data_3F40
# 
_entry.id   3F40 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3F40         
RCSB  RCSB050118   
WWPDB D_1000050118 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          390727 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        3F40 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-10-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Joint Center for Structural Genomics (JCSG)' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of NTF2-like protein of unknown function (YP_677363.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.27 A resolution
;
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id        primary 
_citation_author.name               'Joint Center for Structural Genomics (JCSG)' 
_citation_author.ordinal            1 
_citation_author.identifier_ORCID   ? 
# 
_cell.entry_id           3F40 
_cell.length_a           58.720 
_cell.length_b           60.280 
_cell.length_c           63.330 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3F40 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'uncharacterized NTF2-like protein' 13642.481 1   ? ? ? ? 
2 water   nat water                               18.015    146 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;G(MSE)KTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFNGP(MSE)GHREGSERY(MSE)ND(MSE)EK(MSE)KFK
YVVHK(MSE)FEEGNDVCLIYDIN(MSE)NGKTIAASGLYHLEKGEITSLHVYFDPRPLFEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMKTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFNGPMGHREGSERYMNDMEKMKFKYVVHKMFEEGNDVCLIYDIN
MNGKTIAASGLYHLEKGEITSLHVYFDPRPLFEE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         390727 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MSE n 
1 3   LYS n 
1 4   THR n 
1 5   GLN n 
1 6   ILE n 
1 7   THR n 
1 8   THR n 
1 9   ARG n 
1 10  ASP n 
1 11  LEU n 
1 12  VAL n 
1 13  LEU n 
1 14  GLU n 
1 15  PHE n 
1 16  ILE n 
1 17  HIS n 
1 18  ALA n 
1 19  LEU n 
1 20  ASN n 
1 21  THR n 
1 22  GLU n 
1 23  ASN n 
1 24  PHE n 
1 25  PRO n 
1 26  ALA n 
1 27  ALA n 
1 28  LYS n 
1 29  LYS n 
1 30  ARG n 
1 31  LEU n 
1 32  ASN n 
1 33  GLU n 
1 34  ASN n 
1 35  PHE n 
1 36  THR n 
1 37  PHE n 
1 38  ASN n 
1 39  GLY n 
1 40  PRO n 
1 41  MSE n 
1 42  GLY n 
1 43  HIS n 
1 44  ARG n 
1 45  GLU n 
1 46  GLY n 
1 47  SER n 
1 48  GLU n 
1 49  ARG n 
1 50  TYR n 
1 51  MSE n 
1 52  ASN n 
1 53  ASP n 
1 54  MSE n 
1 55  GLU n 
1 56  LYS n 
1 57  MSE n 
1 58  LYS n 
1 59  PHE n 
1 60  LYS n 
1 61  TYR n 
1 62  VAL n 
1 63  VAL n 
1 64  HIS n 
1 65  LYS n 
1 66  MSE n 
1 67  PHE n 
1 68  GLU n 
1 69  GLU n 
1 70  GLY n 
1 71  ASN n 
1 72  ASP n 
1 73  VAL n 
1 74  CYS n 
1 75  LEU n 
1 76  ILE n 
1 77  TYR n 
1 78  ASP n 
1 79  ILE n 
1 80  ASN n 
1 81  MSE n 
1 82  ASN n 
1 83  GLY n 
1 84  LYS n 
1 85  THR n 
1 86  ILE n 
1 87  ALA n 
1 88  ALA n 
1 89  SER n 
1 90  GLY n 
1 91  LEU n 
1 92  TYR n 
1 93  HIS n 
1 94  LEU n 
1 95  GLU n 
1 96  LYS n 
1 97  GLY n 
1 98  GLU n 
1 99  ILE n 
1 100 THR n 
1 101 SER n 
1 102 LEU n 
1 103 HIS n 
1 104 VAL n 
1 105 TYR n 
1 106 PHE n 
1 107 ASP n 
1 108 PRO n 
1 109 ARG n 
1 110 PRO n 
1 111 LEU n 
1 112 PHE n 
1 113 GLU n 
1 114 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CHU_0736, YP_677363.1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Cytophaga hutchinsonii ATCC 33406' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     269798 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 33406 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               HK100 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       SpeedET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q11X43_CYTH3 
_struct_ref.pdbx_db_accession          Q11X43 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFNGPMGHREGSERYMNDMEKMKFKYVVHKMFEEGNDVCLIYDINM
NGKTIAASGLYHLEKGEITSLHVYFDPRPLFEE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3F40 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 114 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q11X43 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  113 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       113 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3F40 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q11X43 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'leader sequence' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          3F40 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   40.11 
_exptl_crystal.description           
'THE STATISTICS REPORTED IN THE STATEMENTS ABOVE WERE COMPUTED WITH THE FRIEDEL PAIRS KEPT SEPARATE' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'0.2000M MgCl2, 30.0000% PEG-4000, 0.1M TRIS pH 8.5, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.details                'Flat collimating mirror, toroid focusing mirror' 
_diffrn_detector.pdbx_collection_date   2008-08-10 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97936 1.0 
2 0.91162 1.0 
3 0.97925 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_wavelength_list        0.97936,0.91162,0.97925 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.entry_id                     3F40 
_reflns.d_resolution_high            1.27 
_reflns.d_resolution_low             27.217 
_reflns.number_obs                   29394 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.percent_possible_obs         94.900 
_reflns.B_iso_Wilson_estimate        13.044 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.270 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
1.27 1.32   12568 ? 6098 0.519 1.9  ? ? ? ? ? 97.80 ? 1  
1.32 1.37   10914 ? 5258 0.419 2.3  ? ? ? ? ? 97.60 ? 2  
1.37 1.43   11255 ? 5374 0.338 2.8  ? ? ? ? ? 97.50 ? 3  
1.43 1.51   12511 ? 5914 0.230 3.9  ? ? ? ? ? 97.20 ? 4  
1.51 1.60   11110 ? 5218 0.143 5.9  ? ? ? ? ? 96.90 ? 5  
1.60 1.72   11665 ? 5385 0.107 7.5  ? ? ? ? ? 95.80 ? 6  
1.72 1.90   12444 ? 5663 0.072 10.6 ? ? ? ? ? 94.80 ? 7  
1.90 2.17   11680 ? 5207 0.052 14.2 ? ? ? ? ? 92.80 ? 8  
2.17 2.73   12015 ? 5208 0.047 16.7 ? ? ? ? ? 90.70 ? 9  
2.73 27.217 12021 ? 5072 0.044 18.9 ? ? ? ? ? 87.70 ? 10 
# 
_refine.entry_id                                 3F40 
_refine.ls_d_res_high                            1.270 
_refine.ls_d_res_low                             27.217 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.930 
_refine.ls_number_reflns_obs                     29370 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;1.HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2.A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 TO ACCOUNT FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.183 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.199 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1476 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               16.062 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.290 
_refine.aniso_B[2][2]                            0.120 
_refine.aniso_B[3][3]                            0.170 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.957 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.063 
_refine.pdbx_overall_ESU_R_Free                  0.053 
_refine.overall_SU_ML                            0.036 
_refine.overall_SU_B                             1.829 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                50.37 
_refine.B_iso_min                                7.16 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.20 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1040 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             150 
_refine_hist.number_atoms_total               1190 
_refine_hist.d_res_high                       1.270 
_refine_hist.d_res_low                        27.217 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       'X-RAY DIFFRACTION' 1074 0.015  0.022  ? ? 
r_bond_other_d         'X-RAY DIFFRACTION' 727  0.001  0.020  ? ? 
r_angle_refined_deg    'X-RAY DIFFRACTION' 1462 1.519  1.948  ? ? 
r_angle_other_deg      'X-RAY DIFFRACTION' 1779 1.338  3.000  ? ? 
r_dihedral_angle_1_deg 'X-RAY DIFFRACTION' 142  5.184  5.000  ? ? 
r_dihedral_angle_2_deg 'X-RAY DIFFRACTION' 49   36.610 24.898 ? ? 
r_dihedral_angle_3_deg 'X-RAY DIFFRACTION' 196  9.938  15.000 ? ? 
r_dihedral_angle_4_deg 'X-RAY DIFFRACTION' 3    11.038 15.000 ? ? 
r_chiral_restr         'X-RAY DIFFRACTION' 153  0.072  0.200  ? ? 
r_gen_planes_refined   'X-RAY DIFFRACTION' 1255 0.009  0.020  ? ? 
r_gen_planes_other     'X-RAY DIFFRACTION' 224  0.003  0.020  ? ? 
r_mcbond_it            'X-RAY DIFFRACTION' 662  1.481  1.500  ? ? 
r_mcbond_other         'X-RAY DIFFRACTION' 265  0.811  1.500  ? ? 
r_mcangle_it           'X-RAY DIFFRACTION' 1083 2.283  2.000  ? ? 
r_scbond_it            'X-RAY DIFFRACTION' 412  3.531  3.000  ? ? 
r_scangle_it           'X-RAY DIFFRACTION' 379  4.763  4.500  ? ? 
r_rigid_bond_restr     'X-RAY DIFFRACTION' 1801 1.898  3.000  ? ? 
r_sphericity_free      'X-RAY DIFFRACTION' 152  7.735  3.000  ? ? 
r_sphericity_bonded    'X-RAY DIFFRACTION' 1767 4.828  3.000  ? ? 
# 
_refine_ls_shell.d_res_high                       1.270 
_refine_ls_shell.d_res_low                        1.303 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.630 
_refine_ls_shell.number_reflns_R_work             2053 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.235 
_refine_ls_shell.R_factor_R_free                  0.309 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             99 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2152 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3F40 
_struct.title                     
;Crystal structure of NTF2-like protein of unknown function (YP_677363.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.27 A resolution
;
_struct.pdbx_descriptor           'uncharacterized NTF2-like protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;YP_677363.1, NTF2-like protein of unknown function, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
;
_struct_keywords.pdbx_keywords   'structural genomics, unknown function' 
_struct_keywords.entry_id        3F40 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;ANALYTICAL SIZE EXCLUSION CHROMATOGRAPHY MEASUREMENTS SUPPORT THE ASSIGNMENT OF A DIMER AS A SIGNIFICANT OLIGOMERIZATION STATE IN SOLUTION.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 7   ? THR A 21  ? THR A 6   THR A 20  1 ? 15 
HELX_P HELX_P2 2 ASN A 23  ? ARG A 30  ? ASN A 22  ARG A 29  1 ? 8  
HELX_P HELX_P3 3 GLY A 46  ? LYS A 58  ? GLY A 45  LYS A 57  1 ? 13 
HELX_P HELX_P4 4 PRO A 108 ? GLU A 113 ? PRO A 107 GLU A 112 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A MSE 2  C ? ? ? 1_555 A LYS 3  N ? ? A MSE 1  A LYS 2  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale2  covale both ? A PRO 40 C ? ? ? 1_555 A MSE 41 N ? ? A PRO 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.310 ? 
covale3  covale both ? A MSE 41 C ? ? ? 1_555 A GLY 42 N ? ? A MSE 40 A GLY 41 1_555 ? ? ? ? ? ? ? 1.311 ? 
covale4  covale both ? A TYR 50 C A ? ? 1_555 A MSE 51 N ? ? A TYR 49 A MSE 50 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale5  covale both ? A TYR 50 C B ? ? 1_555 A MSE 51 N ? ? A TYR 49 A MSE 50 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6  covale both ? A MSE 51 C ? ? ? 1_555 A ASN 52 N ? ? A MSE 50 A ASN 51 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale7  covale both ? A ASP 53 C ? ? ? 1_555 A MSE 54 N A ? A ASP 52 A MSE 53 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale8  covale both ? A ASP 53 C ? ? ? 1_555 A MSE 54 N B ? A ASP 52 A MSE 53 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale9  covale both ? A ASP 53 C ? ? ? 1_555 A MSE 54 N C ? A ASP 52 A MSE 53 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale10 covale both ? A MSE 54 C A ? ? 1_555 A GLU 55 N A ? A MSE 53 A GLU 54 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale11 covale both ? A MSE 54 C B ? ? 1_555 A GLU 55 N B ? A MSE 53 A GLU 54 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale12 covale both ? A LYS 56 C A ? ? 1_555 A MSE 57 N A ? A LYS 55 A MSE 56 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale13 covale both ? A LYS 56 C B ? ? 1_555 A MSE 57 N B ? A LYS 55 A MSE 56 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale14 covale both ? A MSE 57 C A ? ? 1_555 A LYS 58 N ? ? A MSE 56 A LYS 57 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale15 covale both ? A MSE 57 C B ? ? 1_555 A LYS 58 N ? ? A MSE 56 A LYS 57 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale16 covale both ? A MSE 57 C C ? ? 1_555 A LYS 58 N ? ? A MSE 56 A LYS 57 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale17 covale both ? A LYS 65 C ? ? ? 1_555 A MSE 66 N ? ? A LYS 64 A MSE 65 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale18 covale both ? A MSE 66 C ? ? ? 1_555 A PHE 67 N ? ? A MSE 65 A PHE 66 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale19 covale both ? A ASN 80 C ? ? ? 1_555 A MSE 81 N ? ? A ASN 79 A MSE 80 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale20 covale both ? A MSE 81 C ? ? ? 1_555 A ASN 82 N ? ? A MSE 80 A ASN 81 1_555 ? ? ? ? ? ? ? 1.325 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 42 ? GLU A 45  ? GLY A 41 GLU A 44  
A 2 LEU A 31 ? GLY A 39  ? LEU A 30 GLY A 38  
A 3 GLU A 98 ? TYR A 105 ? GLU A 97 TYR A 104 
A 4 LYS A 84 ? GLU A 95  ? LYS A 83 GLU A 94  
A 5 ASP A 72 ? MSE A 81  ? ASP A 71 MSE A 80  
A 6 LYS A 60 ? GLU A 69  ? LYS A 59 GLU A 68  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 42  ? O GLY A 41  N GLY A 39 ? N GLY A 38 
A 2 3 N ASN A 32  ? N ASN A 31  O ILE A 99 ? O ILE A 98 
A 3 4 O HIS A 103 ? O HIS A 102 N LEU A 91 ? N LEU A 90 
A 4 5 O LYS A 84  ? O LYS A 83  N MSE A 81 ? N MSE A 80 
A 5 6 O ILE A 76  ? O ILE A 75  N HIS A 64 ? N HIS A 63 
# 
_atom_sites.entry_id                    3F40 
_atom_sites.fract_transf_matrix[1][1]   0.017030 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016589 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015790 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N   . MSE A 1 2   ? 40.058 6.393  24.293 1.00 19.13 ? 1   MSE A N   1 
HETATM 2    C  CA  . MSE A 1 2   ? 41.383 6.750  24.859 1.00 20.06 ? 1   MSE A CA  1 
HETATM 3    C  C   . MSE A 1 2   ? 42.169 7.464  23.814 1.00 19.06 ? 1   MSE A C   1 
HETATM 4    O  O   . MSE A 1 2   ? 43.152 8.146  24.128 1.00 21.28 ? 1   MSE A O   1 
HETATM 5    C  CB  . MSE A 1 2   ? 42.177 5.499  25.289 1.00 18.99 ? 1   MSE A CB  1 
HETATM 6    C  CG  . MSE A 1 2   ? 41.645 4.840  26.513 1.00 18.89 ? 1   MSE A CG  1 
HETATM 7    SE SE  . MSE A 1 2   ? 41.876 5.950  28.079 0.75 20.09 ? 1   MSE A SE  1 
HETATM 8    C  CE  . MSE A 1 2   ? 43.792 6.008  27.956 1.00 17.76 ? 1   MSE A CE  1 
ATOM   9    N  N   . LYS A 1 3   ? 41.781 7.299  22.559 1.00 20.42 ? 2   LYS A N   1 
ATOM   10   C  CA  . LYS A 1 3   ? 42.555 7.821  21.432 1.00 20.26 ? 2   LYS A CA  1 
ATOM   11   C  C   . LYS A 1 3   ? 42.006 9.180  20.969 1.00 18.89 ? 2   LYS A C   1 
ATOM   12   O  O   . LYS A 1 3   ? 42.663 9.939  20.248 1.00 20.36 ? 2   LYS A O   1 
ATOM   13   C  CB  . LYS A 1 3   ? 42.562 6.814  20.269 1.00 21.85 ? 2   LYS A CB  1 
ATOM   14   C  CG  . LYS A 1 3   ? 42.981 5.368  20.666 1.00 24.11 ? 2   LYS A CG  1 
ATOM   15   C  CD  . LYS A 1 3   ? 43.049 4.468  19.429 1.00 27.04 ? 2   LYS A CD  1 
ATOM   16   C  CE  . LYS A 1 3   ? 44.372 4.633  18.732 1.00 29.02 ? 2   LYS A CE  1 
ATOM   17   N  NZ  . LYS A 1 3   ? 45.422 4.133  19.670 1.00 31.85 ? 2   LYS A NZ  1 
ATOM   18   N  N   . THR A 1 4   ? 40.830 9.529  21.476 1.00 16.86 ? 3   THR A N   1 
ATOM   19   C  CA  . THR A 1 4   ? 40.164 10.772 21.103 1.00 16.02 ? 3   THR A CA  1 
ATOM   20   C  C   . THR A 1 4   ? 40.412 11.851 22.140 1.00 16.06 ? 3   THR A C   1 
ATOM   21   O  O   . THR A 1 4   ? 40.906 11.598 23.226 1.00 16.53 ? 3   THR A O   1 
ATOM   22   C  CB  . THR A 1 4   ? 38.645 10.592 20.915 1.00 16.25 ? 3   THR A CB  1 
ATOM   23   O  OG1 . THR A 1 4   ? 38.076 10.164 22.136 1.00 16.20 ? 3   THR A OG1 1 
ATOM   24   C  CG2 . THR A 1 4   ? 38.277 9.601  19.832 1.00 15.81 ? 3   THR A CG2 1 
ATOM   25   N  N   . GLN A 1 5   ? 40.026 13.057 21.789 1.00 14.92 ? 4   GLN A N   1 
ATOM   26   C  CA  . GLN A 1 5   ? 40.110 14.193 22.673 1.00 14.42 ? 4   GLN A CA  1 
ATOM   27   C  C   . GLN A 1 5   ? 38.701 14.779 22.734 1.00 13.78 ? 4   GLN A C   1 
ATOM   28   O  O   . GLN A 1 5   ? 38.427 15.780 22.014 1.00 15.86 ? 4   GLN A O   1 
ATOM   29   C  CB  . GLN A 1 5   ? 41.168 15.216 22.209 1.00 14.71 ? 4   GLN A CB  1 
ATOM   30   C  CG  . GLN A 1 5   ? 42.622 14.705 22.224 1.00 16.36 ? 4   GLN A CG  1 
ATOM   31   C  CD  . GLN A 1 5   ? 43.623 15.798 21.973 1.00 17.82 ? 4   GLN A CD  1 
ATOM   32   O  OE1 . GLN A 1 5   ? 43.343 16.765 21.265 1.00 18.32 ? 4   GLN A OE1 1 
ATOM   33   N  NE2 . GLN A 1 5   ? 44.823 15.651 22.549 1.00 19.06 ? 4   GLN A NE2 1 
ATOM   34   N  N   A ILE A 1 6   ? 37.813 14.118 23.526 0.40 13.22 ? 5   ILE A N   1 
ATOM   35   N  N   B ILE A 1 6   ? 37.828 14.220 23.562 0.60 12.88 ? 5   ILE A N   1 
ATOM   36   C  CA  A ILE A 1 6   ? 36.384 14.527 23.813 0.40 12.21 ? 5   ILE A CA  1 
ATOM   37   C  CA  B ILE A 1 6   ? 36.476 14.767 23.658 0.60 11.72 ? 5   ILE A CA  1 
ATOM   38   C  C   A ILE A 1 6   ? 36.297 15.281 25.146 0.40 11.69 ? 5   ILE A C   1 
ATOM   39   C  C   B ILE A 1 6   ? 36.298 15.297 25.069 0.60 11.30 ? 5   ILE A C   1 
ATOM   40   O  O   A ILE A 1 6   ? 36.363 14.670 26.220 0.40 11.55 ? 5   ILE A O   1 
ATOM   41   O  O   B ILE A 1 6   ? 36.325 14.578 26.070 0.60 11.30 ? 5   ILE A O   1 
ATOM   42   C  CB  A ILE A 1 6   ? 35.333 13.333 23.927 0.40 12.26 ? 5   ILE A CB  1 
ATOM   43   C  CB  B ILE A 1 6   ? 35.459 13.728 23.372 0.60 11.03 ? 5   ILE A CB  1 
ATOM   44   C  CG1 A ILE A 1 6   ? 35.346 12.357 22.740 0.40 12.07 ? 5   ILE A CG1 1 
ATOM   45   C  CG1 B ILE A 1 6   ? 35.642 13.201 21.932 0.60 9.00  ? 5   ILE A CG1 1 
ATOM   46   C  CG2 A ILE A 1 6   ? 33.894 13.845 24.090 0.40 10.25 ? 5   ILE A CG2 1 
ATOM   47   C  CG2 B ILE A 1 6   ? 34.057 14.278 23.559 0.60 12.01 ? 5   ILE A CG2 1 
ATOM   48   C  CD1 A ILE A 1 6   ? 34.947 12.997 21.429 0.40 12.90 ? 5   ILE A CD1 1 
ATOM   49   C  CD1 B ILE A 1 6   ? 34.938 11.875 21.734 0.60 12.20 ? 5   ILE A CD1 1 
ATOM   50   N  N   . THR A 1 7   ? 36.143 16.604 25.104 1.00 11.55 ? 6   THR A N   1 
ATOM   51   C  CA  . THR A 1 7   ? 35.972 17.372 26.350 1.00 11.15 ? 6   THR A CA  1 
ATOM   52   C  C   . THR A 1 7   ? 34.510 17.444 26.741 1.00 10.18 ? 6   THR A C   1 
ATOM   53   O  O   . THR A 1 7   ? 33.615 17.021 26.038 1.00 10.54 ? 6   THR A O   1 
ATOM   54   C  CB  . THR A 1 7   ? 36.461 18.780 26.185 1.00 11.90 ? 6   THR A CB  1 
ATOM   55   O  OG1 . THR A 1 7   ? 35.602 19.452 25.254 1.00 13.29 ? 6   THR A OG1 1 
ATOM   56   C  CG2 . THR A 1 7   ? 37.943 18.836 25.648 1.00 13.25 ? 6   THR A CG2 1 
ATOM   57   N  N   A THR A 1 8   ? 34.264 17.931 27.936 0.60 9.48  ? 7   THR A N   1 
ATOM   58   N  N   B THR A 1 8   ? 34.328 18.041 27.905 0.40 9.52  ? 7   THR A N   1 
ATOM   59   C  CA  A THR A 1 8   ? 32.867 18.053 28.393 0.60 9.33  ? 7   THR A CA  1 
ATOM   60   C  CA  B THR A 1 8   ? 33.002 18.356 28.424 0.40 9.05  ? 7   THR A CA  1 
ATOM   61   C  C   A THR A 1 8   ? 32.063 19.017 27.500 0.60 8.76  ? 7   THR A C   1 
ATOM   62   C  C   B THR A 1 8   ? 32.229 19.166 27.383 0.40 8.53  ? 7   THR A C   1 
ATOM   63   O  O   A THR A 1 8   ? 30.849 18.855 27.319 0.60 9.33  ? 7   THR A O   1 
ATOM   64   O  O   B THR A 1 8   ? 31.101 18.841 27.009 0.40 8.45  ? 7   THR A O   1 
ATOM   65   C  CB  A THR A 1 8   ? 32.821 18.453 29.873 0.60 10.05 ? 7   THR A CB  1 
ATOM   66   C  CB  B THR A 1 8   ? 33.102 19.136 29.742 0.40 9.32  ? 7   THR A CB  1 
ATOM   67   O  OG1 A THR A 1 8   ? 33.748 19.496 30.071 0.60 11.21 ? 7   THR A OG1 1 
ATOM   68   O  OG1 B THR A 1 8   ? 33.807 18.360 30.706 0.40 10.41 ? 7   THR A OG1 1 
ATOM   69   C  CG2 A THR A 1 8   ? 33.272 17.345 30.701 0.60 10.24 ? 7   THR A CG2 1 
ATOM   70   C  CG2 B THR A 1 8   ? 31.710 19.424 30.272 0.40 10.36 ? 7   THR A CG2 1 
ATOM   71   N  N   A ARG A 1 9   ? 32.740 20.008 26.919 0.60 8.79  ? 8   ARG A N   1 
ATOM   72   N  N   B ARG A 1 9   ? 32.846 20.235 26.904 0.40 8.26  ? 8   ARG A N   1 
ATOM   73   C  CA  A ARG A 1 9   ? 32.056 20.949 26.000 0.60 9.49  ? 8   ARG A CA  1 
ATOM   74   C  CA  B ARG A 1 9   ? 32.212 21.060 25.900 0.40 8.99  ? 8   ARG A CA  1 
ATOM   75   C  C   A ARG A 1 9   ? 31.726 20.257 24.687 0.60 9.32  ? 8   ARG A C   1 
ATOM   76   C  C   B ARG A 1 9   ? 31.717 20.217 24.750 0.40 9.25  ? 8   ARG A C   1 
ATOM   77   O  O   A ARG A 1 9   ? 30.664 20.455 24.090 0.60 9.51  ? 8   ARG A O   1 
ATOM   78   O  O   B ARG A 1 9   ? 30.540 20.254 24.358 0.40 9.35  ? 8   ARG A O   1 
ATOM   79   C  CB  A ARG A 1 9   ? 32.890 22.214 25.760 0.60 10.36 ? 8   ARG A CB  1 
ATOM   80   C  CB  B ARG A 1 9   ? 33.219 22.064 25.374 0.40 9.57  ? 8   ARG A CB  1 
ATOM   81   C  CG  A ARG A 1 9   ? 32.933 23.161 26.954 0.60 13.38 ? 8   ARG A CG  1 
ATOM   82   C  CG  B ARG A 1 9   ? 32.556 23.124 24.551 0.40 9.67  ? 8   ARG A CG  1 
ATOM   83   N  N   . ASP A 1 10  ? 32.632 19.401 24.251 1.00 10.38 ? 9   ASP A N   1 
ATOM   84   C  CA  . ASP A 1 10  ? 32.368 18.551 23.074 1.00 10.93 ? 9   ASP A CA  1 
ATOM   85   C  C   . ASP A 1 10  ? 31.186 17.644 23.319 1.00 11.57 ? 9   ASP A C   1 
ATOM   86   O  O   . ASP A 1 10  ? 30.321 17.465 22.470 1.00 12.37 ? 9   ASP A O   1 
ATOM   87   C  CB  . ASP A 1 10  ? 33.586 17.705 22.737 1.00 12.61 ? 9   ASP A CB  1 
ATOM   88   C  CG  . ASP A 1 10  ? 34.779 18.497 22.242 1.00 16.21 ? 9   ASP A CG  1 
ATOM   89   O  OD1 . ASP A 1 10  ? 34.618 19.392 21.420 1.00 19.09 ? 9   ASP A OD1 1 
ATOM   90   O  OD2 . ASP A 1 10  ? 35.927 18.171 22.610 1.00 18.02 ? 9   ASP A OD2 1 
ATOM   91   N  N   A LEU A 1 11  ? 31.082 17.030 24.501 0.60 11.66 ? 10  LEU A N   1 
ATOM   92   N  N   B LEU A 1 11  ? 31.176 17.087 24.507 0.40 11.86 ? 10  LEU A N   1 
ATOM   93   C  CA  A LEU A 1 11  ? 29.912 16.151 24.789 0.60 11.78 ? 10  LEU A CA  1 
ATOM   94   C  CA  B LEU A 1 11  ? 30.149 16.163 24.865 0.40 12.15 ? 10  LEU A CA  1 
ATOM   95   C  C   A LEU A 1 11  ? 28.597 16.845 24.665 0.60 11.06 ? 10  LEU A C   1 
ATOM   96   C  C   B LEU A 1 11  ? 28.748 16.809 24.697 0.40 11.02 ? 10  LEU A C   1 
ATOM   97   O  O   A LEU A 1 11  ? 27.604 16.316 24.125 0.60 11.58 ? 10  LEU A O   1 
ATOM   98   O  O   B LEU A 1 11  ? 27.901 16.201 24.027 0.40 11.97 ? 10  LEU A O   1 
ATOM   99   C  CB  A LEU A 1 11  ? 29.924 15.619 26.212 0.60 12.58 ? 10  LEU A CB  1 
ATOM   100  C  CB  B LEU A 1 11  ? 30.443 15.642 26.275 0.40 12.63 ? 10  LEU A CB  1 
ATOM   101  C  CG  A LEU A 1 11  ? 30.984 14.597 26.553 0.60 13.32 ? 10  LEU A CG  1 
ATOM   102  C  CG  B LEU A 1 11  ? 29.739 14.353 26.681 0.40 14.61 ? 10  LEU A CG  1 
ATOM   103  C  CD1 A LEU A 1 11  ? 30.985 14.282 28.061 0.60 12.86 ? 10  LEU A CD1 1 
ATOM   104  C  CD1 B LEU A 1 11  ? 28.287 14.654 26.889 0.40 15.30 ? 10  LEU A CD1 1 
ATOM   105  C  CD2 A LEU A 1 11  ? 30.805 13.305 25.752 0.60 14.92 ? 10  LEU A CD2 1 
ATOM   106  C  CD2 B LEU A 1 11  ? 29.924 13.239 25.668 0.40 16.72 ? 10  LEU A CD2 1 
ATOM   107  N  N   . VAL A 1 12  ? 28.540 18.044 25.210 1.00 10.33 ? 11  VAL A N   1 
ATOM   108  C  CA  . VAL A 1 12  ? 27.262 18.732 25.141 1.00 10.73 ? 11  VAL A CA  1 
ATOM   109  C  C   . VAL A 1 12  ? 26.922 19.098 23.707 1.00 10.39 ? 11  VAL A C   1 
ATOM   110  O  O   . VAL A 1 12  ? 25.788 18.908 23.249 1.00 10.98 ? 11  VAL A O   1 
ATOM   111  C  CB  . VAL A 1 12  ? 27.199 19.955 26.085 1.00 10.43 ? 11  VAL A CB  1 
ATOM   112  C  CG1 . VAL A 1 12  ? 25.921 20.739 25.879 1.00 12.04 ? 11  VAL A CG1 1 
ATOM   113  C  CG2 . VAL A 1 12  ? 27.354 19.487 27.561 1.00 11.65 ? 11  VAL A CG2 1 
ATOM   114  N  N   . LEU A 1 13  ? 27.904 19.602 22.980 1.00 9.25  ? 12  LEU A N   1 
ATOM   115  C  CA  . LEU A 1 13  ? 27.636 19.977 21.588 1.00 10.24 ? 12  LEU A CA  1 
ATOM   116  C  C   . LEU A 1 13  ? 27.307 18.763 20.728 1.00 10.19 ? 12  LEU A C   1 
ATOM   117  O  O   . LEU A 1 13  ? 26.514 18.873 19.786 1.00 10.94 ? 12  LEU A O   1 
ATOM   118  C  CB  . LEU A 1 13  ? 28.790 20.791 21.028 1.00 11.89 ? 12  LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 13  ? 28.882 22.160 21.679 1.00 13.83 ? 12  LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 13  ? 30.011 22.990 21.027 1.00 15.99 ? 12  LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 13  ? 27.560 22.950 21.642 1.00 16.28 ? 12  LEU A CD2 1 
ATOM   122  N  N   . GLU A 1 14  ? 27.945 17.647 21.017 1.00 10.46 ? 13  GLU A N   1 
ATOM   123  C  CA  . GLU A 1 14  ? 27.627 16.406 20.300 1.00 10.75 ? 13  GLU A CA  1 
ATOM   124  C  C   . GLU A 1 14  ? 26.206 15.972 20.590 1.00 11.91 ? 13  GLU A C   1 
ATOM   125  O  O   . GLU A 1 14  ? 25.505 15.492 19.707 1.00 12.78 ? 13  GLU A O   1 
ATOM   126  C  CB  . GLU A 1 14  ? 28.562 15.290 20.686 1.00 11.84 ? 13  GLU A CB  1 
ATOM   127  C  CG  . GLU A 1 14  ? 29.949 15.489 20.191 1.00 11.69 ? 13  GLU A CG  1 
ATOM   128  C  CD  . GLU A 1 14  ? 30.885 14.434 20.650 1.00 16.90 ? 13  GLU A CD  1 
ATOM   129  O  OE1 . GLU A 1 14  ? 30.430 13.525 21.458 1.00 15.32 ? 13  GLU A OE1 1 
ATOM   130  O  OE2 . GLU A 1 14  ? 32.065 14.580 20.220 1.00 15.37 ? 13  GLU A OE2 1 
ATOM   131  N  N   . PHE A 1 15  ? 25.773 16.119 21.829 1.00 11.15 ? 14  PHE A N   1 
ATOM   132  C  CA  . PHE A 1 15  ? 24.378 15.768 22.193 1.00 11.02 ? 14  PHE A CA  1 
ATOM   133  C  C   . PHE A 1 15  ? 23.398 16.622 21.418 1.00 11.56 ? 14  PHE A C   1 
ATOM   134  O  O   . PHE A 1 15  ? 22.430 16.114 20.842 1.00 12.66 ? 14  PHE A O   1 
ATOM   135  C  CB  . PHE A 1 15  ? 24.186 15.928 23.723 1.00 11.97 ? 14  PHE A CB  1 
ATOM   136  C  CG  . PHE A 1 15  ? 22.794 15.629 24.203 1.00 11.16 ? 14  PHE A CG  1 
ATOM   137  C  CD1 . PHE A 1 15  ? 22.323 14.321 24.206 1.00 12.71 ? 14  PHE A CD1 1 
ATOM   138  C  CD2 . PHE A 1 15  ? 21.965 16.620 24.690 1.00 12.03 ? 14  PHE A CD2 1 
ATOM   139  C  CE1 . PHE A 1 15  ? 21.046 14.035 24.632 1.00 12.40 ? 14  PHE A CE1 1 
ATOM   140  C  CE2 . PHE A 1 15  ? 20.700 16.316 25.128 1.00 14.27 ? 14  PHE A CE2 1 
ATOM   141  C  CZ  . PHE A 1 15  ? 20.250 15.022 25.102 1.00 12.95 ? 14  PHE A CZ  1 
ATOM   142  N  N   . ILE A 1 16  ? 23.650 17.928 21.377 1.00 10.82 ? 15  ILE A N   1 
ATOM   143  C  CA  . ILE A 1 16  ? 22.776 18.825 20.649 1.00 12.27 ? 15  ILE A CA  1 
ATOM   144  C  C   . ILE A 1 16  ? 22.804 18.485 19.156 1.00 12.32 ? 15  ILE A C   1 
ATOM   145  O  O   . ILE A 1 16  ? 21.746 18.466 18.521 1.00 12.75 ? 15  ILE A O   1 
ATOM   146  C  CB  . ILE A 1 16  ? 23.133 20.296 20.853 1.00 11.92 ? 15  ILE A CB  1 
ATOM   147  C  CG1 . ILE A 1 16  ? 22.983 20.664 22.320 1.00 12.95 ? 15  ILE A CG1 1 
ATOM   148  C  CG2 . ILE A 1 16  ? 22.288 21.193 19.976 1.00 14.39 ? 15  ILE A CG2 1 
ATOM   149  C  CD1 . ILE A 1 16  ? 21.576 20.501 22.891 1.00 14.15 ? 15  ILE A CD1 1 
ATOM   150  N  N   . HIS A 1 17  ? 23.986 18.181 18.610 1.00 11.59 ? 16  HIS A N   1 
ATOM   151  C  CA  . HIS A 1 17  ? 24.075 17.813 17.179 1.00 12.21 ? 16  HIS A CA  1 
ATOM   152  C  C   . HIS A 1 17  ? 23.301 16.541 16.877 1.00 12.44 ? 16  HIS A C   1 
ATOM   153  O  O   . HIS A 1 17  ? 22.640 16.444 15.836 1.00 13.52 ? 16  HIS A O   1 
ATOM   154  C  CB  . HIS A 1 17  ? 25.525 17.641 16.760 1.00 12.99 ? 16  HIS A CB  1 
ATOM   155  C  CG  . HIS A 1 17  ? 25.673 17.326 15.319 1.00 12.22 ? 16  HIS A CG  1 
ATOM   156  N  ND1 . HIS A 1 17  ? 25.355 18.235 14.341 1.00 16.15 ? 16  HIS A ND1 1 
ATOM   157  C  CD2 . HIS A 1 17  ? 26.077 16.201 14.694 1.00 12.54 ? 16  HIS A CD2 1 
ATOM   158  C  CE1 . HIS A 1 17  ? 25.580 17.679 13.158 1.00 13.81 ? 16  HIS A CE1 1 
ATOM   159  N  NE2 . HIS A 1 17  ? 25.992 16.445 13.344 1.00 13.25 ? 16  HIS A NE2 1 
ATOM   160  N  N   . ALA A 1 18  ? 23.413 15.577 17.776 1.00 12.09 ? 17  ALA A N   1 
ATOM   161  C  CA  . ALA A 1 18  ? 22.663 14.341 17.623 1.00 13.00 ? 17  ALA A CA  1 
ATOM   162  C  C   . ALA A 1 18  ? 21.156 14.629 17.605 1.00 13.22 ? 17  ALA A C   1 
ATOM   163  O  O   . ALA A 1 18  ? 20.415 14.126 16.757 1.00 13.60 ? 17  ALA A O   1 
ATOM   164  C  CB  . ALA A 1 18  ? 23.048 13.324 18.696 1.00 12.70 ? 17  ALA A CB  1 
ATOM   165  N  N   . LEU A 1 19  ? 20.658 15.445 18.505 1.00 12.17 ? 18  LEU A N   1 
ATOM   166  C  CA  . LEU A 1 19  ? 19.225 15.758 18.487 1.00 12.31 ? 18  LEU A CA  1 
ATOM   167  C  C   . LEU A 1 19  ? 18.843 16.488 17.196 1.00 13.22 ? 18  LEU A C   1 
ATOM   168  O  O   . LEU A 1 19  ? 17.825 16.198 16.560 1.00 12.83 ? 18  LEU A O   1 
ATOM   169  C  CB  . LEU A 1 19  ? 18.849 16.599 19.709 1.00 12.50 ? 18  LEU A CB  1 
ATOM   170  C  CG  . LEU A 1 19  ? 18.979 15.929 21.066 1.00 12.14 ? 18  LEU A CG  1 
ATOM   171  C  CD1 . LEU A 1 19  ? 18.723 16.925 22.187 1.00 13.13 ? 18  LEU A CD1 1 
ATOM   172  C  CD2 . LEU A 1 19  ? 18.032 14.737 21.186 1.00 14.06 ? 18  LEU A CD2 1 
ATOM   173  N  N   . ASN A 1 20  ? 19.668 17.425 16.783 1.00 13.54 ? 19  ASN A N   1 
ATOM   174  C  CA  . ASN A 1 20  ? 19.348 18.226 15.588 1.00 13.74 ? 19  ASN A CA  1 
ATOM   175  C  C   . ASN A 1 20  ? 19.301 17.403 14.312 1.00 14.90 ? 19  ASN A C   1 
ATOM   176  O  O   . ASN A 1 20  ? 18.553 17.716 13.402 1.00 17.07 ? 19  ASN A O   1 
ATOM   177  C  CB  . ASN A 1 20  ? 20.332 19.380 15.404 1.00 14.47 ? 19  ASN A CB  1 
ATOM   178  C  CG  . ASN A 1 20  ? 19.978 20.583 16.241 1.00 13.86 ? 19  ASN A CG  1 
ATOM   179  O  OD1 . ASN A 1 20  ? 18.851 20.696 16.708 1.00 16.63 ? 19  ASN A OD1 1 
ATOM   180  N  ND2 . ASN A 1 20  ? 20.943 21.502 16.452 1.00 14.73 ? 19  ASN A ND2 1 
ATOM   181  N  N   . THR A 1 21  ? 20.097 16.357 14.292 1.00 13.64 ? 20  THR A N   1 
ATOM   182  C  CA  . THR A 1 21  ? 20.155 15.479 13.126 1.00 14.44 ? 20  THR A CA  1 
ATOM   183  C  C   . THR A 1 21  ? 19.297 14.241 13.328 1.00 14.90 ? 20  THR A C   1 
ATOM   184  O  O   . THR A 1 21  ? 19.373 13.265 12.583 1.00 14.44 ? 20  THR A O   1 
ATOM   185  C  CB  . THR A 1 21  ? 21.580 15.082 12.783 1.00 15.18 ? 20  THR A CB  1 
ATOM   186  O  OG1 . THR A 1 21  ? 22.214 14.439 13.907 1.00 15.13 ? 20  THR A OG1 1 
ATOM   187  C  CG2 . THR A 1 21  ? 22.366 16.335 12.288 1.00 15.70 ? 20  THR A CG2 1 
ATOM   188  N  N   . GLU A 1 22  ? 18.421 14.319 14.312 1.00 14.13 ? 21  GLU A N   1 
ATOM   189  C  CA  . GLU A 1 22  ? 17.474 13.250 14.612 1.00 14.86 ? 21  GLU A CA  1 
ATOM   190  C  C   . GLU A 1 22  ? 18.208 11.904 14.740 1.00 15.35 ? 21  GLU A C   1 
ATOM   191  O  O   . GLU A 1 22  ? 17.729 10.861 14.265 1.00 17.10 ? 21  GLU A O   1 
ATOM   192  C  CB  . GLU A 1 22  ? 16.287 13.233 13.603 1.00 14.31 ? 21  GLU A CB  1 
ATOM   193  C  CG  . GLU A 1 22  ? 15.500 14.534 13.627 1.00 15.12 ? 21  GLU A CG  1 
ATOM   194  C  CD  . GLU A 1 22  ? 14.125 14.448 12.899 1.00 11.69 ? 21  GLU A CD  1 
ATOM   195  O  OE1 . GLU A 1 22  ? 13.790 13.370 12.279 1.00 24.24 ? 21  GLU A OE1 1 
ATOM   196  O  OE2 . GLU A 1 22  ? 13.421 15.494 12.936 1.00 16.31 ? 21  GLU A OE2 1 
ATOM   197  N  N   . ASN A 1 23  ? 19.409 11.943 15.323 1.00 16.20 ? 22  ASN A N   1 
ATOM   198  C  CA  . ASN A 1 23  ? 20.174 10.756 15.656 1.00 15.67 ? 22  ASN A CA  1 
ATOM   199  C  C   . ASN A 1 23  ? 20.010 10.395 17.122 1.00 16.25 ? 22  ASN A C   1 
ATOM   200  O  O   . ASN A 1 23  ? 20.850 10.709 17.986 1.00 16.18 ? 22  ASN A O   1 
ATOM   201  C  CB  . ASN A 1 23  ? 21.644 10.918 15.301 1.00 16.32 ? 22  ASN A CB  1 
ATOM   202  C  CG  . ASN A 1 23  ? 22.396 9.569  15.318 1.00 16.66 ? 22  ASN A CG  1 
ATOM   203  O  OD1 . ASN A 1 23  ? 21.966 8.585  15.923 1.00 21.81 ? 22  ASN A OD1 1 
ATOM   204  N  ND2 . ASN A 1 23  ? 23.577 9.546  14.676 1.00 20.85 ? 22  ASN A ND2 1 
ATOM   205  N  N   . PHE A 1 24  ? 18.876 9.784  17.412 1.00 15.69 ? 23  PHE A N   1 
ATOM   206  C  CA  . PHE A 1 24  ? 18.459 9.593  18.805 1.00 15.95 ? 23  PHE A CA  1 
ATOM   207  C  C   . PHE A 1 24  ? 19.314 8.552  19.527 1.00 16.55 ? 23  PHE A C   1 
ATOM   208  O  O   . PHE A 1 24  ? 19.642 8.737  20.688 1.00 16.15 ? 23  PHE A O   1 
ATOM   209  C  CB  . PHE A 1 24  ? 16.920 9.380  18.906 1.00 14.84 ? 23  PHE A CB  1 
ATOM   210  C  CG  . PHE A 1 24  ? 16.151 10.551 18.343 1.00 15.36 ? 23  PHE A CG  1 
ATOM   211  C  CD1 . PHE A 1 24  ? 16.213 11.798 18.947 1.00 13.86 ? 23  PHE A CD1 1 
ATOM   212  C  CD2 . PHE A 1 24  ? 15.429 10.441 17.169 1.00 14.76 ? 23  PHE A CD2 1 
ATOM   213  C  CE1 . PHE A 1 24  ? 15.585 12.866 18.399 1.00 13.99 ? 23  PHE A CE1 1 
ATOM   214  C  CE2 . PHE A 1 24  ? 14.803 11.512 16.652 1.00 15.63 ? 23  PHE A CE2 1 
ATOM   215  C  CZ  . PHE A 1 24  ? 14.885 12.730 17.264 1.00 14.51 ? 23  PHE A CZ  1 
ATOM   216  N  N   . PRO A 1 25  ? 19.754 7.475  18.839 1.00 17.85 ? 24  PRO A N   1 
ATOM   217  C  CA  . PRO A 1 25  ? 20.666 6.583  19.529 1.00 18.11 ? 24  PRO A CA  1 
ATOM   218  C  C   . PRO A 1 25  ? 22.023 7.229  19.904 1.00 18.49 ? 24  PRO A C   1 
ATOM   219  O  O   . PRO A 1 25  ? 22.550 6.963  20.997 1.00 18.45 ? 24  PRO A O   1 
ATOM   220  C  CB  . PRO A 1 25  ? 20.849 5.424  18.513 1.00 19.71 ? 24  PRO A CB  1 
ATOM   221  C  CG  . PRO A 1 25  ? 19.590 5.395  17.797 1.00 20.04 ? 24  PRO A CG  1 
ATOM   222  C  CD  . PRO A 1 25  ? 19.234 6.866  17.602 1.00 18.53 ? 24  PRO A CD  1 
ATOM   223  N  N   . ALA A 1 26  ? 22.510 8.112  19.040 1.00 17.69 ? 25  ALA A N   1 
ATOM   224  C  CA  . ALA A 1 26  ? 23.773 8.836  19.334 1.00 18.20 ? 25  ALA A CA  1 
ATOM   225  C  C   . ALA A 1 26  ? 23.557 9.756  20.534 1.00 17.10 ? 25  ALA A C   1 
ATOM   226  O  O   . ALA A 1 26  ? 24.425 9.891  21.408 1.00 17.06 ? 25  ALA A O   1 
ATOM   227  C  CB  . ALA A 1 26  ? 24.267 9.643  18.153 1.00 18.46 ? 25  ALA A CB  1 
ATOM   228  N  N   . ALA A 1 27  ? 22.422 10.431 20.542 1.00 15.66 ? 26  ALA A N   1 
ATOM   229  C  CA  . ALA A 1 27  ? 22.136 11.388 21.626 1.00 14.40 ? 26  ALA A CA  1 
ATOM   230  C  C   . ALA A 1 27  ? 22.106 10.613 22.962 1.00 13.40 ? 26  ALA A C   1 
ATOM   231  O  O   . ALA A 1 27  ? 22.663 11.042 24.005 1.00 14.20 ? 26  ALA A O   1 
ATOM   232  C  CB  . ALA A 1 27  ? 20.843 12.166 21.331 1.00 13.95 ? 26  ALA A CB  1 
ATOM   233  N  N   A LYS A 1 28  ? 21.429 9.461  22.973 0.50 13.67 ? 27  LYS A N   1 
ATOM   234  N  N   B LYS A 1 28  ? 21.476 9.459  22.901 0.50 14.07 ? 27  LYS A N   1 
ATOM   235  C  CA  A LYS A 1 28  ? 21.278 8.718  24.242 0.50 14.14 ? 27  LYS A CA  1 
ATOM   236  C  CA  B LYS A 1 28  ? 21.255 8.687  24.096 0.50 14.54 ? 27  LYS A CA  1 
ATOM   237  C  C   A LYS A 1 28  ? 22.621 8.303  24.801 0.50 15.26 ? 27  LYS A C   1 
ATOM   238  C  C   B LYS A 1 28  ? 22.569 8.275  24.749 0.50 15.54 ? 27  LYS A C   1 
ATOM   239  O  O   A LYS A 1 28  ? 22.803 8.195  26.014 0.50 15.18 ? 27  LYS A O   1 
ATOM   240  O  O   B LYS A 1 28  ? 22.681 8.164  25.969 0.50 15.50 ? 27  LYS A O   1 
ATOM   241  C  CB  A LYS A 1 28  ? 20.369 7.478  24.125 0.50 14.01 ? 27  LYS A CB  1 
ATOM   242  C  CB  B LYS A 1 28  ? 20.396 7.471  23.750 0.50 14.76 ? 27  LYS A CB  1 
ATOM   243  C  CG  A LYS A 1 28  ? 20.135 6.764  25.466 0.50 14.05 ? 27  LYS A CG  1 
ATOM   244  C  CG  B LYS A 1 28  ? 19.882 6.727  24.958 0.50 15.39 ? 27  LYS A CG  1 
ATOM   245  C  CD  A LYS A 1 28  ? 19.179 5.574  25.330 0.50 15.63 ? 27  LYS A CD  1 
ATOM   246  C  CD  B LYS A 1 28  ? 18.833 5.643  24.595 0.50 16.15 ? 27  LYS A CD  1 
ATOM   247  C  CE  A LYS A 1 28  ? 18.849 4.961  26.684 0.50 16.58 ? 27  LYS A CE  1 
ATOM   248  C  CE  B LYS A 1 28  ? 18.258 4.965  25.836 0.50 18.35 ? 27  LYS A CE  1 
ATOM   249  N  NZ  A LYS A 1 28  ? 19.965 4.161  27.239 0.50 21.79 ? 27  LYS A NZ  1 
ATOM   250  N  NZ  B LYS A 1 28  ? 17.192 3.947  25.529 0.50 20.30 ? 27  LYS A NZ  1 
ATOM   251  N  N   . LYS A 1 29  ? 23.566 8.077  23.902 1.00 16.01 ? 28  LYS A N   1 
ATOM   252  C  CA  . LYS A 1 29  ? 24.900 7.624  24.331 1.00 16.99 ? 28  LYS A CA  1 
ATOM   253  C  C   . LYS A 1 29  ? 25.610 8.620  25.248 1.00 16.53 ? 28  LYS A C   1 
ATOM   254  O  O   . LYS A 1 29  ? 26.512 8.234  25.992 1.00 17.79 ? 28  LYS A O   1 
ATOM   255  C  CB  . LYS A 1 29  ? 25.820 7.291  23.126 1.00 18.49 ? 28  LYS A CB  1 
ATOM   256  C  CG  . LYS A 1 29  ? 25.514 5.947  22.494 1.00 22.45 ? 28  LYS A CG  1 
ATOM   257  C  CD  . LYS A 1 29  ? 26.428 5.712  21.293 1.00 25.20 ? 28  LYS A CD  1 
ATOM   258  N  N   . ARG A 1 30  ? 25.238 9.882  25.119 1.00 15.32 ? 29  ARG A N   1 
ATOM   259  C  CA  . ARG A 1 30  ? 25.908 10.991 25.834 1.00 14.39 ? 29  ARG A CA  1 
ATOM   260  C  C   . ARG A 1 30  ? 25.296 11.134 27.255 1.00 13.65 ? 29  ARG A C   1 
ATOM   261  O  O   . ARG A 1 30  ? 25.829 11.879 28.069 1.00 13.51 ? 29  ARG A O   1 
ATOM   262  C  CB  . ARG A 1 30  ? 25.838 12.334 25.066 1.00 15.30 ? 29  ARG A CB  1 
ATOM   263  C  CG  . ARG A 1 30  ? 26.943 12.601 23.997 1.00 17.58 ? 29  ARG A CG  1 
ATOM   264  C  CD  . ARG A 1 30  ? 26.752 11.861 22.763 1.00 18.50 ? 29  ARG A CD  1 
ATOM   265  N  NE  . ARG A 1 30  ? 27.891 12.008 21.861 1.00 16.30 ? 29  ARG A NE  1 
ATOM   266  C  CZ  . ARG A 1 30  ? 28.015 11.260 20.782 1.00 16.71 ? 29  ARG A CZ  1 
ATOM   267  N  NH1 . ARG A 1 30  ? 27.097 10.352 20.513 1.00 18.27 ? 29  ARG A NH1 1 
ATOM   268  N  NH2 . ARG A 1 30  ? 29.064 11.395 19.985 1.00 17.50 ? 29  ARG A NH2 1 
ATOM   269  N  N   . LEU A 1 31  ? 24.223 10.405 27.535 1.00 12.46 ? 30  LEU A N   1 
ATOM   270  C  CA  . LEU A 1 31  ? 23.500 10.533 28.817 1.00 12.08 ? 30  LEU A CA  1 
ATOM   271  C  C   . LEU A 1 31  ? 23.802 9.395  29.760 1.00 12.39 ? 30  LEU A C   1 
ATOM   272  O  O   . LEU A 1 31  ? 23.873 8.207  29.351 1.00 13.91 ? 30  LEU A O   1 
ATOM   273  C  CB  . LEU A 1 31  ? 21.994 10.548 28.568 1.00 11.42 ? 30  LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 31  ? 21.435 11.612 27.625 1.00 11.19 ? 30  LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 31  ? 19.928 11.575 27.646 1.00 12.06 ? 30  LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 31  ? 21.958 12.970 28.034 1.00 10.93 ? 30  LEU A CD2 1 
ATOM   277  N  N   . ASN A 1 32  ? 23.912 9.715  31.032 1.00 12.27 ? 31  ASN A N   1 
ATOM   278  C  CA  . ASN A 1 32  ? 23.952 8.708  32.070 1.00 12.71 ? 31  ASN A CA  1 
ATOM   279  C  C   . ASN A 1 32  ? 22.611 7.962  32.107 1.00 12.57 ? 31  ASN A C   1 
ATOM   280  O  O   . ASN A 1 32  ? 21.533 8.554  31.863 1.00 12.38 ? 31  ASN A O   1 
ATOM   281  C  CB  . ASN A 1 32  ? 24.260 9.321  33.429 1.00 13.11 ? 31  ASN A CB  1 
ATOM   282  C  CG  . ASN A 1 32  ? 24.180 8.333  34.541 1.00 15.47 ? 31  ASN A CG  1 
ATOM   283  O  OD1 . ASN A 1 32  ? 23.230 8.333  35.322 1.00 17.19 ? 31  ASN A OD1 1 
ATOM   284  N  ND2 . ASN A 1 32  ? 25.189 7.486  34.646 1.00 17.57 ? 31  ASN A ND2 1 
ATOM   285  N  N   A GLU A 1 33  ? 22.685 6.700  32.521 0.50 13.87 ? 32  GLU A N   1 
ATOM   286  N  N   B GLU A 1 33  ? 22.627 6.663  32.412 0.50 13.71 ? 32  GLU A N   1 
ATOM   287  C  CA  A GLU A 1 33  ? 21.502 5.853  32.586 0.50 13.62 ? 32  GLU A CA  1 
ATOM   288  C  CA  B GLU A 1 33  ? 21.361 5.911  32.430 0.50 13.55 ? 32  GLU A CA  1 
ATOM   289  C  C   A GLU A 1 33  ? 20.388 6.499  33.389 0.50 13.30 ? 32  GLU A C   1 
ATOM   290  C  C   B GLU A 1 33  ? 20.325 6.486  33.424 0.50 13.38 ? 32  GLU A C   1 
ATOM   291  O  O   A GLU A 1 33  ? 19.219 6.427  33.015 0.50 14.33 ? 32  GLU A O   1 
ATOM   292  O  O   B GLU A 1 33  ? 19.117 6.328  33.240 0.50 14.77 ? 32  GLU A O   1 
ATOM   293  C  CB  A GLU A 1 33  ? 21.860 4.473  33.183 0.50 14.50 ? 32  GLU A CB  1 
ATOM   294  C  CB  B GLU A 1 33  ? 21.611 4.413  32.707 0.50 14.07 ? 32  GLU A CB  1 
ATOM   295  C  CG  A GLU A 1 33  ? 20.664 3.566  33.382 0.50 15.79 ? 32  GLU A CG  1 
ATOM   296  C  CG  B GLU A 1 33  ? 22.009 4.121  34.160 0.50 16.45 ? 32  GLU A CG  1 
ATOM   297  C  CD  A GLU A 1 33  ? 21.028 2.097  33.438 0.50 18.08 ? 32  GLU A CD  1 
ATOM   298  C  CD  B GLU A 1 33  ? 22.134 2.620  34.490 0.50 20.30 ? 32  GLU A CD  1 
ATOM   299  O  OE1 A GLU A 1 33  ? 21.693 1.616  32.498 0.50 24.21 ? 32  GLU A OE1 1 
ATOM   300  O  OE1 B GLU A 1 33  ? 22.015 1.808  33.575 0.50 20.94 ? 32  GLU A OE1 1 
ATOM   301  O  OE2 A GLU A 1 33  ? 20.616 1.428  34.404 0.50 23.65 ? 32  GLU A OE2 1 
ATOM   302  O  OE2 B GLU A 1 33  ? 22.352 2.269  35.669 0.50 23.53 ? 32  GLU A OE2 1 
ATOM   303  N  N   . ASN A 1 34  ? 20.799 7.129  34.480 1.00 13.15 ? 33  ASN A N   1 
ATOM   304  C  CA  . ASN A 1 34  ? 19.913 7.717  35.498 1.00 13.78 ? 33  ASN A CA  1 
ATOM   305  C  C   . ASN A 1 34  ? 19.817 9.252  35.375 1.00 12.42 ? 33  ASN A C   1 
ATOM   306  O  O   . ASN A 1 34  ? 19.490 9.956  36.312 1.00 13.48 ? 33  ASN A O   1 
ATOM   307  C  CB  . ASN A 1 34  ? 20.373 7.326  36.900 1.00 15.22 ? 33  ASN A CB  1 
ATOM   308  C  CG  . ASN A 1 34  ? 20.378 5.854  37.095 1.00 18.50 ? 33  ASN A CG  1 
ATOM   309  O  OD1 . ASN A 1 34  ? 21.388 5.277  37.477 1.00 24.60 ? 33  ASN A OD1 1 
ATOM   310  N  ND2 . ASN A 1 34  ? 19.256 5.237  36.839 1.00 19.89 ? 33  ASN A ND2 1 
ATOM   311  N  N   . PHE A 1 35  ? 20.051 9.704  34.167 1.00 11.02 ? 34  PHE A N   1 
ATOM   312  C  CA  . PHE A 1 35  ? 19.873 11.118 33.792 1.00 10.22 ? 34  PHE A CA  1 
ATOM   313  C  C   . PHE A 1 35  ? 18.517 11.614 34.251 1.00 10.41 ? 34  PHE A C   1 
ATOM   314  O  O   . PHE A 1 35  ? 17.506 10.914 34.123 1.00 11.33 ? 34  PHE A O   1 
ATOM   315  C  CB  . PHE A 1 35  ? 19.971 11.202 32.281 1.00 10.88 ? 34  PHE A CB  1 
ATOM   316  C  CG  . PHE A 1 35  ? 19.489 12.497 31.664 1.00 9.66  ? 34  PHE A CG  1 
ATOM   317  C  CD1 . PHE A 1 35  ? 20.348 13.567 31.509 1.00 9.24  ? 34  PHE A CD1 1 
ATOM   318  C  CD2 . PHE A 1 35  ? 18.172 12.621 31.208 1.00 10.55 ? 34  PHE A CD2 1 
ATOM   319  C  CE1 . PHE A 1 35  ? 19.914 14.715 30.906 1.00 9.28  ? 34  PHE A CE1 1 
ATOM   320  C  CE2 . PHE A 1 35  ? 17.740 13.777 30.616 1.00 9.79  ? 34  PHE A CE2 1 
ATOM   321  C  CZ  . PHE A 1 35  ? 18.622 14.816 30.446 1.00 8.69  ? 34  PHE A CZ  1 
ATOM   322  N  N   . THR A 1 36  ? 18.501 12.836 34.756 1.00 9.70  ? 35  THR A N   1 
ATOM   323  C  CA  . THR A 1 36  ? 17.256 13.507 35.022 1.00 9.73  ? 35  THR A CA  1 
ATOM   324  C  C   . THR A 1 36  ? 17.058 14.732 34.162 1.00 9.15  ? 35  THR A C   1 
ATOM   325  O  O   . THR A 1 36  ? 17.997 15.402 33.790 1.00 9.43  ? 35  THR A O   1 
ATOM   326  C  CB  . THR A 1 36  ? 17.144 13.940 36.499 1.00 11.60 ? 35  THR A CB  1 
ATOM   327  O  OG1 . THR A 1 36  ? 18.136 14.923 36.803 1.00 13.24 ? 35  THR A OG1 1 
ATOM   328  C  CG2 . THR A 1 36  ? 17.305 12.730 37.439 1.00 13.11 ? 35  THR A CG2 1 
ATOM   329  N  N   . PHE A 1 37  ? 15.794 14.971 33.878 1.00 8.63  ? 36  PHE A N   1 
ATOM   330  C  CA  . PHE A 1 37  ? 15.329 16.162 33.177 1.00 7.98  ? 36  PHE A CA  1 
ATOM   331  C  C   . PHE A 1 37  ? 14.368 16.941 34.049 1.00 8.08  ? 36  PHE A C   1 
ATOM   332  O  O   . PHE A 1 37  ? 13.458 16.355 34.641 1.00 8.97  ? 36  PHE A O   1 
ATOM   333  C  CB  . PHE A 1 37  ? 14.593 15.803 31.879 1.00 9.17  ? 36  PHE A CB  1 
ATOM   334  C  CG  . PHE A 1 37  ? 13.982 16.985 31.209 1.00 8.87  ? 36  PHE A CG  1 
ATOM   335  C  CD1 . PHE A 1 37  ? 14.770 17.839 30.431 1.00 9.98  ? 36  PHE A CD1 1 
ATOM   336  C  CD2 . PHE A 1 37  ? 12.638 17.278 31.357 1.00 11.16 ? 36  PHE A CD2 1 
ATOM   337  C  CE1 . PHE A 1 37  ? 14.215 18.955 29.823 1.00 10.94 ? 36  PHE A CE1 1 
ATOM   338  C  CE2 . PHE A 1 37  ? 12.088 18.399 30.752 1.00 12.06 ? 36  PHE A CE2 1 
ATOM   339  C  CZ  . PHE A 1 37  ? 12.872 19.217 29.996 1.00 10.96 ? 36  PHE A CZ  1 
ATOM   340  N  N   . ASN A 1 38  ? 14.542 18.258 34.086 1.00 8.23  ? 37  ASN A N   1 
ATOM   341  C  CA  . ASN A 1 38  ? 13.585 19.188 34.662 1.00 9.28  ? 37  ASN A CA  1 
ATOM   342  C  C   . ASN A 1 38  ? 13.367 20.336 33.728 1.00 8.84  ? 37  ASN A C   1 
ATOM   343  O  O   . ASN A 1 38  ? 14.300 20.984 33.287 1.00 9.84  ? 37  ASN A O   1 
ATOM   344  C  CB  . ASN A 1 38  ? 14.065 19.730 35.963 1.00 10.44 ? 37  ASN A CB  1 
ATOM   345  C  CG  . ASN A 1 38  ? 13.878 18.801 37.039 1.00 13.24 ? 37  ASN A CG  1 
ATOM   346  O  OD1 . ASN A 1 38  ? 12.859 18.859 37.794 1.00 19.59 ? 37  ASN A OD1 1 
ATOM   347  N  ND2 . ASN A 1 38  ? 14.813 17.928 37.184 1.00 13.08 ? 37  ASN A ND2 1 
ATOM   348  N  N   . GLY A 1 39  ? 12.107 20.593 33.444 1.00 9.39  ? 38  GLY A N   1 
ATOM   349  C  CA  . GLY A 1 39  ? 11.723 21.717 32.625 1.00 9.83  ? 38  GLY A CA  1 
ATOM   350  C  C   . GLY A 1 39  ? 10.438 22.309 33.148 1.00 10.64 ? 38  GLY A C   1 
ATOM   351  O  O   . GLY A 1 39  ? 9.849  21.785 34.117 1.00 11.85 ? 38  GLY A O   1 
ATOM   352  N  N   . PRO A 1 40  ? 9.968  23.370 32.499 1.00 10.82 ? 39  PRO A N   1 
ATOM   353  C  CA  . PRO A 1 40  ? 8.733  24.019 32.960 1.00 12.79 ? 39  PRO A CA  1 
ATOM   354  C  C   . PRO A 1 40  ? 7.524  23.092 33.032 1.00 13.13 ? 39  PRO A C   1 
ATOM   355  O  O   . PRO A 1 40  ? 6.582  23.294 33.839 1.00 15.06 ? 39  PRO A O   1 
ATOM   356  C  CB  . PRO A 1 40  ? 8.477  25.059 31.883 1.00 14.08 ? 39  PRO A CB  1 
ATOM   357  C  CG  . PRO A 1 40  ? 9.738  25.301 31.227 1.00 13.12 ? 39  PRO A CG  1 
ATOM   358  C  CD  . PRO A 1 40  ? 10.622 24.097 31.403 1.00 10.90 ? 39  PRO A CD  1 
HETATM 359  N  N   . MSE A 1 41  ? 7.521  22.097 32.180 1.00 12.57 ? 40  MSE A N   1 
HETATM 360  C  CA  . MSE A 1 41  ? 6.367  21.202 32.041 1.00 13.54 ? 40  MSE A CA  1 
HETATM 361  C  C   . MSE A 1 41  ? 6.573  19.826 32.655 1.00 14.66 ? 40  MSE A C   1 
HETATM 362  O  O   . MSE A 1 41  ? 5.786  18.894 32.455 1.00 15.91 ? 40  MSE A O   1 
HETATM 363  C  CB  . MSE A 1 41  ? 6.008  21.102 30.578 1.00 13.85 ? 40  MSE A CB  1 
HETATM 364  C  CG  . MSE A 1 41  ? 5.457  22.429 30.029 1.00 14.60 ? 40  MSE A CG  1 
HETATM 365  SE SE  . MSE A 1 41  ? 5.220  22.487 28.143 0.75 18.00 ? 40  MSE A SE  1 
HETATM 366  C  CE  . MSE A 1 41  ? 7.057  22.460 27.591 1.00 16.50 ? 40  MSE A CE  1 
ATOM   367  N  N   . GLY A 1 42  ? 7.606  19.693 33.451 1.00 14.65 ? 41  GLY A N   1 
ATOM   368  C  CA  . GLY A 1 42  ? 7.746  18.509 34.247 1.00 15.29 ? 41  GLY A CA  1 
ATOM   369  C  C   . GLY A 1 42  ? 9.109  17.921 34.321 1.00 13.76 ? 41  GLY A C   1 
ATOM   370  O  O   . GLY A 1 42  ? 10.092 18.542 34.021 1.00 14.90 ? 41  GLY A O   1 
ATOM   371  N  N   . HIS A 1 43  ? 9.135  16.745 34.836 1.00 13.13 ? 42  HIS A N   1 
ATOM   372  C  CA  . HIS A 1 43  ? 10.359 16.029 35.165 1.00 11.83 ? 42  HIS A CA  1 
ATOM   373  C  C   . HIS A 1 43  ? 10.326 14.618 34.591 1.00 11.24 ? 42  HIS A C   1 
ATOM   374  O  O   . HIS A 1 43  ? 9.277  13.987 34.535 1.00 13.38 ? 42  HIS A O   1 
ATOM   375  C  CB  . HIS A 1 43  ? 10.464 16.003 36.680 1.00 12.68 ? 42  HIS A CB  1 
ATOM   376  C  CG  . HIS A 1 43  ? 11.378 14.981 37.232 1.00 13.25 ? 42  HIS A CG  1 
ATOM   377  N  ND1 . HIS A 1 43  ? 12.750 15.079 37.174 1.00 12.79 ? 42  HIS A ND1 1 
ATOM   378  C  CD2 . HIS A 1 43  ? 11.106 13.818 37.857 1.00 15.93 ? 42  HIS A CD2 1 
ATOM   379  C  CE1 . HIS A 1 43  ? 13.285 14.015 37.755 1.00 14.13 ? 42  HIS A CE1 1 
ATOM   380  N  NE2 . HIS A 1 43  ? 12.299 13.225 38.155 1.00 15.63 ? 42  HIS A NE2 1 
ATOM   381  N  N   . ARG A 1 44  ? 11.469 14.157 34.137 1.00 10.24 ? 43  ARG A N   1 
ATOM   382  C  CA  . ARG A 1 44  ? 11.652 12.766 33.674 1.00 10.95 ? 43  ARG A CA  1 
ATOM   383  C  C   . ARG A 1 44  ? 12.866 12.157 34.359 1.00 11.28 ? 43  ARG A C   1 
ATOM   384  O  O   . ARG A 1 44  ? 13.888 12.795 34.531 1.00 11.09 ? 43  ARG A O   1 
ATOM   385  C  CB  . ARG A 1 44  ? 11.850 12.679 32.172 1.00 11.96 ? 43  ARG A CB  1 
ATOM   386  C  CG  . ARG A 1 44  ? 10.729 13.171 31.295 1.00 16.56 ? 43  ARG A CG  1 
ATOM   387  C  CD  . ARG A 1 44  ? 9.491  12.365 31.481 1.00 17.66 ? 43  ARG A CD  1 
ATOM   388  N  NE  . ARG A 1 44  ? 8.389  12.845 30.625 1.00 21.18 ? 43  ARG A NE  1 
ATOM   389  N  N   A GLU A 1 45  ? 12.692 10.880 34.694 0.50 11.88 ? 44  GLU A N   1 
ATOM   390  N  N   B GLU A 1 45  ? 12.727 10.894 34.755 0.50 12.07 ? 44  GLU A N   1 
ATOM   391  C  CA  A GLU A 1 45  ? 13.658 10.052 35.370 0.50 13.42 ? 44  GLU A CA  1 
ATOM   392  C  CA  B GLU A 1 45  ? 13.810 10.157 35.384 0.50 13.84 ? 44  GLU A CA  1 
ATOM   393  C  C   A GLU A 1 45  ? 14.217 9.011  34.395 0.50 13.05 ? 44  GLU A C   1 
ATOM   394  C  C   B GLU A 1 45  ? 14.251 9.012  34.478 0.50 13.25 ? 44  GLU A C   1 
ATOM   395  O  O   A GLU A 1 45  ? 13.473 8.181  33.889 0.50 12.93 ? 44  GLU A O   1 
ATOM   396  O  O   B GLU A 1 45  ? 13.486 8.119  34.133 0.50 12.92 ? 44  GLU A O   1 
ATOM   397  C  CB  A GLU A 1 45  ? 12.951 9.358  36.551 0.50 14.70 ? 44  GLU A CB  1 
ATOM   398  C  CB  B GLU A 1 45  ? 13.387 9.636  36.758 0.50 15.34 ? 44  GLU A CB  1 
ATOM   399  C  CG  A GLU A 1 45  ? 13.786 8.439  37.400 0.50 17.46 ? 44  GLU A CG  1 
ATOM   400  C  CG  B GLU A 1 45  ? 14.304 8.615  37.368 0.50 19.30 ? 44  GLU A CG  1 
ATOM   401  C  CD  A GLU A 1 45  ? 14.890 9.150  38.224 0.50 19.18 ? 44  GLU A CD  1 
ATOM   402  C  CD  B GLU A 1 45  ? 15.576 9.213  37.907 0.50 21.87 ? 44  GLU A CD  1 
ATOM   403  O  OE1 A GLU A 1 45  ? 14.731 10.330 38.635 0.50 18.09 ? 44  GLU A OE1 1 
ATOM   404  O  OE1 B GLU A 1 45  ? 15.619 9.548  39.119 0.50 22.74 ? 44  GLU A OE1 1 
ATOM   405  O  OE2 A GLU A 1 45  ? 15.938 8.510  38.471 0.50 21.14 ? 44  GLU A OE2 1 
ATOM   406  O  OE2 B GLU A 1 45  ? 16.537 9.349  37.123 0.50 23.41 ? 44  GLU A OE2 1 
ATOM   407  N  N   . GLY A 1 46  ? 15.516 9.072  34.123 1.00 13.24 ? 45  GLY A N   1 
ATOM   408  C  CA  . GLY A 1 46  ? 16.176 8.081  33.263 1.00 13.44 ? 45  GLY A CA  1 
ATOM   409  C  C   . GLY A 1 46  ? 16.377 8.498  31.834 1.00 13.43 ? 45  GLY A C   1 
ATOM   410  O  O   . GLY A 1 46  ? 15.544 9.182  31.250 1.00 13.47 ? 45  GLY A O   1 
ATOM   411  N  N   . SER A 1 47  ? 17.507 8.090  31.265 1.00 13.54 ? 46  SER A N   1 
ATOM   412  C  CA  . SER A 1 47  ? 17.789 8.435  29.877 1.00 13.57 ? 46  SER A CA  1 
ATOM   413  C  C   . SER A 1 47  ? 16.783 7.798  28.929 1.00 14.06 ? 46  SER A C   1 
ATOM   414  O  O   . SER A 1 47  ? 16.450 8.358  27.889 1.00 14.04 ? 46  SER A O   1 
ATOM   415  C  CB  . SER A 1 47  ? 19.225 8.070  29.483 1.00 13.76 ? 46  SER A CB  1 
ATOM   416  O  OG  . SER A 1 47  ? 19.401 6.683  29.623 1.00 15.75 ? 46  SER A OG  1 
ATOM   417  N  N   . GLU A 1 48  ? 16.291 6.629  29.300 1.00 15.78 ? 47  GLU A N   1 
ATOM   418  C  CA  . GLU A 1 48  ? 15.391 5.904  28.416 1.00 16.50 ? 47  GLU A CA  1 
ATOM   419  C  C   . GLU A 1 48  ? 14.104 6.695  28.188 1.00 15.11 ? 47  GLU A C   1 
ATOM   420  O  O   . GLU A 1 48  ? 13.649 6.910  27.066 1.00 15.63 ? 47  GLU A O   1 
ATOM   421  C  CB  . GLU A 1 48  ? 15.076 4.535  29.007 1.00 17.41 ? 47  GLU A CB  1 
ATOM   422  C  CG  . GLU A 1 48  ? 14.139 3.673  28.154 1.00 19.89 ? 47  GLU A CG  1 
ATOM   423  N  N   . ARG A 1 49  ? 13.523 7.136  29.277 1.00 15.43 ? 48  ARG A N   1 
ATOM   424  C  CA  . ARG A 1 49  ? 12.276 7.847  29.224 1.00 15.92 ? 48  ARG A CA  1 
ATOM   425  C  C   . ARG A 1 49  ? 12.458 9.181  28.512 1.00 14.03 ? 48  ARG A C   1 
ATOM   426  O  O   . ARG A 1 49  ? 11.679 9.562  27.661 1.00 14.02 ? 48  ARG A O   1 
ATOM   427  C  CB  . ARG A 1 49  ? 11.744 8.086  30.636 1.00 17.16 ? 48  ARG A CB  1 
ATOM   428  C  CG  . ARG A 1 49  ? 10.552 8.987  30.687 1.00 21.41 ? 48  ARG A CG  1 
ATOM   429  C  CD  . ARG A 1 49  ? 9.444  8.566  29.705 1.00 26.88 ? 48  ARG A CD  1 
ATOM   430  N  NE  . ARG A 1 49  ? 8.306  9.480  29.847 1.00 29.30 ? 48  ARG A NE  1 
ATOM   431  C  CZ  . ARG A 1 49  ? 7.332  9.305  30.737 1.00 30.79 ? 48  ARG A CZ  1 
ATOM   432  N  NH1 . ARG A 1 49  ? 7.313  8.210  31.492 1.00 30.15 ? 48  ARG A NH1 1 
ATOM   433  N  NH2 . ARG A 1 49  ? 6.359  10.192 30.842 1.00 30.88 ? 48  ARG A NH2 1 
ATOM   434  N  N   A TYR A 1 50  ? 13.521 9.915  28.832 0.50 12.77 ? 49  TYR A N   1 
ATOM   435  N  N   B TYR A 1 50  ? 13.521 9.886  28.855 0.50 13.38 ? 49  TYR A N   1 
ATOM   436  C  CA  A TYR A 1 50  ? 13.725 11.221 28.187 0.50 11.60 ? 49  TYR A CA  1 
ATOM   437  C  CA  B TYR A 1 50  ? 13.761 11.175 28.242 0.50 12.63 ? 49  TYR A CA  1 
ATOM   438  C  C   A TYR A 1 50  ? 13.970 11.046 26.684 0.50 11.43 ? 49  TYR A C   1 
ATOM   439  C  C   B TYR A 1 50  ? 13.965 11.029 26.723 0.50 12.05 ? 49  TYR A C   1 
ATOM   440  O  O   A TYR A 1 50  ? 13.418 11.770 25.862 0.50 12.03 ? 49  TYR A O   1 
ATOM   441  O  O   B TYR A 1 50  ? 13.360 11.745 25.936 0.50 12.60 ? 49  TYR A O   1 
ATOM   442  C  CB  A TYR A 1 50  ? 14.860 12.016 28.836 0.50 11.11 ? 49  TYR A CB  1 
ATOM   443  C  CB  B TYR A 1 50  ? 14.950 11.846 28.900 0.50 12.56 ? 49  TYR A CB  1 
ATOM   444  C  CG  A TYR A 1 50  ? 14.948 13.450 28.327 0.50 9.90  ? 49  TYR A CG  1 
ATOM   445  C  CG  B TYR A 1 50  ? 15.330 13.115 28.212 0.50 13.83 ? 49  TYR A CG  1 
ATOM   446  C  CD1 A TYR A 1 50  ? 13.909 14.338 28.519 0.50 9.68  ? 49  TYR A CD1 1 
ATOM   447  C  CD1 B TYR A 1 50  ? 14.625 14.289 28.441 0.50 14.38 ? 49  TYR A CD1 1 
ATOM   448  C  CD2 A TYR A 1 50  ? 16.077 13.913 27.659 0.50 8.41  ? 49  TYR A CD2 1 
ATOM   449  C  CD2 B TYR A 1 50  ? 16.370 13.142 27.302 0.50 15.96 ? 49  TYR A CD2 1 
ATOM   450  C  CE1 A TYR A 1 50  ? 13.986 15.637 28.065 0.50 8.50  ? 49  TYR A CE1 1 
ATOM   451  C  CE1 B TYR A 1 50  ? 14.970 15.472 27.810 0.50 16.63 ? 49  TYR A CE1 1 
ATOM   452  C  CE2 A TYR A 1 50  ? 16.166 15.207 27.187 0.50 8.40  ? 49  TYR A CE2 1 
ATOM   453  C  CE2 B TYR A 1 50  ? 16.731 14.334 26.667 0.50 17.30 ? 49  TYR A CE2 1 
ATOM   454  C  CZ  A TYR A 1 50  ? 15.125 16.067 27.394 0.50 9.46  ? 49  TYR A CZ  1 
ATOM   455  C  CZ  B TYR A 1 50  ? 16.018 15.487 26.914 0.50 16.53 ? 49  TYR A CZ  1 
ATOM   456  O  OH  A TYR A 1 50  ? 15.198 17.365 26.969 0.50 9.98  ? 49  TYR A OH  1 
ATOM   457  O  OH  B TYR A 1 50  ? 16.386 16.657 26.266 0.50 19.90 ? 49  TYR A OH  1 
HETATM 458  N  N   . MSE A 1 51  ? 14.770 10.052 26.316 1.00 11.80 ? 50  MSE A N   1 
HETATM 459  C  CA  . MSE A 1 51  ? 15.061 9.853  24.874 1.00 12.63 ? 50  MSE A CA  1 
HETATM 460  C  C   . MSE A 1 51  ? 13.840 9.362  24.096 1.00 13.01 ? 50  MSE A C   1 
HETATM 461  O  O   . MSE A 1 51  ? 13.668 9.695  22.948 1.00 14.26 ? 50  MSE A O   1 
HETATM 462  C  CB  . MSE A 1 51  ? 16.248 8.941  24.680 1.00 12.56 ? 50  MSE A CB  1 
HETATM 463  C  CG  . MSE A 1 51  ? 17.541 9.630  25.118 1.00 14.27 ? 50  MSE A CG  1 
HETATM 464  SE SE  . MSE A 1 51  ? 17.905 11.352 24.265 0.75 16.90 ? 50  MSE A SE  1 
HETATM 465  C  CE  . MSE A 1 51  ? 17.464 10.890 22.462 1.00 15.06 ? 50  MSE A CE  1 
ATOM   466  N  N   . ASN A 1 52  ? 12.972 8.599  24.746 1.00 13.89 ? 51  ASN A N   1 
ATOM   467  C  CA  . ASN A 1 52  ? 11.724 8.175  24.078 1.00 15.38 ? 51  ASN A CA  1 
ATOM   468  C  C   . ASN A 1 52  ? 10.882 9.414  23.771 1.00 15.00 ? 51  ASN A C   1 
ATOM   469  O  O   . ASN A 1 52  ? 10.292 9.557  22.685 1.00 16.24 ? 51  ASN A O   1 
ATOM   470  C  CB  . ASN A 1 52  ? 10.937 7.166  24.920 1.00 16.88 ? 51  ASN A CB  1 
ATOM   471  C  CG  . ASN A 1 52  ? 11.548 5.789  24.924 1.00 21.24 ? 51  ASN A CG  1 
ATOM   472  O  OD1 . ASN A 1 52  ? 12.334 5.439  24.043 1.00 27.46 ? 51  ASN A OD1 1 
ATOM   473  N  ND2 . ASN A 1 52  ? 11.149 4.973  25.894 1.00 24.99 ? 51  ASN A ND2 1 
ATOM   474  N  N   . ASP A 1 53  ? 10.814 10.319 24.741 1.00 14.55 ? 52  ASP A N   1 
ATOM   475  C  CA  . ASP A 1 53  ? 10.119 11.596 24.509 1.00 15.60 ? 52  ASP A CA  1 
ATOM   476  C  C   . ASP A 1 53  ? 10.777 12.385 23.391 1.00 14.75 ? 52  ASP A C   1 
ATOM   477  O  O   . ASP A 1 53  ? 10.119 12.916 22.504 1.00 16.09 ? 52  ASP A O   1 
ATOM   478  C  CB  . ASP A 1 53  ? 10.095 12.488 25.752 1.00 16.86 ? 52  ASP A CB  1 
ATOM   479  C  CG  . ASP A 1 53  ? 9.118  12.032 26.788 1.00 19.62 ? 52  ASP A CG  1 
ATOM   480  O  OD1 . ASP A 1 53  ? 8.289  11.174 26.502 1.00 24.44 ? 52  ASP A OD1 1 
ATOM   481  O  OD2 . ASP A 1 53  ? 9.244  12.539 27.914 1.00 24.14 ? 52  ASP A OD2 1 
HETATM 482  N  N   A MSE A 1 54  ? 12.103 12.473 23.457 0.33 13.64 ? 53  MSE A N   1 
HETATM 483  N  N   B MSE A 1 54  ? 12.095 12.474 23.451 0.33 14.35 ? 53  MSE A N   1 
HETATM 484  N  N   C MSE A 1 54  ? 12.097 12.425 23.408 0.34 15.66 ? 53  MSE A N   1 
HETATM 485  C  CA  A MSE A 1 54  ? 12.878 13.268 22.479 0.33 12.78 ? 53  MSE A CA  1 
HETATM 486  C  CA  B MSE A 1 54  ? 12.821 13.290 22.473 0.33 14.02 ? 53  MSE A CA  1 
HETATM 487  C  CA  C MSE A 1 54  ? 12.800 13.206 22.379 0.34 16.26 ? 53  MSE A CA  1 
HETATM 488  C  C   A MSE A 1 54  ? 12.624 12.790 21.054 0.33 12.90 ? 53  MSE A C   1 
HETATM 489  C  C   B MSE A 1 54  ? 12.640 12.761 21.054 0.33 13.68 ? 53  MSE A C   1 
HETATM 490  C  C   C MSE A 1 54  ? 12.582 12.619 20.988 0.34 15.66 ? 53  MSE A C   1 
HETATM 491  O  O   A MSE A 1 54  ? 12.530 13.594 20.126 0.33 11.80 ? 53  MSE A O   1 
HETATM 492  O  O   B MSE A 1 54  ? 12.588 13.544 20.103 0.33 12.79 ? 53  MSE A O   1 
HETATM 493  O  O   C MSE A 1 54  ? 12.353 13.356 20.036 0.34 15.16 ? 53  MSE A O   1 
HETATM 494  C  CB  A MSE A 1 54  ? 14.388 13.219 22.770 0.33 12.50 ? 53  MSE A CB  1 
HETATM 495  C  CB  B MSE A 1 54  ? 14.308 13.379 22.823 0.33 14.25 ? 53  MSE A CB  1 
HETATM 496  C  CB  C MSE A 1 54  ? 14.290 13.316 22.651 0.34 17.10 ? 53  MSE A CB  1 
HETATM 497  C  CG  A MSE A 1 54  ? 14.929 14.163 23.892 0.33 11.11 ? 53  MSE A CG  1 
HETATM 498  C  CG  B MSE A 1 54  ? 14.626 14.267 24.044 0.33 15.08 ? 53  MSE A CG  1 
HETATM 499  C  CG  C MSE A 1 54  ? 14.993 14.034 21.514 0.34 20.72 ? 53  MSE A CG  1 
HETATM 500  SE SE  A MSE A 1 54  ? 14.647 16.104 23.641 0.25 13.51 ? 53  MSE A SE  1 
HETATM 501  SE SE  B MSE A 1 54  ? 13.777 16.049 24.058 0.25 17.91 ? 53  MSE A SE  1 
HETATM 502  SE SE  C MSE A 1 54  ? 14.298 15.817 21.029 0.25 27.51 ? 53  MSE A SE  1 
HETATM 503  C  CE  A MSE A 1 54  ? 12.814 16.202 24.354 0.33 9.98  ? 53  MSE A CE  1 
HETATM 504  C  CE  B MSE A 1 54  ? 12.093 15.628 24.930 0.33 17.74 ? 53  MSE A CE  1 
HETATM 505  C  CE  C MSE A 1 54  ? 12.383 15.548 21.043 0.34 26.58 ? 53  MSE A CE  1 
ATOM   506  N  N   A GLU A 1 55  ? 12.508 11.473 20.904 0.80 14.27 ? 54  GLU A N   1 
ATOM   507  N  N   B GLU A 1 55  ? 12.518 11.437 20.936 0.20 14.39 ? 54  GLU A N   1 
ATOM   508  C  CA  A GLU A 1 55  ? 12.314 10.883 19.563 0.80 15.11 ? 54  GLU A CA  1 
ATOM   509  C  CA  B GLU A 1 55  ? 12.400 10.780 19.625 0.20 14.91 ? 54  GLU A CA  1 
ATOM   510  C  C   A GLU A 1 55  ? 10.928 11.240 19.014 0.80 14.80 ? 54  GLU A C   1 
ATOM   511  C  C   B GLU A 1 55  ? 11.012 10.960 19.027 0.20 15.05 ? 54  GLU A C   1 
ATOM   512  O  O   A GLU A 1 55  ? 10.760 11.470 17.829 0.80 15.26 ? 54  GLU A O   1 
ATOM   513  O  O   B GLU A 1 55  ? 10.813 10.771 17.825 0.20 14.90 ? 54  GLU A O   1 
ATOM   514  C  CB  A GLU A 1 55  ? 12.507 9.367  19.583 0.80 15.76 ? 54  GLU A CB  1 
ATOM   515  C  CB  B GLU A 1 55  ? 12.714 9.292  19.729 0.20 15.08 ? 54  GLU A CB  1 
ATOM   516  C  CG  A GLU A 1 55  ? 12.416 8.721  18.189 0.80 16.41 ? 54  GLU A CG  1 
ATOM   517  C  CG  B GLU A 1 55  ? 14.180 8.998  19.783 0.20 15.44 ? 54  GLU A CG  1 
ATOM   518  N  N   A LYS A 1 56  ? 9.940  11.346 19.900 0.50 14.67 ? 55  LYS A N   1 
ATOM   519  N  N   B LYS A 1 56  ? 10.061 11.301 19.893 0.50 15.53 ? 55  LYS A N   1 
ATOM   520  C  CA  A LYS A 1 56  ? 8.606  11.786 19.472 0.50 14.72 ? 55  LYS A CA  1 
ATOM   521  C  CA  B LYS A 1 56  ? 8.705  11.634 19.481 0.50 16.00 ? 55  LYS A CA  1 
ATOM   522  C  C   A LYS A 1 56  ? 8.514  13.297 19.268 0.50 14.50 ? 55  LYS A C   1 
ATOM   523  C  C   B LYS A 1 56  ? 8.580  13.117 19.156 0.50 15.73 ? 55  LYS A C   1 
ATOM   524  O  O   A LYS A 1 56  ? 7.798  13.766 18.393 0.50 15.22 ? 55  LYS A O   1 
ATOM   525  O  O   B LYS A 1 56  ? 7.982  13.479 18.154 0.50 16.95 ? 55  LYS A O   1 
ATOM   526  C  CB  A LYS A 1 56  ? 7.548  11.360 20.493 0.50 15.02 ? 55  LYS A CB  1 
ATOM   527  C  CB  B LYS A 1 56  ? 7.705  11.273 20.586 0.50 16.44 ? 55  LYS A CB  1 
ATOM   528  C  CG  A LYS A 1 56  ? 7.444  9.849  20.667 0.50 16.17 ? 55  LYS A CG  1 
ATOM   529  C  CG  B LYS A 1 56  ? 6.280  11.714 20.306 0.50 18.23 ? 55  LYS A CG  1 
HETATM 530  N  N   A MSE A 1 57  ? 9.192  14.076 20.110 0.33 13.61 ? 56  MSE A N   1 
HETATM 531  N  N   B MSE A 1 57  ? 9.166  13.969 20.006 0.33 15.40 ? 56  MSE A N   1 
HETATM 532  N  N   C MSE A 1 57  ? 9.225  14.120 20.025 0.34 13.09 ? 56  MSE A N   1 
HETATM 533  C  CA  A MSE A 1 57  ? 9.100  15.530 20.036 0.33 13.52 ? 56  MSE A CA  1 
HETATM 534  C  CA  B MSE A 1 57  ? 9.008  15.427 19.927 0.33 15.45 ? 56  MSE A CA  1 
HETATM 535  C  CA  C MSE A 1 57  ? 8.999  15.544 19.957 0.34 13.98 ? 56  MSE A CA  1 
HETATM 536  C  C   A MSE A 1 57  ? 9.828  16.092 18.823 0.33 13.24 ? 56  MSE A C   1 
HETATM 537  C  C   B MSE A 1 57  ? 9.829  16.099 18.829 0.33 14.37 ? 56  MSE A C   1 
HETATM 538  C  C   C MSE A 1 57  ? 9.869  16.185 18.879 0.34 13.41 ? 56  MSE A C   1 
HETATM 539  O  O   A MSE A 1 57  ? 9.334  16.962 18.121 0.33 13.58 ? 56  MSE A O   1 
HETATM 540  O  O   B MSE A 1 57  ? 9.413  17.096 18.247 0.33 14.38 ? 56  MSE A O   1 
HETATM 541  O  O   C MSE A 1 57  ? 9.522  17.239 18.346 0.34 13.20 ? 56  MSE A O   1 
HETATM 542  C  CB  A MSE A 1 57  ? 9.667  16.167 21.309 0.33 13.87 ? 56  MSE A CB  1 
HETATM 543  C  CB  B MSE A 1 57  ? 9.377  16.048 21.276 0.33 16.58 ? 56  MSE A CB  1 
HETATM 544  C  CB  C MSE A 1 57  ? 9.260  16.179 21.322 0.34 15.30 ? 56  MSE A CB  1 
HETATM 545  C  CG  A MSE A 1 57  ? 8.755  16.043 22.521 0.33 14.85 ? 56  MSE A CG  1 
HETATM 546  C  CG  B MSE A 1 57  ? 8.421  15.668 22.393 0.33 19.45 ? 56  MSE A CG  1 
HETATM 547  C  CG  C MSE A 1 57  ? 8.357  15.621 22.415 0.34 18.76 ? 56  MSE A CG  1 
HETATM 548  SE SE  A MSE A 1 57  ? 6.954  16.786 22.292 0.25 18.74 ? 56  MSE A SE  1 
HETATM 549  SE SE  B MSE A 1 57  ? 9.045  16.285 24.134 0.25 27.28 ? 56  MSE A SE  1 
HETATM 550  SE SE  C MSE A 1 57  ? 6.451  15.710 21.985 0.25 27.98 ? 56  MSE A SE  1 
HETATM 551  C  CE  A MSE A 1 57  ? 6.187  15.489 21.027 0.33 19.49 ? 56  MSE A CE  1 
HETATM 552  C  CE  B MSE A 1 57  ? 7.648  15.530 25.267 0.33 25.63 ? 56  MSE A CE  1 
HETATM 553  C  CE  C MSE A 1 57  ? 6.334  17.613 21.574 0.34 26.09 ? 56  MSE A CE  1 
ATOM   554  N  N   . LYS A 1 58  ? 11.017 15.565 18.603 1.00 13.40 ? 57  LYS A N   1 
ATOM   555  C  CA  . LYS A 1 58  ? 11.900 16.065 17.540 1.00 13.82 ? 57  LYS A CA  1 
ATOM   556  C  C   . LYS A 1 58  ? 12.200 17.571 17.606 1.00 12.91 ? 57  LYS A C   1 
ATOM   557  O  O   . LYS A 1 58  ? 12.129 18.291 16.637 1.00 13.90 ? 57  LYS A O   1 
ATOM   558  C  CB  . LYS A 1 58  ? 11.320 15.705 16.161 1.00 14.65 ? 57  LYS A CB  1 
ATOM   559  C  CG  . LYS A 1 58  ? 11.085 14.208 16.004 1.00 17.45 ? 57  LYS A CG  1 
ATOM   560  C  CD  . LYS A 1 58  ? 10.562 13.857 14.628 1.00 19.45 ? 57  LYS A CD  1 
ATOM   561  C  CE  . LYS A 1 58  ? 10.853 12.427 14.328 1.00 24.11 ? 57  LYS A CE  1 
ATOM   562  N  NZ  . LYS A 1 58  ? 10.192 11.469 15.175 1.00 26.41 ? 57  LYS A NZ  1 
ATOM   563  N  N   . PHE A 1 59  ? 12.553 18.015 18.802 1.00 13.09 ? 58  PHE A N   1 
ATOM   564  C  CA  . PHE A 1 59  ? 12.942 19.406 19.028 1.00 12.45 ? 58  PHE A CA  1 
ATOM   565  C  C   . PHE A 1 59  ? 14.254 19.709 18.329 1.00 12.51 ? 58  PHE A C   1 
ATOM   566  O  O   . PHE A 1 59  ? 15.095 18.846 18.184 1.00 13.32 ? 58  PHE A O   1 
ATOM   567  C  CB  . PHE A 1 59  ? 13.113 19.723 20.527 1.00 13.28 ? 58  PHE A CB  1 
ATOM   568  C  CG  . PHE A 1 59  ? 11.871 19.601 21.345 1.00 14.04 ? 58  PHE A CG  1 
ATOM   569  C  CD1 . PHE A 1 59  ? 10.612 19.759 20.798 1.00 15.99 ? 58  PHE A CD1 1 
ATOM   570  C  CD2 . PHE A 1 59  ? 11.984 19.356 22.685 1.00 15.15 ? 58  PHE A CD2 1 
ATOM   571  C  CE1 . PHE A 1 59  ? 9.476  19.667 21.620 1.00 15.42 ? 58  PHE A CE1 1 
ATOM   572  C  CE2 . PHE A 1 59  ? 10.848 19.280 23.478 1.00 15.44 ? 58  PHE A CE2 1 
ATOM   573  C  CZ  . PHE A 1 59  ? 9.618  19.422 22.935 1.00 15.25 ? 58  PHE A CZ  1 
ATOM   574  N  N   . LYS A 1 60  ? 14.349 20.938 17.836 1.00 12.50 ? 59  LYS A N   1 
ATOM   575  C  CA  . LYS A 1 60  ? 15.544 21.453 17.183 1.00 13.32 ? 59  LYS A CA  1 
ATOM   576  C  C   . LYS A 1 60  ? 16.096 22.660 17.941 1.00 12.73 ? 59  LYS A C   1 
ATOM   577  O  O   . LYS A 1 60  ? 15.349 23.420 18.502 1.00 14.60 ? 59  LYS A O   1 
ATOM   578  C  CB  . LYS A 1 60  ? 15.257 21.818 15.731 1.00 13.98 ? 59  LYS A CB  1 
ATOM   579  C  CG  . LYS A 1 60  ? 14.727 20.676 14.888 1.00 15.44 ? 59  LYS A CG  1 
ATOM   580  C  CD  . LYS A 1 60  ? 15.728 19.542 14.778 1.00 14.98 ? 59  LYS A CD  1 
ATOM   581  C  CE  . LYS A 1 60  ? 15.247 18.362 13.919 1.00 16.38 ? 59  LYS A CE  1 
ATOM   582  N  NZ  . LYS A 1 60  ? 14.060 17.663 14.474 1.00 17.33 ? 59  LYS A NZ  1 
ATOM   583  N  N   . TYR A 1 61  ? 17.422 22.820 17.928 1.00 12.77 ? 60  TYR A N   1 
ATOM   584  C  CA  . TYR A 1 61  ? 18.120 23.793 18.763 1.00 12.38 ? 60  TYR A CA  1 
ATOM   585  C  C   . TYR A 1 61  ? 19.071 24.647 17.956 1.00 12.73 ? 60  TYR A C   1 
ATOM   586  O  O   . TYR A 1 61  ? 19.838 24.118 17.135 1.00 14.99 ? 60  TYR A O   1 
ATOM   587  C  CB  . TYR A 1 61  ? 18.940 23.057 19.839 1.00 12.48 ? 60  TYR A CB  1 
ATOM   588  C  CG  . TYR A 1 61  ? 18.114 22.131 20.690 1.00 11.72 ? 60  TYR A CG  1 
ATOM   589  C  CD1 . TYR A 1 61  ? 17.760 20.884 20.228 1.00 13.66 ? 60  TYR A CD1 1 
ATOM   590  C  CD2 . TYR A 1 61  ? 17.675 22.512 21.945 1.00 11.93 ? 60  TYR A CD2 1 
ATOM   591  C  CE1 . TYR A 1 61  ? 16.975 20.023 20.991 1.00 13.58 ? 60  TYR A CE1 1 
ATOM   592  C  CE2 . TYR A 1 61  ? 16.899 21.667 22.723 1.00 13.16 ? 60  TYR A CE2 1 
ATOM   593  C  CZ  . TYR A 1 61  ? 16.561 20.419 22.225 1.00 13.97 ? 60  TYR A CZ  1 
ATOM   594  O  OH  . TYR A 1 61  ? 15.759 19.530 22.911 1.00 17.48 ? 60  TYR A OH  1 
ATOM   595  N  N   . VAL A 1 62  ? 19.044 25.938 18.215 1.00 13.00 ? 61  VAL A N   1 
ATOM   596  C  CA  . VAL A 1 62  ? 20.033 26.814 17.660 1.00 14.11 ? 61  VAL A CA  1 
ATOM   597  C  C   . VAL A 1 62  ? 20.744 27.439 18.839 1.00 12.61 ? 61  VAL A C   1 
ATOM   598  O  O   . VAL A 1 62  ? 20.150 28.208 19.598 1.00 13.25 ? 61  VAL A O   1 
ATOM   599  C  CB  . VAL A 1 62  ? 19.435 27.907 16.778 1.00 14.91 ? 61  VAL A CB  1 
ATOM   600  C  CG1 . VAL A 1 62  ? 20.527 28.862 16.352 1.00 17.36 ? 61  VAL A CG1 1 
ATOM   601  C  CG2 . VAL A 1 62  ? 18.680 27.307 15.551 1.00 16.69 ? 61  VAL A CG2 1 
ATOM   602  N  N   . VAL A 1 63  ? 22.018 27.093 18.968 1.00 13.18 ? 62  VAL A N   1 
ATOM   603  C  CA  . VAL A 1 63  ? 22.820 27.538 20.100 1.00 13.46 ? 62  VAL A CA  1 
ATOM   604  C  C   . VAL A 1 63  ? 23.437 28.918 19.792 1.00 13.76 ? 62  VAL A C   1 
ATOM   605  O  O   . VAL A 1 63  ? 24.180 29.090 18.795 1.00 15.65 ? 62  VAL A O   1 
ATOM   606  C  CB  . VAL A 1 63  ? 23.955 26.542 20.433 1.00 13.83 ? 62  VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 63  ? 24.806 27.078 21.584 1.00 14.95 ? 62  VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 63  ? 23.413 25.151 20.781 1.00 15.46 ? 62  VAL A CG2 1 
ATOM   609  N  N   . HIS A 1 64  ? 23.121 29.885 20.642 1.00 13.20 ? 63  HIS A N   1 
ATOM   610  C  CA  . HIS A 1 64  ? 23.621 31.262 20.524 1.00 14.30 ? 63  HIS A CA  1 
ATOM   611  C  C   . HIS A 1 64  ? 24.814 31.531 21.412 1.00 13.87 ? 63  HIS A C   1 
ATOM   612  O  O   . HIS A 1 64  ? 25.704 32.290 21.047 1.00 16.22 ? 63  HIS A O   1 
ATOM   613  C  CB  . HIS A 1 64  ? 22.513 32.251 20.823 1.00 14.13 ? 63  HIS A CB  1 
ATOM   614  C  CG  . HIS A 1 64  ? 21.461 32.243 19.772 1.00 18.22 ? 63  HIS A CG  1 
ATOM   615  N  ND1 . HIS A 1 64  ? 20.147 31.925 20.016 1.00 20.33 ? 63  HIS A ND1 1 
ATOM   616  C  CD2 . HIS A 1 64  ? 21.557 32.474 18.444 1.00 19.98 ? 63  HIS A CD2 1 
ATOM   617  C  CE1 . HIS A 1 64  ? 19.471 31.988 18.882 1.00 19.39 ? 63  HIS A CE1 1 
ATOM   618  N  NE2 . HIS A 1 64  ? 20.306 32.309 17.913 1.00 22.81 ? 63  HIS A NE2 1 
ATOM   619  N  N   . LYS A 1 65  ? 24.842 30.932 22.591 1.00 13.68 ? 64  LYS A N   1 
ATOM   620  C  CA  . LYS A 1 65  ? 25.939 31.127 23.556 1.00 14.02 ? 64  LYS A CA  1 
ATOM   621  C  C   . LYS A 1 65  ? 26.134 29.873 24.343 1.00 12.82 ? 64  LYS A C   1 
ATOM   622  O  O   . LYS A 1 65  ? 25.184 29.133 24.598 1.00 12.09 ? 64  LYS A O   1 
ATOM   623  C  CB  . LYS A 1 65  ? 25.641 32.278 24.514 1.00 16.20 ? 64  LYS A CB  1 
ATOM   624  C  CG  . LYS A 1 65  ? 25.460 33.603 23.836 1.00 19.10 ? 64  LYS A CG  1 
ATOM   625  C  CD  . LYS A 1 65  ? 25.023 34.665 24.815 1.00 22.01 ? 64  LYS A CD  1 
ATOM   626  C  CE  . LYS A 1 65  ? 24.655 35.991 24.118 1.00 24.02 ? 64  LYS A CE  1 
ATOM   627  N  NZ  . LYS A 1 65  ? 25.799 36.746 23.555 1.00 24.23 ? 64  LYS A NZ  1 
HETATM 628  N  N   . MSE A 1 66  ? 27.381 29.629 24.704 1.00 12.89 ? 65  MSE A N   1 
HETATM 629  C  CA  . MSE A 1 66  ? 27.743 28.489 25.518 1.00 12.59 ? 65  MSE A CA  1 
HETATM 630  C  C   . MSE A 1 66  ? 28.680 28.947 26.606 1.00 11.93 ? 65  MSE A C   1 
HETATM 631  O  O   . MSE A 1 66  ? 29.653 29.686 26.349 1.00 14.13 ? 65  MSE A O   1 
HETATM 632  C  CB  . MSE A 1 66  ? 28.413 27.446 24.648 1.00 14.23 ? 65  MSE A CB  1 
HETATM 633  C  CG  . MSE A 1 66  ? 28.905 26.240 25.397 1.00 15.14 ? 65  MSE A CG  1 
HETATM 634  SE SE  . MSE A 1 66  ? 29.465 24.921 24.170 0.75 27.09 ? 65  MSE A SE  1 
HETATM 635  C  CE  . MSE A 1 66  ? 29.289 23.490 25.304 1.00 17.26 ? 65  MSE A CE  1 
ATOM   636  N  N   . PHE A 1 67  ? 28.394 28.478 27.805 1.00 9.84  ? 66  PHE A N   1 
ATOM   637  C  CA  . PHE A 1 67  ? 29.191 28.732 28.976 1.00 10.62 ? 66  PHE A CA  1 
ATOM   638  C  C   . PHE A 1 67  ? 29.591 27.432 29.636 1.00 10.52 ? 66  PHE A C   1 
ATOM   639  O  O   . PHE A 1 67  ? 28.866 26.455 29.584 1.00 9.81  ? 66  PHE A O   1 
ATOM   640  C  CB  . PHE A 1 67  ? 28.418 29.524 30.055 1.00 11.42 ? 66  PHE A CB  1 
ATOM   641  C  CG  . PHE A 1 67  ? 27.843 30.805 29.583 1.00 10.49 ? 66  PHE A CG  1 
ATOM   642  C  CD1 . PHE A 1 67  ? 26.613 30.865 28.981 1.00 10.92 ? 66  PHE A CD1 1 
ATOM   643  C  CD2 . PHE A 1 67  ? 28.513 31.998 29.839 1.00 12.06 ? 66  PHE A CD2 1 
ATOM   644  C  CE1 . PHE A 1 67  ? 26.077 32.073 28.587 1.00 11.20 ? 66  PHE A CE1 1 
ATOM   645  C  CE2 . PHE A 1 67  ? 27.977 33.213 29.442 1.00 12.41 ? 66  PHE A CE2 1 
ATOM   646  C  CZ  . PHE A 1 67  ? 26.763 33.237 28.797 1.00 11.62 ? 66  PHE A CZ  1 
ATOM   647  N  N   A GLU A 1 68  ? 30.759 27.422 30.276 0.50 11.16 ? 67  GLU A N   1 
ATOM   648  N  N   B GLU A 1 68  ? 30.696 27.473 30.355 0.50 11.69 ? 67  GLU A N   1 
ATOM   649  C  CA  A GLU A 1 68  ? 31.179 26.278 31.109 0.50 11.60 ? 67  GLU A CA  1 
ATOM   650  C  CA  B GLU A 1 68  ? 31.108 26.316 31.126 0.50 12.67 ? 67  GLU A CA  1 
ATOM   651  C  C   A GLU A 1 68  ? 31.808 26.770 32.401 0.50 10.54 ? 67  GLU A C   1 
ATOM   652  C  C   B GLU A 1 68  ? 31.857 26.726 32.385 0.50 11.35 ? 67  GLU A C   1 
ATOM   653  O  O   A GLU A 1 68  ? 32.544 27.755 32.429 0.50 13.54 ? 67  GLU A O   1 
ATOM   654  O  O   B GLU A 1 68  ? 32.732 27.600 32.367 0.50 14.87 ? 67  GLU A O   1 
ATOM   655  C  CB  A GLU A 1 68  ? 32.199 25.324 30.442 0.50 12.85 ? 67  GLU A CB  1 
ATOM   656  C  CB  B GLU A 1 68  ? 31.963 25.357 30.291 0.50 14.60 ? 67  GLU A CB  1 
ATOM   657  C  CG  A GLU A 1 68  ? 32.401 24.007 31.270 0.50 13.12 ? 67  GLU A CG  1 
ATOM   658  C  CG  B GLU A 1 68  ? 33.054 25.968 29.457 0.50 17.04 ? 67  GLU A CG  1 
ATOM   659  C  CD  A GLU A 1 68  ? 33.204 22.924 30.543 0.50 15.31 ? 67  GLU A CD  1 
ATOM   660  C  CD  B GLU A 1 68  ? 33.725 24.901 28.577 0.50 19.11 ? 67  GLU A CD  1 
ATOM   661  O  OE1 A GLU A 1 68  ? 34.266 23.227 29.991 0.50 13.94 ? 67  GLU A OE1 1 
ATOM   662  O  OE1 B GLU A 1 68  ? 34.028 25.174 27.394 0.50 21.81 ? 67  GLU A OE1 1 
ATOM   663  O  OE2 A GLU A 1 68  ? 32.756 21.755 30.523 0.50 17.04 ? 67  GLU A OE2 1 
ATOM   664  O  OE2 B GLU A 1 68  ? 33.911 23.774 29.086 0.50 22.27 ? 67  GLU A OE2 1 
ATOM   665  N  N   . GLU A 1 69  ? 31.498 26.049 33.468 1.00 12.89 ? 68  GLU A N   1 
ATOM   666  C  CA  . GLU A 1 69  ? 32.085 26.307 34.791 1.00 15.62 ? 68  GLU A CA  1 
ATOM   667  C  C   . GLU A 1 69  ? 32.089 24.965 35.502 1.00 16.66 ? 68  GLU A C   1 
ATOM   668  O  O   . GLU A 1 69  ? 31.056 24.429 35.834 1.00 16.86 ? 68  GLU A O   1 
ATOM   669  C  CB  . GLU A 1 69  ? 31.275 27.354 35.544 1.00 17.22 ? 68  GLU A CB  1 
ATOM   670  C  CG  . GLU A 1 69  ? 31.882 27.831 36.846 1.00 22.48 ? 68  GLU A CG  1 
ATOM   671  C  CD  . GLU A 1 69  ? 33.198 28.513 36.592 1.00 22.04 ? 68  GLU A CD  1 
ATOM   672  O  OE1 . GLU A 1 69  ? 33.228 29.505 35.829 1.00 30.07 ? 68  GLU A OE1 1 
ATOM   673  O  OE2 . GLU A 1 69  ? 34.200 28.051 37.156 1.00 38.92 ? 68  GLU A OE2 1 
ATOM   674  N  N   A GLY A 1 70  ? 33.222 24.560 36.048 0.50 16.46 ? 69  GLY A N   1 
ATOM   675  N  N   B GLY A 1 70  ? 33.265 24.339 35.356 0.50 17.60 ? 69  GLY A N   1 
ATOM   676  C  CA  A GLY A 1 70  ? 33.235 23.316 36.813 0.50 15.94 ? 69  GLY A CA  1 
ATOM   677  C  CA  B GLY A 1 70  ? 33.558 23.021 35.905 0.50 17.67 ? 69  GLY A CA  1 
ATOM   678  C  C   A GLY A 1 70  ? 32.498 22.197 36.059 0.50 14.53 ? 69  GLY A C   1 
ATOM   679  C  C   B GLY A 1 70  ? 32.765 21.924 35.218 0.50 17.68 ? 69  GLY A C   1 
ATOM   680  O  O   A GLY A 1 70  ? 32.744 21.980 34.890 0.50 15.47 ? 69  GLY A O   1 
ATOM   681  O  O   B GLY A 1 70  ? 32.964 21.651 34.022 0.50 18.72 ? 69  GLY A O   1 
ATOM   682  N  N   A ASN A 1 71  ? 31.563 21.506 36.694 0.50 12.80 ? 70  ASN A N   1 
ATOM   683  N  N   B ASN A 1 71  ? 31.922 21.217 35.959 0.50 16.82 ? 70  ASN A N   1 
ATOM   684  C  CA  A ASN A 1 71  ? 30.928 20.355 36.014 0.50 11.75 ? 70  ASN A CA  1 
ATOM   685  C  CA  B ASN A 1 71  ? 31.131 20.176 35.313 0.50 16.66 ? 70  ASN A CA  1 
ATOM   686  C  C   A ASN A 1 71  ? 29.619 20.696 35.299 0.50 11.85 ? 70  ASN A C   1 
ATOM   687  C  C   B ASN A 1 71  ? 29.693 20.652 35.001 0.50 14.42 ? 70  ASN A C   1 
ATOM   688  O  O   A ASN A 1 71  ? 28.777 19.834 35.037 0.50 12.37 ? 70  ASN A O   1 
ATOM   689  O  O   B ASN A 1 71  ? 28.821 19.830 34.756 0.50 14.63 ? 70  ASN A O   1 
ATOM   690  C  CB  A ASN A 1 71  ? 30.724 19.238 36.997 0.50 12.30 ? 70  ASN A CB  1 
ATOM   691  C  CB  B ASN A 1 71  ? 31.200 18.827 36.044 0.50 18.01 ? 70  ASN A CB  1 
ATOM   692  C  CG  A ASN A 1 71  ? 32.057 18.659 37.459 0.50 14.38 ? 70  ASN A CG  1 
ATOM   693  C  CG  B ASN A 1 71  ? 30.902 18.912 37.516 0.50 20.74 ? 70  ASN A CG  1 
ATOM   694  O  OD1 A ASN A 1 71  ? 33.028 18.617 36.689 0.50 19.16 ? 70  ASN A OD1 1 
ATOM   695  O  OD1 B ASN A 1 71  ? 30.234 19.821 37.985 0.50 23.96 ? 70  ASN A OD1 1 
ATOM   696  N  ND2 A ASN A 1 71  ? 32.129 18.279 38.723 0.50 18.97 ? 70  ASN A ND2 1 
ATOM   697  N  ND2 B ASN A 1 71  ? 31.400 17.918 38.267 0.50 22.16 ? 70  ASN A ND2 1 
ATOM   698  N  N   . ASP A 1 72  ? 29.472 21.972 34.984 1.00 11.72 ? 71  ASP A N   1 
ATOM   699  C  CA  . ASP A 1 72  ? 28.250 22.477 34.369 1.00 10.64 ? 71  ASP A CA  1 
ATOM   700  C  C   . ASP A 1 72  ? 28.532 23.232 33.090 1.00 9.56  ? 71  ASP A C   1 
ATOM   701  O  O   . ASP A 1 72  ? 29.486 23.973 32.968 1.00 10.61 ? 71  ASP A O   1 
ATOM   702  C  CB  . ASP A 1 72  ? 27.486 23.414 35.294 1.00 11.70 ? 71  ASP A CB  1 
ATOM   703  C  CG  . ASP A 1 72  ? 27.113 22.739 36.601 1.00 13.61 ? 71  ASP A CG  1 
ATOM   704  O  OD1 . ASP A 1 72  ? 26.349 21.774 36.534 1.00 17.75 ? 71  ASP A OD1 1 
ATOM   705  O  OD2 . ASP A 1 72  ? 27.564 23.172 37.676 1.00 18.20 ? 71  ASP A OD2 1 
ATOM   706  N  N   . VAL A 1 73  ? 27.614 23.041 32.154 1.00 9.13  ? 72  VAL A N   1 
ATOM   707  C  CA  . VAL A 1 73  ? 27.546 23.761 30.895 1.00 9.12  ? 72  VAL A CA  1 
ATOM   708  C  C   . VAL A 1 73  ? 26.182 24.403 30.778 1.00 8.44  ? 72  VAL A C   1 
ATOM   709  O  O   . VAL A 1 73  ? 25.170 23.770 31.041 1.00 9.90  ? 72  VAL A O   1 
ATOM   710  C  CB  . VAL A 1 73  ? 27.830 22.822 29.673 1.00 9.87  ? 72  VAL A CB  1 
ATOM   711  C  CG1 . VAL A 1 73  ? 27.501 23.526 28.338 1.00 11.39 ? 72  VAL A CG1 1 
ATOM   712  C  CG2 . VAL A 1 73  ? 29.268 22.334 29.725 1.00 11.59 ? 72  VAL A CG2 1 
ATOM   713  N  N   A CYS A 1 74  ? 26.150 25.680 30.424 0.50 8.30  ? 73  CYS A N   1 
ATOM   714  N  N   B CYS A 1 74  ? 26.179 25.678 30.422 0.50 8.51  ? 73  CYS A N   1 
ATOM   715  C  CA  A CYS A 1 74  ? 24.878 26.353 30.178 0.50 8.02  ? 73  CYS A CA  1 
ATOM   716  C  CA  B CYS A 1 74  ? 24.959 26.418 30.161 0.50 8.45  ? 73  CYS A CA  1 
ATOM   717  C  C   A CYS A 1 74  ? 24.803 26.885 28.758 0.50 8.36  ? 73  CYS A C   1 
ATOM   718  C  C   B CYS A 1 74  ? 24.882 26.784 28.693 0.50 8.36  ? 73  CYS A C   1 
ATOM   719  O  O   A CYS A 1 74  ? 25.646 27.665 28.324 0.50 8.90  ? 73  CYS A O   1 
ATOM   720  O  O   B CYS A 1 74  ? 25.843 27.315 28.143 0.50 8.98  ? 73  CYS A O   1 
ATOM   721  C  CB  A CYS A 1 74  ? 24.644 27.484 31.189 0.50 8.97  ? 73  CYS A CB  1 
ATOM   722  C  CB  B CYS A 1 74  ? 24.920 27.686 31.024 0.50 9.19  ? 73  CYS A CB  1 
ATOM   723  S  SG  A CYS A 1 74  ? 22.903 27.996 31.267 0.50 10.71 ? 73  CYS A SG  1 
ATOM   724  S  SG  B CYS A 1 74  ? 23.509 28.766 30.687 0.50 14.08 ? 73  CYS A SG  1 
ATOM   725  N  N   . LEU A 1 75  ? 23.754 26.469 28.061 1.00 8.49  ? 74  LEU A N   1 
ATOM   726  C  CA  . LEU A 1 75  ? 23.500 26.897 26.697 1.00 8.95  ? 74  LEU A CA  1 
ATOM   727  C  C   . LEU A 1 75  ? 22.371 27.902 26.659 1.00 8.78  ? 74  LEU A C   1 
ATOM   728  O  O   . LEU A 1 75  ? 21.353 27.732 27.317 1.00 10.82 ? 74  LEU A O   1 
ATOM   729  C  CB  . LEU A 1 75  ? 23.102 25.722 25.789 1.00 9.16  ? 74  LEU A CB  1 
ATOM   730  C  CG  . LEU A 1 75  ? 24.106 24.562 25.698 1.00 9.71  ? 74  LEU A CG  1 
ATOM   731  C  CD1 . LEU A 1 75  ? 23.590 23.471 24.716 1.00 11.71 ? 74  LEU A CD1 1 
ATOM   732  C  CD2 . LEU A 1 75  ? 25.478 25.009 25.306 1.00 11.83 ? 74  LEU A CD2 1 
ATOM   733  N  N   . ILE A 1 76  ? 22.550 28.950 25.868 1.00 8.73  ? 75  ILE A N   1 
ATOM   734  C  CA  . ILE A 1 76  ? 21.516 29.879 25.499 1.00 10.00 ? 75  ILE A CA  1 
ATOM   735  C  C   . ILE A 1 76  ? 21.142 29.501 24.076 1.00 9.75  ? 75  ILE A C   1 
ATOM   736  O  O   . ILE A 1 76  ? 21.954 29.569 23.161 1.00 10.59 ? 75  ILE A O   1 
ATOM   737  C  CB  . ILE A 1 76  ? 22.018 31.332 25.541 1.00 10.99 ? 75  ILE A CB  1 
ATOM   738  C  CG1 . ILE A 1 76  ? 22.530 31.699 26.934 1.00 11.06 ? 75  ILE A CG1 1 
ATOM   739  C  CG2 . ILE A 1 76  ? 20.947 32.316 25.101 1.00 13.19 ? 75  ILE A CG2 1 
ATOM   740  C  CD1 . ILE A 1 76  ? 21.506 31.587 28.048 1.00 12.17 ? 75  ILE A CD1 1 
ATOM   741  N  N   . TYR A 1 77  ? 19.910 29.044 23.912 1.00 9.53  ? 76  TYR A N   1 
ATOM   742  C  CA  . TYR A 1 77  ? 19.486 28.522 22.639 1.00 9.77  ? 76  TYR A CA  1 
ATOM   743  C  C   . TYR A 1 77  ? 18.010 28.746 22.361 1.00 10.74 ? 76  TYR A C   1 
ATOM   744  O  O   . TYR A 1 77  ? 17.190 28.886 23.258 1.00 11.13 ? 76  TYR A O   1 
ATOM   745  C  CB  . TYR A 1 77  ? 19.858 27.040 22.498 1.00 10.70 ? 76  TYR A CB  1 
ATOM   746  C  CG  . TYR A 1 77  ? 19.504 26.025 23.607 1.00 10.69 ? 76  TYR A CG  1 
ATOM   747  C  CD1 . TYR A 1 77  ? 18.590 26.280 24.608 1.00 10.30 ? 76  TYR A CD1 1 
ATOM   748  C  CD2 . TYR A 1 77  ? 20.087 24.778 23.580 1.00 10.13 ? 76  TYR A CD2 1 
ATOM   749  C  CE1 . TYR A 1 77  ? 18.316 25.324 25.595 1.00 10.58 ? 76  TYR A CE1 1 
ATOM   750  C  CE2 . TYR A 1 77  ? 19.829 23.809 24.523 1.00 10.16 ? 76  TYR A CE2 1 
ATOM   751  C  CZ  . TYR A 1 77  ? 18.940 24.082 25.540 1.00 9.43  ? 76  TYR A CZ  1 
ATOM   752  O  OH  . TYR A 1 77  ? 18.669 23.106 26.497 1.00 10.80 ? 76  TYR A OH  1 
ATOM   753  N  N   . ASP A 1 78  ? 17.694 28.770 21.064 1.00 12.07 ? 77  ASP A N   1 
ATOM   754  C  CA  . ASP A 1 78  ? 16.309 28.801 20.614 1.00 12.85 ? 77  ASP A CA  1 
ATOM   755  C  C   . ASP A 1 78  ? 15.919 27.349 20.376 1.00 12.84 ? 77  ASP A C   1 
ATOM   756  O  O   . ASP A 1 78  ? 16.664 26.586 19.719 1.00 15.23 ? 77  ASP A O   1 
ATOM   757  C  CB  . ASP A 1 78  ? 16.139 29.628 19.352 1.00 13.43 ? 77  ASP A CB  1 
ATOM   758  C  CG  . ASP A 1 78  ? 16.296 31.104 19.590 1.00 15.02 ? 77  ASP A CG  1 
ATOM   759  O  OD1 . ASP A 1 78  ? 16.190 31.583 20.731 1.00 17.33 ? 77  ASP A OD1 1 
ATOM   760  O  OD2 . ASP A 1 78  ? 16.495 31.810 18.587 1.00 21.21 ? 77  ASP A OD2 1 
ATOM   761  N  N   . ILE A 1 79  ? 14.755 26.957 20.888 1.00 12.86 ? 78  ILE A N   1 
ATOM   762  C  CA  . ILE A 1 79  ? 14.253 25.609 20.697 1.00 12.75 ? 78  ILE A CA  1 
ATOM   763  C  C   . ILE A 1 79  ? 12.976 25.671 19.865 1.00 13.41 ? 78  ILE A C   1 
ATOM   764  O  O   . ILE A 1 79  ? 12.032 26.388 20.188 1.00 13.98 ? 78  ILE A O   1 
ATOM   765  C  CB  . ILE A 1 79  ? 13.948 24.864 22.027 1.00 11.96 ? 78  ILE A CB  1 
ATOM   766  C  CG1 . ILE A 1 79  ? 15.045 25.067 23.087 1.00 11.88 ? 78  ILE A CG1 1 
ATOM   767  C  CG2 . ILE A 1 79  ? 13.760 23.389 21.723 1.00 12.89 ? 78  ILE A CG2 1 
ATOM   768  C  CD1 . ILE A 1 79  ? 14.700 24.459 24.431 1.00 11.99 ? 78  ILE A CD1 1 
ATOM   769  N  N   . ASN A 1 80  ? 13.004 24.974 18.748 1.00 14.51 ? 79  ASN A N   1 
ATOM   770  C  CA  . ASN A 1 80  ? 11.818 24.819 17.907 1.00 15.94 ? 79  ASN A CA  1 
ATOM   771  C  C   . ASN A 1 80  ? 11.049 23.614 18.426 1.00 16.00 ? 79  ASN A C   1 
ATOM   772  O  O   . ASN A 1 80  ? 11.483 22.476 18.311 1.00 15.22 ? 79  ASN A O   1 
ATOM   773  C  CB  . ASN A 1 80  ? 12.207 24.675 16.437 1.00 17.21 ? 79  ASN A CB  1 
ATOM   774  C  CG  . ASN A 1 80  ? 11.004 24.672 15.539 1.00 20.35 ? 79  ASN A CG  1 
ATOM   775  O  OD1 . ASN A 1 80  ? 9.992  24.094 15.877 1.00 24.16 ? 79  ASN A OD1 1 
ATOM   776  N  ND2 . ASN A 1 80  ? 11.106 25.328 14.395 1.00 26.74 ? 79  ASN A ND2 1 
HETATM 777  N  N   . MSE A 1 81  ? 9.941  23.916 19.091 1.00 17.23 ? 80  MSE A N   1 
HETATM 778  C  CA  . MSE A 1 81  ? 9.098  22.914 19.689 1.00 18.89 ? 80  MSE A CA  1 
HETATM 779  C  C   . MSE A 1 81  ? 7.787  22.919 18.918 1.00 20.69 ? 80  MSE A C   1 
HETATM 780  O  O   . MSE A 1 81  ? 6.918  23.778 19.120 1.00 21.50 ? 80  MSE A O   1 
HETATM 781  C  CB  . MSE A 1 81  ? 8.895  23.237 21.166 1.00 19.33 ? 80  MSE A CB  1 
HETATM 782  C  CG  . MSE A 1 81  ? 10.226 23.319 21.950 1.00 18.96 ? 80  MSE A CG  1 
HETATM 783  SE SE  . MSE A 1 81  ? 10.031 23.898 23.803 0.75 26.76 ? 80  MSE A SE  1 
HETATM 784  C  CE  . MSE A 1 81  ? 8.991  22.447 24.445 1.00 25.61 ? 80  MSE A CE  1 
ATOM   785  N  N   . ASN A 1 82  ? 7.711  21.971 17.995 1.00 23.13 ? 81  ASN A N   1 
ATOM   786  C  CA  . ASN A 1 82  ? 6.519  21.744 17.184 1.00 25.09 ? 81  ASN A CA  1 
ATOM   787  C  C   . ASN A 1 82  ? 6.046  23.013 16.504 1.00 24.97 ? 81  ASN A C   1 
ATOM   788  O  O   . ASN A 1 82  ? 4.858  23.314 16.433 1.00 26.23 ? 81  ASN A O   1 
ATOM   789  C  CB  . ASN A 1 82  ? 5.451  21.111 18.062 1.00 26.05 ? 81  ASN A CB  1 
ATOM   790  C  CG  . ASN A 1 82  ? 5.824  19.700 18.484 1.00 29.81 ? 81  ASN A CG  1 
ATOM   791  O  OD1 . ASN A 1 82  ? 6.029  19.423 19.679 1.00 33.73 ? 81  ASN A OD1 1 
ATOM   792  N  ND2 . ASN A 1 82  ? 5.961  18.803 17.501 1.00 32.48 ? 81  ASN A ND2 1 
ATOM   793  N  N   . GLY A 1 83  ? 7.018  23.748 16.003 1.00 24.56 ? 82  GLY A N   1 
ATOM   794  C  CA  . GLY A 1 83  ? 6.782  24.886 15.144 1.00 24.31 ? 82  GLY A CA  1 
ATOM   795  C  C   . GLY A 1 83  ? 6.839  26.183 15.873 1.00 23.59 ? 82  GLY A C   1 
ATOM   796  O  O   . GLY A 1 83  ? 6.869  27.261 15.270 1.00 24.96 ? 82  GLY A O   1 
ATOM   797  N  N   A LYS A 1 84  ? 6.818  26.092 17.200 0.70 22.86 ? 83  LYS A N   1 
ATOM   798  N  N   B LYS A 1 84  ? 6.885  26.087 17.190 0.30 22.66 ? 83  LYS A N   1 
ATOM   799  C  CA  A LYS A 1 84  ? 6.948  27.279 18.039 0.70 22.09 ? 83  LYS A CA  1 
ATOM   800  C  CA  B LYS A 1 84  ? 6.960  27.283 18.024 0.30 21.68 ? 83  LYS A CA  1 
ATOM   801  C  C   A LYS A 1 84  ? 8.416  27.413 18.407 0.70 20.89 ? 83  LYS A C   1 
ATOM   802  C  C   B LYS A 1 84  ? 8.369  27.458 18.554 0.30 20.66 ? 83  LYS A C   1 
ATOM   803  O  O   A LYS A 1 84  ? 9.055  26.439 18.803 0.70 21.07 ? 83  LYS A O   1 
ATOM   804  O  O   B LYS A 1 84  ? 8.905  26.575 19.239 0.30 20.23 ? 83  LYS A O   1 
ATOM   805  C  CB  A LYS A 1 84  ? 6.089  27.183 19.300 0.70 22.21 ? 83  LYS A CB  1 
ATOM   806  C  CB  B LYS A 1 84  ? 5.953  27.194 19.163 0.30 21.78 ? 83  LYS A CB  1 
ATOM   807  C  CG  A LYS A 1 84  ? 4.573  27.245 19.048 0.70 23.85 ? 83  LYS A CG  1 
ATOM   808  C  CG  B LYS A 1 84  ? 4.518  27.058 18.665 0.30 22.21 ? 83  LYS A CG  1 
ATOM   809  C  CD  A LYS A 1 84  ? 4.149  28.620 18.583 0.70 26.04 ? 83  LYS A CD  1 
ATOM   810  C  CD  B LYS A 1 84  ? 3.546  26.834 19.806 0.30 22.68 ? 83  LYS A CD  1 
ATOM   811  N  N   . THR A 1 85  ? 8.954  28.610 18.240 1.00 19.16 ? 84  THR A N   1 
ATOM   812  C  CA  . THR A 1 85  ? 10.354 28.895 18.635 1.00 19.03 ? 84  THR A CA  1 
ATOM   813  C  C   . THR A 1 85  ? 10.340 29.604 19.980 1.00 17.35 ? 84  THR A C   1 
ATOM   814  O  O   . THR A 1 85  ? 9.690  30.641 20.161 1.00 19.23 ? 84  THR A O   1 
ATOM   815  C  CB  . THR A 1 85  ? 11.100 29.696 17.564 1.00 19.85 ? 84  THR A CB  1 
ATOM   816  O  OG1 . THR A 1 85  ? 11.151 28.913 16.371 1.00 23.22 ? 84  THR A OG1 1 
ATOM   817  C  CG2 . THR A 1 85  ? 12.526 30.025 17.988 1.00 21.27 ? 84  THR A CG2 1 
ATOM   818  N  N   . ILE A 1 86  ? 11.059 28.983 20.925 1.00 14.96 ? 85  ILE A N   1 
ATOM   819  C  CA  . ILE A 1 86  ? 11.135 29.450 22.290 1.00 15.23 ? 85  ILE A CA  1 
ATOM   820  C  C   . ILE A 1 86  ? 12.572 29.689 22.667 1.00 13.82 ? 85  ILE A C   1 
ATOM   821  O  O   . ILE A 1 86  ? 13.412 28.825 22.448 1.00 13.75 ? 85  ILE A O   1 
ATOM   822  C  CB  . ILE A 1 86  ? 10.584 28.362 23.223 1.00 16.77 ? 85  ILE A CB  1 
ATOM   823  C  CG1 . ILE A 1 86  ? 9.130  28.048 22.850 1.00 20.10 ? 85  ILE A CG1 1 
ATOM   824  C  CG2 . ILE A 1 86  ? 10.781 28.738 24.713 1.00 19.80 ? 85  ILE A CG2 1 
ATOM   825  C  CD1 . ILE A 1 86  ? 8.124  28.950 23.460 1.00 22.43 ? 85  ILE A CD1 1 
ATOM   826  N  N   . ALA A 1 87  ? 12.847 30.869 23.227 1.00 12.63 ? 86  ALA A N   1 
ATOM   827  C  CA  . ALA A 1 87  ? 14.174 31.178 23.738 1.00 11.49 ? 86  ALA A CA  1 
ATOM   828  C  C   . ALA A 1 87  ? 14.304 30.578 25.122 1.00 10.31 ? 86  ALA A C   1 
ATOM   829  O  O   . ALA A 1 87  ? 13.509 30.854 26.014 1.00 11.13 ? 86  ALA A O   1 
ATOM   830  C  CB  . ALA A 1 87  ? 14.439 32.691 23.792 1.00 12.73 ? 86  ALA A CB  1 
ATOM   831  N  N   . ALA A 1 88  ? 15.368 29.808 25.304 1.00 9.23  ? 87  ALA A N   1 
ATOM   832  C  CA  . ALA A 1 88  ? 15.596 29.075 26.546 1.00 8.94  ? 87  ALA A CA  1 
ATOM   833  C  C   . ALA A 1 88  ? 17.053 29.123 26.975 1.00 8.02  ? 87  ALA A C   1 
ATOM   834  O  O   . ALA A 1 88  ? 17.951 29.468 26.208 1.00 8.92  ? 87  ALA A O   1 
ATOM   835  C  CB  . ALA A 1 88  ? 15.200 27.584 26.359 1.00 8.84  ? 87  ALA A CB  1 
ATOM   836  N  N   . SER A 1 89  ? 17.248 28.748 28.227 1.00 8.06  ? 88  SER A N   1 
ATOM   837  C  CA  . SER A 1 89  ? 18.558 28.505 28.798 1.00 8.44  ? 88  SER A CA  1 
ATOM   838  C  C   . SER A 1 89  ? 18.576 27.067 29.314 1.00 8.41  ? 88  SER A C   1 
ATOM   839  O  O   . SER A 1 89  ? 17.700 26.695 30.050 1.00 10.03 ? 88  SER A O   1 
ATOM   840  C  CB  . SER A 1 89  ? 18.826 29.489 29.940 1.00 9.37  ? 88  SER A CB  1 
ATOM   841  O  OG  . SER A 1 89  ? 20.081 29.237 30.528 1.00 10.07 ? 88  SER A OG  1 
ATOM   842  N  N   . GLY A 1 90  ? 19.578 26.292 28.935 1.00 7.70  ? 89  GLY A N   1 
ATOM   843  C  CA  . GLY A 1 90  ? 19.674 24.891 29.330 1.00 7.63  ? 89  GLY A CA  1 
ATOM   844  C  C   . GLY A 1 90  ? 20.931 24.673 30.139 1.00 8.10  ? 89  GLY A C   1 
ATOM   845  O  O   . GLY A 1 90  ? 22.037 24.985 29.698 1.00 9.57  ? 89  GLY A O   1 
ATOM   846  N  N   . LEU A 1 91  ? 20.758 24.121 31.340 1.00 7.51  ? 90  LEU A N   1 
ATOM   847  C  CA  . LEU A 1 91  ? 21.844 23.859 32.274 1.00 8.09  ? 90  LEU A CA  1 
ATOM   848  C  C   . LEU A 1 91  ? 22.093 22.351 32.336 1.00 7.87  ? 90  LEU A C   1 
ATOM   849  O  O   . LEU A 1 91  ? 21.247 21.579 32.784 1.00 7.83  ? 90  LEU A O   1 
ATOM   850  C  CB  . LEU A 1 91  ? 21.464 24.382 33.648 1.00 8.25  ? 90  LEU A CB  1 
ATOM   851  C  CG  . LEU A 1 91  ? 22.437 24.118 34.775 1.00 9.73  ? 90  LEU A CG  1 
ATOM   852  C  CD1 . LEU A 1 91  ? 23.760 24.853 34.570 1.00 11.05 ? 90  LEU A CD1 1 
ATOM   853  C  CD2 . LEU A 1 91  ? 21.779 24.516 36.108 1.00 12.38 ? 90  LEU A CD2 1 
ATOM   854  N  N   . TYR A 1 92  ? 23.250 21.942 31.820 1.00 7.66  ? 91  TYR A N   1 
ATOM   855  C  CA  . TYR A 1 92  ? 23.664 20.553 31.735 1.00 8.41  ? 91  TYR A CA  1 
ATOM   856  C  C   . TYR A 1 92  ? 24.738 20.279 32.781 1.00 9.32  ? 91  TYR A C   1 
ATOM   857  O  O   . TYR A 1 92  ? 25.743 21.013 32.845 1.00 10.91 ? 91  TYR A O   1 
ATOM   858  C  CB  . TYR A 1 92  ? 24.230 20.250 30.327 1.00 8.84  ? 91  TYR A CB  1 
ATOM   859  C  CG  . TYR A 1 92  ? 23.265 20.457 29.208 1.00 8.98  ? 91  TYR A CG  1 
ATOM   860  C  CD1 . TYR A 1 92  ? 22.982 21.722 28.727 1.00 9.48  ? 91  TYR A CD1 1 
ATOM   861  C  CD2 . TYR A 1 92  ? 22.647 19.398 28.607 1.00 9.40  ? 91  TYR A CD2 1 
ATOM   862  C  CE1 . TYR A 1 92  ? 22.035 21.914 27.734 1.00 10.26 ? 91  TYR A CE1 1 
ATOM   863  C  CE2 . TYR A 1 92  ? 21.687 19.587 27.610 1.00 10.40 ? 91  TYR A CE2 1 
ATOM   864  C  CZ  . TYR A 1 92  ? 21.374 20.853 27.192 1.00 10.70 ? 91  TYR A CZ  1 
ATOM   865  O  OH  . TYR A 1 92  ? 20.417 21.062 26.230 1.00 12.62 ? 91  TYR A OH  1 
ATOM   866  N  N   . HIS A 1 93  ? 24.543 19.210 33.553 1.00 8.63  ? 92  HIS A N   1 
ATOM   867  C  CA  . HIS A 1 93  ? 25.554 18.782 34.521 1.00 9.22  ? 92  HIS A CA  1 
ATOM   868  C  C   . HIS A 1 93  ? 26.205 17.501 33.996 1.00 9.58  ? 92  HIS A C   1 
ATOM   869  O  O   . HIS A 1 93  ? 25.498 16.616 33.507 1.00 10.11 ? 92  HIS A O   1 
ATOM   870  C  CB  . HIS A 1 93  ? 24.923 18.513 35.888 1.00 10.61 ? 92  HIS A CB  1 
ATOM   871  C  CG  . HIS A 1 93  ? 25.921 18.268 36.966 1.00 12.06 ? 92  HIS A CG  1 
ATOM   872  N  ND1 . HIS A 1 93  ? 26.630 19.289 37.555 1.00 13.70 ? 92  HIS A ND1 1 
ATOM   873  C  CD2 . HIS A 1 93  ? 26.317 17.119 37.571 1.00 13.58 ? 92  HIS A CD2 1 
ATOM   874  C  CE1 . HIS A 1 93  ? 27.431 18.775 38.477 1.00 15.67 ? 92  HIS A CE1 1 
ATOM   875  N  NE2 . HIS A 1 93  ? 27.284 17.461 38.478 1.00 15.10 ? 92  HIS A NE2 1 
ATOM   876  N  N   . LEU A 1 94  ? 27.514 17.437 34.121 1.00 10.55 ? 93  LEU A N   1 
ATOM   877  C  CA  . LEU A 1 94  ? 28.294 16.280 33.637 1.00 11.57 ? 93  LEU A CA  1 
ATOM   878  C  C   . LEU A 1 94  ? 29.130 15.713 34.739 1.00 12.45 ? 93  LEU A C   1 
ATOM   879  O  O   . LEU A 1 94  ? 29.738 16.434 35.558 1.00 13.77 ? 93  LEU A O   1 
ATOM   880  C  CB  . LEU A 1 94  ? 29.194 16.706 32.483 1.00 13.74 ? 93  LEU A CB  1 
ATOM   881  C  CG  . LEU A 1 94  ? 28.371 17.235 31.273 1.00 16.16 ? 93  LEU A CG  1 
ATOM   882  C  CD1 . LEU A 1 94  ? 28.318 18.751 31.283 1.00 17.01 ? 93  LEU A CD1 1 
ATOM   883  C  CD2 . LEU A 1 94  ? 28.892 16.723 29.920 1.00 18.35 ? 93  LEU A CD2 1 
ATOM   884  N  N   . GLU A 1 95  ? 29.167 14.396 34.737 1.00 12.27 ? 94  GLU A N   1 
ATOM   885  C  CA  . GLU A 1 95  ? 30.006 13.656 35.659 1.00 13.69 ? 94  GLU A CA  1 
ATOM   886  C  C   . GLU A 1 95  ? 30.424 12.409 34.959 1.00 12.87 ? 94  GLU A C   1 
ATOM   887  O  O   . GLU A 1 95  ? 29.654 11.769 34.269 1.00 12.79 ? 94  GLU A O   1 
ATOM   888  C  CB  . GLU A 1 95  ? 29.276 13.265 36.929 1.00 14.79 ? 94  GLU A CB  1 
ATOM   889  C  CG  . GLU A 1 95  ? 28.898 14.474 37.732 1.00 19.20 ? 94  GLU A CG  1 
ATOM   890  C  CD  . GLU A 1 95  ? 28.409 14.202 39.122 1.00 24.41 ? 94  GLU A CD  1 
ATOM   891  O  OE1 . GLU A 1 95  ? 28.321 13.027 39.538 1.00 29.35 ? 94  GLU A OE1 1 
ATOM   892  O  OE2 . GLU A 1 95  ? 28.145 15.197 39.827 1.00 29.19 ? 94  GLU A OE2 1 
ATOM   893  N  N   . LYS A 1 96  ? 31.652 12.004 35.196 1.00 13.06 ? 95  LYS A N   1 
ATOM   894  C  CA  . LYS A 1 96  ? 32.152 10.713 34.693 1.00 12.84 ? 95  LYS A CA  1 
ATOM   895  C  C   . LYS A 1 96  ? 31.952 10.527 33.195 1.00 13.02 ? 95  LYS A C   1 
ATOM   896  O  O   . LYS A 1 96  ? 31.709 9.436  32.707 1.00 13.52 ? 95  LYS A O   1 
ATOM   897  C  CB  . LYS A 1 96  ? 31.522 9.559  35.471 1.00 13.86 ? 95  LYS A CB  1 
ATOM   898  C  CG  . LYS A 1 96  ? 31.804 9.603  36.931 1.00 15.83 ? 95  LYS A CG  1 
ATOM   899  C  CD  . LYS A 1 96  ? 31.172 8.427  37.657 1.00 20.62 ? 95  LYS A CD  1 
ATOM   900  C  CE  . LYS A 1 96  ? 31.521 8.411  39.119 1.00 23.97 ? 95  LYS A CE  1 
ATOM   901  N  NZ  . LYS A 1 96  ? 31.002 9.606  39.842 1.00 25.66 ? 95  LYS A NZ  1 
ATOM   902  N  N   . GLY A 1 97  ? 32.124 11.620 32.460 1.00 12.16 ? 96  GLY A N   1 
ATOM   903  C  CA  . GLY A 1 97  ? 32.068 11.571 31.023 1.00 12.75 ? 96  GLY A CA  1 
ATOM   904  C  C   . GLY A 1 97  ? 30.704 11.431 30.434 1.00 11.69 ? 96  GLY A C   1 
ATOM   905  O  O   . GLY A 1 97  ? 30.576 11.096 29.250 1.00 13.00 ? 96  GLY A O   1 
ATOM   906  N  N   . GLU A 1 98  ? 29.684 11.711 31.244 1.00 11.94 ? 97  GLU A N   1 
ATOM   907  C  CA  . GLU A 1 98  ? 28.273 11.638 30.791 1.00 11.77 ? 97  GLU A CA  1 
ATOM   908  C  C   . GLU A 1 98  ? 27.480 12.834 31.275 1.00 11.70 ? 97  GLU A C   1 
ATOM   909  O  O   . GLU A 1 98  ? 27.810 13.433 32.283 1.00 12.18 ? 97  GLU A O   1 
ATOM   910  C  CB  . GLU A 1 98  ? 27.592 10.379 31.312 1.00 12.23 ? 97  GLU A CB  1 
ATOM   911  C  CG  . GLU A 1 98  ? 28.327 9.066  31.099 1.00 13.69 ? 97  GLU A CG  1 
ATOM   912  C  CD  . GLU A 1 98  ? 27.598 7.920  31.748 1.00 15.88 ? 97  GLU A CD  1 
ATOM   913  O  OE1 . GLU A 1 98  ? 27.213 8.025  32.928 1.00 16.26 ? 97  GLU A OE1 1 
ATOM   914  O  OE2 . GLU A 1 98  ? 27.441 6.888  31.071 1.00 20.63 ? 97  GLU A OE2 1 
ATOM   915  N  N   . ILE A 1 99  ? 26.407 13.152 30.568 1.00 10.92 ? 98  ILE A N   1 
ATOM   916  C  CA  . ILE A 1 99  ? 25.462 14.160 31.057 1.00 9.59  ? 98  ILE A CA  1 
ATOM   917  C  C   . ILE A 1 99  ? 24.549 13.496 32.071 1.00 9.62  ? 98  ILE A C   1 
ATOM   918  O  O   . ILE A 1 99  ? 23.882 12.520 31.742 1.00 10.02 ? 98  ILE A O   1 
ATOM   919  C  CB  . ILE A 1 99  ? 24.654 14.760 29.881 1.00 9.61  ? 98  ILE A CB  1 
ATOM   920  C  CG1 . ILE A 1 99  ? 25.564 15.412 28.844 1.00 11.40 ? 98  ILE A CG1 1 
ATOM   921  C  CG2 . ILE A 1 99  ? 23.620 15.771 30.403 1.00 10.98 ? 98  ILE A CG2 1 
ATOM   922  C  CD1 . ILE A 1 99  ? 24.847 15.734 27.510 1.00 12.11 ? 98  ILE A CD1 1 
ATOM   923  N  N   . THR A 1 100 ? 24.498 14.035 33.301 1.00 9.45  ? 99  THR A N   1 
ATOM   924  C  CA  . THR A 1 100 ? 23.690 13.435 34.355 1.00 10.66 ? 99  THR A CA  1 
ATOM   925  C  C   . THR A 1 100 ? 22.369 14.176 34.596 1.00 9.66  ? 99  THR A C   1 
ATOM   926  O  O   . THR A 1 100 ? 21.449 13.612 35.157 1.00 10.07 ? 99  THR A O   1 
ATOM   927  C  CB  . THR A 1 100 ? 24.463 13.326 35.678 1.00 11.30 ? 99  THR A CB  1 
ATOM   928  O  OG1 . THR A 1 100 ? 24.808 14.623 36.104 1.00 12.45 ? 99  THR A OG1 1 
ATOM   929  C  CG2 . THR A 1 100 ? 25.736 12.445 35.525 1.00 13.09 ? 99  THR A CG2 1 
ATOM   930  N  N   . SER A 1 101 ? 22.281 15.424 34.154 1.00 8.80  ? 100 SER A N   1 
ATOM   931  C  CA  . SER A 1 101 ? 21.045 16.180 34.283 1.00 9.03  ? 100 SER A CA  1 
ATOM   932  C  C   . SER A 1 101 ? 20.976 17.323 33.316 1.00 8.46  ? 100 SER A C   1 
ATOM   933  O  O   . SER A 1 101 ? 21.976 17.884 32.929 1.00 8.12  ? 100 SER A O   1 
ATOM   934  C  CB  . SER A 1 101 ? 20.885 16.734 35.702 1.00 9.00  ? 100 SER A CB  1 
ATOM   935  O  OG  . SER A 1 101 ? 21.863 17.672 36.048 1.00 10.48 ? 100 SER A OG  1 
ATOM   936  N  N   . LEU A 1 102 ? 19.730 17.689 33.048 1.00 7.89  ? 101 LEU A N   1 
ATOM   937  C  CA  . LEU A 1 102 ? 19.380 18.912 32.307 1.00 7.80  ? 101 LEU A CA  1 
ATOM   938  C  C   . LEU A 1 102 ? 18.257 19.608 33.063 1.00 7.57  ? 101 LEU A C   1 
ATOM   939  O  O   . LEU A 1 102 ? 17.270 18.974 33.421 1.00 7.86  ? 101 LEU A O   1 
ATOM   940  C  CB  . LEU A 1 102 ? 18.917 18.570 30.895 1.00 8.21  ? 101 LEU A CB  1 
ATOM   941  C  CG  . LEU A 1 102 ? 18.318 19.717 30.075 1.00 8.95  ? 101 LEU A CG  1 
ATOM   942  C  CD1 . LEU A 1 102 ? 19.266 20.925 29.931 1.00 9.11  ? 101 LEU A CD1 1 
ATOM   943  C  CD2 . LEU A 1 102 ? 17.921 19.220 28.696 1.00 10.45 ? 101 LEU A CD2 1 
ATOM   944  N  N   . HIS A 1 103 ? 18.450 20.896 33.315 1.00 7.16  ? 102 HIS A N   1 
ATOM   945  C  CA  . HIS A 1 103 ? 17.415 21.780 33.769 1.00 7.91  ? 102 HIS A CA  1 
ATOM   946  C  C   . HIS A 1 103 ? 17.253 22.862 32.716 1.00 7.88  ? 102 HIS A C   1 
ATOM   947  O  O   . HIS A 1 103 ? 18.229 23.554 32.432 1.00 8.25  ? 102 HIS A O   1 
ATOM   948  C  CB  . HIS A 1 103 ? 17.829 22.449 35.075 1.00 9.07  ? 102 HIS A CB  1 
ATOM   949  C  CG  . HIS A 1 103 ? 17.849 21.535 36.237 1.00 12.81 ? 102 HIS A CG  1 
ATOM   950  N  ND1 . HIS A 1 103 ? 18.837 20.588 36.416 1.00 16.08 ? 102 HIS A ND1 1 
ATOM   951  C  CD2 . HIS A 1 103 ? 17.015 21.424 37.297 1.00 16.09 ? 102 HIS A CD2 1 
ATOM   952  C  CE1 . HIS A 1 103 ? 18.593 19.917 37.538 1.00 16.31 ? 102 HIS A CE1 1 
ATOM   953  N  NE2 . HIS A 1 103 ? 17.489 20.406 38.086 1.00 16.73 ? 102 HIS A NE2 1 
ATOM   954  N  N   . VAL A 1 104 ? 16.070 22.954 32.113 1.00 7.46  ? 103 VAL A N   1 
ATOM   955  C  CA  . VAL A 1 104 ? 15.843 23.944 31.052 1.00 8.24  ? 103 VAL A CA  1 
ATOM   956  C  C   . VAL A 1 104 ? 14.846 24.992 31.541 1.00 8.32  ? 103 VAL A C   1 
ATOM   957  O  O   . VAL A 1 104 ? 13.874 24.687 32.213 1.00 9.14  ? 103 VAL A O   1 
ATOM   958  C  CB  . VAL A 1 104 ? 15.432 23.254 29.701 1.00 9.60  ? 103 VAL A CB  1 
ATOM   959  C  CG1 . VAL A 1 104 ? 14.098 22.588 29.784 1.00 11.59 ? 103 VAL A CG1 1 
ATOM   960  C  CG2 . VAL A 1 104 ? 15.498 24.249 28.560 1.00 11.71 ? 103 VAL A CG2 1 
ATOM   961  N  N   . TYR A 1 105 ? 15.158 26.225 31.202 1.00 7.86  ? 104 TYR A N   1 
ATOM   962  C  CA  . TYR A 1 105 ? 14.450 27.414 31.677 1.00 8.18  ? 104 TYR A CA  1 
ATOM   963  C  C   . TYR A 1 105 ? 13.838 28.166 30.513 1.00 8.02  ? 104 TYR A C   1 
ATOM   964  O  O   . TYR A 1 105 ? 14.557 28.604 29.636 1.00 9.19  ? 104 TYR A O   1 
ATOM   965  C  CB  . TYR A 1 105 ? 15.399 28.363 32.409 1.00 9.40  ? 104 TYR A CB  1 
ATOM   966  C  CG  . TYR A 1 105 ? 16.125 27.803 33.583 1.00 10.29 ? 104 TYR A CG  1 
ATOM   967  C  CD1 . TYR A 1 105 ? 17.271 27.058 33.415 1.00 10.73 ? 104 TYR A CD1 1 
ATOM   968  C  CD2 . TYR A 1 105 ? 15.685 28.054 34.867 1.00 12.79 ? 104 TYR A CD2 1 
ATOM   969  C  CE1 . TYR A 1 105 ? 17.955 26.561 34.509 1.00 12.15 ? 104 TYR A CE1 1 
ATOM   970  C  CE2 . TYR A 1 105 ? 16.364 27.590 35.951 1.00 15.30 ? 104 TYR A CE2 1 
ATOM   971  C  CZ  . TYR A 1 105 ? 17.502 26.816 35.766 1.00 15.09 ? 104 TYR A CZ  1 
ATOM   972  O  OH  . TYR A 1 105 ? 18.215 26.371 36.853 1.00 18.91 ? 104 TYR A OH  1 
ATOM   973  N  N   . PHE A 1 106 ? 12.533 28.357 30.558 1.00 8.70  ? 105 PHE A N   1 
ATOM   974  C  CA  . PHE A 1 106 ? 11.818 29.136 29.575 1.00 8.83  ? 105 PHE A CA  1 
ATOM   975  C  C   . PHE A 1 106 ? 10.379 29.341 29.986 1.00 10.01 ? 105 PHE A C   1 
ATOM   976  O  O   . PHE A 1 106 ? 9.884  28.658 30.878 1.00 9.27  ? 105 PHE A O   1 
ATOM   977  C  CB  . PHE A 1 106 ? 11.875 28.523 28.157 1.00 10.09 ? 105 PHE A CB  1 
ATOM   978  C  CG  . PHE A 1 106 ? 11.243 27.152 28.005 1.00 9.74  ? 105 PHE A CG  1 
ATOM   979  C  CD1 . PHE A 1 106 ? 12.008 26.024 28.149 1.00 11.02 ? 105 PHE A CD1 1 
ATOM   980  C  CD2 . PHE A 1 106 ? 9.915  27.019 27.602 1.00 10.45 ? 105 PHE A CD2 1 
ATOM   981  C  CE1 . PHE A 1 106 ? 11.468 24.775 27.962 1.00 10.81 ? 105 PHE A CE1 1 
ATOM   982  C  CE2 . PHE A 1 106 ? 9.381  25.756 27.442 1.00 12.18 ? 105 PHE A CE2 1 
ATOM   983  C  CZ  . PHE A 1 106 ? 10.165 24.648 27.607 1.00 11.89 ? 105 PHE A CZ  1 
ATOM   984  N  N   . ASP A 1 107 ? 9.735  30.289 29.316 1.00 9.94  ? 106 ASP A N   1 
ATOM   985  C  CA  . ASP A 1 107 ? 8.309  30.558 29.518 1.00 10.51 ? 106 ASP A CA  1 
ATOM   986  C  C   . ASP A 1 107 ? 7.513  29.668 28.554 1.00 10.88 ? 106 ASP A C   1 
ATOM   987  O  O   . ASP A 1 107 ? 7.577  29.859 27.336 1.00 11.99 ? 106 ASP A O   1 
ATOM   988  C  CB  . ASP A 1 107 ? 8.020  32.032 29.250 1.00 12.11 ? 106 ASP A CB  1 
ATOM   989  C  CG  . ASP A 1 107 ? 6.548  32.375 29.280 1.00 13.91 ? 106 ASP A CG  1 
ATOM   990  O  OD1 . ASP A 1 107 ? 5.713  31.519 29.623 1.00 12.34 ? 106 ASP A OD1 1 
ATOM   991  O  OD2 . ASP A 1 107 ? 6.263  33.559 28.928 1.00 14.73 ? 106 ASP A OD2 1 
ATOM   992  N  N   . PRO A 1 108 ? 6.806  28.644 29.054 1.00 10.85 ? 107 PRO A N   1 
ATOM   993  C  CA  . PRO A 1 108 ? 6.142  27.731 28.140 1.00 11.41 ? 107 PRO A CA  1 
ATOM   994  C  C   . PRO A 1 108 ? 4.766  28.177 27.686 1.00 11.83 ? 107 PRO A C   1 
ATOM   995  O  O   . PRO A 1 108 ? 4.133  27.479 26.893 1.00 13.14 ? 107 PRO A O   1 
ATOM   996  C  CB  . PRO A 1 108 ? 5.975  26.491 29.008 1.00 11.44 ? 107 PRO A CB  1 
ATOM   997  C  CG  . PRO A 1 108 ? 5.666  27.101 30.381 1.00 10.85 ? 107 PRO A CG  1 
ATOM   998  C  CD  . PRO A 1 108 ? 6.599  28.288 30.457 1.00 10.67 ? 107 PRO A CD  1 
ATOM   999  N  N   . ARG A 1 109 ? 4.307  29.345 28.118 1.00 12.03 ? 108 ARG A N   1 
ATOM   1000 C  CA  . ARG A 1 109 ? 2.920  29.734 27.822 1.00 12.75 ? 108 ARG A CA  1 
ATOM   1001 C  C   . ARG A 1 109 ? 2.565  29.740 26.321 1.00 13.91 ? 108 ARG A C   1 
ATOM   1002 O  O   . ARG A 1 109 ? 1.459  29.329 25.956 1.00 15.22 ? 108 ARG A O   1 
ATOM   1003 C  CB  . ARG A 1 109 ? 2.553  31.055 28.499 1.00 12.52 ? 108 ARG A CB  1 
ATOM   1004 C  CG  . ARG A 1 109 ? 2.449  30.967 29.996 1.00 12.10 ? 108 ARG A CG  1 
ATOM   1005 C  CD  . ARG A 1 109 ? 2.205  32.313 30.630 1.00 12.73 ? 108 ARG A CD  1 
ATOM   1006 N  NE  . ARG A 1 109 ? 3.331  33.199 30.361 1.00 12.37 ? 108 ARG A NE  1 
ATOM   1007 C  CZ  . ARG A 1 109 ? 3.325  34.524 30.510 1.00 11.76 ? 108 ARG A CZ  1 
ATOM   1008 N  NH1 . ARG A 1 109 ? 2.244  35.140 30.919 1.00 13.92 ? 108 ARG A NH1 1 
ATOM   1009 N  NH2 . ARG A 1 109 ? 4.408  35.217 30.198 1.00 12.72 ? 108 ARG A NH2 1 
ATOM   1010 N  N   . PRO A 1 110 ? 3.464  30.172 25.433 1.00 14.94 ? 109 PRO A N   1 
ATOM   1011 C  CA  . PRO A 1 110 ? 3.118  30.172 24.009 1.00 16.93 ? 109 PRO A CA  1 
ATOM   1012 C  C   . PRO A 1 110 ? 2.762  28.794 23.483 1.00 17.31 ? 109 PRO A C   1 
ATOM   1013 O  O   . PRO A 1 110 ? 2.090  28.667 22.460 1.00 19.80 ? 109 PRO A O   1 
ATOM   1014 C  CB  . PRO A 1 110 ? 4.388  30.712 23.354 1.00 16.76 ? 109 PRO A CB  1 
ATOM   1015 C  CG  . PRO A 1 110 ? 5.029  31.552 24.435 1.00 17.24 ? 109 PRO A CG  1 
ATOM   1016 C  CD  . PRO A 1 110 ? 4.757  30.818 25.691 1.00 15.75 ? 109 PRO A CD  1 
ATOM   1017 N  N   . LEU A 1 111 ? 3.222  27.747 24.171 1.00 16.51 ? 110 LEU A N   1 
ATOM   1018 C  CA  . LEU A 1 111 ? 2.974  26.378 23.705 1.00 17.56 ? 110 LEU A CA  1 
ATOM   1019 C  C   . LEU A 1 111 ? 1.536  25.920 23.948 1.00 18.20 ? 110 LEU A C   1 
ATOM   1020 O  O   . LEU A 1 111 ? 1.103  24.894 23.392 1.00 20.08 ? 110 LEU A O   1 
ATOM   1021 C  CB  . LEU A 1 111 ? 3.900  25.381 24.393 1.00 16.46 ? 110 LEU A CB  1 
ATOM   1022 C  CG  . LEU A 1 111 ? 5.386  25.643 24.237 1.00 16.09 ? 110 LEU A CG  1 
ATOM   1023 C  CD1 . LEU A 1 111 ? 6.188  24.673 25.090 1.00 16.43 ? 110 LEU A CD1 1 
ATOM   1024 C  CD2 . LEU A 1 111 ? 5.763  25.551 22.754 1.00 18.45 ? 110 LEU A CD2 1 
ATOM   1025 N  N   . PHE A 1 112 ? 0.799  26.654 24.772 1.00 19.30 ? 111 PHE A N   1 
ATOM   1026 C  CA  . PHE A 1 112 ? -0.577 26.250 25.165 1.00 20.61 ? 111 PHE A CA  1 
ATOM   1027 C  C   . PHE A 1 112 ? -1.633 26.966 24.350 1.00 23.95 ? 111 PHE A C   1 
ATOM   1028 O  O   . PHE A 1 112 ? -2.839 26.669 24.453 1.00 25.75 ? 111 PHE A O   1 
ATOM   1029 C  CB  . PHE A 1 112 ? -0.807 26.500 26.644 1.00 20.25 ? 111 PHE A CB  1 
ATOM   1030 C  CG  . PHE A 1 112 ? 0.022  25.621 27.539 1.00 16.41 ? 111 PHE A CG  1 
ATOM   1031 C  CD1 . PHE A 1 112 ? -0.433 24.380 27.956 1.00 16.66 ? 111 PHE A CD1 1 
ATOM   1032 C  CD2 . PHE A 1 112 ? 1.275  26.037 27.962 1.00 16.23 ? 111 PHE A CD2 1 
ATOM   1033 C  CE1 . PHE A 1 112 ? 0.308  23.616 28.793 1.00 16.73 ? 111 PHE A CE1 1 
ATOM   1034 C  CE2 . PHE A 1 112 ? 2.047  25.242 28.776 1.00 15.11 ? 111 PHE A CE2 1 
ATOM   1035 C  CZ  . PHE A 1 112 ? 1.562  24.036 29.191 1.00 15.42 ? 111 PHE A CZ  1 
ATOM   1036 N  N   . GLU A 1 113 ? -1.135 27.918 23.581 1.00 25.64 ? 112 GLU A N   1 
ATOM   1037 C  CA  . GLU A 1 113 ? -1.897 28.749 22.651 1.00 28.03 ? 112 GLU A CA  1 
ATOM   1038 C  C   . GLU A 1 113 ? -2.026 30.158 23.193 1.00 29.52 ? 112 GLU A C   1 
ATOM   1039 O  O   . GLU A 1 113 ? -1.012 30.812 23.500 1.00 31.75 ? 112 GLU A O   1 
ATOM   1040 C  CB  . GLU A 1 113 ? -3.270 28.129 22.373 1.00 28.90 ? 112 GLU A CB  1 
HETATM 1041 O  O   . HOH B 2 .   ? 7.918  6.615  27.504 1.00 33.85 ? 114 HOH A O   1 
HETATM 1042 O  O   . HOH B 2 .   ? 5.943  20.637 24.272 1.00 33.01 ? 115 HOH A O   1 
HETATM 1043 O  O   . HOH B 2 .   ? 15.822 4.057  33.383 1.00 36.13 ? 116 HOH A O   1 
HETATM 1044 O  O   . HOH B 2 .   ? 20.920 37.500 24.257 1.00 33.05 ? 117 HOH A O   1 
HETATM 1045 O  O   . HOH B 2 .   ? 23.527 10.011 37.643 1.00 35.15 ? 118 HOH A O   1 
HETATM 1046 O  O   . HOH B 2 .   ? 28.806 32.348 24.531 1.00 32.10 ? 119 HOH A O   1 
HETATM 1047 O  O   . HOH B 2 .   ? 31.174 7.582  28.383 1.00 35.28 ? 120 HOH A O   1 
HETATM 1048 O  O   . HOH B 2 .   ? 13.300 10.642 13.553 1.00 36.33 ? 121 HOH A O   1 
HETATM 1049 O  O   . HOH B 2 .   ? 9.842  17.688 13.122 1.00 37.57 ? 122 HOH A O   1 
HETATM 1050 O  O   . HOH B 2 .   ? 44.712 19.267 21.553 1.00 32.91 ? 123 HOH A O   1 
HETATM 1051 O  O   . HOH B 2 .   ? -3.387 29.617 26.861 1.00 32.84 ? 124 HOH A O   1 
HETATM 1052 O  O   . HOH B 2 .   ? 6.344  11.937 16.583 1.00 34.49 ? 125 HOH A O   1 
HETATM 1053 O  O   . HOH B 2 .   ? 23.880 20.158 39.407 1.00 35.43 ? 126 HOH A O   1 
HETATM 1054 O  O   . HOH B 2 .   ? 6.392  12.318 24.078 1.00 35.45 ? 127 HOH A O   1 
HETATM 1055 O  O   . HOH B 2 .   ? 28.263 33.022 21.175 1.00 36.65 ? 128 HOH A O   1 
HETATM 1056 O  O   . HOH B 2 .   ? 6.553  16.188 17.304 1.00 36.35 ? 129 HOH A O   1 
HETATM 1057 O  O   . HOH B 2 .   ? 6.568  31.241 20.646 1.00 36.83 ? 130 HOH A O   1 
HETATM 1058 O  O   . HOH B 2 .   ? 27.513 25.428 18.662 1.00 37.39 ? 131 HOH A O   1 
HETATM 1059 O  O   . HOH B 2 .   ? 8.198  19.556 26.052 1.00 35.00 ? 132 HOH A O   1 
HETATM 1060 O  O   . HOH B 2 .   ? 24.673 27.879 16.565 1.00 35.84 ? 133 HOH A O   1 
HETATM 1061 O  O   . HOH B 2 .   ? 25.627 7.629  14.673 1.00 34.24 ? 134 HOH A O   1 
HETATM 1062 O  O   . HOH B 2 .   ? 7.528  8.412  25.712 1.00 34.03 ? 135 HOH A O   1 
HETATM 1063 O  O   . HOH B 2 .   ? 21.775 35.359 22.704 1.00 37.57 ? 136 HOH A O   1 
HETATM 1064 O  O   . HOH B 2 .   ? 14.211 23.566 12.985 1.00 39.16 ? 137 HOH A O   1 
HETATM 1065 O  O   A HOH B 2 .   ? 10.403 32.800 23.965 0.50 9.39  ? 138 HOH A O   1 
HETATM 1066 O  O   B HOH B 2 .   ? 10.902 33.426 22.864 0.50 12.79 ? 138 HOH A O   1 
HETATM 1067 O  O   . HOH B 2 .   ? 34.726 28.495 31.076 1.00 38.30 ? 139 HOH A O   1 
HETATM 1068 O  O   . HOH B 2 .   ? 10.627 15.103 28.599 1.00 35.28 ? 140 HOH A O   1 
HETATM 1069 O  O   . HOH B 2 .   ? 29.722 17.951 40.665 1.00 37.90 ? 141 HOH A O   1 
HETATM 1070 O  O   . HOH B 2 .   ? 9.795  5.380  27.997 1.00 36.05 ? 142 HOH A O   1 
HETATM 1071 O  O   . HOH B 2 .   ? 1.774  30.693 20.636 1.00 36.97 ? 143 HOH A O   1 
HETATM 1072 O  O   . HOH B 2 .   ? 22.689 4.357  24.860 1.00 40.90 ? 144 HOH A O   1 
HETATM 1073 O  O   A HOH B 2 .   ? 24.177 12.133 14.079 0.50 11.01 ? 145 HOH A O   1 
HETATM 1074 O  O   B HOH B 2 .   ? 24.282 13.191 13.392 0.50 11.73 ? 145 HOH A O   1 
HETATM 1075 O  O   A HOH B 2 .   ? 4.433  14.906 32.889 0.50 18.50 ? 146 HOH A O   1 
HETATM 1076 O  O   B HOH B 2 .   ? 5.197  16.079 32.762 0.50 10.16 ? 146 HOH A O   1 
HETATM 1077 O  O   A HOH B 2 .   ? 31.313 11.289 22.742 0.50 10.87 ? 147 HOH A O   1 
HETATM 1078 O  O   B HOH B 2 .   ? 30.948 11.898 22.985 0.50 23.79 ? 147 HOH A O   1 
HETATM 1079 O  O   . HOH B 2 .   ? 32.349 11.999 39.617 1.00 45.98 ? 148 HOH A O   1 
HETATM 1080 O  O   . HOH B 2 .   ? 5.500  30.172 15.555 1.00 40.49 ? 149 HOH A O   1 
HETATM 1081 O  O   . HOH B 2 .   ? 21.376 20.260 35.297 1.00 10.58 ? 150 HOH A O   1 
HETATM 1082 O  O   . HOH B 2 .   ? 17.278 17.442 35.989 1.00 11.89 ? 151 HOH A O   1 
HETATM 1083 O  O   . HOH B 2 .   ? 11.285 31.827 27.355 1.00 13.10 ? 152 HOH A O   1 
HETATM 1084 O  O   . HOH B 2 .   ? 11.685 27.209 33.454 1.00 14.12 ? 153 HOH A O   1 
HETATM 1085 O  O   . HOH B 2 .   ? 2.878  37.927 30.667 1.00 15.47 ? 154 HOH A O   1 
HETATM 1086 O  O   . HOH B 2 .   ? 15.105 16.376 16.935 1.00 14.74 ? 155 HOH A O   1 
HETATM 1087 O  O   . HOH B 2 .   ? 38.278 11.559 24.750 1.00 16.04 ? 156 HOH A O   1 
HETATM 1088 O  O   . HOH B 2 .   ? 32.242 29.928 29.992 1.00 15.79 ? 157 HOH A O   1 
HETATM 1089 O  O   . HOH B 2 .   ? 10.637 20.954 27.594 1.00 16.22 ? 158 HOH A O   1 
HETATM 1090 O  O   . HOH B 2 .   ? 35.353 21.427 28.023 1.00 16.24 ? 159 HOH A O   1 
HETATM 1091 O  O   . HOH B 2 .   ? 27.758 9.842  34.940 1.00 16.77 ? 160 HOH A O   1 
HETATM 1092 O  O   . HOH B 2 .   ? 32.811 14.480 32.960 1.00 17.11 ? 161 HOH A O   1 
HETATM 1093 O  O   . HOH B 2 .   ? 17.800 28.400 38.717 1.00 17.70 ? 162 HOH A O   1 
HETATM 1094 O  O   . HOH B 2 .   ? 26.753 14.154 17.554 1.00 18.13 ? 163 HOH A O   1 
HETATM 1095 O  O   . HOH B 2 .   ? 13.873 6.161  32.067 1.00 18.90 ? 164 HOH A O   1 
HETATM 1096 O  O   . HOH B 2 .   ? 41.229 18.348 20.721 1.00 19.56 ? 165 HOH A O   1 
HETATM 1097 O  O   . HOH B 2 .   ? 25.308 5.393  31.996 1.00 21.68 ? 166 HOH A O   1 
HETATM 1098 O  O   . HOH B 2 .   ? 12.208 11.084 39.678 1.00 19.06 ? 167 HOH A O   1 
HETATM 1099 O  O   . HOH B 2 .   ? 32.865 11.012 27.515 1.00 19.41 ? 168 HOH A O   1 
HETATM 1100 O  O   . HOH B 2 .   ? -0.479 34.373 31.749 1.00 18.63 ? 169 HOH A O   1 
HETATM 1101 O  O   . HOH B 2 .   ? 17.553 4.871  31.344 1.00 20.95 ? 170 HOH A O   1 
HETATM 1102 O  O   . HOH B 2 .   ? 38.714 18.472 22.196 1.00 19.21 ? 171 HOH A O   1 
HETATM 1103 O  O   . HOH B 2 .   ? 25.996 21.194 18.312 1.00 19.77 ? 172 HOH A O   1 
HETATM 1104 O  O   . HOH B 2 .   ? 16.413 21.486 26.305 1.00 20.38 ? 173 HOH A O   1 
HETATM 1105 O  O   . HOH B 2 .   ? 22.592 17.586 38.667 1.00 20.01 ? 174 HOH A O   1 
HETATM 1106 O  O   . HOH B 2 .   ? 23.130 21.479 37.103 1.00 21.25 ? 175 HOH A O   1 
HETATM 1107 O  O   . HOH B 2 .   ? 22.016 6.315  28.593 1.00 20.86 ? 176 HOH A O   1 
HETATM 1108 O  O   . HOH B 2 .   ? 8.480  18.314 29.693 1.00 21.88 ? 177 HOH A O   1 
HETATM 1109 O  O   . HOH B 2 .   ? 23.338 25.159 17.001 1.00 22.33 ? 178 HOH A O   1 
HETATM 1110 O  O   . HOH B 2 .   ? 18.940 19.234 25.089 1.00 25.40 ? 179 HOH A O   1 
HETATM 1111 O  O   . HOH B 2 .   ? 17.564 8.396  14.835 1.00 22.29 ? 180 HOH A O   1 
HETATM 1112 O  O   . HOH B 2 .   ? 10.580 20.289 36.860 1.00 21.41 ? 181 HOH A O   1 
HETATM 1113 O  O   . HOH B 2 .   ? 14.375 20.835 25.130 1.00 21.37 ? 182 HOH A O   1 
HETATM 1114 O  O   . HOH B 2 .   ? 32.447 16.453 34.599 1.00 23.71 ? 183 HOH A O   1 
HETATM 1115 O  O   . HOH B 2 .   ? 29.125 9.807  27.059 1.00 22.91 ? 184 HOH A O   1 
HETATM 1116 O  O   . HOH B 2 .   ? 21.229 11.960 37.332 1.00 23.68 ? 185 HOH A O   1 
HETATM 1117 O  O   . HOH B 2 .   ? 29.267 25.331 37.841 1.00 24.02 ? 186 HOH A O   1 
HETATM 1118 O  O   . HOH B 2 .   ? 15.907 17.138 39.511 1.00 24.11 ? 187 HOH A O   1 
HETATM 1119 O  O   . HOH B 2 .   ? 25.504 12.162 16.249 1.00 23.28 ? 188 HOH A O   1 
HETATM 1120 O  O   . HOH B 2 .   ? 15.462 26.324 16.847 1.00 24.32 ? 189 HOH A O   1 
HETATM 1121 O  O   . HOH B 2 .   ? 29.548 30.871 23.051 1.00 25.40 ? 190 HOH A O   1 
HETATM 1122 O  O   . HOH B 2 .   ? 7.795  34.653 26.897 1.00 24.56 ? 191 HOH A O   1 
HETATM 1123 O  O   . HOH B 2 .   ? 15.702 20.176 40.412 1.00 25.75 ? 192 HOH A O   1 
HETATM 1124 O  O   . HOH B 2 .   ? 8.696  31.940 25.884 1.00 24.57 ? 193 HOH A O   1 
HETATM 1125 O  O   . HOH B 2 .   ? 36.385 21.343 23.502 1.00 23.55 ? 194 HOH A O   1 
HETATM 1126 O  O   . HOH B 2 .   ? 19.125 6.477  13.610 1.00 24.31 ? 195 HOH A O   1 
HETATM 1127 O  O   . HOH B 2 .   ? 16.743 18.788 25.234 1.00 24.36 ? 196 HOH A O   1 
HETATM 1128 O  O   . HOH B 2 .   ? 26.974 9.451  37.477 1.00 26.53 ? 197 HOH A O   1 
HETATM 1129 O  O   . HOH B 2 .   ? 13.103 18.783 26.576 1.00 24.89 ? 198 HOH A O   1 
HETATM 1130 O  O   . HOH B 2 .   ? 7.200  30.800 17.447 1.00 25.00 ? 199 HOH A O   1 
HETATM 1131 O  O   . HOH B 2 .   ? 36.710 20.375 19.662 1.00 26.07 ? 200 HOH A O   1 
HETATM 1132 O  O   . HOH B 2 .   ? 18.700 24.337 38.578 1.00 27.50 ? 201 HOH A O   1 
HETATM 1133 O  O   . HOH B 2 .   ? 19.442 20.689 11.467 1.00 25.78 ? 202 HOH A O   1 
HETATM 1134 O  O   . HOH B 2 .   ? 4.326  34.030 26.851 1.00 25.33 ? 203 HOH A O   1 
HETATM 1135 O  O   . HOH B 2 .   ? 18.546 3.748  14.220 1.00 25.76 ? 204 HOH A O   1 
HETATM 1136 O  O   . HOH B 2 .   ? -0.861 29.995 27.479 1.00 25.39 ? 205 HOH A O   1 
HETATM 1137 O  O   . HOH B 2 .   ? 16.729 6.573  36.641 1.00 25.46 ? 206 HOH A O   1 
HETATM 1138 O  O   . HOH B 2 .   ? 19.322 14.849 39.157 1.00 25.69 ? 207 HOH A O   1 
HETATM 1139 O  O   . HOH B 2 .   ? 18.696 23.842 14.538 1.00 27.31 ? 208 HOH A O   1 
HETATM 1140 O  O   . HOH B 2 .   ? 25.025 5.349  36.644 1.00 25.58 ? 209 HOH A O   1 
HETATM 1141 O  O   . HOH B 2 .   ? 23.420 20.936 14.513 1.00 26.19 ? 210 HOH A O   1 
HETATM 1142 O  O   . HOH B 2 .   ? 32.750 10.582 24.842 1.00 27.24 ? 211 HOH A O   1 
HETATM 1143 O  O   . HOH B 2 .   ? 7.309  14.369 31.985 1.00 20.59 ? 212 HOH A O   1 
HETATM 1144 O  O   . HOH B 2 .   ? 11.909 19.218 13.482 1.00 28.19 ? 213 HOH A O   1 
HETATM 1145 O  O   . HOH B 2 .   ? 39.316 21.412 23.364 1.00 25.37 ? 214 HOH A O   1 
HETATM 1146 O  O   . HOH B 2 .   ? 11.164 16.192 11.903 1.00 27.81 ? 215 HOH A O   1 
HETATM 1147 O  O   . HOH B 2 .   ? 8.853  28.957 14.848 1.00 27.21 ? 216 HOH A O   1 
HETATM 1148 O  O   . HOH B 2 .   ? 18.447 31.811 22.161 1.00 25.71 ? 217 HOH A O   1 
HETATM 1149 O  O   . HOH B 2 .   ? 33.828 8.398  28.364 1.00 28.50 ? 218 HOH A O   1 
HETATM 1150 O  O   . HOH B 2 .   ? 14.679 11.795 10.313 1.00 27.15 ? 219 HOH A O   1 
HETATM 1151 O  O   . HOH B 2 .   ? 9.366  19.697 17.267 1.00 27.23 ? 220 HOH A O   1 
HETATM 1152 O  O   . HOH B 2 .   ? 25.804 3.390  33.816 1.00 27.05 ? 221 HOH A O   1 
HETATM 1153 O  O   . HOH B 2 .   ? 15.042 5.696  24.675 1.00 29.22 ? 222 HOH A O   1 
HETATM 1154 O  O   . HOH B 2 .   ? 11.293 13.136 11.183 1.00 26.00 ? 223 HOH A O   1 
HETATM 1155 O  O   . HOH B 2 .   ? 23.439 15.012 38.471 1.00 28.86 ? 224 HOH A O   1 
HETATM 1156 O  O   . HOH B 2 .   ? 19.471 34.560 22.465 1.00 27.10 ? 225 HOH A O   1 
HETATM 1157 O  O   . HOH B 2 .   ? 14.869 7.260  21.589 1.00 29.00 ? 226 HOH A O   1 
HETATM 1158 O  O   . HOH B 2 .   ? 33.329 13.323 37.215 1.00 27.74 ? 227 HOH A O   1 
HETATM 1159 O  O   . HOH B 2 .   ? 18.919 3.167  29.657 1.00 29.35 ? 228 HOH A O   1 
HETATM 1160 O  O   . HOH B 2 .   ? 33.526 18.783 33.480 1.00 27.71 ? 229 HOH A O   1 
HETATM 1161 O  O   . HOH B 2 .   ? 40.414 20.005 22.001 1.00 13.42 ? 230 HOH A O   1 
HETATM 1162 O  O   . HOH B 2 .   ? 47.331 17.032 22.413 1.00 28.19 ? 231 HOH A O   1 
HETATM 1163 O  O   . HOH B 2 .   ? 18.498 9.835  38.916 1.00 28.69 ? 232 HOH A O   1 
HETATM 1164 O  O   . HOH B 2 .   ? 16.300 24.953 14.437 1.00 29.27 ? 233 HOH A O   1 
HETATM 1165 O  O   . HOH B 2 .   ? 11.191 20.977 15.999 1.00 27.74 ? 234 HOH A O   1 
HETATM 1166 O  O   . HOH B 2 .   ? 16.245 24.336 40.007 1.00 29.23 ? 235 HOH A O   1 
HETATM 1167 O  O   . HOH B 2 .   ? 9.867  7.321  20.991 1.00 30.01 ? 236 HOH A O   1 
HETATM 1168 O  O   . HOH B 2 .   ? 31.359 9.145  42.862 1.00 50.37 ? 237 HOH A O   1 
HETATM 1169 O  O   . HOH B 2 .   ? 9.227  16.333 31.456 1.00 25.82 ? 238 HOH A O   1 
HETATM 1170 O  O   . HOH B 2 .   ? 28.752 21.458 39.440 1.00 29.79 ? 239 HOH A O   1 
HETATM 1171 O  O   . HOH B 2 .   ? 15.479 6.940  15.692 1.00 30.70 ? 240 HOH A O   1 
HETATM 1172 O  O   . HOH B 2 .   ? 20.721 2.699  15.317 1.00 31.82 ? 241 HOH A O   1 
HETATM 1173 O  O   . HOH B 2 .   ? 5.632  21.171 21.939 1.00 31.24 ? 242 HOH A O   1 
HETATM 1174 O  O   . HOH B 2 .   ? 14.162 28.078 16.054 1.00 38.01 ? 243 HOH A O   1 
HETATM 1175 O  O   . HOH B 2 .   ? 31.351 21.918 39.202 1.00 30.60 ? 244 HOH A O   1 
HETATM 1176 O  O   . HOH B 2 .   ? 39.524 22.085 25.921 1.00 31.99 ? 245 HOH A O   1 
HETATM 1177 O  O   . HOH B 2 .   ? 18.125 21.587 13.166 1.00 31.95 ? 246 HOH A O   1 
HETATM 1178 O  O   . HOH B 2 .   ? 26.692 6.791  38.457 1.00 30.61 ? 247 HOH A O   1 
HETATM 1179 O  O   . HOH B 2 .   ? 23.890 21.593 16.609 1.00 29.08 ? 248 HOH A O   1 
HETATM 1180 O  O   . HOH B 2 .   ? 16.248 30.774 15.998 1.00 29.98 ? 249 HOH A O   1 
HETATM 1181 O  O   . HOH B 2 .   ? 28.589 10.416 39.460 1.00 33.40 ? 250 HOH A O   1 
HETATM 1182 O  O   . HOH B 2 .   ? 19.665 3.526  21.806 1.00 32.83 ? 251 HOH A O   1 
HETATM 1183 O  O   . HOH B 2 .   ? 22.044 4.566  22.115 1.00 31.81 ? 252 HOH A O   1 
HETATM 1184 O  O   . HOH B 2 .   ? 27.813 8.257  18.573 1.00 31.70 ? 253 HOH A O   1 
HETATM 1185 O  O   . HOH B 2 .   ? 25.341 23.607 18.713 1.00 31.25 ? 254 HOH A O   1 
HETATM 1186 O  O   . HOH B 2 .   ? 16.038 5.564  18.505 1.00 33.91 ? 255 HOH A O   1 
HETATM 1187 O  O   . HOH B 2 .   ? 27.229 9.677  16.149 1.00 34.21 ? 256 HOH A O   1 
HETATM 1188 O  O   . HOH B 2 .   ? 35.812 24.848 33.755 1.00 33.62 ? 257 HOH A O   1 
HETATM 1189 O  O   . HOH B 2 .   ? -0.779 28.335 30.069 1.00 30.79 ? 258 HOH A O   1 
HETATM 1190 O  O   . HOH B 2 .   ? 28.401 22.518 17.390 1.00 32.24 ? 259 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . MSE A 2   ? 0.2602 0.2121 0.2546 -0.0076 -0.0424 -0.0040 1   MSE A N   
2    C  CA  . MSE A 2   ? 0.2604 0.2288 0.2727 0.0080  -0.0273 -0.0065 1   MSE A CA  
3    C  C   . MSE A 2   ? 0.2603 0.2154 0.2484 0.0117  -0.0209 0.0042  1   MSE A C   
4    O  O   . MSE A 2   ? 0.2749 0.2561 0.2773 0.0021  -0.0177 0.0082  1   MSE A O   
5    C  CB  . MSE A 2   ? 0.2581 0.2148 0.2485 0.0112  -0.0252 -0.0082 1   MSE A CB  
6    C  CG  . MSE A 2   ? 0.2595 0.2119 0.2464 -0.0128 -0.0393 -0.0018 1   MSE A CG  
7    SE SE  . MSE A 2   ? 0.2511 0.2602 0.2518 0.0080  -0.0310 0.0002  1   MSE A SE  
8    C  CE  . MSE A 2   ? 0.1543 0.1967 0.3239 -0.0438 -0.0811 0.0129  1   MSE A CE  
9    N  N   . LYS A 3   ? 0.2585 0.2350 0.2821 0.0270  -0.0210 0.0129  2   LYS A N   
10   C  CA  . LYS A 3   ? 0.2553 0.2492 0.2651 0.0345  -0.0168 0.0158  2   LYS A CA  
11   C  C   . LYS A 3   ? 0.2296 0.2363 0.2516 0.0419  -0.0046 0.0306  2   LYS A C   
12   O  O   . LYS A 3   ? 0.2265 0.2838 0.2630 0.0654  -0.0121 0.0480  2   LYS A O   
13   C  CB  . LYS A 3   ? 0.2709 0.2733 0.2860 0.0284  -0.0209 0.0114  2   LYS A CB  
14   C  CG  . LYS A 3   ? 0.3073 0.2989 0.3098 0.0142  -0.0149 0.0020  2   LYS A CG  
15   C  CD  . LYS A 3   ? 0.3416 0.3316 0.3539 0.0122  -0.0032 -0.0178 2   LYS A CD  
16   C  CE  . LYS A 3   ? 0.3659 0.3687 0.3679 -0.0026 -0.0014 -0.0009 2   LYS A CE  
17   N  NZ  . LYS A 3   ? 0.3770 0.4101 0.4230 0.0023  -0.0084 0.0032  2   LYS A NZ  
18   N  N   . THR A 4   ? 0.2176 0.2092 0.2136 0.0407  -0.0160 0.0310  3   THR A N   
19   C  CA  . THR A 4   ? 0.2188 0.1958 0.1939 0.0335  -0.0131 0.0283  3   THR A CA  
20   C  C   . THR A 4   ? 0.2168 0.2071 0.1862 0.0304  -0.0102 0.0252  3   THR A C   
21   O  O   . THR A 4   ? 0.2237 0.2216 0.1827 0.0451  -0.0285 0.0203  3   THR A O   
22   C  CB  . THR A 4   ? 0.2252 0.2050 0.1872 0.0099  0.0051  0.0262  3   THR A CB  
23   O  OG1 . THR A 4   ? 0.2092 0.2014 0.2049 0.0195  0.0106  0.0454  3   THR A OG1 
24   C  CG2 . THR A 4   ? 0.2323 0.1720 0.1963 0.0245  -0.0165 0.0308  3   THR A CG2 
25   N  N   . GLN A 5   ? 0.1842 0.2158 0.1667 0.0573  -0.0169 0.0132  4   GLN A N   
26   C  CA  . GLN A 5   ? 0.1699 0.2103 0.1676 0.0369  -0.0155 0.0158  4   GLN A CA  
27   C  C   . GLN A 5   ? 0.1558 0.2094 0.1583 0.0445  -0.0002 0.0112  4   GLN A C   
28   O  O   . GLN A 5   ? 0.1683 0.2629 0.1714 0.0566  -0.0004 0.0308  4   GLN A O   
29   C  CB  . GLN A 5   ? 0.1748 0.2235 0.1605 0.0419  -0.0054 0.0128  4   GLN A CB  
30   C  CG  . GLN A 5   ? 0.1947 0.2387 0.1880 0.0311  -0.0110 0.0213  4   GLN A CG  
31   C  CD  . GLN A 5   ? 0.2134 0.2527 0.2108 0.0246  0.0076  0.0215  4   GLN A CD  
32   O  OE1 . GLN A 5   ? 0.2289 0.2590 0.2081 0.0246  0.0219  0.0190  4   GLN A OE1 
33   N  NE2 . GLN A 5   ? 0.2119 0.2878 0.2244 0.0103  0.0128  0.0029  4   GLN A NE2 
34   N  N   A ILE A 6   ? 0.1445 0.2014 0.1565 0.0384  -0.0130 0.0093  5   ILE A N   
35   N  N   B ILE A 6   ? 0.1384 0.2025 0.1484 0.0432  -0.0145 0.0091  5   ILE A N   
36   C  CA  A ILE A 6   ? 0.1372 0.1769 0.1497 0.0279  -0.0042 0.0013  5   ILE A CA  
37   C  CA  B ILE A 6   ? 0.1336 0.1714 0.1404 0.0351  -0.0023 -0.0038 5   ILE A CA  
38   C  C   A ILE A 6   ? 0.1321 0.1743 0.1375 0.0214  -0.0038 0.0041  5   ILE A C   
39   C  C   B ILE A 6   ? 0.1261 0.1721 0.1308 0.0217  -0.0020 0.0016  5   ILE A C   
40   O  O   A ILE A 6   ? 0.1311 0.1587 0.1490 0.0145  -0.0063 0.0078  5   ILE A O   
41   O  O   B ILE A 6   ? 0.1267 0.1482 0.1543 0.0156  -0.0040 0.0039  5   ILE A O   
42   C  CB  A ILE A 6   ? 0.1361 0.1824 0.1470 0.0296  -0.0086 -0.0006 5   ILE A CB  
43   C  CB  B ILE A 6   ? 0.1305 0.1666 0.1218 0.0326  -0.0013 0.0034  5   ILE A CB  
44   C  CG1 A ILE A 6   ? 0.1344 0.1758 0.1481 0.0149  -0.0098 0.0023  5   ILE A CG1 
45   C  CG1 B ILE A 6   ? 0.1050 0.1254 0.1114 0.0100  -0.0036 0.0060  5   ILE A CG1 
46   C  CG2 A ILE A 6   ? 0.1167 0.1494 0.1233 0.0203  -0.0182 0.0273  5   ILE A CG2 
47   C  CG2 B ILE A 6   ? 0.1367 0.1794 0.1400 0.0332  0.0010  -0.0026 5   ILE A CG2 
48   C  CD1 A ILE A 6   ? 0.1857 0.1673 0.1370 0.0060  -0.0022 0.0048  5   ILE A CD1 
49   C  CD1 B ILE A 6   ? 0.1361 0.1274 0.1999 -0.0068 0.0083  -0.0029 5   ILE A CD1 
50   N  N   . THR A 7   ? 0.1391 0.1741 0.1254 0.0369  -0.0030 0.0004  6   THR A N   
51   C  CA  . THR A 7   ? 0.1285 0.1685 0.1264 0.0264  -0.0017 0.0015  6   THR A CA  
52   C  C   . THR A 7   ? 0.1214 0.1425 0.1228 0.0224  0.0005  0.0008  6   THR A C   
53   O  O   . THR A 7   ? 0.1397 0.1461 0.1144 0.0200  -0.0061 0.0006  6   THR A O   
54   C  CB  . THR A 7   ? 0.1368 0.1786 0.1365 0.0332  0.0105  0.0012  6   THR A CB  
55   O  OG1 . THR A 7   ? 0.1569 0.2012 0.1469 0.0405  0.0141  0.0221  6   THR A OG1 
56   C  CG2 . THR A 7   ? 0.1411 0.1775 0.1848 0.0413  0.0237  0.0081  6   THR A CG2 
57   N  N   A THR A 8   ? 0.1121 0.1345 0.1136 0.0191  0.0004  0.0065  7   THR A N   
58   N  N   B THR A 8   ? 0.1061 0.1390 0.1165 0.0124  -0.0004 0.0026  7   THR A N   
59   C  CA  A THR A 8   ? 0.1117 0.1293 0.1133 0.0123  0.0011  0.0054  7   THR A CA  
60   C  CA  B THR A 8   ? 0.1014 0.1275 0.1147 0.0105  0.0016  0.0029  7   THR A CA  
61   C  C   A THR A 8   ? 0.1063 0.1122 0.1143 0.0139  0.0014  -0.0085 7   THR A C   
62   C  C   B THR A 8   ? 0.0993 0.1121 0.1126 0.0100  0.0019  -0.0025 7   THR A C   
63   O  O   A THR A 8   ? 0.1053 0.1311 0.1178 0.0089  -0.0104 -0.0153 7   THR A O   
64   O  O   B THR A 8   ? 0.0971 0.1119 0.1119 0.0138  -0.0023 -0.0031 7   THR A O   
65   C  CB  A THR A 8   ? 0.1250 0.1286 0.1282 0.0240  0.0046  0.0005  7   THR A CB  
66   C  CB  B THR A 8   ? 0.0976 0.1278 0.1288 0.0042  0.0000  -0.0018 7   THR A CB  
67   O  OG1 A THR A 8   ? 0.1408 0.1607 0.1241 0.0130  0.0062  -0.0099 7   THR A OG1 
68   O  OG1 B THR A 8   ? 0.1190 0.1484 0.1281 0.0148  0.0129  0.0021  7   THR A OG1 
69   C  CG2 A THR A 8   ? 0.1606 0.1300 0.0982 0.0083  0.0098  -0.0006 7   THR A CG2 
70   C  CG2 B THR A 8   ? 0.1055 0.1470 0.1411 0.0162  0.0172  0.0000  7   THR A CG2 
71   N  N   A ARG A 9   ? 0.1047 0.1175 0.1117 0.0085  -0.0085 -0.0016 8   ARG A N   
72   N  N   B ARG A 9   ? 0.1025 0.1047 0.1064 0.0050  -0.0058 0.0026  8   ARG A N   
73   C  CA  A ARG A 9   ? 0.1181 0.1196 0.1225 0.0044  -0.0069 -0.0017 8   ARG A CA  
74   C  CA  B ARG A 9   ? 0.1171 0.1115 0.1128 0.0062  -0.0070 0.0005  8   ARG A CA  
75   C  C   A ARG A 9   ? 0.1213 0.1196 0.1132 0.0038  -0.0091 0.0077  8   ARG A C   
76   C  C   B ARG A 9   ? 0.1250 0.1124 0.1141 0.0054  -0.0109 0.0056  8   ARG A C   
77   O  O   A ARG A 9   ? 0.1287 0.1280 0.1044 0.0013  -0.0165 0.0158  8   ARG A O   
78   O  O   B ARG A 9   ? 0.1335 0.0964 0.1251 0.0101  -0.0200 0.0063  8   ARG A O   
79   C  CB  A ARG A 9   ? 0.1332 0.1314 0.1289 0.0003  -0.0004 -0.0074 8   ARG A CB  
80   C  CB  B ARG A 9   ? 0.1313 0.1158 0.1165 -0.0002 -0.0056 -0.0049 8   ARG A CB  
81   C  CG  A ARG A 9   ? 0.1504 0.1748 0.1831 -0.0163 -0.0100 -0.0229 8   ARG A CG  
82   C  CG  B ARG A 9   ? 0.1379 0.1204 0.1090 -0.0050 -0.0052 -0.0044 8   ARG A CG  
83   N  N   . ASP A 10  ? 0.1475 0.1270 0.1198 0.0074  -0.0145 0.0033  9   ASP A N   
84   C  CA  . ASP A 10  ? 0.1586 0.1428 0.1140 0.0208  -0.0236 0.0073  9   ASP A CA  
85   C  C   . ASP A 10  ? 0.1823 0.1341 0.1229 0.0116  -0.0213 -0.0059 9   ASP A C   
86   O  O   . ASP A 10  ? 0.2004 0.1435 0.1258 0.0128  -0.0384 -0.0195 9   ASP A O   
87   C  CB  . ASP A 10  ? 0.1820 0.1587 0.1384 0.0394  -0.0185 0.0090  9   ASP A CB  
88   C  CG  . ASP A 10  ? 0.2094 0.2495 0.1569 0.0403  -0.0040 0.0114  9   ASP A CG  
89   O  OD1 . ASP A 10  ? 0.2413 0.3015 0.1825 0.0740  0.0290  0.0686  9   ASP A OD1 
90   O  OD2 . ASP A 10  ? 0.2155 0.2917 0.1772 0.0885  0.0183  0.0357  9   ASP A OD2 
91   N  N   A LEU A 11  ? 0.1852 0.1251 0.1325 0.0043  -0.0165 -0.0021 10  LEU A N   
92   N  N   B LEU A 11  ? 0.1851 0.1323 0.1332 0.0031  -0.0187 -0.0011 10  LEU A N   
93   C  CA  A LEU A 11  ? 0.1897 0.1220 0.1359 -0.0062 -0.0141 -0.0089 10  LEU A CA  
94   C  CA  B LEU A 11  ? 0.1900 0.1330 0.1384 -0.0074 -0.0154 -0.0049 10  LEU A CA  
95   C  C   A LEU A 11  ? 0.1840 0.1113 0.1248 -0.0217 -0.0169 -0.0067 10  LEU A C   
96   C  C   B LEU A 11  ? 0.1771 0.1197 0.1216 -0.0219 -0.0188 -0.0059 10  LEU A C   
97   O  O   A LEU A 11  ? 0.1941 0.1198 0.1258 -0.0338 -0.0179 0.0025  10  LEU A O   
98   O  O   B LEU A 11  ? 0.1981 0.1325 0.1239 -0.0347 -0.0283 0.0001  10  LEU A O   
99   C  CB  A LEU A 11  ? 0.1965 0.1311 0.1504 -0.0068 -0.0040 -0.0052 10  LEU A CB  
100  C  CB  B LEU A 11  ? 0.1878 0.1450 0.1468 -0.0072 -0.0156 -0.0015 10  LEU A CB  
101  C  CG  A LEU A 11  ? 0.1939 0.1489 0.1632 0.0082  -0.0029 -0.0114 10  LEU A CG  
102  C  CG  B LEU A 11  ? 0.2070 0.1646 0.1836 -0.0055 -0.0083 0.0097  10  LEU A CG  
103  C  CD1 A LEU A 11  ? 0.2012 0.1321 0.1551 0.0386  -0.0089 0.0362  10  LEU A CD1 
104  C  CD1 B LEU A 11  ? 0.2124 0.1762 0.1925 -0.0004 0.0059  -0.0174 10  LEU A CD1 
105  C  CD2 A LEU A 11  ? 0.1867 0.1695 0.2104 0.0157  -0.0218 -0.0197 10  LEU A CD2 
106  C  CD2 B LEU A 11  ? 0.2211 0.2119 0.2021 -0.0052 0.0004  0.0000  10  LEU A CD2 
107  N  N   . VAL A 12  ? 0.1718 0.1114 0.1091 -0.0330 -0.0108 -0.0098 11  VAL A N   
108  C  CA  . VAL A 12  ? 0.1593 0.1340 0.1144 -0.0425 -0.0016 -0.0155 11  VAL A CA  
109  C  C   . VAL A 12  ? 0.1461 0.1348 0.1135 -0.0326 -0.0028 -0.0162 11  VAL A C   
110  O  O   . VAL A 12  ? 0.1424 0.1681 0.1066 -0.0401 0.0007  -0.0239 11  VAL A O   
111  C  CB  . VAL A 12  ? 0.1420 0.1426 0.1117 -0.0367 0.0070  -0.0204 11  VAL A CB  
112  C  CG1 . VAL A 12  ? 0.1459 0.1722 0.1390 -0.0221 -0.0221 -0.0213 11  VAL A CG1 
113  C  CG2 . VAL A 12  ? 0.1690 0.1602 0.1132 -0.0469 0.0019  -0.0158 11  VAL A CG2 
114  N  N   . LEU A 13  ? 0.1296 0.1366 0.0853 -0.0372 -0.0186 -0.0074 12  LEU A N   
115  C  CA  . LEU A 13  ? 0.1455 0.1377 0.1056 -0.0233 -0.0153 -0.0024 12  LEU A CA  
116  C  C   . LEU A 13  ? 0.1232 0.1494 0.1146 -0.0375 -0.0082 -0.0033 12  LEU A C   
117  O  O   . LEU A 13  ? 0.1248 0.1729 0.1180 -0.0297 -0.0175 -0.0087 12  LEU A O   
118  C  CB  . LEU A 13  ? 0.1621 0.1689 0.1208 -0.0285 -0.0190 0.0031  12  LEU A CB  
119  C  CG  . LEU A 13  ? 0.1734 0.1723 0.1798 -0.0102 -0.0102 -0.0045 12  LEU A CG  
120  C  CD1 . LEU A 13  ? 0.2164 0.1991 0.1919 -0.0376 0.0132  -0.0050 12  LEU A CD1 
121  C  CD2 . LEU A 13  ? 0.1928 0.1700 0.2554 0.0033  -0.0193 -0.0087 12  LEU A CD2 
122  N  N   . GLU A 14  ? 0.1341 0.1566 0.1066 -0.0377 -0.0075 -0.0160 13  GLU A N   
123  C  CA  . GLU A 14  ? 0.1421 0.1565 0.1096 -0.0344 -0.0072 -0.0179 13  GLU A CA  
124  C  C   . GLU A 14  ? 0.1532 0.1756 0.1234 -0.0474 0.0074  -0.0177 13  GLU A C   
125  O  O   . GLU A 14  ? 0.1506 0.1930 0.1417 -0.0546 -0.0114 -0.0397 13  GLU A O   
126  C  CB  . GLU A 14  ? 0.1711 0.1593 0.1193 -0.0377 -0.0094 -0.0118 13  GLU A CB  
127  C  CG  . GLU A 14  ? 0.1651 0.1537 0.1252 -0.0142 -0.0314 -0.0161 13  GLU A CG  
128  C  CD  . GLU A 14  ? 0.2049 0.2401 0.1971 -0.0144 -0.0378 0.0225  13  GLU A CD  
129  O  OE1 . GLU A 14  ? 0.1937 0.1781 0.2102 -0.0054 -0.0254 0.0257  13  GLU A OE1 
130  O  OE2 . GLU A 14  ? 0.2124 0.1959 0.1755 0.0357  -0.0382 0.0217  13  GLU A OE2 
131  N  N   . PHE A 15  ? 0.1480 0.1689 0.1064 -0.0571 -0.0040 -0.0218 14  PHE A N   
132  C  CA  . PHE A 15  ? 0.1500 0.1580 0.1104 -0.0621 0.0100  -0.0202 14  PHE A CA  
133  C  C   . PHE A 15  ? 0.1566 0.1817 0.1007 -0.0592 0.0224  -0.0224 14  PHE A C   
134  O  O   . PHE A 15  ? 0.1555 0.2032 0.1223 -0.0745 0.0211  -0.0415 14  PHE A O   
135  C  CB  . PHE A 15  ? 0.1633 0.1689 0.1223 -0.0538 0.0079  -0.0167 14  PHE A CB  
136  C  CG  . PHE A 15  ? 0.1627 0.1621 0.0992 -0.0426 0.0285  -0.0093 14  PHE A CG  
137  C  CD1 . PHE A 15  ? 0.1800 0.1672 0.1356 -0.0438 0.0407  -0.0306 14  PHE A CD1 
138  C  CD2 . PHE A 15  ? 0.1835 0.1433 0.1300 -0.0394 0.0031  -0.0258 14  PHE A CD2 
139  C  CE1 . PHE A 15  ? 0.1780 0.1580 0.1349 -0.0445 0.0299  -0.0078 14  PHE A CE1 
140  C  CE2 . PHE A 15  ? 0.2115 0.1797 0.1508 -0.0266 0.0298  -0.0046 14  PHE A CE2 
141  C  CZ  . PHE A 15  ? 0.1871 0.1654 0.1393 -0.0308 0.0370  0.0113  14  PHE A CZ  
142  N  N   . ILE A 16  ? 0.1404 0.1766 0.0941 -0.0496 0.0215  -0.0250 15  ILE A N   
143  C  CA  . ILE A 16  ? 0.1447 0.2045 0.1169 -0.0447 0.0113  -0.0205 15  ILE A CA  
144  C  C   . ILE A 16  ? 0.1276 0.2276 0.1128 -0.0382 0.0185  -0.0282 15  ILE A C   
145  O  O   . ILE A 16  ? 0.1378 0.2641 0.0826 -0.0591 0.0045  -0.0433 15  ILE A O   
146  C  CB  . ILE A 16  ? 0.1415 0.1956 0.1156 -0.0342 0.0181  -0.0219 15  ILE A CB  
147  C  CG1 . ILE A 16  ? 0.1633 0.2056 0.1228 -0.0238 -0.0020 -0.0325 15  ILE A CG1 
148  C  CG2 . ILE A 16  ? 0.1529 0.2082 0.1855 -0.0292 -0.0158 -0.0046 15  ILE A CG2 
149  C  CD1 . ILE A 16  ? 0.1885 0.2200 0.1289 -0.0165 0.0136  -0.0403 15  ILE A CD1 
150  N  N   . HIS A 17  ? 0.1187 0.2223 0.0993 -0.0533 0.0065  -0.0305 16  HIS A N   
151  C  CA  . HIS A 17  ? 0.1237 0.2289 0.1112 -0.0470 0.0195  -0.0134 16  HIS A CA  
152  C  C   . HIS A 17  ? 0.1121 0.2490 0.1114 -0.0463 0.0150  -0.0234 16  HIS A C   
153  O  O   . HIS A 17  ? 0.1230 0.2897 0.1009 -0.0546 0.0047  -0.0342 16  HIS A O   
154  C  CB  . HIS A 17  ? 0.1430 0.2398 0.1106 -0.0321 0.0184  -0.0290 16  HIS A CB  
155  C  CG  . HIS A 17  ? 0.1075 0.2380 0.1186 -0.0298 0.0182  -0.0178 16  HIS A CG  
156  N  ND1 . HIS A 17  ? 0.1959 0.2793 0.1383 -0.0346 0.0213  -0.0111 16  HIS A ND1 
157  C  CD2 . HIS A 17  ? 0.1223 0.2372 0.1169 -0.0348 0.0129  -0.0033 16  HIS A CD2 
158  C  CE1 . HIS A 17  ? 0.1451 0.2694 0.1102 -0.0142 0.0073  -0.0186 16  HIS A CE1 
159  N  NE2 . HIS A 17  ? 0.1422 0.2621 0.0991 -0.0547 0.0160  -0.0053 16  HIS A NE2 
160  N  N   . ALA A 18  ? 0.1183 0.2292 0.1117 -0.0477 0.0121  -0.0462 17  ALA A N   
161  C  CA  . ALA A 18  ? 0.1330 0.2311 0.1296 -0.0486 0.0136  -0.0576 17  ALA A CA  
162  C  C   . ALA A 18  ? 0.1308 0.2422 0.1290 -0.0538 0.0200  -0.0538 17  ALA A C   
163  O  O   . ALA A 18  ? 0.1221 0.2727 0.1219 -0.0636 0.0152  -0.0872 17  ALA A O   
164  C  CB  . ALA A 18  ? 0.1371 0.2040 0.1411 -0.0602 0.0185  -0.0655 17  ALA A CB  
165  N  N   . LEU A 19  ? 0.1158 0.2218 0.1249 -0.0523 0.0106  -0.0598 18  LEU A N   
166  C  CA  . LEU A 19  ? 0.1296 0.2199 0.1181 -0.0462 0.0065  -0.0541 18  LEU A CA  
167  C  C   . LEU A 19  ? 0.1481 0.2418 0.1122 -0.0421 0.0176  -0.0549 18  LEU A C   
168  O  O   . LEU A 19  ? 0.1138 0.2788 0.0947 -0.0332 0.0041  -0.0699 18  LEU A O   
169  C  CB  . LEU A 19  ? 0.1381 0.2148 0.1219 -0.0385 0.0187  -0.0499 18  LEU A CB  
170  C  CG  . LEU A 19  ? 0.1580 0.1804 0.1225 -0.0386 0.0223  -0.0447 18  LEU A CG  
171  C  CD1 . LEU A 19  ? 0.1749 0.2201 0.1040 -0.0182 0.0339  -0.0494 18  LEU A CD1 
172  C  CD2 . LEU A 19  ? 0.1673 0.1902 0.1767 -0.0486 0.0272  -0.0283 18  LEU A CD2 
173  N  N   . ASN A 20  ? 0.1467 0.2472 0.1203 -0.0461 0.0105  -0.0425 19  ASN A N   
174  C  CA  . ASN A 20  ? 0.1628 0.2434 0.1158 -0.0351 0.0123  -0.0448 19  ASN A CA  
175  C  C   . ASN A 20  ? 0.1724 0.2701 0.1235 -0.0340 0.0012  -0.0336 19  ASN A C   
176  O  O   . ASN A 20  ? 0.1923 0.3173 0.1389 -0.0251 -0.0119 -0.0414 19  ASN A O   
177  C  CB  . ASN A 20  ? 0.1594 0.2551 0.1349 -0.0372 0.0056  -0.0298 19  ASN A CB  
178  C  CG  . ASN A 20  ? 0.1356 0.2625 0.1282 -0.0280 -0.0011 -0.0376 19  ASN A CG  
179  O  OD1 . ASN A 20  ? 0.1598 0.2967 0.1753 -0.0433 0.0255  -0.0573 19  ASN A OD1 
180  N  ND2 . ASN A 20  ? 0.1613 0.2543 0.1440 -0.0617 0.0261  -0.0017 19  ASN A ND2 
181  N  N   . THR A 21  ? 0.1436 0.2696 0.1049 -0.0416 0.0166  -0.0533 20  THR A N   
182  C  CA  . THR A 21  ? 0.1609 0.2664 0.1211 -0.0300 0.0161  -0.0579 20  THR A CA  
183  C  C   . THR A 21  ? 0.1661 0.2694 0.1306 -0.0422 0.0097  -0.0506 20  THR A C   
184  O  O   . THR A 21  ? 0.1506 0.2736 0.1242 -0.0316 0.0104  -0.0800 20  THR A O   
185  C  CB  . THR A 21  ? 0.1582 0.2776 0.1408 -0.0304 0.0214  -0.0486 20  THR A CB  
186  O  OG1 . THR A 21  ? 0.1341 0.3108 0.1298 -0.0208 0.0244  -0.0707 20  THR A OG1 
187  C  CG2 . THR A 21  ? 0.1784 0.2797 0.1384 -0.0423 0.0347  -0.0535 20  THR A CG2 
188  N  N   . GLU A 22  ? 0.1570 0.2608 0.1189 -0.0415 0.0040  -0.0630 21  GLU A N   
189  C  CA  . GLU A 22  ? 0.1651 0.2541 0.1453 -0.0335 0.0009  -0.0518 21  GLU A CA  
190  C  C   . GLU A 22  ? 0.1594 0.2503 0.1733 -0.0419 0.0056  -0.0561 21  GLU A C   
191  O  O   . GLU A 22  ? 0.1847 0.2555 0.2093 -0.0463 -0.0024 -0.1143 21  GLU A O   
192  C  CB  . GLU A 22  ? 0.1558 0.2494 0.1384 -0.0417 0.0013  -0.0408 21  GLU A CB  
193  C  CG  . GLU A 22  ? 0.1484 0.2603 0.1658 -0.0396 -0.0047 -0.0268 21  GLU A CG  
194  C  CD  . GLU A 22  ? 0.1213 0.1969 0.1256 -0.0559 -0.0313 -0.0791 21  GLU A CD  
195  O  OE1 . GLU A 22  ? 0.2755 0.3564 0.2890 -0.0061 0.0624  -0.0198 21  GLU A OE1 
196  O  OE2 . GLU A 22  ? 0.1679 0.2799 0.1720 -0.0544 -0.0284 -0.0290 21  GLU A OE2 
197  N  N   . ASN A 23  ? 0.1821 0.2741 0.1591 -0.0342 -0.0006 -0.0643 22  ASN A N   
198  C  CA  . ASN A 23  ? 0.1724 0.2515 0.1715 -0.0399 -0.0006 -0.0602 22  ASN A CA  
199  C  C   . ASN A 23  ? 0.1781 0.2481 0.1910 -0.0306 0.0029  -0.0553 22  ASN A C   
200  O  O   . ASN A 23  ? 0.1611 0.2763 0.1774 -0.0265 0.0099  -0.0918 22  ASN A O   
201  C  CB  . ASN A 23  ? 0.1808 0.2722 0.1669 -0.0279 -0.0012 -0.0674 22  ASN A CB  
202  C  CG  . ASN A 23  ? 0.1653 0.2770 0.1906 -0.0092 0.0140  -0.0586 22  ASN A CG  
203  O  OD1 . ASN A 23  ? 0.2592 0.3059 0.2633 -0.0248 0.0283  -0.1162 22  ASN A OD1 
204  N  ND2 . ASN A 23  ? 0.1846 0.3634 0.2442 -0.0152 0.0379  -0.1145 22  ASN A ND2 
205  N  N   . PHE A 24  ? 0.1680 0.2274 0.2007 -0.0343 -0.0068 -0.0611 23  PHE A N   
206  C  CA  . PHE A 24  ? 0.1739 0.2196 0.2125 -0.0278 0.0023  -0.0439 23  PHE A CA  
207  C  C   . PHE A 24  ? 0.1850 0.2141 0.2296 -0.0134 0.0093  -0.0491 23  PHE A C   
208  O  O   . PHE A 24  ? 0.1840 0.2044 0.2249 -0.0187 0.0164  -0.0632 23  PHE A O   
209  C  CB  . PHE A 24  ? 0.1614 0.2041 0.1981 -0.0326 -0.0013 -0.0513 23  PHE A CB  
210  C  CG  . PHE A 24  ? 0.1601 0.2287 0.1945 -0.0277 -0.0065 -0.0382 23  PHE A CG  
211  C  CD1 . PHE A 24  ? 0.1418 0.2139 0.1709 -0.0205 -0.0112 -0.0359 23  PHE A CD1 
212  C  CD2 . PHE A 24  ? 0.1425 0.2395 0.1789 -0.0314 0.0005  -0.0269 23  PHE A CD2 
213  C  CE1 . PHE A 24  ? 0.1436 0.2159 0.1719 -0.0232 0.0168  -0.0333 23  PHE A CE1 
214  C  CE2 . PHE A 24  ? 0.1749 0.2360 0.1829 -0.0162 0.0187  -0.0301 23  PHE A CE2 
215  C  CZ  . PHE A 24  ? 0.1487 0.2170 0.1854 -0.0258 0.0159  -0.0072 23  PHE A CZ  
216  N  N   . PRO A 25  ? 0.2060 0.2231 0.2492 -0.0135 0.0054  -0.0549 24  PRO A N   
217  C  CA  . PRO A 25  ? 0.2215 0.2106 0.2557 -0.0089 0.0053  -0.0552 24  PRO A CA  
218  C  C   . PRO A 25  ? 0.2215 0.2151 0.2657 0.0094  0.0085  -0.0609 24  PRO A C   
219  O  O   . PRO A 25  ? 0.1899 0.2165 0.2944 0.0181  0.0111  -0.0727 24  PRO A O   
220  C  CB  . PRO A 25  ? 0.2428 0.2330 0.2727 0.0060  0.0024  -0.0554 24  PRO A CB  
221  C  CG  . PRO A 25  ? 0.2436 0.2403 0.2773 -0.0071 0.0043  -0.0495 24  PRO A CG  
222  C  CD  . PRO A 25  ? 0.2227 0.2236 0.2578 -0.0114 0.0031  -0.0506 24  PRO A CD  
223  N  N   . ALA A 26  ? 0.1957 0.2181 0.2582 0.0054  0.0074  -0.0727 25  ALA A N   
224  C  CA  . ALA A 26  ? 0.1980 0.2360 0.2573 -0.0048 0.0015  -0.0642 25  ALA A CA  
225  C  C   . ALA A 26  ? 0.1874 0.2185 0.2436 0.0008  0.0001  -0.0632 25  ALA A C   
226  O  O   . ALA A 26  ? 0.1508 0.2510 0.2462 0.0045  0.0098  -0.0655 25  ALA A O   
227  C  CB  . ALA A 26  ? 0.1982 0.2455 0.2575 0.0010  -0.0021 -0.0602 25  ALA A CB  
228  N  N   . ALA A 27  ? 0.1683 0.2112 0.2155 -0.0181 0.0067  -0.0684 26  ALA A N   
229  C  CA  . ALA A 27  ? 0.1592 0.1871 0.2006 -0.0206 -0.0003 -0.0624 26  ALA A CA  
230  C  C   . ALA A 27  ? 0.1403 0.1709 0.1977 -0.0225 -0.0009 -0.0544 26  ALA A C   
231  O  O   . ALA A 27  ? 0.1507 0.1944 0.1941 -0.0118 0.0101  -0.0604 26  ALA A O   
232  C  CB  . ALA A 27  ? 0.1657 0.1759 0.1882 -0.0287 0.0030  -0.0577 26  ALA A CB  
233  N  N   A LYS A 28  ? 0.1473 0.1682 0.2040 -0.0138 0.0036  -0.0488 27  LYS A N   
234  N  N   B LYS A 28  ? 0.1530 0.1716 0.2099 -0.0130 0.0027  -0.0471 27  LYS A N   
235  C  CA  A LYS A 28  ? 0.1611 0.1649 0.2111 -0.0096 -0.0029 -0.0411 27  LYS A CA  
236  C  CA  B LYS A 28  ? 0.1678 0.1698 0.2145 -0.0085 -0.0032 -0.0398 27  LYS A CA  
237  C  C   A LYS A 28  ? 0.1731 0.1849 0.2216 -0.0038 0.0008  -0.0399 27  LYS A C   
238  C  C   B LYS A 28  ? 0.1773 0.1878 0.2252 -0.0032 0.0005  -0.0393 27  LYS A C   
239  O  O   A LYS A 28  ? 0.1637 0.1860 0.2269 -0.0032 -0.0024 -0.0421 27  LYS A O   
240  O  O   B LYS A 28  ? 0.1732 0.1873 0.2283 -0.0006 0.0001  -0.0398 27  LYS A O   
241  C  CB  A LYS A 28  ? 0.1613 0.1646 0.2062 -0.0094 0.0001  -0.0374 27  LYS A CB  
242  C  CB  B LYS A 28  ? 0.1689 0.1705 0.2212 -0.0117 -0.0056 -0.0373 27  LYS A CB  
243  C  CG  A LYS A 28  ? 0.1653 0.1548 0.2137 -0.0012 -0.0002 -0.0267 27  LYS A CG  
244  C  CG  B LYS A 28  ? 0.1839 0.1769 0.2237 -0.0017 -0.0053 -0.0182 27  LYS A CG  
245  C  CD  A LYS A 28  ? 0.1979 0.1798 0.2162 -0.0120 0.0106  0.0001  27  LYS A CD  
246  C  CD  B LYS A 28  ? 0.2006 0.1965 0.2162 -0.0082 -0.0121 -0.0103 27  LYS A CD  
247  C  CE  A LYS A 28  ? 0.2156 0.1964 0.2178 -0.0081 -0.0044 0.0008  27  LYS A CE  
248  C  CE  B LYS A 28  ? 0.2278 0.2225 0.2466 -0.0067 0.0047  -0.0101 27  LYS A CE  
249  N  NZ  A LYS A 28  ? 0.2671 0.2673 0.2933 0.0112  -0.0091 0.0004  27  LYS A NZ  
250  N  NZ  B LYS A 28  ? 0.2512 0.2306 0.2893 -0.0112 0.0177  -0.0188 27  LYS A NZ  
251  N  N   . LYS A 29  ? 0.1725 0.2047 0.2311 0.0034  -0.0012 -0.0493 28  LYS A N   
252  C  CA  . LYS A 29  ? 0.1875 0.2166 0.2412 0.0133  -0.0067 -0.0474 28  LYS A CA  
253  C  C   . LYS A 29  ? 0.1770 0.2210 0.2301 0.0111  0.0013  -0.0464 28  LYS A C   
254  O  O   . LYS A 29  ? 0.1730 0.2447 0.2583 0.0501  0.0030  -0.0708 28  LYS A O   
255  C  CB  . LYS A 29  ? 0.2155 0.2366 0.2501 0.0041  -0.0035 -0.0412 28  LYS A CB  
256  C  CG  . LYS A 29  ? 0.2751 0.2789 0.2988 0.0135  -0.0076 -0.0342 28  LYS A CG  
257  C  CD  . LYS A 29  ? 0.3149 0.3217 0.3208 0.0184  0.0156  -0.0208 28  LYS A CD  
258  N  N   . ARG A 30  ? 0.1436 0.2177 0.2205 0.0115  0.0146  -0.0610 29  ARG A N   
259  C  CA  . ARG A 30  ? 0.1362 0.2071 0.2034 0.0013  0.0111  -0.0523 29  ARG A CA  
260  C  C   . ARG A 30  ? 0.1304 0.1885 0.1995 -0.0088 0.0188  -0.0508 29  ARG A C   
261  O  O   . ARG A 30  ? 0.1158 0.2045 0.1931 -0.0063 0.0195  -0.0559 29  ARG A O   
262  C  CB  . ARG A 30  ? 0.1441 0.2281 0.2092 -0.0148 0.0129  -0.0486 29  ARG A CB  
263  C  CG  . ARG A 30  ? 0.2099 0.2292 0.2286 -0.0059 0.0158  -0.0214 29  ARG A CG  
264  C  CD  . ARG A 30  ? 0.2099 0.2455 0.2476 -0.0059 0.0277  -0.0243 29  ARG A CD  
265  N  NE  . ARG A 30  ? 0.1918 0.2030 0.2244 -0.0120 0.0248  -0.0404 29  ARG A NE  
266  C  CZ  . ARG A 30  ? 0.1931 0.2119 0.2295 -0.0201 0.0276  -0.0388 29  ARG A CZ  
267  N  NH1 . ARG A 30  ? 0.1941 0.2239 0.2759 -0.0209 0.0240  -0.0318 29  ARG A NH1 
268  N  NH2 . ARG A 30  ? 0.1943 0.2318 0.2387 -0.0138 0.0551  -0.0488 29  ARG A NH2 
269  N  N   . LEU A 31  ? 0.1259 0.1581 0.1892 0.0053  0.0173  -0.0445 30  LEU A N   
270  C  CA  . LEU A 31  ? 0.1236 0.1425 0.1927 0.0017  0.0090  -0.0317 30  LEU A CA  
271  C  C   . LEU A 31  ? 0.1280 0.1404 0.2024 0.0015  -0.0013 -0.0298 30  LEU A C   
272  O  O   . LEU A 31  ? 0.1609 0.1277 0.2399 0.0180  -0.0028 -0.0336 30  LEU A O   
273  C  CB  . LEU A 31  ? 0.1230 0.1330 0.1779 -0.0038 0.0135  -0.0349 30  LEU A CB  
274  C  CG  . LEU A 31  ? 0.1238 0.1420 0.1591 -0.0069 0.0417  -0.0132 30  LEU A CG  
275  C  CD1 . LEU A 31  ? 0.1295 0.1647 0.1639 -0.0126 0.0073  -0.0179 30  LEU A CD1 
276  C  CD2 . LEU A 31  ? 0.1470 0.1159 0.1523 0.0009  0.0179  -0.0310 30  LEU A CD2 
277  N  N   . ASN A 32  ? 0.1257 0.1339 0.2062 0.0163  0.0010  -0.0230 31  ASN A N   
278  C  CA  . ASN A 32  ? 0.1340 0.1347 0.2141 0.0158  -0.0005 -0.0144 31  ASN A CA  
279  C  C   . ASN A 32  ? 0.1368 0.1230 0.2178 0.0193  -0.0023 -0.0062 31  ASN A C   
280  O  O   . ASN A 32  ? 0.1094 0.1308 0.2299 0.0253  0.0043  -0.0104 31  ASN A O   
281  C  CB  . ASN A 32  ? 0.1324 0.1517 0.2139 0.0241  0.0048  -0.0110 31  ASN A CB  
282  C  CG  . ASN A 32  ? 0.1609 0.1756 0.2513 0.0123  -0.0051 0.0003  31  ASN A CG  
283  O  OD1 . ASN A 32  ? 0.1812 0.2139 0.2578 0.0184  -0.0076 0.0177  31  ASN A OD1 
284  N  ND2 . ASN A 32  ? 0.1604 0.2044 0.3027 0.0253  -0.0200 0.0181  31  ASN A ND2 
285  N  N   A GLU A 33  ? 0.1548 0.1392 0.2328 0.0176  -0.0045 -0.0014 32  GLU A N   
286  N  N   B GLU A 33  ? 0.1551 0.1352 0.2303 0.0165  -0.0053 -0.0050 32  GLU A N   
287  C  CA  A GLU A 33  ? 0.1600 0.1303 0.2269 0.0163  -0.0010 0.0044  32  GLU A CA  
288  C  CA  B GLU A 33  ? 0.1587 0.1317 0.2242 0.0154  -0.0039 -0.0001 32  GLU A CA  
289  C  C   A GLU A 33  ? 0.1510 0.1256 0.2284 0.0156  -0.0046 0.0113  32  GLU A C   
290  C  C   B GLU A 33  ? 0.1530 0.1271 0.2281 0.0165  -0.0052 0.0079  32  GLU A C   
291  O  O   A GLU A 33  ? 0.1641 0.1280 0.2522 0.0090  -0.0075 0.0204  32  GLU A O   
292  O  O   B GLU A 33  ? 0.1709 0.1414 0.2486 0.0127  -0.0046 0.0130  32  GLU A O   
293  C  CB  A GLU A 33  ? 0.1727 0.1453 0.2330 0.0157  -0.0023 0.0036  32  GLU A CB  
294  C  CB  B GLU A 33  ? 0.1654 0.1379 0.2310 0.0135  -0.0056 -0.0072 32  GLU A CB  
295  C  CG  A GLU A 33  ? 0.1939 0.1716 0.2342 0.0052  0.0042  0.0117  32  GLU A CG  
296  C  CG  B GLU A 33  ? 0.2058 0.1915 0.2277 0.0148  -0.0013 0.0020  32  GLU A CG  
297  C  CD  A GLU A 33  ? 0.2294 0.2095 0.2480 0.0151  0.0067  0.0114  32  GLU A CD  
298  C  CD  B GLU A 33  ? 0.2604 0.2344 0.2762 0.0075  -0.0047 0.0003  32  GLU A CD  
299  O  OE1 A GLU A 33  ? 0.3331 0.2868 0.2996 0.0175  -0.0183 0.0080  32  GLU A OE1 
300  O  OE1 B GLU A 33  ? 0.3016 0.1982 0.2956 0.0247  -0.0047 -0.0067 32  GLU A OE1 
301  O  OE2 A GLU A 33  ? 0.3185 0.2677 0.3121 0.0089  0.0005  0.0032  32  GLU A OE2 
302  O  OE2 B GLU A 33  ? 0.3192 0.2628 0.3120 0.0172  0.0016  0.0247  32  GLU A OE2 
303  N  N   . ASN A 34  ? 0.1597 0.1118 0.2281 0.0230  0.0056  0.0065  33  ASN A N   
304  C  CA  . ASN A 34  ? 0.1730 0.1294 0.2209 0.0123  0.0046  0.0143  33  ASN A CA  
305  C  C   . ASN A 34  ? 0.1589 0.1105 0.2023 0.0122  0.0055  0.0091  33  ASN A C   
306  O  O   . ASN A 34  ? 0.1855 0.1141 0.2123 0.0221  0.0003  0.0216  33  ASN A O   
307  C  CB  . ASN A 34  ? 0.2036 0.1396 0.2352 0.0158  0.0021  0.0127  33  ASN A CB  
308  C  CG  . ASN A 34  ? 0.2459 0.1743 0.2824 0.0219  -0.0133 0.0190  33  ASN A CG  
309  O  OD1 . ASN A 34  ? 0.3200 0.2467 0.3680 0.0423  -0.0163 0.0364  33  ASN A OD1 
310  N  ND2 . ASN A 34  ? 0.2683 0.1636 0.3236 0.0010  -0.0103 0.0712  33  ASN A ND2 
311  N  N   . PHE A 35  ? 0.1358 0.0885 0.1941 0.0130  0.0066  -0.0002 34  PHE A N   
312  C  CA  . PHE A 35  ? 0.1195 0.0901 0.1784 0.0135  0.0094  0.0054  34  PHE A CA  
313  C  C   . PHE A 35  ? 0.1146 0.1162 0.1646 0.0133  0.0055  0.0015  34  PHE A C   
314  O  O   . PHE A 35  ? 0.1345 0.1150 0.1809 0.0062  0.0155  -0.0079 34  PHE A O   
315  C  CB  . PHE A 35  ? 0.1227 0.1106 0.1801 0.0107  0.0028  -0.0054 34  PHE A CB  
316  C  CG  . PHE A 35  ? 0.1176 0.0933 0.1561 0.0098  0.0125  -0.0091 34  PHE A CG  
317  C  CD1 . PHE A 35  ? 0.0955 0.1057 0.1499 0.0192  0.0075  -0.0104 34  PHE A CD1 
318  C  CD2 . PHE A 35  ? 0.1271 0.1002 0.1733 0.0106  0.0117  -0.0154 34  PHE A CD2 
319  C  CE1 . PHE A 35  ? 0.1196 0.1001 0.1327 0.0089  0.0110  0.0017  34  PHE A CE1 
320  C  CE2 . PHE A 35  ? 0.1032 0.1273 0.1411 0.0000  -0.0119 -0.0114 34  PHE A CE2 
321  C  CZ  . PHE A 35  ? 0.1132 0.0941 0.1226 0.0228  -0.0050 -0.0164 34  PHE A CZ  
322  N  N   . THR A 36  ? 0.1111 0.1086 0.1485 0.0034  0.0026  0.0061  35  THR A N   
323  C  CA  . THR A 36  ? 0.1133 0.1130 0.1433 -0.0019 0.0156  0.0160  35  THR A CA  
324  C  C   . THR A 36  ? 0.1046 0.1035 0.1395 0.0062  0.0197  0.0042  35  THR A C   
325  O  O   . THR A 36  ? 0.0985 0.1097 0.1501 0.0050  0.0164  0.0077  35  THR A O   
326  C  CB  . THR A 36  ? 0.1427 0.1490 0.1491 0.0035  0.0161  0.0040  35  THR A CB  
327  O  OG1 . THR A 36  ? 0.1912 0.1671 0.1446 -0.0060 -0.0018 -0.0051 35  THR A OG1 
328  C  CG2 . THR A 36  ? 0.1994 0.1598 0.1389 0.0000  0.0003  0.0181  35  THR A CG2 
329  N  N   . PHE A 37  ? 0.0974 0.0901 0.1400 -0.0010 0.0140  0.0023  36  PHE A N   
330  C  CA  . PHE A 37  ? 0.0857 0.0887 0.1287 -0.0037 0.0155  0.0057  36  PHE A CA  
331  C  C   . PHE A 37  ? 0.0757 0.0970 0.1341 -0.0052 0.0114  0.0038  36  PHE A C   
332  O  O   . PHE A 37  ? 0.0893 0.0991 0.1523 -0.0009 0.0342  0.0052  36  PHE A O   
333  C  CB  . PHE A 37  ? 0.0947 0.0962 0.1575 0.0054  0.0175  -0.0088 36  PHE A CB  
334  C  CG  . PHE A 37  ? 0.0976 0.1129 0.1263 -0.0057 -0.0046 -0.0025 36  PHE A CG  
335  C  CD1 . PHE A 37  ? 0.1146 0.1207 0.1439 0.0048  0.0248  0.0003  36  PHE A CD1 
336  C  CD2 . PHE A 37  ? 0.1217 0.1402 0.1621 -0.0271 0.0000  -0.0016 36  PHE A CD2 
337  C  CE1 . PHE A 37  ? 0.1621 0.1288 0.1247 -0.0005 0.0005  0.0043  36  PHE A CE1 
338  C  CE2 . PHE A 37  ? 0.1254 0.1489 0.1836 0.0015  -0.0057 0.0000  36  PHE A CE2 
339  C  CZ  . PHE A 37  ? 0.1569 0.1244 0.1349 -0.0033 -0.0248 -0.0128 36  PHE A CZ  
340  N  N   . ASN A 38  ? 0.0783 0.1083 0.1259 -0.0014 0.0246  0.0010  37  ASN A N   
341  C  CA  . ASN A 38  ? 0.0903 0.1168 0.1452 -0.0001 0.0192  0.0009  37  ASN A CA  
342  C  C   . ASN A 38  ? 0.0840 0.1027 0.1491 0.0097  0.0129  -0.0077 37  ASN A C   
343  O  O   . ASN A 38  ? 0.0764 0.1203 0.1770 -0.0033 0.0073  0.0183  37  ASN A O   
344  C  CB  . ASN A 38  ? 0.1154 0.1323 0.1489 0.0154  0.0194  -0.0052 37  ASN A CB  
345  C  CG  . ASN A 38  ? 0.1477 0.1741 0.1809 -0.0026 0.0337  -0.0020 37  ASN A CG  
346  O  OD1 . ASN A 38  ? 0.2045 0.3133 0.2265 0.0076  0.0681  0.0347  37  ASN A OD1 
347  N  ND2 . ASN A 38  ? 0.1706 0.1715 0.1546 0.0183  0.0224  0.0156  37  ASN A ND2 
348  N  N   . GLY A 39  ? 0.0803 0.1040 0.1723 -0.0073 0.0124  0.0022  38  GLY A N   
349  C  CA  . GLY A 39  ? 0.0767 0.1346 0.1622 -0.0028 0.0071  0.0032  38  GLY A CA  
350  C  C   . GLY A 39  ? 0.0933 0.1358 0.1750 0.0095  0.0052  0.0092  38  GLY A C   
351  O  O   . GLY A 39  ? 0.0976 0.1688 0.1837 0.0171  0.0111  -0.0028 38  GLY A O   
352  N  N   . PRO A 40  ? 0.0849 0.1420 0.1839 0.0153  0.0043  0.0049  39  PRO A N   
353  C  CA  . PRO A 40  ? 0.1143 0.1694 0.2021 0.0153  0.0155  0.0013  39  PRO A CA  
354  C  C   . PRO A 40  ? 0.1108 0.1813 0.2066 0.0105  0.0136  0.0014  39  PRO A C   
355  O  O   . PRO A 40  ? 0.1179 0.2141 0.2400 0.0416  0.0253  0.0002  39  PRO A O   
356  C  CB  . PRO A 40  ? 0.1507 0.1585 0.2254 0.0214  0.0071  0.0057  39  PRO A CB  
357  C  CG  . PRO A 40  ? 0.1377 0.1545 0.2061 0.0201  -0.0028 0.0084  39  PRO A CG  
358  C  CD  . PRO A 40  ? 0.0929 0.1405 0.1807 0.0143  -0.0101 0.0016  39  PRO A CD  
359  N  N   . MSE A 41  ? 0.0945 0.1821 0.2010 0.0043  0.0273  0.0070  40  MSE A N   
360  C  CA  . MSE A 41  ? 0.0970 0.1921 0.2252 -0.0073 0.0148  0.0041  40  MSE A CA  
361  C  C   . MSE A 41  ? 0.1225 0.1998 0.2345 -0.0161 0.0048  0.0062  40  MSE A C   
362  O  O   . MSE A 41  ? 0.1433 0.2122 0.2489 -0.0411 0.0027  0.0124  40  MSE A O   
363  C  CB  . MSE A 41  ? 0.1128 0.1816 0.2315 -0.0180 0.0091  0.0017  40  MSE A CB  
364  C  CG  . MSE A 41  ? 0.1369 0.1900 0.2277 0.0043  0.0105  -0.0107 40  MSE A CG  
365  SE SE  . MSE A 41  ? 0.1567 0.2415 0.2854 -0.0219 -0.0086 0.0207  40  MSE A SE  
366  C  CE  . MSE A 41  ? 0.1305 0.2013 0.2948 0.0014  -0.0012 0.0206  40  MSE A CE  
367  N  N   . GLY A 42  ? 0.1340 0.1886 0.2338 -0.0094 0.0011  0.0152  41  GLY A N   
368  C  CA  . GLY A 42  ? 0.1314 0.2058 0.2437 0.0014  0.0066  0.0143  41  GLY A CA  
369  C  C   . GLY A 42  ? 0.1078 0.1910 0.2238 -0.0047 -0.0004 0.0157  41  GLY A C   
370  O  O   . GLY A 42  ? 0.1077 0.2198 0.2384 -0.0082 0.0217  0.0668  41  GLY A O   
371  N  N   . HIS A 43  ? 0.0865 0.1705 0.2418 -0.0213 0.0251  0.0002  42  HIS A N   
372  C  CA  . HIS A 43  ? 0.1030 0.1331 0.2131 -0.0159 0.0149  -0.0107 42  HIS A CA  
373  C  C   . HIS A 43  ? 0.1127 0.1145 0.1995 -0.0126 0.0232  -0.0066 42  HIS A C   
374  O  O   . HIS A 43  ? 0.1147 0.1379 0.2556 -0.0222 0.0229  -0.0314 42  HIS A O   
375  C  CB  . HIS A 43  ? 0.1129 0.1546 0.2143 -0.0089 0.0375  -0.0174 42  HIS A CB  
376  C  CG  . HIS A 43  ? 0.1789 0.1440 0.1804 -0.0204 0.0255  -0.0086 42  HIS A CG  
377  N  ND1 . HIS A 43  ? 0.1660 0.1402 0.1794 0.0062  0.0334  0.0286  42  HIS A ND1 
378  C  CD2 . HIS A 43  ? 0.2372 0.1621 0.2059 -0.0357 0.0399  0.0090  42  HIS A CD2 
379  C  CE1 . HIS A 43  ? 0.1998 0.1508 0.1860 -0.0054 0.0513  0.0115  42  HIS A CE1 
380  N  NE2 . HIS A 43  ? 0.2579 0.1443 0.1913 -0.0156 0.0513  0.0141  42  HIS A NE2 
381  N  N   . ARG A 44  ? 0.1168 0.0991 0.1728 -0.0108 0.0211  -0.0116 43  ARG A N   
382  C  CA  . ARG A 44  ? 0.1298 0.1066 0.1795 -0.0121 0.0119  -0.0145 43  ARG A CA  
383  C  C   . ARG A 44  ? 0.1385 0.1181 0.1720 -0.0080 0.0122  -0.0146 43  ARG A C   
384  O  O   . ARG A 44  ? 0.1363 0.1017 0.1830 0.0045  0.0109  -0.0075 43  ARG A O   
385  C  CB  . ARG A 44  ? 0.1382 0.1308 0.1852 -0.0149 0.0054  -0.0232 43  ARG A CB  
386  C  CG  . ARG A 44  ? 0.1993 0.2009 0.2289 0.0019  0.0089  -0.0045 43  ARG A CG  
387  C  CD  . ARG A 44  ? 0.2120 0.2328 0.2260 -0.0188 0.0067  0.0052  43  ARG A CD  
388  N  NE  . ARG A 44  ? 0.2221 0.2972 0.2853 -0.0266 -0.0230 0.0144  43  ARG A NE  
389  N  N   A GLU A 45  ? 0.1498 0.1230 0.1783 -0.0044 0.0128  -0.0098 44  GLU A N   
390  N  N   B GLU A 45  ? 0.1511 0.1269 0.1804 -0.0019 0.0112  -0.0094 44  GLU A N   
391  C  CA  A GLU A 45  ? 0.1781 0.1413 0.1905 -0.0066 0.0088  -0.0022 44  GLU A CA  
392  C  CA  B GLU A 45  ? 0.1837 0.1466 0.1956 -0.0032 0.0047  -0.0032 44  GLU A CA  
393  C  C   A GLU A 45  ? 0.1688 0.1367 0.1900 0.0005  0.0084  0.0009  44  GLU A C   
394  C  C   B GLU A 45  ? 0.1696 0.1414 0.1922 0.0019  0.0070  0.0001  44  GLU A C   
395  O  O   A GLU A 45  ? 0.1702 0.1327 0.1883 -0.0028 0.0089  -0.0055 44  GLU A O   
396  O  O   B GLU A 45  ? 0.1606 0.1415 0.1888 -0.0061 0.0074  -0.0068 44  GLU A O   
397  C  CB  A GLU A 45  ? 0.1916 0.1686 0.1982 -0.0092 0.0077  -0.0024 44  GLU A CB  
398  C  CB  B GLU A 45  ? 0.2036 0.1759 0.2032 0.0032  -0.0015 0.0014  44  GLU A CB  
399  C  CG  A GLU A 45  ? 0.2198 0.1964 0.2469 -0.0018 0.0041  0.0029  44  GLU A CG  
400  C  CG  B GLU A 45  ? 0.2545 0.2163 0.2622 0.0074  0.0028  0.0019  44  GLU A CG  
401  C  CD  A GLU A 45  ? 0.2401 0.2329 0.2556 -0.0053 -0.0178 -0.0036 44  GLU A CD  
402  C  CD  B GLU A 45  ? 0.2713 0.2617 0.2978 -0.0003 0.0009  0.0000  44  GLU A CD  
403  O  OE1 A GLU A 45  ? 0.1944 0.2190 0.2740 -0.0066 -0.0061 0.0178  44  GLU A OE1 
404  O  OE1 B GLU A 45  ? 0.3059 0.2868 0.2713 -0.0027 0.0089  0.0014  44  GLU A OE1 
405  O  OE2 A GLU A 45  ? 0.2866 0.2380 0.2785 0.0102  -0.0070 0.0188  44  GLU A OE2 
406  O  OE2 B GLU A 45  ? 0.3042 0.2841 0.3011 -0.0033 0.0265  0.0023  44  GLU A OE2 
407  N  N   . GLY A 46  ? 0.1677 0.1344 0.2010 -0.0066 0.0065  0.0069  45  GLY A N   
408  C  CA  . GLY A 46  ? 0.1560 0.1541 0.2003 0.0011  0.0015  0.0121  45  GLY A CA  
409  C  C   . GLY A 46  ? 0.1403 0.1628 0.2069 0.0018  0.0013  0.0194  45  GLY A C   
410  O  O   . GLY A 46  ? 0.1388 0.1484 0.2245 -0.0017 -0.0140 0.0222  45  GLY A O   
411  N  N   . SER A 47  ? 0.1394 0.1610 0.2140 0.0013  0.0017  0.0029  46  SER A N   
412  C  CA  . SER A 47  ? 0.1396 0.1627 0.2132 -0.0049 0.0022  0.0033  46  SER A CA  
413  C  C   . SER A 47  ? 0.1539 0.1537 0.2263 0.0003  -0.0014 0.0023  46  SER A C   
414  O  O   . SER A 47  ? 0.1367 0.1748 0.2218 0.0023  -0.0033 0.0044  46  SER A O   
415  C  CB  . SER A 47  ? 0.1525 0.1591 0.2111 -0.0021 0.0085  -0.0059 46  SER A CB  
416  O  OG  . SER A 47  ? 0.1789 0.1601 0.2593 0.0013  0.0094  -0.0044 46  SER A OG  
417  N  N   . GLU A 48  ? 0.1775 0.1808 0.2412 -0.0035 -0.0061 0.0028  47  GLU A N   
418  C  CA  . GLU A 48  ? 0.2024 0.1759 0.2484 -0.0121 -0.0065 -0.0041 47  GLU A CA  
419  C  C   . GLU A 48  ? 0.1842 0.1653 0.2245 -0.0222 -0.0046 -0.0035 47  GLU A C   
420  O  O   . GLU A 48  ? 0.1760 0.1720 0.2457 -0.0401 -0.0066 -0.0091 47  GLU A O   
421  C  CB  . GLU A 48  ? 0.2085 0.1932 0.2595 -0.0053 -0.0084 -0.0006 47  GLU A CB  
422  C  CG  . GLU A 48  ? 0.2651 0.2006 0.2900 -0.0119 -0.0183 -0.0222 47  GLU A CG  
423  N  N   . ARG A 49  ? 0.1876 0.1791 0.2194 -0.0257 -0.0069 0.0062  48  ARG A N   
424  C  CA  . ARG A 49  ? 0.1854 0.2037 0.2155 -0.0203 0.0004  -0.0018 48  ARG A CA  
425  C  C   . ARG A 49  ? 0.1512 0.1810 0.2009 -0.0175 -0.0006 -0.0065 48  ARG A C   
426  O  O   . ARG A 49  ? 0.1432 0.1794 0.2101 -0.0164 -0.0187 -0.0091 48  ARG A O   
427  C  CB  . ARG A 49  ? 0.2057 0.2192 0.2269 -0.0224 0.0049  0.0050  48  ARG A CB  
428  C  CG  . ARG A 49  ? 0.2453 0.2830 0.2850 -0.0049 0.0230  0.0013  48  ARG A CG  
429  C  CD  . ARG A 49  ? 0.3235 0.3507 0.3467 -0.0049 0.0020  -0.0106 48  ARG A CD  
430  N  NE  . ARG A 49  ? 0.3366 0.3796 0.3970 0.0080  0.0068  0.0062  48  ARG A NE  
431  C  CZ  . ARG A 49  ? 0.3730 0.3978 0.3991 0.0000  0.0147  0.0070  48  ARG A CZ  
432  N  NH1 . ARG A 49  ? 0.3568 0.3939 0.3949 0.0158  0.0217  0.0035  48  ARG A NH1 
433  N  NH2 . ARG A 49  ? 0.3651 0.3930 0.4149 -0.0160 0.0202  0.0093  48  ARG A NH2 
434  N  N   A TYR A 50  ? 0.1338 0.1639 0.1874 -0.0114 0.0010  -0.0094 49  TYR A N   
435  N  N   B TYR A 50  ? 0.1410 0.1719 0.1954 -0.0115 0.0001  -0.0093 49  TYR A N   
436  C  CA  A TYR A 50  ? 0.1184 0.1511 0.1711 -0.0076 0.0046  -0.0101 49  TYR A CA  
437  C  CA  B TYR A 50  ? 0.1322 0.1628 0.1847 -0.0071 0.0036  -0.0080 49  TYR A CA  
438  C  C   A TYR A 50  ? 0.1102 0.1520 0.1720 -0.0125 0.0112  -0.0105 49  TYR A C   
439  C  C   B TYR A 50  ? 0.1186 0.1587 0.1803 -0.0126 0.0102  -0.0099 49  TYR A C   
440  O  O   A TYR A 50  ? 0.1121 0.1646 0.1803 -0.0136 0.0046  -0.0238 49  TYR A O   
441  O  O   B TYR A 50  ? 0.1247 0.1702 0.1836 -0.0161 0.0048  -0.0213 49  TYR A O   
442  C  CB  A TYR A 50  ? 0.1173 0.1462 0.1584 -0.0028 -0.0014 -0.0088 49  TYR A CB  
443  C  CB  B TYR A 50  ? 0.1337 0.1624 0.1810 -0.0044 -0.0026 -0.0062 49  TYR A CB  
444  C  CG  A TYR A 50  ? 0.1034 0.1422 0.1304 -0.0145 0.0051  -0.0099 49  TYR A CG  
445  C  CG  B TYR A 50  ? 0.1610 0.1762 0.1880 -0.0109 -0.0020 -0.0027 49  TYR A CG  
446  C  CD1 A TYR A 50  ? 0.1195 0.1382 0.1098 0.0020  -0.0056 -0.0071 49  TYR A CD1 
447  C  CD1 B TYR A 50  ? 0.1745 0.1850 0.1866 -0.0047 -0.0019 -0.0102 49  TYR A CD1 
448  C  CD2 A TYR A 50  ? 0.1097 0.1270 0.0826 -0.0003 0.0189  -0.0045 49  TYR A CD2 
449  C  CD2 B TYR A 50  ? 0.1774 0.2004 0.2286 -0.0143 0.0173  -0.0031 49  TYR A CD2 
450  C  CE1 A TYR A 50  ? 0.0795 0.1136 0.1298 -0.0192 0.0047  -0.0269 49  TYR A CE1 
451  C  CE1 B TYR A 50  ? 0.2113 0.2025 0.2179 -0.0040 -0.0035 -0.0017 49  TYR A CE1 
452  C  CE2 A TYR A 50  ? 0.1057 0.1259 0.0873 -0.0312 0.0155  0.0002  49  TYR A CE2 
453  C  CE2 B TYR A 50  ? 0.2115 0.2099 0.2357 -0.0110 0.0113  0.0081  49  TYR A CE2 
454  C  CZ  A TYR A 50  ? 0.1217 0.1316 0.1062 -0.0166 -0.0029 -0.0005 49  TYR A CZ  
455  C  CZ  B TYR A 50  ? 0.1992 0.2120 0.2166 -0.0123 -0.0009 0.0052  49  TYR A CZ  
456  O  OH  A TYR A 50  ? 0.1466 0.1308 0.1018 -0.0345 0.0232  -0.0191 49  TYR A OH  
457  O  OH  B TYR A 50  ? 0.2583 0.2385 0.2593 -0.0105 -0.0089 0.0013  49  TYR A OH  
458  N  N   . MSE A 51  ? 0.1191 0.1514 0.1775 -0.0144 0.0175  -0.0070 50  MSE A N   
459  C  CA  . MSE A 51  ? 0.1326 0.1585 0.1886 -0.0106 0.0083  -0.0153 50  MSE A CA  
460  C  C   . MSE A 51  ? 0.1355 0.1674 0.1913 -0.0078 0.0154  -0.0139 50  MSE A C   
461  O  O   . MSE A 51  ? 0.1678 0.1748 0.1989 -0.0272 0.0041  -0.0222 50  MSE A O   
462  C  CB  . MSE A 51  ? 0.1309 0.1535 0.1928 -0.0106 0.0261  -0.0141 50  MSE A CB  
463  C  CG  . MSE A 51  ? 0.1499 0.1842 0.2078 -0.0081 0.0161  -0.0267 50  MSE A CG  
464  SE SE  . MSE A 51  ? 0.1874 0.2201 0.2343 -0.0386 0.0168  -0.0187 50  MSE A SE  
465  C  CE  . MSE A 51  ? 0.1615 0.1788 0.2319 -0.0352 -0.0038 -0.0328 50  MSE A CE  
466  N  N   . ASN A 52  ? 0.1509 0.1906 0.1861 -0.0217 0.0126  -0.0132 51  ASN A N   
467  C  CA  . ASN A 52  ? 0.1675 0.2196 0.1970 -0.0154 0.0071  -0.0079 51  ASN A CA  
468  C  C   . ASN A 52  ? 0.1527 0.2271 0.1898 -0.0154 0.0101  -0.0038 51  ASN A C   
469  O  O   . ASN A 52  ? 0.1636 0.2609 0.1925 -0.0102 0.0124  -0.0151 51  ASN A O   
470  C  CB  . ASN A 52  ? 0.1870 0.2369 0.2172 -0.0158 0.0037  -0.0013 51  ASN A CB  
471  C  CG  . ASN A 52  ? 0.2472 0.2767 0.2829 -0.0252 -0.0052 -0.0047 51  ASN A CG  
472  O  OD1 . ASN A 52  ? 0.3262 0.3408 0.3763 -0.0224 0.0113  -0.0283 51  ASN A OD1 
473  N  ND2 . ASN A 52  ? 0.3066 0.3198 0.3229 -0.0445 -0.0249 -0.0045 51  ASN A ND2 
474  N  N   . ASP A 53  ? 0.1519 0.2240 0.1768 -0.0065 0.0177  -0.0024 52  ASP A N   
475  C  CA  . ASP A 53  ? 0.1699 0.2322 0.1903 0.0064  0.0073  -0.0045 52  ASP A CA  
476  C  C   . ASP A 53  ? 0.1680 0.2153 0.1768 0.0130  0.0075  -0.0071 52  ASP A C   
477  O  O   . ASP A 53  ? 0.1747 0.2589 0.1776 0.0335  0.0083  -0.0036 52  ASP A O   
478  C  CB  . ASP A 53  ? 0.1894 0.2514 0.1998 0.0234  0.0127  -0.0035 52  ASP A CB  
479  C  CG  . ASP A 53  ? 0.2239 0.3002 0.2211 0.0136  0.0075  -0.0103 52  ASP A CG  
480  O  OD1 . ASP A 53  ? 0.2569 0.3846 0.2871 -0.0087 0.0710  -0.0001 52  ASP A OD1 
481  O  OD2 . ASP A 53  ? 0.2891 0.3972 0.2308 0.0414  0.0380  -0.0283 52  ASP A OD2 
482  N  N   A MSE A 54  ? 0.1573 0.1985 0.1622 0.0073  0.0029  -0.0101 53  MSE A N   
483  N  N   B MSE A 54  ? 0.1660 0.2069 0.1720 0.0083  0.0022  -0.0086 53  MSE A N   
484  N  N   C MSE A 54  ? 0.1776 0.2236 0.1936 0.0083  0.0044  -0.0078 53  MSE A N   
485  C  CA  A MSE A 54  ? 0.1524 0.1789 0.1541 0.0012  -0.0002 -0.0119 53  MSE A CA  
486  C  CA  B MSE A 54  ? 0.1692 0.1935 0.1699 0.0025  -0.0013 -0.0088 53  MSE A CA  
487  C  CA  C MSE A 54  ? 0.1908 0.2215 0.2053 0.0023  0.0058  -0.0071 53  MSE A CA  
488  C  C   A MSE A 54  ? 0.1476 0.1836 0.1588 -0.0082 0.0017  -0.0135 53  MSE A C   
489  C  C   B MSE A 54  ? 0.1572 0.1889 0.1737 -0.0044 -0.0007 -0.0075 53  MSE A C   
490  C  C   C MSE A 54  ? 0.1751 0.2144 0.2055 -0.0024 0.0060  -0.0058 53  MSE A C   
491  O  O   A MSE A 54  ? 0.1311 0.1760 0.1413 -0.0013 -0.0019 -0.0248 53  MSE A O   
492  O  O   B MSE A 54  ? 0.1435 0.1847 0.1576 0.0015  -0.0055 -0.0183 53  MSE A O   
493  O  O   C MSE A 54  ? 0.1661 0.2107 0.1992 0.0012  0.0132  -0.0101 53  MSE A O   
494  C  CB  A MSE A 54  ? 0.1499 0.1753 0.1496 -0.0017 -0.0038 -0.0150 53  MSE A CB  
495  C  CB  B MSE A 54  ? 0.1725 0.1988 0.1699 0.0009  -0.0022 -0.0120 53  MSE A CB  
496  C  CB  C MSE A 54  ? 0.2002 0.2298 0.2196 -0.0016 0.0037  -0.0113 53  MSE A CB  
497  C  CG  A MSE A 54  ? 0.1390 0.1467 0.1363 -0.0077 -0.0022 -0.0063 53  MSE A CG  
498  C  CG  B MSE A 54  ? 0.2050 0.2013 0.1664 -0.0081 -0.0071 -0.0126 53  MSE A CG  
499  C  CG  C MSE A 54  ? 0.2444 0.2747 0.2682 -0.0138 0.0170  -0.0093 53  MSE A CG  
500  SE SE  A MSE A 54  ? 0.1783 0.1587 0.1762 -0.0142 -0.0209 0.0038  53  MSE A SE  
501  SE SE  B MSE A 54  ? 0.2581 0.2321 0.1903 -0.0143 -0.0194 -0.0393 53  MSE A SE  
502  SE SE  C MSE A 54  ? 0.3189 0.2852 0.4409 -0.0602 0.0754  -0.0144 53  MSE A SE  
503  C  CE  A MSE A 54  ? 0.1373 0.0849 0.1570 -0.0024 -0.0115 -0.0232 53  MSE A CE  
504  C  CE  B MSE A 54  ? 0.2538 0.2244 0.1957 -0.0042 -0.0048 -0.0244 53  MSE A CE  
505  C  CE  C MSE A 54  ? 0.3192 0.3241 0.3665 -0.0140 0.0150  -0.0094 53  MSE A CE  
506  N  N   A GLU A 55  ? 0.1777 0.2013 0.1629 -0.0120 0.0075  -0.0249 54  GLU A N   
507  N  N   B GLU A 55  ? 0.1737 0.1941 0.1788 -0.0043 0.0004  -0.0091 54  GLU A N   
508  C  CA  A GLU A 55  ? 0.1863 0.2140 0.1737 -0.0152 0.0086  -0.0203 54  GLU A CA  
509  C  CA  B GLU A 55  ? 0.1810 0.1989 0.1864 -0.0054 0.0012  -0.0074 54  GLU A CA  
510  C  C   A GLU A 55  ? 0.1816 0.2102 0.1705 -0.0205 0.0050  -0.0161 54  GLU A C   
511  C  C   B GLU A 55  ? 0.1804 0.2015 0.1899 -0.0074 0.0009  -0.0073 54  GLU A C   
512  O  O   A GLU A 55  ? 0.1779 0.2281 0.1738 -0.0312 0.0067  -0.0072 54  GLU A O   
513  O  O   B GLU A 55  ? 0.1799 0.1953 0.1908 -0.0094 0.0025  -0.0023 54  GLU A O   
514  C  CB  A GLU A 55  ? 0.2038 0.2193 0.1756 -0.0089 0.0066  -0.0205 54  GLU A CB  
515  C  CB  B GLU A 55  ? 0.1866 0.2012 0.1849 -0.0050 -0.0009 -0.0068 54  GLU A CB  
516  C  CG  A GLU A 55  ? 0.2076 0.2352 0.1806 -0.0110 0.0113  -0.0279 54  GLU A CG  
517  C  CG  B GLU A 55  ? 0.1951 0.2006 0.1907 0.0024  -0.0035 -0.0054 54  GLU A CG  
518  N  N   A LYS A 56  ? 0.1661 0.2099 0.1812 -0.0143 0.0037  -0.0143 55  LYS A N   
519  N  N   B LYS A 56  ? 0.1777 0.2125 0.1997 -0.0093 0.0016  -0.0106 55  LYS A N   
520  C  CA  A LYS A 56  ? 0.1648 0.2118 0.1826 -0.0131 0.0059  -0.0098 55  LYS A CA  
521  C  CA  B LYS A 56  ? 0.1811 0.2236 0.2030 -0.0115 0.0049  -0.0075 55  LYS A CA  
522  C  C   A LYS A 56  ? 0.1592 0.2137 0.1779 -0.0118 0.0077  -0.0040 55  LYS A C   
523  C  C   B LYS A 56  ? 0.1749 0.2262 0.1967 -0.0094 0.0079  -0.0031 55  LYS A C   
524  O  O   A LYS A 56  ? 0.1563 0.2272 0.1947 -0.0156 -0.0043 -0.0149 55  LYS A O   
525  O  O   B LYS A 56  ? 0.1740 0.2523 0.2174 -0.0158 -0.0011 -0.0081 55  LYS A O   
526  C  CB  A LYS A 56  ? 0.1636 0.2198 0.1870 -0.0071 0.0073  -0.0099 55  LYS A CB  
527  C  CB  B LYS A 56  ? 0.1883 0.2290 0.2074 -0.0076 0.0051  -0.0079 55  LYS A CB  
528  C  CG  A LYS A 56  ? 0.1879 0.2224 0.2039 -0.0044 0.0007  0.0004  55  LYS A CG  
529  C  CG  B LYS A 56  ? 0.2135 0.2392 0.2397 -0.0040 -0.0070 -0.0009 55  LYS A CG  
530  N  N   A MSE A 57  ? 0.1422 0.2044 0.1702 -0.0111 0.0095  -0.0048 56  MSE A N   
531  N  N   B MSE A 57  ? 0.1659 0.2253 0.1936 -0.0096 0.0078  -0.0025 56  MSE A N   
532  N  N   C MSE A 57  ? 0.1352 0.1971 0.1650 -0.0080 0.0112  -0.0029 56  MSE A N   
533  C  CA  A MSE A 57  ? 0.1483 0.2008 0.1644 -0.0074 0.0081  -0.0024 56  MSE A CA  
534  C  CA  B MSE A 57  ? 0.1736 0.2235 0.1900 -0.0059 0.0086  -0.0005 56  MSE A CA  
535  C  CA  C MSE A 57  ? 0.1571 0.2040 0.1700 -0.0047 0.0098  -0.0007 56  MSE A CA  
536  C  C   A MSE A 57  ? 0.1383 0.2011 0.1637 -0.0135 0.0058  -0.0006 56  MSE A C   
537  C  C   B MSE A 57  ? 0.1533 0.2149 0.1776 -0.0102 0.0049  -0.0007 56  MSE A C   
538  C  C   C MSE A 57  ? 0.1423 0.2026 0.1646 -0.0096 0.0059  0.0002  56  MSE A C   
539  O  O   A MSE A 57  ? 0.1385 0.2115 0.1657 -0.0228 0.0041  0.0037  56  MSE A O   
540  O  O   B MSE A 57  ? 0.1492 0.2246 0.1723 -0.0135 0.0039  0.0015  56  MSE A O   
541  O  O   C MSE A 57  ? 0.1353 0.2129 0.1532 -0.0066 0.0037  -0.0006 56  MSE A O   
542  C  CB  A MSE A 57  ? 0.1558 0.2017 0.1693 -0.0041 0.0077  -0.0003 56  MSE A CB  
543  C  CB  B MSE A 57  ? 0.1943 0.2324 0.2030 -0.0028 0.0054  0.0008  56  MSE A CB  
544  C  CB  C MSE A 57  ? 0.1806 0.2150 0.1856 -0.0027 0.0046  0.0017  56  MSE A CB  
545  C  CG  A MSE A 57  ? 0.1741 0.2097 0.1802 -0.0023 0.0160  -0.0059 56  MSE A CG  
546  C  CG  B MSE A 57  ? 0.2360 0.2655 0.2374 0.0036  0.0196  0.0008  56  MSE A CG  
547  C  CG  C MSE A 57  ? 0.2419 0.2492 0.2216 0.0017  0.0194  0.0026  56  MSE A CG  
548  SE SE  A MSE A 57  ? 0.1927 0.2488 0.2704 0.0136  0.0221  -0.0160 56  MSE A SE  
549  SE SE  B MSE A 57  ? 0.3509 0.3878 0.2976 0.0070  0.0269  -0.0350 56  MSE A SE  
550  SE SE  C MSE A 57  ? 0.3235 0.3763 0.3632 0.0132  0.0179  -0.0024 56  MSE A SE  
551  C  CE  A MSE A 57  ? 0.2295 0.2740 0.2368 0.0044  0.0057  -0.0078 56  MSE A CE  
552  C  CE  B MSE A 57  ? 0.3378 0.3310 0.3047 0.0079  0.0112  -0.0117 56  MSE A CE  
553  C  CE  C MSE A 57  ? 0.3082 0.3544 0.3285 0.0044  0.0084  0.0012  56  MSE A CE  
554  N  N   . LYS A 58  ? 0.1421 0.2160 0.1509 -0.0117 0.0009  -0.0051 57  LYS A N   
555  C  CA  . LYS A 58  ? 0.1481 0.2228 0.1542 -0.0205 -0.0005 -0.0084 57  LYS A CA  
556  C  C   . LYS A 58  ? 0.1207 0.2236 0.1462 -0.0252 -0.0078 -0.0032 57  LYS A C   
557  O  O   . LYS A 58  ? 0.1353 0.2536 0.1393 -0.0508 0.0005  -0.0228 57  LYS A O   
558  C  CB  . LYS A 58  ? 0.1700 0.2308 0.1558 -0.0339 0.0032  -0.0101 57  LYS A CB  
559  C  CG  . LYS A 58  ? 0.2191 0.2580 0.1857 -0.0176 -0.0064 -0.0256 57  LYS A CG  
560  C  CD  . LYS A 58  ? 0.2376 0.2918 0.2094 -0.0362 -0.0120 -0.0193 57  LYS A CD  
561  C  CE  . LYS A 58  ? 0.3171 0.3333 0.2655 -0.0006 -0.0183 -0.0038 57  LYS A CE  
562  N  NZ  . LYS A 58  ? 0.3498 0.3674 0.2861 -0.0367 -0.0189 -0.0233 57  LYS A NZ  
563  N  N   . PHE A 59  ? 0.1356 0.2136 0.1481 -0.0297 -0.0014 -0.0211 58  PHE A N   
564  C  CA  . PHE A 59  ? 0.1215 0.2053 0.1462 -0.0171 -0.0074 -0.0217 58  PHE A CA  
565  C  C   . PHE A 59  ? 0.1338 0.2020 0.1396 -0.0205 -0.0052 -0.0172 58  PHE A C   
566  O  O   . PHE A 59  ? 0.1314 0.2310 0.1437 -0.0234 -0.0052 -0.0269 58  PHE A O   
567  C  CB  . PHE A 59  ? 0.1489 0.2120 0.1434 -0.0099 -0.0042 -0.0189 58  PHE A CB  
568  C  CG  . PHE A 59  ? 0.1605 0.2015 0.1713 -0.0040 0.0049  -0.0110 58  PHE A CG  
569  C  CD1 . PHE A 59  ? 0.1806 0.2383 0.1883 -0.0094 0.0204  -0.0069 58  PHE A CD1 
570  C  CD2 . PHE A 59  ? 0.1814 0.2078 0.1863 -0.0031 0.0176  -0.0043 58  PHE A CD2 
571  C  CE1 . PHE A 59  ? 0.1688 0.2217 0.1953 -0.0079 0.0077  -0.0139 58  PHE A CE1 
572  C  CE2 . PHE A 59  ? 0.1864 0.2256 0.1744 0.0088  0.0253  0.0026  58  PHE A CE2 
573  C  CZ  . PHE A 59  ? 0.1758 0.2030 0.2006 0.0076  0.0363  -0.0061 58  PHE A CZ  
574  N  N   . LYS A 60  ? 0.1370 0.1985 0.1391 -0.0190 -0.0004 -0.0151 59  LYS A N   
575  C  CA  . LYS A 60  ? 0.1486 0.2143 0.1429 -0.0324 0.0030  -0.0150 59  LYS A CA  
576  C  C   . LYS A 60  ? 0.1321 0.2179 0.1336 -0.0287 -0.0113 -0.0177 59  LYS A C   
577  O  O   . LYS A 60  ? 0.1376 0.2430 0.1742 -0.0379 -0.0002 -0.0227 59  LYS A O   
578  C  CB  . LYS A 60  ? 0.1537 0.2240 0.1532 -0.0230 0.0068  -0.0061 59  LYS A CB  
579  C  CG  . LYS A 60  ? 0.1847 0.2475 0.1542 -0.0234 0.0073  -0.0106 59  LYS A CG  
580  C  CD  . LYS A 60  ? 0.1895 0.2309 0.1487 -0.0330 -0.0036 -0.0292 59  LYS A CD  
581  C  CE  . LYS A 60  ? 0.1784 0.2632 0.1806 -0.0360 0.0134  -0.0196 59  LYS A CE  
582  N  NZ  . LYS A 60  ? 0.1762 0.2850 0.1974 -0.0516 -0.0056 -0.0209 59  LYS A NZ  
583  N  N   . TYR A 61  ? 0.1426 0.2170 0.1256 -0.0427 -0.0055 -0.0168 60  TYR A N   
584  C  CA  . TYR A 61  ? 0.1539 0.1998 0.1164 -0.0362 -0.0054 -0.0122 60  TYR A CA  
585  C  C   . TYR A 61  ? 0.1546 0.1977 0.1311 -0.0360 -0.0046 -0.0015 60  TYR A C   
586  O  O   . TYR A 61  ? 0.1860 0.2295 0.1540 -0.0498 0.0091  0.0020  60  TYR A O   
587  C  CB  . TYR A 61  ? 0.1501 0.1923 0.1317 -0.0333 0.0016  -0.0043 60  TYR A CB  
588  C  CG  . TYR A 61  ? 0.1556 0.1776 0.1122 -0.0110 0.0041  -0.0111 60  TYR A CG  
589  C  CD1 . TYR A 61  ? 0.1895 0.1836 0.1456 -0.0250 0.0100  -0.0084 60  TYR A CD1 
590  C  CD2 . TYR A 61  ? 0.1489 0.1734 0.1308 -0.0057 0.0110  -0.0217 60  TYR A CD2 
591  C  CE1 . TYR A 61  ? 0.1787 0.1823 0.1547 -0.0283 -0.0054 -0.0073 60  TYR A CE1 
592  C  CE2 . TYR A 61  ? 0.1541 0.2139 0.1320 -0.0101 0.0142  0.0063  60  TYR A CE2 
593  C  CZ  . TYR A 61  ? 0.1857 0.2036 0.1415 -0.0150 -0.0003 0.0183  60  TYR A CZ  
594  O  OH  . TYR A 61  ? 0.2316 0.2478 0.1847 -0.0578 0.0185  0.0070  60  TYR A OH  
595  N  N   . VAL A 62  ? 0.1593 0.2173 0.1173 -0.0399 0.0001  0.0017  61  VAL A N   
596  C  CA  . VAL A 62  ? 0.1757 0.2279 0.1325 -0.0386 0.0030  0.0030  61  VAL A CA  
597  C  C   . VAL A 62  ? 0.1466 0.2105 0.1220 -0.0437 0.0042  0.0004  61  VAL A C   
598  O  O   . VAL A 62  ? 0.1566 0.2209 0.1258 -0.0506 0.0000  -0.0002 61  VAL A O   
599  C  CB  . VAL A 62  ? 0.1944 0.2295 0.1425 -0.0389 -0.0033 0.0059  61  VAL A CB  
600  C  CG1 . VAL A 62  ? 0.2299 0.2516 0.1781 -0.0601 0.0060  0.0177  61  VAL A CG1 
601  C  CG2 . VAL A 62  ? 0.2267 0.2569 0.1502 -0.0479 -0.0209 0.0042  61  VAL A CG2 
602  N  N   . VAL A 63  ? 0.1578 0.2152 0.1278 -0.0412 0.0093  0.0070  62  VAL A N   
603  C  CA  . VAL A 63  ? 0.1580 0.2131 0.1404 -0.0490 0.0077  -0.0012 62  VAL A CA  
604  C  C   . VAL A 63  ? 0.1534 0.2156 0.1535 -0.0495 0.0126  0.0082  62  VAL A C   
605  O  O   . VAL A 63  ? 0.1817 0.2472 0.1657 -0.0578 0.0348  0.0037  62  VAL A O   
606  C  CB  . VAL A 63  ? 0.1617 0.2239 0.1398 -0.0503 0.0085  0.0007  62  VAL A CB  
607  C  CG1 . VAL A 63  ? 0.1425 0.2458 0.1797 -0.0426 -0.0272 -0.0066 62  VAL A CG1 
608  C  CG2 . VAL A 63  ? 0.2041 0.2065 0.1765 -0.0365 0.0000  0.0102  62  VAL A CG2 
609  N  N   . HIS A 64  ? 0.1629 0.2016 0.1367 -0.0583 0.0063  0.0130  63  HIS A N   
610  C  CA  . HIS A 64  ? 0.1892 0.2065 0.1474 -0.0465 0.0034  0.0219  63  HIS A CA  
611  C  C   . HIS A 64  ? 0.1801 0.1986 0.1480 -0.0475 -0.0013 0.0259  63  HIS A C   
612  O  O   . HIS A 64  ? 0.1934 0.2332 0.1894 -0.0651 -0.0023 0.0340  63  HIS A O   
613  C  CB  . HIS A 64  ? 0.1807 0.1989 0.1573 -0.0586 0.0014  0.0231  63  HIS A CB  
614  C  CG  . HIS A 64  ? 0.2177 0.2616 0.2127 -0.0296 -0.0119 0.0301  63  HIS A CG  
615  N  ND1 . HIS A 64  ? 0.2480 0.2755 0.2489 -0.0255 -0.0215 0.0564  63  HIS A ND1 
616  C  CD2 . HIS A 64  ? 0.2464 0.2976 0.2151 -0.0183 -0.0140 0.0382  63  HIS A CD2 
617  C  CE1 . HIS A 64  ? 0.2173 0.2721 0.2473 -0.0404 -0.0290 0.0227  63  HIS A CE1 
618  N  NE2 . HIS A 64  ? 0.2590 0.3332 0.2743 -0.0078 -0.0219 0.0240  63  HIS A NE2 
619  N  N   . LYS A 65  ? 0.1769 0.1892 0.1537 -0.0425 0.0010  0.0256  64  LYS A N   
620  C  CA  . LYS A 65  ? 0.1741 0.1977 0.1606 -0.0380 0.0043  0.0147  64  LYS A CA  
621  C  C   . LYS A 65  ? 0.1539 0.1882 0.1451 -0.0300 0.0039  0.0058  64  LYS A C   
622  O  O   . LYS A 65  ? 0.1315 0.1864 0.1413 -0.0376 0.0178  -0.0005 64  LYS A O   
623  C  CB  . LYS A 65  ? 0.1978 0.2284 0.1894 -0.0254 0.0027  0.0105  64  LYS A CB  
624  C  CG  . LYS A 65  ? 0.2338 0.2558 0.2358 -0.0102 -0.0080 0.0083  64  LYS A CG  
625  C  CD  . LYS A 65  ? 0.2733 0.2904 0.2723 -0.0009 0.0031  -0.0032 64  LYS A CD  
626  C  CE  . LYS A 65  ? 0.2968 0.3100 0.3056 0.0017  0.0017  -0.0057 64  LYS A CE  
627  N  NZ  . LYS A 65  ? 0.3302 0.3068 0.2834 -0.0126 0.0038  -0.0045 64  LYS A NZ  
628  N  N   . MSE A 66  ? 0.1439 0.1898 0.1557 -0.0431 0.0052  0.0119  65  MSE A N   
629  C  CA  . MSE A 66  ? 0.1279 0.1918 0.1587 -0.0397 0.0000  -0.0018 65  MSE A CA  
630  C  C   . MSE A 66  ? 0.1325 0.1730 0.1476 -0.0477 0.0009  -0.0073 65  MSE A C   
631  O  O   . MSE A 66  ? 0.1469 0.2140 0.1757 -0.0788 0.0017  0.0023  65  MSE A O   
632  C  CB  . MSE A 66  ? 0.1472 0.2193 0.1741 -0.0423 0.0019  -0.0129 65  MSE A CB  
633  C  CG  . MSE A 66  ? 0.1516 0.2331 0.1905 -0.0255 0.0268  -0.0340 65  MSE A CG  
634  SE SE  . MSE A 66  ? 0.3204 0.3557 0.3531 -0.0042 0.0620  -0.0801 65  MSE A SE  
635  C  CE  . MSE A 66  ? 0.2072 0.2214 0.2272 0.0689  0.0065  -0.0546 65  MSE A CE  
636  N  N   . PHE A 67  ? 0.1180 0.1296 0.1260 -0.0439 -0.0028 0.0024  66  PHE A N   
637  C  CA  . PHE A 67  ? 0.1204 0.1444 0.1385 -0.0186 -0.0011 -0.0065 66  PHE A CA  
638  C  C   . PHE A 67  ? 0.1177 0.1389 0.1431 -0.0116 -0.0022 -0.0094 66  PHE A C   
639  O  O   . PHE A 67  ? 0.1021 0.1259 0.1445 -0.0162 0.0066  -0.0121 66  PHE A O   
640  C  CB  . PHE A 67  ? 0.1514 0.1402 0.1422 -0.0170 -0.0142 -0.0176 66  PHE A CB  
641  C  CG  . PHE A 67  ? 0.1521 0.1115 0.1349 -0.0230 -0.0012 0.0000  66  PHE A CG  
642  C  CD1 . PHE A 67  ? 0.1542 0.1150 0.1457 -0.0118 -0.0009 -0.0168 66  PHE A CD1 
643  C  CD2 . PHE A 67  ? 0.1546 0.1348 0.1687 -0.0268 -0.0385 -0.0013 66  PHE A CD2 
644  C  CE1 . PHE A 67  ? 0.1402 0.1265 0.1586 -0.0237 -0.0156 -0.0133 66  PHE A CE1 
645  C  CE2 . PHE A 67  ? 0.1565 0.1337 0.1812 -0.0234 -0.0277 -0.0030 66  PHE A CE2 
646  C  CZ  . PHE A 67  ? 0.1566 0.1194 0.1656 -0.0058 -0.0094 -0.0016 66  PHE A CZ  
647  N  N   A GLU A 68  ? 0.1226 0.1517 0.1495 -0.0190 -0.0083 -0.0171 67  GLU A N   
648  N  N   B GLU A 68  ? 0.1314 0.1559 0.1568 -0.0189 -0.0102 -0.0166 67  GLU A N   
649  C  CA  A GLU A 68  ? 0.1274 0.1505 0.1627 -0.0111 -0.0094 -0.0212 67  GLU A CA  
650  C  CA  B GLU A 68  ? 0.1461 0.1614 0.1738 -0.0115 -0.0105 -0.0192 67  GLU A CA  
651  C  C   A GLU A 68  ? 0.1004 0.1383 0.1618 -0.0243 -0.0227 -0.0207 67  GLU A C   
652  C  C   B GLU A 68  ? 0.1174 0.1448 0.1690 -0.0254 -0.0222 -0.0204 67  GLU A C   
653  O  O   A GLU A 68  ? 0.1456 0.1645 0.2044 0.0058  -0.0041 -0.0051 67  GLU A O   
654  O  O   B GLU A 68  ? 0.1806 0.1720 0.2122 0.0025  -0.0066 -0.0081 67  GLU A O   
655  C  CB  A GLU A 68  ? 0.1457 0.1756 0.1668 -0.0086 -0.0013 -0.0177 67  GLU A CB  
656  C  CB  B GLU A 68  ? 0.1733 0.1953 0.1861 -0.0043 -0.0013 -0.0168 67  GLU A CB  
657  C  CG  A GLU A 68  ? 0.1427 0.1635 0.1919 0.0027  0.0061  -0.0151 67  GLU A CG  
658  C  CG  B GLU A 68  ? 0.2151 0.1983 0.2340 -0.0031 0.0056  -0.0034 67  GLU A CG  
659  C  CD  A GLU A 68  ? 0.1913 0.1819 0.2084 -0.0057 0.0207  -0.0155 67  GLU A CD  
660  C  CD  B GLU A 68  ? 0.2438 0.2422 0.2400 0.0131  0.0138  -0.0095 67  GLU A CD  
661  O  OE1 A GLU A 68  ? 0.1532 0.1757 0.2007 0.0283  0.0142  0.0042  67  GLU A OE1 
662  O  OE1 B GLU A 68  ? 0.2602 0.2920 0.2762 0.0044  0.0182  -0.0210 67  GLU A OE1 
663  O  OE2 A GLU A 68  ? 0.2282 0.1643 0.2546 0.0123  0.0468  -0.0050 67  GLU A OE2 
664  O  OE2 B GLU A 68  ? 0.2857 0.2823 0.2779 0.0218  0.0173  -0.0155 67  GLU A OE2 
665  N  N   . GLU A 69  ? 0.1419 0.1683 0.1795 -0.0207 -0.0392 -0.0141 68  GLU A N   
666  C  CA  . GLU A 69  ? 0.1786 0.2040 0.2108 -0.0280 -0.0285 0.0006  68  GLU A CA  
667  C  C   . GLU A 69  ? 0.1889 0.2223 0.2218 -0.0176 -0.0379 0.0097  68  GLU A C   
668  O  O   . GLU A 69  ? 0.2066 0.2080 0.2256 -0.0363 -0.0426 0.0185  68  GLU A O   
669  C  CB  . GLU A 69  ? 0.2204 0.2173 0.2165 -0.0244 -0.0297 -0.0033 68  GLU A CB  
670  C  CG  . GLU A 69  ? 0.3016 0.2838 0.2684 -0.0193 -0.0290 -0.0096 68  GLU A CG  
671  C  CD  . GLU A 69  ? 0.2686 0.2895 0.2790 -0.0192 -0.0468 0.0442  68  GLU A CD  
672  O  OE1 . GLU A 69  ? 0.3752 0.4003 0.3669 -0.0456 -0.0324 -0.0480 68  GLU A OE1 
673  O  OE2 . GLU A 69  ? 0.4767 0.4830 0.5189 -0.0506 0.0143  -0.0099 68  GLU A OE2 
674  N  N   A GLY A 70  ? 0.1828 0.2136 0.2290 -0.0162 -0.0334 0.0115  69  GLY A N   
675  N  N   B GLY A 70  ? 0.2097 0.2284 0.2305 -0.0174 -0.0217 0.0012  69  GLY A N   
676  C  CA  A GLY A 70  ? 0.1795 0.2096 0.2162 -0.0073 -0.0292 0.0068  69  GLY A CA  
677  C  CA  B GLY A 70  ? 0.2048 0.2383 0.2281 -0.0052 -0.0163 0.0015  69  GLY A CA  
678  C  C   A GLY A 70  ? 0.1609 0.1885 0.2025 0.0004  -0.0249 0.0070  69  GLY A C   
679  C  C   B GLY A 70  ? 0.2082 0.2374 0.2262 0.0007  -0.0146 -0.0002 69  GLY A C   
680  O  O   A GLY A 70  ? 0.1637 0.2255 0.1984 0.0084  -0.0243 0.0023  69  GLY A O   
681  O  O   B GLY A 70  ? 0.2211 0.2603 0.2299 0.0063  -0.0177 0.0005  69  GLY A O   
682  N  N   A ASN A 71  ? 0.1401 0.1683 0.1779 0.0144  -0.0246 0.0091  70  ASN A N   
683  N  N   B ASN A 71  ? 0.1967 0.2166 0.2257 0.0054  -0.0250 0.0054  70  ASN A N   
684  C  CA  A ASN A 71  ? 0.1309 0.1495 0.1661 0.0140  -0.0206 0.0028  70  ASN A CA  
685  C  CA  B ASN A 71  ? 0.1911 0.2068 0.2351 0.0063  -0.0200 0.0025  70  ASN A CA  
686  C  C   A ASN A 71  ? 0.1279 0.1378 0.1843 0.0160  -0.0242 0.0000  70  ASN A C   
687  C  C   B ASN A 71  ? 0.1663 0.1678 0.2136 0.0087  -0.0228 0.0015  70  ASN A C   
688  O  O   A ASN A 71  ? 0.1455 0.1207 0.2037 0.0141  -0.0372 -0.0063 70  ASN A O   
689  O  O   B ASN A 71  ? 0.1782 0.1522 0.2253 0.0069  -0.0363 -0.0095 70  ASN A O   
690  C  CB  A ASN A 71  ? 0.1482 0.1499 0.1690 0.0201  -0.0160 -0.0019 70  ASN A CB  
691  C  CB  B ASN A 71  ? 0.2112 0.2258 0.2473 0.0029  -0.0180 0.0050  70  ASN A CB  
692  C  CG  A ASN A 71  ? 0.1529 0.1911 0.2021 0.0126  -0.0052 0.0015  70  ASN A CG  
693  C  CG  B ASN A 71  ? 0.2600 0.2578 0.2700 -0.0016 -0.0114 0.0046  70  ASN A CG  
694  O  OD1 A ASN A 71  ? 0.1968 0.2571 0.2738 0.0224  -0.0072 0.0148  70  ASN A OD1 
695  O  OD1 B ASN A 71  ? 0.2792 0.3047 0.3261 0.0237  0.0016  0.0180  70  ASN A OD1 
696  N  ND2 A ASN A 71  ? 0.2201 0.2760 0.2244 0.0114  -0.0210 0.0129  70  ASN A ND2 
697  N  ND2 B ASN A 71  ? 0.2756 0.2845 0.2816 0.0005  -0.0333 0.0214  70  ASN A ND2 
698  N  N   . ASP A 72  ? 0.1398 0.1299 0.1756 0.0053  -0.0315 -0.0090 71  ASP A N   
699  C  CA  . ASP A 72  ? 0.1287 0.1260 0.1494 0.0068  -0.0208 -0.0026 71  ASP A CA  
700  C  C   . ASP A 72  ? 0.1059 0.1219 0.1353 -0.0009 -0.0133 -0.0034 71  ASP A C   
701  O  O   . ASP A 72  ? 0.1112 0.1293 0.1627 -0.0040 -0.0198 -0.0076 71  ASP A O   
702  C  CB  . ASP A 72  ? 0.1609 0.1371 0.1462 0.0105  -0.0087 0.0037  71  ASP A CB  
703  C  CG  . ASP A 72  ? 0.2096 0.1692 0.1382 0.0142  -0.0048 -0.0110 71  ASP A CG  
704  O  OD1 . ASP A 72  ? 0.3075 0.1745 0.1924 -0.0002 -0.0108 -0.0044 71  ASP A OD1 
705  O  OD2 . ASP A 72  ? 0.2936 0.2339 0.1640 0.0165  -0.0370 -0.0203 71  ASP A OD2 
706  N  N   . VAL A 73  ? 0.0991 0.1184 0.1291 -0.0048 -0.0091 -0.0130 72  VAL A N   
707  C  CA  . VAL A 73  ? 0.0944 0.1184 0.1336 -0.0117 0.0005  -0.0089 72  VAL A CA  
708  C  C   . VAL A 73  ? 0.0931 0.1223 0.1053 -0.0122 0.0026  -0.0044 72  VAL A C   
709  O  O   . VAL A 73  ? 0.0980 0.1343 0.1437 -0.0208 -0.0041 0.0276  72  VAL A O   
710  C  CB  . VAL A 73  ? 0.1010 0.1364 0.1374 -0.0119 0.0015  -0.0131 72  VAL A CB  
711  C  CG1 . VAL A 73  ? 0.1437 0.1529 0.1360 -0.0228 -0.0097 -0.0071 72  VAL A CG1 
712  C  CG2 . VAL A 73  ? 0.0849 0.1822 0.1732 0.0011  -0.0063 -0.0469 72  VAL A CG2 
713  N  N   A CYS A 74  ? 0.0898 0.1192 0.1061 -0.0094 0.0062  -0.0067 73  CYS A N   
714  N  N   B CYS A 74  ? 0.0904 0.1173 0.1153 -0.0091 0.0062  -0.0052 73  CYS A N   
715  C  CA  A CYS A 74  ? 0.0958 0.1113 0.0976 -0.0064 0.0014  -0.0075 73  CYS A CA  
716  C  CA  B CYS A 74  ? 0.0985 0.1092 0.1133 -0.0039 0.0054  -0.0031 73  CYS A CA  
717  C  C   A CYS A 74  ? 0.0993 0.1143 0.1041 -0.0136 0.0012  -0.0011 73  CYS A C   
718  C  C   B CYS A 74  ? 0.0934 0.1116 0.1126 -0.0118 0.0043  0.0037  73  CYS A C   
719  O  O   A CYS A 74  ? 0.1124 0.1151 0.1103 -0.0179 0.0038  -0.0173 73  CYS A O   
720  O  O   B CYS A 74  ? 0.0972 0.1120 0.1320 -0.0123 0.0101  0.0009  73  CYS A O   
721  C  CB  A CYS A 74  ? 0.1129 0.1269 0.1008 -0.0065 0.0062  -0.0101 73  CYS A CB  
722  C  CB  B CYS A 74  ? 0.1071 0.1169 0.1252 -0.0109 0.0069  -0.0068 73  CYS A CB  
723  S  SG  A CYS A 74  ? 0.1165 0.1425 0.1479 0.0073  0.0012  -0.0214 73  CYS A SG  
724  S  SG  B CYS A 74  ? 0.1609 0.1557 0.2181 0.0339  0.0070  -0.0261 73  CYS A SG  
725  N  N   . LEU A 75  ? 0.0948 0.1217 0.1058 -0.0163 0.0103  0.0067  74  LEU A N   
726  C  CA  . LEU A 75  ? 0.1098 0.1186 0.1114 -0.0179 0.0029  0.0124  74  LEU A CA  
727  C  C   . LEU A 75  ? 0.0993 0.1250 0.1091 -0.0148 -0.0023 0.0102  74  LEU A C   
728  O  O   . LEU A 75  ? 0.1016 0.1610 0.1482 -0.0070 0.0215  0.0358  74  LEU A O   
729  C  CB  . LEU A 75  ? 0.1057 0.1316 0.1106 -0.0289 -0.0020 0.0051  74  LEU A CB  
730  C  CG  . LEU A 75  ? 0.1113 0.1304 0.1272 -0.0198 -0.0053 0.0018  74  LEU A CG  
731  C  CD1 . LEU A 75  ? 0.1485 0.1462 0.1500 -0.0045 -0.0005 -0.0184 74  LEU A CD1 
732  C  CD2 . LEU A 75  ? 0.1226 0.1639 0.1630 -0.0095 0.0037  -0.0320 74  LEU A CD2 
733  N  N   . ILE A 76  ? 0.0976 0.1163 0.1178 -0.0221 0.0033  0.0145  75  ILE A N   
734  C  CA  . ILE A 76  ? 0.1152 0.1311 0.1336 -0.0267 -0.0033 0.0020  75  ILE A CA  
735  C  C   . ILE A 76  ? 0.1214 0.1247 0.1242 -0.0216 0.0080  0.0127  75  ILE A C   
736  O  O   . ILE A 76  ? 0.1357 0.1527 0.1140 -0.0335 -0.0064 0.0061  75  ILE A O   
737  C  CB  . ILE A 76  ? 0.1515 0.1367 0.1293 -0.0321 0.0078  0.0042  75  ILE A CB  
738  C  CG1 . ILE A 76  ? 0.1545 0.1327 0.1329 -0.0298 -0.0052 -0.0076 75  ILE A CG1 
739  C  CG2 . ILE A 76  ? 0.1973 0.1401 0.1636 -0.0208 -0.0300 0.0004  75  ILE A CG2 
740  C  CD1 . ILE A 76  ? 0.1600 0.1608 0.1416 -0.0303 0.0070  -0.0130 75  ILE A CD1 
741  N  N   . TYR A 77  ? 0.1216 0.1380 0.1021 -0.0258 0.0017  0.0054  76  TYR A N   
742  C  CA  . TYR A 77  ? 0.1218 0.1405 0.1087 -0.0201 0.0042  0.0109  76  TYR A CA  
743  C  C   . TYR A 77  ? 0.1315 0.1575 0.1190 -0.0188 -0.0003 0.0026  76  TYR A C   
744  O  O   . TYR A 77  ? 0.1410 0.1712 0.1104 -0.0169 0.0027  -0.0008 76  TYR A O   
745  C  CB  . TYR A 77  ? 0.1354 0.1419 0.1290 -0.0233 0.0087  -0.0015 76  TYR A CB  
746  C  CG  . TYR A 77  ? 0.1224 0.1607 0.1227 -0.0144 0.0069  -0.0061 76  TYR A CG  
747  C  CD1 . TYR A 77  ? 0.1394 0.1242 0.1276 -0.0048 0.0057  -0.0007 76  TYR A CD1 
748  C  CD2 . TYR A 77  ? 0.1278 0.1549 0.1020 -0.0008 -0.0027 -0.0139 76  TYR A CD2 
749  C  CE1 . TYR A 77  ? 0.1216 0.1518 0.1284 -0.0001 0.0145  0.0043  76  TYR A CE1 
750  C  CE2 . TYR A 77  ? 0.1324 0.1408 0.1128 0.0074  0.0036  -0.0068 76  TYR A CE2 
751  C  CZ  . TYR A 77  ? 0.1077 0.1572 0.0931 0.0033  -0.0041 0.0008  76  TYR A CZ  
752  O  OH  . TYR A 77  ? 0.1585 0.1707 0.0810 0.0320  -0.0032 0.0133  76  TYR A OH  
753  N  N   . ASP A 78  ? 0.1487 0.1903 0.1195 -0.0259 0.0002  0.0172  77  ASP A N   
754  C  CA  . ASP A 78  ? 0.1542 0.1984 0.1354 -0.0184 -0.0050 0.0049  77  ASP A CA  
755  C  C   . ASP A 78  ? 0.1429 0.2012 0.1435 -0.0184 -0.0086 -0.0004 77  ASP A C   
756  O  O   . ASP A 78  ? 0.1777 0.2178 0.1832 -0.0400 0.0205  -0.0237 77  ASP A O   
757  C  CB  . ASP A 78  ? 0.1516 0.2137 0.1448 -0.0187 -0.0158 0.0150  77  ASP A CB  
758  C  CG  . ASP A 78  ? 0.1678 0.2303 0.1723 -0.0182 -0.0077 0.0170  77  ASP A CG  
759  O  OD1 . ASP A 78  ? 0.2269 0.2157 0.2157 -0.0153 0.0069  0.0312  77  ASP A OD1 
760  O  OD2 . ASP A 78  ? 0.2623 0.2882 0.2552 -0.0332 -0.0297 0.0612  77  ASP A OD2 
761  N  N   . ILE A 79  ? 0.1466 0.1943 0.1475 -0.0249 -0.0124 -0.0105 78  ILE A N   
762  C  CA  . ILE A 79  ? 0.1411 0.1928 0.1502 -0.0172 -0.0176 -0.0102 78  ILE A CA  
763  C  C   . ILE A 79  ? 0.1464 0.2036 0.1593 -0.0154 -0.0166 -0.0109 78  ILE A C   
764  O  O   . ILE A 79  ? 0.1336 0.2355 0.1619 -0.0076 -0.0247 -0.0237 78  ILE A O   
765  C  CB  . ILE A 79  ? 0.1295 0.1760 0.1489 -0.0219 -0.0165 -0.0091 78  ILE A CB  
766  C  CG1 . ILE A 79  ? 0.1557 0.1688 0.1267 -0.0168 -0.0212 -0.0165 78  ILE A CG1 
767  C  CG2 . ILE A 79  ? 0.1609 0.1685 0.1603 -0.0163 -0.0192 -0.0090 78  ILE A CG2 
768  C  CD1 . ILE A 79  ? 0.1660 0.1533 0.1361 -0.0175 -0.0326 0.0056  78  ILE A CD1 
769  N  N   . ASN A 80  ? 0.1521 0.2204 0.1787 -0.0246 -0.0141 -0.0198 79  ASN A N   
770  C  CA  . ASN A 80  ? 0.1842 0.2344 0.1869 -0.0170 -0.0250 -0.0104 79  ASN A CA  
771  C  C   . ASN A 80  ? 0.1755 0.2444 0.1879 -0.0140 -0.0331 -0.0115 79  ASN A C   
772  O  O   . ASN A 80  ? 0.1694 0.2288 0.1798 -0.0333 -0.0411 -0.0188 79  ASN A O   
773  C  CB  . ASN A 80  ? 0.2045 0.2573 0.1919 -0.0188 -0.0245 -0.0168 79  ASN A CB  
774  C  CG  . ASN A 80  ? 0.2367 0.3073 0.2290 -0.0185 -0.0309 -0.0004 79  ASN A CG  
775  O  OD1 . ASN A 80  ? 0.2572 0.4101 0.2505 -0.0278 -0.0608 0.0048  79  ASN A OD1 
776  N  ND2 . ASN A 80  ? 0.3269 0.3742 0.3149 -0.0194 -0.0263 0.0290  79  ASN A ND2 
777  N  N   . MSE A 81  ? 0.1804 0.2570 0.2173 -0.0086 -0.0305 -0.0049 80  MSE A N   
778  C  CA  . MSE A 81  ? 0.2053 0.2716 0.2407 -0.0037 -0.0211 -0.0029 80  MSE A CA  
779  C  C   . MSE A 81  ? 0.2302 0.2901 0.2658 0.0004  -0.0210 -0.0003 80  MSE A C   
780  O  O   . MSE A 81  ? 0.2385 0.3021 0.2762 0.0020  -0.0200 0.0102  80  MSE A O   
781  C  CB  . MSE A 81  ? 0.1992 0.2827 0.2526 -0.0032 -0.0134 -0.0024 80  MSE A CB  
782  C  CG  . MSE A 81  ? 0.2032 0.2984 0.2184 -0.0259 -0.0045 -0.0020 80  MSE A CG  
783  SE SE  . MSE A 81  ? 0.3179 0.4323 0.2662 -0.0353 0.0581  -0.0415 80  MSE A SE  
784  C  CE  . MSE A 81  ? 0.3138 0.3518 0.3074 -0.0052 0.0118  -0.0273 80  MSE A CE  
785  N  N   . ASN A 82  ? 0.2621 0.3165 0.3001 0.0006  -0.0288 -0.0009 81  ASN A N   
786  C  CA  . ASN A 82  ? 0.2942 0.3376 0.3213 -0.0018 -0.0248 -0.0014 81  ASN A CA  
787  C  C   . ASN A 82  ? 0.2930 0.3367 0.3190 -0.0026 -0.0249 -0.0012 81  ASN A C   
788  O  O   . ASN A 82  ? 0.2950 0.3577 0.3437 0.0013  -0.0298 0.0061  81  ASN A O   
789  C  CB  . ASN A 82  ? 0.3047 0.3508 0.3343 -0.0017 -0.0204 -0.0003 81  ASN A CB  
790  C  CG  . ASN A 82  ? 0.3729 0.3775 0.3821 -0.0047 -0.0143 -0.0024 81  ASN A CG  
791  O  OD1 . ASN A 82  ? 0.4281 0.4369 0.4165 -0.0143 -0.0161 0.0174  81  ASN A OD1 
792  N  ND2 . ASN A 82  ? 0.4108 0.4225 0.4006 -0.0021 -0.0086 -0.0208 81  ASN A ND2 
793  N  N   . GLY A 83  ? 0.2965 0.3313 0.3052 -0.0003 -0.0254 0.0044  82  GLY A N   
794  C  CA  . GLY A 83  ? 0.2973 0.3246 0.3017 0.0002  -0.0211 0.0063  82  GLY A CA  
795  C  C   . GLY A 83  ? 0.2937 0.3100 0.2923 0.0003  -0.0230 0.0083  82  GLY A C   
796  O  O   . GLY A 83  ? 0.3201 0.3300 0.2979 -0.0063 -0.0375 0.0158  82  GLY A O   
797  N  N   A LYS A 84  ? 0.2808 0.2995 0.2881 0.0059  -0.0255 0.0063  83  LYS A N   
798  N  N   B LYS A 84  ? 0.2806 0.2963 0.2839 0.0028  -0.0199 0.0048  83  LYS A N   
799  C  CA  A LYS A 84  ? 0.2636 0.2940 0.2818 0.0063  -0.0238 0.0082  83  LYS A CA  
800  C  CA  B LYS A 84  ? 0.2638 0.2860 0.2736 0.0042  -0.0173 0.0049  83  LYS A CA  
801  C  C   A LYS A 84  ? 0.2490 0.2790 0.2655 0.0071  -0.0300 0.0091  83  LYS A C   
802  C  C   B LYS A 84  ? 0.2504 0.2748 0.2596 0.0056  -0.0214 0.0047  83  LYS A C   
803  O  O   A LYS A 84  ? 0.2416 0.2739 0.2850 0.0232  -0.0321 -0.0016 83  LYS A O   
804  O  O   B LYS A 84  ? 0.2425 0.2668 0.2591 0.0123  -0.0184 0.0002  83  LYS A O   
805  C  CB  A LYS A 84  ? 0.2649 0.2931 0.2859 0.0088  -0.0186 0.0055  83  LYS A CB  
806  C  CB  B LYS A 84  ? 0.2663 0.2846 0.2765 0.0052  -0.0129 0.0029  83  LYS A CB  
807  C  CG  A LYS A 84  ? 0.2840 0.3142 0.3079 -0.0012 -0.0162 0.0044  83  LYS A CG  
808  C  CG  B LYS A 84  ? 0.2712 0.2877 0.2848 0.0016  -0.0121 -0.0003 83  LYS A CG  
809  C  CD  A LYS A 84  ? 0.3229 0.3229 0.3435 -0.0020 -0.0147 0.0038  83  LYS A CD  
810  C  CD  B LYS A 84  ? 0.2757 0.2958 0.2898 0.0032  -0.0080 0.0019  83  LYS A CD  
811  N  N   . THR A 85  ? 0.2229 0.2664 0.2387 0.0118  -0.0326 0.0037  84  THR A N   
812  C  CA  . THR A 85  ? 0.2265 0.2651 0.2312 0.0108  -0.0315 0.0008  84  THR A CA  
813  C  C   . THR A 85  ? 0.2125 0.2317 0.2149 0.0192  -0.0337 0.0000  84  THR A C   
814  O  O   . THR A 85  ? 0.2546 0.2366 0.2392 0.0317  -0.0471 0.0044  84  THR A O   
815  C  CB  . THR A 85  ? 0.2322 0.2790 0.2430 0.0139  -0.0306 -0.0029 84  THR A CB  
816  O  OG1 . THR A 85  ? 0.2942 0.3706 0.2172 0.0114  -0.0290 -0.0033 84  THR A OG1 
817  C  CG2 . THR A 85  ? 0.2456 0.3174 0.2449 -0.0143 -0.0242 0.0059  84  THR A CG2 
818  N  N   . ILE A 86  ? 0.1687 0.2092 0.1906 0.0058  -0.0378 0.0053  85  ILE A N   
819  C  CA  . ILE A 86  ? 0.1779 0.2111 0.1893 -0.0046 -0.0238 0.0100  85  ILE A CA  
820  C  C   . ILE A 86  ? 0.1663 0.1883 0.1704 0.0000  -0.0201 0.0075  85  ILE A C   
821  O  O   . ILE A 86  ? 0.1777 0.1813 0.1634 0.0022  -0.0294 0.0108  85  ILE A O   
822  C  CB  . ILE A 86  ? 0.1902 0.2492 0.1976 -0.0163 -0.0297 0.0095  85  ILE A CB  
823  C  CG1 . ILE A 86  ? 0.2209 0.2865 0.2563 -0.0210 -0.0203 -0.0081 85  ILE A CG1 
824  C  CG2 . ILE A 86  ? 0.2390 0.2853 0.2279 -0.0356 -0.0026 -0.0072 85  ILE A CG2 
825  C  CD1 . ILE A 86  ? 0.2610 0.2888 0.3025 0.0153  -0.0228 -0.0193 85  ILE A CD1 
826  N  N   . ALA A 87  ? 0.1570 0.1576 0.1650 0.0092  -0.0217 0.0173  86  ALA A N   
827  C  CA  . ALA A 87  ? 0.1326 0.1578 0.1458 -0.0006 -0.0108 0.0250  86  ALA A CA  
828  C  C   . ALA A 87  ? 0.1199 0.1424 0.1294 0.0013  -0.0020 0.0189  86  ALA A C   
829  O  O   . ALA A 87  ? 0.1152 0.1534 0.1540 0.0183  0.0002  0.0204  86  ALA A O   
830  C  CB  . ALA A 87  ? 0.1661 0.1581 0.1592 -0.0009 -0.0164 0.0332  86  ALA A CB  
831  N  N   . ALA A 88  ? 0.1006 0.1365 0.1135 -0.0015 0.0031  0.0192  87  ALA A N   
832  C  CA  . ALA A 88  ? 0.0987 0.1229 0.1179 -0.0077 0.0066  0.0093  87  ALA A CA  
833  C  C   . ALA A 88  ? 0.0767 0.1125 0.1154 -0.0054 -0.0014 0.0171  87  ALA A C   
834  O  O   . ALA A 88  ? 0.0978 0.1344 0.1067 -0.0043 0.0024  0.0171  87  ALA A O   
835  C  CB  . ALA A 88  ? 0.1062 0.1035 0.1261 -0.0045 0.0055  -0.0059 87  ALA A CB  
836  N  N   . SER A 89  ? 0.0713 0.1126 0.1222 -0.0092 0.0130  0.0207  88  SER A N   
837  C  CA  . SER A 89  ? 0.0865 0.1065 0.1273 0.0035  0.0124  0.0177  88  SER A CA  
838  C  C   . SER A 89  ? 0.0808 0.1069 0.1317 -0.0014 0.0070  0.0134  88  SER A C   
839  O  O   . SER A 89  ? 0.0946 0.1120 0.1741 0.0080  0.0426  0.0377  88  SER A O   
840  C  CB  . SER A 89  ? 0.0941 0.1259 0.1359 0.0045  0.0149  0.0104  88  SER A CB  
841  O  OG  . SER A 89  ? 0.0981 0.1388 0.1454 0.0192  0.0081  0.0019  88  SER A OG  
842  N  N   . GLY A 90  ? 0.0766 0.1081 0.1075 0.0021  0.0097  0.0044  89  GLY A N   
843  C  CA  . GLY A 90  ? 0.0796 0.0953 0.1149 -0.0085 -0.0001 -0.0042 89  GLY A CA  
844  C  C   . GLY A 90  ? 0.0697 0.1125 0.1255 0.0011  0.0128  0.0108  89  GLY A C   
845  O  O   . GLY A 90  ? 0.0822 0.1658 0.1154 0.0016  0.0067  0.0272  89  GLY A O   
846  N  N   . LEU A 91  ? 0.0609 0.1177 0.1066 -0.0010 0.0013  0.0054  90  LEU A N   
847  C  CA  . LEU A 91  ? 0.0880 0.1084 0.1109 -0.0017 0.0026  -0.0044 90  LEU A CA  
848  C  C   . LEU A 91  ? 0.0784 0.1115 0.1090 0.0042  -0.0069 0.0038  90  LEU A C   
849  O  O   . LEU A 91  ? 0.0740 0.1056 0.1178 -0.0092 0.0023  0.0033  90  LEU A O   
850  C  CB  . LEU A 91  ? 0.0957 0.1201 0.0973 -0.0024 0.0054  -0.0027 90  LEU A CB  
851  C  CG  . LEU A 91  ? 0.1244 0.1220 0.1231 0.0103  -0.0090 -0.0186 90  LEU A CG  
852  C  CD1 . LEU A 91  ? 0.1227 0.1629 0.1342 0.0045  -0.0125 -0.0217 90  LEU A CD1 
853  C  CD2 . LEU A 91  ? 0.1669 0.1980 0.1054 0.0087  0.0085  -0.0231 90  LEU A CD2 
854  N  N   . TYR A 92  ? 0.0861 0.1123 0.0924 0.0062  0.0115  0.0093  91  TYR A N   
855  C  CA  . TYR A 92  ? 0.0837 0.1190 0.1167 0.0015  0.0006  0.0034  91  TYR A CA  
856  C  C   . TYR A 92  ? 0.0981 0.1214 0.1345 0.0045  0.0000  0.0096  91  TYR A C   
857  O  O   . TYR A 92  ? 0.1036 0.1433 0.1674 -0.0025 -0.0308 0.0254  91  TYR A O   
858  C  CB  . TYR A 92  ? 0.0924 0.1215 0.1220 0.0107  0.0130  -0.0034 91  TYR A CB  
859  C  CG  . TYR A 92  ? 0.0908 0.1352 0.1149 0.0158  0.0190  0.0074  91  TYR A CG  
860  C  CD1 . TYR A 92  ? 0.1058 0.1324 0.1218 0.0206  0.0270  0.0000  91  TYR A CD1 
861  C  CD2 . TYR A 92  ? 0.1166 0.1285 0.1120 0.0272  -0.0021 -0.0065 91  TYR A CD2 
862  C  CE1 . TYR A 92  ? 0.1266 0.1480 0.1152 0.0271  0.0344  0.0064  91  TYR A CE1 
863  C  CE2 . TYR A 92  ? 0.1529 0.1286 0.1133 0.0239  -0.0074 -0.0187 91  TYR A CE2 
864  C  CZ  . TYR A 92  ? 0.1386 0.1617 0.1060 0.0367  -0.0029 0.0033  91  TYR A CZ  
865  O  OH  . TYR A 92  ? 0.1477 0.2194 0.1123 0.0543  0.0179  -0.0040 91  TYR A OH  
866  N  N   . HIS A 93  ? 0.0829 0.1167 0.1283 0.0031  -0.0042 0.0066  92  HIS A N   
867  C  CA  . HIS A 93  ? 0.1108 0.1128 0.1267 0.0049  -0.0118 -0.0131 92  HIS A CA  
868  C  C   . HIS A 93  ? 0.1092 0.1273 0.1275 0.0144  -0.0097 -0.0100 92  HIS A C   
869  O  O   . HIS A 93  ? 0.1204 0.1134 0.1500 0.0148  -0.0193 -0.0050 92  HIS A O   
870  C  CB  . HIS A 93  ? 0.1367 0.1320 0.1342 0.0134  -0.0139 -0.0024 92  HIS A CB  
871  C  CG  . HIS A 93  ? 0.1599 0.1454 0.1527 0.0122  -0.0218 0.0041  92  HIS A CG  
872  N  ND1 . HIS A 93  ? 0.1849 0.1875 0.1479 -0.0031 -0.0361 0.0071  92  HIS A ND1 
873  C  CD2 . HIS A 93  ? 0.1777 0.1593 0.1789 0.0166  -0.0257 0.0051  92  HIS A CD2 
874  C  CE1 . HIS A 93  ? 0.2173 0.2175 0.1604 -0.0019 -0.0419 0.0136  92  HIS A CE1 
875  N  NE2 . HIS A 93  ? 0.2256 0.2092 0.1388 0.0032  -0.0228 0.0048  92  HIS A NE2 
876  N  N   . LEU A 94  ? 0.1163 0.1219 0.1626 0.0189  -0.0146 -0.0195 93  LEU A N   
877  C  CA  . LEU A 94  ? 0.1244 0.1367 0.1783 0.0211  -0.0190 -0.0160 93  LEU A CA  
878  C  C   . LEU A 94  ? 0.1357 0.1426 0.1946 0.0208  -0.0307 -0.0197 93  LEU A C   
879  O  O   . LEU A 94  ? 0.1567 0.1371 0.2295 0.0404  -0.0548 -0.0371 93  LEU A O   
880  C  CB  . LEU A 94  ? 0.1506 0.1759 0.1955 0.0235  -0.0051 -0.0256 93  LEU A CB  
881  C  CG  . LEU A 94  ? 0.1964 0.2102 0.2070 0.0177  0.0041  -0.0172 93  LEU A CG  
882  C  CD1 . LEU A 94  ? 0.2384 0.2099 0.1977 0.0250  0.0076  -0.0032 93  LEU A CD1 
883  C  CD2 . LEU A 94  ? 0.2470 0.2194 0.2306 -0.0128 0.0094  -0.0347 93  LEU A CD2 
884  N  N   . GLU A 95  ? 0.1192 0.1363 0.2105 0.0272  -0.0300 -0.0151 94  GLU A N   
885  C  CA  . GLU A 95  ? 0.1400 0.1596 0.2206 0.0208  -0.0258 -0.0094 94  GLU A CA  
886  C  C   . GLU A 95  ? 0.1243 0.1485 0.2162 0.0258  -0.0194 -0.0100 94  GLU A C   
887  O  O   . GLU A 95  ? 0.1315 0.1333 0.2210 0.0258  -0.0166 -0.0097 94  GLU A O   
888  C  CB  . GLU A 95  ? 0.1671 0.1721 0.2227 0.0333  -0.0264 -0.0132 94  GLU A CB  
889  C  CG  . GLU A 95  ? 0.2418 0.2224 0.2650 0.0397  -0.0012 -0.0188 94  GLU A CG  
890  C  CD  . GLU A 95  ? 0.3461 0.2823 0.2992 0.0349  0.0123  0.0039  94  GLU A CD  
891  O  OE1 . GLU A 95  ? 0.4313 0.3544 0.3295 0.0056  0.0200  0.0113  94  GLU A OE1 
892  O  OE2 . GLU A 95  ? 0.4222 0.3566 0.3303 0.0476  -0.0278 0.0013  94  GLU A OE2 
893  N  N   . LYS A 96  ? 0.1177 0.1404 0.2380 0.0155  -0.0180 -0.0069 95  LYS A N   
894  C  CA  . LYS A 96  ? 0.1192 0.1379 0.2306 0.0206  -0.0074 -0.0036 95  LYS A CA  
895  C  C   . LYS A 96  ? 0.1168 0.1404 0.2376 0.0194  -0.0045 -0.0037 95  LYS A C   
896  O  O   . LYS A 96  ? 0.1171 0.1401 0.2564 0.0198  -0.0009 -0.0057 95  LYS A O   
897  C  CB  . LYS A 96  ? 0.1477 0.1481 0.2307 0.0260  -0.0029 0.0070  95  LYS A CB  
898  C  CG  . LYS A 96  ? 0.1841 0.1639 0.2533 0.0195  0.0011  0.0000  95  LYS A CG  
899  C  CD  . LYS A 96  ? 0.2556 0.2489 0.2789 0.0095  0.0097  0.0149  95  LYS A CD  
900  C  CE  . LYS A 96  ? 0.3028 0.3052 0.3026 0.0137  0.0043  0.0055  95  LYS A CE  
901  N  NZ  . LYS A 96  ? 0.3370 0.3119 0.3259 0.0043  0.0271  0.0112  95  LYS A NZ  
902  N  N   . GLY A 97  ? 0.1075 0.1296 0.2247 0.0141  -0.0040 0.0026  96  GLY A N   
903  C  CA  . GLY A 97  ? 0.1208 0.1340 0.2295 0.0040  0.0002  -0.0021 96  GLY A CA  
904  C  C   . GLY A 97  ? 0.1091 0.1202 0.2148 0.0216  0.0004  -0.0110 96  GLY A C   
905  O  O   . GLY A 97  ? 0.1143 0.1557 0.2238 0.0178  0.0162  -0.0145 96  GLY A O   
906  N  N   . GLU A 98  ? 0.1077 0.1308 0.2151 0.0194  -0.0025 -0.0052 97  GLU A N   
907  C  CA  . GLU A 98  ? 0.1108 0.1336 0.2025 0.0181  0.0009  -0.0095 97  GLU A CA  
908  C  C   . GLU A 98  ? 0.1203 0.1309 0.1932 0.0267  -0.0073 -0.0048 97  GLU A C   
909  O  O   . GLU A 98  ? 0.1096 0.1397 0.2135 0.0374  -0.0191 -0.0122 97  GLU A O   
910  C  CB  . GLU A 98  ? 0.1071 0.1322 0.2251 0.0267  -0.0009 -0.0121 97  GLU A CB  
911  C  CG  . GLU A 98  ? 0.1174 0.1456 0.2571 0.0293  0.0112  -0.0095 97  GLU A CG  
912  C  CD  . GLU A 98  ? 0.1490 0.1706 0.2837 0.0182  0.0002  -0.0090 97  GLU A CD  
913  O  OE1 . GLU A 98  ? 0.1432 0.1555 0.3188 0.0239  -0.0042 0.0028  97  GLU A OE1 
914  O  OE2 . GLU A 98  ? 0.2598 0.1634 0.3604 -0.0241 0.0100  -0.0267 97  GLU A OE2 
915  N  N   . ILE A 99  ? 0.1094 0.1280 0.1774 0.0077  -0.0050 -0.0197 98  ILE A N   
916  C  CA  . ILE A 99  ? 0.1035 0.1099 0.1508 0.0102  -0.0081 -0.0061 98  ILE A CA  
917  C  C   . ILE A 99  ? 0.1064 0.1070 0.1519 0.0188  -0.0034 -0.0128 98  ILE A C   
918  O  O   . ILE A 99  ? 0.1046 0.1116 0.1645 0.0130  -0.0016 -0.0225 98  ILE A O   
919  C  CB  . ILE A 99  ? 0.0919 0.1187 0.1543 0.0069  -0.0096 -0.0076 98  ILE A CB  
920  C  CG1 . ILE A 99  ? 0.1200 0.1377 0.1754 0.0168  0.0077  -0.0028 98  ILE A CG1 
921  C  CG2 . ILE A 99  ? 0.1266 0.1169 0.1736 0.0283  -0.0084 -0.0103 98  ILE A CG2 
922  C  CD1 . ILE A 99  ? 0.1329 0.1729 0.1541 0.0157  -0.0034 0.0079  98  ILE A CD1 
923  N  N   . THR A 100 ? 0.1047 0.1121 0.1423 0.0243  -0.0025 -0.0030 99  THR A N   
924  C  CA  . THR A 100 ? 0.1152 0.1295 0.1603 0.0205  -0.0116 0.0016  99  THR A CA  
925  C  C   . THR A 100 ? 0.1040 0.1256 0.1375 0.0204  -0.0095 0.0109  99  THR A C   
926  O  O   . THR A 100 ? 0.1043 0.1305 0.1475 0.0130  0.0020  0.0183  99  THR A O   
927  C  CB  . THR A 100 ? 0.1310 0.1346 0.1634 0.0193  -0.0119 0.0070  99  THR A CB  
928  O  OG1 . THR A 100 ? 0.1529 0.1476 0.1724 0.0135  -0.0317 -0.0013 99  THR A OG1 
929  C  CG2 . THR A 100 ? 0.1200 0.1733 0.2039 0.0361  -0.0187 0.0069  99  THR A CG2 
930  N  N   . SER A 101 ? 0.0856 0.1200 0.1285 0.0126  0.0057  0.0066  100 SER A N   
931  C  CA  . SER A 101 ? 0.1073 0.1054 0.1302 0.0103  -0.0041 0.0082  100 SER A CA  
932  C  C   . SER A 101 ? 0.1026 0.0937 0.1248 0.0055  0.0019  0.0013  100 SER A C   
933  O  O   . SER A 101 ? 0.0976 0.0882 0.1225 0.0067  0.0145  -0.0008 100 SER A O   
934  C  CB  . SER A 101 ? 0.1012 0.1146 0.1261 0.0069  -0.0046 0.0207  100 SER A CB  
935  O  OG  . SER A 101 ? 0.1462 0.1220 0.1300 0.0109  -0.0005 0.0018  100 SER A OG  
936  N  N   . LEU A 102 ? 0.0823 0.0886 0.1287 0.0082  0.0079  0.0041  101 LEU A N   
937  C  CA  . LEU A 102 ? 0.0917 0.0928 0.1116 0.0097  0.0097  0.0009  101 LEU A CA  
938  C  C   . LEU A 102 ? 0.0859 0.0943 0.1072 0.0089  0.0086  0.0025  101 LEU A C   
939  O  O   . LEU A 102 ? 0.0889 0.0837 0.1258 -0.0055 0.0176  0.0032  101 LEU A O   
940  C  CB  . LEU A 102 ? 0.0975 0.0969 0.1173 -0.0039 0.0156  -0.0086 101 LEU A CB  
941  C  CG  . LEU A 102 ? 0.1070 0.1255 0.1072 -0.0031 0.0058  -0.0007 101 LEU A CG  
942  C  CD1 . LEU A 102 ? 0.1084 0.1173 0.1204 -0.0075 -0.0021 -0.0025 101 LEU A CD1 
943  C  CD2 . LEU A 102 ? 0.1432 0.1411 0.1125 -0.0222 0.0003  0.0000  101 LEU A CD2 
944  N  N   . HIS A 103 ? 0.0780 0.0930 0.1008 0.0052  0.0106  -0.0027 102 HIS A N   
945  C  CA  . HIS A 103 ? 0.0822 0.1012 0.1171 0.0079  0.0101  0.0039  102 HIS A CA  
946  C  C   . HIS A 103 ? 0.0740 0.0996 0.1258 0.0140  0.0109  0.0023  102 HIS A C   
947  O  O   . HIS A 103 ? 0.0785 0.0964 0.1383 0.0014  0.0061  0.0157  102 HIS A O   
948  C  CB  . HIS A 103 ? 0.0835 0.1188 0.1422 0.0270  0.0191  -0.0137 102 HIS A CB  
949  C  CG  . HIS A 103 ? 0.1726 0.1465 0.1674 0.0088  0.0143  -0.0049 102 HIS A CG  
950  N  ND1 . HIS A 103 ? 0.1995 0.2092 0.2020 0.0178  0.0113  0.0039  102 HIS A ND1 
951  C  CD2 . HIS A 103 ? 0.1958 0.2135 0.2017 0.0203  0.0263  -0.0014 102 HIS A CD2 
952  C  CE1 . HIS A 103 ? 0.2232 0.1910 0.2056 -0.0070 -0.0066 0.0187  102 HIS A CE1 
953  N  NE2 . HIS A 103 ? 0.2453 0.1896 0.2009 -0.0038 -0.0007 0.0161  102 HIS A NE2 
954  N  N   . VAL A 104 ? 0.0785 0.0899 0.1148 0.0005  0.0090  0.0058  103 VAL A N   
955  C  CA  . VAL A 104 ? 0.0828 0.0993 0.1309 0.0030  0.0083  0.0032  103 VAL A CA  
956  C  C   . VAL A 104 ? 0.0848 0.0900 0.1413 -0.0013 0.0089  0.0075  103 VAL A C   
957  O  O   . VAL A 104 ? 0.0777 0.0936 0.1757 0.0000  0.0232  0.0152  103 VAL A O   
958  C  CB  . VAL A 104 ? 0.1214 0.1074 0.1358 -0.0105 -0.0032 0.0047  103 VAL A CB  
959  C  CG1 . VAL A 104 ? 0.1285 0.1400 0.1716 -0.0009 0.0011  -0.0166 103 VAL A CG1 
960  C  CG2 . VAL A 104 ? 0.1435 0.1485 0.1529 0.0150  -0.0070 0.0207  103 VAL A CG2 
961  N  N   . TYR A 105 ? 0.0803 0.0814 0.1368 -0.0040 0.0117  0.0104  104 TYR A N   
962  C  CA  . TYR A 105 ? 0.0899 0.0845 0.1361 0.0034  0.0074  0.0080  104 TYR A CA  
963  C  C   . TYR A 105 ? 0.0785 0.0806 0.1456 0.0038  0.0092  0.0095  104 TYR A C   
964  O  O   . TYR A 105 ? 0.1031 0.1005 0.1456 -0.0024 0.0073  0.0194  104 TYR A O   
965  C  CB  . TYR A 105 ? 0.0909 0.1009 0.1650 0.0051  0.0070  0.0007  104 TYR A CB  
966  C  CG  . TYR A 105 ? 0.1262 0.1042 0.1603 0.0075  0.0051  -0.0284 104 TYR A CG  
967  C  CD1 . TYR A 105 ? 0.1368 0.0932 0.1777 0.0084  0.0160  -0.0129 104 TYR A CD1 
968  C  CD2 . TYR A 105 ? 0.1614 0.1658 0.1585 0.0248  -0.0067 -0.0155 104 TYR A CD2 
969  C  CE1 . TYR A 105 ? 0.1375 0.1230 0.2011 0.0229  -0.0215 -0.0241 104 TYR A CE1 
970  C  CE2 . TYR A 105 ? 0.2157 0.2142 0.1514 0.0354  -0.0081 -0.0232 104 TYR A CE2 
971  C  CZ  . TYR A 105 ? 0.1852 0.2036 0.1846 0.0281  -0.0366 0.0062  104 TYR A CZ  
972  O  OH  . TYR A 105 ? 0.2209 0.2978 0.1995 0.0418  -0.0637 0.0002  104 TYR A OH  
973  N  N   . PHE A 106 ? 0.0964 0.0852 0.1487 0.0083  0.0070  0.0158  105 PHE A N   
974  C  CA  . PHE A 106 ? 0.0916 0.0888 0.1549 0.0032  0.0058  0.0175  105 PHE A CA  
975  C  C   . PHE A 106 ? 0.0995 0.1044 0.1764 0.0185  0.0079  0.0182  105 PHE A C   
976  O  O   . PHE A 106 ? 0.0906 0.1085 0.1529 0.0177  0.0129  0.0120  105 PHE A O   
977  C  CB  . PHE A 106 ? 0.0997 0.1016 0.1821 0.0030  0.0021  0.0164  105 PHE A CB  
978  C  CG  . PHE A 106 ? 0.1096 0.1053 0.1552 0.0083  -0.0073 -0.0062 105 PHE A CG  
979  C  CD1 . PHE A 106 ? 0.1177 0.1178 0.1830 0.0134  0.0085  -0.0100 105 PHE A CD1 
980  C  CD2 . PHE A 106 ? 0.1062 0.1196 0.1710 -0.0065 0.0044  -0.0076 105 PHE A CD2 
981  C  CE1 . PHE A 106 ? 0.1200 0.0946 0.1959 0.0074  0.0018  -0.0035 105 PHE A CE1 
982  C  CE2 . PHE A 106 ? 0.1281 0.1378 0.1966 -0.0056 -0.0122 -0.0130 105 PHE A CE2 
983  C  CZ  . PHE A 106 ? 0.1314 0.1212 0.1990 -0.0136 0.0026  -0.0122 105 PHE A CZ  
984  N  N   . ASP A 107 ? 0.0888 0.1098 0.1790 0.0217  0.0144  0.0239  106 ASP A N   
985  C  CA  . ASP A 107 ? 0.0923 0.1095 0.1975 0.0163  0.0050  0.0235  106 ASP A CA  
986  C  C   . ASP A 107 ? 0.0975 0.1114 0.2045 0.0176  0.0090  0.0120  106 ASP A C   
987  O  O   . ASP A 107 ? 0.1065 0.1426 0.2063 0.0067  -0.0004 0.0220  106 ASP A O   
988  C  CB  . ASP A 107 ? 0.1158 0.1281 0.2162 0.0103  0.0148  0.0196  106 ASP A CB  
989  C  CG  . ASP A 107 ? 0.1387 0.1405 0.2491 0.0004  0.0017  0.0121  106 ASP A CG  
990  O  OD1 . ASP A 107 ? 0.1205 0.1116 0.2366 0.0163  -0.0039 0.0123  106 ASP A OD1 
991  O  OD2 . ASP A 107 ? 0.1150 0.1192 0.3253 0.0416  0.0143  0.0402  106 ASP A OD2 
992  N  N   . PRO A 108 ? 0.0911 0.1254 0.1956 0.0075  0.0016  0.0074  107 PRO A N   
993  C  CA  . PRO A 108 ? 0.1138 0.1265 0.1933 0.0056  0.0081  0.0064  107 PRO A CA  
994  C  C   . PRO A 108 ? 0.1171 0.1281 0.2042 0.0006  -0.0020 0.0037  107 PRO A C   
995  O  O   . PRO A 108 ? 0.1219 0.1462 0.2309 0.0022  -0.0109 -0.0024 107 PRO A O   
996  C  CB  . PRO A 108 ? 0.1262 0.1160 0.1922 -0.0083 0.0068  0.0072  107 PRO A CB  
997  C  CG  . PRO A 108 ? 0.0858 0.1208 0.2055 0.0027  0.0046  0.0187  107 PRO A CG  
998  C  CD  . PRO A 108 ? 0.0882 0.1228 0.1942 0.0071  -0.0004 0.0066  107 PRO A CD  
999  N  N   . ARG A 109 ? 0.0991 0.1256 0.2324 0.0020  -0.0093 0.0177  108 ARG A N   
1000 C  CA  . ARG A 109 ? 0.1164 0.1367 0.2310 0.0036  -0.0136 0.0104  108 ARG A CA  
1001 C  C   . ARG A 109 ? 0.1441 0.1413 0.2428 0.0085  -0.0190 0.0179  108 ARG A C   
1002 O  O   . ARG A 109 ? 0.1268 0.1836 0.2678 0.0028  -0.0406 0.0242  108 ARG A O   
1003 C  CB  . ARG A 109 ? 0.1164 0.1322 0.2269 0.0069  -0.0159 0.0196  108 ARG A CB  
1004 C  CG  . ARG A 109 ? 0.1024 0.1357 0.2215 0.0052  -0.0086 0.0055  108 ARG A CG  
1005 C  CD  . ARG A 109 ? 0.1245 0.1513 0.2077 0.0025  -0.0064 0.0002  108 ARG A CD  
1006 N  NE  . ARG A 109 ? 0.1050 0.1116 0.2534 0.0135  -0.0074 0.0033  108 ARG A NE  
1007 C  CZ  . ARG A 109 ? 0.1047 0.1279 0.2140 0.0082  -0.0089 0.0114  108 ARG A CZ  
1008 N  NH1 . ARG A 109 ? 0.1259 0.1467 0.2562 0.0079  -0.0040 -0.0096 108 ARG A NH1 
1009 N  NH2 . ARG A 109 ? 0.1141 0.1343 0.2347 0.0088  -0.0114 0.0099  108 ARG A NH2 
1010 N  N   . PRO A 110 ? 0.1646 0.1691 0.2339 0.0201  -0.0200 0.0207  109 PRO A N   
1011 C  CA  . PRO A 110 ? 0.1966 0.1985 0.2482 0.0144  -0.0122 0.0146  109 PRO A CA  
1012 C  C   . PRO A 110 ? 0.2056 0.2107 0.2413 0.0175  -0.0270 0.0129  109 PRO A C   
1013 O  O   . PRO A 110 ? 0.2352 0.2504 0.2667 0.0384  -0.0513 0.0120  109 PRO A O   
1014 C  CB  . PRO A 110 ? 0.2001 0.1990 0.2376 0.0101  -0.0112 0.0196  109 PRO A CB  
1015 C  CG  . PRO A 110 ? 0.2163 0.1994 0.2393 0.0083  -0.0024 0.0203  109 PRO A CG  
1016 C  CD  . PRO A 110 ? 0.1804 0.1799 0.2380 0.0053  -0.0102 0.0203  109 PRO A CD  
1017 N  N   . LEU A 111 ? 0.1824 0.2047 0.2401 0.0244  -0.0288 0.0180  110 LEU A N   
1018 C  CA  . LEU A 111 ? 0.1963 0.2207 0.2502 0.0132  -0.0204 0.0056  110 LEU A CA  
1019 C  C   . LEU A 111 ? 0.1986 0.2255 0.2672 0.0076  -0.0323 -0.0025 110 LEU A C   
1020 O  O   . LEU A 111 ? 0.2105 0.2487 0.3037 0.0019  -0.0379 -0.0252 110 LEU A O   
1021 C  CB  . LEU A 111 ? 0.1844 0.2031 0.2379 0.0084  -0.0192 0.0049  110 LEU A CB  
1022 C  CG  . LEU A 111 ? 0.1789 0.1996 0.2326 0.0223  -0.0124 0.0102  110 LEU A CG  
1023 C  CD1 . LEU A 111 ? 0.2024 0.1854 0.2364 0.0232  -0.0215 0.0110  110 LEU A CD1 
1024 C  CD2 . LEU A 111 ? 0.2040 0.2619 0.2349 0.0211  -0.0144 0.0150  110 LEU A CD2 
1025 N  N   . PHE A 112 ? 0.1996 0.2536 0.2799 0.0011  -0.0320 -0.0015 111 PHE A N   
1026 C  CA  . PHE A 112 ? 0.2225 0.2632 0.2973 0.0012  -0.0184 0.0083  111 PHE A CA  
1027 C  C   . PHE A 112 ? 0.2597 0.3126 0.3375 0.0019  -0.0224 0.0080  111 PHE A C   
1028 O  O   . PHE A 112 ? 0.2776 0.3319 0.3686 -0.0056 -0.0308 0.0181  111 PHE A O   
1029 C  CB  . PHE A 112 ? 0.2100 0.2550 0.3042 0.0029  -0.0172 0.0045  111 PHE A CB  
1030 C  CG  . PHE A 112 ? 0.1633 0.1948 0.2651 -0.0006 -0.0033 0.0115  111 PHE A CG  
1031 C  CD1 . PHE A 112 ? 0.1668 0.2175 0.2487 -0.0081 0.0055  0.0041  111 PHE A CD1 
1032 C  CD2 . PHE A 112 ? 0.1708 0.1834 0.2625 -0.0192 -0.0041 0.0072  111 PHE A CD2 
1033 C  CE1 . PHE A 112 ? 0.1959 0.1767 0.2630 -0.0210 -0.0011 0.0110  111 PHE A CE1 
1034 C  CE2 . PHE A 112 ? 0.1616 0.1579 0.2544 -0.0232 0.0015  0.0047  111 PHE A CE2 
1035 C  CZ  . PHE A 112 ? 0.1867 0.1660 0.2331 -0.0099 -0.0126 0.0161  111 PHE A CZ  
1036 N  N   . GLU A 113 ? 0.2881 0.3376 0.3486 0.0038  -0.0209 0.0095  112 GLU A N   
1037 C  CA  . GLU A 113 ? 0.3229 0.3649 0.3769 0.0057  -0.0179 0.0026  112 GLU A CA  
1038 C  C   . GLU A 113 ? 0.3439 0.3770 0.4005 0.0006  -0.0202 0.0030  112 GLU A C   
1039 O  O   . GLU A 113 ? 0.3692 0.4052 0.4317 0.0003  -0.0250 -0.0056 112 GLU A O   
1040 C  CB  . GLU A 113 ? 0.3359 0.3715 0.3904 -0.0008 -0.0137 -0.0030 112 GLU A CB  
1041 O  O   . HOH B .   ? 0.3725 0.4516 0.4621 -0.0016 0.0273  -0.0029 114 HOH A O   
1042 O  O   . HOH B .   ? 0.3829 0.4398 0.4313 0.0203  0.0337  -0.0371 115 HOH A O   
1043 O  O   . HOH B .   ? 0.4254 0.4666 0.4804 -0.0088 0.0047  0.0085  116 HOH A O   
1044 O  O   . HOH B .   ? 0.4538 0.4286 0.3733 -0.0013 -0.0228 -0.0053 117 HOH A O   
1045 O  O   . HOH B .   ? 0.4701 0.4446 0.4207 -0.0016 0.0255  -0.0174 118 HOH A O   
1046 O  O   . HOH B .   ? 0.3780 0.3576 0.4839 -0.0331 0.0115  0.0093  119 HOH A O   
1047 O  O   . HOH B .   ? 0.4657 0.4307 0.4441 0.0117  -0.0297 -0.0104 120 HOH A O   
1048 O  O   . HOH B .   ? 0.4564 0.4607 0.4632 -0.0460 -0.0171 -0.0043 121 HOH A O   
1049 O  O   . HOH B .   ? 0.4864 0.4898 0.4513 -0.0060 -0.0028 -0.0313 122 HOH A O   
1050 O  O   . HOH B .   ? 0.3793 0.4056 0.4651 -0.0174 0.0034  0.0129  123 HOH A O   
1051 O  O   . HOH B .   ? 0.3360 0.4407 0.4710 0.0078  -0.0329 -0.0031 124 HOH A O   
1052 O  O   . HOH B .   ? 0.3923 0.4798 0.4382 -0.0139 -0.0185 -0.0008 125 HOH A O   
1053 O  O   . HOH B .   ? 0.4243 0.4823 0.4393 -0.0154 0.0068  -0.0095 126 HOH A O   
1054 O  O   . HOH B .   ? 0.4280 0.4744 0.4444 -0.0143 0.0128  0.0182  127 HOH A O   
1055 O  O   . HOH B .   ? 0.4564 0.4836 0.4523 0.0019  -0.0016 0.0014  128 HOH A O   
1056 O  O   . HOH B .   ? 0.4245 0.4856 0.4709 0.0126  -0.0450 0.0086  129 HOH A O   
1057 O  O   . HOH B .   ? 0.4404 0.4882 0.4706 0.0014  0.0235  0.0045  130 HOH A O   
1058 O  O   . HOH B .   ? 0.4631 0.4636 0.4939 0.0143  0.0056  0.0050  131 HOH A O   
1059 O  O   . HOH B .   ? 0.4544 0.4232 0.4520 0.0026  0.0128  -0.0030 132 HOH A O   
1060 O  O   . HOH B .   ? 0.4786 0.4548 0.4284 0.0007  0.0167  -0.0112 133 HOH A O   
1061 O  O   . HOH B .   ? 0.3989 0.4420 0.4598 0.0001  0.0083  -0.0138 134 HOH A O   
1062 O  O   . HOH B .   ? 0.3987 0.4496 0.4444 -0.0225 -0.0169 0.0113  135 HOH A O   
1063 O  O   . HOH B .   ? 0.4995 0.4476 0.4801 -0.0076 0.0031  0.0158  136 HOH A O   
1064 O  O   . HOH B .   ? 0.5117 0.5228 0.4533 -0.0052 -0.0134 0.0032  137 HOH A O   
1065 O  O   A HOH B .   ? 0.1328 0.0733 0.1505 0.0038  0.0156  0.0448  138 HOH A O   
1066 O  O   B HOH B .   ? 0.1345 0.1195 0.2317 0.0022  -0.0496 0.0000  138 HOH A O   
1067 O  O   . HOH B .   ? 0.4479 0.4722 0.5351 0.0058  -0.0041 0.0009  139 HOH A O   
1068 O  O   . HOH B .   ? 0.5006 0.4829 0.3569 -0.0022 0.0337  0.0058  140 HOH A O   
1069 O  O   . HOH B .   ? 0.4797 0.5084 0.4519 0.0134  -0.0261 0.0083  141 HOH A O   
1070 O  O   . HOH B .   ? 0.4679 0.3883 0.5132 -0.0493 -0.0011 -0.0073 142 HOH A O   
1071 O  O   . HOH B .   ? 0.5080 0.4482 0.4483 0.0119  0.0005  0.0205  143 HOH A O   
1072 O  O   . HOH B .   ? 0.4855 0.4963 0.5722 0.0233  -0.0032 0.0134  144 HOH A O   
1073 O  O   A HOH B .   ? 0.1597 0.1444 0.1143 -0.0434 0.0373  -0.0176 145 HOH A O   
1074 O  O   B HOH B .   ? 0.1814 0.1368 0.1274 0.0065  -0.0323 -0.0155 145 HOH A O   
1075 O  O   A HOH B .   ? 0.2997 0.2012 0.2019 -0.0054 0.0225  -0.0269 146 HOH A O   
1076 O  O   B HOH B .   ? 0.1212 0.0993 0.1656 -0.0049 0.0033  0.0156  146 HOH A O   
1077 O  O   A HOH B .   ? 0.1636 0.1104 0.1388 0.0106  0.0346  0.0140  147 HOH A O   
1078 O  O   B HOH B .   ? 0.3237 0.2967 0.2832 -0.0195 -0.0116 0.0061  147 HOH A O   
1079 O  O   . HOH B .   ? 0.6142 0.5730 0.5595 -0.0069 0.0003  -0.0043 148 HOH A O   
1080 O  O   . HOH B .   ? 0.5259 0.5225 0.4898 -0.0153 -0.0257 0.0060  149 HOH A O   
1081 O  O   . HOH B .   ? 0.1465 0.1360 0.1192 0.0204  0.0054  0.0149  150 HOH A O   
1082 O  O   . HOH B .   ? 0.1867 0.1337 0.1310 0.0093  0.0052  -0.0012 151 HOH A O   
1083 O  O   . HOH B .   ? 0.1713 0.1100 0.2162 0.0100  0.0133  0.0302  152 HOH A O   
1084 O  O   . HOH B .   ? 0.1336 0.1972 0.2056 0.0049  0.0439  0.0249  153 HOH A O   
1085 O  O   . HOH B .   ? 0.1653 0.1288 0.2937 -0.0117 0.0067  -0.0083 154 HOH A O   
1086 O  O   . HOH B .   ? 0.1266 0.2491 0.1844 -0.0624 0.0238  -0.0496 155 HOH A O   
1087 O  O   . HOH B .   ? 0.1638 0.1398 0.3055 0.0012  0.0479  -0.0191 156 HOH A O   
1088 O  O   . HOH B .   ? 0.1821 0.1693 0.2483 -0.0489 -0.0275 0.0001  157 HOH A O   
1089 O  O   . HOH B .   ? 0.1716 0.1913 0.2530 0.0251  -0.0077 0.0951  158 HOH A O   
1090 O  O   . HOH B .   ? 0.1506 0.1795 0.2868 0.0071  -0.0167 -0.0224 159 HOH A O   
1091 O  O   . HOH B .   ? 0.1419 0.1876 0.3077 0.0279  0.0030  0.0094  160 HOH A O   
1092 O  O   . HOH B .   ? 0.2000 0.1596 0.2902 -0.0291 0.0019  0.0293  161 HOH A O   
1093 O  O   . HOH B .   ? 0.2137 0.1948 0.2640 0.0101  -0.0050 0.0193  162 HOH A O   
1094 O  O   . HOH B .   ? 0.2127 0.2901 0.1860 -0.0274 0.0160  -0.0661 163 HOH A O   
1095 O  O   . HOH B .   ? 0.2731 0.2078 0.2370 -0.0026 0.0146  -0.0256 164 HOH A O   
1096 O  O   . HOH B .   ? 0.2447 0.3354 0.1631 0.0193  -0.0226 0.0335  165 HOH A O   
1097 O  O   . HOH B .   ? 0.2145 0.2161 0.3930 -0.0180 0.0051  -0.0054 166 HOH A O   
1098 O  O   . HOH B .   ? 0.3073 0.2068 0.2099 -0.0005 0.0013  0.0382  167 HOH A O   
1099 O  O   . HOH B .   ? 0.1850 0.3141 0.2382 0.0406  -0.0050 0.0057  168 HOH A O   
1100 O  O   . HOH B .   ? 0.1066 0.2289 0.3721 -0.0096 0.0289  -0.0326 169 HOH A O   
1101 O  O   . HOH B .   ? 0.2720 0.1678 0.3562 -0.0173 -0.0276 0.0202  170 HOH A O   
1102 O  O   . HOH B .   ? 0.2711 0.2436 0.2150 0.0243  0.0710  0.0369  171 HOH A O   
1103 O  O   . HOH B .   ? 0.2578 0.2737 0.2193 -0.0117 -0.0207 0.0461  172 HOH A O   
1104 O  O   . HOH B .   ? 0.3429 0.2076 0.2239 0.0163  0.0317  0.0014  173 HOH A O   
1105 O  O   . HOH B .   ? 0.2449 0.3182 0.1971 -0.0032 -0.0170 0.0280  174 HOH A O   
1106 O  O   . HOH B .   ? 0.3415 0.2250 0.2406 0.0334  -0.0798 -0.0257 175 HOH A O   
1107 O  O   . HOH B .   ? 0.2018 0.2648 0.3259 0.0063  0.0328  -0.0641 176 HOH A O   
1108 O  O   . HOH B .   ? 0.2088 0.2678 0.3545 -0.0254 0.0241  -0.0228 177 HOH A O   
1109 O  O   . HOH B .   ? 0.2950 0.3435 0.2097 0.0098  0.0100  -0.0310 178 HOH A O   
1110 O  O   . HOH B .   ? 0.3238 0.3822 0.2590 0.0238  -0.0234 -0.0529 179 HOH A O   
1111 O  O   . HOH B .   ? 0.2511 0.2904 0.3053 0.0086  -0.0190 -0.0198 180 HOH A O   
1112 O  O   . HOH B .   ? 0.2362 0.2841 0.2929 0.0162  0.0325  -0.0004 181 HOH A O   
1113 O  O   . HOH B .   ? 0.2707 0.2818 0.2592 0.0225  0.0388  -0.0165 182 HOH A O   
1114 O  O   . HOH B .   ? 0.2531 0.3043 0.3435 -0.0041 -0.0323 -0.0162 183 HOH A O   
1115 O  O   . HOH B .   ? 0.2539 0.2764 0.3400 -0.0248 -0.0346 -0.0296 184 HOH A O   
1116 O  O   . HOH B .   ? 0.2961 0.3278 0.2758 -0.0292 -0.0495 0.0813  185 HOH A O   
1117 O  O   . HOH B .   ? 0.3432 0.2905 0.2786 -0.0224 -0.0161 -0.0227 186 HOH A O   
1118 O  O   . HOH B .   ? 0.2799 0.3417 0.2943 -0.0314 0.0078  0.0474  187 HOH A O   
1119 O  O   . HOH B .   ? 0.2361 0.3797 0.2685 -0.0470 0.0241  -0.0925 188 HOH A O   
1120 O  O   . HOH B .   ? 0.2645 0.4026 0.2567 -0.0149 -0.0065 0.0263  189 HOH A O   
1121 O  O   . HOH B .   ? 0.2503 0.3656 0.3491 -0.0509 0.0305  0.0139  190 HOH A O   
1122 O  O   . HOH B .   ? 0.2792 0.2776 0.3760 0.0017  0.0044  0.0429  191 HOH A O   
1123 O  O   . HOH B .   ? 0.3620 0.3225 0.2939 0.0486  0.0184  0.0097  192 HOH A O   
1124 O  O   . HOH B .   ? 0.3371 0.2341 0.3624 -0.0085 0.0463  0.0171  193 HOH A O   
1125 O  O   . HOH B .   ? 0.2896 0.3064 0.2986 0.0249  0.0141  0.0529  194 HOH A O   
1126 O  O   . HOH B .   ? 0.2882 0.2821 0.3533 -0.0254 -0.0241 0.0067  195 HOH A O   
1127 O  O   . HOH B .   ? 0.2663 0.4217 0.2375 -0.0703 -0.0128 0.0004  196 HOH A O   
1128 O  O   . HOH B .   ? 0.3619 0.3118 0.3343 -0.0047 -0.0014 0.0168  197 HOH A O   
1129 O  O   . HOH B .   ? 0.3717 0.3388 0.2350 0.0168  -0.0260 -0.0303 198 HOH A O   
1130 O  O   . HOH B .   ? 0.3005 0.2995 0.3496 -0.0127 -0.0639 0.0489  199 HOH A O   
1131 O  O   . HOH B .   ? 0.3490 0.4245 0.2170 0.0107  -0.0134 0.0310  200 HOH A O   
1132 O  O   . HOH B .   ? 0.3556 0.3250 0.3643 -0.0461 -0.0144 0.0067  201 HOH A O   
1133 O  O   . HOH B .   ? 0.3914 0.2910 0.2970 -0.0226 -0.0191 -0.0802 202 HOH A O   
1134 O  O   . HOH B .   ? 0.3537 0.2399 0.3685 0.0062  0.0007  -0.0159 203 HOH A O   
1135 O  O   . HOH B .   ? 0.3716 0.2709 0.3360 -0.0172 -0.0295 -0.0242 204 HOH A O   
1136 O  O   . HOH B .   ? 0.2291 0.3218 0.4134 -0.0036 0.0071  -0.0399 205 HOH A O   
1137 O  O   . HOH B .   ? 0.3315 0.3079 0.3277 0.0026  0.0059  0.0618  206 HOH A O   
1138 O  O   . HOH B .   ? 0.3271 0.3659 0.2829 -0.0384 -0.0536 -0.0032 207 HOH A O   
1139 O  O   . HOH B .   ? 0.4060 0.3785 0.2528 0.0020  -0.0012 -0.0053 208 HOH A O   
1140 O  O   . HOH B .   ? 0.3017 0.3029 0.3671 -0.0277 0.0175  0.0683  209 HOH A O   
1141 O  O   . HOH B .   ? 0.2978 0.4034 0.2939 -0.0323 0.0105  -0.0183 210 HOH A O   
1142 O  O   . HOH B .   ? 0.3987 0.3320 0.3043 -0.0259 0.0102  0.0262  211 HOH A O   
1143 O  O   . HOH B .   ? 0.1765 0.2985 0.3070 -0.0200 0.0151  0.0057  212 HOH A O   
1144 O  O   . HOH B .   ? 0.3437 0.4005 0.3269 -0.0101 -0.0499 -0.0289 213 HOH A O   
1145 O  O   . HOH B .   ? 0.3667 0.2566 0.3406 0.0054  0.0069  0.0349  214 HOH A O   
1146 O  O   . HOH B .   ? 0.2964 0.4756 0.2845 0.0153  -0.0115 -0.0177 215 HOH A O   
1147 O  O   . HOH B .   ? 0.3698 0.3802 0.2836 -0.0027 -0.0448 0.0226  216 HOH A O   
1148 O  O   . HOH B .   ? 0.3792 0.2946 0.3030 -0.0042 -0.0459 -0.0392 217 HOH A O   
1149 O  O   . HOH B .   ? 0.3668 0.3726 0.3434 -0.0094 -0.0483 0.0243  218 HOH A O   
1150 O  O   . HOH B .   ? 0.3729 0.3328 0.3259 -0.0252 0.0200  -0.0343 219 HOH A O   
1151 O  O   . HOH B .   ? 0.3668 0.3526 0.3153 -0.0031 -0.0161 -0.0020 220 HOH A O   
1152 O  O   . HOH B .   ? 0.3380 0.3096 0.3800 0.0236  -0.0273 0.0565  221 HOH A O   
1153 O  O   . HOH B .   ? 0.3843 0.3010 0.4248 -0.0271 0.0109  -0.0297 222 HOH A O   
1154 O  O   . HOH B .   ? 0.3581 0.3975 0.2319 -0.0445 -0.0354 -0.0292 223 HOH A O   
1155 O  O   . HOH B .   ? 0.3931 0.3747 0.3286 0.0025  0.0311  -0.0296 224 HOH A O   
1156 O  O   . HOH B .   ? 0.3669 0.3184 0.3442 0.0099  0.0116  -0.0086 225 HOH A O   
1157 O  O   . HOH B .   ? 0.3737 0.3408 0.3873 0.0181  0.0037  -0.0488 226 HOH A O   
1158 O  O   . HOH B .   ? 0.3084 0.3405 0.4048 -0.0386 -0.0652 -0.0276 227 HOH A O   
1159 O  O   . HOH B .   ? 0.3769 0.3446 0.3936 0.0144  -0.0039 0.0182  228 HOH A O   
1160 O  O   . HOH B .   ? 0.3698 0.3475 0.3353 0.0336  -0.0072 -0.0164 229 HOH A O   
1161 O  O   . HOH B .   ? 0.2153 0.1486 0.1457 0.0048  -0.0030 0.0466  230 HOH A O   
1162 O  O   . HOH B .   ? 0.3289 0.4542 0.2878 -0.0095 0.0314  0.0115  231 HOH A O   
1163 O  O   . HOH B .   ? 0.4350 0.3088 0.3462 0.0264  -0.0186 0.0136  232 HOH A O   
1164 O  O   . HOH B .   ? 0.3847 0.4248 0.3024 -0.0200 -0.0305 0.0131  233 HOH A O   
1165 O  O   . HOH B .   ? 0.3290 0.3525 0.3722 -0.0125 -0.0419 -0.0480 234 HOH A O   
1166 O  O   . HOH B .   ? 0.3128 0.4040 0.3934 0.0243  -0.0233 -0.0093 235 HOH A O   
1167 O  O   . HOH B .   ? 0.3962 0.3523 0.3914 -0.0287 -0.0219 -0.0273 236 HOH A O   
1168 O  O   . HOH B .   ? 0.6398 0.6407 0.6330 0.0084  -0.0042 0.0042  237 HOH A O   
1169 O  O   . HOH B .   ? 0.2654 0.3502 0.3655 -0.0140 0.0121  0.0168  238 HOH A O   
1170 O  O   . HOH B .   ? 0.4214 0.3512 0.3593 -0.0179 -0.0295 0.0215  239 HOH A O   
1171 O  O   . HOH B .   ? 0.4065 0.3691 0.3908 -0.0468 0.0293  -0.0458 240 HOH A O   
1172 O  O   . HOH B .   ? 0.4360 0.3736 0.3991 0.0087  -0.0147 0.0014  241 HOH A O   
1173 O  O   . HOH B .   ? 0.3413 0.4280 0.4175 -0.0183 -0.0218 0.0232  242 HOH A O   
1174 O  O   . HOH B .   ? 0.4913 0.5259 0.4267 0.0044  -0.0236 -0.0123 243 HOH A O   
1175 O  O   . HOH B .   ? 0.4276 0.3499 0.3852 -0.0330 -0.0227 -0.0025 244 HOH A O   
1176 O  O   . HOH B .   ? 0.3509 0.4618 0.4026 0.0115  -0.0132 0.0026  245 HOH A O   
1177 O  O   . HOH B .   ? 0.3794 0.4497 0.3848 -0.0241 -0.0033 0.0124  246 HOH A O   
1178 O  O   . HOH B .   ? 0.3901 0.3670 0.4060 0.0351  0.0252  0.0319  247 HOH A O   
1179 O  O   . HOH B .   ? 0.2984 0.4205 0.3856 -0.0017 -0.0189 0.0667  248 HOH A O   
1180 O  O   . HOH B .   ? 0.4696 0.4197 0.2497 0.0058  -0.0043 0.0647  249 HOH A O   
1181 O  O   . HOH B .   ? 0.4142 0.4183 0.4363 -0.0089 0.0117  -0.0014 250 HOH A O   
1182 O  O   . HOH B .   ? 0.4749 0.3547 0.4176 -0.0724 0.0052  -0.0167 251 HOH A O   
1183 O  O   . HOH B .   ? 0.4113 0.3471 0.4500 0.0086  0.0040  -0.0472 252 HOH A O   
1184 O  O   . HOH B .   ? 0.4135 0.3914 0.3993 0.0135  -0.0032 -0.0556 253 HOH A O   
1185 O  O   . HOH B .   ? 0.4100 0.3611 0.4161 0.0046  0.0170  0.0126  254 HOH A O   
1186 O  O   . HOH B .   ? 0.4132 0.4261 0.4488 -0.0154 0.0104  -0.0020 255 HOH A O   
1187 O  O   . HOH B .   ? 0.4053 0.4421 0.4523 0.0009  0.0260  -0.0242 256 HOH A O   
1188 O  O   . HOH B .   ? 0.3846 0.4710 0.4217 -0.0045 0.0090  0.0248  257 HOH A O   
1189 O  O   . HOH B .   ? 0.3847 0.4068 0.3781 0.0660  0.0139  0.0068  258 HOH A O   
1190 O  O   . HOH B .   ? 0.3970 0.4626 0.3651 0.0060  0.0023  0.0163  259 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   ?   ?   ?   A . n 
A 1 2   MSE 2   1   1   MSE MSE A . n 
A 1 3   LYS 3   2   2   LYS LYS A . n 
A 1 4   THR 4   3   3   THR THR A . n 
A 1 5   GLN 5   4   4   GLN GLN A . n 
A 1 6   ILE 6   5   5   ILE ILE A . n 
A 1 7   THR 7   6   6   THR THR A . n 
A 1 8   THR 8   7   7   THR THR A . n 
A 1 9   ARG 9   8   8   ARG ARG A . n 
A 1 10  ASP 10  9   9   ASP ASP A . n 
A 1 11  LEU 11  10  10  LEU LEU A . n 
A 1 12  VAL 12  11  11  VAL VAL A . n 
A 1 13  LEU 13  12  12  LEU LEU A . n 
A 1 14  GLU 14  13  13  GLU GLU A . n 
A 1 15  PHE 15  14  14  PHE PHE A . n 
A 1 16  ILE 16  15  15  ILE ILE A . n 
A 1 17  HIS 17  16  16  HIS HIS A . n 
A 1 18  ALA 18  17  17  ALA ALA A . n 
A 1 19  LEU 19  18  18  LEU LEU A . n 
A 1 20  ASN 20  19  19  ASN ASN A . n 
A 1 21  THR 21  20  20  THR THR A . n 
A 1 22  GLU 22  21  21  GLU GLU A . n 
A 1 23  ASN 23  22  22  ASN ASN A . n 
A 1 24  PHE 24  23  23  PHE PHE A . n 
A 1 25  PRO 25  24  24  PRO PRO A . n 
A 1 26  ALA 26  25  25  ALA ALA A . n 
A 1 27  ALA 27  26  26  ALA ALA A . n 
A 1 28  LYS 28  27  27  LYS LYS A . n 
A 1 29  LYS 29  28  28  LYS LYS A . n 
A 1 30  ARG 30  29  29  ARG ARG A . n 
A 1 31  LEU 31  30  30  LEU LEU A . n 
A 1 32  ASN 32  31  31  ASN ASN A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  ASN 34  33  33  ASN ASN A . n 
A 1 35  PHE 35  34  34  PHE PHE A . n 
A 1 36  THR 36  35  35  THR THR A . n 
A 1 37  PHE 37  36  36  PHE PHE A . n 
A 1 38  ASN 38  37  37  ASN ASN A . n 
A 1 39  GLY 39  38  38  GLY GLY A . n 
A 1 40  PRO 40  39  39  PRO PRO A . n 
A 1 41  MSE 41  40  40  MSE MSE A . n 
A 1 42  GLY 42  41  41  GLY GLY A . n 
A 1 43  HIS 43  42  42  HIS HIS A . n 
A 1 44  ARG 44  43  43  ARG ARG A . n 
A 1 45  GLU 45  44  44  GLU GLU A . n 
A 1 46  GLY 46  45  45  GLY GLY A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ARG 49  48  48  ARG ARG A . n 
A 1 50  TYR 50  49  49  TYR TYR A . n 
A 1 51  MSE 51  50  50  MSE MSE A . n 
A 1 52  ASN 52  51  51  ASN ASN A . n 
A 1 53  ASP 53  52  52  ASP ASP A . n 
A 1 54  MSE 54  53  53  MSE MSE A . n 
A 1 55  GLU 55  54  54  GLU GLU A . n 
A 1 56  LYS 56  55  55  LYS LYS A . n 
A 1 57  MSE 57  56  56  MSE MSE A . n 
A 1 58  LYS 58  57  57  LYS LYS A . n 
A 1 59  PHE 59  58  58  PHE PHE A . n 
A 1 60  LYS 60  59  59  LYS LYS A . n 
A 1 61  TYR 61  60  60  TYR TYR A . n 
A 1 62  VAL 62  61  61  VAL VAL A . n 
A 1 63  VAL 63  62  62  VAL VAL A . n 
A 1 64  HIS 64  63  63  HIS HIS A . n 
A 1 65  LYS 65  64  64  LYS LYS A . n 
A 1 66  MSE 66  65  65  MSE MSE A . n 
A 1 67  PHE 67  66  66  PHE PHE A . n 
A 1 68  GLU 68  67  67  GLU GLU A . n 
A 1 69  GLU 69  68  68  GLU GLU A . n 
A 1 70  GLY 70  69  69  GLY GLY A . n 
A 1 71  ASN 71  70  70  ASN ASN A . n 
A 1 72  ASP 72  71  71  ASP ASP A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  CYS 74  73  73  CYS CYS A . n 
A 1 75  LEU 75  74  74  LEU LEU A . n 
A 1 76  ILE 76  75  75  ILE ILE A . n 
A 1 77  TYR 77  76  76  TYR TYR A . n 
A 1 78  ASP 78  77  77  ASP ASP A . n 
A 1 79  ILE 79  78  78  ILE ILE A . n 
A 1 80  ASN 80  79  79  ASN ASN A . n 
A 1 81  MSE 81  80  80  MSE MSE A . n 
A 1 82  ASN 82  81  81  ASN ASN A . n 
A 1 83  GLY 83  82  82  GLY GLY A . n 
A 1 84  LYS 84  83  83  LYS LYS A . n 
A 1 85  THR 85  84  84  THR THR A . n 
A 1 86  ILE 86  85  85  ILE ILE A . n 
A 1 87  ALA 87  86  86  ALA ALA A . n 
A 1 88  ALA 88  87  87  ALA ALA A . n 
A 1 89  SER 89  88  88  SER SER A . n 
A 1 90  GLY 90  89  89  GLY GLY A . n 
A 1 91  LEU 91  90  90  LEU LEU A . n 
A 1 92  TYR 92  91  91  TYR TYR A . n 
A 1 93  HIS 93  92  92  HIS HIS A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  GLU 95  94  94  GLU GLU A . n 
A 1 96  LYS 96  95  95  LYS LYS A . n 
A 1 97  GLY 97  96  96  GLY GLY A . n 
A 1 98  GLU 98  97  97  GLU GLU A . n 
A 1 99  ILE 99  98  98  ILE ILE A . n 
A 1 100 THR 100 99  99  THR THR A . n 
A 1 101 SER 101 100 100 SER SER A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 HIS 103 102 102 HIS HIS A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 TYR 105 104 104 TYR TYR A . n 
A 1 106 PHE 106 105 105 PHE PHE A . n 
A 1 107 ASP 107 106 106 ASP ASP A . n 
A 1 108 PRO 108 107 107 PRO PRO A . n 
A 1 109 ARG 109 108 108 ARG ARG A . n 
A 1 110 PRO 110 109 109 PRO PRO A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 PHE 112 111 111 PHE PHE A . n 
A 1 113 GLU 113 112 112 GLU GLU A . n 
A 1 114 GLU 114 113 ?   ?   ?   A . n 
# 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Joint Center for Structural Genomics' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     JCSG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   114 114 HOH HOH A . 
B 2 HOH 2   115 115 HOH HOH A . 
B 2 HOH 3   116 116 HOH HOH A . 
B 2 HOH 4   117 117 HOH HOH A . 
B 2 HOH 5   118 118 HOH HOH A . 
B 2 HOH 6   119 119 HOH HOH A . 
B 2 HOH 7   120 120 HOH HOH A . 
B 2 HOH 8   121 121 HOH HOH A . 
B 2 HOH 9   122 122 HOH HOH A . 
B 2 HOH 10  123 123 HOH HOH A . 
B 2 HOH 11  124 124 HOH HOH A . 
B 2 HOH 12  125 125 HOH HOH A . 
B 2 HOH 13  126 126 HOH HOH A . 
B 2 HOH 14  127 127 HOH HOH A . 
B 2 HOH 15  128 128 HOH HOH A . 
B 2 HOH 16  129 129 HOH HOH A . 
B 2 HOH 17  130 130 HOH HOH A . 
B 2 HOH 18  131 131 HOH HOH A . 
B 2 HOH 19  132 132 HOH HOH A . 
B 2 HOH 20  133 133 HOH HOH A . 
B 2 HOH 21  134 134 HOH HOH A . 
B 2 HOH 22  135 135 HOH HOH A . 
B 2 HOH 23  136 136 HOH HOH A . 
B 2 HOH 24  137 137 HOH HOH A . 
B 2 HOH 25  138 138 HOH HOH A . 
B 2 HOH 26  139 139 HOH HOH A . 
B 2 HOH 27  140 140 HOH HOH A . 
B 2 HOH 28  141 141 HOH HOH A . 
B 2 HOH 29  142 142 HOH HOH A . 
B 2 HOH 30  143 143 HOH HOH A . 
B 2 HOH 31  144 144 HOH HOH A . 
B 2 HOH 32  145 145 HOH HOH A . 
B 2 HOH 33  146 146 HOH HOH A . 
B 2 HOH 34  147 147 HOH HOH A . 
B 2 HOH 35  148 1   HOH HOH A . 
B 2 HOH 36  149 2   HOH HOH A . 
B 2 HOH 37  150 3   HOH HOH A . 
B 2 HOH 38  151 4   HOH HOH A . 
B 2 HOH 39  152 5   HOH HOH A . 
B 2 HOH 40  153 6   HOH HOH A . 
B 2 HOH 41  154 7   HOH HOH A . 
B 2 HOH 42  155 8   HOH HOH A . 
B 2 HOH 43  156 9   HOH HOH A . 
B 2 HOH 44  157 10  HOH HOH A . 
B 2 HOH 45  158 11  HOH HOH A . 
B 2 HOH 46  159 12  HOH HOH A . 
B 2 HOH 47  160 13  HOH HOH A . 
B 2 HOH 48  161 14  HOH HOH A . 
B 2 HOH 49  162 15  HOH HOH A . 
B 2 HOH 50  163 16  HOH HOH A . 
B 2 HOH 51  164 17  HOH HOH A . 
B 2 HOH 52  165 18  HOH HOH A . 
B 2 HOH 53  166 19  HOH HOH A . 
B 2 HOH 54  167 20  HOH HOH A . 
B 2 HOH 55  168 21  HOH HOH A . 
B 2 HOH 56  169 22  HOH HOH A . 
B 2 HOH 57  170 23  HOH HOH A . 
B 2 HOH 58  171 24  HOH HOH A . 
B 2 HOH 59  172 25  HOH HOH A . 
B 2 HOH 60  173 26  HOH HOH A . 
B 2 HOH 61  174 27  HOH HOH A . 
B 2 HOH 62  175 28  HOH HOH A . 
B 2 HOH 63  176 29  HOH HOH A . 
B 2 HOH 64  177 30  HOH HOH A . 
B 2 HOH 65  178 31  HOH HOH A . 
B 2 HOH 66  179 32  HOH HOH A . 
B 2 HOH 67  180 33  HOH HOH A . 
B 2 HOH 68  181 34  HOH HOH A . 
B 2 HOH 69  182 35  HOH HOH A . 
B 2 HOH 70  183 36  HOH HOH A . 
B 2 HOH 71  184 37  HOH HOH A . 
B 2 HOH 72  185 38  HOH HOH A . 
B 2 HOH 73  186 39  HOH HOH A . 
B 2 HOH 74  187 40  HOH HOH A . 
B 2 HOH 75  188 41  HOH HOH A . 
B 2 HOH 76  189 42  HOH HOH A . 
B 2 HOH 77  190 43  HOH HOH A . 
B 2 HOH 78  191 44  HOH HOH A . 
B 2 HOH 79  192 45  HOH HOH A . 
B 2 HOH 80  193 46  HOH HOH A . 
B 2 HOH 81  194 47  HOH HOH A . 
B 2 HOH 82  195 48  HOH HOH A . 
B 2 HOH 83  196 49  HOH HOH A . 
B 2 HOH 84  197 50  HOH HOH A . 
B 2 HOH 85  198 51  HOH HOH A . 
B 2 HOH 86  199 52  HOH HOH A . 
B 2 HOH 87  200 53  HOH HOH A . 
B 2 HOH 88  201 54  HOH HOH A . 
B 2 HOH 89  202 55  HOH HOH A . 
B 2 HOH 90  203 56  HOH HOH A . 
B 2 HOH 91  204 57  HOH HOH A . 
B 2 HOH 92  205 58  HOH HOH A . 
B 2 HOH 93  206 59  HOH HOH A . 
B 2 HOH 94  207 60  HOH HOH A . 
B 2 HOH 95  208 61  HOH HOH A . 
B 2 HOH 96  209 62  HOH HOH A . 
B 2 HOH 97  210 63  HOH HOH A . 
B 2 HOH 98  211 64  HOH HOH A . 
B 2 HOH 99  212 65  HOH HOH A . 
B 2 HOH 100 213 66  HOH HOH A . 
B 2 HOH 101 214 67  HOH HOH A . 
B 2 HOH 102 215 68  HOH HOH A . 
B 2 HOH 103 216 70  HOH HOH A . 
B 2 HOH 104 217 71  HOH HOH A . 
B 2 HOH 105 218 72  HOH HOH A . 
B 2 HOH 106 219 73  HOH HOH A . 
B 2 HOH 107 220 74  HOH HOH A . 
B 2 HOH 108 221 75  HOH HOH A . 
B 2 HOH 109 222 76  HOH HOH A . 
B 2 HOH 110 223 77  HOH HOH A . 
B 2 HOH 111 224 78  HOH HOH A . 
B 2 HOH 112 225 79  HOH HOH A . 
B 2 HOH 113 226 80  HOH HOH A . 
B 2 HOH 114 227 81  HOH HOH A . 
B 2 HOH 115 228 82  HOH HOH A . 
B 2 HOH 116 229 83  HOH HOH A . 
B 2 HOH 117 230 84  HOH HOH A . 
B 2 HOH 118 231 85  HOH HOH A . 
B 2 HOH 119 232 86  HOH HOH A . 
B 2 HOH 120 233 87  HOH HOH A . 
B 2 HOH 121 234 88  HOH HOH A . 
B 2 HOH 122 235 89  HOH HOH A . 
B 2 HOH 123 236 90  HOH HOH A . 
B 2 HOH 124 237 91  HOH HOH A . 
B 2 HOH 125 238 92  HOH HOH A . 
B 2 HOH 126 239 93  HOH HOH A . 
B 2 HOH 127 240 94  HOH HOH A . 
B 2 HOH 128 241 95  HOH HOH A . 
B 2 HOH 129 242 96  HOH HOH A . 
B 2 HOH 130 243 97  HOH HOH A . 
B 2 HOH 131 244 98  HOH HOH A . 
B 2 HOH 132 245 99  HOH HOH A . 
B 2 HOH 133 246 100 HOH HOH A . 
B 2 HOH 134 247 101 HOH HOH A . 
B 2 HOH 135 248 102 HOH HOH A . 
B 2 HOH 136 249 103 HOH HOH A . 
B 2 HOH 137 250 104 HOH HOH A . 
B 2 HOH 138 251 105 HOH HOH A . 
B 2 HOH 139 252 106 HOH HOH A . 
B 2 HOH 140 253 107 HOH HOH A . 
B 2 HOH 141 254 108 HOH HOH A . 
B 2 HOH 142 255 109 HOH HOH A . 
B 2 HOH 143 256 110 HOH HOH A . 
B 2 HOH 144 257 111 HOH HOH A . 
B 2 HOH 145 258 112 HOH HOH A . 
B 2 HOH 146 259 113 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 2  A MSE 1  ? MET SELENOMETHIONINE 
2 A MSE 41 A MSE 40 ? MET SELENOMETHIONINE 
3 A MSE 51 A MSE 50 ? MET SELENOMETHIONINE 
4 A MSE 54 A MSE 53 ? MET SELENOMETHIONINE 
5 A MSE 57 A MSE 56 ? MET SELENOMETHIONINE 
6 A MSE 66 A MSE 65 ? MET SELENOMETHIONINE 
7 A MSE 81 A MSE 80 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1630  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  11830 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 60.2800000000 0.0000000000 0.0000000000 -1.0000000000 63.3300000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-18 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
4 'Structure model' 1 3 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance'  
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Refinement description'     
4 4 'Structure model' 'Data collection'            
5 4 'Structure model' 'Derived calculations'       
6 4 'Structure model' 'Refinement description'     
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_struct_assembly_auth_evidence 
2 3 'Structure model' software                           
3 4 'Structure model' software                           
4 4 'Structure model' struct_conn                        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_software.classification'            
2  3 'Structure model' '_software.name'                      
3  4 'Structure model' '_software.classification'            
4  4 'Structure model' '_software.contact_author'            
5  4 'Structure model' '_software.contact_author_email'      
6  4 'Structure model' '_software.language'                  
7  4 'Structure model' '_software.location'                  
8  4 'Structure model' '_software.name'                      
9  4 'Structure model' '_software.type'                      
10 4 'Structure model' '_software.version'                   
11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
# 
_phasing.method   MAD 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.4.0067 ?               program 'Garib N. Murshudov'         garib@ysbl.york.ac.uk                refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html                                Fortran_77 ? 1 
PHENIX      .        ?               package 'P.D. Adams'                 PDAdams@lbl.gov                      refinement        
http://www.phenix-online.org/                                               C++        ? 2 
SHELX       .        ?               package 'George M. Sheldrick'        gsheldr@shelx.uni-ac.gwdg.de         phasing           
http://shelx.uni-ac.gwdg.de/SHELX/                                          Fortran_77 ? 3 
MolProbity  3beta29  ?               package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building'  
http://kinemage.biochem.duke.edu/molprobity/                                ?          ? 4 
XSCALE      .        ?               package 'Wolfgang Kabsch'            ?                                    'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 5 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                          help@deposit.rcsb.org                'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 6 
XDS         .        ?               ?       ?                            ?                                    'data reduction'  ? 
?          ? 7 
SHELXD      .        ?               ?       ?                            ?                                    phasing           ? 
?          ? 8 
autoSHARP   .        ?               ?       ?                            ?                                    phasing           ? 
?          ? 9 
# 
_pdbx_entry_details.entry_id             3F40 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE.
;
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 8   ? CD  ? A ARG 9   CD  
2  1 Y 1 A ARG 8   ? NE  ? A ARG 9   NE  
3  1 Y 1 A ARG 8   ? CZ  ? A ARG 9   CZ  
4  1 Y 1 A ARG 8   ? NH1 ? A ARG 9   NH1 
5  1 Y 1 A ARG 8   ? NH2 ? A ARG 9   NH2 
6  1 Y 1 A LYS 28  ? CE  ? A LYS 29  CE  
7  1 Y 1 A LYS 28  ? NZ  ? A LYS 29  NZ  
8  1 Y 1 A ARG 43  ? CZ  ? A ARG 44  CZ  
9  1 Y 1 A ARG 43  ? NH1 ? A ARG 44  NH1 
10 1 Y 1 A ARG 43  ? NH2 ? A ARG 44  NH2 
11 1 Y 1 A GLU 47  ? CD  ? A GLU 48  CD  
12 1 Y 1 A GLU 47  ? OE1 ? A GLU 48  OE1 
13 1 Y 1 A GLU 47  ? OE2 ? A GLU 48  OE2 
14 1 Y 1 A GLU 54  ? CD  ? A GLU 55  CD  
15 1 Y 1 A GLU 54  ? OE1 ? A GLU 55  OE1 
16 1 Y 1 A GLU 54  ? OE2 ? A GLU 55  OE2 
17 1 Y 1 A LYS 55  ? CD  ? A LYS 56  CD  
18 1 Y 1 A LYS 55  ? CE  ? A LYS 56  CE  
19 1 Y 1 A LYS 55  ? NZ  ? A LYS 56  NZ  
20 1 Y 1 A LYS 83  ? CE  ? A LYS 84  CE  
21 1 Y 1 A LYS 83  ? NZ  ? A LYS 84  NZ  
22 1 Y 1 A GLU 112 ? CG  ? A GLU 113 CG  
23 1 Y 1 A GLU 112 ? CD  ? A GLU 113 CD  
24 1 Y 1 A GLU 112 ? OE1 ? A GLU 113 OE1 
25 1 Y 1 A GLU 112 ? OE2 ? A GLU 113 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 0   ? A GLY 1   
2 1 Y 1 A GLU 113 ? A GLU 114 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#