.06  ? 942  LYS A C     1 
ATOM   3851 O  O     . LYS A 1 528  ? 62.096  54.918  -6.883  1.00 53.58  ? 942  LYS A O     1 
ATOM   3852 C  CB    . LYS A 1 528  ? 64.028  52.754  -5.418  1.00 52.58  ? 942  LYS A CB    1 
ATOM   3853 C  CG    . LYS A 1 528  ? 65.445  53.281  -5.273  1.00 51.81  ? 942  LYS A CG    1 
ATOM   3854 C  CD    . LYS A 1 528  ? 66.440  52.252  -5.795  1.00 51.66  ? 942  LYS A CD    1 
ATOM   3855 C  CE    . LYS A 1 528  ? 67.757  52.247  -5.024  1.00 52.67  ? 942  LYS A CE    1 
ATOM   3856 N  NZ    . LYS A 1 528  ? 68.817  53.114  -5.632  1.00 52.72  ? 942  LYS A NZ    1 
ATOM   3857 N  N     . ASN A 1 529  ? 63.691  55.906  -5.643  1.00 53.36  ? 943  ASN A N     1 
ATOM   3858 C  CA    . ASN A 1 529  ? 63.696  57.117  -6.451  1.00 53.41  ? 943  ASN A CA    1 
ATOM   3859 C  C     . ASN A 1 529  ? 64.859  57.131  -7.433  1.00 53.45  ? 943  ASN A C     1 
ATOM   3860 O  O     . ASN A 1 529  ? 65.916  56.553  -7.168  1.00 53.23  ? 943  ASN A O     1 
ATOM   3861 C  CB    . ASN A 1 529  ? 63.744  58.356  -5.547  1.00 53.25  ? 943  ASN A CB    1 
ATOM   3862 C  CG    . ASN A 1 529  ? 62.542  58.453  -4.605  1.00 53.72  ? 943  ASN A CG    1 
ATOM   3863 O  OD1   . ASN A 1 529  ? 62.672  58.910  -3.473  1.00 53.98  ? 943  ASN A OD1   1 
ATOM   3864 N  ND2   . ASN A 1 529  ? 61.371  58.028  -5.073  1.00 54.35  ? 943  ASN A ND2   1 
ATOM   3865 N  N     . CYS A 1 530  ? 64.655  57.781  -8.573  1.00 53.83  ? 944  CYS A N     1 
ATOM   3866 C  CA    . CYS A 1 530  ? 65.732  57.968  -9.533  1.00 54.20  ? 944  CYS A CA    1 
ATOM   3867 C  C     . CYS A 1 530  ? 66.820  58.828  -8.889  1.00 55.35  ? 944  CYS A C     1 
ATOM   3868 O  O     . CYS A 1 530  ? 66.597  60.004  -8.556  1.00 55.37  ? 944  CYS A O     1 
ATOM   3869 C  CB    . CYS A 1 530  ? 65.216  58.623  -10.815 1.00 54.14  ? 944  CYS A CB    1 
ATOM   3870 S  SG    . CYS A 1 530  ? 66.489  58.892  -12.099 1.00 51.49  ? 944  CYS A SG    1 
ATOM   3871 N  N     . PRO A 1 531  ? 68.002  58.232  -8.691  1.00 56.06  ? 945  PRO A N     1 
ATOM   3872 C  CA    . PRO A 1 531  ? 69.112  58.947  -8.102  1.00 56.49  ? 945  PRO A CA    1 
ATOM   3873 C  C     . PRO A 1 531  ? 69.704  59.936  -9.101  1.00 56.96  ? 945  PRO A C     1 
ATOM   3874 O  O     . PRO A 1 531  ? 70.889  60.252  -9.023  1.00 56.98  ? 945  PRO A O     1 
ATOM   3875 C  CB    . PRO A 1 531  ? 70.108  57.829  -7.784  1.00 56.47  ? 945  PRO A CB    1 
ATOM   3876 C  CG    . PRO A 1 531  ? 69.843  56.793  -8.796  1.00 56.22  ? 945  PRO A CG    1 
ATOM   3877 C  CD    . PRO A 1 531  ? 68.358  56.850  -9.058  1.00 56.28  ? 945  PRO A CD    1 
ATOM   3878 N  N     . ARG A 1 532  ? 68.885  60.409  -10.037 1.00 57.45  ? 946  ARG A N     1 
ATOM   3879 C  CA    . ARG A 1 532  ? 69.323  61.438  -10.975 1.00 58.11  ? 946  ARG A CA    1 
ATOM   3880 C  C     . ARG A 1 532  ? 68.370  62.632  -11.018 1.00 57.92  ? 946  ARG A C     1 
ATOM   3881 O  O     . ARG A 1 532  ? 68.799  63.776  -10.888 1.00 57.92  ? 946  ARG A O     1 
ATOM   3882 C  CB    . ARG A 1 532  ? 69.532  60.878  -12.390 1.00 58.41  ? 946  ARG A CB    1 
ATOM   3883 C  CG    . ARG A 1 532  ? 70.992  60.565  -12.760 1.00 60.48  ? 946  ARG A CG    1 
ATOM   3884 C  CD    . ARG A 1 532  ? 71.385  61.244  -14.091 1.00 63.27  ? 946  ARG A CD    1 
ATOM   3885 N  NE    . ARG A 1 532  ? 72.209  60.381  -14.941 1.00 65.59  ? 946  ARG A NE    1 
ATOM   3886 C  CZ    . ARG A 1 532  ? 72.739  59.220  -14.550 1.00 66.57  ? 946  ARG A CZ    1 
ATOM   3887 N  NH1   . ARG A 1 532  ? 72.552  58.784  -13.305 1.00 66.24  ? 946  ARG A NH1   1 
ATOM   3888 N  NH2   . ARG A 1 532  ? 73.462  58.497  -15.402 1.00 66.27  ? 946  ARG A NH2   1 
ATOM   3889 N  N     . CYS A 1 533  ? 67.083  62.362  -11.208 1.00 57.70  ? 947  CYS A N     1 
ATOM   3890 C  CA    . CYS A 1 533  ? 66.084  63.430  -11.311 1.00 57.48  ? 947  CYS A CA    1 
ATOM   3891 C  C     . CYS A 1 533  ? 65.268  63.558  -10.010 1.00 57.14  ? 947  CYS A C     1 
ATOM   3892 O  O     . CYS A 1 533  ? 64.487  64.499  -9.837  1.00 57.01  ? 947  CYS A O     1 
ATOM   3893 C  CB    . CYS A 1 533  ? 65.169  63.193  -12.528 1.00 57.45  ? 947  CYS A CB    1 
ATOM   3894 S  SG    . CYS A 1 533  ? 63.816  62.042  -12.214 1.00 58.19  ? 947  CYS A SG    1 
ATOM   3895 N  N     . GLY A 1 534  ? 65.482  62.618  -9.090  1.00 56.83  ? 948  GLY A N     1 
ATOM   3896 C  CA    . GLY A 1 534  ? 64.779  62.600  -7.809  1.00 56.19  ? 948  GLY A CA    1 
ATOM   3897 C  C     . GLY A 1 534  ? 63.470  61.829  -7.850  1.00 55.80  ? 948  GLY A C     1 
ATOM   3898 O  O     . GLY A 1 534  ? 62.996  61.352  -6.831  1.00 55.79  ? 948  GLY A O     1 
ATOM   3899 N  N     . THR A 1 535  ? 62.891  61.694  -9.040  1.00 55.44  ? 949  THR A N     1 
ATOM   3900 C  CA    . THR A 1 535  ? 61.523  61.153  -9.194  1.00 54.82  ? 949  THR A CA    1 
ATOM   3901 C  C     . THR A 1 535  ? 61.319  59.660  -8.851  1.00 54.03  ? 949  THR A C     1 
ATOM   3902 O  O     . THR A 1 535  ? 62.273  58.878  -8.795  1.00 54.00  ? 949  THR A O     1 
ATOM   3903 C  CB    . THR A 1 535  ? 60.969  61.447  -10.611 1.00 54.97  ? 949  THR A CB    1 
ATOM   3904 O  OG1   . THR A 1 535  ? 62.048  61.510  -11.545 1.00 56.33  ? 949  THR A OG1   1 
ATOM   3905 C  CG2   . THR A 1 535  ? 60.240  62.790  -10.636 1.00 55.44  ? 949  THR A CG2   1 
ATOM   3906 N  N     . LYS A 1 536  ? 60.064  59.274  -8.637  1.00 52.93  ? 950  LYS A N     1 
ATOM   3907 C  CA    . LYS A 1 536  ? 59.728  57.906  -8.222  1.00 51.87  ? 950  LYS A CA    1 
ATOM   3908 C  C     . LYS A 1 536  ? 59.896  56.873  -9.354  1.00 51.20  ? 950  LYS A C     1 
ATOM   3909 O  O     . LYS A 1 536  ? 59.215  56.945  -10.386 1.00 50.99  ? 950  LYS A O     1 
ATOM   3910 C  CB    . LYS A 1 536  ? 58.287  57.859  -7.708  1.00 52.07  ? 950  LYS A CB    1 
ATOM   3911 C  CG    . LYS A 1 536  ? 57.819  56.481  -7.165  1.00 52.96  ? 950  LYS A CG    1 
ATOM   3912 C  CD    . LYS A 1 536  ? 57.498  56.536  -5.650  1.00 53.39  ? 950  LYS A CD    1 
ATOM   3913 C  CE    . LYS A 1 536  ? 56.785  55.255  -5.136  1.00 53.90  ? 950  LYS A CE    1 
ATOM   3914 N  NZ    . LYS A 1 536  ? 55.470  54.963  -5.803  1.00 51.78  ? 950  LYS A NZ    1 
ATOM   3915 N  N     . TYR A 1 537  ? 60.780  55.901  -9.146  1.00 49.86  ? 951  TYR A N     1 
ATOM   3916 C  CA    . TYR A 1 537  ? 61.051  54.870  -10.149 1.00 48.87  ? 951  TYR A CA    1 
ATOM   3917 C  C     . TYR A 1 537  ? 59.816  54.032  -10.530 1.00 48.30  ? 951  TYR A C     1 
ATOM   3918 O  O     . TYR A 1 537  ? 58.957  53.754  -9.710  1.00 48.10  ? 951  TYR A O     1 
ATOM   3919 C  CB    . TYR A 1 537  ? 62.104  53.913  -9.608  1.00 48.64  ? 951  TYR A CB    1 
ATOM   3920 C  CG    . TYR A 1 537  ? 63.534  54.096  -10.078 1.00 47.77  ? 951  TYR A CG    1 
ATOM   3921 C  CD1   . TYR A 1 537  ? 63.837  54.327  -11.411 1.00 47.51  ? 951  TYR A CD1   1 
ATOM   3922 C  CD2   . TYR A 1 537  ? 64.591  53.948  -9.187  1.00 46.73  ? 951  TYR A CD2   1 
ATOM   3923 C  CE1   . TYR A 1 537  ? 65.162  54.448  -11.836 1.00 46.59  ? 951  TYR A CE1   1 
ATOM   3924 C  CE2   . TYR A 1 537  ? 65.905  54.061  -9.596  1.00 46.12  ? 951  TYR A CE2   1 
ATOM   3925 C  CZ    . TYR A 1 537  ? 66.187  54.311  -10.920 1.00 46.41  ? 951  TYR A CZ    1 
ATOM   3926 O  OH    . TYR A 1 537  ? 67.497  54.423  -11.317 1.00 46.05  ? 951  TYR A OH    1 
ATOM   3927 N  N     . LYS A 1 538  ? 59.732  53.614  -11.781 1.00 48.01  ? 952  LYS A N     1 
ATOM   3928 C  CA    . LYS A 1 538  ? 58.783  52.566  -12.147 1.00 47.72  ? 952  LYS A CA    1 
ATOM   3929 C  C     . LYS A 1 538  ? 59.481  51.193  -12.105 1.00 47.01  ? 952  LYS A C     1 
ATOM   3930 O  O     . LYS A 1 538  ? 60.695  51.094  -12.329 1.00 46.62  ? 952  LYS A O     1 
ATOM   3931 C  CB    . LYS A 1 538  ? 58.173  52.839  -13.530 1.00 48.19  ? 952  LYS A CB    1 
ATOM   3932 C  CG    . LYS A 1 538  ? 56.647  53.044  -13.566 1.00 51.17  ? 952  LYS A CG    1 
ATOM   3933 C  CD    . LYS A 1 538  ? 56.178  54.499  -13.373 1.00 53.72  ? 952  LYS A CD    1 
ATOM   3934 C  CE    . LYS A 1 538  ? 54.721  54.532  -12.879 1.00 55.23  ? 952  LYS A CE    1 
ATOM   3935 N  NZ    . LYS A 1 538  ? 54.310  55.866  -12.320 1.00 56.81  ? 952  LYS A NZ    1 
ATOM   3936 N  N     . LYS A 1 539  ? 58.722  50.143  -11.794 1.00 46.27  ? 953  LYS A N     1 
ATOM   3937 C  CA    . LYS A 1 539  ? 59.279  48.798  -11.681 1.00 45.48  ? 953  LYS A CA    1 
ATOM   3938 C  C     . LYS A 1 539  ? 58.654  47.889  -12.723 1.00 44.82  ? 953  LYS A C     1 
ATOM   3939 O  O     . LYS A 1 539  ? 57.480  48.047  -13.036 1.00 44.80  ? 953  LYS A O     1 
ATOM   3940 C  CB    . LYS A 1 539  ? 58.987  48.246  -10.295 1.00 45.85  ? 953  LYS A CB    1 
ATOM   3941 C  CG    . LYS A 1 539  ? 58.910  49.325  -9.222  1.00 46.59  ? 953  LYS A CG    1 
ATOM   3942 C  CD    . LYS A 1 539  ? 58.956  48.698  -7.853  1.00 46.79  ? 953  LYS A CD    1 
ATOM   3943 C  CE    . LYS A 1 539  ? 58.179  49.499  -6.835  1.00 47.78  ? 953  LYS A CE    1 
ATOM   3944 N  NZ    . LYS A 1 539  ? 57.772  48.569  -5.738  1.00 48.46  ? 953  LYS A NZ    1 
ATOM   3945 N  N     . ASP A 1 540  ? 59.424  46.932  -13.249 1.00 43.68  ? 954  ASP A N     1 
ATOM   3946 C  CA    . ASP A 1 540  ? 58.954  46.073  -14.336 1.00 42.54  ? 954  ASP A CA    1 
ATOM   3947 C  C     . ASP A 1 540  ? 60.012  45.007  -14.667 1.00 41.81  ? 954  ASP A C     1 
ATOM   3948 O  O     . ASP A 1 540  ? 61.138  45.041  -14.149 1.00 41.61  ? 954  ASP A O     1 
ATOM   3949 C  CB    . ASP A 1 540  ? 58.632  46.931  -15.578 1.00 42.37  ? 954  ASP A CB    1 
ATOM   3950 C  CG    . ASP A 1 540  ? 57.421  46.420  -16.384 1.00 43.06  ? 954  ASP A CG    1 
ATOM   3951 O  OD1   . ASP A 1 540  ? 56.887  47.207  -17.205 1.00 45.29  ? 954  ASP A OD1   1 
ATOM   3952 O  OD2   . ASP A 1 540  ? 57.005  45.249  -16.224 1.00 40.32  ? 954  ASP A OD2   1 
ATOM   3953 N  N     . GLY A 1 541  ? 59.643  44.065  -15.529 1.00 40.93  ? 955  GLY A N     1 
ATOM   3954 C  CA    . GLY A 1 541  ? 60.563  43.027  -16.004 1.00 39.94  ? 955  GLY A CA    1 
ATOM   3955 C  C     . GLY A 1 541  ? 60.320  41.689  -15.309 1.00 39.20  ? 955  GLY A C     1 
ATOM   3956 O  O     . GLY A 1 541  ? 60.529  41.574  -14.101 1.00 38.59  ? 955  GLY A O     1 
ATOM   3957 N  N     . HIS A 1 542  ? 59.876  40.675  -16.057 1.00 38.33  ? 956  HIS A N     1 
ATOM   3958 C  CA    . HIS A 1 542  ? 59.613  39.364  -15.443 1.00 38.08  ? 956  HIS A CA    1 
ATOM   3959 C  C     . HIS A 1 542  ? 60.637  38.305  -15.845 1.00 37.50  ? 956  HIS A C     1 
ATOM   3960 O  O     . HIS A 1 542  ? 60.495  37.143  -15.483 1.00 37.83  ? 956  HIS A O     1 
ATOM   3961 C  CB    . HIS A 1 542  ? 58.165  38.914  -15.694 1.00 36.98  ? 956  HIS A CB    1 
ATOM   3962 C  CG    . HIS A 1 542  ? 57.168  39.991  -15.402 1.00 37.83  ? 956  HIS A CG    1 
ATOM   3963 N  ND1   . HIS A 1 542  ? 56.852  40.375  -14.119 1.00 38.05  ? 956  HIS A ND1   1 
ATOM   3964 C  CD2   . HIS A 1 542  ? 56.467  40.810  -16.222 1.00 38.03  ? 956  HIS A CD2   1 
ATOM   3965 C  CE1   . HIS A 1 542  ? 55.976  41.364  -14.160 1.00 39.02  ? 956  HIS A CE1   1 
ATOM   3966 N  NE2   . HIS A 1 542  ? 55.731  41.652  -15.425 1.00 39.02  ? 956  HIS A NE2   1 
ATOM   3967 N  N     . ASP A 1 543  ? 61.662  38.717  -16.587 1.00 37.41  ? 957  ASP A N     1 
ATOM   3968 C  CA    . ASP A 1 543  ? 62.762  37.809  -17.017 1.00 37.41  ? 957  ASP A CA    1 
ATOM   3969 C  C     . ASP A 1 543  ? 62.268  36.604  -17.785 1.00 37.14  ? 957  ASP A C     1 
ATOM   3970 O  O     . ASP A 1 543  ? 62.438  35.469  -17.343 1.00 37.39  ? 957  ASP A O     1 
ATOM   3971 C  CB    . ASP A 1 543  ? 63.608  37.320  -15.833 1.00 37.08  ? 957  ASP A CB    1 
ATOM   3972 C  CG    . ASP A 1 543  ? 65.041  37.012  -16.231 1.00 38.43  ? 957  ASP A CG    1 
ATOM   3973 O  OD1   . ASP A 1 543  ? 65.469  37.329  -17.371 1.00 38.72  ? 957  ASP A OD1   1 
ATOM   3974 O  OD2   . ASP A 1 543  ? 65.751  36.430  -15.397 1.00 40.70  ? 957  ASP A OD2   1 
ATOM   3975 N  N     . ILE A 1 544  ? 61.647  36.862  -18.928 1.00 36.40  ? 958  ILE A N     1 
ATOM   3976 C  CA    . ILE A 1 544  ? 61.141  35.811  -19.765 1.00 35.97  ? 958  ILE A CA    1 
ATOM   3977 C  C     . ILE A 1 544  ? 61.880  35.806  -21.100 1.00 35.93  ? 958  ILE A C     1 
ATOM   3978 O  O     . ILE A 1 544  ? 61.910  36.819  -21.817 1.00 36.64  ? 958  ILE A O     1 
ATOM   3979 C  CB    . ILE A 1 544  ? 59.639  36.020  -20.023 1.00 35.89  ? 958  ILE A CB    1 
ATOM   3980 C  CG1   . ILE A 1 544  ? 58.869  36.123  -18.713 1.00 35.63  ? 958  ILE A CG1   1 
ATOM   3981 C  CG2   . ILE A 1 544  ? 59.079  34.915  -20.865 1.00 35.10  ? 958  ILE A CG2   1 
ATOM   3982 C  CD1   . ILE A 1 544  ? 57.533  36.832  -18.881 1.00 35.35  ? 958  ILE A CD1   1 
ATOM   3983 N  N     . PRO A 1 545  ? 62.440  34.654  -21.452 1.00 35.40  ? 959  PRO A N     1 
ATOM   3984 C  CA    . PRO A 1 545  ? 63.104  34.390  -22.706 1.00 35.41  ? 959  PRO A CA    1 
ATOM   3985 C  C     . PRO A 1 545  ? 62.120  34.405  -23.865 1.00 35.48  ? 959  PRO A C     1 
ATOM   3986 O  O     . PRO A 1 545  ? 61.077  33.730  -23.813 1.00 35.61  ? 959  PRO A O     1 
ATOM   3987 C  CB    . PRO A 1 545  ? 63.600  32.952  -22.533 1.00 35.93  ? 959  PRO A CB    1 
ATOM   3988 C  CG    . PRO A 1 545  ? 62.563  32.324  -21.645 1.00 35.36  ? 959  PRO A CG    1 
ATOM   3989 C  CD    . PRO A 1 545  ? 62.188  33.420  -20.682 1.00 35.77  ? 959  PRO A CD    1 
ATOM   3990 N  N     . PHE A 1 546  ? 62.479  35.155  -24.904 1.00 34.76  ? 960  PHE A N     1 
ATOM   3991 C  CA    . PHE A 1 546  ? 61.722  35.257  -26.141 1.00 33.96  ? 960  PHE A CA    1 
ATOM   3992 C  C     . PHE A 1 546  ? 61.377  33.912  -26.779 1.00 34.34  ? 960  PHE A C     1 
ATOM   3993 O  O     . PHE A 1 546  ? 60.310  33.767  -27.387 1.00 33.69  ? 960  PHE A O     1 
ATOM   3994 C  CB    . PHE A 1 546  ? 62.558  36.053  -27.125 1.00 33.65  ? 960  PHE A CB    1 
ATOM   3995 C  CG    . PHE A 1 546  ? 61.979  36.152  -28.500 1.00 31.11  ? 960  PHE A CG    1 
ATOM   3996 C  CD1   . PHE A 1 546  ? 60.817  36.865  -28.722 1.00 32.30  ? 960  PHE A CD1   1 
ATOM   3997 C  CD2   . PHE A 1 546  ? 62.650  35.631  -29.588 1.00 31.04  ? 960  PHE A CD2   1 
ATOM   3998 C  CE1   . PHE A 1 546  ? 60.308  37.029  -30.008 1.00 29.79  ? 960  PHE A CE1   1 
ATOM   3999 C  CE2   . PHE A 1 546  ? 62.149  35.778  -30.874 1.00 30.91  ? 960  PHE A CE2   1 
ATOM   4000 C  CZ    . PHE A 1 546  ? 60.962  36.475  -31.076 1.00 30.80  ? 960  PHE A CZ    1 
ATOM   4001 N  N     . GLU A 1 547  ? 62.294  32.946  -26.654 1.00 34.26  ? 961  GLU A N     1 
ATOM   4002 C  CA    . GLU A 1 547  ? 62.191  31.677  -27.378 1.00 34.25  ? 961  GLU A CA    1 
ATOM   4003 C  C     . GLU A 1 547  ? 60.945  30.834  -26.999 1.00 34.58  ? 961  GLU A C     1 
ATOM   4004 O  O     . GLU A 1 547  ? 60.481  30.004  -27.782 1.00 34.22  ? 961  GLU A O     1 
ATOM   4005 C  CB    . GLU A 1 547  ? 63.498  30.875  -27.257 1.00 34.87  ? 961  GLU A CB    1 
ATOM   4006 C  CG    . GLU A 1 547  ? 64.681  31.433  -28.107 1.00 35.44  ? 961  GLU A CG    1 
ATOM   4007 C  CD    . GLU A 1 547  ? 65.504  32.513  -27.374 1.00 37.75  ? 961  GLU A CD    1 
ATOM   4008 O  OE1   . GLU A 1 547  ? 65.194  32.817  -26.198 1.00 37.20  ? 961  GLU A OE1   1 
ATOM   4009 O  OE2   . GLU A 1 547  ? 66.467  33.059  -27.982 1.00 38.24  ? 961  GLU A OE2   1 
ATOM   4010 N  N     . THR A 1 548  ? 60.388  31.064  -25.815 1.00 34.45  ? 962  THR A N     1 
ATOM   4011 C  CA    . THR A 1 548  ? 59.147  30.420  -25.444 1.00 34.74  ? 962  THR A CA    1 
ATOM   4012 C  C     . THR A 1 548  ? 58.073  30.702  -26.491 1.00 35.30  ? 962  THR A C     1 
ATOM   4013 O  O     . THR A 1 548  ? 57.163  29.905  -26.689 1.00 35.00  ? 962  THR A O     1 
ATOM   4014 C  CB    . THR A 1 548  ? 58.669  30.923  -24.074 1.00 34.78  ? 962  THR A CB    1 
ATOM   4015 O  OG1   . THR A 1 548  ? 59.691  30.673  -23.113 1.00 33.82  ? 962  THR A OG1   1 
ATOM   4016 C  CG2   . THR A 1 548  ? 57.420  30.200  -23.653 1.00 33.47  ? 962  THR A CG2   1 
ATOM   4017 N  N     . PHE A 1 549  ? 58.188  31.833  -27.180 1.00 36.36  ? 963  PHE A N     1 
ATOM   4018 C  CA    . PHE A 1 549  ? 57.198  32.205  -28.192 1.00 37.17  ? 963  PHE A CA    1 
ATOM   4019 C  C     . PHE A 1 549  ? 57.511  31.478  -29.503 1.00 38.50  ? 963  PHE A C     1 
ATOM   4020 O  O     . PHE A 1 549  ? 56.805  30.520  -29.893 1.00 38.02  ? 963  PHE A O     1 
ATOM   4021 C  CB    . PHE A 1 549  ? 57.164  33.735  -28.366 1.00 37.24  ? 963  PHE A CB    1 
ATOM   4022 C  CG    . PHE A 1 549  ? 56.178  34.214  -29.406 1.00 37.71  ? 963  PHE A CG    1 
ATOM   4023 C  CD1   . PHE A 1 549  ? 56.620  34.852  -30.557 1.00 36.18  ? 963  PHE A CD1   1 
ATOM   4024 C  CD2   . PHE A 1 549  ? 54.816  33.999  -29.250 1.00 38.57  ? 963  PHE A CD2   1 
ATOM   4025 C  CE1   . PHE A 1 549  ? 55.732  35.260  -31.530 1.00 35.63  ? 963  PHE A CE1   1 
ATOM   4026 C  CE2   . PHE A 1 549  ? 53.901  34.423  -30.236 1.00 38.60  ? 963  PHE A CE2   1 
ATOM   4027 C  CZ    . PHE A 1 549  ? 54.364  35.049  -31.367 1.00 36.73  ? 963  PHE A CZ    1 
ATOM   4028 N  N     . LEU A 1 550  ? 58.612  31.874  -30.149 1.00 39.65  ? 964  LEU A N     1 
ATOM   4029 C  CA    . LEU A 1 550  ? 58.951  31.355  -31.494 1.00 40.18  ? 964  LEU A CA    1 
ATOM   4030 C  C     . LEU A 1 550  ? 59.990  30.239  -31.549 1.00 40.84  ? 964  LEU A C     1 
ATOM   4031 O  O     . LEU A 1 550  ? 60.247  29.680  -32.611 1.00 40.92  ? 964  LEU A O     1 
ATOM   4032 C  CB    . LEU A 1 550  ? 59.407  32.487  -32.406 1.00 40.18  ? 964  LEU A CB    1 
ATOM   4033 C  CG    . LEU A 1 550  ? 58.369  33.236  -33.227 1.00 38.98  ? 964  LEU A CG    1 
ATOM   4034 C  CD1   . LEU A 1 550  ? 58.963  34.573  -33.629 1.00 38.00  ? 964  LEU A CD1   1 
ATOM   4035 C  CD2   . LEU A 1 550  ? 58.096  32.399  -34.434 1.00 39.24  ? 964  LEU A CD2   1 
ATOM   4036 N  N     . GLY A 1 551  ? 60.612  29.925  -30.420 1.00 42.08  ? 965  GLY A N     1 
ATOM   4037 C  CA    . GLY A 1 551  ? 61.650  28.896  -30.416 1.00 42.63  ? 965  GLY A CA    1 
ATOM   4038 C  C     . GLY A 1 551  ? 62.932  29.469  -30.980 1.00 43.71  ? 965  GLY A C     1 
ATOM   4039 O  O     . GLY A 1 551  ? 63.061  30.681  -31.117 1.00 43.47  ? 965  GLY A O     1 
ATOM   4040 N  N     . PHE A 1 552  ? 63.889  28.604  -31.300 1.00 44.69  ? 966  PHE A N     1 
ATOM   4041 C  CA    . PHE A 1 552  ? 65.193  29.068  -31.738 1.00 45.80  ? 966  PHE A CA    1 
ATOM   4042 C  C     . PHE A 1 552  ? 65.268  29.009  -33.237 1.00 46.66  ? 966  PHE A C     1 
ATOM   4043 O  O     . PHE A 1 552  ? 65.848  29.892  -33.872 1.00 47.36  ? 966  PHE A O     1 
ATOM   4044 C  CB    . PHE A 1 552  ? 66.323  28.229  -31.135 1.00 45.16  ? 966  PHE A CB    1 
ATOM   4045 C  CG    . PHE A 1 552  ? 66.588  28.547  -29.707 1.00 45.24  ? 966  PHE A CG    1 
ATOM   4046 C  CD1   . PHE A 1 552  ? 67.489  29.538  -29.360 1.00 43.76  ? 966  PHE A CD1   1 
ATOM   4047 C  CD2   . PHE A 1 552  ? 65.899  27.888  -28.707 1.00 44.30  ? 966  PHE A CD2   1 
ATOM   4048 C  CE1   . PHE A 1 552  ? 67.721  29.848  -28.041 1.00 43.32  ? 966  PHE A CE1   1 
ATOM   4049 C  CE2   . PHE A 1 552  ? 66.125  28.189  -27.393 1.00 44.09  ? 966  PHE A CE2   1 
ATOM   4050 C  CZ    . PHE A 1 552  ? 67.033  29.173  -27.053 1.00 43.98  ? 966  PHE A CZ    1 
ATOM   4051 N  N     . LYS A 1 553  ? 64.684  27.966  -33.805 1.00 47.32  ? 967  LYS A N     1 
ATOM   4052 C  CA    . LYS A 1 553  ? 64.788  27.764  -35.234 1.00 48.34  ? 967  LYS A CA    1 
ATOM   4053 C  C     . LYS A 1 553  ? 63.738  28.581  -35.957 1.00 48.44  ? 967  LYS A C     1 
ATOM   4054 O  O     . LYS A 1 553  ? 63.820  28.791  -37.168 1.00 48.61  ? 967  LYS A O     1 
ATOM   4055 C  CB    . LYS A 1 553  ? 64.634  26.281  -35.558 1.00 48.46  ? 967  LYS A CB    1 
ATOM   4056 C  CG    . LYS A 1 553  ? 65.767  25.439  -34.980 1.00 50.14  ? 967  LYS A CG    1 
ATOM   4057 C  CD    . LYS A 1 553  ? 65.672  23.985  -35.412 1.00 51.98  ? 967  LYS A CD    1 
ATOM   4058 C  CE    . LYS A 1 553  ? 67.092  23.437  -35.516 1.00 54.72  ? 967  LYS A CE    1 
ATOM   4059 N  NZ    . LYS A 1 553  ? 67.970  24.272  -34.655 1.00 53.58  ? 967  LYS A NZ    1 
ATOM   4060 N  N     . GLY A 1 554  ? 62.753  29.053  -35.200 1.00 48.62  ? 968  GLY A N     1 
ATOM   4061 C  CA    . GLY A 1 554  ? 61.576  29.678  -35.787 1.00 48.46  ? 968  GLY A CA    1 
ATOM   4062 C  C     . GLY A 1 554  ? 60.779  28.646  -36.578 1.00 48.14  ? 968  GLY A C     1 
ATOM   4063 O  O     . GLY A 1 554  ? 60.000  29.012  -37.457 1.00 48.81  ? 968  GLY A O     1 
ATOM   4064 N  N     . ASP A 1 555  ? 60.996  27.359  -36.282 1.00 47.30  ? 969  ASP A N     1 
ATOM   4065 C  CA    . ASP A 1 555  ? 60.212  26.259  -36.865 1.00 46.09  ? 969  ASP A CA    1 
ATOM   4066 C  C     . ASP A 1 555  ? 59.018  25.799  -35.996 1.00 45.40  ? 969  ASP A C     1 
ATOM   4067 O  O     . ASP A 1 555  ? 58.675  24.607  -35.996 1.00 46.55  ? 969  ASP A O     1 
ATOM   4068 C  CB    . ASP A 1 555  ? 61.114  25.041  -37.079 1.00 46.86  ? 969  ASP A CB    1 
ATOM   4069 N  N     . LYS A 1 556  ? 58.420  26.718  -35.239 1.00 42.66  ? 970  LYS A N     1 
ATOM   4070 C  CA    . LYS A 1 556  ? 57.228  26.442  -34.446 1.00 39.91  ? 970  LYS A CA    1 
ATOM   4071 C  C     . LYS A 1 556  ? 56.207  27.505  -34.817 1.00 38.30  ? 970  LYS A C     1 
ATOM   4072 O  O     . LYS A 1 556  ? 56.576  28.632  -35.111 1.00 37.48  ? 970  LYS A O     1 
ATOM   4073 C  CB    . LYS A 1 556  ? 57.533  26.567  -32.952 1.00 40.04  ? 970  LYS A CB    1 
ATOM   4074 C  CG    . LYS A 1 556  ? 56.280  26.800  -32.108 1.00 39.00  ? 970  LYS A CG    1 
ATOM   4075 C  CD    . LYS A 1 556  ? 56.564  27.359  -30.740 1.00 37.74  ? 970  LYS A CD    1 
ATOM   4076 C  CE    . LYS A 1 556  ? 55.264  27.763  -30.054 1.00 37.14  ? 970  LYS A CE    1 
ATOM   4077 N  NZ    . LYS A 1 556  ? 55.493  28.339  -28.701 1.00 35.85  ? 970  LYS A NZ    1 
ATOM   4078 N  N     . VAL A 1 557  ? 54.929  27.180  -34.826 1.00 35.90  ? 971  VAL A N     1 
ATOM   4079 C  CA    . VAL A 1 557  ? 54.002  28.244  -35.147 1.00 34.70  ? 971  VAL A CA    1 
ATOM   4080 C  C     . VAL A 1 557  ? 53.073  28.638  -33.975 1.00 33.94  ? 971  VAL A C     1 
ATOM   4081 O  O     . VAL A 1 557  ? 52.071  27.967  -33.667 1.00 33.04  ? 971  VAL A O     1 
ATOM   4082 C  CB    . VAL A 1 557  ? 53.354  28.069  -36.556 1.00 34.78  ? 971  VAL A CB    1 
ATOM   4083 C  CG1   . VAL A 1 557  ? 53.446  26.644  -37.028 1.00 35.95  ? 971  VAL A CG1   1 
ATOM   4084 C  CG2   . VAL A 1 557  ? 51.963  28.682  -36.668 1.00 32.89  ? 971  VAL A CG2   1 
ATOM   4085 N  N     . PRO A 1 558  ? 53.468  29.695  -33.272 1.00 33.12  ? 972  PRO A N     1 
ATOM   4086 C  CA    . PRO A 1 558  ? 52.620  30.181  -32.200 1.00 33.66  ? 972  PRO A CA    1 
ATOM   4087 C  C     . PRO A 1 558  ? 51.575  31.094  -32.779 1.00 33.76  ? 972  PRO A C     1 
ATOM   4088 O  O     . PRO A 1 558  ? 51.633  31.454  -33.975 1.00 33.98  ? 972  PRO A O     1 
ATOM   4089 C  CB    . PRO A 1 558  ? 53.578  31.006  -31.340 1.00 33.07  ? 972  PRO A CB    1 
ATOM   4090 C  CG    . PRO A 1 558  ? 54.527  31.615  -32.381 1.00 33.60  ? 972  PRO A CG    1 
ATOM   4091 C  CD    . PRO A 1 558  ? 54.682  30.519  -33.448 1.00 33.21  ? 972  PRO A CD    1 
ATOM   4092 N  N     . ASP A 1 559  ? 50.618  31.455  -31.942 1.00 33.30  ? 973  ASP A N     1 
ATOM   4093 C  CA    . ASP A 1 559  ? 49.628  32.456  -32.310 1.00 32.81  ? 973  ASP A CA    1 
ATOM   4094 C  C     . ASP A 1 559  ? 49.836  33.630  -31.397 1.00 32.74  ? 973  ASP A C     1 
ATOM   4095 O  O     . ASP A 1 559  ? 50.794  33.649  -30.601 1.00 32.46  ? 973  ASP A O     1 
ATOM   4096 C  CB    . ASP A 1 559  ? 48.195  31.917  -32.151 1.00 32.29  ? 973  ASP A CB    1 
ATOM   4097 C  CG    . ASP A 1 559  ? 47.840  31.549  -30.695 1.00 34.02  ? 973  ASP A CG    1 
ATOM   4098 O  OD1   . ASP A 1 559  ? 46.728  30.970  -30.467 1.00 32.61  ? 973  ASP A OD1   1 
ATOM   4099 O  OD2   . ASP A 1 559  ? 48.658  31.840  -29.774 1.00 33.85  ? 973  ASP A OD2   1 
ATOM   4100 N  N     . ILE A 1 560  ? 48.926  34.593  -31.510 1.00 33.07  ? 974  ILE A N     1 
ATOM   4101 C  CA    . ILE A 1 560  ? 48.827  35.716  -30.603 1.00 33.67  ? 974  ILE A CA    1 
ATOM   4102 C  C     . ILE A 1 560  ? 47.474  35.655  -29.855 1.00 33.78  ? 974  ILE A C     1 
ATOM   4103 O  O     . ILE A 1 560  ? 46.415  35.548  -30.483 1.00 33.33  ? 974  ILE A O     1 
ATOM   4104 C  CB    . ILE A 1 560  ? 48.940  37.038  -31.328 1.00 33.53  ? 974  ILE A CB    1 
ATOM   4105 C  CG1   . ILE A 1 560  ? 50.362  37.227  -31.854 1.00 34.27  ? 974  ILE A CG1   1 
ATOM   4106 C  CG2   . ILE A 1 560  ? 48.653  38.154  -30.353 1.00 34.09  ? 974  ILE A CG2   1 
ATOM   4107 C  CD1   . ILE A 1 560  ? 50.598  38.529  -32.595 1.00 31.93  ? 974  ILE A CD1   1 
ATOM   4108 N  N     . ASP A 1 561  ? 47.524  35.676  -28.521 1.00 33.74  ? 975  ASP A N     1 
ATOM   4109 C  CA    . ASP A 1 561  ? 46.308  35.490  -27.708 1.00 33.49  ? 975  ASP A CA    1 
ATOM   4110 C  C     . ASP A 1 561  ? 45.943  36.805  -27.062 1.00 33.91  ? 975  ASP A C     1 
ATOM   4111 O  O     . ASP A 1 561  ? 46.792  37.457  -26.427 1.00 33.34  ? 975  ASP A O     1 
ATOM   4112 C  CB    . ASP A 1 561  ? 46.483  34.430  -26.612 1.00 32.35  ? 975  ASP A CB    1 
ATOM   4113 C  CG    . ASP A 1 561  ? 46.998  33.104  -27.146 1.00 31.96  ? 975  ASP A CG    1 
ATOM   4114 O  OD1   . ASP A 1 561  ? 46.196  32.264  -27.632 1.00 31.35  ? 975  ASP A OD1   1 
ATOM   4115 O  OD2   . ASP A 1 561  ? 48.218  32.856  -27.024 1.00 29.21  ? 975  ASP A OD2   1 
ATOM   4116 N  N     . LEU A 1 562  ? 44.684  37.205  -27.249 1.00 34.96  ? 976  LEU A N     1 
ATOM   4117 C  CA    . LEU A 1 562  ? 44.142  38.404  -26.583 1.00 34.94  ? 976  LEU A CA    1 
ATOM   4118 C  C     . LEU A 1 562  ? 42.824  38.092  -25.898 1.00 34.77  ? 976  LEU A C     1 
ATOM   4119 O  O     . LEU A 1 562  ? 41.922  37.435  -26.469 1.00 33.87  ? 976  LEU A O     1 
ATOM   4120 C  CB    . LEU A 1 562  ? 43.901  39.520  -27.569 1.00 34.29  ? 976  LEU A CB    1 
ATOM   4121 C  CG    . LEU A 1 562  ? 44.943  40.495  -28.130 1.00 36.42  ? 976  LEU A CG    1 
ATOM   4122 C  CD1   . LEU A 1 562  ? 46.209  40.656  -27.311 1.00 33.77  ? 976  LEU A CD1   1 
ATOM   4123 C  CD2   . LEU A 1 562  ? 45.194  40.277  -29.630 1.00 34.60  ? 976  LEU A CD2   1 
ATOM   4124 N  N     . ASN A 1 563  ? 42.719  38.584  -24.671 1.00 34.97  ? 977  ASN A N     1 
ATOM   4125 C  CA    . ASN A 1 563  ? 41.503  38.485  -23.888 1.00 35.53  ? 977  ASN A CA    1 
ATOM   4126 C  C     . ASN A 1 563  ? 40.677  39.750  -24.050 1.00 35.87  ? 977  ASN A C     1 
ATOM   4127 O  O     . ASN A 1 563  ? 40.911  40.743  -23.332 1.00 36.87  ? 977  ASN A O     1 
ATOM   4128 C  CB    . ASN A 1 563  ? 41.855  38.344  -22.408 1.00 35.96  ? 977  ASN A CB    1 
ATOM   4129 C  CG    . ASN A 1 563  ? 41.895  36.911  -21.945 1.00 36.01  ? 977  ASN A CG    1 
ATOM   4130 O  OD1   . ASN A 1 563  ? 41.477  36.010  -22.659 1.00 39.59  ? 977  ASN A OD1   1 
ATOM   4131 N  ND2   . ASN A 1 563  ? 42.372  36.691  -20.724 1.00 37.28  ? 977  ASN A ND2   1 
ATOM   4132 N  N     . PHE A 1 564  ? 39.724  39.762  -24.972 1.00 35.16  ? 978  PHE A N     1 
ATOM   4133 C  CA    . PHE A 1 564  ? 38.825  40.914  -25.012 1.00 34.61  ? 978  PHE A CA    1 
ATOM   4134 C  C     . PHE A 1 564  ? 37.647  40.668  -24.104 1.00 35.20  ? 978  PHE A C     1 
ATOM   4135 O  O     . PHE A 1 564  ? 37.340  39.519  -23.764 1.00 35.68  ? 978  PHE A O     1 
ATOM   4136 C  CB    . PHE A 1 564  ? 38.300  41.164  -26.414 1.00 34.05  ? 978  PHE A CB    1 
ATOM   4137 C  CG    . PHE A 1 564  ? 39.352  41.552  -27.397 1.00 32.51  ? 978  PHE A CG    1 
ATOM   4138 C  CD1   . PHE A 1 564  ? 39.575  42.881  -27.693 1.00 30.47  ? 978  PHE A CD1   1 
ATOM   4139 C  CD2   . PHE A 1 564  ? 40.113  40.584  -28.035 1.00 30.06  ? 978  PHE A CD2   1 
ATOM   4140 C  CE1   . PHE A 1 564  ? 40.528  43.249  -28.614 1.00 29.07  ? 978  PHE A CE1   1 
ATOM   4141 C  CE2   . PHE A 1 564  ? 41.086  40.941  -28.956 1.00 29.29  ? 978  PHE A CE2   1 
ATOM   4142 C  CZ    . PHE A 1 564  ? 41.293  42.271  -29.246 1.00 30.49  ? 978  PHE A CZ    1 
ATOM   4143 N  N     . SER A 1 565  ? 36.945  41.734  -23.744 1.00 35.57  ? 979  SER A N     1 
ATOM   4144 C  CA    . SER A 1 565  ? 35.756  41.559  -22.928 1.00 35.99  ? 979  SER A CA    1 
ATOM   4145 C  C     . SER A 1 565  ? 34.735  40.734  -23.725 1.00 36.51  ? 979  SER A C     1 
ATOM   4146 O  O     . SER A 1 565  ? 34.633  40.878  -24.953 1.00 36.26  ? 979  SER A O     1 
ATOM   4147 C  CB    . SER A 1 565  ? 35.170  42.906  -22.501 1.00 35.62  ? 979  SER A CB    1 
ATOM   4148 O  OG    . SER A 1 565  ? 33.762  42.789  -22.362 1.00 35.91  ? 979  SER A OG    1 
ATOM   4149 N  N     . GLY A 1 566  ? 34.006  39.858  -23.038 1.00 36.68  ? 980  GLY A N     1 
ATOM   4150 C  CA    . GLY A 1 566  ? 32.984  39.042  -23.695 1.00 37.69  ? 980  GLY A CA    1 
ATOM   4151 C  C     . GLY A 1 566  ? 31.950  39.900  -24.400 1.00 38.77  ? 980  GLY A C     1 
ATOM   4152 O  O     . GLY A 1 566  ? 31.464  39.553  -25.487 1.00 39.41  ? 980  GLY A O     1 
ATOM   4153 N  N     . GLU A 1 567  ? 31.618  41.042  -23.799 1.00 39.02  ? 981  GLU A N     1 
ATOM   4154 C  CA    . GLU A 1 567  ? 30.732  42.019  -24.457 1.00 39.07  ? 981  GLU A CA    1 
ATOM   4155 C  C     . GLU A 1 567  ? 31.251  42.475  -25.836 1.00 38.41  ? 981  GLU A C     1 
ATOM   4156 O  O     . GLU A 1 567  ? 30.462  42.709  -26.760 1.00 38.83  ? 981  GLU A O     1 
ATOM   4157 C  CB    . GLU A 1 567  ? 30.549  43.254  -23.569 1.00 39.45  ? 981  GLU A CB    1 
ATOM   4158 C  CG    . GLU A 1 567  ? 29.957  42.992  -22.170 1.00 42.12  ? 981  GLU A CG    1 
ATOM   4159 C  CD    . GLU A 1 567  ? 29.602  44.300  -21.455 1.00 47.05  ? 981  GLU A CD    1 
ATOM   4160 O  OE1   . GLU A 1 567  ? 29.291  44.274  -20.224 1.00 46.51  ? 981  GLU A OE1   1 
ATOM   4161 O  OE2   . GLU A 1 567  ? 29.629  45.361  -22.147 1.00 48.29  ? 981  GLU A OE2   1 
ATOM   4162 N  N     . TYR A 1 568  ? 32.569  42.611  -25.963 1.00 37.35  ? 982  TYR A N     1 
ATOM   4163 C  CA    . TYR A 1 568  ? 33.180  43.286  -27.111 1.00 36.93  ? 982  TYR A CA    1 
ATOM   4164 C  C     . TYR A 1 568  ? 33.726  42.309  -28.166 1.00 37.10  ? 982  TYR A C     1 
ATOM   4165 O  O     . TYR A 1 568  ? 33.901  42.671  -29.330 1.00 37.25  ? 982  TYR A O     1 
ATOM   4166 C  CB    . TYR A 1 568  ? 34.303  44.218  -26.621 1.00 36.56  ? 982  TYR A CB    1 
ATOM   4167 C  CG    . TYR A 1 568  ? 34.960  45.048  -27.708 1.00 35.70  ? 982  TYR A CG    1 
ATOM   4168 C  CD1   . TYR A 1 568  ? 36.069  44.580  -28.397 1.00 34.97  ? 982  TYR A CD1   1 
ATOM   4169 C  CD2   . TYR A 1 568  ? 34.468  46.298  -28.042 1.00 35.04  ? 982  TYR A CD2   1 
ATOM   4170 C  CE1   . TYR A 1 568  ? 36.670  45.332  -29.393 1.00 33.77  ? 982  TYR A CE1   1 
ATOM   4171 C  CE2   . TYR A 1 568  ? 35.055  47.051  -29.033 1.00 35.31  ? 982  TYR A CE2   1 
ATOM   4172 C  CZ    . TYR A 1 568  ? 36.158  46.568  -29.708 1.00 34.38  ? 982  TYR A CZ    1 
ATOM   4173 O  OH    . TYR A 1 568  ? 36.735  47.341  -30.693 1.00 33.80  ? 982  TYR A OH    1 
ATOM   4174 N  N     . GLN A 1 569  ? 33.982  41.072  -27.754 1.00 36.67  ? 983  GLN A N     1 
ATOM   4175 C  CA    . GLN A 1 569  ? 34.618  40.091  -28.619 1.00 36.63  ? 983  GLN A CA    1 
ATOM   4176 C  C     . GLN A 1 569  ? 34.119  40.147  -30.050 1.00 36.68  ? 983  GLN A C     1 
ATOM   4177 O  O     . GLN A 1 569  ? 34.916  40.193  -30.969 1.00 36.52  ? 983  GLN A O     1 
ATOM   4178 C  CB    . GLN A 1 569  ? 34.453  38.667  -28.075 1.00 36.48  ? 983  GLN A CB    1 
ATOM   4179 C  CG    . GLN A 1 569  ? 35.251  37.616  -28.847 1.00 36.20  ? 983  GLN A CG    1 
ATOM   4180 C  CD    . GLN A 1 569  ? 34.994  36.199  -28.352 1.00 35.18  ? 983  GLN A CD    1 
ATOM   4181 O  OE1   . GLN A 1 569  ? 33.943  35.917  -27.782 1.00 37.39  ? 983  GLN A OE1   1 
ATOM   4182 N  NE2   . GLN A 1 569  ? 35.947  35.307  -28.569 1.00 31.34  ? 983  GLN A NE2   1 
ATOM   4183 N  N     . PRO A 1 570  ? 32.795  40.116  -30.251 1.00 37.08  ? 984  PRO A N     1 
ATOM   4184 C  CA    . PRO A 1 570  ? 32.343  40.128  -31.651 1.00 37.27  ? 984  PRO A CA    1 
ATOM   4185 C  C     . PRO A 1 570  ? 32.863  41.329  -32.442 1.00 37.42  ? 984  PRO A C     1 
ATOM   4186 O  O     . PRO A 1 570  ? 33.120  41.208  -33.633 1.00 38.35  ? 984  PRO A O     1 
ATOM   4187 C  CB    . PRO A 1 570  ? 30.809  40.176  -31.542 1.00 37.21  ? 984  PRO A CB    1 
ATOM   4188 C  CG    . PRO A 1 570  ? 30.492  39.714  -30.135 1.00 37.16  ? 984  PRO A CG    1 
ATOM   4189 C  CD    . PRO A 1 570  ? 31.682  40.049  -29.284 1.00 36.87  ? 984  PRO A CD    1 
ATOM   4190 N  N     . ARG A 1 571  ? 33.019  42.485  -31.809 1.00 37.42  ? 985  ARG A N     1 
ATOM   4191 C  CA    . ARG A 1 571  ? 33.428  43.677  -32.565 1.00 37.13  ? 985  ARG A CA    1 
ATOM   4192 C  C     . ARG A 1 571  ? 34.904  43.600  -32.937 1.00 37.17  ? 985  ARG A C     1 
ATOM   4193 O  O     . ARG A 1 571  ? 35.317  44.090  -33.993 1.00 37.27  ? 985  ARG A O     1 
ATOM   4194 C  CB    . ARG A 1 571  ? 33.136  44.978  -31.800 1.00 36.88  ? 985  ARG A CB    1 
ATOM   4195 C  CG    . ARG A 1 571  ? 31.656  45.264  -31.559 1.00 35.80  ? 985  ARG A CG    1 
ATOM   4196 C  CD    . ARG A 1 571  ? 31.436  46.347  -30.461 1.00 32.94  ? 985  ARG A CD    1 
ATOM   4197 N  NE    . ARG A 1 571  ? 31.887  47.685  -30.866 1.00 31.04  ? 985  ARG A NE    1 
ATOM   4198 C  CZ    . ARG A 1 571  ? 31.905  48.760  -30.075 1.00 28.55  ? 985  ARG A CZ    1 
ATOM   4199 N  NH1   . ARG A 1 571  ? 31.495  48.694  -28.803 1.00 26.08  ? 985  ARG A NH1   1 
ATOM   4200 N  NH2   . ARG A 1 571  ? 32.352  49.906  -30.556 1.00 26.89  ? 985  ARG A NH2   1 
ATOM   4201 N  N     . ALA A 1 572  ? 35.707  43.002  -32.061 1.00 36.70  ? 986  ALA A N     1 
ATOM   4202 C  CA    . ALA A 1 572  ? 37.105  42.754  -32.386 1.00 36.19  ? 986  ALA A CA    1 
ATOM   4203 C  C     . ALA A 1 572  ? 37.158  41.819  -33.581 1.00 36.23  ? 986  ALA A C     1 
ATOM   4204 O  O     . ALA A 1 572  ? 37.908  42.051  -34.538 1.00 36.21  ? 986  ALA A O     1 
ATOM   4205 C  CB    . ALA A 1 572  ? 37.830  42.173  -31.214 1.00 36.01  ? 986  ALA A CB    1 
ATOM   4206 N  N     . HIS A 1 573  ? 36.335  40.778  -33.537 1.00 36.23  ? 987  HIS A N     1 
ATOM   4207 C  CA    . HIS A 1 573  ? 36.211  39.856  -34.664 1.00 36.79  ? 987  HIS A CA    1 
ATOM   4208 C  C     . HIS A 1 573  ? 35.933  40.533  -36.002 1.00 36.67  ? 987  HIS A C     1 
ATOM   4209 O  O     . HIS A 1 573  ? 36.658  40.315  -36.957 1.00 36.36  ? 987  HIS A O     1 
ATOM   4210 C  CB    . HIS A 1 573  ? 35.159  38.779  -34.385 1.00 36.30  ? 987  HIS A CB    1 
ATOM   4211 C  CG    . HIS A 1 573  ? 35.696  37.644  -33.572 1.00 38.48  ? 987  HIS A CG    1 
ATOM   4212 N  ND1   . HIS A 1 573  ? 34.892  36.746  -32.908 1.00 38.81  ? 987  HIS A ND1   1 
ATOM   4213 C  CD2   . HIS A 1 573  ? 36.972  37.290  -33.283 1.00 39.61  ? 987  HIS A CD2   1 
ATOM   4214 C  CE1   . HIS A 1 573  ? 35.645  35.873  -32.264 1.00 39.24  ? 987  HIS A CE1   1 
ATOM   4215 N  NE2   . HIS A 1 573  ? 36.911  36.183  -32.472 1.00 40.54  ? 987  HIS A NE2   1 
ATOM   4216 N  N     . ASN A 1 574  ? 34.861  41.324  -36.063 1.00 37.26  ? 988  ASN A N     1 
ATOM   4217 C  CA    . ASN A 1 574  ? 34.483  42.057  -37.263 1.00 37.31  ? 988  ASN A CA    1 
ATOM   4218 C  C     . ASN A 1 574  ? 35.561  43.029  -37.758 1.00 36.98  ? 988  ASN A C     1 
ATOM   4219 O  O     . ASN A 1 574  ? 35.710  43.231  -38.964 1.00 36.96  ? 988  ASN A O     1 
ATOM   4220 C  CB    . ASN A 1 574  ? 33.183  42.818  -37.021 1.00 37.91  ? 988  ASN A CB    1 
ATOM   4221 C  CG    . ASN A 1 574  ? 31.951  41.908  -37.051 1.00 41.06  ? 988  ASN A CG    1 
ATOM   4222 O  OD1   . ASN A 1 574  ? 31.919  40.908  -37.776 1.00 44.63  ? 988  ASN A OD1   1 
ATOM   4223 N  ND2   . ASN A 1 574  ? 30.923  42.265  -36.269 1.00 42.49  ? 988  ASN A ND2   1 
ATOM   4224 N  N     . TYR A 1 575  ? 36.306  43.642  -36.843 1.00 36.27  ? 989  TYR A N     1 
ATOM   4225 C  CA    . TYR A 1 575  ? 37.387  44.521  -37.264 1.00 36.53  ? 989  TYR A CA    1 
ATOM   4226 C  C     . TYR A 1 575  ? 38.460  43.782  -38.118 1.00 36.75  ? 989  TYR A C     1 
ATOM   4227 O  O     . TYR A 1 575  ? 39.130  44.416  -38.956 1.00 36.26  ? 989  TYR A O     1 
ATOM   4228 C  CB    . TYR A 1 575  ? 38.000  45.233  -36.060 1.00 36.53  ? 989  TYR A CB    1 
ATOM   4229 C  CG    . TYR A 1 575  ? 38.963  46.363  -36.402 1.00 37.65  ? 989  TYR A CG    1 
ATOM   4230 C  CD1   . TYR A 1 575  ? 38.715  47.245  -37.457 1.00 38.97  ? 989  TYR A CD1   1 
ATOM   4231 C  CD2   . TYR A 1 575  ? 40.107  46.570  -35.640 1.00 38.52  ? 989  TYR A CD2   1 
ATOM   4232 C  CE1   . TYR A 1 575  ? 39.605  48.283  -37.758 1.00 38.40  ? 989  TYR A CE1   1 
ATOM   4233 C  CE2   . TYR A 1 575  ? 40.993  47.603  -35.927 1.00 38.32  ? 989  TYR A CE2   1 
ATOM   4234 C  CZ    . TYR A 1 575  ? 40.746  48.450  -36.986 1.00 38.63  ? 989  TYR A CZ    1 
ATOM   4235 O  OH    . TYR A 1 575  ? 41.662  49.457  -37.236 1.00 37.95  ? 989  TYR A OH    1 
ATOM   4236 N  N     . THR A 1 576  ? 38.610  42.455  -37.943 1.00 36.43  ? 990  THR A N     1 
ATOM   4237 C  CA    . THR A 1 576  ? 39.528  41.689  -38.820 1.00 36.62  ? 990  THR A CA    1 
ATOM   4238 C  C     . THR A 1 576  ? 39.023  41.523  -40.277 1.00 36.82  ? 990  THR A C     1 
ATOM   4239 O  O     . THR A 1 576  ? 39.818  41.368  -41.201 1.00 36.88  ? 990  THR A O     1 
ATOM   4240 C  CB    . THR A 1 576  ? 39.961  40.307  -38.236 1.00 36.54  ? 990  THR A CB    1 
ATOM   4241 O  OG1   . THR A 1 576  ? 38.918  39.331  -38.424 1.00 36.88  ? 990  THR A OG1   1 
ATOM   4242 C  CG2   . THR A 1 576  ? 40.292  40.432  -36.788 1.00 35.68  ? 990  THR A CG2   1 
ATOM   4243 N  N     . LYS A 1 577  ? 37.712  41.537  -40.492 1.00 36.64  ? 991  LYS A N     1 
ATOM   4244 C  CA    . LYS A 1 577  ? 37.225  41.613  -41.855 1.00 36.74  ? 991  LYS A CA    1 
ATOM   4245 C  C     . LYS A 1 577  ? 37.661  42.913  -42.530 1.00 37.18  ? 991  LYS A C     1 
ATOM   4246 O  O     . LYS A 1 577  ? 38.041  42.915  -43.709 1.00 37.64  ? 991  LYS A O     1 
ATOM   4247 C  CB    . LYS A 1 577  ? 35.718  41.475  -41.903 1.00 36.69  ? 991  LYS A CB    1 
ATOM   4248 C  CG    . LYS A 1 577  ? 35.229  40.059  -41.614 1.00 37.25  ? 991  LYS A CG    1 
ATOM   4249 C  CD    . LYS A 1 577  ? 33.730  39.986  -41.804 1.00 36.76  ? 991  LYS A CD    1 
ATOM   4250 C  CE    . LYS A 1 577  ? 33.186  38.591  -41.606 1.00 36.29  ? 991  LYS A CE    1 
ATOM   4251 N  NZ    . LYS A 1 577  ? 31.698  38.641  -41.735 1.00 35.84  ? 991  LYS A NZ    1 
ATOM   4252 N  N     . VAL A 1 578  ? 37.622  44.020  -41.794 1.00 37.41  ? 992  VAL A N     1 
ATOM   4253 C  CA    . VAL A 1 578  ? 38.029  45.300  -42.362 1.00 37.59  ? 992  VAL A CA    1 
ATOM   4254 C  C     . VAL A 1 578  ? 39.507  45.317  -42.669 1.00 38.17  ? 992  VAL A C     1 
ATOM   4255 O  O     . VAL A 1 578  ? 39.911  45.777  -43.735 1.00 38.02  ? 992  VAL A O     1 
ATOM   4256 C  CB    . VAL A 1 578  ? 37.727  46.513  -41.441 1.00 37.93  ? 992  VAL A CB    1 
ATOM   4257 C  CG1   . VAL A 1 578  ? 38.148  47.801  -42.156 1.00 36.61  ? 992  VAL A CG1   1 
ATOM   4258 C  CG2   . VAL A 1 578  ? 36.238  46.553  -41.040 1.00 36.55  ? 992  VAL A CG2   1 
ATOM   4259 N  N     . LEU A 1 579  ? 40.313  44.830  -41.727 1.00 38.38  ? 993  LEU A N     1 
ATOM   4260 C  CA    . LEU A 1 579  ? 41.762  44.844  -41.889 1.00 39.09  ? 993  LEU A CA    1 
ATOM   4261 C  C     . LEU A 1 579  ? 42.330  43.946  -42.991 1.00 39.59  ? 993  LEU A C     1 
ATOM   4262 O  O     . LEU A 1 579  ? 43.246  44.359  -43.699 1.00 39.82  ? 993  LEU A O     1 
ATOM   4263 C  CB    . LEU A 1 579  ? 42.459  44.538  -40.562 1.00 39.29  ? 993  LEU A CB    1 
ATOM   4264 C  CG    . LEU A 1 579  ? 42.231  45.647  -39.532 1.00 39.71  ? 993  LEU A CG    1 
ATOM   4265 C  CD1   . LEU A 1 579  ? 42.830  45.291  -38.211 1.00 39.65  ? 993  LEU A CD1   1 
ATOM   4266 C  CD2   . LEU A 1 579  ? 42.817  46.944  -40.039 1.00 39.30  ? 993  LEU A CD2   1 
ATOM   4267 N  N     . PHE A 1 580  ? 41.801  42.730  -43.134 1.00 39.94  ? 994  PHE A N     1 
ATOM   4268 C  CA    . PHE A 1 580  ? 42.389  41.729  -44.030 1.00 39.82  ? 994  PHE A CA    1 
ATOM   4269 C  C     . PHE A 1 580  ? 41.595  41.576  -45.302 1.00 39.97  ? 994  PHE A C     1 
ATOM   4270 O  O     . PHE A 1 580  ? 42.076  40.979  -46.256 1.00 40.03  ? 994  PHE A O     1 
ATOM   4271 C  CB    . PHE A 1 580  ? 42.433  40.352  -43.364 1.00 39.58  ? 994  PHE A CB    1 
ATOM   4272 C  CG    . PHE A 1 580  ? 43.598  40.154  -42.443 1.00 40.61  ? 994  PHE A CG    1 
ATOM   4273 C  CD1   . PHE A 1 580  ? 44.866  39.914  -42.950 1.00 41.12  ? 994  PHE A CD1   1 
ATOM   4274 C  CD2   . PHE A 1 580  ? 43.423  40.194  -41.070 1.00 40.35  ? 994  PHE A CD2   1 
ATOM   4275 C  CE1   . PHE A 1 580  ? 45.936  39.730  -42.102 1.00 42.41  ? 994  PHE A CE1   1 
ATOM   4276 C  CE2   . PHE A 1 580  ? 44.475  40.012  -40.223 1.00 41.18  ? 994  PHE A CE2   1 
ATOM   4277 C  CZ    . PHE A 1 580  ? 45.741  39.782  -40.731 1.00 42.99  ? 994  PHE A CZ    1 
ATOM   4278 N  N     . GLY A 1 581  ? 40.363  42.078  -45.302 1.00 40.63  ? 995  GLY A N     1 
ATOM   4279 C  CA    . GLY A 1 581  ? 39.413  41.821  -46.398 1.00 40.71  ? 995  GLY A CA    1 
ATOM   4280 C  C     . GLY A 1 581  ? 38.480  40.665  -46.062 1.00 41.27  ? 995  GLY A C     1 
ATOM   4281 O  O     . GLY A 1 581  ? 38.906  39.653  -45.516 1.00 40.80  ? 995  GLY A O     1 
ATOM   4282 N  N     . GLU A 1 582  ? 37.206  40.820  -46.399 1.00 42.05  ? 996  GLU A N     1 
ATOM   4283 C  CA    . GLU A 1 582  ? 36.158  39.842  -46.101 1.00 42.89  ? 996  GLU A CA    1 
ATOM   4284 C  C     . GLU A 1 582  ? 36.475  38.390  -46.435 1.00 42.56  ? 996  GLU A C     1 
ATOM   4285 O  O     . GLU A 1 582  ? 36.039  37.486  -45.723 1.00 42.79  ? 996  GLU A O     1 
ATOM   4286 C  CB    . GLU A 1 582  ? 34.870  40.235  -46.822 1.00 43.42  ? 996  GLU A CB    1 
ATOM   4287 C  CG    . GLU A 1 582  ? 33.608  39.957  -46.018 1.00 47.60  ? 996  GLU A CG    1 
ATOM   4288 C  CD    . GLU A 1 582  ? 32.532  41.020  -46.237 1.00 53.23  ? 996  GLU A CD    1 
ATOM   4289 O  OE1   . GLU A 1 582  ? 31.978  41.105  -47.370 1.00 54.18  ? 996  GLU A OE1   1 
ATOM   4290 O  OE2   . GLU A 1 582  ? 32.248  41.772  -45.267 1.00 55.81  ? 996  GLU A OE2   1 
ATOM   4291 N  N     . ASP A 1 583  ? 37.198  38.155  -47.522 1.00 42.26  ? 997  ASP A N     1 
ATOM   4292 C  CA    . ASP A 1 583  ? 37.501  36.787  -47.951 1.00 42.47  ? 997  ASP A CA    1 
ATOM   4293 C  C     . ASP A 1 583  ? 38.880  36.224  -47.500 1.00 42.08  ? 997  ASP A C     1 
ATOM   4294 O  O     . ASP A 1 583  ? 39.280  35.134  -47.905 1.00 42.44  ? 997  ASP A O     1 
ATOM   4295 C  CB    . ASP A 1 583  ? 37.313  36.654  -49.480 1.00 42.48  ? 997  ASP A CB    1 
ATOM   4296 C  CG    . ASP A 1 583  ? 35.829  36.723  -49.901 1.00 43.28  ? 997  ASP A CG    1 
ATOM   4297 O  OD1   . ASP A 1 583  ? 34.966  36.135  -49.208 1.00 42.29  ? 997  ASP A OD1   1 
ATOM   4298 O  OD2   . ASP A 1 583  ? 35.526  37.372  -50.929 1.00 45.43  ? 997  ASP A OD2   1 
ATOM   4299 N  N     . ASN A 1 584  ? 39.600  36.951  -46.659 1.00 41.30  ? 998  ASN A N     1 
ATOM   4300 C  CA    . ASN A 1 584  ? 40.886  36.474  -46.201 1.00 40.91  ? 998  ASN A CA    1 
ATOM   4301 C  C     . ASN A 1 584  ? 40.936  36.130  -44.706 1.00 40.10  ? 998  ASN A C     1 
ATOM   4302 O  O     . ASN A 1 584  ? 42.006  35.851  -44.147 1.00 39.93  ? 998  ASN A O     1 
ATOM   4303 C  CB    . ASN A 1 584  ? 41.955  37.474  -46.612 1.00 41.10  ? 998  ASN A CB    1 
ATOM   4304 C  CG    . ASN A 1 584  ? 41.916  37.749  -48.119 1.00 42.69  ? 998  ASN A CG    1 
ATOM   4305 O  OD1   . ASN A 1 584  ? 42.422  36.958  -48.917 1.00 42.21  ? 998  ASN A OD1   1 
ATOM   4306 N  ND2   . ASN A 1 584  ? 41.290  38.858  -48.507 1.00 44.22  ? 998  ASN A ND2   1 
ATOM   4307 N  N     . VAL A 1 585  ? 39.777  36.132  -44.061 1.00 38.82  ? 999  VAL A N     1 
ATOM   4308 C  CA    . VAL A 1 585  ? 39.713  35.657  -42.682 1.00 38.25  ? 999  VAL A CA    1 
ATOM   4309 C  C     . VAL A 1 585  ? 38.509  34.759  -42.559 1.00 37.69  ? 999  VAL A C     1 
ATOM   4310 O  O     . VAL A 1 585  ? 37.533  34.973  -43.247 1.00 37.49  ? 999  VAL A O     1 
ATOM   4311 C  CB    . VAL A 1 585  ? 39.611  36.807  -41.675 1.00 38.02  ? 999  VAL A CB    1 
ATOM   4312 C  CG1   . VAL A 1 585  ? 40.893  37.584  -41.651 1.00 37.95  ? 999  VAL A CG1   1 
ATOM   4313 C  CG2   . VAL A 1 585  ? 38.448  37.721  -42.021 1.00 38.12  ? 999  VAL A CG2   1 
ATOM   4314 N  N     . TYR A 1 586  ? 38.614  33.726  -41.732 1.00 37.34  ? 1000 TYR A N     1 
ATOM   4315 C  CA    . TYR A 1 586  ? 37.544  32.770  -41.486 1.00 37.04  ? 1000 TYR A CA    1 
ATOM   4316 C  C     . TYR A 1 586  ? 37.568  32.364  -40.021 1.00 37.11  ? 1000 TYR A C     1 
ATOM   4317 O  O     . TYR A 1 586  ? 38.638  32.221  -39.435 1.00 37.44  ? 1000 TYR A O     1 
ATOM   4318 C  CB    . TYR A 1 586  ? 37.690  31.534  -42.378 1.00 37.38  ? 1000 TYR A CB    1 
ATOM   4319 C  CG    . TYR A 1 586  ? 37.540  31.882  -43.831 1.00 38.46  ? 1000 TYR A CG    1 
ATOM   4320 C  CD1   . TYR A 1 586  ? 38.632  32.304  -44.562 1.00 39.56  ? 1000 TYR A CD1   1 
ATOM   4321 C  CD2   . TYR A 1 586  ? 36.292  31.878  -44.446 1.00 39.39  ? 1000 TYR A CD2   1 
ATOM   4322 C  CE1   . TYR A 1 586  ? 38.509  32.664  -45.872 1.00 40.79  ? 1000 TYR A CE1   1 
ATOM   4323 C  CE2   . TYR A 1 586  ? 36.155  32.237  -45.768 1.00 39.76  ? 1000 TYR A CE2   1 
ATOM   4324 C  CZ    . TYR A 1 586  ? 37.277  32.630  -46.471 1.00 41.87  ? 1000 TYR A CZ    1 
ATOM   4325 O  OH    . TYR A 1 586  ? 37.197  32.997  -47.789 1.00 46.15  ? 1000 TYR A OH    1 
ATOM   4326 N  N     . ARG A 1 587  ? 36.400  32.200  -39.411 1.00 36.66  ? 1001 ARG A N     1 
ATOM   4327 C  CA    . ARG A 1 587  ? 36.379  31.760  -38.043 1.00 36.50  ? 1001 ARG A CA    1 
ATOM   4328 C  C     . ARG A 1 587  ? 36.748  30.296  -38.099 1.00 36.02  ? 1001 ARG A C     1 
ATOM   4329 O  O     . ARG A 1 587  ? 36.252  29.578  -38.947 1.00 36.85  ? 1001 ARG A O     1 
ATOM   4330 C  CB    . ARG A 1 587  ? 34.990  31.967  -37.431 1.00 36.57  ? 1001 ARG A CB    1 
ATOM   4331 C  CG    . ARG A 1 587  ? 34.809  31.414  -36.029 1.00 36.15  ? 1001 ARG A CG    1 
ATOM   4332 C  CD    . ARG A 1 587  ? 35.269  32.411  -34.979 1.00 37.74  ? 1001 ARG A CD    1 
ATOM   4333 N  NE    . ARG A 1 587  ? 34.869  32.077  -33.609 1.00 36.04  ? 1001 ARG A NE    1 
ATOM   4334 C  CZ    . ARG A 1 587  ? 33.816  32.605  -32.992 1.00 37.99  ? 1001 ARG A CZ    1 
ATOM   4335 N  NH1   . ARG A 1 587  ? 33.526  32.259  -31.744 1.00 38.19  ? 1001 ARG A NH1   1 
ATOM   4336 N  NH2   . ARG A 1 587  ? 33.044  33.475  -33.625 1.00 36.80  ? 1001 ARG A NH2   1 
ATOM   4337 N  N     . ALA A 1 588  ? 37.638  29.852  -37.225 1.00 35.48  ? 1002 ALA A N     1 
ATOM   4338 C  CA    . ALA A 1 588  ? 37.963  28.421  -37.123 1.00 34.58  ? 1002 ALA A CA    1 
ATOM   4339 C  C     . ALA A 1 588  ? 36.725  27.591  -36.776 1.00 34.18  ? 1002 ALA A C     1 
ATOM   4340 O  O     . ALA A 1 588  ? 35.970  27.957  -35.868 1.00 34.52  ? 1002 ALA A O     1 
ATOM   4341 C  CB    . ALA A 1 588  ? 39.036  28.222  -36.061 1.00 35.00  ? 1002 ALA A CB    1 
ATOM   4342 N  N     . GLY A 1 589  ? 36.502  26.480  -37.483 1.00 33.80  ? 1003 GLY A N     1 
ATOM   4343 C  CA    . GLY A 1 589  ? 35.341  25.603  -37.213 1.00 32.62  ? 1003 GLY A CA    1 
ATOM   4344 C  C     . GLY A 1 589  ? 35.694  24.499  -36.218 1.00 33.36  ? 1003 GLY A C     1 
ATOM   4345 O  O     . GLY A 1 589  ? 36.871  24.160  -36.049 1.00 33.12  ? 1003 GLY A O     1 
ATOM   4346 N  N     . THR A 1 590  ? 34.692  23.933  -35.553 1.00 32.84  ? 1004 THR A N     1 
ATOM   4347 C  CA    . THR A 1 590  ? 34.909  22.762  -34.738 1.00 32.87  ? 1004 THR A CA    1 
ATOM   4348 C  C     . THR A 1 590  ? 33.946  21.664  -35.141 1.00 33.38  ? 1004 THR A C     1 
ATOM   4349 O  O     . THR A 1 590  ? 32.874  21.950  -35.680 1.00 32.49  ? 1004 THR A O     1 
ATOM   4350 C  CB    . THR A 1 590  ? 34.680  23.042  -33.222 1.00 33.03  ? 1004 THR A CB    1 
ATOM   4351 O  OG1   . THR A 1 590  ? 33.287  23.332  -32.986 1.00 31.30  ? 1004 THR A OG1   1 
ATOM   4352 C  CG2   . THR A 1 590  ? 35.591  24.195  -32.732 1.00 32.37  ? 1004 THR A CG2   1 
ATOM   4353 N  N     . ILE A 1 591  ? 34.336  20.420  -34.841 1.00 33.83  ? 1005 ILE A N     1 
ATOM   4354 C  CA    . ILE A 1 591  ? 33.493  19.242  -35.024 1.00 34.73  ? 1005 ILE A CA    1 
ATOM   4355 C  C     . ILE A 1 591  ? 33.003  18.652  -33.671 1.00 34.84  ? 1005 ILE A C     1 
ATOM   4356 O  O     . ILE A 1 591  ? 33.801  18.264  -32.834 1.00 35.03  ? 1005 ILE A O     1 
ATOM   4357 C  CB    . ILE A 1 591  ? 34.210  18.144  -35.858 1.00 34.69  ? 1005 ILE A CB    1 
ATOM   4358 C  CG1   . ILE A 1 591  ? 34.307  18.558  -37.333 1.00 36.05  ? 1005 ILE A CG1   1 
ATOM   4359 C  CG2   . ILE A 1 591  ? 33.394  16.876  -35.860 1.00 35.07  ? 1005 ILE A CG2   1 
ATOM   4360 C  CD1   . ILE A 1 591  ? 35.559  19.160  -37.729 1.00 36.57  ? 1005 ILE A CD1   1 
ATOM   4361 N  N     . GLY A 1 592  ? 31.689  18.565  -33.486 1.00 34.93  ? 1006 GLY A N     1 
ATOM   4362 C  CA    . GLY A 1 592  ? 31.108  18.035  -32.259 1.00 35.33  ? 1006 GLY A CA    1 
ATOM   4363 C  C     . GLY A 1 592  ? 30.905  16.531  -32.279 1.00 35.63  ? 1006 GLY A C     1 
ATOM   4364 O  O     . GLY A 1 592  ? 30.044  15.998  -33.013 1.00 36.36  ? 1006 GLY A O     1 
ATOM   4365 N  N     . THR A 1 593  ? 31.682  15.823  -31.478 1.00 34.85  ? 1007 THR A N     1 
ATOM   4366 C  CA    . THR A 1 593  ? 31.593  14.381  -31.535 1.00 35.40  ? 1007 THR A CA    1 
ATOM   4367 C  C     . THR A 1 593  ? 30.956  13.855  -30.281 1.00 35.45  ? 1007 THR A C     1 
ATOM   4368 O  O     . THR A 1 593  ? 30.770  14.592  -29.324 1.00 35.61  ? 1007 THR A O     1 
ATOM   4369 C  CB    . THR A 1 593  ? 32.955  13.727  -31.675 1.00 35.38  ? 1007 THR A CB    1 
ATOM   4370 O  OG1   . THR A 1 593  ? 33.739  14.022  -30.507 1.00 34.54  ? 1007 THR A OG1   1 
ATOM   4371 C  CG2   . THR A 1 593  ? 33.647  14.249  -32.931 1.00 35.46  ? 1007 THR A CG2   1 
ATOM   4372 N  N     . VAL A 1 594  ? 30.620  12.574  -30.299 1.00 35.37  ? 1008 VAL A N     1 
ATOM   4373 C  CA    . VAL A 1 594  ? 30.014  11.949  -29.154 1.00 35.05  ? 1008 VAL A CA    1 
ATOM   4374 C  C     . VAL A 1 594  ? 31.109  11.583  -28.166 1.00 35.72  ? 1008 VAL A C     1 
ATOM   4375 O  O     . VAL A 1 594  ? 31.989  10.795  -28.475 1.00 36.01  ? 1008 VAL A O     1 
ATOM   4376 C  CB    . VAL A 1 594  ? 29.228  10.696  -29.572 1.00 34.76  ? 1008 VAL A CB    1 
ATOM   4377 C  CG1   . VAL A 1 594  ? 28.709  9.946   -28.342 1.00 34.92  ? 1008 VAL A CG1   1 
ATOM   4378 C  CG2   . VAL A 1 594  ? 28.070  11.070  -30.524 1.00 33.34  ? 1008 VAL A CG2   1 
ATOM   4379 N  N     . ALA A 1 595  ? 31.079  12.171  -26.978 1.00 36.30  ? 1009 ALA A N     1 
ATOM   4380 C  CA    . ALA A 1 595  ? 31.988  11.728  -25.924 1.00 37.31  ? 1009 ALA A CA    1 
ATOM   4381 C  C     . ALA A 1 595  ? 31.248  10.917  -24.844 1.00 37.93  ? 1009 ALA A C     1 
ATOM   4382 O  O     . ALA A 1 595  ? 30.050  10.645  -24.959 1.00 38.22  ? 1009 ALA A O     1 
ATOM   4383 C  CB    . ALA A 1 595  ? 32.769  12.889  -25.331 1.00 36.36  ? 1009 ALA A CB    1 
ATOM   4384 N  N     . ASP A 1 596  ? 31.980  10.482  -23.831 1.00 39.28  ? 1010 ASP A N     1 
ATOM   4385 C  CA    . ASP A 1 596  ? 31.456  9.516   -22.873 1.00 40.69  ? 1010 ASP A CA    1 
ATOM   4386 C  C     . ASP A 1 596  ? 30.015  9.794   -22.430 1.00 40.69  ? 1010 ASP A C     1 
ATOM   4387 O  O     . ASP A 1 596  ? 29.130  8.967   -22.617 1.00 40.50  ? 1010 ASP A O     1 
ATOM   4388 C  CB    . ASP A 1 596  ? 32.399  9.393   -21.664 1.00 41.18  ? 1010 ASP A CB    1 
ATOM   4389 C  CG    . ASP A 1 596  ? 33.593  8.463   -21.932 1.00 44.29  ? 1010 ASP A CG    1 
ATOM   4390 O  OD1   . ASP A 1 596  ? 33.516  7.586   -22.830 1.00 47.58  ? 1010 ASP A OD1   1 
ATOM   4391 O  OD2   . ASP A 1 596  ? 34.621  8.602   -21.228 1.00 48.80  ? 1010 ASP A OD2   1 
ATOM   4392 N  N     . LYS A 1 597  ? 29.770  10.960  -21.847 1.00 41.46  ? 1011 LYS A N     1 
ATOM   4393 C  CA    . LYS A 1 597  ? 28.442  11.239  -21.280 1.00 41.99  ? 1011 LYS A CA    1 
ATOM   4394 C  C     . LYS A 1 597  ? 27.283  11.057  -22.267 1.00 42.13  ? 1011 LYS A C     1 
ATOM   4395 O  O     . LYS A 1 597  ? 26.228  10.486  -21.913 1.00 41.97  ? 1011 LYS A O     1 
ATOM   4396 C  CB    . LYS A 1 597  ? 28.398  12.627  -20.648 1.00 42.34  ? 1011 LYS A CB    1 
ATOM   4397 C  CG    . LYS A 1 597  ? 29.333  12.755  -19.479 1.00 43.10  ? 1011 LYS A CG    1 
ATOM   4398 C  CD    . LYS A 1 597  ? 29.250  14.111  -18.838 1.00 47.09  ? 1011 LYS A CD    1 
ATOM   4399 C  CE    . LYS A 1 597  ? 29.183  13.944  -17.312 1.00 49.92  ? 1011 LYS A CE    1 
ATOM   4400 N  NZ    . LYS A 1 597  ? 29.689  15.136  -16.567 1.00 51.09  ? 1011 LYS A NZ    1 
ATOM   4401 N  N     . THR A 1 598  ? 27.475  11.526  -23.499 1.00 41.42  ? 1012 THR A N     1 
ATOM   4402 C  CA    . THR A 1 598  ? 26.464  11.336  -24.527 1.00 41.31  ? 1012 THR A CA    1 
ATOM   4403 C  C     . THR A 1 598  ? 26.314  9.869   -24.931 1.00 40.90  ? 1012 THR A C     1 
ATOM   4404 O  O     . THR A 1 598  ? 25.201  9.393   -25.132 1.00 40.59  ? 1012 THR A O     1 
ATOM   4405 C  CB    . THR A 1 598  ? 26.788  12.152  -25.786 1.00 41.59  ? 1012 THR A CB    1 
ATOM   4406 O  OG1   . THR A 1 598  ? 27.034  13.512  -25.420 1.00 42.80  ? 1012 THR A OG1   1 
ATOM   4407 C  CG2   . THR A 1 598  ? 25.618  12.108  -26.752 1.00 41.71  ? 1012 THR A CG2   1 
ATOM   4408 N  N     . ALA A 1 599  ? 27.438  9.162   -25.070 1.00 40.87  ? 1013 ALA A N     1 
ATOM   4409 C  CA    . ALA A 1 599  ? 27.413  7.730   -25.404 1.00 40.96  ? 1013 ALA A CA    1 
ATOM   4410 C  C     . ALA A 1 599  ? 26.660  6.904   -24.362 1.00 41.19  ? 1013 ALA A C     1 
ATOM   4411 O  O     . ALA A 1 599  ? 25.785  6.109   -24.703 1.00 41.08  ? 1013 ALA A O     1 
ATOM   4412 C  CB    . ALA A 1 599  ? 28.822  7.189   -25.557 1.00 41.13  ? 1013 ALA A CB    1 
ATOM   4413 N  N     . TYR A 1 600  ? 27.010  7.081   -23.092 1.00 40.96  ? 1014 TYR A N     1 
ATOM   4414 C  CA    . TYR A 1 600  ? 26.315  6.359   -22.049 1.00 41.46  ? 1014 TYR A CA    1 
ATOM   4415 C  C     . TYR A 1 600  ? 24.834  6.682   -22.103 1.00 41.84  ? 1014 TYR A C     1 
ATOM   4416 O  O     . TYR A 1 600  ? 23.993  5.776   -21.983 1.00 41.53  ? 1014 TYR A O     1 
ATOM   4417 C  CB    . TYR A 1 600  ? 26.908  6.642   -20.674 1.00 41.25  ? 1014 TYR A CB    1 
ATOM   4418 C  CG    . TYR A 1 600  ? 28.134  5.803   -20.368 1.00 41.37  ? 1014 TYR A CG    1 
ATOM   4419 C  CD1   . TYR A 1 600  ? 28.010  4.493   -19.908 1.00 39.84  ? 1014 TYR A CD1   1 
ATOM   4420 C  CD2   . TYR A 1 600  ? 29.420  6.327   -20.524 1.00 40.29  ? 1014 TYR A CD2   1 
ATOM   4421 C  CE1   . TYR A 1 600  ? 29.122  3.740   -19.616 1.00 38.89  ? 1014 TYR A CE1   1 
ATOM   4422 C  CE2   . TYR A 1 600  ? 30.528  5.580   -20.241 1.00 39.10  ? 1014 TYR A CE2   1 
ATOM   4423 C  CZ    . TYR A 1 600  ? 30.379  4.286   -19.791 1.00 40.28  ? 1014 TYR A CZ    1 
ATOM   4424 O  OH    . TYR A 1 600  ? 31.503  3.541   -19.517 1.00 40.35  ? 1014 TYR A OH    1 
ATOM   4425 N  N     . GLY A 1 601  ? 24.514  7.961   -22.321 1.00 42.35  ? 1015 GLY A N     1 
ATOM   4426 C  CA    . GLY A 1 601  ? 23.109  8.386   -22.477 1.00 42.45  ? 1015 GLY A CA    1 
ATOM   4427 C  C     . GLY A 1 601  ? 22.410  7.617   -23.591 1.00 42.86  ? 1015 GLY A C     1 
ATOM   4428 O  O     . GLY A 1 601  ? 21.339  7.009   -23.379 1.00 42.90  ? 1015 GLY A O     1 
ATOM   4429 N  N     . PHE A 1 602  ? 23.013  7.622   -24.781 1.00 42.82  ? 1016 PHE A N     1 
ATOM   4430 C  CA    . PHE A 1 602  ? 22.421  6.899   -25.914 1.00 42.96  ? 1016 PHE A CA    1 
ATOM   4431 C  C     . PHE A 1 602  ? 22.208  5.422   -25.613 1.00 42.76  ? 1016 PHE A C     1 
ATOM   4432 O  O     . PHE A 1 602  ? 21.182  4.851   -25.990 1.00 42.93  ? 1016 PHE A O     1 
ATOM   4433 C  CB    . PHE A 1 602  ? 23.284  6.996   -27.170 1.00 42.99  ? 1016 PHE A CB    1 
ATOM   4434 C  CG    . PHE A 1 602  ? 23.290  8.343   -27.801 1.00 44.28  ? 1016 PHE A CG    1 
ATOM   4435 C  CD1   . PHE A 1 602  ? 22.323  9.280   -27.470 1.00 44.95  ? 1016 PHE A CD1   1 
ATOM   4436 C  CD2   . PHE A 1 602  ? 24.257  8.668   -28.756 1.00 44.33  ? 1016 PHE A CD2   1 
ATOM   4437 C  CE1   . PHE A 1 602  ? 22.336  10.528  -28.068 1.00 45.98  ? 1016 PHE A CE1   1 
ATOM   4438 C  CE2   . PHE A 1 602  ? 24.275  9.900   -29.359 1.00 43.61  ? 1016 PHE A CE2   1 
ATOM   4439 C  CZ    . PHE A 1 602  ? 23.322  10.839  -29.021 1.00 45.26  ? 1016 PHE A CZ    1 
ATOM   4440 N  N     . VAL A 1 603  ? 23.191  4.791   -24.976 1.00 42.35  ? 1017 VAL A N     1 
ATOM   4441 C  CA    . VAL A 1 603  ? 23.139  3.352   -24.768 1.00 42.49  ? 1017 VAL A CA    1 
ATOM   4442 C  C     . VAL A 1 603  ? 22.038  2.967   -23.790 1.00 42.75  ? 1017 VAL A C     1 
ATOM   4443 O  O     . VAL A 1 603  ? 21.266  2.039   -24.028 1.00 43.28  ? 1017 VAL A O     1 
ATOM   4444 C  CB    . VAL A 1 603  ? 24.486  2.802   -24.274 1.00 42.62  ? 1017 VAL A CB    1 
ATOM   4445 C  CG1   . VAL A 1 603  ? 24.344  1.343   -23.862 1.00 41.72  ? 1017 VAL A CG1   1 
ATOM   4446 C  CG2   . VAL A 1 603  ? 25.531  2.958   -25.355 1.00 42.89  ? 1017 VAL A CG2   1 
ATOM   4447 N  N     . LYS A 1 604  ? 21.952  3.677   -22.682 1.00 42.99  ? 1018 LYS A N     1 
ATOM   4448 C  CA    . LYS A 1 604  ? 20.889  3.384   -21.750 1.00 44.03  ? 1018 LYS A CA    1 
ATOM   4449 C  C     . LYS A 1 604  ? 19.488  3.519   -22.394 1.00 44.40  ? 1018 LYS A C     1 
ATOM   4450 O  O     . LYS A 1 604  ? 18.706  2.579   -22.342 1.00 44.04  ? 1018 LYS A O     1 
ATOM   4451 C  CB    . LYS A 1 604  ? 21.039  4.202   -20.465 1.00 44.25  ? 1018 LYS A CB    1 
ATOM   4452 C  CG    . LYS A 1 604  ? 22.241  3.809   -19.598 1.00 44.94  ? 1018 LYS A CG    1 
ATOM   4453 C  CD    . LYS A 1 604  ? 22.527  4.917   -18.595 1.00 47.25  ? 1018 LYS A CD    1 
ATOM   4454 C  CE    . LYS A 1 604  ? 23.676  4.591   -17.668 1.00 49.67  ? 1018 LYS A CE    1 
ATOM   4455 N  NZ    . LYS A 1 604  ? 24.293  5.844   -17.106 1.00 51.20  ? 1018 LYS A NZ    1 
ATOM   4456 N  N     . ALA A 1 605  ? 19.183  4.652   -23.024 1.00 44.97  ? 1019 ALA A N     1 
ATOM   4457 C  CA    . ALA A 1 605  ? 17.886  4.797   -23.691 1.00 45.82  ? 1019 ALA A CA    1 
ATOM   4458 C  C     . ALA A 1 605  ? 17.594  3.625   -24.649 1.00 46.39  ? 1019 ALA A C     1 
ATOM   4459 O  O     . ALA A 1 605  ? 16.513  3.033   -24.610 1.00 46.31  ? 1019 ALA A O     1 
ATOM   4460 C  CB    . ALA A 1 605  ? 17.792  6.136   -24.417 1.00 45.59  ? 1019 ALA A CB    1 
ATOM   4461 N  N     . TYR A 1 606  ? 18.566  3.285   -25.496 1.00 47.15  ? 1020 TYR A N     1 
ATOM   4462 C  CA    . TYR A 1 606  ? 18.465  2.103   -26.362 1.00 47.56  ? 1020 TYR A CA    1 
ATOM   4463 C  C     . TYR A 1 606  ? 18.210  0.821   -25.583 1.00 48.03  ? 1020 TYR A C     1 
ATOM   4464 O  O     . TYR A 1 606  ? 17.424  -0.020  -26.014 1.00 48.65  ? 1020 TYR A O     1 
ATOM   4465 C  CB    . TYR A 1 606  ? 19.738  1.900   -27.164 1.00 47.30  ? 1020 TYR A CB    1 
ATOM   4466 C  CG    . TYR A 1 606  ? 19.666  0.718   -28.092 1.00 47.37  ? 1020 TYR A CG    1 
ATOM   4467 C  CD1   . TYR A 1 606  ? 19.071  0.839   -29.340 1.00 48.28  ? 1020 TYR A CD1   1 
ATOM   4468 C  CD2   . TYR A 1 606  ? 20.184  -0.514  -27.730 1.00 47.30  ? 1020 TYR A CD2   1 
ATOM   4469 C  CE1   . TYR A 1 606  ? 18.996  -0.222  -30.204 1.00 47.88  ? 1020 TYR A CE1   1 
ATOM   4470 C  CE2   . TYR A 1 606  ? 20.121  -1.598  -28.598 1.00 47.78  ? 1020 TYR A CE2   1 
ATOM   4471 C  CZ    . TYR A 1 606  ? 19.517  -1.438  -29.831 1.00 48.90  ? 1020 TYR A CZ    1 
ATOM   4472 O  OH    . TYR A 1 606  ? 19.434  -2.485  -30.718 1.00 50.31  ? 1020 TYR A OH    1 
ATOM   4473 N  N     . ALA A 1 607  ? 18.893  0.651   -24.459 1.00 48.12  ? 1021 ALA A N     1 
ATOM   4474 C  CA    . ALA A 1 607  ? 18.613  -0.487  -23.592 1.00 48.54  ? 1021 ALA A CA    1 
ATOM   4475 C  C     . ALA A 1 607  ? 17.162  -0.461  -23.067 1.00 48.77  ? 1021 ALA A C     1 
ATOM   4476 O  O     . ALA A 1 607  ? 16.396  -1.419  -23.241 1.00 48.42  ? 1021 ALA A O     1 
ATOM   4477 C  CB    . ALA A 1 607  ? 19.605  -0.531  -22.432 1.00 48.37  ? 1021 ALA A CB    1 
ATOM   4478 N  N     . SER A 1 608  ? 16.818  0.635   -22.401 1.00 49.11  ? 1022 SER A N     1 
ATOM   4479 C  CA    . SER A 1 608  ? 15.474  0.903   -21.917 1.00 49.57  ? 1022 SER A CA    1 
ATOM   4480 C  C     . SER A 1 608  ? 14.378  0.688   -22.984 1.00 50.02  ? 1022 SER A C     1 
ATOM   4481 O  O     . SER A 1 608  ? 13.421  -0.067  -22.763 1.00 49.54  ? 1022 SER A O     1 
ATOM   4482 C  CB    . SER A 1 608  ? 15.423  2.340   -21.389 1.00 49.60  ? 1022 SER A CB    1 
ATOM   4483 O  OG    . SER A 1 608  ? 14.383  2.515   -20.449 1.00 50.35  ? 1022 SER A OG    1 
ATOM   4484 N  N     . ASP A 1 609  ? 14.506  1.343   -24.135 1.00 50.30  ? 1023 ASP A N     1 
ATOM   4485 C  CA    . ASP A 1 609  ? 13.465  1.211   -25.161 1.00 50.96  ? 1023 ASP A CA    1 
ATOM   4486 C  C     . ASP A 1 609  ? 13.325  -0.236  -25.642 1.00 51.35  ? 1023 ASP A C     1 
ATOM   4487 O  O     . ASP A 1 609  ? 12.290  -0.602  -26.198 1.00 51.66  ? 1023 ASP A O     1 
ATOM   4488 C  CB    . ASP A 1 609  ? 13.726  2.106   -26.386 1.00 51.01  ? 1023 ASP A CB    1 
ATOM   4489 C  CG    . ASP A 1 609  ? 13.737  3.607   -26.061 1.00 50.76  ? 1023 ASP A CG    1 
ATOM   4490 O  OD1   . ASP A 1 609  ? 13.152  4.038   -25.050 1.00 50.63  ? 1023 ASP A OD1   1 
ATOM   4491 O  OD2   . ASP A 1 609  ? 14.335  4.363   -26.850 1.00 50.09  ? 1023 ASP A OD2   1 
ATOM   4492 N  N     . HIS A 1 610  ? 14.369  -1.045  -25.464 1.00 51.47  ? 1024 HIS A N     1 
ATOM   4493 C  CA    . HIS A 1 610  ? 14.377  -2.419  -25.981 1.00 51.58  ? 1024 HIS A CA    1 
ATOM   4494 C  C     . HIS A 1 610  ? 14.168  -3.448  -24.898 1.00 51.55  ? 1024 HIS A C     1 
ATOM   4495 O  O     . HIS A 1 610  ? 14.364  -4.637  -25.123 1.00 51.59  ? 1024 HIS A O     1 
ATOM   4496 C  CB    . HIS A 1 610  ? 15.716  -2.725  -26.636 1.00 51.80  ? 1024 HIS A CB    1 
ATOM   4497 C  CG    . HIS A 1 610  ? 15.819  -2.265  -28.053 1.00 52.71  ? 1024 HIS A CG    1 
ATOM   4498 N  ND1   . HIS A 1 610  ? 15.403  -3.034  -29.118 1.00 54.07  ? 1024 HIS A ND1   1 
ATOM   4499 C  CD2   . HIS A 1 610  ? 16.300  -1.119  -28.582 1.00 53.25  ? 1024 HIS A CD2   1 
ATOM   4500 C  CE1   . HIS A 1 610  ? 15.623  -2.381  -30.244 1.00 53.97  ? 1024 HIS A CE1   1 
ATOM   4501 N  NE2   . HIS A 1 610  ? 16.170  -1.217  -29.946 1.00 53.94  ? 1024 HIS A NE2   1 
ATOM   4502 N  N     . ASN A 1 611  ? 13.801  -2.986  -23.712 1.00 51.52  ? 1025 ASN A N     1 
ATOM   4503 C  CA    . ASN A 1 611  ? 13.816  -3.831  -22.532 1.00 51.75  ? 1025 ASN A CA    1 
ATOM   4504 C  C     . ASN A 1 611  ? 14.997  -4.797  -22.383 1.00 51.47  ? 1025 ASN A C     1 
ATOM   4505 O  O     . ASN A 1 611  ? 14.810  -5.985  -22.101 1.00 51.61  ? 1025 ASN A O     1 
ATOM   4506 C  CB    . ASN A 1 611  ? 12.492  -4.574  -22.386 1.00 52.17  ? 1025 ASN A CB    1 
ATOM   4507 C  CG    . ASN A 1 611  ? 11.511  -3.802  -21.555 1.00 52.60  ? 1025 ASN A CG    1 
ATOM   4508 O  OD1   . ASN A 1 611  ? 10.857  -2.864  -22.043 1.00 52.50  ? 1025 ASN A OD1   1 
ATOM   4509 N  ND2   . ASN A 1 611  ? 11.421  -4.161  -20.278 1.00 51.45  ? 1025 ASN A ND2   1 
ATOM   4510 N  N     . LEU A 1 612  ? 16.210  -4.284  -22.551 1.00 51.11  ? 1026 LEU A N     1 
ATOM   4511 C  CA    . LEU A 1 612  ? 17.406  -5.052  -22.228 1.00 50.52  ? 1026 LEU A CA    1 
ATOM   4512 C  C     . LEU A 1 612  ? 17.874  -4.654  -20.830 1.00 50.11  ? 1026 LEU A C     1 
ATOM   4513 O  O     . LEU A 1 612  ? 17.871  -3.469  -20.483 1.00 49.66  ? 1026 LEU A O     1 
ATOM   4514 C  CB    . LEU A 1 612  ? 18.500  -4.790  -23.262 1.00 50.72  ? 1026 LEU A CB    1 
ATOM   4515 C  CG    . LEU A 1 612  ? 18.532  -5.605  -24.564 1.00 50.63  ? 1026 LEU A CG    1 
ATOM   4516 C  CD1   . LEU A 1 612  ? 17.260  -6.411  -24.792 1.00 50.73  ? 1026 LEU A CD1   1 
ATOM   4517 C  CD2   . LEU A 1 612  ? 18.848  -4.717  -25.761 1.00 50.09  ? 1026 LEU A CD2   1 
ATOM   4518 N  N     . GLU A 1 613  ? 18.218  -5.647  -20.012 1.00 49.66  ? 1027 GLU A N     1 
ATOM   4519 C  CA    . GLU A 1 613  ? 18.873  -5.388  -18.740 1.00 49.51  ? 1027 GLU A CA    1 
ATOM   4520 C  C     . GLU A 1 613  ? 20.329  -5.753  -18.973 1.00 48.32  ? 1027 GLU A C     1 
ATOM   4521 O  O     . GLU A 1 613  ? 20.655  -6.919  -19.157 1.00 48.54  ? 1027 GLU A O     1 
ATOM   4522 C  CB    . GLU A 1 613  ? 18.296  -6.261  -17.616 1.00 50.03  ? 1027 GLU A CB    1 
ATOM   4523 C  CG    . GLU A 1 613  ? 16.767  -6.369  -17.582 1.00 53.05  ? 1027 GLU A CG    1 
ATOM   4524 C  CD    . GLU A 1 613  ? 16.111  -5.525  -16.483 1.00 56.36  ? 1027 GLU A CD    1 
ATOM   4525 O  OE1   . GLU A 1 613  ? 16.700  -5.411  -15.377 1.00 56.70  ? 1027 GLU A OE1   1 
ATOM   4526 O  OE2   . GLU A 1 613  ? 14.997  -4.993  -16.730 1.00 56.48  ? 1027 GLU A OE2   1 
ATOM   4527 N  N     . LEU A 1 614  ? 21.217  -4.777  -18.996 1.00 46.85  ? 1028 LEU A N     1 
ATOM   4528 C  CA    . LEU A 1 614  ? 22.591  -5.109  -19.333 1.00 44.85  ? 1028 LEU A CA    1 
ATOM   4529 C  C     . LEU A 1 614  ? 23.546  -4.995  -18.159 1.00 43.92  ? 1028 LEU A C     1 
ATOM   4530 O  O     . LEU A 1 614  ? 23.328  -4.213  -17.228 1.00 43.65  ? 1028 LEU A O     1 
ATOM   4531 C  CB    . LEU A 1 614  ? 23.069  -4.262  -20.502 1.00 44.84  ? 1028 LEU A CB    1 
ATOM   4532 C  CG    . LEU A 1 614  ? 22.228  -4.316  -21.782 1.00 43.57  ? 1028 LEU A CG    1 
ATOM   4533 C  CD1   . LEU A 1 614  ? 22.883  -3.417  -22.808 1.00 43.42  ? 1028 LEU A CD1   1 
ATOM   4534 C  CD2   . LEU A 1 614  ? 22.084  -5.719  -22.326 1.00 42.27  ? 1028 LEU A CD2   1 
ATOM   4535 N  N     . ARG A 1 615  ? 24.601  -5.801  -18.201 1.00 42.53  ? 1029 ARG A N     1 
ATOM   4536 C  CA    . ARG A 1 615  ? 25.671  -5.679  -17.233 1.00 41.24  ? 1029 ARG A CA    1 
ATOM   4537 C  C     . ARG A 1 615  ? 26.375  -4.333  -17.403 1.00 40.52  ? 1029 ARG A C     1 
ATOM   4538 O  O     . ARG A 1 615  ? 26.457  -3.790  -18.516 1.00 40.39  ? 1029 ARG A O     1 
ATOM   4539 C  CB    . ARG A 1 615  ? 26.662  -6.846  -17.379 1.00 41.42  ? 1029 ARG A CB    1 
ATOM   4540 C  CG    . ARG A 1 615  ? 26.041  -8.237  -17.133 1.00 40.69  ? 1029 ARG A CG    1 
ATOM   4541 C  CD    . ARG A 1 615  ? 27.114  -9.313  -17.005 1.00 39.92  ? 1029 ARG A CD    1 
ATOM   4542 N  NE    . ARG A 1 615  ? 27.607  -9.771  -18.305 1.00 38.73  ? 1029 ARG A NE    1 
ATOM   4543 C  CZ    . ARG A 1 615  ? 27.128  -10.820 -18.973 1.00 38.42  ? 1029 ARG A CZ    1 
ATOM   4544 N  NH1   . ARG A 1 615  ? 26.139  -11.553 -18.470 1.00 38.18  ? 1029 ARG A NH1   1 
ATOM   4545 N  NH2   . ARG A 1 615  ? 27.653  -11.148 -20.143 1.00 36.72  ? 1029 ARG A NH2   1 
ATOM   4546 N  N     . GLY A 1 616  ? 26.866  -3.789  -16.295 1.00 39.54  ? 1030 GLY A N     1 
ATOM   4547 C  CA    . GLY A 1 616  ? 27.710  -2.601  -16.335 1.00 38.62  ? 1030 GLY A CA    1 
ATOM   4548 C  C     . GLY A 1 616  ? 28.729  -2.723  -17.463 1.00 38.26  ? 1030 GLY A C     1 
ATOM   4549 O  O     . GLY A 1 616  ? 28.764  -1.902  -18.377 1.00 38.37  ? 1030 GLY A O     1 
ATOM   4550 N  N     . ALA A 1 617  ? 29.525  -3.781  -17.418 1.00 37.35  ? 1031 ALA A N     1 
ATOM   4551 C  CA    . ALA A 1 617  ? 30.610  -3.984  -18.347 1.00 37.27  ? 1031 ALA A CA    1 
ATOM   4552 C  C     . ALA A 1 617  ? 30.202  -3.926  -19.847 1.00 37.52  ? 1031 ALA A C     1 
ATOM   4553 O  O     . ALA A 1 617  ? 30.979  -3.469  -20.687 1.00 36.97  ? 1031 ALA A O     1 
ATOM   4554 C  CB    . ALA A 1 617  ? 31.300  -5.281  -18.024 1.00 36.80  ? 1031 ALA A CB    1 
ATOM   4555 N  N     . GLU A 1 618  ? 28.997  -4.400  -20.150 1.00 37.31  ? 1032 GLU A N     1 
ATOM   4556 C  CA    . GLU A 1 618  ? 28.430  -4.348  -21.488 1.00 37.71  ? 1032 GLU A CA    1 
ATOM   4557 C  C     . GLU A 1 618  ? 27.878  -2.967  -21.835 1.00 38.00  ? 1032 GLU A C     1 
ATOM   4558 O  O     . GLU A 1 618  ? 27.817  -2.597  -23.005 1.00 38.39  ? 1032 GLU A O     1 
ATOM   4559 C  CB    . GLU A 1 618  ? 27.285  -5.344  -21.617 1.00 37.30  ? 1032 GLU A CB    1 
ATOM   4560 C  CG    . GLU A 1 618  ? 26.572  -5.259  -22.944 1.00 37.16  ? 1032 GLU A CG    1 
ATOM   4561 C  CD    . GLU A 1 618  ? 27.439  -5.742  -24.096 1.00 40.10  ? 1032 GLU A CD    1 
ATOM   4562 O  OE1   . GLU A 1 618  ? 28.692  -5.553  -24.064 1.00 40.10  ? 1032 GLU A OE1   1 
ATOM   4563 O  OE2   . GLU A 1 618  ? 26.864  -6.300  -25.047 1.00 40.38  ? 1032 GLU A OE2   1 
ATOM   4564 N  N     . ILE A 1 619  ? 27.414  -2.222  -20.843 1.00 38.13  ? 1033 ILE A N     1 
ATOM   4565 C  CA    . ILE A 1 619  ? 27.006  -0.860  -21.125 1.00 38.32  ? 1033 ILE A CA    1 
ATOM   4566 C  C     . ILE A 1 619  ? 28.289  -0.069  -21.457 1.00 38.34  ? 1033 ILE A C     1 
ATOM   4567 O  O     . ILE A 1 619  ? 28.302  0.724   -22.404 1.00 37.80  ? 1033 ILE A O     1 
ATOM   4568 C  CB    . ILE A 1 619  ? 26.265  -0.201  -19.943 1.00 38.24  ? 1033 ILE A CB    1 
ATOM   4569 C  CG1   . ILE A 1 619  ? 24.836  -0.732  -19.817 1.00 38.13  ? 1033 ILE A CG1   1 
ATOM   4570 C  CG2   . ILE A 1 619  ? 26.220  1.314   -20.116 1.00 38.89  ? 1033 ILE A CG2   1 
ATOM   4571 C  CD1   . ILE A 1 619  ? 24.212  -0.517  -18.409 1.00 35.00  ? 1033 ILE A CD1   1 
ATOM   4572 N  N     . ASP A 1 620  ? 29.361  -0.305  -20.693 1.00 37.91  ? 1034 ASP A N     1 
ATOM   4573 C  CA    . ASP A 1 620  ? 30.610  0.392   -20.944 1.00 38.38  ? 1034 ASP A CA    1 
ATOM   4574 C  C     . ASP A 1 620  ? 31.045  0.131   -22.378 1.00 38.85  ? 1034 ASP A C     1 
ATOM   4575 O  O     . ASP A 1 620  ? 31.442  1.059   -23.078 1.00 38.65  ? 1034 ASP A O     1 
ATOM   4576 C  CB    . ASP A 1 620  ? 31.754  -0.052  -20.027 1.00 38.28  ? 1034 ASP A CB    1 
ATOM   4577 C  CG    . ASP A 1 620  ? 31.509  0.255   -18.568 1.00 39.21  ? 1034 ASP A CG    1 
ATOM   4578 O  OD1   . ASP A 1 620  ? 30.862  1.277   -18.271 1.00 41.24  ? 1034 ASP A OD1   1 
ATOM   4579 O  OD2   . ASP A 1 620  ? 31.986  -0.530  -17.715 1.00 36.65  ? 1034 ASP A OD2   1 
ATOM   4580 N  N     . ARG A 1 621  ? 31.000  -1.120  -22.827 1.00 39.39  ? 1035 ARG A N     1 
ATOM   4581 C  CA    . ARG A 1 621  ? 31.605  -1.376  -24.132 1.00 40.32  ? 1035 ARG A CA    1 
ATOM   4582 C  C     . ARG A 1 621  ? 30.773  -0.823  -25.301 1.00 40.20  ? 1035 ARG A C     1 
ATOM   4583 O  O     . ARG A 1 621  ? 31.329  -0.315  -26.274 1.00 40.96  ? 1035 ARG A O     1 
ATOM   4584 C  CB    . ARG A 1 621  ? 32.146  -2.813  -24.310 1.00 40.11  ? 1035 ARG A CB    1 
ATOM   4585 C  CG    . ARG A 1 621  ? 31.199  -3.855  -24.807 1.00 40.87  ? 1035 ARG A CG    1 
ATOM   4586 C  CD    . ARG A 1 621  ? 30.993  -3.880  -26.348 1.00 38.06  ? 1035 ARG A CD    1 
ATOM   4587 N  NE    . ARG A 1 621  ? 29.840  -4.751  -26.602 1.00 35.55  ? 1035 ARG A NE    1 
ATOM   4588 C  CZ    . ARG A 1 621  ? 29.382  -5.137  -27.783 1.00 35.73  ? 1035 ARG A CZ    1 
ATOM   4589 N  NH1   . ARG A 1 621  ? 28.322  -5.936  -27.837 1.00 37.37  ? 1035 ARG A NH1   1 
ATOM   4590 N  NH2   . ARG A 1 621  ? 29.965  -4.749  -28.901 1.00 36.59  ? 1035 ARG A NH2   1 
ATOM   4591 N  N     . LEU A 1 622  ? 29.450  -0.890  -25.187 1.00 39.99  ? 1036 LEU A N     1 
ATOM   4592 C  CA    . LEU A 1 622  ? 28.596  -0.227  -26.165 1.00 39.44  ? 1036 LEU A CA    1 
ATOM   4593 C  C     . LEU A 1 622  ? 28.869  1.277   -26.151 1.00 39.71  ? 1036 LEU A C     1 
ATOM   4594 O  O     . LEU A 1 622  ? 28.968  1.919   -27.194 1.00 39.74  ? 1036 LEU A O     1 
ATOM   4595 C  CB    . LEU A 1 622  ? 27.139  -0.507  -25.880 1.00 38.51  ? 1036 LEU A CB    1 
ATOM   4596 C  CG    . LEU A 1 622  ? 26.787  -1.986  -26.030 1.00 38.10  ? 1036 LEU A CG    1 
ATOM   4597 C  CD1   . LEU A 1 622  ? 25.406  -2.260  -25.496 1.00 35.90  ? 1036 LEU A CD1   1 
ATOM   4598 C  CD2   . LEU A 1 622  ? 26.908  -2.448  -27.475 1.00 36.20  ? 1036 LEU A CD2   1 
ATOM   4599 N  N     . ALA A 1 623  ? 28.993  1.834   -24.958 1.00 39.53  ? 1037 ALA A N     1 
ATOM   4600 C  CA    . ALA A 1 623  ? 29.373  3.220   -24.836 1.00 39.75  ? 1037 ALA A CA    1 
ATOM   4601 C  C     . ALA A 1 623  ? 30.638  3.510   -25.658 1.00 39.34  ? 1037 ALA A C     1 
ATOM   4602 O  O     . ALA A 1 623  ? 30.649  4.396   -26.511 1.00 39.55  ? 1037 ALA A O     1 
ATOM   4603 C  CB    . ALA A 1 623  ? 29.586  3.575   -23.380 1.00 39.81  ? 1037 ALA A CB    1 
ATOM   4604 N  N     . ALA A 1 624  ? 31.691  2.748   -25.415 1.00 38.78  ? 1038 ALA A N     1 
ATOM   4605 C  CA    . ALA A 1 624  ? 32.972  3.021   -26.037 1.00 38.50  ? 1038 ALA A CA    1 
ATOM   4606 C  C     . ALA A 1 624  ? 32.942  2.906   -27.570 1.00 38.82  ? 1038 ALA A C     1 
ATOM   4607 O  O     . ALA A 1 624  ? 33.806  3.463   -28.253 1.00 38.45  ? 1038 ALA A O     1 
ATOM   4608 C  CB    . ALA A 1 624  ? 34.036  2.123   -25.454 1.00 38.07  ? 1038 ALA A CB    1 
ATOM   4609 N  N     . GLY A 1 625  ? 31.947  2.200   -28.112 1.00 38.62  ? 1039 GLY A N     1 
ATOM   4610 C  CA    . GLY A 1 625  ? 31.931  1.911   -29.529 1.00 37.78  ? 1039 GLY A CA    1 
ATOM   4611 C  C     . GLY A 1 625  ? 31.218  3.020   -30.261 1.00 38.57  ? 1039 GLY A C     1 
ATOM   4612 O  O     . GLY A 1 625  ? 31.231  3.063   -31.509 1.00 38.05  ? 1039 GLY A O     1 
ATOM   4613 N  N     . CYS A 1 626  ? 30.584  3.906   -29.487 1.00 38.53  ? 1040 CYS A N     1 
ATOM   4614 C  CA    . CYS A 1 626  ? 29.869  5.065   -30.048 1.00 38.59  ? 1040 CYS A CA    1 
ATOM   4615 C  C     . CYS A 1 626  ? 30.679  6.369   -30.023 1.00 38.70  ? 1040 CYS A C     1 
ATOM   4616 O  O     . CYS A 1 626  ? 30.284  7.353   -30.655 1.00 38.67  ? 1040 CYS A O     1 
ATOM   4617 C  CB    . CYS A 1 626  ? 28.575  5.314   -29.288 1.00 37.98  ? 1040 CYS A CB    1 
ATOM   4618 S  SG    . CYS A 1 626  ? 27.385  3.997   -29.364 1.00 38.36  ? 1040 CYS A SG    1 
ATOM   4619 N  N     . THR A 1 627  ? 31.765  6.406   -29.260 1.00 38.24  ? 1041 THR A N     1 
ATOM   4620 C  CA    . THR A 1 627  ? 32.455  7.671   -29.076 1.00 38.92  ? 1041 THR A CA    1 
ATOM   4621 C  C     . THR A 1 627  ? 33.229  8.004   -30.327 1.00 39.17  ? 1041 THR A C     1 
ATOM   4622 O  O     . THR A 1 627  ? 33.603  7.108   -31.079 1.00 39.37  ? 1041 THR A O     1 
ATOM   4623 C  CB    . THR A 1 627  ? 33.394  7.683   -27.845 1.00 38.76  ? 1041 THR A CB    1 
ATOM   4624 O  OG1   . THR A 1 627  ? 34.363  6.640   -27.972 1.00 39.02  ? 1041 THR A OG1   1 
ATOM   4625 C  CG2   . THR A 1 627  ? 32.597  7.461   -26.577 1.00 38.94  ? 1041 THR A CG2   1 
ATOM   4626 N  N     . GLY A 1 628  ? 33.452  9.292   -30.564 1.00 39.25  ? 1042 GLY A N     1 
ATOM   4627 C  CA    . GLY A 1 628  ? 34.207  9.723   -31.746 1.00 39.21  ? 1042 GLY A CA    1 
ATOM   4628 C  C     . GLY A 1 628  ? 33.368  10.044  -32.975 1.00 39.21  ? 1042 GLY A C     1 
ATOM   4629 O  O     . GLY A 1 628  ? 33.867  10.643  -33.926 1.00 40.12  ? 1042 GLY A O     1 
ATOM   4630 N  N     . VAL A 1 629  ? 32.100  9.650   -32.975 1.00 38.65  ? 1043 VAL A N     1 
ATOM   4631 C  CA    . VAL A 1 629  ? 31.255  9.871   -34.123 1.00 38.00  ? 1043 VAL A CA    1 
ATOM   4632 C  C     . VAL A 1 629  ? 30.817  11.319  -34.093 1.00 38.26  ? 1043 VAL A C     1 
ATOM   4633 O  O     . VAL A 1 629  ? 30.521  11.867  -33.010 1.00 37.89  ? 1043 VAL A O     1 
ATOM   4634 C  CB    . VAL A 1 629  ? 30.016  8.913   -34.122 1.00 38.42  ? 1043 VAL A CB    1 
ATOM   4635 C  CG1   . VAL A 1 629  ? 29.165  9.080   -35.393 1.00 37.45  ? 1043 VAL A CG1   1 
ATOM   4636 C  CG2   . VAL A 1 629  ? 30.473  7.479   -34.021 1.00 38.05  ? 1043 VAL A CG2   1 
ATOM   4637 N  N     . LYS A 1 630  ? 30.797  11.942  -35.275 1.00 38.19  ? 1044 LYS A N     1 
ATOM   4638 C  CA    . LYS A 1 630  ? 30.413  13.336  -35.394 1.00 38.93  ? 1044 LYS A CA    1 
ATOM   4639 C  C     . LYS A 1 630  ? 28.921  13.492  -35.212 1.00 39.21  ? 1044 LYS A C     1 
ATOM   4640 O  O     . LYS A 1 630  ? 28.133  12.744  -35.782 1.00 39.48  ? 1044 LYS A O     1 
ATOM   4641 C  CB    . LYS A 1 630  ? 30.825  13.910  -36.755 1.00 39.12  ? 1044 LYS A CB    1 
ATOM   4642 C  CG    . LYS A 1 630  ? 30.159  15.241  -37.116 1.00 38.56  ? 1044 LYS A CG    1 
ATOM   4643 C  CD    . LYS A 1 630  ? 30.503  15.670  -38.551 1.00 40.62  ? 1044 LYS A CD    1 
ATOM   4644 C  CE    . LYS A 1 630  ? 29.994  17.074  -38.845 1.00 42.38  ? 1044 LYS A CE    1 
ATOM   4645 N  NZ    . LYS A 1 630  ? 29.854  17.401  -40.315 1.00 45.45  ? 1044 LYS A NZ    1 
ATOM   4646 N  N     . ARG A 1 631  ? 28.531  14.484  -34.426 1.00 39.75  ? 1045 ARG A N     1 
ATOM   4647 C  CA    . ARG A 1 631  ? 27.117  14.775  -34.255 1.00 40.18  ? 1045 ARG A CA    1 
ATOM   4648 C  C     . ARG A 1 631  ? 26.737  16.173  -34.732 1.00 39.55  ? 1045 ARG A C     1 
ATOM   4649 O  O     . ARG A 1 631  ? 25.598  16.391  -35.137 1.00 40.31  ? 1045 ARG A O     1 
ATOM   4650 C  CB    . ARG A 1 631  ? 26.669  14.562  -32.798 1.00 40.78  ? 1045 ARG A CB    1 
ATOM   4651 C  CG    . ARG A 1 631  ? 25.657  15.598  -32.348 1.00 43.62  ? 1045 ARG A CG    1 
ATOM   4652 C  CD    . ARG A 1 631  ? 24.422  14.999  -31.624 1.00 47.06  ? 1045 ARG A CD    1 
ATOM   4653 N  NE    . ARG A 1 631  ? 24.655  14.841  -30.194 1.00 49.34  ? 1045 ARG A NE    1 
ATOM   4654 C  CZ    . ARG A 1 631  ? 23.699  14.865  -29.267 1.00 50.19  ? 1045 ARG A CZ    1 
ATOM   4655 N  NH1   . ARG A 1 631  ? 22.431  15.054  -29.604 1.00 51.74  ? 1045 ARG A NH1   1 
ATOM   4656 N  NH2   . ARG A 1 631  ? 24.015  14.709  -27.996 1.00 50.21  ? 1045 ARG A NH2   1 
ATOM   4657 N  N     . THR A 1 632  ? 27.685  17.112  -34.689 1.00 38.44  ? 1046 THR A N     1 
ATOM   4658 C  CA    . THR A 1 632  ? 27.409  18.504  -35.037 1.00 37.19  ? 1046 THR A CA    1 
ATOM   4659 C  C     . THR A 1 632  ? 28.664  19.241  -35.494 1.00 36.57  ? 1046 THR A C     1 
ATOM   4660 O  O     . THR A 1 632  ? 29.778  18.712  -35.447 1.00 36.39  ? 1046 THR A O     1 
ATOM   4661 C  CB    . THR A 1 632  ? 26.933  19.278  -33.800 1.00 37.71  ? 1046 THR A CB    1 
ATOM   4662 O  OG1   . THR A 1 632  ? 27.981  19.283  -32.819 1.00 37.65  ? 1046 THR A OG1   1 
ATOM   4663 C  CG2   . THR A 1 632  ? 25.717  18.613  -33.170 1.00 38.24  ? 1046 THR A CG2   1 
ATOM   4664 N  N     . THR A 1 633  ? 28.482  20.493  -35.889 1.00 34.92  ? 1047 THR A N     1 
ATOM   4665 C  CA    . THR A 1 633  ? 29.607  21.393  -36.070 1.00 33.36  ? 1047 THR A CA    1 
ATOM   4666 C  C     . THR A 1 633  ? 29.325  22.657  -35.277 1.00 33.11  ? 1047 THR A C     1 
ATOM   4667 O  O     . THR A 1 633  ? 28.181  22.924  -34.922 1.00 32.62  ? 1047 THR A O     1 
ATOM   4668 C  CB    . THR A 1 633  ? 29.808  21.828  -37.538 1.00 33.21  ? 1047 THR A CB    1 
ATOM   4669 O  OG1   . THR A 1 633  ? 28.568  22.350  -38.049 1.00 31.95  ? 1047 THR A OG1   1 
ATOM   4670 C  CG2   . THR A 1 633  ? 30.321  20.689  -38.388 1.00 29.45  ? 1047 THR A CG2   1 
ATOM   4671 N  N     . GLY A 1 634  ? 30.372  23.448  -35.067 1.00 32.66  ? 1048 GLY A N     1 
ATOM   4672 C  CA    . GLY A 1 634  ? 30.324  24.621  -34.213 1.00 32.90  ? 1048 GLY A CA    1 
ATOM   4673 C  C     . GLY A 1 634  ? 31.401  25.659  -34.522 1.00 33.21  ? 1048 GLY A C     1 
ATOM   4674 O  O     . GLY A 1 634  ? 31.956  25.716  -35.642 1.00 33.29  ? 1048 GLY A O     1 
ATOM   4675 N  N     . GLN A 1 635  ? 31.700  26.497  -33.534 1.00 33.46  ? 1049 GLN A N     1 
ATOM   4676 C  CA    . GLN A 1 635  ? 32.654  27.595  -33.717 1.00 33.35  ? 1049 GLN A CA    1 
ATOM   4677 C  C     . GLN A 1 635  ? 33.776  27.511  -32.717 1.00 33.38  ? 1049 GLN A C     1 
ATOM   4678 O  O     . GLN A 1 635  ? 33.541  27.327  -31.544 1.00 33.87  ? 1049 GLN A O     1 
ATOM   4679 C  CB    . GLN A 1 635  ? 31.955  28.953  -33.567 1.00 33.32  ? 1049 GLN A CB    1 
ATOM   4680 C  CG    . GLN A 1 635  ? 30.915  29.247  -34.624 1.00 32.38  ? 1049 GLN A CG    1 
ATOM   4681 C  CD    . GLN A 1 635  ? 30.215  30.597  -34.423 1.00 33.23  ? 1049 GLN A CD    1 
ATOM   4682 O  OE1   . GLN A 1 635  ? 30.856  31.642  -34.408 1.00 35.20  ? 1049 GLN A OE1   1 
ATOM   4683 N  NE2   . GLN A 1 635  ? 28.894  30.572  -34.306 1.00 30.07  ? 1049 GLN A NE2   1 
ATOM   4684 N  N     . HIS A 1 636  ? 35.009  27.651  -33.181 1.00 33.62  ? 1050 HIS A N     1 
ATOM   4685 C  CA    . HIS A 1 636  ? 36.143  27.806  -32.279 1.00 32.83  ? 1050 HIS A CA    1 
ATOM   4686 C  C     . HIS A 1 636  ? 35.778  28.948  -31.333 1.00 32.95  ? 1050 HIS A C     1 
ATOM   4687 O  O     . HIS A 1 636  ? 35.084  29.873  -31.724 1.00 32.98  ? 1050 HIS A O     1 
ATOM   4688 C  CB    . HIS A 1 636  ? 37.349  28.172  -33.133 1.00 32.70  ? 1050 HIS A CB    1 
ATOM   4689 C  CG    . HIS A 1 636  ? 38.650  28.175  -32.401 1.00 32.16  ? 1050 HIS A CG    1 
ATOM   4690 N  ND1   . HIS A 1 636  ? 39.011  29.187  -31.537 1.00 32.06  ? 1050 HIS A ND1   1 
ATOM   4691 C  CD2   . HIS A 1 636  ? 39.688  27.305  -32.426 1.00 30.44  ? 1050 HIS A CD2   1 
ATOM   4692 C  CE1   . HIS A 1 636  ? 40.225  28.941  -31.069 1.00 33.40  ? 1050 HIS A CE1   1 
ATOM   4693 N  NE2   . HIS A 1 636  ? 40.664  27.814  -31.605 1.00 30.83  ? 1050 HIS A NE2   1 
ATOM   4694 N  N     . PRO A 1 637  ? 36.215  28.891  -30.071 1.00 33.42  ? 1051 PRO A N     1 
ATOM   4695 C  CA    . PRO A 1 637  ? 35.751  29.967  -29.203 1.00 33.32  ? 1051 PRO A CA    1 
ATOM   4696 C  C     . PRO A 1 637  ? 36.368  31.360  -29.511 1.00 34.19  ? 1051 PRO A C     1 
ATOM   4697 O  O     . PRO A 1 637  ? 36.005  32.341  -28.849 1.00 34.75  ? 1051 PRO A O     1 
ATOM   4698 C  CB    . PRO A 1 637  ? 36.160  29.514  -27.807 1.00 32.97  ? 1051 PRO A CB    1 
ATOM   4699 C  CG    . PRO A 1 637  ? 36.547  28.093  -27.924 1.00 33.50  ? 1051 PRO A CG    1 
ATOM   4700 C  CD    . PRO A 1 637  ? 36.946  27.843  -29.343 1.00 33.27  ? 1051 PRO A CD    1 
ATOM   4701 N  N     . GLY A 1 638  ? 37.267  31.476  -30.486 1.00 33.41  ? 1052 GLY A N     1 
ATOM   4702 C  CA    . GLY A 1 638  ? 37.756  32.813  -30.827 1.00 33.60  ? 1052 GLY A CA    1 
ATOM   4703 C  C     . GLY A 1 638  ? 38.794  32.963  -31.934 1.00 33.81  ? 1052 GLY A C     1 
ATOM   4704 O  O     . GLY A 1 638  ? 39.121  34.082  -32.337 1.00 34.47  ? 1052 GLY A O     1 
ATOM   4705 N  N     . GLY A 1 639  ? 39.330  31.855  -32.434 1.00 33.01  ? 1053 GLY A N     1 
ATOM   4706 C  CA    . GLY A 1 639  ? 40.375  31.940  -33.432 1.00 31.80  ? 1053 GLY A CA    1 
ATOM   4707 C  C     . GLY A 1 639  ? 39.913  32.448  -34.791 1.00 31.73  ? 1053 GLY A C     1 
ATOM   4708 O  O     . GLY A 1 639  ? 38.963  31.921  -35.379 1.00 30.04  ? 1053 GLY A O     1 
ATOM   4709 N  N     . ILE A 1 640  ? 40.610  33.468  -35.298 1.00 31.74  ? 1054 ILE A N     1 
ATOM   4710 C  CA    . ILE A 1 640  ? 40.414  33.885  -36.667 1.00 32.15  ? 1054 ILE A CA    1 
ATOM   4711 C  C     . ILE A 1 640  ? 41.614  33.451  -37.465 1.00 32.95  ? 1054 ILE A C     1 
ATOM   4712 O  O     . ILE A 1 640  ? 42.752  33.788  -37.120 1.00 33.50  ? 1054 ILE A O     1 
ATOM   4713 C  CB    . ILE A 1 640  ? 40.214  35.384  -36.763 1.00 32.24  ? 1054 ILE A CB    1 
ATOM   4714 C  CG1   . ILE A 1 640  ? 38.985  35.757  -35.951 1.00 32.45  ? 1054 ILE A CG1   1 
ATOM   4715 C  CG2   . ILE A 1 640  ? 40.023  35.793  -38.195 1.00 31.35  ? 1054 ILE A CG2   1 
ATOM   4716 C  CD1   . ILE A 1 640  ? 37.698  35.058  -36.466 1.00 34.51  ? 1054 ILE A CD1   1 
ATOM   4717 N  N     . ILE A 1 641  ? 41.348  32.693  -38.528 1.00 33.15  ? 1055 ILE A N     1 
ATOM   4718 C  CA    . ILE A 1 641  ? 42.370  32.092  -39.367 1.00 32.77  ? 1055 ILE A CA    1 
ATOM   4719 C  C     . ILE A 1 641  ? 42.685  33.027  -40.519 1.00 33.39  ? 1055 ILE A C     1 
ATOM   4720 O  O     . ILE A 1 641  ? 41.777  33.384  -41.294 1.00 34.11  ? 1055 ILE A O     1 
ATOM   4721 C  CB    . ILE A 1 641  ? 41.809  30.836  -39.998 1.00 33.58  ? 1055 ILE A CB    1 
ATOM   4722 C  CG1   . ILE A 1 641  ? 41.354  29.860  -38.911 1.00 33.22  ? 1055 ILE A CG1   1 
ATOM   4723 C  CG2   . ILE A 1 641  ? 42.852  30.188  -40.919 1.00 32.12  ? 1055 ILE A CG2   1 
ATOM   4724 C  CD1   . ILE A 1 641  ? 42.536  29.330  -38.105 1.00 35.34  ? 1055 ILE A CD1   1 
ATOM   4725 N  N     . VAL A 1 642  ? 43.940  33.433  -40.670 1.00 32.55  ? 1056 VAL A N     1 
ATOM   4726 C  CA    . VAL A 1 642  ? 44.218  34.418  -41.675 1.00 32.24  ? 1056 VAL A CA    1 
ATOM   4727 C  C     . VAL A 1 642  ? 44.780  33.835  -42.991 1.00 32.15  ? 1056 VAL A C     1 
ATOM   4728 O  O     . VAL A 1 642  ? 45.736  33.060  -42.997 1.00 31.31  ? 1056 VAL A O     1 
ATOM   4729 C  CB    . VAL A 1 642  ? 45.067  35.606  -41.131 1.00 32.73  ? 1056 VAL A CB    1 
ATOM   4730 C  CG1   . VAL A 1 642  ? 45.025  35.683  -39.617 1.00 32.14  ? 1056 VAL A CG1   1 
ATOM   4731 C  CG2   . VAL A 1 642  ? 46.468  35.591  -41.672 1.00 33.01  ? 1056 VAL A CG2   1 
ATOM   4732 N  N     . VAL A 1 643  ? 44.142  34.191  -44.108 1.00 31.84  ? 1057 VAL A N     1 
ATOM   4733 C  CA    . VAL A 1 643  ? 44.571  33.682  -45.401 1.00 32.01  ? 1057 VAL A CA    1 
ATOM   4734 C  C     . VAL A 1 643  ? 45.466  34.663  -46.132 1.00 31.68  ? 1057 VAL A C     1 
ATOM   4735 O  O     . VAL A 1 643  ? 45.082  35.790  -46.401 1.00 32.60  ? 1057 VAL A O     1 
ATOM   4736 C  CB    . VAL A 1 643  ? 43.387  33.281  -46.289 1.00 32.25  ? 1057 VAL A CB    1 
ATOM   4737 C  CG1   . VAL A 1 643  ? 43.886  32.757  -47.655 1.00 31.97  ? 1057 VAL A CG1   1 
ATOM   4738 C  CG2   . VAL A 1 643  ? 42.537  32.229  -45.576 1.00 31.84  ? 1057 VAL A CG2   1 
ATOM   4739 N  N     . PRO A 1 644  ? 46.686  34.249  -46.435 1.00 31.28  ? 1058 PRO A N     1 
ATOM   4740 C  CA    . PRO A 1 644  ? 47.511  35.172  -47.216 1.00 31.99  ? 1058 PRO A CA    1 
ATOM   4741 C  C     . PRO A 1 644  ? 46.832  35.528  -48.545 1.00 32.62  ? 1058 PRO A C     1 
ATOM   4742 O  O     . PRO A 1 644  ? 46.058  34.730  -49.095 1.00 32.86  ? 1058 PRO A O     1 
ATOM   4743 C  CB    . PRO A 1 644  ? 48.801  34.394  -47.441 1.00 30.93  ? 1058 PRO A CB    1 
ATOM   4744 C  CG    . PRO A 1 644  ? 48.861  33.459  -46.221 1.00 32.38  ? 1058 PRO A CG    1 
ATOM   4745 C  CD    . PRO A 1 644  ? 47.424  33.082  -45.941 1.00 30.84  ? 1058 PRO A CD    1 
ATOM   4746 N  N     . ASP A 1 645  ? 47.102  36.720  -49.051 1.00 33.50  ? 1059 ASP A N     1 
ATOM   4747 C  CA    . ASP A 1 645  ? 46.416  37.169  -50.260 1.00 34.84  ? 1059 ASP A CA    1 
ATOM   4748 C  C     . ASP A 1 645  ? 46.946  36.487  -51.527 1.00 34.49  ? 1059 ASP A C     1 
ATOM   4749 O  O     . ASP A 1 645  ? 46.376  36.641  -52.597 1.00 35.21  ? 1059 ASP A O     1 
ATOM   4750 C  CB    . ASP A 1 645  ? 46.491  38.705  -50.388 1.00 34.97  ? 1059 ASP A CB    1 
ATOM   4751 C  CG    . ASP A 1 645  ? 47.908  39.206  -50.686 1.00 36.50  ? 1059 ASP A CG    1 
ATOM   4752 O  OD1   . ASP A 1 645  ? 48.881  38.435  -50.451 1.00 35.75  ? 1059 ASP A OD1   1 
ATOM   4753 O  OD2   . ASP A 1 645  ? 48.039  40.368  -51.152 1.00 36.01  ? 1059 ASP A OD2   1 
ATOM   4754 N  N     . TYR A 1 646  ? 48.045  35.750  -51.421 1.00 34.43  ? 1060 TYR A N     1 
ATOM   4755 C  CA    . TYR A 1 646  ? 48.615  35.125  -52.609 1.00 33.93  ? 1060 TYR A CA    1 
ATOM   4756 C  C     . TYR A 1 646  ? 48.230  33.636  -52.688 1.00 33.76  ? 1060 TYR A C     1 
ATOM   4757 O  O     . TYR A 1 646  ? 48.569  32.941  -53.667 1.00 32.69  ? 1060 TYR A O     1 
ATOM   4758 C  CB    . TYR A 1 646  ? 50.136  35.338  -52.655 1.00 34.66  ? 1060 TYR A CB    1 
ATOM   4759 C  CG    . TYR A 1 646  ? 50.854  34.841  -51.413 1.00 34.78  ? 1060 TYR A CG    1 
ATOM   4760 C  CD1   . TYR A 1 646  ? 51.059  35.676  -50.324 1.00 35.40  ? 1060 TYR A CD1   1 
ATOM   4761 C  CD2   . TYR A 1 646  ? 51.302  33.524  -51.327 1.00 35.59  ? 1060 TYR A CD2   1 
ATOM   4762 C  CE1   . TYR A 1 646  ? 51.711  35.219  -49.173 1.00 35.68  ? 1060 TYR A CE1   1 
ATOM   4763 C  CE2   . TYR A 1 646  ? 51.949  33.050  -50.187 1.00 34.88  ? 1060 TYR A CE2   1 
ATOM   4764 C  CZ    . TYR A 1 646  ? 52.153  33.905  -49.117 1.00 35.88  ? 1060 TYR A CZ    1 
ATOM   4765 O  OH    . TYR A 1 646  ? 52.799  33.441  -47.993 1.00 37.17  ? 1060 TYR A OH    1 
ATOM   4766 N  N     . MET A 1 647  ? 47.514  33.170  -51.658 1.00 33.13  ? 1061 MET A N     1 
ATOM   4767 C  CA    . MET A 1 647  ? 46.899  31.841  -51.637 1.00 33.10  ? 1061 MET A CA    1 
ATOM   4768 C  C     . MET A 1 647  ? 45.367  32.005  -51.611 1.00 32.76  ? 1061 MET A C     1 
ATOM   4769 O  O     . MET A 1 647  ? 44.870  33.097  -51.842 1.00 32.13  ? 1061 MET A O     1 
ATOM   4770 C  CB    . MET A 1 647  ? 47.369  31.066  -50.410 1.00 33.27  ? 1061 MET A CB    1 
ATOM   4771 C  CG    . MET A 1 647  ? 48.876  30.912  -50.335 1.00 34.77  ? 1061 MET A CG    1 
ATOM   4772 S  SD    . MET A 1 647  ? 49.411  29.820  -51.661 1.00 40.30  ? 1061 MET A SD    1 
ATOM   4773 C  CE    . MET A 1 647  ? 49.150  28.207  -50.951 1.00 38.98  ? 1061 MET A CE    1 
ATOM   4774 N  N     . GLU A 1 648  ? 44.626  30.933  -51.332 1.00 32.40  ? 1062 GLU A N     1 
ATOM   4775 C  CA    . GLU A 1 648  ? 43.175  31.034  -51.155 1.00 33.30  ? 1062 GLU A CA    1 
ATOM   4776 C  C     . GLU A 1 648  ? 42.715  29.987  -50.147 1.00 33.00  ? 1062 GLU A C     1 
ATOM   4777 O  O     . GLU A 1 648  ? 43.384  28.964  -49.942 1.00 32.91  ? 1062 GLU A O     1 
ATOM   4778 C  CB    . GLU A 1 648  ? 42.416  30.901  -52.511 1.00 33.88  ? 1062 GLU A CB    1 
ATOM   4779 C  CG    . GLU A 1 648  ? 42.298  29.467  -53.075 1.00 35.72  ? 1062 GLU A CG    1 
ATOM   4780 C  CD    . GLU A 1 648  ? 41.647  29.382  -54.475 1.00 37.90  ? 1062 GLU A CD    1 
ATOM   4781 O  OE1   . GLU A 1 648  ? 40.965  30.345  -54.884 1.00 38.00  ? 1062 GLU A OE1   1 
ATOM   4782 O  OE2   . GLU A 1 648  ? 41.819  28.336  -55.164 1.00 38.11  ? 1062 GLU A OE2   1 
ATOM   4783 N  N     . ILE A 1 649  ? 41.577  30.205  -49.513 1.00 33.00  ? 1063 ILE A N     1 
ATOM   4784 C  CA    . ILE A 1 649  ? 41.201  29.281  -48.451 1.00 32.98  ? 1063 ILE A CA    1 
ATOM   4785 C  C     . ILE A 1 649  ? 41.172  27.841  -48.991 1.00 33.21  ? 1063 ILE A C     1 
ATOM   4786 O  O     . ILE A 1 649  ? 41.552  26.885  -48.277 1.00 33.30  ? 1063 ILE A O     1 
ATOM   4787 C  CB    . ILE A 1 649  ? 39.856  29.637  -47.791 1.00 33.19  ? 1063 ILE A CB    1 
ATOM   4788 C  CG1   . ILE A 1 649  ? 39.615  28.780  -46.525 1.00 33.14  ? 1063 ILE A CG1   1 
ATOM   4789 C  CG2   . ILE A 1 649  ? 38.716  29.413  -48.795 1.00 33.20  ? 1063 ILE A CG2   1 
ATOM   4790 C  CD1   . ILE A 1 649  ? 40.651  28.930  -45.385 1.00 31.37  ? 1063 ILE A CD1   1 
ATOM   4791 N  N     . TYR A 1 650  ? 40.749  27.675  -50.241 1.00 32.56  ? 1064 TYR A N     1 
ATOM   4792 C  CA    . TYR A 1 650  ? 40.638  26.323  -50.802 1.00 32.83  ? 1064 TYR A CA    1 
ATOM   4793 C  C     . TYR A 1 650  ? 41.966  25.600  -50.993 1.00 33.20  ? 1064 TYR A C     1 
ATOM   4794 O  O     . TYR A 1 650  ? 41.981  24.402  -51.298 1.00 33.67  ? 1064 TYR A O     1 
ATOM   4795 C  CB    . TYR A 1 650  ? 39.844  26.306  -52.102 1.00 31.69  ? 1064 TYR A CB    1 
ATOM   4796 C  CG    . TYR A 1 650  ? 38.587  27.094  -51.996 1.00 32.78  ? 1064 TYR A CG    1 
ATOM   4797 C  CD1   . TYR A 1 650  ? 37.519  26.645  -51.221 1.00 32.92  ? 1064 TYR A CD1   1 
ATOM   4798 C  CD2   . TYR A 1 650  ? 38.464  28.314  -52.650 1.00 34.39  ? 1064 TYR A CD2   1 
ATOM   4799 C  CE1   . TYR A 1 650  ? 36.344  27.397  -51.106 1.00 33.32  ? 1064 TYR A CE1   1 
ATOM   4800 C  CE2   . TYR A 1 650  ? 37.303  29.063  -52.552 1.00 35.52  ? 1064 TYR A CE2   1 
ATOM   4801 C  CZ    . TYR A 1 650  ? 36.248  28.604  -51.773 1.00 36.33  ? 1064 TYR A CZ    1 
ATOM   4802 O  OH    . TYR A 1 650  ? 35.103  29.371  -51.685 1.00 38.33  ? 1064 TYR A OH    1 
ATOM   4803 N  N     . ASP A 1 651  ? 43.080  26.304  -50.822 1.00 33.68  ? 1065 ASP A N     1 
ATOM   4804 C  CA    . ASP A 1 651  ? 44.376  25.627  -50.848 1.00 33.60  ? 1065 ASP A CA    1 
ATOM   4805 C  C     . ASP A 1 651  ? 44.538  24.860  -49.538 1.00 33.62  ? 1065 ASP A C     1 
ATOM   4806 O  O     . ASP A 1 651  ? 45.479  24.073  -49.383 1.00 33.32  ? 1065 ASP A O     1 
ATOM   4807 C  CB    . ASP A 1 651  ? 45.538  26.632  -50.961 1.00 33.73  ? 1065 ASP A CB    1 
ATOM   4808 C  CG    . ASP A 1 651  ? 45.643  27.297  -52.339 1.00 34.62  ? 1065 ASP A CG    1 
ATOM   4809 O  OD1   . ASP A 1 651  ? 45.608  26.593  -53.393 1.00 33.84  ? 1065 ASP A OD1   1 
ATOM   4810 O  OD2   . ASP A 1 651  ? 45.780  28.545  -52.351 1.00 34.32  ? 1065 ASP A OD2   1 
ATOM   4811 N  N     . PHE A 1 652  ? 43.631  25.106  -48.589 1.00 33.55  ? 1066 PHE A N     1 
ATOM   4812 C  CA    . PHE A 1 652  ? 43.825  24.628  -47.214 1.00 33.82  ? 1066 PHE A CA    1 
ATOM   4813 C  C     . PHE A 1 652  ? 42.666  23.834  -46.657 1.00 34.03  ? 1066 PHE A C     1 
ATOM   4814 O  O     . PHE A 1 652  ? 42.875  22.786  -46.037 1.00 34.73  ? 1066 PHE A O     1 
ATOM   4815 C  CB    . PHE A 1 652  ? 44.141  25.807  -46.281 1.00 33.71  ? 1066 PHE A CB    1 
ATOM   4816 C  CG    . PHE A 1 652  ? 45.339  26.577  -46.714 1.00 33.56  ? 1066 PHE A CG    1 
ATOM   4817 C  CD1   . PHE A 1 652  ? 46.603  26.103  -46.447 1.00 33.39  ? 1066 PHE A CD1   1 
ATOM   4818 C  CD2   . PHE A 1 652  ? 45.204  27.726  -47.450 1.00 33.02  ? 1066 PHE A CD2   1 
ATOM   4819 C  CE1   . PHE A 1 652  ? 47.707  26.781  -46.890 1.00 33.09  ? 1066 PHE A CE1   1 
ATOM   4820 C  CE2   . PHE A 1 652  ? 46.311  28.421  -47.872 1.00 32.90  ? 1066 PHE A CE2   1 
ATOM   4821 C  CZ    . PHE A 1 652  ? 47.560  27.941  -47.597 1.00 32.36  ? 1066 PHE A CZ    1 
ATOM   4822 N  N     . THR A 1 653  ? 41.448  24.337  -46.855 1.00 33.57  ? 1067 THR A N     1 
ATOM   4823 C  CA    . THR A 1 653  ? 40.276  23.688  -46.322 1.00 33.36  ? 1067 THR A CA    1 
ATOM   4824 C  C     . THR A 1 653  ? 39.039  24.178  -47.048 1.00 33.49  ? 1067 THR A C     1 
ATOM   4825 O  O     . THR A 1 653  ? 39.050  25.257  -47.639 1.00 33.91  ? 1067 THR A O     1 
ATOM   4826 C  CB    . THR A 1 653  ? 40.150  23.958  -44.807 1.00 33.43  ? 1067 THR A CB    1 
ATOM   4827 O  OG1   . THR A 1 653  ? 38.838  23.601  -44.331 1.00 33.77  ? 1067 THR A OG1   1 
ATOM   4828 C  CG2   . THR A 1 653  ? 40.424  25.401  -44.509 1.00 33.84  ? 1067 THR A CG2   1 
ATOM   4829 N  N     . PRO A 1 654  ? 37.985  23.362  -47.054 1.00 33.03  ? 1068 PRO A N     1 
ATOM   4830 C  CA    . PRO A 1 654  ? 36.671  23.857  -47.416 1.00 32.97  ? 1068 PRO A CA    1 
ATOM   4831 C  C     . PRO A 1 654  ? 36.128  24.791  -46.324 1.00 33.05  ? 1068 PRO A C     1 
ATOM   4832 O  O     . PRO A 1 654  ? 36.679  24.873  -45.222 1.00 31.99  ? 1068 PRO A O     1 
ATOM   4833 C  CB    . PRO A 1 654  ? 35.819  22.579  -47.461 1.00 32.91  ? 1068 PRO A CB    1 
ATOM   4834 C  CG    . PRO A 1 654  ? 36.777  21.483  -47.657 1.00 33.16  ? 1068 PRO A CG    1 
ATOM   4835 C  CD    . PRO A 1 654  ? 37.998  21.901  -46.886 1.00 33.17  ? 1068 PRO A CD    1 
ATOM   4836 N  N     . ILE A 1 655  ? 35.036  25.479  -46.639 1.00 33.53  ? 1069 ILE A N     1 
ATOM   4837 C  CA    . ILE A 1 655  ? 34.377  26.355  -45.699 1.00 33.81  ? 1069 ILE A CA    1 
ATOM   4838 C  C     . ILE A 1 655  ? 32.904  26.019  -45.658 1.00 34.84  ? 1069 ILE A C     1 
ATOM   4839 O  O     . ILE A 1 655  ? 32.408  25.215  -46.464 1.00 35.20  ? 1069 ILE A O     1 
ATOM   4840 C  CB    . ILE A 1 655  ? 34.571  27.807  -46.088 1.00 34.07  ? 1069 ILE A CB    1 
ATOM   4841 C  CG1   . ILE A 1 655  ? 34.014  28.066  -47.488 1.00 34.09  ? 1069 ILE A CG1   1 
ATOM   4842 C  CG2   . ILE A 1 655  ? 36.058  28.177  -46.018 1.00 33.28  ? 1069 ILE A CG2   1 
ATOM   4843 C  CD1   . ILE A 1 655  ? 34.229  29.517  -48.011 1.00 30.99  ? 1069 ILE A CD1   1 
ATOM   4844 N  N     . GLN A 1 656  ? 32.192  26.622  -44.717 1.00 35.14  ? 1070 GLN A N     1 
ATOM   4845 C  CA    . GLN A 1 656  ? 30.804  26.248  -44.496 1.00 35.38  ? 1070 GLN A CA    1 
ATOM   4846 C  C     . GLN A 1 656  ? 30.225  27.174  -43.442 1.00 35.65  ? 1070 GLN A C     1 
ATOM   4847 O  O     . GLN A 1 656  ? 30.857  28.163  -43.079 1.00 36.15  ? 1070 GLN A O     1 
ATOM   4848 C  CB    . GLN A 1 656  ? 30.733  24.802  -44.015 1.00 35.48  ? 1070 GLN A CB    1 
ATOM   4849 C  CG    . GLN A 1 656  ? 31.319  24.580  -42.602 1.00 34.96  ? 1070 GLN A CG    1 
ATOM   4850 C  CD    . GLN A 1 656  ? 30.896  23.247  -42.034 1.00 35.44  ? 1070 GLN A CD    1 
ATOM   4851 O  OE1   . GLN A 1 656  ? 31.408  22.198  -42.447 1.00 36.50  ? 1070 GLN A OE1   1 
ATOM   4852 N  NE2   . GLN A 1 656  ? 29.947  23.269  -41.090 1.00 32.09  ? 1070 GLN A NE2   1 
ATOM   4853 N  N     . TYR A 1 657  ? 29.032  26.873  -42.949 1.00 35.42  ? 1071 TYR A N     1 
ATOM   4854 C  CA    . TYR A 1 657  ? 28.523  27.625  -41.811 1.00 35.77  ? 1071 TYR A CA    1 
ATOM   4855 C  C     . TYR A 1 657  ? 28.552  26.752  -40.552 1.00 36.12  ? 1071 TYR A C     1 
ATOM   4856 O  O     . TYR A 1 657  ? 28.344  25.530  -40.622 1.00 35.18  ? 1071 TYR A O     1 
ATOM   4857 C  CB    . TYR A 1 657  ? 27.100  28.125  -42.050 1.00 35.40  ? 1071 TYR A CB    1 
ATOM   4858 C  CG    . TYR A 1 657  ? 26.937  29.230  -43.078 1.00 35.80  ? 1071 TYR A CG    1 
ATOM   4859 C  CD1   . TYR A 1 657  ? 27.528  30.483  -42.898 1.00 35.69  ? 1071 TYR A CD1   1 
ATOM   4860 C  CD2   . TYR A 1 657  ? 26.147  29.034  -44.207 1.00 35.28  ? 1071 TYR A CD2   1 
ATOM   4861 C  CE1   . TYR A 1 657  ? 27.345  31.503  -43.836 1.00 35.11  ? 1071 TYR A CE1   1 
ATOM   4862 C  CE2   . TYR A 1 657  ? 25.964  30.027  -45.137 1.00 35.83  ? 1071 TYR A CE2   1 
ATOM   4863 C  CZ    . TYR A 1 657  ? 26.566  31.264  -44.953 1.00 36.36  ? 1071 TYR A CZ    1 
ATOM   4864 O  OH    . TYR A 1 657  ? 26.371  32.253  -45.895 1.00 36.10  ? 1071 TYR A OH    1 
ATOM   4865 N  N     . PRO A 1 658  ? 28.807  27.377  -39.389 1.00 36.64  ? 1072 PRO A N     1 
ATOM   4866 C  CA    . PRO A 1 658  ? 28.780  26.575  -38.169 1.00 37.43  ? 1072 PRO A CA    1 
ATOM   4867 C  C     . PRO A 1 658  ? 27.354  26.128  -37.914 1.00 37.97  ? 1072 PRO A C     1 
ATOM   4868 O  O     . PRO A 1 658  ? 26.454  26.949  -37.961 1.00 37.99  ? 1072 PRO A O     1 
ATOM   4869 C  CB    . PRO A 1 658  ? 29.262  27.553  -37.094 1.00 37.55  ? 1072 PRO A CB    1 
ATOM   4870 C  CG    . PRO A 1 658  ? 28.918  28.919  -37.635 1.00 36.43  ? 1072 PRO A CG    1 
ATOM   4871 C  CD    . PRO A 1 658  ? 28.973  28.817  -39.123 1.00 36.51  ? 1072 PRO A CD    1 
ATOM   4872 N  N     . ALA A 1 659  ? 27.168  24.836  -37.659 1.00 39.08  ? 1073 ALA A N     1 
ATOM   4873 C  CA    . ALA A 1 659  ? 25.844  24.217  -37.502 1.00 40.29  ? 1073 ALA A CA    1 
ATOM   4874 C  C     . ALA A 1 659  ? 24.966  24.465  -38.701 1.00 41.07  ? 1073 ALA A C     1 
ATOM   4875 O  O     . ALA A 1 659  ? 23.761  24.270  -38.654 1.00 41.54  ? 1073 ALA A O     1 
ATOM   4876 C  CB    . ALA A 1 659  ? 25.146  24.669  -36.215 1.00 40.22  ? 1073 ALA A CB    1 
ATOM   4877 N  N     . ASP A 1 660  ? 25.563  24.904  -39.793 1.00 42.41  ? 1074 ASP A N     1 
ATOM   4878 C  CA    . ASP A 1 660  ? 24.787  24.995  -41.015 1.00 43.41  ? 1074 ASP A CA    1 
ATOM   4879 C  C     . ASP A 1 660  ? 23.709  26.041  -40.879 1.00 43.95  ? 1074 ASP A C     1 
ATOM   4880 O  O     . ASP A 1 660  ? 22.601  25.855  -41.338 1.00 44.49  ? 1074 ASP A O     1 
ATOM   4881 C  CB    . ASP A 1 660  ? 24.144  23.646  -41.303 1.00 43.16  ? 1074 ASP A CB    1 
ATOM   4882 C  CG    . ASP A 1 660  ? 25.160  22.612  -41.720 1.00 43.98  ? 1074 ASP A CG    1 
ATOM   4883 O  OD1   . ASP A 1 660  ? 26.172  23.022  -42.346 1.00 43.17  ? 1074 ASP A OD1   1 
ATOM   4884 O  OD2   . ASP A 1 660  ? 24.957  21.406  -41.419 1.00 43.81  ? 1074 ASP A OD2   1 
ATOM   4885 N  N     . ASP A 1 661  ? 24.046  27.156  -40.256 1.00 44.86  ? 1075 ASP A N     1 
ATOM   4886 C  CA    . ASP A 1 661  ? 23.094  28.209  -40.040 1.00 45.78  ? 1075 ASP A CA    1 
ATOM   4887 C  C     . ASP A 1 661  ? 23.381  29.265  -41.077 1.00 46.03  ? 1075 ASP A C     1 
ATOM   4888 O  O     . ASP A 1 661  ? 24.404  29.954  -41.003 1.00 45.97  ? 1075 ASP A O     1 
ATOM   4889 C  CB    . ASP A 1 661  ? 23.281  28.760  -38.630 1.00 46.05  ? 1075 ASP A CB    1 
ATOM   4890 C  CG    . ASP A 1 661  ? 22.581  30.085  -38.420 1.00 48.22  ? 1075 ASP A CG    1 
ATOM   4891 O  OD1   . ASP A 1 661  ? 22.220  30.771  -39.419 1.00 48.93  ? 1075 ASP A OD1   1 
ATOM   4892 O  OD2   . ASP A 1 661  ? 22.403  30.433  -37.234 1.00 49.49  ? 1075 ASP A OD2   1 
ATOM   4893 N  N     . THR A 1 662  ? 22.498  29.375  -42.062 1.00 46.56  ? 1076 THR A N     1 
ATOM   4894 C  CA    . THR A 1 662  ? 22.777  30.202  -43.250 1.00 47.10  ? 1076 THR A CA    1 
ATOM   4895 C  C     . THR A 1 662  ? 22.773  31.721  -42.990 1.00 47.38  ? 1076 THR A C     1 
ATOM   4896 O  O     . THR A 1 662  ? 23.187  32.505  -43.846 1.00 47.24  ? 1076 THR A O     1 
ATOM   4897 C  CB    . THR A 1 662  ? 21.817  29.845  -44.390 1.00 46.75  ? 1076 THR A CB    1 
ATOM   4898 O  OG1   . THR A 1 662  ? 20.549  29.503  -43.828 1.00 47.75  ? 1076 THR A OG1   1 
ATOM   4899 C  CG2   . THR A 1 662  ? 22.320  28.630  -45.123 1.00 47.16  ? 1076 THR A CG2   1 
ATOM   4900 N  N     . SER A 1 663  ? 22.321  32.122  -41.802 1.00 47.87  ? 1077 SER A N     1 
ATOM   4901 C  CA    . SER A 1 663  ? 22.299  33.531  -41.417 1.00 48.58  ? 1077 SER A CA    1 
ATOM   4902 C  C     . SER A 1 663  ? 23.515  33.932  -40.571 1.00 48.45  ? 1077 SER A C     1 
ATOM   4903 O  O     . SER A 1 663  ? 23.611  35.067  -40.110 1.00 48.66  ? 1077 SER A O     1 
ATOM   4904 C  CB    . SER A 1 663  ? 21.018  33.859  -40.628 1.00 49.05  ? 1077 SER A CB    1 
ATOM   4905 O  OG    . SER A 1 663  ? 21.224  33.671  -39.227 1.00 51.03  ? 1077 SER A OG    1 
ATOM   4906 N  N     . SER A 1 664  ? 24.441  33.012  -40.360 1.00 48.24  ? 1078 SER A N     1 
ATOM   4907 C  CA    . SER A 1 664  ? 25.641  33.326  -39.590 1.00 47.99  ? 1078 SER A CA    1 
ATOM   4908 C  C     . SER A 1 664  ? 26.430  34.489  -40.203 1.00 48.25  ? 1078 SER A C     1 
ATOM   4909 O  O     . SER A 1 664  ? 26.593  34.581  -41.427 1.00 48.58  ? 1078 SER A O     1 
ATOM   4910 C  CB    . SER A 1 664  ? 26.525  32.085  -39.468 1.00 47.58  ? 1078 SER A CB    1 
ATOM   4911 O  OG    . SER A 1 664  ? 27.699  32.392  -38.766 1.00 47.04  ? 1078 SER A OG    1 
ATOM   4912 N  N     . GLU A 1 665  ? 26.901  35.398  -39.354 1.00 48.20  ? 1079 GLU A N     1 
ATOM   4913 C  CA    . GLU A 1 665  ? 27.784  36.474  -39.815 1.00 47.59  ? 1079 GLU A CA    1 
ATOM   4914 C  C     . GLU A 1 665  ? 29.079  35.893  -40.386 1.00 46.05  ? 1079 GLU A C     1 
ATOM   4915 O  O     . GLU A 1 665  ? 29.662  36.469  -41.299 1.00 46.47  ? 1079 GLU A O     1 
ATOM   4916 C  CB    . GLU A 1 665  ? 28.177  37.378  -38.647 1.00 48.71  ? 1079 GLU A CB    1 
ATOM   4917 C  CG    . GLU A 1 665  ? 27.166  38.422  -38.207 1.00 52.34  ? 1079 GLU A CG    1 
ATOM   4918 C  CD    . GLU A 1 665  ? 27.727  39.255  -37.063 1.00 57.25  ? 1079 GLU A CD    1 
ATOM   4919 O  OE1   . GLU A 1 665  ? 26.988  40.113  -36.524 1.00 59.34  ? 1079 GLU A OE1   1 
ATOM   4920 O  OE2   . GLU A 1 665  ? 28.914  39.043  -36.707 1.00 57.58  ? 1079 GLU A OE2   1 
ATOM   4921 N  N     . TRP A 1 666  ? 29.539  34.774  -39.823 1.00 43.29  ? 1080 TRP A N     1 
ATOM   4922 C  CA    . TRP A 1 666  ? 30.816  34.192  -40.200 1.00 41.05  ? 1080 TRP A CA    1 
ATOM   4923 C  C     . TRP A 1 666  ? 30.736  32.836  -40.854 1.00 39.43  ? 1080 TRP A C     1 
ATOM   4924 O  O     . TRP A 1 666  ? 30.026  31.940  -40.399 1.00 39.27  ? 1080 TRP A O     1 
ATOM   4925 C  CB    . TRP A 1 666  ? 31.713  34.042  -38.971 1.00 41.03  ? 1080 TRP A CB    1 
ATOM   4926 C  CG    . TRP A 1 666  ? 32.355  35.321  -38.548 1.00 41.87  ? 1080 TRP A CG    1 
ATOM   4927 C  CD1   . TRP A 1 666  ? 31.832  36.274  -37.696 1.00 41.27  ? 1080 TRP A CD1   1 
ATOM   4928 C  CD2   . TRP A 1 666  ? 33.637  35.816  -38.971 1.00 39.15  ? 1080 TRP A CD2   1 
ATOM   4929 N  NE1   . TRP A 1 666  ? 32.720  37.316  -37.562 1.00 41.57  ? 1080 TRP A NE1   1 
ATOM   4930 C  CE2   . TRP A 1 666  ? 33.835  37.060  -38.326 1.00 39.19  ? 1080 TRP A CE2   1 
ATOM   4931 C  CE3   . TRP A 1 666  ? 34.637  35.320  -39.816 1.00 36.98  ? 1080 TRP A CE3   1 
ATOM   4932 C  CZ2   . TRP A 1 666  ? 34.988  37.810  -38.499 1.00 35.80  ? 1080 TRP A CZ2   1 
ATOM   4933 C  CZ3   . TRP A 1 666  ? 35.780  36.067  -39.991 1.00 36.29  ? 1080 TRP A CZ3   1 
ATOM   4934 C  CH2   . TRP A 1 666  ? 35.943  37.307  -39.335 1.00 36.58  ? 1080 TRP A CH2   1 
ATOM   4935 N  N     . ARG A 1 667  ? 31.533  32.660  -41.889 1.00 37.68  ? 1081 ARG A N     1 
ATOM   4936 C  CA    . ARG A 1 667  ? 31.784  31.334  -42.402 1.00 36.58  ? 1081 ARG A CA    1 
ATOM   4937 C  C     . ARG A 1 667  ? 32.867  30.643  -41.555 1.00 35.69  ? 1081 ARG A C     1 
ATOM   4938 O  O     . ARG A 1 667  ? 33.767  31.312  -41.026 1.00 35.55  ? 1081 ARG A O     1 
ATOM   4939 C  CB    . ARG A 1 667  ? 32.222  31.433  -43.858 1.00 36.52  ? 1081 ARG A CB    1 
ATOM   4940 C  CG    . ARG A 1 667  ? 31.104  31.877  -44.804 1.00 36.82  ? 1081 ARG A CG    1 
ATOM   4941 C  CD    . ARG A 1 667  ? 31.644  32.343  -46.178 1.00 38.20  ? 1081 ARG A CD    1 
ATOM   4942 N  NE    . ARG A 1 667  ? 32.583  33.467  -46.055 1.00 38.62  ? 1081 ARG A NE    1 
ATOM   4943 C  CZ    . ARG A 1 667  ? 33.248  34.029  -47.065 1.00 38.07  ? 1081 ARG A CZ    1 
ATOM   4944 N  NH1   . ARG A 1 667  ? 33.098  33.596  -48.321 1.00 35.94  ? 1081 ARG A NH1   1 
ATOM   4945 N  NH2   . ARG A 1 667  ? 34.071  35.042  -46.816 1.00 39.00  ? 1081 ARG A NH2   1 
ATOM   4946 N  N     . THR A 1 668  ? 32.784  29.322  -41.425 1.00 34.37  ? 1082 THR A N     1 
ATOM   4947 C  CA    . THR A 1 668  ? 33.819  28.561  -40.728 1.00 34.35  ? 1082 THR A CA    1 
ATOM   4948 C  C     . THR A 1 668  ? 34.677  27.649  -41.604 1.00 34.05  ? 1082 THR A C     1 
ATOM   4949 O  O     . THR A 1 668  ? 34.270  27.240  -42.699 1.00 34.02  ? 1082 THR A O     1 
ATOM   4950 C  CB    . THR A 1 668  ? 33.209  27.649  -39.660 1.00 34.29  ? 1082 THR A CB    1 
ATOM   4951 O  OG1   . THR A 1 668  ? 31.991  27.093  -40.163 1.00 35.74  ? 1082 THR A OG1   1 
ATOM   4952 C  CG2   . THR A 1 668  ? 32.917  28.423  -38.428 1.00 33.87  ? 1082 THR A CG2   1 
ATOM   4953 N  N     . THR A 1 669  ? 35.852  27.279  -41.094 1.00 33.44  ? 1083 THR A N     1 
ATOM   4954 C  CA    . THR A 1 669  ? 36.663  26.279  -41.780 1.00 32.47  ? 1083 THR A CA    1 
ATOM   4955 C  C     . THR A 1 669  ? 36.007  24.904  -41.632 1.00 33.18  ? 1083 THR A C     1 
ATOM   4956 O  O     . THR A 1 669  ? 35.437  24.579  -40.583 1.00 33.14  ? 1083 THR A O     1 
ATOM   4957 C  CB    . THR A 1 669  ? 38.098  26.262  -41.259 1.00 32.75  ? 1083 THR A CB    1 
ATOM   4958 O  OG1   . THR A 1 669  ? 38.120  25.969  -39.859 1.00 31.89  ? 1083 THR A OG1   1 
ATOM   4959 C  CG2   . THR A 1 669  ? 38.784  27.631  -41.492 1.00 32.38  ? 1083 THR A CG2   1 
ATOM   4960 N  N     . HIS A 1 670  ? 36.049  24.099  -42.689 1.00 33.27  ? 1084 HIS A N     1 
ATOM   4961 C  CA    . HIS A 1 670  ? 35.463  22.747  -42.648 1.00 32.93  ? 1084 HIS A CA    1 
ATOM   4962 C  C     . HIS A 1 670  ? 36.306  21.817  -41.767 1.00 33.74  ? 1084 HIS A C     1 
ATOM   4963 O  O     . HIS A 1 670  ? 35.748  21.023  -40.978 1.00 33.63  ? 1084 HIS A O     1 
ATOM   4964 C  CB    . HIS A 1 670  ? 35.354  22.195  -44.071 1.00 32.42  ? 1084 HIS A CB    1 
ATOM   4965 C  CG    . HIS A 1 670  ? 34.573  20.926  -44.180 1.00 31.88  ? 1084 HIS A CG    1 
ATOM   4966 N  ND1   . HIS A 1 670  ? 33.214  20.860  -43.942 1.00 32.29  ? 1084 HIS A ND1   1 
ATOM   4967 C  CD2   . HIS A 1 670  ? 34.952  19.683  -44.554 1.00 31.48  ? 1084 HIS A CD2   1 
ATOM   4968 C  CE1   . HIS A 1 670  ? 32.797  19.626  -44.146 1.00 32.89  ? 1084 HIS A CE1   1 
ATOM   4969 N  NE2   . HIS A 1 670  ? 33.833  18.890  -44.508 1.00 34.30  ? 1084 HIS A NE2   1 
ATOM   4970 N  N     . PHE A 1 671  ? 37.635  21.912  -41.923 1.00 33.54  ? 1085 PHE A N     1 
ATOM   4971 C  CA    . PHE A 1 671  ? 38.624  21.295  -41.023 1.00 34.11  ? 1085 PHE A CA    1 
ATOM   4972 C  C     . PHE A 1 671  ? 38.752  22.130  -39.745 1.00 34.91  ? 1085 PHE A C     1 
ATOM   4973 O  O     . PHE A 1 671  ? 38.626  23.342  -39.827 1.00 35.64  ? 1085 PHE A O     1 
ATOM   4974 C  CB    . PHE A 1 671  ? 40.004  21.288  -41.702 1.00 33.50  ? 1085 PHE A CB    1 
ATOM   4975 C  CG    . PHE A 1 671  ? 40.067  20.440  -42.951 1.00 31.91  ? 1085 PHE A CG    1 
ATOM   4976 C  CD1   . PHE A 1 671  ? 41.028  20.664  -43.915 1.00 30.75  ? 1085 PHE A CD1   1 
ATOM   4977 C  CD2   . PHE A 1 671  ? 39.161  19.408  -43.152 1.00 30.56  ? 1085 PHE A CD2   1 
ATOM   4978 C  CE1   . PHE A 1 671  ? 41.092  19.853  -45.066 1.00 29.48  ? 1085 PHE A CE1   1 
ATOM   4979 C  CE2   . PHE A 1 671  ? 39.229  18.615  -44.287 1.00 28.22  ? 1085 PHE A CE2   1 
ATOM   4980 C  CZ    . PHE A 1 671  ? 40.190  18.851  -45.245 1.00 27.17  ? 1085 PHE A CZ    1 
ATOM   4981 N  N     . ASP A 1 672  ? 39.013  21.518  -38.579 1.00 35.16  ? 1086 ASP A N     1 
ATOM   4982 C  CA    . ASP A 1 672  ? 39.218  22.314  -37.364 1.00 35.35  ? 1086 ASP A CA    1 
ATOM   4983 C  C     . ASP A 1 672  ? 40.624  22.893  -37.353 1.00 36.44  ? 1086 ASP A C     1 
ATOM   4984 O  O     . ASP A 1 672  ? 41.479  22.493  -38.166 1.00 36.17  ? 1086 ASP A O     1 
ATOM   4985 C  CB    . ASP A 1 672  ? 38.931  21.530  -36.067 1.00 35.28  ? 1086 ASP A CB    1 
ATOM   4986 C  CG    . ASP A 1 672  ? 39.648  20.173  -36.009 1.00 35.19  ? 1086 ASP A CG    1 
ATOM   4987 O  OD1   . ASP A 1 672  ? 39.040  19.176  -35.535 1.00 35.73  ? 1086 ASP A OD1   1 
ATOM   4988 O  OD2   . ASP A 1 672  ? 40.815  20.101  -36.429 1.00 32.37  ? 1086 ASP A OD2   1 
ATOM   4989 N  N     . PHE A 1 673  ? 40.869  23.827  -36.437 1.00 37.02  ? 1087 PHE A N     1 
ATOM   4990 C  CA    . PHE A 1 673  ? 42.140  24.521  -36.425 1.00 38.11  ? 1087 PHE A CA    1 
ATOM   4991 C  C     . PHE A 1 673  ? 43.262  23.528  -36.225 1.00 38.36  ? 1087 PHE A C     1 
ATOM   4992 O  O     . PHE A 1 673  ? 44.361  23.715  -36.746 1.00 37.67  ? 1087 PHE A O     1 
ATOM   4993 C  CB    . PHE A 1 673  ? 42.209  25.563  -35.325 1.00 38.65  ? 1087 PHE A CB    1 
ATOM   4994 C  CG    . PHE A 1 673  ? 43.600  26.082  -35.084 1.00 40.71  ? 1087 PHE A CG    1 
ATOM   4995 C  CD1   . PHE A 1 673  ? 44.278  26.767  -36.083 1.00 41.93  ? 1087 PHE A CD1   1 
ATOM   4996 C  CD2   . PHE A 1 673  ? 44.232  25.881  -33.854 1.00 44.44  ? 1087 PHE A CD2   1 
ATOM   4997 C  CE1   . PHE A 1 673  ? 45.568  27.244  -35.873 1.00 42.55  ? 1087 PHE A CE1   1 
ATOM   4998 C  CE2   . PHE A 1 673  ? 45.536  26.369  -33.629 1.00 45.39  ? 1087 PHE A CE2   1 
ATOM   4999 C  CZ    . PHE A 1 673  ? 46.191  27.047  -34.650 1.00 44.17  ? 1087 PHE A CZ    1 
ATOM   5000 N  N     . HIS A 1 674  ? 42.991  22.464  -35.480 1.00 38.88  ? 1088 HIS A N     1 
ATOM   5001 C  CA    . HIS A 1 674  ? 44.053  21.515  -35.200 1.00 40.02  ? 1088 HIS A CA    1 
ATOM   5002 C  C     . HIS A 1 674  ? 44.625  20.900  -36.490 1.00 39.89  ? 1088 HIS A C     1 
ATOM   5003 O  O     . HIS A 1 674  ? 45.824  20.788  -36.632 1.00 40.49  ? 1088 HIS A O     1 
ATOM   5004 C  CB    . HIS A 1 674  ? 43.627  20.441  -34.189 1.00 40.46  ? 1088 HIS A CB    1 
ATOM   5005 C  CG    . HIS A 1 674  ? 44.704  19.436  -33.905 1.00 44.42  ? 1088 HIS A CG    1 
ATOM   5006 N  ND1   . HIS A 1 674  ? 44.748  18.192  -34.508 1.00 46.95  ? 1088 HIS A ND1   1 
ATOM   5007 C  CD2   . HIS A 1 674  ? 45.805  19.509  -33.117 1.00 46.30  ? 1088 HIS A CD2   1 
ATOM   5008 C  CE1   . HIS A 1 674  ? 45.814  17.535  -34.087 1.00 47.11  ? 1088 HIS A CE1   1 
ATOM   5009 N  NE2   . HIS A 1 674  ? 46.469  18.311  -33.240 1.00 48.63  ? 1088 HIS A NE2   1 
ATOM   5010 N  N     . SER A 1 675  ? 43.778  20.535  -37.442 1.00 39.83  ? 1089 SER A N     1 
ATOM   5011 C  CA    . SER A 1 675  ? 44.265  19.990  -38.702 1.00 39.65  ? 1089 SER A CA    1 
ATOM   5012 C  C     . SER A 1 675  ? 45.154  20.923  -39.506 1.00 39.78  ? 1089 SER A C     1 
ATOM   5013 O  O     . SER A 1 675  ? 45.960  20.451  -40.316 1.00 40.64  ? 1089 SER A O     1 
ATOM   5014 C  CB    . SER A 1 675  ? 43.097  19.604  -39.607 1.00 39.49  ? 1089 SER A CB    1 
ATOM   5015 O  OG    . SER A 1 675  ? 42.185  18.752  -38.936 1.00 39.50  ? 1089 SER A OG    1 
ATOM   5016 N  N     . ILE A 1 676  ? 44.997  22.232  -39.350 1.00 39.18  ? 1090 ILE A N     1 
ATOM   5017 C  CA    . ILE A 1 676  ? 45.730  23.151  -40.221 1.00 39.19  ? 1090 ILE A CA    1 
ATOM   5018 C  C     . ILE A 1 676  ? 46.663  24.049  -39.414 1.00 40.08  ? 1090 ILE A C     1 
ATOM   5019 O  O     . ILE A 1 676  ? 47.190  25.036  -39.921 1.00 39.42  ? 1090 ILE A O     1 
ATOM   5020 C  CB    . ILE A 1 676  ? 44.793  24.008  -41.104 1.00 38.86  ? 1090 ILE A CB    1 
ATOM   5021 C  CG1   . ILE A 1 676  ? 43.714  24.704  -40.262 1.00 37.03  ? 1090 ILE A CG1   1 
ATOM   5022 C  CG2   . ILE A 1 676  ? 44.139  23.151  -42.184 1.00 39.26  ? 1090 ILE A CG2   1 
ATOM   5023 C  CD1   . ILE A 1 676  ? 42.890  25.722  -41.033 1.00 31.94  ? 1090 ILE A CD1   1 
ATOM   5024 N  N     . HIS A 1 677  ? 46.859  23.651  -38.161 1.00 40.95  ? 1091 HIS A N     1 
ATOM   5025 C  CA    . HIS A 1 677  ? 47.692  24.340  -37.158 1.00 42.08  ? 1091 HIS A CA    1 
ATOM   5026 C  C     . HIS A 1 677  ? 48.974  24.901  -37.742 1.00 41.14  ? 1091 HIS A C     1 
ATOM   5027 O  O     . HIS A 1 677  ? 49.419  25.968  -37.370 1.00 41.29  ? 1091 HIS A O     1 
ATOM   5028 C  CB    . HIS A 1 677  ? 48.000  23.359  -35.985 1.00 42.60  ? 1091 HIS A CB    1 
ATOM   5029 C  CG    . HIS A 1 677  ? 48.692  23.988  -34.817 1.00 45.82  ? 1091 HIS A CG    1 
ATOM   5030 N  ND1   . HIS A 1 677  ? 49.964  24.522  -34.900 1.00 49.52  ? 1091 HIS A ND1   1 
ATOM   5031 C  CD2   . HIS A 1 677  ? 48.306  24.142  -33.525 1.00 47.66  ? 1091 HIS A CD2   1 
ATOM   5032 C  CE1   . HIS A 1 677  ? 50.319  25.001  -33.718 1.00 49.01  ? 1091 HIS A CE1   1 
ATOM   5033 N  NE2   . HIS A 1 677  ? 49.334  24.777  -32.865 1.00 47.83  ? 1091 HIS A NE2   1 
ATOM   5034 N  N     . ASP A 1 678  ? 49.572  24.200  -38.679 1.00 41.33  ? 1092 ASP A N     1 
ATOM   5035 C  CA    . ASP A 1 678  ? 50.882  24.630  -39.132 1.00 41.28  ? 1092 ASP A CA    1 
ATOM   5036 C  C     . ASP A 1 678  ? 50.830  25.293  -40.490 1.00 40.69  ? 1092 ASP A C     1 
ATOM   5037 O  O     . ASP A 1 678  ? 51.868  25.645  -41.050 1.00 40.81  ? 1092 ASP A O     1 
ATOM   5038 C  CB    . ASP A 1 678  ? 51.844  23.451  -39.156 1.00 41.95  ? 1092 ASP A CB    1 
ATOM   5039 C  CG    . ASP A 1 678  ? 52.182  22.932  -37.750 1.00 44.43  ? 1092 ASP A CG    1 
ATOM   5040 O  OD1   . ASP A 1 678  ? 51.951  23.639  -36.720 1.00 44.00  ? 1092 ASP A OD1   1 
ATOM   5041 O  OD2   . ASP A 1 678  ? 52.695  21.797  -37.683 1.00 48.51  ? 1092 ASP A OD2   1 
ATOM   5042 N  N     . ASN A 1 679  ? 49.629  25.493  -41.022 1.00 39.24  ? 1093 ASN A N     1 
ATOM   5043 C  CA    . ASN A 1 679  ? 49.535  26.013  -42.377 1.00 38.38  ? 1093 ASN A CA    1 
ATOM   5044 C  C     . ASN A 1 679  ? 49.223  27.512  -42.463 1.00 37.54  ? 1093 ASN A C     1 
ATOM   5045 O  O     . ASN A 1 679  ? 49.692  28.191  -43.372 1.00 37.45  ? 1093 ASN A O     1 
ATOM   5046 C  CB    . ASN A 1 679  ? 48.497  25.244  -43.164 1.00 38.20  ? 1093 ASN A CB    1 
ATOM   5047 C  CG    . ASN A 1 679  ? 48.796  23.779  -43.249 1.00 38.85  ? 1093 ASN A CG    1 
ATOM   5048 O  OD1   . ASN A 1 679  ? 49.909  23.347  -43.574 1.00 41.10  ? 1093 ASN A OD1   1 
ATOM   5049 N  ND2   . ASN A 1 679  ? 47.779  22.989  -43.022 1.00 40.42  ? 1093 ASN A ND2   1 
ATOM   5050 N  N     . LEU A 1 680  ? 48.439  27.999  -41.507 1.00 36.79  ? 1094 LEU A N     1 
ATOM   5051 C  CA    . LEU A 1 680  ? 47.953  29.361  -41.475 1.00 35.39  ? 1094 LEU A CA    1 
ATOM   5052 C  C     . LEU A 1 680  ? 48.024  29.933  -40.068 1.00 35.28  ? 1094 LEU A C     1 
ATOM   5053 O  O     . LEU A 1 680  ? 47.772  29.227  -39.080 1.00 35.32  ? 1094 LEU A O     1 
ATOM   5054 C  CB    . LEU A 1 680  ? 46.512  29.360  -41.907 1.00 35.25  ? 1094 LEU A CB    1 
ATOM   5055 C  CG    . LEU A 1 680  ? 46.229  29.057  -43.372 1.00 35.27  ? 1094 LEU A CG    1 
ATOM   5056 C  CD1   . LEU A 1 680  ? 44.737  28.945  -43.540 1.00 33.08  ? 1094 LEU A CD1   1 
ATOM   5057 C  CD2   . LEU A 1 680  ? 46.809  30.139  -44.303 1.00 33.34  ? 1094 LEU A CD2   1 
ATOM   5058 N  N     . LEU A 1 681  ? 48.355  31.218  -39.970 1.00 35.18  ? 1095 LEU A N     1 
ATOM   5059 C  CA    . LEU A 1 681  ? 48.430  31.910  -38.691 1.00 34.13  ? 1095 LEU A CA    1 
ATOM   5060 C  C     . LEU A 1 681  ? 47.047  32.127  -38.116 1.00 34.68  ? 1095 LEU A C     1 
ATOM   5061 O  O     . LEU A 1 681  ? 46.089  32.262  -38.864 1.00 34.23  ? 1095 LEU A O     1 
ATOM   5062 C  CB    . LEU A 1 681  ? 49.106  33.255  -38.876 1.00 33.74  ? 1095 LEU A CB    1 
ATOM   5063 C  CG    . LEU A 1 681  ? 50.576  33.064  -39.235 1.00 32.47  ? 1095 LEU A CG    1 
ATOM   5064 C  CD1   . LEU A 1 681  ? 51.228  34.409  -39.394 1.00 28.93  ? 1095 LEU A CD1   1 
ATOM   5065 C  CD2   . LEU A 1 681  ? 51.248  32.236  -38.150 1.00 30.41  ? 1095 LEU A CD2   1 
ATOM   5066 N  N     . LYS A 1 682  ? 46.962  32.178  -36.786 1.00 34.84  ? 1096 LYS A N     1 
ATOM   5067 C  CA    . LYS A 1 682  ? 45.702  32.357  -36.077 1.00 34.93  ? 1096 LYS A CA    1 
ATOM   5068 C  C     . LYS A 1 682  ? 45.755  33.527  -35.081 1.00 35.00  ? 1096 LYS A C     1 
ATOM   5069 O  O     . LYS A 1 682  ? 46.741  33.722  -34.347 1.00 34.51  ? 1096 LYS A O     1 
ATOM   5070 C  CB    . LYS A 1 682  ? 45.300  31.062  -35.362 1.00 34.33  ? 1096 LYS A CB    1 
ATOM   5071 C  CG    . LYS A 1 682  ? 43.992  31.181  -34.634 1.00 35.16  ? 1096 LYS A CG    1 
ATOM   5072 C  CD    . LYS A 1 682  ? 43.692  29.954  -33.747 1.00 34.05  ? 1096 LYS A CD    1 
ATOM   5073 C  CE    . LYS A 1 682  ? 44.800  29.689  -32.726 1.00 33.70  ? 1096 LYS A CE    1 
ATOM   5074 N  NZ    . LYS A 1 682  ? 44.347  29.233  -31.373 1.00 30.81  ? 1096 LYS A NZ    1 
ATOM   5075 N  N     . LEU A 1 683  ? 44.691  34.319  -35.086 1.00 35.13  ? 1097 LEU A N     1 
ATOM   5076 C  CA    . LEU A 1 683  ? 44.494  35.349  -34.077 1.00 35.59  ? 1097 LEU A CA    1 
ATOM   5077 C  C     . LEU A 1 683  ? 43.492  34.818  -33.069 1.00 35.50  ? 1097 LEU A C     1 
ATOM   5078 O  O     . LEU A 1 683  ? 42.319  34.627  -33.394 1.00 35.95  ? 1097 LEU A O     1 
ATOM   5079 C  CB    . LEU A 1 683  ? 43.965  36.629  -34.710 1.00 35.53  ? 1097 LEU A CB    1 
ATOM   5080 C  CG    . LEU A 1 683  ? 44.979  37.257  -35.653 1.00 36.45  ? 1097 LEU A CG    1 
ATOM   5081 C  CD1   . LEU A 1 683  ? 44.367  38.374  -36.462 1.00 34.30  ? 1097 LEU A CD1   1 
ATOM   5082 C  CD2   . LEU A 1 683  ? 46.190  37.727  -34.843 1.00 37.14  ? 1097 LEU A CD2   1 
ATOM   5083 N  N     . ASP A 1 684  ? 43.964  34.539  -31.861 1.00 35.41  ? 1098 ASP A N     1 
ATOM   5084 C  CA    . ASP A 1 684  ? 43.086  34.029  -30.815 1.00 35.05  ? 1098 ASP A CA    1 
ATOM   5085 C  C     . ASP A 1 684  ? 42.453  35.206  -30.107 1.00 34.83  ? 1098 ASP A C     1 
ATOM   5086 O  O     . ASP A 1 684  ? 42.984  35.733  -29.125 1.00 35.57  ? 1098 ASP A O     1 
ATOM   5087 C  CB    . ASP A 1 684  ? 43.838  33.111  -29.838 1.00 34.72  ? 1098 ASP A CB    1 
ATOM   5088 C  CG    . ASP A 1 684  ? 43.390  31.668  -29.957 1.00 35.20  ? 1098 ASP A CG    1 
ATOM   5089 O  OD1   . ASP A 1 684  ? 42.483  31.432  -30.772 1.00 34.08  ? 1098 ASP A OD1   1 
ATOM   5090 O  OD2   . ASP A 1 684  ? 43.923  30.777  -29.255 1.00 35.25  ? 1098 ASP A OD2   1 
ATOM   5091 N  N     . ILE A 1 685  ? 41.316  35.626  -30.638 1.00 34.80  ? 1099 ILE A N     1 
ATOM   5092 C  CA    . ILE A 1 685  ? 40.579  36.767  -30.127 1.00 33.41  ? 1099 ILE A CA    1 
ATOM   5093 C  C     . ILE A 1 685  ? 39.523  36.225  -29.192 1.00 33.08  ? 1099 ILE A C     1 
ATOM   5094 O  O     . ILE A 1 685  ? 38.396  35.908  -29.601 1.00 32.65  ? 1099 ILE A O     1 
ATOM   5095 C  CB    . ILE A 1 685  ? 40.013  37.552  -31.306 1.00 33.77  ? 1099 ILE A CB    1 
ATOM   5096 C  CG1   . ILE A 1 685  ? 41.191  38.076  -32.142 1.00 34.19  ? 1099 ILE A CG1   1 
ATOM   5097 C  CG2   . ILE A 1 685  ? 39.142  38.716  -30.852 1.00 32.70  ? 1099 ILE A CG2   1 
ATOM   5098 C  CD1   . ILE A 1 685  ? 40.763  38.633  -33.501 1.00 36.32  ? 1099 ILE A CD1   1 
ATOM   5099 N  N     . LEU A 1 686  ? 39.910  36.096  -27.924 1.00 32.85  ? 1100 LEU A N     1 
ATOM   5100 C  CA    . LEU A 1 686  ? 39.110  35.342  -26.954 1.00 32.33  ? 1100 LEU A CA    1 
ATOM   5101 C  C     . LEU A 1 686  ? 38.182  36.256  -26.171 1.00 31.74  ? 1100 LEU A C     1 
ATOM   5102 O  O     . LEU A 1 686  ? 38.362  37.464  -26.187 1.00 30.88  ? 1100 LEU A O     1 
ATOM   5103 C  CB    . LEU A 1 686  ? 40.015  34.528  -26.029 1.00 32.00  ? 1100 LEU A CB    1 
ATOM   5104 C  CG    . LEU A 1 686  ? 40.911  33.559  -26.824 1.00 33.69  ? 1100 LEU A CG    1 
ATOM   5105 C  CD1   . LEU A 1 686  ? 41.886  32.799  -25.940 1.00 33.61  ? 1100 LEU A CD1   1 
ATOM   5106 C  CD2   . LEU A 1 686  ? 40.079  32.576  -27.624 1.00 35.42  ? 1100 LEU A CD2   1 
ATOM   5107 N  N     . GLY A 1 687  ? 37.181  35.677  -25.510 1.00 31.60  ? 1101 GLY A N     1 
ATOM   5108 C  CA    . GLY A 1 687  ? 36.301  36.462  -24.642 1.00 31.97  ? 1101 GLY A CA    1 
ATOM   5109 C  C     . GLY A 1 687  ? 36.631  36.093  -23.206 1.00 32.21  ? 1101 GLY A C     1 
ATOM   5110 O  O     . GLY A 1 687  ? 37.021  34.952  -22.937 1.00 32.33  ? 1101 GLY A O     1 
ATOM   5111 N  N     . HIS A 1 688  ? 36.509  37.040  -22.279 1.00 31.24  ? 1102 HIS A N     1 
ATOM   5112 C  CA    . HIS A 1 688  ? 36.920  36.764  -20.905 1.00 31.33  ? 1102 HIS A CA    1 
ATOM   5113 C  C     . HIS A 1 688  ? 36.218  37.744  -19.940 1.00 31.46  ? 1102 HIS A C     1 
ATOM   5114 O  O     . HIS A 1 688  ? 35.827  38.814  -20.351 1.00 32.39  ? 1102 HIS A O     1 
ATOM   5115 C  CB    . HIS A 1 688  ? 38.448  36.824  -20.819 1.00 30.40  ? 1102 HIS A CB    1 
ATOM   5116 C  CG    . HIS A 1 688  ? 39.033  36.310  -19.531 1.00 30.19  ? 1102 HIS A CG    1 
ATOM   5117 N  ND1   . HIS A 1 688  ? 39.631  35.073  -19.424 1.00 28.92  ? 1102 HIS A ND1   1 
ATOM   5118 C  CD2   . HIS A 1 688  ? 39.182  36.903  -18.320 1.00 29.87  ? 1102 HIS A CD2   1 
ATOM   5119 C  CE1   . HIS A 1 688  ? 40.083  34.906  -18.191 1.00 28.87  ? 1102 HIS A CE1   1 
ATOM   5120 N  NE2   . HIS A 1 688  ? 39.831  36.005  -17.504 1.00 30.38  ? 1102 HIS A NE2   1 
ATOM   5121 N  N     . ASP A 1 689  ? 36.021  37.375  -18.680 1.00 31.42  ? 1103 ASP A N     1 
ATOM   5122 C  CA    . ASP A 1 689  ? 35.342  38.283  -17.743 1.00 31.42  ? 1103 ASP A CA    1 
ATOM   5123 C  C     . ASP A 1 689  ? 36.311  39.250  -17.050 1.00 31.46  ? 1103 ASP A C     1 
ATOM   5124 O  O     . ASP A 1 689  ? 35.886  40.274  -16.547 1.00 31.23  ? 1103 ASP A O     1 
ATOM   5125 C  CB    . ASP A 1 689  ? 34.577  37.507  -16.669 1.00 31.02  ? 1103 ASP A CB    1 
ATOM   5126 C  CG    . ASP A 1 689  ? 33.362  36.803  -17.202 1.00 32.42  ? 1103 ASP A CG    1 
ATOM   5127 O  OD1   . ASP A 1 689  ? 33.073  36.934  -18.407 1.00 33.79  ? 1103 ASP A OD1   1 
ATOM   5128 O  OD2   . ASP A 1 689  ? 32.659  36.132  -16.399 1.00 35.86  ? 1103 ASP A OD2   1 
ATOM   5129 N  N     . ASP A 1 690  ? 37.604  38.926  -17.001 1.00 31.54  ? 1104 ASP A N     1 
ATOM   5130 C  CA    . ASP A 1 690  ? 38.540  39.777  -16.262 1.00 31.59  ? 1104 ASP A CA    1 
ATOM   5131 C  C     . ASP A 1 690  ? 38.541  41.212  -16.763 1.00 31.72  ? 1104 ASP A C     1 
ATOM   5132 O  O     . ASP A 1 690  ? 38.385  42.137  -15.976 1.00 32.57  ? 1104 ASP A O     1 
ATOM   5133 C  CB    . ASP A 1 690  ? 39.960  39.222  -16.293 1.00 32.01  ? 1104 ASP A CB    1 
ATOM   5134 C  CG    . ASP A 1 690  ? 40.276  38.353  -15.099 1.00 31.44  ? 1104 ASP A CG    1 
ATOM   5135 O  OD1   . ASP A 1 690  ? 39.373  38.040  -14.298 1.00 29.50  ? 1104 ASP A OD1   1 
ATOM   5136 O  OD2   . ASP A 1 690  ? 41.447  37.967  -14.974 1.00 33.29  ? 1104 ASP A OD2   1 
ATOM   5137 N  N     . PRO A 1 691  ? 38.710  41.410  -18.072 1.00 31.21  ? 1105 PRO A N     1 
ATOM   5138 C  CA    . PRO A 1 691  ? 38.693  42.773  -18.618 1.00 31.46  ? 1105 PRO A CA    1 
ATOM   5139 C  C     . PRO A 1 691  ? 37.385  43.514  -18.360 1.00 31.28  ? 1105 PRO A C     1 
ATOM   5140 O  O     . PRO A 1 691  ? 37.400  44.701  -18.026 1.00 31.78  ? 1105 PRO A O     1 
ATOM   5141 C  CB    . PRO A 1 691  ? 38.909  42.545  -20.130 1.00 30.57  ? 1105 PRO A CB    1 
ATOM   5142 C  CG    . PRO A 1 691  ? 39.685  41.282  -20.171 1.00 30.06  ? 1105 PRO A CG    1 
ATOM   5143 C  CD    . PRO A 1 691  ? 39.007  40.426  -19.119 1.00 31.22  ? 1105 PRO A CD    1 
ATOM   5144 N  N     . THR A 1 692  ? 36.266  42.819  -18.501 1.00 31.47  ? 1106 THR A N     1 
ATOM   5145 C  CA    . THR A 1 692  ? 34.970  43.395  -18.180 1.00 31.85  ? 1106 THR A CA    1 
ATOM   5146 C  C     . THR A 1 692  ? 34.872  43.774  -16.689 1.00 32.21  ? 1106 THR A C     1 
ATOM   5147 O  O     . THR A 1 692  ? 34.371  44.846  -16.335 1.00 32.01  ? 1106 THR A O     1 
ATOM   5148 C  CB    . THR A 1 692  ? 33.875  42.382  -18.477 1.00 32.43  ? 1106 THR A CB    1 
ATOM   5149 O  OG1   . THR A 1 692  ? 34.142  41.753  -19.742 1.00 32.05  ? 1106 THR A OG1   1 
ATOM   5150 C  CG2   . THR A 1 692  ? 32.474  43.044  -18.461 1.00 30.23  ? 1106 THR A CG2   1 
ATOM   5151 N  N     . VAL A 1 693  ? 35.340  42.893  -15.814 1.00 32.48  ? 1107 VAL A N     1 
ATOM   5152 C  CA    . VAL A 1 693  ? 35.286  43.191  -14.396 1.00 33.00  ? 1107 VAL A CA    1 
ATOM   5153 C  C     . VAL A 1 693  ? 36.118  44.431  -14.101 1.00 33.97  ? 1107 VAL A C     1 
ATOM   5154 O  O     . VAL A 1 693  ? 35.636  45.371  -13.471 1.00 34.60  ? 1107 VAL A O     1 
ATOM   5155 C  CB    . VAL A 1 693  ? 35.729  41.998  -13.489 1.00 33.15  ? 1107 VAL A CB    1 
ATOM   5156 C  CG1   . VAL A 1 693  ? 36.201  42.501  -12.110 1.00 31.34  ? 1107 VAL A CG1   1 
ATOM   5157 C  CG2   . VAL A 1 693  ? 34.586  41.008  -13.322 1.00 31.49  ? 1107 VAL A CG2   1 
ATOM   5158 N  N     . ILE A 1 694  ? 37.364  44.480  -14.543 1.00 34.76  ? 1108 ILE A N     1 
ATOM   5159 C  CA    . ILE A 1 694  ? 38.115  45.633  -14.090 1.00 35.34  ? 1108 ILE A CA    1 
ATOM   5160 C  C     . ILE A 1 694  ? 37.680  46.885  -14.821 1.00 35.31  ? 1108 ILE A C     1 
ATOM   5161 O  O     . ILE A 1 694  ? 37.841  47.975  -14.296 1.00 35.85  ? 1108 ILE A O     1 
ATOM   5162 C  CB    . ILE A 1 694  ? 39.664  45.483  -14.057 1.00 35.41  ? 1108 ILE A CB    1 
ATOM   5163 C  CG1   . ILE A 1 694  ? 40.313  46.627  -14.812 1.00 37.23  ? 1108 ILE A CG1   1 
ATOM   5164 C  CG2   . ILE A 1 694  ? 40.149  44.136  -14.479 1.00 34.42  ? 1108 ILE A CG2   1 
ATOM   5165 C  CD1   . ILE A 1 694  ? 41.674  46.907  -14.337 1.00 40.26  ? 1108 ILE A CD1   1 
ATOM   5166 N  N     . ARG A 1 695  ? 37.095  46.744  -16.008 1.00 35.16  ? 1109 ARG A N     1 
ATOM   5167 C  CA    . ARG A 1 695  ? 36.487  47.905  -16.648 1.00 35.16  ? 1109 ARG A CA    1 
ATOM   5168 C  C     . ARG A 1 695  ? 35.363  48.536  -15.818 1.00 34.91  ? 1109 ARG A C     1 
ATOM   5169 O  O     . ARG A 1 695  ? 35.267  49.763  -15.703 1.00 34.44  ? 1109 ARG A O     1 
ATOM   5170 C  CB    . ARG A 1 695  ? 35.923  47.578  -18.035 1.00 35.32  ? 1109 ARG A CB    1 
ATOM   5171 C  CG    . ARG A 1 695  ? 35.025  48.693  -18.544 1.00 35.87  ? 1109 ARG A CG    1 
ATOM   5172 C  CD    . ARG A 1 695  ? 34.936  48.711  -20.055 1.00 39.34  ? 1109 ARG A CD    1 
ATOM   5173 N  NE    . ARG A 1 695  ? 33.621  48.348  -20.577 1.00 41.40  ? 1109 ARG A NE    1 
ATOM   5174 C  CZ    . ARG A 1 695  ? 32.665  49.228  -20.854 1.00 41.25  ? 1109 ARG A CZ    1 
ATOM   5175 N  NH1   . ARG A 1 695  ? 31.510  48.829  -21.343 1.00 39.89  ? 1109 ARG A NH1   1 
ATOM   5176 N  NH2   . ARG A 1 695  ? 32.878  50.519  -20.650 1.00 45.07  ? 1109 ARG A NH2   1 
ATOM   5177 N  N     . MET A 1 696  ? 34.479  47.698  -15.295 1.00 34.77  ? 1110 MET A N     1 
ATOM   5178 C  CA    . MET A 1 696  ? 33.391  48.198  -14.475 1.00 35.01  ? 1110 MET A CA    1 
ATOM   5179 C  C     . MET A 1 696  ? 33.977  48.690  -13.160 1.00 35.31  ? 1110 MET A C     1 
ATOM   5180 O  O     . MET A 1 696  ? 33.562  49.698  -12.642 1.00 35.01  ? 1110 MET A O     1 
ATOM   5181 C  CB    . MET A 1 696  ? 32.334  47.115  -14.269 1.00 34.68  ? 1110 MET A CB    1 
ATOM   5182 C  CG    . MET A 1 696  ? 31.297  47.396  -13.209 1.00 34.34  ? 1110 MET A CG    1 
ATOM   5183 S  SD    . MET A 1 696  ? 30.130  45.996  -13.108 1.00 35.54  ? 1110 MET A SD    1 
ATOM   5184 C  CE    . MET A 1 696  ? 28.988  46.604  -11.875 1.00 30.94  ? 1110 MET A CE    1 
ATOM   5185 N  N     . LEU A 1 697  ? 34.970  47.994  -12.626 1.00 36.57  ? 1111 LEU A N     1 
ATOM   5186 C  CA    . LEU A 1 697  ? 35.623  48.485  -11.415 1.00 37.79  ? 1111 LEU A CA    1 
ATOM   5187 C  C     . LEU A 1 697  ? 36.140  49.919  -11.620 1.00 38.90  ? 1111 LEU A C     1 
ATOM   5188 O  O     . LEU A 1 697  ? 35.993  50.759  -10.737 1.00 39.11  ? 1111 LEU A O     1 
ATOM   5189 C  CB    . LEU A 1 697  ? 36.726  47.526  -10.930 1.00 37.62  ? 1111 LEU A CB    1 
ATOM   5190 C  CG    . LEU A 1 697  ? 36.430  46.615  -9.716  1.00 37.08  ? 1111 LEU A CG    1 
ATOM   5191 C  CD1   . LEU A 1 697  ? 35.405  47.268  -8.793  1.00 34.02  ? 1111 LEU A CD1   1 
ATOM   5192 C  CD2   . LEU A 1 697  ? 35.994  45.217  -10.082 1.00 36.06  ? 1111 LEU A CD2   1 
ATOM   5193 N  N     . GLN A 1 698  ? 36.700  50.211  -12.796 1.00 40.19  ? 1112 GLN A N     1 
ATOM   5194 C  CA    . GLN A 1 698  ? 37.154  51.570  -13.116 1.00 41.62  ? 1112 GLN A CA    1 
ATOM   5195 C  C     . GLN A 1 698  ? 36.025  52.568  -13.421 1.00 42.54  ? 1112 GLN A C     1 
ATOM   5196 O  O     . GLN A 1 698  ? 36.100  53.726  -12.998 1.00 42.65  ? 1112 GLN A O     1 
ATOM   5197 C  CB    . GLN A 1 698  ? 38.162  51.572  -14.280 1.00 41.89  ? 1112 GLN A CB    1 
ATOM   5198 C  CG    . GLN A 1 698  ? 38.660  52.983  -14.673 1.00 42.99  ? 1112 GLN A CG    1 
ATOM   5199 C  CD    . GLN A 1 698  ? 39.712  52.981  -15.796 1.00 45.79  ? 1112 GLN A CD    1 
ATOM   5200 O  OE1   . GLN A 1 698  ? 39.719  52.110  -16.670 1.00 47.56  ? 1112 GLN A OE1   1 
ATOM   5201 N  NE2   . GLN A 1 698  ? 40.610  53.953  -15.761 1.00 44.58  ? 1112 GLN A NE2   1 
ATOM   5202 N  N     . ASP A 1 699  ? 35.006  52.141  -14.171 1.00 43.42  ? 1113 ASP A N     1 
ATOM   5203 C  CA    . ASP A 1 699  ? 33.927  53.045  -14.561 1.00 44.47  ? 1113 ASP A CA    1 
ATOM   5204 C  C     . ASP A 1 699  ? 33.127  53.422  -13.311 1.00 44.64  ? 1113 ASP A C     1 
ATOM   5205 O  O     . ASP A 1 699  ? 32.184  54.222  -13.383 1.00 44.89  ? 1113 ASP A O     1 
ATOM   5206 C  CB    . ASP A 1 699  ? 32.986  52.417  -15.618 1.00 45.12  ? 1113 ASP A CB    1 
ATOM   5207 C  CG    . ASP A 1 699  ? 33.628  52.278  -17.045 1.00 48.50  ? 1113 ASP A CG    1 
ATOM   5208 O  OD1   . ASP A 1 699  ? 32.865  52.027  -18.018 1.00 50.82  ? 1113 ASP A OD1   1 
ATOM   5209 O  OD2   . ASP A 1 699  ? 34.872  52.392  -17.226 1.00 51.35  ? 1113 ASP A OD2   1 
ATOM   5210 N  N     . LEU A 1 700  ? 33.499  52.842  -12.171 1.00 44.22  ? 1114 LEU A N     1 
ATOM   5211 C  CA    . LEU A 1 700  ? 32.734  53.022  -10.935 1.00 44.50  ? 1114 LEU A CA    1 
ATOM   5212 C  C     . LEU A 1 700  ? 33.507  53.739  -9.833  1.00 44.52  ? 1114 LEU A C     1 
ATOM   5213 O  O     . LEU A 1 700  ? 32.905  54.350  -8.952  1.00 44.54  ? 1114 LEU A O     1 
ATOM   5214 C  CB    . LEU A 1 700  ? 32.258  51.679  -10.363 1.00 44.27  ? 1114 LEU A CB    1 
ATOM   5215 C  CG    . LEU A 1 700  ? 30.917  51.041  -10.724 1.00 44.36  ? 1114 LEU A CG    1 
ATOM   5216 C  CD1   . LEU A 1 700  ? 30.655  49.869  -9.784  1.00 44.94  ? 1114 LEU A CD1   1 
ATOM   5217 C  CD2   . LEU A 1 700  ? 29.793  52.031  -10.627 1.00 44.44  ? 1114 LEU A CD2   1 
ATOM   5218 N  N     . SER A 1 701  ? 34.830  53.617  -9.853  1.00 44.40  ? 1115 SER A N     1 
ATOM   5219 C  CA    . SER A 1 701  ? 35.655  54.254  -8.840  1.00 44.20  ? 1115 SER A CA    1 
ATOM   5220 C  C     . SER A 1 701  ? 36.362  55.454  -9.447  1.00 44.64  ? 1115 SER A C     1 
ATOM   5221 O  O     . SER A 1 701  ? 36.801  56.345  -8.738  1.00 44.87  ? 1115 SER A O     1 
ATOM   5222 C  CB    . SER A 1 701  ? 36.696  53.273  -8.283  1.00 43.83  ? 1115 SER A CB    1 
ATOM   5223 O  OG    . SER A 1 701  ? 37.624  52.861  -9.271  1.00 42.26  ? 1115 SER A OG    1 
ATOM   5224 N  N     . GLY A 1 702  ? 36.471  55.467  -10.770 1.00 44.89  ? 1116 GLY A N     1 
ATOM   5225 C  CA    . GLY A 1 702  ? 37.245  56.487  -11.449 1.00 45.44  ? 1116 GLY A CA    1 
ATOM   5226 C  C     . GLY A 1 702  ? 38.733  56.204  -11.341 1.00 45.91  ? 1116 GLY A C     1 
ATOM   5227 O  O     . GLY A 1 702  ? 39.561  57.027  -11.711 1.00 45.96  ? 1116 GLY A O     1 
ATOM   5228 N  N     . ILE A 1 703  ? 39.088  55.030  -10.839 1.00 46.40  ? 1117 ILE A N     1 
ATOM   5229 C  CA    . ILE A 1 703  ? 40.481  54.750  -10.577 1.00 47.03  ? 1117 ILE A CA    1 
ATOM   5230 C  C     . ILE A 1 703  ? 41.125  54.075  -11.783 1.00 47.75  ? 1117 ILE A C     1 
ATOM   5231 O  O     . ILE A 1 703  ? 40.587  53.133  -12.355 1.00 47.30  ? 1117 ILE A O     1 
ATOM   5232 C  CB    . ILE A 1 703  ? 40.664  53.953  -9.283  1.00 47.00  ? 1117 ILE A CB    1 
ATOM   5233 C  CG1   . ILE A 1 703  ? 40.238  54.814  -8.095  1.00 47.55  ? 1117 ILE A CG1   1 
ATOM   5234 C  CG2   . ILE A 1 703  ? 42.115  53.552  -9.092  1.00 47.12  ? 1117 ILE A CG2   1 
ATOM   5235 C  CD1   . ILE A 1 703  ? 40.331  54.118  -6.743  1.00 48.51  ? 1117 ILE A CD1   1 
ATOM   5236 N  N     . ASP A 1 704  ? 42.262  54.611  -12.198 1.00 48.77  ? 1118 ASP A N     1 
ATOM   5237 C  CA    . ASP A 1 704  ? 42.979  54.051  -13.324 1.00 50.18  ? 1118 ASP A CA    1 
ATOM   5238 C  C     . ASP A 1 704  ? 43.761  52.811  -12.893 1.00 50.62  ? 1118 ASP A C     1 
ATOM   5239 O  O     . ASP A 1 704  ? 44.815  52.921  -12.261 1.00 50.56  ? 1118 ASP A O     1 
ATOM   5240 C  CB    . ASP A 1 704  ? 43.917  55.087  -13.936 1.00 50.21  ? 1118 ASP A CB    1 
ATOM   5241 C  CG    . ASP A 1 704  ? 44.748  54.513  -15.048 1.00 52.32  ? 1118 ASP A CG    1 
ATOM   5242 O  OD1   . ASP A 1 704  ? 45.655  55.226  -15.536 1.00 54.05  ? 1118 ASP A OD1   1 
ATOM   5243 O  OD2   . ASP A 1 704  ? 44.497  53.340  -15.425 1.00 53.19  ? 1118 ASP A OD2   1 
ATOM   5244 N  N     . PRO A 1 705  ? 43.252  51.628  -13.249 1.00 51.13  ? 1119 PRO A N     1 
ATOM   5245 C  CA    . PRO A 1 705  ? 43.826  50.382  -12.757 1.00 51.83  ? 1119 PRO A CA    1 
ATOM   5246 C  C     . PRO A 1 705  ? 45.298  50.213  -13.084 1.00 52.14  ? 1119 PRO A C     1 
ATOM   5247 O  O     . PRO A 1 705  ? 45.950  49.397  -12.453 1.00 52.84  ? 1119 PRO A O     1 
ATOM   5248 C  CB    . PRO A 1 705  ? 42.998  49.290  -13.451 1.00 52.02  ? 1119 PRO A CB    1 
ATOM   5249 C  CG    . PRO A 1 705  ? 42.178  49.980  -14.485 1.00 52.15  ? 1119 PRO A CG    1 
ATOM   5250 C  CD    . PRO A 1 705  ? 42.080  51.415  -14.113 1.00 51.17  ? 1119 PRO A CD    1 
ATOM   5251 N  N     . LYS A 1 706  ? 45.825  50.963  -14.050 1.00 52.56  ? 1120 LYS A N     1 
ATOM   5252 C  CA    . LYS A 1 706  ? 47.272  50.926  -14.318 1.00 52.60  ? 1120 LYS A CA    1 
ATOM   5253 C  C     . LYS A 1 706  ? 48.089  51.493  -13.163 1.00 52.44  ? 1120 LYS A C     1 
ATOM   5254 O  O     . LYS A 1 706  ? 49.268  51.212  -13.058 1.00 52.49  ? 1120 LYS A O     1 
ATOM   5255 C  CB    . LYS A 1 706  ? 47.642  51.690  -15.587 1.00 52.62  ? 1120 LYS A CB    1 
ATOM   5256 C  CG    . LYS A 1 706  ? 47.071  51.123  -16.876 1.00 54.11  ? 1120 LYS A CG    1 
ATOM   5257 C  CD    . LYS A 1 706  ? 47.951  51.547  -18.061 1.00 56.31  ? 1120 LYS A CD    1 
ATOM   5258 C  CE    . LYS A 1 706  ? 47.212  51.444  -19.392 1.00 57.76  ? 1120 LYS A CE    1 
ATOM   5259 N  NZ    . LYS A 1 706  ? 46.478  50.144  -19.517 1.00 59.57  ? 1120 LYS A NZ    1 
ATOM   5260 N  N     . THR A 1 707  ? 47.468  52.300  -12.311 1.00 52.31  ? 1121 THR A N     1 
ATOM   5261 C  CA    . THR A 1 707  ? 48.173  52.922  -11.196 1.00 52.59  ? 1121 THR A CA    1 
ATOM   5262 C  C     . THR A 1 707  ? 48.165  52.061  -9.932  1.00 52.89  ? 1121 THR A C     1 
ATOM   5263 O  O     . THR A 1 707  ? 48.824  52.393  -8.943  1.00 53.34  ? 1121 THR A O     1 
ATOM   5264 C  CB    . THR A 1 707  ? 47.546  54.286  -10.809 1.00 52.75  ? 1121 THR A CB    1 
ATOM   5265 O  OG1   . THR A 1 707  ? 46.185  54.088  -10.391 1.00 51.69  ? 1121 THR A OG1   1 
ATOM   5266 C  CG2   . THR A 1 707  ? 47.600  55.272  -11.978 1.00 52.83  ? 1121 THR A CG2   1 
ATOM   5267 N  N     . ILE A 1 708  ? 47.391  50.982  -9.945  1.00 52.47  ? 1122 ILE A N     1 
ATOM   5268 C  CA    . ILE A 1 708  ? 47.330  50.089  -8.801  1.00 51.94  ? 1122 ILE A CA    1 
ATOM   5269 C  C     . ILE A 1 708  ? 48.694  49.423  -8.523  1.00 51.38  ? 1122 ILE A C     1 
ATOM   5270 O  O     . ILE A 1 708  ? 49.314  48.891  -9.431  1.00 51.35  ? 1122 ILE A O     1 
ATOM   5271 C  CB    . ILE A 1 708  ? 46.222  49.055  -9.026  1.00 52.01  ? 1122 ILE A CB    1 
ATOM   5272 C  CG1   . ILE A 1 708  ? 44.868  49.763  -8.992  1.00 51.98  ? 1122 ILE A CG1   1 
ATOM   5273 C  CG2   . ILE A 1 708  ? 46.287  47.956  -7.992  1.00 51.94  ? 1122 ILE A CG2   1 
ATOM   5274 C  CD1   . ILE A 1 708  ? 43.703  48.894  -9.383  1.00 52.36  ? 1122 ILE A CD1   1 
ATOM   5275 N  N     . PRO A 1 709  ? 49.167  49.473  -7.263  1.00 50.97  ? 1123 PRO A N     1 
ATOM   5276 C  CA    . PRO A 1 709  ? 50.476  48.935  -6.891  1.00 50.90  ? 1123 PRO A CA    1 
ATOM   5277 C  C     . PRO A 1 709  ? 50.467  47.425  -6.747  1.00 50.96  ? 1123 PRO A C     1 
ATOM   5278 O  O     . PRO A 1 709  ? 49.460  46.845  -6.330  1.00 51.05  ? 1123 PRO A O     1 
ATOM   5279 C  CB    . PRO A 1 709  ? 50.760  49.566  -5.522  1.00 50.69  ? 1123 PRO A CB    1 
ATOM   5280 C  CG    . PRO A 1 709  ? 49.661  50.560  -5.280  1.00 51.05  ? 1123 PRO A CG    1 
ATOM   5281 C  CD    . PRO A 1 709  ? 48.516  50.156  -6.135  1.00 51.03  ? 1123 PRO A CD    1 
ATOM   5282 N  N     . THR A 1 710  ? 51.590  46.797  -7.083  1.00 50.51  ? 1124 THR A N     1 
ATOM   5283 C  CA    . THR A 1 710  ? 51.674  45.353  -7.106  1.00 50.19  ? 1124 THR A CA    1 
ATOM   5284 C  C     . THR A 1 710  ? 52.480  44.847  -5.910  1.00 50.32  ? 1124 THR A C     1 
ATOM   5285 O  O     . THR A 1 710  ? 53.007  43.736  -5.919  1.00 50.81  ? 1124 THR A O     1 
ATOM   5286 C  CB    . THR A 1 710  ? 52.238  44.830  -8.471  1.00 50.46  ? 1124 THR A CB    1 
ATOM   5287 O  OG1   . THR A 1 710  ? 53.601  45.236  -8.646  1.00 49.62  ? 1124 THR A OG1   1 
ATOM   5288 C  CG2   . THR A 1 710  ? 51.406  45.369  -9.645  1.00 49.91  ? 1124 THR A CG2   1 
ATOM   5289 N  N     . ASP A 1 711  ? 52.590  45.679  -4.879  1.00 50.04  ? 1125 ASP A N     1 
ATOM   5290 C  CA    . ASP A 1 711  ? 53.181  45.228  -3.616  1.00 49.73  ? 1125 ASP A CA    1 
ATOM   5291 C  C     . ASP A 1 711  ? 52.520  45.854  -2.395  1.00 49.09  ? 1125 ASP A C     1 
ATOM   5292 O  O     . ASP A 1 711  ? 53.122  45.895  -1.321  1.00 48.81  ? 1125 ASP A O     1 
ATOM   5293 C  CB    . ASP A 1 711  ? 54.702  45.432  -3.573  1.00 49.98  ? 1125 ASP A CB    1 
ATOM   5294 C  CG    . ASP A 1 711  ? 55.109  46.882  -3.732  1.00 50.24  ? 1125 ASP A CG    1 
ATOM   5295 O  OD1   . ASP A 1 711  ? 56.334  47.139  -3.744  1.00 52.10  ? 1125 ASP A OD1   1 
ATOM   5296 O  OD2   . ASP A 1 711  ? 54.226  47.758  -3.846  1.00 49.03  ? 1125 ASP A OD2   1 
ATOM   5297 N  N     . ASP A 1 712  ? 51.296  46.352  -2.590  1.00 48.16  ? 1126 ASP A N     1 
ATOM   5298 C  CA    . ASP A 1 712  ? 50.440  46.819  -1.503  1.00 47.68  ? 1126 ASP A CA    1 
ATOM   5299 C  C     . ASP A 1 712  ? 50.243  45.682  -0.508  1.00 47.12  ? 1126 ASP A C     1 
ATOM   5300 O  O     . ASP A 1 712  ? 49.638  44.648  -0.833  1.00 46.93  ? 1126 ASP A O     1 
ATOM   5301 C  CB    . ASP A 1 712  ? 49.092  47.305  -2.066  1.00 48.11  ? 1126 ASP A CB    1 
ATOM   5302 C  CG    . ASP A 1 712  ? 48.105  47.709  -0.981  1.00 48.25  ? 1126 ASP A CG    1 
ATOM   5303 O  OD1   . ASP A 1 712  ? 47.166  48.491  -1.275  1.00 46.60  ? 1126 ASP A OD1   1 
ATOM   5304 O  OD2   . ASP A 1 712  ? 48.277  47.238  0.164   1.00 49.97  ? 1126 ASP A OD2   1 
ATOM   5305 N  N     . PRO A 1 713  ? 50.771  45.867  0.707   1.00 46.53  ? 1127 PRO A N     1 
ATOM   5306 C  CA    . PRO A 1 713  ? 50.820  44.820  1.718   1.00 46.09  ? 1127 PRO A CA    1 
ATOM   5307 C  C     . PRO A 1 713  ? 49.440  44.275  2.090   1.00 45.65  ? 1127 PRO A C     1 
ATOM   5308 O  O     . PRO A 1 713  ? 49.307  43.090  2.361   1.00 45.32  ? 1127 PRO A O     1 
ATOM   5309 C  CB    . PRO A 1 713  ? 51.521  45.489  2.921   1.00 46.44  ? 1127 PRO A CB    1 
ATOM   5310 C  CG    . PRO A 1 713  ? 51.471  46.970  2.660   1.00 46.47  ? 1127 PRO A CG    1 
ATOM   5311 C  CD    . PRO A 1 713  ? 51.349  47.144  1.161   1.00 46.55  ? 1127 PRO A CD    1 
ATOM   5312 N  N     . ASP A 1 714  ? 48.412  45.111  2.093   1.00 45.66  ? 1128 ASP A N     1 
ATOM   5313 C  CA    . ASP A 1 714  ? 47.082  44.613  2.464   1.00 45.61  ? 1128 ASP A CA    1 
ATOM   5314 C  C     . ASP A 1 714  ? 46.443  43.817  1.341   1.00 45.22  ? 1128 ASP A C     1 
ATOM   5315 O  O     . ASP A 1 714  ? 45.735  42.840  1.591   1.00 45.65  ? 1128 ASP A O     1 
ATOM   5316 C  CB    . ASP A 1 714  ? 46.173  45.751  2.910   1.00 46.06  ? 1128 ASP A CB    1 
ATOM   5317 C  CG    . ASP A 1 714  ? 46.689  46.436  4.161   1.00 48.09  ? 1128 ASP A CG    1 
ATOM   5318 O  OD1   . ASP A 1 714  ? 46.183  47.526  4.514   1.00 49.55  ? 1128 ASP A OD1   1 
ATOM   5319 O  OD2   . ASP A 1 714  ? 47.626  45.880  4.790   1.00 50.24  ? 1128 ASP A OD2   1 
ATOM   5320 N  N     . VAL A 1 715  ? 46.711  44.215  0.100   1.00 44.23  ? 1129 VAL A N     1 
ATOM   5321 C  CA    . VAL A 1 715  ? 46.161  43.510  -1.043  1.00 43.14  ? 1129 VAL A CA    1 
ATOM   5322 C  C     . VAL A 1 715  ? 46.873  42.165  -1.175  1.00 42.85  ? 1129 VAL A C     1 
ATOM   5323 O  O     . VAL A 1 715  ? 46.230  41.114  -1.278  1.00 42.81  ? 1129 VAL A O     1 
ATOM   5324 C  CB    . VAL A 1 715  ? 46.284  44.343  -2.342  1.00 43.21  ? 1129 VAL A CB    1 
ATOM   5325 C  CG1   . VAL A 1 715  ? 45.620  43.649  -3.497  1.00 41.95  ? 1129 VAL A CG1   1 
ATOM   5326 C  CG2   . VAL A 1 715  ? 45.664  45.714  -2.154  1.00 43.19  ? 1129 VAL A CG2   1 
ATOM   5327 N  N     . MET A 1 716  ? 48.201  42.192  -1.156  1.00 41.93  ? 1130 MET A N     1 
ATOM   5328 C  CA    . MET A 1 716  ? 48.973  40.947  -1.224  1.00 41.06  ? 1130 MET A CA    1 
ATOM   5329 C  C     . MET A 1 716  ? 48.683  40.029  -0.040  1.00 40.28  ? 1130 MET A C     1 
ATOM   5330 O  O     . MET A 1 716  ? 48.874  38.817  -0.137  1.00 40.54  ? 1130 MET A O     1 
ATOM   5331 C  CB    . MET A 1 716  ? 50.477  41.230  -1.260  1.00 41.08  ? 1130 MET A CB    1 
ATOM   5332 C  CG    . MET A 1 716  ? 50.873  42.171  -2.357  1.00 41.75  ? 1130 MET A CG    1 
ATOM   5333 S  SD    . MET A 1 716  ? 50.317  41.549  -3.951  1.00 45.02  ? 1130 MET A SD    1 
ATOM   5334 C  CE    . MET A 1 716  ? 51.763  40.612  -4.446  1.00 45.40  ? 1130 MET A CE    1 
ATOM   5335 N  N     . GLY A 1 717  ? 48.255  40.602  1.082   1.00 38.84  ? 1131 GLY A N     1 
ATOM   5336 C  CA    . GLY A 1 717  ? 47.979  39.806  2.269   1.00 37.50  ? 1131 GLY A CA    1 
ATOM   5337 C  C     . GLY A 1 717  ? 46.809  38.841  2.116   1.00 37.15  ? 1131 GLY A C     1 
ATOM   5338 O  O     . GLY A 1 717  ? 46.754  37.840  2.825   1.00 36.85  ? 1131 GLY A O     1 
ATOM   5339 N  N     . ILE A 1 718  ? 45.867  39.140  1.212   1.00 36.34  ? 1132 ILE A N     1 
ATOM   5340 C  CA    . ILE A 1 718  ? 44.700  38.285  1.045   1.00 36.36  ? 1132 ILE A CA    1 
ATOM   5341 C  C     . ILE A 1 718  ? 45.073  36.975  0.394   1.00 36.54  ? 1132 ILE A C     1 
ATOM   5342 O  O     . ILE A 1 718  ? 44.291  36.035  0.382   1.00 36.01  ? 1132 ILE A O     1 
ATOM   5343 C  CB    . ILE A 1 718  ? 43.489  38.928  0.267   1.00 35.91  ? 1132 ILE A CB    1 
ATOM   5344 C  CG1   . ILE A 1 718  ? 43.780  39.067  -1.228  1.00 35.51  ? 1132 ILE A CG1   1 
ATOM   5345 C  CG2   . ILE A 1 718  ? 43.063  40.228  0.907   1.00 35.50  ? 1132 ILE A CG2   1 
ATOM   5346 C  CD1   . ILE A 1 718  ? 42.522  39.306  -2.107  1.00 33.38  ? 1132 ILE A CD1   1 
ATOM   5347 N  N     . PHE A 1 719  ? 46.281  36.899  -0.140  1.00 37.48  ? 1133 PHE A N     1 
ATOM   5348 C  CA    . PHE A 1 719  ? 46.686  35.648  -0.773  1.00 37.93  ? 1133 PHE A CA    1 
ATOM   5349 C  C     . PHE A 1 719  ? 47.145  34.638  0.256   1.00 38.41  ? 1133 PHE A C     1 
ATOM   5350 O  O     . PHE A 1 719  ? 47.512  33.524  -0.082  1.00 39.80  ? 1133 PHE A O     1 
ATOM   5351 C  CB    . PHE A 1 719  ? 47.683  35.885  -1.899  1.00 37.23  ? 1133 PHE A CB    1 
ATOM   5352 C  CG    . PHE A 1 719  ? 47.044  36.528  -3.108  1.00 37.92  ? 1133 PHE A CG    1 
ATOM   5353 C  CD1   . PHE A 1 719  ? 46.327  35.757  -4.020  1.00 35.62  ? 1133 PHE A CD1   1 
ATOM   5354 C  CD2   . PHE A 1 719  ? 47.095  37.909  -3.293  1.00 36.39  ? 1133 PHE A CD2   1 
ATOM   5355 C  CE1   . PHE A 1 719  ? 45.696  36.345  -5.114  1.00 36.51  ? 1133 PHE A CE1   1 
ATOM   5356 C  CE2   . PHE A 1 719  ? 46.473  38.508  -4.389  1.00 35.61  ? 1133 PHE A CE2   1 
ATOM   5357 C  CZ    . PHE A 1 719  ? 45.781  37.723  -5.313  1.00 34.96  ? 1133 PHE A CZ    1 
ATOM   5358 N  N     . SER A 1 720  ? 47.068  35.002  1.525   1.00 38.76  ? 1134 SER A N     1 
ATOM   5359 C  CA    . SER A 1 720  ? 47.538  34.104  2.563   1.00 39.00  ? 1134 SER A CA    1 
ATOM   5360 C  C     . SER A 1 720  ? 46.788  34.254  3.873   1.00 39.12  ? 1134 SER A C     1 
ATOM   5361 O  O     . SER A 1 720  ? 47.114  33.573  4.844   1.00 38.94  ? 1134 SER A O     1 
ATOM   5362 C  CB    . SER A 1 720  ? 49.025  34.312  2.803   1.00 39.18  ? 1134 SER A CB    1 
ATOM   5363 O  OG    . SER A 1 720  ? 49.250  35.597  3.330   1.00 39.86  ? 1134 SER A OG    1 
ATOM   5364 N  N     . SER A 1 721  ? 45.770  35.119  3.896   1.00 39.28  ? 1135 SER A N     1 
ATOM   5365 C  CA    . SER A 1 721  ? 45.071  35.419  5.138   1.00 39.43  ? 1135 SER A CA    1 
ATOM   5366 C  C     . SER A 1 721  ? 43.722  36.082  4.893   1.00 40.14  ? 1135 SER A C     1 
ATOM   5367 O  O     . SER A 1 721  ? 43.486  36.627  3.808   1.00 40.31  ? 1135 SER A O     1 
ATOM   5368 C  CB    . SER A 1 721  ? 45.936  36.345  5.987   1.00 39.16  ? 1135 SER A CB    1 
ATOM   5369 O  OG    . SER A 1 721  ? 45.256  36.720  7.157   1.00 38.14  ? 1135 SER A OG    1 
ATOM   5370 N  N     . THR A 1 722  ? 42.851  36.039  5.904   1.00 40.34  ? 1136 THR A N     1 
ATOM   5371 C  CA    . THR A 1 722  ? 41.599  36.798  5.890   1.00 41.04  ? 1136 THR A CA    1 
ATOM   5372 C  C     . THR A 1 722  ? 41.725  38.154  6.604   1.00 41.61  ? 1136 THR A C     1 
ATOM   5373 O  O     . THR A 1 722  ? 40.852  39.019  6.476   1.00 41.37  ? 1136 THR A O     1 
ATOM   5374 C  CB    . THR A 1 722  ? 40.452  36.029  6.570   1.00 40.94  ? 1136 THR A CB    1 
ATOM   5375 O  OG1   . THR A 1 722  ? 40.612  36.107  7.992   1.00 39.75  ? 1136 THR A OG1   1 
ATOM   5376 C  CG2   . THR A 1 722  ? 40.447  34.567  6.133   1.00 41.08  ? 1136 THR A CG2   1 
ATOM   5377 N  N     . GLU A 1 723  ? 42.815  38.342  7.342   1.00 42.45  ? 1137 GLU A N     1 
ATOM   5378 C  CA    . GLU A 1 723  ? 43.097  39.612  8.032   1.00 43.65  ? 1137 GLU A CA    1 
ATOM   5379 C  C     . GLU A 1 723  ? 42.630  40.884  7.278   1.00 42.80  ? 1137 GLU A C     1 
ATOM   5380 O  O     . GLU A 1 723  ? 41.841  41.648  7.806   1.00 42.68  ? 1137 GLU A O     1 
ATOM   5381 C  CB    . GLU A 1 723  ? 44.603  39.725  8.308   1.00 44.52  ? 1137 GLU A CB    1 
ATOM   5382 C  CG    . GLU A 1 723  ? 44.994  40.216  9.692   1.00 49.58  ? 1137 GLU A CG    1 
ATOM   5383 C  CD    . GLU A 1 723  ? 44.729  39.149  10.754  1.00 56.17  ? 1137 GLU A CD    1 
ATOM   5384 O  OE1   . GLU A 1 723  ? 43.531  38.983  11.102  1.00 58.96  ? 1137 GLU A OE1   1 
ATOM   5385 O  OE2   . GLU A 1 723  ? 45.699  38.474  11.210  1.00 56.92  ? 1137 GLU A OE2   1 
ATOM   5386 N  N     . PRO A 1 724  ? 43.145  41.124  6.054   1.00 42.24  ? 1138 PRO A N     1 
ATOM   5387 C  CA    . PRO A 1 724  ? 42.877  42.393  5.349   1.00 41.78  ? 1138 PRO A CA    1 
ATOM   5388 C  C     . PRO A 1 724  ? 41.412  42.622  5.024   1.00 41.18  ? 1138 PRO A C     1 
ATOM   5389 O  O     . PRO A 1 724  ? 41.029  43.721  4.624   1.00 41.09  ? 1138 PRO A O     1 
ATOM   5390 C  CB    . PRO A 1 724  ? 43.673  42.248  4.034   1.00 41.56  ? 1138 PRO A CB    1 
ATOM   5391 C  CG    . PRO A 1 724  ? 44.760  41.274  4.349   1.00 42.20  ? 1138 PRO A CG    1 
ATOM   5392 C  CD    . PRO A 1 724  ? 44.114  40.286  5.323   1.00 42.15  ? 1138 PRO A CD    1 
ATOM   5393 N  N     . LEU A 1 725  ? 40.599  41.586  5.181   1.00 40.69  ? 1139 LEU A N     1 
ATOM   5394 C  CA    . LEU A 1 725  ? 39.179  41.673  4.847   1.00 40.09  ? 1139 LEU A CA    1 
ATOM   5395 C  C     . LEU A 1 725  ? 38.354  42.083  6.047   1.00 39.40  ? 1139 LEU A C     1 
ATOM   5396 O  O     . LEU A 1 725  ? 37.189  42.455  5.895   1.00 39.56  ? 1139 LEU A O     1 
ATOM   5397 C  CB    . LEU A 1 725  ? 38.666  40.331  4.329   1.00 40.39  ? 1139 LEU A CB    1 
ATOM   5398 C  CG    . LEU A 1 725  ? 38.657  40.014  2.829   1.00 41.52  ? 1139 LEU A CG    1 
ATOM   5399 C  CD1   . LEU A 1 725  ? 39.600  40.879  2.041   1.00 41.48  ? 1139 LEU A CD1   1 
ATOM   5400 C  CD2   . LEU A 1 725  ? 38.985  38.533  2.624   1.00 41.29  ? 1139 LEU A CD2   1 
ATOM   5401 N  N     . GLY A 1 726  ? 38.953  42.005  7.237   1.00 38.48  ? 1140 GLY A N     1 
ATOM   5402 C  CA    . GLY A 1 726  ? 38.276  42.396  8.477   1.00 37.84  ? 1140 GLY A CA    1 
ATOM   5403 C  C     . GLY A 1 726  ? 37.264  41.355  8.934   1.00 37.88  ? 1140 GLY A C     1 
ATOM   5404 O  O     . GLY A 1 726  ? 36.303  41.675  9.630   1.00 37.85  ? 1140 GLY A O     1 
ATOM   5405 N  N     . VAL A 1 727  ? 37.468  40.106  8.523   1.00 37.39  ? 1141 VAL A N     1 
ATOM   5406 C  CA    . VAL A 1 727  ? 36.647  39.001  8.995   1.00 36.73  ? 1141 VAL A CA    1 
ATOM   5407 C  C     . VAL A 1 727  ? 37.506  37.789  9.330   1.00 36.73  ? 1141 VAL A C     1 
ATOM   5408 O  O     . VAL A 1 727  ? 38.651  37.682  8.942   1.00 36.26  ? 1141 VAL A O     1 
ATOM   5409 C  CB    . VAL A 1 727  ? 35.614  38.558  7.946   1.00 36.79  ? 1141 VAL A CB    1 
ATOM   5410 C  CG1   . VAL A 1 727  ? 34.664  39.700  7.624   1.00 36.33  ? 1141 VAL A CG1   1 
ATOM   5411 C  CG2   . VAL A 1 727  ? 36.322  38.038  6.694   1.00 34.98  ? 1141 VAL A CG2   1 
ATOM   5412 N  N     . THR A 1 728  ? 36.886  36.873  10.036  1.00 36.94  ? 1142 THR A N     1 
ATOM   5413 C  CA    . THR A 1 728  ? 37.484  35.687  10.576  1.00 37.67  ? 1142 THR A CA    1 
ATOM   5414 C  C     . THR A 1 728  ? 37.364  34.580  9.543   1.00 37.56  ? 1142 THR A C     1 
ATOM   5415 O  O     . THR A 1 728  ? 36.424  34.588  8.748   1.00 37.34  ? 1142 THR A O     1 
ATOM   5416 C  CB    . THR A 1 728  ? 36.649  35.275  11.826  1.00 37.72  ? 1142 THR A CB    1 
ATOM   5417 O  OG1   . THR A 1 728  ? 37.029  36.083  12.942  1.00 38.48  ? 1142 THR A OG1   1 
ATOM   5418 C  CG2   . THR A 1 728  ? 36.838  33.808  12.179  1.00 39.42  ? 1142 THR A CG2   1 
ATOM   5419 N  N     . PRO A 1 729  ? 38.307  33.626  9.554   1.00 37.87  ? 1143 PRO A N     1 
ATOM   5420 C  CA    . PRO A 1 729  ? 38.184  32.395  8.766   1.00 38.77  ? 1143 PRO A CA    1 
ATOM   5421 C  C     . PRO A 1 729  ? 36.900  31.641  9.099   1.00 39.29  ? 1143 PRO A C     1 
ATOM   5422 O  O     . PRO A 1 729  ? 36.267  31.075  8.220   1.00 39.59  ? 1143 PRO A O     1 
ATOM   5423 C  CB    . PRO A 1 729  ? 39.387  31.569  9.206   1.00 38.29  ? 1143 PRO A CB    1 
ATOM   5424 C  CG    . PRO A 1 729  ? 40.397  32.588  9.683   1.00 38.28  ? 1143 PRO A CG    1 
ATOM   5425 C  CD    . PRO A 1 729  ? 39.635  33.771  10.183  1.00 38.19  ? 1143 PRO A CD    1 
ATOM   5426 N  N     . GLU A 1 730  ? 36.528  31.628  10.368  1.00 40.21  ? 1144 GLU A N     1 
ATOM   5427 C  CA    . GLU A 1 730  ? 35.288  30.991  10.773  1.00 41.37  ? 1144 GLU A CA    1 
ATOM   5428 C  C     . GLU A 1 730  ? 34.078  31.763  10.220  1.00 40.79  ? 1144 GLU A C     1 
ATOM   5429 O  O     . GLU A 1 730  ? 33.118  31.166  9.736   1.00 40.67  ? 1144 GLU A O     1 
ATOM   5430 C  CB    . GLU A 1 730  ? 35.213  30.862  12.295  1.00 41.70  ? 1144 GLU A CB    1 
ATOM   5431 C  CG    . GLU A 1 730  ? 33.863  30.288  12.798  1.00 47.11  ? 1144 GLU A CG    1 
ATOM   5432 C  CD    . GLU A 1 730  ? 33.582  28.836  12.305  1.00 53.22  ? 1144 GLU A CD    1 
ATOM   5433 O  OE1   . GLU A 1 730  ? 34.083  27.882  12.958  1.00 55.25  ? 1144 GLU A OE1   1 
ATOM   5434 O  OE2   . GLU A 1 730  ? 32.854  28.646  11.281  1.00 54.36  ? 1144 GLU A OE2   1 
ATOM   5435 N  N     . GLN A 1 731  ? 34.126  33.089  10.285  1.00 40.16  ? 1145 GLN A N     1 
ATOM   5436 C  CA    . GLN A 1 731  ? 33.080  33.910  9.665   1.00 39.61  ? 1145 GLN A CA    1 
ATOM   5437 C  C     . GLN A 1 731  ? 32.818  33.610  8.183   1.00 39.07  ? 1145 GLN A C     1 
ATOM   5438 O  O     . GLN A 1 731  ? 31.679  33.589  7.745   1.00 38.80  ? 1145 GLN A O     1 
ATOM   5439 C  CB    . GLN A 1 731  ? 33.423  35.381  9.793   1.00 39.65  ? 1145 GLN A CB    1 
ATOM   5440 C  CG    . GLN A 1 731  ? 33.071  36.001  11.131  1.00 39.14  ? 1145 GLN A CG    1 
ATOM   5441 C  CD    . GLN A 1 731  ? 33.457  37.457  11.145  1.00 39.00  ? 1145 GLN A CD    1 
ATOM   5442 O  OE1   . GLN A 1 731  ? 34.635  37.792  11.261  1.00 38.55  ? 1145 GLN A OE1   1 
ATOM   5443 N  NE2   . GLN A 1 731  ? 32.474  38.336  10.970  1.00 39.22  ? 1145 GLN A NE2   1 
ATOM   5444 N  N     . ILE A 1 732  ? 33.863  33.390  7.402   1.00 38.80  ? 1146 ILE A N     1 
ATOM   5445 C  CA    . ILE A 1 732  ? 33.636  33.199  5.975   1.00 38.77  ? 1146 ILE A CA    1 
ATOM   5446 C  C     . ILE A 1 732  ? 33.940  31.788  5.504   1.00 39.72  ? 1146 ILE A C     1 
ATOM   5447 O  O     . ILE A 1 732  ? 33.988  31.549  4.316   1.00 40.15  ? 1146 ILE A O     1 
ATOM   5448 C  CB    . ILE A 1 732  ? 34.382  34.218  5.084   1.00 37.96  ? 1146 ILE A CB    1 
ATOM   5449 C  CG1   . ILE A 1 732  ? 35.892  34.009  5.177   1.00 37.97  ? 1146 ILE A CG1   1 
ATOM   5450 C  CG2   . ILE A 1 732  ? 33.982  35.639  5.440   1.00 35.54  ? 1146 ILE A CG2   1 
ATOM   5451 C  CD1   . ILE A 1 732  ? 36.703  34.775  4.121   1.00 36.05  ? 1146 ILE A CD1   1 
ATOM   5452 N  N     . MET A 1 733  ? 34.114  30.849  6.428   1.00 40.49  ? 1147 MET A N     1 
ATOM   5453 C  CA    . MET A 1 733  ? 34.308  29.442  6.051   1.00 41.24  ? 1147 MET A CA    1 
ATOM   5454 C  C     . MET A 1 733  ? 35.497  29.259  5.111   1.00 41.23  ? 1147 MET A C     1 
ATOM   5455 O  O     . MET A 1 733  ? 35.412  28.519  4.127   1.00 42.20  ? 1147 MET A O     1 
ATOM   5456 C  CB    . MET A 1 733  ? 33.047  28.884  5.376   1.00 41.26  ? 1147 MET A CB    1 
ATOM   5457 C  CG    . MET A 1 733  ? 31.844  28.641  6.317   1.00 43.44  ? 1147 MET A CG    1 
ATOM   5458 S  SD    . MET A 1 733  ? 30.392  27.909  5.483   1.00 46.53  ? 1147 MET A SD    1 
ATOM   5459 C  CE    . MET A 1 733  ? 30.807  28.210  3.746   1.00 47.16  ? 1147 MET A CE    1 
ATOM   5460 N  N     . CYS A 1 734  ? 36.607  29.920  5.414   1.00 40.88  ? 1148 CYS A N     1 
ATOM   5461 C  CA    . CYS A 1 734  ? 37.755  29.947  4.511   1.00 40.48  ? 1148 CYS A CA    1 
ATOM   5462 C  C     . CYS A 1 734  ? 38.944  30.604  5.191   1.00 39.26  ? 1148 CYS A C     1 
ATOM   5463 O  O     . CYS A 1 734  ? 38.769  31.538  5.970   1.00 39.42  ? 1148 CYS A O     1 
ATOM   5464 C  CB    . CYS A 1 734  ? 37.411  30.731  3.251   1.00 40.40  ? 1148 CYS A CB    1 
ATOM   5465 S  SG    . CYS A 1 734  ? 38.736  30.692  2.020   1.00 44.79  ? 1148 CYS A SG    1 
ATOM   5466 N  N     . ASN A 1 735  ? 40.145  30.123  4.892   1.00 38.23  ? 1149 ASN A N     1 
ATOM   5467 C  CA    . ASN A 1 735  ? 41.338  30.517  5.644   1.00 37.01  ? 1149 ASN A CA    1 
ATOM   5468 C  C     . ASN A 1 735  ? 42.144  31.569  4.922   1.00 35.78  ? 1149 ASN A C     1 
ATOM   5469 O  O     . ASN A 1 735  ? 43.027  32.190  5.510   1.00 35.85  ? 1149 ASN A O     1 
ATOM   5470 C  CB    . ASN A 1 735  ? 42.252  29.319  5.890   1.00 37.30  ? 1149 ASN A CB    1 
ATOM   5471 C  CG    . ASN A 1 735  ? 41.689  28.354  6.897   1.00 39.21  ? 1149 ASN A CG    1 
ATOM   5472 O  OD1   . ASN A 1 735  ? 41.194  28.757  7.952   1.00 42.07  ? 1149 ASN A OD1   1 
ATOM   5473 N  ND2   . ASN A 1 735  ? 41.778  27.060  6.591   1.00 39.42  ? 1149 ASN A ND2   1 
ATOM   5474 N  N     . VAL A 1 736  ? 41.891  31.742  3.633   1.00 34.04  ? 1150 VAL A N     1 
ATOM   5475 C  CA    . VAL A 1 736  ? 42.590  32.793  2.914   1.00 32.51  ? 1150 VAL A CA    1 
ATOM   5476 C  C     . VAL A 1 736  ? 41.569  33.734  2.343   1.00 32.41  ? 1150 VAL A C     1 
ATOM   5477 O  O     . VAL A 1 736  ? 40.373  33.419  2.314   1.00 32.08  ? 1150 VAL A O     1 
ATOM   5478 C  CB    . VAL A 1 736  ? 43.559  32.252  1.848   1.00 32.58  ? 1150 VAL A CB    1 
ATOM   5479 C  CG1   . VAL A 1 736  ? 44.512  31.228  2.488   1.00 31.82  ? 1150 VAL A CG1   1 
ATOM   5480 C  CG2   . VAL A 1 736  ? 42.818  31.639  0.700   1.00 30.14  ? 1150 VAL A CG2   1 
ATOM   5481 N  N     . GLY A 1 737  ? 42.035  34.891  1.902   1.00 32.29  ? 1151 GLY A N     1 
ATOM   5482 C  CA    . GLY A 1 737  ? 41.135  35.952  1.473   1.00 32.95  ? 1151 GLY A CA    1 
ATOM   5483 C  C     . GLY A 1 737  ? 40.878  36.089  -0.015  1.00 33.32  ? 1151 GLY A C     1 
ATOM   5484 O  O     . GLY A 1 737  ? 40.504  37.169  -0.469  1.00 33.10  ? 1151 GLY A O     1 
ATOM   5485 N  N     . THR A 1 738  ? 41.040  34.996  -0.768  1.00 33.51  ? 1152 THR A N     1 
ATOM   5486 C  CA    . THR A 1 738  ? 40.911  35.054  -2.222  1.00 34.32  ? 1152 THR A CA    1 
ATOM   5487 C  C     . THR A 1 738  ? 39.571  34.586  -2.759  1.00 34.42  ? 1152 THR A C     1 
ATOM   5488 O  O     . THR A 1 738  ? 39.466  34.200  -3.914  1.00 34.82  ? 1152 THR A O     1 
ATOM   5489 C  CB    . THR A 1 738  ? 41.986  34.206  -2.935  1.00 34.46  ? 1152 THR A CB    1 
ATOM   5490 O  OG1   . THR A 1 738  ? 41.812  32.822  -2.582  1.00 33.88  ? 1152 THR A OG1   1 
ATOM   5491 C  CG2   . THR A 1 738  ? 43.357  34.678  -2.548  1.00 34.05  ? 1152 THR A CG2   1 
ATOM   5492 N  N     . ILE A 1 739  ? 38.534  34.591  -1.952  1.00 34.93  ? 1153 ILE A N     1 
ATOM   5493 C  CA    . ILE A 1 739  ? 37.248  34.228  -2.528  1.00 35.40  ? 1153 ILE A CA    1 
ATOM   5494 C  C     . ILE A 1 739  ? 36.830  35.181  -3.670  1.00 35.36  ? 1153 ILE A C     1 
ATOM   5495 O  O     . ILE A 1 739  ? 36.954  36.409  -3.553  1.00 35.51  ? 1153 ILE A O     1 
ATOM   5496 C  CB    . ILE A 1 739  ? 36.177  34.093  -1.447  1.00 35.52  ? 1153 ILE A CB    1 
ATOM   5497 C  CG1   . ILE A 1 739  ? 36.337  32.727  -0.781  1.00 34.03  ? 1153 ILE A CG1   1 
ATOM   5498 C  CG2   . ILE A 1 739  ? 34.788  34.229  -2.048  1.00 36.35  ? 1153 ILE A CG2   1 
ATOM   5499 C  CD1   . ILE A 1 739  ? 35.872  32.688  0.625   1.00 32.51  ? 1153 ILE A CD1   1 
ATOM   5500 N  N     . GLY A 1 740  ? 36.383  34.607  -4.787  1.00 35.27  ? 1154 GLY A N     1 
ATOM   5501 C  CA    . GLY A 1 740  ? 35.971  35.405  -5.961  1.00 34.68  ? 1154 GLY A CA    1 
ATOM   5502 C  C     . GLY A 1 740  ? 37.066  35.904  -6.898  1.00 34.75  ? 1154 GLY A C     1 
ATOM   5503 O  O     . GLY A 1 740  ? 36.785  36.270  -8.033  1.00 34.38  ? 1154 GLY A O     1 
ATOM   5504 N  N     . ILE A 1 741  ? 38.316  35.938  -6.428  1.00 34.84  ? 1155 ILE A N     1 
ATOM   5505 C  CA    . ILE A 1 741  ? 39.469  36.344  -7.256  1.00 34.50  ? 1155 ILE A CA    1 
ATOM   5506 C  C     . ILE A 1 741  ? 39.694  35.360  -8.420  1.00 34.42  ? 1155 ILE A C     1 
ATOM   5507 O  O     . ILE A 1 741  ? 39.725  34.174  -8.204  1.00 35.91  ? 1155 ILE A O     1 
ATOM   5508 C  CB    . ILE A 1 741  ? 40.743  36.401  -6.383  1.00 34.01  ? 1155 ILE A CB    1 
ATOM   5509 C  CG1   . ILE A 1 741  ? 40.528  37.344  -5.211  1.00 33.00  ? 1155 ILE A CG1   1 
ATOM   5510 C  CG2   . ILE A 1 741  ? 41.901  36.917  -7.173  1.00 33.63  ? 1155 ILE A CG2   1 
ATOM   5511 C  CD1   . ILE A 1 741  ? 40.497  38.793  -5.637  1.00 31.00  ? 1155 ILE A CD1   1 
ATOM   5512 N  N     . PRO A 1 742  ? 39.842  35.833  -9.658  1.00 34.44  ? 1156 PRO A N     1 
ATOM   5513 C  CA    . PRO A 1 742  ? 39.937  34.809  -10.714 1.00 34.61  ? 1156 PRO A CA    1 
ATOM   5514 C  C     . PRO A 1 742  ? 41.066  33.806  -10.443 1.00 34.66  ? 1156 PRO A C     1 
ATOM   5515 O  O     . PRO A 1 742  ? 42.119  34.219  -9.963  1.00 34.64  ? 1156 PRO A O     1 
ATOM   5516 C  CB    . PRO A 1 742  ? 40.254  35.636  -11.979 1.00 34.45  ? 1156 PRO A CB    1 
ATOM   5517 C  CG    . PRO A 1 742  ? 40.845  36.955  -11.435 1.00 34.33  ? 1156 PRO A CG    1 
ATOM   5518 C  CD    . PRO A 1 742  ? 40.009  37.195  -10.196 1.00 34.84  ? 1156 PRO A CD    1 
ATOM   5519 N  N     . GLU A 1 743  ? 40.846  32.521  -10.748 1.00 34.48  ? 1157 GLU A N     1 
ATOM   5520 C  CA    . GLU A 1 743  ? 41.857  31.444  -10.559 1.00 34.87  ? 1157 GLU A CA    1 
ATOM   5521 C  C     . GLU A 1 743  ? 42.127  31.093  -9.091  1.00 35.64  ? 1157 GLU A C     1 
ATOM   5522 O  O     . GLU A 1 743  ? 41.862  29.976  -8.641  1.00 36.68  ? 1157 GLU A O     1 
ATOM   5523 C  CB    . GLU A 1 743  ? 43.182  31.771  -11.266 1.00 34.31  ? 1157 GLU A CB    1 
ATOM   5524 C  CG    . GLU A 1 743  ? 43.034  32.410  -12.660 1.00 32.76  ? 1157 GLU A CG    1 
ATOM   5525 C  CD    . GLU A 1 743  ? 42.551  31.449  -13.736 1.00 31.25  ? 1157 GLU A CD    1 
ATOM   5526 O  OE1   . GLU A 1 743  ? 42.216  31.913  -14.855 1.00 32.65  ? 1157 GLU A OE1   1 
ATOM   5527 O  OE2   . GLU A 1 743  ? 42.490  30.238  -13.472 1.00 29.79  ? 1157 GLU A OE2   1 
ATOM   5528 N  N     . PHE A 1 744  ? 42.623  32.057  -8.331  1.00 35.93  ? 1158 PHE A N     1 
ATOM   5529 C  CA    . PHE A 1 744  ? 42.918  31.854  -6.914  1.00 35.22  ? 1158 PHE A CA    1 
ATOM   5530 C  C     . PHE A 1 744  ? 41.745  31.623  -5.977  1.00 35.53  ? 1158 PHE A C     1 
ATOM   5531 O  O     . PHE A 1 744  ? 41.962  31.377  -4.784  1.00 35.32  ? 1158 PHE A O     1 
ATOM   5532 C  CB    . PHE A 1 744  ? 43.683  33.058  -6.398  1.00 34.67  ? 1158 PHE A CB    1 
ATOM   5533 C  CG    . PHE A 1 744  ? 45.030  33.206  -7.029  1.00 34.56  ? 1158 PHE A CG    1 
ATOM   5534 C  CD1   . PHE A 1 744  ? 45.211  34.036  -8.134  1.00 29.40  ? 1158 PHE A CD1   1 
ATOM   5535 C  CD2   . PHE A 1 744  ? 46.117  32.468  -6.550  1.00 32.16  ? 1158 PHE A CD2   1 
ATOM   5536 C  CE1   . PHE A 1 744  ? 46.460  34.169  -8.723  1.00 29.04  ? 1158 PHE A CE1   1 
ATOM   5537 C  CE2   . PHE A 1 744  ? 47.378  32.609  -7.153  1.00 32.41  ? 1158 PHE A CE2   1 
ATOM   5538 C  CZ    . PHE A 1 744  ? 47.541  33.464  -8.239  1.00 28.66  ? 1158 PHE A CZ    1 
ATOM   5539 N  N     . GLY A 1 745  ? 40.513  31.753  -6.475  1.00 35.79  ? 1159 GLY A N     1 
ATOM   5540 C  CA    . GLY A 1 745  ? 39.341  31.706  -5.585  1.00 35.51  ? 1159 GLY A CA    1 
ATOM   5541 C  C     . GLY A 1 745  ? 38.769  30.314  -5.404  1.00 35.71  ? 1159 GLY A C     1 
ATOM   5542 O  O     . GLY A 1 745  ? 37.909  30.070  -4.573  1.00 35.95  ? 1159 GLY A O     1 
ATOM   5543 N  N     . THR A 1 746  ? 39.272  29.402  -6.202  1.00 35.93  ? 1160 THR A N     1 
ATOM   5544 C  CA    . THR A 1 746  ? 38.890  28.011  -6.198  1.00 36.18  ? 1160 THR A CA    1 
ATOM   5545 C  C     . THR A 1 746  ? 39.236  27.262  -4.921  1.00 36.44  ? 1160 THR A C     1 
ATOM   5546 O  O     . THR A 1 746  ? 40.148  27.645  -4.180  1.00 36.80  ? 1160 THR A O     1 
ATOM   5547 C  CB    . THR A 1 746  ? 39.608  27.357  -7.359  1.00 36.44  ? 1160 THR A CB    1 
ATOM   5548 O  OG1   . THR A 1 746  ? 38.644  26.994  -8.350  1.00 38.11  ? 1160 THR A OG1   1 
ATOM   5549 C  CG2   . THR A 1 746  ? 40.392  26.184  -6.928  1.00 34.73  ? 1160 THR A CG2   1 
ATOM   5550 N  N     . ARG A 1 747  ? 38.515  26.175  -4.664  1.00 36.54  ? 1161 ARG A N     1 
ATOM   5551 C  CA    . ARG A 1 747  ? 38.778  25.364  -3.473  1.00 36.94  ? 1161 ARG A CA    1 
ATOM   5552 C  C     . ARG A 1 747  ? 40.196  24.768  -3.437  1.00 36.24  ? 1161 ARG A C     1 
ATOM   5553 O  O     . ARG A 1 747  ? 40.841  24.795  -2.393  1.00 36.10  ? 1161 ARG A O     1 
ATOM   5554 C  CB    . ARG A 1 747  ? 37.693  24.283  -3.275  1.00 37.05  ? 1161 ARG A CB    1 
ATOM   5555 C  CG    . ARG A 1 747  ? 36.716  24.645  -2.170  1.00 38.91  ? 1161 ARG A CG    1 
ATOM   5556 C  CD    . ARG A 1 747  ? 35.260  24.310  -2.509  1.00 40.95  ? 1161 ARG A CD    1 
ATOM   5557 N  NE    . ARG A 1 747  ? 34.336  25.017  -1.612  1.00 44.37  ? 1161 ARG A NE    1 
ATOM   5558 C  CZ    . ARG A 1 747  ? 33.558  24.417  -0.705  1.00 44.18  ? 1161 ARG A CZ    1 
ATOM   5559 N  NH1   . ARG A 1 747  ? 32.744  25.132  0.066   1.00 42.68  ? 1161 ARG A NH1   1 
ATOM   5560 N  NH2   . ARG A 1 747  ? 33.576  23.094  -0.590  1.00 43.02  ? 1161 ARG A NH2   1 
ATOM   5561 N  N     . PHE A 1 748  ? 40.655  24.246  -4.577  1.00 35.50  ? 1162 PHE A N     1 
ATOM   5562 C  CA    . PHE A 1 748  ? 41.986  23.661  -4.729  1.00 35.34  ? 1162 PHE A CA    1 
ATOM   5563 C  C     . PHE A 1 748  ? 43.068  24.733  -4.540  1.00 35.12  ? 1162 PHE A C     1 
ATOM   5564 O  O     . PHE A 1 748  ? 44.038  24.518  -3.814  1.00 34.30  ? 1162 PHE A O     1 
ATOM   5565 C  CB    . PHE A 1 748  ? 42.115  22.975  -6.107  1.00 35.27  ? 1162 PHE A CB    1 
ATOM   5566 C  CG    . PHE A 1 748  ? 43.505  22.435  -6.419  1.00 34.93  ? 1162 PHE A CG    1 
ATOM   5567 C  CD1   . PHE A 1 748  ? 44.117  21.511  -5.593  1.00 35.72  ? 1162 PHE A CD1   1 
ATOM   5568 C  CD2   . PHE A 1 748  ? 44.162  22.811  -7.573  1.00 35.17  ? 1162 PHE A CD2   1 
ATOM   5569 C  CE1   . PHE A 1 748  ? 45.378  21.005  -5.887  1.00 34.59  ? 1162 PHE A CE1   1 
ATOM   5570 C  CE2   . PHE A 1 748  ? 45.431  22.310  -7.874  1.00 34.68  ? 1162 PHE A CE2   1 
ATOM   5571 C  CZ    . PHE A 1 748  ? 46.035  21.412  -7.038  1.00 34.03  ? 1162 PHE A CZ    1 
ATOM   5572 N  N     . VAL A 1 749  ? 42.880  25.891  -5.165  1.00 34.46  ? 1163 VAL A N     1 
ATOM   5573 C  CA    . VAL A 1 749  ? 43.906  26.940  -5.115  1.00 34.17  ? 1163 VAL A CA    1 
ATOM   5574 C  C     . VAL A 1 749  ? 43.989  27.573  -3.724  1.00 34.92  ? 1163 VAL A C     1 
ATOM   5575 O  O     . VAL A 1 749  ? 45.085  27.769  -3.182  1.00 34.91  ? 1163 VAL A O     1 
ATOM   5576 C  CB    . VAL A 1 749  ? 43.708  28.027  -6.205  1.00 33.63  ? 1163 VAL A CB    1 
ATOM   5577 C  CG1   . VAL A 1 749  ? 44.838  29.051  -6.155  1.00 32.69  ? 1163 VAL A CG1   1 
ATOM   5578 C  CG2   . VAL A 1 749  ? 43.632  27.383  -7.608  1.00 31.59  ? 1163 VAL A CG2   1 
ATOM   5579 N  N     . ARG A 1 750  ? 42.839  27.866  -3.126  1.00 35.29  ? 1164 ARG A N     1 
ATOM   5580 C  CA    . ARG A 1 750  ? 42.828  28.275  -1.711  1.00 36.05  ? 1164 ARG A CA    1 
ATOM   5581 C  C     . ARG A 1 750  ? 43.675  27.353  -0.799  1.00 35.96  ? 1164 ARG A C     1 
ATOM   5582 O  O     . ARG A 1 750  ? 44.441  27.818  0.047   1.00 35.54  ? 1164 ARG A O     1 
ATOM   5583 C  CB    . ARG A 1 750  ? 41.391  28.333  -1.176  1.00 35.97  ? 1164 ARG A CB    1 
ATOM   5584 C  CG    . ARG A 1 750  ? 40.615  29.542  -1.618  1.00 36.88  ? 1164 ARG A CG    1 
ATOM   5585 C  CD    . ARG A 1 750  ? 39.286  29.566  -0.884  1.00 39.64  ? 1164 ARG A CD    1 
ATOM   5586 N  NE    . ARG A 1 750  ? 38.180  29.457  -1.815  1.00 40.64  ? 1164 ARG A NE    1 
ATOM   5587 C  CZ    . ARG A 1 750  ? 36.998  28.907  -1.555  1.00 39.34  ? 1164 ARG A CZ    1 
ATOM   5588 N  NH1   . ARG A 1 750  ? 36.742  28.358  -0.370  1.00 34.67  ? 1164 ARG A NH1   1 
ATOM   5589 N  NH2   . ARG A 1 750  ? 36.080  28.891  -2.521  1.00 36.58  ? 1164 ARG A NH2   1 
ATOM   5590 N  N     . GLN A 1 751  ? 43.509  26.045  -0.956  1.00 36.31  ? 1165 GLN A N     1 
ATOM   5591 C  CA    . GLN A 1 751  ? 44.301  25.096  -0.181  1.00 36.88  ? 1165 GLN A CA    1 
ATOM   5592 C  C     . GLN A 1 751  ? 45.811  25.221  -0.505  1.00 36.73  ? 1165 GLN A C     1 
ATOM   5593 O  O     . GLN A 1 751  ? 46.646  25.242  0.400   1.00 36.57  ? 1165 GLN A O     1 
ATOM   5594 C  CB    . GLN A 1 751  ? 43.762  23.673  -0.353  1.00 36.44  ? 1165 GLN A CB    1 
ATOM   5595 C  CG    . GLN A 1 751  ? 44.535  22.601  0.417   1.00 39.67  ? 1165 GLN A CG    1 
ATOM   5596 C  CD    . GLN A 1 751  ? 44.468  22.783  1.930   1.00 41.67  ? 1165 GLN A CD    1 
ATOM   5597 O  OE1   . GLN A 1 751  ? 43.447  23.211  2.473   1.00 44.24  ? 1165 GLN A OE1   1 
ATOM   5598 N  NE2   . GLN A 1 751  ? 45.559  22.456  2.616   1.00 42.83  ? 1165 GLN A NE2   1 
ATOM   5599 N  N     . MET A 1 752  ? 46.159  25.377  -1.780  1.00 36.34  ? 1166 MET A N     1 
ATOM   5600 C  CA    . MET A 1 752  ? 47.561  25.570  -2.134  1.00 36.30  ? 1166 MET A CA    1 
ATOM   5601 C  C     . MET A 1 752  ? 48.123  26.834  -1.487  1.00 36.04  ? 1166 MET A C     1 
ATOM   5602 O  O     . MET A 1 752  ? 49.291  26.884  -1.085  1.00 35.28  ? 1166 MET A O     1 
ATOM   5603 C  CB    . MET A 1 752  ? 47.730  25.656  -3.649  1.00 36.18  ? 1166 MET A CB    1 
ATOM   5604 C  CG    . MET A 1 752  ? 47.517  24.352  -4.364  1.00 36.73  ? 1166 MET A CG    1 
ATOM   5605 S  SD    . MET A 1 752  ? 47.842  24.576  -6.130  1.00 39.62  ? 1166 MET A SD    1 
ATOM   5606 C  CE    . MET A 1 752  ? 49.417  25.432  -6.066  1.00 30.17  ? 1166 MET A CE    1 
ATOM   5607 N  N     . LEU A 1 753  ? 47.284  27.864  -1.429  1.00 36.17  ? 1167 LEU A N     1 
ATOM   5608 C  CA    . LEU A 1 753  ? 47.654  29.132  -0.848  1.00 36.45  ? 1167 LEU A CA    1 
ATOM   5609 C  C     . LEU A 1 753  ? 47.839  28.957  0.660   1.00 37.54  ? 1167 LEU A C     1 
ATOM   5610 O  O     . LEU A 1 753  ? 48.733  29.536  1.255   1.00 37.37  ? 1167 LEU A O     1 
ATOM   5611 C  CB    . LEU A 1 753  ? 46.580  30.171  -1.153  1.00 36.33  ? 1167 LEU A CB    1 
ATOM   5612 C  CG    . LEU A 1 753  ? 46.668  31.245  -2.262  1.00 35.90  ? 1167 LEU A CG    1 
ATOM   5613 C  CD1   . LEU A 1 753  ? 47.623  30.964  -3.386  1.00 33.61  ? 1167 LEU A CD1   1 
ATOM   5614 C  CD2   . LEU A 1 753  ? 45.292  31.592  -2.820  1.00 32.09  ? 1167 LEU A CD2   1 
ATOM   5615 N  N     . GLU A 1 754  ? 47.014  28.124  1.269   1.00 38.81  ? 1168 GLU A N     1 
ATOM   5616 C  CA    . GLU A 1 754  ? 47.109  27.884  2.692   1.00 40.74  ? 1168 GLU A CA    1 
ATOM   5617 C  C     . GLU A 1 754  ? 48.489  27.311  2.980   1.00 41.02  ? 1168 GLU A C     1 
ATOM   5618 O  O     . GLU A 1 754  ? 49.146  27.659  3.967   1.00 40.75  ? 1168 GLU A O     1 
ATOM   5619 C  CB    . GLU A 1 754  ? 46.021  26.886  3.114   1.00 41.48  ? 1168 GLU A CB    1 
ATOM   5620 C  CG    . GLU A 1 754  ? 45.707  26.814  4.598   1.00 44.17  ? 1168 GLU A CG    1 
ATOM   5621 C  CD    . GLU A 1 754  ? 44.357  26.136  4.872   1.00 48.79  ? 1168 GLU A CD    1 
ATOM   5622 O  OE1   . GLU A 1 754  ? 43.301  26.700  4.489   1.00 49.82  ? 1168 GLU A OE1   1 
ATOM   5623 O  OE2   . GLU A 1 754  ? 44.358  25.039  5.473   1.00 50.02  ? 1168 GLU A OE2   1 
ATOM   5624 N  N     . GLU A 1 755  ? 48.959  26.449  2.096   1.00 41.49  ? 1169 GLU A N     1 
ATOM   5625 C  CA    . GLU A 1 755  ? 50.208  25.802  2.384   1.00 41.94  ? 1169 GLU A CA    1 
ATOM   5626 C  C     . GLU A 1 755  ? 51.444  26.414  1.728   1.00 41.99  ? 1169 GLU A C     1 
ATOM   5627 O  O     . GLU A 1 755  ? 52.570  26.023  2.046   1.00 42.72  ? 1169 GLU A O     1 
ATOM   5628 C  CB    . GLU A 1 755  ? 50.086  24.311  2.128   1.00 42.24  ? 1169 GLU A CB    1 
ATOM   5629 C  CG    . GLU A 1 755  ? 50.818  23.780  0.950   1.00 44.05  ? 1169 GLU A CG    1 
ATOM   5630 C  CD    . GLU A 1 755  ? 50.537  22.305  0.798   1.00 46.54  ? 1169 GLU A CD    1 
ATOM   5631 O  OE1   . GLU A 1 755  ? 49.311  21.972  0.739   1.00 43.62  ? 1169 GLU A OE1   1 
ATOM   5632 O  OE2   . GLU A 1 755  ? 51.530  21.507  0.776   1.00 47.03  ? 1169 GLU A OE2   1 
ATOM   5633 N  N     . THR A 1 756  ? 51.257  27.398  0.856   1.00 41.44  ? 1170 THR A N     1 
ATOM   5634 C  CA    . THR A 1 756  ? 52.400  28.072  0.261   1.00 41.02  ? 1170 THR A CA    1 
ATOM   5635 C  C     . THR A 1 756  ? 52.551  29.539  0.674   1.00 41.41  ? 1170 THR A C     1 
ATOM   5636 O  O     . THR A 1 756  ? 53.620  30.111  0.536   1.00 40.95  ? 1170 THR A O     1 
ATOM   5637 C  CB    . THR A 1 756  ? 52.350  28.012  -1.280  1.00 41.11  ? 1170 THR A CB    1 
ATOM   5638 O  OG1   . THR A 1 756  ? 51.075  28.491  -1.730  1.00 39.93  ? 1170 THR A OG1   1 
ATOM   5639 C  CG2   . THR A 1 756  ? 52.601  26.575  -1.789  1.00 39.43  ? 1170 THR A CG2   1 
ATOM   5640 N  N     . ARG A 1 757  ? 51.466  30.161  1.124   1.00 42.11  ? 1171 ARG A N     1 
ATOM   5641 C  CA    . ARG A 1 757  ? 51.504  31.538  1.625   1.00 42.37  ? 1171 ARG A CA    1 
ATOM   5642 C  C     . ARG A 1 757  ? 52.323  32.542  0.800   1.00 41.93  ? 1171 ARG A C     1 
ATOM   5643 O  O     . ARG A 1 757  ? 53.240  33.179  1.312   1.00 42.10  ? 1171 ARG A O     1 
ATOM   5644 C  CB    . ARG A 1 757  ? 52.001  31.550  3.072   1.00 42.61  ? 1171 ARG A CB    1 
ATOM   5645 C  CG    . ARG A 1 757  ? 51.326  30.535  3.945   1.00 45.42  ? 1171 ARG A CG    1 
ATOM   5646 C  CD    . ARG A 1 757  ? 51.242  31.016  5.402   1.00 51.51  ? 1171 ARG A CD    1 
ATOM   5647 N  NE    . ARG A 1 757  ? 50.255  30.224  6.140   1.00 57.09  ? 1171 ARG A NE    1 
ATOM   5648 C  CZ    . ARG A 1 757  ? 48.924  30.321  6.004   1.00 59.78  ? 1171 ARG A CZ    1 
ATOM   5649 N  NH1   . ARG A 1 757  ? 48.379  31.194  5.153   1.00 60.72  ? 1171 ARG A NH1   1 
ATOM   5650 N  NH2   . ARG A 1 757  ? 48.127  29.529  6.719   1.00 59.63  ? 1171 ARG A NH2   1 
ATOM   5651 N  N     . PRO A 1 758  ? 51.976  32.727  -0.475  1.00 41.77  ? 1172 PRO A N     1 
ATOM   5652 C  CA    . PRO A 1 758  ? 52.773  33.682  -1.255  1.00 41.51  ? 1172 PRO A CA    1 
ATOM   5653 C  C     . PRO A 1 758  ? 52.489  35.121  -0.834  1.00 41.72  ? 1172 PRO A C     1 
ATOM   5654 O  O     . PRO A 1 758  ? 51.392  35.431  -0.403  1.00 41.95  ? 1172 PRO A O     1 
ATOM   5655 C  CB    . PRO A 1 758  ? 52.308  33.433  -2.684  1.00 41.53  ? 1172 PRO A CB    1 
ATOM   5656 C  CG    . PRO A 1 758  ? 50.951  32.827  -2.548  1.00 40.78  ? 1172 PRO A CG    1 
ATOM   5657 C  CD    . PRO A 1 758  ? 50.897  32.102  -1.251  1.00 41.14  ? 1172 PRO A CD    1 
ATOM   5658 N  N     . LYS A 1 759  ? 53.477  35.993  -0.964  1.00 42.39  ? 1173 LYS A N     1 
ATOM   5659 C  CA    . LYS A 1 759  ? 53.367  37.379  -0.502  1.00 42.90  ? 1173 LYS A CA    1 
ATOM   5660 C  C     . LYS A 1 759  ? 53.788  38.344  -1.608  1.00 42.61  ? 1173 LYS A C     1 
ATOM   5661 O  O     . LYS A 1 759  ? 53.409  39.516  -1.616  1.00 43.55  ? 1173 LYS A O     1 
ATOM   5662 C  CB    . LYS A 1 759  ? 54.253  37.584  0.723   1.00 42.92  ? 1173 LYS A CB    1 
ATOM   5663 C  CG    . LYS A 1 759  ? 53.500  37.507  2.052   1.00 46.16  ? 1173 LYS A CG    1 
ATOM   5664 C  CD    . LYS A 1 759  ? 54.300  36.782  3.168   1.00 49.06  ? 1173 LYS A CD    1 
ATOM   5665 C  CE    . LYS A 1 759  ? 55.807  37.016  3.062   1.00 49.85  ? 1173 LYS A CE    1 
ATOM   5666 N  NZ    . LYS A 1 759  ? 56.566  35.794  3.446   1.00 49.88  ? 1173 LYS A NZ    1 
ATOM   5667 N  N     . THR A 1 760  ? 54.528  37.805  -2.561  1.00 41.70  ? 1174 THR A N     1 
ATOM   5668 C  CA    . THR A 1 760  ? 55.248  38.549  -3.577  1.00 41.47  ? 1174 THR A CA    1 
ATOM   5669 C  C     . THR A 1 760  ? 54.617  38.313  -4.943  1.00 40.71  ? 1174 THR A C     1 
ATOM   5670 O  O     . THR A 1 760  ? 54.021  37.266  -5.168  1.00 41.35  ? 1174 THR A O     1 
ATOM   5671 C  CB    . THR A 1 760  ? 56.676  37.974  -3.617  1.00 41.55  ? 1174 THR A CB    1 
ATOM   5672 O  OG1   . THR A 1 760  ? 57.532  38.775  -2.795  1.00 43.26  ? 1174 THR A OG1   1 
ATOM   5673 C  CG2   . THR A 1 760  ? 57.212  37.930  -5.003  1.00 42.18  ? 1174 THR A CG2   1 
ATOM   5674 N  N     . PHE A 1 761  ? 54.759  39.255  -5.869  1.00 39.36  ? 1175 PHE A N     1 
ATOM   5675 C  CA    . PHE A 1 761  ? 54.262  39.034  -7.218  1.00 38.25  ? 1175 PHE A CA    1 
ATOM   5676 C  C     . PHE A 1 761  ? 54.817  37.732  -7.808  1.00 38.12  ? 1175 PHE A C     1 
ATOM   5677 O  O     . PHE A 1 761  ? 54.057  36.835  -8.202  1.00 38.45  ? 1175 PHE A O     1 
ATOM   5678 C  CB    . PHE A 1 761  ? 54.588  40.214  -8.132  1.00 38.20  ? 1175 PHE A CB    1 
ATOM   5679 C  CG    . PHE A 1 761  ? 53.844  40.192  -9.454  1.00 37.69  ? 1175 PHE A CG    1 
ATOM   5680 C  CD1   . PHE A 1 761  ? 54.402  39.595  -10.574 1.00 36.33  ? 1175 PHE A CD1   1 
ATOM   5681 C  CD2   . PHE A 1 761  ? 52.595  40.783  -9.573  1.00 38.21  ? 1175 PHE A CD2   1 
ATOM   5682 C  CE1   . PHE A 1 761  ? 53.731  39.578  -11.784 1.00 36.93  ? 1175 PHE A CE1   1 
ATOM   5683 C  CE2   . PHE A 1 761  ? 51.901  40.764  -10.792 1.00 37.92  ? 1175 PHE A CE2   1 
ATOM   5684 C  CZ    . PHE A 1 761  ? 52.475  40.164  -11.898 1.00 37.32  ? 1175 PHE A CZ    1 
ATOM   5685 N  N     . SER A 1 762  ? 56.135  37.604  -7.867  1.00 37.16  ? 1176 SER A N     1 
ATOM   5686 C  CA    . SER A 1 762  ? 56.702  36.405  -8.464  1.00 36.65  ? 1176 SER A CA    1 
ATOM   5687 C  C     . SER A 1 762  ? 56.347  35.091  -7.714  1.00 36.19  ? 1176 SER A C     1 
ATOM   5688 O  O     . SER A 1 762  ? 56.215  34.052  -8.331  1.00 35.99  ? 1176 SER A O     1 
ATOM   5689 C  CB    . SER A 1 762  ? 58.212  36.557  -8.734  1.00 36.78  ? 1176 SER A CB    1 
ATOM   5690 O  OG    . SER A 1 762  ? 58.948  36.247  -7.591  1.00 36.39  ? 1176 SER A OG    1 
ATOM   5691 N  N     . GLU A 1 763  ? 56.147  35.141  -6.402  1.00 35.83  ? 1177 GLU A N     1 
ATOM   5692 C  CA    . GLU A 1 763  ? 55.598  33.989  -5.679  1.00 35.04  ? 1177 GLU A CA    1 
ATOM   5693 C  C     . GLU A 1 763  ? 54.187  33.604  -6.164  1.00 34.73  ? 1177 GLU A C     1 
ATOM   5694 O  O     . GLU A 1 763  ? 53.865  32.435  -6.290  1.00 34.68  ? 1177 GLU A O     1 
ATOM   5695 C  CB    . GLU A 1 763  ? 55.574  34.274  -4.180  1.00 34.40  ? 1177 GLU A CB    1 
ATOM   5696 C  CG    . GLU A 1 763  ? 56.873  33.874  -3.485  1.00 35.78  ? 1177 GLU A CG    1 
ATOM   5697 C  CD    . GLU A 1 763  ? 57.086  34.542  -2.129  1.00 34.71  ? 1177 GLU A CD    1 
ATOM   5698 O  OE1   . GLU A 1 763  ? 56.121  34.964  -1.458  1.00 34.63  ? 1177 GLU A OE1   1 
ATOM   5699 O  OE2   . GLU A 1 763  ? 58.250  34.654  -1.742  1.00 37.03  ? 1177 GLU A OE2   1 
ATOM   5700 N  N     . LEU A 1 764  ? 53.351  34.605  -6.406  1.00 34.19  ? 1178 LEU A N     1 
ATOM   5701 C  CA    . LEU A 1 764  ? 52.014  34.417  -6.932  1.00 33.68  ? 1178 LEU A CA    1 
ATOM   5702 C  C     . LEU A 1 764  ? 52.105  33.865  -8.357  1.00 33.45  ? 1178 LEU A C     1 
ATOM   5703 O  O     . LEU A 1 764  ? 51.398  32.932  -8.721  1.00 32.51  ? 1178 LEU A O     1 
ATOM   5704 C  CB    . LEU A 1 764  ? 51.304  35.770  -6.933  1.00 33.59  ? 1178 LEU A CB    1 
ATOM   5705 C  CG    . LEU A 1 764  ? 50.158  36.102  -5.970  1.00 34.91  ? 1178 LEU A CG    1 
ATOM   5706 C  CD1   . LEU A 1 764  ? 50.004  35.166  -4.762  1.00 33.87  ? 1178 LEU A CD1   1 
ATOM   5707 C  CD2   . LEU A 1 764  ? 50.255  37.553  -5.549  1.00 33.39  ? 1178 LEU A CD2   1 
ATOM   5708 N  N     . VAL A 1 765  ? 52.992  34.440  -9.158  1.00 33.54  ? 1179 VAL A N     1 
ATOM   5709 C  CA    . VAL A 1 765  ? 53.290  33.866  -10.475 1.00 34.55  ? 1179 VAL A CA    1 
ATOM   5710 C  C     . VAL A 1 765  ? 53.707  32.387  -10.390 1.00 35.37  ? 1179 VAL A C     1 
ATOM   5711 O  O     . VAL A 1 765  ? 53.260  31.556  -11.192 1.00 35.72  ? 1179 VAL A O     1 
ATOM   5712 C  CB    . VAL A 1 765  ? 54.377  34.700  -11.212 1.00 34.49  ? 1179 VAL A CB    1 
ATOM   5713 C  CG1   . VAL A 1 765  ? 54.880  33.974  -12.469 1.00 33.37  ? 1179 VAL A CG1   1 
ATOM   5714 C  CG2   . VAL A 1 765  ? 53.822  36.073  -11.546 1.00 32.27  ? 1179 VAL A CG2   1 
ATOM   5715 N  N     . GLN A 1 766  ? 54.539  32.042  -9.411  1.00 35.60  ? 1180 GLN A N     1 
ATOM   5716 C  CA    . GLN A 1 766  ? 54.963  30.649  -9.281  1.00 36.94  ? 1180 GLN A CA    1 
ATOM   5717 C  C     . GLN A 1 766  ? 53.719  29.784  -8.967  1.00 37.61  ? 1180 GLN A C     1 
ATOM   5718 O  O     . GLN A 1 766  ? 53.539  28.687  -9.505  1.00 37.34  ? 1180 GLN A O     1 
ATOM   5719 C  CB    . GLN A 1 766  ? 56.089  30.507  -8.222  1.00 37.27  ? 1180 GLN A CB    1 
ATOM   5720 C  CG    . GLN A 1 766  ? 56.458  29.087  -7.744  1.00 38.18  ? 1180 GLN A CG    1 
ATOM   5721 C  CD    . GLN A 1 766  ? 57.406  28.361  -8.686  1.00 43.51  ? 1180 GLN A CD    1 
ATOM   5722 O  OE1   . GLN A 1 766  ? 58.050  27.376  -8.300  1.00 45.42  ? 1180 GLN A OE1   1 
ATOM   5723 N  NE2   . GLN A 1 766  ? 57.498  28.840  -9.943  1.00 45.31  ? 1180 GLN A NE2   1 
ATOM   5724 N  N     . ILE A 1 767  ? 52.828  30.262  -8.118  1.00 37.74  ? 1181 ILE A N     1 
ATOM   5725 C  CA    . ILE A 1 767  ? 51.733  29.363  -7.825  1.00 38.37  ? 1181 ILE A CA    1 
ATOM   5726 C  C     . ILE A 1 767  ? 50.603  29.368  -8.878  1.00 38.57  ? 1181 ILE A C     1 
ATOM   5727 O  O     . ILE A 1 767  ? 49.929  28.362  -9.084  1.00 38.50  ? 1181 ILE A O     1 
ATOM   5728 C  CB    . ILE A 1 767  ? 51.238  29.416  -6.354  1.00 38.34  ? 1181 ILE A CB    1 
ATOM   5729 C  CG1   . ILE A 1 767  ? 50.105  30.352  -6.214  1.00 39.09  ? 1181 ILE A CG1   1 
ATOM   5730 C  CG2   . ILE A 1 767  ? 52.389  29.347  -5.274  1.00 37.64  ? 1181 ILE A CG2   1 
ATOM   5731 C  CD1   . ILE A 1 767  ? 48.901  29.512  -6.264  1.00 40.71  ? 1181 ILE A CD1   1 
ATOM   5732 N  N     . SER A 1 768  ? 50.428  30.478  -9.584  1.00 38.54  ? 1182 SER A N     1 
ATOM   5733 C  CA    . SER A 1 768  ? 49.581  30.471  -10.766 1.00 38.18  ? 1182 SER A CA    1 
ATOM   5734 C  C     . SER A 1 768  ? 49.976  29.311  -11.687 1.00 38.65  ? 1182 SER A C     1 
ATOM   5735 O  O     . SER A 1 768  ? 49.138  28.510  -12.139 1.00 38.95  ? 1182 SER A O     1 
ATOM   5736 C  CB    . SER A 1 768  ? 49.753  31.773  -11.521 1.00 37.78  ? 1182 SER A CB    1 
ATOM   5737 O  OG    . SER A 1 768  ? 49.086  31.718  -12.769 1.00 38.19  ? 1182 SER A OG    1 
ATOM   5738 N  N     . GLY A 1 769  ? 51.262  29.247  -11.991 1.00 38.08  ? 1183 GLY A N     1 
ATOM   5739 C  CA    . GLY A 1 769  ? 51.809  28.121  -12.741 1.00 37.95  ? 1183 GLY A CA    1 
ATOM   5740 C  C     . GLY A 1 769  ? 51.564  26.731  -12.158 1.00 36.82  ? 1183 GLY A C     1 
ATOM   5741 O  O     . GLY A 1 769  ? 51.166  25.826  -12.865 1.00 36.36  ? 1183 GLY A O     1 
ATOM   5742 N  N     . LEU A 1 770  ? 51.793  26.510  -10.879 1.00 36.77  ? 1184 LEU A N     1 
ATOM   5743 C  CA    . LEU A 1 770  ? 51.589  25.128  -10.446 1.00 36.66  ? 1184 LEU A CA    1 
ATOM   5744 C  C     . LEU A 1 770  ? 50.163  24.708  -10.095 1.00 35.84  ? 1184 LEU A C     1 
ATOM   5745 O  O     . LEU A 1 770  ? 49.920  23.534  -9.821  1.00 35.26  ? 1184 LEU A O     1 
ATOM   5746 C  CB    . LEU A 1 770  ? 52.655  24.653  -9.455  1.00 38.09  ? 1184 LEU A CB    1 
ATOM   5747 C  CG    . LEU A 1 770  ? 53.200  25.757  -8.604  1.00 39.56  ? 1184 LEU A CG    1 
ATOM   5748 C  CD1   . LEU A 1 770  ? 52.024  26.064  -7.718  1.00 41.61  ? 1184 LEU A CD1   1 
ATOM   5749 C  CD2   . LEU A 1 770  ? 54.423  25.385  -7.802  1.00 39.39  ? 1184 LEU A CD2   1 
ATOM   5750 N  N     . SER A 1 771  ? 49.219  25.656  -10.194 1.00 35.03  ? 1185 SER A N     1 
ATOM   5751 C  CA    . SER A 1 771  ? 47.815  25.422  -9.891  1.00 34.15  ? 1185 SER A CA    1 
ATOM   5752 C  C     . SER A 1 771  ? 46.999  25.135  -11.164 1.00 34.50  ? 1185 SER A C     1 
ATOM   5753 O  O     . SER A 1 771  ? 45.775  24.940  -11.086 1.00 33.27  ? 1185 SER A O     1 
ATOM   5754 C  CB    . SER A 1 771  ? 47.190  26.612  -9.127  1.00 34.31  ? 1185 SER A CB    1 
ATOM   5755 O  OG    . SER A 1 771  ? 47.220  27.844  -9.850  1.00 33.05  ? 1185 SER A OG    1 
ATOM   5756 N  N     . HIS A 1 772  ? 47.675  25.103  -12.316 1.00 34.06  ? 1186 HIS A N     1 
ATOM   5757 C  CA    . HIS A 1 772  ? 46.995  24.941  -13.599 1.00 34.44  ? 1186 HIS A CA    1 
ATOM   5758 C  C     . HIS A 1 772  ? 47.541  23.780  -14.440 1.00 34.47  ? 1186 HIS A C     1 
ATOM   5759 O  O     . HIS A 1 772  ? 48.529  23.918  -15.168 1.00 34.09  ? 1186 HIS A O     1 
ATOM   5760 C  CB    . HIS A 1 772  ? 47.036  26.255  -14.388 1.00 34.12  ? 1186 HIS A CB    1 
ATOM   5761 C  CG    . HIS A 1 772  ? 46.106  27.305  -13.856 1.00 34.75  ? 1186 HIS A CG    1 
ATOM   5762 N  ND1   . HIS A 1 772  ? 46.523  28.328  -13.029 1.00 34.50  ? 1186 HIS A ND1   1 
ATOM   5763 C  CD2   . HIS A 1 772  ? 44.774  27.488  -14.035 1.00 34.41  ? 1186 HIS A CD2   1 
ATOM   5764 C  CE1   . HIS A 1 772  ? 45.488  29.096  -12.726 1.00 33.56  ? 1186 HIS A CE1   1 
ATOM   5765 N  NE2   . HIS A 1 772  ? 44.415  28.606  -13.321 1.00 34.12  ? 1186 HIS A NE2   1 
ATOM   5766 N  N     . GLY A 1 773  ? 46.877  22.636  -14.359 1.00 34.49  ? 1187 GLY A N     1 
ATOM   5767 C  CA    . GLY A 1 773  ? 47.386  21.443  -15.020 1.00 33.90  ? 1187 GLY A CA    1 
ATOM   5768 C  C     . GLY A 1 773  ? 47.473  20.230  -14.112 1.00 34.10  ? 1187 GLY A C     1 
ATOM   5769 O  O     . GLY A 1 773  ? 47.872  20.309  -12.941 1.00 33.71  ? 1187 GLY A O     1 
ATOM   5770 N  N     . THR A 1 774  ? 47.121  19.089  -14.674 1.00 33.51  ? 1188 THR A N     1 
ATOM   5771 C  CA    . THR A 1 774  ? 47.122  17.852  -13.950 1.00 33.24  ? 1188 THR A CA    1 
ATOM   5772 C  C     . THR A 1 774  ? 48.531  17.299  -13.690 1.00 33.07  ? 1188 THR A C     1 
ATOM   5773 O  O     . THR A 1 774  ? 49.368  17.232  -14.605 1.00 32.05  ? 1188 THR A O     1 
ATOM   5774 C  CB    . THR A 1 774  ? 46.303  16.865  -14.749 1.00 33.47  ? 1188 THR A CB    1 
ATOM   5775 O  OG1   . THR A 1 774  ? 45.064  17.501  -15.054 1.00 33.75  ? 1188 THR A OG1   1 
ATOM   5776 C  CG2   . THR A 1 774  ? 46.060  15.562  -13.972 1.00 34.25  ? 1188 THR A CG2   1 
ATOM   5777 N  N     . ASP A 1 775  ? 48.766  16.873  -12.443 1.00 32.79  ? 1189 ASP A N     1 
ATOM   5778 C  CA    . ASP A 1 775  ? 50.023  16.227  -12.066 1.00 32.47  ? 1189 ASP A CA    1 
ATOM   5779 C  C     . ASP A 1 775  ? 51.169  17.244  -12.018 1.00 32.96  ? 1189 ASP A C     1 
ATOM   5780 O  O     . ASP A 1 775  ? 52.353  16.869  -12.139 1.00 33.09  ? 1189 ASP A O     1 
ATOM   5781 C  CB    . ASP A 1 775  ? 50.357  15.096  -13.051 1.00 31.90  ? 1189 ASP A CB    1 
ATOM   5782 C  CG    . ASP A 1 775  ? 49.401  13.894  -12.923 1.00 33.30  ? 1189 ASP A CG    1 
ATOM   5783 O  OD1   . ASP A 1 775  ? 48.921  13.373  -13.970 1.00 32.57  ? 1189 ASP A OD1   1 
ATOM   5784 O  OD2   . ASP A 1 775  ? 49.117  13.473  -11.771 1.00 33.09  ? 1189 ASP A OD2   1 
ATOM   5785 N  N     . VAL A 1 776  ? 50.824  18.529  -11.889 1.00 32.62  ? 1190 VAL A N     1 
ATOM   5786 C  CA    . VAL A 1 776  ? 51.827  19.576  -11.739 1.00 32.07  ? 1190 VAL A CA    1 
ATOM   5787 C  C     . VAL A 1 776  ? 52.148  19.715  -10.269 1.00 32.40  ? 1190 VAL A C     1 
ATOM   5788 O  O     . VAL A 1 776  ? 53.314  19.779  -9.910  1.00 33.68  ? 1190 VAL A O     1 
ATOM   5789 C  CB    . VAL A 1 776  ? 51.353  20.947  -12.302 1.00 32.53  ? 1190 VAL A CB    1 
ATOM   5790 C  CG1   . VAL A 1 776  ? 52.351  22.090  -11.955 1.00 31.06  ? 1190 VAL A CG1   1 
ATOM   5791 C  CG2   . VAL A 1 776  ? 51.111  20.882  -13.802 1.00 31.42  ? 1190 VAL A CG2   1 
ATOM   5792 N  N     . TRP A 1 777  ? 51.123  19.727  -9.413  1.00 32.07  ? 1191 TRP A N     1 
ATOM   5793 C  CA    . TRP A 1 777  ? 51.293  19.939  -7.967  1.00 31.41  ? 1191 TRP A CA    1 
ATOM   5794 C  C     . TRP A 1 777  ? 51.073  18.687  -7.148  1.00 31.80  ? 1191 TRP A C     1 
ATOM   5795 O  O     . TRP A 1 777  ? 52.008  18.147  -6.521  1.00 32.54  ? 1191 TRP A O     1 
ATOM   5796 C  CB    . TRP A 1 777  ? 50.306  20.991  -7.499  1.00 31.32  ? 1191 TRP A CB    1 
ATOM   5797 C  CG    . TRP A 1 777  ? 50.290  21.260  -6.036  1.00 32.54  ? 1191 TRP A CG    1 
ATOM   5798 C  CD1   . TRP A 1 777  ? 49.302  20.917  -5.134  1.00 32.78  ? 1191 TRP A CD1   1 
ATOM   5799 C  CD2   . TRP A 1 777  ? 51.273  21.981  -5.289  1.00 32.51  ? 1191 TRP A CD2   1 
ATOM   5800 N  NE1   . TRP A 1 777  ? 49.628  21.374  -3.880  1.00 32.35  ? 1191 TRP A NE1   1 
ATOM   5801 C  CE2   . TRP A 1 777  ? 50.829  22.036  -3.950  1.00 33.17  ? 1191 TRP A CE2   1 
ATOM   5802 C  CE3   . TRP A 1 777  ? 52.466  22.605  -5.624  1.00 34.08  ? 1191 TRP A CE3   1 
ATOM   5803 C  CZ2   . TRP A 1 777  ? 51.561  22.671  -2.947  1.00 33.60  ? 1191 TRP A CZ2   1 
ATOM   5804 C  CZ3   . TRP A 1 777  ? 53.182  23.251  -4.626  1.00 35.04  ? 1191 TRP A CZ3   1 
ATOM   5805 C  CH2   . TRP A 1 777  ? 52.734  23.265  -3.304  1.00 33.48  ? 1191 TRP A CH2   1 
ATOM   5806 N  N     . LEU A 1 778  ? 49.817  18.257  -7.110  1.00 31.69  ? 1192 LEU A N     1 
ATOM   5807 C  CA    . LEU A 1 778  ? 49.425  16.981  -6.508  1.00 31.90  ? 1192 LEU A CA    1 
ATOM   5808 C  C     . LEU A 1 778  ? 50.279  15.846  -7.059  1.00 31.82  ? 1192 LEU A C     1 
ATOM   5809 O  O     . LEU A 1 778  ? 50.280  15.627  -8.272  1.00 32.12  ? 1192 LEU A O     1 
ATOM   5810 C  CB    . LEU A 1 778  ? 47.977  16.659  -6.892  1.00 31.23  ? 1192 LEU A CB    1 
ATOM   5811 C  CG    . LEU A 1 778  ? 46.792  16.889  -5.984  1.00 31.30  ? 1192 LEU A CG    1 
ATOM   5812 C  CD1   . LEU A 1 778  ? 47.153  17.687  -4.708  1.00 29.55  ? 1192 LEU A CD1   1 
ATOM   5813 C  CD2   . LEU A 1 778  ? 45.754  17.617  -6.813  1.00 30.57  ? 1192 LEU A CD2   1 
ATOM   5814 N  N     . GLY A 1 779  ? 50.956  15.105  -6.185  1.00 31.20  ? 1193 GLY A N     1 
ATOM   5815 C  CA    . GLY A 1 779  ? 51.735  13.947  -6.622  1.00 30.84  ? 1193 GLY A CA    1 
ATOM   5816 C  C     . GLY A 1 779  ? 53.046  14.323  -7.303  1.00 31.23  ? 1193 GLY A C     1 
ATOM   5817 O  O     . GLY A 1 779  ? 53.771  13.449  -7.795  1.00 30.97  ? 1193 GLY A O     1 
ATOM   5818 N  N     . ASN A 1 780  ? 53.367  15.616  -7.339  1.00 30.66  ? 1194 ASN A N     1 
ATOM   5819 C  CA    . ASN A 1 780  ? 54.559  16.052  -8.051  1.00 31.22  ? 1194 ASN A CA    1 
ATOM   5820 C  C     . ASN A 1 780  ? 55.272  17.142  -7.237  1.00 31.36  ? 1194 ASN A C     1 
ATOM   5821 O  O     . ASN A 1 780  ? 55.874  16.836  -6.223  1.00 31.25  ? 1194 ASN A O     1 
ATOM   5822 C  CB    . ASN A 1 780  ? 54.214  16.503  -9.486  1.00 31.24  ? 1194 ASN A CB    1 
ATOM   5823 C  CG    . ASN A 1 780  ? 55.463  16.792  -10.357 1.00 32.19  ? 1194 ASN A CG    1 
ATOM   5824 O  OD1   . ASN A 1 780  ? 56.591  16.485  -9.975  1.00 34.84  ? 1194 ASN A OD1   1 
ATOM   5825 N  ND2   . ASN A 1 780  ? 55.249  17.382  -11.531 1.00 29.19  ? 1194 ASN A ND2   1 
ATOM   5826 N  N     . ALA A 1 781  ? 55.194  18.403  -7.664  1.00 31.53  ? 1195 ALA A N     1 
ATOM   5827 C  CA    . ALA A 1 781  ? 55.851  19.485  -6.932  1.00 31.30  ? 1195 ALA A CA    1 
ATOM   5828 C  C     . ALA A 1 781  ? 55.495  19.465  -5.442  1.00 31.93  ? 1195 ALA A C     1 
ATOM   5829 O  O     . ALA A 1 781  ? 56.330  19.803  -4.587  1.00 32.00  ? 1195 ALA A O     1 
ATOM   5830 C  CB    . ALA A 1 781  ? 55.525  20.842  -7.551  1.00 30.21  ? 1195 ALA A CB    1 
ATOM   5831 N  N     . GLN A 1 782  ? 54.272  19.061  -5.111  1.00 32.13  ? 1196 GLN A N     1 
ATOM   5832 C  CA    . GLN A 1 782  ? 53.904  19.096  -3.696  1.00 32.40  ? 1196 GLN A CA    1 
ATOM   5833 C  C     . GLN A 1 782  ? 54.757  18.100  -2.944  1.00 32.79  ? 1196 GLN A C     1 
ATOM   5834 O  O     . GLN A 1 782  ? 55.323  18.422  -1.884  1.00 33.08  ? 1196 GLN A O     1 
ATOM   5835 C  CB    . GLN A 1 782  ? 52.403  18.866  -3.433  1.00 31.72  ? 1196 GLN A CB    1 
ATOM   5836 C  CG    . GLN A 1 782  ? 52.027  18.983  -1.959  1.00 31.10  ? 1196 GLN A CG    1 
ATOM   5837 C  CD    . GLN A 1 782  ? 50.539  18.694  -1.655  1.00 31.35  ? 1196 GLN A CD    1 
ATOM   5838 O  OE1   . GLN A 1 782  ? 49.858  19.501  -1.015  1.00 29.52  ? 1196 GLN A OE1   1 
ATOM   5839 N  NE2   . GLN A 1 782  ? 50.048  17.543  -2.097  1.00 29.37  ? 1196 GLN A NE2   1 
ATOM   5840 N  N     . GLU A 1 783  ? 54.850  16.888  -3.481  1.00 33.20  ? 1197 GLU A N     1 
ATOM   5841 C  CA    . GLU A 1 783  ? 55.643  15.856  -2.827  1.00 33.60  ? 1197 GLU A CA    1 
ATOM   5842 C  C     . GLU A 1 783  ? 57.106  16.286  -2.753  1.00 32.26  ? 1197 GLU A C     1 
ATOM   5843 O  O     . GLU A 1 783  ? 57.762  16.093  -1.733  1.00 32.20  ? 1197 GLU A O     1 
ATOM   5844 C  CB    . GLU A 1 783  ? 55.526  14.523  -3.552  1.00 34.58  ? 1197 GLU A CB    1 
ATOM   5845 C  CG    . GLU A 1 783  ? 54.305  13.686  -3.185  1.00 40.73  ? 1197 GLU A CG    1 
ATOM   5846 C  CD    . GLU A 1 783  ? 54.152  12.433  -4.097  1.00 49.20  ? 1197 GLU A CD    1 
ATOM   5847 O  OE1   . GLU A 1 783  ? 53.073  11.768  -4.025  1.00 52.00  ? 1197 GLU A OE1   1 
ATOM   5848 O  OE2   . GLU A 1 783  ? 55.103  12.112  -4.884  1.00 50.04  ? 1197 GLU A OE2   1 
ATOM   5849 N  N     . LEU A 1 784  ? 57.613  16.880  -3.826  1.00 31.07  ? 1198 LEU A N     1 
ATOM   5850 C  CA    . LEU A 1 784  ? 59.010  17.318  -3.870  1.00 30.16  ? 1198 LEU A CA    1 
ATOM   5851 C  C     . LEU A 1 784  ? 59.367  18.309  -2.734  1.00 29.75  ? 1198 LEU A C     1 
ATOM   5852 O  O     . LEU A 1 784  ? 60.424  18.208  -2.128  1.00 28.73  ? 1198 LEU A O     1 
ATOM   5853 C  CB    . LEU A 1 784  ? 59.341  17.918  -5.237  1.00 30.41  ? 1198 LEU A CB    1 
ATOM   5854 C  CG    . LEU A 1 784  ? 59.303  16.992  -6.453  1.00 29.49  ? 1198 LEU A CG    1 
ATOM   5855 C  CD1   . LEU A 1 784  ? 59.443  17.800  -7.724  1.00 27.74  ? 1198 LEU A CD1   1 
ATOM   5856 C  CD2   . LEU A 1 784  ? 60.409  15.952  -6.361  1.00 29.82  ? 1198 LEU A CD2   1 
ATOM   5857 N  N     . ILE A 1 785  ? 58.478  19.256  -2.448  1.00 29.72  ? 1199 ILE A N     1 
ATOM   5858 C  CA    . ILE A 1 785  ? 58.690  20.202  -1.363  1.00 29.38  ? 1199 ILE A CA    1 
ATOM   5859 C  C     . ILE A 1 785  ? 58.507  19.540  0.007   1.00 30.31  ? 1199 ILE A C     1 
ATOM   5860 O  O     . ILE A 1 785  ? 59.310  19.719  0.920   1.00 30.27  ? 1199 ILE A O     1 
ATOM   5861 C  CB    . ILE A 1 785  ? 57.742  21.390  -1.509  1.00 29.29  ? 1199 ILE A CB    1 
ATOM   5862 C  CG1   . ILE A 1 785  ? 57.978  22.049  -2.867  1.00 28.72  ? 1199 ILE A CG1   1 
ATOM   5863 C  CG2   . ILE A 1 785  ? 57.934  22.376  -0.364  1.00 27.95  ? 1199 ILE A CG2   1 
ATOM   5864 C  CD1   . ILE A 1 785  ? 56.862  22.970  -3.313  1.00 27.83  ? 1199 ILE A CD1   1 
ATOM   5865 N  N     . GLN A 1 786  ? 57.461  18.741  0.158   1.00 31.23  ? 1200 GLN A N     1 
ATOM   5866 C  CA    . GLN A 1 786  ? 57.231  18.109  1.453   1.00 31.71  ? 1200 GLN A CA    1 
ATOM   5867 C  C     . GLN A 1 786  ? 58.333  17.106  1.829   1.00 32.34  ? 1200 GLN A C     1 
ATOM   5868 O  O     . GLN A 1 786  ? 58.615  16.943  3.017   1.00 31.94  ? 1200 GLN A O     1 
ATOM   5869 C  CB    . GLN A 1 786  ? 55.849  17.470  1.475   1.00 31.94  ? 1200 GLN A CB    1 
ATOM   5870 C  CG    . GLN A 1 786  ? 54.721  18.473  1.530   1.00 31.43  ? 1200 GLN A CG    1 
ATOM   5871 C  CD    . GLN A 1 786  ? 53.382  17.821  1.851   1.00 32.86  ? 1200 GLN A CD    1 
ATOM   5872 O  OE1   . GLN A 1 786  ? 52.323  18.419  1.677   1.00 36.83  ? 1200 GLN A OE1   1 
ATOM   5873 N  NE2   . GLN A 1 786  ? 53.425  16.595  2.298   1.00 35.06  ? 1200 GLN A NE2   1 
ATOM   5874 N  N     . ASN A 1 787  ? 58.954  16.483  0.809   1.00 33.12  ? 1201 ASN A N     1 
ATOM   5875 C  CA    . ASN A 1 787  ? 60.122  15.565  0.897   1.00 34.81  ? 1201 ASN A CA    1 
ATOM   5876 C  C     . ASN A 1 787  ? 61.420  16.247  1.265   1.00 35.12  ? 1201 ASN A C     1 
ATOM   5877 O  O     . ASN A 1 787  ? 62.371  15.600  1.651   1.00 35.01  ? 1201 ASN A O     1 
ATOM   5878 C  CB    . ASN A 1 787  ? 60.481  15.040  -0.505  1.00 36.05  ? 1201 ASN A CB    1 
ATOM   5879 C  CG    . ASN A 1 787  ? 59.603  13.910  -0.969  1.00 39.75  ? 1201 ASN A CG    1 
ATOM   5880 O  OD1   . ASN A 1 787  ? 58.753  13.398  -0.216  1.00 43.78  ? 1201 ASN A OD1   1 
ATOM   5881 N  ND2   . ASN A 1 787  ? 59.777  13.519  -2.235  1.00 41.63  ? 1201 ASN A ND2   1 
ATOM   5882 N  N     . GLY A 1 788  ? 61.518  17.544  1.007   1.00 35.82  ? 1202 GLY A N     1 
ATOM   5883 C  CA    . GLY A 1 788  ? 62.797  18.224  1.146   1.00 36.10  ? 1202 GLY A CA    1 
ATOM   5884 C  C     . GLY A 1 788  ? 63.664  18.017  -0.079  1.00 36.54  ? 1202 GLY A C     1 
ATOM   5885 O  O     . GLY A 1 788  ? 64.846  18.352  -0.090  1.00 36.69  ? 1202 GLY A O     1 
ATOM   5886 N  N     . THR A 1 789  ? 63.094  17.471  -1.140  1.00 36.90  ? 1203 THR A N     1 
ATOM   5887 C  CA    . THR A 1 789  ? 63.950  17.176  -2.270  1.00 37.13  ? 1203 THR A CA    1 
ATOM   5888 C  C     . THR A 1 789  ? 64.322  18.475  -3.022  1.00 37.02  ? 1203 THR A C     1 
ATOM   5889 O  O     . THR A 1 789  ? 65.445  18.622  -3.486  1.00 37.36  ? 1203 THR A O     1 
ATOM   5890 C  CB    . THR A 1 789  ? 63.509  15.859  -3.029  1.00 37.24  ? 1203 THR A CB    1 
ATOM   5891 O  OG1   . THR A 1 789  ? 63.639  15.977  -4.456  1.00 37.62  ? 1203 THR A OG1   1 
ATOM   5892 C  CG2   . THR A 1 789  ? 62.087  15.423  -2.589  1.00 37.89  ? 1203 THR A CG2   1 
ATOM   5893 N  N     . CYS A 1 790  ? 63.422  19.449  -3.048  1.00 36.92  ? 1204 CYS A N     1 
ATOM   5894 C  CA    . CYS A 1 790  ? 63.823  20.806  -3.395  1.00 36.69  ? 1204 CYS A CA    1 
ATOM   5895 C  C     . CYS A 1 790  ? 62.940  21.810  -2.706  1.00 36.80  ? 1204 CYS A C     1 
ATOM   5896 O  O     . CYS A 1 790  ? 62.079  21.434  -1.919  1.00 37.44  ? 1204 CYS A O     1 
ATOM   5897 C  CB    . CYS A 1 790  ? 63.828  21.040  -4.911  1.00 37.29  ? 1204 CYS A CB    1 
ATOM   5898 S  SG    . CYS A 1 790  ? 62.273  20.750  -5.741  1.00 35.04  ? 1204 CYS A SG    1 
ATOM   5899 N  N     . THR A 1 791  ? 63.161  23.087  -3.000  1.00 36.71  ? 1205 THR A N     1 
ATOM   5900 C  CA    . THR A 1 791  ? 62.407  24.175  -2.374  1.00 36.40  ? 1205 THR A CA    1 
ATOM   5901 C  C     . THR A 1 791  ? 61.249  24.627  -3.258  1.00 36.15  ? 1205 THR A C     1 
ATOM   5902 O  O     . THR A 1 791  ? 61.159  24.262  -4.425  1.00 35.80  ? 1205 THR A O     1 
ATOM   5903 C  CB    . THR A 1 791  ? 63.289  25.423  -2.065  1.00 36.38  ? 1205 THR A CB    1 
ATOM   5904 O  OG1   . THR A 1 791  ? 63.607  26.103  -3.291  1.00 38.05  ? 1205 THR A OG1   1 
ATOM   5905 C  CG2   . THR A 1 791  ? 64.576  25.039  -1.338  1.00 36.25  ? 1205 THR A CG2   1 
ATOM   5906 N  N     . LEU A 1 792  ? 60.364  25.429  -2.680  1.00 35.92  ? 1206 LEU A N     1 
ATOM   5907 C  CA    . LEU A 1 792  ? 59.204  25.898  -3.389  1.00 35.90  ? 1206 LEU A CA    1 
ATOM   5908 C  C     . LEU A 1 792  ? 59.628  26.653  -4.650  1.00 36.25  ? 1206 LEU A C     1 
ATOM   5909 O  O     . LEU A 1 792  ? 59.022  26.512  -5.711  1.00 35.57  ? 1206 LEU A O     1 
ATOM   5910 C  CB    . LEU A 1 792  ? 58.368  26.783  -2.479  1.00 35.41  ? 1206 LEU A CB    1 
ATOM   5911 C  CG    . LEU A 1 792  ? 57.178  27.490  -3.120  1.00 35.68  ? 1206 LEU A CG    1 
ATOM   5912 C  CD1   . LEU A 1 792  ? 56.246  26.524  -3.932  1.00 31.67  ? 1206 LEU A CD1   1 
ATOM   5913 C  CD2   . LEU A 1 792  ? 56.405  28.219  -2.001  1.00 34.92  ? 1206 LEU A CD2   1 
ATOM   5914 N  N     . SER A 1 793  ? 60.683  27.448  -4.548  1.00 36.32  ? 1207 SER A N     1 
ATOM   5915 C  CA    . SER A 1 793  ? 61.086  28.229  -5.713  1.00 37.12  ? 1207 SER A CA    1 
ATOM   5916 C  C     . SER A 1 793  ? 61.741  27.373  -6.840  1.00 36.84  ? 1207 SER A C     1 
ATOM   5917 O  O     . SER A 1 793  ? 61.696  27.760  -7.994  1.00 37.26  ? 1207 SER A O     1 
ATOM   5918 C  CB    . SER A 1 793  ? 61.948  29.438  -5.294  1.00 37.04  ? 1207 SER A CB    1 
ATOM   5919 O  OG    . SER A 1 793  ? 63.154  29.040  -4.654  1.00 38.39  ? 1207 SER A OG    1 
ATOM   5920 N  N     . GLU A 1 794  ? 62.282  26.202  -6.496  1.00 36.76  ? 1208 GLU A N     1 
ATOM   5921 C  CA    . GLU A 1 794  ? 63.005  25.305  -7.415  1.00 36.87  ? 1208 GLU A CA    1 
ATOM   5922 C  C     . GLU A 1 794  ? 62.136  24.253  -8.131  1.00 36.29  ? 1208 GLU A C     1 
ATOM   5923 O  O     . GLU A 1 794  ? 62.590  23.479  -8.990  1.00 36.80  ? 1208 GLU A O     1 
ATOM   5924 C  CB    . GLU A 1 794  ? 64.088  24.573  -6.626  1.00 36.73  ? 1208 GLU A CB    1 
ATOM   5925 C  CG    . GLU A 1 794  ? 65.122  25.500  -6.043  1.00 39.81  ? 1208 GLU A CG    1 
ATOM   5926 C  CD    . GLU A 1 794  ? 66.130  24.799  -5.136  1.00 44.37  ? 1208 GLU A CD    1 
ATOM   5927 O  OE1   . GLU A 1 794  ? 67.138  25.450  -4.784  1.00 45.90  ? 1208 GLU A OE1   1 
ATOM   5928 O  OE2   . GLU A 1 794  ? 65.933  23.608  -4.785  1.00 45.94  ? 1208 GLU A OE2   1 
ATOM   5929 N  N     . VAL A 1 795  ? 60.890  24.189  -7.732  1.00 35.23  ? 1209 VAL A N     1 
ATOM   5930 C  CA    . VAL A 1 795  ? 59.942  23.258  -8.286  1.00 34.24  ? 1209 VAL A CA    1 
ATOM   5931 C  C     . VAL A 1 795  ? 59.598  23.772  -9.688  1.00 34.21  ? 1209 VAL A C     1 
ATOM   5932 O  O     . VAL A 1 795  ? 59.781  24.956  -9.961  1.00 34.07  ? 1209 VAL A O     1 
ATOM   5933 C  CB    . VAL A 1 795  ? 58.763  23.235  -7.294  1.00 34.45  ? 1209 VAL A CB    1 
ATOM   5934 C  CG1   . VAL A 1 795  ? 57.501  23.925  -7.812  1.00 34.04  ? 1209 VAL A CG1   1 
ATOM   5935 C  CG2   . VAL A 1 795  ? 58.588  21.896  -6.661  1.00 33.63  ? 1209 VAL A CG2   1 
ATOM   5936 N  N     . ILE A 1 796  ? 59.158  22.906  -10.598 1.00 34.02  ? 1210 ILE A N     1 
ATOM   5937 C  CA    . ILE A 1 796  ? 58.868  23.372  -11.957 1.00 33.72  ? 1210 ILE A CA    1 
ATOM   5938 C  C     . ILE A 1 796  ? 57.506  24.044  -12.039 1.00 34.26  ? 1210 ILE A C     1 
ATOM   5939 O  O     . ILE A 1 796  ? 56.484  23.342  -12.014 1.00 34.42  ? 1210 ILE A O     1 
ATOM   5940 C  CB    . ILE A 1 796  ? 58.838  22.233  -12.952 1.00 33.51  ? 1210 ILE A CB    1 
ATOM   5941 C  CG1   . ILE A 1 796  ? 60.239  21.656  -13.148 1.00 31.08  ? 1210 ILE A CG1   1 
ATOM   5942 C  CG2   . ILE A 1 796  ? 58.297  22.716  -14.289 1.00 33.25  ? 1210 ILE A CG2   1 
ATOM   5943 C  CD1   . ILE A 1 796  ? 60.197  20.344  -13.803 1.00 25.57  ? 1210 ILE A CD1   1 
ATOM   5944 N  N     . GLY A 1 797  ? 57.500  25.377  -12.174 1.00 33.79  ? 1211 GLY A N     1 
ATOM   5945 C  CA    . GLY A 1 797  ? 56.259  26.169  -12.130 1.00 34.24  ? 1211 GLY A CA    1 
ATOM   5946 C  C     . GLY A 1 797  ? 55.892  27.028  -13.354 1.00 34.37  ? 1211 GLY A C     1 
ATOM   5947 O  O     . GLY A 1 797  ? 54.892  27.769  -13.327 1.00 34.36  ? 1211 GLY A O     1 
ATOM   5948 N  N     . CYS A 1 798  ? 56.712  26.967  -14.396 1.00 33.52  ? 1212 CYS A N     1 
ATOM   5949 C  CA    . CYS A 1 798  ? 56.317  27.417  -15.715 1.00 34.05  ? 1212 CYS A CA    1 
ATOM   5950 C  C     . CYS A 1 798  ? 57.205  26.670  -16.701 1.00 33.80  ? 1212 CYS A C     1 
ATOM   5951 O  O     . CYS A 1 798  ? 58.299  26.257  -16.339 1.00 33.03  ? 1212 CYS A O     1 
ATOM   5952 C  CB    . CYS A 1 798  ? 56.487  28.929  -15.876 1.00 34.25  ? 1212 CYS A CB    1 
ATOM   5953 S  SG    . CYS A 1 798  ? 58.186  29.562  -15.685 1.00 36.70  ? 1212 CYS A SG    1 
ATOM   5954 N  N     . ARG A 1 799  ? 56.723  26.497  -17.932 1.00 33.54  ? 1213 ARG A N     1 
ATOM   5955 C  CA    . ARG A 1 799  ? 57.467  25.823  -18.979 1.00 32.81  ? 1213 ARG A CA    1 
ATOM   5956 C  C     . ARG A 1 799  ? 58.806  26.502  -19.249 1.00 32.84  ? 1213 ARG A C     1 
ATOM   5957 O  O     . ARG A 1 799  ? 59.776  25.818  -19.607 1.00 32.90  ? 1213 ARG A O     1 
ATOM   5958 C  CB    . ARG A 1 799  ? 56.632  25.747  -20.261 1.00 32.56  ? 1213 ARG A CB    1 
ATOM   5959 C  CG    . ARG A 1 799  ? 56.510  27.068  -20.983 1.00 32.39  ? 1213 ARG A CG    1 
ATOM   5960 C  CD    . ARG A 1 799  ? 55.716  26.947  -22.279 1.00 32.80  ? 1213 ARG A CD    1 
ATOM   5961 N  NE    . ARG A 1 799  ? 54.300  26.659  -22.048 1.00 32.78  ? 1213 ARG A NE    1 
ATOM   5962 C  CZ    . ARG A 1 799  ? 53.305  26.955  -22.883 1.00 33.43  ? 1213 ARG A CZ    1 
ATOM   5963 N  NH1   . ARG A 1 799  ? 52.061  26.638  -22.546 1.00 35.70  ? 1213 ARG A NH1   1 
ATOM   5964 N  NH2   . ARG A 1 799  ? 53.527  27.567  -24.038 1.00 29.24  ? 1213 ARG A NH2   1 
ATOM   5965 N  N     . ASP A 1 800  ? 58.886  27.823  -19.044 1.00 32.65  ? 1214 ASP A N     1 
ATOM   5966 C  CA    . ASP A 1 800  ? 60.122  28.560  -19.381 1.00 33.23  ? 1214 ASP A CA    1 
ATOM   5967 C  C     . ASP A 1 800  ? 61.284  28.068  -18.501 1.00 34.14  ? 1214 ASP A C     1 
ATOM   5968 O  O     . ASP A 1 800  ? 62.385  27.789  -18.988 1.00 34.25  ? 1214 ASP A O     1 
ATOM   5969 C  CB    . ASP A 1 800  ? 59.988  30.088  -19.291 1.00 32.81  ? 1214 ASP A CB    1 
ATOM   5970 C  CG    . ASP A 1 800  ? 58.639  30.627  -19.827 1.00 33.76  ? 1214 ASP A CG    1 
ATOM   5971 O  OD1   . ASP A 1 800  ? 58.663  31.537  -20.703 1.00 28.05  ? 1214 ASP A OD1   1 
ATOM   5972 O  OD2   . ASP A 1 800  ? 57.565  30.158  -19.354 1.00 32.70  ? 1214 ASP A OD2   1 
ATOM   5973 N  N     . ASP A 1 801  ? 61.025  27.919  -17.209 1.00 34.51  ? 1215 ASP A N     1 
ATOM   5974 C  CA    . ASP A 1 801  ? 62.060  27.466  -16.321 1.00 35.11  ? 1215 ASP A CA    1 
ATOM   5975 C  C     . ASP A 1 801  ? 62.685  26.155  -16.772 1.00 34.82  ? 1215 ASP A C     1 
ATOM   5976 O  O     . ASP A 1 801  ? 63.864  25.935  -16.554 1.00 34.94  ? 1215 ASP A O     1 
ATOM   5977 C  CB    . ASP A 1 801  ? 61.528  27.364  -14.891 1.00 36.26  ? 1215 ASP A CB    1 
ATOM   5978 C  CG    . ASP A 1 801  ? 61.261  28.741  -14.276 1.00 38.75  ? 1215 ASP A CG    1 
ATOM   5979 O  OD1   . ASP A 1 801  ? 61.751  29.740  -14.848 1.00 42.27  ? 1215 ASP A OD1   1 
ATOM   5980 O  OD2   . ASP A 1 801  ? 60.572  28.829  -13.232 1.00 42.39  ? 1215 ASP A OD2   1 
ATOM   5981 N  N     . ILE A 1 802  ? 61.921  25.272  -17.404 1.00 34.91  ? 1216 ILE A N     1 
ATOM   5982 C  CA    . ILE A 1 802  ? 62.522  23.998  -17.852 1.00 33.75  ? 1216 ILE A CA    1 
ATOM   5983 C  C     . ILE A 1 802  ? 63.602  24.298  -18.882 1.00 33.41  ? 1216 ILE A C     1 
ATOM   5984 O  O     . ILE A 1 802  ? 64.689  23.739  -18.857 1.00 33.95  ? 1216 ILE A O     1 
ATOM   5985 C  CB    . ILE A 1 802  ? 61.499  23.064  -18.555 1.00 33.91  ? 1216 ILE A CB    1 
ATOM   5986 C  CG1   . ILE A 1 802  ? 60.346  22.690  -17.633 1.00 32.57  ? 1216 ILE A CG1   1 
ATOM   5987 C  CG2   . ILE A 1 802  ? 62.191  21.792  -19.094 1.00 32.82  ? 1216 ILE A CG2   1 
ATOM   5988 C  CD1   . ILE A 1 802  ? 59.321  21.795  -18.344 1.00 31.62  ? 1216 ILE A CD1   1 
ATOM   5989 N  N     . MET A 1 803  ? 63.276  25.160  -19.826 1.00 32.90  ? 1217 MET A N     1 
ATOM   5990 C  CA    . MET A 1 803  ? 64.190  25.464  -20.893 1.00 32.38  ? 1217 MET A CA    1 
ATOM   5991 C  C     . MET A 1 803  ? 65.392  26.154  -20.284 1.00 32.36  ? 1217 MET A C     1 
ATOM   5992 O  O     . MET A 1 803  ? 66.520  25.760  -20.529 1.00 32.62  ? 1217 MET A O     1 
ATOM   5993 C  CB    . MET A 1 803  ? 63.520  26.399  -21.899 1.00 32.17  ? 1217 MET A CB    1 
ATOM   5994 C  CG    . MET A 1 803  ? 64.429  26.857  -23.027 1.00 31.19  ? 1217 MET A CG    1 
ATOM   5995 S  SD    . MET A 1 803  ? 63.607  27.980  -24.180 1.00 31.42  ? 1217 MET A SD    1 
ATOM   5996 C  CE    . MET A 1 803  ? 64.371  27.370  -25.669 1.00 36.81  ? 1217 MET A CE    1 
ATOM   5997 N  N     . VAL A 1 804  ? 65.141  27.184  -19.481 1.00 32.31  ? 1218 VAL A N     1 
ATOM   5998 C  CA    . VAL A 1 804  ? 66.211  28.036  -18.983 1.00 32.64  ? 1218 VAL A CA    1 
ATOM   5999 C  C     . VAL A 1 804  ? 67.191  27.215  -18.153 1.00 33.26  ? 1218 VAL A C     1 
ATOM   6000 O  O     . VAL A 1 804  ? 68.383  27.509  -18.141 1.00 33.69  ? 1218 VAL A O     1 
ATOM   6001 C  CB    . VAL A 1 804  ? 65.655  29.218  -18.125 1.00 32.91  ? 1218 VAL A CB    1 
ATOM   6002 C  CG1   . VAL A 1 804  ? 66.800  30.017  -17.471 1.00 32.30  ? 1218 VAL A CG1   1 
ATOM   6003 C  CG2   . VAL A 1 804  ? 64.788  30.129  -18.958 1.00 32.15  ? 1218 VAL A CG2   1 
ATOM   6004 N  N     . TYR A 1 805  ? 66.672  26.207  -17.451 1.00 33.02  ? 1219 TYR A N     1 
ATOM   6005 C  CA    . TYR A 1 805  ? 67.462  25.385  -16.564 1.00 33.93  ? 1219 TYR A CA    1 
ATOM   6006 C  C     . TYR A 1 805  ? 68.286  24.387  -17.356 1.00 33.88  ? 1219 TYR A C     1 
ATOM   6007 O  O     . TYR A 1 805  ? 69.417  24.081  -17.007 1.00 33.23  ? 1219 TYR A O     1 
ATOM   6008 C  CB    . TYR A 1 805  ? 66.552  24.618  -15.617 1.00 34.14  ? 1219 TYR A CB    1 
ATOM   6009 C  CG    . TYR A 1 805  ? 67.242  23.512  -14.846 1.00 35.90  ? 1219 TYR A CG    1 
ATOM   6010 C  CD1   . TYR A 1 805  ? 68.244  23.794  -13.904 1.00 36.76  ? 1219 TYR A CD1   1 
ATOM   6011 C  CD2   . TYR A 1 805  ? 66.867  22.188  -15.022 1.00 37.08  ? 1219 TYR A CD2   1 
ATOM   6012 C  CE1   . TYR A 1 805  ? 68.857  22.767  -13.164 1.00 35.78  ? 1219 TYR A CE1   1 
ATOM   6013 C  CE2   . TYR A 1 805  ? 67.474  21.166  -14.310 1.00 37.27  ? 1219 TYR A CE2   1 
ATOM   6014 C  CZ    . TYR A 1 805  ? 68.461  21.454  -13.380 1.00 37.84  ? 1219 TYR A CZ    1 
ATOM   6015 O  OH    . TYR A 1 805  ? 69.042  20.406  -12.683 1.00 39.31  ? 1219 TYR A OH    1 
ATOM   6016 N  N     . LEU A 1 806  ? 67.710  23.881  -18.436 1.00 34.40  ? 1220 LEU A N     1 
ATOM   6017 C  CA    . LEU A 1 806  ? 68.410  22.897  -19.221 1.00 34.36  ? 1220 LEU A CA    1 
ATOM   6018 C  C     . LEU A 1 806  ? 69.588  23.548  -19.959 1.00 35.16  ? 1220 LEU A C     1 
ATOM   6019 O  O     . LEU A 1 806  ? 70.666  22.942  -20.103 1.00 35.09  ? 1220 LEU A O     1 
ATOM   6020 C  CB    . LEU A 1 806  ? 67.443  22.129  -20.115 1.00 33.92  ? 1220 LEU A CB    1 
ATOM   6021 C  CG    . LEU A 1 806  ? 66.556  21.150  -19.317 1.00 32.86  ? 1220 LEU A CG    1 
ATOM   6022 C  CD1   . LEU A 1 806  ? 65.607  20.380  -20.245 1.00 30.00  ? 1220 LEU A CD1   1 
ATOM   6023 C  CD2   . LEU A 1 806  ? 67.389  20.169  -18.484 1.00 31.52  ? 1220 LEU A CD2   1 
ATOM   6024 N  N     . ILE A 1 807  ? 69.410  24.802  -20.360 1.00 35.35  ? 1221 ILE A N     1 
ATOM   6025 C  CA    . ILE A 1 807  ? 70.506  25.554  -20.953 1.00 35.83  ? 1221 ILE A CA    1 
ATOM   6026 C  C     . ILE A 1 807  ? 71.625  25.785  -19.925 1.00 36.40  ? 1221 ILE A C     1 
ATOM   6027 O  O     . ILE A 1 807  ? 72.801  25.492  -20.168 1.00 36.06  ? 1221 ILE A O     1 
ATOM   6028 C  CB    . ILE A 1 807  ? 70.002  26.888  -21.537 1.00 35.93  ? 1221 ILE A CB    1 
ATOM   6029 C  CG1   . ILE A 1 807  ? 69.060  26.617  -22.720 1.00 35.01  ? 1221 ILE A CG1   1 
ATOM   6030 C  CG2   . ILE A 1 807  ? 71.174  27.779  -21.953 1.00 35.72  ? 1221 ILE A CG2   1 
ATOM   6031 C  CD1   . ILE A 1 807  ? 68.348  27.820  -23.215 1.00 32.05  ? 1221 ILE A CD1   1 
ATOM   6032 N  N     . TYR A 1 808  ? 71.247  26.293  -18.762 1.00 37.30  ? 1222 TYR A N     1 
ATOM   6033 C  CA    . TYR A 1 808  ? 72.169  26.402  -17.640 1.00 37.88  ? 1222 TYR A CA    1 
ATOM   6034 C  C     . TYR A 1 808  ? 72.942  25.106  -17.449 1.00 37.72  ? 1222 TYR A C     1 
ATOM   6035 O  O     . TYR A 1 808  ? 74.164  25.106  -17.365 1.00 38.30  ? 1222 TYR A O     1 
ATOM   6036 C  CB    . TYR A 1 808  ? 71.405  26.724  -16.357 1.00 38.22  ? 1222 TYR A CB    1 
ATOM   6037 C  CG    . TYR A 1 808  ? 72.313  26.803  -15.152 1.00 41.51  ? 1222 TYR A CG    1 
ATOM   6038 C  CD1   . TYR A 1 808  ? 73.215  27.859  -15.002 1.00 43.73  ? 1222 TYR A CD1   1 
ATOM   6039 C  CD2   . TYR A 1 808  ? 72.292  25.815  -14.174 1.00 44.18  ? 1222 TYR A CD2   1 
ATOM   6040 C  CE1   . TYR A 1 808  ? 74.055  27.938  -13.909 1.00 44.94  ? 1222 TYR A CE1   1 
ATOM   6041 C  CE2   . TYR A 1 808  ? 73.135  25.884  -13.066 1.00 46.13  ? 1222 TYR A CE2   1 
ATOM   6042 C  CZ    . TYR A 1 808  ? 74.011  26.948  -12.942 1.00 46.56  ? 1222 TYR A CZ    1 
ATOM   6043 O  OH    . TYR A 1 808  ? 74.841  27.016  -11.843 1.00 48.94  ? 1222 TYR A OH    1 
ATOM   6044 N  N     . ARG A 1 809  ? 72.223  23.998  -17.359 1.00 37.96  ? 1223 ARG A N     1 
ATOM   6045 C  CA    . ARG A 1 809  ? 72.848  22.697  -17.179 1.00 38.18  ? 1223 ARG A CA    1 
ATOM   6046 C  C     . ARG A 1 809  ? 73.737  22.239  -18.365 1.00 38.05  ? 1223 ARG A C     1 
ATOM   6047 O  O     . ARG A 1 809  ? 74.327  21.164  -18.308 1.00 38.14  ? 1223 ARG A O     1 
ATOM   6048 C  CB    . ARG A 1 809  ? 71.788  21.637  -16.839 1.00 38.62  ? 1223 ARG A CB    1 
ATOM   6049 C  CG    . ARG A 1 809  ? 71.712  21.277  -15.352 1.00 41.33  ? 1223 ARG A CG    1 
ATOM   6050 C  CD    . ARG A 1 809  ? 73.069  21.596  -14.661 1.00 45.72  ? 1223 ARG A CD    1 
ATOM   6051 N  NE    . ARG A 1 809  ? 73.474  20.662  -13.614 1.00 48.36  ? 1223 ARG A NE    1 
ATOM   6052 C  CZ    . ARG A 1 809  ? 73.062  20.713  -12.343 1.00 51.86  ? 1223 ARG A CZ    1 
ATOM   6053 N  NH1   . ARG A 1 809  ? 73.497  19.801  -11.469 1.00 51.12  ? 1223 ARG A NH1   1 
ATOM   6054 N  NH2   . ARG A 1 809  ? 72.194  21.658  -11.942 1.00 52.29  ? 1223 ARG A NH2   1 
ATOM   6055 N  N     . GLY A 1 810  ? 73.828  23.035  -19.433 1.00 37.50  ? 1224 GLY A N     1 
ATOM   6056 C  CA    . GLY A 1 810  ? 74.683  22.684  -20.572 1.00 36.71  ? 1224 GLY A CA    1 
ATOM   6057 C  C     . GLY A 1 810  ? 74.082  22.081  -21.857 1.00 36.51  ? 1224 GLY A C     1 
ATOM   6058 O  O     . GLY A 1 810  ? 74.812  21.890  -22.831 1.00 35.80  ? 1224 GLY A O     1 
ATOM   6059 N  N     . LEU A 1 811  ? 72.780  21.764  -21.882 1.00 35.84  ? 1225 LEU A N     1 
ATOM   6060 C  CA    . LEU A 1 811  ? 72.134  21.319  -23.129 1.00 35.15  ? 1225 LEU A CA    1 
ATOM   6061 C  C     . LEU A 1 811  ? 72.068  22.441  -24.172 1.00 35.14  ? 1225 LEU A C     1 
ATOM   6062 O  O     . LEU A 1 811  ? 71.994  23.632  -23.824 1.00 35.34  ? 1225 LEU A O     1 
ATOM   6063 C  CB    . LEU A 1 811  ? 70.716  20.801  -22.875 1.00 35.19  ? 1225 LEU A CB    1 
ATOM   6064 C  CG    . LEU A 1 811  ? 70.583  19.416  -22.226 1.00 34.92  ? 1225 LEU A CG    1 
ATOM   6065 C  CD1   . LEU A 1 811  ? 71.075  19.425  -20.779 1.00 32.39  ? 1225 LEU A CD1   1 
ATOM   6066 C  CD2   . LEU A 1 811  ? 69.155  18.914  -22.306 1.00 33.95  ? 1225 LEU A CD2   1 
ATOM   6067 N  N     . GLU A 1 812  ? 72.087  22.050  -25.446 1.00 34.56  ? 1226 GLU A N     1 
ATOM   6068 C  CA    . GLU A 1 812  ? 71.890  22.948  -26.590 1.00 33.63  ? 1226 GLU A CA    1 
ATOM   6069 C  C     . GLU A 1 812  ? 70.518  23.628  -26.548 1.00 32.94  ? 1226 GLU A C     1 
ATOM   6070 O  O     . GLU A 1 812  ? 69.489  22.977  -26.416 1.00 32.73  ? 1226 GLU A O     1 
ATOM   6071 C  CB    . GLU A 1 812  ? 72.059  22.145  -27.884 1.00 33.64  ? 1226 GLU A CB    1 
ATOM   6072 C  CG    . GLU A 1 812  ? 71.771  22.902  -29.177 1.00 35.26  ? 1226 GLU A CG    1 
ATOM   6073 C  CD    . GLU A 1 812  ? 72.813  23.979  -29.475 1.00 36.74  ? 1226 GLU A CD    1 
ATOM   6074 O  OE1   . GLU A 1 812  ? 73.969  23.861  -29.011 1.00 37.07  ? 1226 GLU A OE1   1 
ATOM   6075 O  OE2   . GLU A 1 812  ? 72.473  24.944  -30.185 1.00 38.01  ? 1226 GLU A OE2   1 
ATOM   6076 N  N     . PRO A 1 813  ? 70.493  24.951  -26.674 1.00 32.92  ? 1227 PRO A N     1 
ATOM   6077 C  CA    . PRO A 1 813  ? 69.232  25.662  -26.415 1.00 33.11  ? 1227 PRO A CA    1 
ATOM   6078 C  C     . PRO A 1 813  ? 68.009  25.091  -27.165 1.00 33.42  ? 1227 PRO A C     1 
ATOM   6079 O  O     . PRO A 1 813  ? 66.930  24.911  -26.580 1.00 32.76  ? 1227 PRO A O     1 
ATOM   6080 C  CB    . PRO A 1 813  ? 69.547  27.091  -26.863 1.00 32.18  ? 1227 PRO A CB    1 
ATOM   6081 C  CG    . PRO A 1 813  ? 71.008  27.243  -26.513 1.00 33.57  ? 1227 PRO A CG    1 
ATOM   6082 C  CD    . PRO A 1 813  ? 71.624  25.880  -26.874 1.00 33.18  ? 1227 PRO A CD    1 
ATOM   6083 N  N     . SER A 1 814  ? 68.176  24.831  -28.450 1.00 33.92  ? 1228 SER A N     1 
ATOM   6084 C  CA    . SER A 1 814  ? 67.065  24.382  -29.254 1.00 35.25  ? 1228 SER A CA    1 
ATOM   6085 C  C     . SER A 1 814  ? 66.558  23.022  -28.751 1.00 34.98  ? 1228 SER A C     1 
ATOM   6086 O  O     . SER A 1 814  ? 65.374  22.747  -28.791 1.00 35.66  ? 1228 SER A O     1 
ATOM   6087 C  CB    . SER A 1 814  ? 67.456  24.308  -30.735 1.00 34.95  ? 1228 SER A CB    1 
ATOM   6088 O  OG    . SER A 1 814  ? 68.076  23.061  -30.991 1.00 38.15  ? 1228 SER A OG    1 
ATOM   6089 N  N     . LEU A 1 815  ? 67.454  22.180  -28.266 1.00 34.92  ? 1229 LEU A N     1 
ATOM   6090 C  CA    . LEU A 1 815  ? 67.042  20.949  -27.609 1.00 34.93  ? 1229 LEU A CA    1 
ATOM   6091 C  C     . LEU A 1 815  ? 66.335  21.211  -26.261 1.00 35.04  ? 1229 LEU A C     1 
ATOM   6092 O  O     . LEU A 1 815  ? 65.350  20.546  -25.925 1.00 35.37  ? 1229 LEU A O     1 
ATOM   6093 C  CB    . LEU A 1 815  ? 68.250  20.040  -27.388 1.00 34.53  ? 1229 LEU A CB    1 
ATOM   6094 C  CG    . LEU A 1 815  ? 67.938  18.842  -26.500 1.00 35.22  ? 1229 LEU A CG    1 
ATOM   6095 C  CD1   . LEU A 1 815  ? 67.059  17.823  -27.217 1.00 35.57  ? 1229 LEU A CD1   1 
ATOM   6096 C  CD2   . LEU A 1 815  ? 69.236  18.196  -26.073 1.00 36.83  ? 1229 LEU A CD2   1 
ATOM   6097 N  N     . ALA A 1 816  ? 66.833  22.169  -25.488 1.00 34.51  ? 1230 ALA A N     1 
ATOM   6098 C  CA    . ALA A 1 816  ? 66.169  22.529  -24.235 1.00 34.60  ? 1230 ALA A CA    1 
ATOM   6099 C  C     . ALA A 1 816  ? 64.766  23.044  -24.520 1.00 34.34  ? 1230 ALA A C     1 
ATOM   6100 O  O     . ALA A 1 816  ? 63.824  22.825  -23.733 1.00 33.92  ? 1230 ALA A O     1 
ATOM   6101 C  CB    . ALA A 1 816  ? 66.973  23.583  -23.475 1.00 34.58  ? 1230 ALA A CB    1 
ATOM   6102 N  N     . PHE A 1 817  ? 64.629  23.740  -25.650 1.00 34.23  ? 1231 PHE A N     1 
ATOM   6103 C  CA    . PHE A 1 817  ? 63.334  24.277  -26.049 1.00 32.87  ? 1231 PHE A CA    1 
ATOM   6104 C  C     . PHE A 1 817  ? 62.428  23.110  -26.430 1.00 33.24  ? 1231 PHE A C     1 
ATOM   6105 O  O     . PHE A 1 817  ? 61.256  23.085  -26.051 1.00 32.78  ? 1231 PHE A O     1 
ATOM   6106 C  CB    . PHE A 1 817  ? 63.494  25.236  -27.218 1.00 32.42  ? 1231 PHE A CB    1 
ATOM   6107 C  CG    . PHE A 1 817  ? 62.218  25.493  -27.977 1.00 31.96  ? 1231 PHE A CG    1 
ATOM   6108 C  CD1   . PHE A 1 817  ? 61.300  26.438  -27.522 1.00 30.74  ? 1231 PHE A CD1   1 
ATOM   6109 C  CD2   . PHE A 1 817  ? 61.930  24.780  -29.140 1.00 30.02  ? 1231 PHE A CD2   1 
ATOM   6110 C  CE1   . PHE A 1 817  ? 60.117  26.674  -28.217 1.00 31.97  ? 1231 PHE A CE1   1 
ATOM   6111 C  CE2   . PHE A 1 817  ? 60.749  25.011  -29.851 1.00 30.67  ? 1231 PHE A CE2   1 
ATOM   6112 C  CZ    . PHE A 1 817  ? 59.841  25.953  -29.397 1.00 31.17  ? 1231 PHE A CZ    1 
ATOM   6113 N  N     . LYS A 1 818  ? 62.968  22.145  -27.171 1.00 33.21  ? 1232 LYS A N     1 
ATOM   6114 C  CA    . LYS A 1 818  ? 62.154  21.028  -27.646 1.00 34.81  ? 1232 LYS A CA    1 
ATOM   6115 C  C     . LYS A 1 818  ? 61.535  20.317  -26.452 1.00 34.52  ? 1232 LYS A C     1 
ATOM   6116 O  O     . LYS A 1 818  ? 60.379  19.849  -26.503 1.00 34.13  ? 1232 LYS A O     1 
ATOM   6117 C  CB    . LYS A 1 818  ? 62.996  19.998  -28.414 1.00 35.40  ? 1232 LYS A CB    1 
ATOM   6118 C  CG    . LYS A 1 818  ? 63.063  20.140  -29.951 1.00 38.91  ? 1232 LYS A CG    1 
ATOM   6119 C  CD    . LYS A 1 818  ? 63.651  18.829  -30.633 1.00 42.84  ? 1232 LYS A CD    1 
ATOM   6120 C  CE    . LYS A 1 818  ? 65.185  18.853  -30.836 1.00 47.58  ? 1232 LYS A CE    1 
ATOM   6121 N  NZ    . LYS A 1 818  ? 65.868  17.493  -31.026 1.00 49.77  ? 1232 LYS A NZ    1 
ATOM   6122 N  N     . ILE A 1 819  ? 62.326  20.258  -25.379 1.00 34.15  ? 1233 ILE A N     1 
ATOM   6123 C  CA    . ILE A 1 819  ? 62.039  19.401  -24.231 1.00 33.43  ? 1233 ILE A CA    1 
ATOM   6124 C  C     . ILE A 1 819  ? 61.000  20.113  -23.419 1.00 33.66  ? 1233 ILE A C     1 
ATOM   6125 O  O     . ILE A 1 819  ? 60.012  19.520  -23.003 1.00 34.05  ? 1233 ILE A O     1 
ATOM   6126 C  CB    . ILE A 1 819  ? 63.307  19.114  -23.380 1.00 33.51  ? 1233 ILE A CB    1 
ATOM   6127 C  CG1   . ILE A 1 819  ? 64.214  18.091  -24.063 1.00 31.34  ? 1233 ILE A CG1   1 
ATOM   6128 C  CG2   . ILE A 1 819  ? 62.942  18.644  -21.975 1.00 32.70  ? 1233 ILE A CG2   1 
ATOM   6129 C  CD1   . ILE A 1 819  ? 65.469  17.728  -23.223 1.00 29.98  ? 1233 ILE A CD1   1 
ATOM   6130 N  N     . MET A 1 820  ? 61.200  21.410  -23.250 1.00 33.68  ? 1234 MET A N     1 
ATOM   6131 C  CA    . MET A 1 820  ? 60.186  22.259  -22.657 1.00 33.45  ? 1234 MET A CA    1 
ATOM   6132 C  C     . MET A 1 820  ? 58.844  22.074  -23.354 1.00 33.51  ? 1234 MET A C     1 
ATOM   6133 O  O     . MET A 1 820  ? 57.836  21.845  -22.706 1.00 33.72  ? 1234 MET A O     1 
ATOM   6134 C  CB    . MET A 1 820  ? 60.600  23.729  -22.765 1.00 33.32  ? 1234 MET A CB    1 
ATOM   6135 C  CG    . MET A 1 820  ? 59.482  24.685  -22.374 1.00 34.82  ? 1234 MET A CG    1 
ATOM   6136 S  SD    . MET A 1 820  ? 59.905  26.397  -22.649 1.00 38.70  ? 1234 MET A SD    1 
ATOM   6137 C  CE    . MET A 1 820  ? 59.617  26.524  -24.421 1.00 33.55  ? 1234 MET A CE    1 
ATOM   6138 N  N     . GLU A 1 821  ? 58.837  22.193  -24.680 1.00 33.27  ? 1235 GLU A N     1 
ATOM   6139 C  CA    . GLU A 1 821  ? 57.611  22.131  -25.451 1.00 33.36  ? 1235 GLU A CA    1 
ATOM   6140 C  C     . GLU A 1 821  ? 56.932  20.774  -25.323 1.00 33.83  ? 1235 GLU A C     1 
ATOM   6141 O  O     . GLU A 1 821  ? 55.714  20.719  -25.247 1.00 35.13  ? 1235 GLU A O     1 
ATOM   6142 C  CB    . GLU A 1 821  ? 57.857  22.410  -26.937 1.00 32.86  ? 1235 GLU A CB    1 
ATOM   6143 C  CG    . GLU A 1 821  ? 58.091  23.849  -27.276 1.00 32.94  ? 1235 GLU A CG    1 
ATOM   6144 C  CD    . GLU A 1 821  ? 56.940  24.755  -26.858 1.00 33.59  ? 1235 GLU A CD    1 
ATOM   6145 O  OE1   . GLU A 1 821  ? 56.747  24.984  -25.656 1.00 35.54  ? 1235 GLU A OE1   1 
ATOM   6146 O  OE2   . GLU A 1 821  ? 56.224  25.254  -27.737 1.00 34.39  ? 1235 GLU A OE2   1 
ATOM   6147 N  N     . SER A 1 822  ? 57.708  19.691  -25.314 1.00 33.31  ? 1236 SER A N     1 
ATOM   6148 C  CA    . SER A 1 822  ? 57.154  18.361  -25.109 1.00 32.87  ? 1236 SER A CA    1 
ATOM   6149 C  C     . SER A 1 822  ? 56.482  18.223  -23.731 1.00 33.12  ? 1236 SER A C     1 
ATOM   6150 O  O     . SER A 1 822  ? 55.351  17.719  -23.638 1.00 32.24  ? 1236 SER A O     1 
ATOM   6151 C  CB    . SER A 1 822  ? 58.230  17.273  -25.283 1.00 33.54  ? 1236 SER A CB    1 
ATOM   6152 O  OG    . SER A 1 822  ? 57.749  15.996  -24.868 1.00 32.11  ? 1236 SER A OG    1 
ATOM   6153 N  N     . VAL A 1 823  ? 57.144  18.670  -22.660 1.00 32.94  ? 1237 VAL A N     1 
ATOM   6154 C  CA    . VAL A 1 823  ? 56.537  18.439  -21.359 1.00 33.40  ? 1237 VAL A CA    1 
ATOM   6155 C  C     . VAL A 1 823  ? 55.312  19.293  -21.092 1.00 33.74  ? 1237 VAL A C     1 
ATOM   6156 O  O     . VAL A 1 823  ? 54.374  18.828  -20.459 1.00 33.81  ? 1237 VAL A O     1 
ATOM   6157 C  CB    . VAL A 1 823  ? 57.528  18.426  -20.140 1.00 34.15  ? 1237 VAL A CB    1 
ATOM   6158 C  CG1   . VAL A 1 823  ? 58.984  18.704  -20.543 1.00 34.77  ? 1237 VAL A CG1   1 
ATOM   6159 C  CG2   . VAL A 1 823  ? 57.043  19.329  -19.026 1.00 33.91  ? 1237 VAL A CG2   1 
ATOM   6160 N  N     . ARG A 1 824  ? 55.295  20.526  -21.596 1.00 33.92  ? 1238 ARG A N     1 
ATOM   6161 C  CA    . ARG A 1 824  ? 54.162  21.419  -21.348 1.00 33.45  ? 1238 ARG A CA    1 
ATOM   6162 C  C     . ARG A 1 824  ? 52.928  21.034  -22.169 1.00 33.70  ? 1238 ARG A C     1 
ATOM   6163 O  O     . ARG A 1 824  ? 51.858  21.616  -21.985 1.00 33.68  ? 1238 ARG A O     1 
ATOM   6164 C  CB    . ARG A 1 824  ? 54.542  22.890  -21.594 1.00 32.78  ? 1238 ARG A CB    1 
ATOM   6165 C  CG    . ARG A 1 824  ? 54.883  23.283  -23.050 1.00 32.94  ? 1238 ARG A CG    1 
ATOM   6166 C  CD    . ARG A 1 824  ? 53.659  23.733  -23.862 1.00 31.54  ? 1238 ARG A CD    1 
ATOM   6167 N  NE    . ARG A 1 824  ? 54.019  24.353  -25.147 1.00 30.49  ? 1238 ARG A NE    1 
ATOM   6168 C  CZ    . ARG A 1 824  ? 53.125  24.880  -25.992 1.00 28.48  ? 1238 ARG A CZ    1 
ATOM   6169 N  NH1   . ARG A 1 824  ? 51.847  24.850  -25.679 1.00 27.68  ? 1238 ARG A NH1   1 
ATOM   6170 N  NH2   . ARG A 1 824  ? 53.492  25.425  -27.153 1.00 26.98  ? 1238 ARG A NH2   1 
ATOM   6171 N  N     . LYS A 1 825  ? 53.080  20.088  -23.096 1.00 33.84  ? 1239 LYS A N     1 
ATOM   6172 C  CA    . LYS A 1 825  ? 51.915  19.525  -23.810 1.00 34.25  ? 1239 LYS A CA    1 
ATOM   6173 C  C     . LYS A 1 825  ? 51.555  18.175  -23.198 1.00 34.53  ? 1239 LYS A C     1 
ATOM   6174 O  O     . LYS A 1 825  ? 50.806  17.385  -23.786 1.00 34.37  ? 1239 LYS A O     1 
ATOM   6175 C  CB    . LYS A 1 825  ? 52.231  19.303  -25.275 1.00 33.99  ? 1239 LYS A CB    1 
ATOM   6176 C  CG    . LYS A 1 825  ? 52.464  20.563  -26.075 1.00 35.31  ? 1239 LYS A CG    1 
ATOM   6177 C  CD    . LYS A 1 825  ? 53.299  20.272  -27.318 1.00 33.48  ? 1239 LYS A CD    1 
ATOM   6178 C  CE    . LYS A 1 825  ? 53.300  21.454  -28.246 1.00 36.00  ? 1239 LYS A CE    1 
ATOM   6179 N  NZ    . LYS A 1 825  ? 54.112  21.153  -29.469 1.00 40.49  ? 1239 LYS A NZ    1 
ATOM   6180 N  N     . GLY A 1 826  ? 52.121  17.913  -22.019 1.00 34.88  ? 1240 GLY A N     1 
ATOM   6181 C  CA    . GLY A 1 826  ? 52.083  16.595  -21.392 1.00 35.28  ? 1240 GLY A CA    1 
ATOM   6182 C  C     . GLY A 1 826  ? 52.522  15.415  -22.262 1.00 35.55  ? 1240 GLY A C     1 
ATOM   6183 O  O     . GLY A 1 826  ? 51.946  14.326  -22.155 1.00 35.11  ? 1240 GLY A O     1 
ATOM   6184 N  N     . LYS A 1 827  ? 53.527  15.608  -23.113 1.00 35.42  ? 1241 LYS A N     1 
ATOM   6185 C  CA    . LYS A 1 827  ? 54.037  14.490  -23.894 1.00 36.47  ? 1241 LYS A CA    1 
ATOM   6186 C  C     . LYS A 1 827  ? 55.246  13.823  -23.260 1.00 36.46  ? 1241 LYS A C     1 
ATOM   6187 O  O     . LYS A 1 827  ? 55.802  12.882  -23.809 1.00 37.33  ? 1241 LYS A O     1 
ATOM   6188 C  CB    . LYS A 1 827  ? 54.338  14.907  -25.331 1.00 37.15  ? 1241 LYS A CB    1 
ATOM   6189 C  CG    . LYS A 1 827  ? 53.087  15.398  -26.067 1.00 40.04  ? 1241 LYS A CG    1 
ATOM   6190 C  CD    . LYS A 1 827  ? 53.391  15.851  -27.491 1.00 45.33  ? 1241 LYS A CD    1 
ATOM   6191 C  CE    . LYS A 1 827  ? 52.115  15.789  -28.331 1.00 48.25  ? 1241 LYS A CE    1 
ATOM   6192 N  NZ    . LYS A 1 827  ? 52.214  16.684  -29.512 1.00 50.13  ? 1241 LYS A NZ    1 
ATOM   6193 N  N     . GLY A 1 828  ? 55.651  14.276  -22.086 1.00 36.30  ? 1242 GLY A N     1 
ATOM   6194 C  CA    . GLY A 1 828  ? 56.714  13.572  -21.388 1.00 36.06  ? 1242 GLY A CA    1 
ATOM   6195 C  C     . GLY A 1 828  ? 58.039  13.681  -22.107 1.00 36.18  ? 1242 GLY A C     1 
ATOM   6196 O  O     . GLY A 1 828  ? 58.309  14.681  -22.775 1.00 35.83  ? 1242 GLY A O     1 
ATOM   6197 N  N     . LEU A 1 829  ? 58.854  12.635  -21.971 1.00 36.22  ? 1243 LEU A N     1 
ATOM   6198 C  CA    . LEU A 1 829  ? 60.239  12.638  -22.400 1.00 35.96  ? 1243 LEU A CA    1 
ATOM   6199 C  C     . LEU A 1 829  ? 60.526  11.423  -23.262 1.00 36.27  ? 1243 LEU A C     1 
ATOM   6200 O  O     . LEU A 1 829  ? 60.057  10.333  -22.961 1.00 36.33  ? 1243 LEU A O     1 
ATOM   6201 C  CB    . LEU A 1 829  ? 61.133  12.569  -21.168 1.00 35.61  ? 1243 LEU A CB    1 
ATOM   6202 C  CG    . LEU A 1 829  ? 61.761  13.846  -20.588 1.00 35.58  ? 1243 LEU A CG    1 
ATOM   6203 C  CD1   . LEU A 1 829  ? 61.223  15.139  -21.204 1.00 32.34  ? 1243 LEU A CD1   1 
ATOM   6204 C  CD2   . LEU A 1 829  ? 61.649  13.873  -19.075 1.00 31.26  ? 1243 LEU A CD2   1 
ATOM   6205 N  N     . THR A 1 830  ? 61.301  11.607  -24.327 1.00 36.29  ? 1244 THR A N     1 
ATOM   6206 C  CA    . THR A 1 830  ? 61.771  10.485  -25.127 1.00 36.46  ? 1244 THR A CA    1 
ATOM   6207 C  C     . THR A 1 830  ? 63.054  9.976   -24.502 1.00 36.61  ? 1244 THR A C     1 
ATOM   6208 O  O     . THR A 1 830  ? 63.690  10.694  -23.723 1.00 36.37  ? 1244 THR A O     1 
ATOM   6209 C  CB    . THR A 1 830  ? 62.093  10.893  -26.581 1.00 36.57  ? 1244 THR A CB    1 
ATOM   6210 O  OG1   . THR A 1 830  ? 63.207  11.806  -26.589 1.00 36.56  ? 1244 THR A OG1   1 
ATOM   6211 C  CG2   . THR A 1 830  ? 60.863  11.522  -27.269 1.00 36.10  ? 1244 THR A CG2   1 
ATOM   6212 N  N     . PRO A 1 831  ? 63.449  8.736   -24.842 1.00 36.68  ? 1245 PRO A N     1 
ATOM   6213 C  CA    . PRO A 1 831  ? 64.721  8.200   -24.337 1.00 36.98  ? 1245 PRO A CA    1 
ATOM   6214 C  C     . PRO A 1 831  ? 65.893  9.150   -24.593 1.00 37.21  ? 1245 PRO A C     1 
ATOM   6215 O  O     . PRO A 1 831  ? 66.763  9.311   -23.738 1.00 37.10  ? 1245 PRO A O     1 
ATOM   6216 C  CB    . PRO A 1 831  ? 64.882  6.888   -25.119 1.00 36.76  ? 1245 PRO A CB    1 
ATOM   6217 C  CG    . PRO A 1 831  ? 63.458  6.420   -25.312 1.00 36.70  ? 1245 PRO A CG    1 
ATOM   6218 C  CD    . PRO A 1 831  ? 62.640  7.704   -25.513 1.00 36.48  ? 1245 PRO A CD    1 
ATOM   6219 N  N     . GLU A 1 832  ? 65.896  9.793   -25.756 1.00 37.96  ? 1246 GLU A N     1 
ATOM   6220 C  CA    . GLU A 1 832  ? 66.946  10.743  -26.091 1.00 38.51  ? 1246 GLU A CA    1 
ATOM   6221 C  C     . GLU A 1 832  ? 66.972  11.967  -25.156 1.00 38.23  ? 1246 GLU A C     1 
ATOM   6222 O  O     . GLU A 1 832  ? 68.056  12.410  -24.733 1.00 38.38  ? 1246 GLU A O     1 
ATOM   6223 C  CB    . GLU A 1 832  ? 66.819  11.169  -27.557 1.00 39.09  ? 1246 GLU A CB    1 
ATOM   6224 C  CG    . GLU A 1 832  ? 67.132  10.049  -28.556 1.00 42.07  ? 1246 GLU A CG    1 
ATOM   6225 C  CD    . GLU A 1 832  ? 66.005  8.996   -28.763 1.00 44.92  ? 1246 GLU A CD    1 
ATOM   6226 O  OE1   . GLU A 1 832  ? 64.803  9.258   -28.462 1.00 43.03  ? 1246 GLU A OE1   1 
ATOM   6227 O  OE2   . GLU A 1 832  ? 66.353  7.893   -29.272 1.00 44.82  ? 1246 GLU A OE2   1 
ATOM   6228 N  N     . PHE A 1 833  ? 65.796  12.510  -24.828 1.00 37.33  ? 1247 PHE A N     1 
ATOM   6229 C  CA    . PHE A 1 833  ? 65.737  13.623  -23.902 1.00 36.65  ? 1247 PHE A CA    1 
ATOM   6230 C  C     . PHE A 1 833  ? 66.312  13.183  -22.551 1.00 36.86  ? 1247 PHE A C     1 
ATOM   6231 O  O     . PHE A 1 833  ? 67.123  13.890  -21.934 1.00 36.93  ? 1247 PHE A O     1 
ATOM   6232 C  CB    . PHE A 1 833  ? 64.303  14.166  -23.729 1.00 36.48  ? 1247 PHE A CB    1 
ATOM   6233 C  CG    . PHE A 1 833  ? 63.692  14.757  -24.988 1.00 35.44  ? 1247 PHE A CG    1 
ATOM   6234 C  CD1   . PHE A 1 833  ? 64.471  15.057  -26.108 1.00 34.99  ? 1247 PHE A CD1   1 
ATOM   6235 C  CD2   . PHE A 1 833  ? 62.332  15.045  -25.036 1.00 35.39  ? 1247 PHE A CD2   1 
ATOM   6236 C  CE1   . PHE A 1 833  ? 63.900  15.604  -27.265 1.00 33.23  ? 1247 PHE A CE1   1 
ATOM   6237 C  CE2   . PHE A 1 833  ? 61.742  15.595  -26.196 1.00 34.67  ? 1247 PHE A CE2   1 
ATOM   6238 C  CZ    . PHE A 1 833  ? 62.531  15.877  -27.310 1.00 33.68  ? 1247 PHE A CZ    1 
ATOM   6239 N  N     . GLU A 1 834  ? 65.893  12.021  -22.067 1.00 36.52  ? 1248 GLU A N     1 
ATOM   6240 C  CA    . GLU A 1 834  ? 66.334  11.641  -20.737 1.00 36.40  ? 1248 GLU A CA    1 
ATOM   6241 C  C     . GLU A 1 834  ? 67.845  11.562  -20.795 1.00 35.81  ? 1248 GLU A C     1 
ATOM   6242 O  O     . GLU A 1 834  ? 68.559  12.085  -19.915 1.00 35.84  ? 1248 GLU A O     1 
ATOM   6243 C  CB    . GLU A 1 834  ? 65.731  10.305  -20.290 1.00 36.82  ? 1248 GLU A CB    1 
ATOM   6244 C  CG    . GLU A 1 834  ? 64.221  10.199  -20.488 1.00 38.41  ? 1248 GLU A CG    1 
ATOM   6245 C  CD    . GLU A 1 834  ? 63.601  8.950   -19.858 1.00 41.86  ? 1248 GLU A CD    1 
ATOM   6246 O  OE1   . GLU A 1 834  ? 64.130  7.843   -20.045 1.00 46.99  ? 1248 GLU A OE1   1 
ATOM   6247 O  OE2   . GLU A 1 834  ? 62.556  9.059   -19.194 1.00 43.49  ? 1248 GLU A OE2   1 
ATOM   6248 N  N     . ALA A 1 835  ? 68.343  10.909  -21.835 1.00 34.53  ? 1249 ALA A N     1 
ATOM   6249 C  CA    . ALA A 1 835  ? 69.777  10.665  -21.904 1.00 33.85  ? 1249 ALA A CA    1 
ATOM   6250 C  C     . ALA A 1 835  ? 70.572  11.982  -21.986 1.00 33.55  ? 1249 ALA A C     1 
ATOM   6251 O  O     . ALA A 1 835  ? 71.693  12.081  -21.462 1.00 32.84  ? 1249 ALA A O     1 
ATOM   6252 C  CB    . ALA A 1 835  ? 70.121  9.725   -23.077 1.00 33.68  ? 1249 ALA A CB    1 
ATOM   6253 N  N     . GLU A 1 836  ? 70.004  12.983  -22.660 1.00 33.17  ? 1250 GLU A N     1 
ATOM   6254 C  CA    . GLU A 1 836  ? 70.650  14.288  -22.743 1.00 33.34  ? 1250 GLU A CA    1 
ATOM   6255 C  C     . GLU A 1 836  ? 70.581  14.965  -21.382 1.00 33.12  ? 1250 GLU A C     1 
ATOM   6256 O  O     . GLU A 1 836  ? 71.498  15.672  -20.961 1.00 32.52  ? 1250 GLU A O     1 
ATOM   6257 C  CB    . GLU A 1 836  ? 69.989  15.164  -23.802 1.00 33.43  ? 1250 GLU A CB    1 
ATOM   6258 C  CG    . GLU A 1 836  ? 70.280  14.729  -25.215 1.00 34.89  ? 1250 GLU A CG    1 
ATOM   6259 C  CD    . GLU A 1 836  ? 71.550  15.341  -25.753 1.00 35.19  ? 1250 GLU A CD    1 
ATOM   6260 O  OE1   . GLU A 1 836  ? 71.873  15.079  -26.923 1.00 35.89  ? 1250 GLU A OE1   1 
ATOM   6261 O  OE2   . GLU A 1 836  ? 72.227  16.084  -25.008 1.00 36.17  ? 1250 GLU A OE2   1 
ATOM   6262 N  N     . MET A 1 837  ? 69.485  14.731  -20.683 1.00 33.61  ? 1251 MET A N     1 
ATOM   6263 C  CA    . MET A 1 837  ? 69.335  15.336  -19.373 1.00 34.35  ? 1251 MET A CA    1 
ATOM   6264 C  C     . MET A 1 837  ? 70.337  14.702  -18.419 1.00 34.79  ? 1251 MET A C     1 
ATOM   6265 O  O     . MET A 1 837  ? 71.138  15.404  -17.798 1.00 35.00  ? 1251 MET A O     1 
ATOM   6266 C  CB    . MET A 1 837  ? 67.877  15.281  -18.892 1.00 33.55  ? 1251 MET A CB    1 
ATOM   6267 C  CG    . MET A 1 837  ? 67.000  16.182  -19.731 1.00 33.40  ? 1251 MET A CG    1 
ATOM   6268 S  SD    . MET A 1 837  ? 65.238  15.822  -19.641 1.00 33.71  ? 1251 MET A SD    1 
ATOM   6269 C  CE    . MET A 1 837  ? 64.868  16.570  -18.062 1.00 29.03  ? 1251 MET A CE    1 
ATOM   6270 N  N     . ARG A 1 838  ? 70.346  13.375  -18.346 1.00 35.53  ? 1252 ARG A N     1 
ATOM   6271 C  CA    . ARG A 1 838  ? 71.298  12.693  -17.455 1.00 36.19  ? 1252 ARG A CA    1 
ATOM   6272 C  C     . ARG A 1 838  ? 72.744  13.089  -17.720 1.00 36.28  ? 1252 ARG A C     1 
ATOM   6273 O  O     . ARG A 1 838  ? 73.511  13.372  -16.787 1.00 36.19  ? 1252 ARG A O     1 
ATOM   6274 C  CB    . ARG A 1 838  ? 71.159  11.175  -17.564 1.00 36.05  ? 1252 ARG A CB    1 
ATOM   6275 C  CG    . ARG A 1 838  ? 70.125  10.621  -16.605 1.00 36.28  ? 1252 ARG A CG    1 
ATOM   6276 C  CD    . ARG A 1 838  ? 69.615  9.292   -17.082 1.00 36.42  ? 1252 ARG A CD    1 
ATOM   6277 N  NE    . ARG A 1 838  ? 68.361  8.924   -16.435 1.00 36.30  ? 1252 ARG A NE    1 
ATOM   6278 C  CZ    . ARG A 1 838  ? 67.432  8.180   -17.022 1.00 36.28  ? 1252 ARG A CZ    1 
ATOM   6279 N  NH1   . ARG A 1 838  ? 67.617  7.765   -18.268 1.00 36.11  ? 1252 ARG A NH1   1 
ATOM   6280 N  NH2   . ARG A 1 838  ? 66.317  7.874   -16.379 1.00 35.53  ? 1252 ARG A NH2   1 
ATOM   6281 N  N     . LYS A 1 839  ? 73.112  13.127  -18.993 1.00 36.45  ? 1253 LYS A N     1 
ATOM   6282 C  CA    . LYS A 1 839  ? 74.509  13.312  -19.323 1.00 36.90  ? 1253 LYS A CA    1 
ATOM   6283 C  C     . LYS A 1 839  ? 74.971  14.713  -18.911 1.00 36.84  ? 1253 LYS A C     1 
ATOM   6284 O  O     . LYS A 1 839  ? 76.166  14.965  -18.769 1.00 36.52  ? 1253 LYS A O     1 
ATOM   6285 C  CB    . LYS A 1 839  ? 74.787  12.950  -20.790 1.00 37.06  ? 1253 LYS A CB    1 
ATOM   6286 C  CG    . LYS A 1 839  ? 75.026  14.096  -21.779 1.00 38.82  ? 1253 LYS A CG    1 
ATOM   6287 C  CD    . LYS A 1 839  ? 76.512  14.204  -22.092 1.00 40.05  ? 1253 LYS A CD    1 
ATOM   6288 C  CE    . LYS A 1 839  ? 76.787  14.782  -23.473 1.00 39.48  ? 1253 LYS A CE    1 
ATOM   6289 N  NZ    . LYS A 1 839  ? 76.740  13.743  -24.508 1.00 38.45  ? 1253 LYS A NZ    1 
ATOM   6290 N  N     . HIS A 1 840  ? 74.025  15.617  -18.673 1.00 36.79  ? 1254 HIS A N     1 
ATOM   6291 C  CA    . HIS A 1 840  ? 74.388  16.927  -18.126 1.00 37.16  ? 1254 HIS A CA    1 
ATOM   6292 C  C     . HIS A 1 840  ? 74.025  17.111  -16.645 1.00 37.35  ? 1254 HIS A C     1 
ATOM   6293 O  O     . HIS A 1 840  ? 73.768  18.232  -16.191 1.00 37.14  ? 1254 HIS A O     1 
ATOM   6294 C  CB    . HIS A 1 840  ? 73.773  18.036  -18.950 1.00 37.37  ? 1254 HIS A CB    1 
ATOM   6295 C  CG    . HIS A 1 840  ? 74.480  18.291  -20.238 1.00 37.96  ? 1254 HIS A CG    1 
ATOM   6296 N  ND1   . HIS A 1 840  ? 74.122  17.674  -21.422 1.00 38.41  ? 1254 HIS A ND1   1 
ATOM   6297 C  CD2   . HIS A 1 840  ? 75.522  19.103  -20.533 1.00 38.44  ? 1254 HIS A CD2   1 
ATOM   6298 C  CE1   . HIS A 1 840  ? 74.912  18.099  -22.392 1.00 38.92  ? 1254 HIS A CE1   1 
ATOM   6299 N  NE2   . HIS A 1 840  ? 75.769  18.967  -21.879 1.00 39.64  ? 1254 HIS A NE2   1 
ATOM   6300 N  N     . ASP A 1 841  ? 73.990  15.997  -15.915 1.00 37.82  ? 1255 ASP A N     1 
ATOM   6301 C  CA    . ASP A 1 841  ? 73.772  15.989  -14.468 1.00 38.46  ? 1255 ASP A CA    1 
ATOM   6302 C  C     . ASP A 1 841  ? 72.410  16.525  -13.995 1.00 38.31  ? 1255 ASP A C     1 
ATOM   6303 O  O     . ASP A 1 841  ? 72.271  16.935  -12.842 1.00 39.23  ? 1255 ASP A O     1 
ATOM   6304 C  CB    . ASP A 1 841  ? 74.915  16.724  -13.773 1.00 38.50  ? 1255 ASP A CB    1 
ATOM   6305 C  CG    . ASP A 1 841  ? 76.289  16.112  -14.100 1.00 40.50  ? 1255 ASP A CG    1 
ATOM   6306 O  OD1   . ASP A 1 841  ? 76.501  14.901  -13.850 1.00 40.68  ? 1255 ASP A OD1   1 
ATOM   6307 O  OD2   . ASP A 1 841  ? 77.163  16.851  -14.607 1.00 41.78  ? 1255 ASP A OD2   1 
ATOM   6308 N  N     . VAL A 1 842  ? 71.415  16.544  -14.874 1.00 37.74  ? 1256 VAL A N     1 
ATOM   6309 C  CA    . VAL A 1 842  ? 70.057  16.797  -14.434 1.00 37.28  ? 1256 VAL A CA    1 
ATOM   6310 C  C     . VAL A 1 842  ? 69.687  15.619  -13.558 1.00 37.42  ? 1256 VAL A C     1 
ATOM   6311 O  O     . VAL A 1 842  ? 69.833  14.478  -13.971 1.00 37.51  ? 1256 VAL A O     1 
ATOM   6312 C  CB    . VAL A 1 842  ? 69.094  16.904  -15.597 1.00 37.12  ? 1256 VAL A CB    1 
ATOM   6313 C  CG1   . VAL A 1 842  ? 67.675  17.124  -15.097 1.00 37.30  ? 1256 VAL A CG1   1 
ATOM   6314 C  CG2   . VAL A 1 842  ? 69.521  18.048  -16.509 1.00 37.35  ? 1256 VAL A CG2   1 
ATOM   6315 N  N     . PRO A 1 843  ? 69.251  15.895  -12.319 1.00 37.28  ? 1257 PRO A N     1 
ATOM   6316 C  CA    . PRO A 1 843  ? 68.952  14.856  -11.330 1.00 36.94  ? 1257 PRO A CA    1 
ATOM   6317 C  C     . PRO A 1 843  ? 67.756  14.009  -11.717 1.00 36.57  ? 1257 PRO A C     1 
ATOM   6318 O  O     . PRO A 1 843  ? 66.874  14.456  -12.436 1.00 36.23  ? 1257 PRO A O     1 
ATOM   6319 C  CB    . PRO A 1 843  ? 68.588  15.654  -10.079 1.00 37.07  ? 1257 PRO A CB    1 
ATOM   6320 C  CG    . PRO A 1 843  ? 69.174  17.041  -10.321 1.00 37.74  ? 1257 PRO A CG    1 
ATOM   6321 C  CD    . PRO A 1 843  ? 69.059  17.252  -11.787 1.00 36.88  ? 1257 PRO A CD    1 
ATOM   6322 N  N     . GLU A 1 844  ? 67.703  12.809  -11.181 1.00 36.54  ? 1258 GLU A N     1 
ATOM   6323 C  CA    . GLU A 1 844  ? 66.617  11.900  -11.470 1.00 36.88  ? 1258 GLU A CA    1 
ATOM   6324 C  C     . GLU A 1 844  ? 65.230  12.369  -11.032 1.00 36.76  ? 1258 GLU A C     1 
ATOM   6325 O  O     . GLU A 1 844  ? 64.229  11.893  -11.564 1.00 37.31  ? 1258 GLU A O     1 
ATOM   6326 C  CB    . GLU A 1 844  ? 66.897  10.545  -10.843 1.00 36.90  ? 1258 GLU A CB    1 
ATOM   6327 C  CG    . GLU A 1 844  ? 66.425  9.401   -11.708 1.00 39.57  ? 1258 GLU A CG    1 
ATOM   6328 C  CD    . GLU A 1 844  ? 67.213  9.297   -13.012 1.00 40.80  ? 1258 GLU A CD    1 
ATOM   6329 O  OE1   . GLU A 1 844  ? 68.409  9.661   -13.048 1.00 40.12  ? 1258 GLU A OE1   1 
ATOM   6330 O  OE2   . GLU A 1 844  ? 66.625  8.842   -14.009 1.00 42.69  ? 1258 GLU A OE2   1 
ATOM   6331 N  N     . TRP A 1 845  ? 65.147  13.267  -10.057 1.00 36.02  ? 1259 TRP A N     1 
ATOM   6332 C  CA    . TRP A 1 845  ? 63.843  13.688  -9.592  1.00 35.51  ? 1259 TRP A CA    1 
ATOM   6333 C  C     . TRP A 1 845  ? 63.284  14.752  -10.538 1.00 35.95  ? 1259 TRP A C     1 
ATOM   6334 O  O     . TRP A 1 845  ? 62.083  14.838  -10.756 1.00 35.27  ? 1259 TRP A O     1 
ATOM   6335 C  CB    . TRP A 1 845  ? 63.916  14.225  -8.167  1.00 34.61  ? 1259 TRP A CB    1 
ATOM   6336 C  CG    . TRP A 1 845  ? 64.713  15.487  -8.056  1.00 33.69  ? 1259 TRP A CG    1 
ATOM   6337 C  CD1   . TRP A 1 845  ? 66.016  15.607  -7.619  1.00 31.96  ? 1259 TRP A CD1   1 
ATOM   6338 C  CD2   . TRP A 1 845  ? 64.273  16.820  -8.370  1.00 30.52  ? 1259 TRP A CD2   1 
ATOM   6339 N  NE1   . TRP A 1 845  ? 66.397  16.927  -7.644  1.00 32.20  ? 1259 TRP A NE1   1 
ATOM   6340 C  CE2   . TRP A 1 845  ? 65.352  17.693  -8.100  1.00 30.87  ? 1259 TRP A CE2   1 
ATOM   6341 C  CE3   . TRP A 1 845  ? 63.079  17.356  -8.842  1.00 29.15  ? 1259 TRP A CE3   1 
ATOM   6342 C  CZ2   . TRP A 1 845  ? 65.273  19.079  -8.303  1.00 30.53  ? 1259 TRP A CZ2   1 
ATOM   6343 C  CZ3   . TRP A 1 845  ? 62.996  18.736  -9.048  1.00 31.44  ? 1259 TRP A CZ3   1 
ATOM   6344 C  CH2   . TRP A 1 845  ? 64.093  19.582  -8.776  1.00 30.29  ? 1259 TRP A CH2   1 
ATOM   6345 N  N     . TYR A 1 846  ? 64.164  15.570  -11.097 1.00 36.46  ? 1260 TYR A N     1 
ATOM   6346 C  CA    . TYR A 1 846  ? 63.724  16.554  -12.078 1.00 36.72  ? 1260 TYR A CA    1 
ATOM   6347 C  C     . TYR A 1 846  ? 63.206  15.861  -13.350 1.00 36.65  ? 1260 TYR A C     1 
ATOM   6348 O  O     . TYR A 1 846  ? 62.178  16.248  -13.900 1.00 36.85  ? 1260 TYR A O     1 
ATOM   6349 C  CB    . TYR A 1 846  ? 64.853  17.545  -12.404 1.00 36.61  ? 1260 TYR A CB    1 
ATOM   6350 C  CG    . TYR A 1 846  ? 64.421  18.749  -13.222 1.00 37.19  ? 1260 TYR A CG    1 
ATOM   6351 C  CD1   . TYR A 1 846  ? 64.231  19.995  -12.620 1.00 37.92  ? 1260 TYR A CD1   1 
ATOM   6352 C  CD2   . TYR A 1 846  ? 64.189  18.634  -14.585 1.00 37.32  ? 1260 TYR A CD2   1 
ATOM   6353 C  CE1   . TYR A 1 846  ? 63.854  21.090  -13.358 1.00 37.64  ? 1260 TYR A CE1   1 
ATOM   6354 C  CE2   . TYR A 1 846  ? 63.803  19.720  -15.331 1.00 38.01  ? 1260 TYR A CE2   1 
ATOM   6355 C  CZ    . TYR A 1 846  ? 63.639  20.938  -14.717 1.00 38.09  ? 1260 TYR A CZ    1 
ATOM   6356 O  OH    . TYR A 1 846  ? 63.258  22.000  -15.469 1.00 38.29  ? 1260 TYR A OH    1 
ATOM   6357 N  N     . ILE A 1 847  ? 63.916  14.842  -13.818 1.00 36.55  ? 1261 ILE A N     1 
ATOM   6358 C  CA    . ILE A 1 847  ? 63.503  14.132  -15.026 1.00 36.68  ? 1261 ILE A CA    1 
ATOM   6359 C  C     . ILE A 1 847  ? 62.147  13.449  -14.830 1.00 36.99  ? 1261 ILE A C     1 
ATOM   6360 O  O     . ILE A 1 847  ? 61.294  13.457  -15.711 1.00 36.65  ? 1261 ILE A O     1 
ATOM   6361 C  CB    . ILE A 1 847  ? 64.478  13.018  -15.367 1.00 36.68  ? 1261 ILE A CB    1 
ATOM   6362 C  CG1   . ILE A 1 847  ? 65.824  13.588  -15.812 1.00 37.03  ? 1261 ILE A CG1   1 
ATOM   6363 C  CG2   . ILE A 1 847  ? 63.875  12.100  -16.432 1.00 35.81  ? 1261 ILE A CG2   1 
ATOM   6364 C  CD1   . ILE A 1 847  ? 66.906  12.522  -16.001 1.00 36.70  ? 1261 ILE A CD1   1 
ATOM   6365 N  N     . ASP A 1 848  ? 61.989  12.829  -13.670 1.00 37.06  ? 1262 ASP A N     1 
ATOM   6366 C  CA    . ASP A 1 848  ? 60.777  12.150  -13.307 1.00 37.63  ? 1262 ASP A CA    1 
ATOM   6367 C  C     . ASP A 1 848  ? 59.632  13.159  -13.154 1.00 37.12  ? 1262 ASP A C     1 
ATOM   6368 O  O     . ASP A 1 848  ? 58.463  12.884  -13.495 1.00 37.23  ? 1262 ASP A O     1 
ATOM   6369 C  CB    . ASP A 1 848  ? 61.030  11.404  -12.002 1.00 38.60  ? 1262 ASP A CB    1 
ATOM   6370 C  CG    . ASP A 1 848  ? 59.807  10.680  -11.499 1.00 42.89  ? 1262 ASP A CG    1 
ATOM   6371 O  OD1   . ASP A 1 848  ? 59.449  9.638   -12.115 1.00 46.44  ? 1262 ASP A OD1   1 
ATOM   6372 O  OD2   . ASP A 1 848  ? 59.210  11.146  -10.480 1.00 46.05  ? 1262 ASP A OD2   1 
ATOM   6373 N  N     . SER A 1 849  ? 59.967  14.342  -12.665 1.00 35.76  ? 1263 SER A N     1 
ATOM   6374 C  CA    . SER A 1 849  ? 58.971  15.397  -12.531 1.00 35.05  ? 1263 SER A CA    1 
ATOM   6375 C  C     . SER A 1 849  ? 58.465  15.905  -13.912 1.00 34.77  ? 1263 SER A C     1 
ATOM   6376 O  O     . SER A 1 849  ? 57.276  16.160  -14.099 1.00 34.58  ? 1263 SER A O     1 
ATOM   6377 C  CB    . SER A 1 849  ? 59.543  16.546  -11.702 1.00 34.26  ? 1263 SER A CB    1 
ATOM   6378 O  OG    . SER A 1 849  ? 58.646  17.621  -11.698 1.00 34.06  ? 1263 SER A OG    1 
ATOM   6379 N  N     . CYS A 1 850  ? 59.374  16.062  -14.870 1.00 34.02  ? 1264 CYS A N     1 
ATOM   6380 C  CA    . CYS A 1 850  ? 58.974  16.331  -16.250 1.00 33.08  ? 1264 CYS A CA    1 
ATOM   6381 C  C     . CYS A 1 850  ? 58.026  15.284  -16.820 1.00 32.46  ? 1264 CYS A C     1 
ATOM   6382 O  O     . CYS A 1 850  ? 57.123  15.588  -17.600 1.00 32.95  ? 1264 CYS A O     1 
ATOM   6383 C  CB    . CYS A 1 850  ? 60.198  16.441  -17.147 1.00 32.21  ? 1264 CYS A CB    1 
ATOM   6384 S  SG    . CYS A 1 850  ? 61.063  17.971  -16.832 1.00 33.63  ? 1264 CYS A SG    1 
ATOM   6385 N  N     . LYS A 1 851  ? 58.218  14.034  -16.459 1.00 32.17  ? 1265 LYS A N     1 
ATOM   6386 C  CA    . LYS A 1 851  ? 57.369  13.005  -17.050 1.00 31.81  ? 1265 LYS A CA    1 
ATOM   6387 C  C     . LYS A 1 851  ? 55.970  13.081  -16.490 1.00 31.31  ? 1265 LYS A C     1 
ATOM   6388 O  O     . LYS A 1 851  ? 55.048  12.607  -17.101 1.00 31.69  ? 1265 LYS A O     1 
ATOM   6389 C  CB    . LYS A 1 851  ? 57.959  11.606  -16.882 1.00 31.24  ? 1265 LYS A CB    1 
ATOM   6390 C  CG    . LYS A 1 851  ? 59.272  11.418  -17.626 1.00 32.92  ? 1265 LYS A CG    1 
ATOM   6391 C  CD    . LYS A 1 851  ? 60.180  10.353  -16.941 1.00 34.68  ? 1265 LYS A CD    1 
ATOM   6392 C  CE    . LYS A 1 851  ? 59.782  8.933   -17.333 1.00 34.80  ? 1265 LYS A CE    1 
ATOM   6393 N  NZ    . LYS A 1 851  ? 59.896  8.815   -18.812 1.00 36.29  ? 1265 LYS A NZ    1 
ATOM   6394 N  N     . LYS A 1 852  ? 55.791  13.692  -15.338 1.00 31.42  ? 1266 LYS A N     1 
ATOM   6395 C  CA    . LYS A 1 852  ? 54.441  13.739  -14.796 1.00 32.06  ? 1266 LYS A CA    1 
ATOM   6396 C  C     . LYS A 1 852  ? 53.537  14.803  -15.433 1.00 31.76  ? 1266 LYS A C     1 
ATOM   6397 O  O     . LYS A 1 852  ? 52.388  14.525  -15.740 1.00 32.45  ? 1266 LYS A O     1 
ATOM   6398 C  CB    . LYS A 1 852  ? 54.455  13.856  -13.256 1.00 31.65  ? 1266 LYS A CB    1 
ATOM   6399 C  CG    . LYS A 1 852  ? 54.952  12.599  -12.570 1.00 31.32  ? 1266 LYS A CG    1 
ATOM   6400 C  CD    . LYS A 1 852  ? 55.359  12.903  -11.147 1.00 32.28  ? 1266 LYS A CD    1 
ATOM   6401 C  CE    . LYS A 1 852  ? 55.942  11.711  -10.445 1.00 31.19  ? 1266 LYS A CE    1 
ATOM   6402 N  NZ    . LYS A 1 852  ? 56.032  12.000  -9.001  1.00 32.43  ? 1266 LYS A NZ    1 
ATOM   6403 N  N     . ILE A 1 853  ? 54.073  15.999  -15.635 1.00 31.98  ? 1267 ILE A N     1 
ATOM   6404 C  CA    . ILE A 1 853  ? 53.299  17.195  -15.980 1.00 31.99  ? 1267 ILE A CA    1 
ATOM   6405 C  C     . ILE A 1 853  ? 52.431  16.973  -17.216 1.00 32.58  ? 1267 ILE A C     1 
ATOM   6406 O  O     . ILE A 1 853  ? 52.965  16.639  -18.271 1.00 32.95  ? 1267 ILE A O     1 
ATOM   6407 C  CB    . ILE A 1 853  ? 54.277  18.379  -16.250 1.00 31.73  ? 1267 ILE A CB    1 
ATOM   6408 C  CG1   . ILE A 1 853  ? 55.210  18.560  -15.059 1.00 29.91  ? 1267 ILE A CG1   1 
ATOM   6409 C  CG2   . ILE A 1 853  ? 53.527  19.676  -16.536 1.00 31.57  ? 1267 ILE A CG2   1 
ATOM   6410 C  CD1   . ILE A 1 853  ? 56.164  19.717  -15.185 1.00 26.55  ? 1267 ILE A CD1   1 
ATOM   6411 N  N     . LYS A 1 854  ? 51.113  17.150  -17.091 1.00 32.56  ? 1268 LYS A N     1 
ATOM   6412 C  CA    . LYS A 1 854  ? 50.201  16.935  -18.221 1.00 33.44  ? 1268 LYS A CA    1 
ATOM   6413 C  C     . LYS A 1 854  ? 49.998  18.213  -19.042 1.00 33.41  ? 1268 LYS A C     1 
ATOM   6414 O  O     . LYS A 1 854  ? 49.697  18.160  -20.231 1.00 33.99  ? 1268 LYS A O     1 
ATOM   6415 C  CB    . LYS A 1 854  ? 48.827  16.389  -17.753 1.00 33.26  ? 1268 LYS A CB    1 
ATOM   6416 C  CG    . LYS A 1 854  ? 48.820  14.935  -17.220 1.00 34.80  ? 1268 LYS A CG    1 
ATOM   6417 C  CD    . LYS A 1 854  ? 49.443  13.920  -18.216 1.00 36.51  ? 1268 LYS A CD    1 
ATOM   6418 C  CE    . LYS A 1 854  ? 49.533  12.498  -17.621 1.00 37.22  ? 1268 LYS A CE    1 
ATOM   6419 N  NZ    . LYS A 1 854  ? 50.340  12.458  -16.337 1.00 38.56  ? 1268 LYS A NZ    1 
ATOM   6420 N  N     . TYR A 1 855  ? 50.145  19.354  -18.395 1.00 33.49  ? 1269 TYR A N     1 
ATOM   6421 C  CA    . TYR A 1 855  ? 49.973  20.648  -19.040 1.00 34.03  ? 1269 TYR A CA    1 
ATOM   6422 C  C     . TYR A 1 855  ? 50.695  21.736  -18.239 1.00 34.26  ? 1269 TYR A C     1 
ATOM   6423 O  O     . TYR A 1 855  ? 50.793  21.632  -17.040 1.00 34.78  ? 1269 TYR A O     1 
ATOM   6424 C  CB    . TYR A 1 855  ? 48.495  21.013  -19.126 1.00 33.92  ? 1269 TYR A CB    1 
ATOM   6425 C  CG    . TYR A 1 855  ? 48.366  22.438  -19.559 1.00 34.34  ? 1269 TYR A CG    1 
ATOM   6426 C  CD1   . TYR A 1 855  ? 48.428  22.762  -20.915 1.00 34.64  ? 1269 TYR A CD1   1 
ATOM   6427 C  CD2   . TYR A 1 855  ? 48.276  23.473  -18.630 1.00 33.02  ? 1269 TYR A CD2   1 
ATOM   6428 C  CE1   . TYR A 1 855  ? 48.359  24.068  -21.348 1.00 34.26  ? 1269 TYR A CE1   1 
ATOM   6429 C  CE2   . TYR A 1 855  ? 48.216  24.807  -19.053 1.00 33.05  ? 1269 TYR A CE2   1 
ATOM   6430 C  CZ    . TYR A 1 855  ? 48.261  25.084  -20.418 1.00 34.92  ? 1269 TYR A CZ    1 
ATOM   6431 O  OH    . TYR A 1 855  ? 48.210  26.365  -20.889 1.00 35.28  ? 1269 TYR A OH    1 
ATOM   6432 N  N     . MET A 1 856  ? 51.187  22.791  -18.873 1.00 35.31  ? 1270 MET A N     1 
ATOM   6433 C  CA    . MET A 1 856  ? 51.898  23.846  -18.115 1.00 35.95  ? 1270 MET A CA    1 
ATOM   6434 C  C     . MET A 1 856  ? 51.975  25.228  -18.788 1.00 35.46  ? 1270 MET A C     1 
ATOM   6435 O  O     . MET A 1 856  ? 52.397  25.352  -19.942 1.00 35.34  ? 1270 MET A O     1 
ATOM   6436 C  CB    . MET A 1 856  ? 53.309  23.376  -17.742 1.00 36.34  ? 1270 MET A CB    1 
ATOM   6437 C  CG    . MET A 1 856  ? 54.193  24.490  -17.179 1.00 39.99  ? 1270 MET A CG    1 
ATOM   6438 S  SD    . MET A 1 856  ? 55.106  23.988  -15.702 1.00 45.21  ? 1270 MET A SD    1 
ATOM   6439 C  CE    . MET A 1 856  ? 56.584  23.326  -16.417 1.00 47.59  ? 1270 MET A CE    1 
ATOM   6440 N  N     . PHE A 1 857  ? 51.597  26.262  -18.043 1.00 35.02  ? 1271 PHE A N     1 
ATOM   6441 C  CA    . PHE A 1 857  ? 51.645  27.665  -18.502 1.00 34.66  ? 1271 PHE A CA    1 
ATOM   6442 C  C     . PHE A 1 857  ? 53.007  28.105  -19.045 1.00 34.89  ? 1271 PHE A C     1 
ATOM   6443 O  O     . PHE A 1 857  ? 54.057  27.575  -18.661 1.00 34.76  ? 1271 PHE A O     1 
ATOM   6444 C  CB    . PHE A 1 857  ? 51.381  28.615  -17.330 1.00 34.31  ? 1271 PHE A CB    1 
ATOM   6445 C  CG    . PHE A 1 857  ? 49.932  28.777  -16.955 1.00 34.11  ? 1271 PHE A CG    1 
ATOM   6446 C  CD1   . PHE A 1 857  ? 48.912  28.345  -17.793 1.00 32.61  ? 1271 PHE A CD1   1 
ATOM   6447 C  CD2   . PHE A 1 857  ? 49.598  29.417  -15.776 1.00 34.67  ? 1271 PHE A CD2   1 
ATOM   6448 C  CE1   . PHE A 1 857  ? 47.585  28.528  -17.451 1.00 33.56  ? 1271 PHE A CE1   1 
ATOM   6449 C  CE2   . PHE A 1 857  ? 48.264  29.606  -15.409 1.00 35.71  ? 1271 PHE A CE2   1 
ATOM   6450 C  CZ    . PHE A 1 857  ? 47.255  29.153  -16.246 1.00 35.02  ? 1271 PHE A CZ    1 
ATOM   6451 N  N     . PRO A 1 858  ? 53.004  29.128  -19.908 1.00 34.49  ? 1272 PRO A N     1 
ATOM   6452 C  CA    . PRO A 1 858  ? 54.217  29.909  -20.060 1.00 34.00  ? 1272 PRO A CA    1 
ATOM   6453 C  C     . PRO A 1 858  ? 54.186  31.042  -19.047 1.00 33.98  ? 1272 PRO A C     1 
ATOM   6454 O  O     . PRO A 1 858  ? 53.093  31.587  -18.741 1.00 34.66  ? 1272 PRO A O     1 
ATOM   6455 C  CB    . PRO A 1 858  ? 54.092  30.469  -21.469 1.00 34.28  ? 1272 PRO A CB    1 
ATOM   6456 C  CG    . PRO A 1 858  ? 52.602  30.607  -21.692 1.00 34.03  ? 1272 PRO A CG    1 
ATOM   6457 C  CD    . PRO A 1 858  ? 51.927  29.574  -20.804 1.00 34.26  ? 1272 PRO A CD    1 
ATOM   6458 N  N     . LYS A 1 859  ? 55.360  31.410  -18.542 1.00 33.07  ? 1273 LYS A N     1 
ATOM   6459 C  CA    . LYS A 1 859  ? 55.469  32.432  -17.516 1.00 33.11  ? 1273 LYS A CA    1 
ATOM   6460 C  C     . LYS A 1 859  ? 54.671  33.685  -17.852 1.00 33.12  ? 1273 LYS A C     1 
ATOM   6461 O  O     . LYS A 1 859  ? 54.033  34.276  -16.976 1.00 32.33  ? 1273 LYS A O     1 
ATOM   6462 C  CB    . LYS A 1 859  ? 56.917  32.817  -17.317 1.00 33.72  ? 1273 LYS A CB    1 
ATOM   6463 C  CG    . LYS A 1 859  ? 57.262  33.216  -15.887 1.00 35.42  ? 1273 LYS A CG    1 
ATOM   6464 C  CD    . LYS A 1 859  ? 58.165  34.442  -15.883 1.00 40.42  ? 1273 LYS A CD    1 
ATOM   6465 C  CE    . LYS A 1 859  ? 58.845  34.603  -14.526 1.00 42.37  ? 1273 LYS A CE    1 
ATOM   6466 N  NZ    . LYS A 1 859  ? 60.100  33.821  -14.575 1.00 45.94  ? 1273 LYS A NZ    1 
ATOM   6467 N  N     . ALA A 1 860  ? 54.726  34.095  -19.118 1.00 33.05  ? 1274 ALA A N     1 
ATOM   6468 C  CA    . ALA A 1 860  ? 54.111  35.352  -19.534 1.00 33.47  ? 1274 ALA A CA    1 
ATOM   6469 C  C     . ALA A 1 860  ? 52.597  35.299  -19.310 1.00 33.41  ? 1274 ALA A C     1 
ATOM   6470 O  O     . ALA A 1 860  ? 51.974  36.285  -18.922 1.00 32.94  ? 1274 ALA A O     1 
ATOM   6471 C  CB    . ALA A 1 860  ? 54.444  35.667  -20.988 1.00 33.06  ? 1274 ALA A CB    1 
ATOM   6472 N  N     . HIS A 1 861  ? 52.013  34.121  -19.517 1.00 33.79  ? 1275 HIS A N     1 
ATOM   6473 C  CA    . HIS A 1 861  ? 50.611  33.936  -19.154 1.00 33.67  ? 1275 HIS A CA    1 
ATOM   6474 C  C     . HIS A 1 861  ? 50.378  34.078  -17.641 1.00 33.32  ? 1275 HIS A C     1 
ATOM   6475 O  O     . HIS A 1 861  ? 49.547  34.846  -17.200 1.00 34.29  ? 1275 HIS A O     1 
ATOM   6476 C  CB    . HIS A 1 861  ? 50.110  32.581  -19.624 1.00 33.62  ? 1275 HIS A CB    1 
ATOM   6477 C  CG    . HIS A 1 861  ? 48.636  32.398  -19.436 1.00 33.94  ? 1275 HIS A CG    1 
ATOM   6478 N  ND1   . HIS A 1 861  ? 47.712  32.903  -20.326 1.00 33.01  ? 1275 HIS A ND1   1 
ATOM   6479 C  CD2   . HIS A 1 861  ? 47.926  31.771  -18.466 1.00 31.93  ? 1275 HIS A CD2   1 
ATOM   6480 C  CE1   . HIS A 1 861  ? 46.495  32.578  -19.918 1.00 33.55  ? 1275 HIS A CE1   1 
ATOM   6481 N  NE2   . HIS A 1 861  ? 46.596  31.895  -18.794 1.00 31.34  ? 1275 HIS A NE2   1 
ATOM   6482 N  N     . ALA A 1 862  ? 51.110  33.326  -16.847 1.00 33.12  ? 1276 ALA A N     1 
ATOM   6483 C  CA    . ALA A 1 862  ? 51.010  33.454  -15.389 1.00 33.54  ? 1276 ALA A CA    1 
ATOM   6484 C  C     . ALA A 1 862  ? 51.147  34.906  -14.926 1.00 33.25  ? 1276 ALA A C     1 
ATOM   6485 O  O     . ALA A 1 862  ? 50.445  35.344  -14.012 1.00 33.89  ? 1276 ALA A O     1 
ATOM   6486 C  CB    . ALA A 1 862  ? 52.065  32.537  -14.675 1.00 32.79  ? 1276 ALA A CB    1 
ATOM   6487 N  N     . ALA A 1 863  ? 52.044  35.660  -15.549 1.00 32.97  ? 1277 ALA A N     1 
ATOM   6488 C  CA    . ALA A 1 863  ? 52.283  37.030  -15.097 1.00 32.70  ? 1277 ALA A CA    1 
ATOM   6489 C  C     . ALA A 1 863  ? 51.117  37.959  -15.503 1.00 33.03  ? 1277 ALA A C     1 
ATOM   6490 O  O     . ALA A 1 863  ? 50.610  38.763  -14.698 1.00 33.60  ? 1277 ALA A O     1 
ATOM   6491 C  CB    . ALA A 1 863  ? 53.650  37.538  -15.606 1.00 31.87  ? 1277 ALA A CB    1 
ATOM   6492 N  N     . ALA A 1 864  ? 50.685  37.842  -16.756 1.00 32.68  ? 1278 ALA A N     1 
ATOM   6493 C  CA    . ALA A 1 864  ? 49.455  38.488  -17.183 1.00 32.27  ? 1278 ALA A CA    1 
ATOM   6494 C  C     . ALA A 1 864  ? 48.307  38.187  -16.212 1.00 32.25  ? 1278 ALA A C     1 
ATOM   6495 O  O     . ALA A 1 864  ? 47.618  39.112  -15.761 1.00 32.55  ? 1278 ALA A O     1 
ATOM   6496 C  CB    . ALA A 1 864  ? 49.072  38.045  -18.592 1.00 31.77  ? 1278 ALA A CB    1 
ATOM   6497 N  N     . TYR A 1 865  ? 48.048  36.916  -15.914 1.00 31.27  ? 1279 TYR A N     1 
ATOM   6498 C  CA    . TYR A 1 865  ? 46.817  36.636  -15.142 1.00 31.55  ? 1279 TYR A CA    1 
ATOM   6499 C  C     . TYR A 1 865  ? 46.968  37.109  -13.700 1.00 32.18  ? 1279 TYR A C     1 
ATOM   6500 O  O     . TYR A 1 865  ? 46.038  37.656  -13.124 1.00 32.16  ? 1279 TYR A O     1 
ATOM   6501 C  CB    . TYR A 1 865  ? 46.419  35.176  -15.173 1.00 30.54  ? 1279 TYR A CB    1 
ATOM   6502 C  CG    . TYR A 1 865  ? 45.520  34.810  -16.310 1.00 30.25  ? 1279 TYR A CG    1 
ATOM   6503 C  CD1   . TYR A 1 865  ? 45.684  35.401  -17.572 1.00 30.95  ? 1279 TYR A CD1   1 
ATOM   6504 C  CD2   . TYR A 1 865  ? 44.521  33.851  -16.149 1.00 26.88  ? 1279 TYR A CD2   1 
ATOM   6505 C  CE1   . TYR A 1 865  ? 44.872  35.042  -18.647 1.00 29.91  ? 1279 TYR A CE1   1 
ATOM   6506 C  CE2   . TYR A 1 865  ? 43.699  33.504  -17.196 1.00 29.67  ? 1279 TYR A CE2   1 
ATOM   6507 C  CZ    . TYR A 1 865  ? 43.875  34.093  -18.447 1.00 31.58  ? 1279 TYR A CZ    1 
ATOM   6508 O  OH    . TYR A 1 865  ? 43.053  33.740  -19.503 1.00 32.91  ? 1279 TYR A OH    1 
ATOM   6509 N  N     . VAL A 1 866  ? 48.161  36.937  -13.138 1.00 32.63  ? 1280 VAL A N     1 
ATOM   6510 C  CA    . VAL A 1 866  ? 48.403  37.444  -11.815 1.00 33.33  ? 1280 VAL A CA    1 
ATOM   6511 C  C     . VAL A 1 866  ? 48.217  38.955  -11.729 1.00 33.81  ? 1280 VAL A C     1 
ATOM   6512 O  O     . VAL A 1 866  ? 47.625  39.446  -10.769 1.00 34.32  ? 1280 VAL A O     1 
ATOM   6513 C  CB    . VAL A 1 866  ? 49.774  37.012  -11.285 1.00 33.90  ? 1280 VAL A CB    1 
ATOM   6514 C  CG1   . VAL A 1 866  ? 50.071  37.695  -9.961  1.00 33.57  ? 1280 VAL A CG1   1 
ATOM   6515 C  CG2   . VAL A 1 866  ? 49.830  35.492  -11.150 1.00 31.99  ? 1280 VAL A CG2   1 
ATOM   6516 N  N     . LEU A 1 867  ? 48.692  39.696  -12.724 1.00 34.28  ? 1281 LEU A N     1 
ATOM   6517 C  CA    . LEU A 1 867  ? 48.595  41.160  -12.694 1.00 34.77  ? 1281 LEU A CA    1 
ATOM   6518 C  C     . LEU A 1 867  ? 47.140  41.591  -12.635 1.00 35.53  ? 1281 LEU A C     1 
ATOM   6519 O  O     . LEU A 1 867  ? 46.796  42.579  -11.982 1.00 36.35  ? 1281 LEU A O     1 
ATOM   6520 C  CB    . LEU A 1 867  ? 49.256  41.761  -13.938 1.00 34.98  ? 1281 LEU A CB    1 
ATOM   6521 C  CG    . LEU A 1 867  ? 48.959  43.235  -14.225 1.00 34.00  ? 1281 LEU A CG    1 
ATOM   6522 C  CD1   . LEU A 1 867  ? 49.500  44.103  -13.119 1.00 34.61  ? 1281 LEU A CD1   1 
ATOM   6523 C  CD2   . LEU A 1 867  ? 49.522  43.677  -15.558 1.00 32.33  ? 1281 LEU A CD2   1 
ATOM   6524 N  N     . MET A 1 868  ? 46.286  40.846  -13.332 1.00 35.61  ? 1282 MET A N     1 
ATOM   6525 C  CA    . MET A 1 868  ? 44.850  41.113  -13.364 1.00 35.62  ? 1282 MET A CA    1 
ATOM   6526 C  C     . MET A 1 868  ? 44.222  40.743  -12.023 1.00 34.89  ? 1282 MET A C     1 
ATOM   6527 O  O     . MET A 1 868  ? 43.361  41.452  -11.494 1.00 34.66  ? 1282 MET A O     1 
ATOM   6528 C  CB    . MET A 1 868  ? 44.204  40.279  -14.475 1.00 35.70  ? 1282 MET A CB    1 
ATOM   6529 C  CG    . MET A 1 868  ? 43.314  41.067  -15.427 1.00 39.15  ? 1282 MET A CG    1 
ATOM   6530 S  SD    . MET A 1 868  ? 44.212  42.223  -16.486 1.00 40.77  ? 1282 MET A SD    1 
ATOM   6531 C  CE    . MET A 1 868  ? 45.648  41.210  -16.783 1.00 41.27  ? 1282 MET A CE    1 
ATOM   6532 N  N     . ALA A 1 869  ? 44.636  39.608  -11.488 1.00 34.29  ? 1283 ALA A N     1 
ATOM   6533 C  CA    . ALA A 1 869  ? 44.190  39.200  -10.165 1.00 34.56  ? 1283 ALA A CA    1 
ATOM   6534 C  C     . ALA A 1 869  ? 44.472  40.280  -9.112  1.00 34.14  ? 1283 ALA A C     1 
ATOM   6535 O  O     . ALA A 1 869  ? 43.633  40.564  -8.272  1.00 34.14  ? 1283 ALA A O     1 
ATOM   6536 C  CB    . ALA A 1 869  ? 44.867  37.903  -9.770  1.00 35.12  ? 1283 ALA A CB    1 
ATOM   6537 N  N     . VAL A 1 870  ? 45.663  40.865  -9.160  1.00 33.93  ? 1284 VAL A N     1 
ATOM   6538 C  CA    . VAL A 1 870  ? 46.088  41.833  -8.156  1.00 33.59  ? 1284 VAL A CA    1 
ATOM   6539 C  C     . VAL A 1 870  ? 45.319  43.147  -8.312  1.00 33.52  ? 1284 VAL A C     1 
ATOM   6540 O  O     . VAL A 1 870  ? 44.900  43.748  -7.314  1.00 33.58  ? 1284 VAL A O     1 
ATOM   6541 C  CB    . VAL A 1 870  ? 47.637  42.011  -8.162  1.00 33.82  ? 1284 VAL A CB    1 
ATOM   6542 C  CG1   . VAL A 1 870  ? 48.065  43.276  -7.440  1.00 33.05  ? 1284 VAL A CG1   1 
ATOM   6543 C  CG2   . VAL A 1 870  ? 48.299  40.784  -7.529  1.00 33.74  ? 1284 VAL A CG2   1 
ATOM   6544 N  N     . ARG A 1 871  ? 45.113  43.586  -9.551  1.00 32.91  ? 1285 ARG A N     1 
ATOM   6545 C  CA    . ARG A 1 871  ? 44.241  44.731  -9.806  1.00 33.06  ? 1285 ARG A CA    1 
ATOM   6546 C  C     . ARG A 1 871  ? 42.891  44.538  -9.136  1.00 33.31  ? 1285 ARG A C     1 
ATOM   6547 O  O     . ARG A 1 871  ? 42.425  45.395  -8.422  1.00 33.93  ? 1285 ARG A O     1 
ATOM   6548 C  CB    . ARG A 1 871  ? 44.071  44.974  -11.317 1.00 32.45  ? 1285 ARG A CB    1 
ATOM   6549 C  CG    . ARG A 1 871  ? 45.117  45.943  -11.905 1.00 32.88  ? 1285 ARG A CG    1 
ATOM   6550 C  CD    . ARG A 1 871  ? 45.421  45.682  -13.367 1.00 31.51  ? 1285 ARG A CD    1 
ATOM   6551 N  NE    . ARG A 1 871  ? 46.595  46.435  -13.835 1.00 32.92  ? 1285 ARG A NE    1 
ATOM   6552 C  CZ    . ARG A 1 871  ? 47.004  46.471  -15.107 1.00 32.73  ? 1285 ARG A CZ    1 
ATOM   6553 N  NH1   . ARG A 1 871  ? 46.333  45.814  -16.044 1.00 30.50  ? 1285 ARG A NH1   1 
ATOM   6554 N  NH2   . ARG A 1 871  ? 48.071  47.184  -15.456 1.00 33.63  ? 1285 ARG A NH2   1 
ATOM   6555 N  N     . ILE A 1 872  ? 42.258  43.403  -9.371  1.00 33.98  ? 1286 ILE A N     1 
ATOM   6556 C  CA    . ILE A 1 872  ? 40.935  43.154  -8.828  1.00 34.53  ? 1286 ILE A CA    1 
ATOM   6557 C  C     . ILE A 1 872  ? 40.996  43.024  -7.307  1.00 34.91  ? 1286 ILE A C     1 
ATOM   6558 O  O     . ILE A 1 872  ? 40.136  43.521  -6.591  1.00 34.87  ? 1286 ILE A O     1 
ATOM   6559 C  CB    . ILE A 1 872  ? 40.336  41.878  -9.439  1.00 34.50  ? 1286 ILE A CB    1 
ATOM   6560 C  CG1   . ILE A 1 872  ? 39.969  42.149  -10.894 1.00 33.07  ? 1286 ILE A CG1   1 
ATOM   6561 C  CG2   . ILE A 1 872  ? 39.101  41.428  -8.631  1.00 35.06  ? 1286 ILE A CG2   1 
ATOM   6562 C  CD1   . ILE A 1 872  ? 39.956  40.917  -11.758 1.00 32.45  ? 1286 ILE A CD1   1 
ATOM   6563 N  N     . ALA A 1 873  ? 42.035  42.361  -6.817  1.00 35.36  ? 1287 ALA A N     1 
ATOM   6564 C  CA    . ALA A 1 873  ? 42.229  42.234  -5.384  1.00 35.92  ? 1287 ALA A CA    1 
ATOM   6565 C  C     . ALA A 1 873  ? 42.227  43.611  -4.751  1.00 36.41  ? 1287 ALA A C     1 
ATOM   6566 O  O     . ALA A 1 873  ? 41.728  43.804  -3.644  1.00 36.47  ? 1287 ALA A O     1 
ATOM   6567 C  CB    . ALA A 1 873  ? 43.546  41.526  -5.095  1.00 36.12  ? 1287 ALA A CB    1 
ATOM   6568 N  N     . TYR A 1 874  ? 42.807  44.579  -5.455  1.00 36.68  ? 1288 TYR A N     1 
ATOM   6569 C  CA    . TYR A 1 874  ? 42.921  45.908  -4.895  1.00 36.67  ? 1288 TYR A CA    1 
ATOM   6570 C  C     . TYR A 1 874  ? 41.541  46.433  -4.572  1.00 36.41  ? 1288 TYR A C     1 
ATOM   6571 O  O     . TYR A 1 874  ? 41.329  47.055  -3.544  1.00 36.06  ? 1288 TYR A O     1 
ATOM   6572 C  CB    . TYR A 1 874  ? 43.607  46.835  -5.877  1.00 36.65  ? 1288 TYR A CB    1 
ATOM   6573 C  CG    . TYR A 1 874  ? 43.661  48.269  -5.453  1.00 37.03  ? 1288 TYR A CG    1 
ATOM   6574 C  CD1   . TYR A 1 874  ? 44.714  48.759  -4.685  1.00 38.91  ? 1288 TYR A CD1   1 
ATOM   6575 C  CD2   . TYR A 1 874  ? 42.679  49.154  -5.853  1.00 38.96  ? 1288 TYR A CD2   1 
ATOM   6576 C  CE1   . TYR A 1 874  ? 44.779  50.117  -4.325  1.00 39.67  ? 1288 TYR A CE1   1 
ATOM   6577 C  CE2   . TYR A 1 874  ? 42.725  50.492  -5.498  1.00 39.98  ? 1288 TYR A CE2   1 
ATOM   6578 C  CZ    . TYR A 1 874  ? 43.773  50.976  -4.736  1.00 40.79  ? 1288 TYR A CZ    1 
ATOM   6579 O  OH    . TYR A 1 874  ? 43.790  52.331  -4.406  1.00 42.50  ? 1288 TYR A OH    1 
ATOM   6580 N  N     . PHE A 1 875  ? 40.596  46.183  -5.459  1.00 36.37  ? 1289 PHE A N     1 
ATOM   6581 C  CA    . PHE A 1 875  ? 39.240  46.626  -5.187  1.00 36.23  ? 1289 PHE A CA    1 
ATOM   6582 C  C     . PHE A 1 875  ? 38.602  45.754  -4.096  1.00 35.81  ? 1289 PHE A C     1 
ATOM   6583 O  O     . PHE A 1 875  ? 37.840  46.247  -3.270  1.00 35.58  ? 1289 PHE A O     1 
ATOM   6584 C  CB    . PHE A 1 875  ? 38.412  46.649  -6.477  1.00 36.52  ? 1289 PHE A CB    1 
ATOM   6585 C  CG    . PHE A 1 875  ? 38.855  47.708  -7.458  1.00 37.00  ? 1289 PHE A CG    1 
ATOM   6586 C  CD1   . PHE A 1 875  ? 38.333  49.002  -7.396  1.00 37.42  ? 1289 PHE A CD1   1 
ATOM   6587 C  CD2   . PHE A 1 875  ? 39.796  47.422  -8.430  1.00 35.93  ? 1289 PHE A CD2   1 
ATOM   6588 C  CE1   . PHE A 1 875  ? 38.750  49.988  -8.301  1.00 37.53  ? 1289 PHE A CE1   1 
ATOM   6589 C  CE2   . PHE A 1 875  ? 40.215  48.410  -9.336  1.00 36.85  ? 1289 PHE A CE2   1 
ATOM   6590 C  CZ    . PHE A 1 875  ? 39.687  49.694  -9.268  1.00 35.22  ? 1289 PHE A CZ    1 
ATOM   6591 N  N     . LYS A 1 876  ? 38.929  44.462  -4.067  1.00 35.34  ? 1290 LYS A N     1 
ATOM   6592 C  CA    . LYS A 1 876  ? 38.314  43.607  -3.056  1.00 34.76  ? 1290 LYS A CA    1 
ATOM   6593 C  C     . LYS A 1 876  ? 38.542  44.201  -1.655  1.00 34.61  ? 1290 LYS A C     1 
ATOM   6594 O  O     . LYS A 1 876  ? 37.683  44.115  -0.785  1.00 33.64  ? 1290 LYS A O     1 
ATOM   6595 C  CB    . LYS A 1 876  ? 38.826  42.164  -3.102  1.00 34.18  ? 1290 LYS A CB    1 
ATOM   6596 C  CG    . LYS A 1 876  ? 38.036  41.237  -2.153  1.00 34.35  ? 1290 LYS A CG    1 
ATOM   6597 C  CD    . LYS A 1 876  ? 38.473  39.774  -2.179  1.00 34.84  ? 1290 LYS A CD    1 
ATOM   6598 C  CE    . LYS A 1 876  ? 37.576  38.919  -1.273  1.00 35.16  ? 1290 LYS A CE    1 
ATOM   6599 N  NZ    . LYS A 1 876  ? 37.811  37.451  -1.443  1.00 36.36  ? 1290 LYS A NZ    1 
ATOM   6600 N  N     . VAL A 1 877  ? 39.712  44.802  -1.459  1.00 34.63  ? 1291 VAL A N     1 
ATOM   6601 C  CA    . VAL A 1 877  ? 40.126  45.227  -0.146  1.00 34.52  ? 1291 VAL A CA    1 
ATOM   6602 C  C     . VAL A 1 877  ? 39.685  46.655  0.071   1.00 34.81  ? 1291 VAL A C     1 
ATOM   6603 O  O     . VAL A 1 877  ? 39.069  46.969  1.076   1.00 35.03  ? 1291 VAL A O     1 
ATOM   6604 C  CB    . VAL A 1 877  ? 41.663  45.109  0.051   1.00 34.63  ? 1291 VAL A CB    1 
ATOM   6605 C  CG1   . VAL A 1 877  ? 42.096  45.864  1.326   1.00 34.45  ? 1291 VAL A CG1   1 
ATOM   6606 C  CG2   . VAL A 1 877  ? 42.095  43.648  0.128   1.00 33.90  ? 1291 VAL A CG2   1 
ATOM   6607 N  N     . HIS A 1 878  ? 39.965  47.528  -0.880  1.00 35.04  ? 1292 HIS A N     1 
ATOM   6608 C  CA    . HIS A 1 878  ? 39.789  48.942  -0.605  1.00 35.78  ? 1292 HIS A CA    1 
ATOM   6609 C  C     . HIS A 1 878  ? 38.410  49.491  -0.955  1.00 36.20  ? 1292 HIS A C     1 
ATOM   6610 O  O     . HIS A 1 878  ? 38.000  50.509  -0.405  1.00 36.04  ? 1292 HIS A O     1 
ATOM   6611 C  CB    . HIS A 1 878  ? 40.865  49.756  -1.310  1.00 35.86  ? 1292 HIS A CB    1 
ATOM   6612 C  CG    . HIS A 1 878  ? 42.243  49.510  -0.791  1.00 35.83  ? 1292 HIS A CG    1 
ATOM   6613 N  ND1   . HIS A 1 878  ? 42.599  49.764  0.513   1.00 36.18  ? 1292 HIS A ND1   1 
ATOM   6614 C  CD2   . HIS A 1 878  ? 43.359  49.058  -1.408  1.00 36.18  ? 1292 HIS A CD2   1 
ATOM   6615 C  CE1   . HIS A 1 878  ? 43.876  49.475  0.681   1.00 36.63  ? 1292 HIS A CE1   1 
ATOM   6616 N  NE2   . HIS A 1 878  ? 44.362  49.049  -0.471  1.00 37.22  ? 1292 HIS A NE2   1 
ATOM   6617 N  N     . HIS A 1 879  ? 37.711  48.813  -1.870  1.00 36.53  ? 1293 HIS A N     1 
ATOM   6618 C  CA    . HIS A 1 879  ? 36.394  49.240  -2.333  1.00 36.33  ? 1293 HIS A CA    1 
ATOM   6619 C  C     . HIS A 1 879  ? 35.460  48.034  -2.446  1.00 36.64  ? 1293 HIS A C     1 
ATOM   6620 O  O     . HIS A 1 879  ? 34.994  47.668  -3.524  1.00 36.26  ? 1293 HIS A O     1 
ATOM   6621 C  CB    . HIS A 1 879  ? 36.538  49.929  -3.681  1.00 36.15  ? 1293 HIS A CB    1 
ATOM   6622 C  CG    . HIS A 1 879  ? 37.533  51.045  -3.674  1.00 35.90  ? 1293 HIS A CG    1 
ATOM   6623 N  ND1   . HIS A 1 879  ? 37.233  52.306  -3.197  1.00 36.72  ? 1293 HIS A ND1   1 
ATOM   6624 C  CD2   . HIS A 1 879  ? 38.821  51.095  -4.085  1.00 34.34  ? 1293 HIS A CD2   1 
ATOM   6625 C  CE1   . HIS A 1 879  ? 38.295  53.084  -3.318  1.00 35.78  ? 1293 HIS A CE1   1 
ATOM   6626 N  NE2   . HIS A 1 879  ? 39.272  52.374  -3.856  1.00 35.31  ? 1293 HIS A NE2   1 
ATOM   6627 N  N     . PRO A 1 880  ? 35.179  47.411  -1.312  1.00 36.99  ? 1294 PRO A N     1 
ATOM   6628 C  CA    . PRO A 1 880  ? 34.473  46.130  -1.287  1.00 37.00  ? 1294 PRO A CA    1 
ATOM   6629 C  C     . PRO A 1 880  ? 33.146  46.037  -2.075  1.00 37.24  ? 1294 PRO A C     1 
ATOM   6630 O  O     . PRO A 1 880  ? 32.953  45.060  -2.811  1.00 37.50  ? 1294 PRO A O     1 
ATOM   6631 C  CB    . PRO A 1 880  ? 34.275  45.865  0.215   1.00 37.31  ? 1294 PRO A CB    1 
ATOM   6632 C  CG    . PRO A 1 880  ? 34.722  47.152  0.946   1.00 37.04  ? 1294 PRO A CG    1 
ATOM   6633 C  CD    . PRO A 1 880  ? 35.661  47.834  0.016   1.00 36.97  ? 1294 PRO A CD    1 
ATOM   6634 N  N     . LEU A 1 881  ? 32.236  47.001  -1.915  1.00 37.15  ? 1295 LEU A N     1 
ATOM   6635 C  CA    . LEU A 1 881  ? 30.922  46.947  -2.572  1.00 36.60  ? 1295 LEU A CA    1 
ATOM   6636 C  C     . LEU A 1 881  ? 31.046  47.042  -4.066  1.00 36.56  ? 1295 LEU A C     1 
ATOM   6637 O  O     . LEU A 1 881  ? 30.190  46.544  -4.826  1.00 36.44  ? 1295 LEU A O     1 
ATOM   6638 C  CB    . LEU A 1 881  ? 30.031  48.104  -2.128  1.00 37.01  ? 1295 LEU A CB    1 
ATOM   6639 C  CG    . LEU A 1 881  ? 28.931  47.805  -1.115  1.00 38.16  ? 1295 LEU A CG    1 
ATOM   6640 C  CD1   . LEU A 1 881  ? 28.031  49.012  -0.986  1.00 39.26  ? 1295 LEU A CD1   1 
ATOM   6641 C  CD2   . LEU A 1 881  ? 28.119  46.557  -1.509  1.00 38.12  ? 1295 LEU A CD2   1 
ATOM   6642 N  N     . LEU A 1 882  ? 32.084  47.744  -4.490  1.00 36.18  ? 1296 LEU A N     1 
ATOM   6643 C  CA    . LEU A 1 882  ? 32.368  47.885  -5.908  1.00 36.01  ? 1296 LEU A CA    1 
ATOM   6644 C  C     . LEU A 1 882  ? 32.824  46.544  -6.440  1.00 35.34  ? 1296 LEU A C     1 
ATOM   6645 O  O     . LEU A 1 882  ? 32.396  46.114  -7.511  1.00 34.73  ? 1296 LEU A O     1 
ATOM   6646 C  CB    . LEU A 1 882  ? 33.441  48.946  -6.139  1.00 36.30  ? 1296 LEU A CB    1 
ATOM   6647 C  CG    . LEU A 1 882  ? 32.908  50.380  -6.264  1.00 37.61  ? 1296 LEU A CG    1 
ATOM   6648 C  CD1   . LEU A 1 882  ? 32.272  50.877  -4.973  1.00 38.98  ? 1296 LEU A CD1   1 
ATOM   6649 C  CD2   . LEU A 1 882  ? 34.028  51.306  -6.681  1.00 37.44  ? 1296 LEU A CD2   1 
ATOM   6650 N  N     . TYR A 1 883  ? 33.680  45.885  -5.665  1.00 34.86  ? 1297 TYR A N     1 
ATOM   6651 C  CA    . TYR A 1 883  ? 34.118  44.532  -5.956  1.00 34.69  ? 1297 TYR A CA    1 
ATOM   6652 C  C     . TYR A 1 883  ? 32.947  43.562  -6.039  1.00 34.48  ? 1297 TYR A C     1 
ATOM   6653 O  O     . TYR A 1 883  ? 32.825  42.799  -6.990  1.00 34.43  ? 1297 TYR A O     1 
ATOM   6654 C  CB    . TYR A 1 883  ? 35.074  44.052  -4.876  1.00 34.87  ? 1297 TYR A CB    1 
ATOM   6655 C  CG    . TYR A 1 883  ? 35.421  42.594  -5.028  1.00 35.80  ? 1297 TYR A CG    1 
ATOM   6656 C  CD1   . TYR A 1 883  ? 36.236  42.156  -6.074  1.00 34.69  ? 1297 TYR A CD1   1 
ATOM   6657 C  CD2   . TYR A 1 883  ? 34.936  41.651  -4.130  1.00 36.32  ? 1297 TYR A CD2   1 
ATOM   6658 C  CE1   . TYR A 1 883  ? 36.559  40.807  -6.214  1.00 34.31  ? 1297 TYR A CE1   1 
ATOM   6659 C  CE2   . TYR A 1 883  ? 35.256  40.324  -4.260  1.00 36.88  ? 1297 TYR A CE2   1 
ATOM   6660 C  CZ    . TYR A 1 883  ? 36.066  39.910  -5.307  1.00 36.08  ? 1297 TYR A CZ    1 
ATOM   6661 O  OH    . TYR A 1 883  ? 36.361  38.581  -5.417  1.00 39.68  ? 1297 TYR A OH    1 
ATOM   6662 N  N     . TYR A 1 884  ? 32.064  43.593  -5.050  1.00 34.03  ? 1298 TYR A N     1 
ATOM   6663 C  CA    . TYR A 1 884  ? 30.906  42.707  -5.111  1.00 33.66  ? 1298 TYR A CA    1 
ATOM   6664 C  C     . TYR A 1 884  ? 29.924  43.069  -6.242  1.00 33.30  ? 1298 TYR A C     1 
ATOM   6665 O  O     . TYR A 1 884  ? 29.492  42.201  -6.988  1.00 33.88  ? 1298 TYR A O     1 
ATOM   6666 C  CB    . TYR A 1 884  ? 30.221  42.566  -3.743  1.00 33.29  ? 1298 TYR A CB    1 
ATOM   6667 C  CG    . TYR A 1 884  ? 31.135  41.979  -2.697  1.00 32.79  ? 1298 TYR A CG    1 
ATOM   6668 C  CD1   . TYR A 1 884  ? 31.513  42.714  -1.565  1.00 30.74  ? 1298 TYR A CD1   1 
ATOM   6669 C  CD2   . TYR A 1 884  ? 31.641  40.687  -2.839  1.00 30.17  ? 1298 TYR A CD2   1 
ATOM   6670 C  CE1   . TYR A 1 884  ? 32.368  42.166  -0.616  1.00 29.63  ? 1298 TYR A CE1   1 
ATOM   6671 C  CE2   . TYR A 1 884  ? 32.497  40.141  -1.893  1.00 28.79  ? 1298 TYR A CE2   1 
ATOM   6672 C  CZ    . TYR A 1 884  ? 32.866  40.873  -0.795  1.00 29.32  ? 1298 TYR A CZ    1 
ATOM   6673 O  OH    . TYR A 1 884  ? 33.719  40.297  0.136   1.00 28.29  ? 1298 TYR A OH    1 
ATOM   6674 N  N     . ALA A 1 885  ? 29.579  44.330  -6.406  1.00 32.84  ? 1299 ALA A N     1 
ATOM   6675 C  CA    . ALA A 1 885  ? 28.674  44.645  -7.498  1.00 32.62  ? 1299 ALA A CA    1 
ATOM   6676 C  C     . ALA A 1 885  ? 29.240  44.050  -8.791  1.00 33.14  ? 1299 ALA A C     1 
ATOM   6677 O  O     . ALA A 1 885  ? 28.540  43.334  -9.519  1.00 33.21  ? 1299 ALA A O     1 
ATOM   6678 C  CB    . ALA A 1 885  ? 28.467  46.136  -7.627  1.00 31.92  ? 1299 ALA A CB    1 
ATOM   6679 N  N     . SER A 1 886  ? 30.511  44.328  -9.077  1.00 33.27  ? 1300 SER A N     1 
ATOM   6680 C  CA    . SER A 1 886  ? 31.101  43.881  -10.352 1.00 33.25  ? 1300 SER A CA    1 
ATOM   6681 C  C     . SER A 1 886  ? 31.159  42.371  -10.434 1.00 33.33  ? 1300 SER A C     1 
ATOM   6682 O  O     . SER A 1 886  ? 30.953  41.814  -11.512 1.00 34.15  ? 1300 SER A O     1 
ATOM   6683 C  CB    . SER A 1 886  ? 32.490  44.470  -10.595 1.00 33.04  ? 1300 SER A CB    1 
ATOM   6684 O  OG    . SER A 1 886  ? 33.487  43.697  -9.954  1.00 32.52  ? 1300 SER A OG    1 
ATOM   6685 N  N     . TYR A 1 887  ? 31.418  41.706  -9.307  1.00 32.92  ? 1301 TYR A N     1 
ATOM   6686 C  CA    . TYR A 1 887  ? 31.381  40.245  -9.265  1.00 32.82  ? 1301 TYR A CA    1 
ATOM   6687 C  C     . TYR A 1 887  ? 30.040  39.617  -9.641  1.00 32.74  ? 1301 TYR A C     1 
ATOM   6688 O  O     . TYR A 1 887  ? 29.972  38.754  -10.512 1.00 32.26  ? 1301 TYR A O     1 
ATOM   6689 C  CB    . TYR A 1 887  ? 31.777  39.691  -7.894  1.00 33.58  ? 1301 TYR A CB    1 
ATOM   6690 C  CG    . TYR A 1 887  ? 31.858  38.185  -7.975  1.00 33.70  ? 1301 TYR A CG    1 
ATOM   6691 C  CD1   . TYR A 1 887  ? 33.060  37.545  -8.326  1.00 33.70  ? 1301 TYR A CD1   1 
ATOM   6692 C  CD2   . TYR A 1 887  ? 30.719  37.407  -7.805  1.00 33.64  ? 1301 TYR A CD2   1 
ATOM   6693 C  CE1   . TYR A 1 887  ? 33.135  36.175  -8.438  1.00 32.17  ? 1301 TYR A CE1   1 
ATOM   6694 C  CE2   . TYR A 1 887  ? 30.781  36.027  -7.921  1.00 35.31  ? 1301 TYR A CE2   1 
ATOM   6695 C  CZ    . TYR A 1 887  ? 31.998  35.424  -8.237  1.00 33.46  ? 1301 TYR A CZ    1 
ATOM   6696 O  OH    . TYR A 1 887  ? 32.043  34.078  -8.367  1.00 32.08  ? 1301 TYR A OH    1 
ATOM   6697 N  N     . PHE A 1 888  ? 28.974  40.030  -8.967  1.00 32.95  ? 1302 PHE A N     1 
ATOM   6698 C  CA    . PHE A 1 888  ? 27.654  39.483  -9.257  1.00 33.11  ? 1302 PHE A CA    1 
ATOM   6699 C  C     . PHE A 1 888  ? 27.099  39.981  -10.587 1.00 33.06  ? 1302 PHE A C     1 
ATOM   6700 O  O     . PHE A 1 888  ? 26.272  39.331  -11.213 1.00 33.24  ? 1302 PHE A O     1 
ATOM   6701 C  CB    . PHE A 1 888  ? 26.711  39.808  -8.121  1.00 32.73  ? 1302 PHE A CB    1 
ATOM   6702 C  CG    . PHE A 1 888  ? 27.188  39.295  -6.809  1.00 34.17  ? 1302 PHE A CG    1 
ATOM   6703 C  CD1   . PHE A 1 888  ? 27.112  37.941  -6.515  1.00 32.64  ? 1302 PHE A CD1   1 
ATOM   6704 C  CD2   . PHE A 1 888  ? 27.723  40.151  -5.859  1.00 36.10  ? 1302 PHE A CD2   1 
ATOM   6705 C  CE1   . PHE A 1 888  ? 27.527  37.460  -5.316  1.00 31.10  ? 1302 PHE A CE1   1 
ATOM   6706 C  CE2   . PHE A 1 888  ? 28.158  39.656  -4.639  1.00 34.51  ? 1302 PHE A CE2   1 
ATOM   6707 C  CZ    . PHE A 1 888  ? 28.056  38.308  -4.375  1.00 32.81  ? 1302 PHE A CZ    1 
ATOM   6708 N  N     . THR A 1 889  ? 27.548  41.136  -11.037 1.00 33.62  ? 1303 THR A N     1 
ATOM   6709 C  CA    . THR A 1 889  ? 27.046  41.639  -12.300 1.00 34.27  ? 1303 THR A CA    1 
ATOM   6710 C  C     . THR A 1 889  ? 27.675  40.863  -13.457 1.00 35.00  ? 1303 THR A C     1 
ATOM   6711 O  O     . THR A 1 889  ? 26.984  40.343  -14.333 1.00 35.82  ? 1303 THR A O     1 
ATOM   6712 C  CB    . THR A 1 889  ? 27.340  43.138  -12.441 1.00 34.66  ? 1303 THR A CB    1 
ATOM   6713 O  OG1   . THR A 1 889  ? 26.659  43.858  -11.397 1.00 34.64  ? 1303 THR A OG1   1 
ATOM   6714 C  CG2   . THR A 1 889  ? 26.902  43.689  -13.833 1.00 34.12  ? 1303 THR A CG2   1 
ATOM   6715 N  N     . VAL A 1 890  ? 28.994  40.765  -13.449 1.00 35.35  ? 1304 VAL A N     1 
ATOM   6716 C  CA    . VAL A 1 890  ? 29.734  40.200  -14.569 1.00 35.49  ? 1304 VAL A CA    1 
ATOM   6717 C  C     . VAL A 1 890  ? 29.871  38.662  -14.566 1.00 36.49  ? 1304 VAL A C     1 
ATOM   6718 O  O     . VAL A 1 890  ? 29.619  38.023  -15.593 1.00 37.49  ? 1304 VAL A O     1 
ATOM   6719 C  CB    . VAL A 1 890  ? 31.140  40.874  -14.664 1.00 35.19  ? 1304 VAL A CB    1 
ATOM   6720 C  CG1   . VAL A 1 890  ? 32.061  40.135  -15.655 1.00 33.86  ? 1304 VAL A CG1   1 
ATOM   6721 C  CG2   . VAL A 1 890  ? 30.993  42.329  -15.037 1.00 32.17  ? 1304 VAL A CG2   1 
ATOM   6722 N  N     . ARG A 1 891  ? 30.271  38.075  -13.433 1.00 37.19  ? 1305 ARG A N     1 
ATOM   6723 C  CA    . ARG A 1 891  ? 30.574  36.623  -13.342 1.00 37.49  ? 1305 ARG A CA    1 
ATOM   6724 C  C     . ARG A 1 891  ? 29.402  35.700  -12.960 1.00 37.81  ? 1305 ARG A C     1 
ATOM   6725 O  O     . ARG A 1 891  ? 29.182  34.705  -13.623 1.00 38.00  ? 1305 ARG A O     1 
ATOM   6726 C  CB    . ARG A 1 891  ? 31.779  36.356  -12.418 1.00 37.02  ? 1305 ARG A CB    1 
ATOM   6727 C  CG    . ARG A 1 891  ? 32.890  37.404  -12.504 1.00 37.07  ? 1305 ARG A CG    1 
ATOM   6728 C  CD    . ARG A 1 891  ? 34.093  37.070  -11.606 1.00 37.10  ? 1305 ARG A CD    1 
ATOM   6729 N  NE    . ARG A 1 891  ? 35.118  36.533  -12.469 1.00 41.70  ? 1305 ARG A NE    1 
ATOM   6730 C  CZ    . ARG A 1 891  ? 36.218  37.168  -12.854 1.00 40.15  ? 1305 ARG A CZ    1 
ATOM   6731 N  NH1   . ARG A 1 891  ? 36.528  38.368  -12.400 1.00 39.07  ? 1305 ARG A NH1   1 
ATOM   6732 N  NH2   . ARG A 1 891  ? 37.025  36.563  -13.689 1.00 42.20  ? 1305 ARG A NH2   1 
ATOM   6733 N  N     . ALA A 1 892  ? 28.649  36.030  -11.907 1.00 37.90  ? 1306 ALA A N     1 
ATOM   6734 C  CA    . ALA A 1 892  ? 27.587  35.151  -11.402 1.00 37.73  ? 1306 ALA A CA    1 
ATOM   6735 C  C     . ALA A 1 892  ? 26.395  34.908  -12.342 1.00 38.03  ? 1306 ALA A C     1 
ATOM   6736 O  O     . ALA A 1 892  ? 25.842  35.838  -12.910 1.00 37.76  ? 1306 ALA A O     1 
ATOM   6737 C  CB    . ALA A 1 892  ? 27.078  35.679  -10.071 1.00 37.55  ? 1306 ALA A CB    1 
ATOM   6738 N  N     . GLU A 1 893  ? 25.963  33.657  -12.451 1.00 38.54  ? 1307 GLU A N     1 
ATOM   6739 C  CA    . GLU A 1 893  ? 24.754  33.338  -13.196 1.00 39.31  ? 1307 GLU A CA    1 
ATOM   6740 C  C     . GLU A 1 893  ? 23.829  32.390  -12.443 1.00 39.21  ? 1307 GLU A C     1 
ATOM   6741 O  O     . GLU A 1 893  ? 22.827  31.917  -12.973 1.00 39.84  ? 1307 GLU A O     1 
ATOM   6742 C  CB    . GLU A 1 893  ? 25.108  32.735  -14.556 1.00 39.90  ? 1307 GLU A CB    1 
ATOM   6743 C  CG    . GLU A 1 893  ? 25.666  33.727  -15.556 1.00 42.56  ? 1307 GLU A CG    1 
ATOM   6744 C  CD    . GLU A 1 893  ? 26.127  33.031  -16.809 1.00 47.67  ? 1307 GLU A CD    1 
ATOM   6745 O  OE1   . GLU A 1 893  ? 26.860  33.651  -17.609 1.00 50.80  ? 1307 GLU A OE1   1 
ATOM   6746 O  OE2   . GLU A 1 893  ? 25.769  31.846  -16.983 1.00 49.33  ? 1307 GLU A OE2   1 
ATOM   6747 N  N     . ASP A 1 894  ? 24.156  32.098  -11.202 1.00 39.19  ? 1308 ASP A N     1 
ATOM   6748 C  CA    . ASP A 1 894  ? 23.351  31.154  -10.450 1.00 39.32  ? 1308 ASP A CA    1 
ATOM   6749 C  C     . ASP A 1 894  ? 23.190  31.755  -9.096  1.00 38.86  ? 1308 ASP A C     1 
ATOM   6750 O  O     . ASP A 1 894  ? 24.173  32.053  -8.430  1.00 39.48  ? 1308 ASP A O     1 
ATOM   6751 C  CB    . ASP A 1 894  ? 24.044  29.789  -10.326 1.00 39.69  ? 1308 ASP A CB    1 
ATOM   6752 C  CG    . ASP A 1 894  ? 24.299  29.148  -11.660 1.00 40.37  ? 1308 ASP A CG    1 
ATOM   6753 O  OD1   . ASP A 1 894  ? 23.506  28.257  -12.051 1.00 42.18  ? 1308 ASP A OD1   1 
ATOM   6754 O  OD2   . ASP A 1 894  ? 25.284  29.554  -12.323 1.00 40.93  ? 1308 ASP A OD2   1 
ATOM   6755 N  N     . PHE A 1 895  ? 21.950  31.934  -8.689  1.00 38.56  ? 1309 PHE A N     1 
ATOM   6756 C  CA    . PHE A 1 895  ? 21.666  32.594  -7.438  1.00 38.13  ? 1309 PHE A CA    1 
ATOM   6757 C  C     . PHE A 1 895  ? 20.656  31.799  -6.588  1.00 38.28  ? 1309 PHE A C     1 
ATOM   6758 O  O     . PHE A 1 895  ? 19.872  30.996  -7.110  1.00 37.21  ? 1309 PHE A O     1 
ATOM   6759 C  CB    . PHE A 1 895  ? 21.113  33.993  -7.731  1.00 37.52  ? 1309 PHE A CB    1 
ATOM   6760 C  CG    . PHE A 1 895  ? 22.019  34.852  -8.582  1.00 35.45  ? 1309 PHE A CG    1 
ATOM   6761 C  CD1   . PHE A 1 895  ? 23.000  35.647  -7.997  1.00 31.86  ? 1309 PHE A CD1   1 
ATOM   6762 C  CD2   . PHE A 1 895  ? 21.887  34.873  -9.962  1.00 33.88  ? 1309 PHE A CD2   1 
ATOM   6763 C  CE1   . PHE A 1 895  ? 23.820  36.448  -8.760  1.00 30.30  ? 1309 PHE A CE1   1 
ATOM   6764 C  CE2   . PHE A 1 895  ? 22.725  35.677  -10.749 1.00 31.12  ? 1309 PHE A CE2   1 
ATOM   6765 C  CZ    . PHE A 1 895  ? 23.689  36.466  -10.149 1.00 29.44  ? 1309 PHE A CZ    1 
ATOM   6766 N  N     . ASP A 1 896  ? 20.706  32.028  -5.277  1.00 38.76  ? 1310 ASP A N     1 
ATOM   6767 C  CA    . ASP A 1 896  ? 19.577  31.790  -4.386  1.00 39.51  ? 1310 ASP A CA    1 
ATOM   6768 C  C     . ASP A 1 896  ? 19.266  33.135  -3.735  1.00 39.66  ? 1310 ASP A C     1 
ATOM   6769 O  O     . ASP A 1 896  ? 19.831  33.479  -2.684  1.00 39.45  ? 1310 ASP A O     1 
ATOM   6770 C  CB    . ASP A 1 896  ? 19.916  30.740  -3.334  1.00 39.80  ? 1310 ASP A CB    1 
ATOM   6771 C  CG    . ASP A 1 896  ? 18.737  30.416  -2.421  1.00 41.44  ? 1310 ASP A CG    1 
ATOM   6772 O  OD1   . ASP A 1 896  ? 17.951  31.329  -2.072  1.00 43.36  ? 1310 ASP A OD1   1 
ATOM   6773 O  OD2   . ASP A 1 896  ? 18.603  29.239  -2.033  1.00 43.78  ? 1310 ASP A OD2   1 
ATOM   6774 N  N     . LEU A 1 897  ? 18.395  33.904  -4.378  1.00 39.83  ? 1311 LEU A N     1 
ATOM   6775 C  CA    . LEU A 1 897  ? 18.149  35.289  -3.968  1.00 40.24  ? 1311 LEU A CA    1 
ATOM   6776 C  C     . LEU A 1 897  ? 17.487  35.389  -2.614  1.00 40.57  ? 1311 LEU A C     1 
ATOM   6777 O  O     . LEU A 1 897  ? 17.806  36.276  -1.818  1.00 41.28  ? 1311 LEU A O     1 
ATOM   6778 C  CB    . LEU A 1 897  ? 17.277  36.009  -4.986  1.00 39.86  ? 1311 LEU A CB    1 
ATOM   6779 C  CG    . LEU A 1 897  ? 17.978  36.329  -6.307  1.00 40.72  ? 1311 LEU A CG    1 
ATOM   6780 C  CD1   . LEU A 1 897  ? 16.974  36.902  -7.317  1.00 40.24  ? 1311 LEU A CD1   1 
ATOM   6781 C  CD2   . LEU A 1 897  ? 19.148  37.285  -6.076  1.00 40.31  ? 1311 LEU A CD2   1 
ATOM   6782 N  N     . ASP A 1 898  ? 16.541  34.498  -2.349  1.00 40.50  ? 1312 ASP A N     1 
ATOM   6783 C  CA    . ASP A 1 898  ? 15.900  34.495  -1.051  1.00 40.25  ? 1312 ASP A CA    1 
ATOM   6784 C  C     . ASP A 1 898  ? 16.909  34.264  0.087   1.00 39.93  ? 1312 ASP A C     1 
ATOM   6785 O  O     . ASP A 1 898  ? 16.881  34.949  1.118   1.00 40.05  ? 1312 ASP A O     1 
ATOM   6786 C  CB    . ASP A 1 898  ? 14.811  33.439  -1.031  1.00 40.18  ? 1312 ASP A CB    1 
ATOM   6787 C  CG    . ASP A 1 898  ? 13.698  33.754  -1.989  1.00 40.68  ? 1312 ASP A CG    1 
ATOM   6788 O  OD1   . ASP A 1 898  ? 12.991  32.797  -2.387  1.00 41.46  ? 1312 ASP A OD1   1 
ATOM   6789 O  OD2   . ASP A 1 898  ? 13.517  34.956  -2.320  1.00 39.25  ? 1312 ASP A OD2   1 
ATOM   6790 N  N     . ALA A 1 899  ? 17.802  33.303  -0.109  1.00 39.45  ? 1313 ALA A N     1 
ATOM   6791 C  CA    . ALA A 1 899  ? 18.865  33.062  0.848   1.00 39.51  ? 1313 ALA A CA    1 
ATOM   6792 C  C     . ALA A 1 899  ? 19.707  34.317  0.970   1.00 39.46  ? 1313 ALA A C     1 
ATOM   6793 O  O     . ALA A 1 899  ? 19.921  34.842  2.066   1.00 38.81  ? 1313 ALA A O     1 
ATOM   6794 C  CB    . ALA A 1 899  ? 19.715  31.905  0.391   1.00 39.36  ? 1313 ALA A CB    1 
ATOM   6795 N  N     . MET A 1 900  ? 20.170  34.810  -0.176  1.00 40.16  ? 1314 MET A N     1 
ATOM   6796 C  CA    . MET A 1 900  ? 21.071  35.977  -0.193  1.00 40.14  ? 1314 MET A CA    1 
ATOM   6797 C  C     . MET A 1 900  ? 20.470  37.168  0.532   1.00 40.29  ? 1314 MET A C     1 
ATOM   6798 O  O     . MET A 1 900  ? 21.165  37.868  1.261   1.00 40.63  ? 1314 MET A O     1 
ATOM   6799 C  CB    . MET A 1 900  ? 21.520  36.332  -1.609  1.00 39.66  ? 1314 MET A CB    1 
ATOM   6800 C  CG    . MET A 1 900  ? 22.406  35.270  -2.244  1.00 40.18  ? 1314 MET A CG    1 
ATOM   6801 S  SD    . MET A 1 900  ? 22.377  35.338  -4.048  1.00 42.80  ? 1314 MET A SD    1 
ATOM   6802 C  CE    . MET A 1 900  ? 23.333  36.829  -4.324  1.00 42.63  ? 1314 MET A CE    1 
ATOM   6803 N  N     . ILE A 1 901  ? 19.168  37.371  0.373   1.00 40.38  ? 1315 ILE A N     1 
ATOM   6804 C  CA    . ILE A 1 901  ? 18.505  38.510  0.997   1.00 40.09  ? 1315 ILE A CA    1 
ATOM   6805 C  C     . ILE A 1 901  ? 18.300  38.352  2.515   1.00 40.61  ? 1315 ILE A C     1 
ATOM   6806 O  O     . ILE A 1 901  ? 18.502  39.298  3.275   1.00 40.28  ? 1315 ILE A O     1 
ATOM   6807 C  CB    . ILE A 1 901  ? 17.145  38.806  0.315   1.00 40.11  ? 1315 ILE A CB    1 
ATOM   6808 C  CG1   . ILE A 1 901  ? 17.360  39.172  -1.170  1.00 39.07  ? 1315 ILE A CG1   1 
ATOM   6809 C  CG2   . ILE A 1 901  ? 16.386  39.856  1.118   1.00 37.78  ? 1315 ILE A CG2   1 
ATOM   6810 C  CD1   . ILE A 1 901  ? 16.130  38.983  -2.070  1.00 37.39  ? 1315 ILE A CD1   1 
ATOM   6811 N  N     . LYS A 1 902  ? 17.858  37.175  2.955   1.00 41.24  ? 1316 LYS A N     1 
ATOM   6812 C  CA    . LYS A 1 902  ? 17.794  36.900  4.398   1.00 41.83  ? 1316 LYS A CA    1 
ATOM   6813 C  C     . LYS A 1 902  ? 19.164  37.205  4.997   1.00 41.44  ? 1316 LYS A C     1 
ATOM   6814 O  O     . LYS A 1 902  ? 19.262  37.802  6.077   1.00 41.52  ? 1316 LYS A O     1 
ATOM   6815 C  CB    . LYS A 1 902  ? 17.419  35.444  4.695   1.00 42.09  ? 1316 LYS A CB    1 
ATOM   6816 C  CG    . LYS A 1 902  ? 15.940  35.090  4.511   1.00 45.20  ? 1316 LYS A CG    1 
ATOM   6817 C  CD    . LYS A 1 902  ? 15.590  33.799  5.301   1.00 50.84  ? 1316 LYS A CD    1 
ATOM   6818 C  CE    . LYS A 1 902  ? 14.285  33.140  4.821   1.00 52.60  ? 1316 LYS A CE    1 
ATOM   6819 N  NZ    . LYS A 1 902  ? 14.336  32.662  3.397   1.00 53.42  ? 1316 LYS A NZ    1 
ATOM   6820 N  N     . GLY A 1 903  ? 20.217  36.784  4.294   1.00 40.35  ? 1317 GLY A N     1 
ATOM   6821 C  CA    . GLY A 1 903  ? 21.578  37.137  4.673   1.00 39.59  ? 1317 GLY A CA    1 
ATOM   6822 C  C     . GLY A 1 903  ? 22.446  36.031  5.255   1.00 39.42  ? 1317 GLY A C     1 
ATOM   6823 O  O     . GLY A 1 903  ? 22.240  34.833  5.023   1.00 39.30  ? 1317 GLY A O     1 
ATOM   6824 N  N     . SER A 1 904  ? 23.430  36.444  6.038   1.00 39.15  ? 1318 SER A N     1 
ATOM   6825 C  CA    . SER A 1 904  ? 24.523  35.553  6.408   1.00 38.93  ? 1318 SER A CA    1 
ATOM   6826 C  C     . SER A 1 904  ? 24.130  34.121  6.783   1.00 38.65  ? 1318 SER A C     1 
ATOM   6827 O  O     . SER A 1 904  ? 24.623  33.168  6.202   1.00 39.38  ? 1318 SER A O     1 
ATOM   6828 C  CB    . SER A 1 904  ? 25.325  36.179  7.533   1.00 38.64  ? 1318 SER A CB    1 
ATOM   6829 O  OG    . SER A 1 904  ? 26.633  35.693  7.486   1.00 38.85  ? 1318 SER A OG    1 
ATOM   6830 N  N     . ALA A 1 905  ? 23.270  33.960  7.773   1.00 38.40  ? 1319 ALA A N     1 
ATOM   6831 C  CA    . ALA A 1 905  ? 22.950  32.629  8.260   1.00 38.14  ? 1319 ALA A CA    1 
ATOM   6832 C  C     . ALA A 1 905  ? 22.209  31.801  7.221   1.00 38.31  ? 1319 ALA A C     1 
ATOM   6833 O  O     . ALA A 1 905  ? 22.449  30.610  7.091   1.00 38.05  ? 1319 ALA A O     1 
ATOM   6834 C  CB    . ALA A 1 905  ? 22.153  32.706  9.574   1.00 37.88  ? 1319 ALA A CB    1 
ATOM   6835 N  N     . ALA A 1 906  ? 21.290  32.419  6.491   1.00 39.15  ? 1320 ALA A N     1 
ATOM   6836 C  CA    . ALA A 1 906  ? 20.575  31.690  5.442   1.00 40.13  ? 1320 ALA A CA    1 
ATOM   6837 C  C     . ALA A 1 906  ? 21.524  31.202  4.332   1.00 40.68  ? 1320 ALA A C     1 
ATOM   6838 O  O     . ALA A 1 906  ? 21.417  30.061  3.885   1.00 40.32  ? 1320 ALA A O     1 
ATOM   6839 C  CB    . ALA A 1 906  ? 19.451  32.529  4.864   1.00 39.59  ? 1320 ALA A CB    1 
ATOM   6840 N  N     . ILE A 1 907  ? 22.446  32.068  3.901   1.00 41.55  ? 1321 ILE A N     1 
ATOM   6841 C  CA    . ILE A 1 907  ? 23.415  31.718  2.850   1.00 42.47  ? 1321 ILE A CA    1 
ATOM   6842 C  C     . ILE A 1 907  ? 24.229  30.511  3.292   1.00 42.59  ? 1321 ILE A C     1 
ATOM   6843 O  O     . ILE A 1 907  ? 24.411  29.538  2.542   1.00 42.29  ? 1321 ILE A O     1 
ATOM   6844 C  CB    . ILE A 1 907  ? 24.364  32.903  2.549   1.00 42.68  ? 1321 ILE A CB    1 
ATOM   6845 C  CG1   . ILE A 1 907  ? 23.555  34.097  2.061   1.00 43.08  ? 1321 ILE A CG1   1 
ATOM   6846 C  CG2   . ILE A 1 907  ? 25.435  32.541  1.501   1.00 42.40  ? 1321 ILE A CG2   1 
ATOM   6847 C  CD1   . ILE A 1 907  ? 24.266  35.377  2.233   1.00 44.15  ? 1321 ILE A CD1   1 
ATOM   6848 N  N     . ARG A 1 908  ? 24.690  30.570  4.533   1.00 43.01  ? 1322 ARG A N     1 
ATOM   6849 C  CA    . ARG A 1 908  ? 25.509  29.510  5.088   1.00 43.46  ? 1322 ARG A CA    1 
ATOM   6850 C  C     . ARG A 1 908  ? 24.723  28.198  5.083   1.00 43.67  ? 1322 ARG A C     1 
ATOM   6851 O  O     . ARG A 1 908  ? 25.240  27.139  4.727   1.00 43.81  ? 1322 ARG A O     1 
ATOM   6852 C  CB    . ARG A 1 908  ? 25.964  29.895  6.486   1.00 43.36  ? 1322 ARG A CB    1 
ATOM   6853 C  CG    . ARG A 1 908  ? 27.039  29.008  7.068   1.00 45.16  ? 1322 ARG A CG    1 
ATOM   6854 C  CD    . ARG A 1 908  ? 27.210  29.299  8.540   1.00 48.21  ? 1322 ARG A CD    1 
ATOM   6855 N  NE    . ARG A 1 908  ? 27.343  30.736  8.799   1.00 52.31  ? 1322 ARG A NE    1 
ATOM   6856 C  CZ    . ARG A 1 908  ? 28.505  31.377  8.948   1.00 53.12  ? 1322 ARG A CZ    1 
ATOM   6857 N  NH1   . ARG A 1 908  ? 29.659  30.708  8.883   1.00 52.11  ? 1322 ARG A NH1   1 
ATOM   6858 N  NH2   . ARG A 1 908  ? 28.512  32.688  9.179   1.00 53.13  ? 1322 ARG A NH2   1 
ATOM   6859 N  N     . LYS A 1 909  ? 23.457  28.265  5.455   1.00 44.10  ? 1323 LYS A N     1 
ATOM   6860 C  CA    . LYS A 1 909  ? 22.639  27.071  5.429   1.00 44.52  ? 1323 LYS A CA    1 
ATOM   6861 C  C     . LYS A 1 909  ? 22.606  26.430  4.039   1.00 44.62  ? 1323 LYS A C     1 
ATOM   6862 O  O     . LYS A 1 909  ? 22.660  25.208  3.921   1.00 44.90  ? 1323 LYS A O     1 
ATOM   6863 C  CB    . LYS A 1 909  ? 21.240  27.389  5.909   1.00 44.75  ? 1323 LYS A CB    1 
ATOM   6864 C  CG    . LYS A 1 909  ? 20.424  26.162  6.172   1.00 46.84  ? 1323 LYS A CG    1 
ATOM   6865 C  CD    . LYS A 1 909  ? 19.472  26.375  7.339   1.00 49.38  ? 1323 LYS A CD    1 
ATOM   6866 C  CE    . LYS A 1 909  ? 18.349  25.343  7.278   1.00 51.29  ? 1323 LYS A CE    1 
ATOM   6867 N  NZ    . LYS A 1 909  ? 17.704  25.378  5.927   1.00 50.99  ? 1323 LYS A NZ    1 
ATOM   6868 N  N     . ARG A 1 910  ? 22.536  27.238  2.981   1.00 44.27  ? 1324 ARG A N     1 
ATOM   6869 C  CA    . ARG A 1 910  ? 22.499  26.670  1.637   1.00 44.36  ? 1324 ARG A CA    1 
ATOM   6870 C  C     . ARG A 1 910  ? 23.824  26.051  1.246   1.00 43.83  ? 1324 ARG A C     1 
ATOM   6871 O  O     . ARG A 1 910  ? 23.849  24.997  0.625   1.00 43.67  ? 1324 ARG A O     1 
ATOM   6872 C  CB    . ARG A 1 910  ? 22.092  27.697  0.571   1.00 44.40  ? 1324 ARG A CB    1 
ATOM   6873 C  CG    . ARG A 1 910  ? 20.589  27.830  0.311   1.00 46.29  ? 1324 ARG A CG    1 
ATOM   6874 C  CD    . ARG A 1 910  ? 19.848  26.517  -0.076  1.00 48.47  ? 1324 ARG A CD    1 
ATOM   6875 N  NE    . ARG A 1 910  ? 20.393  25.742  -1.203  1.00 48.92  ? 1324 ARG A NE    1 
ATOM   6876 C  CZ    . ARG A 1 910  ? 20.053  25.903  -2.486  1.00 50.05  ? 1324 ARG A CZ    1 
ATOM   6877 N  NH1   . ARG A 1 910  ? 19.192  26.846  -2.856  1.00 50.48  ? 1324 ARG A NH1   1 
ATOM   6878 N  NH2   . ARG A 1 910  ? 20.584  25.124  -3.416  1.00 49.64  ? 1324 ARG A NH2   1 
ATOM   6879 N  N     . ILE A 1 911  ? 24.919  26.729  1.588   1.00 43.51  ? 1325 ILE A N     1 
ATOM   6880 C  CA    . ILE A 1 911  ? 26.265  26.253  1.295   1.00 42.90  ? 1325 ILE A CA    1 
ATOM   6881 C  C     . ILE A 1 911  ? 26.516  24.909  1.968   1.00 43.53  ? 1325 ILE A C     1 
ATOM   6882 O  O     . ILE A 1 911  ? 27.134  24.004  1.404   1.00 43.28  ? 1325 ILE A O     1 
ATOM   6883 C  CB    . ILE A 1 911  ? 27.311  27.265  1.795   1.00 42.98  ? 1325 ILE A CB    1 
ATOM   6884 C  CG1   . ILE A 1 911  ? 27.408  28.456  0.846   1.00 41.95  ? 1325 ILE A CG1   1 
ATOM   6885 C  CG2   . ILE A 1 911  ? 28.698  26.611  1.955   1.00 42.49  ? 1325 ILE A CG2   1 
ATOM   6886 C  CD1   . ILE A 1 911  ? 28.232  29.588  1.391   1.00 39.96  ? 1325 ILE A CD1   1 
ATOM   6887 N  N     . GLU A 1 912  ? 26.041  24.775  3.194   1.00 44.12  ? 1326 GLU A N     1 
ATOM   6888 C  CA    . GLU A 1 912  ? 26.242  23.535  3.904   1.00 45.06  ? 1326 GLU A CA    1 
ATOM   6889 C  C     . GLU A 1 912  ? 25.447  22.418  3.248   1.00 44.90  ? 1326 GLU A C     1 
ATOM   6890 O  O     . GLU A 1 912  ? 25.907  21.275  3.198   1.00 45.39  ? 1326 GLU A O     1 
ATOM   6891 C  CB    . GLU A 1 912  ? 25.934  23.711  5.396   1.00 45.53  ? 1326 GLU A CB    1 
ATOM   6892 C  CG    . GLU A 1 912  ? 26.970  24.633  6.056   1.00 47.84  ? 1326 GLU A CG    1 
ATOM   6893 C  CD    . GLU A 1 912  ? 26.655  24.990  7.508   1.00 51.65  ? 1326 GLU A CD    1 
ATOM   6894 O  OE1   . GLU A 1 912  ? 25.454  25.198  7.846   1.00 52.18  ? 1326 GLU A OE1   1 
ATOM   6895 O  OE2   . GLU A 1 912  ? 27.628  25.078  8.306   1.00 51.75  ? 1326 GLU A OE2   1 
ATOM   6896 N  N     . GLU A 1 913  ? 24.277  22.745  2.712   1.00 44.67  ? 1327 GLU A N     1 
ATOM   6897 C  CA    . GLU A 1 913  ? 23.504  21.744  1.986   1.00 44.78  ? 1327 GLU A CA    1 
ATOM   6898 C  C     . GLU A 1 913  ? 24.307  21.234  0.798   1.00 44.68  ? 1327 GLU A C     1 
ATOM   6899 O  O     . GLU A 1 913  ? 24.348  20.028  0.543   1.00 45.55  ? 1327 GLU A O     1 
ATOM   6900 C  CB    . GLU A 1 913  ? 22.174  22.299  1.488   1.00 44.67  ? 1327 GLU A CB    1 
ATOM   6901 C  CG    . GLU A 1 913  ? 21.078  22.344  2.521   1.00 45.78  ? 1327 GLU A CG    1 
ATOM   6902 C  CD    . GLU A 1 913  ? 19.890  23.198  2.081   1.00 47.89  ? 1327 GLU A CD    1 
ATOM   6903 O  OE1   . GLU A 1 913  ? 19.609  23.300  0.864   1.00 48.13  ? 1327 GLU A OE1   1 
ATOM   6904 O  OE2   . GLU A 1 913  ? 19.234  23.778  2.967   1.00 50.00  ? 1327 GLU A OE2   1 
ATOM   6905 N  N     . ILE A 1 914  ? 24.933  22.144  0.065   1.00 43.92  ? 1328 ILE A N     1 
ATOM   6906 C  CA    . ILE A 1 914  ? 25.677  21.759  -1.120  1.00 43.96  ? 1328 ILE A CA    1 
ATOM   6907 C  C     . ILE A 1 914  ? 26.997  21.067  -0.751  1.00 44.53  ? 1328 ILE A C     1 
ATOM   6908 O  O     . ILE A 1 914  ? 27.386  20.073  -1.374  1.00 44.14  ? 1328 ILE A O     1 
ATOM   6909 C  CB    . ILE A 1 914  ? 25.940  22.963  -2.018  1.00 43.52  ? 1328 ILE A CB    1 
ATOM   6910 C  CG1   . ILE A 1 914  ? 24.627  23.456  -2.630  1.00 42.85  ? 1328 ILE A CG1   1 
ATOM   6911 C  CG2   . ILE A 1 914  ? 26.950  22.616  -3.097  1.00 43.68  ? 1328 ILE A CG2   1 
ATOM   6912 C  CD1   . ILE A 1 914  ? 24.754  24.799  -3.355  1.00 40.85  ? 1328 ILE A CD1   1 
ATOM   6913 N  N     . ASN A 1 915  ? 27.682  21.596  0.260   1.00 45.19  ? 1329 ASN A N     1 
ATOM   6914 C  CA    . ASN A 1 915  ? 28.882  20.936  0.780   1.00 46.28  ? 1329 ASN A CA    1 
ATOM   6915 C  C     . ASN A 1 915  ? 28.588  19.485  1.123   1.00 46.96  ? 1329 ASN A C     1 
ATOM   6916 O  O     . ASN A 1 915  ? 29.380  18.609  0.815   1.00 47.21  ? 1329 ASN A O     1 
ATOM   6917 C  CB    . ASN A 1 915  ? 29.452  21.650  2.018   1.00 45.64  ? 1329 ASN A CB    1 
ATOM   6918 C  CG    . ASN A 1 915  ? 30.336  22.843  1.664   1.00 45.07  ? 1329 ASN A CG    1 
ATOM   6919 O  OD1   . ASN A 1 915  ? 30.743  23.591  2.546   1.00 45.14  ? 1329 ASN A OD1   1 
ATOM   6920 N  ND2   . ASN A 1 915  ? 30.637  23.021  0.374   1.00 42.24  ? 1329 ASN A ND2   1 
ATOM   6921 N  N     . ALA A 1 916  ? 27.442  19.235  1.749   1.00 47.90  ? 1330 ALA A N     1 
ATOM   6922 C  CA    . ALA A 1 916  ? 27.090  17.879  2.155   1.00 49.17  ? 1330 ALA A CA    1 
ATOM   6923 C  C     . ALA A 1 916  ? 27.046  16.885  0.990   1.00 49.88  ? 1330 ALA A C     1 
ATOM   6924 O  O     . ALA A 1 916  ? 27.309  15.698  1.185   1.00 49.92  ? 1330 ALA A O     1 
ATOM   6925 C  CB    . ALA A 1 916  ? 25.767  17.867  2.923   1.00 49.22  ? 1330 ALA A CB    1 
ATOM   6926 N  N     . LYS A 1 917  ? 26.713  17.360  -0.211  1.00 50.83  ? 1331 LYS A N     1 
ATOM   6927 C  CA    . LYS A 1 917  ? 26.651  16.486  -1.394  1.00 51.81  ? 1331 LYS A CA    1 
ATOM   6928 C  C     . LYS A 1 917  ? 28.033  16.095  -1.940  1.00 52.57  ? 1331 LYS A C     1 
ATOM   6929 O  O     . LYS A 1 917  ? 28.149  15.263  -2.854  1.00 52.48  ? 1331 LYS A O     1 
ATOM   6930 C  CB    . LYS A 1 917  ? 25.802  17.121  -2.505  1.00 51.91  ? 1331 LYS A CB    1 
ATOM   6931 C  CG    . LYS A 1 917  ? 24.299  17.141  -2.199  1.00 52.32  ? 1331 LYS A CG    1 
ATOM   6932 C  CD    . LYS A 1 917  ? 23.463  17.335  -3.451  1.00 53.08  ? 1331 LYS A CD    1 
ATOM   6933 C  CE    . LYS A 1 917  ? 21.971  17.322  -3.129  1.00 53.66  ? 1331 LYS A CE    1 
ATOM   6934 N  NZ    . LYS A 1 917  ? 21.136  17.237  -4.364  1.00 53.67  ? 1331 LYS A NZ    1 
ATOM   6935 N  N     . GLY A 1 918  ? 29.075  16.710  -1.382  1.00 53.45  ? 1332 GLY A N     1 
ATOM   6936 C  CA    . GLY A 1 918  ? 30.448  16.493  -1.837  1.00 54.43  ? 1332 GLY A CA    1 
ATOM   6937 C  C     . GLY A 1 918  ? 30.636  16.607  -3.344  1.00 55.01  ? 1332 GLY A C     1 
ATOM   6938 O  O     . GLY A 1 918  ? 30.191  17.576  -3.965  1.00 54.71  ? 1332 GLY A O     1 
ATOM   6939 N  N     . ILE A 1 919  ? 31.308  15.615  -3.922  1.00 55.75  ? 1333 ILE A N     1 
ATOM   6940 C  CA    . ILE A 1 919  ? 31.547  15.576  -5.358  1.00 56.38  ? 1333 ILE A CA    1 
ATOM   6941 C  C     . ILE A 1 919  ? 30.325  15.003  -6.062  1.00 56.61  ? 1333 ILE A C     1 
ATOM   6942 O  O     . ILE A 1 919  ? 30.258  14.988  -7.290  1.00 56.65  ? 1333 ILE A O     1 
ATOM   6943 C  CB    . ILE A 1 919  ? 32.798  14.749  -5.715  1.00 56.62  ? 1333 ILE A CB    1 
ATOM   6944 C  CG1   . ILE A 1 919  ? 32.559  13.256  -5.416  1.00 57.14  ? 1333 ILE A CG1   1 
ATOM   6945 C  CG2   . ILE A 1 919  ? 34.026  15.305  -4.978  1.00 56.62  ? 1333 ILE A CG2   1 
ATOM   6946 C  CD1   . ILE A 1 919  ? 33.615  12.311  -5.989  1.00 57.02  ? 1333 ILE A CD1   1 
ATOM   6947 N  N     . GLN A 1 920  ? 29.349  14.537  -5.287  1.00 56.90  ? 1334 GLN A N     1 
ATOM   6948 C  CA    . GLN A 1 920  ? 28.061  14.185  -5.881  1.00 57.31  ? 1334 GLN A CA    1 
ATOM   6949 C  C     . GLN A 1 920  ? 27.269  15.457  -6.216  1.00 57.02  ? 1334 GLN A C     1 
ATOM   6950 O  O     . GLN A 1 920  ? 26.058  15.417  -6.464  1.00 57.24  ? 1334 GLN A O     1 
ATOM   6951 C  CB    . GLN A 1 920  ? 27.255  13.247  -4.975  1.00 57.61  ? 1334 GLN A CB    1 
ATOM   6952 C  CG    . GLN A 1 920  ? 27.724  11.785  -5.029  1.00 59.03  ? 1334 GLN A CG    1 
ATOM   6953 C  CD    . GLN A 1 920  ? 26.769  10.816  -4.322  1.00 61.03  ? 1334 GLN A CD    1 
ATOM   6954 O  OE1   . GLN A 1 920  ? 26.060  10.042  -4.972  1.00 61.26  ? 1334 GLN A OE1   1 
ATOM   6955 N  NE2   . GLN A 1 920  ? 26.755  10.852  -2.987  1.00 61.50  ? 1334 GLN A NE2   1 
ATOM   6956 N  N     . ALA A 1 921  ? 27.970  16.586  -6.232  1.00 56.48  ? 1335 ALA A N     1 
ATOM   6957 C  CA    . ALA A 1 921  ? 27.356  17.855  -6.590  1.00 56.02  ? 1335 ALA A CA    1 
ATOM   6958 C  C     . ALA A 1 921  ? 27.317  18.035  -8.095  1.00 55.52  ? 1335 ALA A C     1 
ATOM   6959 O  O     . ALA A 1 921  ? 28.288  17.774  -8.801  1.00 55.00  ? 1335 ALA A O     1 
ATOM   6960 C  CB    . ALA A 1 921  ? 28.088  19.023  -5.934  1.00 55.95  ? 1335 ALA A CB    1 
ATOM   6961 N  N     . THR A 1 922  ? 26.174  18.484  -8.580  1.00 55.33  ? 1336 THR A N     1 
ATOM   6962 C  CA    . THR A 1 922  ? 26.023  18.742  -10.000 1.00 55.22  ? 1336 THR A CA    1 
ATOM   6963 C  C     . THR A 1 922  ? 26.829  19.981  -10.382 1.00 54.84  ? 1336 THR A C     1 
ATOM   6964 O  O     . THR A 1 922  ? 27.016  20.892  -9.567  1.00 54.77  ? 1336 THR A O     1 
ATOM   6965 C  CB    . THR A 1 922  ? 24.540  18.946  -10.374 1.00 55.31  ? 1336 THR A CB    1 
ATOM   6966 O  OG1   . THR A 1 922  ? 24.093  20.234  -9.925  1.00 54.92  ? 1336 THR A OG1   1 
ATOM   6967 C  CG2   . THR A 1 922  ? 23.668  17.850  -9.751  1.00 55.22  ? 1336 THR A CG2   1 
ATOM   6968 N  N     . ALA A 1 923  ? 27.317  20.003  -11.618 1.00 54.40  ? 1337 ALA A N     1 
ATOM   6969 C  CA    . ALA A 1 923  ? 28.017  21.174  -12.141 1.00 53.97  ? 1337 ALA A CA    1 
ATOM   6970 C  C     . ALA A 1 923  ? 27.298  22.470  -11.740 1.00 53.44  ? 1337 ALA A C     1 
ATOM   6971 O  O     . ALA A 1 923  ? 27.937  23.505  -11.513 1.00 52.90  ? 1337 ALA A O     1 
ATOM   6972 C  CB    . ALA A 1 923  ? 28.148  21.079  -13.674 1.00 53.91  ? 1337 ALA A CB    1 
ATOM   6973 N  N     . LYS A 1 924  ? 25.969  22.390  -11.637 1.00 52.77  ? 1338 LYS A N     1 
ATOM   6974 C  CA    . LYS A 1 924  ? 25.147  23.561  -11.415 1.00 52.51  ? 1338 LYS A CA    1 
ATOM   6975 C  C     . LYS A 1 924  ? 25.078  23.897  -9.952  1.00 51.61  ? 1338 LYS A C     1 
ATOM   6976 O  O     . LYS A 1 924  ? 24.942  25.057  -9.577  1.00 51.49  ? 1338 LYS A O     1 
ATOM   6977 C  CB    . LYS A 1 924  ? 23.742  23.371  -11.994 1.00 52.90  ? 1338 LYS A CB    1 
ATOM   6978 C  CG    . LYS A 1 924  ? 23.711  23.474  -13.522 1.00 54.89  ? 1338 LYS A CG    1 
ATOM   6979 C  CD    . LYS A 1 924  ? 24.414  24.761  -14.002 1.00 58.83  ? 1338 LYS A CD    1 
ATOM   6980 C  CE    . LYS A 1 924  ? 24.257  25.011  -15.515 1.00 59.68  ? 1338 LYS A CE    1 
ATOM   6981 N  NZ    . LYS A 1 924  ? 25.100  24.066  -16.322 1.00 60.98  ? 1338 LYS A NZ    1 
ATOM   6982 N  N     . GLU A 1 925  ? 25.169  22.881  -9.114  1.00 50.79  ? 1339 GLU A N     1 
ATOM   6983 C  CA    . GLU A 1 925  ? 25.245  23.146  -7.690  1.00 50.05  ? 1339 GLU A CA    1 
ATOM   6984 C  C     . GLU A 1 925  ? 26.577  23.808  -7.370  1.00 49.01  ? 1339 GLU A C     1 
ATOM   6985 O  O     . GLU A 1 925  ? 26.654  24.652  -6.475  1.00 48.72  ? 1339 GLU A O     1 
ATOM   6986 C  CB    . GLU A 1 925  ? 25.031  21.869  -6.870  1.00 50.31  ? 1339 GLU A CB    1 
ATOM   6987 C  CG    . GLU A 1 925  ? 23.571  21.646  -6.495  1.00 50.75  ? 1339 GLU A CG    1 
ATOM   6988 C  CD    . GLU A 1 925  ? 23.176  20.180  -6.457  1.00 51.60  ? 1339 GLU A CD    1 
ATOM   6989 O  OE1   . GLU A 1 925  ? 23.437  19.448  -7.443  1.00 51.44  ? 1339 GLU A OE1   1 
ATOM   6990 O  OE2   . GLU A 1 925  ? 22.585  19.769  -5.438  1.00 52.06  ? 1339 GLU A OE2   1 
ATOM   6991 N  N     . LYS A 1 926  ? 27.611  23.452  -8.132  1.00 47.84  ? 1340 LYS A N     1 
ATOM   6992 C  CA    . LYS A 1 926  ? 28.947  23.991  -7.896  1.00 46.91  ? 1340 LYS A CA    1 
ATOM   6993 C  C     . LYS A 1 926  ? 29.008  25.452  -8.287  1.00 46.00  ? 1340 LYS A C     1 
ATOM   6994 O  O     . LYS A 1 926  ? 29.664  26.259  -7.602  1.00 46.44  ? 1340 LYS A O     1 
ATOM   6995 C  CB    . LYS A 1 926  ? 30.032  23.169  -8.613  1.00 47.22  ? 1340 LYS A CB    1 
ATOM   6996 C  CG    . LYS A 1 926  ? 30.212  21.755  -8.030  1.00 47.33  ? 1340 LYS A CG    1 
ATOM   6997 C  CD    . LYS A 1 926  ? 31.295  20.946  -8.760  1.00 50.31  ? 1340 LYS A CD    1 
ATOM   6998 C  CE    . LYS A 1 926  ? 31.174  19.438  -8.464  1.00 51.71  ? 1340 LYS A CE    1 
ATOM   6999 N  NZ    . LYS A 1 926  ? 32.350  18.633  -8.921  1.00 53.16  ? 1340 LYS A NZ    1 
ATOM   7000 N  N     . SER A 1 927  ? 28.302  25.801  -9.360  1.00 44.26  ? 1341 SER A N     1 
ATOM   7001 C  CA    . SER A 1 927  ? 28.291  27.178  -9.830  1.00 42.84  ? 1341 SER A CA    1 
ATOM   7002 C  C     . SER A 1 927  ? 27.572  28.000  -8.796  1.00 41.81  ? 1341 SER A C     1 
ATOM   7003 O  O     . SER A 1 927  ? 28.001  29.107  -8.468  1.00 41.81  ? 1341 SER A O     1 
ATOM   7004 C  CB    . SER A 1 927  ? 27.613  27.329  -11.210 1.00 42.82  ? 1341 SER A CB    1 
ATOM   7005 O  OG    . SER A 1 927  ? 28.151  26.412  -12.145 1.00 42.08  ? 1341 SER A OG    1 
ATOM   7006 N  N     . LEU A 1 928  ? 26.489  27.452  -8.255  1.00 40.55  ? 1342 LEU A N     1 
ATOM   7007 C  CA    . LEU A 1 928  ? 25.770  28.159  -7.211  1.00 39.60  ? 1342 LEU A CA    1 
ATOM   7008 C  C     . LEU A 1 928  ? 26.642  28.338  -5.971  1.00 39.27  ? 1342 LEU A C     1 
ATOM   7009 O  O     . LEU A 1 928  ? 26.737  29.435  -5.439  1.00 39.32  ? 1342 LEU A O     1 
ATOM   7010 C  CB    . LEU A 1 928  ? 24.458  27.457  -6.877  1.00 39.41  ? 1342 LEU A CB    1 
ATOM   7011 C  CG    . LEU A 1 928  ? 23.686  28.009  -5.671  1.00 39.57  ? 1342 LEU A CG    1 
ATOM   7012 C  CD1   . LEU A 1 928  ? 23.269  29.470  -5.834  1.00 39.12  ? 1342 LEU A CD1   1 
ATOM   7013 C  CD2   . LEU A 1 928  ? 22.455  27.139  -5.383  1.00 39.86  ? 1342 LEU A CD2   1 
ATOM   7014 N  N     . LEU A 1 929  ? 27.281  27.258  -5.517  1.00 39.05  ? 1343 LEU A N     1 
ATOM   7015 C  CA    . LEU A 1 929  ? 28.155  27.298  -4.343  1.00 38.74  ? 1343 LEU A CA    1 
ATOM   7016 C  C     . LEU A 1 929  ? 29.212  28.397  -4.483  1.00 38.76  ? 1343 LEU A C     1 
ATOM   7017 O  O     . LEU A 1 929  ? 29.432  29.187  -3.560  1.00 38.85  ? 1343 LEU A O     1 
ATOM   7018 C  CB    . LEU A 1 929  ? 28.838  25.937  -4.129  1.00 38.64  ? 1343 LEU A CB    1 
ATOM   7019 C  CG    . LEU A 1 929  ? 29.940  25.817  -3.056  1.00 38.48  ? 1343 LEU A CG    1 
ATOM   7020 C  CD1   . LEU A 1 929  ? 29.361  25.877  -1.622  1.00 37.91  ? 1343 LEU A CD1   1 
ATOM   7021 C  CD2   . LEU A 1 929  ? 30.729  24.521  -3.225  1.00 36.26  ? 1343 LEU A CD2   1 
ATOM   7022 N  N     . THR A 1 930  ? 29.872  28.431  -5.639  1.00 38.57  ? 1344 THR A N     1 
ATOM   7023 C  CA    . THR A 1 930  ? 30.869  29.450  -5.905  1.00 37.87  ? 1344 THR A CA    1 
ATOM   7024 C  C     . THR A 1 930  ? 30.266  30.816  -5.609  1.00 37.92  ? 1344 THR A C     1 
ATOM   7025 O  O     . THR A 1 930  ? 30.819  31.589  -4.845  1.00 37.82  ? 1344 THR A O     1 
ATOM   7026 C  CB    . THR A 1 930  ? 31.386  29.379  -7.375  1.00 38.17  ? 1344 THR A CB    1 
ATOM   7027 O  OG1   . THR A 1 930  ? 32.233  28.227  -7.524  1.00 37.93  ? 1344 THR A OG1   1 
ATOM   7028 C  CG2   . THR A 1 930  ? 32.198  30.633  -7.758  1.00 35.96  ? 1344 THR A CG2   1 
ATOM   7029 N  N     . VAL A 1 931  ? 29.116  31.137  -6.190  1.00 38.08  ? 1345 VAL A N     1 
ATOM   7030 C  CA    . VAL A 1 931  ? 28.605  32.488  -5.930  1.00 37.42  ? 1345 VAL A CA    1 
ATOM   7031 C  C     . VAL A 1 931  ? 28.119  32.704  -4.491  1.00 37.30  ? 1345 VAL A C     1 
ATOM   7032 O  O     . VAL A 1 931  ? 28.288  33.801  -3.955  1.00 37.71  ? 1345 VAL A O     1 
ATOM   7033 C  CB    . VAL A 1 931  ? 27.636  33.073  -7.035  1.00 37.50  ? 1345 VAL A CB    1 
ATOM   7034 C  CG1   . VAL A 1 931  ? 27.644  32.223  -8.294  1.00 37.35  ? 1345 VAL A CG1   1 
ATOM   7035 C  CG2   . VAL A 1 931  ? 26.251  33.344  -6.526  1.00 35.90  ? 1345 VAL A CG2   1 
ATOM   7036 N  N     . LEU A 1 932  ? 27.566  31.679  -3.846  1.00 36.55  ? 1346 LEU A N     1 
ATOM   7037 C  CA    . LEU A 1 932  ? 27.123  31.889  -2.477  1.00 36.64  ? 1346 LEU A CA    1 
ATOM   7038 C  C     . LEU A 1 932  ? 28.318  32.125  -1.561  1.00 36.47  ? 1346 LEU A C     1 
ATOM   7039 O  O     . LEU A 1 932  ? 28.229  32.852  -0.576  1.00 35.85  ? 1346 LEU A O     1 
ATOM   7040 C  CB    . LEU A 1 932  ? 26.318  30.712  -1.966  1.00 36.39  ? 1346 LEU A CB    1 
ATOM   7041 C  CG    . LEU A 1 932  ? 24.986  30.408  -2.620  1.00 36.97  ? 1346 LEU A CG    1 
ATOM   7042 C  CD1   . LEU A 1 932  ? 24.467  29.147  -1.944  1.00 36.80  ? 1346 LEU A CD1   1 
ATOM   7043 C  CD2   . LEU A 1 932  ? 24.014  31.560  -2.443  1.00 33.71  ? 1346 LEU A CD2   1 
ATOM   7044 N  N     . GLU A 1 933  ? 29.440  31.493  -1.875  1.00 36.66  ? 1347 GLU A N     1 
ATOM   7045 C  CA    . GLU A 1 933  ? 30.625  31.731  -1.075  1.00 36.57  ? 1347 GLU A CA    1 
ATOM   7046 C  C     . GLU A 1 933  ? 30.921  33.216  -1.016  1.00 37.03  ? 1347 GLU A C     1 
ATOM   7047 O  O     . GLU A 1 933  ? 31.129  33.768  0.076   1.00 36.70  ? 1347 GLU A O     1 
ATOM   7048 C  CB    . GLU A 1 933  ? 31.818  30.938  -1.593  1.00 36.12  ? 1347 GLU A CB    1 
ATOM   7049 C  CG    . GLU A 1 933  ? 31.873  29.548  -0.972  1.00 35.93  ? 1347 GLU A CG    1 
ATOM   7050 C  CD    . GLU A 1 933  ? 32.970  28.688  -1.527  1.00 34.09  ? 1347 GLU A CD    1 
ATOM   7051 O  OE1   . GLU A 1 933  ? 33.511  28.966  -2.617  1.00 34.22  ? 1347 GLU A OE1   1 
ATOM   7052 O  OE2   . GLU A 1 933  ? 33.284  27.704  -0.871  1.00 36.48  ? 1347 GLU A OE2   1 
ATOM   7053 N  N     . VAL A 1 934  ? 30.885  33.882  -2.172  1.00 37.25  ? 1348 VAL A N     1 
ATOM   7054 C  CA    . VAL A 1 934  ? 31.201  35.302  -2.185  1.00 38.00  ? 1348 VAL A CA    1 
ATOM   7055 C  C     . VAL A 1 934  ? 30.112  36.178  -1.574  1.00 38.41  ? 1348 VAL A C     1 
ATOM   7056 O  O     . VAL A 1 934  ? 30.405  37.270  -1.079  1.00 38.48  ? 1348 VAL A O     1 
ATOM   7057 C  CB    . VAL A 1 934  ? 31.688  35.841  -3.586  1.00 38.28  ? 1348 VAL A CB    1 
ATOM   7058 C  CG1   . VAL A 1 934  ? 31.532  34.808  -4.665  1.00 38.86  ? 1348 VAL A CG1   1 
ATOM   7059 C  CG2   . VAL A 1 934  ? 31.032  37.163  -3.947  1.00 37.24  ? 1348 VAL A CG2   1 
ATOM   7060 N  N     . ALA A 1 935  ? 28.875  35.688  -1.583  1.00 38.83  ? 1349 ALA A N     1 
ATOM   7061 C  CA    . ALA A 1 935  ? 27.748  36.408  -0.984  1.00 39.18  ? 1349 ALA A CA    1 
ATOM   7062 C  C     . ALA A 1 935  ? 27.837  36.398  0.541   1.00 39.55  ? 1349 ALA A C     1 
ATOM   7063 O  O     . ALA A 1 935  ? 27.501  37.388  1.199   1.00 40.21  ? 1349 ALA A O     1 
ATOM   7064 C  CB    . ALA A 1 935  ? 26.431  35.778  -1.427  1.00 39.16  ? 1349 ALA A CB    1 
ATOM   7065 N  N     . LEU A 1 936  ? 28.254  35.260  1.097   1.00 39.51  ? 1350 LEU A N     1 
ATOM   7066 C  CA    . LEU A 1 936  ? 28.358  35.096  2.548   1.00 39.55  ? 1350 LEU A CA    1 
ATOM   7067 C  C     . LEU A 1 936  ? 29.474  36.024  3.048   1.00 39.83  ? 1350 LEU A C     1 
ATOM   7068 O  O     . LEU A 1 936  ? 29.302  36.760  4.023   1.00 40.36  ? 1350 LEU A O     1 
ATOM   7069 C  CB    . LEU A 1 936  ? 28.651  33.640  2.928   1.00 38.38  ? 1350 LEU A CB    1 
ATOM   7070 C  CG    . LEU A 1 936  ? 29.128  33.473  4.387   1.00 39.22  ? 1350 LEU A CG    1 
ATOM   7071 C  CD1   . LEU A 1 936  ? 27.970  33.577  5.346   1.00 36.08  ? 1350 LEU A CD1   1 
ATOM   7072 C  CD2   . LEU A 1 936  ? 29.929  32.169  4.662   1.00 38.42  ? 1350 LEU A CD2   1 
ATOM   7073 N  N     . GLU A 1 937  ? 30.612  35.989  2.356   1.00 39.82  ? 1351 GLU A N     1 
ATOM   7074 C  CA    . GLU A 1 937  ? 31.726  36.888  2.646   1.00 39.37  ? 1351 GLU A CA    1 
ATOM   7075 C  C     . GLU A 1 937  ? 31.283  38.349  2.491   1.00 39.38  ? 1351 GLU A C     1 
ATOM   7076 O  O     . GLU A 1 937  ? 31.607  39.185  3.330   1.00 39.15  ? 1351 GLU A O     1 
ATOM   7077 C  CB    . GLU A 1 937  ? 32.915  36.588  1.729   1.00 39.20  ? 1351 GLU A CB    1 
ATOM   7078 C  CG    . GLU A 1 937  ? 34.137  37.479  1.964   1.00 37.54  ? 1351 GLU A CG    1 
ATOM   7079 C  CD    . GLU A 1 937  ? 35.058  37.528  0.752   1.00 35.07  ? 1351 GLU A CD    1 
ATOM   7080 O  OE1   . GLU A 1 937  ? 34.775  38.290  -0.176  1.00 35.39  ? 1351 GLU A OE1   1 
ATOM   7081 O  OE2   . GLU A 1 937  ? 36.080  36.816  0.725   1.00 35.91  ? 1351 GLU A OE2   1 
ATOM   7082 N  N     . MET A 1 938  ? 30.539  38.661  1.433   1.00 39.38  ? 1352 MET A N     1 
ATOM   7083 C  CA    . MET A 1 938  ? 29.985  40.004  1.331   1.00 39.58  ? 1352 MET A CA    1 
ATOM   7084 C  C     . MET A 1 938  ? 29.217  40.366  2.612   1.00 39.77  ? 1352 MET A C     1 
ATOM   7085 O  O     . MET A 1 938  ? 29.382  41.445  3.163   1.00 39.78  ? 1352 MET A O     1 
ATOM   7086 C  CB    . MET A 1 938  ? 29.087  40.170  0.094   1.00 39.67  ? 1352 MET A CB    1 
ATOM   7087 C  CG    . MET A 1 938  ? 28.570  41.615  -0.094  1.00 39.73  ? 1352 MET A CG    1 
ATOM   7088 S  SD    . MET A 1 938  ? 27.561  41.919  -1.558  1.00 41.09  ? 1352 MET A SD    1 
ATOM   7089 C  CE    . MET A 1 938  ? 25.990  42.335  -0.816  1.00 37.07  ? 1352 MET A CE    1 
ATOM   7090 N  N     . CYS A 1 939  ? 28.389  39.450  3.101   1.00 40.08  ? 1353 CYS A N     1 
ATOM   7091 C  CA    . CYS A 1 939  ? 27.530  39.782  4.221   1.00 39.85  ? 1353 CYS A CA    1 
ATOM   7092 C  C     . CYS A 1 939  ? 28.318  39.967  5.508   1.00 39.70  ? 1353 CYS A C     1 
ATOM   7093 O  O     . CYS A 1 939  ? 28.033  40.878  6.288   1.00 39.94  ? 1353 CYS A O     1 
ATOM   7094 C  CB    . CYS A 1 939  ? 26.426  38.745  4.378   1.00 39.85  ? 1353 CYS A CB    1 
ATOM   7095 S  SG    . CYS A 1 939  ? 25.192  38.818  3.014   1.00 39.78  ? 1353 CYS A SG    1 
ATOM   7096 N  N     . GLU A 1 940  ? 29.326  39.128  5.721   1.00 38.92  ? 1354 GLU A N     1 
ATOM   7097 C  CA    . GLU A 1 940  ? 30.128  39.212  6.934   1.00 37.90  ? 1354 GLU A CA    1 
ATOM   7098 C  C     . GLU A 1 940  ? 30.960  40.489  6.980   1.00 37.12  ? 1354 GLU A C     1 
ATOM   7099 O  O     . GLU A 1 940  ? 31.434  40.899  8.049   1.00 36.12  ? 1354 GLU A O     1 
ATOM   7100 C  CB    . GLU A 1 940  ? 31.050  38.003  7.014   1.00 38.53  ? 1354 GLU A CB    1 
ATOM   7101 C  CG    . GLU A 1 940  ? 30.299  36.705  7.277   1.00 40.26  ? 1354 GLU A CG    1 
ATOM   7102 C  CD    . GLU A 1 940  ? 29.688  36.671  8.673   1.00 40.76  ? 1354 GLU A CD    1 
ATOM   7103 O  OE1   . GLU A 1 940  ? 30.337  37.168  9.634   1.00 41.74  ? 1354 GLU A OE1   1 
ATOM   7104 O  OE2   . GLU A 1 940  ? 28.563  36.154  8.805   1.00 39.11  ? 1354 GLU A OE2   1 
ATOM   7105 N  N     . ARG A 1 941  ? 31.161  41.105  5.818   1.00 36.12  ? 1355 ARG A N     1 
ATOM   7106 C  CA    . ARG A 1 941  ? 31.997  42.282  5.757   1.00 35.95  ? 1355 ARG A CA    1 
ATOM   7107 C  C     . ARG A 1 941  ? 31.157  43.488  6.105   1.00 36.54  ? 1355 ARG A C     1 
ATOM   7108 O  O     . ARG A 1 941  ? 31.661  44.618  6.215   1.00 36.41  ? 1355 ARG A O     1 
ATOM   7109 C  CB    . ARG A 1 941  ? 32.666  42.418  4.399   1.00 36.36  ? 1355 ARG A CB    1 
ATOM   7110 C  CG    . ARG A 1 941  ? 33.797  41.382  4.169   1.00 35.35  ? 1355 ARG A CG    1 
ATOM   7111 C  CD    . ARG A 1 941  ? 35.079  42.096  3.806   1.00 34.36  ? 1355 ARG A CD    1 
ATOM   7112 N  NE    . ARG A 1 941  ? 35.233  42.179  2.369   1.00 36.10  ? 1355 ARG A NE    1 
ATOM   7113 C  CZ    . ARG A 1 941  ? 36.104  42.952  1.724   1.00 35.95  ? 1355 ARG A CZ    1 
ATOM   7114 N  NH1   . ARG A 1 941  ? 36.123  42.899  0.399   1.00 37.58  ? 1355 ARG A NH1   1 
ATOM   7115 N  NH2   . ARG A 1 941  ? 36.942  43.763  2.373   1.00 31.34  ? 1355 ARG A NH2   1 
ATOM   7116 N  N     . GLY A 1 942  ? 29.864  43.222  6.295   1.00 36.55  ? 1356 GLY A N     1 
ATOM   7117 C  CA    . GLY A 1 942  ? 28.922  44.223  6.766   1.00 36.45  ? 1356 GLY A CA    1 
ATOM   7118 C  C     . GLY A 1 942  ? 27.905  44.708  5.755   1.00 36.44  ? 1356 GLY A C     1 
ATOM   7119 O  O     . GLY A 1 942  ? 27.175  45.652  6.042   1.00 36.35  ? 1356 GLY A O     1 
ATOM   7120 N  N     . PHE A 1 943  ? 27.837  44.077  4.578   1.00 36.24  ? 1357 PHE A N     1 
ATOM   7121 C  CA    . PHE A 1 943  ? 26.961  44.583  3.507   1.00 36.02  ? 1357 PHE A CA    1 
ATOM   7122 C  C     . PHE A 1 943  ? 25.753  43.696  3.358   1.00 36.67  ? 1357 PHE A C     1 
ATOM   7123 O  O     . PHE A 1 943  ? 25.553  42.815  4.160   1.00 37.23  ? 1357 PHE A O     1 
ATOM   7124 C  CB    . PHE A 1 943  ? 27.729  44.694  2.180   1.00 35.51  ? 1357 PHE A CB    1 
ATOM   7125 C  CG    . PHE A 1 943  ? 29.005  45.481  2.292   1.00 33.76  ? 1357 PHE A CG    1 
ATOM   7126 C  CD1   . PHE A 1 943  ? 30.228  44.836  2.327   1.00 33.74  ? 1357 PHE A CD1   1 
ATOM   7127 C  CD2   . PHE A 1 943  ? 28.980  46.862  2.389   1.00 31.44  ? 1357 PHE A CD2   1 
ATOM   7128 C  CE1   . PHE A 1 943  ? 31.432  45.567  2.445   1.00 31.52  ? 1357 PHE A CE1   1 
ATOM   7129 C  CE2   . PHE A 1 943  ? 30.153  47.595  2.504   1.00 31.18  ? 1357 PHE A CE2   1 
ATOM   7130 C  CZ    . PHE A 1 943  ? 31.393  46.931  2.538   1.00 31.85  ? 1357 PHE A CZ    1 
ATOM   7131 N  N     . SER A 1 944  ? 24.931  43.911  2.341   1.00 37.71  ? 1358 SER A N     1 
ATOM   7132 C  CA    . SER A 1 944  ? 23.751  43.061  2.204   1.00 38.65  ? 1358 SER A CA    1 
ATOM   7133 C  C     . SER A 1 944  ? 23.012  43.201  0.880   1.00 39.12  ? 1358 SER A C     1 
ATOM   7134 O  O     . SER A 1 944  ? 23.344  44.058  0.057   1.00 39.33  ? 1358 SER A O     1 
ATOM   7135 C  CB    . SER A 1 944  ? 22.788  43.311  3.363   1.00 38.59  ? 1358 SER A CB    1 
ATOM   7136 O  OG    . SER A 1 944  ? 22.365  44.652  3.324   1.00 39.42  ? 1358 SER A OG    1 
ATOM   7137 N  N     . PHE A 1 945  ? 22.021  42.332  0.686   1.00 39.68  ? 1359 PHE A N     1 
ATOM   7138 C  CA    . PHE A 1 945  ? 21.209  42.291  -0.524  1.00 40.52  ? 1359 PHE A CA    1 
ATOM   7139 C  C     . PHE A 1 945  ? 19.752  42.655  -0.210  1.00 41.45  ? 1359 PHE A C     1 
ATOM   7140 O  O     . PHE A 1 945  ? 19.154  42.069  0.698   1.00 41.04  ? 1359 PHE A O     1 
ATOM   7141 C  CB    . PHE A 1 945  ? 21.209  40.886  -1.118  1.00 40.07  ? 1359 PHE A CB    1 
ATOM   7142 C  CG    . PHE A 1 945  ? 22.557  40.398  -1.561  1.00 40.61  ? 1359 PHE A CG    1 
ATOM   7143 C  CD1   . PHE A 1 945  ? 22.983  40.594  -2.876  1.00 39.75  ? 1359 PHE A CD1   1 
ATOM   7144 C  CD2   . PHE A 1 945  ? 23.388  39.718  -0.682  1.00 38.73  ? 1359 PHE A CD2   1 
ATOM   7145 C  CE1   . PHE A 1 945  ? 24.214  40.144  -3.295  1.00 39.26  ? 1359 PHE A CE1   1 
ATOM   7146 C  CE2   . PHE A 1 945  ? 24.619  39.260  -1.100  1.00 40.60  ? 1359 PHE A CE2   1 
ATOM   7147 C  CZ    . PHE A 1 945  ? 25.035  39.471  -2.413  1.00 39.88  ? 1359 PHE A CZ    1 
ATOM   7148 N  N     . LYS A 1 946  ? 19.172  43.579  -0.993  1.00 42.14  ? 1360 LYS A N     1 
ATOM   7149 C  CA    . LYS A 1 946  ? 17.763  43.965  -0.838  1.00 42.57  ? 1360 LYS A CA    1 
ATOM   7150 C  C     . LYS A 1 946  ? 16.917  43.255  -1.882  1.00 42.28  ? 1360 LYS A C     1 
ATOM   7151 O  O     . LYS A 1 946  ? 17.451  42.761  -2.888  1.00 42.34  ? 1360 LYS A O     1 
ATOM   7152 C  CB    . LYS A 1 946  ? 17.612  45.477  -0.981  1.00 43.43  ? 1360 LYS A CB    1 
ATOM   7153 C  CG    . LYS A 1 946  ? 18.615  46.261  -0.140  1.00 45.66  ? 1360 LYS A CG    1 
ATOM   7154 C  CD    . LYS A 1 946  ? 17.946  47.020  0.990   1.00 51.98  ? 1360 LYS A CD    1 
ATOM   7155 C  CE    . LYS A 1 946  ? 17.347  48.356  0.495   1.00 55.13  ? 1360 LYS A CE    1 
ATOM   7156 N  NZ    . LYS A 1 946  ? 18.358  49.234  -0.230  1.00 57.30  ? 1360 LYS A NZ    1 
ATOM   7157 N  N     . ASN A 1 947  ? 15.608  43.181  -1.647  1.00 41.40  ? 1361 ASN A N     1 
ATOM   7158 C  CA    . ASN A 1 947  ? 14.723  42.496  -2.581  1.00 40.98  ? 1361 ASN A CA    1 
ATOM   7159 C  C     . ASN A 1 947  ? 14.732  43.140  -3.978  1.00 41.02  ? 1361 ASN A C     1 
ATOM   7160 O  O     . ASN A 1 947  ? 15.201  44.272  -4.164  1.00 41.30  ? 1361 ASN A O     1 
ATOM   7161 C  CB    . ASN A 1 947  ? 13.277  42.492  -2.061  1.00 40.96  ? 1361 ASN A CB    1 
ATOM   7162 C  CG    . ASN A 1 947  ? 13.058  41.534  -0.891  1.00 40.48  ? 1361 ASN A CG    1 
ATOM   7163 O  OD1   . ASN A 1 947  ? 12.909  41.976  0.240   1.00 40.28  ? 1361 ASN A OD1   1 
ATOM   7164 N  ND2   . ASN A 1 947  ? 13.000  40.232  -1.164  1.00 38.03  ? 1361 ASN A ND2   1 
ATOM   7165 N  N     . ILE A 1 948  ? 14.178  42.446  -4.962  1.00 40.37  ? 1362 ILE A N     1 
ATOM   7166 C  CA    . ILE A 1 948  ? 13.983  43.099  -6.226  1.00 40.42  ? 1362 ILE A CA    1 
ATOM   7167 C  C     . ILE A 1 948  ? 13.112  44.313  -5.947  1.00 40.65  ? 1362 ILE A C     1 
ATOM   7168 O  O     . ILE A 1 948  ? 12.204  44.271  -5.117  1.00 40.24  ? 1362 ILE A O     1 
ATOM   7169 C  CB    . ILE A 1 948  ? 13.361  42.181  -7.278  1.00 40.53  ? 1362 ILE A CB    1 
ATOM   7170 C  CG1   . ILE A 1 948  ? 14.467  41.427  -8.027  1.00 42.22  ? 1362 ILE A CG1   1 
ATOM   7171 C  CG2   . ILE A 1 948  ? 12.595  42.984  -8.293  1.00 40.34  ? 1362 ILE A CG2   1 
ATOM   7172 C  CD1   . ILE A 1 948  ? 14.778  40.064  -7.427  1.00 45.19  ? 1362 ILE A CD1   1 
ATOM   7173 N  N     . ASP A 1 949  ? 13.415  45.409  -6.623  1.00 41.18  ? 1363 ASP A N     1 
ATOM   7174 C  CA    . ASP A 1 949  ? 12.702  46.660  -6.410  1.00 41.17  ? 1363 ASP A CA    1 
ATOM   7175 C  C     . ASP A 1 949  ? 12.238  47.192  -7.756  1.00 41.52  ? 1363 ASP A C     1 
ATOM   7176 O  O     . ASP A 1 949  ? 13.040  47.422  -8.660  1.00 41.78  ? 1363 ASP A O     1 
ATOM   7177 C  CB    . ASP A 1 949  ? 13.616  47.669  -5.726  1.00 40.93  ? 1363 ASP A CB    1 
ATOM   7178 C  CG    . ASP A 1 949  ? 12.994  49.044  -5.610  1.00 41.56  ? 1363 ASP A CG    1 
ATOM   7179 O  OD1   . ASP A 1 949  ? 12.167  49.409  -6.481  1.00 41.47  ? 1363 ASP A OD1   1 
ATOM   7180 O  OD2   . ASP A 1 949  ? 13.337  49.761  -4.643  1.00 41.05  ? 1363 ASP A OD2   1 
ATOM   7181 N  N     . LEU A 1 950  ? 10.938  47.393  -7.878  1.00 41.91  ? 1364 LEU A N     1 
ATOM   7182 C  CA    . LEU A 1 950  ? 10.330  47.715  -9.149  1.00 42.20  ? 1364 LEU A CA    1 
ATOM   7183 C  C     . LEU A 1 950  ? 10.938  48.952  -9.806  1.00 42.56  ? 1364 LEU A C     1 
ATOM   7184 O  O     . LEU A 1 950  ? 11.032  49.026  -11.021 1.00 41.90  ? 1364 LEU A O     1 
ATOM   7185 C  CB    . LEU A 1 950  ? 8.835   47.927  -8.948  1.00 42.42  ? 1364 LEU A CB    1 
ATOM   7186 C  CG    . LEU A 1 950  ? 8.045   47.795  -10.237 1.00 42.70  ? 1364 LEU A CG    1 
ATOM   7187 C  CD1   . LEU A 1 950  ? 8.434   46.479  -10.879 1.00 43.32  ? 1364 LEU A CD1   1 
ATOM   7188 C  CD2   . LEU A 1 950  ? 6.552   47.856  -9.953  1.00 41.39  ? 1364 LEU A CD2   1 
ATOM   7189 N  N     . TYR A 1 951  ? 11.346  49.925  -9.001  1.00 43.37  ? 1365 TYR A N     1 
ATOM   7190 C  CA    . TYR A 1 951  ? 11.758  51.223  -9.541  1.00 44.50  ? 1365 TYR A CA    1 
ATOM   7191 C  C     . TYR A 1 951  ? 13.251  51.505  -9.429  1.00 44.69  ? 1365 TYR A C     1 
ATOM   7192 O  O     . TYR A 1 951  ? 13.740  52.477  -9.997  1.00 45.54  ? 1365 TYR A O     1 
ATOM   7193 C  CB    . TYR A 1 951  ? 10.947  52.368  -8.892  1.00 44.98  ? 1365 TYR A CB    1 
ATOM   7194 C  CG    . TYR A 1 951  ? 9.491   52.399  -9.336  1.00 46.89  ? 1365 TYR A CG    1 
ATOM   7195 C  CD1   . TYR A 1 951  ? 9.148   52.802  -10.640 1.00 49.29  ? 1365 TYR A CD1   1 
ATOM   7196 C  CD2   . TYR A 1 951  ? 8.460   52.018  -8.464  1.00 47.37  ? 1365 TYR A CD2   1 
ATOM   7197 C  CE1   . TYR A 1 951  ? 7.819   52.812  -11.062 1.00 51.27  ? 1365 TYR A CE1   1 
ATOM   7198 C  CE2   . TYR A 1 951  ? 7.132   52.034  -8.866  1.00 48.73  ? 1365 TYR A CE2   1 
ATOM   7199 C  CZ    . TYR A 1 951  ? 6.817   52.427  -10.173 1.00 51.17  ? 1365 TYR A CZ    1 
ATOM   7200 O  OH    . TYR A 1 951  ? 5.508   52.446  -10.605 1.00 52.98  ? 1365 TYR A OH    1 
ATOM   7201 N  N     . ARG A 1 952  ? 13.979  50.661  -8.709  1.00 44.38  ? 1366 ARG A N     1 
ATOM   7202 C  CA    . ARG A 1 952  ? 15.389  50.904  -8.480  1.00 43.55  ? 1366 ARG A CA    1 
ATOM   7203 C  C     . ARG A 1 952  ? 16.224  49.768  -9.041  1.00 42.55  ? 1366 ARG A C     1 
ATOM   7204 O  O     . ARG A 1 952  ? 17.412  49.927  -9.242  1.00 42.33  ? 1366 ARG A O     1 
ATOM   7205 C  CB    . ARG A 1 952  ? 15.666  51.065  -6.983  1.00 44.52  ? 1366 ARG A CB    1 
ATOM   7206 C  CG    . ARG A 1 952  ? 15.149  52.381  -6.348  1.00 47.41  ? 1366 ARG A CG    1 
ATOM   7207 C  CD    . ARG A 1 952  ? 15.544  52.460  -4.869  1.00 52.41  ? 1366 ARG A CD    1 
ATOM   7208 N  NE    . ARG A 1 952  ? 15.743  53.832  -4.393  1.00 56.69  ? 1366 ARG A NE    1 
ATOM   7209 C  CZ    . ARG A 1 952  ? 16.940  54.400  -4.216  1.00 58.55  ? 1366 ARG A CZ    1 
ATOM   7210 N  NH1   . ARG A 1 952  ? 18.050  53.713  -4.480  1.00 60.11  ? 1366 ARG A NH1   1 
ATOM   7211 N  NH2   . ARG A 1 952  ? 17.038  55.653  -3.775  1.00 57.82  ? 1366 ARG A NH2   1 
ATOM   7212 N  N     . SER A 1 953  ? 15.611  48.615  -9.287  1.00 41.33  ? 1367 SER A N     1 
ATOM   7213 C  CA    . SER A 1 953  ? 16.359  47.483  -9.833  1.00 40.21  ? 1367 SER A CA    1 
ATOM   7214 C  C     . SER A 1 953  ? 16.673  47.707  -11.305 1.00 39.55  ? 1367 SER A C     1 
ATOM   7215 O  O     . SER A 1 953  ? 15.867  48.283  -12.040 1.00 39.35  ? 1367 SER A O     1 
ATOM   7216 C  CB    . SER A 1 953  ? 15.608  46.156  -9.635  1.00 40.22  ? 1367 SER A CB    1 
ATOM   7217 O  OG    . SER A 1 953  ? 15.498  45.817  -8.253  1.00 39.73  ? 1367 SER A OG    1 
ATOM   7218 N  N     . GLN A 1 954  ? 17.852  47.270  -11.745 1.00 38.44  ? 1368 GLN A N     1 
ATOM   7219 C  CA    . GLN A 1 954  ? 18.206  47.473  -13.140 1.00 37.72  ? 1368 GLN A CA    1 
ATOM   7220 C  C     . GLN A 1 954  ? 18.023  46.173  -13.896 1.00 37.31  ? 1368 GLN A C     1 
ATOM   7221 O  O     . GLN A 1 954  ? 17.599  45.177  -13.305 1.00 36.89  ? 1368 GLN A O     1 
ATOM   7222 C  CB    . GLN A 1 954  ? 19.627  48.021  -13.286 1.00 37.79  ? 1368 GLN A CB    1 
ATOM   7223 C  CG    . GLN A 1 954  ? 19.818  49.442  -12.747 1.00 37.85  ? 1368 GLN A CG    1 
ATOM   7224 C  CD    . GLN A 1 954  ? 19.076  50.521  -13.539 1.00 38.29  ? 1368 GLN A CD    1 
ATOM   7225 O  OE1   . GLN A 1 954  ? 18.365  51.329  -12.958 1.00 39.40  ? 1368 GLN A OE1   1 
ATOM   7226 N  NE2   . GLN A 1 954  ? 19.253  50.546  -14.858 1.00 37.43  ? 1368 GLN A NE2   1 
ATOM   7227 N  N     . ALA A 1 955  ? 18.320  46.192  -15.196 1.00 36.92  ? 1369 ALA A N     1 
ATOM   7228 C  CA    . ALA A 1 955  ? 18.158  45.023  -16.058 1.00 36.95  ? 1369 ALA A CA    1 
ATOM   7229 C  C     . ALA A 1 955  ? 19.154  43.895  -15.737 1.00 37.29  ? 1369 ALA A C     1 
ATOM   7230 O  O     . ALA A 1 955  ? 18.766  42.774  -15.433 1.00 36.81  ? 1369 ALA A O     1 
ATOM   7231 C  CB    . ALA A 1 955  ? 18.312  45.429  -17.507 1.00 36.87  ? 1369 ALA A CB    1 
ATOM   7232 N  N     . THR A 1 956  ? 20.446  44.182  -15.837 1.00 37.48  ? 1370 THR A N     1 
ATOM   7233 C  CA    . THR A 1 956  ? 21.420  43.131  -15.638 1.00 37.73  ? 1370 THR A CA    1 
ATOM   7234 C  C     . THR A 1 956  ? 22.471  43.519  -14.633 1.00 38.19  ? 1370 THR A C     1 
ATOM   7235 O  O     . THR A 1 956  ? 23.335  42.721  -14.308 1.00 39.33  ? 1370 THR A O     1 
ATOM   7236 C  CB    . THR A 1 956  ? 22.152  42.783  -16.947 1.00 37.70  ? 1370 THR A CB    1 
ATOM   7237 O  OG1   . THR A 1 956  ? 22.803  43.957  -17.446 1.00 37.47  ? 1370 THR A OG1   1 
ATOM   7238 C  CG2   . THR A 1 956  ? 21.177  42.233  -18.016 1.00 36.30  ? 1370 THR A CG2   1 
ATOM   7239 N  N     . GLU A 1 957  ? 22.433  44.747  -14.154 1.00 37.86  ? 1371 GLU A N     1 
ATOM   7240 C  CA    . GLU A 1 957  ? 23.488  45.212  -13.292 1.00 38.18  ? 1371 GLU A CA    1 
ATOM   7241 C  C     . GLU A 1 957  ? 23.060  45.262  -11.818 1.00 38.22  ? 1371 GLU A C     1 
ATOM   7242 O  O     . GLU A 1 957  ? 21.997  45.802  -11.489 1.00 37.55  ? 1371 GLU A O     1 
ATOM   7243 C  CB    . GLU A 1 957  ? 23.949  46.581  -13.781 1.00 38.67  ? 1371 GLU A CB    1 
ATOM   7244 C  CG    . GLU A 1 957  ? 24.981  47.263  -12.903 1.00 41.58  ? 1371 GLU A CG    1 
ATOM   7245 C  CD    . GLU A 1 957  ? 25.506  48.543  -13.539 1.00 45.20  ? 1371 GLU A CD    1 
ATOM   7246 O  OE1   . GLU A 1 957  ? 25.272  48.758  -14.768 1.00 44.43  ? 1371 GLU A OE1   1 
ATOM   7247 O  OE2   . GLU A 1 957  ? 26.152  49.329  -12.804 1.00 45.82  ? 1371 GLU A OE2   1 
ATOM   7248 N  N     . PHE A 1 958  ? 23.865  44.662  -10.938 1.00 38.42  ? 1372 PHE A N     1 
ATOM   7249 C  CA    . PHE A 1 958  ? 23.679  44.829  -9.489  1.00 38.59  ? 1372 PHE A CA    1 
ATOM   7250 C  C     . PHE A 1 958  ? 24.082  46.255  -9.151  1.00 39.48  ? 1372 PHE A C     1 
ATOM   7251 O  O     . PHE A 1 958  ? 25.212  46.666  -9.425  1.00 40.04  ? 1372 PHE A O     1 
ATOM   7252 C  CB    . PHE A 1 958  ? 24.558  43.861  -8.697  1.00 38.42  ? 1372 PHE A CB    1 
ATOM   7253 C  CG    . PHE A 1 958  ? 24.006  42.471  -8.611  1.00 36.82  ? 1372 PHE A CG    1 
ATOM   7254 C  CD1   . PHE A 1 958  ? 23.388  42.031  -7.456  1.00 34.65  ? 1372 PHE A CD1   1 
ATOM   7255 C  CD2   . PHE A 1 958  ? 24.094  41.610  -9.693  1.00 34.98  ? 1372 PHE A CD2   1 
ATOM   7256 C  CE1   . PHE A 1 958  ? 22.877  40.746  -7.374  1.00 35.32  ? 1372 PHE A CE1   1 
ATOM   7257 C  CE2   . PHE A 1 958  ? 23.571  40.332  -9.629  1.00 34.93  ? 1372 PHE A CE2   1 
ATOM   7258 C  CZ    . PHE A 1 958  ? 22.964  39.891  -8.465  1.00 34.11  ? 1372 PHE A CZ    1 
ATOM   7259 N  N     . VAL A 1 959  ? 23.172  47.027  -8.571  1.00 40.18  ? 1373 VAL A N     1 
ATOM   7260 C  CA    . VAL A 1 959  ? 23.509  48.411  -8.295  1.00 40.45  ? 1373 VAL A CA    1 
ATOM   7261 C  C     . VAL A 1 959  ? 23.748  48.670  -6.803  1.00 40.50  ? 1373 VAL A C     1 
ATOM   7262 O  O     . VAL A 1 959  ? 23.172  47.994  -5.928  1.00 40.35  ? 1373 VAL A O     1 
ATOM   7263 C  CB    . VAL A 1 959  ? 22.452  49.386  -8.881  1.00 40.98  ? 1373 VAL A CB    1 
ATOM   7264 C  CG1   . VAL A 1 959  ? 22.505  49.359  -10.394 1.00 41.84  ? 1373 VAL A CG1   1 
ATOM   7265 C  CG2   . VAL A 1 959  ? 21.071  49.024  -8.433  1.00 40.52  ? 1373 VAL A CG2   1 
ATOM   7266 N  N     . ILE A 1 960  ? 24.607  49.648  -6.534  1.00 39.90  ? 1374 ILE A N     1 
ATOM   7267 C  CA    . ILE A 1 960  ? 24.944  50.040  -5.179  1.00 39.48  ? 1374 ILE A CA    1 
ATOM   7268 C  C     . ILE A 1 960  ? 23.970  51.068  -4.585  1.00 40.01  ? 1374 ILE A C     1 
ATOM   7269 O  O     . ILE A 1 960  ? 23.634  52.096  -5.205  1.00 40.51  ? 1374 ILE A O     1 
ATOM   7270 C  CB    . ILE A 1 960  ? 26.380  50.556  -5.127  1.00 39.08  ? 1374 ILE A CB    1 
ATOM   7271 C  CG1   . ILE A 1 960  ? 27.332  49.401  -5.378  1.00 37.82  ? 1374 ILE A CG1   1 
ATOM   7272 C  CG2   . ILE A 1 960  ? 26.679  51.231  -3.809  1.00 38.71  ? 1374 ILE A CG2   1 
ATOM   7273 C  CD1   . ILE A 1 960  ? 28.647  49.853  -5.882  1.00 37.94  ? 1374 ILE A CD1   1 
ATOM   7274 N  N     . ASP A 1 961  ? 23.524  50.776  -3.370  1.00 40.02  ? 1375 ASP A N     1 
ATOM   7275 C  CA    . ASP A 1 961  ? 22.641  51.660  -2.622  1.00 39.84  ? 1375 ASP A CA    1 
ATOM   7276 C  C     . ASP A 1 961  ? 23.020  51.566  -1.137  1.00 39.67  ? 1375 ASP A C     1 
ATOM   7277 O  O     . ASP A 1 961  ? 22.686  50.582  -0.457  1.00 39.14  ? 1375 ASP A O     1 
ATOM   7278 C  CB    . ASP A 1 961  ? 21.205  51.236  -2.845  1.00 39.54  ? 1375 ASP A CB    1 
ATOM   7279 C  CG    . ASP A 1 961  ? 20.229  52.003  -1.982  1.00 41.10  ? 1375 ASP A CG    1 
ATOM   7280 O  OD1   . ASP A 1 961  ? 20.406  53.234  -1.843  1.00 40.09  ? 1375 ASP A OD1   1 
ATOM   7281 O  OD2   . ASP A 1 961  ? 19.267  51.369  -1.463  1.00 42.79  ? 1375 ASP A OD2   1 
ATOM   7282 N  N     . GLY A 1 962  ? 23.758  52.567  -0.659  1.00 39.27  ? 1376 GLY A N     1 
ATOM   7283 C  CA    . GLY A 1 962  ? 24.224  52.586  0.721   1.00 39.11  ? 1376 GLY A CA    1 
ATOM   7284 C  C     . GLY A 1 962  ? 25.189  51.435  0.914   1.00 39.37  ? 1376 GLY A C     1 
ATOM   7285 O  O     . GLY A 1 962  ? 26.209  51.362  0.240   1.00 39.11  ? 1376 GLY A O     1 
ATOM   7286 N  N     . ASN A 1 963  ? 24.869  50.530  1.834   1.00 39.51  ? 1377 ASN A N     1 
ATOM   7287 C  CA    . ASN A 1 963  ? 25.683  49.347  2.046   1.00 39.82  ? 1377 ASN A CA    1 
ATOM   7288 C  C     . ASN A 1 963  ? 25.060  48.095  1.449   1.00 39.70  ? 1377 ASN A C     1 
ATOM   7289 O  O     . ASN A 1 963  ? 25.397  46.980  1.845   1.00 39.63  ? 1377 ASN A O     1 
ATOM   7290 C  CB    . ASN A 1 963  ? 25.947  49.144  3.531   1.00 39.86  ? 1377 ASN A CB    1 
ATOM   7291 C  CG    . ASN A 1 963  ? 26.971  50.113  4.065   1.00 40.90  ? 1377 ASN A CG    1 
ATOM   7292 O  OD1   . ASN A 1 963  ? 28.119  50.121  3.630   1.00 42.99  ? 1377 ASN A OD1   1 
ATOM   7293 N  ND2   . ASN A 1 963  ? 26.566  50.933  5.020   1.00 42.89  ? 1377 ASN A ND2   1 
ATOM   7294 N  N     . SER A 1 964  ? 24.162  48.275  0.490   1.00 39.25  ? 1378 SER A N     1 
ATOM   7295 C  CA    . SER A 1 964  ? 23.552  47.127  -0.154  1.00 39.61  ? 1378 SER A CA    1 
ATOM   7296 C  C     . SER A 1 964  ? 23.709  47.038  -1.678  1.00 39.26  ? 1378 SER A C     1 
ATOM   7297 O  O     . SER A 1 964  ? 24.266  47.919  -2.337  1.00 39.61  ? 1378 SER A O     1 
ATOM   7298 C  CB    . SER A 1 964  ? 22.070  47.070  0.189   1.00 39.38  ? 1378 SER A CB    1 
ATOM   7299 O  OG    . SER A 1 964  ? 21.917  46.657  1.525   1.00 42.07  ? 1378 SER A OG    1 
ATOM   7300 N  N     . LEU A 1 965  ? 23.163  45.963  -2.220  1.00 38.25  ? 1379 LEU A N     1 
ATOM   7301 C  CA    . LEU A 1 965  ? 23.130  45.743  -3.635  1.00 37.56  ? 1379 LEU A CA    1 
ATOM   7302 C  C     . LEU A 1 965  ? 21.682  45.453  -3.921  1.00 37.48  ? 1379 LEU A C     1 
ATOM   7303 O  O     . LEU A 1 965  ? 21.044  44.667  -3.210  1.00 38.25  ? 1379 LEU A O     1 
ATOM   7304 C  CB    . LEU A 1 965  ? 23.984  44.521  -4.021  1.00 36.87  ? 1379 LEU A CB    1 
ATOM   7305 C  CG    . LEU A 1 965  ? 25.509  44.635  -3.941  1.00 35.73  ? 1379 LEU A CG    1 
ATOM   7306 C  CD1   . LEU A 1 965  ? 26.156  43.410  -4.536  1.00 32.97  ? 1379 LEU A CD1   1 
ATOM   7307 C  CD2   . LEU A 1 965  ? 26.002  45.915  -4.641  1.00 33.58  ? 1379 LEU A CD2   1 
ATOM   7308 N  N     . ILE A 1 966  ? 21.147  46.131  -4.919  1.00 36.85  ? 1380 ILE A N     1 
ATOM   7309 C  CA    . ILE A 1 966  ? 19.822  45.837  -5.369  1.00 36.94  ? 1380 ILE A CA    1 
ATOM   7310 C  C     . ILE A 1 966  ? 20.009  44.965  -6.573  1.00 36.77  ? 1380 ILE A C     1 
ATOM   7311 O  O     . ILE A 1 966  ? 20.586  45.396  -7.574  1.00 36.95  ? 1380 ILE A O     1 
ATOM   7312 C  CB    . ILE A 1 966  ? 19.026  47.109  -5.788  1.00 37.38  ? 1380 ILE A CB    1 
ATOM   7313 C  CG1   . ILE A 1 966  ? 18.926  48.103  -4.615  1.00 37.41  ? 1380 ILE A CG1   1 
ATOM   7314 C  CG2   . ILE A 1 966  ? 17.639  46.714  -6.277  1.00 37.30  ? 1380 ILE A CG2   1 
ATOM   7315 C  CD1   . ILE A 1 966  ? 18.219  49.410  -4.958  1.00 37.12  ? 1380 ILE A CD1   1 
ATOM   7316 N  N     . PRO A 1 967  ? 19.527  43.724  -6.475  1.00 36.35  ? 1381 PRO A N     1 
ATOM   7317 C  CA    . PRO A 1 967  ? 19.642  42.741  -7.531  1.00 35.84  ? 1381 PRO A CA    1 
ATOM   7318 C  C     . PRO A 1 967  ? 18.840  43.148  -8.759  1.00 35.82  ? 1381 PRO A C     1 
ATOM   7319 O  O     . PRO A 1 967  ? 17.790  43.782  -8.637  1.00 36.17  ? 1381 PRO A O     1 
ATOM   7320 C  CB    . PRO A 1 967  ? 19.044  41.485  -6.899  1.00 35.96  ? 1381 PRO A CB    1 
ATOM   7321 C  CG    . PRO A 1 967  ? 18.077  42.005  -5.865  1.00 36.00  ? 1381 PRO A CG    1 
ATOM   7322 C  CD    . PRO A 1 967  ? 18.740  43.239  -5.322  1.00 35.86  ? 1381 PRO A CD    1 
ATOM   7323 N  N     . PRO A 1 968  ? 19.342  42.800  -9.943  1.00 36.08  ? 1382 PRO A N     1 
ATOM   7324 C  CA    . PRO A 1 968  ? 18.654  43.155  -11.172 1.00 36.54  ? 1382 PRO A CA    1 
ATOM   7325 C  C     . PRO A 1 968  ? 17.576  42.130  -11.523 1.00 36.89  ? 1382 PRO A C     1 
ATOM   7326 O  O     . PRO A 1 968  ? 17.593  41.004  -11.011 1.00 36.48  ? 1382 PRO A O     1 
ATOM   7327 C  CB    . PRO A 1 968  ? 19.766  43.068  -12.207 1.00 36.28  ? 1382 PRO A CB    1 
ATOM   7328 C  CG    . PRO A 1 968  ? 20.583  41.918  -11.704 1.00 36.52  ? 1382 PRO A CG    1 
ATOM   7329 C  CD    . PRO A 1 968  ? 20.596  42.063  -10.207 1.00 35.27  ? 1382 PRO A CD    1 
ATOM   7330 N  N     . PHE A 1 969  ? 16.657  42.514  -12.400 1.00 37.07  ? 1383 PHE A N     1 
ATOM   7331 C  CA    . PHE A 1 969  ? 15.620  41.592  -12.820 1.00 37.34  ? 1383 PHE A CA    1 
ATOM   7332 C  C     . PHE A 1 969  ? 16.177  40.278  -13.397 1.00 37.93  ? 1383 PHE A C     1 
ATOM   7333 O  O     . PHE A 1 969  ? 15.611  39.210  -13.136 1.00 38.56  ? 1383 PHE A O     1 
ATOM   7334 C  CB    . PHE A 1 969  ? 14.664  42.244  -13.820 1.00 37.17  ? 1383 PHE A CB    1 
ATOM   7335 C  CG    . PHE A 1 969  ? 13.958  43.471  -13.293 1.00 36.51  ? 1383 PHE A CG    1 
ATOM   7336 C  CD1   . PHE A 1 969  ? 12.980  43.367  -12.310 1.00 37.08  ? 1383 PHE A CD1   1 
ATOM   7337 C  CD2   . PHE A 1 969  ? 14.258  44.727  -13.798 1.00 36.20  ? 1383 PHE A CD2   1 
ATOM   7338 C  CE1   . PHE A 1 969  ? 12.313  44.503  -11.837 1.00 37.96  ? 1383 PHE A CE1   1 
ATOM   7339 C  CE2   . PHE A 1 969  ? 13.601  45.865  -13.334 1.00 37.99  ? 1383 PHE A CE2   1 
ATOM   7340 C  CZ    . PHE A 1 969  ? 12.620  45.751  -12.351 1.00 37.02  ? 1383 PHE A CZ    1 
ATOM   7341 N  N     . ASN A 1 970  ? 17.254  40.318  -14.179 1.00 37.29  ? 1384 ASN A N     1 
ATOM   7342 C  CA    . ASN A 1 970  ? 17.679  39.064  -14.808 1.00 37.42  ? 1384 ASN A CA    1 
ATOM   7343 C  C     . ASN A 1 970  ? 18.199  38.044  -13.790 1.00 37.94  ? 1384 ASN A C     1 
ATOM   7344 O  O     . ASN A 1 970  ? 18.455  36.896  -14.138 1.00 37.95  ? 1384 ASN A O     1 
ATOM   7345 C  CB    . ASN A 1 970  ? 18.690  39.270  -15.947 1.00 36.65  ? 1384 ASN A CB    1 
ATOM   7346 C  CG    . ASN A 1 970  ? 20.096  39.610  -15.442 1.00 36.36  ? 1384 ASN A CG    1 
ATOM   7347 O  OD1   . ASN A 1 970  ? 20.254  40.252  -14.412 1.00 35.67  ? 1384 ASN A OD1   1 
ATOM   7348 N  ND2   . ASN A 1 970  ? 21.121  39.201  -16.192 1.00 35.45  ? 1384 ASN A ND2   1 
ATOM   7349 N  N     . ALA A 1 971  ? 18.358  38.467  -12.541 1.00 38.39  ? 1385 ALA A N     1 
ATOM   7350 C  CA    . ALA A 1 971  ? 18.771  37.549  -11.491 1.00 39.20  ? 1385 ALA A CA    1 
ATOM   7351 C  C     . ALA A 1 971  ? 17.621  36.611  -11.125 1.00 39.77  ? 1385 ALA A C     1 
ATOM   7352 O  O     . ALA A 1 971  ? 17.837  35.543  -10.557 1.00 40.42  ? 1385 ALA A O     1 
ATOM   7353 C  CB    . ALA A 1 971  ? 19.275  38.296  -10.264 1.00 38.21  ? 1385 ALA A CB    1 
ATOM   7354 N  N     . ILE A 1 972  ? 16.399  36.987  -11.481 1.00 40.12  ? 1386 ILE A N     1 
ATOM   7355 C  CA    . ILE A 1 972  ? 15.243  36.143  -11.151 1.00 40.29  ? 1386 ILE A CA    1 
ATOM   7356 C  C     . ILE A 1 972  ? 15.212  34.874  -12.002 1.00 40.40  ? 1386 ILE A C     1 
ATOM   7357 O  O     . ILE A 1 972  ? 15.294  34.935  -13.218 1.00 40.45  ? 1386 ILE A O     1 
ATOM   7358 C  CB    . ILE A 1 972  ? 13.880  36.907  -11.282 1.00 40.10  ? 1386 ILE A CB    1 
ATOM   7359 C  CG1   . ILE A 1 972  ? 13.818  38.082  -10.306 1.00 39.00  ? 1386 ILE A CG1   1 
ATOM   7360 C  CG2   . ILE A 1 972  ? 12.688  35.948  -11.056 1.00 40.14  ? 1386 ILE A CG2   1 
ATOM   7361 C  CD1   . ILE A 1 972  ? 12.626  39.003  -10.524 1.00 36.82  ? 1386 ILE A CD1   1 
ATOM   7362 N  N     . PRO A 1 973  ? 15.054  33.711  -11.369 1.00 40.82  ? 1387 PRO A N     1 
ATOM   7363 C  CA    . PRO A 1 973  ? 14.992  32.519  -12.236 1.00 40.92  ? 1387 PRO A CA    1 
ATOM   7364 C  C     . PRO A 1 973  ? 13.893  32.624  -13.320 1.00 41.11  ? 1387 PRO A C     1 
ATOM   7365 O  O     . PRO A 1 973  ? 12.767  33.046  -13.049 1.00 41.04  ? 1387 PRO A O     1 
ATOM   7366 C  CB    . PRO A 1 973  ? 14.687  31.378  -11.257 1.00 41.11  ? 1387 PRO A CB    1 
ATOM   7367 C  CG    . PRO A 1 973  ? 14.896  31.974  -9.846  1.00 40.82  ? 1387 PRO A CG    1 
ATOM   7368 C  CD    . PRO A 1 973  ? 14.668  33.433  -9.972  1.00 40.61  ? 1387 PRO A CD    1 
ATOM   7369 N  N     . GLY A 1 974  ? 14.231  32.259  -14.551 1.00 41.40  ? 1388 GLY A N     1 
ATOM   7370 C  CA    . GLY A 1 974  ? 13.279  32.337  -15.657 1.00 41.18  ? 1388 GLY A CA    1 
ATOM   7371 C  C     . GLY A 1 974  ? 13.226  33.698  -16.334 1.00 41.21  ? 1388 GLY A C     1 
ATOM   7372 O  O     . GLY A 1 974  ? 12.701  33.833  -17.441 1.00 41.21  ? 1388 GLY A O     1 
ATOM   7373 N  N     . LEU A 1 975  ? 13.761  34.714  -15.666 1.00 41.14  ? 1389 LEU A N     1 
ATOM   7374 C  CA    . LEU A 1 975  ? 13.760  36.062  -16.208 1.00 41.21  ? 1389 LEU A CA    1 
ATOM   7375 C  C     . LEU A 1 975  ? 15.090  36.360  -16.884 1.00 41.34  ? 1389 LEU A C     1 
ATOM   7376 O  O     . LEU A 1 975  ? 16.115  36.548  -16.229 1.00 41.49  ? 1389 LEU A O     1 
ATOM   7377 C  CB    . LEU A 1 975  ? 13.473  37.080  -15.108 1.00 40.91  ? 1389 LEU A CB    1 
ATOM   7378 C  CG    . LEU A 1 975  ? 12.733  38.331  -15.574 1.00 41.64  ? 1389 LEU A CG    1 
ATOM   7379 C  CD1   . LEU A 1 975  ? 12.227  39.171  -14.377 1.00 40.49  ? 1389 LEU A CD1   1 
ATOM   7380 C  CD2   . LEU A 1 975  ? 13.651  39.133  -16.471 1.00 41.45  ? 1389 LEU A CD2   1 
ATOM   7381 N  N     . GLY A 1 976  ? 15.082  36.394  -18.204 1.00 41.64  ? 1390 GLY A N     1 
ATOM   7382 C  CA    . GLY A 1 976  ? 16.331  36.572  -18.928 1.00 42.01  ? 1390 GLY A CA    1 
ATOM   7383 C  C     . GLY A 1 976  ? 16.579  38.011  -19.317 1.00 42.39  ? 1390 GLY A C     1 
ATOM   7384 O  O     . GLY A 1 976  ? 15.725  38.886  -19.145 1.00 42.11  ? 1390 GLY A O     1 
ATOM   7385 N  N     . THR A 1 977  ? 17.763  38.247  -19.858 1.00 42.77  ? 1391 THR A N     1 
ATOM   7386 C  CA    . THR A 1 977  ? 18.178  39.569  -20.284 1.00 43.38  ? 1391 THR A CA    1 
ATOM   7387 C  C     . THR A 1 977  ? 17.104  40.331  -21.045 1.00 43.45  ? 1391 THR A C     1 
ATOM   7388 O  O     . THR A 1 977  ? 16.988  41.547  -20.949 1.00 43.53  ? 1391 THR A O     1 
ATOM   7389 C  CB    . THR A 1 977  ? 19.368  39.407  -21.179 1.00 43.21  ? 1391 THR A CB    1 
ATOM   7390 O  OG1   . THR A 1 977  ? 20.210  38.432  -20.570 1.00 44.74  ? 1391 THR A OG1   1 
ATOM   7391 C  CG2   . THR A 1 977  ? 20.111  40.710  -21.328 1.00 43.06  ? 1391 THR A CG2   1 
ATOM   7392 N  N     . ASN A 1 978  ? 16.314  39.610  -21.808 1.00 43.75  ? 1392 ASN A N     1 
ATOM   7393 C  CA    . ASN A 1 978  ? 15.406  40.268  -22.701 1.00 44.27  ? 1392 ASN A CA    1 
ATOM   7394 C  C     . ASN A 1 978  ? 14.249  40.960  -21.985 1.00 44.10  ? 1392 ASN A C     1 
ATOM   7395 O  O     . ASN A 1 978  ? 13.994  42.158  -22.165 1.00 43.97  ? 1392 ASN A O     1 
ATOM   7396 C  CB    . ASN A 1 978  ? 14.881  39.254  -23.678 1.00 44.65  ? 1392 ASN A CB    1 
ATOM   7397 C  CG    . ASN A 1 978  ? 14.688  39.838  -25.015 1.00 46.71  ? 1392 ASN A CG    1 
ATOM   7398 O  OD1   . ASN A 1 978  ? 13.697  40.537  -25.248 1.00 48.75  ? 1392 ASN A OD1   1 
ATOM   7399 N  ND2   . ASN A 1 978  ? 15.643  39.590  -25.921 1.00 46.42  ? 1392 ASN A ND2   1 
ATOM   7400 N  N     . VAL A 1 979  ? 13.540  40.179  -21.184 1.00 43.63  ? 1393 VAL A N     1 
ATOM   7401 C  CA    . VAL A 1 979  ? 12.476  40.693  -20.360 1.00 43.16  ? 1393 VAL A CA    1 
ATOM   7402 C  C     . VAL A 1 979  ? 13.035  41.728  -19.398 1.00 42.70  ? 1393 VAL A C     1 
ATOM   7403 O  O     . VAL A 1 979  ? 12.465  42.806  -19.215 1.00 42.61  ? 1393 VAL A O     1 
ATOM   7404 C  CB    . VAL A 1 979  ? 11.814  39.546  -19.599 1.00 43.40  ? 1393 VAL A CB    1 
ATOM   7405 C  CG1   . VAL A 1 979  ? 10.906  40.076  -18.504 1.00 43.65  ? 1393 VAL A CG1   1 
ATOM   7406 C  CG2   . VAL A 1 979  ? 11.059  38.657  -20.584 1.00 42.90  ? 1393 VAL A CG2   1 
ATOM   7407 N  N     . ALA A 1 980  ? 14.157  41.401  -18.777 1.00 42.59  ? 1394 ALA A N     1 
ATOM   7408 C  CA    . ALA A 1 980  ? 14.824  42.370  -17.905 1.00 42.35  ? 1394 ALA A CA    1 
ATOM   7409 C  C     . ALA A 1 980  ? 14.878  43.716  -18.616 1.00 41.96  ? 1394 ALA A C     1 
ATOM   7410 O  O     . ALA A 1 980  ? 14.475  44.739  -18.062 1.00 42.31  ? 1394 ALA A O     1 
ATOM   7411 C  CB    . ALA A 1 980  ? 16.222  41.905  -17.552 1.00 41.86  ? 1394 ALA A CB    1 
ATOM   7412 N  N     . GLN A 1 981  ? 15.367  43.705  -19.853 1.00 41.60  ? 1395 GLN A N     1 
ATOM   7413 C  CA    . GLN A 1 981  ? 15.616  44.947  -20.587 1.00 41.63  ? 1395 GLN A CA    1 
ATOM   7414 C  C     . GLN A 1 981  ? 14.319  45.665  -20.944 1.00 41.61  ? 1395 GLN A C     1 
ATOM   7415 O  O     . GLN A 1 981  ? 14.251  46.895  -20.884 1.00 41.35  ? 1395 GLN A O     1 
ATOM   7416 C  CB    . GLN A 1 981  ? 16.508  44.707  -21.816 1.00 41.46  ? 1395 GLN A CB    1 
ATOM   7417 C  CG    . GLN A 1 981  ? 17.996  44.947  -21.498 1.00 42.12  ? 1395 GLN A CG    1 
ATOM   7418 C  CD    . GLN A 1 981  ? 18.986  44.282  -22.463 1.00 43.87  ? 1395 GLN A CD    1 
ATOM   7419 O  OE1   . GLN A 1 981  ? 18.697  44.063  -23.651 1.00 43.07  ? 1395 GLN A OE1   1 
ATOM   7420 N  NE2   . GLN A 1 981  ? 20.181  43.984  -21.948 1.00 42.90  ? 1395 GLN A NE2   1 
ATOM   7421 N  N     . ALA A 1 982  ? 13.291  44.879  -21.270 1.00 41.31  ? 1396 ALA A N     1 
ATOM   7422 C  CA    . ALA A 1 982  ? 11.978  45.405  -21.589 1.00 41.42  ? 1396 ALA A CA    1 
ATOM   7423 C  C     . ALA A 1 982  ? 11.340  46.079  -20.387 1.00 41.40  ? 1396 ALA A C     1 
ATOM   7424 O  O     . ALA A 1 982  ? 10.732  47.146  -20.516 1.00 41.03  ? 1396 ALA A O     1 
ATOM   7425 C  CB    . ALA A 1 982  ? 11.082  44.293  -22.105 1.00 41.58  ? 1396 ALA A CB    1 
ATOM   7426 N  N     . ILE A 1 983  ? 11.456  45.446  -19.220 1.00 41.77  ? 1397 ILE A N     1 
ATOM   7427 C  CA    . ILE A 1 983  ? 10.852  46.012  -18.003 1.00 42.01  ? 1397 ILE A CA    1 
ATOM   7428 C  C     . ILE A 1 983  ? 11.398  47.409  -17.752 1.00 42.05  ? 1397 ILE A C     1 
ATOM   7429 O  O     . ILE A 1 983  ? 10.668  48.324  -17.371 1.00 41.66  ? 1397 ILE A O     1 
ATOM   7430 C  CB    . ILE A 1 983  ? 11.153  45.198  -16.750 1.00 41.67  ? 1397 ILE A CB    1 
ATOM   7431 C  CG1   . ILE A 1 983  ? 10.483  43.820  -16.808 1.00 42.33  ? 1397 ILE A CG1   1 
ATOM   7432 C  CG2   . ILE A 1 983  ? 10.655  45.960  -15.537 1.00 41.89  ? 1397 ILE A CG2   1 
ATOM   7433 C  CD1   . ILE A 1 983  ? 10.668  42.983  -15.541 1.00 40.16  ? 1397 ILE A CD1   1 
ATOM   7434 N  N     . VAL A 1 984  ? 12.698  47.555  -17.970 1.00 42.23  ? 1398 VAL A N     1 
ATOM   7435 C  CA    . VAL A 1 984  ? 13.379  48.821  -17.768 1.00 42.60  ? 1398 VAL A CA    1 
ATOM   7436 C  C     . VAL A 1 984  ? 12.990  49.865  -18.837 1.00 42.87  ? 1398 VAL A C     1 
ATOM   7437 O  O     . VAL A 1 984  ? 12.795  51.047  -18.528 1.00 42.67  ? 1398 VAL A O     1 
ATOM   7438 C  CB    . VAL A 1 984  ? 14.900  48.575  -17.734 1.00 42.64  ? 1398 VAL A CB    1 
ATOM   7439 C  CG1   . VAL A 1 984  ? 15.678  49.863  -17.928 1.00 42.84  ? 1398 VAL A CG1   1 
ATOM   7440 C  CG2   . VAL A 1 984  ? 15.288  47.889  -16.419 1.00 42.52  ? 1398 VAL A CG2   1 
ATOM   7441 N  N     . ARG A 1 985  ? 12.878  49.401  -20.082 1.00 43.39  ? 1399 ARG A N     1 
ATOM   7442 C  CA    . ARG A 1 985  ? 12.392  50.181  -21.225 1.00 43.86  ? 1399 ARG A CA    1 
ATOM   7443 C  C     . ARG A 1 985  ? 10.987  50.729  -20.960 1.00 43.68  ? 1399 ARG A C     1 
ATOM   7444 O  O     . ARG A 1 985  ? 10.716  51.917  -21.151 1.00 43.45  ? 1399 ARG A O     1 
ATOM   7445 C  CB    . ARG A 1 985  ? 12.336  49.279  -22.459 1.00 44.09  ? 1399 ARG A CB    1 
ATOM   7446 C  CG    . ARG A 1 985  ? 12.638  49.980  -23.791 1.00 47.05  ? 1399 ARG A CG    1 
ATOM   7447 C  CD    . ARG A 1 985  ? 12.396  49.107  -25.063 1.00 50.54  ? 1399 ARG A CD    1 
ATOM   7448 N  NE    . ARG A 1 985  ? 12.523  47.648  -24.896 1.00 52.49  ? 1399 ARG A NE    1 
ATOM   7449 C  CZ    . ARG A 1 985  ? 13.671  46.968  -24.920 1.00 53.39  ? 1399 ARG A CZ    1 
ATOM   7450 N  NH1   . ARG A 1 985  ? 13.667  45.646  -24.767 1.00 53.20  ? 1399 ARG A NH1   1 
ATOM   7451 N  NH2   . ARG A 1 985  ? 14.825  47.606  -25.077 1.00 53.80  ? 1399 ARG A NH2   1 
ATOM   7452 N  N     . ALA A 1 986  ? 10.095  49.859  -20.504 1.00 43.43  ? 1400 ALA A N     1 
ATOM   7453 C  CA    . ALA A 1 986  ? 8.726   50.272  -20.283 1.00 43.31  ? 1400 ALA A CA    1 
ATOM   7454 C  C     . ALA A 1 986  ? 8.624   51.313  -19.181 1.00 43.38  ? 1400 ALA A C     1 
ATOM   7455 O  O     . ALA A 1 986  ? 7.931   52.308  -19.332 1.00 43.49  ? 1400 ALA A O     1 
ATOM   7456 C  CB    . ALA A 1 986  ? 7.843   49.071  -19.980 1.00 43.18  ? 1400 ALA A CB    1 
ATOM   7457 N  N     . ARG A 1 987  ? 9.296   51.098  -18.059 1.00 43.71  ? 1401 ARG A N     1 
ATOM   7458 C  CA    . ARG A 1 987  ? 9.137   52.037  -16.948 1.00 44.04  ? 1401 ARG A CA    1 
ATOM   7459 C  C     . ARG A 1 987  ? 9.790   53.393  -17.247 1.00 43.91  ? 1401 ARG A C     1 
ATOM   7460 O  O     . ARG A 1 987  ? 9.401   54.420  -16.692 1.00 43.61  ? 1401 ARG A O     1 
ATOM   7461 C  CB    . ARG A 1 987  ? 9.656   51.451  -15.623 1.00 44.06  ? 1401 ARG A CB    1 
ATOM   7462 C  CG    . ARG A 1 987  ? 11.084  51.779  -15.321 1.00 44.67  ? 1401 ARG A CG    1 
ATOM   7463 C  CD    . ARG A 1 987  ? 11.522  51.368  -13.938 1.00 45.28  ? 1401 ARG A CD    1 
ATOM   7464 N  NE    . ARG A 1 987  ? 12.967  51.536  -13.881 1.00 46.03  ? 1401 ARG A NE    1 
ATOM   7465 C  CZ    . ARG A 1 987  ? 13.833  50.630  -13.441 1.00 44.78  ? 1401 ARG A CZ    1 
ATOM   7466 N  NH1   . ARG A 1 987  ? 13.416  49.473  -12.948 1.00 42.91  ? 1401 ARG A NH1   1 
ATOM   7467 N  NH2   . ARG A 1 987  ? 15.129  50.911  -13.471 1.00 44.94  ? 1401 ARG A NH2   1 
ATOM   7468 N  N     . GLU A 1 988  ? 10.779  53.389  -18.129 1.00 44.09  ? 1402 GLU A N     1 
ATOM   7469 C  CA    . GLU A 1 988  ? 11.445  54.629  -18.480 1.00 44.53  ? 1402 GLU A CA    1 
ATOM   7470 C  C     . GLU A 1 988  ? 10.504  55.486  -19.321 1.00 44.46  ? 1402 GLU A C     1 
ATOM   7471 O  O     . GLU A 1 988  ? 10.594  56.714  -19.345 1.00 44.22  ? 1402 GLU A O     1 
ATOM   7472 C  CB    . GLU A 1 988  ? 12.782  54.348  -19.174 1.00 44.79  ? 1402 GLU A CB    1 
ATOM   7473 C  CG    . GLU A 1 988  ? 13.929  54.233  -18.160 1.00 46.21  ? 1402 GLU A CG    1 
ATOM   7474 C  CD    . GLU A 1 988  ? 15.181  53.534  -18.685 1.00 49.05  ? 1402 GLU A CD    1 
ATOM   7475 O  OE1   . GLU A 1 988  ? 15.362  53.406  -19.927 1.00 50.10  ? 1402 GLU A OE1   1 
ATOM   7476 O  OE2   . GLU A 1 988  ? 16.004  53.131  -17.831 1.00 48.61  ? 1402 GLU A OE2   1 
ATOM   7477 N  N     . GLU A 1 989  ? 9.558   54.834  -19.978 1.00 44.39  ? 1403 GLU A N     1 
ATOM   7478 C  CA    . GLU A 1 989  ? 8.612   55.571  -20.784 1.00 44.37  ? 1403 GLU A CA    1 
ATOM   7479 C  C     . GLU A 1 989  ? 7.217   55.626  -20.180 1.00 44.31  ? 1403 GLU A C     1 
ATOM   7480 O  O     . GLU A 1 989  ? 6.245   55.835  -20.901 1.00 43.95  ? 1403 GLU A O     1 
ATOM   7481 C  CB    . GLU A 1 989  ? 8.540   54.982  -22.176 1.00 44.80  ? 1403 GLU A CB    1 
ATOM   7482 C  CG    . GLU A 1 989  ? 7.388   54.047  -22.424 1.00 46.25  ? 1403 GLU A CG    1 
ATOM   7483 C  CD    . GLU A 1 989  ? 7.575   53.377  -23.782 1.00 49.01  ? 1403 GLU A CD    1 
ATOM   7484 O  OE1   . GLU A 1 989  ? 8.739   52.989  -24.066 1.00 48.23  ? 1403 GLU A OE1   1 
ATOM   7485 O  OE2   . GLU A 1 989  ? 6.594   53.276  -24.563 1.00 49.06  ? 1403 GLU A OE2   1 
ATOM   7486 N  N     . GLY A 1 990  ? 7.136   55.445  -18.860 1.00 44.04  ? 1404 GLY A N     1 
ATOM   7487 C  CA    . GLY A 1 990  ? 5.893   55.583  -18.125 1.00 43.58  ? 1404 GLY A CA    1 
ATOM   7488 C  C     . GLY A 1 990  ? 5.802   54.610  -16.974 1.00 43.39  ? 1404 GLY A C     1 
ATOM   7489 O  O     . GLY A 1 990  ? 5.824   53.398  -17.179 1.00 43.15  ? 1404 GLY A O     1 
ATOM   7490 N  N     . GLU A 1 991  ? 5.690   55.135  -15.759 1.00 43.46  ? 1405 GLU A N     1 
ATOM   7491 C  CA    . GLU A 1 991  ? 5.506   54.285  -14.580 1.00 43.92  ? 1405 GLU A CA    1 
ATOM   7492 C  C     . GLU A 1 991  ? 4.453   53.220  -14.816 1.00 43.05  ? 1405 GLU A C     1 
ATOM   7493 O  O     . GLU A 1 991  ? 3.608   53.364  -15.691 1.00 42.83  ? 1405 GLU A O     1 
ATOM   7494 C  CB    . GLU A 1 991  ? 5.045   55.106  -13.379 1.00 44.34  ? 1405 GLU A CB    1 
ATOM   7495 C  CG    . GLU A 1 991  ? 5.965   56.238  -12.995 1.00 47.28  ? 1405 GLU A CG    1 
ATOM   7496 C  CD    . GLU A 1 991  ? 5.258   57.198  -12.060 1.00 50.93  ? 1405 GLU A CD    1 
ATOM   7497 O  OE1   . GLU A 1 991  ? 5.909   58.126  -11.519 1.00 52.26  ? 1405 GLU A OE1   1 
ATOM   7498 O  OE2   . GLU A 1 991  ? 4.033   57.004  -11.878 1.00 52.14  ? 1405 GLU A OE2   1 
ATOM   7499 N  N     . PHE A 1 992  ? 4.489   52.169  -14.001 1.00 42.46  ? 1406 PHE A N     1 
ATOM   7500 C  CA    . PHE A 1 992  ? 3.445   51.157  -14.045 1.00 41.75  ? 1406 PHE A CA    1 
ATOM   7501 C  C     . PHE A 1 992  ? 2.264   51.626  -13.205 1.00 41.36  ? 1406 PHE A C     1 
ATOM   7502 O  O     . PHE A 1 992  ? 2.448   52.207  -12.147 1.00 41.55  ? 1406 PHE A O     1 
ATOM   7503 C  CB    . PHE A 1 992  ? 3.978   49.822  -13.569 1.00 41.89  ? 1406 PHE A CB    1 
ATOM   7504 C  CG    . PHE A 1 992  ? 5.198   49.383  -14.305 1.00 41.45  ? 1406 PHE A CG    1 
ATOM   7505 C  CD1   . PHE A 1 992  ? 6.439   49.451  -13.702 1.00 41.91  ? 1406 PHE A CD1   1 
ATOM   7506 C  CD2   . PHE A 1 992  ? 5.108   48.933  -15.611 1.00 41.50  ? 1406 PHE A CD2   1 
ATOM   7507 C  CE1   . PHE A 1 992  ? 7.579   49.044  -14.374 1.00 42.01  ? 1406 PHE A CE1   1 
ATOM   7508 C  CE2   . PHE A 1 992  ? 6.245   48.529  -16.313 1.00 41.92  ? 1406 PHE A CE2   1 
ATOM   7509 C  CZ    . PHE A 1 992  ? 7.485   48.582  -15.690 1.00 42.34  ? 1406 PHE A CZ    1 
ATOM   7510 N  N     . LEU A 1 993  ? 1.055   51.409  -13.705 1.00 40.39  ? 1407 LEU A N     1 
ATOM   7511 C  CA    . LEU A 1 993  ? -0.121  51.959  -13.081 1.00 39.88  ? 1407 LEU A CA    1 
ATOM   7512 C  C     . LEU A 1 993  ? -0.949  50.833  -12.467 1.00 39.78  ? 1407 LEU A C     1 
ATOM   7513 O  O     . LEU A 1 993  ? -1.871  51.083  -11.715 1.00 39.54  ? 1407 LEU A O     1 
ATOM   7514 C  CB    . LEU A 1 993  ? -0.948  52.769  -14.095 1.00 39.88  ? 1407 LEU A CB    1 
ATOM   7515 C  CG    . LEU A 1 993  ? -0.229  53.738  -15.075 1.00 39.62  ? 1407 LEU A CG    1 
ATOM   7516 C  CD1   . LEU A 1 993  ? -1.102  54.062  -16.269 1.00 37.56  ? 1407 LEU A CD1   1 
ATOM   7517 C  CD2   . LEU A 1 993  ? 0.280   55.037  -14.409 1.00 37.85  ? 1407 LEU A CD2   1 
ATOM   7518 N  N     . SER A 1 994  ? -0.609  49.588  -12.779 1.00 39.53  ? 1408 SER A N     1 
ATOM   7519 C  CA    . SER A 1 994  ? -1.239  48.457  -12.109 1.00 39.50  ? 1408 SER A CA    1 
ATOM   7520 C  C     . SER A 1 994  ? -0.396  47.206  -12.327 1.00 39.41  ? 1408 SER A C     1 
ATOM   7521 O  O     . SER A 1 994  ? 0.558   47.240  -13.078 1.00 39.49  ? 1408 SER A O     1 
ATOM   7522 C  CB    . SER A 1 994  ? -2.650  48.260  -12.624 1.00 39.10  ? 1408 SER A CB    1 
ATOM   7523 O  OG    . SER A 1 994  ? -2.606  47.871  -13.978 1.00 40.64  ? 1408 SER A OG    1 
ATOM   7524 N  N     . LYS A 1 995  ? -0.709  46.109  -11.659 1.00 39.73  ? 1409 LYS A N     1 
ATOM   7525 C  CA    . LYS A 1 995  ? 0.110   44.922  -11.860 1.00 40.43  ? 1409 LYS A CA    1 
ATOM   7526 C  C     . LYS A 1 995  ? -0.172  44.401  -13.248 1.00 41.09  ? 1409 LYS A C     1 
ATOM   7527 O  O     . LYS A 1 995  ? 0.657   43.726  -13.874 1.00 41.43  ? 1409 LYS A O     1 
ATOM   7528 C  CB    . LYS A 1 995  ? -0.173  43.843  -10.815 1.00 40.14  ? 1409 LYS A CB    1 
ATOM   7529 C  CG    . LYS A 1 995  ? -0.147  44.376  -9.389  1.00 40.15  ? 1409 LYS A CG    1 
ATOM   7530 C  CD    . LYS A 1 995  ? -0.255  43.294  -8.331  1.00 37.11  ? 1409 LYS A CD    1 
ATOM   7531 C  CE    . LYS A 1 995  ? -0.564  43.943  -7.009  1.00 38.00  ? 1409 LYS A CE    1 
ATOM   7532 N  NZ    . LYS A 1 995  ? -1.054  43.008  -5.971  1.00 41.77  ? 1409 LYS A NZ    1 
ATOM   7533 N  N     . GLU A 1 996  ? -1.357  44.710  -13.742 1.00 41.43  ? 1410 GLU A N     1 
ATOM   7534 C  CA    . GLU A 1 996  ? -1.690  44.289  -15.093 1.00 41.92  ? 1410 GLU A CA    1 
ATOM   7535 C  C     . GLU A 1 996  ? -0.878  45.116  -16.086 1.00 41.31  ? 1410 GLU A C     1 
ATOM   7536 O  O     . GLU A 1 996  ? -0.392  44.592  -17.085 1.00 41.69  ? 1410 GLU A O     1 
ATOM   7537 C  CB    . GLU A 1 996  ? -3.188  44.443  -15.343 1.00 42.48  ? 1410 GLU A CB    1 
ATOM   7538 C  CG    . GLU A 1 996  ? -3.727  43.652  -16.520 1.00 45.58  ? 1410 GLU A CG    1 
ATOM   7539 C  CD    . GLU A 1 996  ? -5.190  43.987  -16.794 1.00 49.55  ? 1410 GLU A CD    1 
ATOM   7540 O  OE1   . GLU A 1 996  ? -5.950  44.250  -15.822 1.00 49.39  ? 1410 GLU A OE1   1 
ATOM   7541 O  OE2   . GLU A 1 996  ? -5.566  43.993  -17.988 1.00 50.96  ? 1410 GLU A OE2   1 
ATOM   7542 N  N     . ASP A 1 997  ? -0.708  46.403  -15.796 1.00 40.78  ? 1411 ASP A N     1 
ATOM   7543 C  CA    . ASP A 1 997  ? 0.021   47.300  -16.692 1.00 40.27  ? 1411 ASP A CA    1 
ATOM   7544 C  C     . ASP A 1 997  ? 1.473   46.868  -16.815 1.00 40.04  ? 1411 ASP A C     1 
ATOM   7545 O  O     . ASP A 1 997  ? 2.023   46.826  -17.914 1.00 39.39  ? 1411 ASP A O     1 
ATOM   7546 C  CB    . ASP A 1 997  ? -0.049  48.740  -16.192 1.00 40.18  ? 1411 ASP A CB    1 
ATOM   7547 C  CG    . ASP A 1 997  ? 0.625   49.721  -17.134 1.00 40.00  ? 1411 ASP A CG    1 
ATOM   7548 O  OD1   . ASP A 1 997  ? 0.497   49.548  -18.355 1.00 40.79  ? 1411 ASP A OD1   1 
ATOM   7549 O  OD2   . ASP A 1 997  ? 1.286   50.667  -16.659 1.00 39.30  ? 1411 ASP A OD2   1 
ATOM   7550 N  N     . LEU A 1 998  ? 2.080   46.560  -15.669 1.00 39.80  ? 1412 LEU A N     1 
ATOM   7551 C  CA    . LEU A 1 998  ? 3.419   45.962  -15.598 1.00 39.72  ? 1412 LEU A CA    1 
ATOM   7552 C  C     . LEU A 1 998  ? 3.545   44.622  -16.366 1.00 40.59  ? 1412 LEU A C     1 
ATOM   7553 O  O     . LEU A 1 998  ? 4.560   44.361  -17.019 1.00 40.31  ? 1412 LEU A O     1 
ATOM   7554 C  CB    . LEU A 1 998  ? 3.830   45.777  -14.138 1.00 38.87  ? 1412 LEU A CB    1 
ATOM   7555 C  CG    . LEU A 1 998  ? 5.012   44.842  -13.888 1.00 38.28  ? 1412 LEU A CG    1 
ATOM   7556 C  CD1   . LEU A 1 998  ? 6.289   45.364  -14.576 1.00 34.88  ? 1412 LEU A CD1   1 
ATOM   7557 C  CD2   . LEU A 1 998  ? 5.233   44.654  -12.407 1.00 35.41  ? 1412 LEU A CD2   1 
ATOM   7558 N  N     . GLN A 1 999  ? 2.534   43.763  -16.279 1.00 41.50  ? 1413 GLN A N     1 
ATOM   7559 C  CA    . GLN A 1 999  ? 2.569   42.513  -17.033 1.00 42.63  ? 1413 GLN A CA    1 
ATOM   7560 C  C     . GLN A 1 999  ? 2.548   42.733  -18.544 1.00 42.64  ? 1413 GLN A C     1 
ATOM   7561 O  O     . GLN A 1 999  ? 3.384   42.192  -19.250 1.00 43.12  ? 1413 GLN A O     1 
ATOM   7562 C  CB    . GLN A 1 999  ? 1.425   41.584  -16.625 1.00 42.80  ? 1413 GLN A CB    1 
ATOM   7563 C  CG    . GLN A 1 999  ? 1.280   40.390  -17.564 1.00 44.62  ? 1413 GLN A CG    1 
ATOM   7564 C  CD    . GLN A 1 999  ? 0.402   39.302  -16.984 1.00 46.77  ? 1413 GLN A CD    1 
ATOM   7565 O  OE1   . GLN A 1 999  ? -0.472  39.579  -16.163 1.00 49.08  ? 1413 GLN A OE1   1 
ATOM   7566 N  NE2   . GLN A 1 999  ? 0.634   38.057  -17.394 1.00 45.46  ? 1413 GLN A NE2   1 
ATOM   7567 N  N     . GLN A 1 1000 ? 1.596   43.520  -19.037 1.00 43.10  ? 1414 GLN A N     1 
ATOM   7568 C  CA    . GLN A 1 1000 ? 1.489   43.804  -20.479 1.00 43.95  ? 1414 GLN A CA    1 
ATOM   7569 C  C     . GLN A 1 1000 ? 2.734   44.471  -21.027 1.00 43.30  ? 1414 GLN A C     1 
ATOM   7570 O  O     . GLN A 1 1000 ? 3.357   43.970  -21.952 1.00 43.75  ? 1414 GLN A O     1 
ATOM   7571 C  CB    . GLN A 1 1000 ? 0.293   44.717  -20.804 1.00 44.56  ? 1414 GLN A CB    1 
ATOM   7572 C  CG    . GLN A 1 1000 ? -1.037  44.338  -20.142 1.00 48.89  ? 1414 GLN A CG    1 
ATOM   7573 C  CD    . GLN A 1 1000 ? -1.675  43.073  -20.728 1.00 54.68  ? 1414 GLN A CD    1 
ATOM   7574 O  OE1   . GLN A 1 1000 ? -1.167  42.488  -21.703 1.00 56.24  ? 1414 GLN A OE1   1 
ATOM   7575 N  NE2   . GLN A 1 1000 ? -2.809  42.655  -20.143 1.00 55.63  ? 1414 GLN A NE2   1 
ATOM   7576 N  N     . ARG A 1 1001 ? 3.087   45.620  -20.468 1.00 42.99  ? 1415 ARG A N     1 
ATOM   7577 C  CA    . ARG A 1 1001 ? 4.199   46.410  -20.993 1.00 42.74  ? 1415 ARG A CA    1 
ATOM   7578 C  C     . ARG A 1 1001 ? 5.564   45.853  -20.623 1.00 43.29  ? 1415 ARG A C     1 
ATOM   7579 O  O     . ARG A 1 1001 ? 6.568   46.177  -21.256 1.00 43.72  ? 1415 ARG A O     1 
ATOM   7580 C  CB    . ARG A 1 1001 ? 4.099   47.871  -20.543 1.00 42.07  ? 1415 ARG A CB    1 
ATOM   7581 C  CG    . ARG A 1 1001 ? 2.819   48.556  -20.987 1.00 40.01  ? 1415 ARG A CG    1 
ATOM   7582 C  CD    . ARG A 1 1001 ? 2.911   50.063  -20.837 1.00 37.83  ? 1415 ARG A CD    1 
ATOM   7583 N  NE    . ARG A 1 1001 ? 2.989   50.530  -19.450 1.00 35.98  ? 1415 ARG A NE    1 
ATOM   7584 C  CZ    . ARG A 1 1001 ? 4.037   51.165  -18.936 1.00 35.40  ? 1415 ARG A CZ    1 
ATOM   7585 N  NH1   . ARG A 1 1001 ? 5.117   51.393  -19.689 1.00 33.15  ? 1415 ARG A NH1   1 
ATOM   7586 N  NH2   . ARG A 1 1001 ? 4.008   51.566  -17.667 1.00 34.68  ? 1415 ARG A NH2   1 
ATOM   7587 N  N     . GLY A 1 1002 ? 5.613   45.038  -19.582 1.00 43.69  ? 1416 GLY A N     1 
ATOM   7588 C  CA    . GLY A 1 1002 ? 6.877   44.504  -19.125 1.00 44.10  ? 1416 GLY A CA    1 
ATOM   7589 C  C     . GLY A 1 1002 ? 7.075   43.127  -19.705 1.00 44.60  ? 1416 GLY A C     1 
ATOM   7590 O  O     . GLY A 1 1002 ? 8.158   42.546  -19.580 1.00 44.36  ? 1416 GLY A O     1 
ATOM   7591 N  N     . LYS A 1 1003 ? 6.019   42.598  -20.330 1.00 45.05  ? 1417 LYS A N     1 
ATOM   7592 C  CA    . LYS A 1 1003 ? 6.149   41.365  -21.104 1.00 45.64  ? 1417 LYS A CA    1 
ATOM   7593 C  C     . LYS A 1 1003 ? 6.408   40.221  -20.128 1.00 45.53  ? 1417 LYS A C     1 
ATOM   7594 O  O     . LYS A 1 1003 ? 7.350   39.440  -20.288 1.00 45.38  ? 1417 LYS A O     1 
ATOM   7595 C  CB    . LYS A 1 1003 ? 7.328   41.499  -22.071 1.00 45.79  ? 1417 LYS A CB    1 
ATOM   7596 C  CG    . LYS A 1 1003 ? 7.037   42.067  -23.473 1.00 48.23  ? 1417 LYS A CG    1 
ATOM   7597 C  CD    . LYS A 1 1003 ? 5.598   42.514  -23.711 1.00 50.02  ? 1417 LYS A CD    1 
ATOM   7598 C  CE    . LYS A 1 1003 ? 4.824   41.461  -24.489 1.00 52.56  ? 1417 LYS A CE    1 
ATOM   7599 N  NZ    . LYS A 1 1003 ? 3.417   41.907  -24.763 1.00 53.89  ? 1417 LYS A NZ    1 
ATOM   7600 N  N     . LEU A 1 1004 ? 5.577   40.154  -19.092 1.00 45.38  ? 1418 LEU A N     1 
ATOM   7601 C  CA    . LEU A 1 1004 ? 5.780   39.201  -17.999 1.00 44.56  ? 1418 LEU A CA    1 
ATOM   7602 C  C     . LEU A 1 1004 ? 4.781   38.038  -18.062 1.00 43.80  ? 1418 LEU A C     1 
ATOM   7603 O  O     . LEU A 1 1004 ? 3.571   38.220  -18.185 1.00 43.40  ? 1418 LEU A O     1 
ATOM   7604 C  CB    . LEU A 1 1004 ? 5.718   39.912  -16.629 1.00 44.51  ? 1418 LEU A CB    1 
ATOM   7605 C  CG    . LEU A 1 1004 ? 6.883   40.811  -16.189 1.00 44.59  ? 1418 LEU A CG    1 
ATOM   7606 C  CD1   . LEU A 1 1004 ? 6.539   41.578  -14.941 1.00 45.37  ? 1418 LEU A CD1   1 
ATOM   7607 C  CD2   . LEU A 1 1004 ? 8.102   39.962  -15.921 1.00 45.30  ? 1418 LEU A CD2   1 
ATOM   7608 N  N     . SER A 1 1005 ? 5.314   36.835  -17.988 1.00 43.18  ? 1419 SER A N     1 
ATOM   7609 C  CA    . SER A 1 1005 ? 4.503   35.651  -17.840 1.00 42.74  ? 1419 SER A CA    1 
ATOM   7610 C  C     . SER A 1 1005 ? 3.819   35.669  -16.477 1.00 42.65  ? 1419 SER A C     1 
ATOM   7611 O  O     . SER A 1 1005 ? 4.219   36.397  -15.565 1.00 42.73  ? 1419 SER A O     1 
ATOM   7612 C  CB    . SER A 1 1005 ? 5.407   34.428  -17.916 1.00 42.68  ? 1419 SER A CB    1 
ATOM   7613 O  OG    . SER A 1 1005 ? 6.280   34.448  -16.803 1.00 41.74  ? 1419 SER A OG    1 
ATOM   7614 N  N     . LYS A 1 1006 ? 2.792   34.849  -16.332 1.00 42.69  ? 1420 LYS A N     1 
ATOM   7615 C  CA    . LYS A 1 1006 ? 2.082   34.737  -15.070 1.00 43.11  ? 1420 LYS A CA    1 
ATOM   7616 C  C     . LYS A 1 1006 ? 3.048   34.351  -13.952 1.00 42.64  ? 1420 LYS A C     1 
ATOM   7617 O  O     . LYS A 1 1006 ? 3.011   34.921  -12.864 1.00 42.84  ? 1420 LYS A O     1 
ATOM   7618 C  CB    . LYS A 1 1006 ? 0.972   33.686  -15.189 1.00 43.49  ? 1420 LYS A CB    1 
ATOM   7619 C  CG    . LYS A 1 1006 ? -0.300  33.997  -14.411 1.00 45.95  ? 1420 LYS A CG    1 
ATOM   7620 C  CD    . LYS A 1 1006 ? -1.371  32.937  -14.698 1.00 49.52  ? 1420 LYS A CD    1 
ATOM   7621 C  CE    . LYS A 1 1006 ? -2.388  32.832  -13.560 1.00 51.14  ? 1420 LYS A CE    1 
ATOM   7622 N  NZ    . LYS A 1 1006 ? -3.314  31.659  -13.739 1.00 52.10  ? 1420 LYS A NZ    1 
ATOM   7623 N  N     . THR A 1 1007 ? 3.914   33.379  -14.219 1.00 42.01  ? 1421 THR A N     1 
ATOM   7624 C  CA    . THR A 1 1007 ? 4.848   32.908  -13.217 1.00 41.68  ? 1421 THR A CA    1 
ATOM   7625 C  C     . THR A 1 1007 ? 5.789   34.018  -12.738 1.00 41.60  ? 1421 THR A C     1 
ATOM   7626 O  O     . THR A 1 1007 ? 6.005   34.174  -11.542 1.00 42.09  ? 1421 THR A O     1 
ATOM   7627 C  CB    . THR A 1 1007 ? 5.621   31.680  -13.747 1.00 42.12  ? 1421 THR A CB    1 
ATOM   7628 O  OG1   . THR A 1 1007 ? 4.678   30.634  -13.995 1.00 42.71  ? 1421 THR A OG1   1 
ATOM   7629 C  CG2   . THR A 1 1007 ? 6.686   31.186  -12.752 1.00 40.92  ? 1421 THR A CG2   1 
ATOM   7630 N  N     . LEU A 1 1008 ? 6.323   34.814  -13.656 1.00 41.31  ? 1422 LEU A N     1 
ATOM   7631 C  CA    . LEU A 1 1008 ? 7.252   35.861  -13.264 1.00 41.41  ? 1422 LEU A CA    1 
ATOM   7632 C  C     . LEU A 1 1008 ? 6.524   36.905  -12.444 1.00 41.98  ? 1422 LEU A C     1 
ATOM   7633 O  O     . LEU A 1 1008 ? 7.072   37.419  -11.461 1.00 42.27  ? 1422 LEU A O     1 
ATOM   7634 C  CB    . LEU A 1 1008 ? 7.957   36.491  -14.481 1.00 41.08  ? 1422 LEU A CB    1 
ATOM   7635 C  CG    . LEU A 1 1008 ? 8.916   35.527  -15.204 1.00 40.69  ? 1422 LEU A CG    1 
ATOM   7636 C  CD1   . LEU A 1 1008 ? 9.371   36.053  -16.583 1.00 39.97  ? 1422 LEU A CD1   1 
ATOM   7637 C  CD2   . LEU A 1 1008 ? 10.099  35.170  -14.326 1.00 37.96  ? 1422 LEU A CD2   1 
ATOM   7638 N  N     . LEU A 1 1009 ? 5.281   37.205  -12.829 1.00 41.95  ? 1423 LEU A N     1 
ATOM   7639 C  CA    . LEU A 1 1009 ? 4.475   38.166  -12.086 1.00 42.45  ? 1423 LEU A CA    1 
ATOM   7640 C  C     . LEU A 1 1009 ? 4.248   37.683  -10.638 1.00 42.52  ? 1423 LEU A C     1 
ATOM   7641 O  O     . LEU A 1 1009 ? 4.448   38.457  -9.694  1.00 43.14  ? 1423 LEU A O     1 
ATOM   7642 C  CB    . LEU A 1 1009 ? 3.159   38.457  -12.830 1.00 42.64  ? 1423 LEU A CB    1 
ATOM   7643 C  CG    . LEU A 1 1009 ? 2.315   39.718  -12.587 1.00 43.24  ? 1423 LEU A CG    1 
ATOM   7644 C  CD1   . LEU A 1 1009 ? 1.584   39.616  -11.273 1.00 44.61  ? 1423 LEU A CD1   1 
ATOM   7645 C  CD2   . LEU A 1 1009 ? 3.096   41.024  -12.660 1.00 42.29  ? 1423 LEU A CD2   1 
ATOM   7646 N  N     . GLU A 1 1010 ? 3.870   36.410  -10.462 1.00 42.10  ? 1424 GLU A N     1 
ATOM   7647 C  CA    . GLU A 1 1010 ? 3.743   35.809  -9.120  1.00 41.59  ? 1424 GLU A CA    1 
ATOM   7648 C  C     . GLU A 1 1010 ? 5.036   35.903  -8.350  1.00 40.77  ? 1424 GLU A C     1 
ATOM   7649 O  O     . GLU A 1 1010 ? 5.028   36.057  -7.131  1.00 40.19  ? 1424 GLU A O     1 
ATOM   7650 C  CB    . GLU A 1 1010 ? 3.354   34.326  -9.174  1.00 41.73  ? 1424 GLU A CB    1 
ATOM   7651 C  CG    . GLU A 1 1010 ? 2.024   33.972  -8.488  1.00 44.14  ? 1424 GLU A CG    1 
ATOM   7652 C  CD    . GLU A 1 1010 ? 1.986   34.262  -6.971  1.00 46.90  ? 1424 GLU A CD    1 
ATOM   7653 O  OE1   . GLU A 1 1010 ? 2.984   34.043  -6.242  1.00 49.37  ? 1424 GLU A OE1   1 
ATOM   7654 O  OE2   . GLU A 1 1010 ? 0.928   34.693  -6.492  1.00 48.56  ? 1424 GLU A OE2   1 
ATOM   7655 N  N     . TYR A 1 1011 ? 6.157   35.765  -9.046  1.00 39.70  ? 1425 TYR A N     1 
ATOM   7656 C  CA    . TYR A 1 1011 ? 7.412   35.761  -8.322  1.00 39.06  ? 1425 TYR A CA    1 
ATOM   7657 C  C     . TYR A 1 1011 ? 7.583   37.106  -7.618  1.00 38.60  ? 1425 TYR A C     1 
ATOM   7658 O  O     . TYR A 1 1011 ? 7.896   37.176  -6.428  1.00 38.29  ? 1425 TYR A O     1 
ATOM   7659 C  CB    . TYR A 1 1011 ? 8.568   35.437  -9.246  1.00 38.55  ? 1425 TYR A CB    1 
ATOM   7660 C  CG    . TYR A 1 1011 ? 9.908   35.484  -8.577  1.00 39.07  ? 1425 TYR A CG    1 
ATOM   7661 C  CD1   . TYR A 1 1011 ? 10.514  36.695  -8.290  1.00 38.30  ? 1425 TYR A CD1   1 
ATOM   7662 C  CD2   . TYR A 1 1011 ? 10.594  34.306  -8.246  1.00 39.86  ? 1425 TYR A CD2   1 
ATOM   7663 C  CE1   . TYR A 1 1011 ? 11.752  36.739  -7.687  1.00 38.59  ? 1425 TYR A CE1   1 
ATOM   7664 C  CE2   . TYR A 1 1011 ? 11.838  34.348  -7.645  1.00 37.14  ? 1425 TYR A CE2   1 
ATOM   7665 C  CZ    . TYR A 1 1011 ? 12.409  35.566  -7.371  1.00 38.03  ? 1425 TYR A CZ    1 
ATOM   7666 O  OH    . TYR A 1 1011 ? 13.635  35.636  -6.755  1.00 38.85  ? 1425 TYR A OH    1 
ATOM   7667 N  N     . LEU A 1 1012 ? 7.336   38.176  -8.354  1.00 38.59  ? 1426 LEU A N     1 
ATOM   7668 C  CA    . LEU A 1 1012 ? 7.406   39.518  -7.795  1.00 38.87  ? 1426 LEU A CA    1 
ATOM   7669 C  C     . LEU A 1 1012 ? 6.346   39.769  -6.729  1.00 38.96  ? 1426 LEU A C     1 
ATOM   7670 O  O     . LEU A 1 1012 ? 6.610   40.401  -5.704  1.00 38.75  ? 1426 LEU A O     1 
ATOM   7671 C  CB    . LEU A 1 1012 ? 7.268   40.555  -8.904  1.00 38.75  ? 1426 LEU A CB    1 
ATOM   7672 C  CG    . LEU A 1 1012 ? 8.420   40.492  -9.905  1.00 39.22  ? 1426 LEU A CG    1 
ATOM   7673 C  CD1   . LEU A 1 1012 ? 8.163   41.425  -11.082 1.00 39.54  ? 1426 LEU A CD1   1 
ATOM   7674 C  CD2   . LEU A 1 1012 ? 9.698   40.862  -9.200  1.00 38.83  ? 1426 LEU A CD2   1 
ATOM   7675 N  N     . GLU A 1 1013 ? 5.143   39.269  -6.961  1.00 39.43  ? 1427 GLU A N     1 
ATOM   7676 C  CA    . GLU A 1 1013 ? 4.046   39.617  -6.086  1.00 39.98  ? 1427 GLU A CA    1 
ATOM   7677 C  C     . GLU A 1 1013 ? 4.154   38.937  -4.723  1.00 39.54  ? 1427 GLU A C     1 
ATOM   7678 O  O     . GLU A 1 1013 ? 3.861   39.529  -3.671  1.00 38.32  ? 1427 GLU A O     1 
ATOM   7679 C  CB    . GLU A 1 1013 ? 2.728   39.283  -6.756  1.00 40.91  ? 1427 GLU A CB    1 
ATOM   7680 C  CG    . GLU A 1 1013 ? 1.668   40.375  -6.523  1.00 44.71  ? 1427 GLU A CG    1 
ATOM   7681 C  CD    . GLU A 1 1013 ? 0.567   39.886  -5.661  1.00 48.30  ? 1427 GLU A CD    1 
ATOM   7682 O  OE1   . GLU A 1 1013 ? 0.170   40.588  -4.702  1.00 51.31  ? 1427 GLU A OE1   1 
ATOM   7683 O  OE2   . GLU A 1 1013 ? 0.098   38.771  -5.954  1.00 51.54  ? 1427 GLU A OE2   1 
ATOM   7684 N  N     . SER A 1 1014 ? 4.601   37.692  -4.748  1.00 38.85  ? 1428 SER A N     1 
ATOM   7685 C  CA    . SER A 1 1014 ? 4.716   36.937  -3.521  1.00 39.12  ? 1428 SER A CA    1 
ATOM   7686 C  C     . SER A 1 1014 ? 5.826   37.462  -2.595  1.00 38.83  ? 1428 SER A C     1 
ATOM   7687 O  O     . SER A 1 1014 ? 5.810   37.180  -1.412  1.00 38.25  ? 1428 SER A O     1 
ATOM   7688 C  CB    . SER A 1 1014 ? 4.933   35.457  -3.833  1.00 38.82  ? 1428 SER A CB    1 
ATOM   7689 O  OG    . SER A 1 1014 ? 6.261   35.243  -4.273  1.00 40.07  ? 1428 SER A OG    1 
ATOM   7690 N  N     . ARG A 1 1015 ? 6.779   38.225  -3.135  1.00 38.99  ? 1429 ARG A N     1 
ATOM   7691 C  CA    . ARG A 1 1015 ? 7.873   38.777  -2.330  1.00 38.62  ? 1429 ARG A CA    1 
ATOM   7692 C  C     . ARG A 1 1015 ? 7.601   40.229  -1.947  1.00 38.88  ? 1429 ARG A C     1 
ATOM   7693 O  O     . ARG A 1 1015 ? 8.516   40.966  -1.567  1.00 38.48  ? 1429 ARG A O     1 
ATOM   7694 C  CB    . ARG A 1 1015 ? 9.181   38.712  -3.113  1.00 38.75  ? 1429 ARG A CB    1 
ATOM   7695 C  CG    . ARG A 1 1015 ? 9.867   37.355  -3.079  1.00 38.46  ? 1429 ARG A CG    1 
ATOM   7696 C  CD    . ARG A 1 1015 ? 10.717  37.109  -4.321  1.00 37.30  ? 1429 ARG A CD    1 
ATOM   7697 N  NE    . ARG A 1 1015 ? 11.291  35.766  -4.276  1.00 38.45  ? 1429 ARG A NE    1 
ATOM   7698 C  CZ    . ARG A 1 1015 ? 10.641  34.654  -4.621  1.00 38.28  ? 1429 ARG A CZ    1 
ATOM   7699 N  NH1   . ARG A 1 1015 ? 9.383   34.726  -5.087  1.00 33.53  ? 1429 ARG A NH1   1 
ATOM   7700 N  NH2   . ARG A 1 1015 ? 11.260  33.474  -4.506  1.00 34.63  ? 1429 ARG A NH2   1 
ATOM   7701 N  N     . GLY A 1 1016 ? 6.349   40.647  -2.091  1.00 39.18  ? 1430 GLY A N     1 
ATOM   7702 C  CA    . GLY A 1 1016 ? 5.944   42.005  -1.722  1.00 39.61  ? 1430 GLY A CA    1 
ATOM   7703 C  C     . GLY A 1 1016 ? 6.282   43.113  -2.718  1.00 39.79  ? 1430 GLY A C     1 
ATOM   7704 O  O     . GLY A 1 1016 ? 5.977   44.278  -2.472  1.00 40.14  ? 1430 GLY A O     1 
ATOM   7705 N  N     . CYS A 1 1017 ? 6.882   42.762  -3.850  1.00 39.28  ? 1431 CYS A N     1 
ATOM   7706 C  CA    . CYS A 1 1017 ? 7.304   43.769  -4.843  1.00 39.48  ? 1431 CYS A CA    1 
ATOM   7707 C  C     . CYS A 1 1017 ? 6.229   44.675  -5.417  1.00 38.45  ? 1431 CYS A C     1 
ATOM   7708 O  O     . CYS A 1 1017 ? 6.513   45.811  -5.776  1.00 38.12  ? 1431 CYS A O     1 
ATOM   7709 C  CB    . CYS A 1 1017 ? 7.995   43.094  -6.022  1.00 39.29  ? 1431 CYS A CB    1 
ATOM   7710 S  SG    . CYS A 1 1017 ? 9.297   42.096  -5.433  1.00 42.67  ? 1431 CYS A SG    1 
ATOM   7711 N  N     . LEU A 1 1018 ? 5.020   44.144  -5.553  1.00 37.98  ? 1432 LEU A N     1 
ATOM   7712 C  CA    . LEU A 1 1018 ? 3.941   44.834  -6.253  1.00 37.18  ? 1432 LEU A CA    1 
ATOM   7713 C  C     . LEU A 1 1018 ? 2.918   45.389  -5.270  1.00 37.02  ? 1432 LEU A C     1 
ATOM   7714 O  O     . LEU A 1 1018 ? 1.839   45.813  -5.669  1.00 36.60  ? 1432 LEU A O     1 
ATOM   7715 C  CB    . LEU A 1 1018 ? 3.242   43.863  -7.223  1.00 37.45  ? 1432 LEU A CB    1 
ATOM   7716 C  CG    . LEU A 1 1018 ? 3.862   43.526  -8.609  1.00 37.78  ? 1432 LEU A CG    1 
ATOM   7717 C  CD1   . LEU A 1 1018 ? 5.371   43.719  -8.716  1.00 33.34  ? 1432 LEU A CD1   1 
ATOM   7718 C  CD2   . LEU A 1 1018 ? 3.471   42.145  -9.079  1.00 36.80  ? 1432 LEU A CD2   1 
ATOM   7719 N  N     . ASP A 1 1019 ? 3.238   45.382  -3.976  1.00 36.51  ? 1433 ASP A N     1 
ATOM   7720 C  CA    . ASP A 1 1019 ? 2.226   45.735  -2.996  1.00 35.40  ? 1433 ASP A CA    1 
ATOM   7721 C  C     . ASP A 1 1019 ? 1.708   47.135  -3.196  1.00 34.59  ? 1433 ASP A C     1 
ATOM   7722 O  O     . ASP A 1 1019 ? 0.581   47.386  -2.886  1.00 34.34  ? 1433 ASP A O     1 
ATOM   7723 C  CB    . ASP A 1 1019 ? 2.739   45.582  -1.571  1.00 36.31  ? 1433 ASP A CB    1 
ATOM   7724 C  CG    . ASP A 1 1019 ? 2.559   44.174  -1.027  1.00 37.33  ? 1433 ASP A CG    1 
ATOM   7725 O  OD1   . ASP A 1 1019 ? 2.723   43.991  0.195   1.00 40.78  ? 1433 ASP A OD1   1 
ATOM   7726 O  OD2   . ASP A 1 1019 ? 2.248   43.256  -1.805  1.00 38.97  ? 1433 ASP A OD2   1 
ATOM   7727 N  N     . SER A 1 1020 ? 2.513   48.053  -3.713  1.00 34.59  ? 1434 SER A N     1 
ATOM   7728 C  CA    . SER A 1 1020 ? 2.055   49.435  -3.843  1.00 35.06  ? 1434 SER A CA    1 
ATOM   7729 C  C     . SER A 1 1020 ? 1.142   49.712  -5.040  1.00 35.53  ? 1434 SER A C     1 
ATOM   7730 O  O     . SER A 1 1020 ? 0.667   50.825  -5.211  1.00 34.70  ? 1434 SER A O     1 
ATOM   7731 C  CB    . SER A 1 1020 ? 3.223   50.412  -3.861  1.00 35.00  ? 1434 SER A CB    1 
ATOM   7732 O  OG    . SER A 1 1020 ? 3.839   50.460  -5.128  1.00 35.11  ? 1434 SER A OG    1 
ATOM   7733 N  N     . LEU A 1 1021 ? 0.874   48.696  -5.844  1.00 36.71  ? 1435 LEU A N     1 
ATOM   7734 C  CA    . LEU A 1 1021 ? 0.061   48.877  -7.043  1.00 38.14  ? 1435 LEU A CA    1 
ATOM   7735 C  C     . LEU A 1 1021 ? -1.277  48.173  -6.902  1.00 38.79  ? 1435 LEU A C     1 
ATOM   7736 O  O     . LEU A 1 1021 ? -1.351  47.135  -6.282  1.00 38.76  ? 1435 LEU A O     1 
ATOM   7737 C  CB    . LEU A 1 1021 ? 0.807   48.291  -8.252  1.00 38.12  ? 1435 LEU A CB    1 
ATOM   7738 C  CG    . LEU A 1 1021 ? 2.114   48.972  -8.688  1.00 38.47  ? 1435 LEU A CG    1 
ATOM   7739 C  CD1   . LEU A 1 1021 ? 2.787   48.144  -9.732  1.00 38.33  ? 1435 LEU A CD1   1 
ATOM   7740 C  CD2   . LEU A 1 1021 ? 1.860   50.383  -9.232  1.00 38.67  ? 1435 LEU A CD2   1 
ATOM   7741 N  N     . PRO A 1 1022 ? -2.333  48.727  -7.513  1.00 39.72  ? 1436 PRO A N     1 
ATOM   7742 C  CA    . PRO A 1 1022 ? -3.619  48.024  -7.590  1.00 40.46  ? 1436 PRO A CA    1 
ATOM   7743 C  C     . PRO A 1 1022 ? -3.528  46.904  -8.616  1.00 41.27  ? 1436 PRO A C     1 
ATOM   7744 O  O     . PRO A 1 1022 ? -2.773  47.030  -9.574  1.00 41.12  ? 1436 PRO A O     1 
ATOM   7745 C  CB    . PRO A 1 1022 ? -4.572  49.101  -8.124  1.00 39.95  ? 1436 PRO A CB    1 
ATOM   7746 C  CG    . PRO A 1 1022 ? -3.694  49.969  -8.981  1.00 39.35  ? 1436 PRO A CG    1 
ATOM   7747 C  CD    . PRO A 1 1022 ? -2.326  49.967  -8.316  1.00 39.73  ? 1436 PRO A CD    1 
ATOM   7748 N  N     . ASP A 1 1023 ? -4.305  45.837  -8.442  1.00 42.35  ? 1437 ASP A N     1 
ATOM   7749 C  CA    . ASP A 1 1023 ? -4.250  44.724  -9.379  1.00 43.67  ? 1437 ASP A CA    1 
ATOM   7750 C  C     . ASP A 1 1023 ? -4.477  45.205  -10.822 1.00 43.77  ? 1437 ASP A C     1 
ATOM   7751 O  O     . ASP A 1 1023 ? -3.728  44.848  -11.740 1.00 43.99  ? 1437 ASP A O     1 
ATOM   7752 C  CB    . ASP A 1 1023 ? -5.239  43.610  -8.983  1.00 44.21  ? 1437 ASP A CB    1 
ATOM   7753 C  CG    . ASP A 1 1023 ? -4.798  42.829  -7.725  1.00 46.07  ? 1437 ASP A CG    1 
ATOM   7754 O  OD1   . ASP A 1 1023 ? -5.453  42.964  -6.664  1.00 48.37  ? 1437 ASP A OD1   1 
ATOM   7755 O  OD2   . ASP A 1 1023 ? -3.801  42.072  -7.787  1.00 48.89  ? 1437 ASP A OD2   1 
ATOM   7756 N  N     . HIS A 1 1024 ? -5.514  46.006  -11.016 1.00 44.05  ? 1438 HIS A N     1 
ATOM   7757 C  CA    . HIS A 1 1024 ? -5.771  46.634  -12.314 1.00 44.54  ? 1438 HIS A CA    1 
ATOM   7758 C  C     . HIS A 1 1024 ? -6.303  48.050  -12.155 1.00 43.06  ? 1438 HIS A C     1 
ATOM   7759 O  O     . HIS A 1 1024 ? -6.647  48.470  -11.055 1.00 42.55  ? 1438 HIS A O     1 
ATOM   7760 C  CB    . HIS A 1 1024 ? -6.756  45.808  -13.159 1.00 45.57  ? 1438 HIS A CB    1 
ATOM   7761 C  CG    . HIS A 1 1024 ? -7.910  45.274  -12.379 1.00 48.72  ? 1438 HIS A CG    1 
ATOM   7762 N  ND1   . HIS A 1 1024 ? -9.126  45.925  -12.307 1.00 52.08  ? 1438 HIS A ND1   1 
ATOM   7763 C  CD2   . HIS A 1 1024 ? -8.030  44.159  -11.616 1.00 51.80  ? 1438 HIS A CD2   1 
ATOM   7764 C  CE1   . HIS A 1 1024 ? -9.949  45.232  -11.536 1.00 53.22  ? 1438 HIS A CE1   1 
ATOM   7765 N  NE2   . HIS A 1 1024 ? -9.309  44.157  -11.103 1.00 54.59  ? 1438 HIS A NE2   1 
ATOM   7766 N  N     . ASN A 1 1025 ? -6.343  48.770  -13.272 1.00 42.06  ? 1439 ASN A N     1 
ATOM   7767 C  CA    . ASN A 1 1025 ? -6.897  50.110  -13.345 1.00 41.28  ? 1439 ASN A CA    1 
ATOM   7768 C  C     . ASN A 1 1025 ? -8.341  50.021  -13.773 1.00 41.13  ? 1439 ASN A C     1 
ATOM   7769 O  O     . ASN A 1 1025 ? -8.662  49.207  -14.620 1.00 40.25  ? 1439 ASN A O     1 
ATOM   7770 C  CB    . ASN A 1 1025 ? -6.115  50.928  -14.367 1.00 41.14  ? 1439 ASN A CB    1 
ATOM   7771 C  CG    . ASN A 1 1025 ? -4.678  51.096  -13.969 1.00 40.00  ? 1439 ASN A CG    1 
ATOM   7772 O  OD1   . ASN A 1 1025 ? -4.372  51.799  -12.998 1.00 39.77  ? 1439 ASN A OD1   1 
ATOM   7773 N  ND2   . ASN A 1 1025 ? -3.789  50.414  -14.669 1.00 35.94  ? 1439 ASN A ND2   1 
ATOM   7774 N  N     . GLN A 1 1026 ? -9.205  50.842  -13.175 1.00 41.53  ? 1440 GLN A N     1 
ATOM   7775 C  CA    . GLN A 1 1026 ? -10.616 50.917  -13.578 1.00 42.15  ? 1440 GLN A CA    1 
ATOM   7776 C  C     . GLN A 1 1026 ? -10.780 51.905  -14.744 1.00 41.56  ? 1440 GLN A C     1 
ATOM   7777 O  O     . GLN A 1 1026 ? -11.844 52.006  -15.357 1.00 41.55  ? 1440 GLN A O     1 
ATOM   7778 C  CB    . GLN A 1 1026 ? -11.528 51.310  -12.392 1.00 42.33  ? 1440 GLN A CB    1 
ATOM   7779 C  CG    . GLN A 1 1026 ? -11.630 50.279  -11.238 1.00 45.29  ? 1440 GLN A CG    1 
ATOM   7780 C  CD    . GLN A 1 1026 ? -11.613 48.827  -11.743 1.00 50.34  ? 1440 GLN A CD    1 
ATOM   7781 O  OE1   . GLN A 1 1026 ? -10.644 48.080  -11.522 1.00 51.36  ? 1440 GLN A OE1   1 
ATOM   7782 N  NE2   . GLN A 1 1026 ? -12.675 48.434  -12.449 1.00 51.74  ? 1440 GLN A NE2   1 
ATOM   7783 N  N     . LEU A 1 1027 ? -9.727  52.657  -15.024 1.00 41.60  ? 1441 LEU A N     1 
ATOM   7784 C  CA    . LEU A 1 1027 ? -9.694  53.543  -16.193 1.00 41.70  ? 1441 LEU A CA    1 
ATOM   7785 C  C     . LEU A 1 1027 ? -8.617  53.122  -17.179 1.00 42.41  ? 1441 LEU A C     1 
ATOM   7786 O  O     . LEU A 1 1027 ? -7.566  52.584  -16.786 1.00 42.70  ? 1441 LEU A O     1 
ATOM   7787 C  CB    . LEU A 1 1027 ? -9.358  54.982  -15.786 1.00 41.30  ? 1441 LEU A CB    1 
ATOM   7788 C  CG    . LEU A 1 1027 ? -10.178 55.964  -14.920 1.00 40.16  ? 1441 LEU A CG    1 
ATOM   7789 C  CD1   . LEU A 1 1027 ? -11.270 56.639  -15.707 1.00 38.70  ? 1441 LEU A CD1   1 
ATOM   7790 C  CD2   . LEU A 1 1027 ? -10.712 55.355  -13.654 1.00 36.80  ? 1441 LEU A CD2   1 
ATOM   7791 N  N     . SER A 1 1028 ? -8.865  53.382  -18.458 1.00 43.19  ? 1442 SER A N     1 
ATOM   7792 C  CA    . SER A 1 1028 ? -7.792  53.414  -19.452 1.00 43.99  ? 1442 SER A CA    1 
ATOM   7793 C  C     . SER A 1 1028 ? -8.073  54.486  -20.508 1.00 44.14  ? 1442 SER A C     1 
ATOM   7794 O  O     . SER A 1 1028 ? -9.223  54.672  -20.920 1.00 44.11  ? 1442 SER A O     1 
ATOM   7795 C  CB    . SER A 1 1028 ? -7.621  52.060  -20.132 1.00 44.28  ? 1442 SER A CB    1 
ATOM   7796 O  OG    . SER A 1 1028 ? -8.630  51.884  -21.105 1.00 46.49  ? 1442 SER A OG    1 
ATOM   7797 N  N     . LEU A 1 1029 ? -7.014  55.175  -20.939 1.00 44.11  ? 1443 LEU A N     1 
ATOM   7798 C  CA    . LEU A 1 1029 ? -7.093  56.168  -22.007 1.00 43.98  ? 1443 LEU A CA    1 
ATOM   7799 C  C     . LEU A 1 1029 ? -6.017  55.863  -23.036 1.00 44.42  ? 1443 LEU A C     1 
ATOM   7800 O  O     . LEU A 1 1029 ? -5.181  54.983  -22.809 1.00 44.43  ? 1443 LEU A O     1 
ATOM   7801 C  CB    . LEU A 1 1029 ? -6.831  57.562  -21.459 1.00 43.81  ? 1443 LEU A CB    1 
ATOM   7802 C  CG    . LEU A 1 1029 ? -7.444  57.891  -20.107 1.00 43.43  ? 1443 LEU A CG    1 
ATOM   7803 C  CD1   . LEU A 1 1029 ? -6.800  59.142  -19.538 1.00 43.05  ? 1443 LEU A CD1   1 
ATOM   7804 C  CD2   . LEU A 1 1029 ? -8.939  58.047  -20.255 1.00 42.63  ? 1443 LEU A CD2   1 
ATOM   7805 N  N     . PHE A 1 1030 ? -6.008  56.608  -24.148 1.00 44.62  ? 1444 PHE A N     1 
ATOM   7806 C  CA    . PHE A 1 1030 ? -4.993  56.410  -25.196 1.00 44.68  ? 1444 PHE A CA    1 
ATOM   7807 C  C     . PHE A 1 1030 ? -3.558  56.778  -24.793 1.00 44.83  ? 1444 PHE A C     1 
ATOM   7808 O  O     . PHE A 1 1030 ? -3.341  57.711  -24.020 1.00 45.11  ? 1444 PHE A O     1 
ATOM   7809 C  CB    . PHE A 1 1030 ? -5.358  57.189  -26.461 1.00 44.76  ? 1444 PHE A CB    1 
ATOM   7810 C  CG    . PHE A 1 1030 ? -6.616  56.706  -27.164 1.00 44.41  ? 1444 PHE A CG    1 
ATOM   7811 C  CD1   . PHE A 1 1030 ? -7.381  57.607  -27.932 1.00 43.63  ? 1444 PHE A CD1   1 
ATOM   7812 C  CD2   . PHE A 1 1030 ? -7.028  55.362  -27.125 1.00 44.11  ? 1444 PHE A CD2   1 
ATOM   7813 C  CE1   . PHE A 1 1030 ? -8.546  57.205  -28.625 1.00 43.88  ? 1444 PHE A CE1   1 
ATOM   7814 C  CE2   . PHE A 1 1030 ? -8.205  54.946  -27.814 1.00 43.75  ? 1444 PHE A CE2   1 
ATOM   7815 C  CZ    . PHE A 1 1030 ? -8.966  55.866  -28.562 1.00 44.15  ? 1444 PHE A CZ    1 
ATOM   7816 P  P     . DG  B 2 5    ? 2.032   23.259  -35.239 1.00 94.53  ? 5    DG  P P     1 
ATOM   7817 O  OP1   . DG  B 2 5    ? 0.931   22.693  -34.414 1.00 93.91  ? 5    DG  P OP1   1 
ATOM   7818 O  OP2   . DG  B 2 5    ? 2.387   22.648  -36.554 1.00 94.16  ? 5    DG  P OP2   1 
ATOM   7819 O  "O5'" . DG  B 2 5    ? 1.744   24.840  -35.411 1.00 93.40  ? 5    DG  P "O5'" 1 
ATOM   7820 C  "C5'" . DG  B 2 5    ? 2.667   25.764  -36.035 1.00 91.70  ? 5    DG  P "C5'" 1 
ATOM   7821 C  "C4'" . DG  B 2 5    ? 3.832   26.198  -35.152 1.00 90.20  ? 5    DG  P "C4'" 1 
ATOM   7822 O  "O4'" . DG  B 2 5    ? 3.390   26.280  -33.767 1.00 89.65  ? 5    DG  P "O4'" 1 
ATOM   7823 C  "C3'" . DG  B 2 5    ? 5.055   25.261  -35.189 1.00 89.10  ? 5    DG  P "C3'" 1 
ATOM   7824 O  "O3'" . DG  B 2 5    ? 6.315   25.872  -35.626 1.00 87.82  ? 5    DG  P "O3'" 1 
ATOM   7825 C  "C2'" . DG  B 2 5    ? 5.179   24.739  -33.750 1.00 88.93  ? 5    DG  P "C2'" 1 
ATOM   7826 C  "C1'" . DG  B 2 5    ? 4.463   25.842  -32.942 1.00 88.93  ? 5    DG  P "C1'" 1 
ATOM   7827 N  N9    . DG  B 2 5    ? 3.946   25.556  -31.568 1.00 88.17  ? 5    DG  P N9    1 
ATOM   7828 C  C8    . DG  B 2 5    ? 3.747   24.342  -30.925 1.00 87.49  ? 5    DG  P C8    1 
ATOM   7829 N  N7    . DG  B 2 5    ? 3.275   24.445  -29.713 1.00 86.77  ? 5    DG  P N7    1 
ATOM   7830 C  C5    . DG  B 2 5    ? 3.151   25.814  -29.528 1.00 86.66  ? 5    DG  P C5    1 
ATOM   7831 C  C6    . DG  B 2 5    ? 2.588   26.532  -28.409 1.00 86.26  ? 5    DG  P C6    1 
ATOM   7832 O  O6    . DG  B 2 5    ? 2.074   26.101  -27.318 1.00 86.73  ? 5    DG  P O6    1 
ATOM   7833 N  N1    . DG  B 2 5    ? 2.626   27.895  -28.654 1.00 85.89  ? 5    DG  P N1    1 
ATOM   7834 C  C2    . DG  B 2 5    ? 3.125   28.515  -29.800 1.00 85.66  ? 5    DG  P C2    1 
ATOM   7835 N  N2    . DG  B 2 5    ? 3.052   29.854  -29.818 1.00 85.24  ? 5    DG  P N2    1 
ATOM   7836 N  N3    . DG  B 2 5    ? 3.571   27.858  -30.853 1.00 86.33  ? 5    DG  P N3    1 
ATOM   7837 C  C4    . DG  B 2 5    ? 3.526   26.514  -30.652 1.00 87.17  ? 5    DG  P C4    1 
ATOM   7838 P  P     . DA  B 2 6    ? 6.510   27.339  -36.277 1.00 86.96  ? 6    DA  P P     1 
ATOM   7839 O  OP1   . DA  B 2 6    ? 5.690   27.428  -37.518 1.00 86.65  ? 6    DA  P OP1   1 
ATOM   7840 O  OP2   . DA  B 2 6    ? 7.969   27.632  -36.344 1.00 86.08  ? 6    DA  P OP2   1 
ATOM   7841 O  "O5'" . DA  B 2 6    ? 5.859   28.286  -35.152 1.00 85.69  ? 6    DA  P "O5'" 1 
ATOM   7842 C  "C5'" . DA  B 2 6    ? 5.742   29.710  -35.293 1.00 83.15  ? 6    DA  P "C5'" 1 
ATOM   7843 C  "C4'" . DA  B 2 6    ? 6.509   30.431  -34.182 1.00 80.97  ? 6    DA  P "C4'" 1 
ATOM   7844 O  "O4'" . DA  B 2 6    ? 6.169   29.915  -32.855 1.00 80.12  ? 6    DA  P "O4'" 1 
ATOM   7845 C  "C3'" . DA  B 2 6    ? 8.036   30.364  -34.302 1.00 79.81  ? 6    DA  P "C3'" 1 
ATOM   7846 O  "O3'" . DA  B 2 6    ? 8.538   31.716  -34.199 1.00 78.58  ? 6    DA  P "O3'" 1 
ATOM   7847 C  "C2'" . DA  B 2 6    ? 8.465   29.438  -33.148 1.00 79.24  ? 6    DA  P "C2'" 1 
ATOM   7848 C  "C1'" . DA  B 2 6    ? 7.344   29.588  -32.114 1.00 78.41  ? 6    DA  P "C1'" 1 
ATOM   7849 N  N9    . DA  B 2 6    ? 7.114   28.437  -31.215 1.00 76.68  ? 6    DA  P N9    1 
ATOM   7850 C  C8    . DA  B 2 6    ? 7.165   27.089  -31.511 1.00 76.03  ? 6    DA  P C8    1 
ATOM   7851 N  N7    . DA  B 2 6    ? 6.893   26.297  -30.505 1.00 75.25  ? 6    DA  P N7    1 
ATOM   7852 C  C5    . DA  B 2 6    ? 6.640   27.173  -29.455 1.00 75.06  ? 6    DA  P C5    1 
ATOM   7853 C  C6    . DA  B 2 6    ? 6.279   26.937  -28.120 1.00 74.82  ? 6    DA  P C6    1 
ATOM   7854 N  N6    . DA  B 2 6    ? 6.137   25.707  -27.618 1.00 74.25  ? 6    DA  P N6    1 
ATOM   7855 N  N1    . DA  B 2 6    ? 6.113   28.013  -27.313 1.00 75.32  ? 6    DA  P N1    1 
ATOM   7856 C  C2    . DA  B 2 6    ? 6.293   29.250  -27.845 1.00 75.72  ? 6    DA  P C2    1 
ATOM   7857 N  N3    . DA  B 2 6    ? 6.612   29.594  -29.104 1.00 75.64  ? 6    DA  P N3    1 
ATOM   7858 C  C4    . DA  B 2 6    ? 6.788   28.496  -29.875 1.00 75.67  ? 6    DA  P C4    1 
ATOM   7859 P  P     . DG  B 2 7    ? 10.097  32.120  -34.155 1.00 77.78  ? 7    DG  P P     1 
ATOM   7860 O  OP1   . DG  B 2 7    ? 10.328  33.140  -35.205 1.00 77.20  ? 7    DG  P OP1   1 
ATOM   7861 O  OP2   . DG  B 2 7    ? 10.929  30.892  -34.145 1.00 77.44  ? 7    DG  P OP2   1 
ATOM   7862 O  "O5'" . DG  B 2 7    ? 10.247  32.810  -32.707 1.00 77.02  ? 7    DG  P "O5'" 1 
ATOM   7863 C  "C5'" . DG  B 2 7    ? 9.128   32.967  -31.813 1.00 75.23  ? 7    DG  P "C5'" 1 
ATOM   7864 C  "C4'" . DG  B 2 7    ? 9.563   32.916  -30.359 1.00 73.23  ? 7    DG  P "C4'" 1 
ATOM   7865 O  "O4'" . DG  B 2 7    ? 9.213   31.655  -29.715 1.00 71.77  ? 7    DG  P "O4'" 1 
ATOM   7866 C  "C3'" . DG  B 2 7    ? 11.064  33.038  -30.182 1.00 72.86  ? 7    DG  P "C3'" 1 
ATOM   7867 O  "O3'" . DG  B 2 7    ? 11.265  33.752  -28.992 1.00 74.41  ? 7    DG  P "O3'" 1 
ATOM   7868 C  "C2'" . DG  B 2 7    ? 11.508  31.585  -30.028 1.00 71.21  ? 7    DG  P "C2'" 1 
ATOM   7869 C  "C1'" . DG  B 2 7    ? 10.384  31.130  -29.093 1.00 69.61  ? 7    DG  P "C1'" 1 
ATOM   7870 N  N9    . DG  B 2 7    ? 10.217  29.689  -28.787 1.00 66.48  ? 7    DG  P N9    1 
ATOM   7871 C  C8    . DG  B 2 7    ? 10.460  28.587  -29.594 1.00 65.21  ? 7    DG  P C8    1 
ATOM   7872 N  N7    . DG  B 2 7    ? 10.182  27.442  -29.038 1.00 63.87  ? 7    DG  P N7    1 
ATOM   7873 C  C5    . DG  B 2 7    ? 9.731   27.789  -27.781 1.00 63.46  ? 7    DG  P C5    1 
ATOM   7874 C  C6    . DG  B 2 7    ? 9.286   26.952  -26.734 1.00 62.55  ? 7    DG  P C6    1 
ATOM   7875 O  O6    . DG  B 2 7    ? 9.122   25.714  -26.725 1.00 61.11  ? 7    DG  P O6    1 
ATOM   7876 N  N1    . DG  B 2 7    ? 8.901   27.702  -25.617 1.00 63.15  ? 7    DG  P N1    1 
ATOM   7877 C  C2    . DG  B 2 7    ? 8.925   29.080  -25.504 1.00 63.68  ? 7    DG  P C2    1 
ATOM   7878 N  N2    . DG  B 2 7    ? 8.492   29.582  -24.323 1.00 62.61  ? 7    DG  P N2    1 
ATOM   7879 N  N3    . DG  B 2 7    ? 9.344   29.881  -26.492 1.00 64.31  ? 7    DG  P N3    1 
ATOM   7880 C  C4    . DG  B 2 7    ? 9.736   29.165  -27.596 1.00 64.81  ? 7    DG  P C4    1 
ATOM   7881 P  P     . DA  B 2 8    ? 12.562  34.660  -28.806 1.00 76.45  ? 8    DA  P P     1 
ATOM   7882 O  OP1   . DA  B 2 8    ? 12.089  36.054  -28.616 1.00 76.71  ? 8    DA  P OP1   1 
ATOM   7883 O  OP2   . DA  B 2 8    ? 13.542  34.375  -29.896 1.00 76.74  ? 8    DA  P OP2   1 
ATOM   7884 O  "O5'" . DA  B 2 8    ? 13.158  34.140  -27.415 1.00 74.95  ? 8    DA  P "O5'" 1 
ATOM   7885 C  "C5'" . DA  B 2 8    ? 13.238  35.135  -26.394 1.00 73.23  ? 8    DA  P "C5'" 1 
ATOM   7886 C  "C4'" . DA  B 2 8    ? 12.658  34.678  -25.062 1.00 71.64  ? 8    DA  P "C4'" 1 
ATOM   7887 O  "O4'" . DA  B 2 8    ? 12.016  33.373  -25.124 1.00 70.71  ? 8    DA  P "O4'" 1 
ATOM   7888 C  "C3'" . DA  B 2 8    ? 13.756  34.526  -24.022 1.00 71.19  ? 8    DA  P "C3'" 1 
ATOM   7889 O  "O3'" . DA  B 2 8    ? 13.279  34.847  -22.734 1.00 70.40  ? 8    DA  P "O3'" 1 
ATOM   7890 C  "C2'" . DA  B 2 8    ? 14.168  33.064  -24.140 1.00 70.24  ? 8    DA  P "C2'" 1 
ATOM   7891 C  "C1'" . DA  B 2 8    ? 12.805  32.423  -24.425 1.00 69.45  ? 8    DA  P "C1'" 1 
ATOM   7892 N  N9    . DA  B 2 8    ? 12.863  31.182  -25.215 1.00 68.23  ? 8    DA  P N9    1 
ATOM   7893 C  C8    . DA  B 2 8    ? 13.224  31.015  -26.543 1.00 67.39  ? 8    DA  P C8    1 
ATOM   7894 N  N7    . DA  B 2 8    ? 13.170  29.754  -26.941 1.00 66.91  ? 8    DA  P N7    1 
ATOM   7895 C  C5    . DA  B 2 8    ? 12.732  29.058  -25.817 1.00 66.01  ? 8    DA  P C5    1 
ATOM   7896 C  C6    . DA  B 2 8    ? 12.471  27.684  -25.600 1.00 65.32  ? 8    DA  P C6    1 
ATOM   7897 N  N6    . DA  B 2 8    ? 12.581  26.732  -26.536 1.00 64.64  ? 8    DA  P N6    1 
ATOM   7898 N  N1    . DA  B 2 8    ? 12.019  27.351  -24.356 1.00 65.47  ? 8    DA  P N1    1 
ATOM   7899 C  C2    . DA  B 2 8    ? 11.864  28.300  -23.404 1.00 64.45  ? 8    DA  P C2    1 
ATOM   7900 N  N3    . DA  B 2 8    ? 12.101  29.615  -23.483 1.00 65.74  ? 8    DA  P N3    1 
ATOM   7901 C  C4    . DA  B 2 8    ? 12.534  29.926  -24.736 1.00 66.60  ? 8    DA  P C4    1 
ATOM   7902 P  P     . DC  B 2 9    ? 14.425  35.430  -21.798 1.00 70.22  ? 9    DC  P P     1 
ATOM   7903 O  OP1   . DC  B 2 9    ? 13.848  36.476  -20.920 1.00 70.89  ? 9    DC  P OP1   1 
ATOM   7904 O  OP2   . DC  B 2 9    ? 15.599  35.732  -22.672 1.00 70.49  ? 9    DC  P OP2   1 
ATOM   7905 O  "O5'" . DC  B 2 9    ? 14.793  34.134  -20.946 1.00 68.48  ? 9    DC  P "O5'" 1 
ATOM   7906 C  "C5'" . DC  B 2 9    ? 13.751  33.296  -20.500 1.00 65.13  ? 9    DC  P "C5'" 1 
ATOM   7907 C  "C4'" . DC  B 2 9    ? 14.354  31.980  -20.055 1.00 63.29  ? 9    DC  P "C4'" 1 
ATOM   7908 O  "O4'" . DC  B 2 9    ? 14.233  31.054  -21.151 1.00 61.67  ? 9    DC  P "O4'" 1 
ATOM   7909 C  "C3'" . DC  B 2 9    ? 15.837  32.015  -19.661 1.00 62.22  ? 9    DC  P "C3'" 1 
ATOM   7910 O  "O3'" . DC  B 2 9    ? 15.914  31.728  -18.254 1.00 61.86  ? 9    DC  P "O3'" 1 
ATOM   7911 C  "C2'" . DC  B 2 9    ? 16.489  30.948  -20.545 1.00 61.14  ? 9    DC  P "C2'" 1 
ATOM   7912 C  "C1'" . DC  B 2 9    ? 15.293  30.138  -21.038 1.00 60.25  ? 9    DC  P "C1'" 1 
ATOM   7913 N  N1    . DC  B 2 9    ? 15.485  29.475  -22.374 1.00 57.30  ? 9    DC  P N1    1 
ATOM   7914 C  C2    . DC  B 2 9    ? 15.191  28.110  -22.462 1.00 55.91  ? 9    DC  P C2    1 
ATOM   7915 O  O2    . DC  B 2 9    ? 14.760  27.556  -21.437 1.00 55.43  ? 9    DC  P O2    1 
ATOM   7916 N  N3    . DC  B 2 9    ? 15.340  27.462  -23.659 1.00 54.94  ? 9    DC  P N3    1 
ATOM   7917 C  C4    . DC  B 2 9    ? 15.785  28.129  -24.732 1.00 53.63  ? 9    DC  P C4    1 
ATOM   7918 N  N4    . DC  B 2 9    ? 15.914  27.450  -25.877 1.00 52.42  ? 9    DC  P N4    1 
ATOM   7919 C  C5    . DC  B 2 9    ? 16.107  29.527  -24.655 1.00 55.01  ? 9    DC  P C5    1 
ATOM   7920 C  C6    . DC  B 2 9    ? 15.943  30.163  -23.473 1.00 56.22  ? 9    DC  P C6    1 
ATOM   7921 P  P     . DG  B 2 10   ? 17.238  31.873  -17.354 1.00 60.64  ? 10   DG  P P     1 
ATOM   7922 O  OP1   . DG  B 2 10   ? 16.827  32.468  -16.062 1.00 61.97  ? 10   DG  P OP1   1 
ATOM   7923 O  OP2   . DG  B 2 10   ? 18.316  32.502  -18.165 1.00 60.37  ? 10   DG  P OP2   1 
ATOM   7924 O  "O5'" . DG  B 2 10   ? 17.591  30.344  -17.048 1.00 58.21  ? 10   DG  P "O5'" 1 
ATOM   7925 C  "C5'" . DG  B 2 10   ? 16.544  29.405  -16.905 1.00 58.01  ? 10   DG  P "C5'" 1 
ATOM   7926 C  "C4'" . DG  B 2 10   ? 17.118  28.001  -17.009 1.00 59.53  ? 10   DG  P "C4'" 1 
ATOM   7927 O  "O4'" . DG  B 2 10   ? 17.200  27.544  -18.391 1.00 57.97  ? 10   DG  P "O4'" 1 
ATOM   7928 C  "C3'" . DG  B 2 10   ? 18.530  27.828  -16.440 1.00 60.33  ? 10   DG  P "C3'" 1 
ATOM   7929 O  "O3'" . DG  B 2 10   ? 18.536  26.622  -15.673 1.00 62.99  ? 10   DG  P "O3'" 1 
ATOM   7930 C  "C2'" . DG  B 2 10   ? 19.436  27.748  -17.673 1.00 58.07  ? 10   DG  P "C2'" 1 
ATOM   7931 C  "C1'" . DG  B 2 10   ? 18.499  27.047  -18.660 1.00 56.54  ? 10   DG  P "C1'" 1 
ATOM   7932 N  N9    . DG  B 2 10   ? 18.722  27.341  -20.068 1.00 52.69  ? 10   DG  P N9    1 
ATOM   7933 C  C8    . DG  B 2 10   ? 19.108  28.544  -20.609 1.00 53.28  ? 10   DG  P C8    1 
ATOM   7934 N  N7    . DG  B 2 10   ? 19.212  28.528  -21.915 1.00 52.05  ? 10   DG  P N7    1 
ATOM   7935 C  C5    . DG  B 2 10   ? 18.863  27.221  -22.248 1.00 50.24  ? 10   DG  P C5    1 
ATOM   7936 C  C6    . DG  B 2 10   ? 18.798  26.605  -23.516 1.00 48.30  ? 10   DG  P C6    1 
ATOM   7937 O  O6    . DG  B 2 10   ? 19.039  27.119  -24.609 1.00 47.35  ? 10   DG  P O6    1 
ATOM   7938 N  N1    . DG  B 2 10   ? 18.410  25.273  -23.435 1.00 47.45  ? 10   DG  P N1    1 
ATOM   7939 C  C2    . DG  B 2 10   ? 18.127  24.611  -22.256 1.00 48.26  ? 10   DG  P C2    1 
ATOM   7940 N  N2    . DG  B 2 10   ? 17.765  23.318  -22.369 1.00 46.73  ? 10   DG  P N2    1 
ATOM   7941 N  N3    . DG  B 2 10   ? 18.180  25.177  -21.050 1.00 49.14  ? 10   DG  P N3    1 
ATOM   7942 C  C4    . DG  B 2 10   ? 18.551  26.482  -21.126 1.00 50.60  ? 10   DG  P C4    1 
ATOM   7943 P  P     . DG  B 2 11   ? 19.822  26.249  -14.795 1.00 64.69  ? 11   DG  P P     1 
ATOM   7944 O  OP1   . DG  B 2 11   ? 19.508  26.503  -13.361 1.00 61.73  ? 11   DG  P OP1   1 
ATOM   7945 O  OP2   . DG  B 2 11   ? 20.921  26.943  -15.525 1.00 64.83  ? 11   DG  P OP2   1 
ATOM   7946 O  "O5'" . DG  B 2 11   ? 20.045  24.667  -15.000 1.00 62.49  ? 11   DG  P "O5'" 1 
ATOM   7947 C  "C5'" . DG  B 2 11   ? 18.969  23.807  -15.344 1.00 59.85  ? 11   DG  P "C5'" 1 
ATOM   7948 C  "C4'" . DG  B 2 11   ? 19.462  22.693  -16.251 1.00 57.36  ? 11   DG  P "C4'" 1 
ATOM   7949 O  "O4'" . DG  B 2 11   ? 19.582  23.147  -17.624 1.00 56.60  ? 11   DG  P "O4'" 1 
ATOM   7950 C  "C3'" . DG  B 2 11   ? 20.823  22.121  -15.887 1.00 55.80  ? 11   DG  P "C3'" 1 
ATOM   7951 O  "O3'" . DG  B 2 11   ? 20.639  20.729  -15.868 1.00 54.77  ? 11   DG  P "O3'" 1 
ATOM   7952 C  "C2'" . DG  B 2 11   ? 21.748  22.526  -17.036 1.00 54.93  ? 11   DG  P "C2'" 1 
ATOM   7953 C  "C1'" . DG  B 2 11   ? 20.779  22.676  -18.203 1.00 53.40  ? 11   DG  P "C1'" 1 
ATOM   7954 N  N9    . DG  B 2 11   ? 21.194  23.666  -19.198 1.00 51.15  ? 11   DG  P N9    1 
ATOM   7955 C  C8    . DG  B 2 11   ? 21.614  24.960  -18.984 1.00 50.02  ? 11   DG  P C8    1 
ATOM   7956 N  N7    . DG  B 2 11   ? 21.920  25.596  -20.084 1.00 48.88  ? 11   DG  P N7    1 
ATOM   7957 C  C5    . DG  B 2 11   ? 21.685  24.663  -21.088 1.00 48.41  ? 11   DG  P C5    1 
ATOM   7958 C  C6    . DG  B 2 11   ? 21.822  24.756  -22.487 1.00 48.36  ? 11   DG  P C6    1 
ATOM   7959 O  O6    . DG  B 2 11   ? 22.197  25.711  -23.167 1.00 49.28  ? 11   DG  P O6    1 
ATOM   7960 N  N1    . DG  B 2 11   ? 21.488  23.571  -23.124 1.00 47.60  ? 11   DG  P N1    1 
ATOM   7961 C  C2    . DG  B 2 11   ? 21.047  22.443  -22.493 1.00 46.34  ? 11   DG  P C2    1 
ATOM   7962 N  N2    . DG  B 2 11   ? 20.743  21.395  -23.266 1.00 43.32  ? 11   DG  P N2    1 
ATOM   7963 N  N3    . DG  B 2 11   ? 20.906  22.344  -21.189 1.00 47.75  ? 11   DG  P N3    1 
ATOM   7964 C  C4    . DG  B 2 11   ? 21.242  23.482  -20.558 1.00 48.60  ? 11   DG  P C4    1 
ATOM   7965 P  P     . DG  B 2 12   ? 21.775  19.753  -15.331 1.00 54.28  ? 12   DG  P P     1 
ATOM   7966 O  OP1   . DG  B 2 12   ? 21.013  18.674  -14.667 1.00 54.96  ? 12   DG  P OP1   1 
ATOM   7967 O  OP2   . DG  B 2 12   ? 22.811  20.534  -14.616 1.00 54.80  ? 12   DG  P OP2   1 
ATOM   7968 O  "O5'" . DG  B 2 12   ? 22.485  19.224  -16.668 1.00 50.99  ? 12   DG  P "O5'" 1 
ATOM   7969 C  "C5'" . DG  B 2 12   ? 21.641  18.777  -17.703 1.00 48.57  ? 12   DG  P "C5'" 1 
ATOM   7970 C  "C4'" . DG  B 2 12   ? 22.499  18.250  -18.829 1.00 47.03  ? 12   DG  P "C4'" 1 
ATOM   7971 O  "O4'" . DG  B 2 12   ? 22.664  19.271  -19.860 1.00 45.45  ? 12   DG  P "O4'" 1 
ATOM   7972 C  "C3'" . DG  B 2 12   ? 23.902  17.839  -18.383 1.00 45.86  ? 12   DG  P "C3'" 1 
ATOM   7973 O  "O3'" . DG  B 2 12   ? 24.236  16.763  -19.206 1.00 45.64  ? 12   DG  P "O3'" 1 
ATOM   7974 C  "C2'" . DG  B 2 12   ? 24.715  19.081  -18.726 1.00 45.13  ? 12   DG  P "C2'" 1 
ATOM   7975 C  "C1'" . DG  B 2 12   ? 24.044  19.505  -20.039 1.00 43.67  ? 12   DG  P "C1'" 1 
ATOM   7976 N  N9    . DG  B 2 12   ? 24.320  20.894  -20.403 1.00 40.58  ? 12   DG  P N9    1 
ATOM   7977 C  C8    . DG  B 2 12   ? 24.546  21.927  -19.527 1.00 38.47  ? 12   DG  P C8    1 
ATOM   7978 N  N7    . DG  B 2 12   ? 24.804  23.056  -20.120 1.00 37.26  ? 12   DG  P N7    1 
ATOM   7979 C  C5    . DG  B 2 12   ? 24.770  22.762  -21.478 1.00 37.47  ? 12   DG  P C5    1 
ATOM   7980 C  C6    . DG  B 2 12   ? 24.983  23.610  -22.597 1.00 36.48  ? 12   DG  P C6    1 
ATOM   7981 O  O6    . DG  B 2 12   ? 25.232  24.823  -22.633 1.00 35.77  ? 12   DG  P O6    1 
ATOM   7982 N  N1    . DG  B 2 12   ? 24.850  22.926  -23.780 1.00 35.74  ? 12   DG  P N1    1 
ATOM   7983 C  C2    . DG  B 2 12   ? 24.560  21.593  -23.896 1.00 36.08  ? 12   DG  P C2    1 
ATOM   7984 N  N2    . DG  B 2 12   ? 24.490  21.152  -25.171 1.00 30.88  ? 12   DG  P N2    1 
ATOM   7985 N  N3    . DG  B 2 12   ? 24.359  20.777  -22.853 1.00 36.17  ? 12   DG  P N3    1 
ATOM   7986 C  C4    . DG  B 2 12   ? 24.472  21.433  -21.677 1.00 37.98  ? 12   DG  P C4    1 
ATOM   7987 P  P     . DC  B 2 13   ? 25.441  15.738  -18.940 1.00 46.88  ? 13   DC  P P     1 
ATOM   7988 O  OP1   . DC  B 2 13   ? 24.889  14.374  -19.059 1.00 42.11  ? 13   DC  P OP1   1 
ATOM   7989 O  OP2   . DC  B 2 13   ? 26.184  16.230  -17.748 1.00 44.44  ? 13   DC  P OP2   1 
ATOM   7990 O  "O5'" . DC  B 2 13   ? 26.336  15.976  -20.264 1.00 44.64  ? 13   DC  P "O5'" 1 
ATOM   7991 C  "C5'" . DC  B 2 13   ? 25.723  16.021  -21.564 1.00 40.53  ? 13   DC  P "C5'" 1 
ATOM   7992 C  "C4'" . DC  B 2 13   ? 26.560  16.807  -22.579 1.00 39.37  ? 13   DC  P "C4'" 1 
ATOM   7993 O  "O4'" . DC  B 2 13   ? 26.441  18.235  -22.398 1.00 36.04  ? 13   DC  P "O4'" 1 
ATOM   7994 C  "C3'" . DC  B 2 13   ? 28.075  16.524  -22.591 1.00 39.57  ? 13   DC  P "C3'" 1 
ATOM   7995 O  "O3'" . DC  B 2 13   ? 28.386  15.806  -23.785 1.00 37.02  ? 13   DC  P "O3'" 1 
ATOM   7996 C  "C2'" . DC  B 2 13   ? 28.744  17.905  -22.514 1.00 37.04  ? 13   DC  P "C2'" 1 
ATOM   7997 C  "C1'" . DC  B 2 13   ? 27.609  18.832  -22.912 1.00 36.66  ? 13   DC  P "C1'" 1 
ATOM   7998 N  N1    . DC  B 2 13   ? 27.795  20.208  -22.346 1.00 34.18  ? 13   DC  P N1    1 
ATOM   7999 C  C2    . DC  B 2 13   ? 27.926  21.266  -23.233 1.00 33.23  ? 13   DC  P C2    1 
ATOM   8000 O  O2    . DC  B 2 13   ? 27.852  20.974  -24.431 1.00 34.27  ? 13   DC  P O2    1 
ATOM   8001 N  N3    . DC  B 2 13   ? 28.101  22.510  -22.731 1.00 32.35  ? 13   DC  P N3    1 
ATOM   8002 C  C4    . DC  B 2 13   ? 28.135  22.666  -21.376 1.00 32.37  ? 13   DC  P C4    1 
ATOM   8003 N  N4    . DC  B 2 13   ? 28.295  23.860  -20.817 1.00 28.76  ? 13   DC  P N4    1 
ATOM   8004 C  C5    . DC  B 2 13   ? 28.030  21.586  -20.469 1.00 32.32  ? 13   DC  P C5    1 
ATOM   8005 C  C6    . DC  B 2 13   ? 27.859  20.385  -21.005 1.00 32.12  ? 13   DC  P C6    1 
ATOM   8006 P  P     . DA  B 2 14   ? 29.748  15.028  -23.967 1.00 38.13  ? 14   DA  P P     1 
ATOM   8007 O  OP1   . DA  B 2 14   ? 29.384  13.819  -24.727 1.00 37.54  ? 14   DA  P OP1   1 
ATOM   8008 O  OP2   . DA  B 2 14   ? 30.524  15.000  -22.703 1.00 38.74  ? 14   DA  P OP2   1 
ATOM   8009 O  "O5'" . DA  B 2 14   ? 30.554  16.028  -24.937 1.00 38.97  ? 14   DA  P "O5'" 1 
ATOM   8010 C  "C5'" . DA  B 2 14   ? 29.975  16.351  -26.221 1.00 37.75  ? 14   DA  P "C5'" 1 
ATOM   8011 C  "C4'" . DA  B 2 14   ? 30.794  17.443  -26.877 1.00 36.90  ? 14   DA  P "C4'" 1 
ATOM   8012 O  "O4'" . DA  B 2 14   ? 30.585  18.659  -26.137 1.00 35.75  ? 14   DA  P "O4'" 1 
ATOM   8013 C  "C3'" . DA  B 2 14   ? 32.312  17.216  -26.900 1.00 36.27  ? 14   DA  P "C3'" 1 
ATOM   8014 O  "O3'" . DA  B 2 14   ? 32.719  17.385  -28.220 1.00 35.46  ? 14   DA  P "O3'" 1 
ATOM   8015 C  "C2'" . DA  B 2 14   ? 32.881  18.301  -25.984 1.00 36.38  ? 14   DA  P "C2'" 1 
ATOM   8016 C  "C1'" . DA  B 2 14   ? 31.794  19.374  -26.101 1.00 35.49  ? 14   DA  P "C1'" 1 
ATOM   8017 N  N9    . DA  B 2 14   ? 31.676  20.292  -24.978 1.00 34.21  ? 14   DA  P N9    1 
ATOM   8018 C  C8    . DA  B 2 14   ? 31.511  19.948  -23.661 1.00 34.89  ? 14   DA  P C8    1 
ATOM   8019 N  N7    . DA  B 2 14   ? 31.431  20.989  -22.850 1.00 36.66  ? 14   DA  P N7    1 
ATOM   8020 C  C5    . DA  B 2 14   ? 31.552  22.085  -23.696 1.00 33.40  ? 14   DA  P C5    1 
ATOM   8021 C  C6    . DA  B 2 14   ? 31.545  23.461  -23.466 1.00 33.29  ? 14   DA  P C6    1 
ATOM   8022 N  N6    . DA  B 2 14   ? 31.397  24.006  -22.244 1.00 30.83  ? 14   DA  P N6    1 
ATOM   8023 N  N1    . DA  B 2 14   ? 31.702  24.278  -24.557 1.00 33.00  ? 14   DA  P N1    1 
ATOM   8024 C  C2    . DA  B 2 14   ? 31.855  23.739  -25.763 1.00 31.88  ? 14   DA  P C2    1 
ATOM   8025 N  N3    . DA  B 2 14   ? 31.855  22.459  -26.096 1.00 32.71  ? 14   DA  P N3    1 
ATOM   8026 C  C4    . DA  B 2 14   ? 31.701  21.676  -25.013 1.00 34.00  ? 14   DA  P C4    1 
ATOM   8027 P  P     . DA  B 2 15   ? 34.211  17.053  -28.660 1.00 35.22  ? 15   DA  P P     1 
ATOM   8028 O  OP1   . DA  B 2 15   ? 34.193  16.578  -30.055 1.00 34.66  ? 15   DA  P OP1   1 
ATOM   8029 O  OP2   . DA  B 2 15   ? 34.816  16.236  -27.593 1.00 35.84  ? 15   DA  P OP2   1 
ATOM   8030 O  "O5'" . DA  B 2 15   ? 34.811  18.530  -28.659 1.00 35.11  ? 15   DA  P "O5'" 1 
ATOM   8031 C  "C5'" . DA  B 2 15   ? 34.074  19.482  -29.436 1.00 35.91  ? 15   DA  P "C5'" 1 
ATOM   8032 C  "C4'" . DA  B 2 15   ? 34.888  20.748  -29.636 1.00 34.22  ? 15   DA  P "C4'" 1 
ATOM   8033 O  "O4'" . DA  B 2 15   ? 34.579  21.637  -28.533 1.00 32.15  ? 15   DA  P "O4'" 1 
ATOM   8034 C  "C3'" . DA  B 2 15   ? 36.406  20.544  -29.635 1.00 32.56  ? 15   DA  P "C3'" 1 
ATOM   8035 O  "O3'" . DA  B 2 15   ? 36.971  21.313  -30.681 1.00 31.51  ? 15   DA  P "O3'" 1 
ATOM   8036 C  "C2'" . DA  B 2 15   ? 36.847  21.062  -28.265 1.00 31.60  ? 15   DA  P "C2'" 1 
ATOM   8037 C  "C1'" . DA  B 2 15   ? 35.771  22.099  -27.918 1.00 33.28  ? 15   DA  P "C1'" 1 
ATOM   8038 N  N9    . DA  B 2 15   ? 35.533  22.240  -26.476 1.00 32.38  ? 15   DA  P N9    1 
ATOM   8039 C  C8    . DA  B 2 15   ? 35.482  21.197  -25.579 1.00 33.15  ? 15   DA  P C8    1 
ATOM   8040 N  N7    . DA  B 2 15   ? 35.256  21.564  -24.335 1.00 32.86  ? 15   DA  P N7    1 
ATOM   8041 C  C5    . DA  B 2 15   ? 35.166  22.940  -24.412 1.00 31.35  ? 15   DA  P C5    1 
ATOM   8042 C  C6    . DA  B 2 15   ? 34.920  23.905  -23.422 1.00 30.37  ? 15   DA  P C6    1 
ATOM   8043 N  N6    . DA  B 2 15   ? 34.743  23.588  -22.137 1.00 30.21  ? 15   DA  P N6    1 
ATOM   8044 N  N1    . DA  B 2 15   ? 34.861  25.198  -23.795 1.00 30.39  ? 15   DA  P N1    1 
ATOM   8045 C  C2    . DA  B 2 15   ? 35.056  25.466  -25.095 1.00 32.56  ? 15   DA  P C2    1 
ATOM   8046 N  N3    . DA  B 2 15   ? 35.283  24.631  -26.119 1.00 33.08  ? 15   DA  P N3    1 
ATOM   8047 C  C4    . DA  B 2 15   ? 35.333  23.369  -25.717 1.00 30.79  ? 15   DA  P C4    1 
ATOM   8048 P  P     . DC  B 2 16   ? 38.536  21.408  -31.039 1.00 30.70  ? 16   DC  P P     1 
ATOM   8049 O  OP1   . DC  B 2 16   ? 38.569  21.751  -32.480 1.00 29.96  ? 16   DC  P OP1   1 
ATOM   8050 O  OP2   . DC  B 2 16   ? 39.148  20.157  -30.522 1.00 31.77  ? 16   DC  P OP2   1 
ATOM   8051 O  "O5'" . DC  B 2 16   ? 39.196  22.608  -30.209 1.00 29.04  ? 16   DC  P "O5'" 1 
ATOM   8052 C  "C5'" . DC  B 2 16   ? 38.616  23.919  -30.301 1.00 28.82  ? 16   DC  P "C5'" 1 
ATOM   8053 C  "C4'" . DC  B 2 16   ? 39.080  24.800  -29.165 1.00 29.11  ? 16   DC  P "C4'" 1 
ATOM   8054 O  "O4'" . DC  B 2 16   ? 38.359  24.718  -27.949 1.00 28.51  ? 16   DC  P "O4'" 1 
ATOM   8055 C  "C3'" . DC  B 2 16   ? 40.559  24.623  -28.838 1.00 29.62  ? 16   DC  P "C3'" 1 
ATOM   8056 O  "O3'" . DC  B 2 16   ? 41.233  25.683  -29.560 1.00 29.11  ? 16   DC  P "O3'" 1 
ATOM   8057 C  "C2'" . DC  B 2 16   ? 40.528  24.616  -27.299 1.00 29.78  ? 16   DC  P "C2'" 1 
ATOM   8058 C  "C1'" . DC  B 2 16   ? 39.136  25.045  -26.871 1.00 30.24  ? 16   DC  P "C1'" 1 
ATOM   8059 N  N1    . DC  B 2 16   ? 38.888  24.338  -25.562 1.00 32.19  ? 16   DC  P N1    1 
ATOM   8060 C  C2    . DC  B 2 16   ? 38.559  25.072  -24.414 1.00 32.94  ? 16   DC  P C2    1 
ATOM   8061 O  O2    . DC  B 2 16   ? 38.442  26.312  -24.480 1.00 35.15  ? 16   DC  P O2    1 
ATOM   8062 N  N3    . DC  B 2 16   ? 38.373  24.421  -23.253 1.00 30.55  ? 16   DC  P N3    1 
ATOM   8063 C  C4    . DC  B 2 16   ? 38.518  23.104  -23.181 1.00 33.02  ? 16   DC  P C4    1 
ATOM   8064 N  N4    . DC  B 2 16   ? 38.295  22.525  -21.976 1.00 29.04  ? 16   DC  P N4    1 
ATOM   8065 C  C5    . DC  B 2 16   ? 38.859  22.332  -24.347 1.00 31.33  ? 16   DC  P C5    1 
ATOM   8066 C  C6    . DC  B 2 16   ? 39.048  22.991  -25.497 1.00 31.64  ? 16   DC  P C6    1 
ATOM   8067 P  P     . DC  B 2 17   ? 42.796  26.031  -29.501 1.00 27.36  ? 17   DC  P P     1 
ATOM   8068 O  OP1   . DC  B 2 17   ? 43.059  26.799  -30.736 1.00 28.45  ? 17   DC  P OP1   1 
ATOM   8069 O  OP2   . DC  B 2 17   ? 43.513  24.778  -29.157 1.00 27.54  ? 17   DC  P OP2   1 
ATOM   8070 O  "O5'" . DC  B 2 17   ? 42.991  27.084  -28.324 1.00 26.80  ? 17   DC  P "O5'" 1 
ATOM   8071 C  "C5'" . DC  B 2 17   ? 42.151  28.203  -28.329 1.00 27.83  ? 17   DC  P "C5'" 1 
ATOM   8072 C  "C4'" . DC  B 2 17   ? 42.373  29.001  -27.076 1.00 27.22  ? 17   DC  P "C4'" 1 
ATOM   8073 O  "O4'" . DC  B 2 17   ? 41.677  28.358  -25.985 1.00 25.82  ? 17   DC  P "O4'" 1 
ATOM   8074 C  "C3'" . DC  B 2 17   ? 43.825  29.048  -26.634 1.00 27.63  ? 17   DC  P "C3'" 1 
ATOM   8075 C  "C2'" . DC  B 2 17   ? 43.703  29.258  -25.122 1.00 26.44  ? 17   DC  P "C2'" 1 
ATOM   8076 C  "C1'" . DC  B 2 17   ? 42.388  28.570  -24.781 1.00 25.38  ? 17   DC  P "C1'" 1 
ATOM   8077 N  N1    . DC  B 2 17   ? 42.314  27.236  -24.097 1.00 26.68  ? 17   DC  P N1    1 
ATOM   8078 C  C2    . DC  B 2 17   ? 42.052  27.255  -22.714 1.00 26.54  ? 17   DC  P C2    1 
ATOM   8079 O  O2    . DC  B 2 17   ? 41.979  28.318  -22.096 1.00 29.62  ? 17   DC  P O2    1 
ATOM   8080 N  N3    . DC  B 2 17   ? 41.892  26.113  -22.053 1.00 27.18  ? 17   DC  P N3    1 
ATOM   8081 C  C4    . DC  B 2 17   ? 41.976  24.964  -22.716 1.00 27.75  ? 17   DC  P C4    1 
ATOM   8082 N  N4    . DC  B 2 17   ? 41.799  23.909  -21.916 1.00 23.37  ? 17   DC  P N4    1 
ATOM   8083 C  C5    . DC  B 2 17   ? 42.236  24.884  -24.145 1.00 24.42  ? 17   DC  P C5    1 
ATOM   8084 C  C6    . DC  B 2 17   ? 42.399  26.051  -24.794 1.00 24.00  ? 17   DC  P C6    1 
ATOM   8085 O  "O5'" . DA  C 3 1    ? 35.056  19.127  5.041   1.00 64.43  ? 1    DA  T "O5'" 1 
ATOM   8086 C  "C5'" . DA  C 3 1    ? 36.116  18.698  5.877   1.00 63.48  ? 1    DA  T "C5'" 1 
ATOM   8087 C  "C4'" . DA  C 3 1    ? 36.670  17.369  5.370   1.00 63.41  ? 1    DA  T "C4'" 1 
ATOM   8088 O  "O4'" . DA  C 3 1    ? 35.613  16.388  5.195   1.00 63.91  ? 1    DA  T "O4'" 1 
ATOM   8089 C  "C3'" . DA  C 3 1    ? 37.453  17.411  4.059   1.00 61.85  ? 1    DA  T "C3'" 1 
ATOM   8090 O  "O3'" . DA  C 3 1    ? 38.663  16.712  4.235   1.00 58.63  ? 1    DA  T "O3'" 1 
ATOM   8091 C  "C2'" . DA  C 3 1    ? 36.608  16.647  3.050   1.00 63.77  ? 1    DA  T "C2'" 1 
ATOM   8092 C  "C1'" . DA  C 3 1    ? 35.722  15.768  3.927   1.00 65.24  ? 1    DA  T "C1'" 1 
ATOM   8093 N  N9    . DA  C 3 1    ? 34.383  15.730  3.371   1.00 66.96  ? 1    DA  T N9    1 
ATOM   8094 C  C8    . DA  C 3 1    ? 33.478  16.761  3.360   1.00 67.09  ? 1    DA  T C8    1 
ATOM   8095 N  N7    . DA  C 3 1    ? 32.344  16.447  2.779   1.00 67.43  ? 1    DA  T N7    1 
ATOM   8096 C  C5    . DA  C 3 1    ? 32.527  15.130  2.381   1.00 67.06  ? 1    DA  T C5    1 
ATOM   8097 C  C6    . DA  C 3 1    ? 31.690  14.220  1.711   1.00 66.66  ? 1    DA  T C6    1 
ATOM   8098 N  N6    . DA  C 3 1    ? 30.453  14.538  1.309   1.00 66.43  ? 1    DA  T N6    1 
ATOM   8099 N  N1    . DA  C 3 1    ? 32.184  12.984  1.468   1.00 66.54  ? 1    DA  T N1    1 
ATOM   8100 C  C2    . DA  C 3 1    ? 33.429  12.682  1.868   1.00 66.89  ? 1    DA  T C2    1 
ATOM   8101 N  N3    . DA  C 3 1    ? 34.312  13.453  2.506   1.00 67.04  ? 1    DA  T N3    1 
ATOM   8102 C  C4    . DA  C 3 1    ? 33.785  14.670  2.734   1.00 67.19  ? 1    DA  T C4    1 
ATOM   8103 P  P     . DT  C 3 2    ? 39.841  16.983  3.207   1.00 54.83  ? 2    DT  T P     1 
ATOM   8104 O  OP1   . DT  C 3 2    ? 41.064  17.232  4.010   1.00 53.96  ? 2    DT  T OP1   1 
ATOM   8105 O  OP2   . DT  C 3 2    ? 39.334  18.002  2.251   1.00 56.23  ? 2    DT  T OP2   1 
ATOM   8106 O  "O5'" . DT  C 3 2    ? 40.006  15.614  2.393   1.00 53.47  ? 2    DT  T "O5'" 1 
ATOM   8107 C  "C5'" . DT  C 3 2    ? 39.523  14.377  2.857   1.00 50.92  ? 2    DT  T "C5'" 1 
ATOM   8108 C  "C4'" . DT  C 3 2    ? 39.450  13.386  1.716   1.00 49.89  ? 2    DT  T "C4'" 1 
ATOM   8109 O  "O4'" . DT  C 3 2    ? 38.056  13.257  1.399   1.00 49.50  ? 2    DT  T "O4'" 1 
ATOM   8110 C  "C3'" . DT  C 3 2    ? 40.162  13.759  0.407   1.00 49.80  ? 2    DT  T "C3'" 1 
ATOM   8111 O  "O3'" . DT  C 3 2    ? 40.857  12.635  -0.135  1.00 49.80  ? 2    DT  T "O3'" 1 
ATOM   8112 C  "C2'" . DT  C 3 2    ? 39.033  14.089  -0.551  1.00 50.31  ? 2    DT  T "C2'" 1 
ATOM   8113 C  "C1'" . DT  C 3 2    ? 37.958  13.167  0.000   1.00 50.82  ? 2    DT  T "C1'" 1 
ATOM   8114 N  N1    . DT  C 3 2    ? 36.591  13.554  -0.382  1.00 52.52  ? 2    DT  T N1    1 
ATOM   8115 C  C2    . DT  C 3 2    ? 35.806  12.565  -0.931  1.00 52.95  ? 2    DT  T C2    1 
ATOM   8116 O  O2    . DT  C 3 2    ? 36.202  11.425  -1.106  1.00 52.17  ? 2    DT  T O2    1 
ATOM   8117 N  N3    . DT  C 3 2    ? 34.543  12.974  -1.269  1.00 53.83  ? 2    DT  T N3    1 
ATOM   8118 C  C4    . DT  C 3 2    ? 34.022  14.246  -1.109  1.00 54.57  ? 2    DT  T C4    1 
ATOM   8119 O  O4    . DT  C 3 2    ? 32.873  14.509  -1.443  1.00 57.14  ? 2    DT  T O4    1 
ATOM   8120 C  C5    . DT  C 3 2    ? 34.894  15.238  -0.528  1.00 53.73  ? 2    DT  T C5    1 
ATOM   8121 C  C7    . DT  C 3 2    ? 34.394  16.637  -0.310  1.00 52.72  ? 2    DT  T C7    1 
ATOM   8122 C  C6    . DT  C 3 2    ? 36.133  14.851  -0.188  1.00 52.85  ? 2    DT  T C6    1 
ATOM   8123 P  P     . DA  C 3 3    ? 42.332  12.793  -0.740  1.00 48.83  ? 3    DA  T P     1 
ATOM   8124 O  OP1   . DA  C 3 3    ? 42.942  11.451  -0.721  1.00 50.18  ? 3    DA  T OP1   1 
ATOM   8125 O  OP2   . DA  C 3 3    ? 42.960  13.935  -0.037  1.00 49.38  ? 3    DA  T OP2   1 
ATOM   8126 O  "O5'" . DA  C 3 3    ? 42.146  13.193  -2.280  1.00 47.66  ? 3    DA  T "O5'" 1 
ATOM   8127 C  "C5'" . DA  C 3 3    ? 41.296  12.399  -3.095  1.00 45.86  ? 3    DA  T "C5'" 1 
ATOM   8128 C  "C4'" . DA  C 3 3    ? 41.166  12.967  -4.502  1.00 43.97  ? 3    DA  T "C4'" 1 
ATOM   8129 O  "O4'" . DA  C 3 3    ? 40.209  14.045  -4.456  1.00 42.78  ? 3    DA  T "O4'" 1 
ATOM   8130 C  "C3'" . DA  C 3 3    ? 42.420  13.562  -5.160  1.00 42.07  ? 3    DA  T "C3'" 1 
ATOM   8131 O  "O3'" . DA  C 3 3    ? 42.260  13.437  -6.562  1.00 40.97  ? 3    DA  T "O3'" 1 
ATOM   8132 C  "C2'" . DA  C 3 3    ? 42.390  15.025  -4.724  1.00 41.61  ? 3    DA  T "C2'" 1 
ATOM   8133 C  "C1'" . DA  C 3 3    ? 40.887  15.290  -4.607  1.00 41.98  ? 3    DA  T "C1'" 1 
ATOM   8134 N  N9    . DA  C 3 3    ? 40.480  16.050  -3.433  1.00 41.01  ? 3    DA  T N9    1 
ATOM   8135 C  C8    . DA  C 3 3    ? 41.138  16.142  -2.235  1.00 40.89  ? 3    DA  T C8    1 
ATOM   8136 N  N7    . DA  C 3 3    ? 40.520  16.887  -1.353  1.00 40.41  ? 3    DA  T N7    1 
ATOM   8137 C  C5    . DA  C 3 3    ? 39.377  17.297  -2.013  1.00 40.08  ? 3    DA  T C5    1 
ATOM   8138 C  C6    . DA  C 3 3    ? 38.305  18.104  -1.599  1.00 40.55  ? 3    DA  T C6    1 
ATOM   8139 N  N6    . DA  C 3 3    ? 38.257  18.636  -0.371  1.00 40.16  ? 3    DA  T N6    1 
ATOM   8140 N  N1    . DA  C 3 3    ? 37.315  18.335  -2.503  1.00 40.42  ? 3    DA  T N1    1 
ATOM   8141 C  C2    . DA  C 3 3    ? 37.387  17.782  -3.729  1.00 39.95  ? 3    DA  T C2    1 
ATOM   8142 N  N3    . DA  C 3 3    ? 38.349  16.996  -4.225  1.00 40.48  ? 3    DA  T N3    1 
ATOM   8143 C  C4    . DA  C 3 3    ? 39.325  16.796  -3.304  1.00 40.67  ? 3    DA  T C4    1 
ATOM   8144 P  P     . DA  C 3 4    ? 43.345  14.010  -7.595  1.00 42.07  ? 4    DA  T P     1 
ATOM   8145 O  OP1   . DA  C 3 4    ? 43.092  13.377  -8.900  1.00 42.62  ? 4    DA  T OP1   1 
ATOM   8146 O  OP2   . DA  C 3 4    ? 44.695  13.970  -6.992  1.00 41.94  ? 4    DA  T OP2   1 
ATOM   8147 O  "O5'" . DA  C 3 4    ? 42.836  15.518  -7.762  1.00 41.26  ? 4    DA  T "O5'" 1 
ATOM   8148 C  "C5'" . DA  C 3 4    ? 41.704  15.722  -8.606  1.00 39.83  ? 4    DA  T "C5'" 1 
ATOM   8149 C  "C4'" . DA  C 3 4    ? 41.293  17.175  -8.510  1.00 39.47  ? 4    DA  T "C4'" 1 
ATOM   8150 O  "O4'" . DA  C 3 4    ? 41.039  17.455  -7.117  1.00 38.60  ? 4    DA  T "O4'" 1 
ATOM   8151 C  "C3'" . DA  C 3 4    ? 42.396  18.166  -8.885  1.00 37.74  ? 4    DA  T "C3'" 1 
ATOM   8152 O  "O3'" . DA  C 3 4    ? 42.172  18.642  -10.190 1.00 35.76  ? 4    DA  T "O3'" 1 
ATOM   8153 C  "C2'" . DA  C 3 4    ? 42.234  19.306  -7.874  1.00 36.78  ? 4    DA  T "C2'" 1 
ATOM   8154 C  "C1'" . DA  C 3 4    ? 41.120  18.854  -6.938  1.00 38.04  ? 4    DA  T "C1'" 1 
ATOM   8155 N  N9    . DA  C 3 4    ? 41.421  19.088  -5.516  1.00 37.85  ? 4    DA  T N9    1 
ATOM   8156 C  C8    . DA  C 3 4    ? 42.522  18.616  -4.860  1.00 38.45  ? 4    DA  T C8    1 
ATOM   8157 N  N7    . DA  C 3 4    ? 42.589  18.943  -3.587  1.00 36.25  ? 4    DA  T N7    1 
ATOM   8158 C  C5    . DA  C 3 4    ? 41.445  19.676  -3.396  1.00 34.57  ? 4    DA  T C5    1 
ATOM   8159 C  C6    . DA  C 3 4    ? 40.952  20.308  -2.237  1.00 32.90  ? 4    DA  T C6    1 
ATOM   8160 N  N6    . DA  C 3 4    ? 41.614  20.260  -1.089  1.00 31.23  ? 4    DA  T N6    1 
ATOM   8161 N  N1    . DA  C 3 4    ? 39.781  20.977  -2.331  1.00 32.98  ? 4    DA  T N1    1 
ATOM   8162 C  C2    . DA  C 3 4    ? 39.172  21.005  -3.535  1.00 33.37  ? 4    DA  T C2    1 
ATOM   8163 N  N3    . DA  C 3 4    ? 39.557  20.461  -4.703  1.00 34.20  ? 4    DA  T N3    1 
ATOM   8164 C  C4    . DA  C 3 4    ? 40.709  19.783  -4.563  1.00 34.94  ? 4    DA  T C4    1 
ATOM   8165 P  P     . DC  C 3 5    ? 43.159  18.341  -11.396 1.00 34.92  ? 5    DC  T P     1 
ATOM   8166 O  OP1   . DC  C 3 5    ? 42.335  17.893  -12.527 1.00 39.03  ? 5    DC  T OP1   1 
ATOM   8167 O  OP2   . DC  C 3 5    ? 44.208  17.455  -10.884 1.00 38.54  ? 5    DC  T OP2   1 
ATOM   8168 O  "O5'" . DC  C 3 5    ? 43.831  19.727  -11.828 1.00 34.76  ? 5    DC  T "O5'" 1 
ATOM   8169 C  "C5'" . DC  C 3 5    ? 44.407  20.634  -10.900 1.00 32.07  ? 5    DC  T "C5'" 1 
ATOM   8170 C  "C4'" . DC  C 3 5    ? 43.966  22.038  -11.255 1.00 30.21  ? 5    DC  T "C4'" 1 
ATOM   8171 O  "O4'" . DC  C 3 5    ? 44.362  22.263  -12.623 1.00 31.75  ? 5    DC  T "O4'" 1 
ATOM   8172 C  "C3'" . DC  C 3 5    ? 42.461  22.310  -11.221 1.00 30.20  ? 5    DC  T "C3'" 1 
ATOM   8173 O  "O3'" . DC  C 3 5    ? 42.309  23.548  -10.617 1.00 26.65  ? 5    DC  T "O3'" 1 
ATOM   8174 C  "C2'" . DC  C 3 5    ? 42.065  22.368  -12.698 1.00 30.55  ? 5    DC  T "C2'" 1 
ATOM   8175 C  "C1'" . DC  C 3 5    ? 43.330  22.915  -13.340 1.00 30.88  ? 5    DC  T "C1'" 1 
ATOM   8176 N  N1    . DC  C 3 5    ? 43.578  22.514  -14.748 1.00 33.74  ? 5    DC  T N1    1 
ATOM   8177 C  C2    . DC  C 3 5    ? 43.909  23.476  -15.704 1.00 36.59  ? 5    DC  T C2    1 
ATOM   8178 O  O2    . DC  C 3 5    ? 43.954  24.656  -15.360 1.00 39.90  ? 5    DC  T O2    1 
ATOM   8179 N  N3    . DC  C 3 5    ? 44.148  23.089  -16.984 1.00 37.36  ? 5    DC  T N3    1 
ATOM   8180 C  C4    . DC  C 3 5    ? 44.074  21.784  -17.298 1.00 35.90  ? 5    DC  T C4    1 
ATOM   8181 N  N4    . DC  C 3 5    ? 44.316  21.436  -18.559 1.00 33.83  ? 5    DC  T N4    1 
ATOM   8182 C  C5    . DC  C 3 5    ? 43.763  20.783  -16.340 1.00 32.06  ? 5    DC  T C5    1 
ATOM   8183 C  C6    . DC  C 3 5    ? 43.529  21.199  -15.098 1.00 32.80  ? 5    DC  T C6    1 
ATOM   8184 P  P     . DG  C 3 6    ? 40.878  24.193  -10.346 1.00 29.13  ? 6    DG  T P     1 
ATOM   8185 O  OP1   . DG  C 3 6    ? 40.956  24.723  -8.968  1.00 28.24  ? 6    DG  T OP1   1 
ATOM   8186 O  OP2   . DG  C 3 6    ? 39.790  23.274  -10.731 1.00 29.12  ? 6    DG  T OP2   1 
ATOM   8187 O  "O5'" . DG  C 3 6    ? 40.829  25.415  -11.400 1.00 28.11  ? 6    DG  T "O5'" 1 
ATOM   8188 C  "C5'" . DG  C 3 6    ? 41.824  26.442  -11.279 1.00 26.07  ? 6    DG  T "C5'" 1 
ATOM   8189 C  "C4'" . DG  C 3 6    ? 41.348  27.606  -12.130 1.00 26.97  ? 6    DG  T "C4'" 1 
ATOM   8190 O  "O4'" . DG  C 3 6    ? 41.691  27.297  -13.505 1.00 24.44  ? 6    DG  T "O4'" 1 
ATOM   8191 C  "C3'" . DG  C 3 6    ? 39.825  27.880  -12.078 1.00 24.45  ? 6    DG  T "C3'" 1 
ATOM   8192 O  "O3'" . DG  C 3 6    ? 39.666  29.266  -12.036 1.00 22.98  ? 6    DG  T "O3'" 1 
ATOM   8193 C  "C2'" . DG  C 3 6    ? 39.287  27.318  -13.387 1.00 26.45  ? 6    DG  T "C2'" 1 
ATOM   8194 C  "C1'" . DG  C 3 6    ? 40.524  27.420  -14.311 1.00 28.04  ? 6    DG  T "C1'" 1 
ATOM   8195 N  N9    . DG  C 3 6    ? 40.626  26.368  -15.330 1.00 28.77  ? 6    DG  T N9    1 
ATOM   8196 C  C8    . DG  C 3 6    ? 40.472  25.021  -15.103 1.00 28.14  ? 6    DG  T C8    1 
ATOM   8197 N  N7    . DG  C 3 6    ? 40.629  24.327  -16.196 1.00 30.09  ? 6    DG  T N7    1 
ATOM   8198 C  C5    . DG  C 3 6    ? 40.886  25.253  -17.200 1.00 27.19  ? 6    DG  T C5    1 
ATOM   8199 C  C6    . DG  C 3 6    ? 41.128  25.059  -18.578 1.00 28.40  ? 6    DG  T C6    1 
ATOM   8200 O  O6    . DG  C 3 6    ? 41.164  23.995  -19.199 1.00 27.94  ? 6    DG  T O6    1 
ATOM   8201 N  N1    . DG  C 3 6    ? 41.359  26.255  -19.257 1.00 28.14  ? 6    DG  T N1    1 
ATOM   8202 C  C2    . DG  C 3 6    ? 41.322  27.497  -18.652 1.00 28.19  ? 6    DG  T C2    1 
ATOM   8203 N  N2    . DG  C 3 6    ? 41.548  28.558  -19.458 1.00 25.80  ? 6    DG  T N2    1 
ATOM   8204 N  N3    . DG  C 3 6    ? 41.084  27.680  -17.344 1.00 26.61  ? 6    DG  T N3    1 
ATOM   8205 C  C4    . DG  C 3 6    ? 40.882  26.519  -16.687 1.00 27.04  ? 6    DG  T C4    1 
ATOM   8206 P  P     . DG  C 3 7    ? 38.257  30.050  -12.153 1.00 23.47  ? 7    DG  T P     1 
ATOM   8207 O  OP1   . DG  C 3 7    ? 38.449  31.374  -11.524 1.00 23.59  ? 7    DG  T OP1   1 
ATOM   8208 O  OP2   . DG  C 3 7    ? 37.167  29.153  -11.717 1.00 23.18  ? 7    DG  T OP2   1 
ATOM   8209 O  "O5'" . DG  C 3 7    ? 38.107  30.308  -13.731 1.00 26.04  ? 7    DG  T "O5'" 1 
ATOM   8210 C  "C5'" . DG  C 3 7    ? 39.097  31.074  -14.392 1.00 26.02  ? 7    DG  T "C5'" 1 
ATOM   8211 C  "C4'" . DG  C 3 7    ? 38.657  31.254  -15.830 1.00 28.50  ? 7    DG  T "C4'" 1 
ATOM   8212 O  "O4'" . DG  C 3 7    ? 38.825  29.997  -16.530 1.00 30.99  ? 7    DG  T "O4'" 1 
ATOM   8213 C  "C3'" . DG  C 3 7    ? 37.204  31.665  -16.079 1.00 27.63  ? 7    DG  T "C3'" 1 
ATOM   8214 O  "O3'" . DG  C 3 7    ? 37.217  32.758  -17.016 1.00 26.81  ? 7    DG  T "O3'" 1 
ATOM   8215 C  "C2'" . DG  C 3 7    ? 36.565  30.419  -16.703 1.00 27.46  ? 7    DG  T "C2'" 1 
ATOM   8216 C  "C1'" . DG  C 3 7    ? 37.768  29.816  -17.425 1.00 29.64  ? 7    DG  T "C1'" 1 
ATOM   8217 N  N9    . DG  C 3 7    ? 37.657  28.394  -17.698 1.00 29.33  ? 7    DG  T N9    1 
ATOM   8218 C  C8    . DG  C 3 7    ? 37.279  27.408  -16.819 1.00 29.39  ? 7    DG  T C8    1 
ATOM   8219 N  N7    . DG  C 3 7    ? 37.236  26.220  -17.356 1.00 30.04  ? 7    DG  T N7    1 
ATOM   8220 C  C5    . DG  C 3 7    ? 37.611  26.439  -18.677 1.00 31.96  ? 7    DG  T C5    1 
ATOM   8221 C  C6    . DG  C 3 7    ? 37.763  25.526  -19.750 1.00 33.84  ? 7    DG  T C6    1 
ATOM   8222 O  O6    . DG  C 3 7    ? 37.565  24.296  -19.735 1.00 34.43  ? 7    DG  T O6    1 
ATOM   8223 N  N1    . DG  C 3 7    ? 38.161  26.166  -20.931 1.00 31.54  ? 7    DG  T N1    1 
ATOM   8224 C  C2    . DG  C 3 7    ? 38.378  27.499  -21.066 1.00 31.46  ? 7    DG  T C2    1 
ATOM   8225 N  N2    . DG  C 3 7    ? 38.738  27.917  -22.290 1.00 32.29  ? 7    DG  T N2    1 
ATOM   8226 N  N3    . DG  C 3 7    ? 38.243  28.366  -20.074 1.00 31.95  ? 7    DG  T N3    1 
ATOM   8227 C  C4    . DG  C 3 7    ? 37.865  27.771  -18.911 1.00 31.08  ? 7    DG  T C4    1 
ATOM   8228 P  P     . DT  C 3 8    ? 36.090  33.858  -17.018 1.00 25.32  ? 8    DT  T P     1 
ATOM   8229 O  OP1   . DT  C 3 8    ? 36.748  35.156  -16.786 1.00 26.09  ? 8    DT  T OP1   1 
ATOM   8230 O  OP2   . DT  C 3 8    ? 35.026  33.329  -16.127 1.00 27.86  ? 8    DT  T OP2   1 
ATOM   8231 O  "O5'" . DT  C 3 8    ? 35.310  33.808  -18.443 1.00 29.02  ? 8    DT  T "O5'" 1 
ATOM   8232 C  "C5'" . DT  C 3 8    ? 35.944  33.910  -19.683 1.00 30.63  ? 8    DT  T "C5'" 1 
ATOM   8233 C  "C4'" . DT  C 3 8    ? 35.625  32.898  -20.806 1.00 32.15  ? 8    DT  T "C4'" 1 
ATOM   8234 O  "O4'" . DT  C 3 8    ? 36.197  31.680  -20.758 1.00 33.08  ? 8    DT  T "O4'" 1 
ATOM   8235 C  "C3'" . DT  C 3 8    ? 34.236  32.683  -21.401 1.00 31.85  ? 8    DT  T "C3'" 1 
ATOM   8236 O  "O3'" . DT  C 3 8    ? 33.964  33.733  -22.338 1.00 30.47  ? 8    DT  T "O3'" 1 
ATOM   8237 C  "C2'" . DT  C 3 8    ? 34.244  31.179  -21.852 1.00 32.89  ? 8    DT  T "C2'" 1 
ATOM   8238 C  "C1'" . DT  C 3 8    ? 35.746  30.834  -21.711 1.00 31.35  ? 8    DT  T "C1'" 1 
ATOM   8239 N  N1    . DT  C 3 8    ? 35.347  29.492  -21.336 1.00 32.16  ? 8    DT  T N1    1 
ATOM   8240 C  C2    . DT  C 3 8    ? 35.416  28.566  -22.333 1.00 31.63  ? 8    DT  T C2    1 
ATOM   8241 O  O2    . DT  C 3 8    ? 35.847  28.866  -23.419 1.00 31.60  ? 8    DT  T O2    1 
ATOM   8242 N  N3    . DT  C 3 8    ? 35.004  27.310  -21.984 1.00 31.96  ? 8    DT  T N3    1 
ATOM   8243 C  C4    . DT  C 3 8    ? 34.502  26.938  -20.721 1.00 32.00  ? 8    DT  T C4    1 
ATOM   8244 O  O4    . DT  C 3 8    ? 34.144  25.788  -20.453 1.00 31.21  ? 8    DT  T O4    1 
ATOM   8245 C  C5    . DT  C 3 8    ? 34.427  27.983  -19.719 1.00 31.79  ? 8    DT  T C5    1 
ATOM   8246 C  C7    . DT  C 3 8    ? 33.884  27.663  -18.330 1.00 27.26  ? 8    DT  T C7    1 
ATOM   8247 C  C6    . DT  C 3 8    ? 34.816  29.219  -20.095 1.00 29.78  ? 8    DT  T C6    1 
ATOM   8248 P  P     . DT  C 3 9    ? 32.502  34.066  -22.912 1.00 26.68  ? 9    DT  T P     1 
ATOM   8249 O  OP1   . DT  C 3 9    ? 32.421  35.522  -23.089 1.00 28.75  ? 9    DT  T OP1   1 
ATOM   8250 O  OP2   . DT  C 3 9    ? 31.543  33.354  -22.061 1.00 28.83  ? 9    DT  T OP2   1 
ATOM   8251 O  "O5'" . DT  C 3 9    ? 32.457  33.410  -24.378 1.00 26.46  ? 9    DT  T "O5'" 1 
ATOM   8252 C  "C5'" . DT  C 3 9    ? 33.576  33.394  -25.285 1.00 22.54  ? 9    DT  T "C5'" 1 
ATOM   8253 C  "C4'" . DT  C 3 9    ? 33.236  32.385  -26.362 1.00 25.78  ? 9    DT  T "C4'" 1 
ATOM   8254 O  "O4'" . DT  C 3 9    ? 33.384  31.016  -25.887 1.00 25.73  ? 9    DT  T "O4'" 1 
ATOM   8255 C  "C3'" . DT  C 3 9    ? 31.799  32.508  -26.899 1.00 24.97  ? 9    DT  T "C3'" 1 
ATOM   8256 O  "O3'" . DT  C 3 9    ? 31.874  32.490  -28.323 1.00 26.00  ? 9    DT  T "O3'" 1 
ATOM   8257 C  "C2'" . DT  C 3 9    ? 31.089  31.269  -26.378 1.00 25.11  ? 9    DT  T "C2'" 1 
ATOM   8258 C  "C1'" . DT  C 3 9    ? 32.222  30.258  -26.204 1.00 27.37  ? 9    DT  T "C1'" 1 
ATOM   8259 N  N1    . DT  C 3 9    ? 32.015  29.400  -25.016 1.00 29.85  ? 9    DT  T N1    1 
ATOM   8260 C  C2    . DT  C 3 9    ? 32.172  28.047  -25.135 1.00 29.49  ? 9    DT  T C2    1 
ATOM   8261 O  O2    . DT  C 3 9    ? 32.459  27.525  -26.190 1.00 27.91  ? 9    DT  T O2    1 
ATOM   8262 N  N3    . DT  C 3 9    ? 31.985  27.345  -23.965 1.00 28.30  ? 9    DT  T N3    1 
ATOM   8263 C  C4    . DT  C 3 9    ? 31.661  27.859  -22.735 1.00 30.09  ? 9    DT  T C4    1 
ATOM   8264 O  O4    . DT  C 3 9    ? 31.509  27.122  -21.759 1.00 34.88  ? 9    DT  T O4    1 
ATOM   8265 C  C5    . DT  C 3 9    ? 31.514  29.296  -22.673 1.00 29.61  ? 9    DT  T C5    1 
ATOM   8266 C  C7    . DT  C 3 9    ? 31.168  29.973  -21.373 1.00 26.25  ? 9    DT  T C7    1 
ATOM   8267 C  C6    . DT  C 3 9    ? 31.700  29.987  -23.798 1.00 28.40  ? 9    DT  T C6    1 
ATOM   8268 P  P     . DG  C 3 10   ? 30.662  32.786  -29.322 1.00 26.39  ? 10   DG  T P     1 
ATOM   8269 O  OP1   . DG  C 3 10   ? 31.365  33.182  -30.561 1.00 28.36  ? 10   DG  T OP1   1 
ATOM   8270 O  OP2   . DG  C 3 10   ? 29.654  33.705  -28.743 1.00 28.76  ? 10   DG  T OP2   1 
ATOM   8271 O  "O5'" . DG  C 3 10   ? 29.979  31.355  -29.472 1.00 26.96  ? 10   DG  T "O5'" 1 
ATOM   8272 C  "C5'" . DG  C 3 10   ? 30.804  30.359  -30.112 1.00 28.72  ? 10   DG  T "C5'" 1 
ATOM   8273 C  "C4'" . DG  C 3 10   ? 30.108  29.015  -30.150 1.00 29.23  ? 10   DG  T "C4'" 1 
ATOM   8274 O  "O4'" . DG  C 3 10   ? 30.158  28.505  -28.798 1.00 29.25  ? 10   DG  T "O4'" 1 
ATOM   8275 C  "C3'" . DG  C 3 10   ? 28.626  29.021  -30.556 1.00 30.91  ? 10   DG  T "C3'" 1 
ATOM   8276 O  "O3'" . DG  C 3 10   ? 28.439  28.133  -31.639 1.00 31.24  ? 10   DG  T "O3'" 1 
ATOM   8277 C  "C2'" . DG  C 3 10   ? 27.882  28.469  -29.335 1.00 31.29  ? 10   DG  T "C2'" 1 
ATOM   8278 C  "C1'" . DG  C 3 10   ? 29.005  27.751  -28.551 1.00 30.87  ? 10   DG  T "C1'" 1 
ATOM   8279 N  N9    . DG  C 3 10   ? 28.814  27.737  -27.104 1.00 31.94  ? 10   DG  T N9    1 
ATOM   8280 C  C8    . DG  C 3 10   ? 28.710  28.798  -26.241 1.00 32.15  ? 10   DG  T C8    1 
ATOM   8281 N  N7    . DG  C 3 10   ? 28.544  28.439  -24.992 1.00 34.13  ? 10   DG  T N7    1 
ATOM   8282 C  C5    . DG  C 3 10   ? 28.520  27.052  -25.030 1.00 34.92  ? 10   DG  T C5    1 
ATOM   8283 C  C6    . DG  C 3 10   ? 28.334  26.094  -24.002 1.00 36.90  ? 10   DG  T C6    1 
ATOM   8284 O  O6    . DG  C 3 10   ? 28.171  26.246  -22.781 1.00 38.98  ? 10   DG  T O6    1 
ATOM   8285 N  N1    . DG  C 3 10   ? 28.387  24.802  -24.494 1.00 37.48  ? 10   DG  T N1    1 
ATOM   8286 C  C2    . DG  C 3 10   ? 28.568  24.470  -25.812 1.00 37.12  ? 10   DG  T C2    1 
ATOM   8287 N  N2    . DG  C 3 10   ? 28.570  23.162  -26.089 1.00 36.10  ? 10   DG  T N2    1 
ATOM   8288 N  N3    . DG  C 3 10   ? 28.712  25.349  -26.792 1.00 37.47  ? 10   DG  T N3    1 
ATOM   8289 C  C4    . DG  C 3 10   ? 28.685  26.617  -26.324 1.00 34.73  ? 10   DG  T C4    1 
ATOM   8290 P  P     . DC  C 3 11   ? 27.117  28.118  -32.538 1.00 31.98  ? 11   DC  T P     1 
ATOM   8291 O  OP1   . DC  C 3 11   ? 27.566  28.316  -33.944 1.00 31.97  ? 11   DC  T OP1   1 
ATOM   8292 O  OP2   . DC  C 3 11   ? 26.108  29.062  -31.991 1.00 32.35  ? 11   DC  T OP2   1 
ATOM   8293 O  "O5'" . DC  C 3 11   ? 26.515  26.657  -32.272 1.00 29.58  ? 11   DC  T "O5'" 1 
ATOM   8294 C  "C5'" . DC  C 3 11   ? 27.356  25.538  -32.190 1.00 30.70  ? 11   DC  T "C5'" 1 
ATOM   8295 C  "C4'" . DC  C 3 11   ? 26.491  24.312  -31.959 1.00 32.79  ? 11   DC  T "C4'" 1 
ATOM   8296 O  "O4'" . DC  C 3 11   ? 26.504  24.011  -30.546 1.00 34.97  ? 11   DC  T "O4'" 1 
ATOM   8297 C  "C3'" . DC  C 3 11   ? 25.019  24.438  -32.352 1.00 34.02  ? 11   DC  T "C3'" 1 
ATOM   8298 O  "O3'" . DC  C 3 11   ? 24.636  23.204  -32.964 1.00 36.20  ? 11   DC  T "O3'" 1 
ATOM   8299 C  "C2'" . DC  C 3 11   ? 24.288  24.686  -31.028 1.00 34.27  ? 11   DC  T "C2'" 1 
ATOM   8300 C  "C1'" . DC  C 3 11   ? 25.198  23.992  -30.012 1.00 34.20  ? 11   DC  T "C1'" 1 
ATOM   8301 N  N1    . DC  C 3 11   ? 25.212  24.670  -28.695 1.00 35.31  ? 11   DC  T N1    1 
ATOM   8302 C  C2    . DC  C 3 11   ? 25.138  23.897  -27.528 1.00 36.66  ? 11   DC  T C2    1 
ATOM   8303 O  O2    . DC  C 3 11   ? 25.093  22.673  -27.655 1.00 37.43  ? 11   DC  T O2    1 
ATOM   8304 N  N3    . DC  C 3 11   ? 25.119  24.508  -26.310 1.00 35.45  ? 11   DC  T N3    1 
ATOM   8305 C  C4    . DC  C 3 11   ? 25.169  25.846  -26.247 1.00 35.80  ? 11   DC  T C4    1 
ATOM   8306 N  N4    . DC  C 3 11   ? 25.171  26.421  -25.033 1.00 34.38  ? 11   DC  T N4    1 
ATOM   8307 C  C5    . DC  C 3 11   ? 25.234  26.658  -27.428 1.00 33.80  ? 11   DC  T C5    1 
ATOM   8308 C  C6    . DC  C 3 11   ? 25.250  26.036  -28.612 1.00 34.69  ? 11   DC  T C6    1 
ATOM   8309 P  P     . DC  C 3 12   ? 23.150  22.823  -33.470 1.00 36.22  ? 12   DC  T P     1 
ATOM   8310 O  OP1   . DC  C 3 12   ? 23.274  21.869  -34.585 1.00 35.64  ? 12   DC  T OP1   1 
ATOM   8311 O  OP2   . DC  C 3 12   ? 22.313  24.039  -33.579 1.00 36.86  ? 12   DC  T OP2   1 
ATOM   8312 O  "O5'" . DC  C 3 12   ? 22.588  21.978  -32.247 1.00 38.58  ? 12   DC  T "O5'" 1 
ATOM   8313 C  "C5'" . DC  C 3 12   ? 23.068  20.655  -32.099 1.00 41.29  ? 12   DC  T "C5'" 1 
ATOM   8314 C  "C4'" . DC  C 3 12   ? 22.395  19.977  -30.922 1.00 43.63  ? 12   DC  T "C4'" 1 
ATOM   8315 O  "O4'" . DC  C 3 12   ? 22.624  20.714  -29.683 1.00 42.76  ? 12   DC  T "O4'" 1 
ATOM   8316 C  "C3'" . DC  C 3 12   ? 20.885  19.830  -31.079 1.00 44.57  ? 12   DC  T "C3'" 1 
ATOM   8317 O  "O3'" . DC  C 3 12   ? 20.585  18.540  -30.594 1.00 46.00  ? 12   DC  T "O3'" 1 
ATOM   8318 C  "C2'" . DC  C 3 12   ? 20.327  20.928  -30.171 1.00 44.15  ? 12   DC  T "C2'" 1 
ATOM   8319 C  "C1'" . DC  C 3 12   ? 21.383  20.955  -29.061 1.00 44.40  ? 12   DC  T "C1'" 1 
ATOM   8320 N  N1    . DC  C 3 12   ? 21.457  22.231  -28.279 1.00 46.67  ? 12   DC  T N1    1 
ATOM   8321 C  C2    . DC  C 3 12   ? 21.396  22.155  -26.869 1.00 48.61  ? 12   DC  T C2    1 
ATOM   8322 O  O2    . DC  C 3 12   ? 21.315  21.036  -26.323 1.00 48.38  ? 12   DC  T O2    1 
ATOM   8323 N  N3    . DC  C 3 12   ? 21.440  23.306  -26.131 1.00 48.12  ? 12   DC  T N3    1 
ATOM   8324 C  C4    . DC  C 3 12   ? 21.540  24.494  -26.743 1.00 47.90  ? 12   DC  T C4    1 
ATOM   8325 N  N4    . DC  C 3 12   ? 21.601  25.590  -25.968 1.00 47.51  ? 12   DC  T N4    1 
ATOM   8326 C  C5    . DC  C 3 12   ? 21.591  24.593  -28.171 1.00 46.65  ? 12   DC  T C5    1 
ATOM   8327 C  C6    . DC  C 3 12   ? 21.551  23.458  -28.895 1.00 46.74  ? 12   DC  T C6    1 
ATOM   8328 P  P     . DC  C 3 13   ? 19.252  17.728  -30.957 1.00 46.85  ? 13   DC  T P     1 
ATOM   8329 O  OP1   . DC  C 3 13   ? 19.749  16.340  -31.098 1.00 46.45  ? 13   DC  T OP1   1 
ATOM   8330 O  OP2   . DC  C 3 13   ? 18.465  18.409  -32.004 1.00 45.44  ? 13   DC  T OP2   1 
ATOM   8331 O  "O5'" . DC  C 3 13   ? 18.380  17.827  -29.625 1.00 48.43  ? 13   DC  T "O5'" 1 
ATOM   8332 C  "C5'" . DC  C 3 13   ? 18.940  17.341  -28.426 1.00 51.06  ? 13   DC  T "C5'" 1 
ATOM   8333 C  "C4'" . DC  C 3 13   ? 18.058  17.828  -27.309 1.00 53.75  ? 13   DC  T "C4'" 1 
ATOM   8334 O  "O4'" . DC  C 3 13   ? 18.367  19.217  -27.019 1.00 54.23  ? 13   DC  T "O4'" 1 
ATOM   8335 C  "C3'" . DC  C 3 13   ? 16.571  17.800  -27.663 1.00 54.68  ? 13   DC  T "C3'" 1 
ATOM   8336 O  "O3'" . DC  C 3 13   ? 15.884  17.280  -26.532 1.00 56.12  ? 13   DC  T "O3'" 1 
ATOM   8337 C  "C2'" . DC  C 3 13   ? 16.219  19.267  -27.921 1.00 54.33  ? 13   DC  T "C2'" 1 
ATOM   8338 C  "C1'" . DC  C 3 13   ? 17.130  19.891  -26.869 1.00 55.03  ? 13   DC  T "C1'" 1 
ATOM   8339 N  N1    . DC  C 3 13   ? 17.356  21.379  -26.922 1.00 54.65  ? 13   DC  T N1    1 
ATOM   8340 C  C2    . DC  C 3 13   ? 17.544  22.115  -25.681 1.00 54.90  ? 13   DC  T C2    1 
ATOM   8341 O  O2    . DC  C 3 13   ? 17.605  21.547  -24.563 1.00 55.72  ? 13   DC  T O2    1 
ATOM   8342 N  N3    . DC  C 3 13   ? 17.802  23.472  -25.745 1.00 55.15  ? 13   DC  T N3    1 
ATOM   8343 C  C4    . DC  C 3 13   ? 17.722  24.053  -26.974 1.00 54.66  ? 13   DC  T C4    1 
ATOM   8344 N  N4    . DC  C 3 13   ? 17.967  25.375  -27.017 1.00 54.34  ? 13   DC  T N4    1 
ATOM   8345 C  C5    . DC  C 3 13   ? 17.539  23.318  -28.232 1.00 54.40  ? 13   DC  T C5    1 
ATOM   8346 C  C6    . DC  C 3 13   ? 17.358  21.978  -28.181 1.00 54.11  ? 13   DC  T C6    1 
ATOM   8347 P  P     . DG  C 3 14   ? 14.536  16.424  -26.685 1.00 55.62  ? 14   DG  T P     1 
ATOM   8348 O  OP1   . DG  C 3 14   ? 14.961  15.022  -26.860 1.00 54.91  ? 14   DG  T OP1   1 
ATOM   8349 O  OP2   . DG  C 3 14   ? 13.604  17.106  -27.628 1.00 53.38  ? 14   DG  T OP2   1 
ATOM   8350 O  "O5'" . DG  C 3 14   ? 13.939  16.570  -25.211 1.00 55.65  ? 14   DG  T "O5'" 1 
ATOM   8351 C  "C5'" . DG  C 3 14   ? 14.840  16.540  -24.117 1.00 55.67  ? 14   DG  T "C5'" 1 
ATOM   8352 C  "C4'" . DG  C 3 14   ? 14.239  17.293  -22.942 1.00 56.05  ? 14   DG  T "C4'" 1 
ATOM   8353 O  "O4'" . DG  C 3 14   ? 14.544  18.715  -23.006 1.00 55.23  ? 14   DG  T "O4'" 1 
ATOM   8354 C  "C3'" . DG  C 3 14   ? 12.723  17.217  -22.853 1.00 55.90  ? 14   DG  T "C3'" 1 
ATOM   8355 O  "O3'" . DG  C 3 14   ? 12.445  17.233  -21.470 1.00 57.26  ? 14   DG  T "O3'" 1 
ATOM   8356 C  "C2'" . DG  C 3 14   ? 12.276  18.482  -23.588 1.00 55.18  ? 14   DG  T "C2'" 1 
ATOM   8357 C  "C1'" . DG  C 3 14   ? 13.353  19.474  -23.165 1.00 54.32  ? 14   DG  T "C1'" 1 
ATOM   8358 N  N9    . DG  C 3 14   ? 13.657  20.568  -24.101 1.00 53.59  ? 14   DG  T N9    1 
ATOM   8359 C  C8    . DG  C 3 14   ? 13.774  20.449  -25.472 1.00 53.40  ? 14   DG  T C8    1 
ATOM   8360 N  N7    . DG  C 3 14   ? 14.096  21.564  -26.072 1.00 53.00  ? 14   DG  T N7    1 
ATOM   8361 C  C5    . DG  C 3 14   ? 14.166  22.512  -25.033 1.00 52.91  ? 14   DG  T C5    1 
ATOM   8362 C  C6    . DG  C 3 14   ? 14.462  23.911  -25.062 1.00 52.38  ? 14   DG  T C6    1 
ATOM   8363 O  O6    . DG  C 3 14   ? 14.724  24.618  -26.045 1.00 51.32  ? 14   DG  T O6    1 
ATOM   8364 N  N1    . DG  C 3 14   ? 14.495  24.486  -23.786 1.00 52.98  ? 14   DG  T N1    1 
ATOM   8365 C  C2    . DG  C 3 14   ? 14.237  23.813  -22.615 1.00 53.75  ? 14   DG  T C2    1 
ATOM   8366 N  N2    . DG  C 3 14   ? 14.332  24.510  -21.464 1.00 54.12  ? 14   DG  T N2    1 
ATOM   8367 N  N3    . DG  C 3 14   ? 13.916  22.521  -22.571 1.00 53.73  ? 14   DG  T N3    1 
ATOM   8368 C  C4    . DG  C 3 14   ? 13.912  21.918  -23.809 1.00 53.67  ? 14   DG  T C4    1 
ATOM   8369 P  P     . DT  C 3 15   ? 10.972  17.290  -20.834 1.00 59.67  ? 15   DT  T P     1 
ATOM   8370 O  OP1   . DT  C 3 15   ? 11.151  16.656  -19.508 1.00 59.16  ? 15   DT  T OP1   1 
ATOM   8371 O  OP2   . DT  C 3 15   ? 9.938   16.793  -21.781 1.00 58.66  ? 15   DT  T OP2   1 
ATOM   8372 O  "O5'" . DT  C 3 15   ? 10.727  18.863  -20.636 1.00 59.77  ? 15   DT  T "O5'" 1 
ATOM   8373 C  "C5'" . DT  C 3 15   ? 11.593  19.575  -19.745 1.00 60.99  ? 15   DT  T "C5'" 1 
ATOM   8374 C  "C4'" . DT  C 3 15   ? 10.977  20.879  -19.288 1.00 61.30  ? 15   DT  T "C4'" 1 
ATOM   8375 O  "O4'" . DT  C 3 15   ? 11.403  21.976  -20.148 1.00 60.93  ? 15   DT  T "O4'" 1 
ATOM   8376 C  "C3'" . DT  C 3 15   ? 9.448   20.867  -19.269 1.00 62.14  ? 15   DT  T "C3'" 1 
ATOM   8377 O  "O3'" . DT  C 3 15   ? 9.069   21.327  -17.942 1.00 63.07  ? 15   DT  T "O3'" 1 
ATOM   8378 C  "C2'" . DT  C 3 15   ? 9.132   21.717  -20.511 1.00 62.00  ? 15   DT  T "C2'" 1 
ATOM   8379 C  "C1'" . DT  C 3 15   ? 10.274  22.720  -20.556 1.00 61.34  ? 15   DT  T "C1'" 1 
ATOM   8380 N  N1    . DT  C 3 15   ? 10.424  23.130  -21.963 1.00 61.33  ? 15   DT  T N1    1 
ATOM   8381 C  C2    . DT  C 3 15   ? 10.720  24.451  -22.373 1.00 61.18  ? 15   DT  T C2    1 
ATOM   8382 O  O2    . DT  C 3 15   ? 10.878  25.393  -21.614 1.00 61.58  ? 15   DT  T O2    1 
ATOM   8383 N  N3    . DT  C 3 15   ? 10.796  24.607  -23.737 1.00 60.57  ? 15   DT  T N3    1 
ATOM   8384 C  C4    . DT  C 3 15   ? 10.630  23.629  -24.713 1.00 60.63  ? 15   DT  T C4    1 
ATOM   8385 O  O4    . DT  C 3 15   ? 10.729  23.901  -25.908 1.00 60.12  ? 15   DT  T O4    1 
ATOM   8386 C  C5    . DT  C 3 15   ? 10.358  22.274  -24.208 1.00 61.09  ? 15   DT  T C5    1 
ATOM   8387 C  C7    . DT  C 3 15   ? 10.201  21.077  -25.129 1.00 61.03  ? 15   DT  T C7    1 
ATOM   8388 C  C6    . DT  C 3 15   ? 10.262  22.098  -22.872 1.00 61.34  ? 15   DT  T C6    1 
ATOM   8389 P  P     . DC  C 3 16   ? 7.649   21.827  -17.386 1.00 63.72  ? 16   DC  T P     1 
ATOM   8390 O  OP1   . DC  C 3 16   ? 7.124   20.827  -16.430 1.00 63.21  ? 16   DC  T OP1   1 
ATOM   8391 O  OP2   . DC  C 3 16   ? 6.780   22.289  -18.496 1.00 64.32  ? 16   DC  T OP2   1 
ATOM   8392 O  "O5'" . DC  C 3 16   ? 8.149   23.108  -16.565 1.00 63.43  ? 16   DC  T "O5'" 1 
ATOM   8393 C  "C5'" . DC  C 3 16   ? 9.018   24.053  -17.191 1.00 63.68  ? 16   DC  T "C5'" 1 
ATOM   8394 C  "C4'" . DC  C 3 16   ? 8.295   25.280  -17.751 1.00 63.77  ? 16   DC  T "C4'" 1 
ATOM   8395 O  "O4'" . DC  C 3 16   ? 8.457   25.401  -19.190 1.00 63.57  ? 16   DC  T "O4'" 1 
ATOM   8396 C  "C3'" . DC  C 3 16   ? 6.794   25.436  -17.488 1.00 64.00  ? 16   DC  T "C3'" 1 
ATOM   8397 O  "O3'" . DC  C 3 16   ? 6.735   26.656  -16.709 1.00 64.69  ? 16   DC  T "O3'" 1 
ATOM   8398 C  "C2'" . DC  C 3 16   ? 6.152   25.434  -18.894 1.00 63.09  ? 16   DC  T "C2'" 1 
ATOM   8399 C  "C1'" . DC  C 3 16   ? 7.284   25.964  -19.763 1.00 62.84  ? 16   DC  T "C1'" 1 
ATOM   8400 N  N1    . DC  C 3 16   ? 7.286   25.556  -21.223 1.00 62.10  ? 16   DC  T N1    1 
ATOM   8401 C  C2    . DC  C 3 16   ? 7.664   26.495  -22.261 1.00 62.08  ? 16   DC  T C2    1 
ATOM   8402 O  O2    . DC  C 3 16   ? 7.987   27.692  -22.020 1.00 62.39  ? 16   DC  T O2    1 
ATOM   8403 N  N3    . DC  C 3 16   ? 7.728   26.053  -23.550 1.00 61.46  ? 16   DC  T N3    1 
ATOM   8404 C  C4    . DC  C 3 16   ? 7.359   24.764  -23.817 1.00 61.07  ? 16   DC  T C4    1 
ATOM   8405 N  N4    . DC  C 3 16   ? 7.439   24.378  -25.096 1.00 60.49  ? 16   DC  T N4    1 
ATOM   8406 C  C5    . DC  C 3 16   ? 7.045   23.784  -22.776 1.00 61.19  ? 16   DC  T C5    1 
ATOM   8407 C  C6    . DC  C 3 16   ? 6.996   24.228  -21.508 1.00 61.79  ? 16   DC  T C6    1 
ATOM   8408 P  P     . DT  C 3 17   ? 5.479   27.635  -16.496 1.00 65.65  ? 17   DT  T P     1 
ATOM   8409 O  OP1   . DT  C 3 17   ? 5.799   28.535  -15.362 1.00 64.66  ? 17   DT  T OP1   1 
ATOM   8410 O  OP2   . DT  C 3 17   ? 4.208   26.866  -16.485 1.00 64.88  ? 17   DT  T OP2   1 
ATOM   8411 O  "O5'" . DT  C 3 17   ? 5.541   28.474  -17.864 1.00 65.92  ? 17   DT  T "O5'" 1 
ATOM   8412 C  "C5'" . DT  C 3 17   ? 4.574   29.487  -18.005 1.00 65.80  ? 17   DT  T "C5'" 1 
ATOM   8413 C  "C4'" . DT  C 3 17   ? 4.566   30.148  -19.371 1.00 65.36  ? 17   DT  T "C4'" 1 
ATOM   8414 O  "O4'" . DT  C 3 17   ? 5.039   29.273  -20.435 1.00 64.27  ? 17   DT  T "O4'" 1 
ATOM   8415 C  "C3'" . DT  C 3 17   ? 3.148   30.570  -19.744 1.00 65.71  ? 17   DT  T "C3'" 1 
ATOM   8416 O  "O3'" . DT  C 3 17   ? 3.132   31.989  -20.028 1.00 67.70  ? 17   DT  T "O3'" 1 
ATOM   8417 C  "C2'" . DT  C 3 17   ? 2.816   29.644  -20.924 1.00 64.72  ? 17   DT  T "C2'" 1 
ATOM   8418 C  "C1'" . DT  C 3 17   ? 4.184   29.474  -21.563 1.00 63.43  ? 17   DT  T "C1'" 1 
ATOM   8419 N  N1    . DT  C 3 17   ? 4.245   28.363  -22.553 1.00 61.53  ? 17   DT  T N1    1 
ATOM   8420 C  C2    . DT  C 3 17   ? 4.648   28.668  -23.844 1.00 60.94  ? 17   DT  T C2    1 
ATOM   8421 O  O2    . DT  C 3 17   ? 4.929   29.801  -24.196 1.00 60.26  ? 17   DT  T O2    1 
ATOM   8422 N  N3    . DT  C 3 17   ? 4.734   27.596  -24.700 1.00 60.83  ? 17   DT  T N3    1 
ATOM   8423 C  C4    . DT  C 3 17   ? 4.383   26.278  -24.382 1.00 60.33  ? 17   DT  T C4    1 
ATOM   8424 O  O4    . DT  C 3 17   ? 4.483   25.396  -25.230 1.00 59.62  ? 17   DT  T O4    1 
ATOM   8425 C  C5    . DT  C 3 17   ? 3.954   26.037  -23.013 1.00 60.58  ? 17   DT  T C5    1 
ATOM   8426 C  C7    . DT  C 3 17   ? 3.625   24.653  -22.476 1.00 60.08  ? 17   DT  T C7    1 
ATOM   8427 C  C6    . DT  C 3 17   ? 3.925   27.076  -22.164 1.00 60.75  ? 17   DT  T C6    1 
ATOM   8428 P  P     . DC  C 3 18   ? 1.793   32.889  -20.064 1.00 67.73  ? 18   DC  T P     1 
ATOM   8429 O  OP1   . DC  C 3 18   ? 1.535   33.309  -18.668 1.00 66.36  ? 18   DC  T OP1   1 
ATOM   8430 O  OP2   . DC  C 3 18   ? 0.731   32.168  -20.816 1.00 67.15  ? 18   DC  T OP2   1 
ATOM   8431 O  "O5'" . DC  C 3 18   ? 2.227   34.168  -20.959 1.00 68.70  ? 18   DC  T "O5'" 1 
ATOM   8432 C  "C5'" . DC  C 3 18   ? 2.867   34.074  -22.275 1.00 69.36  ? 18   DC  T "C5'" 1 
ATOM   8433 C  "C4'" . DC  C 3 18   ? 1.955   34.113  -23.518 1.00 70.05  ? 18   DC  T "C4'" 1 
ATOM   8434 O  "O4'" . DC  C 3 18   ? 2.205   32.917  -24.330 1.00 70.05  ? 18   DC  T "O4'" 1 
ATOM   8435 C  "C3'" . DC  C 3 18   ? 0.424   34.230  -23.338 1.00 70.02  ? 18   DC  T "C3'" 1 
ATOM   8436 O  "O3'" . DC  C 3 18   ? -0.155  35.331  -24.064 1.00 69.75  ? 18   DC  T "O3'" 1 
ATOM   8437 C  "C2'" . DC  C 3 18   ? -0.133  32.900  -23.846 1.00 69.80  ? 18   DC  T "C2'" 1 
ATOM   8438 C  "C1'" . DC  C 3 18   ? 0.971   32.352  -24.763 1.00 69.80  ? 18   DC  T "C1'" 1 
ATOM   8439 N  N1    . DC  C 3 18   ? 1.046   30.832  -24.765 1.00 69.27  ? 18   DC  T N1    1 
ATOM   8440 C  C2    . DC  C 3 18   ? 1.725   30.126  -25.795 1.00 69.07  ? 18   DC  T C2    1 
ATOM   8441 O  O2    . DC  C 3 18   ? 2.280   30.763  -26.708 1.00 69.35  ? 18   DC  T O2    1 
ATOM   8442 N  N3    . DC  C 3 18   ? 1.765   28.755  -25.757 1.00 68.54  ? 18   DC  T N3    1 
ATOM   8443 C  C4    . DC  C 3 18   ? 1.152   28.103  -24.749 1.00 68.14  ? 18   DC  T C4    1 
ATOM   8444 N  N4    . DC  C 3 18   ? 1.205   26.766  -24.710 1.00 67.50  ? 18   DC  T N4    1 
ATOM   8445 C  C5    . DC  C 3 18   ? 0.459   28.805  -23.691 1.00 68.15  ? 18   DC  T C5    1 
ATOM   8446 C  C6    . DC  C 3 18   ? 0.426   30.147  -23.734 1.00 68.81  ? 18   DC  T C6    1 
HETATM 8447 P  P     . PO4 D 4 .    ? 32.409  50.180  -34.447 1.00 94.13  ? 1    PO4 A P     1 
HETATM 8448 O  O1    . PO4 D 4 .    ? 32.266  48.681  -34.227 1.00 92.80  ? 1    PO4 A O1    1 
HETATM 8449 O  O2    . PO4 D 4 .    ? 31.128  50.788  -34.969 1.00 93.50  ? 1    PO4 A O2    1 
HETATM 8450 O  O3    . PO4 D 4 .    ? 32.749  50.827  -33.125 1.00 94.06  ? 1    PO4 A O3    1 
HETATM 8451 O  O4    . PO4 D 4 .    ? 33.508  50.483  -35.444 1.00 94.17  ? 1    PO4 A O4    1 
HETATM 8452 P  P     . PO4 E 4 .    ? 15.513  -0.006  -33.532 1.00 123.67 ? 2    PO4 A P     1 
HETATM 8453 O  O1    . PO4 E 4 .    ? 16.824  -0.644  -33.130 1.00 123.49 ? 2    PO4 A O1    1 
HETATM 8454 O  O2    . PO4 E 4 .    ? 15.726  0.896   -34.725 1.00 123.36 ? 2    PO4 A O2    1 
HETATM 8455 O  O3    . PO4 E 4 .    ? 14.536  -1.107  -33.884 1.00 123.61 ? 2    PO4 A O3    1 
HETATM 8456 O  O4    . PO4 E 4 .    ? 14.959  0.827   -32.399 1.00 123.39 ? 2    PO4 A O4    1 
HETATM 8457 P  P     . PO4 F 4 .    ? 36.042  27.759  -60.032 1.00 97.33  ? 3    PO4 A P     1 
HETATM 8458 O  O1    . PO4 F 4 .    ? 36.968  28.474  -59.077 1.00 97.13  ? 3    PO4 A O1    1 
HETATM 8459 O  O2    . PO4 F 4 .    ? 34.644  27.832  -59.455 1.00 97.69  ? 3    PO4 A O2    1 
HETATM 8460 O  O3    . PO4 F 4 .    ? 36.086  28.445  -61.377 1.00 97.43  ? 3    PO4 A O3    1 
HETATM 8461 O  O4    . PO4 F 4 .    ? 36.462  26.317  -60.226 1.00 97.41  ? 3    PO4 A O4    1 
HETATM 8462 ZN ZN    . ZN  G 5 .    ? 65.277  60.250  -13.246 1.00 73.81  ? 4    ZN  A ZN    1 
HETATM 8463 MG MG    . MG  H 6 .    ? 49.145  31.185  -27.740 1.00 24.18  ? 5    MG  A MG    1 
HETATM 8464 MG MG    . MG  I 6 .    ? 24.649  6.398   -50.343 1.00 61.12  ? 6    MG  A MG    1 
HETATM 8465 MG MG    . MG  J 6 .    ? 27.383  5.156   -48.998 1.00 49.82  ? 7    MG  A MG    1 
HETATM 8466 P  PG    . DGT K 7 .    ? 51.730  29.005  -28.212 1.00 25.72  ? 1456 DGT A PG    1 
HETATM 8467 O  O1G   . DGT K 7 .    ? 51.866  27.683  -28.881 1.00 24.57  ? 1456 DGT A O1G   1 
HETATM 8468 O  O2G   . DGT K 7 .    ? 50.519  29.785  -28.681 1.00 23.44  ? 1456 DGT A O2G   1 
HETATM 8469 O  O3G   . DGT K 7 .    ? 52.994  29.851  -28.206 1.00 26.84  ? 1456 DGT A O3G   1 
HETATM 8470 O  O3B   . DGT K 7 .    ? 51.542  28.695  -26.632 1.00 27.03  ? 1456 DGT A O3B   1 
HETATM 8471 P  PB    . DGT K 7 .    ? 50.384  29.356  -25.701 1.00 24.48  ? 1456 DGT A PB    1 
HETATM 8472 O  O1B   . DGT K 7 .    ? 50.095  30.784  -26.066 1.00 23.31  ? 1456 DGT A O1B   1 
HETATM 8473 O  O2B   . DGT K 7 .    ? 50.603  28.983  -24.270 1.00 26.71  ? 1456 DGT A O2B   1 
HETATM 8474 O  O3A   . DGT K 7 .    ? 49.123  28.473  -26.177 1.00 26.49  ? 1456 DGT A O3A   1 
HETATM 8475 P  PA    . DGT K 7 .    ? 47.675  28.974  -26.677 1.00 27.32  ? 1456 DGT A PA    1 
HETATM 8476 O  O1A   . DGT K 7 .    ? 46.839  27.734  -26.785 1.00 28.28  ? 1456 DGT A O1A   1 
HETATM 8477 O  O2A   . DGT K 7 .    ? 47.709  30.003  -27.768 1.00 30.39  ? 1456 DGT A O2A   1 
HETATM 8478 O  "O5'" . DGT K 7 .    ? 47.033  29.902  -25.546 1.00 30.12  ? 1456 DGT A "O5'" 1 
HETATM 8479 C  "C5'" . DGT K 7 .    ? 46.842  29.296  -24.327 1.00 30.84  ? 1456 DGT A "C5'" 1 
HETATM 8480 C  "C4'" . DGT K 7 .    ? 47.021  30.393  -23.338 1.00 29.34  ? 1456 DGT A "C4'" 1 
HETATM 8481 O  "O4'" . DGT K 7 .    ? 45.754  30.368  -22.694 1.00 28.52  ? 1456 DGT A "O4'" 1 
HETATM 8482 C  "C3'" . DGT K 7 .    ? 48.040  29.745  -22.405 1.00 30.35  ? 1456 DGT A "C3'" 1 
HETATM 8483 O  "O3'" . DGT K 7 .    ? 49.269  30.473  -22.332 1.00 28.85  ? 1456 DGT A "O3'" 1 
HETATM 8484 C  "C2'" . DGT K 7 .    ? 47.294  29.598  -21.097 1.00 28.29  ? 1456 DGT A "C2'" 1 
HETATM 8485 C  "C1'" . DGT K 7 .    ? 45.819  29.613  -21.499 1.00 28.59  ? 1456 DGT A "C1'" 1 
HETATM 8486 N  N9    . DGT K 7 .    ? 45.576  28.163  -21.652 1.00 29.76  ? 1456 DGT A N9    1 
HETATM 8487 C  C8    . DGT K 7 .    ? 45.749  27.402  -22.752 1.00 29.01  ? 1456 DGT A C8    1 
HETATM 8488 N  N7    . DGT K 7 .    ? 45.476  26.102  -22.442 1.00 29.81  ? 1456 DGT A N7    1 
HETATM 8489 C  C5    . DGT K 7 .    ? 45.147  26.020  -21.143 1.00 27.41  ? 1456 DGT A C5    1 
HETATM 8490 C  C6    . DGT K 7 .    ? 44.792  24.950  -20.196 1.00 28.21  ? 1456 DGT A C6    1 
HETATM 8491 O  O6    . DGT K 7 .    ? 44.709  23.755  -20.576 1.00 30.18  ? 1456 DGT A O6    1 
HETATM 8492 N  N1    . DGT K 7 .    ? 44.538  25.296  -18.935 1.00 26.89  ? 1456 DGT A N1    1 
HETATM 8493 C  C2    . DGT K 7 .    ? 44.597  26.579  -18.511 1.00 27.75  ? 1456 DGT A C2    1 
HETATM 8494 N  N2    . DGT K 7 .    ? 44.344  26.884  -17.195 1.00 25.38  ? 1456 DGT A N2    1 
HETATM 8495 N  N3    . DGT K 7 .    ? 44.944  27.592  -19.345 1.00 27.26  ? 1456 DGT A N3    1 
HETATM 8496 C  C4    . DGT K 7 .    ? 45.226  27.376  -20.630 1.00 27.60  ? 1456 DGT A C4    1 
HETATM 8497 O  O     . HOH L 8 .    ? 48.017  21.732  -10.617 1.00 30.14  ? 8    HOH A O     1 
HETATM 8498 O  O     . HOH L 8 .    ? 55.338  15.647  -19.679 1.00 26.92  ? 9    HOH A O     1 
HETATM 8499 O  O     . HOH L 8 .    ? 45.211  21.698  -22.540 1.00 37.75  ? 10   HOH A O     1 
HETATM 8500 O  O     . HOH L 8 .    ? 49.391  26.310  -23.610 1.00 28.34  ? 11   HOH A O     1 
HETATM 8501 O  O     . HOH L 8 .    ? 44.591  30.146  -18.294 1.00 24.29  ? 12   HOH A O     1 
HETATM 8502 O  O     . HOH L 8 .    ? 46.745  32.594  -11.855 1.00 28.47  ? 13   HOH A O     1 
HETATM 8503 O  O     . HOH L 8 .    ? 45.016  34.638  -11.557 1.00 24.47  ? 14   HOH A O     1 
HETATM 8504 O  O     . HOH L 8 .    ? 50.642  25.764  -15.574 1.00 16.02  ? 15   HOH A O     1 
HETATM 8505 O  O     . HOH L 8 .    ? 32.619  -23.506 -21.525 1.00 54.19  ? 16   HOH A O     1 
HETATM 8506 O  O     . HOH L 8 .    ? 50.188  -13.464 -4.411  1.00 33.25  ? 17   HOH A O     1 
HETATM 8507 O  O     . HOH L 8 .    ? 47.655  -17.171 -9.048  1.00 35.30  ? 18   HOH A O     1 
HETATM 8508 O  O     . HOH L 8 .    ? 40.771  -1.480  -49.822 1.00 36.65  ? 19   HOH A O     1 
HETATM 8509 O  O     . HOH L 8 .    ? 34.517  6.400   -33.807 1.00 39.39  ? 20   HOH A O     1 
HETATM 8510 O  O     . HOH L 8 .    ? 33.403  3.545   -40.062 1.00 34.46  ? 21   HOH A O     1 
HETATM 8511 O  O     . HOH L 8 .    ? 47.609  3.258   -36.339 1.00 48.21  ? 22   HOH A O     1 
HETATM 8512 O  O     . HOH L 8 .    ? 42.797  10.707  -53.805 1.00 36.58  ? 23   HOH A O     1 
HETATM 8513 O  O     . HOH L 8 .    ? 47.187  22.720  -45.347 1.00 35.34  ? 24   HOH A O     1 
HETATM 8514 O  O     . HOH L 8 .    ? 53.413  23.016  -48.818 1.00 51.92  ? 25   HOH A O     1 
HETATM 8515 O  O     . HOH L 8 .    ? 58.514  46.773  -44.846 1.00 37.08  ? 26   HOH A O     1 
HETATM 8516 O  O     . HOH L 8 .    ? 56.259  32.997  -21.385 1.00 31.96  ? 27   HOH A O     1 
HETATM 8517 O  O     . HOH L 8 .    ? 38.309  44.362  -24.545 1.00 32.73  ? 28   HOH A O     1 
HETATM 8518 O  O     . HOH L 8 .    ? 32.918  23.817  -30.252 1.00 21.75  ? 29   HOH A O     1 
HETATM 8519 O  O     . HOH L 8 .    ? 26.248  3.287   -16.551 1.00 53.83  ? 30   HOH A O     1 
HETATM 8520 O  O     . HOH L 8 .    ? 43.203  35.289  -51.112 1.00 39.44  ? 31   HOH A O     1 
HETATM 8521 O  O     . HOH L 8 .    ? 44.533  33.065  -54.949 1.00 41.30  ? 32   HOH A O     1 
HETATM 8522 O  O     . HOH L 8 .    ? 29.809  20.084  -42.128 1.00 37.58  ? 33   HOH A O     1 
HETATM 8523 O  O     . HOH L 8 .    ? 39.147  18.584  -39.259 1.00 42.06  ? 34   HOH A O     1 
HETATM 8524 O  O     . HOH L 8 .    ? 55.092  31.300  -1.718  1.00 37.17  ? 37   HOH A O     1 
HETATM 8525 O  O     . HOH L 8 .    ? 63.778  29.156  -1.968  1.00 57.58  ? 38   HOH A O     1 
HETATM 8526 O  O     . HOH L 8 .    ? 57.997  10.309  -7.704  1.00 46.38  ? 40   HOH A O     1 
HETATM 8527 O  O     . HOH L 8 .    ? 50.371  23.099  -23.674 1.00 21.51  ? 41   HOH A O     1 
HETATM 8528 O  O     . HOH L 8 .    ? 33.204  49.978  -1.452  1.00 36.77  ? 42   HOH A O     1 
HETATM 8529 O  O     . HOH L 8 .    ? 19.646  46.063  -10.063 1.00 31.20  ? 43   HOH A O     1 
HETATM 8530 O  O     . HOH L 8 .    ? 22.032  38.675  -12.783 1.00 29.06  ? 44   HOH A O     1 
HETATM 8531 O  O     . HOH L 8 .    ? 13.107  40.135  -3.911  1.00 43.52  ? 46   HOH A O     1 
HETATM 8532 O  O     . HOH L 8 .    ? 3.424   42.163  -3.913  1.00 35.31  ? 49   HOH A O     1 
HETATM 8533 O  O     . HOH L 8 .    ? 38.307  34.861  0.923   1.00 33.08  ? 50   HOH A O     1 
HETATM 8534 O  O     . HOH L 8 .    ? 21.358  46.555  -16.234 1.00 30.16  ? 51   HOH A O     1 
HETATM 8535 O  O     . HOH L 8 .    ? 55.385  30.894  -4.261  1.00 35.20  ? 52   HOH A O     1 
HETATM 8536 O  O     . HOH L 8 .    ? 27.033  -6.212  -40.099 1.00 51.78  ? 53   HOH A O     1 
HETATM 8537 O  O     . HOH L 8 .    ? 55.112  32.320  -45.986 1.00 42.98  ? 54   HOH A O     1 
HETATM 8538 O  O     . HOH L 8 .    ? 41.159  32.073  -18.952 1.00 17.25  ? 57   HOH A O     1 
HETATM 8539 O  O     . HOH L 8 .    ? 35.911  12.541  -44.834 1.00 41.01  ? 59   HOH A O     1 
HETATM 8540 O  O     . HOH L 8 .    ? 64.466  38.461  -20.021 1.00 29.80  ? 60   HOH A O     1 
HETATM 8541 O  O     . HOH L 8 .    ? 57.193  39.222  -40.970 1.00 29.60  ? 61   HOH A O     1 
HETATM 8542 O  O     . HOH L 8 .    ? 40.313  13.907  -39.669 1.00 42.96  ? 63   HOH A O     1 
HETATM 8543 O  O     . HOH L 8 .    ? 30.727  40.430  -39.855 1.00 60.55  ? 64   HOH A O     1 
HETATM 8544 O  O     . HOH L 8 .    ? 38.386  34.575  -14.613 1.00 21.28  ? 65   HOH A O     1 
HETATM 8545 O  O     . HOH L 8 .    ? 39.056  24.731  -34.525 1.00 37.14  ? 66   HOH A O     1 
HETATM 8546 O  O     . HOH L 8 .    ? 46.358  -11.046 -27.384 1.00 47.17  ? 67   HOH A O     1 
HETATM 8547 O  O     . HOH L 8 .    ? 51.766  26.788  -31.408 1.00 25.61  ? 68   HOH A O     1 
HETATM 8548 O  O     . HOH L 8 .    ? 40.889  41.560  10.382  1.00 51.27  ? 69   HOH A O     1 
HETATM 8549 O  O     . HOH L 8 .    ? 57.345  13.270  -6.001  1.00 50.15  ? 72   HOH A O     1 
HETATM 8550 O  O     . HOH L 8 .    ? 60.297  13.592  -9.278  1.00 37.39  ? 73   HOH A O     1 
HETATM 8551 O  O     . HOH L 8 .    ? 50.736  38.477  -23.357 1.00 37.97  ? 74   HOH A O     1 
HETATM 8552 O  O     . HOH L 8 .    ? 24.568  38.198  -12.987 1.00 26.74  ? 75   HOH A O     1 
HETATM 8553 O  O     . HOH L 8 .    ? 19.918  31.621  -10.519 1.00 35.75  ? 76   HOH A O     1 
HETATM 8554 O  O     . HOH L 8 .    ? 23.817  3.353   -58.588 1.00 46.27  ? 77   HOH A O     1 
HETATM 8555 O  O     . HOH L 8 .    ? 46.459  42.216  -19.030 1.00 37.27  ? 78   HOH A O     1 
HETATM 8556 O  O     . HOH L 8 .    ? 38.024  49.598  -20.515 1.00 39.90  ? 79   HOH A O     1 
HETATM 8557 O  O     . HOH L 8 .    ? 21.377  35.735  -14.198 1.00 36.35  ? 80   HOH A O     1 
HETATM 8558 O  O     . HOH L 8 .    ? 50.577  36.505  -21.545 1.00 26.29  ? 81   HOH A O     1 
HETATM 8559 O  O     . HOH L 8 .    ? 55.321  43.658  -16.964 1.00 29.37  ? 82   HOH A O     1 
HETATM 8560 O  O     . HOH L 8 .    ? 23.224  -18.100 -58.792 1.00 38.22  ? 83   HOH A O     1 
HETATM 8561 O  O     . HOH L 8 .    ? 49.413  1.197   -51.008 1.00 37.04  ? 84   HOH A O     1 
HETATM 8562 O  O     . HOH L 8 .    ? 70.449  26.284  -30.385 1.00 34.62  ? 85   HOH A O     1 
HETATM 8563 O  O     . HOH L 8 .    ? 49.834  35.078  -26.839 1.00 22.62  ? 86   HOH A O     1 
HETATM 8564 O  O     . HOH L 8 .    ? 39.590  30.645  -20.739 1.00 16.84  ? 87   HOH A O     1 
HETATM 8565 O  O     . HOH L 8 .    ? 41.995  30.348  -17.007 1.00 32.86  ? 88   HOH A O     1 
HETATM 8566 O  O     . HOH L 8 .    ? 41.239  34.440  -15.052 1.00 30.79  ? 89   HOH A O     1 
HETATM 8567 O  O     . HOH L 8 .    ? 36.934  32.812  -26.275 1.00 27.30  ? 90   HOH A O     1 
HETATM 8568 O  O     . HOH L 8 .    ? 24.846  5.942   -45.053 1.00 49.27  ? 91   HOH A O     1 
HETATM 8569 O  O     . HOH L 8 .    ? 24.971  5.220   -48.397 1.00 50.24  ? 92   HOH A O     1 
HETATM 8570 O  O     . HOH L 8 .    ? 52.861  51.262  -29.543 1.00 46.13  ? 93   HOH A O     1 
HETATM 8571 O  O     . HOH L 8 .    ? 55.827  23.798  -29.836 1.00 25.56  ? 97   HOH A O     1 
HETATM 8572 O  O     . HOH L 8 .    ? 48.833  30.814  -35.406 1.00 30.42  ? 98   HOH A O     1 
HETATM 8573 O  O     . HOH L 8 .    ? 48.956  28.323  -30.475 1.00 28.98  ? 99   HOH A O     1 
HETATM 8574 O  O     . HOH L 8 .    ? 29.313  30.387  -10.466 1.00 29.73  ? 101  HOH A O     1 
HETATM 8575 O  O     . HOH L 8 .    ? 50.770  32.726  -28.080 1.00 23.61  ? 1457 HOH A O     1 
HETATM 8576 O  O     . HOH L 8 .    ? 38.096  8.437   -38.086 1.00 46.40  ? 1458 HOH A O     1 
HETATM 8577 O  O     . HOH L 8 .    ? 27.114  25.257  -43.774 1.00 39.08  ? 1459 HOH A O     1 
HETATM 8578 O  O     . HOH L 8 .    ? 48.354  39.131  -25.152 1.00 25.44  ? 1460 HOH A O     1 
HETATM 8579 O  O     . HOH L 8 .    ? 53.765  24.584  -34.307 1.00 31.22  ? 1461 HOH A O     1 
HETATM 8580 O  O     . HOH L 8 .    ? 36.902  20.196  -33.792 1.00 26.03  ? 1462 HOH A O     1 
HETATM 8581 O  O     . HOH M 8 .    ? 17.437  34.609  -14.967 1.00 31.83  ? 45   HOH P O     1 
HETATM 8582 O  O     . HOH M 8 .    ? 23.063  20.314  -12.324 1.00 46.60  ? 48   HOH P O     1 
HETATM 8583 O  O     . HOH M 8 .    ? 38.853  28.569  -25.680 1.00 33.17  ? 94   HOH P O     1 
HETATM 8584 O  O     . HOH M 8 .    ? 31.324  22.295  -28.837 1.00 29.81  ? 95   HOH P O     1 
HETATM 8585 O  O     . HOH N 8 .    ? 37.575  30.765  -24.578 1.00 23.61  ? 35   HOH T O     1 
HETATM 8586 O  O     . HOH N 8 .    ? 36.693  23.635  -16.202 1.00 31.06  ? 36   HOH T O     1 
HETATM 8587 O  O     . HOH N 8 .    ? 46.718  17.156  -10.564 1.00 43.08  ? 39   HOH T O     1 
HETATM 8588 O  O     . HOH N 8 .    ? 37.464  33.713  -12.406 1.00 27.03  ? 58   HOH T O     1 
HETATM 8589 O  O     . HOH N 8 .    ? 38.118  31.728  -8.681  1.00 31.58  ? 70   HOH T O     1 
HETATM 8590 O  O     . HOH N 8 .    ? 25.155  20.750  -35.963 1.00 46.09  ? 96   HOH T O     1 
HETATM 8591 O  O     . HOH N 8 .    ? 32.459  30.912  -18.190 1.00 29.45  ? 100  HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    MET 1    227  ?    ?   ?   A . n 
A 1 2    ARG 2    228  ?    ?   ?   A . n 
A 1 3    ASP 3    229  ?    ?   ?   A . n 
A 1 4    GLU 4    230  ?    ?   ?   A . n 
A 1 5    GLU 5    231  ?    ?   ?   A . n 
A 1 6    PRO 6    232  ?    ?   ?   A . n 
A 1 7    VAL 7    233  233  VAL VAL A . n 
A 1 8    ARG 8    234  234  ARG ARG A . n 
A 1 9    ARG 9    235  235  ARG ARG A . n 
A 1 10   LEU 10   236  236  LEU LEU A . n 
A 1 11   GLU 11   237  237  GLU GLU A . n 
A 1 12   THR 12   238  238  THR THR A . n 
A 1 13   ILE 13   239  239  ILE ILE A . n 
A 1 14   VAL 14   240  240  VAL VAL A . n 
A 1 15   GLU 15   241  241  GLU GLU A . n 
A 1 16   GLU 16   242  242  GLU GLU A . n 
A 1 17   GLU 17   243  243  GLU GLU A . n 
A 1 18   ARG 18   244  244  ARG ARG A . n 
A 1 19   ARG 19   245  245  ARG ARG A . n 
A 1 20   VAL 20   246  246  VAL VAL A . n 
A 1 21   VAL 21   247  247  VAL VAL A . n 
A 1 22   VAL 22   248  248  VAL VAL A . n 
A 1 23   GLN 23   249  249  GLN GLN A . n 
A 1 24   GLY 24   250  250  GLY GLY A . n 
A 1 25   TYR 25   251  251  TYR TYR A . n 
A 1 26   VAL 26   252  252  VAL VAL A . n 
A 1 27   PHE 27   253  253  PHE PHE A . n 
A 1 28   ASP 28   254  254  ASP ASP A . n 
A 1 29   ALA 29   255  255  ALA ALA A . n 
A 1 30   GLU 30   256  256  GLU GLU A . n 
A 1 31   VAL 31   257  257  VAL VAL A . n 
A 1 32   SER 32   258  258  SER SER A . n 
A 1 33   GLU 33   259  259  GLU GLU A . n 
A 1 34   LEU 34   260  260  LEU LEU A . n 
A 1 35   LYS 35   261  261  LYS LYS A . n 
A 1 36   SER 36   262  262  SER SER A . n 
A 1 37   GLY 37   263  263  GLY GLY A . n 
A 1 38   ARG 38   264  264  ARG ARG A . n 
A 1 39   THR 39   265  265  THR THR A . n 
A 1 40   LEU 40   266  266  LEU LEU A . n 
A 1 41   LEU 41   267  267  LEU LEU A . n 
A 1 42   THR 42   268  268  THR THR A . n 
A 1 43   MET 43   269  269  MET MET A . n 
A 1 44   LYS 44   270  270  LYS LYS A . n 
A 1 45   ILE 45   271  271  ILE ILE A . n 
A 1 46   THR 46   272  272  THR THR A . n 
A 1 47   ASP 47   273  273  ASP ASP A . n 
A 1 48   TYR 48   274  274  TYR TYR A . n 
A 1 49   THR 49   275  275  THR THR A . n 
A 1 50   ASN 50   276  276  ASN ASN A . n 
A 1 51   SER 51   277  277  SER SER A . n 
A 1 52   ILE 52   278  278  ILE ILE A . n 
A 1 53   LEU 53   279  279  LEU LEU A . n 
A 1 54   VAL 54   280  280  VAL VAL A . n 
A 1 55   LYS 55   281  281  LYS LYS A . n 
A 1 56   MET 56   282  282  MET MET A . n 
A 1 57   PHE 57   283  283  PHE PHE A . n 
A 1 58   SER 58   284  284  SER SER A . n 
A 1 59   ARG 59   285  285  ARG ARG A . n 
A 1 60   ASP 60   286  286  ASP ASP A . n 
A 1 61   LYS 61   287  287  LYS LYS A . n 
A 1 62   GLU 62   288  288  GLU GLU A . n 
A 1 63   ASP 63   289  289  ASP ASP A . n 
A 1 64   ALA 64   290  290  ALA ALA A . n 
A 1 65   GLU 65   291  291  GLU GLU A . n 
A 1 66   LEU 66   292  292  LEU LEU A . n 
A 1 67   MET 67   293  293  MET MET A . n 
A 1 68   SER 68   294  294  SER SER A . n 
A 1 69   GLY 69   295  295  GLY GLY A . n 
A 1 70   VAL 70   296  296  VAL VAL A . n 
A 1 71   LYS 71   297  297  LYS LYS A . n 
A 1 72   LYS 72   298  298  LYS LYS A . n 
A 1 73   GLY 73   299  299  GLY GLY A . n 
A 1 74   MET 74   300  300  MET MET A . n 
A 1 75   TRP 75   301  301  TRP TRP A . n 
A 1 76   VAL 76   302  302  VAL VAL A . n 
A 1 77   LYS 77   303  303  LYS LYS A . n 
A 1 78   VAL 78   304  304  VAL VAL A . n 
A 1 79   ARG 79   305  305  ARG ARG A . n 
A 1 80   GLY 80   306  306  GLY GLY A . n 
A 1 81   SER 81   307  307  SER SER A . n 
A 1 82   VAL 82   308  308  VAL VAL A . n 
A 1 83   GLN 83   309  309  GLN GLN A . n 
A 1 84   ASN 84   310  310  ASN ASN A . n 
A 1 85   ASP 85   311  311  ASP ASP A . n 
A 1 86   THR 86   312  312  THR THR A . n 
A 1 87   PHE 87   313  313  PHE PHE A . n 
A 1 88   VAL 88   314  314  VAL VAL A . n 
A 1 89   ARG 89   315  315  ARG ARG A . n 
A 1 90   ASP 90   316  316  ASP ASP A . n 
A 1 91   LEU 91   317  317  LEU LEU A . n 
A 1 92   VAL 92   318  318  VAL VAL A . n 
A 1 93   ILE 93   319  319  ILE ILE A . n 
A 1 94   ILE 94   320  320  ILE ILE A . n 
A 1 95   ALA 95   321  321  ALA ALA A . n 
A 1 96   ASN 96   322  322  ASN ASN A . n 
A 1 97   ASP 97   323  323  ASP ASP A . n 
A 1 98   LEU 98   324  324  LEU LEU A . n 
A 1 99   ASN 99   325  325  ASN ASN A . n 
A 1 100  GLU 100  326  326  GLU GLU A . n 
A 1 101  ILE 101  327  327  ILE ILE A . n 
A 1 102  ALA 102  328  328  ALA ALA A . n 
A 1 103  ALA 103  329  329  ALA ALA A . n 
A 1 104  ASN 104  330  330  ASN ASN A . n 
A 1 105  GLU 105  331  331  GLU GLU A . n 
A 1 106  ARG 106  332  332  ARG ARG A . n 
A 1 107  GLN 107  333  333  GLN GLN A . n 
A 1 108  ASP 108  334  334  ASP ASP A . n 
A 1 109  THR 109  335  335  THR THR A . n 
A 1 110  ALA 110  336  336  ALA ALA A . n 
A 1 111  PRO 111  337  337  PRO PRO A . n 
A 1 112  GLU 112  338  338  GLU GLU A . n 
A 1 113  GLY 113  339  339  GLY GLY A . n 
A 1 114  GLU 114  340  340  GLU GLU A . n 
A 1 115  LYS 115  341  341  LYS LYS A . n 
A 1 116  ARG 116  342  342  ARG ARG A . n 
A 1 117  VAL 117  343  343  VAL VAL A . n 
A 1 118  GLU 118  344  344  GLU GLU A . n 
A 1 119  LEU 119  345  345  LEU LEU A . n 
A 1 120  HIS 120  346  346  HIS HIS A . n 
A 1 121  LEU 121  347  347  LEU LEU A . n 
A 1 122  HIS 122  348  348  HIS HIS A . n 
A 1 123  THR 123  349  349  THR THR A . n 
A 1 124  PRO 124  350  350  PRO PRO A . n 
A 1 125  MET 125  351  351  MET MET A . n 
A 1 126  SER 126  352  352  SER SER A . n 
A 1 127  GLN 127  353  353  GLN GLN A . n 
A 1 128  MET 128  354  354  MET MET A . n 
A 1 129  ASP 129  355  355  ASP ASP A . n 
A 1 130  ALA 130  356  356  ALA ALA A . n 
A 1 131  VAL 131  357  357  VAL VAL A . n 
A 1 132  THR 132  358  358  THR THR A . n 
A 1 133  SER 133  359  359  SER SER A . n 
A 1 134  VAL 134  360  360  VAL VAL A . n 
A 1 135  THR 135  361  361  THR THR A . n 
A 1 136  LYS 136  362  362  LYS LYS A . n 
A 1 137  LEU 137  363  363  LEU LEU A . n 
A 1 138  ILE 138  364  364  ILE ILE A . n 
A 1 139  GLU 139  365  365  GLU GLU A . n 
A 1 140  GLN 140  366  366  GLN GLN A . n 
A 1 141  ALA 141  367  367  ALA ALA A . n 
A 1 142  LYS 142  368  368  LYS LYS A . n 
A 1 143  LYS 143  369  369  LYS LYS A . n 
A 1 144  TRP 144  370  370  TRP TRP A . n 
A 1 145  GLY 145  371  371  GLY GLY A . n 
A 1 146  HIS 146  372  372  HIS HIS A . n 
A 1 147  PRO 147  373  373  PRO PRO A . n 
A 1 148  ALA 148  374  374  ALA ALA A . n 
A 1 149  ILE 149  375  375  ILE ILE A . n 
A 1 150  ALA 150  376  376  ALA ALA A . n 
A 1 151  VAL 151  377  377  VAL VAL A . n 
A 1 152  THR 152  378  378  THR THR A . n 
A 1 153  ASP 153  379  379  ASP ASP A . n 
A 1 154  HIS 154  380  380  HIS HIS A . n 
A 1 155  ALA 155  381  381  ALA ALA A . n 
A 1 156  VAL 156  382  382  VAL VAL A . n 
A 1 157  VAL 157  383  383  VAL VAL A . n 
A 1 158  GLN 158  384  384  GLN GLN A . n 
A 1 159  SER 159  385  385  SER SER A . n 
A 1 160  PHE 160  386  386  PHE PHE A . n 
A 1 161  PRO 161  387  387  PRO PRO A . n 
A 1 162  GLU 162  388  388  GLU GLU A . n 
A 1 163  ALA 163  389  389  ALA ALA A . n 
A 1 164  TYR 164  390  390  TYR TYR A . n 
A 1 165  SER 165  391  391  SER SER A . n 
A 1 166  ALA 166  392  392  ALA ALA A . n 
A 1 167  ALA 167  393  393  ALA ALA A . n 
A 1 168  LYS 168  394  394  LYS LYS A . n 
A 1 169  LYS 169  395  395  LYS LYS A . n 
A 1 170  HIS 170  396  396  HIS HIS A . n 
A 1 171  GLY 171  397  397  GLY GLY A . n 
A 1 172  MET 172  398  398  MET MET A . n 
A 1 173  LYS 173  399  399  LYS LYS A . n 
A 1 174  VAL 174  400  400  VAL VAL A . n 
A 1 175  ILE 175  401  401  ILE ILE A . n 
A 1 176  TYR 176  402  402  TYR TYR A . n 
A 1 177  GLY 177  403  403  GLY GLY A . n 
A 1 178  LEU 178  404  404  LEU LEU A . n 
A 1 179  GLU 179  405  405  GLU GLU A . n 
A 1 180  ALA 180  406  406  ALA ALA A . n 
A 1 181  ASN 181  407  407  ASN ASN A . n 
A 1 182  ILE 182  408  408  ILE ILE A . n 
A 1 183  VAL 183  409  409  VAL VAL A . n 
A 1 184  ASP 184  410  410  ASP ASP A . n 
A 1 185  ASP 185  411  411  ASP ASP A . n 
A 1 186  GLY 186  412  ?    ?   ?   A . n 
A 1 187  VAL 187  413  ?    ?   ?   A . n 
A 1 188  PRO 188  414  ?    ?   ?   A . n 
A 1 189  ILE 189  415  ?    ?   ?   A . n 
A 1 190  ALA 190  416  ?    ?   ?   A . n 
A 1 191  TYR 191  417  ?    ?   ?   A . n 
A 1 192  ASN 192  418  ?    ?   ?   A . n 
A 1 193  GLU 193  419  ?    ?   ?   A . n 
A 1 194  THR 194  420  ?    ?   ?   A . n 
A 1 195  HIS 195  421  ?    ?   ?   A . n 
A 1 196  ARG 196  422  ?    ?   ?   A . n 
A 1 197  ARG 197  423  ?    ?   ?   A . n 
A 1 198  LEU 198  424  ?    ?   ?   A . n 
A 1 199  GLY 199  425  ?    ?   ?   A . n 
A 1 200  SER 200  426  ?    ?   ?   A . n 
A 1 201  GLY 201  427  ?    ?   ?   A . n 
A 1 202  SER 202  428  ?    ?   ?   A . n 
A 1 203  GLY 203  429  ?    ?   ?   A . n 
A 1 204  PRO 204  618  618  PRO PRO A . n 
A 1 205  PHE 205  619  619  PHE PHE A . n 
A 1 206  HIS 206  620  620  HIS HIS A . n 
A 1 207  VAL 207  621  621  VAL VAL A . n 
A 1 208  THR 208  622  622  THR THR A . n 
A 1 209  LEU 209  623  623  LEU LEU A . n 
A 1 210  LEU 210  624  624  LEU LEU A . n 
A 1 211  ALA 211  625  625  ALA ALA A . n 
A 1 212  GLN 212  626  626  GLN GLN A . n 
A 1 213  ASN 213  627  627  ASN ASN A . n 
A 1 214  GLU 214  628  628  GLU GLU A . n 
A 1 215  THR 215  629  629  THR THR A . n 
A 1 216  GLY 216  630  630  GLY GLY A . n 
A 1 217  LEU 217  631  631  LEU LEU A . n 
A 1 218  LYS 218  632  632  LYS LYS A . n 
A 1 219  ASN 219  633  633  ASN ASN A . n 
A 1 220  LEU 220  634  634  LEU LEU A . n 
A 1 221  PHE 221  635  635  PHE PHE A . n 
A 1 222  LYS 222  636  636  LYS LYS A . n 
A 1 223  LEU 223  637  637  LEU LEU A . n 
A 1 224  VAL 224  638  638  VAL VAL A . n 
A 1 225  SER 225  639  639  SER SER A . n 
A 1 226  LEU 226  640  640  LEU LEU A . n 
A 1 227  SER 227  641  641  SER SER A . n 
A 1 228  HIS 228  642  642  HIS HIS A . n 
A 1 229  ILE 229  643  643  ILE ILE A . n 
A 1 230  GLN 230  644  644  GLN GLN A . n 
A 1 231  TYR 231  645  645  TYR TYR A . n 
A 1 232  PHE 232  646  646  PHE PHE A . n 
A 1 233  HIS 233  647  647  HIS HIS A . n 
A 1 234  ARG 234  648  648  ARG ARG A . n 
A 1 235  VAL 235  649  649  VAL VAL A . n 
A 1 236  PRO 236  650  650  PRO PRO A . n 
A 1 237  ARG 237  651  651  ARG ARG A . n 
A 1 238  ILE 238  652  652  ILE ILE A . n 
A 1 239  PRO 239  653  653  PRO PRO A . n 
A 1 240  ARG 240  654  654  ARG ARG A . n 
A 1 241  SER 241  655  655  SER SER A . n 
A 1 242  VAL 242  656  656  VAL VAL A . n 
A 1 243  LEU 243  657  657  LEU LEU A . n 
A 1 244  VAL 244  658  658  VAL VAL A . n 
A 1 245  LYS 245  659  659  LYS LYS A . n 
A 1 246  HIS 246  660  660  HIS HIS A . n 
A 1 247  ARG 247  661  661  ARG ARG A . n 
A 1 248  ASP 248  662  662  ASP ASP A . n 
A 1 249  GLY 249  663  663  GLY GLY A . n 
A 1 250  LEU 250  664  664  LEU LEU A . n 
A 1 251  LEU 251  665  665  LEU LEU A . n 
A 1 252  VAL 252  666  666  VAL VAL A . n 
A 1 253  GLY 253  667  667  GLY GLY A . n 
A 1 254  SER 254  668  668  SER SER A . n 
A 1 255  GLY 255  669  669  GLY GLY A . n 
A 1 256  CYS 256  670  670  CYS CYS A . n 
A 1 257  ASP 257  671  671  ASP ASP A . n 
A 1 258  LYS 258  672  672  LYS LYS A . n 
A 1 259  GLY 259  673  673  GLY GLY A . n 
A 1 260  GLU 260  674  674  GLU GLU A . n 
A 1 261  LEU 261  675  675  LEU LEU A . n 
A 1 262  PHE 262  676  676  PHE PHE A . n 
A 1 263  ASP 263  677  677  ASP ASP A . n 
A 1 264  ASN 264  678  678  ASN ASN A . n 
A 1 265  LEU 265  679  ?    ?   ?   A . n 
A 1 266  ILE 266  680  ?    ?   ?   A . n 
A 1 267  GLN 267  681  ?    ?   ?   A . n 
A 1 268  LYS 268  682  ?    ?   ?   A . n 
A 1 269  ALA 269  683  ?    ?   ?   A . n 
A 1 270  PRO 270  684  ?    ?   ?   A . n 
A 1 271  GLU 271  685  ?    ?   ?   A . n 
A 1 272  GLU 272  686  ?    ?   ?   A . n 
A 1 273  VAL 273  687  687  VAL VAL A . n 
A 1 274  GLU 274  688  688  GLU GLU A . n 
A 1 275  ASP 275  689  689  ASP ASP A . n 
A 1 276  ILE 276  690  690  ILE ILE A . n 
A 1 277  ALA 277  691  691  ALA ALA A . n 
A 1 278  ARG 278  692  692  ARG ARG A . n 
A 1 279  PHE 279  693  693  PHE PHE A . n 
A 1 280  TYR 280  694  694  TYR TYR A . n 
A 1 281  ASP 281  695  695  ASP ASP A . n 
A 1 282  PHE 282  696  696  PHE PHE A . n 
A 1 283  LEU 283  697  697  LEU LEU A . n 
A 1 284  GLU 284  698  698  GLU GLU A . n 
A 1 285  VAL 285  699  699  VAL VAL A . n 
A 1 286  HIS 286  700  700  HIS HIS A . n 
A 1 287  PRO 287  701  701  PRO PRO A . n 
A 1 288  PRO 288  702  702  PRO PRO A . n 
A 1 289  ASP 289  703  703  ASP ASP A . n 
A 1 290  VAL 290  704  704  VAL VAL A . n 
A 1 291  TYR 291  705  705  TYR TYR A . n 
A 1 292  LYS 292  706  706  LYS LYS A . n 
A 1 293  PRO 293  707  707  PRO PRO A . n 
A 1 294  LEU 294  708  708  LEU LEU A . n 
A 1 295  ILE 295  709  ?    ?   ?   A . n 
A 1 296  GLU 296  710  ?    ?   ?   A . n 
A 1 297  MET 297  711  ?    ?   ?   A . n 
A 1 298  ASP 298  712  ?    ?   ?   A . n 
A 1 299  TYR 299  713  713  TYR TYR A . n 
A 1 300  VAL 300  714  714  VAL VAL A . n 
A 1 301  LYS 301  715  715  LYS LYS A . n 
A 1 302  ASP 302  716  716  ASP ASP A . n 
A 1 303  GLU 303  717  717  GLU GLU A . n 
A 1 304  GLU 304  718  718  GLU GLU A . n 
A 1 305  MET 305  719  719  MET MET A . n 
A 1 306  ILE 306  720  720  ILE ILE A . n 
A 1 307  LYS 307  721  721  LYS LYS A . n 
A 1 308  ASN 308  722  722  ASN ASN A . n 
A 1 309  ILE 309  723  723  ILE ILE A . n 
A 1 310  ILE 310  724  724  ILE ILE A . n 
A 1 311  ARG 311  725  725  ARG ARG A . n 
A 1 312  SER 312  726  726  SER SER A . n 
A 1 313  ILE 313  727  727  ILE ILE A . n 
A 1 314  VAL 314  728  728  VAL VAL A . n 
A 1 315  ALA 315  729  729  ALA ALA A . n 
A 1 316  LEU 316  730  730  LEU LEU A . n 
A 1 317  GLY 317  731  731  GLY GLY A . n 
A 1 318  GLU 318  732  732  GLU GLU A . n 
A 1 319  LYS 319  733  733  LYS LYS A . n 
A 1 320  LEU 320  734  734  LEU LEU A . n 
A 1 321  ASP 321  735  735  ASP ASP A . n 
A 1 322  ILE 322  736  736  ILE ILE A . n 
A 1 323  PRO 323  737  737  PRO PRO A . n 
A 1 324  VAL 324  738  738  VAL VAL A . n 
A 1 325  VAL 325  739  739  VAL VAL A . n 
A 1 326  ALA 326  740  740  ALA ALA A . n 
A 1 327  THR 327  741  741  THR THR A . n 
A 1 328  GLY 328  742  742  GLY GLY A . n 
A 1 329  ASN 329  743  743  ASN ASN A . n 
A 1 330  VAL 330  744  744  VAL VAL A . n 
A 1 331  HIS 331  745  745  HIS HIS A . n 
A 1 332  TYR 332  746  746  TYR TYR A . n 
A 1 333  LEU 333  747  747  LEU LEU A . n 
A 1 334  ASN 334  748  748  ASN ASN A . n 
A 1 335  PRO 335  749  749  PRO PRO A . n 
A 1 336  GLU 336  750  750  GLU GLU A . n 
A 1 337  ASP 337  751  751  ASP ASP A . n 
A 1 338  LYS 338  752  752  LYS LYS A . n 
A 1 339  ILE 339  753  753  ILE ILE A . n 
A 1 340  TYR 340  754  754  TYR TYR A . n 
A 1 341  ARG 341  755  755  ARG ARG A . n 
A 1 342  LYS 342  756  756  LYS LYS A . n 
A 1 343  ILE 343  757  757  ILE ILE A . n 
A 1 344  LEU 344  758  758  LEU LEU A . n 
A 1 345  ILE 345  759  759  ILE ILE A . n 
A 1 346  HIS 346  760  760  HIS HIS A . n 
A 1 347  SER 347  761  761  SER SER A . n 
A 1 348  GLN 348  762  762  GLN GLN A . n 
A 1 349  GLY 349  763  763  GLY GLY A . n 
A 1 350  GLY 350  764  764  GLY GLY A . n 
A 1 351  ALA 351  765  765  ALA ALA A . n 
A 1 352  ASN 352  766  766  ASN ASN A . n 
A 1 353  PRO 353  767  767  PRO PRO A . n 
A 1 354  LEU 354  768  768  LEU LEU A . n 
A 1 355  ASN 355  769  769  ASN ASN A . n 
A 1 356  ARG 356  770  770  ARG ARG A . n 
A 1 357  HIS 357  771  771  HIS HIS A . n 
A 1 358  GLU 358  772  772  GLU GLU A . n 
A 1 359  LEU 359  773  773  LEU LEU A . n 
A 1 360  PRO 360  774  774  PRO PRO A . n 
A 1 361  ASP 361  775  775  ASP ASP A . n 
A 1 362  VAL 362  776  776  VAL VAL A . n 
A 1 363  TYR 363  777  777  TYR TYR A . n 
A 1 364  PHE 364  778  778  PHE PHE A . n 
A 1 365  ARG 365  779  779  ARG ARG A . n 
A 1 366  THR 366  780  780  THR THR A . n 
A 1 367  THR 367  781  781  THR THR A . n 
A 1 368  ASN 368  782  782  ASN ASN A . n 
A 1 369  GLU 369  783  783  GLU GLU A . n 
A 1 370  MET 370  784  784  MET MET A . n 
A 1 371  LEU 371  785  785  LEU LEU A . n 
A 1 372  ASP 372  786  786  ASP ASP A . n 
A 1 373  CYS 373  787  787  CYS CYS A . n 
A 1 374  PHE 374  788  788  PHE PHE A . n 
A 1 375  SER 375  789  789  SER SER A . n 
A 1 376  PHE 376  790  790  PHE PHE A . n 
A 1 377  LEU 377  791  791  LEU LEU A . n 
A 1 378  GLY 378  792  792  GLY GLY A . n 
A 1 379  PRO 379  793  793  PRO PRO A . n 
A 1 380  GLU 380  794  794  GLU GLU A . n 
A 1 381  LYS 381  795  795  LYS LYS A . n 
A 1 382  ALA 382  796  796  ALA ALA A . n 
A 1 383  LYS 383  797  797  LYS LYS A . n 
A 1 384  GLU 384  798  798  GLU GLU A . n 
A 1 385  ILE 385  799  799  ILE ILE A . n 
A 1 386  VAL 386  800  800  VAL VAL A . n 
A 1 387  VAL 387  801  801  VAL VAL A . n 
A 1 388  ASP 388  802  802  ASP ASP A . n 
A 1 389  ASN 389  803  803  ASN ASN A . n 
A 1 390  THR 390  804  804  THR THR A . n 
A 1 391  GLN 391  805  805  GLN GLN A . n 
A 1 392  LYS 392  806  806  LYS LYS A . n 
A 1 393  ILE 393  807  807  ILE ILE A . n 
A 1 394  ALA 394  808  808  ALA ALA A . n 
A 1 395  SER 395  809  809  SER SER A . n 
A 1 396  LEU 396  810  810  LEU LEU A . n 
A 1 397  ILE 397  811  811  ILE ILE A . n 
A 1 398  GLY 398  812  812  GLY GLY A . n 
A 1 399  ASP 399  813  813  ASP ASP A . n 
A 1 400  VAL 400  814  814  VAL VAL A . n 
A 1 401  LYS 401  815  815  LYS LYS A . n 
A 1 402  PRO 402  816  816  PRO PRO A . n 
A 1 403  ILE 403  817  817  ILE ILE A . n 
A 1 404  LYS 404  818  818  LYS LYS A . n 
A 1 405  ASP 405  819  819  ASP ASP A . n 
A 1 406  GLU 406  820  820  GLU GLU A . n 
A 1 407  LEU 407  821  821  LEU LEU A . n 
A 1 408  TYR 408  822  822  TYR TYR A . n 
A 1 409  THR 409  823  823  THR THR A . n 
A 1 410  PRO 410  824  824  PRO PRO A . n 
A 1 411  ARG 411  825  825  ARG ARG A . n 
A 1 412  ILE 412  826  826  ILE ILE A . n 
A 1 413  GLU 413  827  827  GLU GLU A . n 
A 1 414  GLY 414  828  828  GLY GLY A . n 
A 1 415  ALA 415  829  829  ALA ALA A . n 
A 1 416  ASP 416  830  830  ASP ASP A . n 
A 1 417  GLU 417  831  831  GLU GLU A . n 
A 1 418  GLU 418  832  832  GLU GLU A . n 
A 1 419  ILE 419  833  833  ILE ILE A . n 
A 1 420  ARG 420  834  834  ARG ARG A . n 
A 1 421  GLU 421  835  835  GLU GLU A . n 
A 1 422  MET 422  836  836  MET MET A . n 
A 1 423  SER 423  837  837  SER SER A . n 
A 1 424  TYR 424  838  838  TYR TYR A . n 
A 1 425  ARG 425  839  839  ARG ARG A . n 
A 1 426  ARG 426  840  840  ARG ARG A . n 
A 1 427  ALA 427  841  841  ALA ALA A . n 
A 1 428  LYS 428  842  842  LYS LYS A . n 
A 1 429  GLU 429  843  843  GLU GLU A . n 
A 1 430  ILE 430  844  844  ILE ILE A . n 
A 1 431  TYR 431  845  845  TYR TYR A . n 
A 1 432  GLY 432  846  846  GLY GLY A . n 
A 1 433  ASP 433  847  847  ASP ASP A . n 
A 1 434  PRO 434  848  848  PRO PRO A . n 
A 1 435  LEU 435  849  849  LEU LEU A . n 
A 1 436  PRO 436  850  850  PRO PRO A . n 
A 1 437  LYS 437  851  851  LYS LYS A . n 
A 1 438  LEU 438  852  852  LEU LEU A . n 
A 1 439  VAL 439  853  853  VAL VAL A . n 
A 1 440  GLU 440  854  854  GLU GLU A . n 
A 1 441  GLU 441  855  855  GLU GLU A . n 
A 1 442  ARG 442  856  856  ARG ARG A . n 
A 1 443  LEU 443  857  857  LEU LEU A . n 
A 1 444  GLU 444  858  858  GLU GLU A . n 
A 1 445  LYS 445  859  859  LYS LYS A . n 
A 1 446  GLU 446  860  860  GLU GLU A . n 
A 1 447  LEU 447  861  861  LEU LEU A . n 
A 1 448  LYS 448  862  862  LYS LYS A . n 
A 1 449  SER 449  863  863  SER SER A . n 
A 1 450  ILE 450  864  864  ILE ILE A . n 
A 1 451  ILE 451  865  865  ILE ILE A . n 
A 1 452  GLY 452  866  866  GLY GLY A . n 
A 1 453  HIS 453  867  867  HIS HIS A . n 
A 1 454  GLY 454  868  868  GLY GLY A . n 
A 1 455  PHE 455  869  869  PHE PHE A . n 
A 1 456  ALA 456  870  870  ALA ALA A . n 
A 1 457  VAL 457  871  871  VAL VAL A . n 
A 1 458  ILE 458  872  872  ILE ILE A . n 
A 1 459  TYR 459  873  873  TYR TYR A . n 
A 1 460  LEU 460  874  874  LEU LEU A . n 
A 1 461  ILE 461  875  875  ILE ILE A . n 
A 1 462  SER 462  876  876  SER SER A . n 
A 1 463  HIS 463  877  877  HIS HIS A . n 
A 1 464  LYS 464  878  878  LYS LYS A . n 
A 1 465  LEU 465  879  879  LEU LEU A . n 
A 1 466  VAL 466  880  880  VAL VAL A . n 
A 1 467  LYS 467  881  881  LYS LYS A . n 
A 1 468  LYS 468  882  882  LYS LYS A . n 
A 1 469  SER 469  883  883  SER SER A . n 
A 1 470  LEU 470  884  884  LEU LEU A . n 
A 1 471  ASP 471  885  885  ASP ASP A . n 
A 1 472  ASP 472  886  886  ASP ASP A . n 
A 1 473  GLY 473  887  887  GLY GLY A . n 
A 1 474  TYR 474  888  888  TYR TYR A . n 
A 1 475  LEU 475  889  889  LEU LEU A . n 
A 1 476  VAL 476  890  890  VAL VAL A . n 
A 1 477  GLY 477  891  891  GLY GLY A . n 
A 1 478  SER 478  892  892  SER SER A . n 
A 1 479  ARG 479  893  893  ARG ARG A . n 
A 1 480  GLY 480  894  894  GLY GLY A . n 
A 1 481  SER 481  895  895  SER SER A . n 
A 1 482  VAL 482  896  896  VAL VAL A . n 
A 1 483  GLY 483  897  897  GLY GLY A . n 
A 1 484  SER 484  898  898  SER SER A . n 
A 1 485  SER 485  899  899  SER SER A . n 
A 1 486  PHE 486  900  900  PHE PHE A . n 
A 1 487  VAL 487  901  901  VAL VAL A . n 
A 1 488  ALA 488  902  902  ALA ALA A . n 
A 1 489  THR 489  903  903  THR THR A . n 
A 1 490  MET 490  904  904  MET MET A . n 
A 1 491  THR 491  905  905  THR THR A . n 
A 1 492  GLU 492  906  906  GLU GLU A . n 
A 1 493  ILE 493  907  907  ILE ILE A . n 
A 1 494  THR 494  908  908  THR THR A . n 
A 1 495  GLU 495  909  909  GLU GLU A . n 
A 1 496  VAL 496  910  910  VAL VAL A . n 
A 1 497  ASN 497  911  911  ASN ASN A . n 
A 1 498  PRO 498  912  912  PRO PRO A . n 
A 1 499  LEU 499  913  913  LEU LEU A . n 
A 1 500  PRO 500  914  914  PRO PRO A . n 
A 1 501  PRO 501  915  915  PRO PRO A . n 
A 1 502  HIS 502  916  916  HIS HIS A . n 
A 1 503  TYR 503  917  917  TYR TYR A . n 
A 1 504  VAL 504  918  918  VAL VAL A . n 
A 1 505  CYS 505  919  919  CYS CYS A . n 
A 1 506  PRO 506  920  920  PRO PRO A . n 
A 1 507  ASN 507  921  921  ASN ASN A . n 
A 1 508  CYS 508  922  922  CYS CYS A . n 
A 1 509  LYS 509  923  923  LYS LYS A . n 
A 1 510  HIS 510  924  924  HIS HIS A . n 
A 1 511  SER 511  925  925  SER SER A . n 
A 1 512  GLU 512  926  926  GLU GLU A . n 
A 1 513  PHE 513  927  927  PHE PHE A . n 
A 1 514  PHE 514  928  928  PHE PHE A . n 
A 1 515  ASN 515  929  929  ASN ASN A . n 
A 1 516  ASP 516  930  930  ASP ASP A . n 
A 1 517  GLY 517  931  931  GLY GLY A . n 
A 1 518  SER 518  932  932  SER SER A . n 
A 1 519  VAL 519  933  933  VAL VAL A . n 
A 1 520  GLY 520  934  934  GLY GLY A . n 
A 1 521  SER 521  935  935  SER SER A . n 
A 1 522  GLY 522  936  936  GLY GLY A . n 
A 1 523  PHE 523  937  937  PHE PHE A . n 
A 1 524  ASP 524  938  938  ASP ASP A . n 
A 1 525  LEU 525  939  939  LEU LEU A . n 
A 1 526  PRO 526  940  940  PRO PRO A . n 
A 1 527  ASP 527  941  941  ASP ASP A . n 
A 1 528  LYS 528  942  942  LYS LYS A . n 
A 1 529  ASN 529  943  943  ASN ASN A . n 
A 1 530  CYS 530  944  944  CYS CYS A . n 
A 1 531  PRO 531  945  945  PRO PRO A . n 
A 1 532  ARG 532  946  946  ARG ARG A . n 
A 1 533  CYS 533  947  947  CYS CYS A . n 
A 1 534  GLY 534  948  948  GLY GLY A . n 
A 1 535  THR 535  949  949  THR THR A . n 
A 1 536  LYS 536  950  950  LYS LYS A . n 
A 1 537  TYR 537  951  951  TYR TYR A . n 
A 1 538  LYS 538  952  952  LYS LYS A . n 
A 1 539  LYS 539  953  953  LYS LYS A . n 
A 1 540  ASP 540  954  954  ASP ASP A . n 
A 1 541  GLY 541  955  955  GLY GLY A . n 
A 1 542  HIS 542  956  956  HIS HIS A . n 
A 1 543  ASP 543  957  957  ASP ASP A . n 
A 1 544  ILE 544  958  958  ILE ILE A . n 
A 1 545  PRO 545  959  959  PRO PRO A . n 
A 1 546  PHE 546  960  960  PHE PHE A . n 
A 1 547  GLU 547  961  961  GLU GLU A . n 
A 1 548  THR 548  962  962  THR THR A . n 
A 1 549  PHE 549  963  963  PHE PHE A . n 
A 1 550  LEU 550  964  964  LEU LEU A . n 
A 1 551  GLY 551  965  965  GLY GLY A . n 
A 1 552  PHE 552  966  966  PHE PHE A . n 
A 1 553  LYS 553  967  967  LYS LYS A . n 
A 1 554  GLY 554  968  968  GLY GLY A . n 
A 1 555  ASP 555  969  969  ASP ASP A . n 
A 1 556  LYS 556  970  970  LYS LYS A . n 
A 1 557  VAL 557  971  971  VAL VAL A . n 
A 1 558  PRO 558  972  972  PRO PRO A . n 
A 1 559  ASP 559  973  973  ASP ASP A . n 
A 1 560  ILE 560  974  974  ILE ILE A . n 
A 1 561  ASP 561  975  975  ASP ASP A . n 
A 1 562  LEU 562  976  976  LEU LEU A . n 
A 1 563  ASN 563  977  977  ASN ASN A . n 
A 1 564  PHE 564  978  978  PHE PHE A . n 
A 1 565  SER 565  979  979  SER SER A . n 
A 1 566  GLY 566  980  980  GLY GLY A . n 
A 1 567  GLU 567  981  981  GLU GLU A . n 
A 1 568  TYR 568  982  982  TYR TYR A . n 
A 1 569  GLN 569  983  983  GLN GLN A . n 
A 1 570  PRO 570  984  984  PRO PRO A . n 
A 1 571  ARG 571  985  985  ARG ARG A . n 
A 1 572  ALA 572  986  986  ALA ALA A . n 
A 1 573  HIS 573  987  987  HIS HIS A . n 
A 1 574  ASN 574  988  988  ASN ASN A . n 
A 1 575  TYR 575  989  989  TYR TYR A . n 
A 1 576  THR 576  990  990  THR THR A . n 
A 1 577  LYS 577  991  991  LYS LYS A . n 
A 1 578  VAL 578  992  992  VAL VAL A . n 
A 1 579  LEU 579  993  993  LEU LEU A . n 
A 1 580  PHE 580  994  994  PHE PHE A . n 
A 1 581  GLY 581  995  995  GLY GLY A . n 
A 1 582  GLU 582  996  996  GLU GLU A . n 
A 1 583  ASP 583  997  997  ASP ASP A . n 
A 1 584  ASN 584  998  998  ASN ASN A . n 
A 1 585  VAL 585  999  999  VAL VAL A . n 
A 1 586  TYR 586  1000 1000 TYR TYR A . n 
A 1 587  ARG 587  1001 1001 ARG ARG A . n 
A 1 588  ALA 588  1002 1002 ALA ALA A . n 
A 1 589  GLY 589  1003 1003 GLY GLY A . n 
A 1 590  THR 590  1004 1004 THR THR A . n 
A 1 591  ILE 591  1005 1005 ILE ILE A . n 
A 1 592  GLY 592  1006 1006 GLY GLY A . n 
A 1 593  THR 593  1007 1007 THR THR A . n 
A 1 594  VAL 594  1008 1008 VAL VAL A . n 
A 1 595  ALA 595  1009 1009 ALA ALA A . n 
A 1 596  ASP 596  1010 1010 ASP ASP A . n 
A 1 597  LYS 597  1011 1011 LYS LYS A . n 
A 1 598  THR 598  1012 1012 THR THR A . n 
A 1 599  ALA 599  1013 1013 ALA ALA A . n 
A 1 600  TYR 600  1014 1014 TYR TYR A . n 
A 1 601  GLY 601  1015 1015 GLY GLY A . n 
A 1 602  PHE 602  1016 1016 PHE PHE A . n 
A 1 603  VAL 603  1017 1017 VAL VAL A . n 
A 1 604  LYS 604  1018 1018 LYS LYS A . n 
A 1 605  ALA 605  1019 1019 ALA ALA A . n 
A 1 606  TYR 606  1020 1020 TYR TYR A . n 
A 1 607  ALA 607  1021 1021 ALA ALA A . n 
A 1 608  SER 608  1022 1022 SER SER A . n 
A 1 609  ASP 609  1023 1023 ASP ASP A . n 
A 1 610  HIS 610  1024 1024 HIS HIS A . n 
A 1 611  ASN 611  1025 1025 ASN ASN A . n 
A 1 612  LEU 612  1026 1026 LEU LEU A . n 
A 1 613  GLU 613  1027 1027 GLU GLU A . n 
A 1 614  LEU 614  1028 1028 LEU LEU A . n 
A 1 615  ARG 615  1029 1029 ARG ARG A . n 
A 1 616  GLY 616  1030 1030 GLY GLY A . n 
A 1 617  ALA 617  1031 1031 ALA ALA A . n 
A 1 618  GLU 618  1032 1032 GLU GLU A . n 
A 1 619  ILE 619  1033 1033 ILE ILE A . n 
A 1 620  ASP 620  1034 1034 ASP ASP A . n 
A 1 621  ARG 621  1035 1035 ARG ARG A . n 
A 1 622  LEU 622  1036 1036 LEU LEU A . n 
A 1 623  ALA 623  1037 1037 ALA ALA A . n 
A 1 624  ALA 624  1038 1038 ALA ALA A . n 
A 1 625  GLY 625  1039 1039 GLY GLY A . n 
A 1 626  CYS 626  1040 1040 CYS CYS A . n 
A 1 627  THR 627  1041 1041 THR THR A . n 
A 1 628  GLY 628  1042 1042 GLY GLY A . n 
A 1 629  VAL 629  1043 1043 VAL VAL A . n 
A 1 630  LYS 630  1044 1044 LYS LYS A . n 
A 1 631  ARG 631  1045 1045 ARG ARG A . n 
A 1 632  THR 632  1046 1046 THR THR A . n 
A 1 633  THR 633  1047 1047 THR THR A . n 
A 1 634  GLY 634  1048 1048 GLY GLY A . n 
A 1 635  GLN 635  1049 1049 GLN GLN A . n 
A 1 636  HIS 636  1050 1050 HIS HIS A . n 
A 1 637  PRO 637  1051 1051 PRO PRO A . n 
A 1 638  GLY 638  1052 1052 GLY GLY A . n 
A 1 639  GLY 639  1053 1053 GLY GLY A . n 
A 1 640  ILE 640  1054 1054 ILE ILE A . n 
A 1 641  ILE 641  1055 1055 ILE ILE A . n 
A 1 642  VAL 642  1056 1056 VAL VAL A . n 
A 1 643  VAL 643  1057 1057 VAL VAL A . n 
A 1 644  PRO 644  1058 1058 PRO PRO A . n 
A 1 645  ASP 645  1059 1059 ASP ASP A . n 
A 1 646  TYR 646  1060 1060 TYR TYR A . n 
A 1 647  MET 647  1061 1061 MET MET A . n 
A 1 648  GLU 648  1062 1062 GLU GLU A . n 
A 1 649  ILE 649  1063 1063 ILE ILE A . n 
A 1 650  TYR 650  1064 1064 TYR TYR A . n 
A 1 651  ASP 651  1065 1065 ASP ASP A . n 
A 1 652  PHE 652  1066 1066 PHE PHE A . n 
A 1 653  THR 653  1067 1067 THR THR A . n 
A 1 654  PRO 654  1068 1068 PRO PRO A . n 
A 1 655  ILE 655  1069 1069 ILE ILE A . n 
A 1 656  GLN 656  1070 1070 GLN GLN A . n 
A 1 657  TYR 657  1071 1071 TYR TYR A . n 
A 1 658  PRO 658  1072 1072 PRO PRO A . n 
A 1 659  ALA 659  1073 1073 ALA ALA A . n 
A 1 660  ASP 660  1074 1074 ASP ASP A . n 
A 1 661  ASP 661  1075 1075 ASP ASP A . n 
A 1 662  THR 662  1076 1076 THR THR A . n 
A 1 663  SER 663  1077 1077 SER SER A . n 
A 1 664  SER 664  1078 1078 SER SER A . n 
A 1 665  GLU 665  1079 1079 GLU GLU A . n 
A 1 666  TRP 666  1080 1080 TRP TRP A . n 
A 1 667  ARG 667  1081 1081 ARG ARG A . n 
A 1 668  THR 668  1082 1082 THR THR A . n 
A 1 669  THR 669  1083 1083 THR THR A . n 
A 1 670  HIS 670  1084 1084 HIS HIS A . n 
A 1 671  PHE 671  1085 1085 PHE PHE A . n 
A 1 672  ASP 672  1086 1086 ASP ASP A . n 
A 1 673  PHE 673  1087 1087 PHE PHE A . n 
A 1 674  HIS 674  1088 1088 HIS HIS A . n 
A 1 675  SER 675  1089 1089 SER SER A . n 
A 1 676  ILE 676  1090 1090 ILE ILE A . n 
A 1 677  HIS 677  1091 1091 HIS HIS A . n 
A 1 678  ASP 678  1092 1092 ASP ASP A . n 
A 1 679  ASN 679  1093 1093 ASN ASN A . n 
A 1 680  LEU 680  1094 1094 LEU LEU A . n 
A 1 681  LEU 681  1095 1095 LEU LEU A . n 
A 1 682  LYS 682  1096 1096 LYS LYS A . n 
A 1 683  LEU 683  1097 1097 LEU LEU A . n 
A 1 684  ASP 684  1098 1098 ASP ASP A . n 
A 1 685  ILE 685  1099 1099 ILE ILE A . n 
A 1 686  LEU 686  1100 1100 LEU LEU A . n 
A 1 687  GLY 687  1101 1101 GLY GLY A . n 
A 1 688  HIS 688  1102 1102 HIS HIS A . n 
A 1 689  ASP 689  1103 1103 ASP ASP A . n 
A 1 690  ASP 690  1104 1104 ASP ASP A . n 
A 1 691  PRO 691  1105 1105 PRO PRO A . n 
A 1 692  THR 692  1106 1106 THR THR A . n 
A 1 693  VAL 693  1107 1107 VAL VAL A . n 
A 1 694  ILE 694  1108 1108 ILE ILE A . n 
A 1 695  ARG 695  1109 1109 ARG ARG A . n 
A 1 696  MET 696  1110 1110 MET MET A . n 
A 1 697  LEU 697  1111 1111 LEU LEU A . n 
A 1 698  GLN 698  1112 1112 GLN GLN A . n 
A 1 699  ASP 699  1113 1113 ASP ASP A . n 
A 1 700  LEU 700  1114 1114 LEU LEU A . n 
A 1 701  SER 701  1115 1115 SER SER A . n 
A 1 702  GLY 702  1116 1116 GLY GLY A . n 
A 1 703  ILE 703  1117 1117 ILE ILE A . n 
A 1 704  ASP 704  1118 1118 ASP ASP A . n 
A 1 705  PRO 705  1119 1119 PRO PRO A . n 
A 1 706  LYS 706  1120 1120 LYS LYS A . n 
A 1 707  THR 707  1121 1121 THR THR A . n 
A 1 708  ILE 708  1122 1122 ILE ILE A . n 
A 1 709  PRO 709  1123 1123 PRO PRO A . n 
A 1 710  THR 710  1124 1124 THR THR A . n 
A 1 711  ASP 711  1125 1125 ASP ASP A . n 
A 1 712  ASP 712  1126 1126 ASP ASP A . n 
A 1 713  PRO 713  1127 1127 PRO PRO A . n 
A 1 714  ASP 714  1128 1128 ASP ASP A . n 
A 1 715  VAL 715  1129 1129 VAL VAL A . n 
A 1 716  MET 716  1130 1130 MET MET A . n 
A 1 717  GLY 717  1131 1131 GLY GLY A . n 
A 1 718  ILE 718  1132 1132 ILE ILE A . n 
A 1 719  PHE 719  1133 1133 PHE PHE A . n 
A 1 720  SER 720  1134 1134 SER SER A . n 
A 1 721  SER 721  1135 1135 SER SER A . n 
A 1 722  THR 722  1136 1136 THR THR A . n 
A 1 723  GLU 723  1137 1137 GLU GLU A . n 
A 1 724  PRO 724  1138 1138 PRO PRO A . n 
A 1 725  LEU 725  1139 1139 LEU LEU A . n 
A 1 726  GLY 726  1140 1140 GLY GLY A . n 
A 1 727  VAL 727  1141 1141 VAL VAL A . n 
A 1 728  THR 728  1142 1142 THR THR A . n 
A 1 729  PRO 729  1143 1143 PRO PRO A . n 
A 1 730  GLU 730  1144 1144 GLU GLU A . n 
A 1 731  GLN 731  1145 1145 GLN GLN A . n 
A 1 732  ILE 732  1146 1146 ILE ILE A . n 
A 1 733  MET 733  1147 1147 MET MET A . n 
A 1 734  CYS 734  1148 1148 CYS CYS A . n 
A 1 735  ASN 735  1149 1149 ASN ASN A . n 
A 1 736  VAL 736  1150 1150 VAL VAL A . n 
A 1 737  GLY 737  1151 1151 GLY GLY A . n 
A 1 738  THR 738  1152 1152 THR THR A . n 
A 1 739  ILE 739  1153 1153 ILE ILE A . n 
A 1 740  GLY 740  1154 1154 GLY GLY A . n 
A 1 741  ILE 741  1155 1155 ILE ILE A . n 
A 1 742  PRO 742  1156 1156 PRO PRO A . n 
A 1 743  GLU 743  1157 1157 GLU GLU A . n 
A 1 744  PHE 744  1158 1158 PHE PHE A . n 
A 1 745  GLY 745  1159 1159 GLY GLY A . n 
A 1 746  THR 746  1160 1160 THR THR A . n 
A 1 747  ARG 747  1161 1161 ARG ARG A . n 
A 1 748  PHE 748  1162 1162 PHE PHE A . n 
A 1 749  VAL 749  1163 1163 VAL VAL A . n 
A 1 750  ARG 750  1164 1164 ARG ARG A . n 
A 1 751  GLN 751  1165 1165 GLN GLN A . n 
A 1 752  MET 752  1166 1166 MET MET A . n 
A 1 753  LEU 753  1167 1167 LEU LEU A . n 
A 1 754  GLU 754  1168 1168 GLU GLU A . n 
A 1 755  GLU 755  1169 1169 GLU GLU A . n 
A 1 756  THR 756  1170 1170 THR THR A . n 
A 1 757  ARG 757  1171 1171 ARG ARG A . n 
A 1 758  PRO 758  1172 1172 PRO PRO A . n 
A 1 759  LYS 759  1173 1173 LYS LYS A . n 
A 1 760  THR 760  1174 1174 THR THR A . n 
A 1 761  PHE 761  1175 1175 PHE PHE A . n 
A 1 762  SER 762  1176 1176 SER SER A . n 
A 1 763  GLU 763  1177 1177 GLU GLU A . n 
A 1 764  LEU 764  1178 1178 LEU LEU A . n 
A 1 765  VAL 765  1179 1179 VAL VAL A . n 
A 1 766  GLN 766  1180 1180 GLN GLN A . n 
A 1 767  ILE 767  1181 1181 ILE ILE A . n 
A 1 768  SER 768  1182 1182 SER SER A . n 
A 1 769  GLY 769  1183 1183 GLY GLY A . n 
A 1 770  LEU 770  1184 1184 LEU LEU A . n 
A 1 771  SER 771  1185 1185 SER SER A . n 
A 1 772  HIS 772  1186 1186 HIS HIS A . n 
A 1 773  GLY 773  1187 1187 GLY GLY A . n 
A 1 774  THR 774  1188 1188 THR THR A . n 
A 1 775  ASP 775  1189 1189 ASP ASP A . n 
A 1 776  VAL 776  1190 1190 VAL VAL A . n 
A 1 777  TRP 777  1191 1191 TRP TRP A . n 
A 1 778  LEU 778  1192 1192 LEU LEU A . n 
A 1 779  GLY 779  1193 1193 GLY GLY A . n 
A 1 780  ASN 780  1194 1194 ASN ASN A . n 
A 1 781  ALA 781  1195 1195 ALA ALA A . n 
A 1 782  GLN 782  1196 1196 GLN GLN A . n 
A 1 783  GLU 783  1197 1197 GLU GLU A . n 
A 1 784  LEU 784  1198 1198 LEU LEU A . n 
A 1 785  ILE 785  1199 1199 ILE ILE A . n 
A 1 786  GLN 786  1200 1200 GLN GLN A . n 
A 1 787  ASN 787  1201 1201 ASN ASN A . n 
A 1 788  GLY 788  1202 1202 GLY GLY A . n 
A 1 789  THR 789  1203 1203 THR THR A . n 
A 1 790  CYS 790  1204 1204 CYS CYS A . n 
A 1 791  THR 791  1205 1205 THR THR A . n 
A 1 792  LEU 792  1206 1206 LEU LEU A . n 
A 1 793  SER 793  1207 1207 SER SER A . n 
A 1 794  GLU 794  1208 1208 GLU GLU A . n 
A 1 795  VAL 795  1209 1209 VAL VAL A . n 
A 1 796  ILE 796  1210 1210 ILE ILE A . n 
A 1 797  GLY 797  1211 1211 GLY GLY A . n 
A 1 798  CYS 798  1212 1212 CYS CYS A . n 
A 1 799  ARG 799  1213 1213 ARG ARG A . n 
A 1 800  ASP 800  1214 1214 ASP ASP A . n 
A 1 801  ASP 801  1215 1215 ASP ASP A . n 
A 1 802  ILE 802  1216 1216 ILE ILE A . n 
A 1 803  MET 803  1217 1217 MET MET A . n 
A 1 804  VAL 804  1218 1218 VAL VAL A . n 
A 1 805  TYR 805  1219 1219 TYR TYR A . n 
A 1 806  LEU 806  1220 1220 LEU LEU A . n 
A 1 807  ILE 807  1221 1221 ILE ILE A . n 
A 1 808  TYR 808  1222 1222 TYR TYR A . n 
A 1 809  ARG 809  1223 1223 ARG ARG A . n 
A 1 810  GLY 810  1224 1224 GLY GLY A . n 
A 1 811  LEU 811  1225 1225 LEU LEU A . n 
A 1 812  GLU 812  1226 1226 GLU GLU A . n 
A 1 813  PRO 813  1227 1227 PRO PRO A . n 
A 1 814  SER 814  1228 1228 SER SER A . n 
A 1 815  LEU 815  1229 1229 LEU LEU A . n 
A 1 816  ALA 816  1230 1230 ALA ALA A . n 
A 1 817  PHE 817  1231 1231 PHE PHE A . n 
A 1 818  LYS 818  1232 1232 LYS LYS A . n 
A 1 819  ILE 819  1233 1233 ILE ILE A . n 
A 1 820  MET 820  1234 1234 MET MET A . n 
A 1 821  GLU 821  1235 1235 GLU GLU A . n 
A 1 822  SER 822  1236 1236 SER SER A . n 
A 1 823  VAL 823  1237 1237 VAL VAL A . n 
A 1 824  ARG 824  1238 1238 ARG ARG A . n 
A 1 825  LYS 825  1239 1239 LYS LYS A . n 
A 1 826  GLY 826  1240 1240 GLY GLY A . n 
A 1 827  LYS 827  1241 1241 LYS LYS A . n 
A 1 828  GLY 828  1242 1242 GLY GLY A . n 
A 1 829  LEU 829  1243 1243 LEU LEU A . n 
A 1 830  THR 830  1244 1244 THR THR A . n 
A 1 831  PRO 831  1245 1245 PRO PRO A . n 
A 1 832  GLU 832  1246 1246 GLU GLU A . n 
A 1 833  PHE 833  1247 1247 PHE PHE A . n 
A 1 834  GLU 834  1248 1248 GLU GLU A . n 
A 1 835  ALA 835  1249 1249 ALA ALA A . n 
A 1 836  GLU 836  1250 1250 GLU GLU A . n 
A 1 837  MET 837  1251 1251 MET MET A . n 
A 1 838  ARG 838  1252 1252 ARG ARG A . n 
A 1 839  LYS 839  1253 1253 LYS LYS A . n 
A 1 840  HIS 840  1254 1254 HIS HIS A . n 
A 1 841  ASP 841  1255 1255 ASP ASP A . n 
A 1 842  VAL 842  1256 1256 VAL VAL A . n 
A 1 843  PRO 843  1257 1257 PRO PRO A . n 
A 1 844  GLU 844  1258 1258 GLU GLU A . n 
A 1 845  TRP 845  1259 1259 TRP TRP A . n 
A 1 846  TYR 846  1260 1260 TYR TYR A . n 
A 1 847  ILE 847  1261 1261 ILE ILE A . n 
A 1 848  ASP 848  1262 1262 ASP ASP A . n 
A 1 849  SER 849  1263 1263 SER SER A . n 
A 1 850  CYS 850  1264 1264 CYS CYS A . n 
A 1 851  LYS 851  1265 1265 LYS LYS A . n 
A 1 852  LYS 852  1266 1266 LYS LYS A . n 
A 1 853  ILE 853  1267 1267 ILE ILE A . n 
A 1 854  LYS 854  1268 1268 LYS LYS A . n 
A 1 855  TYR 855  1269 1269 TYR TYR A . n 
A 1 856  MET 856  1270 1270 MET MET A . n 
A 1 857  PHE 857  1271 1271 PHE PHE A . n 
A 1 858  PRO 858  1272 1272 PRO PRO A . n 
A 1 859  LYS 859  1273 1273 LYS LYS A . n 
A 1 860  ALA 860  1274 1274 ALA ALA A . n 
A 1 861  HIS 861  1275 1275 HIS HIS A . n 
A 1 862  ALA 862  1276 1276 ALA ALA A . n 
A 1 863  ALA 863  1277 1277 ALA ALA A . n 
A 1 864  ALA 864  1278 1278 ALA ALA A . n 
A 1 865  TYR 865  1279 1279 TYR TYR A . n 
A 1 866  VAL 866  1280 1280 VAL VAL A . n 
A 1 867  LEU 867  1281 1281 LEU LEU A . n 
A 1 868  MET 868  1282 1282 MET MET A . n 
A 1 869  ALA 869  1283 1283 ALA ALA A . n 
A 1 870  VAL 870  1284 1284 VAL VAL A . n 
A 1 871  ARG 871  1285 1285 ARG ARG A . n 
A 1 872  ILE 872  1286 1286 ILE ILE A . n 
A 1 873  ALA 873  1287 1287 ALA ALA A . n 
A 1 874  TYR 874  1288 1288 TYR TYR A . n 
A 1 875  PHE 875  1289 1289 PHE PHE A . n 
A 1 876  LYS 876  1290 1290 LYS LYS A . n 
A 1 877  VAL 877  1291 1291 VAL VAL A . n 
A 1 878  HIS 878  1292 1292 HIS HIS A . n 
A 1 879  HIS 879  1293 1293 HIS HIS A . n 
A 1 880  PRO 880  1294 1294 PRO PRO A . n 
A 1 881  LEU 881  1295 1295 LEU LEU A . n 
A 1 882  LEU 882  1296 1296 LEU LEU A . n 
A 1 883  TYR 883  1297 1297 TYR TYR A . n 
A 1 884  TYR 884  1298 1298 TYR TYR A . n 
A 1 885  ALA 885  1299 1299 ALA ALA A . n 
A 1 886  SER 886  1300 1300 SER SER A . n 
A 1 887  TYR 887  1301 1301 TYR TYR A . n 
A 1 888  PHE 888  1302 1302 PHE PHE A . n 
A 1 889  THR 889  1303 1303 THR THR A . n 
A 1 890  VAL 890  1304 1304 VAL VAL A . n 
A 1 891  ARG 891  1305 1305 ARG ARG A . n 
A 1 892  ALA 892  1306 1306 ALA ALA A . n 
A 1 893  GLU 893  1307 1307 GLU GLU A . n 
A 1 894  ASP 894  1308 1308 ASP ASP A . n 
A 1 895  PHE 895  1309 1309 PHE PHE A . n 
A 1 896  ASP 896  1310 1310 ASP ASP A . n 
A 1 897  LEU 897  1311 1311 LEU LEU A . n 
A 1 898  ASP 898  1312 1312 ASP ASP A . n 
A 1 899  ALA 899  1313 1313 ALA ALA A . n 
A 1 900  MET 900  1314 1314 MET MET A . n 
A 1 901  ILE 901  1315 1315 ILE ILE A . n 
A 1 902  LYS 902  1316 1316 LYS LYS A . n 
A 1 903  GLY 903  1317 1317 GLY GLY A . n 
A 1 904  SER 904  1318 1318 SER SER A . n 
A 1 905  ALA 905  1319 1319 ALA ALA A . n 
A 1 906  ALA 906  1320 1320 ALA ALA A . n 
A 1 907  ILE 907  1321 1321 ILE ILE A . n 
A 1 908  ARG 908  1322 1322 ARG ARG A . n 
A 1 909  LYS 909  1323 1323 LYS LYS A . n 
A 1 910  ARG 910  1324 1324 ARG ARG A . n 
A 1 911  ILE 911  1325 1325 ILE ILE A . n 
A 1 912  GLU 912  1326 1326 GLU GLU A . n 
A 1 913  GLU 913  1327 1327 GLU GLU A . n 
A 1 914  ILE 914  1328 1328 ILE ILE A . n 
A 1 915  ASN 915  1329 1329 ASN ASN A . n 
A 1 916  ALA 916  1330 1330 ALA ALA A . n 
A 1 917  LYS 917  1331 1331 LYS LYS A . n 
A 1 918  GLY 918  1332 1332 GLY GLY A . n 
A 1 919  ILE 919  1333 1333 ILE ILE A . n 
A 1 920  GLN 920  1334 1334 GLN GLN A . n 
A 1 921  ALA 921  1335 1335 ALA ALA A . n 
A 1 922  THR 922  1336 1336 THR THR A . n 
A 1 923  ALA 923  1337 1337 ALA ALA A . n 
A 1 924  LYS 924  1338 1338 LYS LYS A . n 
A 1 925  GLU 925  1339 1339 GLU GLU A . n 
A 1 926  LYS 926  1340 1340 LYS LYS A . n 
A 1 927  SER 927  1341 1341 SER SER A . n 
A 1 928  LEU 928  1342 1342 LEU LEU A . n 
A 1 929  LEU 929  1343 1343 LEU LEU A . n 
A 1 930  THR 930  1344 1344 THR THR A . n 
A 1 931  VAL 931  1345 1345 VAL VAL A . n 
A 1 932  LEU 932  1346 1346 LEU LEU A . n 
A 1 933  GLU 933  1347 1347 GLU GLU A . n 
A 1 934  VAL 934  1348 1348 VAL VAL A . n 
A 1 935  ALA 935  1349 1349 ALA ALA A . n 
A 1 936  LEU 936  1350 1350 LEU LEU A . n 
A 1 937  GLU 937  1351 1351 GLU GLU A . n 
A 1 938  MET 938  1352 1352 MET MET A . n 
A 1 939  CYS 939  1353 1353 CYS CYS A . n 
A 1 940  GLU 940  1354 1354 GLU GLU A . n 
A 1 941  ARG 941  1355 1355 ARG ARG A . n 
A 1 942  GLY 942  1356 1356 GLY GLY A . n 
A 1 943  PHE 943  1357 1357 PHE PHE A . n 
A 1 944  SER 944  1358 1358 SER SER A . n 
A 1 945  PHE 945  1359 1359 PHE PHE A . n 
A 1 946  LYS 946  1360 1360 LYS LYS A . n 
A 1 947  ASN 947  1361 1361 ASN ASN A . n 
A 1 948  ILE 948  1362 1362 ILE ILE A . n 
A 1 949  ASP 949  1363 1363 ASP ASP A . n 
A 1 950  LEU 950  1364 1364 LEU LEU A . n 
A 1 951  TYR 951  1365 1365 TYR TYR A . n 
A 1 952  ARG 952  1366 1366 ARG ARG A . n 
A 1 953  SER 953  1367 1367 SER SER A . n 
A 1 954  GLN 954  1368 1368 GLN GLN A . n 
A 1 955  ALA 955  1369 1369 ALA ALA A . n 
A 1 956  THR 956  1370 1370 THR THR A . n 
A 1 957  GLU 957  1371 1371 GLU GLU A . n 
A 1 958  PHE 958  1372 1372 PHE PHE A . n 
A 1 959  VAL 959  1373 1373 VAL VAL A . n 
A 1 960  ILE 960  1374 1374 ILE ILE A . n 
A 1 961  ASP 961  1375 1375 ASP ASP A . n 
A 1 962  GLY 962  1376 1376 GLY GLY A . n 
A 1 963  ASN 963  1377 1377 ASN ASN A . n 
A 1 964  SER 964  1378 1378 SER SER A . n 
A 1 965  LEU 965  1379 1379 LEU LEU A . n 
A 1 966  ILE 966  1380 1380 ILE ILE A . n 
A 1 967  PRO 967  1381 1381 PRO PRO A . n 
A 1 968  PRO 968  1382 1382 PRO PRO A . n 
A 1 969  PHE 969  1383 1383 PHE PHE A . n 
A 1 970  ASN 970  1384 1384 ASN ASN A . n 
A 1 971  ALA 971  1385 1385 ALA ALA A . n 
A 1 972  ILE 972  1386 1386 ILE ILE A . n 
A 1 973  PRO 973  1387 1387 PRO PRO A . n 
A 1 974  GLY 974  1388 1388 GLY GLY A . n 
A 1 975  LEU 975  1389 1389 LEU LEU A . n 
A 1 976  GLY 976  1390 1390 GLY GLY A . n 
A 1 977  THR 977  1391 1391 THR THR A . n 
A 1 978  ASN 978  1392 1392 ASN ASN A . n 
A 1 979  VAL 979  1393 1393 VAL VAL A . n 
A 1 980  ALA 980  1394 1394 ALA ALA A . n 
A 1 981  GLN 981  1395 1395 GLN GLN A . n 
A 1 982  ALA 982  1396 1396 ALA ALA A . n 
A 1 983  ILE 983  1397 1397 ILE ILE A . n 
A 1 984  VAL 984  1398 1398 VAL VAL A . n 
A 1 985  ARG 985  1399 1399 ARG ARG A . n 
A 1 986  ALA 986  1400 1400 ALA ALA A . n 
A 1 987  ARG 987  1401 1401 ARG ARG A . n 
A 1 988  GLU 988  1402 1402 GLU GLU A . n 
A 1 989  GLU 989  1403 1403 GLU GLU A . n 
A 1 990  GLY 990  1404 1404 GLY GLY A . n 
A 1 991  GLU 991  1405 1405 GLU GLU A . n 
A 1 992  PHE 992  1406 1406 PHE PHE A . n 
A 1 993  LEU 993  1407 1407 LEU LEU A . n 
A 1 994  SER 994  1408 1408 SER SER A . n 
A 1 995  LYS 995  1409 1409 LYS LYS A . n 
A 1 996  GLU 996  1410 1410 GLU GLU A . n 
A 1 997  ASP 997  1411 1411 ASP ASP A . n 
A 1 998  LEU 998  1412 1412 LEU LEU A . n 
A 1 999  GLN 999  1413 1413 GLN GLN A . n 
A 1 1000 GLN 1000 1414 1414 GLN GLN A . n 
A 1 1001 ARG 1001 1415 1415 ARG ARG A . n 
A 1 1002 GLY 1002 1416 1416 GLY GLY A . n 
A 1 1003 LYS 1003 1417 1417 LYS LYS A . n 
A 1 1004 LEU 1004 1418 1418 LEU LEU A . n 
A 1 1005 SER 1005 1419 1419 SER SER A . n 
A 1 1006 LYS 1006 1420 1420 LYS LYS A . n 
A 1 1007 THR 1007 1421 1421 THR THR A . n 
A 1 1008 LEU 1008 1422 1422 LEU LEU A . n 
A 1 1009 LEU 1009 1423 1423 LEU LEU A . n 
A 1 1010 GLU 1010 1424 1424 GLU GLU A . n 
A 1 1011 TYR 1011 1425 1425 TYR TYR A . n 
A 1 1012 LEU 1012 1426 1426 LEU LEU A . n 
A 1 1013 GLU 1013 1427 1427 GLU GLU A . n 
A 1 1014 SER 1014 1428 1428 SER SER A . n 
A 1 1015 ARG 1015 1429 1429 ARG ARG A . n 
A 1 1016 GLY 1016 1430 1430 GLY GLY A . n 
A 1 1017 CYS 1017 1431 1431 CYS CYS A . n 
A 1 1018 LEU 1018 1432 1432 LEU LEU A . n 
A 1 1019 ASP 1019 1433 1433 ASP ASP A . n 
A 1 1020 SER 1020 1434 1434 SER SER A . n 
A 1 1021 LEU 1021 1435 1435 LEU LEU A . n 
A 1 1022 PRO 1022 1436 1436 PRO PRO A . n 
A 1 1023 ASP 1023 1437 1437 ASP ASP A . n 
A 1 1024 HIS 1024 1438 1438 HIS HIS A . n 
A 1 1025 ASN 1025 1439 1439 ASN ASN A . n 
A 1 1026 GLN 1026 1440 1440 GLN GLN A . n 
A 1 1027 LEU 1027 1441 1441 LEU LEU A . n 
A 1 1028 SER 1028 1442 1442 SER SER A . n 
A 1 1029 LEU 1029 1443 1443 LEU LEU A . n 
A 1 1030 PHE 1030 1444 1444 PHE PHE A . n 
A 1 1031 SER 1031 1445 ?    ?   ?   A . n 
A 1 1032 GLY 1032 1446 ?    ?   ?   A . n 
A 1 1033 GLY 1033 1447 ?    ?   ?   A . n 
A 1 1034 HIS 1034 1448 ?    ?   ?   A . n 
A 1 1035 HIS 1035 1449 ?    ?   ?   A . n 
A 1 1036 HIS 1036 1450 ?    ?   ?   A . n 
A 1 1037 HIS 1037 1451 ?    ?   ?   A . n 
A 1 1038 HIS 1038 1452 ?    ?   ?   A . n 
A 1 1039 HIS 1039 1453 ?    ?   ?   A . n 
A 1 1040 HIS 1040 1454 ?    ?   ?   A . n 
A 1 1041 HIS 1041 1455 ?    ?   ?   A . n 
B 2 1    DC  1    1    ?    ?   ?   P . n 
B 2 2    DA  2    2    ?    ?   ?   P . n 
B 2 3    DG  3    3    ?    ?   ?   P . n 
B 2 4    DT  4    4    ?    ?   ?   P . n 
B 2 5    DG  5    5    5    DG  DG  P . n 
B 2 6    DA  6    6    6    DA  DA  P . n 
B 2 7    DG  7    7    7    DG  DG  P . n 
B 2 8    DA  8    8    8    DA  DA  P . n 
B 2 9    DC  9    9    9    DC  DC  P . n 
B 2 10   DG  10   10   10   DG  DG  P . n 
B 2 11   DG  11   11   11   DG  DG  P . n 
B 2 12   DG  12   12   12   DG  DG  P . n 
B 2 13   DC  13   13   13   DC  DC  P . n 
B 2 14   DA  14   14   14   DA  DA  P . n 
B 2 15   DA  15   15   15   DA  DA  P . n 
B 2 16   DC  16   16   16   DC  DC  P . n 
B 2 17   DC  17   17   17   DC  DC  P . n 
C 3 1    DA  1    1    1    DA  DA  T . n 
C 3 2    DT  2    2    2    DT  DT  T . n 
C 3 3    DA  3    3    3    DA  DA  T . n 
C 3 4    DA  4    4    4    DA  DA  T . n 
C 3 5    DC  5    5    5    DC  DC  T . n 
C 3 6    DG  6    6    6    DG  DG  T . n 
C 3 7    DG  7    7    7    DG  DG  T . n 
C 3 8    DT  8    8    8    DT  DT  T . n 
C 3 9    DT  9    9    9    DT  DT  T . n 
C 3 10   DG  10   10   10   DG  DG  T . n 
C 3 11   DC  11   11   11   DC  DC  T . n 
C 3 12   DC  12   12   12   DC  DC  T . n 
C 3 13   DC  13   13   13   DC  DC  T . n 
C 3 14   DG  14   14   14   DG  DG  T . n 
C 3 15   DT  15   15   15   DT  DT  T . n 
C 3 16   DC  16   16   16   DC  DC  T . n 
C 3 17   DT  17   17   17   DT  DT  T . n 
C 3 18   DC  18   18   18   DC  DC  T . n 
C 3 19   DA  19   19   ?    ?   ?   T . n 
C 3 20   DC  20   20   ?    ?   ?   T . n 
C 3 21   DT  21   21   ?    ?   ?   T . n 
C 3 22   DG  22   22   ?    ?   ?   T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 PO4 1  1    1   PO4 PO4 A . 
E 4 PO4 1  2    2   PO4 PO4 A . 
F 4 PO4 1  3    3   PO4 PO4 A . 
G 5 ZN  1  4    4   ZN  ZN  A . 
H 6 MG  1  5    5   MG  MG  A . 
I 6 MG  1  6    6   MG  MG  A . 
J 6 MG  1  7    7   MG  MG  A . 
K 7 DGT 1  1456 1   DGT DGT A . 
L 8 HOH 1  8    8   HOH HOH A . 
L 8 HOH 2  9    9   HOH HOH A . 
L 8 HOH 3  10   10  HOH HOH A . 
L 8 HOH 4  11   11  HOH HOH A . 
L 8 HOH 5  12   12  HOH HOH A . 
L 8 HOH 6  13   13  HOH HOH A . 
L 8 HOH 7  14   14  HOH HOH A . 
L 8 HOH 8  15   15  HOH HOH A . 
L 8 HOH 9  16   16  HOH HOH A . 
L 8 HOH 10 17   17  HOH HOH A . 
L 8 HOH 11 18   18  HOH HOH A . 
L 8 HOH 12 19   19  HOH HOH A . 
L 8 HOH 13 20   20  HOH HOH A . 
L 8 HOH 14 21   21  HOH HOH A . 
L 8 HOH 15 22   22  HOH HOH A . 
L 8 HOH 16 23   23  HOH HOH A . 
L 8 HOH 17 24   24  HOH HOH A . 
L 8 HOH 18 25   25  HOH HOH A . 
L 8 HOH 19 26   26  HOH HOH A . 
L 8 HOH 20 27   27  HOH HOH A . 
L 8 HOH 21 28   28  HOH HOH A . 
L 8 HOH 22 29   29  HOH HOH A . 
L 8 HOH 23 30   30  HOH HOH A . 
L 8 HOH 24 31   31  HOH HOH A . 
L 8 HOH 25 32   32  HOH HOH A . 
L 8 HOH 26 33   33  HOH HOH A . 
L 8 HOH 27 34   34  HOH HOH A . 
L 8 HOH 28 37   37  HOH HOH A . 
L 8 HOH 29 38   38  HOH HOH A . 
L 8 HOH 30 40   40  HOH HOH A . 
L 8 HOH 31 41   41  HOH HOH A . 
L 8 HOH 32 42   42  HOH HOH A . 
L 8 HOH 33 43   43  HOH HOH A . 
L 8 HOH 34 44   44  HOH HOH A . 
L 8 HOH 35 46   46  HOH HOH A . 
L 8 HOH 36 49   49  HOH HOH A . 
L 8 HOH 37 50   50  HOH HOH A . 
L 8 HOH 38 51   51  HOH HOH A . 
L 8 HOH 39 52   52  HOH HOH A . 
L 8 HOH 40 53   53  HOH HOH A . 
L 8 HOH 41 54   54  HOH HOH A . 
L 8 HOH 42 57   57  HOH HOH A . 
L 8 HOH 43 59   59  HOH HOH A . 
L 8 HOH 44 60   60  HOH HOH A . 
L 8 HOH 45 61   61  HOH HOH A . 
L 8 HOH 46 63   63  HOH HOH A . 
L 8 HOH 47 64   64  HOH HOH A . 
L 8 HOH 48 65   65  HOH HOH A . 
L 8 HOH 49 66   66  HOH HOH A . 
L 8 HOH 50 67   67  HOH HOH A . 
L 8 HOH 51 68   68  HOH HOH A . 
L 8 HOH 52 69   69  HOH HOH A . 
L 8 HOH 53 72   72  HOH HOH A . 
L 8 HOH 54 73   73  HOH HOH A . 
L 8 HOH 55 74   74  HOH HOH A . 
L 8 HOH 56 75   75  HOH HOH A . 
L 8 HOH 57 76   76  HOH HOH A . 
L 8 HOH 58 77   77  HOH HOH A . 
L 8 HOH 59 78   78  HOH HOH A . 
L 8 HOH 60 79   79  HOH HOH A . 
L 8 HOH 61 80   80  HOH HOH A . 
L 8 HOH 62 81   81  HOH HOH A . 
L 8 HOH 63 82   82  HOH HOH A . 
L 8 HOH 64 83   83  HOH HOH A . 
L 8 HOH 65 84   84  HOH HOH A . 
L 8 HOH 66 85   85  HOH HOH A . 
L 8 HOH 67 86   86  HOH HOH A . 
L 8 HOH 68 87   87  HOH HOH A . 
L 8 HOH 69 88   88  HOH HOH A . 
L 8 HOH 70 89   89  HOH HOH A . 
L 8 HOH 71 90   90  HOH HOH A . 
L 8 HOH 72 91   91  HOH HOH A . 
L 8 HOH 73 92   92  HOH HOH A . 
L 8 HOH 74 93   93  HOH HOH A . 
L 8 HOH 75 97   97  HOH HOH A . 
L 8 HOH 76 98   98  HOH HOH A . 
L 8 HOH 77 99   99  HOH HOH A . 
L 8 HOH 78 101  101 HOH HOH A . 
L 8 HOH 79 1457 1   HOH HOH A . 
L 8 HOH 80 1458 2   HOH HOH A . 
L 8 HOH 81 1459 3   HOH HOH A . 
L 8 HOH 82 1460 5   HOH HOH A . 
L 8 HOH 83 1461 6   HOH HOH A . 
L 8 HOH 84 1462 7   HOH HOH A . 
M 8 HOH 1  45   45  HOH HOH P . 
M 8 HOH 2  48   48  HOH HOH P . 
M 8 HOH 3  94   94  HOH HOH P . 
M 8 HOH 4  95   95  HOH HOH P . 
N 8 HOH 1  35   35  HOH HOH T . 
N 8 HOH 2  36   36  HOH HOH T . 
N 8 HOH 3  39   39  HOH HOH T . 
N 8 HOH 4  58   58  HOH HOH T . 
N 8 HOH 5  70   70  HOH HOH T . 
N 8 HOH 6  96   96  HOH HOH T . 
N 8 HOH 7  100  100 HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6570  ? 
1 MORE         -73   ? 
1 'SSA (A^2)'  45660 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 120 ? A HIS 346  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 NE2 ? A HIS 122 ? A HIS 348  ? 1_555 107.8 ? 
2  NE2 ? A HIS 120 ? A HIS 346  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 OE1 ? A GLU 179 ? A GLU 405  ? 1_555 80.7  ? 
3  NE2 ? A HIS 122 ? A HIS 348  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 OE1 ? A GLU 179 ? A GLU 405  ? 1_555 101.6 ? 
4  NE2 ? A HIS 120 ? A HIS 346  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 OD1 ? A ASN 329 ? A ASN 743  ? 1_555 91.4  ? 
5  NE2 ? A HIS 122 ? A HIS 348  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 OD1 ? A ASN 329 ? A ASN 743  ? 1_555 92.8  ? 
6  OE1 ? A GLU 179 ? A GLU 405  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 OD1 ? A ASN 329 ? A ASN 743  ? 1_555 165.1 ? 
7  NE2 ? A HIS 120 ? A HIS 346  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 O   ? L HOH .   ? A HOH 92   ? 1_555 143.4 ? 
8  NE2 ? A HIS 122 ? A HIS 348  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 O   ? L HOH .   ? A HOH 92   ? 1_555 106.9 ? 
9  OE1 ? A GLU 179 ? A GLU 405  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 O   ? L HOH .   ? A HOH 92   ? 1_555 81.1  ? 
10 OD1 ? A ASN 329 ? A ASN 743  ? 1_555 MG ? J MG . ? A MG 7 ? 1_555 O   ? L HOH .   ? A HOH 92   ? 1_555 98.3  ? 
11 OE1 ? A GLU 179 ? A GLU 405  ? 1_555 MG ? I MG . ? A MG 6 ? 1_555 O   ? L HOH .   ? A HOH 92   ? 1_555 92.1  ? 
12 SG  ? A CYS 505 ? A CYS 919  ? 1_555 ZN ? G ZN . ? A ZN 4 ? 1_555 SG  ? A CYS 508 ? A CYS 922  ? 1_555 110.7 ? 
13 SG  ? A CYS 505 ? A CYS 919  ? 1_555 ZN ? G ZN . ? A ZN 4 ? 1_555 SG  ? A CYS 530 ? A CYS 944  ? 1_555 110.9 ? 
14 SG  ? A CYS 508 ? A CYS 922  ? 1_555 ZN ? G ZN . ? A ZN 4 ? 1_555 SG  ? A CYS 530 ? A CYS 944  ? 1_555 100.6 ? 
15 SG  ? A CYS 505 ? A CYS 919  ? 1_555 ZN ? G ZN . ? A ZN 4 ? 1_555 SG  ? A CYS 533 ? A CYS 947  ? 1_555 76.5  ? 
16 SG  ? A CYS 508 ? A CYS 922  ? 1_555 ZN ? G ZN . ? A ZN 4 ? 1_555 SG  ? A CYS 533 ? A CYS 947  ? 1_555 130.0 ? 
17 SG  ? A CYS 530 ? A CYS 944  ? 1_555 ZN ? G ZN . ? A ZN 4 ? 1_555 SG  ? A CYS 533 ? A CYS 947  ? 1_555 123.7 ? 
18 OD2 ? A ASP 559 ? A ASP 973  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 OD2 ? A ASP 561 ? A ASP 975  ? 1_555 88.9  ? 
19 OD2 ? A ASP 559 ? A ASP 973  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O2A ? K DGT .   ? A DGT 1456 ? 1_555 90.3  ? 
20 OD2 ? A ASP 561 ? A ASP 975  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O2A ? K DGT .   ? A DGT 1456 ? 1_555 100.1 ? 
21 OD2 ? A ASP 559 ? A ASP 973  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O2G ? K DGT .   ? A DGT 1456 ? 1_555 86.1  ? 
22 OD2 ? A ASP 561 ? A ASP 975  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O2G ? K DGT .   ? A DGT 1456 ? 1_555 164.9 ? 
23 O2A ? K DGT .   ? A DGT 1456 ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O2G ? K DGT .   ? A DGT 1456 ? 1_555 94.1  ? 
24 OD2 ? A ASP 559 ? A ASP 973  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O   ? L HOH .   ? A HOH 1457 ? 1_555 79.4  ? 
25 OD2 ? A ASP 561 ? A ASP 975  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O   ? L HOH .   ? A HOH 1457 ? 1_555 79.7  ? 
26 O2A ? K DGT .   ? A DGT 1456 ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O   ? L HOH .   ? A HOH 1457 ? 1_555 169.7 ? 
27 O2G ? K DGT .   ? A DGT 1456 ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O   ? L HOH .   ? A HOH 1457 ? 1_555 85.4  ? 
28 OD2 ? A ASP 559 ? A ASP 973  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O1B ? K DGT .   ? A DGT 1456 ? 1_555 163.4 ? 
29 OD2 ? A ASP 561 ? A ASP 975  ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O1B ? K DGT .   ? A DGT 1456 ? 1_555 95.0  ? 
30 O2A ? K DGT .   ? A DGT 1456 ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O1B ? K DGT .   ? A DGT 1456 ? 1_555 104.8 ? 
31 O2G ? K DGT .   ? A DGT 1456 ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O1B ? K DGT .   ? A DGT 1456 ? 1_555 86.1  ? 
32 O   ? L HOH .   ? A HOH 1457 ? 1_555 MG ? H MG . ? A MG 5 ? 1_555 O1B ? K DGT .   ? A DGT 1456 ? 1_555 85.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-01-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-07-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Refinement description'    
5 3 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen 
2 3 'Structure model' software       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 38.2807 -12.1426 -16.1455 -0.0716 -0.0759 -0.1267 -0.0459 0.0062  0.0776  6.2547 3.4847 3.3164 
-2.1880 1.8214  -2.2223 0.1029  0.1508  -0.2536 -0.0269 -0.1923 0.1999  -0.2610 0.2261  0.0005  
'X-RAY DIFFRACTION' 2  ? refined 38.5900 4.3948   -46.4176 0.1107  -0.0337 -0.1031 -0.1935 -0.0693 0.0333  0.8618 1.9122 2.2246 
0.5266  -0.3795 0.0043  -0.1189 0.3534  -0.2345 -0.0029 -0.1036 -0.1164 -0.1561 0.5792  -0.3697 
'X-RAY DIFFRACTION' 3  ? refined 28.1327 12.3487  -57.2261 -0.0555 0.3352  -0.1750 -0.3262 -0.1219 0.1301  1.2050 3.0102 3.2898 
-0.1327 0.2080  0.5967  -0.0954 0.2305  -0.1351 0.3297  0.1666  0.2198  -0.3685 0.3546  -1.0761 
'X-RAY DIFFRACTION' 4  ? refined 23.9795 -1.6722  -49.0967 0.1967  0.3966  -0.0469 -0.5306 -0.1490 0.1297  0.5410 1.2186 7.2598 
-0.0845 -1.9341 0.9472  -0.2886 0.3494  -0.0608 0.5237  -0.1452 0.1930  -0.2767 0.8801  -1.6472 
'X-RAY DIFFRACTION' 5  ? refined 38.9952 1.0510   -53.3966 0.1489  -0.0112 -0.1542 -0.2690 -0.0292 0.0007  0.8272 1.7082 1.5743 
0.8358  0.3859  0.3817  -0.1512 0.4086  -0.2574 0.1995  -0.1771 -0.4038 -0.3276 0.5009  -0.3021 
'X-RAY DIFFRACTION' 6  ? refined 55.6995 44.7092  -25.8983 -0.0145 -0.0955 -0.0176 -0.0095 0.0457  -0.0080 1.3384 0.7591 2.5441 
0.3636  0.3033  -0.1983 0.1305  -0.0135 -0.1170 0.0219  0.0924  -0.0852 0.0496  -0.4934 0.2139  
'X-RAY DIFFRACTION' 7  ? refined 34.4785 24.5086  -31.5013 -0.1042 0.0573  -0.0228 0.0172  -0.0011 0.0789  0.2318 0.7185 0.2991 
-0.0448 0.0487  -0.1130 0.0030  0.2034  -0.2064 0.0079  0.0932  0.1482  0.0014  0.0118  -0.2095 
'X-RAY DIFFRACTION' 8  ? refined 51.5789 28.5676  -9.9096  -0.0617 -0.0439 -0.0551 0.0342  -0.0175 -0.0093 1.5735 0.3185 1.2777 
-0.4002 -0.2795 -0.0926 0.0315  0.0522  -0.0837 -0.1152 0.0230  -0.0693 0.0855  0.0964  0.0830  
'X-RAY DIFFRACTION' 9  ? refined 25.6167 30.3168  -1.0801  -0.0634 0.0290  -0.0629 0.0521  0.0170  0.0786  2.8411 4.5791 1.4698 
-2.6449 -0.6712 -0.5603 0.0434  0.0085  -0.0520 -0.2805 -0.3632 0.2056  0.0951  0.2194  -0.3591 
'X-RAY DIFFRACTION' 10 ? refined 9.0215  45.1770  -12.4536 -0.0401 0.0997  -0.0729 0.1150  0.0531  0.0218  7.8110 0.4371 0.0856 
-1.8416 0.6514  -0.1631 0.0908  -0.1822 0.0915  0.4082  0.1689  0.0009  -0.1412 -0.0908 -0.0605 
'X-RAY DIFFRACTION' 11 ? refined 23.6307 24.2914  -19.8596 -0.0927 0.2076  0.1084  0.0397  0.0458  0.0185  1.5170 0.8953 1.0484 
0.5047  0.4031  0.9615  -0.1504 -0.1306 0.2810  0.0227  0.1239  0.3199  0.0688  -0.0795 -0.4796 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 233  A 331  ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 332  A 411  ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 619  A 708  ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 716  A 772  ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 773  A 825  ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  A 826  A 996  ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  A 997  A 1122 ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  A 1123 A 1307 ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  A 1308 A 1359 ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 A 1360 A 1444 ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 P 5    P 17   ? . . . . ? 
'X-RAY DIFFRACTION' 12 11 T 1    T 18   ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.4.0069 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG  A CYS 947 ? ? OG1 A THR 949 ? ? 1.96 
2 1 NH1 A ARG 654 ? ? OE2 A GLU 674 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG    A GLU 688 ? ? CD    A GLU 688 ? ? 1.623 1.515 0.108  0.015 N 
2 1 CD    A GLU 717 ? ? OE1   A GLU 717 ? ? 1.323 1.252 0.071  0.011 N 
3 1 CD    A GLU 718 ? ? OE1   A GLU 718 ? ? 1.182 1.252 -0.070 0.011 N 
4 1 "O4'" T DT  8   ? ? "C4'" T DT  8   ? ? 1.346 1.446 -0.100 0.010 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C     A GLY 792 ? ? N     A PRO 793 ? ? CA    A PRO 793 ? ? 128.36 119.30 9.06   1.50 Y 
2  1 CB    A VAL 896 ? ? CA    A VAL 896 ? ? C     A VAL 896 ? ? 99.70  111.40 -11.70 1.90 N 
3  1 "C3'" P DG  5   ? ? "O3'" P DG  5   ? ? P     P DA  6   ? ? 126.98 119.70 7.28   1.20 Y 
4  1 "O4'" P DA  6   ? ? "C1'" P DA  6   ? ? N9    P DA  6   ? ? 111.47 108.30 3.17   0.30 N 
5  1 "C3'" P DG  7   ? ? "C2'" P DG  7   ? ? "C1'" P DG  7   ? ? 97.52  102.40 -4.88  0.80 N 
6  1 "O4'" P DG  7   ? ? "C1'" P DG  7   ? ? N9    P DG  7   ? ? 110.81 108.30 2.51   0.30 N 
7  1 "C3'" P DA  8   ? ? "O3'" P DA  8   ? ? P     P DC  9   ? ? 112.16 119.70 -7.54  1.20 Y 
8  1 "O4'" P DG  12  ? ? "C1'" P DG  12  ? ? N9    P DG  12  ? ? 111.94 108.30 3.64   0.30 N 
9  1 "O4'" P DC  13  ? ? "C1'" P DC  13  ? ? N1    P DC  13  ? ? 110.73 108.30 2.43   0.30 N 
10 1 C5    P DC  13  ? ? C4    P DC  13  ? ? N4    P DC  13  ? ? 115.19 120.20 -5.01  0.70 N 
11 1 "C5'" P DC  16  ? ? "C4'" P DC  16  ? ? "O4'" P DC  16  ? ? 117.10 109.80 7.30   1.10 N 
12 1 "O4'" P DC  16  ? ? "C1'" P DC  16  ? ? N1    P DC  16  ? ? 118.57 108.30 10.27  0.30 N 
13 1 N1    P DC  17  ? ? "C1'" P DC  17  ? ? "C2'" P DC  17  ? ? 123.10 114.30 8.80   1.40 N 
14 1 "O4'" P DC  17  ? ? "C1'" P DC  17  ? ? N1    P DC  17  ? ? 103.29 108.00 -4.71  0.70 N 
15 1 N3    P DC  17  ? ? C4    P DC  17  ? ? N4    P DC  17  ? ? 112.06 118.00 -5.94  0.70 N 
16 1 C5    P DC  17  ? ? C4    P DC  17  ? ? N4    P DC  17  ? ? 124.65 120.20 4.45   0.70 N 
17 1 "O4'" T DA  3   ? ? "C1'" T DA  3   ? ? N9    T DA  3   ? ? 103.73 108.00 -4.27  0.70 N 
18 1 "O4'" T DC  5   ? ? "C1'" T DC  5   ? ? N1    T DC  5   ? ? 103.54 108.00 -4.46  0.70 N 
19 1 "O5'" T DT  8   ? ? P     T DT  8   ? ? OP2   T DT  8   ? ? 99.86  105.70 -5.84  0.90 N 
20 1 "C5'" T DT  8   ? ? "C4'" T DT  8   ? ? "C3'" T DT  8   ? ? 124.30 115.70 8.60   1.20 N 
21 1 "C5'" T DT  8   ? ? "C4'" T DT  8   ? ? "O4'" T DT  8   ? ? 118.61 109.80 8.81   1.10 N 
22 1 N1    T DT  8   ? ? "C1'" T DT  8   ? ? "C2'" T DT  8   ? ? 87.87  112.60 -24.73 1.90 N 
23 1 "O4'" T DT  8   ? ? "C1'" T DT  8   ? ? N1    T DT  8   ? ? 119.27 108.30 10.97  0.30 N 
24 1 C5    T DT  8   ? ? C4    T DT  8   ? ? O4    T DT  8   ? ? 120.44 124.90 -4.46  0.70 N 
25 1 C6    T DC  13  ? ? N1    T DC  13  ? ? C2    T DC  13  ? ? 123.55 120.30 3.25   0.40 N 
26 1 C2    T DC  13  ? ? N3    T DC  13  ? ? C4    T DC  13  ? ? 116.71 119.90 -3.19  0.50 N 
27 1 N3    T DC  13  ? ? C4    T DC  13  ? ? C5    T DC  13  ? ? 124.54 121.90 2.64   0.40 N 
28 1 C5    T DC  13  ? ? C6    T DC  13  ? ? N1    T DC  13  ? ? 117.37 121.00 -3.63  0.50 N 
29 1 "C3'" T DT  15  ? ? "O3'" T DT  15  ? ? P     T DC  16  ? ? 130.17 119.70 10.47  1.20 Y 
30 1 N1    T DC  16  ? ? C2    T DC  16  ? ? O2    T DC  16  ? ? 122.95 118.90 4.05   0.60 N 
31 1 "C3'" T DC  16  ? ? "O3'" T DC  16  ? ? P     T DT  17  ? ? 128.04 119.70 8.34   1.20 Y 
32 1 "O4'" T DT  17  ? ? "C1'" T DT  17  ? ? N1    T DT  17  ? ? 113.27 108.30 4.97   0.30 N 
33 1 C4    T DT  17  ? ? C5    T DT  17  ? ? C7    T DT  17  ? ? 123.16 119.00 4.16   0.60 N 
34 1 C6    T DT  17  ? ? C5    T DT  17  ? ? C7    T DT  17  ? ? 118.46 122.90 -4.44  0.60 N 
35 1 "O4'" T DC  18  ? ? "C1'" T DC  18  ? ? N1    T DC  18  ? ? 110.72 108.30 2.42   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 243  ? ? -171.20 128.36  
2  1 TYR A 274  ? ? 81.88   1.51    
3  1 ASN A 276  ? ? -166.25 -161.49 
4  1 ASN A 330  ? ? 24.23   47.41   
5  1 ARG A 332  ? ? -39.25  127.53  
6  1 GLN A 353  ? ? -35.07  114.16  
7  1 VAL A 357  ? ? -140.51 -23.64  
8  1 ALA A 381  ? ? 65.71   -5.34   
9  1 ILE A 643  ? ? -116.68 -75.54  
10 1 HIS A 647  ? ? -101.63 -80.06  
11 1 CYS A 670  ? ? -37.22  -175.17 
12 1 PRO A 707  ? ? -55.93  98.80   
13 1 LEU A 747  ? ? -62.07  -70.83  
14 1 PRO A 767  ? ? 26.90   55.28   
15 1 LYS A 923  ? ? 72.43   -1.49   
16 1 PRO A 945  ? ? -73.67  27.21   
17 1 ARG A 946  ? ? -127.71 -51.54  
18 1 ASP A 969  ? ? -94.58  31.36   
19 1 ASN A 1025 ? ? 39.90   49.09   
20 1 MET A 1061 ? ? -114.75 -167.34 
21 1 GLN A 1070 ? ? -175.66 -170.00 
22 1 ALA A 1073 ? ? 55.55   14.68   
23 1 HIS A 1091 ? ? -39.58  -36.54  
24 1 ASP A 1125 ? ? -144.43 20.16   
25 1 CYS A 1148 ? ? -171.98 145.14  
26 1 GLU A 1157 ? ? 70.62   -62.11  
27 1 TRP A 1191 ? ? -107.85 -69.28  
28 1 ASN A 1194 ? ? -139.34 -106.36 
29 1 GLU A 1405 ? ? -45.98  160.25  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 305 ? CG    ? A ARG 79  CG    
2  1 Y 1 A ARG 305 ? CD    ? A ARG 79  CD    
3  1 Y 1 A ARG 305 ? NE    ? A ARG 79  NE    
4  1 Y 1 A ARG 305 ? CZ    ? A ARG 79  CZ    
5  1 Y 1 A ARG 305 ? NH1   ? A ARG 79  NH1   
6  1 Y 1 A ARG 305 ? NH2   ? A ARG 79  NH2   
7  1 Y 1 A ASN 330 ? CG    ? A ASN 104 CG    
8  1 Y 1 A ASN 330 ? OD1   ? A ASN 104 OD1   
9  1 Y 1 A ASN 330 ? ND2   ? A ASN 104 ND2   
10 1 Y 1 A GLU 340 ? CG    ? A GLU 114 CG    
11 1 Y 1 A GLU 340 ? CD    ? A GLU 114 CD    
12 1 Y 1 A GLU 340 ? OE1   ? A GLU 114 OE1   
13 1 Y 1 A GLU 340 ? OE2   ? A GLU 114 OE2   
14 1 Y 1 A ARG 648 ? CG    ? A ARG 234 CG    
15 1 Y 1 A ARG 648 ? CD    ? A ARG 234 CD    
16 1 Y 1 A ARG 648 ? NE    ? A ARG 234 NE    
17 1 Y 1 A ARG 648 ? CZ    ? A ARG 234 CZ    
18 1 Y 1 A ARG 648 ? NH1   ? A ARG 234 NH1   
19 1 Y 1 A ARG 648 ? NH2   ? A ARG 234 NH2   
20 1 Y 1 A LYS 706 ? CG    ? A LYS 292 CG    
21 1 Y 1 A LYS 706 ? CD    ? A LYS 292 CD    
22 1 Y 1 A LYS 706 ? CE    ? A LYS 292 CE    
23 1 Y 1 A LYS 706 ? NZ    ? A LYS 292 NZ    
24 1 Y 1 A LEU 708 ? CG    ? A LEU 294 CG    
25 1 Y 1 A LEU 708 ? CD1   ? A LEU 294 CD1   
26 1 Y 1 A LEU 708 ? CD2   ? A LEU 294 CD2   
27 1 Y 1 A TYR 713 ? CG    ? A TYR 299 CG    
28 1 Y 1 A TYR 713 ? CD1   ? A TYR 299 CD1   
29 1 Y 1 A TYR 713 ? CD2   ? A TYR 299 CD2   
30 1 Y 1 A TYR 713 ? CE1   ? A TYR 299 CE1   
31 1 Y 1 A TYR 713 ? CE2   ? A TYR 299 CE2   
32 1 Y 1 A TYR 713 ? CZ    ? A TYR 299 CZ    
33 1 Y 1 A TYR 713 ? OH    ? A TYR 299 OH    
34 1 Y 1 A VAL 714 ? CG1   ? A VAL 300 CG1   
35 1 Y 1 A VAL 714 ? CG2   ? A VAL 300 CG2   
36 1 Y 1 A LYS 715 ? CG    ? A LYS 301 CG    
37 1 Y 1 A LYS 715 ? CD    ? A LYS 301 CD    
38 1 Y 1 A LYS 715 ? CE    ? A LYS 301 CE    
39 1 Y 1 A LYS 715 ? NZ    ? A LYS 301 NZ    
40 1 Y 1 A ARG 770 ? CG    ? A ARG 356 CG    
41 1 Y 1 A ARG 770 ? CD    ? A ARG 356 CD    
42 1 Y 1 A ARG 770 ? NE    ? A ARG 356 NE    
43 1 Y 1 A ARG 770 ? CZ    ? A ARG 356 CZ    
44 1 Y 1 A ARG 770 ? NH1   ? A ARG 356 NH1   
45 1 Y 1 A ARG 770 ? NH2   ? A ARG 356 NH2   
46 1 Y 1 A HIS 771 ? CG    ? A HIS 357 CG    
47 1 Y 1 A HIS 771 ? ND1   ? A HIS 357 ND1   
48 1 Y 1 A HIS 771 ? CD2   ? A HIS 357 CD2   
49 1 Y 1 A HIS 771 ? CE1   ? A HIS 357 CE1   
50 1 Y 1 A HIS 771 ? NE2   ? A HIS 357 NE2   
51 1 Y 1 A ASP 969 ? CG    ? A ASP 555 CG    
52 1 Y 1 A ASP 969 ? OD1   ? A ASP 555 OD1   
53 1 Y 1 A ASP 969 ? OD2   ? A ASP 555 OD2   
54 1 Y 1 P DC  17  ? "O3'" ? B DC  17  "O3'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 227  ? A MET 1    
2  1 Y 1 A ARG 228  ? A ARG 2    
3  1 Y 1 A ASP 229  ? A ASP 3    
4  1 Y 1 A GLU 230  ? A GLU 4    
5  1 Y 1 A GLU 231  ? A GLU 5    
6  1 Y 1 A PRO 232  ? A PRO 6    
7  1 Y 1 A GLY 412  ? A GLY 186  
8  1 Y 1 A VAL 413  ? A VAL 187  
9  1 Y 1 A PRO 414  ? A PRO 188  
10 1 Y 1 A ILE 415  ? A ILE 189  
11 1 Y 1 A ALA 416  ? A ALA 190  
12 1 Y 1 A TYR 417  ? A TYR 191  
13 1 Y 1 A ASN 418  ? A ASN 192  
14 1 Y 1 A GLU 419  ? A GLU 193  
15 1 Y 1 A THR 420  ? A THR 194  
16 1 Y 1 A HIS 421  ? A HIS 195  
17 1 Y 1 A ARG 422  ? A ARG 196  
18 1 Y 1 A ARG 423  ? A ARG 197  
19 1 Y 1 A LEU 424  ? A LEU 198  
20 1 Y 1 A GLY 425  ? A GLY 199  
21 1 Y 1 A SER 426  ? A SER 200  
22 1 Y 1 A GLY 427  ? A GLY 201  
23 1 Y 1 A SER 428  ? A SER 202  
24 1 Y 1 A GLY 429  ? A GLY 203  
25 1 Y 1 A LEU 679  ? A LEU 265  
26 1 Y 1 A ILE 680  ? A ILE 266  
27 1 Y 1 A GLN 681  ? A GLN 267  
28 1 Y 1 A LYS 682  ? A LYS 268  
29 1 Y 1 A ALA 683  ? A ALA 269  
30 1 Y 1 A PRO 684  ? A PRO 270  
31 1 Y 1 A GLU 685  ? A GLU 271  
32 1 Y 1 A GLU 686  ? A GLU 272  
33 1 Y 1 A ILE 709  ? A ILE 295  
34 1 Y 1 A GLU 710  ? A GLU 296  
35 1 Y 1 A MET 711  ? A MET 297  
36 1 Y 1 A ASP 712  ? A ASP 298  
37 1 Y 1 A SER 1445 ? A SER 1031 
38 1 Y 1 A GLY 1446 ? A GLY 1032 
39 1 Y 1 A GLY 1447 ? A GLY 1033 
40 1 Y 1 A HIS 1448 ? A HIS 1034 
41 1 Y 1 A HIS 1449 ? A HIS 1035 
42 1 Y 1 A HIS 1450 ? A HIS 1036 
43 1 Y 1 A HIS 1451 ? A HIS 1037 
44 1 Y 1 A HIS 1452 ? A HIS 1038 
45 1 Y 1 A HIS 1453 ? A HIS 1039 
46 1 Y 1 A HIS 1454 ? A HIS 1040 
47 1 Y 1 A HIS 1455 ? A HIS 1041 
48 1 Y 1 P DC  1    ? B DC  1    
49 1 Y 1 P DA  2    ? B DA  2    
50 1 Y 1 P DG  3    ? B DG  3    
51 1 Y 1 P DT  4    ? B DT  4    
52 1 Y 1 T DA  19   ? C DA  19   
53 1 Y 1 T DC  20   ? C DC  20   
54 1 Y 1 T DT  21   ? C DT  21   
55 1 Y 1 T DG  22   ? C DG  22   
# 
_ndb_struct_conf_na.entry_id   3F2B 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 5  1_555 C DC 18 1_555 -0.942 -0.241 -0.623 -7.071 -6.743  -7.172  1  P_DG5:DC18_T  P 5  ? T 18 ? 19 1 
1 B DA 6  1_555 C DT 17 1_555 0.048  -0.073 0.662  -1.434 -8.146  -8.380  2  P_DA6:DT17_T  P 6  ? T 17 ? 20 1 
1 B DG 7  1_555 C DC 16 1_555 -0.052 -0.207 0.635  7.208  -16.714 -10.128 3  P_DG7:DC16_T  P 7  ? T 16 ? 19 1 
1 B DA 8  1_555 C DT 15 1_555 -0.162 0.068  0.816  3.202  -14.574 3.181   4  P_DA8:DT15_T  P 8  ? T 15 ? 20 1 
1 B DC 9  1_555 C DG 14 1_555 0.209  0.079  0.285  -0.676 -8.763  -1.563  5  P_DC9:DG14_T  P 9  ? T 14 ? 19 1 
1 B DG 10 1_555 C DC 13 1_555 0.231  0.071  0.334  -2.166 -11.705 -0.021  6  P_DG10:DC13_T P 10 ? T 13 ? 19 1 
1 B DG 11 1_555 C DC 12 1_555 0.322  -0.015 0.278  -0.601 -15.344 -5.193  7  P_DG11:DC12_T P 11 ? T 12 ? 19 1 
1 B DG 12 1_555 C DC 11 1_555 -0.067 -0.031 0.039  -3.721 -9.941  -3.057  8  P_DG12:DC11_T P 12 ? T 11 ? 19 1 
1 B DC 13 1_555 C DG 10 1_555 0.025  -0.067 0.105  -0.389 -11.035 2.002   9  P_DC13:DG10_T P 13 ? T 10 ? 19 1 
1 B DA 14 1_555 C DT 9  1_555 -0.234 0.078  -0.541 -6.184 -5.480  -1.409  10 P_DA14:DT9_T  P 14 ? T 9  ? 20 1 
1 B DA 15 1_555 C DT 8  1_555 0.271  -0.184 -0.128 8.861  -17.910 -4.188  11 P_DA15:DT8_T  P 15 ? T 8  ? 20 1 
1 B DC 16 1_555 C DG 7  1_555 0.325  -0.134 -0.228 4.431  -13.990 2.235   12 P_DC16:DG7_T  P 16 ? T 7  ? 19 1 
1 B DC 17 1_555 C DG 6  1_555 0.187  -0.140 0.053  -0.380 -2.102  -0.083  13 P_DC17:DG6_T  P 17 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 5  1_555 C DC 18 1_555 B DA 6  1_555 C DT 17 1_555 -0.311 0.586  3.149 -14.301 3.139  42.024 0.489  -0.898 3.124 4.226  
19.254 44.392 1  PP_DG5DA6:DT17DC18_TT   P 5  ? T 18 ? P 6  ? T 17 ? 
1 B DA 6  1_555 C DT 17 1_555 B DG 7  1_555 C DC 16 1_555 -0.002 -0.698 3.113 -0.364  3.278  25.987 -2.374 -0.089 3.003 7.253  
0.805  26.192 2  PP_DA6DG7:DC16DT17_TT   P 6  ? T 17 ? P 7  ? T 16 ? 
1 B DG 7  1_555 C DC 16 1_555 B DA 8  1_555 C DT 15 1_555 -0.111 0.209  3.244 -2.122  3.713  37.345 -0.157 -0.103 3.251 5.776  
3.301  37.581 3  PP_DG7DA8:DT15DC16_TT   P 7  ? T 16 ? P 8  ? T 15 ? 
1 B DA 8  1_555 C DT 15 1_555 B DC 9  1_555 C DG 14 1_555 0.179  -0.683 3.459 3.040   -0.211 34.753 -1.106 0.190  3.466 -0.352 
-5.077 34.882 4  PP_DA8DC9:DG14DT15_TT   P 8  ? T 15 ? P 9  ? T 14 ? 
1 B DC 9  1_555 C DG 14 1_555 B DG 10 1_555 C DC 13 1_555 0.589  0.584  3.365 4.489   8.959  37.627 -0.278 -0.306 3.455 13.598 
-6.813 38.892 5  PP_DC9DG10:DC13DG14_TT  P 9  ? T 14 ? P 10 ? T 13 ? 
1 B DG 10 1_555 C DC 13 1_555 B DG 11 1_555 C DC 12 1_555 -0.711 0.092  3.439 -3.420  -0.289 33.917 0.205  0.636  3.491 -0.493 
5.844  34.085 6  PP_DG10DG11:DC12DC13_TT P 10 ? T 13 ? P 11 ? T 12 ? 
1 B DG 11 1_555 C DC 12 1_555 B DG 12 1_555 C DC 11 1_555 0.314  -0.422 3.449 2.267   3.435  31.264 -1.448 -0.134 3.398 6.339  
-4.183 31.527 7  PP_DG11DG12:DC11DC12_TT P 11 ? T 12 ? P 12 ? T 11 ? 
1 B DG 12 1_555 C DC 11 1_555 B DC 13 1_555 C DG 10 1_555 1.138  -0.516 3.186 0.625   3.391  33.689 -1.415 -1.856 3.140 5.831  
-1.075 33.860 8  PP_DG12DC13:DG10DC11_TT P 12 ? T 11 ? P 13 ? T 10 ? 
1 B DC 13 1_555 C DG 10 1_555 B DA 14 1_555 C DT 9  1_555 -0.468 -0.449 3.521 4.281   7.973  30.177 -2.393 1.703  3.206 14.898 
-8.000 31.475 9  PP_DC13DA14:DT9DG10_TT  P 13 ? T 10 ? P 14 ? T 9  ? 
1 B DA 14 1_555 C DT 9  1_555 B DA 15 1_555 C DT 8  1_555 -0.108 -0.406 3.017 -4.809  5.532  37.894 -1.242 -0.381 2.922 8.423  
7.322  38.570 10 PP_DA14DA15:DT8DT9_TT   P 14 ? T 9  ? P 15 ? T 8  ? 
1 B DA 15 1_555 C DT 8  1_555 B DC 16 1_555 C DG 7  1_555 0.763  -0.948 3.501 2.057   -2.786 29.059 -1.217 -1.025 3.618 -5.528 
-4.082 29.260 11 PP_DA15DC16:DG7DT8_TT   P 15 ? T 8  ? P 16 ? T 7  ? 
1 B DC 16 1_555 C DG 7  1_555 B DC 17 1_555 C DG 6  1_555 -0.441 -0.551 3.655 -3.156  1.890  31.797 -1.381 0.163  3.642 3.435  
5.736  32.004 12 PP_DC16DC17:DG6DG7_TT   P 16 ? T 7  ? P 17 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'PHOSPHATE ION'                     PO4 
5 'ZINC ION'                          ZN  
6 'MAGNESIUM ION'                     MG  
7 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
8 water                               HOH 
#